3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
molecule keywords PmoB
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
3RFRA 4O65A 1YEWA 4PI2A 3CHXA 4PI0A 3RGBA 4PHZA
chains in the Genus database with same CATH superfamily
4NRZA 2DWDC 2W0PA 4UV7L 4GKKB 4YSQA 2X0UA 4FXLA 1NT2B 3KDMB 1ORQB 3F5TA 5FDWA 3IPVA 4GJZA 1OZTG 3KGZA 1DQML 1ZGLM 4Z23A 3RLSA 3BVUA 1AJOA 2XMLA 1KBVA 3CJIB 2JK5A 3KGTA 1QBMH 3OR6C 3O3DA 4UVAA 2AREA 2LVCA 5JR2A 4X6BB 2Y36H 5D7KE 1WWYA 3T04D 3FZUD 4TPRL 5D7LB 4P9XA 1NANI 3MCLL 5IW6A 1RPUA 3GBEA 4LORA 3LQZB 1OF4A 4D6QA 4MO3M 4QRUB 3DMMD 3RZCB 3L95B 3R1GH 4WWOA 1SACA 3BQUA 3O2DH 3KM1A 3GB7A 3QPXH 4M61A 5F6HJ 4FP8H 4YSAA 5FO8A 3WHE1 2ADEA 3MIDA 3RS6A 4R90L 3L3DA 4EN6B 4N9GB 2P24B 3WHXA 1BK0A 4HPOL 3UP6A 4QXKA 2EYRB 4LSVH 5FP4A 4MZRA 1D7CA 4J12A 5BNPC 5IHWA 2F1AA 3CZLA 2GTQA 3GMNA 4N3UA 4U1KA 2Q1EA 1GJIA 1DQLH 2WBXA 3H55A 3X12B 3KVQA 1F5JA 3IPVB 3D18B 1A4KA 2QKIA 4PB9H 3SGDH 5L2KA 2IADB 1UKSA 1YMMD 3U9PL 4HZ3A 1NGPL 4IRJB 4XXDB 5C8CA 4CS2A 2ZR2A 1F4HA 3DJZA 5FZOB 5LG1A 2VLLA 4B9ZA 3NFSL 2A9AA 3J7NA 1M57B 2EJ1A 4XMLL 9PCYA 2XTAA 4Z3GA 1DQQB 5C2BH 1IEHA 3POFA 1W03A 4MX3A 4EQ3A 1MCIA 3SE8L 5JQGA 5KVEH 4HCGA 2K1EA 4G2KA 1HE8A 2X28A 5SWQA 4BQ1A 2IQAA 2QM8A 2JD4A 1Q6IA 2V2WA 3LH2H 1ZLVH 1KD7A 2J1WA 1SEFA 3JCIA 2HVKB 4DR1O 4NHUB 5E2UL 3UBXG 1W2AX 2JKRM 1XF2B 1A6AB 3DPDA 4XWGL 4QGPA 3O3EA 3IE4A 3Q8CA 1F7YA 2WM0A 3J2PA 1JRHI 4N2IA 1IM9B 2MFNA 3BEVA 3MACL 1GNYA 1QRKA 3U4EB 2J3SA 5FW8A 2JVDA 2ZKYA 3LHPL 2XYCA 4RAHA 4I3SH 2YAQA 1T22A 2Z7ZA 3O8XA 3UTSB 4B9JA 1X8EA 1UACL 2Y23A 4PA9A 3BP6B 3CK0H 2E7QA 2BNQD 3L13A 1SC5B 1R5VB 3IT8D 4X1YB 1DL7H 1RUJ1 4XZUG 5SWSD 2JFCA 2WO7A 3SE3A 4LKXA 3DJSA 1WW6A 1QFWL 4N1CA 3BAAA 4RA0A 4U2ZA 1LTEA 1KEXA 1SFNA 4PT6A 2X2JA 1TQVA 1D2DA 4XWOD 1B4LA 2JELL 3DO7B 3AYDA 3B3IA 4A5UB 3JV0A 4KRPB 5AL0A 3TVMD 1JF5A 1CGSH 3GMQA 5EBMB 4XAKE 5IQ9B 3AVSA 4CUAA 3TEXA 1JHLL 4WK4B 3SJVE 2ZXAA 5GLVA 3SE4A 4F24A 1F51A 3BN3B 1OKEA 4TUYB 1AYOA 2DPKA 2ZPKL 4KKBD 2YLKA 4HG4J 1QQP2 4Y1UA 4ICGA 2PTVA 3CPLA 1PX4A 4NQCD 1QJEA 4UXAA 3H56A 4DV4O 1DQJA 3QIUC 2BE3A 4XHJC 4YDLC 4MCZB 5IMOA 1WW4A 5L3BA 3JQWA 1P5VA 3NRPA 4X8AA 1DGRA 3R1GL 15C8H 3PURA 1ZTXL 4FP2A 2FBEA 3ES1A 1NQTA 4EIZC 3LEMA 1NS1A 2UZXB 5CILH 4FP8L 4PJGE 4HT1T 2YD6A 1A7RH 4EI5C 1J95A 3ILPB 4YDLB 4AG4A 2P45B 1IKOP 2NRDA 2VKXA 4FAHA 2XPGA 4XE0A 2UWEB 5FYBA 3L4ZA 3QEGH 3VFOB 4OH2A 5DEGB 4UTAH 2D6PA 4IXLA 4G7VL 1OM3L 3NSTA 5ICUA 2I07B 2KKQA 5F7AA 5AW1B 4R26L 5IVXF 3SBRA 4WFBV 2DKMA 4NSKB 3UBHA 3ENEA 3QNFA 1RIHL 1SM3L 3DRQA 3JWNG 5GGVL 1Z5VA 1NSNH 4PLOB 3QDGE 4OMCA 3B6SA 2PYJA 3QORD 1NC4D 3CNKA 1MELA 3HG3A 3UBGA 3V4UL 3R4DB 3ABZA 3KPRB 1FL5B 1KIUA 3O1TA 5C0EA 4I4TA 1ZT4A 3G6JF 3H2WA 4GIQA 4HJ0D 1LO3L 4K8FA 2F7OA 1GZPB 2NXYD 3APFA 4ZD3L 4QPJA 3V79C 4K8RC 4NZJA 1ZPUA 3VG0L 1CICB 1JMXA 4A42A 3KLQA 3ARXA 2HRPH 4CILA 1MRCL 1RTVA 3UYRH 1VFAA 5F21B 1PL3A 4BA0A 1P6FA 1NGQH 1QI5A 1WRFA 2DEXX 5ANMB 1E2VA 3PJSA 1N12A 2ITDC 2GBTA 4A66A 1WCSA 3SGEI 3V0HA 4OI2A 2ZEYA 2JIXD 4F7CA 5DDJ2 4FEMA 4MGXA 5FV3A 2RJZA 2OIGA 4OD1H 3ARFB 