3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
3RFRA 4PI2A 3RGBA 3CHXA 4PHZA 4PI0A 4O65A 1YEWA
chains in the Genus database with same CATH superfamily
3NFPB 4A3XA 1Z2GA 1RLWA 3R8BB 4YSFA 2VCBA 3TTSA 4NXNO 3OAZH 4Q6GA 3K74B 1UEMA 4OGYH 1UFIA 2LP7A 1QG3A 2JB6B 2NY2B 2PWGA 3VXSD 3U0TA 1CPMA 4K15A 4A2LA 4RS5A 3MROA 3MDJA 3BVCA 2DLIA 2YJQA 5FGCE 2YGQA 1QATA 4LVHC 2B42B 1TQBB 3RUGE 2NDGA 1MCPL 2W9EL 3TN93 1DDHB 2Z35A 4TVPH 1HLCA 4ZMTA 1WTLA 1N5YH 3O5SA 2CNZA 2QPSA 1IV8A 3CFJB 5DJYB 3UIZA 1POV0 4L8DA 1EHLL 2QLVB 1K9MW 4YHNA 4PV9B 1MCKA 1KMGA 1VIWB 2Z42A 4U2AA 5DZFA 1CGVA 1KGUA 1QA9B 4MXWL 1QZ1A 3EDDA 3TT1H 12E8L 4WI6A 3I59B 2DQTL 1J05A 5TJWK 4E0RA 1LNQA 3N27A 4FG6D 3GMNA 5IQLA 2ITCC 4NRXB 3RYRA 3B9CA 1MVEA 1HYRC 4PLKC 4B3MO 2CIKB 2WM0A 5A3MA 4Q0PA 4HUWB 1LGCA 2XT1B 5I1AB 1KKCA 5EF3A 4Y2LA 4PW9A 2Q1MA 1HH6B 4FMTA 1OGAB 1NCBL 5EBWC 1T1WA 3BP7B 4Y2DD 3ZYZA 3I2FA 5BOPA 4KU8A 4M5SA 4J80A 2RMKB 4RFOL 5FK9A 4PMEA 2GPZA 5EU5B 4U7NA 1CDUA 2GSIA 4MGYE 4WUUA 5D2NB 1ZS8B 2FH6A 5CEHA 4R90H 1FVCA 4GKZB 1WA6X 1LEIA 5DO8A 5GSRB 2Z31A 3RL2A 1NCGA 4XNYH 2G9HB 1RZFL 2BP3A 3ES6B 5DFTA 2H9GA 4PW4A 4JG1H 3ZTNL 4Q5OA 3SEEA 1OAQH 2AMUA 2J6EL 3LXCA 5DQJB 5TDNB 3S5YA 4FQCH 1LOAA 2P4EA 4XFBA 4AVSA 5I8EB 3V0AA 1DCLA 3MRHB 3WOGA 1K73W 2WLLA 2N4IA 5EC2A 1DUZA 1HOCA 2J3SA 3T2NH 1NFKA 1KYDA 5JVVA 3MRLA 1HRI2 4TSCL 1P2CB 2DDUA 2FGWL 1LILA 4FIPC 2YGOA 1ZHBA 2G60H 2NY5C 2RMNA 2YFOA 4FQ2L 4N2GA 5D2LF 5ICZB 3JWNC 3SGEI 4K4KA 5FLVA 1QJX2 3IFOB 2VZRA 4MQTB 4OFKA 4FM2A 3LD8C 3SC7X 3IF1A 4B4PA 4J9ZB 1ENSA 2PAKA 1SY6L 4GLRI 4MFHA 4UW4A 2EYTB 3HIFA 1WSST 4FYRA 2V4VA 1NBVL 1PPIA 1L4IA 2NUPA 32C2B 4EN3A 5IYDO 3CFBB 1AGCA 3MV01 4D9LL 1UIKA 2Y48A 3N2KA 3UT5A 2G3XA 3MNWA 4U0QB 4G8IA 2FX8L 1MOEA 3GI8L 3WFBH 4WV8A 4KXBA 5BNOA 2IGLA 3OUSA 5CFDB 4P5TA 2VDPL 3KGZA 4FAHA 1IZ3A 3WEXA 5DR5L 3HR5A 3DIFA 2M7WA 3KQ4B 3MYJB 2YEQA 1KCRH 3LRGA 4P2QD 2AJSH 4Y1AD 3VBOA 2UYBA 2VXUL 2LFEA 1BQHG 1YAZA 2RB8A 3ZS8C 2VDQH 3BAAA 3FU8A 5IROC 1WW4A 3GCWA 1DL7L 1FZOA 2VIRB 3FU5A 5JJEB 4NKDB 2DJUA 4MNGE 1XC6A 4RA0C 1KXVA 3S88L 4JCKA 2KQNA 1YY8A 4G4FA 1RP8A 1D5NA 4WV1C 4J1XA 4CJ1A 1J9CT 4UV7L 1C8M3 3OSKA 5T1KA 4XCNB 2XX1A 3S3XA 4MDRA 1R64A 4HYTB 5T5FA 4G6JH 1MZYA 1R34A 1VZGA 1WCKA 1YQ2A 2VDRL 3C8KB 3CN0A 3DMMB 3NEEA 1RJZB 1IAII 1KYUA 2M83A 4I18B 2M1KA 3VFGL 2QVSB 4P00B 4R52A 3I50L 5E8DH 1ZHKA 1REDA 3ARGB 2R27A 1RUJ2 4LLMB 1KT2A 2XPGB 4AITA 2QWNB 3CX2A 3EYUH 5EIQA 4ELMF 4GKKB 3GSRA 3DROB 4ENED 3PWUA 1N1VA 3CSYB 3VDBA 4JGZA 2R2BA 4P2QE 3WDWA 4GAGH 4UQIM 4PA6A 5F7MC 4Y1AE 7PAZA 4PV1B 4L18A 5DCCA 2QBWA 4H26A 2CIIB 2NX5D 4OZGA 1Z9NA 1RH8A 3N0AA 1UEYA 1E0OB 4BQ5A 2D3LA 3LN4B 1BREA 3PPEA 2ITEA 2UVFA 3NP4A 2H0EA 1KULA 1WEJH 4O2FB 3FXIC 3VWJB 5DHVB 1NH2D 4JDTH 4ASUG 1ANUA 1JGLL 1IURA 2BWCA 3ZFEB 3OZ9L 2AP2A 3TA3C 1VQ8V 1JHTA 3NIFE 4LH6A 2PWEA 1I7RB 2WC2A 4HEMA 1GZHC 2Q4PA 1JTOA 3MSPA 3DOIA 4G8EB 4YM2A 3AXHA 3MO1B 2IU3A 2A4CA 1NLBH 2ADGA 4OF8A 5I0WA 2FBEA 3DGTA 2UY7B 3PIGA 4BH7B 4F9LA 1FPN2 4JI6B 4MHHG 5CWSB 1S2EA 3BQVA 5TE4H 3WNPA 3QR1A 1JFQH 2P5BA 4MQ7A 2FL4A 2J25A 4UM9A 1K85A 5J8OA 4NQEB 2A73B 1H8EG 3ZBHA 4TOYL 3FB6C 2Q7EA 1C12B 3GZTB 1XIWD 4N25A 1DEEA 3O1MA 1UOFA 43CAA 5G5DA 1H6XA 5DS2A 4LK7A 1YEDA 4CJ0A 3AP9A 2NX5E 2AJUH 4BGDA 3P77A 5FYLL 1RHI2 1CS6A 2CMRH 1QHOA 5KXCA 2MHAB 1CFNB 3PIQB 3O4LA 5F89A 1KPRA 2ATKA 3HAEA 1QO3B 2Y06L 1N7MH 4N23A 2BFVH 3EDJA 5B1AB 1E8XA 1N5AA 1ZHNA 3HG1B 4OKVB 5A7BA 3URFA 3ENEA 3U25A 3GYDA 4HJGB 5D7LD 3EO1B 2QPDB 3HJEA 2YD4A 1JZ4A 3TESA 4XN9A 4Q4V3 1AGDB 3Q5YA 3QRFM 3L1OL 1I4FB 3GBDA 1N3NB 4ZW6A 2GAZB 4JDNA 4UZSA 2WZAA 5DEJA 2B1IA 2RR11 3VBSC 4J4PC 4LEOB 3QNZA 4AW7A 3L2NA 3OQRA 3S5LA 2EUVA 4UCVA 5L9DH 2O93L 1FFPA 1BFOA 5E9DB 2FYYA 3PXLA 3MICA 2XJPA 4OM1H 1WBYA 4TVPL 3QZWG 5FOJA 3NK4A 4CKVX 1AOHA 1S9VA 3EZ8A 1QQP3 43C9A 2YSUB 3KDMA 5ABDE 3RQ0A 2CH7A 3O8XC 3QHZL 4EDXA 2EULA 4EWEA 3HHRB 1S46A 5ADOH 1K5QA 3NCEB 4F3FB 4YHMH 2TRYA 4WVZA 2IGFL 2Q6WA 2YN3A 4GUPB 4P9HH 5IQ7H 1XSRA 1YC61 5GS2H 4YFZA 5GZNC 3BESR 4JKWA 1AVAA 4NC1C 3KPMA 4GG8B 2XAQA 4JRYA 3V0JA 1VF7A 1I53A 5E4AA 2OYZA 4FNLL 2G30A 4BKSC 4Q4Y1 2QM7A 3O1OA 4KWUA 1F4NA 4B3SB 2WKKA 4I4TA 5JH7A 2D31A 2OMYB 4PJAF 1MS9A 2DWTA 3VXNB 3BCWA 4FF9A 2BVTA 1HR0B 5HSFA 2GMMA 2WO2B 3WLWD 2IWEA 4X80H 4I7ZC 4DRVA 3J8F3 5IK3A 3GSNA 4GLXA 2OTPA 3KYOB 2EEDA 2PCXA 3K79A 1LM8V 1TETL 3BAEH 4IEFB 2XJQA 2AABH 4WJ5B 3BGAA 3RBSA 4MX7B 3UYPB 4G28B 1RITA 4HK0A 4XNYL 3UH8A 4FXGC 3RIAF 5CEZD 4AAPA 3PU3A 2V2TB 2AH2A 3LDDA 4F91B 1FO0B 3VTMA 4FM0A 4M5YH 4L8SC 4M4PA 2DMBA 4HKZA 4G1EA 5D93C 3T2NL 1GNZA 2PW2B 3DX0A 3C60C 3WSQH 1OHHG 2G60L 4X8JB 3ZTCC 1QDOA 5BNNC 1INEH 2MJWA 4D0DA 5FUPA 2B4CC 3RG1C 4UILL 3UAJD 2MNGA 4KRPC 3N7LA 2VMHA 3SYAA 3BN3B 4PJ9D 5A2CA 5AVRB 4CW1B 2WZR3 2C4FT 2XJKA 2YUWA 1ZLWK 2WXMA 3AY4C 3QUZC 2XA3A 5CGYD 2H6BA 2UWCA 2OFQA 1K12A 5FYBA 2A5UA 4GB31 4D8MA 1V3LA 1RUF1 2F23A 3LOIA 1UYWH 4L4TD 4YW7A 3U4SA 4Z7WB 4X98B 1X5MA 1LNUA 1AVMA 1AGEB 2GY7B 1NEZG 2VDOL 3WFBL 3QARA 4IEWA 3ILPA 