4NKGB

Crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/transferase
molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 25
structure length 66
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 4nkgB00
1CXZB 4IGGA 2RMKB 4NB5A 1URFA 4NKGB 1UPGA 1RFYA 4DYLA 1US6A 2HJDA 2Q0OC
chains in the Genus database with same CATH superfamily
1ROPA 4IIJB 2KG7B 2X6CA 2EINB 1JCHA 1FXHA 4JI7B 1GRJA 3G6EV 4J11A 1IBLB 1Y76B 4G28B 1VQKV 4B3SB 1Y67A 1SZTA 1LUWA 3CD6V 4J10A 3QNEA 4YJ2A 3Q4HB 3ZHUA 3EHBB 3ASNB 1JX9A 2HVKC 1OZ0A 4XDKA 4D7TA 1N36B 2Y69B 1I94B 2AW9A 2V1DA 2V4DA 1KECA 4FM0A 4YJ2B 4JZGA 1WPBA 4GX2A 1FFXA 1MSDA 4O4IB 3CB2A 3E35A 4X66O 1N32O 3CCRV 4DR6O 1U96A 1I0HA 3JAKA 3SYOA 4EKWA 3B8MA 1XEQA 3K9AA 1EN6A 3UO3A 5DEDA 4MTFA 3KKYA 5L3DA 1B6QA 3W7TA 2HHHB 2WA4A 1IBMO 1VQPV 1N0NA 1G1XB 1P7GA 1AR5A 3TCUA 5L3EA 3ZMTA 3ABLC 2FYUH 3FB5C 1JMKC 3ZMZA 5KAIZ 4WCEV 3I56V 4DV2O 1HWYA 1H2SB 5EYPA 4O2AA 3FYIB 1AB3A 2WWWA 4WBNB 4JTCB 3H1JH 1M56C 3CX5F 1E1RG 4ZOLA 4JI0B 1R3KC 3CCJV 1D5NA 1DLBA 2RDCA 3L71H 3CXCU 3J7AU 5KHJA 1G4YB 4O4HA 4UCSA 1IVSA 4MS2A 3HKBA 4XDLA 3S3XA 2ZINA 3ZN1A 2JGDB 3ABUA 1YZBA 3LUTB 4TV9B 1S3JA 2IU3A 4X20A 1K9MW 1I08A 4LNUA 2FL4A 2OTLV 1ZSPA 2XHBA 3M8AA 2GHYA 3ZEDA 4LWSA 1FXKB 2UXBB 4GKKB 3NXSA 2UU9B 5J9PC 3L74H 1ZL8A 4FLXA 1G6UA 1W0JG 5JCOC 2C2AA 3ABMB 4CS4A 2F95B 2A3QA 3GWKC 4D6TH 3ZHTA 2DE0X 4JI5O 3WU2Z 4ASUG 3DC6A 4PA6A 2YIDA 3FKSG 1BHAA 4OX9O 1ENVA 1KU9A 3CCLV 2HEPA 2Q7HA 2DWDC 4ZI7A 1N4CA 1YDXA 3IJ4A 2L35A 5B1BC 2Z5UA 4JI1O 3CEIA 4BIUA 3ABKB 4R7CA 3A8TA 3OMNB 3KZIZ 4X66B 5EBWC 1HNWO 4JYAO 1OCRB 3H1HH 5H6QA 2LFRA 1K5SA 1P7BA 3CCQV 5BR8O 4DR6B 5B3SC 1PKXA 5TISZ 4J7KA 2F23A 1OJHA 3CHXA 2XAFA 4B3MO 2YS8A 4L8JA 2PTMA 2QM7A 1H2NA 4N23A 2MW2B 3CC2V 5H9CA 5LA6A 4GCZA 3F7YC 1GK9A 3N2KA 1IBMB 3VQVA 3ML0A 3VQXA 1H2LA 1NQTA 4LF4O 5LMNO 3JAWA 2JJ1G 2IM9A 4KP4A 3G6BA 1W59A 2CE4A 5JH7A 4TUYA 4FLUA 1K4CC 4DV2B 3N2KB 3QO7A 4W4KA 3GWOA 1Z5VA 4LP8A 4DV1B 1K7DA 5JH7B 2YI9A 5IYZB 2KB1A 2PI4A 3C3TA 2P90A 2E5LO 2QJ1A 4FLTA 5CBHA 1VMGA 3P32A 1F23A 4CC5A 4DR5O 1MZEA 3AK2A 2OCCB 3BY6A 4BWAA 4DR3B 1COWG 4JYBA 3S3WA 1SQVH 4OGQB 2ZT9B 3D36C 4TOIA 4ZIBA 5IWAO 1U97A 3K5MA 2DYSC 2WLHA 3BEHA 3VQWA 1BMFG 4I55A 4MSWC 1QVFU 4GKJO 4DV6O 2DQ3A 2A9HA 2DQ0A 4QE9A 2K9PA 4JI4O 3DXRA 4MVRA 5J2TA 2XT9A 4JI5B 2QE7G 3E2EA 2X0LA 3WG7B 1R6KA 1AJQA 3C3SA 5EK0A 2KQXA 1QR8A 4YIPA 3U11A 4OX9B 4JYYA 4X64B 3O9OA 3VQYA 3E89A 5J2TB 4MVQA 1FS0G 3A0RA 3G71V 3AG4C 2QKCA 3ZRWB 4JTDB 4QGPA 2EBOA 1YF2A 4WFEA 4NTXA 4FLVA 1XILA 3RYIA 4WFFA 2HVJC 4LH6A 3GVMA 3K9SA 4JI8B 4FVMA 3UT5B 3CCEV 5BR8B 2CDYA 4NVPA 4LF7O 4UCVA 1RPRA 1DGSA 1LNQA 4YY3O 1HP8A 3CCSV 1SF9A 5B1AB 4AQYB 4LF4B 3BFRA 1Q8IA 5A9GA 4FPPA 3ZMUA 2CUGA 4BAYA 5LGUA 1XNQO 2HP8A 1SQQH 4K3AA 3LDCA 2BTQB 1AVMA 3LNNA 4JAUA 1IBKB 4UCTA 3ZS8C 2OT5A 2Q7EA 2KKWA 2OIEA 1AROP 5CMUA 2E5LB 1S5JA 2OCHA 1XUQA 1VF6C 3B09A 3K03A 4Z1VA 2XASA 1B04A 3M99B 4JAAA 4O4LA 2DYRC 1RSOB 5J2UB 3IAYA 1GTOA 4JGSA 4HNAA 5LOVA 4DV0O 3HPLC 4UB8Z 1QBZA 2UXNA 1XREA 4J7JA 1THZA 1KKDA 3ICXA 2XUMA 2IJHA 5IWAB 2CTQA 4LF9B 4X88A 4X1YA 1Q81W 2Q4PA 4UVCA 2QM8A 2BSKA 3CSXA 4GKJB 3JAMN 4AILC 2ZR3A 3CCUV 1Q6HA 3FX7A 1XHXA 2QWRB 2XAJA 3K06A 4UXNA 3FD9A 4X1YB 4NYKA 2Q7GA 2A06H 4JI3O 3RVYA 3K04A 4LF6O 2XAQA 3QVNA 1Q86W 4U7NA 3BVOA 3B8NA 5KHKA 4DYLA 3FB6C 3FYEB 3J81N 4DV5O 2BTOA 1AI4A 4YXWG 4X1IA 1R3LC 1OCOC 5EZYB 4PV1B 2YIBA 4DK1A 4PA3A 1F4NA 4BW9A 4JI7O 2RNBA 1IBLO 3IC9A 3N2GA 5HFLA 3FB7C 2WLMA 4CH3A 1F7YA 4I50B 1N33O 1MA1A 1NR7A 4K0KO 4LF7B 1RPOA 1N36O 3N2GB 3W7WA 2A0LA 4HBNA 5LGNA 5JVDA 3KG2A 4H13B 4PI2A 1GMGA 3KCYA 3DTUB 4GYCB 4YJ3B 4YY3B 2K1EA 1VQ4V 1SQPH 1IXBA 2WA3A 5IJ9A 1KP2A 1NT2B 1AI6A 1FPOA 2WLIB 2XAGA 3CJHB 5JVDB 3TXSA 