1PYWA 2YSSB 4BFNA 2YXSA 2WRAA 4YHIA 5ERWA 1VBE2 5I8EA 2HP8A 3PJSB 1P4BH 4C58B 1X8MA 3OUJA 4N5ED 1DZQA 3K75B 2QT6A 4KH9A 3MNVA 2MEJB 3FOLB 2O5XL 3RWJB 4AQEB 1A0QH 1T6BX 1BLZA 1WBLA 2IW5A 4AFAA 2VLMD 1BXXA 3B8NA 1KU9A 5KHKA 4MAYD 3RKDC 1JDAA 3VGEA 5LYJB 1UZYA 5DJAA 3LPGA 4P23C 5AOKA 3NNFA 3WY6A 3DX2A 3MOQA 5EFIA 5CHNB 5TE6H 2JCCE 2ZONA 5CA1B 4B7LA 5CR1A 4Y5TA 2C9PA 1SPPB 5CLWA 4X4ME 3G5YA 1W0YT 4RHV2 5GZCA 2YC0A 4X8GA 4UFMA 2R56H 3HNVL 1XHXA 4S0HA 1BZ9B 5IVOA 4JFEB 2DS4A 2OMVA 2YXWA 3BSGA 1U8KA 4A2UA 2PW2B 3N41F 4CSWA 3IZOA 3FXIC 2W9XA 2VULA 5H2BA 2A7WA 5IVJA 1QLEB 2ZHMA 3DWTA 4AHCA 5T5OA 2H3OA 3UBXB 5GGQH 1TE1B 1HXS2 1DJXA 3OZ9H 2CH8A 4DP4X 2AEZA 2EKSA 3NN8B 4XNMA 4CMMA 3QUZC 1MOEA 1S5JA 3P3UA 1QPPA 1JTOA 2VIRB 1CJYA 3ZT6A 1JS9A 1JXJA 1RXFA 2KXLA 3IF1B 3WL9B 3D85A 3C5JB 1L9RA 2CGNA 2HH0H 3D2TA 4TNGA 1VF6A 3O9OA 3DX7A 3S48A 1G4RA 5I1EL 1XMQB 4G6AD 1GYKA 5J09A 3VD1A 1CAVA 3IDMB 1WGPA 2V72A 1GUIA 3CVIH 4H5SA 4J25A 5D5PA 4PV1C 1M71B 3RY6C 3VBHC 4U3HA 5T3XL 4CCLA 1LD9A 3W37A 3GKZA 3K5RA 1D3CA 3TCTA 4PQQA 4Y7MA 4DRXA 2BBVA 4LPVA 3ZXGA 1TIUA 3MLVL 3DHPA 1E4KC 4X6EB 3SDXF 1AI1H 3QUMA 1NT0A 3L3IA 4Q14A 1DCSA 3NKGA 4RMVA 1FN4B 3SKMB 5J9PB 2OYZA 4AT6A 3RI9A 3I6KB 1YQ5A 4GALA 5IJKC 2F1BA 1QBLL 5F3HA 3VFSB 2W1SA 1C5IA 4PRIE 3ON7A 1IQWL 2C3GA 4NN7C 4DPAX 4L4TD 2R0WL 1NINA 2A7AA 4BK4A 2VAAA 4WV1C 3BP5B 3LN4B 2ZX2A 3ZOIA 1OQEA 4N8VA 4XHJD 3KVPA 4AQ2A 1JPGB 3WJLC 4JYBA 4NKGB 3FX3A 3OGVA 5CEYA 1ASJ3 3BSHA 2BSKA 4XAEA 5EBLC 2CGRH 2VRKA 4CC0A 5HHME 2O5ZH 1F8VA 1DDHB 3JASA 1TZAA 4IRJD 4QHMB 1AYM1 4I3RH 4QGNA 3KCPB 5EO9A 1MVFA 2A9NH 1VQ4V 3I75B 4L8CB 3TN0C 4BQWA 4OHYA 3HI6L 3ECBA 4FLZA 2NZ9A 4LHJB 2FTAA 5H9CA 2YMOA 4TVPE 5CBAB 4PB0L 3NKTA 3NOIA 1DO6A 4X99B 3E22B 1LNUA 3VTAA 1TF4A 4ZQKB 4DPCX 3Q9PA 3AZXA 4ONGL 1Q6UA 2FLRT 5B38B 1QKQA 4XFGA 3MRGA 1QEXA 2EKSB 3NN8A 1OWRM 2JQZA 1PVC3 1EIBA 1NIAA 4B9GA 3QFJE 4JFDD 4ODBD 4TOYL 5KBPA 5IT9N 4J8RB 3GXUA 1AY1H 1HWYA 3QZBA 1ZVHA 2BVEA 2WXIA 4XXPA 5IM7B 3FU7B 3TV3H 1WFOA 3B7RL 4C4BA 3ML0A 1UG9A 1HIMH 2EC9U 5FY5A 2HJFC 3ZIAG 3O0LA 4MTMA 1AD9A 5HI5D 3VQLA 4NHXA 3AXLA 1RPKA 3QJFA 4JAVA 1NBVH 2FZ3A 4XXCC 4PYHA 4JFFA 3V5KB 2COQA 4PJBB 1OWWA 1OBNA 2FHFA 2FHRA 3SJCC 5FPBA 3RVWD 1U58B 2BC4B 5C8WA 5ID0B 1ASQA 3BT2L 4XT1C 1BE3H 3O6KH 1NBZB 4K3JH 2HX9A 4OLZL 1GN6A 2XY2A 3NSYA 4OQ9A 3GZOA 2YUAA 5D7LE 1KJMB 5A2LH 5L4IA 3WS6A 1O4ZA 2LU7A 1J9TA 1PIV1 1W8FA 3VHOA 4Z7QF 4UI9L 1B04A 1KLGA 1MH5A 2F6AA 2PXYC 4NQXA 4U1HB 1OTSC 4HS8H 4RMWA 3VCLA 3KR3L 5D4QA 4EVNA 1OOAA 1BZEA 2WNGA 1YECL 5FKPA 3PWPB 1XB9A 4ABQA 3AZVA 5IFPA 1MLCA 1KLFA 1WWCA 4QHNA 4QT5B 2CKBA 3H7BB 3LZNA 2FYYA 3CX5J 3F58L 4LA3A 1SUHA 3PXJA 4L8QA 3LEVL 1JVLA 1D6VH 4FFIA 1EEZA 3MLRH 3GSNB 3BP5A 1VCBC 3LN4A 3STZB 3RU8L 1AC6A 2H2SC 1E5UI 1NUFA 1U8JB 2WBWB 4YBHA 2I45A 1TVKB 5IW6B 4OCXL 2WMPB 5HYJB 3WF4A 5JLVA 4G7SB 1J5EO 1J88A 1K45A 2X29A 4HXBH 5A7BA 1KENH 1NICA 4PS7A 3U1SH 1AZCA 3OPWA 1GV9A 3M8OH 3QZWA 3MV8A 4XPTH 1A25A 4NXNO 4GH4B 4P9OA 1VENA 4KY2A 1A3LL 4QY8B 3CRQA 2X7LA 4YW4A 2WK2A 5BR8O 1IGMH 1WAPA 3AREC 1X4XA 4MS8D 3K6IA 