4NKGB

Crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase/transferase
total genus 25
structure length 66
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 4nkgB00
1CXZB 4NKGB 1UPGA 4IGGA 4NB5A 1RFYA 4DYLA 1US6A 2RMKB 1URFA 2Q0OC 2HJDA
chains in the Genus database with same CATH superfamily
4I0XA 4R6ZA 3ZMZA 5EYPB 4LFBB 3ML0A 2BOCC 1IX9A 2OT5A 3BEHA 4FZ0A 1KKCA 1Y74A 4O4JB 4B3TB 3ICXA 3KG2A 5IE9A 1N34B 3JSNA 1IBMO 5EBWC 4XBFA 1WB8A 2RJZA 2UXBO 4H44B 4F4LA 4KP4A 4DV3B 1PNKA 5BXZA 3CYOA 1PPJH 1AVMA 3ABMB 2FB5A 2UUCB 5LHHA 3Q4HA 3JD0A 4X64B 2X7RB 3RBZA 4MVUA 4WFHA 2DE0X 4NTWA 4GT1A 4BAYA 2OYQA 2IM9A 3RGBA 1SZTA 1Z5VA 4YXWG 2BSKA 2UUAB 1PP9H 3JARA 4X62B 3H9VA 3JSLA 4YHHB 1YHQV 2Y4UA 1VF5B 1WP7A 3G71V 1BT8A 4LP8A 3E8BA 1XHXA 3MHHC 2ETNA 1PKXA 4EB6A 4G2KA 2QKSA 3OMNB 4J80A 1VQ9V 2Q7HA 4L87A 5LOVB 1SC5B 1N0JA 5CA1A 1XBLA 5KLVH 3K59A 2FKXA 3CJHA 4I4TA 1BHBA 1RFYA 3K57A 2CTQA 2M7WA 3N2KA 1Q90D 1FXKA 3QNEA 5LYJA 3M7MX 2EIMC 1V9PA 2E76B 1KQSU 3CXCU 1AB3A 1R1BA 2EILC 4LF5B 1ROPA 3X2QB 1IXMA 1YITV 4FMTA 1VQLV 2ILMA 4GKKB 4P9OA 2LFRA 5DECA 3CCLV 1QBZA 4JF3A 4UB8Z 1DF5A 4DR2B 3VQYA 1VQ4V 2EJRA 5EBLC 5KA5A 4GCZA 5IY5C 3CSXA 2AHYA 2DYRC 2RN9A 4PHZA 3AG2B 2A7WA 4NXNB 4JI7B 2R70A 1EFRG 3W7XA 5LXTB 3SPJA 4LF4B 3CCVV 1CP9A 5AG2A 5L3CA 1JQ0A 4IT5A 1YCIA 1SA0B 5IYZA 3BABA 3UT5A 4DV2B 3C3TA 5L3DA 5TISZ 1JMKC 1AI4A 3CB2A 1OV9A 3ZMSA 3CP1A 2OTLV 2M6YA 1BL8A 2X6AA 4FPPA 3ABMC 5CN0A 2YICA 1TUBA 1BE3H 4ZOLA 1OCZB 2CAZC 1GKFA 3OD4A 4EKWA 2ZXWB 2WLLA 3IC7A 2UXDB 2DN9A 1ZTEA 3L71H 4PA7A 1ZAUA 5C8YA 3QO5A 4DV5B 2D3OW 1NVPB 1YJ9V 2BTQA 1E79G 4GLXA 1JA8A 4E2LA 4YJ2A 2AGAA 3ZX6A 4B3MB 1GO3F 4BR6A 2A9HA 4LF6O 3ASNB 1AI7A 4YIPA 1F4NA 5H9CA 2K9PA 2EBOA 3O9OA 4HBNA 4FM2A 1SZXA 4U7OA 1NI8A 4DV1B 3STZC 1NT2B 2JJ2G 5KHHA 2Q0OC 5KHIA 2OIGA 3QF7A 4ZKIA 3ZHTA 4CZZA 5LGUA 3IGAC 1N32O 5IJ0A 4LNUA 1HP8A 2Y4TA 1O9GA 4WFEA 1V55B 2CH7B 2B1GA 2MW2B 1WPXA 2EINB 5J2TA 2IJHA 2Q5ZA 2HG5C 3OEEG 1XDCA 3ZBHA 2VQFB 1FPOA 2JEXA 3OT7A 1XHZA 1WP8A 1FJGO 3F7VC 5IYCO 1Q6IA 4JI1B 3AG2C 3ZRWA 4XDLA 2DJVA 2W0FC 1KU9A 4MTXA 3SJBC 1VF6C 3ABLB 1I94B 2P67A 2QWOB 2X6CA 2CUGA 1QU7A 2JS5A 2EZPA 4P9PA 4ZBMA 2Z5UA 3APOA 5KX5A 3KZIZ 5KAFZ 5LMNO 1GN6A 3HKBA 1S72V 1BZKA 3OGIB 5ITZA 3D3QA 4N23A 4Q20A 3K04A 3ZHRA 4LCUC 3JAWA 5IT9N 4PA9A 1OCZC 3CC4V 4TV8A 4I0XB 5B1AB 4WBNA 2IH1C 4WCEV 3CC2V 2XAJA 3OTOO 1Y74B 1K92A 2QSAA 3B40A 4Z2WA 1NH2B 4UCOA 4FLVA 1GN3A 3P3PA 2UU9O 1GM7A 2YEVA 1X59A 1AJPA 1AR4A 3ASNC 3Q4HB 4J7ZA 3AK1A 1Z5WA 4FVMA 4CH5A 1KBHA 2BSKB 3DTUB 3AG1B 2HVKC 2QWNB 2E75B 1YVWA 3RW0A 4CS4A 3M99B 4LF8B 2ADPA 4HYOA 3ZIAG 3BA8A 1L0NH 3FB7C 3I55V 1H2GA 3EVKA 5LP6B 1FXVA 4MS2A 4TQDA 4EB6B 2JVDA 4X65B 1IDSA 3SR2C 5KA6A 1V55C 2JEUA 4PA4A 2LFSA 5B1BB 3OW2U 5CA1B 5FL7G 3RVYA 3CJHB 3CC7V 2VWJA 1XMQO 2KKWA 3N2KB 1AP6A 1FXKB 3F7YC 5LYJB 2WLHA 2Q6AA 3AG3C 2CE4A 4TWKA 4DR1O 1K8AW 1COWG 2H8PC 2YIDA 2OCCC 3QTCA 1HW7A 3JATA 4DUYO 3EHBB 3RFRA 3H01A 4FJCC 3BA9A 4KHPO 2HJFC 1B6QA 4FLWA 2Y69B 1XNQO 4MTGA 2L35A 4DV6B 1M57B 1FAFA 1XNRB 3CCMV 1H2MA 4UCUA 1JCHA 2YUAA 3SPCA 1XUQA 3VQWA 4IGGA 2W6IG 2R9RB 1BCCH 2ZDIA 3MDSA 1MG1A 4P2ZA 4YIOA 5B1AC 5IYZB 2GDSA 2QM7A 3UT5B 2F43G 4J9YB 4I50A 3IJ4A 2Q4PA 3UO3A 1DTOA 4OX9B 4W4LA 3SJQC 1TUBB 4O4IA 4ZOLB 4K3AA 4PD4F 3RVZA 4UVCA 4J10A 4G27B 3C90A 3A0RA 1UJWB 2LGWA 1HDJA 2WLLB 3G4SV 4ICGA 1OCRB 5H5NA 3AG1C 3ZRSA 4XDJA 1K34A 2G38A 1XMOB 1EN5A 2XAQA 2BTQB 4X9QA 4FLUA 2WSSG 3HR0A 2ZM6O 2EIKB 3FX7A 5IJ9A 2ZR3A 5JVDB 2A3QA 3SYOA 1JPXA 2HJDA 4JYBA 2EULA 4JI5O 5FPRA 5B1BC 5CB4B 2BCCH 5IWAO 1M5IA 2XASA 4R8CA 3U0ZA 4X66O 4GKJO 4F6EA 3OMAB 1GRJA 2LQTA 4BW9A 1FXKC 4G28B 4LFAB 3ABKC 5EC2C 3SGIA 1U96A 3JD3A 4CBCA 5IJ0B 3ZMTA 4LNUB 2XAGA 3CPWU 3E35A 