5L3CA 1AR1B 3K5LA 3OM3B 4FFBB 1XNQB 1VARA 2IJKA 3UM7A 4DR7O 2E74B 5IJ9B 2D3OW 1B06A 3CMAV 1KYOF 1M57B 1ZUQA 3OMIB 1VIBA 4ABMA 4DW1A 2LGQA 1JFFA 1IURA 5K1XA 3RBZA 3AG1B 3U10A 5EC2C 3RYCB 2PI5A 3JSLA 4DV3O 1JFFB 3HKCA 3CS5A 4E4EA 4DV0B 3HR0A 4IT5A 1KKCA 1FJGO 4I4TB 4X1KB 1NBMG 4B3TO 2EIKC 4G27B 4H0LB 4JI0O 2F93B 3HKCB 2E76B 4WFBV 4PD4F 3B40A 2CH7A 1PL4A 2QSAA 4PDMA 4RUEA 4MVZA 4B7EA 5L3BA 4XBFA 4JV5B 4EFBA 4LF6B 2CH7B 2JS3A 4G2KA 2PYJA 4NKGB 3B77A 2EIMB 4DV5B 3AG3C 2UXBO 3MAQA 5CN0A 4RAIA 3HKEA 5AG2A 1SA0A 2P4VA 4R8CA 5LMUB 2UU9O 3P30A 1YVWA 1FYJA 5LXTB 1TVKB 3E8HA 3D3IA 3AG2B 5EIBC 1GM8A 3STLC 3ZRSA 2R9AA 2VS0A 2X6BA 1EBOA 2AZ0A 4PDVA 1N34O 3TK1A 1N33B 3T1CA 1BL8A 4K0KB 1V55C 2Q73A 4AI8A 1YCIA 2R9IA 2UXCO 1P84F 1NKDA 3ETEA 1M1KW 3OEEG 4J41A 3K5NA 5JCOA 3K3WA 1XNRO 2AXTZ 3WB2A 3IFXA 2ZE6A 5LGTA 3T1HB 1SKVA 2ZDIC 2ZM6O 2ZXWB 1AR4A 1WB8A 4DXWA 3R66A 3BA9A 1LUVA 1AJNA 1FFXB 1WPXA 4DR7B 1YTFD 3DC5A 3ETQA 5FNVA 3F5TA 5GONA 1TUBA 2LJ2A 1WP8A 3JAKB 1FD9A 2JJ2G 5FNVB 2NNUA 3SJAC 3ZN0A 1QR9A 3RWRD 3OFNG 4DV3B 1TUBB 1BSMA 1IZ3A 4RO2A 5E79Z 1K8AW 3APOA 2H94A 3ZHQA 1XMQO 3CPWU 4Q20A 1FJGB 2VQEO 4UV9A 1NU1H 4DV1O 4KHPB 3SYQA 5LP6C 2QWOB 3OR6C 3E8BA 4B3TB 5B3SB 1J5EO 2OTJV 1V54B 1VF7A 4I5SA 4WFGA 1YTFB 2GUZA 5CA1A 2WLKA 4IL6Z 5EYPB 4O2AB 5ITZA 4WFAV 2WSSG 4FIPC 4P30A 4DR3O 4ZOLB 4PJ0Z 4UVAA 2EINC 2PY5A 2GUZB 5CA1B 2ZE8A 1JPXA 1JJ2U 2ETNA 4RUFA 4O4HB 3HKBB 4J9ZB 4PELA 3SJCC 5A2QN 1RM1C 4BR6A 5HFMA 1P4RA 1ORQC 3ZHSA 3OUFA 1S5HC 2HG5C 3ASNC 3K59A 4FK5C 4X20B 2Y4UA 3K0DA 5BZBA 4LNUB 2Y69C 5KHGA 4LWSB 1HNXO 1QLEC 3ABTA 2YEVA 1N34B 1ZL8B 4OPAA 2JRIA 2XNDG 1EZJA 5IYCO 3D36A 1XL4A 4X64O 5C93A 3SR2C 4EEQA 3W7SA 1PP9H 2PGGA 2EILB 4JYCA 1VQNV 3THOA 2UXCB 1NZ6A 3I5DA 2ADQB 5DM6V 4CS2A 4LFAO 3TJTA 1S0VA 5H5NA 1XNRB 4ZI7B 1OCZC 4HAMA 4JI8O 4LF8O 2ZKOA 4IGGA 2ZM6B 1XL6A 3AK1A 3QG5A 1M9NA 1ZAUA 4IHJA 1CXZB 5C8YA 1FFTB 2DMXA 4J42A 1F4MA 1SESA 2IBZH 3TETA 1JA8A 3BHPA 4IHJB 1GAXA 4DRXA 4AQYO 4ZBMA 1KUQA 3E8FA 1GN6A 2EJRA 2O57A 2B9ZA 3B2EE 3T1YB 4H33A 3K08A 2QDOA 5LA6B 2ZE5A 3JSNA 4DRXB 1M4UA 2AHZA 2X6AA 4RQEA 1L8DA 1XMQB 2LW7A 3JAWB 2NLJC 2VQEB 1H8EG 1YIJV 4Z1MG 2Q6AA 2Y0PA 3JCZA 1K73W 1IBKO 2ZNIA 4TUYB 4FM2A 4GLXA 3E86A 5BY1A 1J5EB 3FAVA 1FXKC 2LO1A 4FJCC 2F66C 2DOSA 2IU0A 3LSQA 2X7RB 3KCXA 1R6TA 3DGEA 1JR9A 2QGNA 4KL1A 3ABMC 2P22C 3CRAA 2OWOA 1GM9A 4PA7A 1O9HA 3DSQA 2Z3YA 4LF9O 2FMLA 1VF6A 4I0XA 4DW0A 2IW5A 1QQCA 4LCUC 1IDSA 3OD4A 2EZPA 4N21A 3RYFA 3AG7A 1HNXB 1QVGU 1WA8A 4I55B 1OCCB 4U3JA 3RN4A 3ABKC 3H1LH 5K1PA 3ZCCA 1GN2A 3CYOA 2F43G 2ZR2A 3DXRB 1OCRC 3GB7C 1VQ5V 2EIJB 1TAEA 3T4ZA 2B1IA 3ZHRA 3SYAA 2UUBO 2Q8VA 4LBEC 4OXSA 1KMIZ 4LFAB 2OYQA 5IT9N 3SDLA 4YIOA 1Z2GA 3C90A 5D5PA 2ZE7A 4LF8B 3JD3A 2PYLA 1SETA 4UUJC 1UFIA 3RYIB 1KC8W 1BGYH 3J80N 4PHZA 2Q69A 3I55V 3W7XA 3ETGA 5EBMC 3W7UA 4LFCB 5GTIZ 2DWEC 2ITCC 3ZMVA 4NXMB 3K5OA 2Y48A 2YSUB 1MNGA 1K5QA 1NTMH 2ZIMA 1XQ8A 1NR1A 2W0XA 3QTCA 1KP3A 4LH7A 4TSFG 4CH4A 1YEWA 2OCCC 5JQGA 4MT8A 3BABA 5LHIA 3X2QB 5FL7G 1A32A 3LNMB 4CH6A 1E79G 2BCCH 1PL0A 4RQFA 2P6JA 2JEXA 3ASOB 4QE7A 3LDEA 1LR1A 2YI8A 2E3CA 4H44B 4HZ3A 5LBQA 4P2ZA 1QHTA 4D7SA 4JI6O 3WFVA 1BQZA 2PZSA 2QKAA 4O4LB 2HFEC 1HW7A 2ZIOA 2P5OA 3JD2A 1BE3H 4HNAB 2VWKA 2WLLA 4JAVA 3WG7C 2RJZA 2UXXA 3K57A 4IYHA 1DTOA 2YDEA 2LQTA 5B5EZ 4RWUA 3N27A 5LOVB 3CMEV 2DJVA 2YIBD 5GTHZ 3RYHA 2PF4E 4X89A 5E1AC 1QLNA 4U7OA 3SPIA 5B1OA 4TQFA 3A2FA 5KMGA 4MW3A 1Y6XA 4JV5O 4J80A 2LW1A 1I5YA 3RYHB 2BSKB 5IDJA 3EVKA 1Q3EA 2BOCC 3ZIAG 4GX1A 5IY5B 5LMUO 1DF4A 2WLNA 3JD4A 4JTAB 2UUBB 3RW0A 4X1IB 1S5LZ 4UVBA 5IJ0A 2P06A 4X65O 4X62B 1RFYA 1HNZO 3CRQA 3TGUH 5B1AC 1SERA 4R50A 3OUSA 4JI2O 4U3FH 4FLYA 3AK3A 1QU7A 4LFBO 2JEUA 4EFEA 2F4VB 2QEXV 2XOKG 3ZX6A 4B7KA 