4NKGB

Crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase/transferase
molecule keywords E3 ubiquitin-protein ligase sspH1
total genus 25
structure length 66
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 4nkgB00
1CXZB 1RFYA 2Q0OC 4DYLA 1UPGA 1US6A 2RMKB 1URFA 4IGGA 4NB5A 4NKGB 2HJDA
chains in the Genus database with same CATH superfamily
1CP9A 1R6NA 2ADPA 1HP8A 4IL6Z 5CA1B 2DQ0A 1J95A 3T1HO 4MVQA 4ZHQB 3JARA 1N0NA 1R6KA 2OWOA 3BEHA 5IE9A 2IJJA 4BWAA 3DC6A 1QU7A 2BTOA 4LR3A 2UXDB 1Q43A 1M57B 3GB7C 4XBFA 3JYCA 5EK0A 2H8PC 4CZZA 5IWAB 2IM9A 1YTFB 3P30A 3C90A 2HJFC 1XDCA 4X64O 1MZFA 4R7CA 4YIPA 1YDXA 1KECA 4CH3A 2ATKC 4X1KB 5IJ0B 3CB2A 2KSDA 3HKCB 5D5PA 3JASA 1NH2B 3F5WC 3ZRVA 4DR3O 4LF8B 3AK3A 2AHZA 4GUNA 2UXXA 3GWOA 3JATA 4PA7A 1MSWD 1URFA 1F23A 1T5EA 2HKOA 1GK9A 4JTCB 2P4VA 2VWJA 2WAMA 2YEVA 2QWRB 1KKDA 2UUCO 2BCCH 2F93B 2XTAA 1R1BA 1AP5A 3ASOC 1QVFU 5EZYB 1EFRG 1Q6IA 2PF4E 1Q90D 1AJNA 2BSKB 4WFGA 3OD4A 4AQYO 1SC5B 3SJQC 1IBKB 3AG7A 3K57A 1N8RW 1L1FA 3H01A 4YY3O 4B3RB 1GKFA 3STZC 2ZNIA 4PD4F 1BE3H 1K92A 2WLKA 4O2BA 1UJWB 1I94O 1TUBA 3LDEA 3JALB 1KD1W 1VQ6V 4FK5C 2CTRA 1AP6A 5TISZ 3CYOA 1E1RG 1Z5VA 1OZ0A 3E83A 4X1IA 4G27B 1SRYA 2LGWA 4LF9O 4N23A 4JYCA 5C8YB 1WPBA 1R73A 3HKDA 4DV4O 1W2BU 4HYOA 1B3QA 2DOSA 3OMNB 4JI7O 3FB6C 1HNWB 1W0KG 3E22B 1M90W 4DV0B 3B77A 5LA6B 3WG7C 4BIZA 2E3CA 3ETDA 1MABG 3B8MA 1H2SB 1XNQO 3VBBA 1D5AA 1KC8W 3FX7A 2UUAO 1K97A 3ML0A 5LHHA 2AW9A 4FJCC 3LDCA 1CXZB 3N2KB 2GTSA 2ZM6O 3OMIB 1PPJH 2UUCB 2K9PA 5LGNA 1SZXA 4FFBB 4JI1O 1N36O 1Z2GA 3AK2A 1O9GA 4FM1A 1HR0O 1OCCB 2JVDA 5BMVA 2F4VB 3LDDA 2BE3A 2BOCC 5LP6B 3CXCU 4PDLA 4LF7B 1D5NA 3JSNA 1VQMV 1LUWA 3LSQA 5DM6V 2F43G 4UUJC 3ZRXA 2AZ2A 2EILB 4RQFA 1Y6XA 3EVKA 3MD0A 2LW7A 1Y66A 2N05A 2WLIA 4O4JA 4H44B 2QSAA 1HNXB 4MS2A 3K9AA 3K59A 2ZE6A 3EFFK 4NYKA 2Q67A 3H1HH 3P3PA 2KKWA 3JD1A 2EZPA 2ADQB 1KP2A 1NR1A 1XMOB 1AI7A 2UXDO 1ZL8B 3OW2U 2IU3A 2YEVB 3N27A 4J7KA 1FS0G 2VQFB 3J80N 4OX9B 2RCVA 3N2GB 4DRXA 4FVMA 5DECA 1IBMO 1VQPV 4LFAB 5IY5C 1OCZC 3ZN1A 1G8MA 1SQGA 4E2LA 3KZIZ 5EBLC 4CC5A 1VQKV 2Q0AA 2XAFA 1P4RA 3OTFA 4JI8B 4QGPA 2DMXA 4X88A 1WP8A 3E8HA 2WLIB 5AG2A 2NNUA 4CH6A 4KP4A 1VQ9V 1BHBA 1HW7A 2Z5UA 4TV8A 4OX9O 3CC7V 1HR0B 3UM7A 4JTAB 2QM4A 3ZS8C 1IBMB 1SQXH 3HPLC 1Q86W 3FAVA 1IBLB 4LF4O 1R3LC 1Q7YW 2D2CB 2DWEC 5LYJB 2P22C 3JASB 1XNRO 1WB8A 2CDYA 2QGNA 3A2FA 4R8CA 1PNMA 1H38A 2E5LB 3E35A 5KMGB 3SGIA 5A9GA 4PDRA 5B1BC 1Y67A 1VF6A 3BABA 4DV0O 4JF3A 1XILA 4JI5O 1ZWIC 1H2KA 2IBZH 4BIUA 2QWQB 4G2KA 3BPZA 4MW3A 1F4MA 5LP6A 1VQ5V 2CE4A 4OPAA 1V55C 5L3DA 2OCHA 5B5EZ 4L87A 1P84F 3QO7A 4B7EA 3B8NA 3I5DA 5BZBA 4I5SA 3BCCH 1L0NH 4PJ0Z 2NR5A 3QO5A 1YIJV 3HKBA 4D7SA 5C8YA 2ZM6B 1Q8IA 2XOKG 1AR1B 4FLUA 2ILMA 4DK1A 3A0BZ 4PA3A 4LNUB 1GM7A 2C2AA 2QKCA 2ARHA 1NJIW 2ZXWC 2VS0A 4CBCA 5E79Z 3SPIA 2W6IG 3BA8A 2QKSA 3ASOB 4X1IB 5B1OA 1VQ7V 4B3SB 1ENVA 1IURA 1OHHG 5KHIA 4FLVA 4JYAB 4MSWC 3ZBHA 3EXAA 5LXTB 4ZBMA 1HNWO 4YHHB 4GKJB 1PP9H 1YEWA 4LNUA 2HP8A 1XHXA 4H13B 5DEDA 4O4HB 3FFQA 5K1PA 3A8TA 3HKBB 4J10A 4J7ZA 5LBQA 1R6TA 1DK1A 2R9RB 1JJ2U 2YXHA 3K3WA 2HFEC 3RYFB 2KB1A 1MA1A 2OCCB 1MG1A 4JI2B 1SA0A 5BR8O 1FXHA 5FNVB 1BGYH 4DW0A 5IJ0A 2RN9A 3OEHG 4LWSA 4GKKO 1NR7A 1Y76B 3TK1A 4DR6B 2Q73A 1IDSA 1NT2B 2UXCO 1XL4A 4MTGA 3CP1A 3FYIB 4WFEA 1EN6A 3JCZA 2WSSG 3ZHTA 2QKAA 4DK0A 3X2QC 2WLLA 1VQOV 4DV3B 3M99B 5LL6Y 1WP7A 1XMOO 2QEXV 4JI4O 3RYIB 1SZTA 3ZHQA 4I50A 1KMIZ 4ZHQA 3SJBC 4YXWG 2EJRA 4K8ZA 2Q69A 4YHHO 4YJ2A 2QWOB 2CAZC 5LGTA 2LP7A 2H94A 3CRRA 4DV3O 2P7TC 3G6BA 5BXZA 4TUYB 2QM7A 3ABKB 1EM1A 3OM3B 2Y69B 2ZIOA 5KAFZ 1S76D 1U97A 4I7ZB 1JX9A 1QLEC 5EZYA 1W59A 3JALA 1SQVH 4NXNB 4NTWA 2OIEA 1SESA 5IJ9B 5IJ9A 1N36B 2EX3A 3QF7A 4TWKA 1DF5A 5IY5B 1SQBH 