3PAUA 3OKLB 5CEZE 2C3GA 3QF7A 3HNVH 3N40F 4MS8D 4N8UA 2HRHA 2OJ1A 2DI8A 3RX7A 5DZGA 4CU9A 3ZHKA 2DTWA 4QKXB 5I6NA 1AGFB 4KH9A 2AJSL 4DO2A 1U91A 3ARBA 3QZOA 4E41D 4QXHA 3KPTA 2VDQL 4UQ3A 3MNZA 5F7NC 1HWWA 4DCQB 4EZMA 1D4M3 3ZLIA 5AOZA 4OUEA 4DXRA 3R4RA 2EIMB 3B7YA 1AQMA 4ZW5A 3VN4A 2WAMA 5DZAA 1UYPA 1LHUA 2BYVE 2RJMA 1QLFA 2LR4A 3Q0HA 1EEUA 1JF6A 1WTGT 4JFOA 4XXWA 4DHLA 1SLVA 4HVBA 3UKMA 4G6JL 3AU0A 3V0HA 4ILDA 1AG0A 1I9IH 3D4GA 1WMDA 1WAZA 1Q6HA 2Y6GA 5EBLA 3VZJA 2HKXA 1BXVA 4KKBD 4MMXB 1REEA 1IFHL 1ED3B 2DQEL 4CAGA 4OU3A 5E8DL 2H26B 2OT7A 3DGEA 4Y4HC 2HBTA 3MRRB 4NO0A 4B9IA 4YJ2A 2ZICA 3TBVA 1I85C 1ZV5A 4MYEA 3OL2A 5ITZB 4ZSOB 5LXGL 1A8DA 5FM5M 4LF8O 3FB8B 3E80A 3OB8A 1A6ZB 2OA9A 4OLVL 4QRPE 5SV3A 3LEKA 4HH9B 3G67A 1VQ6V 1TSHA 5BUAA 3KMDA 4E41E 3FYIB 3PP4L 3WTUA 4JYBA 3GUFA 3US1A 1BZEA 3KW7A 4Y5YB 4AXOA 3CU7A 3Q5TA 1IKPA 5D9SB 5C0NC 1LWRA 4J9YB 4IIQB 1MZ5A 3FFQA 1PO22 1WEJL 4GQZA 1FWXA 5I93A 2LALA 3ARDA 4Z1PA 2FLBT 4JPIB 3SKUD 5L3FA 1A6TA 4OY9A 1PIV2 1HINH 4Q58C 5A2KH 4XN1A 1QR4A 4HIJB 4ODWB 1CU4H 2C5DC 2J6WA 1A6AB 4X66O 3KVPA 4NYLB 1ZTXH 3ETBJ 3GSUA 4QRTB 5JUVA 2WRAA 1AXSB 5I6PA 5K7PA 1WFTA 4S2SA 3EUUA 3OHXB 3MXWH 3HMWH 5DUMH 2KLRA 3WDJA 4C57C 1LOFC 2R39A 2VXSH 4ZW8A 3FAVB 2Y34A 2AUYA 2P67A 4XP9H 4XVUC 5IMMB 1AYM1 2G2RB 3IJ7A 5TE4L 2OQ6A 3UO3A 1EJ6A 4KUZH 1M6OB 2DMKA 5HDOA 5FFOC 3IDJB 2B9ZA 3T09A 2E6VA 3RVVD 3D6EA 3TZVA 2VOXA 1CVNA 4GWNA 4V1PA 3ILQD 4PP2A 2E47A 1G7JB 1W39A 2ET1A 1IC5L 1E9OB 2JX9A 4ZPTB 2A6IB 4EXPX 3QEQB 4ZFZB 3TN0A 2P34A 4UFMA 3N6YA 2AJUL 4Z7QE 5I75C 1RUC3 2X1QA 2D7QA 4HGKC 1P7QD 5ABAA 3QC5X 1S8DA 4HIXH 2DQFB 1A4CA 3G6EV 2YKLH 3FTUA 4P99A 4META 4D9RD 3K59A 2ZPKH 3BEWB 35C8L 1P7HL 4NKGB 3QNEA 1TVHB 4ACTA 3N91A 5B3NA 3JT2A 4LBNA 1RSFA 1UXSA 4NO2B 5D1QD 5DEGA 2DQ0A 4Y16A 5HJBA 2ICWA 3OXSB 4X6BA 4PYHA 1S0JA 4XVUD 4QHNB 4AX3A 1HCYA 2A0LA 2ZT9C 1FV3A 2GJZA 4N1EA 5LL6Y 3IT8A 5IVEA 1YPZF 4PQQA 2DWRA 2UWBA 5JHDD 3H9VA 5L9DL 1W0NA 3UKNA 3U1PA 4AENA 1OALA 3C6SB 4WFGE 4E42B 5AUMB 1RK1B 3WF1A 1ZIAA 2G9KA 4TUYA 2YS8A 1AZCA 1CFTA 1CXFA 2NNFA 3BEVB 3UCRA 1X8EA 3AFGA 4EUPB 4OHYA 3HZKB 1GC1L 3VD0A 1YMMB 3IPVA 1MRCH 2WCGA 3LN9A 1KIPA 3QPXH 1F42A 4MVBD 3CP1A 5D2LB 1FIEA 3LZNA 4JM2A 3STBA 3T0EB 2V1DA 3CCEV 3CCLV 4YHML 4DEQA 3B7RL 1F97A 1PZBA 3KZ4C 1GW6A 4QKDA 4N0UE 3VG9C 5IQ7L 1ASJ3 1F1DA 2Q7GA 3IJHA 2IFWA 3AL6A 2KDGA 5TK4A 4D9RE 3FRPG 3DO7B 1HL5A 2OMTB 2I2SA 3BKZA 4F7TA 2YPLD 5GJTL 1WD4A 4A39A 3CMAV 5D1QE 5FA4A 4XDPA 4RHV3 5FAXA 3VQMA 5FOBB 3S5AA 2X3CA 4JZOB 1S5HA 1Z5LB 4P30A 4JI0B 1SEBB 2NMNA 4J25A 1R4XA 5JI7A 3F7YB 3VTTA 3ZTEA 1D7DA 4JFHD 4ALAH 3VFRB 2B2XH 1WCDJ 2CO3A 3UNPA 5H6RA 3GMMA 3FBMA 1E5AA 1PX8A 4RAVB 3H42B 4HKBB 4XB8A 3EJYD 5IM7B 3VI4E 5HVHC 4JY6A 1E5CA 1DQ6A 4KX8A 1MY7A 3OUFA 2IV8A 3D06A 1ZBA2 3RAJL 5IB3B 1S0CA 2XBDA 1D5BA 2G75B 2PA7A 1U3HB 5AFAA 1NLDH 5DUVA 3ROUA 5BZBA 2OSLA 1KY6A 5DJDA 1BD2A 5EPMA 1QQP1 2IXQB 1ASOA 3RMXA 2H32B 4MVQA 3BUIA 2Y24A 5LA1A 3POBA 2NY2C 2J44A 2R83A 1BHGA 4QPKA 1Z7S3 2YPLE 1EFXB 1BP3B 5M94B 4L1TA 1XNBA 4Q4W3 3WG2A 1KN2H 4XFGA 3MV7B 4UDUB 4NQVB 2AHYA 2HN7A 3EO9L 5BO0D 1TQBC 1T03H 2JKBA 3ACIA 5MHSD 5IOKA 2X6CA 5J57B 5FP7A 3BOWA 4YHZH 3RX8A 4RH4A 3DOSB 3LV3A 1GHFH 4QHBA 1BCIA 4LRNH 4ELMB 3J7HA 2NYYA 3UEZA 1XUQA 1OCRB 1M3IA 3WUWB 2X0VA 5F8RC 1PG7H 1UYWL 1LE9B 3NUKA 4QJFB 3LQAH 4KDVA 4P3WA 5EO9B 4NFBA 4DV5O 5E4IA 2AXGB 1MHCA 3AREC 4L9DA 3SDAB 1RK7A 3FZUD 3HNVL 3IDIB 4OULA 4OQ1A 2W46A 1H3TA 4AQSA 4ODTL 3CFEA 3D1MC 3GHPA 4H7LA 3VVVA 3EG9A 1BOGA 2NCEA 5EU7E 5I15L 4JYAB 3NEOA 3EXLA 1UOGA 3K2KA 4ZW3A 4FZ1A 1BQUA 2CBQA 4QHUA 5FWQA 1GR3A 3AWFA 1G6RB 4CA9A 4DZGA 4MGTA 2XWJB 2OYLA 4J3SA 3BZEA 4HD5A 4TT3G 4KV5F 2M26A 3L3JB 3AGWA 4JFSA 4OZHE 3N85H 4LULA 4E2OA 1VFOA 4IOSD 2QKIA 3F00A 3ABKC 2YO3A 4MD5A 3VZOA 4WM7B 1FOD2 4RWUA 2O1QA 3MYXA 1EBPA 2AQ1A 2CGZA 2NYKA 5MHSE 5JQGB 2NRDA 4WFFA 4CH3A 1PS3A 4HPYH 2ITDA 4LVOC 2OVUA 3N35A 1KB9J 4M3CA 1B04A 3N9QA 1BMFG 4BCZA 1I9IL 5T3XH 2XR4A 1XEDA 4BFRA 1K92A 4YVSA 3S5ZA 2P5EB 4IYIA 1NBZB 4P48A 4DWHA 1P1VA 4HKLA 1AS7A 3HN1A 3H8XA 2E56A 4PRIB 4RGOH 5GRWA 4DUVA 1FI8C 4MD4A 3ZX7A 5IYZB 5FP9A 1OAXL 5HCAA 4BIZA 4Y3OA 5SX5H 3W82A 2ODHA 3UV9A 1G9HA 3HMXA 4KFZC 1KBHA 4NPJA 3RNQB 3ARXA 4JTAB 1JMKC 5H2FZ 1TYRA 1UKTA 1J88A 2BHYA 3QIBA 4NC2B 3II3A 2IDQA 4KKLC 2YBKA 3CJIB 2BCKA 1Q7YW 3NJJA 4X9YA 4XP5H 3ZXDA 4CVUA 2HFTA 4IDLA 4HK3J 4AGLA 2C24A 4AE2A 2YXSA 4D69A 2ZYRA 1NTMH 2DYPD 4NKMA 4U6XB 1K8AW 3H7BA 3ULVL 1WLDA 2VDMB 4DP5X 4DKDC 5KHHA 2N0MA 3N9OA 1CI5A 3RWDA 1S1AA 2JJ6A 4FFVD 3TNMA 4A6SA 1KGXA 3AQDA 3LN5B 2B5IB 2PGGA 1HINL 3QVAA 4ODUA 4F15B 2QSAA 1OOPC 3JZVA 2X9XA 2ZOTA 1CU4L 3LMJH 5BVPL 4X7EC 4GKJO 1IAKB 2FX9H 2HFGH 4O2BA 3HC2A 4KTDH 5FYJL 1CYGA 4GAFB 4LVNB 3ZL2A 5BOJA 5T33L 4UTAH 3AK1A 3MXWL 2XVLA 2QJDA 1PFOA 4K3DH 3S37L 4KZEH 2WS93 4NO4A 4ELDA 2NY3C 2DFCA 1VLNA 1BYNA 5G4OA 4XP9L 3WDTA 5FY7A 1CK0L 1A1NB 1S0FA 3QNXA 4M9PA 3NAPB 1NCRB 4R2GC 4YZ5A 4CEWC 2CRYA 3N9GH 4LO8A 3WV6A 5HHNB 4MAZA 4R7LA 1OE3A 1HEHC 3LX9A 3FMGH 