1H8HG 3NR7A 4F6RA 4QJFB 3T1HO 1X59A 3UKMA 1OHHG 1VQ8V 4ZHQA 1TUEB 1EFRG 4MVSA 3T4DA 1K33A 1K3EA 1XI1A 4K8XA 1Q5OA 5JWPA 5BMVA 2GTAA 2QA4V 3G67A 5H2FZ 1L0LH 4TWKA 4TV8A 1SQGA 1V55B 5LHGA 3T2MA 1D5AA 1W0KG 1TA8A 1SS3A 1HR0O 2LFSA 2W6IG 1WNSA 1M93A 3CP1A 4JI6B 3BCCH 1YITV 1PNMA 1WN7A 4YHHB 4KHPO 2ZNJA 2G38A 4H37A 5KX5A 1O9GA 3D8CA 5KA6A 1H2MA 1NI8A 2P67A 4JZ2A 5KUMA 4DR2B 1JVMA 5LYJA 2RMKB 4JPRA 5F2VO 4DO2A 3CRRA 2VRZA 5KX5B 4AHCA 4B08A 4PDLA 5FPOA 3BPZA 3CC4V 3ABLB 4P9OA 2UUAO 1DF5A 4I9QA 1EN5A 2WAMA 3SPJA 5CA3A 2GDSA 2CTRA 1URFA 2IJIA 3ZJZA 2RQ6A 5IE9A 3L73H 3OGIB 1W2BU 1M56B 4DV4O 3HKEB 4P9PA 1SA0B 3OTFA 2GBOA 1KD1W 4IIJA 2KG7A 3UCSC 3FFQA 1T5EA 4X65B 1CP9A 3BRCA 3K79A 1TGOA 1Y76A 4MVOA 1HNZB 4UCRA 2CGOA 1PM9A 3UQ8A 1VEWA 4JI2B 3JD1A 3OE7G 4GZRB 2QWNB 3MDSA 2JIZG 3L72H 2N74A 4LFBB 3MD0A 1J95A 3Q4HA 4O2BA 3R65A 1PPJH 1PV0A 1M57C 1RM1B 3CCVV 1VQLV 4L87A 4O2BB 1GN4A 3QF7A 1MMMA 4O4IA 1SQFA 3AG1C 4GT1A 1DK1A 3SGIA 1KB9F 4DR1O 1Z5WA 1QLEB 3E83A 1SQXH 2D2CB 2R70A 4KXRA 4O4JA 1L0NH 1ZTEA 5DN6G 2JS5A 2M6YA 3B4SA 1XHZA 4NTYA 3JATA 3T1YO 4O4JB 2RCVA 2Q0AA 1EM1A 1Q90D 5GONB 3K58A 5B1BB 1HR0B 5LHHA 1US6A 1SZXA 2HLDG 2QKSA 1OCZB 2ARHA 3JATB 1L1FA 2JDIG 2UUCB 1MOFA 1NTKH 3BA8A 1R73A 2HJDA 4MTXA 1R3IC 2YXHA 1BHBA 4B3RB 5H6RA 2JK5C 3CE2A 3JCUZ 4WBNA 1NTZH 2EIMC 2H8PC 1YSCA 5D5QA 1Q6UA 5CA0A 1H2GA 1AJPA 4QPKA 5ITZB 3AG2C 2UXDB 3SYCA 3RFRA 2CTPA 1YJWV 2JGDA 5CA0B 2UUAB 4TV9A 4WFHA 4TQDA 1NJIW 1P49A 3CXHF 1FXKA 4FM1A 1S72V 1UJWB 1K4DC 2R9RB 5FLXN 4DV4B 3EXAA 2GV9A 1XMOO 1Q82W 4DV7B 2B5UA 2EX3A 2L6LA 3CRMA 3A0BZ 1NS1A 1GKFA 3SPHA 2VQFB 2ILMA 3PN1A 2ZCEA 3WB1A 1D2DA 2ZXWC 2WLJA 3STZC 2YEVB 2LGWA 1BQ0A 3OAAG 2DW4A 5IYDO 4KFMA 2GSMB 1YJNV 2ADPA 3OW2U 1Q43A 2ITDC 2DYSB 4EB6A 2PUSA 4BIOA 1FAFA 1RP3B 3F7VC 2HR3A 2ZD9A 1MZFA 1QNMA 5KHIA 3LSSA 1BCCH 4QPJA 3LDDA 4EB6B 4DR1B 3VOUA 1FKAO 1HDJA 4LFCO 3OT7A 1K92A 2XAHA 4NXMO 1IX9A 4TT3G 5C8YB 4ZKIA 4GX0A 2GTSA 1H38A 1N32B 4I9WA 1Q6IA 3AG4B 1I5XA 1V54C 3P3PA 4GX5A 2CGNA 1VQOV 4LF5O 3JARA 3G80A 2H3OA 2FTKA 1YI2V 1SRYA 5KHHA 4CH5A 4QNHB 2EULA 4PDRA 1GN3A 2V7QG 3JARB 2ATKC 4FMTA 1S77D 1AP6A 4Q6GA 1NVPD 1VQ7V 2B1GA 5IYZA 1MABG 5JJEB 3H1IH 3FAVB 3E8GA 2IJJA 2VWJA 2AHYA 3APQA 3HB3B 1N0JA 2F1MA 4LR3A 3P3NA 2ZQMA 5CBFA 3UO2A 5FPRA 2XTAA 3OTOO 3G4SV 2RN9A 3O65A 4CBCA 1N8RW 5DECA 3ZHVA 3OMAB 2A7WA 2EILC 3SJQC 5L3GA 5B1NA 1EN4A 1NVPB 3IC7A 2Q0OC 1XMOB 5KAFZ 1VQ9V 4DR4O 4FLZA 2CTWA 4I0XB 1UPGA 1VP7A 2DYRB 4BW5A 1R1BA 1AILA 1YXBA 2FKXA 3RYFB 3ZMSA 1R3JC 1Y66A 5KLVH 4UCUA 4F4LA 1WA8B 1YJ9V 4U3JB 3F5WC 2BE3A 3L70H 4XDJA 1KBHA 1OV9A 3ZRWA 2AGAA 4X62O 4UFZA 2LP7A 2YXYA 2Q9LA 3QO5A 4KUMA 5LL6Y 1GH6A 2P7TC 4F6EA 2WPDG 3L9DA 3QO8A 1E1QG 4JI1B 1ZLZA 2KSDA 3UT5A 2F4VO 4CC6A 1Y4MA 1WAZA 2YIAA 4GUNA 1HNWB 3TXQA 4JYAB 1MG1A 2OIGA 4UCOA 3ZBHA 1CEZA 1OCOB 2M7WA 1PNLA 4R6ZA 4W4LA 1BZKA 4IYIA 3VBBA 4LF5B 4B3MB 4MTOA 4Z2WA 1F51A 1ZX3A 3RGBA 3E22A 1XBLA 4NTWA 4MVMA 2HKOA 3JASA 5LMNB 2BTQA 1YHQV 3OGCC 5JQGB 5JJJB 3E22B 3CWBH 4FZ1A 2W6JG 3JASB 2JGUA 4J9YB 1RSOA 5J2UA 2IH3C 5JJNB 1G8MA 1XOUA 2CK3G 1XDCA 4JASA 4YHHO 3U0ZA 1FXVA 2IH1C 4JF3A 4FFKA 1OCCC 1KQSU 4OPHA 3M7MX 2NN4A 4CZZA 4DUYO 4LC1A 4DR5B 2HJFC 4DR2O 3OTOB 2YICA 3AEIA 1AI7A 3SPCA 2EIJC 3MHSC 3EFFK 4NXNO 2WLLB 1JOYA 1H2KA 4DR4B 3PJSK 5EC1C 1BS3A 3H1KH 4DUZO 4UB6Z 1MSWD 2Q67A 3ETDA 2QTOA 3SPGA 5KMGB 3D3QA 1S76D 1Q7YW 4DV6B 2AZ2A 4J7ZA 1M90W 4JI4B 1GM7A 4C7UA 1K34A 1K97A 2YXLA 2EIKB 1SC5B 2MK3A 5EZYA 1WLEA 5EIBD 3A0HZ 4MVUA 1M5IA 1AP5A 2Y4TA 5L3FA 3OR7C 2Q68A 2YC0A 2QM4A 3H01A 5BXZA 1ZWIC 4QIWF 4FZ0A 1GO3F 1VQMV 4FLWA 1B3QA 4PA9A 2W0FC 4I50A 1AI5A 5IJ0B 2R72A 2QWQB 4X8AA 5EBLC 3H9VA 4B3SO 1Y74A 2E75B 1R6NA 3AG3B 3X2QC 5GW7A 1X4TA 3IGAC 4YJ3A 3CRCA 4K35A 