4J80A 2XAJA 2X7RB 5DN6G 5KA5A 4FLYA 3DTUB 1AJPA 3B09A 3UCSC 1TUBB 3E86A 3I55V 5L3FA 1BS3A 4G28B 1Y4MA 5H9CA 2DQ3A 5CBHA 1YZBA 4O2AA 1WLEA 1QQCA 1NKDA 1IVSA 1FFXA 3OTOB 5KHHA 3RYIA 3MHHC 4DR4O 4DR2O 1H8HG 3H1JH 4GKJO 1GRJA 1K5SA 3LSUA 1YJNV 4LFAO 4GZRB 4JYAO 2PI5A 4RO2A 1JFFA 3ETEA 2RMKB 2IH1C 4DUYO 4I4TB 2YXLA 2JS5A 4JZGA 1U96A 4MVUA 3CE2A 3ZRSA 4MVRA 1GMGA 1G6UA 4TV8B 5A2QN 1F7YA 4QPKA 2GBOA 5LOVB 3ZMZA 3OGCC 3OMAB 4EB6A 3ABUA 4JI0B 5L3BA 3BRCA 3CCJV 5JWPA 2YIBA 4AQYB 3D3QA 1YCIA 4QJFB 2JJ1G 5GW7A 3F7YC 3H1IH 2UUAB 1FXKC 2YDEA 1GTOA 2E74B 4MVSA 3T1YB 3ETQA 1GM9A 1K4CC 2HHHB 4EKWA 1R3IC 2UXNA 4EEQA 4TQFA 1XMQO 3F7VC 5CA0B 4PA6A 4NTYA 1FD9A 1RPRA 2X6AA 1PKXA 3VQYA 2DYRC 4JYBA 1PV0A 4O4HA 3APQA 3W7TA 2XUMA 5JVDB 3ZRWB 4PDVA 1NTZH 2CGNA 1DGSA 5L3GA 5LXTA 3OR6C 2WA3A 4LFCO 1GM8A 3HR0A 3RYFA 4I9QA 4LF8O 3HKEA 2P5OA 2QDOA 2V7QG 4DR3B 1Q3EA 1OCOC 4I55A 4F6EA 1N33O 3KKYA 2CUGA 4DR5O 1P7BA 5HFLA 5LGUA 3AG1B 5EIBC 3BVOA 2HG5C 3ABLB 2WLMA 4N21A 2VRZA 1NS1A 3T4ZA 1I7FA 4MW8A 4RAIA 5IWAO 2FYUH 3CRAA 3CMEV 5EYPB 3E2EA 5CN0A 1BL8A 1H2MA 2DJVA 2N04A 2JGUA 3KCYA 3CX5F 2KG7A 4MVMA 1FXVA 4LH7A 3SJCC 3X2QB 4FM0A 1I5YA 2ZNJA 4GCZA 4UCRA 2OT5A 2M6YA 3CJHB 2P4KA 4NR1A 3LUTB 5IYZB 1R3KC 4RQEA 1Y74B 2NLJC 1FJGB 3WB0A 3BY6A 1K3EA 5H5NA 3O9OA 2Y0PA 3K08A 2F66C 3K5MA 4ZI7A 2JIZG 2ZE5A 1YJWV 2YI9A 5JJNB 5B66Z 4X9QA 4CC6A 2JEUA 4KFMA 3OR7C 4X65B 4I4TA 5C93A 2UUBO 2A79B 3FKSG 1QBZA 2KG7B 2Y4UA 3CCEV 2ETNA 3S3WA 1RPOA 2EJ7A 4YJ3B 4P2ZA 4LFCB 5B3SC 2JRIA 3JARB 2ITCC 1F51A 1E79G 5EYPA 1PM9A 4MVOA 1HNZB 1AI4A 4D7TA 3K58A 1KKCA 5LMNB 3UKMA 2Y0IA 5D5QA 2EIKC 4ZKIA 1P7GA 4O4JB 1EN5A 2FL4A 4J7JA 3ICXA 4UVCA 1K33A 5GONB 5CA0A 3CS5A 2PTMA 2Y69C 4DV6B 2ZE7A 3FB8C 2GV9A 4B3TB 1XI1A 4JI7B 1I08A 5CMUA 4JGSA 3CCVV 2ZXWB 4TSFG 2DYRB 3DXRB 3SPGA 1LNQA 2EIMC 5JH7B 3MDSA 3J7AU 5J2UB 4DO2A 1AILA 2DN9A 3TETA 1S3JA 1COWG 1JJOA 4DUYB 4I0XA 4B3MB 2EIJB 4GX2A 1VQLV 4ZOLA 1SS3A 3JAKA 5IT9N 2XAQA 3VQWA 3TXSA 2LQTA 2M7WA 3L73H 2X6BA 4GX0A 1I94B 3RYCA 2AXTZ 2UXBB 3AG1C 1YJ9V 1QHTA 4XDJA 4HZ3A 1V55B 2FKXA 2P6JA 3L74H 5IYCO 4DV6O 1RP3B 3K79A 1K5QA 1SQPH 2QR4A 1H2GA 1M93A 1YTFD 4RWUA 1NZ6A 5LHGA 1NH2D 2Z0AA 5LHIA 2QJ1A 2W0FC 3S3XA 3SYAA 4JAAA 3CWBH 1N34B 4JPRA 4TV9A 1OCRB 1FXKA 3T2MA 1NU1H 3E8BA 5CBGA 1JFFB 4K3AA 4W4KA 2LO1A 3C3SA 1TVKB 1GH6A 2FMLA 4NXMO 4X1KA 3JAWB 2JGDA 3UQ8A 2QWNB 4K0KB 3CCUV 5EC1C 2YIDA 3TXQA 2ITDC 3RBZA 4DR7O 4DV7B 1XL6A 4UXNA 2B9ZA 3K5LA 2Q68A 4DUZB 2WWWA 4X64B 4Z2WA 4DV5O 1LR1A 3R66A 4A5UB 3L75H 3ZHSA 3AG2C 5IYBO 4ZIBA 1ORQC 5KHJA 5KHGA 2W0XA 1CEZA 4X1YA 4JTDB 4FZ1A 2R9IA 4LF4B 1GN6A 4JI3B 1S77D 3L72H 5K1XA 1EBOA 4Z1MG 5JJJB 2YXYA 4X66O 1QVGU 1XOUA 1FFTB 5FL7G 2PY5A 4X62B 4LH6A 3ZMVA 2E76B 4H0LB 3ASNB 5ITZA 3J81N 2DYSC 1XUQA 1TGOA 1YSCA 3ABKC 1FKAO 3JD2A 5H2FZ 2Q5ZA 2R70A 3JSLA 4O4IB 2JGDB 4MTOA 4IHJA 3Q4HA 1QR8A 1DTOA 4UVBA 2FTKA 2N74A 2ZINA 5LMUO 1N33B 3OT7A 3T4DA 2XT9A 3JD4A 4AILC 1QLNA 1ZX3A 3E22A 2YS8A 3G6EV 1D2DA 3BAAA 1B6QA 4F6RB 5JQGA 4X20A 4PDMA 4HBNA 4UV8A 4ASUG 4E4EA 1HNXO 2K1EA 3QO8A 3K9SA 1ZUQA 2XAHA 3RN4A 2WLHA 3WG7B 5E1AC 2L6LA 3ZMSA 4B08A 4DR4B 2IJKA 3AG3B 2ZDIC 3H1KH 1MNGA 2WLNA 3CCRV 1IBKO 4LFBB 2Z3YA 2CTQA 3OUSA 2ZIMA 3VQXA 1Q5OA 1EZVH 1ZAUA 2EBOA 5HFMA 1OV9A 2Q8VA 4UV9A 2QTOA 1HWYA 2H3OA 1YF2A 3UO3A 2HLDG 4JI0O 3CJHA 5EIBD 2QM8A 4WFFA 5JJEB 4PI0A 4PHZA 4K8XA 3R65A 1R3JC 3K5OA 3Q4HB 1JVMA 4IHJB 4QPJA 3ZCCA 4GT1A 3DXRA 3MAQA 3CRCA 1KB9F 1YI2V 4BW9A 1M4UA 2WLJA 4O2BB 3TGUH 1QCEA 4CS2A 3N2GA 4DRXB 3K0GA 4X1YB 4TT3G 4CS4A 1WB7A 2HJDA 4QNHB 4DV7O 4WCEV 4J41A 1Q81W 3ZIAG 4P30A 3ABMB 4CH5A 4J9ZB 4DR2B 4W4LA 4GKKB 4Z1VA 3E8FA 4WFBV 1DF4A 1PNLA 3BFRA 3CHXA 2JK5C 2FB5A 3JCUZ 2Q9LA 3F5TA 3T1CA 2OYQA 1L8DA 2OTJV 5LMNO 1IBLO 