3BJ91 2FO4B 5IJKA 4PBOA 3JV5A 1M7UA 3K5LA 4QJ5B 3FO2A 1WF5A 3QO0B 4YM0A 2NQDA 3O4OB 5C5UA 2QQPA 2BIMA 3MRPA 3AP6A 3LTVA 2FRGP 4H20H 4EFEA 4PJAB 4RX4D 1IM9A 2ZD9A 5BV7B 2NR5A 4PRHB 2QL1A 1S7SB 5LA6A 2ZPKL 3IE4A 4RQQA 5CBEA 4TTDC 4CSPA 3N55A 1O6TA 1MCWW 4LKXB 4PIBA 2A6XA 1ZE3C 3RI8A 4KJQC 5HYEA 4FP3A 2AW2A 2O6FA 3ZZSA 3C5SB 5KBDA 4JDEA 4NERA 3QDMB 4NN5C 4B6ZA 5AVYB 3FHIB 1PCSA 4LMQI 2XX0A 4X6FB 3M17A 4LBAA 2ZJSH 2DW5A 2VQTA 3LPPA 4FPLA 1MOFA 5TE6H 5IR1A 5DJ6B 5HHOD 1Y6XA 1E5YA 3LDBC 2JDAA 4BQ1A 4CCDA 3FB7A 2EADA 2F74B 3VWKC 4ADIA 4LO9A 1QPXA 4NGHH 3QQ9D 4M48H 5LNGA 2C7FA 5D96B 1Y0LA 3RSJA 2A9NH 2DM4A 5I5MA 3LKJA 1RUKL 5D7EA 3KM2A 3QIUB 4J3OC 1KBGL 1MVUB 4IBVA 1C08A 5F9DC 1MRCL 4Z92B 3FU9A 1UT9A 4FSJA 2DI7A 2NTFB 4XOCA 3SYPA 4JE0A 2BM3A 4MGKE 1ZS2A 3QDGA 2A3XA 4P9GA 5KYYB 3U4AA 1W8OA 4LLYA 4ZS6D 2H8PB 3KD4A 3NPSB 3RIAK 5KVMC 4QX8A 1GL4B 2PUQT 4GXFA 1HZHH 3ZSJA 5E70A 5C08B 1UGNA 3MIFA 1SQ2N 1ND3C 4B3MB 2HFFA 3VBUB 2JJ2G 5KC6A 2HJFC 4HJUA 3VSVA 1UY1A 1R9FA 1Y9QA 3GLEA 4FI8A 4YUEH 2GU9A 1P84F 3ZTJG 1R091 2XVGA 3BLKA 3QRBA 5HHOE 5MEPA 1JDDA 1R3JB 4WI3A 3WIFA 1UL9A 4Z0XA 4ALAL 4HIQA 1GP4A 1SACA 3O7OA 1SKVA 1A7OH 1MF2H 3B5LB 1RZJC 4UYQA 5EMYA 1GOHA 1B4LA 4MTMA 4P05A 4WTZG 3UC2A 1LP9E 1TEYA 2PKDA 4KO6A 3MZTA 4NWTL 4YAQA 4WM8A 4EN8B 4NYKA 4YHKL 5IT9N 2NXYD 4QRAA 2XU9A 4UW6A 3B2UC 3ASWA 4OIIL 4Q6IC 4D7SA 1KJ2H 1NLDL 5DGRA 4O5LH 4J39A 2OQ7A 4J1WA 2E7MA 4F8OA 5ABJC 3FAWA 2W07A 5I73C 1AYN3 2FJGB 2CGRH 3CTTA 1BQ5A 3WX5A 1BSIA 4KKAD 2PP8A 4MJ5B 3T9WA 5CLYA 1VBC2 3AG3B 3OAZK 1G1OA 2P46B 3BCFA 5FY0A 2QSVA 3IJYB 1EZVX 2UYLB 2RS33 4QGLA 4TUUA 2WNUB 4LBQD 1KN2L 4PJDF 1IARB 2Q8EA 4U7SA 1X5KA 2NN8A 4X20B 4DGUA 1WZAA 3JWDC 2V17H 2FECL 3OMAB 2CO6A 2F54E 2GTQA 1YG9A 3EGDA 4XMLH 4DGIH 4RQPC 1DQDH 3NZ8B 5TDPB 3QH3B 1L6PA 1S9XB 5EBWA 1BEV1 1UMIA 4ZKIA 3REWA 1P6AB 1PG7L 2R4RL 5KYWB 2ORXA 2D9QB 3LQAL 1K42A 5FZMA 3B9KB 4F2MA 4MVTA 2H6UA 1J58A 3M1CA 1NIAA 5GIRA 4PCTA 1URFA 5AYUH 4KO9A 4YXKH 3IXTA 4IJTA 2EXWD 2JSFA 3WB0A 1BPLB 2P5WD 5LOVA 4GRMA 1WAAF 4PBXA 4V1DE 3RVWD 5A2BA 1O7DC 2OJZL 1Z0HA 1KKDA 2XY2A 4AG4A 4M7LH 3UBXA 3ACGA 4L11A 1DZ0A 2X4QA 1PY0A 3BVVA 3QFJA 2F1MA 1YDXA 3N85L 4Y5XB 4L0ZA 4CTEA 4FYTA 1APNA 2QE7G 4H8QA 5EUKB 4ZMVA 3H6JA 3KHQA 1T66C 3ZGIA 3O45B 3JASB 3K6SB 3QUMA 5I8KL 3ZQXA 2R30A 5E2TH 5AG2A 4K3GA 2YU1A 4IV1B 2DQGL 4C8DA 3KPOB 2NY7L 1C8QA 3AXLB 4AMKH 3M7MX 1SQBH 2NW2A 1BBT3 2JB4A 1RPKA 4ZQTA 1S5JA 2YRBA 2EAKA 3O2WL 5AVVB 3P32A 4LIQE 1NWOA 4RGOL 4AEIL 1TE1B 1H8HG 5CZXC 1VBB1 2BNMA 3HUJA 4L3EA 1NQBA 5EZYA 2H0FA 4R84A 3IFLL 1Q56A 4NOFA 1CD3G 2X6BA 1E6OL 4F7KA 3H2QA 4U1KA 2QQNA 4OM0H 1B0GA 1XGRA 3ZDZE 1AR92 3H9HB 3GBNH 4LP8A 1EAJA 3QXWA 4U1IA 1OQ1A 3TV3L 1CN1A 4ZPVB 5KVDE 4AFDA 5TQ0L 4LORA 1A4AA 4PTUA 4GI9A 5DK0B 4XIOA 4XC1L 1R1BA 1GJWA 3JWOC 4G8AC 4PWFA 3L9JT 3EQEA 5IROA 4ONHA 4U7KA 3SKMB 4ZI8A 4N9HA 1CICC 3GMPB 3ATBA 2WSSG 5HDBE 4DH2A 1YPZB 4RA0A 3SPVB 4KTDL 2FX9L 2HFGL 4I0KA 4WV1A 2F08A 1TVDA 4K7PL 5JHLA 1ADWA 5EZOH 3BAKA 2J1EA 3O6FB 4UTAL 4CE8A 3U1XA 1NDTA 4H2CA 4P5KA 5H37A 1ZSDB 4KZEL 2ZX4A 1FF5A 4S1SH 3M8LA 2AKRB 3LEGA 1DVYA 4MV2A 5CB4B 3WDXA 4NMIA 1L1FA 1VQOV 3TO2B 4FPEA 1DYPA 5LMNO 3OR7B 2UXCO 3BMWA 3N9GL 1MNNA 4FOWA 4MHHI 4GW4B 4U1HA 1UF2C 3WKQA 3IU3A 4P0DA 2W1QA 2R29A 4CH4A 3EYOA 3HMYA 2QR0B 5K9KA 2C34A 4WFHA 5DJXA 2Z8SA 2VOKA 1SN0A 4QT6A 4AEFA 5MEND 1Y74B 4OQ8A 1R47A 2JJVA 2F8IA 4XZPA 2WQUA 4H20L 1BXAA 3AJ7A 1QR8A 4A6YH 5ITFB 5IB4B 2QLYA 1D5IL 3JD1A 1N1SA 3V0GA 4S2HA 5AEAA 4AIXA 3QXDB 2P90A 3HKBB 2YK1H 4GRLC 1ETZA 4BSVA 4JZJB 3MR9B 3QUYD 3TA3A 5FYYA 1QHTA 1GA2A 2ZJSL 5LA0A 3VXQA 4I2OA 3E2HB 3CCMV 2AC0A 4U1JB 1GZHA 4LF7O 1RXLA 4AQAA 1H6FA 1RUJ1 2XZCL 3VFNA 2FJFB 4PFEA 4G9FB 4OCYL 4JVPA 3WXVL 1ULEA 4M48L 5IMOB 4A3ZA 5K39B 3NJKA 4Z7IA 2A9NL 5I19H 2VNRA 3VDDC 4FFZH 5BY1A 4QF1B 2JI3A 4PGCA 3AMMA 1JXNA 5FZKA 3DJSA 3LSEA 3Q05A 1L6XA 1EV13 2W95A 3FB6A 3ZTJH 1M05A 3R06A 5EJ1B 4BH9A 2G5BB 3VM5A 2GSYA 1E4WL 3GI9H 3HB3C 5MENE 1FLTX 2P8LA 3GSWB 2DQUL 1D6VH 3KJ4C 5C07E 1GZCA 2PO6B 4BMEA 3GTVA 2HWE2 2QQKA 4LBEB 1DQKA 3K6OA 5KAFZ 2LU3A 3HFFA 1EX0A 5LGTA 2YSSA 1JGUH 3NJLA 1S9YB 4LSPH 4Y1UA 2V8MA 3O41B 5AWNH 2VDLL 1QNZH 5I9QB 3JV4A 4EOWL 4E5XA 2VKWA 1U5IA 3AYAA 4N43B 5A7NA 4FQ1L 5FQ0A 5GJSH 1S7QA 3HI5H 4X4KA 3CDZA 1IE5A 4I50A 4GQ9H 3RZZA 1WA8B 1OF2A 1C16B 3VXRB 3CX5J 2ZOKA 3KPSA 2YZ4A 3PMSA 4N90A 4H33A 5L9RA 2EDQA 5IB5A 1FPN1 4FLRA 5D7IE 4X6DF 3WDUA 2BRRH 3L2HA 5DS8B 1J1XH 3LDEA 4LSQH 3VBSA 1MF2L 2DIJA 3MPCA 4J4PA 4MQXC 3FT2A 5IBLD 2GDSA 5A40E 4N5ED 1AR82 2O57A 1NSNL 1FL6B 2D0HA 4R97B 3G04A 5IP4A 4OZXA 1RMU3 2MQ0A 4YY3O 3H8NA 4JO2L 3DUSA 4UANA 3LSOA 5DRZA 5JUEL 2LM3A 4NHMA 5HVWA 4PY8I 3ZMZA 4X7DC 1RHI1 4AGRA 1A2YA 4JZGA 4M1CC 1A9EB 3L2LA 1KEGH 3DA0A 1FCGA 2IANA 1KJ2L 1GSMA 2J1KA 4HGWB 5E6UB 3B83A 1FNEB 1E7UA 4IQPA 3AKRA 3O8XA 4LDLB 1RL3A 2QDNA 2GT9A 4WU7A 2XZAH 2CGRL 4OUMA 2VZ3A 2E6JA 4HDIA 3CSTA 3HC3H 4WUUD 4D3CL 3DV4A 4IW3A 1GW0A 1OT5A 3CDCA 2JCWA 4X89A 3CK0H 2Z31D 2ZM6O 3CXDL 4TNFA 1FC2D 