2P4KA 3ASOC 1Y74B 3LSUA 1V9PA 2WLIA 1I94O 3CJHA 4F6RB 1EZVH 1I7FA 3BAAA 4FFBA 3CCMV 3JD0A 2QWPB 3OEHG 4ZHQB 2DN9A 1QCEA 4PA4A 3SJBC 1VF5B 5CB4A 4E2LA 5KUKA 5BMVB 2JVDA 1NH2D 3JALA 5IYBO 3L75H 2ZDIA 3K0GA 4NR1A 4K8ZA 1WB7A 1JJOA 4TV8B 5CB4B 3RYCA 1JQ0A 3JALB 3RVZA 2HHHO 2UUCO 4WF9V 4X9QA 4UV8A 3WB0A 1BT8A 4HYOA 2NR5A 4MW8A 3MHHC 4B3RO 2BOBC 2EJ7A 4I4TA 4MTGA 4X1KA 4DUYB 3SYPA 4ICGA 5CBGA 1SQBH 1PNKA 2QR4A 3CC7V 5IY5C 3ZRVA 4NXNB 1IXMA 2Y0IA 1WP7A 1WJZA 1PD3A 1NH2B 5LYJB 2UXDO 2ODMA 4DUZB 2Z0AA 4I7ZB 2CAZC 5LP6A 2EZOA 4DK0A 1VQ6V 2QTSA 2N04A 1CPYA 3HKDA 5LP6B 5B66Z 4JI3B 5KA5A 4DV7O 4NB5A 2Q5ZA 2A79B 3RT3C 4A5UB 5LXTA 1TVKA 2N05A 4PI0A 2YUAA 4BIZA 4GKKO 2FB5A 3FB8C 3HKDB 3JYCA 2VQFO 4CS3A 3ZRXA
chains in the Genus database with same CATH topology
1CXZB 4IGGA 2RMKB 4NB5A 1URFA 4NKGB 1UPGA 1RFYA 4DYLA 1US6A 2HJDA 2Q0OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  4IGG A;  2RMK B;  4NB5 A;  1URF A;  4NKG B;  1UPG A;  1RFY A;  4DYL A;  1US6 A;  2HJD A;  2Q0O C; 
#chains in the Genus database with same CATH topology
 1ROP A;  4IIJ B;  2KG7 B;  2X6C A;  2EIN B;  1JCH A;  1FXH A;  4JI7 B;  1GRJ A;  3G6E V;  4J11 A;  1IBL B;  1Y76 B;  4G28 B;  1VQK V;  4B3S B;  1Y67 A;  1SZT A;  1LUW A;  3CD6 V;  4J10 A;  3QNE A;  4YJ2 A;  3Q4H B;  3ZHU A;  3EHB B;  3ASN B;  1JX9 A;  2HVK C;  1OZ0 A;  4XDK A;  4D7T A;  1N36 B;  2Y69 B;  1I94 B;  2AW9 A;  2V1D A;  2V4D A;  1KEC A;  4FM0 A;  4YJ2 B;  4JZG A;  1WPB A;  4GX2 A;  1FFX A;  1MSD A;  4O4I B;  3CB2 A;  3E35 A;  4X66 O;  1N32 O;  3CCR V;  4DR6 O;  1U96 A;  1I0H A;  3JAK A;  3SYO A;  4EKW A;  3B8M A;  1XEQ A;  3K9A A;  1EN6 A;  3UO3 A;  5DED A;  4MTF A;  3KKY A;  5L3D A;  1B6Q A;  3W7T A;  2HHH B;  2WA4 A;  1IBM O;  1VQP V;  1N0N A;  1G1X B;  1P7G A;  1AR5 A;  3TCU A;  5L3E A;  3ZMT A;  3ABL C;  2FYU H;  3FB5 C;  1JMK C;  3ZMZ A;  5KAI Z;  4WCE V;  3I56 V;  4DV2 O;  1HWY A;  1H2S B;  5EYP A;  4O2A A;  3FYI B;  1AB3 A;  2WWW A;  4WBN B;  4JTC B;  3H1J H;  1M56 C;  3CX5 F;  1E1R G;  4ZOL A;  4JI0 B;  1R3K C;  3CCJ V;  1D5N A;  1DLB A;  2RDC A;  3L71 H;  3CXC U;  3J7A U;  5KHJ A;  1G4Y B;  4O4H A;  4UCS A;  1IVS A;  4MS2 A;  3HKB A;  4XDL A;  3S3X A;  2ZIN A;  3ZN1 A;  2JGD B;  3ABU A;  1YZB A;  3LUT B;  4TV9 B;  1S3J A;  2IU3 A;  4X20 A;  1K9M W;  1I08 A;  4LNU A;  2FL4 A;  2OTL V;  1ZSP A;  2XHB A;  3M8A A;  2GHY A;  3ZED A;  4LWS A;  1FXK B;  2UXB B;  4GKK B;  3NXS A;  2UU9 B;  5J9P C;  3L74 H;  1ZL8 A;  4FLX A;  1G6U A;  1W0J G;  5JCO C;  2C2A A;  3ABM B;  4CS4 A;  2F95 B;  2A3Q A;  3GWK C;  4D6T H;  3ZHT A;  2DE0 X;  4JI5 O;  3WU2 Z;  4ASU G;  3DC6 A;  4PA6 A;  2YID A;  3FKS G;  1BHA A;  4OX9 O;  1ENV A;  1KU9 A;  3CCL V;  2HEP A;  2Q7H A;  2DWD C;  4ZI7 A;  1N4C A;  1YDX A;  3IJ4 A;  2L35 A;  5B1B C;  2Z5U A;  4JI1 O;  3CEI A;  4BIU A;  3ABK B;  4R7C A;  3A8T A;  3OMN B;  3KZI Z;  4X66 B;  5EBW C;  1HNW O;  4JYA O;  1OCR B;  3H1H H;  5H6Q A;  2LFR A;  1K5S A;  1P7B A;  3CCQ V;  5BR8 O;  4DR6 B;  5B3S C;  1PKX A;  5TIS Z;  4J7K A;  2F23 A;  1OJH A;  3CHX A;  2XAF A;  4B3M O;  2YS8 A;  4L8J A;  2PTM A;  2QM7 A;  1H2N A;  4N23 A;  2MW2 B;  3CC2 V;  5H9C A;  5LA6 A;  4GCZ A;  3F7Y C;  1GK9 A;  3N2K A;  1IBM B;  3VQV A;  3ML0 A;  3VQX A;  1H2L A;  1NQT A;  4LF4 O;  5LMN O;  3JAW A;  2JJ1 G;  2IM9 A;  4KP4 A;  3G6B A;  1W59 A;  2CE4 A;  5JH7 A;  4TUY A;  4FLU A;  1K4C C;  4DV2 B;  3N2K B;  3QO7 A;  4W4K A;  3GWO A;  1Z5V A;  4LP8 A;  4DV1 B;  1K7D A;  5JH7 B;  2YI9 A;  5IYZ B;  2KB1 A;  2PI4 A;  3C3T A;  2P90 A;  2E5L O;  2QJ1 A;  4FLT A;  5CBH A;  1VMG A;  3P32 A;  1F23 A;  4CC5 A;  4DR5 O;  1MZE A;  3AK2 A;  2OCC B;  3BY6 A;  4BWA A;  4DR3 B;  1COW G;  4JYB