2CTWA 1SQVH 3U10A 5J2TB 4PDMA 4JV5O 1GM8A 2CTPA 2QJ1A 4X89A 2Q73A 3OEHG 3ZRWB 1WA8A 4LBEC 3ETQA 1UFIA 1IBLO 2UXXA 5HFLA 4Q6GA 3K79A 2LW1A 3W7SA 1S5HC 1ZL8A 1Q86W 1EBOA 3R65A 4LF7O 2Z3YA 1IBMB 2HHHO 2E5LB 2F4VO 1BMFG 4NR1A 3TETA 2QA4V 4D7TA 1KP3A 4NKGB 3GWOA 5KX5B 1GMGA 1K4CC 3CCUV 3NR7A 4KFMA 2PI5A 3EXAA 1WNSA 3CHXA 5EIBC 2UXNA 5ITZB 3S3WA 3CCRV 4LFCO 2ZD9A 4WFFA 3ZJZA 4I9WA 1RM1B 3JAWB 4DK1A 5GW7A 4I9QA 1TAEA 4TV8B 4LH6A 4WBNB 3FB5C 1OCRC 2QEXV 3ZCCA 4O4LA 3D8CA 1EZVH 2QWPB 4X1KA 4JI8O 2EIKC 1Q81W 4GYCB 2LGQA 3SYPA 1SS3A 3ASOB 2YEVB 2DQ0A 1XQ8A 1HNXO 3SPGA 3A2FA 2BE3A 2P5OA 1SQXH 3JD1A 3G80A 2E3CA 5HFMA 3IFXA 1Q7YW 2YXLA 2IBZH 2A0LA 4PDLA 3K58A 1VQMV 1U97A 1VQOV 1R3KC 2L6LA 4XDKA 5DEDA 4FFBA 2AHZA 3O65A 1NVPD 3APQA 1P4RA 4F6RA 2Q7GA 1L8DA 3G67A 3K9SA 5LP6A 4QNHB 4MVMA 1HNWO 5KHKA 4JYAO 1JOYA 1BQ0A 3JATB 4MVOA 4OXSA 4BIZA 1N4CA 3JCUZ 2IW5A 1H38A 2YI9A 4R7CA 1SF9A 1QNMA 2OWOA 3RYCA 4LWSA 5JH7A 1JJOA 5L3FA 1ZUQA 4E4EA 2XAHA 3SYCA 4LFBO 4UCTA 1RM1C 3CRAA 2R9IA 1N34O 1QLNA 3HPLC 1S0VA 2WWWA 4LF6B 5LGNA 3CE2A 4I50B 4YJ3A 3TXSA 3SPIA 2NLJC 4X64O 1FD9A 3ZHQA 2NN4A 1M9NA 1K3EA 1V54B 4LR3A 3ASOC 2JJ1G 4RUEA 2VS0A 4O4IB 4RO2A 3BRCA 4X62O 1R6KA 4OGQB 1BQZA 3ETEA 2ZE5A 4PV1B 4DV4B 1N32B 1Q6HA 5KHJA 2VQEO 1KKDA 3KCYA 5GTHZ 2KSDA 2NNUA 3ZHSA 1A32A 3CWBH 1VQNV 1WN7A 5IJ9B 2QR4A 2PGGA 3J81N 2XNDG 1H2SB 1B04A 2ZE6A 4J9ZB 2YIAA 4MTFA 1FJGB 5JCOA 3CCQV 1KD1W 1QR9A 2LP7A 4FM1A 1VQ6V 4LF5O 1DF4A 5JVDA 5IYDO 4JTAB 4GKKO 1NH2D 4DR7O 2VWKA 1UPGA 1VMGA 5CB4A 3TK1A 2NR5A 4DR2O 4QPJA 1BHAA 1M90W 1ZLZA 4JI2O 5B66Z 4JGSA 3B2EE 2ZCEA 3NXSA 5LMNB 3T1HO 5KUKA 4MVZA 2AXTZ 2Q69A 2ATKC 3BVOA 3CEIA 3X2QC 5DN6G 1Q5OA 2WLIB 4J7JA 4LF4O 3L73H 1WA8B 5JJJB 2ITDC 1Q8IA 1I7FA 4MT8A 2JIZG 2PF4E 1JJ2U 2WLJA 4DV2O 3B8MA 5LMUO 5K1XA 3T4DA 5BY1A 1OCOB 2ZIOA 1ZL8B 2ZT9B 3OTOB 3B4SA 2ZDIC 4O4HA 2ADQB 4PJ0Z 1XL4A 4DV7B 1H2NA 5BR8O 4AQYB 1Q3EA 1S3JA 3W7UA 2QTOA 1KECA 1JR9A 2UXDO 3E86A 1P7GA 2CK3G 1P84F 3QVNA 4DV5O 2KG7B 2AZ0A 1PNLA 4D6TH 1G1XB 4I5SA 2IJJA 5L3EA 3KCXA 2EJ7A 2IJKA 1SQQH 4DW1A 3AG4B 4O4LB 2IH3C 4X1KB 4RWUA 4UVBA 1XMQB 1NU1H 5B1NA 3J7AU 4TV9A 4PELA 2ZXWC 4ZI7B 4ZHQA 1OCCB 4DV1O 4JI0O 1J5EB 3A0BZ 3G6BA 2YS8A 3CRMA 4DK0A 1RPOA 3ZMVA 1WJZA 2B5UA 2HVJC 4BWAA 1I5XA 3JAKA 1VQ7V 2EX3A 5CBHA 1QLEB 2RMKB 2HKOA 3I5DA 1NZ6A 1PM9A 4KHPB 4K0KB 3DXRA 5EIBD 4WFBV 3VQXA 4JYYA 2YC0A 1XNQB 1HNZO 2QE7G 1NBMG 5E79Z 4CS2A 5H6QA 2VQFO 3N27A 1BSMA 3ZRVA 1X4TA 2BOBC 5CBFA 2EZOA 4X1IA 1PV0A 1R3JC 4FFBB 3MD0A 4JI1O 2JGDA 2F23A 4UB6Z 3RYIA 2HEPA 2O57A 4F6RB 5LA6A 5CA0A 4MW8A 3UO2A 4HNAA 3WB2A 3CXHF 3SPHA 1K97A 4JI3B 1LR1A 2EINC 4MTOA 3HKEA 3RYFB 1OCOC 1K5SA 2ZE8A 1WB7A 2QGNA 1Y67A 1SRYA 3L75H 3BHPA 4MW3A 4UCRA 4JI6O 3ABLC 1VARA 4DW0A 3RYCB 4LWSB 5EZYA 1ZWIC 4TT3G 4IYHA 5JH7B 4TSFG 1R6NA 4JAVA 4PI0A 4FK5C 4RUFA 1D5AA 1S76D 3VQVA 3VOUA 2ZM6B 2BTOA 1MSDA 2H3OA 3AG4C 4YJ3B 3VBBA 3H1JH 4EFBA 5E1AC 3TCUA 3SYAA 4JI4B 2MK3A 5IWAB 2CGOA 4DV0B 2P90A 5F2VO 4X66B 4GKJB 3OFNG 3H1IH 4K8XA 4YY3O 3RWRD 3WG7B 2IU0A 1OCCC 4LF8O 2WLMA 1QQCA 4QE9A 4DR3B 3JCZA 1NS1A 5JWPA 3CCJV 1VP7A 3ZMUA 2KQXA 3B77A 4AI8A 1AR5A 3CCSV 1H8EG 1Y4MA 1AJNA 4DR6O 2DYSB 1E1QG 4A5UB 4NXMB 1N0NA 3SYQA 4O2AB 5D5QA 5J9PC 1M4UA 1MOFA 4DO2A 3T4ZA 1IBLB 3RN4A 5C93A 1TGOA 4CH4A 1FFXA 5LGTA 4LF7B 5LP6C 2HHHB 2F4VB 1SQBH 4JZGA 3CS5A 1XL6A 1N36B 2FYUH 2WPDG 1HR0O 1PD3A 2R9AA 1KC8W 1SESA 4K35A 4B3SO 5J2UA 1FYJA 5GTIZ 3CMEV 4LFCB 3CRQA 1MNGA 1H8HG 3ABUA 1KB9F 4FLXA 3D36A 4B3RO 5KUMA 4UVAA 3TGUH 2LW7A 1MABG 1E1RG 1S5JA 2GHYA 4NB5A 1Y76A 3K9AA 2K1EA 3K5LA 1PL0A 2Y69C 3CX5F 1PNMA 2W6JG 1YSCA 3A0HZ 4RQEA 3JAMN 1M57C 4DUZO 2QKCA 3CCEV 4OX9O 2RNBA 4JI8B 3D3IA 2C2AA 2WLIA 3JD4A 4O4HB 4IIJB 4W4KA 4HAMA 1HNXB 2XAFA 