5FYKU 4Y9GA 1HHHA 3DX7B 5E6SB 3TGXA 4DEWA 1FXZA 5GZNA 2WSVA 2HKOA 5CN0A 5LHGA 1ZLDA 1Y18B 2IBZX 1BGXH 2ZX6A 3MLWL 4AXWB 4HG4J 5FA3B 4H8UA 5EF2A 3P73A 2Y9RT 4FEMA 2MTAA 4PMFA 5DJZB 3RVTC 4XMLL 2NNCA 5IHWA 1USZA 1QABA 4NNXB 5CILH 1DQDL 4NENB 2R49A 4NJ9H 3W0WD 4TSVA 1EUTA 2QV2A 4WTWA 4G11A 3VQLA 1YC7A 5D7SH 5CCJA 2OTWA 5EN2A 1EH9A 4A7SA 4X1KA 4YXKL 4X1IB 3MUGA 4LOUC 1FORH 3V5KA 1V05A 5KHKA 1JI2A 2YAFA 1RPRA 1XDCA 4J6RH 1Z0NA 1OOPB 3FLTA 4FXGA 1TJMA 1FNFA 4EN3D 1LWJA 1QLRB 3GNMH 4XVHA 3VKLA 4PWIA 1IFRA 3LZQA 5H35A 4HX1B 1TTGA 3SDXA 1RZ7H 3EBHA 1VF6C 4CBPA 1ND0B 4WUUE 2XJSA 3TBDA 1HT6A 4K94H 3H7YA 4R4ND 1U8NB 3CFKA 1QR1A 4L8SA 4P5TD 1TME1 2XFGB 4YFDB 3GCXA 1GZPA 3G6AB 3RVZA 5C8YA 3QDAA 3QUGA 1O5LA 3C60A 3ALPA 5CFCC 1WDAA 4OJDH 4I5SA 3CUPB 3G7TA 2X2UA 4MJIE 1PZ2A 4AV4A 4ITCA 3FTZA 5BNNA 1ZLZA 2R071 4AMKL 3EDFA 4HUVB 5DEFB 4X7SH 3W0WE 1A6VL 2HT4D 4NUGH 5DZEA 2HX7A 4UFKA 3AY4A 3QUZA 2R2HA 3MUY1 3CNAA 1CO1A 4K21A 1WD8A 3U4KA 5T1KD 4JYCA 1VRH2 4N2NA 1LO0L 4MXVF 2TBVA 3WQ1A 3B09A 1CLZH 5CGBA 4OM0L 3AITA 2JK5C 3HEIA 4HHAB 4HWZB 1WJ3A 4HS3B 2LFGA 3ESNA 3IBEA 1VQ7V 2EXTA 2RD0A 4WJKB 4L0PA 4U3XA 5JZGB 2GIMA 2OMNA 4FPCA 2EVIA 4KXRA 3ML9A 1GJIA 4ZNEA 1MACA 4OPAA 2WKLA 3SBWC 2CU5A 5AENA 4CC0A 1HP8A 5F9OH 3JCIA 1Z7JA 5HI5C 1E4JA 4OCSL 2DIAA 3IDCB 4CDUB 5E4EB 3CMOH 3ZUCA 5IHZB 5JDJA 4Y4FB 4YVWC 3C2SA 1KECA 2ERJC 3SDAC 1SYVA 3MLVH 1RU9L 1VQ5V 4K1YA 3GTTA 1B0WA 4N2LA 3OYWB 3NCYS 2OSWA 1QWUA 3DKHA 4JFDB 4CADA 2AF2A 4KNUA 3ZMRA 5LJYH 4GJYA 4A7KA 1FNSH 1H8SA 3SGDH 1UFUA 4FMFA 2XJTA 1LDPH 2CGNA 3CJJA 4M62L 2JECA 3CZFA 1UY0A 2BGPA 4EN0A 4ZO6A 4Y4HA 3PL6B 4XCYA 1CAVB 3WNLA 1AZRA 3B6SA 3PTYA 1JOBA 1I85A 3CG8A 3GS0A 1HNYA 2IAMC 3NO8A 1SXSA 3H8RA 5ELIA 2IH8A 4KL1A 1W8WA 3DX1A 5H9SA 1IM3B 4B9FA 1M7IB 4CN1A 4HWUA 1XCQB 4GH4A 5DYOA 3S35H 1UUSA 3CDYA 4P9PA 3P30A 2VDKL 4RA3A 1NR1A 2JJUA 1XI1A 4TULL 3AZWA 4HV8B 5EEUA 3UYJA 4UM9D 1SEQL 3WE1A 2P5PA 5E7FA 3FQWB 4YGDA 3DJTA 3C09C 3JD72 1BMV2 3PNWA 1UN1A 3M99B 5I1KL 1MEC2 5DU7A 3HN5A 2WYIA 4HMZA 4N0CC 3KKYA 1U8QB 1HRV2 5LBVA 2CWRA 3GGLA 2K3TA 3SGKC 1MVFA 5ANQA 2C5DA 5EU3A 2A9MH 3SITA 1RK0B 1EDHA 2A4EA 4OAWB 2IH1B 3O4LD 5F9AC 5KWYC 2AEQH 4MAYB 1MCQA 3DO4A 1VSCA 3WU1A 3KYNB 3IVKA 2EYRB 4I77H 1GXEA 5F2FA 1E5ZA 1OIOA 3W7XA 3UGFA 4F57H 1LOFA 2IPKB 4BSJA 1L3NA 4EI5C 3QIWB 1NFIB 2E5EA 2R7EB 4FFZL 3CCRV 3TPUA 2ZKNA 3UGHA 4E8CA 1P84K 5FFOA 4A45A 1IB5A 2AAVA 1AQ8A 3KBEA 4FNPA 4ZIBA 1F4WH 4MYWB 4LLDA 4ZX3A 4XP4H 5I17A 4IBWA 2W9DL 3A4AA 4P2YA 3OD4A 4RAUA 2VR4A 1VADA 3GI9L 2OCJA 1UM4H 5DUJA 5JVDB 4ICWA 4PJDB 3UC0H 4DW2H 1C57A 1PO21 1SZTA 5BNQA 1RZKH 1E9PA 1CAWA 1EXHA 2VMDA 1JR9A 1QNMA 4LSPL 4IEYA 5A3NA 1JGUL 3HE6B 2OX5A 4FE9A 4AC2A 4AJVA 1MJJA 1HQ4A 4NTXA 5AWNL 2Q8AH 1OVPA 1I08A 4I1RA 2WVVB 3W1ZA 1V55B 3QZWB 3VHOA 5GJSL 4CN6A 3HI5L 4GQ9L 3VGGA 5ICYB 1W8FA 1FFNB 4OI4A 5C09B 5I0DA 1RJLB 2VN4A 1IGJA 1Q9WA 2J1UA 2K9FB 2ZXDA 3M6DA 4XNBA 1FH2A 1P1ZA 4N9GB 4S11A 2BRRL 5JPMB 1QH6A 1J1XL 1KXQE 4LL9A 3O4OC 4OHXA 3NEXA 4AVVA 4P23D 1R3HB 2DB8A 4HWBA 3MJ8A 3T6XA 5CA1A 3BAWA 3GWJA 4URKA 2BCCH 3TO4C 5IB1B 4UQ2B 5DD6B 3P3TA 3EFFA 1HXYA 4I2XE 4KC3B 2J7LA 3MBXL 1SVBA 1ZX5A 4G5ZH 5J4MA 1KEGL 5HHPA 3K5OA 3GXFA 4HPOL 1W6QB 4NRQA 4HP5A 1UZ8B 5DTFB 1F4AA 3ZFGB 1BIIB 2VCOA 2GIXA 2XZAL 2B14A 4FCAA 4P57B 3HC3L 3VH8B 2YPDA 3T4YB 5FPAA 4C0HA 1OQDA 4FAGA 5BUGA 4CP9B 5HJ3A 3LSSA 2VQUA 1D5ZA 4OFQA 1UJTA 1R5WA 3WFEH 5J56B 3A67L 1MRFH 2XQYA 1WFNA 4G8GD 4GAJH 3CPUA 3CFUA 4NWUH 2ZHNA 1SFPA 4JG0H 1R081 2KQMA 2FDKA 4WO4C 1U2HA 2EYSB 3DXAB 3P54A 4OF5A 4UF7C 5I5JA 2R16A 4S0HA 1CQKA 4KK9C 4TQDA 2A9CA 4YDNA 2XJUA 1A47A 3CRMA 1PX4A 4UV4H 3D0VA 4NJ9L 3B9DA 1TG8A 4B4RA 1H2NA 4JFFB 3G6DL 2OSYA 2H6CA 4PS4H 1MLBA 1OW0C 1G0DA 3GIZH 5D7SL 2FCVA 4XBNA 2EDFA 1DJYA 2YBSA 2H8PC 1PLAA 1JGIA 1UENA 3D3VA 4X6CF 4XOBA 1O7VA 3WP5A 1FORL 2YWYA 4AYFA 4OGAC 3FPXA 4J6RL 4BJLA 4EZHA 1E6JH 3WF2A 1KTRL 3EHBB 1M1KW 2PW1B 1I3HA 1P6WA 1LE5A 2WR9A 3ELNA 3X29B 3X3FH 4QX0A 2AEYA 4BQ3A 5D5PA 1RZ7L 4ZOBA 1JBJA 1GM9A 4JPKH 1DSFL 3K3QA 1AL23 1L6ZA 3WDHA 2VBBA 5FY1A 1B3JA 3IRCA 2YRLA 4OCNC 4AUYA 1R3JC 1SMDA 2RDQA 5CN2A 5J37A 4NIHA 4RMBA 3DVIA 5C0RH 1OKQA 4HPKA 1D0HA 4SBVA 1ND2B 1ZLUH 3O0RH 3O3BB 4G8GE 5AVPA 1U97A 1U8HB 4HJ0D 3K3WA 3SOBH 3RLSA 1A02N 3F05A 3ARBD 3K57A 1S7RB 3X14B 2H0JA 5I30H 5A2QN 4XHQA 1M1XA 1IG0A 1UOWA 4X7SL 4XN7A 1DF5A 3DV6A 1SERA 3MRGB 1PMYA 3L3OC 3CF6E 2VLKD 3BDXA 2ZNXA 3FO0H 3CFJA 4ABUA 2SEBB 3OKEB 4I0CC 5BXXA 2CLZB 1LTXA 4OJYA 4PV9A 3O6MH 1OKOA 2DQIL 2WVSA 1ZBA1 3AG3C 3HKDB 4EZLA 1CLZL 1YEWA 1VQKV 3AREA 3QNFA 4RGNC 3T6WA 5K69A 4MVUA 4Y4YA 4LL1A 5I8YA 1QJEA 3H55A 4QLRA 1IT9H 5IF0A 4ODVH 1JAEA 3IDMB 2X0LA 4LCIH 1PV0A 2LJ2A 3AG7A 4AQYO 4DP0X 1PFCA 2MSPA 2CIKA 2I7SA 3UMTA 2CRIA 3QRGH 1SDYA 4NAJA 4YE4H 2E7AA 3RTQB 4MLOA 3GXUA 5D55A 5HGGS 2P48B 1ZAGA 3PABB 3BP7A 3AGVA 2W0XA 1FNAA 2HA1A 3H3ZA 2W39A 1ZTEA 2B20A 4CSSA 1ONQA 3CMOL 4MLIA 2E76B 5K0UB 2DZEA 5T3ZH 1YY9C 3E9UA 4GKJB 1Z5HA 3SQBA 1NAKH 2DVAA 4IE7A 3QUXB 3ASNB 2X2IA 4QXWA 