5F7YC 4EDWL 1S7UB 2KLSA 3AITA 1HDJA 4MX7A 3T77A 5C0AB 1LE9B 2PYEE 1FL3B 1KN2H 1ENRA 3AFKA 3J9SA 4K3HA 4LEOB 4NM8L 5BRZE 4GIPD 3PNAA 3C6SA 2V4DA 3TCLA 5ICZA 3I3MA 1NDTA 1QABA 3NZ8B 3ULVE 3QJZA 1ZKAA 4N0UA 1N5AB 2E8ZA 4IRJC 5KVDE 2B8MA 3NL1A 4Q0QA 5AKRA 5IHRA 4ALAC 4I85A 5A3PA 1XH2A 2VDML 1J84A 1AS6A 3BESR 5JIIA 4JFFD 2LS6A 1X44A 4IT5A 4RHV3 3VZKA 4NRXA 4AEHH 1RULL 1KXQA 2EH8L 2H9GB 5JPMC 5JW3L 3WW4A 2ZE8A 4NHCL 1UWEL 4PJGA 2JH2A 2WLMA 4YHYC 4HK3N 4EZJA 1ZWIC 2P5EB 4F83A 3I5DA 3CCEV 1XE8A 2FJGB 3H3PL 4LCWD 1K73W 1RSFA 2N56A 5FW6A 3ARDB 3CN3A 3QHZH 5F89B 4G8GD 4HXAL 1G7HA 1NCBL 5EYPB 3AWGA 4FZEL 4JZJB 4OQ1A 3R0MA 1GK9A 5A16B 4BHUA 2O6CA 1AUYA 1U0AA 4J7KA 4M1CD 4XH2A 3WAJA 2OMVB 1VBE3 2UXFA 3D05A 1ACZA 3T0ED 1LHUA 4NPRA 5LLIC 5CFDA 4YHLH 4PI0A 4XGZB 1SHXA 4LL1A 2DM2A 4KWUA 5EO0A 3VM5A 3VFPB 2NZ9D 2EO1A 2R042 2YUZA 2HWE1 5EYPA 4JZJA 3NIFB 2BH0A 2KDYA 2RG4A 5KXBA 1PBYA 1ZLWH 2V2XB 4RSVA 3X3FL 4U2YA 1Y76A 3B8MA 3CYOA 3EJYC 3Q01A 1ZSDA 4R7DA 1AIZA 2WLKA 3WO4B 4U3XA 5E0FA 4BE3A 1M2VA 1XCQB 1VRH1 5FAXA 3BPCA 1O6VA 4B9KC 2NY4D 4FFVD 4Q4X2 5I1HL 1PO13 5GZOD 2OMWB 1UB5B 4W4LA 4GKSA 2B5IC 1W04A 1W8UA 2F15A 4BR6A 1QQDB 1F31A 1VZIA 3IDUA 3VI3E 3HAEH 1DK1A 3MICA 4X66O 1TVDA 3CN2A 4AVTA 2HVKA 4G7YL 4PY8I 5DC4B 3M1BB 2QBXA 4XFAA 2XA3A 1IVTA 1MS1A 1RUQH 4NUGL 2Q8BH 1BVKA 5K1PA 2QM7A 3LRSB 3QIUA 5DTFB 3ZQ9A 2MRYA 4BFEA 4I48B 4OAWA 5JDJA 4O51B 2VMDA 3CDGB 3UQ8A 1HHIB 5GGTH 3O4LB 1ZA3B 4NTWA 4E5XA 4HEMA 3EJZD 5T1LB 3WNPA 3HLAA 3H1IH 3ROLA 5JMRA 3BVDB 3O41B 5C7GA 4WUUD 1BCXA 3CL1A 5E8EB 1GTNA 3RYMA 1TXKA 3LNFA 2W07A 1GP6A 2C3VA 2KM2A 3AMLA 5ICYA 2R073 3WJJC 2JKSA 5ITBL 2Q7AA 2YPVL 4HYOA 1CL7H 4OLXH 5CU9A 3ZMRA 2BY1A 1GAXA 2Y7MA 4MT8A 4C56E 4IEUA 2VY0A 4Y1XA 3SE3C 3C2AL 5ANME 2C5DC 1S0CA 4TUJA 1JV2A 2Y07H 3H9SD 2CE6A 4XMAA 4IBZA 3BA8A 3R66A 1J87A 5LXGL 1AR82 2E31A 4IBSA 3VQMA 4IW3A 4FQ1L 4E5XG 1TQBB 3U75A 3CRMA 3AYAA 1AYN1 3GJFH 1NGWB 3EJTA 4YHHB 1CICC 4LFHD 1B0GA 4UBDC 1FA4A 4KMTH 3QPKA 4JS7A 2WBJB 1P5VB 4QTHB 3HKCB 2WFF2 5E4AA 3T4HB 1HQLA 4ATFA 1MG3C 2NSXA 1AP6A 4PVNA 2HTLC 4D0CA 3QDGB 4WM7B 2IEPA 3ILPA 4I0PA 2F93B 1A3KA 5DA4A 2WBJC 1Q7YW 3IM0A 1PTZA 3NXSA 1OCCC 3BLBA 1WD3A 3ARFC 1E6OH 2I60L 1XXFC 3CFEB 4UT9H 4X1IA 3HNVH 5C0JA 3ZHFA 3NRQA 5LATA 2JJWA 5JOXA 3PHQB 2I27N 2OR7A 4TQDA 3SMHA 4RWUA 2O6FA 4LSQL 5A1LA 4UILH 5FYMA 1U8MB 4HIJB 3V0IA 2FR4B 5C07B 2I9TA 4LQFL 3L9RB 2E6VA 3VWJC 2VCCA 4ATEA 4WFHA 5SX4H 3E89A 1PIV2 3FCUB 3K72B 2NM1A 2Y38A 4KKCD 4RSUA 1UUSA 3PIQB 4U1GB 1G1YA 2ZGTA 5F32A 2GUYA 4PRPD 4L11A 4QX8A 3TO4B 1TZHA 3LH8A 4XZ4A 1D5ZA 1CFSB 4F2FA 5IVNA 1JWSA 2IXQA 4NIHA 1W6MA 2ADIA 2JJSA 2ZUWA 2D4DA 4RIRA 4JDOA 3VBFB 4M5ZH 2APBA 4U7KA 5CEZL 2D7NA 5DHVH 4HIXH 1OAZL 1FO0B 2EDFA 4K2UH 1XCTB 4K9EH 1RUF1 1MFNA 1MAKA 4AX3A 3VDBA 4N22A 2ZGLA 1HH6B 2IJKA 3BXNA 3MTXA 4POYA 1I3GH 2HA1A 4RGMC 3QIBD 3ZYFA 2X4NA 1KB5A 2OJZL 1OI6A 3JT0A 1KS4A 3ULUC 1QHDA 1UXSA 4Y9EA 5FK9A 3RB5A 4MCMA 3WIIH 2CDFA 1BXHA 2BXYA 5JJEB 2VQ1B 3G04A 4OTXH 4YUEH 3B2DC 3DGEA 3NAAH 1FNFA 4KJQC 3K4DA 1MSPA 1UENA 2YFNA 3RKPA 3NNGA 3OPZA 3RUGF 