A;  3S3W A;  1SQV H;  4OGQ B;  2ZT9 B;  3D36 C;  4TOI A;  4ZIB A;  5IWA O;  1U97 A;  3K5M A;  2DYS C;  2WLH A;  3BEH A;  3VQW A;  1BMF G;  4I55 A;  4MSW C;  1QVF U;  4GKJ O;  4DV6 O;  2DQ3 A;  2A9H A;  2DQ0 A;  4QE9 A;  2K9P A;  4JI4 O;  3DXR A;  4MVR A;  5J2T A;  2XT9 A;  4JI5 B;  2QE7 G;  3E2E A;  2X0L A;  3WG7 B;  1R6K A;  1AJQ A;  3C3S A;  5EK0 A;  2KQX A;  1QR8 A;  4YIP A;  3U11 A;  4OX9 B;  4JYY A;  4X64 B;  3O9O A;  3VQY A;  3E89 A;  5J2T B;  4MVQ A;  1FS0 G;  3A0R A;  3G71 V;  3AG4 C;  2QKC A;  3ZRW B;  4JTD B;  4QGP A;  2EBO A;  1YF2 A;  4WFE A;  4NTX A;  4FLV A;  1XIL A;  3RYI A;  4WFF A;  2HVJ C;  4LH6 A;  3GVM A;  3K9S A;  4JI8 B;  4FVM A;  3UT5 B;  3CCE V;  5BR8 B;  2CDY A;  4NVP A;  4LF7 O;  4UCV A;  1RPR A;  1DGS A;  1LNQ A;  4YY3 O;  1HP8 A;  3CCS V;  1SF9 A;  5B1A B;  4AQY B;  4LF4 B;  3BFR A;  1Q8I A;  5A9G A;  4FPP A;  3ZMU A;  2CUG A;  4BAY A;  5LGU A;  1XNQ O;  2HP8 A;  1SQQ H;  4K3A A;  3LDC A;  2BTQ B;  1AVM A;  3LNN A;  4JAU A;  1IBK B;  4UCT A;  3ZS8 C;  2OT5 A;  2Q7E A;  2KKW A;  2OIE A;  1ARO P;  5CMU A;  2E5L B;  1S5J A;  2OCH A;  1XUQ A;  1VF6 C;  3B09 A;  3K03 A;  4Z1V A;  2XAS A;  1B04 A;  3M99 B;  4JAA A;  4O4L A;  2DYR C;  1RSO B;  5J2U B;  3IAY A;  1GTO A;  4JGS A;  4HNA A;  5LOV A;  4DV0 O;  3HPL C;  4UB8 Z;  1QBZ A;  2UXN A;  1XRE A;  4J7J A;  1THZ A;  1KKD A;  3ICX A;  2XUM A;  2IJH A;  5IWA B;  2CTQ A;  4LF9 B;  4X88 A;  4X1Y A;  1Q81 W;  2Q4P A;  4UVC A;  2QM8 A;  2BSK A;  3CSX A;  4GKJ B;  3JAM N;  4AIL C;  2ZR3 A;  3CCU V;  1Q6H A;  3FX7 A;  1XHX A;  2QWR B;  2XAJ A;  3K06 A;  4UXN A;  3FD9 A;  4X1Y B;  4NYK A;  2Q7G A;  2A06 H;  4JI3 O;  3RVY A;  3K04 A;  4LF6 O;  2XAQ A;  3QVN A;  1Q86 W;  4U7N A;  3BVO A;  3B8N A;  5KHK A;  4DYL A;  3FB6 C;  3FYE B;  3J81 N;  4DV5 O;  2BTO A;  1AI4 A;  4YXW G;  4X1I A;  1R3L C;  1OCO C;  5EZY B;  4PV1 B;  2YIB A;  4DK1 A;  4PA3 A;  1F4N A;  4BW9 A;  4JI7 O;  2RNB A;  1IBL O;  3IC9 A;  3N2G A;  5HFL A;  3FB7 C;  2WLM A;  4CH3 A;  1F7Y A;  4I50 B;  1N33 O;  1MA1 A;  1NR7 A;  4K0K O;  4LF7 B;  1RPO A;  1N36 O;  3N2G B;  3W7W A;  2A0L A;  4HBN A;  5LGN A;  5JVD A;  3KG2 A;  4H13 B;  4PI2 A;  1GMG A;  3KCY A;  3DTU B;  4GYC B;  4YJ3 B;  4YY3 B;  2K1E A;  1VQ4 V;  1SQP H;  1IXB A;  2WA3 A;  5IJ9 A;  1KP2 A;  1NT2 B;  1AI6 A;  1FPO A;  2WLI B;  2XAG A;  3CJH B;  5JVD B;  3TXS A;  5L3C A;  1AR1 B;  3K5L A;  3OM3 B;  4FFB B;  1XNQ B;  1VAR A;  2IJK A;  3UM7 A;  4DR7 O;  2E74 B;  5IJ9 B;  2D3O W;  1B06 A;  3CMA V;  1KYO F;  1M57 B;  1ZUQ A;  3OMI B;  1VIB A;  4ABM A;  4DW1 A;  2LGQ A;  1JFF A;  1IUR A;  5K1X A;  3RBZ A;  3AG1 B;  3U10 A;  5EC2 C;  3RYC B;  2PI5 A;  3JSL A;  4DV3 O;  1JFF B;  3HKC A;  3CS5 A;  4E4E A;  4DV0 B;  3HR0 A;  4IT5 A;  1KKC A;  1FJG O;  4I4T B;  4X1K B;  1NBM G;  4B3T O;  2EIK C;  4G27 B;  4H0L B;  4JI0 O;  2F93 B;  3HKC B;  2E76 B;  4WFB V;  4PD4 F;  3B40 A;  2CH7 A;  1PL4 A;  2QSA A;  4PDM A;  4RUE A;  4MVZ A;  4B7E A;  5L3B A;  4XBF A;  4JV5 B;  4EFB A;  4LF6 B;  2CH7 B;  2JS3 A;  4G2K A;  2PYJ A;  4NKG B;  3B77 A;  2EIM B;  4DV5 B;  3AG3 C;  2UXB O;  3MAQ A;  5CN0 A;  4RAI A;  3HKE A;  5AG2 A;  1SA0 A;  2P4V A;  4R8C A;  5LMU B;  2UU9 O;  3P30 A;  1YVW A;  1FYJ A;  5LXT B;  1TVK B;  3E8H A;  3D3I A;  3AG2 B;  5EIB C;  1GM8 A;  3STL C;  3ZRS A;  2R9A A;  2VS0 A;  2X6B A;  1EBO A;  2AZ0 A;  4PDV A;  1N34 O;  3TK1 A;  1N33 B;  3T1C A;  1BL8 A;  4K0K B;  1V55 C;  2Q73 A;  4AI8 A;  1YCI A;  2R9I A;  2UXC O;  1P84 F;  1NKD A;  3ETE A;  1M1K W;  3OEE G;  4J41 A;  3K5N A;  5JCO A;  3K3W A;  1XNR O;  2AXT Z;  3WB2 A;  3IFX A;  2ZE6 A;  5LGT A;  3T1H B;  1SKV A;  2ZDI C;  2ZM6 O;  2ZXW B;  1AR4 A;  1WB8 A;  