2UUBO 2Q8VA 3W7TA 3LUTB 2CTRA 4CH3A 2HLDG 3E8GA 1NTMH 4DR5O 2UXBB 2QDOA 2V7QG 2DWDC 1DGSA 2YI8A 1H2KA 3WG7C 3T1YO 4DYLA 2B1IA 3OUFA 1XMOO 2Z0AA 4LF9O 4DR4O 4GX2A 4J41A 3FFQA 3B09A 3L70H 2WA3A 3RYHA 1D2DA 3K5OA 5A9GA 3FAVA 4KXRA 1YTFB 4U7NA 3CMAV 3HB3B 4LH7A 1MMMA 2EIMB 3N2GA 2GTSA 2KG7A 3UCSC 4TV9B 2P6JA 4ZHQB 2UXCO 4I7ZB 4WFGA 1K5QA 3C3SA 4GX1A 1HNWB 3AK2A 4WFAV 3OR6C 4JYAB 3JAKB 4TOIA 4PDVA 2ODMA 1GN2A 1W0JG 1XEQA 3TXQA 3QG5A 4JAUA 3OUSA 2ZINA 2JDIG 3DXRB 1QVGU 4ZI7A 4GZRB 1RSOA 2DYRB 1WPBA 1IBKO 3P3NA 5LHGA 2AZ2A 1M93A 1NR7A 2F66C 4IL6Z 2HP8A 4X20A 1MA1A 2QWQB 3DC6A 4X1IB 1K9MW 2ZNJA 1BS3A 2JGDB 2B9ZA 3RYIB 1CXZB 3I56V 2V1DA 2ITCC 4CC6A 5LA6B 3ZN1A 3LSSA 5CA0B 4MVSA 1N33O 2E5LO 4HNAB 4QPKA 5A2QN 1NTKH 3UKMA 3F5TA 3HKEB 1SETA 4NTYA 3S3XA 2N74A 1AROP 1M56B 2YXHA 4JPRA 3LSUA 5KHGA 2YIBA 1B06A 1VQ5V 3GWKC 5H2FZ 2XT9A 1ORQC 1VQKV 1PL4A 3RYFA 5EZYB 4DRXA 3MAQA 1R3LC 3DGEA 4AHCA 2VQEB 3ZS8C 1IURA 4HZ3A 4UCSA 4OPAA 4FLZA 2P22C 5H6RA 5B1OA 1DLBA 1RPRA 4O2BA 3U11A 3K5NA 4QIWF 1NKDA 1QHTA 4N21A 2QWRB 1KMIZ 1M1KW 1XI1A 4H13B 4B3TO 4KL1A 2D2CB 4DV3O 1AILA 1R73A 2R72A 1Q82W 4TUYA 4DR7B 2UUCO 2F1MA 1P49A 1KUQA 3STLC 2A79B 4FIPC 4DXWA 4H37A 5IDJA 1JFFA 2PI4A 2WLNA 2JGUA 3PJSK 3UQ8A 4JI2B 1AP5A 1XILA 4D7SA 2UUAO 1GK9A 1KP2A 2RQ6A 4IYIA 4FLYA 1FS0G 1CEZA 3T1HB 4YHHO 2AW9A 1WAZA 4P30A 4BW5A 3AEIA 1L0LH 1SQPH 1FKAO 1YJNV 3HKCA 3T1CA 5KMGA 2QKAA 1SQGA 4FM0A 4U3FH 5LMUB 1FFXB 4B7KA 4MSWC 1EM1A 3ZHVA 3HKDA 1H2LA 1GN4A 4O2AA 4U3JA 2LO1A 2H94A 1L1FA 2XOKG 1GM9A 1QR8A 4GUNA 4JYCA 5GONA 1M56C 2OIEA 3SJAC 3QO7A 5J2UB 5BR8B 3JALA 4J7KA 3FYIB 3LDEA 1R3IC 2F93B 3GB7C 1T5EA 1CPYA 1XREA 2DW4A 2JK5C 1R6TA 3LNNA 5BMVB 4FLTA 1Y76B 4QE7A 3ZN0A 2IU3A 1EZJA 2V4DA 4NXNO 4JI7O 4UFZA 5LBQA 1VEWA 5CA3A 1VIBA 3IAYA 2Q9LA 3AK3A 2P06A 2F95B 1FFTB 1J95A 4UCVA 4NTXA 4JI0B 4CS3A 2YIBD 1IZ3A 4B08A 5FPOA 5FNVB 4DV4O 1F23A 5L3GA 1N8RW 2FL4A 2JS3A 2Y0IA 4CH6A 4IIJA 3E22A 2UU9B 2RCVA 2EIJB 5KAIZ 1QCEA 4MVQA 2VRZA 2PYJA 3K0GA 2DOSA 3RYHB 1HNZB 1V54C 5K1PA 1NTZH 4PA6A 3FAVB 5DM6V 3ZHUA 1Q43A 2HR3A 1HWYA 5JQGA 3N2GB 1F4MA 1QVFU 3AG3B 3JYCA 4K8ZA 4AILC 3OM3B 2GSMB 2OCCB 1TUEB 4B3MO 2YSUB 3ABTA 1NQTA 2GV9A 2QTSA 1AI5A 2PTMA 1URFA 1RP3B 2ARHA 4ZIBA 2P4KA 2OCHA 3EFFK 1W2BU 4H0LB 2XTAA 1GTOA 3L74H 1RSOB 4WF9V 3P30A 3JASA 4DR1B 2PYLA 1Y6XA 4L8JA 3K0DA 4X88A 1F7YA 4QGPA 2GUZB 3GVMA 4NYKA 4BIUA 2WAMA 4IHJB 4X20B 1TVKA 4DUYB 2X6BA 5D5PA 4JI6B 1Y66A 2Q68A 2YDEA 3L72H 3E8FA 4JTCB 1KYOF 3CRCA 1GH6A 2WLKA 3OTFA 3ZRXA 4EEQA 1MZEA 2PY5A 1I08A 3D36C 3FB6C 4I55A 4X1YA 3DC5A 1K33A 1OJHA 1IXBA 1P7BA 2PZSA 1F51A 2CDYA 1W0KG 4J42A 2N05A 5EYPA 4BIOA 4DV7O 4J11A 5IYBO 3BY6A 1W59A 1I94O 1EN6A 4AQYO 4FFKA 1IVSA 4O4JA 4JTDB 4YY3B 3T2MA 3QO8A 1I0HA 3JARB 2A06H 1S5LZ 4DRXB 1XOUA 1GAXA 1G8MA 2EIJC 3MHSC 3W7WA 3G6EV 1YDXA 1OZ0A 4I4TB 3K06A 4DR6B 1G4YB 4O2BB 1O9HA 3LNMB 3H1KH 1J5EO 3ABKB 1SQFA 3E2EA 1YXBA 1AJQA 5JJEB 3P32A 5LOVA 3OGCC 3LDDA 1TA8A 4GX0A 2YXYA 4TUYB 5B5EZ 2IJIA 1JX9A 1YIJV 4K0KO 1SKVA 3SJCC 4JI5B 4OPHA 1HR0B 1YZBA 4TQFA 1Q6UA 3AG7A 1MZFA 1JFFB 3FD9A 4ABMA 2GTAA 4H33A 1YI2V 3BCCH 2QM4A 1NJIW 4B3SB 4EFEA 4JAAA 1VF7A 2PUSA 1MSWD 5B3SB 4B3RB 3FB8C 1QLEC 3HKCB 5KMGB 1K73W 4UV9A 4X65O 1Z2GA 4C7UA 3K08A 1EN4A 1YTFD 4JI3O 1S77D 2Q0AA 4Z1VA 4JV5B 5L3BA 3FYEB 4DUZB 1VF6A 5LXTA 2CGNA 3HKDB 2X0LA 3CRRA 4U3JB 1LUWA 3K5MA 2UUBB 4UUJC 5GONB 3THOA 1SA0A 1DK1A 4MVRA 2QM8A 1ENVA 5CBGA 4QJFB 3JALB 3ETGA 3H1HH 1AI6A 2DWEC 3BPZA 3DSQA 4DR5B 4UXNA 4NVPA 3T1YB 4PDRA 5C8YB 4LF9B 4GX5A 4DR4B 3K3WA 3LDCA 2FTKA 4DV6O 3BAAA 3K03A 4YJ2B 1SERA 3F5WC 1XNRO 4RQFA 3A8TA 1K4DC 2KB1A 4FZ1A 2OTJV 4LC1A 3SDLA 5LHIA 1ZSPA 3UM7A 5EC1C 2ZKOA 5EBMC 4JI4O 2LJ2A 3TJTA 3WU2Z 4DV0O 3WB1A 1ZX3A 5BMVA 