4PRDA 2B9BA 4UZGA 1IKFL 2QSCL 3VXUB 2ZF8A 1W8EA 5D1QA 3N5AA 3ZZSA 3PVEA 1CLCA 3TCXA 3OAUH 2P1YA 3AWFA 5LGJB 1W9XA 2D7OA 4JVPA 3WD5H 4NP9A 2RQ8A 2DQCL 3ATFA 4X64O 1M71A 5DLML 3UV9A 4F2ME 4OZIB 1Q90D 4QYOB 1PZ9A 3SEEA 2WGNB 5J13C 4DRXB 4P2OD 2IU0A 4B29A 4BEIA 3FD9A 1UZ6E 4X80H 1ZHKA 3CFKB 3QG7L 2E3CA 4N8CH 1LO4H 1TU2A 4JE4B 3VSQA 1QF3A 1JHLH 3TN92 3T4AC 4NQCA 1XOYA 2BIIA 4N8MA 5KAIZ 3U48A 4W81A 1SQQH 4OCWL 4DO5A 2Y8KA 3ZL2A 2ZQMA 3CRCA 4J4PD 4JFDB 3POEA 5D1IA 4U0RB 3MRKA 2YD8A 4MHHG 2VMFA 3QI9A 2ORZA 4XMPL 3RY4A 5I1DB 5L4JA 1DYZA 1U3ZA 2DN9A 4L3CB 1XNAA 4FLVA 1EPWA 3FRPG 3ZKXB 3N04A 4UOJA 4C55A 1ZTMA 3GSWB 3VMNA 1T83A 1CG9B 4Q56A 3NCWA 5GRUL 3ULSA 5ADOL 1YWKA 3AK2A 5LGTA 1PLAA 2NP0A 2DRUA 3RYHA 1JPSH 3FF7A 5KAQG 4F7MB 5IYZB 1BYPA 4J11A 2WVVB 3MZGB 1ORQA 3LJ3A 2MPAL 3GC3A 4OM0L 4BH8A 5EFIB 1KITA 1UN1A 4BMEA 2CZNA 3ATDA 3OBAA 1ZEAL 3I2OA 1CIYA 5SX5K 1OSGA 4DS0A 4PRBA 3G5YB 2PCPB 3LDBA 2BIHA 2N0KA 3VGHA 3RHWF 1SF3A 1EJOH 2YQBA 4E9KA 4NIYE 5E6RB 1BZ7B 4TYUA 1P2CB 4WW2F 5D1XC 1HKFA 3CJIC 2G3NA 3PXLA 4G42B 4MFHA 5BRZA 4NIKB 3L54A 2X6VA 5DMGC 5DZ9A 2YHGA 3O0RH 3AG4C 2YKKA 1J9QA 4LLAA 4P5KA 2VBBA 4NWTL 4XPBL 4YHNB 3JD4A 1CF8H 5F5QA 3ARDC 4F7MA 3CLFH 3FU9A 3QW9A 5KS9E 4IGPA 1I8IA 5D7IE 5TDNB 1VSCA 4L37B 2JB5L 3BZDA 4EKJA 3QDME 5EHFA 2RHPA 3N6YA 5IV2B 1VZGA 1ZXKA 2R9RB 1NEUA 1UWWA 1U30A 1RHHA 4H2CA 3P73B 4HUXB 4F6RB 1VEWA 2CXGA 4H40A 1ZT7B 3DUSA 3V6FA 2IXJA 1A3LH 2E5EA 4XC1H 5GRJH 3BD4A 4N8VG 5DFAA 1IKQA 3SKVA 5FZ7A 1GGCL 2NNAB 4OFGA 3V6ZA 5C0GB 1EHAA 1QFUL 2I07A 2Q0ZX 5FYLL 1OD5A 1SDWA 1AXTH 5L0QC 5LL6Y 3V4VH 5DM6V 3JQOB 4O4LB 3BUIA 4R7CA 3KMHA 3EO9H 3BPLC 5C0FB 4LBQA 3RWCB 3L71H 3OX8B 4FNUA 4I0XA 4L0PB 4XPFH 5G05L 1LK3L 3BJLA 4P5MA 5EU7E 1F90L 4HHWA 3ZY7A 2ZHNA 2V5MA 3BKZA 4JGSA 2XPJA 2UWEA 3OGSA 5FOBA 2X9XA 4I9QA 2F54E 2Y5EA 2AXGA 5TE7H 1YYNA 1K5MA 3GMQB 4TVPL 3DCQA 4K3EL 2FB5A 2W6JG 1I9RA 4A7QA 4JO4L 3HI5H 2ARJB 4Z0BH 4LQ1A 1AACA 3IJEB 1U21A 2FD6H 2FX8H 1K85A 1PKQE 4COVA 4ENEC 5F7DA 1DQJB 1JE6A 5FGSA 1NAMB 1PO22 4ODUA 1RUG2 2O6DA 4HQQL 2JV6A 5EC1A 4ISQA 4YFWA 2BVYA 1JYWA 1NBQA 1JOIA 5TF1H 1QHTA 5GXBB 4DRVA 5IQMA 1NI8A 1MDAA 1R19A 1CXZB 2G9HB 2MPAH 3F65A 3PAUA 4N9OB 4UAOC 4QIWF 5L8LB 2SLIA 3GSQB 3QOPA 3G6DL 3V9EA 1VP7A 4LF4O 1GRWA 2B59B 3WUDA 5HCAA 5BW7A 4GH4C 4D3CH 3RT3C 5MEOB 1I7ZA 2CRYA 2H94A 1DBJL 5FA3A 3RE0A 1IVSA 5LMNO 5T52A 3WDTA 5TDNA 4ARXA 5B1JC 1SRYA 3UBXI 3JTBA 4BCYA 2Q6AA 3OTOB 2ADIB 2VLJA 4RIRB 2JWPA 4WM8C 5KVFE 3GSNH 4RMUA 1FYTB 3U0WL 2WINA 2K6ZA 3SKJH 4XCYA 3V7MA 5A3WA 3FH5A 2N7SA 1A8ZA 3G9AB 1OV9A 1HDMA 2VDMB 3MPBA 3FYIB 4PI2A 1H8HG 2HJKA 1MVQA 5BS0D 2XJTA 1U8PB 3FOMB 4J27A 5FYZA 3EJJX 5T3ZL 3A5VA 1JGEB 3T65A 1OXCA 2QQJA 2D2CB 1KJMA 4DR6B 2XY1A 1QKZL 1V7NH 2KA3A 5I15H 4JPVH 1V6NA 2EXIA 3GCXA 1JD7A 2XUWA 3BPOC 4YGEA 2E7HA 3LHPH 2DQUH 3FL7A 4PJ5B 2P6CA 2XH6A 2IPKB 4B60A 2QDRA 4HJUA 1EV13 3ZMZA 5T5FH 1V7ML 3QPQC 1L0XA 3D6GA 1KCLA 4LF3B 5LY1A 1MLCB 3C5SA 1K9MW 2OMTA 4QT5A 4MCNA 1Q8QA 4ELDA 4IBLT 4GYBA 5L2KB 4BYYA 1NLDL 3GSRB 1MHHA 3ZFFC 2C9RA 4OV5A 4DP6X 1A6UL 4BIZA 3UGEA 1REDA 