1KEXA 1LO4H 3J27A 2QR4A 2R72A 2VLKE 1RSOB 5F88B 3C6LC 1UJ3B 3ARDD 1FNSL 4KK5C 4IE5A 2YI9A 3QE5A 3WFCL 2EDRA 3IGKA 1LOBA 1ZJAA 5I8EA 1SCRA 3OKNA 1Y7VA 3MCKB 4BFJA 1HKDA 3K58A 4YDVA 3PHOB 3V4PA 1BE3H 4Y5VC 3JD2A 1PD6A 1K4DC 1A1MB 1XHHA 2X4OA 1ZGLM 3T2OA 5E2UL 2PYEB 3MU3A 4LFBB 4P5MA 5LGHH 5EJ3A 2YIDA 4N24A 3S35L 4X64O 1GLHA 3VYOA 3OPUA 4OD3H 4U4BA 3IFOA 1H5BC 3GIVA 4XNZB 3EADA 3W3BA 1OMIA 3OX8B 3T3PF 2XSKA 5FUOL 3BZ4A 4DR3O 1ZLVH 1USQA 4ZUWB 3DHPA 5ACA2 2XICA 3DRTA 3SKNB 4L1DA 1XMQO 1MCEA 2H0PA 1YJDH 2J55A 3FQ4A 3MREA 3TZVD 1FOD1 1RKRA 2YXVA 3V4VH 3EYFB 4X6DB 5JA9A 1CT8A 4OV5A 1H8TC 5CBFA 4LF6O 1HHJB 5B4MC 5CEXB 2TEPA 3DX6A 3TN0D 5GSVA 1W8ZA 5SX5K 1MA1A 2E5LO 3GS7A 3JTSA 3B2EE 1SYSA 3FUMA 1PMHX 2A9ML 3ZE2E 4FA6A 4M00A 4UI9L 2CL2A 4ZMXA 5FPOA 1YSCA 5JMRA 2X4PB 1RFYA 4K8RL 1WA1X 4FZ8H 5TFSH 3A0NA 3NGBB 4I77L 5IEHB 3FU0A 3MYJA 2WYSA 4F57L 3AP7A 4W93A 4OF6A 5E6RB 4WHTB 4DP1X 5GLZA 4W6WB 1JIBA 3L54A 2CQVA 4HLZG 2EINC 1OE1A 1PY4A 2FD6L 2J7MA 2IM9A 1NCHA 4OTXH 3L1GA 3MRFB 4Y16D 2KHAA 5KVFE 2OXHB 5C07B 4CEWA 2J56A 4XP4L 3BP6B 3IT8D 3TX4A 2A0LD 4M6AA 3K1KC 3V0IA 1AHMA 1YYNA 4XUQA 1UXMA 1B88A 1AX2A 1SPPB 3PREA 4DW2L 2P43B 5C3IA 3QLQA 3L4UA 4GKSB 4U0RC 1RZKL 2X1WL 3I2HA 4GOSA 4M56A 3HCVB 5LBSH 4OI0A 2Q1FA 4NO3A 4ZY9A 1W0KG 2R0WL 5J12B 2F53A 2Q8AL 2PCPB 3MTRA 3SDDD 2GBOA 2PYFB 4AF9A 1NVPD 2VO8A 3KLKA 4RAHA 3OR7C 1NE4A 1FUNA 4XRCB 4ETQA 5C6WH 4JM2D 2PHDA 2V2WB 1OLMA 2X87A 4NIDA 5SX4H 3LNMB 2OMWB 1DLLA 1NCTA 1POV1 3QQDA 3DROA 1FN4A 1AXYA 1JTZX 1S7XA 2C1FA 5L0QC 3HIZA 1MAML 1D5XB 4ABMA 3LDBA 1JHJA 1G9BA 3FRPB 4FHBD 3VWKA 4PJXE 2CIIA 5J48A 4L3CB 1TJIL 3P02A 1HHGB 3QJRB 4BIUA 4LHUB 1GTFA 4OGZA 4G5ZL 4YSQA 3KPNB 4OQ9A 3IDUA 3WG7C 4TV3A 4QDRA 3DJRA 2W92A 3IKCA 3UJJH 3ZFEA 1DQ1A 1SJEB 2CO4A 2CHWA 3CVHH 3ETBF 5KYNA 2WBJC 1OPOA 2W87A 1SNRA 1RURL 5E51A 4P9WA 3US0A 1KRIA 3LRLA 1AF9A 5LDUA 4HKXA 2QQMA 4G8EA 3TJHD 4XOGA 3MO1A 2HTKD 1J12A 3WFEL 2RDRA 4BEIA 5FMBA 1W9SA 3MRBA 4DK5A 4NWUL 2UY7A 1PKQE 1KENL 5I2IA 1WCQA 1X5AA 4JG0L 3WTXA 4TKWA 3WJMB 1ND3A 1QOOA 2YOCA 1HVXA 1E2VA 2HJFA 4M3KB 4ZMWA 1JPST 1BD2D 4FTVB 1JQ0A 3L2YA 3QJQB 1C12A 3UTTA 3N5AA 4KY2A 3MOAL 2H3KA 3NJVA 4JQVC 4GXVH 2VM4A 3GIZL 1NPNA 4PLMA 2Y5QA 3Q2VA 4HFWB 1OUXA 5BNPB 1XNDA 4AEDB 4XNDA 4MS2A 4PRIE 2DVGA 4UT5A 1CFNA 2WGNB 3FHEA 3MGOA 4ORZC 2QNKA 3WF0A 1JFFA 2OQJA 1XGQB 4DZBB 4N43C 1T5EA 1W9TA 1A22B 5KG9A 2ETWA 2NYYD 5FBZA 2DJVA 1M2VA 1X4ZA 4HJGA 1YLLA 1PNGA 4IDJH 1DF4A 4XN5A 1IGYB 3OMZA 4ZDHB 4JPKL 4Q6IA 4HFSA 4UM8B 5LA9A 2BFGA 1BK0A 5ABJA 3LZPA 3QBQA 4PGEA 4XDKA 1PIGA 1AGDA 3C5ZC 1YIPA 3LEYL 3MLKA 5FWRA 5JDSA 3ET9F 5FLXN 1S9WA 3O0RL 4S0SD 3PWNB 5ALBH 1EXUB 2OL3L 3LEVL 3SOBL 5KZCD 1T1XB 4JGYC 4UZGA 5I24A 4Q29A 2WW8A 1TZIB 4IGBC 5F1RA 5DO2C 5BY5A 5I30L 3NNJA 1BD2E 4IS6B 4BINA 2X6VA 5EYPB 1GC1C 3MLYL 4M8VA 5AOMA 4AVKA 3EYSH 3L3HB 1MG2C 1WCBB 4LSDA 3H7JA 2X2HA 1G9FA 1IVLA 1SVZA 1ECZA 1KTDA 1PZDA 2D0GA 4RQPA 2VXTH 1IXMA 2W38A 4YBHA 2XJVA 3ETEA 5AQ0A 2EILB 4WFFD 4HKWA 1HJBC 3BPOB 3C6EA 4P3DB 4ZAKB 1C4RA 2NNAA 2ZXQA 5IVZA 3WD5A 1IT9L 1Q82W 4ODVL 4F5CA 4BR6A 4XB3A 1M1SA 2JH2A 1QJY3 4JVAA 1SRDA 1P9MC 1DLFL 1YEIL 2H4EA 2XN9A 1BDYA 3QRGL 4BZ2A 3TEZA 3OXRA 1P8JA 1XBFA 2OMYA 2V5YA 1U0QA 3HNSL 4MRCA 2OSXA 4FNUA 3VXNA 4LEBA 3LH2H 4CCOA 2Y4TA 3QIBD 1WISA 3Q2LA 3AG4B 4YZ1A 3O3DB 5D5MF 4FI6A 2Z4QA 4JM0A 5T3ZL 1QVOA 4BQYA 1NAKL 2KLSA 1U4FA 3KPRA 3KYOA 2D6NA 5JQ6H 4Y4RA 5E24E 1SBSL 1EAPB 2FHRA 1LO4L 3HC0B 4PGDB 1WBLA 3TBSB 3CDGA 3K2UH 4YO0A 4KXAA 1S3JA 4MOAA 1N47A 2YOAA 4FQHB 5T55A 3ROLB 2ZGMA 1FO0A 5JOYA 1TT6A 2HT2C 1R5VA 4WFFE 5EO0B 1FHNA 2UXCB 4ANVA 1BM3H 5E99H 3PV7A 3U6XS 3JBG3 4CXXA 1W99A 3VRLF 1GIGH 1MCRA 4O2CB 5GLWA 2XUWA 3WAKA 1PZ7A 3H8UA 3CCHB 5LGHL 4HIEA 3GGWB 1C5HA 5IHUL 5DVLA 1VAMA 4OD3L 1D6EB 1JRHL 3BVXA 3BUTA 3HQRA 4TUKH 3PNRB 3B40A 2CKBB 5J6SA 3AMHA 3KB5A 5CYYA 1YNKH 4DR1O 1YJDL 4HLZH 1AOZA 2VY0A 4L3FA 1BVLB 4LVEA 3HS0B 3T3ME 2GITB 2J5LC 1DVTA 1HKLL 3H9SB 4WW1A 1FJGB 1UQSB 5F72S 4TUJB 3SGDI 1R1A3 2YYOA 1CICA 3RURA 1ULFA 2DF7A 2I24N 3UAEA 4G8FA 3RZCC 2FCTA 1UU6A 3AQXA 1EJOH 1L3WA 4Z7WA 2XBZA 1BVNT 3VFPB 3OGSA 3BGFB 5CKQA 5DPNA 4HBCH 1QHDA 2XN0A 5FECA 3OKLA 4AYSA 2P6JA 4FXTA 2XKSA 3VXPA 4GIPD 1SM3L 1IM9D 4OZFG 4LF7B 4JV4A 2YWZA 4R4BB 3PG2A 1RZGB 3SJVB 4AQEB 4FADA 3B02A 2IWGB 1BZ7B 1LVEA 2GNMA 3AQZA 3NFNB 4BKTC 4R26L 2R9IA 1MIML 4HS8L 4I0PC 4ICGA 5LCVH 1AR91 3CYOA 4OTXL 4APXB 1EGJH 5D6CA 4HC1A 3I6LD 2A71A 3D4ZA 2NXZD 3ARWA 1F6AB 2VR9A 1IGTA 3NNGA 2D9CA 5E4EC 1TYJA 3JSSA 4DZ8B 2P4KA 3X3GH 4PLOA 2I25N 3H4HA 4XVTH 4RVBA 1ZX3A 1A0QH 5C93A 1I94O 4KDWA 2ZNJA 4TF4A 1YEGH 3E6BA 4DYLA 2G3NA 5LBSL 3VD9A 1M9SA 4YGBA 1CP9A 2P8MB 4I3RL 4AOFA 4A6YB 4Q4IA 1T1ZB 4NRZB 1SDWA 2F58H 3COOA 1EV2E 3TF4A 2JE7A 1IBBA 1ED3A 1JMZA 4K8ZA 4ZS7H 4P3CH 4RUEA 1KB5A 2F15A 2IDCA 5EORH 1QJU2 1Q9KA 3HR6A 1LEGA 4GRLA 1SOXA 1AFVL 4ZFOA 4POYA 2AQNA 3QDGD 2ZUQB 3KPPA 4N8MA 4ZSOA 4X6CB 1R0AH 5BZDA 1RIUH 2JTYA 4NFCA 3OEEG 1NZ6A 3OM3B 2ZUWA 4WWOA 3VACA 4R4XA 2VWJA 3D08A 