2Y48A 2UXCB 3WB0A 1LUVA 4R50A 3KKYA 1G6UA 3H1LH 1YEWA 2HFEC 3E83A 3FKSG 2JRIA 4PA3A 4DR3O 4PI2A 1VQPV 5JJNB 3E22B 2N04A 1D5NA 5CMUA 3ETDA 5BZBA 3IC9A 3PN1A 1IBKB 5FNVA 2ZQMA 5JQGB 3LSQA 1AR1B 4KUMA 3J80N 4NXMO 1LNQA 4X8AA 5FLXN 2ZE7A 2Q67A 1BGYH 4B7EA 1NR1A 1OHHG 2CH7A 5EK0A 2P7TC 3RT3C 5B3SC 2ZR2A 4Z1MG 3R66A 2XUMA 2FMLA 3OE7G 2W0XA 2E74B 4UV8A 1N33B 2ZIMA 3BFRA 1US6A 1N36O 2EILB 2GBOA 4JZ2A 4ASUG 2DYSC 1YJWV 5JCOC 3HKBB 3JASB 1VQ8V 2ZNIA 4LFAO 3OAAG 2Q7EA 3OR7C 2P4VA 2RDCA 1TVKB 3E89A 1THZA 1K7DA 5IY5B 1YF2A 3CD6V 2Y0PA 3OMIB 4JASA 4CC5A 2DQ3A 2XHBA 3JD2A 3M8AA 3WFVA 5LL6Y 1B3QA 3E8HA 4X1YB 4I55B 1WLEA 1FXHA 2GUZA 4IHJA 2WA4A 3ZEDA 2DMXA 1I5YA 4RAIA 3L9DA 1JVMA 3B8NA
chains in the Genus database with same CATH topology
1CXZB 4NKGB 1UPGA 4IGGA 4NB5A 1RFYA 4DYLA 1US6A 2RMKB 1URFA 2Q0OC 2HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  4NKG B;  1UPG A;  4IGG A;  4NB5 A;  1RFY A;  4DYL A;  1US6 A;  2RMK B;  1URF A;  2Q0O C;  2HJD A; 
#chains in the Genus database with same CATH topology
 4I0X A;  4R6Z A;  3ZMZ A;  5EYP B;  4LFB B;  3ML0 A;  2BOC C;  1IX9 A;  2OT5 A;  3BEH A;  4FZ0 A;  1KKC A;  1Y74 A;  4O4J B;  4B3T B;  3ICX A;  3KG2 A;  5IE9 A;  1N34 B;  3JSN A;  1IBM O;  5EBW C;  4XBF A;  1WB8 A;  2RJZ A;  2UXB O;  4H44 B;  4F4L A;  4KP4 A;  4DV3 B;  1PNK A;  5BXZ A;  3CYO A;  1PPJ H;  1AVM A;  3ABM B;  2FB5 A;  2UUC B;  5LHH A;  3Q4H A;  3JD0 A;  4X64 B;  2X7R B;  3RBZ A;  4MVU A;  4WFH A;  2DE0 X;  4NTW A;  4GT1 A;  4BAY A;  2OYQ A;  2IM9 A;  3RGB A;  1SZT A;  1Z5V A;  4YXW G;  2BSK A;  2UUA B;  1PP9 H;  3JAR A;  4X62 B;  3H9V A;  3JSL A;  4YHH B;  1YHQ V;  2Y4U A;  1VF5 B;  1WP7 A;  3G71 V;  1BT8 A;  4LP8 A;  3E8B A;  1XHX A;  3MHH C;  2ETN A;  1PKX A;  4EB6 A;  4G2K A;  2QKS A;  3OMN B;  4J80 A;  1VQ9 V;  2Q7H A;  4L87 A;  5LOV B;  1SC5 B;  1N0J A;  5CA1 A;  1XBL A;  5KLV H;  3K59 A;  2FKX A;  3CJH A;  4I4T A;  1BHB A;  1RFY A;  3K57 A;  2CTQ A;  2M7W A;  3N2K A;  1Q90 D;  1FXK A;  3QNE A;  5LYJ A;  3M7M X;  2EIM C;  1V9P A;  2E76 B;  1KQS U;  3CXC U;  1AB3 A;  1R1B A;  2EIL C;  4LF5 B;  1ROP A;  3X2Q B;  1IXM A;  1YIT V;  4FMT A;  1VQL V;  2ILM A;  4GKK B;  4P9O A;  2LFR A;  5DEC A;  3CCL V;  1QBZ A;  4JF3 A;  4UB8 Z;  1DF5 A;  4DR2 B;  3VQY A;  1VQ4 V;  2EJR A;  5EBL C;  5KA5 A;  4GCZ A;  5IY5 C;  3CSX A;  2AHY A;  2DYR C;  2RN9 A;  4PHZ A;  3AG2 B;  2A7W A;  4NXN B;  4JI7 B;  2R70 A;  1EFR G;  3W7X A;  5LXT B;  3SPJ A;  4LF4 B;  3CCV V;  1CP9 A;  5AG2 A;  5L3C A;  1JQ0 A;  4IT5 A;  1YCI A;  1SA0 B;  5IYZ A;  3BAB A;  3UT5 A;  4DV2 B;  3C3T A;  5L3D A;  5TIS Z;  1JMK C;  1AI4 A;  3CB2 A;  1OV9 A;  3ZMS A;  3CP1 A;  2OTL V;  2M6Y A;  1BL8 A;  2X6A A;  4FPP A;  3ABM C;  5CN0 A;  2YIC A;  1TUB A;  1BE3 H;  4ZOL A;  1OCZ B;  2CAZ C;  1GKF A;  3OD4 A;  4EKW A;  2ZXW B;  2WLL A;  3IC7 A;  2UXD B;  2DN9 A;  1ZTE A;  3L71 H;  4PA7 A;  1ZAU A;  5C8Y A;  3QO5 A;  4DV5 B;  2D3O W;  1NVP B;  1YJ9 V;  2BTQ A;  1E79 G;  4GLX A;  1JA8 A;  4E2L A;  4YJ2 A;  2AGA A;  3ZX6 A;  4B3M B;  1GO3 F;  4BR6 A;  2A9H A;  4LF6 O;  3ASN B;  1AI7 A;  4YIP A;  1F4N A;  5H9C A;  2K9P A;  2EBO A;  3O9O A;  4HBN A;  4FM2 A;  1SZX A;  4U7O A;  1NI8 A;  4DV1 B;  3STZ C;  1NT2 B;  2JJ2 G;  5KHH A;  2Q0O C;  5KHI A;  2OIG A;  3QF7 A;  4ZKI A;  3ZHT A;  4CZZ A;  5LGU A;  3IGA C;  1N32 O;  5IJ0 A;  4LNU A;  1HP8 A;  2Y4T A;  1O9G A;  4WFE A;  1V55 B;  2CH7 B;  2B1G A;  2MW2 B;  1WPX A;  2EIN B;  5J2T A;  2IJH A;  2Q5Z A;  2HG5 C;  3OEE G;  1XDC A;  3ZBH A;  2VQF B;  1FPO A;  2JEX A;  3OT7 A;  1XHZ A;  1WP8 A;  1FJG O;  3F7V C;  5IYC O;  1Q6I A;  4JI1 B;  3AG2 C;  3ZRW A;  4XDL A;  2DJV A;  2W0F C;  1KU9 A;  4MTX A;  