2GSMB 3FD9A 4JI3O 5IYDO 1DLBA 2UU9B 4LC1A 3AG3C 4BR6A 4UB8Z 4IYIA 4FLTA 3QTCA 4J42A 1N32B 3SDLA 2YC0A 3P3NA 1X59A 2Y48A 3K04A 4FFKA 4DV2B 2PYJA 1VARA 1RSOA 4MVZA 3PN1A 2DE0X 1FXKB 5H6RA 5KA6A 5JCOA 4JI8O 2A0LA 4PA9A 1PL0A 4X65O 4QE7A 1BMFG 3FYEB 1VQNV 1GN4A 2JEXA 4KXRA 4H33A 2VWKA 1VP7A 4DV2O 3HB3B 4X62O 1K7DA 5CA1A 2RDCA 5FPRA 4I50B 5EC2C 4QE9A 2IH3C 2OIGA 3WFVA 3TJTA 5KLVH 5LA6A 4FFBA 3OUFA 3CEIA 1BZKA 4DV5B 3HKDB 5FPOA 4UVAA 4H37A 3CPWU 3JD0A 3CCMV 4JI4B 3AK1A 1EZJA 1XBLA 4Q6GA 2BOBC 3ETGA 4MTFA 5CA3A 5L3EA 3WU2Z 1BHAA 1XEQA 2F23A 5CB4B 4BW5A 5CB4A 4LFBO 2XHBA 4K0KO 1S5HC 1YHQV 3ZX6A 4UCTA 1Q82W 1ROPA 2A7WA 5EBMC 2R72A 2ZR2A 2V4DA 4IIJB 2EINB 1KBHA 5IDJA 3K5NA 3JAWA 3T1HB 3RVZA 5BMVB 3CC2V 2PYLA 4PI2A 3B2EE 1JPXA 4WBNB 2WPDG 1V54C 5LOVA 3GWKC 3M7MX 4WFHA 5LMUB 4FZ0A 4LF6O 1THZA 3ZHRA 1Q6HA 2XASA 2QWPB 5GTHZ 2LGQA 1OCZB 2HVJC 4AHCA 4OPHA 1JCHA 2OTLV 4UCSA 3UT5A 5B1BB 1JR9A 3CMAV 2IW5A 3L71H 1SKVA 4YIOA 4LF6B 1RSOB 3E8GA 4LBEC 5KUKA 1RFYA 3WB2A 1S5LZ 4DR7B 1AI5A 4NVPA 1XREA 4YJ2B 3CC4V 5B1NA 1H2LA 4KHPB 4EFBA 2Y4TA 3W7WA 3LNMB 4B3MO 3IC9A 4BAYA 1PL4A 3CCLV 3THOA 4XDLA 1FFXB 2ZDIA 1XQ8A 1JQ0A 1Y76A 2CK3G 2OCCC 2GUZA 3U10A 3VOUA 5KX5A 2A3QA 1MOFA 3APOA 1K34A 1FAFA 1E1QG 2HEPA 3C3TA 4NXNO 3A0RA 1UPGA 4DW1A 4P9PA 5F2VO 4NKGB 3SYPA 2ZE8A 3AG2B 4O4IA 2EIMB 5L3CA 3FB7C 4DV1O 3G67A 5FLXN 2YI8A 2Q7GA 4U7OA 3JAMN 4JI5B 1SA0B 2YSUB 1RM1B 1A32A 2CGOA 4OXSA 1IZ3A 3UT5B 2EIJC 4HNAB 3ASNC 1K8AW 1GO3F 2CH7A 3OE7G 3DSQA 1VMGA 5B1AC 4I9WA 5ITZB 1NVPB 2KQXA 3RFRA 3QG5A 1NVPD 3IC7A 1TUEB 4O4LB 2GDSA 3RWRD 4TOIA 4LF5B 5B3SB 3CRMA 4RUEA 1ZTEA 2UXCB 4B3TO 2EILC 4B3RO 1BSMA 1Z5WA 1AROP 1F4NA 2GUZB 1KUQA 3M8AA 3RVYA 2ODMA 3STLC 4LP8A 4X66B 1BQZA 4NXMB 4JI2O 4LF5O 2UXBO 4AI8A 5J9PC 2GTAA 2MW2B 4CS3A 1BT8A 1M57C 1AR5A 4JI1B 4DR5B 4DR1O 4X20B 1WN7A 5B1AB 1VF5B 3LSSA 4TQDA 5JCOC 4FLZA 2XNDG 4IT5A 3JD3A 4JI6B 3D36C 4LF9B 2RNBA 1IX9A 4UCVA 1O9HA 2F95B 2Q7HA 1IXBA 2P06A 3ZJZA 2DWDC 2EIKB 4GX1A 3RYHB 2JS3A 1JOYA 1WJZA 3D8CA 3RYHA 3N2KA 3D3IA 1YVWA 2YUAA 4DUZO 3SYCA 4ZOLB 3OEEG 3SR2C 5KAIZ 1AR4A 4F6RA 5JQGB 1MSDA 3RGBA 3O65A 3BA9A 1VQ8V 2G38A 1XMQB 1J5EB 4JAUA 4WFAV 1SQQH 2LFSA 2A9HA 2ZT9B 1EN4A 2VQEB 4DV4B 2DW4A 1SF9A 1QNMA 2EULA 2AZ0A 4O4LA 1YXBA 2QE7G 5J2TA 4U3FH 3I56V 1NI8A 1H8EG 1HDJA 1FJGO 2QTSA 2RJZA 1BQ0A 1L0LH 4KUMA 1M56C 2Q0OC 3K03A 3SPCA 4DXWA 4X8AA 2F4VO 4WBNA 4U7NA 5KMGA 2PGGA 3NXSA 2CTWA 1N34O 2Q7EA 1JMKC 3W7XA 4KHPO 5FNVA 4NTXA 2PZSA 3U0ZA 2ZD9A 2BTQB 4FLWA 2A06H 2V1DA 3AG4B 4K35A 1TA8A 1N0JA 4JV5O 4O2AB 1AI6A 2CH7B 1PD3A 1KU9A 2E75B 3K06A 4KL1A 4JAVA 1NBMG 4YJ3A 2B1IA 1P49A 1V9PA 5J2UA 1SERA 1UFIA 3DGEA 4IGGA 4UB6Z 1TAEA 4FIPC 1AB3A 1WA8B 3NR7A 2PUSA 4MT8A 3SPJA 4EB6B 2Q4PA 1KP3A 4FMTA 1N4CA 4PELA 3HKCA 4UCOA 1GAXA 1K4DC 3ZRWA 4OGQB 5JVDA 4TUYA 2HVKC 1M5IA 1OCOB 1JA8A 2PI4A 3OFNG 1NTKH 3ZEDA 1QR9A 4FPPA 2F1MA 4TV9B 1XNRB 2JJ2G 4GX5A 1VIBA 3ABLC 3SJAC 2ZCEA 1ZSPA 3CXHF 2BTQA 4ICGA 1W0JG 3ZHUA 1S72V 3OGIB 3ZHVA 1I5XA 1ZLZA 5KHKA 3SYQA 1XHZA 1S5JA 3PJSK 2RQ6A 2LJ2A 2ZKOA 5KX5B 3EHBB 3T1YO 5BR8B 3ABMC 3W7SA 1OCCC 1LUVA 5J2TB 3JAKB 1KQSU 1N32O 4CH4A 1HNZO 1SQFA 2UU9O 1NQTA 4D6TH 1GN2A 3H1LH 3G80A 1MMMA 4R50A 1AJQA 3GVMA 2HR3A 2Q6AA 2EZOA 4P9OA 3B40A 5KUMA 4GYCB 3IAYA 2WLLB 3IFXA 1QLEB 2YIBD 3IGAC 1VEWA 3L70H 2YIAA 3A0HZ 1OCRC 4PV1B 3IJ4A 3ZN0A 2JDIG 2QA4V 4WF9V 1K9MW 4GLXA 3ABTA 3U11A 3SYOA 2HHHO 3CD6V 4XDKA 4UFZA 1CPYA 3H9VA 5IYZA 2IJHA 4IIJA 3WB1A 3OTOO 1YITV 3G71V 2DYSB 3VQVA 1V54B 2X6CA 1VF7A 1B04A 1IXMA 1BCCH 4JI6O 3FB5C 3LNNA 3L9DA 5H6QA 4DR1B 2O57A 2MK3A 4I55B 4UCUA 1FPOA 1KYOF 3UO2A 3ZMUA 3ZMTA 4EFEA 2YICA 4RUFA 1B06A 4DR6O 2D3OW 1RM1C 3SPHA 1G1XB 1WNSA 3AG4C 1XNQB 1M9NA 1I0HA 1X4TA 3MHSC 4BIOA 3OAAG 4ZI7B 