4DXW A;  3R66 A;  3BA9 A;  1LUV A;  1AJN A;  1FFX B;  1WPX A;  4DR7 B;  1YTF D;  3DC5 A;  3ETQ A;  5FNV A;  3F5T A;  5GON A;  1TUB A;  2LJ2 A;  1WP8 A;  3JAK B;  1FD9 A;  2JJ2 G;  5FNV B;  2NNU A;  3SJA C;  3ZN0 A;  1QR9 A;  3RWR D;  3OFN G;  4DV3 B;  1TUB B;  1BSM A;  1IZ3 A;  4RO2 A;  5E79 Z;  1K8A W;  3APO A;  2H94 A;  3ZHQ A;  1XMQ O;  3CPW U;  4Q20 A;  1FJG B;  2VQE O;  4UV9 A;  1NU1 H;  4DV1 O;  4KHP B;  3SYQ A;  5LP6 C;  2QWO B;  3OR6 C;  3E8B A;  4B3T B;  5B3S B;  1J5E O;  2OTJ V;  1V54 B;  1VF7 A;  4I5S A;  4WFG A;  1YTF B;  2GUZ A;  5CA1 A;  2WLK A;  4IL6 Z;  5EYP B;  4O2A B;  5ITZ A;  4WFA V;  2WSS G;  4FIP C;  4P30 A;  4DR3 O;  4ZOL B;  4PJ0 Z;  4UVA A;  2EIN C;  2PY5 A;  2GUZ B;  5CA1 B;  2ZE8 A;  1JPX A;  1JJ2 U;  2ETN A;  4RUF A;  4O4H B;  3HKB B;  4J9Z B;  4PEL A;  3SJC C;  5A2Q N;  1RM1 C;  4BR6 A;  5HFM A;  1P4R A;  1ORQ C;  3ZHS A;  3OUF A;  1S5H C;  2HG5 C;  3ASN C;  3K59 A;  4FK5 C;  4X20 B;  2Y4U A;  3K0D A;  5BZB A;  4LNU B;  2Y69 C;  5KHG A;  4LWS B;  1HNX O;  1QLE C;  3ABT A;  2YEV A;  1N34 B;  1ZL8 B;  4OPA A;  2JRI A;  2XND G;  1EZJ A;  5IYC O;  3D36 A;  1XL4 A;  4X64 O;  5C93 A;  3SR2 C;  4EEQ A;  3W7S A;  1PP9 H;  2PGG A;  2EIL B;  4JYC A;  1VQN V;  3THO A;  2UXC B;  1NZ6 A;  3I5D A;  2ADQ B;  5DM6 V;  4CS2 A;  4LFA O;  3TJT A;  1S0V A;  5H5N A;  1XNR B;  4ZI7 B;  1OCZ C;  4HAM A;  4JI8 O;  4LF8 O;  2ZKO A;  4IGG A;  2ZM6 B;  1XL6 A;  3AK1 A;  3QG5 A;  1M9N A;  1ZAU A;  4IHJ A;  1CXZ B;  5C8Y A;  1FFT B;  2DMX A;  4J42 A;  1F4M A;  1SES A;  2IBZ H;  3TET A;  1JA8 A;  3BHP A;  4IHJ B;  1GAX A;  4DRX A;  4AQY O;  4ZBM A;  1KUQ A;  3E8F A;  1GN6 A;  2EJR A;  2O57 A;  2B9Z A;  3B2E E;  3T1Y B;  4H33 A;  3K08 A;  2QDO A;  5LA6 B;  2ZE5 A;  3JSN A;  4DRX B;  1M4U A;  2AHZ A;  2X6A A;  4RQE A;  1L8D A;  1XMQ B;  2LW7 A;  3JAW B;  2NLJ C;  2VQE B;  1H8E G;  1YIJ V;  4Z1M G;  2Q6A A;  2Y0P A;  3JCZ A;  1K73 W;  1IBK O;  2ZNI A;  4TUY B;  4FM2 A;  4GLX A;  3E86 A;  5BY1 A;  1J5E B;  3FAV A;  1FXK C;  2LO1 A;  4FJC C;  2F66 C;  2DOS A;  2IU0 A;  3LSQ A;  2X7R B;  3KCX A;  1R6T A;  3DGE A;  1JR9 A;  2QGN A;  4KL1 A;  3ABM C;  2P22 C;  3CRA A;  2OWO A;  1GM9 A;  4PA7 A;  1O9H A;  3DSQ A;  2Z3Y A;  4LF9 O;  2FML A;  1VF6 A;  4I0X A;  4DW0 A;  2IW5 A;  1QQC A;  4LCU C;  1IDS A;  3OD4 A;  2EZP A;  4N21 A;  3RYF A;  3AG7 A;  1HNX B;  1QVG U;  1WA8 A;  4I55 B;  1OCC B;  4U3J A;  3RN4 A;  3ABK C;  3H1L H;  5K1P A;  3ZCC A;  1GN2 A;  3CYO A;  2F43 G;  2ZR2 A;  3DXR B;  1OCR C;  3GB7 C;  1VQ5 V;  2EIJ B;  1TAE A;  3T4Z A;  2B1I A;  3ZHR A;  3SYA A;  2UUB O;  2Q8V A;  4LBE C;  4OXS A;  1KMI Z;  4LFA B;  2OYQ A;  5IT9 N;  3SDL A;  4YIO A;  1Z2G A;  3C90 A;  5D5P A;  2ZE7 A;  4LF8 B;  3JD3 A;  2PYL A;  1SET A;  4UUJ C;  1UFI A;  3RYI B;  1KC8 W;  1BGY H;  3J80 N;  4PHZ A;  2Q69 A;  3I55 V;  3W7X A;  3ETG A;  5EBM C;  3W7U A;  4LFC B;  5GTI Z;  2DWE C;  2ITC C;  3ZMV A;  4NXM B;  3K5O A;  2Y48 A;  2YSU B;  1MNG A;  1K5Q A;  1NTM H;  2ZIM A;  1XQ8 A;  1NR1 A;  2W0X A;  3QTC A;  1KP3 A;  4LH7 A;  4TSF G;  4CH4 A;  1YEW A;  2OCC C;  5JQG A;  4MT8 A;  3BAB A;  5LHI A;  3X2Q B;  5FL7 G;  1A32 A;  3LNM B;  4CH6 A;  1E79 G;  2BCC H;  1PL0 A;  4RQF A;  2P6J A;  2JEX A;  3ASO B;  4QE7 A;  3LDE A;  1LR1 A;  2YI8 A;  2E3C A;  4H44 B;  4HZ3 A;  5LBQ A;  4P2Z A;  1QHT A;  4D7S A;  4JI6 O;  3WFV A;  1BQZ A;  2PZS A;  2QKA A;  4O4L B;  2HFE C;  1HW7 A;  2ZIO A;  2P5O A;  3JD2 A;  1BE3 H;  4HNA B;  2VWK A;  2WLL A;  4JAV A;  3WG7 C;  2RJZ A;  2UXX A;  3K57 A;  4IYH A;  1DTO A;  2YDE A;  2LQT A;  5B5E Z;  4RWU A;  3N27 A;  5LOV B;  3CME V;  2DJV A;  2YIB D;  5GTH Z;  3RYH A;  2PF4 E;  4X89 A;  5E1A C;  