3SJB C;  1VF6 C;  3ABL B;  1I94 B;  2P67 A;  2QWO B;  2X6C A;  2CUG A;  1QU7 A;  2JS5 A;  2EZP A;  4P9P A;  4ZBM A;  2Z5U A;  3APO A;  5KX5 A;  3KZI Z;  5KAF Z;  5LMN O;  1GN6 A;  3HKB A;  1S72 V;  1BZK A;  3OGI B;  5ITZ A;  3D3Q A;  4N23 A;  4Q20 A;  3K04 A;  3ZHR A;  4LCU C;  3JAW A;  5IT9 N;  4PA9 A;  1OCZ C;  3CC4 V;  4TV8 A;  4I0X B;  5B1A B;  4WBN A;  2IH1 C;  4WCE V;  3CC2 V;  2XAJ A;  3OTO O;  1Y74 B;  1K92 A;  2QSA A;  3B40 A;  4Z2W A;  1NH2 B;  4UCO A;  4FLV A;  1GN3 A;  3P3P A;  2UU9 O;  1GM7 A;  2YEV A;  1X59 A;  1AJP A;  1AR4 A;  3ASN C;  3Q4H B;  4J7Z A;  3AK1 A;  1Z5W A;  4FVM A;  4CH5 A;  1KBH A;  2BSK B;  3DTU B;  3AG1 B;  2HVK C;  2QWN B;  2E75 B;  1YVW A;  3RW0 A;  4CS4 A;  3M99 B;  4LF8 B;  2ADP A;  4HYO A;  3ZIA G;  3BA8 A;  1L0N H;  3FB7 C;  3I55 V;  1H2G A;  3EVK A;  5LP6 B;  1FXV A;  4MS2 A;  4TQD A;  4EB6 B;  2JVD A;  4X65 B;  1IDS A;  3SR2 C;  5KA6 A;  1V55 C;  2JEU A;  4PA4 A;  2LFS A;  5B1B B;  3OW2 U;  5CA1 B;  5FL7 G;  3RVY A;  3CJH B;  3CC7 V;  2VWJ A;  1XMQ O;  2KKW A;  3N2K B;  1AP6 A;  1FXK B;  3F7Y C;  5LYJ B;  2WLH A;  2Q6A A;  3AG3 C;  2CE4 A;  4TWK A;  4DR1 O;  1K8A W;  1COW G;  2H8P C;  2YID A;  2OCC C;  3QTC A;  1HW7 A;  3JAT A;  4DUY O;  3EHB B;  3RFR A;  3H01 A;  4FJC C;  3BA9 A;  4KHP O;  2HJF C;  1B6Q A;  4FLW A;  2Y69 B;  1XNQ O;  4MTG A;  2L35 A;  4DV6 B;  1M57 B;  1FAF A;  1XNR B;  3CCM V;  1H2M A;  4UCU A;  1JCH A;  2YUA A;  3SPC A;  1XUQ A;  3VQW A;  4IGG A;  2W6I G;  2R9R B;  1BCC H;  2ZDI A;  3MDS A;  1MG1 A;  4P2Z A;  4YIO A;  5B1A C;  5IYZ B;  2GDS A;  2QM7 A;  3UT5 B;  2F43 G;  4J9Y B;  4I50 A;  3IJ4 A;  2Q4P A;  3UO3 A;  1DTO A;  4OX9 B;  4W4L A;  3SJQ C;  1TUB B;  4O4I A;  4ZOL B;  4K3A A;  4PD4 F;  3RVZ A;  4UVC A;  4J10 A;  4G27 B;  3C90 A;  3A0R A;  1UJW B;  2LGW A;  1HDJ A;  2WLL B;  3G4S V;  4ICG A;  1OCR B;  5H5N A;  3AG1 C;  3ZRS A;  4XDJ A;  1K34 A;  2G38 A;  1XMO B;  1EN5 A;  2XAQ A;  2BTQ B;  4X9Q A;  4FLU A;  2WSS G;  3HR0 A;  2ZM6 O;  2EIK B;  3FX7 A;  5IJ9 A;  2ZR3 A;  5JVD B;  2A3Q A;  3SYO A;  1JPX A;  2HJD A;  4JYB A;  2EUL A;  4JI5 O;  5FPR A;  5B1B C;  5CB4 B;  2BCC H;  5IWA O;  1M5I A;  2XAS A;  4R8C A;  3U0Z A;  4X66 O;  4GKJ O;  4F6E A;  3OMA B;  1GRJ A;  2LQT A;  4BW9 A;  1FXK C;  4G28 B;  4LFA B;  3ABK C;  5EC2 C;  3SGI A;  1U96 A;  3JD3 A;  4CBC A;  5IJ0 B;  3ZMT A;  4LNU B;  2XAG A;  3CPW U;  3E35 A;  2CTW A;  1SQV H;  3U10 A;  5J2T B;  4PDM A;  4JV5 O;  1GM8 A;  2CTP A;  2QJ1 A;  4X89 A;  2Q73 A;  3OEH G;  3ZRW B;  1WA8 A;  4LBE C;  3ETQ A;  1UFI A;  1IBL O;  2UXX A;  5HFL A;  4Q6G A;  3K79 A;  2LW1 A;  3W7S A;  1S5H C;  1ZL8 A;  1Q86 W;  1EBO A;  3R65 A;  4LF7 O;  2Z3Y A;  1IBM B;  2HHH O;  2E5L B;  2F4V O;  1BMF G;  4NR1 A;  3TET A;  2QA4 V;  4D7T A;  1KP3 A;  4NKG B;  3GWO A;  5KX5 B;  1GMG A;  1K4C C;  3CCU V;  3NR7 A;  4KFM A;  2PI5 A;  3EXA A;  1WNS A;  3CHX A;  5EIB C;  2UXN A;  5ITZ B;  3S3W A;  3CCR V;  4LFC O;  2ZD9 A;  4WFF A;  3ZJZ A;  4I9W A;  1RM1 B;  3JAW B;  4DK1 A;  5GW7 A;  4I9Q A;  1TAE A;  4TV8 B;  4LH6 A;  4WBN B;  3FB5 C;  1OCR C;  2QEX V;  3ZCC A;  4O4L A;  3D8C A;  1EZV H;  2QWP B;  4X1K A;  4JI8 O;  2EIK C;  1Q81 W;  4GYC B;  2LGQ A;  3SYP A;  1SS3 A;  3ASO B;  2YEV B;  2DQ0 A;  1XQ8 A;  1HNX O;  3SPG A;  3A2F A;  2BE3 A;  2P5O A;  1SQX H;  3JD1 A;  3G80 A;  2E3C A;  5HFM A;  3IFX A;  1Q7Y W;  2YXL A;  2IBZ H;  2A0L A;  4PDL A;  3K58 A;  1VQM V;  1U97 A;  1VQO V;  1R3K C;  2L6L A;  4XDK A;  5DED A;  4FFB A;  2AHZ A;  3O65 A;  1NVP D;  3APQ A;  1P4R A;  4F6R A;  2Q7G A;  1L8D A;  3G67 A;  3K9S A;  5LP6 A;  4QNH B;  4MVM A;  1HNW O;  5KHK A;  4JYA O;  1JOY A;  1BQ0 A;  3JAT B;  4MVO