2CGYA 1WJZA 5LWYH 4OJAA 4E68A 1MNUL 2WXOA 3B7UX 3TO4C 4AEIL 1PMIA 4CP0A 1I1AD 1B3IA 1W2KT 2GFBB 1M1KW 2VXUH 1NC2A 5B1AB 3FN3A 1MCKA 4DTGL 3MV01 3WDVA 4PWIA 2P4KA 4PLJD 4TV8A 1KPRB 5I71B 1XF5B 3P77A 5FKBA 4PGEB 1NGXA 4MNQE 4OF7A 4C1XA 1RB8G 4DW1A 1M9NA 3SPVB 3WY1A 1MS4A 3NJZA 1R5WB 1F11A 3H7LA 1TVHA 3N9MA 3ZS8C 5DQ0A 4ZZ5A 1RFDL 1NPUA 2JQMA 3C12A 5IWAO 4TLSA 1RUKH 2IH1A 3ZHLA 1KTDA 2EXYC 3GXIA 3PREA 3UC0L 1H1IA 1S7TB 1HR0O 1I9IH 4Z78A 4JFSA 5IG7A 2L7UA 1MCPH 5LRSA 5AW4B 3T8XB 1YNTF 4FQIL 3MIGA 1CX4A 4QRUA 2WZPP 4AKQA 4YBQD 2UUDH 5KZCD 2W47A 1V6OA 1I5ZA 4Q26A 5FZFA 2X4OA 2OKXA 1AG6A 1N7ML 2FL5B 4HS6B 3F00A 4O2AA 4GAJH 1U8LB 1YN7A 1Z6JT 5TF1L 4OVVA 4N8VB 2DM3A 4F5CA 4L5FH 2IWGB 1NH2D 3NQHA 2YR3A 3ESOA 2P42B 3PUUA 3H1MA 1QRNB 2QE7G 1HINH 1OHZA 4OCYH 4DR1B 2C7FA 4HDIA 3KLDA 2AQRA 4PCTA 2CO1A 2F19H 4LBLA 3NV1A 3VDCA 2Y9RT 3RHWK 3JASB 4QHMA 3IFXA 1JZ8A 1FT9A 1EEUA 1YIPA 2Z79A 4PCRA 4NPYA 5EOQH 2HJKB 4D6SA 1PMYA 5FCSH 1DSFL 2ZOKA 4U4BA 3D30A 4PGDA 3RWFB 5CLZA 5JIDA 1MFDL 3ROLB 4Z3IA 1UJWB 3GM0A 2QMJA 1A7OL 1YQVH 4XMZA 5D1QE 2MCPL 4U6HA 2UX7A 2WAHA 3DOSA 4UQ3B 1T3FA 5KJRL 3ULUD 4QQLA 1E5YA 1Z5YD 4MGZE 1VCAA 2R4SL 4QRRD 5ECGA 1TME2 2YPJA 3ZTDC 5ABJB 1EMTL 5HDBB 3DC0A 4D9LH 1QLEH 4HIHA 1ZLWK 5KTEH 4K3DL 3LS5L 3V9FA 2IWFA 3SHSA 1WCDJ 4J3OF 3E8HA 4YHML 5ILTH 5FS5A 3UPRA 1UMZA 1TUBB 2CUHA 2VLRA 4Q6IA 1T1YA 1UM4L 1A6TB 1M9SA 1E9PB 2H32B 4N2HA 1KELH 1VALA 2J88L 3MLKA 3GTNA 4KTEH 4UQ2B 1JPFB 3GSXA 5E08L 4NNYB 4LSSH 1XGTB 1BPLB 1N5YH 2RDNA 1ZLZA 1OANA 4TTDC 5ESQA 1I94B 1YNLL 1T6VN 2A5UA 2RBLA 3NCJH 3OG2A 1FN4A 3ARPA 5J9PA 3C7EA 5JTWA 2XHKA 1T7WA 1UQXA 1GN3A 1Z5LB 2P5WD 3L17A 4GY4A 3T0EA 1U36A 2X4TA 1F8TH 4QAMB 4P2QD 5AAMC 4BFFA 1XIWA 1AD0B 2CUAA 4FYTA 3HZVA 2QFRA 2VXUL 1GCFA 1UM6L 4X8NA 5CEZE 5LEKA 2P2KA 2XDHA 1MHPH 4DV5O 5EUKA 2C7UB 5D7IB 1YRKA 3TTYA 3WP3A 3VXTA 5DJ2B 1ETB1 1SY6H 5DK0A 2ZUQC 4UANA 3WFCL 1MFCL 3WF2A 5C0FA 1QTSA 4P02B 2NY2C 1O4TA 5A7WA 5C8YA 5AZ2L 5DD0L 3SYPA 3TBDA 4JJ5B 2XJPA 4GKYA 4X5XA 1CFTB 2AXFB 4QPGA 5I8EB 1VQNV 3P9MB 5HSFA 3RUGB 1RZJH 3CFNA 5HTSA 5ISZE 3RTQA 2B46X 4QHBA 1H2KA 4G9FB 2GNTA 3DSFL 5C08E 1KY7A 3E6FA 1VBE1 5DAXA 1YFUA 4WFFE 1A9VA 3WN5A 4GQZA 1NAML 4QF1B 1FHNA 4ONUA 4PJIB 4UB8Z 1L7TL 2B2XL 2VABA 3ZE0B 4K55A 3H9SA 4S1QL 1PAZA 2XC8A 4RMBA 1QCEA 3CJIA 3BKYH 4LKCB 1DZBA 4M7LL 4JGYC 3G6AA 1Q8VA 3RVHA 1DQLL 2UVFA 4JZ2A 1KJ2B 1KTCA 3AGVA 1OKQA 4XCEB 3N42B 1VQ6V 4LXLA 3C08L 5C0EB 3FT9A 2QE3A 1Q9LB 1WIPA 1NCOA 3ZHVA 1WCQA 2TAAA 2NTFB 1RZIA 1UACH 3H9SB 4GKLA 4MD0A 1DQKA 5HHOE 3WDJA 3C8HA 4AMWA 1J1LA 1E6JH 4MMYB 2IOOA 4PH8A 2BHFA 3IN2A 4XC1L 3BCWA 1OT4A 3TNQA 4EIGB 1GH7A 3ZDYF 2JIZG 3DI2B 5F1NA 3B1TA 4Z7NF 4R6UA 4KU1A 5EHDA 2UXDB 4XO8A 4RN5A 3VYNA 3H42H 1KJ3L 1NR1A 1J8RA 3BKJL 4EN3B 2CKBB 2RCSL 1IAKA 3OUIA 3WGUB 3LH2L 5ERLA 3VL8A 3S3WA 3APNA 2UZIL 4ZAKA 2HBUA 4KNSA 3EFOB 4Q0VA 2XWBA 3AABA 4Z7OE 2CO6A 2V9UA 4XPFL 1Y43B 3L3KA 4OSUH 4JY4A 1E3XA 3EH1A 4IJTA 3U0PA 1TSRA 4IERA 3ZYJB 1D5IL 2HT3D 2UWEE 5GZOA 4BPZA 4D7SA 3QTCA 3FUNA 1B2YA 2V2XA 3I9GH 1XQ8A 3BSZL 4Z0XA 4EEEA 3FX7A 3ELAT 