4X89A 5GONA 3P32A 4L8JA 1G4YB 1SETA 3D36A 5CBFA 5BY1A 3BHPA 1M1KW 3G4SV 2W6JG 4B3SO 2GHYA 3CSXA 2VQFO 4LWSB 4FLXA 3W7UA 1VF6C 3QVNA 4QIWF 4J11A 4LF7O 4U3JA 3QNEA 3RT3C 4U3JB 1GN3A 3JATB 2P90A 2ZR3A 5LP6C 1Y74A 1VQ4V 4HAMA 4JZ2A 1WPXA 4FM2A 2AHYA 1FYJA 4B7KA 5GTIZ 4IYHA 2X0LA 4R6ZA 3RYCB 4DV1B 3CCSV 2WA4A 1US6A 5EBWC 4C7UA 4JV5B 2IU0A 3RW0A 4J9YB 4JYYA 3KCXA 1Q6UA 1ZL8A 1PNKA 1NTMH 2NN4A 1OJHA 2B5UA 3KG2A 3CRQA 4NB5A 5JH7A 2EINC 1K73W 2LFRA 3FAVB 3B4SA 2P67A 4MTXA 2E5LO 1M56B 3AEIA 1WA8A 3K0DA 5LYJA 2UUBB 2LW1A 4ABMA 1MZEA 1WAZA 1S0VA 1J5EO 3DC5A 4HNAA 2VQEO 2B1GA 2AGAA 3HKEB 2XAGA 3E89A 4PA4A 4F4LA 4I0XB 3CCQV 2BSKA 1AVMA 2CTPA 1H2NA 4LCUC 3TCUA 2IJIA 4JASA 4YY3B 2R9AA 2ZQMA 1TVKA 4Q20A 4DYLA 2L35A
chains in the Genus database with same CATH topology
1CXZB 1RFYA 2Q0OC 4DYLA 1UPGA 1US6A 2RMKB 1URFA 4IGGA 4NB5A 4NKGB 2HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  1RFY A;  2Q0O C;  4DYL A;  1UPG A;  1US6 A;  2RMK B;  1URF A;  4IGG A;  4NB5 A;  4NKG B;  2HJD A; 
#chains in the Genus database with same CATH topology
 1CP9 A;  1R6N A;  2ADP A;  1HP8 A;  4IL6 Z;  5CA1 B;  2DQ0 A;  1J95 A;  3T1H O;  4MVQ A;  4ZHQ B;  3JAR A;  1N0N A;  1R6K A;  2OWO A;  3BEH A;  5IE9 A;  2IJJ A;  4BWA A;  3DC6 A;  1QU7 A;  2BTO A;  4LR3 A;  2UXD B;  1Q43 A;  1M57 B;  3GB7 C;  4XBF A;  3JYC A;  5EK0 A;  2H8P C;  4CZZ A;  5IWA B;  2IM9 A;  1YTF B;  3P30 A;  3C90 A;  2HJF C;  1XDC A;  4X64 O;  1MZF A;  4R7C A;  4YIP A;  1YDX A;  1KEC A;  4CH3 A;  2ATK C;  4X1K B;  5IJ0 B;  3CB2 A;  2KSD A;  3HKC B;  5D5P A;  3JAS A;  1NH2 B;  3F5W C;  3ZRV A;  4DR3 O;  4LF8 B;  3AK3 A;  2AHZ A;  4GUN A;  2UXX A;  3GWO A;  3JAT A;  4PA7 A;  1MSW D;  1URF A;  1F23 A;  1T5E A;  2HKO A;  1GK9 A;  4JTC B;  2P4V A;  2VWJ A;  2WAM A;  2YEV A;  2QWR B;  1KKD A;  2UUC O;  2BCC H;  2F93 B;  2XTA A;  1R1B A;  1AP5 A;  3ASO C;  1QVF U;  5EZY B;  1EFR G;  1Q6I A;  2PF4 E;  1Q90 D;  1AJN A;  2BSK B;  4WFG A;  3OD4 A;  4AQY O;  1SC5 B;  3SJQ C;  1IBK B;  3AG7 A;  3K57 A;  1N8R W;  1L1F A;  3H01 A;  4YY3 O;  4B3R B;  1GKF A;  3STZ C;  2ZNI A;  4PD4 F;  1BE3 H;  1K92 A;  2WLK A;  4O2B A;  1UJW B;  1I94 O;  1TUB A;  3LDE A;  3JAL B;  1KD1 W;  1VQ6 V;  4FK5 C;  2CTR A;  1AP6 A;  5TIS Z;  3CYO A;  1E1R G;  1Z5V A;  1OZ0 A;  3E83 A;  4X1I A;  4G27 B;  1SRY A;  2LGW A;  4LF9 O;  4N23 A;  4JYC A;  5C8Y B;  1WPB A;  1R73 A;  3HKD A;  4DV4 O;  1W2B U;  4HYO A;  1B3Q A;  2DOS A;  3OMN B;  4JI7 O;  3FB6 C;  1HNW B;  1W0K G;  3E22 B;  1M90 W;  4DV0 B;  3B77 A;  5LA6 B;  3WG7 C;  4BIZ A;  2E3C A;  3ETD A;  1MAB G;  3B8M A;  1H2S B;  1XNQ O;  3VBB A;  1D5A A;  1KC8 W;  3FX7 A;  2UUA O;  1K97 A;  3ML0 A;  5LHH A;  2AW9 A;  4FJC C;  3LDC A;  1CXZ B;  3N2K B;  2GTS A;  2ZM6 O;  3OMI B;  1PPJ H;  2UUC B;  2K9P A;  5LGN A;  1SZX A;  4FFB B;  4JI1 O;  1N36 O;  1Z2G A;  3AK2 A;  1O9G A;  4FM1 A;  1HR0 O;  1OCC B;  2JVD A;  5BMV A;  2F4V B;  3LDD A;  2BE3 A;  2BOC C;  5LP6 B;  3CXC U;  4PDL A;  4LF7 B;  1D5N A;  3JSN A;  1VQM V;  1LUW A;  3LSQ A;  5DM6 V;  2F43 G;  4UUJ C;  3ZRX A;  2AZ2 A;  2EIL B;  4RQF A;  1Y6X A;  3EVK A;  3MD0 A;  2LW7 A;  1Y66 A;  2N05 A;  2WLI A;  4O4J A;  4H44 B;  2QSA A;  1HNX B;  4MS2 A;  3K9A A;  3K59 A;  2ZE6 A;  3EFF K;  4NYK A;  2Q67 A;  3H1H H;  3P3P A;  2KKW A;  3JD1 A;  2EZP A;  2ADQ B;  1KP2 A;  1NR1 A;  1XMO B;  1AI7 A;  2UXD O;  1ZL8 B;  3OW2 U;  2IU3 A;  2YEV B;  3N27 A;  4J7K A;  1FS0 G;  2VQF B;  3J80 N;  4OX9 B;  2RCV A;  3N2G B;  4DRX A;  4FVM A;  5DEC A;  1IBM O;  1VQP V;  4LFA B;  5IY5 C;  1OCZ C;  3ZN1 A;  1G8M A;  1SQG A;  4E2L A;  3KZI Z;  5EBL C;  4CC5 A;  1VQK V;  2Q0A A;  2XAF A;  1P4R A;  3OTF A;  4JI8 B;  4QGP A;  