1QLN A;  4U7O A;  3SPI A;  5B1O A;  4TQF A;  3A2F A;  5KMG A;  4MW3 A;  1Y6X A;  4JV5 O;  4J80 A;  2LW1 A;  1I5Y A;  3RYH B;  2BSK B;  5IDJ A;  3EVK A;  1Q3E A;  2BOC C;  3ZIA G;  4GX1 A;  5IY5 B;  5LMU O;  1DF4 A;  2WLN A;  3JD4 A;  4JTA B;  2UUB B;  3RW0 A;  4X1I B;  1S5L Z;  4UVB A;  5IJ0 A;  2P06 A;  4X65 O;  4X62 B;  1RFY A;  1HNZ O;  3CRQ A;  3TGU H;  5B1A C;  1SER A;  4R50 A;  3OUS A;  4JI2 O;  4U3F H;  4FLY A;  3AK3 A;  1QU7 A;  4LFB O;  2JEU A;  4EFE A;  2F4V B;  2QEX V;  2XOK G;  3ZX6 A;  4B7K A;  1H8H G;  3NR7 A;  4F6R A;  4QJF B;  3T1H O;  1X59 A;  3UKM A;  1OHH G;  1VQ8 V;  4ZHQ A;  1TUE B;  1EFR G;  4MVS A;  3T4D A;  1K33 A;  1K3E A;  1XI1 A;  4K8X A;  1Q5O A;  5JWP A;  5BMV A;  2GTA A;  2QA4 V;  3G67 A;  5H2F Z;  1L0L H;  4TWK A;  4TV8 A;  1SQG A;  1V55 B;  5LHG A;  3T2M A;  1D5A A;  1W0K G;  1TA8 A;  1SS3 A;  1HR0 O;  2LFS A;  2W6I G;  1WNS A;  1M93 A;  3CP1 A;  4JI6 B;  3BCC H;  1YIT V;  1PNM A;  1WN7 A;  4YHH B;  4KHP O;  2ZNJ A;  2G38 A;  4H37 A;  5KX5 A;  1O9G A;  3D8C A;  5KA6 A;  1H2M A;  1NI8 A;  2P67 A;  4JZ2 A;  5KUM A;  4DR2 B;  1JVM A;  5LYJ A;  2RMK B;  4JPR A;  5F2V O;  4DO2 A;  3CRR A;  2VRZ A;  5KX5 B;  4AHC A;  4B08 A;  4PDL A;  5FPO A;  3BPZ A;  3CC4 V;  3ABL B;  4P9O A;  2UUA O;  1DF5 A;  4I9Q A;  1EN5 A;  2WAM A;  3SPJ A;  5CA3 A;  2GDS A;  2CTR A;  1URF A;  2IJI A;  3ZJZ A;  2RQ6 A;  5IE9 A;  3L73 H;  3OGI B;  1W2B U;  1M56 B;  4DV4 O;  3HKE B;  4P9P A;  1SA0 B;  3OTF A;  2GBO A;  1KD1 W;  4IIJ A;  2KG7 A;  3UCS C;  3FFQ A;  1T5E A;  4X65 B;  1CP9 A;  3BRC A;  3K79 A;  1TGO A;  1Y76 A;  4MVO A;  1HNZ B;  4UCR A;  2CGO A;  1PM9 A;  3UQ8 A;  1VEW A;  4JI2 B;  3JD1 A;  3OE7 G;  4GZR B;  2QWN B;  3MDS A;  2JIZ G;  3L72 H;  2N74 A;  4LFB B;  3MD0 A;  1J95 A;  3Q4H A;  4O2B A;  3R65 A;  1PPJ H;  1PV0 A;  1M57 C;  1RM1 B;  3CCV V;  1VQL V;  4L87 A;  4O2B B;  1GN4 A;  3QF7 A;  1MMM A;  4O4I A;  1SQF A;  3AG1 C;  4GT1 A;  1DK1 A;  3SGI A;  1KB9 F;  4DR1 O;  1Z5W A;  1QLE B;  3E83 A;  1SQX H;  2D2C B;  2R70 A;  4KXR A;  4O4J A;  1L0N H;  1ZTE A;  5DN6 G;  2JS5 A;  2M6Y A;  3B4S A;  1XHZ A;  4NTY A;  3JAT A;  3T1Y O;  4O4J B;  2RCV A;  2Q0A A;  1EM1 A;  1Q90 D;  5GON B;  3K58 A;  5B1B B;  1HR0 B;  5LHH A;  1US6 A;  1SZX A;  2HLD G;  2QKS A;  1OCZ B;  2ARH A;  3JAT B;  1L1F A;  2JDI G;  2UUC B;  1MOF A;  1NTK H;  3BA8 A;  1R73 A;  2HJD A;  4MTX A;  1R3I C;  2YXH A;  1BHB A;  4B3R B;  5H6R A;  2JK5 C;  3CE2 A;  3JCU Z;  4WBN A;  1NTZ H;  2EIM C;  2H8P C;  1YSC A;  5D5Q A;  1Q6U A;  5CA0 A;  1H2G A;  1AJP A;  4QPK A;  5ITZ B;  3AG2 C;  2UXD B;  3SYC A;  3RFR A;  2CTP A;  1YJW V;  2JGD A;  5CA0 B;  2UUA B;  4TV9 A;  4WFH A;  4TQD A;  1NJI W;  1P49 A;  3CXH F;  1FXK A;  4FM1 A;  1S72 V;  1UJW B;  1K4D C;  2R9R B;  5FLX N;  4DV4 B;  3EXA A;  2GV9 A;  1XMO O;  1Q82 W;  4DV7 B;  2B5U A;  2EX3 A;  2L6L A;  3CRM A;  3A0B Z;  1NS1 A;  1GKF A;  3SPH A;  2VQF B;  2ILM A;  3PN1 A;  2ZCE A;  3WB1 A;  1D2D A;  2ZXW C;  2WLJ A;  3STZ C;  2YEV B;  2LGW A;  1BQ0 A;  3OAA G;  2DW4 A;  5IYD O;  4KFM A;  2GSM B;  1YJN V;  2ADP A;  3OW2 U;  1Q43 A;  2ITD C;  2DYS B;  4EB6 A;  2PUS A;  4BIO A;  1FAF A;  1RP3 B;  3F7V C;  2HR3 A;  2ZD9 A;  1MZF A;  1QNM A;  5KHI A;  3LSS A;  1BCC H;  4QPJ A;  3LDD A;  4EB6 B;  4DR1 B;  3VOU A;  1FKA O;  1HDJ A;  4LFC O;  3OT7 A;  1K92 A;  2XAH A;  4NXM O;  1IX9 A;  4TT3 G;  5C8Y B;  4ZKI A;  4GX0 A;  2GTS A;  1H38 A;  1N32 B;  4I9W A;  1Q6I A;  3AG4 B;  1I5X A;  1V54 C;  3P3P A;  4GX5 A;  2CGN A;  1VQO V;  4LF5 O;  3JAR A;  3G80 A;  2H3O A;  2FTK A;  1YI2 V;  1SRY A;  5KHH A;  4CH5 A;  4QNH B;  2EUL A;  4PDR A;  1GN3 A;  2V7Q G;  3JAR B;  2ATK C;  4FMT A;  1S77 