1DEEA 2PYFB 2F7QA 2DMGA 1A32A 1V05A 3BVVA 4ESKA 2OL3H 5C8YB 1EV11 1T03L 3TN91 4J2XA 3VDAA 5C0IA 3AK3A 3OZKA 3QUHA 4OLEA 3O4LD 1T1XA 3MRNA 2J55A 1HJBC 4CDUB 4RS5C 2V9RA 2QPSA 1K5NB 2YROA 4NN5C 4WEUD 3OR6A 3OGGA 1FYHB 4OFQA 3VKNA 4XNBA 2BSRA 1V6KA 1S3KL 1WZ1L 2IDFA 4L9LB 4LOVA 3K6NA 4F37F 3ILNA 1MHEB 3UO1L 4OCLC 1MN4A 4Q8LA 5JR7B 1F23A 1JERA 3B5GA 4XMKH 4YJZL 2I69A 4M8QB 4F37K 3TP4A 4JMXA 1TJGH 2R2HA 5CEYB 2AQSA 2CBPA 1YEDB 2LTNA 3G08B 3T1FA 4YDIH 2W9DL 5E95B 2A0LA 5J3HD 1BF5A 2BTOA 3KJ4B 1IIKA 3BUCA 3RI5K 4B27A 2B0SH 1EY2A 2CKNA 4OI9A 4H25B 1B4RA 1EH9A 4KDWA 1DLHB 1YN6A 2ZXGA 1UJTA 3KR3H 1WHPA 2FD6L 1XI1A 3O3BA 2P5EA 1AR62 1TU2B 2RGSA 2JJTC 3BVOA 2ZE5A 1CT8B 2ZQKA 4DAGL 4UTAL 4KK5D 3IJSA 1H15B 5F1IB 2R0ZL 5E89A 1KD1W 3RZWA 3RURA 4U6TA 3FUIA 3GNML 3CXDL 5CIPB 4XNZC 2J1EA 1WTGT 1I3GL 1EXUB 1CFSA 2C9UA 4JFOA 3NCYS 2PR4L 3LSUA 3L9YA 1S7XA 4WNQA 4P2YA 3IJSB 3ZYPA 1VJSA 1YSOA 2B1HH 2PELA 4YYOA 5M7QA 5L4MA 3OBRA 4NMIA 4EN9B 3SKMA 2EYTB 4MNQD 4KZDH 2WAAA 1LWRA 1AFVL 1CXLA 1O5DT 3MV8D 1E42A 4KNQA 5BQDA 4LK4A 3PL6D 4QD2E 1H3GA 4YOKA 2MCG1 4ZG1A 1GQHA 4PBVC 2PPEA 2DQ6A 1M6OA 4XNQA 4DKTA 4L18A 1NEPA 3H9ZA 3KWWA 4P5TB 5AB1A 1VBB1 4IL7A 2JJTA 4MMXB 3VGAC 5C5UA 2IU3A 1AYM2 2ET1A 2FQGA 3O9WA 2VLME 5HDRA 4NRMA 1SOKA 3T2QA 5HJDA 3ZDXB 2HVKC 2OTUA 3GSVB 2MSPA 1NH6A 1FVDB 5CEXA 2VSKB 5F7FA 2FATH 3MXVH 4E9SA 2GDFA 1Y9QA 1U8MA 2FR4A 1VBC3 4D0CB 2Q7YA 4YHZH 5JQ6H 4K4KA 2VXJA 5IVBA 4FQCH 3EQEA 1IC5H 2N59A 3FU3A 1XGZA 1EEZB 2YS8A 2C9SA 3UMNA 1JNJA 3UIZA 3MDSA 4HWUA 2JX9A 1D5AA 1N32O 1QJX1 1TPXC 1MCWW 2Q86B 4BCXA 1MS9A 4NPLA 4ZY9A 3RVXC 3CMGA 4JVUA 3L2LA 5E2JA 3RN4A 3N1GC 3B94A 5I8TA 2RS53 1N8RW 1HEZA 4AEDA 2YMXH 1ST8A 1JNLH 4RBPH 5C7ZA 1TPXB 2AKRA 3D4YA 3SY0B 3DK0A 3M8AA 4XJAA 2A6DA 2I9TB 2Y24A 1AG0A 1H2LA 2D2CC 3CDCA 5IZ7A 2NLJB 4DUYB 4G11A 4NZFA 1WIOA 1DVFA 1KBBA 4W6WB 2BM3A 1NOAA 2CHXA 1D9KD 4UU9B 1N64H 2VUKA 2XJLA 3SGDI 3LPWA 3CC5A 4LSPH 4LWSA 4JM2C 2YQ2A 4KV5F 2F4LA 3S8GB 1RIRA 1PO21 4G28B 2QGBA 3JTTB 2WPGA 3AXLB 4BZ1H 1LYQA 5DABA 3RZCA 2A75A 5BO1L 4ICXA 2ZAHA 3JBG2 1DVFB 3MDPA 1MEC1 4Q1RA 4KXDA 1NWOA 1TTRA 3M88A 5D5ME 1TYJA 3B43A 3IMMA 2O57A 5D4JA 1EDYA 5F88A 4BUHA 1HHJA 3HG2A 4H8QA 3F6LA 3RFZC 3TBBA 3WFEH 1BEV2 2BQPA 5EEXA 4CYDA 1MG2C 3M3OA 2XNAA 4U1LA 4H0IA 4IOIA 5AW7B 1B90A 4YAQA 5HHNA 3MLPA 1S1AA 1H3UA 4OLUL 1N7MH 4GG6A 3HLAB 3SDXE 3TL5A 2HTKD 4DVRL 3BZEB 5I1KH 2XXGA 1JMKC 4TQEL 3KM2A 3RNKA 1RUQL 3BUTA 1FNGB 3ARZA 1E9OA 4DN3L 3Q48A 2ZIOA 5L3GA 3HC3H 2C9KA 3G7DA 3UJQA 4AZUA 1EVTC 1WLDA 5FCUL 4UBHA 2G9KA 5FZ6A 4ZU4A 3QC6X 3OAWA 3D52A 3G6AB 4NAJA 3I2IA 4D0QA 4JRYE 1DGWA 1HXYA 3TBVA 2A6WA 1ERNA 1DQVA 3QJUB 3ZFEA 1U97A 2OTUB 4XDKA 2VJ8A 3GSVA 3VNYA 4ADJA 2K46A 2DH2A 3BKMH 2J43A 3OJVC 1WP7A 4PP1C 3VBUA 1B4JL 2X2IA 4IKKA 2F7PA 2AJSH 2IJ0C 3AP6A 1RZ7H 2AI0H 4P48A 3QEUB 1DVFC 3APCA 3C6LB 4WU7A 2PWDA 1UM6H 3CFTA 1M2VB 1UOLA 1A78A 3LA3A 3FUKA 2HHHO 2HJIA 4F8PA 4ZHQA 5F1OB 3QO0A 2GK2A 2JE7A 2GTZB 2VDNB 2JELH 1KGUA 3VB8A 3AQDA 5J0BA 3D5OA 1QQDA 1OPGL 2UUCO 1MPAH 1PZ5B 4PIBA 3V4VL 4O9HH 1O4YA 1Q82W 4NI6A 1MFAL 