2DMX A;  4X88 A;  1WP8 A;  3E8H A;  2WLI B;  5AG2 A;  2NNU A;  4CH6 A;  4KP4 A;  1VQ9 V;  1BHB A;  1HW7 A;  2Z5U A;  4TV8 A;  4OX9 O;  3CC7 V;  1HR0 B;  3UM7 A;  4JTA B;  2QM4 A;  3ZS8 C;  1IBM B;  1SQX H;  3HPL C;  1Q86 W;  3FAV A;  1IBL B;  4LF4 O;  1R3L C;  1Q7Y W;  2D2C B;  2DWE C;  5LYJ B;  2P22 C;  3JAS B;  1XNR O;  1WB8 A;  2CDY A;  2QGN A;  3A2F A;  4R8C A;  1PNM A;  1H38 A;  2E5L B;  3E35 A;  5KMG B;  3SGI A;  5A9G A;  4PDR A;  5B1B C;  1Y67 A;  1VF6 A;  3BAB A;  4DV0 O;  4JF3 A;  1XIL A;  4JI5 O;  1ZWI C;  1H2K A;  2IBZ H;  4BIU A;  2QWQ B;  4G2K A;  3BPZ A;  4MW3 A;  1F4M A;  5LP6 A;  1VQ5 V;  2CE4 A;  4OPA A;  1V55 C;  5L3D A;  2OCH A;  5B5E Z;  4L87 A;  1P84 F;  3QO7 A;  4B7E A;  3B8N A;  3I5D A;  5BZB A;  4I5S A;  3BCC H;  1L0N H;  4PJ0 Z;  2NR5 A;  3QO5 A;  1YIJ V;  3HKB A;  4D7S A;  5C8Y A;  2ZM6 B;  1Q8I A;  2XOK G;  1AR1 B;  4FLU A;  2ILM A;  4DK1 A;  3A0B Z;  4PA3 A;  4LNU B;  1GM7 A;  2C2A A;  2QKC A;  2ARH A;  1NJI W;  2ZXW C;  2VS0 A;  4CBC A;  5E79 Z;  3SPI A;  2W6I G;  3BA8 A;  2QKS A;  3ASO B;  4X1I B;  5B1O A;  1VQ7 V;  4B3S B;  1ENV A;  1IUR A;  1OHH G;  5KHI A;  4FLV A;  4JYA B;  4MSW C;  3ZBH A;  3EXA A;  5LXT B;  4ZBM A;  1HNW O;  4YHH B;  4GKJ B;  1PP9 H;  1YEW A;  4LNU A;  2HP8 A;  1XHX A;  4H13 B;  5DED A;  4O4H B;  3FFQ A;  5K1P A;  3A8T A;  3HKB B;  4J10 A;  4J7Z A;  5LBQ A;  1R6T A;  1DK1 A;  2R9R B;  1JJ2 U;  2YXH A;  3K3W A;  2HFE C;  3RYF B;  2KB1 A;  1MA1 A;  2OCC B;  1MG1 A;  4JI2 B;  1SA0 A;  5BR8 O;  1FXH A;  5FNV B;  1BGY H;  4DW0 A;  5IJ0 A;  2RN9 A;  3OEH G;  4LWS A;  4GKK O;  1NR7 A;  1Y76 B;  3TK1 A;  4DR6 B;  2Q73 A;  1IDS A;  1NT2 B;  2UXC O;  1XL4 A;  4MTG A;  3CP1 A;  3FYI B;  4WFE A;  1EN6 A;  3JCZ A;  2WSS G;  3ZHT A;  2QKA A;  4DK0 A;  3X2Q C;  2WLL A;  1VQO V;  4DV3 B;  3M99 B;  5LL6 Y;  1WP7 A;  1XMO O;  2QEX V;  4JI4 O;  3RYI B;  1SZT A;  3ZHQ A;  4I50 A;  1KMI Z;  4ZHQ A;  3SJB C;  4YXW G;  2EJR A;  4K8Z A;  2Q69 A;  4YHH O;  4YJ2 A;  2QWO B;  2CAZ C;  5LGT A;  2LP7 A;  2H94 A;  3CRR A;  4DV3 O;  2P7T C;  3G6B A;  5BXZ A;  4TUY B;  2QM7 A;  3ABK B;  1EM1 A;  3OM3 B;  2Y69 B;  2ZIO A;  5KAF Z;  1S76 D;  1U97 A;  4I7Z B;  1JX9 A;  1QLE C;  5EZY A;  1W59 A;  3JAL A;  1SQV H;  4NXN B;  4NTW A;  2OIE A;  1SES A;  5IJ9 B;  5IJ9 A;  1N36 B;  2EX3 A;  3QF7 A;  4TWK A;  1DF5 A;  5IY5 B;  1SQB H;  4J80 A;  2XAJ A;  2X7R B;  5DN6 G;  5KA5 A;  4FLY A;  3DTU B;  1AJP A;  3B09 A;  3UCS C;  1TUB B;  3E86 A;  3I55 V;  5L3F A;  1BS3 A;  4G28 B;  1Y4M A;  5H9C A;  2DQ3 A;  5CBH A;  1YZB A;  4O2A A;  1WLE A;  1QQC A;  1NKD A;  1IVS A;  1FFX A;  3OTO B;  5KHH A;  3RYI A;  3MHH C;  4DR4 O;  4DR2 O;  1H8H G;  3H1J H;  4GKJ O;  1GRJ A;  1K5S A;  3LSU A;  1YJN V;  4LFA O;  4GZR B;  4JYA O;  2PI5 A;  4RO2 A;  1JFF A;  3ETE A;  2RMK B;  2IH1 C;  4DUY O;  4I4T B;  2YXL A;  2JS5 A;  4JZG A;  1U96 A;  4MVU A;  3CE2 A;  3ZRS A;  4MVR A;  1GMG A;  1G6U A;  4TV8 B;  5A2Q N;  1F7Y A;  4QPK A;  2GBO A;  5LOV B;  3ZMZ A;  3OGC C;  3OMA B;  4EB6 A;  3ABU A;  4JI0 B;  5L3B A;  3BRC A;  3CCJ V;  5JWP A;  2YIB A;  4AQY B;  3D3Q A;  1YCI A;  4QJF B;  2JJ1 G;  5GW7 A;  3F7Y C;  3H1I H;  2UUA B;  1FXK C;  2YDE A;  1GTO A;  2E74 B;  4MVS A;  3T1Y B;  3ETQ A;  1GM9 A;  1K4C C;  2HHH B;  4EKW A;  1R3I C;  2UXN A;  4EEQ A;  4TQF A;  1XMQ O;  3F7V C;  5CA0 B;  4PA6 A;  4NTY A;  1FD9 A;  1RPR A;  2X6A A;  1PKX A;  3VQY A;  2DYR C;  4JYB A;  1PV0 A;  4O4H A;  3APQ A;  3W7T A;  2XUM A;  5JVD B;  3ZRW B;  4PDV A;  1NTZ H;  2CGN A;  1DGS A;  5L3G A;  5LXT A;  3OR6 C;  2WA3 A;  4LFC O;  1GM8 A;  3HR0 A;  3RYF A;  4I9Q A;  4LF8 O;  3HKE A;  2P5O A;  2QDO A;  2V7Q G;  4DR3 B;  1Q3E A;  1OCO