4AYID 4MG2A 1IPSA 1S7UB 3EJSA 4JI8O 4FQXB 4O02H 1ILSA 5F44A 4XO9A 3ULVC 2CJ3A 1X36A 3V95A 3ZN6A 3ZHQA 2V72A 4WEMB 1GS6X 3I6LE 4YHPA 3BIKB 5D9SA 1GO3F 4N9IA 3QI9B 2BMKA 4YY3B 1MNUH 1EZUA 1CUOA 2D2CB 5IY5B 1X7TA 5E4OA 3UDWC 1N59B 4KU1A 3BA8A 3VQVA 3UJJL 4HIJA 4GP5B 1G7LA 2OCCC 4CUCA 2XXFA 3CVHL 4NYLA 4FFBA 3NCBB 4QRTA 3IJ8A 2CXKA 2CHZA 2C3WA 1AXSA 5JLVA 4YXWG 3HOBA 3WB2A 2ZM6B 1ZZBA 4LPCA 1CFQA 3FAVA 3H0TA 1XB6A 3CBRA 3PQYB 1ODUA 1ORQC 4HH8A 4LP5A 2HKAA 4N26A 4D0CB 1QU7A 5EC1B 5IMMA 2YFUA 3QDGE 2B0SH 3ZO0B 2I9TB 4D3WA 3D2UB 2RALA 5K9YA 1G9AA 3DPRC 1RUE3 4W8JA 1XGZA 4FQPA 4D7PA 1IGML 5IK7A 3CZUB 2GCYA 4ZPTA 4BQCA 3QEQA 1T83C 4ZI7B 1RI8A 4YDLC 2Q0OC 1ZGLB 5IMLA 3IAGC 2Y6HA 2FDGA 4BWOA 4XACA 3WUDA 3HVNA 5ISZB 2GAUA 4PLKD 4GMP1 2DVFA 4BJ0A 2HR3A 1IEAB 3CBJB 4PJGF 4TPRL 5EIIA 4LLOA 2UU9O 2DQFA 3MN8A 3QORB 2X3AA 3WN5C 1V55C 3I2CH 1LEDA 4FP8L 4LPTA 3KLHC 2A6WA 4FL4B 2X4UB 2J8HA 4IDJL 1JI1A 2HWE1 5EOTA 1I75A 2D40A 2IXHA 4MADA 5BMVA 3AABA 4TQFA 1XF3A 3MJ9H 3EVKA 2UUCO 5TK2A 1GGBL 3VE0B 3NV2A 3POGA 3THPA 3DECA 5JPMC 1PZ9A 4HSLA 4ZBJA 3ZIXA 2O26U 3FSVA 4LO4B 4LK4A 3RMYA 5ALBL 1HZLA 3FFCB 4LLVA 3WGVB 1A3RL 4C83B 5FZ6A 1E9QB 3OKOA 1O9HA 4BWTA 4DV0O 3VBFB 3VZMA 3RYHB 1MFDH 1FL5B 1QFUH 2YGNA 1RK1A 1RIVL 2C7UA 2BHUA 3BT2H 2DD8H 4DJMA 2OUJA 4E27A 1L7QA 3QFJD 2IC1A 5K1JA 4CDXC 4KTGA 2WMPB 1L3JA 5FFGA 4A7UA 3JYBA 1AR81 3ZFGC 1V27A 2VXTL 3BSZA 1OBNA 1PSKH 1NY71 5D2LA 1V6JA 1LENA 3VZKA 5DM6V 5A7OA 2AJZB 2H2PC 1ZM1A 1OB0A 1NIBA 3T3PB 2Z92B 2E7BA 4NP9A 1GS7A 1KBWA 1KCLA 3ZRWB 1MWAL 3BQUC 4K7PY 1R5IA 2R0LH 1MFAH 2OMTA 3K46A 4PIXA 5C9AB 4D0QA 5E6YA 2EEXA 1QIQA 2I60L 1UD1A 2VZOA 4L3ED 4UQEA 3I6KB 1DFBH 2OMUB 2HLEB 2JWYA 4NCC1 4XPTL 1XV8A 2AJ3A 5BR8O 3WS3A 3QUKA 1OP5H 1VF6A 1Z5LA 3DC6A 1DE4A 4FKEA 4I0BA 4LPLA 3EFDL 4Q9RH 4PVMA 2OS7A 3TCTA 4ALAC 3F7YA 2SLIA 1LMKA 2EDEA 4XMKH 4NHYA 1A7PL 2R23A 3TBWB 1DLHB 4UAOC 2ARWA 5GGUB 3EBRA 2NLJB 3VZLA 5CP3H 1OE2A 1OK0A 4UZUA 1J9QA 5CFCA 5ECGA 2AJYH 3GSOA 1HN1A 5T1LB 5C8JA 3VU2A 4NQCA 3QFJE 2H3NB 2DV9A 2VXRA 1OQXA 3K2UL 2K70A 3KCPA 4XF3A 5CINH 1YZBA 3EHBC 4Z7UE 5GRYA 3V0WH 4ABQA 5IROD 5K9OA 3AMPA 1U58A 3QT2A 4XE9A 2G75A 5J36A 2IJHA 1U3HA 3EOYG 5L73A 3PNAA 2JDNA 1I1AC 2Y69C 1THZA 1CDYA 4NB5A 5E99L 4IHBA 2CHHA 4MXWA 1GIGL 5KS9A 1GR7A 4PJEA 2H32A 3UOAB 4FM1A 1GGTA 5FYJU 3O6KH 2XDHA 3WHUA 3RA7H 5DLMH 4CBCA 1T2JA 3TWCH 4M8UA 1NGPH 5ICXB 4NZRH 4UBHA 1GZWA 2AEPH 4CCLA 4RMTA 4PRDB 3BO8A 4CNIB 4U3CA 5F3HB 3LQZB 5KOVC 3KG2A 4TUKL 3AT9A 1OZ0A 2GFBA 3N9MA 1RSYA 1GH7A 1UPSA 3D48R 1F4HA 3SBWA 4ELMA 3PWPB 3TGUH 5BUVA 3P9LA 1AKJB 3I9GH 4QRUA 1WZ1H 5C9JB 5GGSB 1LHWA 1HEJC 3LQAC 1UZ0A 3IFNH 5I0VA 1O4TA 1ZZCA 5JIUA 4ZTOH 1TO4A 2WNXA 5SWQB 5C0IB 5EO9A 1TQCB 4WFHD 1XSJA 1FJ1A 1KLGA 4YVWA 2X41A 1CL7L 3SDAA 3R8QA 1SLWA 4U6YB 4U3FH 3B01A 1ZIBA 3P11H 3P69A 4QXTB 5EZJA 3LH9A 4YM1A 1XGTB 1VRH1 2J6EA 3GYRA 1RZPA 2X9WA 3GZOA 2Y0OA 3ACHA 5JHLH 3FUQA 4IEPA 4L3AA 5FRAA 3J8F2 5LGNA 3QNYB 5T1DH 3RTQC 5IT2H 2Z7YA 3O1RA 3RJQB 2PCFB 1EGJL 1NIFA 3MHZA 5B39A 3RWRD 2W0FB 1CBVH 3TA3D 3IMVA 5IJVA 1C5DB 1CLVA 2CR3A 4OFDA 3CHRA 3P4MB 2E76C 1NBYB 1XHXA 4DUYO 1TDQA 2IAMA 5PCYA 1KCSH 4XVTL 3GK8H 1A0QL 3P0VH 5IATA 5IVBA 1AR1C 4NBZB 2VTFA 3WDYA 4KY1H 4TZDA 4LBOA 3TJTA 1YHFA 1JNLH 2EZ0C 2F7IA 2EC8A 2KERA 4OUUB 5F96H 2KYIA 1SY6A 4ISQA 4I48B 1NC4B 2F58L 1GZQA 3MRMB 2KSDA 1FAKT 3BJLA 2P5EA 3GKZA 4K8FA 1EEZB 3BFQG 1PM7A 4P3CL 3G5YA 1O9GA 3MRNA 4WFHE 5EORL 3U7AA 2XQ0A 4HZ3A 5L2KA 4XCAA 3ZHRA 3R4SA 1GY1A 4ARXA 2WOYA 3SGKA 1R0AL 4H1LB 1DLBA 2DOSA 4BSWB 4XZ4A 1RIUL 1E27B 3QH7A 1YEJH 1OEZW 1YMHA 2WZR2 3BH8B 1W2OA 1AJKA 2PTVA 2BNQB 2F7QA 1HCVA 5FLUA 1J86A 4XXDA 3ZHVA 1N33O 3OKDB 4HJEA 2AREA 4PRPB 1YVLA 3QJZA 5DC0A 4EI5A 5DUBA 2DYCA 2VLJB 5FLIA 5G4NA 1RZ8A 3LKSA 3KPSD 4N90D 1MNUL 3RWJB 3I9IA 1OVZA 2BIPA 4LCYB 4B50A 4BCYA 4YLQT 4XMIA 2P7TB 4W9FC 4JQRA 2CXGA 3QWNA 1KFGA 5SWSA 3TEYA 2ZZJA 2H6PA 3J7LA 4L5FE 2FQGA 5KSBA 2DW4A 4J4PD 3E8UL 1T89C 1CCZA 3JD71 5SX4I 1BMV1 4UTBL 5A16A 5ACMA 2PNDA 1LO2H 4J10A 1D4M2 1MEC1 2B39A 1ZVSA 3MGUA 1MLCB 2AZ0A 1KWKA 4PJBF 5GGQH 5AZ2H 4LDOB 5LP6B 1R3KC 4KHTH 4PREB 2CGPA 1TVKA 4A7ZA 1V7MH 4J41A 3WFDH 5EQUA 2R51A 3O8XD 3NAPA 3QYCA 4H2AA 1IBMO 4FPPA 1FQ9C 4JFYA 5I1LB 1HB2A 3FLPA 3K9SA 3KV5A 2IH3B 4CXWA 2HX8A 3TXAA 4BLJA 3L1EA 4CC1A 2PMZA 3FUIA 3EJUA 2JB5L 2BSEA 5MP6L 4P9IA 4YNIA 1OJHA 5KVEE 4KI1A 5GZND 3J7NA 3WNKA 4UWDA 3ZSTA 1VEWA 2CNYA 4HZFA 3NVCA 3E5XA 5FZ0A 2XPJA 2GMPA 1G84A 3TO4A 4MD0B 3LSDA 4PJCA 1JGEB 4N8VG 3I2CL 3ACFA 3N2JA 3GMLB 2DLHA 1XR8B 3VI3F 2BY3A 5D5MB 4EN9B 4PTTA 1MN4A 2G1MA 2YD2A 3C5SA 3MJ9L 3GXPA 3T65B 4BIKA 3H1IH 1V5JA 2B3RA 1MIEH 5D2AA 4WJG3 2JKTM 1OCZC 4M5ZL 4YG6A 4HKJA 2WAOA 3VMPA 1VB4A 4LNRB 3B9IA 5DJ6A 5ILTH 3MFFA 3S8WA 3FYEB 1XQ4A 2QDWA 4NI3A 2YU2A 1XF2B 3R19A 1TOXA 1B4TA 1OAUL 1US6A 4JAVA 1N2RB 3WKMH 5LK5A 5KXEA 1QFUL 3FQXA 2AK1H 2ZSWB 5KYUB 3BTAA 5EYXA 3RJOA 1L0PA 4H8WH 3DX9B 4UDTA 4Z7NF 1XU2A 3BT2L 4WO4A 1YF2A 2DD8L 3T8MA 1A9BA 1ULGA 3ULUL 5EF0A 3WDIA 1XMWA 5BJTB 