A;  4OXS A;  4BIZ A;  1N4C A;  3JCU Z;  2IW5 A;  1H38 A;  2YI9 A;  4R7C A;  1SF9 A;  1QNM A;  2OWO A;  3RYC A;  4LWS A;  5JH7 A;  1JJO A;  5L3F A;  1ZUQ A;  4E4E A;  2XAH A;  3SYC A;  4LFB O;  4UCT A;  1RM1 C;  3CRA A;  2R9I A;  1N34 O;  1QLN A;  3HPL C;  1S0V A;  2WWW A;  4LF6 B;  5LGN A;  3CE2 A;  4I50 B;  4YJ3 A;  3TXS A;  3SPI A;  2NLJ C;  4X64 O;  1FD9 A;  3ZHQ A;  2NN4 A;  1M9N A;  1K3E A;  1V54 B;  4LR3 A;  3ASO C;  2JJ1 G;  4RUE A;  2VS0 A;  4O4I B;  4RO2 A;  3BRC A;  4X62 O;  1R6K A;  4OGQ B;  1BQZ A;  3ETE A;  2ZE5 A;  4PV1 B;  4DV4 B;  1N32 B;  1Q6H A;  5KHJ A;  2VQE O;  1KKD A;  3KCY A;  5GTH Z;  2KSD A;  2NNU A;  3ZHS A;  1A32 A;  3CWB H;  1VQN V;  1WN7 A;  5IJ9 B;  2QR4 A;  2PGG A;  3J81 N;  2XND G;  1H2S B;  1B04 A;  2ZE6 A;  4J9Z B;  2YIA A;  4MTF A;  1FJG B;  5JCO A;  3CCQ V;  1KD1 W;  1QR9 A;  2LP7 A;  4FM1 A;  1VQ6 V;  4LF5 O;  1DF4 A;  5JVD A;  5IYD O;  4JTA B;  4GKK O;  1NH2 D;  4DR7 O;  2VWK A;  1UPG A;  1VMG A;  5CB4 A;  3TK1 A;  2NR5 A;  4DR2 O;  4QPJ A;  1BHA A;  1M90 W;  1ZLZ A;  4JI2 O;  5B66 Z;  4JGS A;  3B2E E;  2ZCE A;  3NXS A;  5LMN B;  3T1H O;  5KUK A;  4MVZ A;  2AXT Z;  2Q69 A;  2ATK C;  3BVO A;  3CEI A;  3X2Q C;  5DN6 G;  1Q5O A;  2WLI B;  4J7J A;  4LF4 O;  3L73 H;  1WA8 B;  5JJJ B;  2ITD C;  1Q8I A;  1I7F A;  4MT8 A;  2JIZ G;  2PF4 E;  1JJ2 U;  2WLJ A;  4DV2 O;  3B8M A;  5LMU O;  5K1X A;  3T4D A;  5BY1 A;  1OCO B;  2ZIO A;  1ZL8 B;  2ZT9 B;  3OTO B;  3B4S A;  2ZDI C;  4O4H A;  2ADQ B;  4PJ0 Z;  1XL4 A;  4DV7 B;  1H2N A;  5BR8 O;  4AQY B;  1Q3E A;  1S3J A;  3W7U A;  2QTO A;  1KEC A;  1JR9 A;  2UXD O;  3E86 A;  1P7G A;  2CK3 G;  1P84 F;  3QVN A;  4DV5 O;  2KG7 B;  2AZ0 A;  1PNL A;  4D6T H;  1G1X B;  4I5S A;  2IJJ A;  5L3E A;  3KCX A;  2EJ7 A;  2IJK A;  1SQQ H;  4DW1 A;  3AG4 B;  4O4L B;  2IH3 C;  4X1K B;  4RWU A;  4UVB A;  1XMQ B;  1NU1 H;  5B1N A;  3J7A U;  4TV9 A;  4PEL A;  2ZXW C;  4ZI7 B;  4ZHQ A;  1OCC B;  4DV1 O;  4JI0 O;  1J5E B;  3A0B Z;  3G6B A;  2YS8 A;  3CRM A;  4DK0 A;  1RPO A;  3ZMV A;  1WJZ A;  2B5U A;  2HVJ C;  4BWA A;  1I5X A;  3JAK A;  1VQ7 V;  2EX3 A;  5CBH A;  1QLE B;  2RMK B;  2HKO A;  3I5D A;  1NZ6 A;  1PM9 A;  4KHP B;  4K0K B;  3DXR A;  5EIB D;  4WFB V;  3VQX A;  4JYY A;  2YC0 A;  1XNQ B;  1HNZ O;  2QE7 G;  1NBM G;  5E79 Z;  4CS2 A;  5H6Q A;  2VQF O;  3N27 A;  1BSM A;  3ZRV A;  1X4T A;  2BOB C;  5CBF A;  2EZO A;  4X1I A;  1PV0 A;  1R3J C;  4FFB B;  3MD0 A;  4JI1 O;  2JGD A;  2F23 A;  4UB6 Z;  3RYI A;  2HEP A;  2O57 A;  4F6R B;  5LA6 A;  5CA0 A;  4MW8 A;  3UO2 A;  4HNA A;  3WB2 A;  3CXH F;  3SPH A;  1K97 A;  4JI3 B;  1LR1 A;  2EIN C;  4MTO A;  3HKE A;  3RYF B;  1OCO C;  1K5S A;  2ZE8 A;  1WB7 A;  2QGN A;  1Y67 A;  1SRY A;  3L75 H;  3BHP A;  4MW3 A;  4UCR A;  4JI6 O;  3ABL C;  1VAR A;  4DW0 A;  3RYC B;  4LWS B;  5EZY A;  1ZWI C;  4TT3 G;  4IYH A;  5JH7 B;  4TSF G;  1R6N A;  4JAV A;  4PI0 A;  4FK5 C;  4RUF A;  1D5A A;  1S76 D;  3VQV A;  3VOU A;  2ZM6 B;  2BTO A;  1MSD A;  2H3O A;  3AG4 C;  4YJ3 B;  3VBB A;  3H1J H;  4EFB A;  5E1A C;  3TCU A;  3SYA A;  4JI4 B;  2MK3 A;  5IWA B;  2CGO A;  4DV0 B;  2P90 A;  5F2V O;  4X66 B;  4GKJ B;  3OFN G;  3H1I H;  4K8X A;  4YY3 O;  3RWR D;  3WG7 B;  2IU0 A;  1OCC C;  4LF8 O;  2WLM A;  1QQC A;  4QE9 A;  4DR3 B;  3JCZ A;  1NS1 A;  5JWP A;  3CCJ V;  1VP7 A;  3ZMU A;  2KQX A;  3B77 A;  4AI8 A;  1AR5 A;  3CCS V;  1H8E G;  1Y4M A;  1AJN A;  4DR6 O;  2DYS B;  1E1Q G;  4A5U B;  4NXM B;  1N0N A;  3SYQ A;  4O2A B;  5D5Q A;  5J9P C;  1M4U A;  1MOF A;  4DO2 A;  3T4Z A;  1IBL B;  3RN4 A;  5C93 A;  1TGO A;  4CH4 A;  1FFX A;  5LGT A;  4LF7 B;  5LP6 C;  2HHH B;  2F4V B;  1SQB H;  4JZG A;  3CS5 A;  1XL6 A;  1N36 B;  