C;  4I55 A;  4F6E A;  1N33 O;  3KKY A;  2CUG A;  4DR5 O;  1P7B A;  5HFL A;  5LGU A;  3AG1 B;  5EIB C;  3BVO A;  2HG5 C;  3ABL B;  2WLM A;  4N21 A;  2VRZ A;  1NS1 A;  3T4Z A;  1I7F A;  4MW8 A;  4RAI A;  5IWA O;  2FYU H;  3CRA A;  3CME V;  5EYP B;  3E2E A;  5CN0 A;  1BL8 A;  1H2M A;  2DJV A;  2N04 A;  2JGU A;  3KCY A;  3CX5 F;  2KG7 A;  4MVM A;  1FXV A;  4LH7 A;  3SJC C;  3X2Q B;  4FM0 A;  1I5Y A;  2ZNJ A;  4GCZ A;  4UCR A;  2OT5 A;  2M6Y A;  3CJH B;  2P4K A;  4NR1 A;  3LUT B;  5IYZ B;  1R3K C;  4RQE A;  1Y74 B;  2NLJ C;  1FJG B;  3WB0 A;  3BY6 A;  1K3E A;  5H5N A;  3O9O A;  2Y0P A;  3K08 A;  2F66 C;  3K5M A;  4ZI7 A;  2JIZ G;  2ZE5 A;  1YJW V;  2YI9 A;  5JJN B;  5B66 Z;  4X9Q A;  4CC6 A;  2JEU A;  4KFM A;  3OR7 C;  4X65 B;  4I4T A;  5C93 A;  2UUB O;  2A79 B;  3FKS G;  1QBZ A;  2KG7 B;  2Y4U A;  3CCE V;  2ETN A;  3S3W A;  1RPO A;  2EJ7 A;  4YJ3 B;  4P2Z A;  4LFC B;  5B3S C;  2JRI A;  3JAR B;  2ITC C;  1F51 A;  1E79 G;  5EYP A;  1PM9 A;  4MVO A;  1HNZ B;  1AI4 A;  4D7T A;  3K58 A;  1KKC A;  5LMN B;  3UKM A;  2Y0I A;  5D5Q A;  2EIK C;  4ZKI A;  1P7G A;  4O4J B;  1EN5 A;  2FL4 A;  4J7J A;  3ICX A;  4UVC A;  1K33 A;  5GON B;  5CA0 A;  3CS5 A;  2PTM A;  2Y69 C;  4DV6 B;  2ZE7 A;  3FB8 C;  2GV9 A;  4B3T B;  1XI1 A;  4JI7 B;  1I08 A;  5CMU A;  4JGS A;  3CCV V;  2ZXW B;  4TSF G;  2DYR B;  3DXR B;  3SPG A;  1LNQ A;  2EIM C;  5JH7 B;  3MDS A;  3J7A U;  5J2U B;  4DO2 A;  1AIL A;  2DN9 A;  3TET A;  1S3J A;  1COW G;  1JJO A;  4DUY B;  4I0X A;  4B3M B;  2EIJ B;  4GX2 A;  1VQL V;  4ZOL A;  1SS3 A;  3JAK A;  5IT9 N;  2XAQ A;  3VQW A;  3TXS A;  2LQT A;  2M7W A;  3L73 H;  2X6B A;  4GX0 A;  1I94 B;  3RYC A;  2AXT Z;  2UXB B;  3AG1 C;  1YJ9 V;  1QHT A;  4XDJ A;  4HZ3 A;  1V55 B;  2FKX A;  2P6J A;  3L74 H;  5IYC O;  4DV6 O;  1RP3 B;  3K79 A;  1K5Q A;  1SQP H;  2QR4 A;  1H2G A;  1M93 A;  1YTF D;  4RWU A;  1NZ6 A;  5LHG A;  1NH2 D;  2Z0A A;  5LHI A;  2QJ1 A;  2W0F C;  3S3X A;  3SYA A;  4JAA A;  3CWB H;  1N34 B;  4JPR A;  4TV9 A;  1OCR B;  1FXK A;  3T2M A;  1NU1 H;  3E8B A;  5CBG A;  1JFF B;  4K3A A;  4W4K A;  2LO1 A;  3C3S A;  1TVK B;  1GH6 A;  2FML A;  4NXM O;  4X1K A;  3JAW B;  2JGD A;  3UQ8 A;  2QWN B;  4K0K B;  3CCU V;  5EC1 C;  2YID A;  3TXQ A;  2ITD C;  3RBZ A;  4DR7 O;  4DV7 B;  1XL6 A;  4UXN A;  2B9Z A;  3K5L A;  2Q68 A;  4DUZ B;  2WWW A;  4X64 B;  4Z2W A;  4DV5 O;  1LR1 A;  3R66 A;  4A5U B;  3L75 H;  3ZHS A;  3AG2 C;  5IYB O;  4ZIB A;  1ORQ C;  5KHJ A;  5KHG A;  2W0X A;  1CEZ A;  4X1Y A;  4JTD B;  4FZ1 A;  2R9I A;  4LF4 B;  1GN6 A;  4JI3 B;  1S77 D;  3L72 H;  5K1X A;  1EBO A;  4Z1M G;  5JJJ B;  2YXY A;  4X66 O;  1QVG U;  1XOU A;  1FFT B;  5FL7 G;  2PY5 A;  4X62 B;  4LH6 A;  3ZMV A;  2E76 B;  4H0L B;  3ASN B;  5ITZ A;  3J81 N;  2DYS C;  1XUQ A;  1TGO A;  1YSC A;  3ABK C;  1FKA O;  3JD2 A;  5H2F Z;  2Q5Z A;  2R70 A;  3JSL A;  4O4I B;  2JGD B;  4MTO A;  4IHJ A;  3Q4H A;  1QR8 A;  1DTO A;  4UVB A;  2FTK A;  2N74 A;  2ZIN A;  5LMU O;  1N33 B;  3OT7 A;  3T4D A;  2XT9 A;  3JD4 A;  4AIL C;  1QLN A;  1ZX3 A;  3E22 A;  2YS8 A;  3G6E V;  1D2D A;  3BAA A;  1B6Q A;  4F6R B;  5JQG A;  4X20 A;  4PDM A;  4HBN A;  4UV8 A;  4ASU G;  4E4E A;  1HNX O;  2K1E A;  3QO8 A;  3K9S A;  1ZUQ A;  2XAH A;  3RN4 A;  2WLH A;  3WG7 B;  5E1A C;  2L6L A;  3ZMS A;  4B08 A;  4DR4 B;  2IJK A;  3AG3 B;  2ZDI C;  3H1K H;  1MNG A;  2WLN A;  3CCR V;  1IBK O;  4LFB B;  2Z3Y A;  2CTQ A;  3OUS A;  2ZIM A;  3VQX A;  1Q5O A;  1EZV H;  1ZAU A;  2EBO A;  5HFM A;  1OV9 A;  2Q8V A;  4UV9 A;  2QTO A;  1HWY A;  2H3O A;  1YF2 A;  3UO3 A;  2HLD G;  4JI0 O;  3CJH A;  5EIB D;  2QM8 A;  4WFF A;  5JJE B;  4PI0 A;  4PHZ A;  4K8X A;  3R65 A;  1R3J C;  3K5O A;  3Q4H B;  