D;  1AP6 A;  4Q6G A;  1NVP D;  1VQ7 V;  2B1G A;  5IYZ A;  1MAB G;  5JJE B;  3H1I H;  3FAV B;  3E8G A;  2IJJ A;  2VWJ A;  2AHY A;  3APQ A;  3HB3 B;  1N0J A;  2F1M A;  4LR3 A;  3P3N A;  2ZQM A;  5CBF A;  3UO2 A;  5FPR A;  2XTA A;  3OTO O;  3G4S V;  2RN9 A;  3O65 A;  4CBC A;  1N8R W;  5DEC A;  3ZHV A;  3OMA B;  2A7W A;  2EIL C;  3SJQ C;  5L3G A;  5B1N A;  1EN4 A;  1NVP B;  3IC7 A;  2Q0O C;  1XMO B;  5KAF Z;  1VQ9 V;  4DR4 O;  4FLZ A;  2CTW A;  4I0X B;  1UPG A;  1VP7 A;  2DYR B;  4BW5 A;  1R1B A;  1AIL A;  1YXB A;  2FKX A;  3RYF B;  3ZMS A;  1R3J C;  1Y66 A;  5KLV H;  4UCU A;  4F4L A;  1WA8 B;  1YJ9 V;  4U3J B;  3F5W C;  2BE3 A;  3L70 H;  4XDJ A;  1KBH A;  1OV9 A;  3ZRW A;  2AGA A;  4X62 O;  4UFZ A;  2LP7 A;  2YXY A;  2Q9L A;  3QO5 A;  4KUM A;  5LL6 Y;  1GH6 A;  2P7T C;  4F6E A;  2WPD G;  3L9D A;  3QO8 A;  1E1Q G;  4JI1 B;  1ZLZ A;  2KSD A;  3UT5 A;  2F4V O;  4CC6 A;  1Y4M A;  1WAZ A;  2YIA A;  4GUN A;  1HNW B;  3TXQ A;  4JYA B;  1MG1 A;  2OIG A;  4UCO A;  3ZBH A;  1CEZ A;  1OCO B;  2M7W A;  1PNL A;  4R6Z A;  4W4L A;  1BZK A;  4IYI A;  3VBB A;  4LF5 B;  4B3M B;  4MTO A;  4Z2W A;  1F51 A;  1ZX3 A;  3RGB A;  3E22 A;  1XBL A;  4NTW A;  4MVM A;  2HKO A;  3JAS A;  5LMN B;  2BTQ A;  1YHQ V;  3OGC C;  5JQG B;  5JJJ B;  3E22 B;  3CWB H;  4FZ1 A;  2W6J G;  3JAS B;  2JGU A;  4J9Y B;  1RSO A;  5J2U A;  2IH3 C;  5JJN B;  1G8M A;  1XOU A;  2CK3 G;  1XDC A;  4JAS A;  4YHH O;  3U0Z A;  1FXV A;  2IH1 C;  4JF3 A;  4FFK A;  1OCC C;  1KQS U;  4OPH A;  3M7M X;  2NN4 A;  4CZZ A;  4DUY O;  4LC1 A;  4DR5 B;  2HJF C;  4DR2 O;  3OTO B;  2YIC A;  3AEI A;  1AI7 A;  3SPC A;  2EIJ C;  3MHS C;  3EFF K;  4NXN O;  2WLL B;  1JOY A;  1H2K A;  4DR4 B;  3PJS K;  5EC1 C;  1BS3 A;  3H1K H;  4DUZ O;  4UB6 Z;  1MSW D;  2Q67 A;  3ETD A;  2QTO A;  3SPG A;  5KMG B;  3D3Q A;  1S76 D;  1Q7Y W;  4DV6 B;  2AZ2 A;  4J7Z A;  1M90 W;  4JI4 B;  1GM7 A;  4C7U A;  1K34 A;  1K97 A;  2YXL A;  2EIK B;  1SC5 B;  2MK3 A;  5EZY A;  1WLE A;  5EIB D;  3A0H Z;  4MVU A;  1M5I A;  1AP5 A;  2Y4T A;  5L3F A;  3OR7 C;  2Q68 A;  2YC0 A;  2QM4 A;  3H01 A;  5BXZ A;  1ZWI C;  4QIW F;  4FZ0 A;  1GO3 F;  1VQM V;  4FLW A;  1B3Q A;  4PA9 A;  2W0F C;  4I50 A;  1AI5 A;  5IJ0 B;  2R72 A;  2QWQ B;  4X8A A;  5EBL C;  3H9V A;  4B3S O;  1Y74 A;  2E75 B;  1R6N A;  3AG3 B;  3X2Q C;  5GW7 A;  1X4T A;  3IGA C;  4YJ3 A;  3CRC A;  4K35 A;  2P4K A;  3ASO C;  1Y74 B;  3LSU A;  1V9P A;  2WLI A;  1I94 O;  3CJH A;  4F6R B;  1EZV H;  1I7F A;  3BAA A;  4FFB A;  3CCM V;  3JD0 A;  2QWP B;  3OEH G;  4ZHQ B;  2DN9 A;  1QCE A;  4PA4 A;  3SJB C;  1VF5 B;  5CB4 A;  4E2L A;  5KUK A;  5BMV B;  2JVD A;  1NH2 D;  3JAL A;  5IYB O;  3L75 H;  2ZDI A;  3K0G A;  4NR1 A;  4K8Z A;  1WB7 A;  1JJO A;  4TV8 B;  5CB4 B;  3RYC A;  1JQ0 A;  3JAL B;  3RVZ A;  2HHH O;  2UUC O;  4WF9 V;  4X9Q A;  4UV8 A;  3WB0 A;  1BT8 A;  4HYO A;  2NR5 A;  4MW8 A;  3MHH C;  4B3R O;  2BOB C;  2EJ7 A;  4I4T A;  4MTG A;  4X1K A;  4DUY B;  3SYP A;  4ICG A;  5CBG A;  1SQB H;  1PNK A;  2QR4 A;  3CC7 V;  5IY5 C;  3ZRV A;  4NXN B;  1IXM A;  2Y0I A;  1WP7 A;  1WJZ A;  1PD3 A;  1NH2 B;  5LYJ B;  2UXD O;  2ODM A;  4DUZ B;  2Z0A A;  4I7Z B;  2CAZ C;  5LP6 A;  2EZO A;  4DK0 A;  1VQ6 V;  2QTS A;  2N04 A;  1CPY A;  3HKD A;  5LP6 B;  5B66 Z;  4JI3 B;  5KA5 A;  4DV7 O;  4NB5 A;  2Q5Z A;  2A79 B;  3RT3 C;  4A5U B;  5LXT A;  1TVK A;  2N05 A;  4PI0 A;  2YUA A;  4BIZ A;  4GKK O;  2FB5 A;  3FB8 C;  3HKD B;  3JYC A;  2VQF O;  4CS3 A;  3ZRX A; 
#chains in the Genus database with same CATH homology
 1CXZ B;  4IGG A;  2RMK B;  4NB5 A;  1URF A;  4NKG B;  1UPG A;  1RFY A;  4DYL A;  1US6 A;  2HJD A;  2Q0O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...