4K94H 2XZCL 2PLTA 3CLEH 5D1XA 4Q6YA 2RFXA 3TZVC 1FG2A 2G3ZA 5D1QC 2ID5A 2H2PC 1WMDA 4L4TB 1ZIAA 2A1XA 4CDXC 1XTMA 1YY8A 4WBNA 3P2DA 1C1EH 1EO8H 2GP3A 2VN7A 2CLZB 1OF2B 1HCYA 4L1LA 4Y4KC 1C7TA 5J89A 4MTOA 4CDUA 4N0RA 1VJ2A 3MR9B 2VQUA 3VTMA 5FYJU 3H3BC 4OGYH 5AVQB 3O1PA 4ZPTA 5CD5C 4YE4H 4S1QH 1QLEC 1ZX3A 2QKCA 4PA3A 1XAKA 4EOWH 3LIGA 3D36A 4LQFH 2WXRA 4UQ2A 3AQZA 3T4AB 4HG4K 3BN6A 2DQMA 4XQDA 2DUPA 3RJ2X 1BXVA 1RIHH 5GGVH 4AUJA 4MGQA 4ET7A 5CXPA 4S1SL 5EC2A 1N59B 3OMAB 4KKBC 3T2OA 2E7TA 1HHHB 1FNSH 1BDYA 1QJU2 1R6NA 2B16A 5D1XB 2YU1A 3NR7A 2A2QT 4PWJA 3K77A 4LSTH 5HD8D 5L3EA 4U6HB 4K3JL 1MCHA 2QDWA 4BFIB 4ELKB 2YOCA 4ZMZA 5KBNC 2LRPA 3HA0A 4PJAF 3CBKB 4XOCA 4A55A 2XBO3 1G9CA 2GJ6D 2VAJA 3HW7A 4FMKA 3BCDA 2EVHA 2K0GA 3ZT7A 3ZHNA 1W6NA 2Q20A 3MRHA 4DR2B 4JHWL 2V2TA 3F7PC 1AYN3 3OD0A 2X9YA 1JWUB 1YO8A 3KQ4B 3F7YA 3RVWC 1VZHA 4KPHL 5E9AA 3ES4A 5J98B 5D4HA 5FLJA 1NCDH 4LCUA 3SE9L 4NB7A 4F8NA 4N2BA 4LDOB 4U1KB 3ZKXC 2EDEA 3RJDA 3TT1L 2A77L 2WGXA 4JDTH 4XCCL 2QNKA 4GIAA 1D5IH 5F70A 2IJJA 4YZWA 4YG0A 2BSCA 2V5DA 3KAAA 1KXHA 1KJVA 4OR1A 2IWGA 5J7MA 1Q86W 3BH4A 5EU6B 4JV5O 1N70A 4ZW3A 1I1FB 1YLBB 1WD4A 2D7FA 1ZRCA 4G8FA 3FO9A 3TH4T 4LC1A 1CK0L 2YMTA 2QHLA 5DVOA 3ZIMA 5BJTA 4N2CA 5GSRA 2A6VA 3D5OF 5HDLA 1QVOA 3FKSG 4LLWA 4Y2OB 5HDBF 2K2SA 4UFJA 1C5DB 3EOTH 4ZX4A 3DGGB 2VRQA 5MENB 2D3LA 3SPIA 1WFMA 4OI1A 4C47A 2AITA 2CWMA 1PQZB 4HZAA 1WAAE 5EU6A 3ZVXA 1MNUH 2ZYHA 5HXMA 5DJCB 5DFWH 3RA7H 2G5RA 2PYTA 4TVPD 2CDYA 3U6RB 4OI7A 5LA6B 5CBEB 2G2PA 1QAWA 3HKDA 3VRIB 4JZRA 3DGGA 1WS7A 4EN3D 1MQTC 2VZRA 3KT1A 4OZOA 2K78A 3DXAD 4AQ1C 1UKRA 2ARHA 3KBHE 3S3JA 2VR9A 1L7IL 3N42F 3OD4A 1OD9A 5HYIA 3LDDA 3IIIA 3LF7A 2AZ0A 4G8GB 5CU1A 3EBIA 2QQNH 1I1FA 1G8WA 3B02A 5IWFA 1XYNA 1K2DA 4UIMA 4QRTB 5PCYA 1TTAA 2VDKL 4IYKA 2F66C 3U11A 1A9EA 3OKNB 1NTKH 1QHPA 3V0GA 5IQ7H 1BS3A 2CHWA 4HPKB 2AJXL 4AQ1A 9CGTA 2IVIB 2WB7A 3MI6A 3OSKA 4D7PA 2LFRA 1KKDA 4LBQD 4LFAO 5BCAA 3ECBB 4IQHA 1KEMH 4B0MB 2C1PA 1CLZH 2P7TB 4JDZA 4OGAC 2EVGA 2QQVA 2DYRC 5BZZA 3KVAA 5LBBA 1LJ7A 2DQIH 4Y1TA 1JU3A 1MHCB 2CJUL 3MRGB 1PL0A 4R0LA 3MJ9A 1HB2A 2BWAA 1FYTA 2DIJA 2WHVA 3VXRB 2OMYA 5AW0B 2XN1A 1HJGA 1IAIM 5GGUA 3US9A 4J3OD 4KDVA 1S9XB 1ODNA 3WLBB 4BIUA 1G1KA 3W59A 5JVDB 4JHWH 5AAWC 1J5EB 1W9YA 4DZBB 1YI9A 2DMBA 1OAJA 2B20A 4CRPA 5F0LB 4MMZA 3IFNH 4CC4C 3NSJA 4YM2A 5F93C 1RUH1 5E0QA 1DN0A 1E27A 2ADJB 2ZX6A 4JHBA 4GB33 2FATL 3MXVL 2MHFA 4HZFA 4ZMVA 2OX5B 3CZEA 3PGCB 5FY7A 2W1NA 2LO1A 4NHMA 1P9MA 2ZCKL 3PHSA 1FZOB 3QG5A 5ESAA 3N2KB 2EDMA 5F3HB 5FKAB 2VQEB 4Z3FA 1UX7A 5HP5A 1KELL 5MEOA 2Q5TA 4GBXA 4JG0L 5AFBA 1E8XA 1FZMA 3OC5A 4HIHB 4P2RA 1W28A 2R69H 1Z7S3 5FM5O 1FZJB 5JHLH 3WKNA 2J4WH 2FZ1A 1BFOA 3NCJL 2YMXL 4NAOA 1PNLA 5IK7A 4QIRA 4DB5A 2XT1B 2CTVA 4AZ8A 1KTKE 2RE9A 5FXWA 4R4NC 3RWGB 5L36A 1K5NA 5DUPL 1LHVA 1LNSA 3R06A 4Z76A 1TFPA 2ZWNA 2FX7H 3H7YA 1CTMA 4OKVB 4Q4W2 1E3FA 5KWRA 1A1OA 1KG0A 1R5IB 1JF1B 3PHOA 3ARGA 1AANA 5IMKB 3NJKA 3PL6B 1Z9SA 2VR6A 1Q72L 1NWPA 5EEYA 3DMMC 4HN1A 5AW3B 5DD6B 5CHNA 2IIJA 3U6XA 5T55A 2OL3B 1MJ7H 1UQSA 2G5BB 1OE3A 5DZLA 