1JVM A;  4IHJ B;  4QPJ A;  3ZCC A;  4GT1 A;  3DXR A;  3MAQ A;  3CRC A;  1KB9 F;  1YI2 V;  4BW9 A;  1M4U A;  2WLJ A;  4O2B B;  3TGU H;  1QCE A;  4CS2 A;  3N2G A;  4DRX B;  3K0G A;  4X1Y B;  4TT3 G;  4CS4 A;  1WB7 A;  2HJD A;  4QNH B;  4DV7 O;  4WCE V;  4J41 A;  1Q81 W;  3ZIA G;  4P30 A;  3ABM B;  4CH5 A;  4J9Z B;  4DR2 B;  4W4L A;  4GKK B;  4Z1V A;  3E8F A;  4WFB V;  1DF4 A;  1PNL A;  3BFR A;  3CHX A;  2JK5 C;  2FB5 A;  3JCU Z;  2Q9L A;  3F5T A;  3T1C A;  2OYQ A;  1L8D A;  2OTJ V;  5LMN O;  1IBL O;  2GSM B;  3FD9 A;  4JI3 O;  5IYD O;  1DLB A;  2UU9 B;  4LC1 A;  3AG3 C;  4BR6 A;  4UB8 Z;  4IYI A;  4FLT A;  3QTC A;  4J42 A;  1N32 B;  3SDL A;  2YC0 A;  3P3N A;  1X59 A;  2Y48 A;  3K04 A;  4FFK A;  4DV2 B;  2PYJ A;  1VAR A;  1RSO A;  4MVZ A;  3PN1 A;  2DE0 X;  1FXK B;  5H6R A;  5KA6 A;  5JCO A;  4JI8 O;  2A0L A;  4PA9 A;  1PL0 A;  4X65 O;  4QE7 A;  1BMF G;  3FYE B;  1VQN V;  1GN4 A;  2JEX A;  4KXR A;  4H33 A;  2VWK A;  1VP7 A;  4DV2 O;  3HB3 B;  4X62 O;  1K7D A;  5CA1 A;  2RDC A;  5FPR A;  4I50 B;  5EC2 C;  4QE9 A;  2IH3 C;  2OIG A;  3WFV A;  3TJT A;  5KLV H;  5LA6 A;  4FFB A;  3OUF A;  3CEI A;  1BZK A;  4DV5 B;  3HKD B;  5FPO A;  4UVA A;  4H37 A;  3CPW U;  3JD0 A;  3CCM V;  4JI4 B;  3AK1 A;  1EZJ A;  1XBL A;  4Q6G A;  2BOB C;  3ETG A;  4MTF A;  5CA3 A;  5L3E A;  3WU2 Z;  1BHA A;  1XEQ A;  2F23 A;  5CB4 B;  4BW5 A;  5CB4 A;  4LFB O;  2XHB A;  4K0K O;  1S5H C;  1YHQ V;  3ZX6 A;  4UCT A;  1Q82 W;  1ROP A;  2A7W A;  5EBM C;  2R72 A;  2ZR2 A;  2V4D A;  4IIJ B;  2EIN B;  1KBH A;  5IDJ A;  3K5N A;  3JAW A;  3T1H B;  3RVZ A;  5BMV B;  3CC2 V;  2PYL A;  4PI2 A;  3B2E E;  1JPX A;  4WBN B;  2WPD G;  1V54 C;  5LOV A;  3GWK C;  3M7M X;  4WFH A;  5LMU B;  4FZ0 A;  4LF6 O;  1THZ A;  3ZHR A;  1Q6H A;  2XAS A;  2QWP B;  5GTH Z;  2LGQ A;  1OCZ B;  2HVJ C;  4AHC A;  4OPH A;  1JCH A;  2OTL V;  4UCS A;  3UT5 A;  5B1B B;  1JR9 A;  3CMA V;  2IW5 A;  3L71 H;  1SKV A;  4YIO A;  4LF6 B;  1RSO B;  3E8G A;  4LBE C;  5KUK A;  1RFY A;  3WB2 A;  1S5L Z;  4DR7 B;  1AI5 A;  4NVP A;  1XRE A;  4YJ2 B;  3CC4 V;  5B1N A;  1H2L A;  4KHP B;  4EFB A;  2Y4T A;  3W7W A;  3LNM B;  4B3M O;  3IC9 A;  4BAY A;  1PL4 A;  3CCL V;  3THO A;  4XDL A;  1FFX B;  2ZDI A;  1XQ8 A;  1JQ0 A;  1Y76 A;  2CK3 G;  2OCC C;  2GUZ A;  3U10 A;  3VOU A;  5KX5 A;  2A3Q A;  1MOF A;  3APO A;  1K34 A;  1FAF A;  1E1Q G;  2HEP A;  3C3T A;  4NXN O;  3A0R A;  1UPG A;  4DW1 A;  4P9P A;  5F2V O;  4NKG B;  3SYP A;  2ZE8 A;  3AG2 B;  4O4I A;  2EIM B;  5L3C A;  3FB7 C;  4DV1 O;  3G67 A;  5FLX N;  2YI8 A;  2Q7G A;  4U7O A;  3JAM N;  4JI5 B;  1SA0 B;  2YSU B;  1RM1 B;  1A32 A;  2CGO A;  4OXS A;  1IZ3 A;  3UT5 B;  2EIJ C;  4HNA B;  3ASN C;  1K8A W;  1GO3 F;  2CH7 A;  3OE7 G;  3DSQ A;  1VMG A;  5B1A C;  4I9W A;  5ITZ B;  1NVP B;  2KQX A;  3RFR A;  3QG5 A;  1NVP D;  3IC7 A;  1TUE B;  4O4L B;  2GDS A;  3RWR D;  4TOI A;  4LF5 B;  5B3S B;  3CRM A;  4RUE A;  1ZTE A;  2UXC B;  4B3T O;  2EIL C;  4B3R O;  1BSM A;  1Z5W A;  1ARO P;  1F4N A;  2GUZ B;  1KUQ A;  3M8A A;  3RVY A;  2ODM A;  3STL C;  4LP8 A;  4X66 B;  1BQZ A;  4NXM B;  4JI2 O;  4LF5 O;  2UXB O;  4AI8 A;  5J9P C;  2GTA A;  2MW2 B;  4CS3 A;  1BT8 A;  1M57 C;  1AR5 A;  4JI1 B;  4DR5 B;  4DR1 O;  4X20 B;  1WN7 A;  5B1A B;  1VF5 B;  3LSS A;  4TQD A;  5JCO C;  4FLZ A;  2XND G;  4IT5 A;  3JD3 A;  4JI6 B;  3D36 C;  4LF9 B;  2RNB A;  1IX9 A;  4UCV A;  1O9H A;  2F95 B;  2Q7H A;  1IXB A;  2P06 A;  3ZJZ A;  2DWD C;  2EIK B;  4GX1 A;  3RYH B;  2JS3 A;  1JOY A;  1WJZ A;  3D8C A;  3RYH A;  3N2K A;  3D3I A;  1YVW A;  2YUA A;  4DUZ O;  3SYC A;  4ZOL B;  3OEE G;  3SR2 C;  5KAI Z;  1AR4 A;  4F6R A;  5JQG B;  1MSD A;  3RGB A;  3O65 A;  3BA9 A;  