2FYU H;  2WPD G;  1HR0 O;  1PD3 A;  2R9A A;  1KC8 W;  1SES A;  4K35 A;  4B3S O;  5J2U A;  1FYJ A;  5GTI Z;  3CME V;  4LFC B;  3CRQ A;  1MNG A;  1H8H G;  3ABU A;  1KB9 F;  4FLX A;  3D36 A;  4B3R O;  5KUM A;  4UVA A;  3TGU H;  2LW7 A;  1MAB G;  1E1R G;  1S5J A;  2GHY A;  4NB5 A;  1Y76 A;  3K9A A;  2K1E A;  3K5L A;  1PL0 A;  2Y69 C;  3CX5 F;  1PNM A;  2W6J G;  1YSC A;  3A0H Z;  4RQE A;  3JAM N;  1M57 C;  4DUZ O;  2QKC A;  3CCE V;  4OX9 O;  2RNB A;  4JI8 B;  3D3I A;  2C2A A;  2WLI A;  3JD4 A;  4O4H B;  4IIJ B;  4W4K A;  4HAM A;  1HNX B;  2XAF A;  2UUB O;  2Q8V A;  3W7T A;  3LUT B;  2CTR A;  4CH3 A;  2HLD G;  3E8G A;  1NTM H;  4DR5 O;  2UXB B;  2QDO A;  2V7Q G;  2DWD C;  1DGS A;  2YI8 A;  1H2K A;  3WG7 C;  3T1Y O;  4DYL A;  2B1I A;  3OUF A;  1XMO O;  2Z0A A;  4LF9 O;  4DR4 O;  4GX2 A;  4J41 A;  3FFQ A;  3B09 A;  3L70 H;  2WA3 A;  3RYH A;  1D2D A;  3K5O A;  5A9G A;  3FAV A;  4KXR A;  1YTF B;  4U7N A;  3CMA V;  3HB3 B;  4LH7 A;  1MMM A;  2EIM B;  3N2G A;  2GTS A;  2KG7 A;  3UCS C;  4TV9 B;  2P6J A;  4ZHQ B;  2UXC O;  4I7Z B;  4WFG A;  1K5Q A;  3C3S A;  4GX1 A;  1HNW B;  3AK2 A;  4WFA V;  3OR6 C;  4JYA B;  3JAK B;  4TOI A;  4PDV A;  2ODM A;  1GN2 A;  1W0J G;  1XEQ A;  3TXQ A;  3QG5 A;  4JAU A;  3OUS A;  2ZIN A;  2JDI G;  3DXR B;  1QVG U;  4ZI7 A;  4GZR B;  1RSO A;  2DYR B;  1WPB A;  1IBK O;  3P3N A;  5LHG A;  2AZ2 A;  1M93 A;  1NR7 A;  2F66 C;  4IL6 Z;  2HP8 A;  4X20 A;  1MA1 A;  2QWQ B;  3DC6 A;  4X1I B;  1K9M W;  2ZNJ A;  1BS3 A;  2JGD B;  2B9Z A;  3RYI B;  1CXZ B;  3I56 V;  2V1D A;  2ITC C;  4CC6 A;  5LA6 B;  3ZN1 A;  3LSS A;  5CA0 B;  4MVS A;  1N33 O;  2E5L O;  4HNA B;  4QPK A;  5A2Q N;  1NTK H;  3UKM A;  3F5T A;  3HKE B;  1SET A;  4NTY A;  3S3X A;  2N74 A;  1ARO P;  1M56 B;  2YXH A;  4JPR A;  3LSU A;  5KHG A;  2YIB A;  1B06 A;  1VQ5 V;  3GWK C;  5H2F Z;  2XT9 A;  1ORQ C;  1VQK V;  1PL4 A;  3RYF A;  5EZY B;  4DRX A;  3MAQ A;  1R3L C;  3DGE A;  4AHC A;  2VQE B;  3ZS8 C;  1IUR A;  4HZ3 A;  4UCS A;  4OPA A;  4FLZ A;  2P22 C;  5H6R A;  5B1O A;  1DLB A;  1RPR A;  4O2B A;  3U11 A;  3K5N A;  4QIW F;  1NKD A;  1QHT A;  4N21 A;  2QWR B;  1KMI Z;  1M1K W;  1XI1 A;  4H13 B;  4B3T O;  4KL1 A;  2D2C B;  4DV3 O;  1AIL A;  1R73 A;  2R72 A;  1Q82 W;  4TUY A;  4DR7 B;  2UUC O;  2F1M A;  1P49 A;  1KUQ A;  3STL C;  2A79 B;  4FIP C;  4DXW A;  4H37 A;  5IDJ A;  1JFF A;  2PI4 A;  2WLN A;  2JGU A;  3PJS K;  3UQ8 A;  4JI2 B;  1AP5 A;  1XIL A;  4D7S A;  2UUA O;  1GK9 A;  1KP2 A;  2RQ6 A;  4IYI A;  4FLY A;  1FS0 G;  1CEZ A;  3T1H B;  4YHH O;  2AW9 A;  1WAZ A;  4P30 A;  4BW5 A;  3AEI A;  1L0L H;  1SQP H;  1FKA O;  1YJN V;  3HKC A;  3T1C A;  5KMG A;  2QKA A;  1SQG A;  4FM0 A;  4U3F H;  5LMU B;  1FFX B;  4B7K A;  4MSW C;  1EM1 A;  3ZHV A;  3HKD A;  1H2L A;  1GN4 A;  4O2A A;  4U3J A;  2LO1 A;  2H94 A;  1L1F A;  2XOK G;  1GM9 A;  1QR8 A;  4GUN A;  4JYC A;  5GON A;  1M56 C;  2OIE A;  3SJA C;  3QO7 A;  5J2U B;  5BR8 B;  3JAL A;  4J7K A;  3FYI B;  3LDE A;  1R3I C;  2F93 B;  3GB7 C;  1T5E A;  1CPY A;  1XRE A;  2DW4 A;  2JK5 C;  1R6T A;  3LNN A;  5BMV B;  4FLT A;  1Y76 B;  4QE7 A;  3ZN0 A;  2IU3 A;  1EZJ A;  2V4D A;  4NXN O;  4JI7 O;  4UFZ A;  5LBQ A;  1VEW A;  5CA3 A;  1VIB A;  3IAY A;  2Q9L A;  3AK3 A;  2P06 A;  2F95 B;  1FFT B;  1J95 A;  4UCV A;  4NTX A;  4JI0 B;  4CS3 A;  2YIB D;  1IZ3 A;  4B08 A;  5FPO A;  5FNV B;  4DV4 O;  1F23 A;  5L3G A;  1N8R W;  2FL4 A;  2JS3 A;  2Y0I A;  4CH6 A;  4IIJ A;  3E22 A;  2UU9 B;  2RCV A;  2EIJ B;  5KAI Z;  1QCE A;  4MVQ A;  2VRZ A;  2PYJ A;  3K0G A;  2DOS A;  3RYH B;  1HNZ B;  1V54 C;  5K1P A;  1NTZ H;  4PA6 A;  3FAV B;  5DM6 V;  3ZHU A;  1Q43 A;  2HR3 A;  1HWY A;  5JQG A;  3N2G B;  1F4M A;  