1FZKB 5KSBE 2JG8B 2OX0A 1OPGL 5HGHA 2CSPA 1PSKL 1F13A 5DQ9A 2HWD3 3BPNB 4MNQA 4NC1E 4GT1A 5I8CA 3C60D 4R8HA 4B0MB 1OW0A 2ZGLA 4I55A 1TU2B 5I16B 3BP4A 2H8PA 2OULB 2EACA 4KRPD 4BW5A 3L5JA 1MFAL 2CUAA 4E9QA 3ASIA 1OSEA 3T6VA 1GYKA 5C08A 2Y36L 1JA8A 1LK2B 2MFNA 1QSVA 2XZZA 1QCEA 1FYTB 2HJKA 3LS4H 3QUZD 1DFBL 4XC3L 2QSQA 5GGRB 2AACA 3SNMA 1UVQA 2D03H 1RUC2 4XQDA 3S2AA 3IETB 4ZYKA 3CIAA 4GX2A 2V7HB 5IVJA 1R3JA 1QBML 4XMKL 3HG4A 3JAWB 3D85A 3AP4A 5DA0B 1ROWA 3IMTA 4Y2OB 3QDJA 3NDYE 4BRJA 2Y60A 1DN0A 4BFNA 2AJYL 4YG0A 4NZFA 4NROA 4Z8BA 4PCSA 3VXTA 4I30A 2OM5A 4QDGA 3HHSA 1KCVH 3HA0A 3QQ4A 3V0WL 4TNGA 5KMGB 2OYQA 2HT3C 3B7TA 1DQVA 3K72A 4G72B 3L3OA 2D3OW 3D8CA 5K8SA 3NFSH 1KGYA 3BCDA 4ANUA 1C5CL 3BLPX 4BFGA 3ZMNA 4CGTA 1DQIA 3OJMB 4HWEH 4WSKA 1RUH3 1OQOA 2B8MA 1ZLUK 4WEBH 3RWIA 5HYJA 5KJ7E 3B7MA 4RGKA 2KH2B 1MXDA 5FZLA 3RA7L 5DLML 4XMUA 2UYLA 2XVBA 5F2SA 1NGPL 3DYPA 1AHSA 1N36O 1K4CB 2P5OA 1SHWA 5HCBA 3TYFA 3MKKA 4KHPO 3WKNA 4JREC 1JF1B 1DJWA 3NIGF 1ASJ2 3WW3A 1XMQB 2ENQA 2GVYA 3G6JA 1KPVA 1WZ1L 3I9GL 3NZ8A 5DJ0B 1JUHA 1S9XA 1MZEA 1NGXB 4LF6B 3IFNL 3OKKB 4B53A 5J2UB 2WQAA 3INUH 5C0GA 5KSAB 3HLKA 2GN7A 3FQUA 4ASLA 4YE0A 2CK3G 4M8QA 2I9LB 4ZOLB 2YHGA 4RZCB 5DZVA 4RHV2 1Q9OA 1E2WA 1KB9K 2A6YA 1UXWA 3APQA 2I85A 4U1LB 5C0ND 3OUHA 3BH4A 2GBUA 5FXXA 4GUNA 1LODA 5JDBA 3C6LA 3L5HA 1M93A 3ZKXC 2AGJL 1SFNA 3L73H 2ZMNA 1ZA6A 3K4ZA 2RFXB 3H1YA 3RPQA 5T1DL 3E22B 5IT2L 3RY4A 3LY6A 4YIQB 2FGZA 1CBVL 5GRZA 3GHBL 3SD5A 2DUOA 2BSKA 3L9YA 1MSDA 2XYCA 1SA0A 3H0OA 2EX3A 2Z69A 2W60A 1K4DA 4XURA 1KCSL 2J72A 3GK8L 4CDQC 1JERA 3P0VL 1N8ZB 3O45A 4KY1L 5F96L 4O9GA 1IAOB 3LB6C 1H5BA 4AWDA 3AS3A 1RERA 3B3IB 3E9TA 4U1NA 4XNXH 5A3IC 3V4VB 3JAMN 1OV8A 1SDDA 1H8TA 5DD1H 5FKCA 3CHXA 1CXLA 2L4OA 4N0FB 2RM21 5FXCH 4Q4W2 4NIAA 1I7FA 2WLIB 3IGLA 3I97A 1FBIH 2A1WH 3DXTA 2V3EA 3L81A 1LTEA 2E9GA 4PJGB 3PWJB 2EIDA 2GC4C 1YEJL 2WXLA 5C0AE 4APQC 3DXAE 1F8TL 2EP6A 5H2BA 3O2VH 1OGTA 2ZAIA 3RWEB 5JLZB 4HYOA 5F1IB 1ZLVK 1D2QA 3K06A 1F4XL 3KBHE 3DTDA 3VGAC 4KPHL 2WB1A 3X1EA 3LCYA 4H0LB 3RBZA 4FOQA 3D0AA 3QXAB 1ADQH 3JV6B 5K1VA 1TZGH 1MS8A 4RNRB 4X50A 3MVSA 2VW6A 2ZZQA 5T8IA 4UW3A 4NKOB 3MD0A 4X7FC 4PWKA 4ZK8A 5HP5A 1M4WA 4J7JA 4F2ME 2VAJA 1AYRA 1P4UA 1IQWH 4QXBA 4JLRB 3PU7A 4AL9A 1FG2B 3SY0A 3ROOB 1VMJA 2X10A 4LCCC 5GGQL 5AZ2L 1K6QL 2YEVB 4JTOA 4DV2B 4IKKA 3WNOA 1AXIB 2ICEC 3UADA 2OUHA 1X4YA 1V7ML 1ZA3B 1IKOP 3QCTH 3WFDL 1W03A 2DBIA 3OR7A 3NJHA 5J1AB 4WHCA 3F85A 4LDCA 3DX3A 2VZQA 1MCDA 1H2MA 3Q6FB 1KLFA 4JI1O 2ICCA 2MWCA 4AYMC 1Y1UA 3IMUA 2WLQA 3SGJC 4WZFA 1F3JA 2FR4A 1LO5B 3K6NA 4M6NL 5LGYA 2UZXB 2X12A 5ITBH 2EXKA 2P52A 3LPGA 2CBOA 5LBGA 1AROP 3MBEB 4EZJA 2YPVH 1N32O 5L4MA 1VFAB 1TTFA 2ATFA 2B5UA 2ZG2A 1XCTA 4YC2B 2Z93B 5JIAA 3WB1A 5E1AB 4INDA 3VL8A 4BQWA 4XO4A 3X1FA 2TNFA 1E3XA 3D3IA 2OMBA 5DD0L 2GNDA 2ZUQC 3CVHB 5E8PA 4FABH 3IGAB 1MS3A 4ZONA 1MIEL 5HY9B 5FF6B 3G3LA 3D3VD 1JZ7A 1YFWA 1Q1PA 2WBJA 5CA0B 3P3SA 2IQAA 4DFHA 3MHHC 1MEXH 1CLYH 1YHPA 4FQXC 4LSVH 1ACCA 4QO1B 4TQEH 4F2EA 2B9UA 1F3RB 3C2AH 4G9FA 4BCUA 4BWAA 5J6GB 2JD9A 4LE3A 2X89A 3GRWL 4IL6Z 1W6NB 3IJEB 4H8WL 4PR5B 2FQPA 4ACPA 1EAH3 1OCCC 5HVFB 2JJSC 4FLQA 4JQXA 2BINA 4WNQB 3ZUNC 5E1HB 1SQPH 2G5RA 3E6DA 1R3LB 2HLDG 3GRGA 1FNGB 4IGPA 2ADEA 4H7MA 5CEZH 1CDHA 1O8SA 4M1GH 4LRIC 3VDCA 2G5BA 3ETDA 3LXAA 4JQVA 1O3RA 3AB0B 5E5LA 3BW9B 4RDQF 5CBAA 1WUNT 2FEDC 2JCCF 4N6RB 1FPTH 1AQHA 1THAA 5FPRA 1MCNA 3RUGF 3CZJA 4S2DA 2A79B 3EOAA 3IMBA 3ZXKA 3O41A 4N43A 2LLNA 4YR6A 2FHFA 3LS4L 1BVP1 2DI9A 2PYEE 1H8VA 2D03L 4JJ5A 3U75A 1C16A 3D3VE 4M9OA 5IG7B 4YEFA 1NMCB 1K5MC 1XNTA 5C0CB 1X7NA 3HOGA 4W81A 4KROC 3C5ZA 3ARED 3MFCA 4PCRA 5AOJA 5HYSB 2NY6C 3ESPA 2E9QA 3ZYOA 1U8PA 1N0LA 2VM3A 1FSKB 3SCMB 3D4CA 2R69L 3FQRA 3EW3B 3WTTA 1VBE3 3I3MA 5CJBA 4JGYA 3WHE0 1Z3RA 3DVNA 3JXAA 3CC5A 5E00A 3RVUC 1AR4A 3R4DA 5DJ2B 5C0BB 4IGBA 3W39B 3P1IA 4X8NA 3WINE 4Z1VA 2X4RA 5L9VA 1KCVL 3EYQC 3ZIMA 1JS9A 1FH5H 1XGUB 2RA1A 2ARAA 4FL4C 4GWMA 4JO1L 2CLRB 3PDOA 3RWFB 5CIPH 5EEVA 4AL8L 3EH5B 5J13B 4HWEL 2APXA 5DWUH 5HGAB 2BSRB 9PCYA 4PU2A 2WNWA 4WEBL 3UGXA 5ID0A 4KUCD 5D6DA 2XVKA 3GMOA 3NJXA 1S0BA 4UV9A 3QRLA 3VBFC 3ZYRA 5FM5O 4YW1A 4DXSA 1Y18A 4DO6A 1K72A 5DDHA 2Z5UA 5DECA 4IE4A 5FA3A 5C7GA 1XRUA 1QTPA 2ZKHH 1P9MA 3U4EA 1W6LA 1GFF2 1JYIA 5F7HA 4DR1B 2F8VA 3HW7A 1AXKA 4XYXA 3NCFB 1AJNA 2QKDA 5HXVA 2J8UA 2WO3B 3VXMB 4Q97A 3KEHA 1DBBH 3UYOD 4K9EL 4KKLD 5BO1L 3BWAB 4KOBA 5A70A 3U4BH 1H2KA 1YQ5A 3STZB 1UA6H 4JFWA 4X1IA 3KBPA 2JTDA 4E4EA 1OOPA 2R1WB 1ZTMA 3WHTA 3UACA 3K1DA 3POJA 4L99A 4LCUB 4JI3O 3UXFA 2VO5A 5HGDA 4B3RO 5D72H 4HX1A 3IPBA 4GT7A 3DGGB 4RIRB 4XQ4A 1FVEB 4YGEA 2C0ZA 2A6JA 3S96B 3BISA 4XOAA 3VGHA 2OT5A 3AC0A 1G1KA 5F7DA 3UJOA 1Y1DA 5AAMC 4PJBB 1EVUA 4Q9QH 4YFLF 4M01A 2NY3D 1I94B 5HYQB 2ODMA 3KWVA 4CVWA 3VUOA 1FZJA 3L5XH 1AYN2 2HJLB 4NO5B 3G80A 5I76B 1P4LB 3IDEA 4XNXL 5D1XC 5L3CA 3DO3A 4R2GD 2Q7YA 3SE8H 5LBQA 5D1ZI 2AQTA 3WIAA 1BQHA 5ETUA 2XETA 4PI2A 5KJRH 3VA2C 1FZMA 4IRSC 3B2MA 2JKNA 4DGYH 2AV1B 4P2RB 