1VQ8 V;  2G38 A;  1XMQ B;  1J5E B;  4JAU A;  4WFA V;  1SQQ H;  2LFS A;  2A9H A;  2ZT9 B;  1EN4 A;  2VQE B;  4DV4 B;  2DW4 A;  1SF9 A;  1QNM A;  2EUL A;  2AZ0 A;  4O4L A;  1YXB A;  2QE7 G;  5J2T A;  4U3F H;  3I56 V;  1NI8 A;  1H8E G;  1HDJ A;  1FJG O;  2QTS A;  2RJZ A;  1BQ0 A;  1L0L H;  4KUM A;  1M56 C;  2Q0O C;  3K03 A;  3SPC A;  4DXW A;  4X8A A;  2F4V O;  4WBN A;  4U7N A;  5KMG A;  2PGG A;  3NXS A;  2CTW A;  1N34 O;  2Q7E A;  1JMK C;  3W7X A;  4KHP O;  5FNV A;  4NTX A;  2PZS A;  3U0Z A;  2ZD9 A;  2BTQ B;  4FLW A;  2A06 H;  2V1D A;  3AG4 B;  4K35 A;  1TA8 A;  1N0J A;  4JV5 O;  4O2A B;  1AI6 A;  2CH7 B;  1PD3 A;  1KU9 A;  2E75 B;  3K06 A;  4KL1 A;  4JAV A;  1NBM G;  4YJ3 A;  2B1I A;  1P49 A;  1V9P A;  5J2U A;  1SER A;  1UFI A;  3DGE A;  4IGG A;  4UB6 Z;  1TAE A;  4FIP C;  1AB3 A;  1WA8 B;  3NR7 A;  2PUS A;  4MT8 A;  3SPJ A;  4EB6 B;  2Q4P A;  1KP3 A;  4FMT A;  1N4C A;  4PEL A;  3HKC A;  4UCO A;  1GAX A;  1K4D C;  3ZRW A;  4OGQ B;  5JVD A;  4TUY A;  2HVK C;  1M5I A;  1OCO B;  1JA8 A;  2PI4 A;  3OFN G;  1NTK H;  3ZED A;  1QR9 A;  4FPP A;  2F1M A;  4TV9 B;  1XNR B;  2JJ2 G;  4GX5 A;  1VIB A;  3ABL C;  3SJA C;  2ZCE A;  1ZSP A;  3CXH F;  2BTQ A;  4ICG A;  1W0J G;  3ZHU A;  1S72 V;  3OGI B;  3ZHV A;  1I5X A;  1ZLZ A;  5KHK A;  3SYQ A;  1XHZ A;  1S5J A;  3PJS K;  2RQ6 A;  2LJ2 A;  2ZKO A;  5KX5 B;  3EHB B;  3T1Y O;  5BR8 B;  3ABM C;  3W7S A;  1OCC C;  1LUV A;  5J2T B;  3JAK B;  1KQS U;  1N32 O;  4CH4 A;  1HNZ O;  1SQF A;  2UU9 O;  1NQT A;  4D6T H;  1GN2 A;  3H1L H;  3G80 A;  1MMM A;  4R50 A;  1AJQ A;  3GVM A;  2HR3 A;  2Q6A A;  2EZO A;  4P9O A;  3B40 A;  5KUM A;  4GYC B;  3IAY A;  2WLL B;  3IFX A;  1QLE B;  2YIB D;  3IGA C;  1VEW A;  3L70 H;  2YIA A;  3A0H Z;  1OCR C;  4PV1 B;  3IJ4 A;  3ZN0 A;  2JDI G;  2QA4 V;  4WF9 V;  1K9M W;  4GLX A;  3ABT A;  3U11 A;  3SYO A;  2HHH O;  3CD6 V;  4XDK A;  4UFZ A;  1CPY A;  3H9V A;  5IYZ A;  2IJH A;  4IIJ A;  3WB1 A;  3OTO O;  1YIT V;  3G71 V;  2DYS B;  3VQV A;  1V54 B;  2X6C A;  1VF7 A;  1B04 A;  1IXM A;  1BCC H;  4JI6 O;  3FB5 C;  3LNN A;  3L9D A;  5H6Q A;  4DR1 B;  2O57 A;  2MK3 A;  4I55 B;  4UCU A;  1FPO A;  1KYO F;  3UO2 A;  3ZMU A;  3ZMT A;  4EFE A;  2YIC A;  4RUF A;  1B06 A;  4DR6 O;  2D3O W;  1RM1 C;  3SPH A;  1G1X B;  1WNS A;  3AG4 C;  1XNQ B;  1M9N A;  1I0H A;  1X4T A;  3MHS C;  4BIO A;  3OAA G;  4ZI7 B;  4X89 A;  5GON A;  3P32 A;  4L8J A;  1G4Y B;  1SET A;  3D36 A;  5CBF A;  5BY1 A;  3BHP A;  1M1K W;  3G4S V;  2W6J G;  4B3S O;  2GHY A;  3CSX A;  2VQF O;  4LWS B;  4FLX A;  3W7U A;  1VF6 C;  3QVN A;  4QIW F;  4J11 A;  4LF7 O;  4U3J A;  3QNE A;  3RT3 C;  4U3J B;  1GN3 A;  3JAT B;  2P90 A;  2ZR3 A;  5LP6 C;  1Y74 A;  1VQ4 V;  4HAM A;  4JZ2 A;  1WPX A;  4FM2 A;  2AHY A;  1FYJ A;  4B7K A;  5GTI Z;  4IYH A;  2X0L A;  4R6Z A;  3RYC B;  4DV1 B;  3CCS V;  2WA4 A;  1US6 A;  5EBW C;  4C7U A;  4JV5 B;  2IU0 A;  3RW0 A;  4J9Y B;  4JYY A;  3KCX A;  1Q6U A;  1ZL8 A;  1PNK A;  1NTM H;  2NN4 A;  1OJH A;  2B5U A;  3KG2 A;  3CRQ A;  4NB5 A;  5JH7 A;  2EIN C;  1K73 W;  2LFR A;  3FAV B;  3B4S A;  2P67 A;  4MTX A;  2E5L O;  1M56 B;  3AEI A;  1WA8 A;  3K0D A;  5LYJ A;  2UUB B;  2LW1 A;  4ABM A;  1MZE A;  1WAZ A;  1S0V A;  1J5E O;  3DC5 A;  4HNA A;  2VQE O;  2B1G A;  2AGA A;  3HKE B;  2XAG A;  3E89 A;  4PA4 A;  4F4L A;  4I0X B;  3CCQ V;  2BSK A;  1AVM A;  2CTP A;  1H2N A;  4LCU C;  3TCU A;  2IJI A;  4JAS A;  4YY3 B;  2R9A A;  2ZQM A;  1TVK A;  4Q20 A;  4DYL A;  2L35 A; 
#chains in the Genus database with same CATH homology
 1CXZ B;  1RFY A;  2Q0O C;  4DYL A;  1UPG A;  1US6 A;  2RMK B;  1URF A;  4IGG A;  4NB5 A;  4NKG B;  2HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...