1QVF U;  3AG3 B;  3JYC A;  4K8Z A;  4AIL C;  3OM3 B;  2GSM B;  2OCC B;  1TUE B;  4B3M O;  2YSU B;  3ABT A;  1NQT A;  2GV9 A;  2QTS A;  1AI5 A;  2PTM A;  1URF A;  1RP3 B;  2ARH A;  4ZIB A;  2P4K A;  2OCH A;  3EFF K;  1W2B U;  4H0L B;  2XTA A;  1GTO A;  3L74 H;  1RSO B;  4WF9 V;  3P30 A;  3JAS A;  4DR1 B;  2PYL A;  1Y6X A;  4L8J A;  3K0D A;  4X88 A;  1F7Y A;  4QGP A;  2GUZ B;  3GVM A;  4NYK A;  4BIU A;  2WAM A;  4IHJ B;  4X20 B;  1TVK A;  4DUY B;  2X6B A;  5D5P A;  4JI6 B;  1Y66 A;  2Q68 A;  2YDE A;  3L72 H;  3E8F A;  4JTC B;  1KYO F;  3CRC A;  1GH6 A;  2WLK A;  3OTF A;  3ZRX A;  4EEQ A;  1MZE A;  2PY5 A;  1I08 A;  3D36 C;  3FB6 C;  4I55 A;  4X1Y A;  3DC5 A;  1K33 A;  1OJH A;  1IXB A;  1P7B A;  2PZS A;  1F51 A;  2CDY A;  1W0K G;  4J42 A;  2N05 A;  5EYP A;  4BIO A;  4DV7 O;  4J11 A;  5IYB O;  3BY6 A;  1W59 A;  1I94 O;  1EN6 A;  4AQY O;  4FFK A;  1IVS A;  4O4J A;  4JTD B;  4YY3 B;  3T2M A;  3QO8 A;  1I0H A;  3JAR B;  2A06 H;  1S5L Z;  4DRX B;  1XOU A;  1GAX A;  1G8M A;  2EIJ C;  3MHS C;  3W7W A;  3G6E V;  1YDX A;  1OZ0 A;  4I4T B;  3K06 A;  4DR6 B;  1G4Y B;  4O2B B;  1O9H A;  3LNM B;  3H1K H;  1J5E O;  3ABK B;  1SQF A;  3E2E A;  1YXB A;  1AJQ A;  5JJE B;  3P32 A;  5LOV A;  3OGC C;  3LDD A;  1TA8 A;  4GX0 A;  2YXY A;  4TUY B;  5B5E Z;  2IJI A;  1JX9 A;  1YIJ V;  4K0K O;  1SKV A;  3SJC C;  4JI5 B;  4OPH A;  1HR0 B;  1YZB A;  4TQF A;  1Q6U A;  3AG7 A;  1MZF A;  1JFF B;  3FD9 A;  4ABM A;  2GTA A;  4H33 A;  1YI2 V;  3BCC H;  2QM4 A;  1NJI W;  4B3S B;  4EFE A;  4JAA A;  1VF7 A;  2PUS A;  1MSW D;  5B3S B;  4B3R B;  3FB8 C;  1QLE C;  3HKC B;  5KMG B;  1K73 W;  4UV9 A;  4X65 O;  1Z2G A;  4C7U A;  3K08 A;  1EN4 A;  1YTF D;  4JI3 O;  1S77 D;  2Q0A A;  4Z1V A;  4JV5 B;  5L3B A;  3FYE B;  4DUZ B;  1VF6 A;  5LXT A;  2CGN A;  3HKD B;  2X0L A;  3CRR A;  4U3J B;  1LUW A;  3K5M A;  2UUB B;  4UUJ C;  5GON B;  3THO A;  1SA0 A;  1DK1 A;  4MVR A;  2QM8 A;  1ENV A;  5CBG A;  4QJF B;  3JAL B;  3ETG A;  3H1H H;  1AI6 A;  2DWE C;  3BPZ A;  3DSQ A;  4DR5 B;  4UXN A;  4NVP A;  3T1Y B;  4PDR A;  5C8Y B;  4LF9 B;  4GX5 A;  4DR4 B;  3K3W A;  3LDC A;  2FTK A;  4DV6 O;  3BAA A;  3K03 A;  4YJ2 B;  1SER A;  3F5W C;  1XNR O;  4RQF A;  3A8T A;  1K4D C;  2KB1 A;  4FZ1 A;  2OTJ V;  4LC1 A;  3SDL A;  5LHI A;  1ZSP A;  3UM7 A;  5EC1 C;  2ZKO A;  5EBM C;  4JI4 O;  2LJ2 A;  3TJT A;  3WU2 Z;  4DV0 O;  3WB1 A;  1ZX3 A;  5BMV A;  2Y48 A;  2UXC B;  3WB0 A;  1LUV A;  4R50 A;  3KKY A;  1G6U A;  3H1L H;  1YEW A;  2HFE C;  3E83 A;  3FKS G;  2JRI A;  4PA3 A;  4DR3 O;  4PI2 A;  1VQP V;  5JJN B;  3E22 B;  2N04 A;  1D5N A;  5CMU A;  3ETD A;  5BZB A;  3IC9 A;  3PN1 A;  1IBK B;  5FNV A;  2ZQM A;  5JQG B;  3LSQ A;  1AR1 B;  4KUM A;  3J80 N;  4NXM O;  1LNQ A;  4X8A A;  5FLX N;  2ZE7 A;  2Q67 A;  1BGY H;  4B7E A;  1NR1 A;  1OHH G;  2CH7 A;  5EK0 A;  2P7T C;  3RT3 C;  5B3S C;  2ZR2 A;  4Z1M G;  3R66 A;  2XUM A;  2FML A;  3OE7 G;  2W0X A;  2E74 B;  4UV8 A;  1N33 B;  2ZIM A;  3BFR A;  1US6 A;  1N36 O;  2EIL B;  2GBO A;  4JZ2 A;  4ASU G;  2DYS C;  1YJW V;  5JCO C;  3HKB B;  3JAS B;  1VQ8 V;  2ZNI A;  4LFA O;  3OAA G;  2Q7E A;  3OR7 C;  2P4V A;  2RDC A;  1TVK B;  3E89 A;  1THZ A;  1K7D A;  5IY5 B;  1YF2 A;  3CD6 V;  2Y0P A;  3OMI B;  4JAS A;  4CC5 A;  2DQ3 A;  2XHB A;  3JD2 A;  3M8A A;  3WFV A;  5LL6 Y;  1B3Q A;  3E8H A;  4X1Y B;  4I55 B;  1WLE A;  1FXH A;  2GUZ A;  4IHJ A;  2WA4 A;  3ZED A;  2DMX A;  1I5Y A;  4RAI A;  3L9D A;  1JVM A;  3B8N A; 
#chains in the Genus database with same CATH homology
 1CXZ B;  4NKG B;  1UPG A;  4IGG A;  4NB5 A;  1RFY A;  4DYL A;  1US6 A;  2RMK B;  1URF A;  2Q0O C;  2HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...