5DRXB 1HX0A 1FBIL 1JPEA 2W88A 2A1WL 3BKCL 3RZCA 1QQCA 3JVFC 3WO4C 1RM1B 1QY4A 2A75A 4ONUA 3VG0H 3BUYB 1J5OH 4PG9B 4XHBA 5FNVB 5HBBA 2ODIA 2F53D 2YFNA 2NNXA 4HHAA 3O2VL 4JY4B 4JI8B 2FT8A 2W08A 3VI3B 4TTDD 3DI3B 1LO3H 4C55A 1AACA 2L7UA 3QWOA 1AO7D 4QHZA 2OI9C 1KP2A 3FOMB 4KJQD 1WW6A 2BNOA 2VITB 4G6AC 1V6OA 4I0PA 2QEJA 4OJAA 1BVVA 1ADQL 3ZPOA 1MJ7H 2M2DA 5DT1H 4KFMA 5LGUA 1DVSA 3VD5A 3ZHFA 2A6DA 3G5XB 2CCVA 5L7OC 3BHBA 3TK1A 1TFHA 3L9BA 5IHZA 4LITA 5E2JA 2OZJA 2WXJA 5IFJB 4O2AB 3VWKD 5A7QA 3QOPA 1IQWL 2OMZB 4NDMA 4YPGA 1MQTC 4Z7NB 1INQA 4R7DA 5ESVB 4LC1A 3TBBA 4A2GA 5D7JC 4QQLA 3DPBB 2D7OA 4J3OD 1Q72H 5IVNA 5GISL 4Y89A 4PF1A 3VBRB 2Y3AA 1Y76A 3QCTL 5AOIA 5KBLA 1ICTA 4G80B 3L7FB 4AAXA 5IJBC 3MKGA 1Y67A 2P24B 5ENWB 1MQ8A 5F0MB 2W0FC 5BMFL 5FV3A 5FKPB 2YQBA 5INCB 3PL6A 4E4HA 3NIFF 4OUSA 4KJWC 1TNRA 1C5BH 2VQFO 3TVMC 4AEJA 3NH7H 1HV1A 2OZNA 1UD4A 3DX8B 1RHFA 4E9XA 2OZ4H 4O02B 4XPGL 2J88H 3UESA 1NIDA 3ZIYA 3JB4C 1QSEA 1AO7E 3FLRA 3PVOA 1FNLA 3DX4A 3GWOA 3FONA 2IXLA 2GEEA 2ZE7A 2DWSA 2F4VO 1BFVL 3UTTD 2YSTA 3OGOE 1GNHA 1MMMA 2CCLA 3KGLA 2X7LA 3UDWA 5AB9A 5JCOC 2GC7C 1L8DA 1U8QA 4MZIA 2WT1A 4Z77A 1AI7A 1EDYA 5FPZA 3JAKB 2JGDA 4OLUH 5GGTH 2UUCB 3BPLC 2EO9A 4ODXA 4K8RC 4OAWA 1R17A 3JCZA 4PS3A 4YHIB 2E75B 1EXGA 3T1YB 2DWDB 3HZYB 3KYNA 4GAAA 3CFIC 4N85A 1MEXL 4TQHA 4XZUB 1QJU1 4DPCX 2Z2SB 1CF8H 4DR4B 2Q0AA 4XMVA 5GS0H 5BW7C 4DV0B 2WSKA 3BUQA 4E2QA 3RYCA 3B2UD 3QIWA 4QOKB 1G8MA 1ORQA 2J4WH 4DKAA 2R7EA 2A7WA 1NFDA 1U8LA 3CX5K 1MVYA 4X7CC 5DA4A 3V52H 4F7PA 5LVEA 1URXA 1JI6A 5F37A 5D4QA 4IT5A 2J12B 4DP6X 1LOCA 3DPRA 3V5DB 5CEZL 2EC9T 4QJ3B 2ILMA 5IW6B 3G6BA 4G7VH 3CHOA 5LEJA 1T6WA 4UIMA 5JVDA 1T83A 4PJDA 4AVBA 4NT6B 1FPTL 4A41A 3A4FA 4TLFA 3HPJB 2IXKA 3LDCA 1RUG3 1DFXA 4JGMA 3NIGB 1ZVHA 3S98A 1HB4A 2AJXL 2DCKA 2WVVA 4A2MA 3WN5A 5IEKA 3QZWA 4CP1A 3W5NA 3KDPB 5AVXB 3LXUX 3T8VA 3PGFH 2GKIA 3HC4L 4MJHA 3ZR6A 5KBPA 3GKWL 3S34H 2VNOA 1RJLA 1V54C 2XA8H 2ZGRA 2HVJC 5HI3C 3FBYA 3MW3A 4Q4EA 1B0RB 2N01B 2PXYB 5JPMA 3L17A 3QJFB 1EY2A 4HUKB 4XFAA 4RISH 3AU1A 1DQ2A 4QXCA 1WK0A 2GK0B 1M53A 5A1FA 1T0PB 3H9SE 4YFLI 4HG4K 3O11B 1Y9MA 3MLJA 1DCSA 3WQBA 1DZQA 2XN9D 3BPSA 3QJSB 3WUZA 2JVDA 1FDLL 1NCAL 1U6AH 3TIDB 1FH5L 2HFEB 4WI0A 3E5QA 2J1SA 1EEYA 3VFWA 5EBMB 1RUD2 2WUBL 4YW4A 3GLAA 3B9EA 2ZKXA 5DTFA 3ZFGA 2L7QA 1CIYA 4LA3A 4CYDA 1K5WA 2OTUA 1I9EA 2PF6A 3KPRD 1RCYA 4N2AA 5A32A 4P57A 2JS5A 4GYCB 3SJVE 1SJXA 1T66D 2MOQA 2QPFA 4UV8A 4IKNA 4PV8A 4XBMA 4AJWA 3UYRH 2DQCL 2GHWB 3BQUA 2IALB 2PP7A 3M7FB 4TOIA 3B5TA 3SY6A 1BKZA 2E7TA 4YZ2A 1HCFX 1QFWL 3ZL4H 4A2FA 3TH2T 4N6QA 1CXEA 1FP5A 1EN4A 3HHMA 4L4VB 5CZXD 3RWGB 3WXPA 2BHFA 2ZKHL 1T04B 2YUZA 3ABMC 1MCHA 2ZXGA 1T5WA 1EPFA 1NANH 4JDVA 5GPRA 3MIEA 1L9MA 3POIA 3D25A 1BZ9A 3WNNA 5JW4Q 1ASPA 4KI5E 4Y88A 4DERA 1QLEB 4OCWH 4U1GC 4WBNA 3ZDYE 3QDHA 3U4BL 5GALA 3NDZE 2ENSA 2IEPA 2XN9E 4XDJA 4YJZL 4NJAH 4MVZA 3P2DA 1L9RA 4NSKB 4A4AA 3BZDA 3QEUB 3BRGC 4RO2A 4B3NA 2EIJB 1CICD 3C8HA 2E9WA 4BDVB 4FQJL 1OP5K 4GBXC 2OR8A 4Z76A 3ILEA 4B3EA 1T22A 1I1AA 2LU7A 2ZQMA 1RMU2 4BK8A 4KI5M 1O3TA 3ATAA 3RFZC 1NEZA 4QRSB 4FLXA 1DVFB 1T0OA 2JICA 4ARYA 3V6OC 1U8HA 1B35B 1C7TA 2H6OA 2WLZA 2DLTA 2WXKA 1GKBA 3L5XL 4PRNB 1ZLSH 2VUDA 1DQTA 4WLCA 1PDKB 1OAZL 2L0DA 3CMGA 3SE8L 4DKEH 3QCVH 3MRGA 2H3OA 4AE1A 4O61A 3GSXA 4ATFA 3H1JH 2B1OA 4QNHB 2SEBA 4AMXA 1WWAX 2YIAA 1I9RL 1JK8B 2CLZA 4DGYL 2P3KA 3POHA 1T21A 4S10A 3D30A 4J8RA 2GBAA 3H3PH 2PLV2 4H8HA 2A6KB 5DMYA 3HKDA 3VG0L 3FKSG 1XR9A 2A4ZA 5LHIA 1J5OL 4AQZA 1WLCA 1YNLH 5D1ZB 3GJBA 2J1RA 1XEQA 3VGEA 1K4CC 1G7MA 2ZKLA 3CB2A 3IDMA 1Z0MA 3F2ZA 1SDAB 4F58L 1KNOA 4ELKB 5FYCA 1W9YA 1LO3L 2MKWA 4PDWB 4OX9O 2BSBA 3SBRA 4YMPA 3QO8A 4GRLD 1XF5B 3RTQA 1XE7A 4UU9B 1MJ7L 5DT1L 3T0DA 2DOCA 1U92A 3T4AB 4R96B 1CD8A 1IBLB 4OMCA 3BN9D 4JFVA 2FATH 4P2OB 5FIXA 3JUZA 3M3OA 2DQ6A 2QM4A 3OLGA 5F7FA 4HPHA 3CFMA 3QUXA 2P45B 3OAUL 1H3WM 4GS7C 1W9WA 2L9LA 3S48A 4YJ3B 1RZIB 4JFEB 4MB5A 4D6SA 5CG9A 4TNWF 4QEGA 4AVIA 2TUNA 4IKIA 4M4RA 2ZGTA 2WTOA 3OZKA 5BRZA 2BIQA 3IFPB 5CM1A 1P5UB 5JSRA 4P5RA 3EH3B 4MKTA 1FL3B 2DPKA 4P4KC 2GJRA 4IV3B 1U8OB 1IBMB 4G43B 2VSKB 3HB3D 4U33A 1ZAUA 1NGQH 3LRHA 4PWGA 1C5BL 2JCCB 3VCLB 1ZT1A 3I4IA 4M7ZC 3RUGB 2R8SH 2BGOA 4BPZA 2V5MA 3J8F1 4HK3N 3CPLA 2OZ4L 1IEBB 2ZGKA 5GXBB 1KWGA 3VBBA 4R0LB 1WA4A 4LASH 1L7RA 1M7DA 5AG8A 3VJ6B 3GBMH 4PAZA 2X9YA 5JPNC 4GUQA 1YJDC 1JW6A 4XDQA 1RIHH 3RGVC 3KSCA 4PSRA 2RHPA 2EXYC 5I82A 1SBBA 1V3KA 4K7FA 2HVKB 3LNNA 3CBNA 3TBYB 5CEXA 3W5MA 3QEHB 1Q8PA 2NY0B 3QEQD 3N43F 4OLUL 2AK4B 4WVRA 1P5VA 3W2DH 4Z7QF 4MQXD 4NN6B 3OWRA 4ZFGL 1T89A 4J28A 4UTAA 1PK6C 2X4PA 1NCOA 1HXS2 5DK2A 4W9LC 1JWMA 2LFSA 5DUPH 5GS0L 4PRBB 3MX0A 1DGLA 1QHPA 1R3KA 1KQSU 3OB0K 4M1CD 2MRYA 1ZJBA 4MT8A 1BFSA 4JRXE 5CMAA 4AQ1C 5FEBA 3K71A 2WQ4A 2WZR1 5GZOC 4BIOA 1E3ZA 2OXHA 1G1YA 5C07A 3WE6A 5J11C 1F11B 5AYQA 4YWGH 4Z5RB 1TJGH 4I02A 1OT2A 2LGWA 1OCWH 4G7VL 4LCWA 2ZNWA 2ZONA 2QE3A 3UT0A 2EECA 1BF8A 1JZDC 4JCLA 2VAAB 1WB7A 4NN7B 2PCPA 5F5CA 3KL0A 2OK0H 3HZMB