4LH7A 5GZGA 3JBG3 4WSGA 1T5XB 3LIUA 3GJEB 4N23A 1H3XA 1MVYA 4NGHL 2QQNL 3Q6GH 2FSEA 5DMIH 4Q74A 1ZZ8A 4BZ1A 3T3PF 3FBYA 4YX2L 5IKCA 3AREA 4PJCE 1XNRB 2CR6A 3DLQR 5B1OA 3DV6A 3EGDA 1BAFH 4ONHA 1JCHA 3EGXA 4H8UA 3ZYHA 3A21A 3SDXA 2YQ3A 2VMEA 4P06A 4IDZA 2QTOA 2ENQA 1HLCA 3JARA 1QU7A 3HRPA 1TTUA 1GS6X 4HJJH 4POZC 5MERB 2IDCA 2VYRE 4L87A 3HB3D 1PZUB 4HWBL 3UEQA 4XDPA 1KUMA 2NUTB 3IAYA 2GBOA 4MDIA 1KC5H 4PDRA 1BM3L 1G6NA 1RK1A 1H8VA 3RUGA 4J1XA 4UV4H 4X1KB 3ALXA 1R3HA 2QDOA 4JQIL 4MS2A 3R7QA 1EHLH 1HHKB 5C70A 1IB5A 3LH9A 4PGCA 4OAWB 1TGOA 1CE6B 2A9DA 1Y9MA 2B9UA 5AD0B 3BP7A 5AVSB 2E7LA 1R091 3QH7A 4AQTA 4EI5D 4AI1A 5LHGA 1IBDA 3EKCA 4NQDB 1LVEA 4KTDL 1RHI1 2OTWA 2WCPA 3B3QE 3P1VA 1JZJA 3IJ9A 5DJYA 4JFPB 4CADB 2IBZH 2V2TB 4I50A 2CCWA 2EACA 4NT6B 2XLAA 3SJQC 1NMBL 2QLYA 3VXSE 1FUNA 3VBRC 4WI6A 4HFUH 3VGFA 3S35H 3AP7A 2Y3AA 2XUMA 2W0KA 4XOBA 3DKWA 1XL6A 5E8DL 4X4MA 2WZ5A 2BEOA 2RCSH 2UYLA 2WUCL 2ITFA 3A3YB 5F7UA 3VFUA 1FVEB 4JI3O 1FPN1 1UD3A 4O2BA 5AVWB 1CXKA 3OGCA 4MHHI 4AGLA 4FXKB 4LLFA 1G9BA 5HHXL 4GKSB 5EIBD 3GSOA 4QXVA 4X6DF 1RHI3 4KAQL 2R8SL 4WVMB 1PGRB 1QFWI 4PG9A 5J6GB 3ILQD 1UWXK 3OKLA 3P9MA 4DV5B 1PZBA 4JKNA 2QELA 4ZSOE 3ZDZF 1UXMA 3X17A 1FQ9C 4MGIE 3RFRA 2WT0A 4YY3B 4RFEA 5CMAA 5EIIA 4TYSA 5I6PA 4WO4A 3VA6A 2QEJA 4DK1A 3FFCE 4CMHC 4MGSA 1JOYA 3WIAA 5H94A 4IEPA 4RDBA 3MSPA 4YE4L 2CY6A 4WY7H 2ZCHH 3Q1EA 3QB7C 2UVEA 5AUMB 4JB9H 5J1AA 1UXXX 2OWOA 4NKOA 5FZLA 3GB7C 3BSZA 1OSPL 3P3YA 1N68A 5C4WB 1JPFA 4RFOH 4OM1L 4YDZA 3U9PH 3NV3A 2XI9A 4FYQA 2Y6GA 3WP5A 1RZPA 4YVUA 2WKOF 3MF6A 4Q2ZA 3PNWB 1H4HA 4CEWC 1UGKA 4FFYL 4BUGA 1YEGH 3W39A 3BUYB 5DURD 1LEKB 5FHAL 1NCQA 3B5TA 5CGYC 4NIAA 1SEBA 4AEEA 5IT2H 1GLHA 1NGYA 5A6XA 3APDA 1DGRN 5A2QN 4URTB 4TTGA 2BVPA 4R90H 3C2UA 1BQHA 4PRIA 1HSBB 3LKJA 1DGSA 2X4NB 3ABGA 2PUQT 4NXMB 1MNNA 3JD0A 3U0ZA 3GXNA 3RB7A 2JB8A 1Y1DA 2V1DA 2CDFB 2YPKB 3NWKA 4LULA 2WNVA 1WWAX 4MLOA 4YPGB 5E5UB 3M17A 4UOQA 2NYKA 1AOZA 1GP5A 3O3BB 3OKKB 2ZNWA 2B7DT 2NY0C 4DEVA 3V5HB 1XGRB 5TD4A 1EUTA 4UQ9A 3ESMA 2WYSA 3GHPA 5C92A 1IPKA 3LQAL 2LHAA 1S78C 3L6FB 4TN7A 1SLUA 1JR9A 3D39D 1JFQH 1G9MC 1ML0A 5I16A 4DK6A 2NX5E 3PYCA 5G55A 2DTYA 3OLIA 1URZA 2CIKB 1SRDA 3GIZH 1E40A 1UM5L 2W87A 4Q29A 4Z0XB 3I02B 3VD4A 4YVSC 1EZVY 1BMZA 4H7MA 2OXBA 1KGYE 1OTTC 3SE9H 3MCKA 3VXRE 4N5UA 3FT4B 5IUSA 4BGDA 1NCUA 4Z9KB 1ZA7A 2CTWA 1XDCA 4FNTA 4XUPA 5DD3H 5HBBA 1EAH2 1R1A2 3QR2A 5C0BB 4FHBD 3LPPA 2J5LC 3ZMTA 1Z78A 2WAQA 2C8NA 2Y25A 1WF5A 3SPHA 2LR4A 2QGEA 3DOIA 2VDQB 4GAGL 1FORH 1KB9J 4LF3A 4NQDD 5FO8B 4NPYB 1LOFC 2DWRA 5LGUA 5E1QA 3F04A 4P9HH 1F35A 3FYEB 1N3NA 1K5WA 3NFPA 1SQFA 3CAFA 4FC3E 3U4KA 1S7QA 2CRMA 2HUEA 3O2VL 3ULSB 2D98A 4XF9A 2HHHB 4AGPA 5IEHB 2BZ7A 4XFIA 2WLZA 3WXPA 1JCKA 4BK5A 1VR3A 4M02A 4DGIL 3GBGA 3BDXA 5CP7B 2GALA 4JO8A 1K7DA 4WSKA 4MNQB 3PCYA 4JRXB 4JR9H 1FL6A 1KXGA 1OLQA 3L2HA 4P59H 5F0JB 1DVUA 3S8FB 3TWYA 4MXWB 3VBSA 2WNVC 4RBPK 4AI8A 2B5UA 2PHLA 1P4IH 4XMVA 4KHTH 2G3XA 4DCQA 1NBVL 4IGBC 3QIWB 4HT1L 4DINB 1URFA 1VAMA 3IJYA 1KXTB 2X41A 3J4UH 5GGRB 2R9AA 4X7EC 4B4PA 3I6GB 4KNUA 3H8NA 4B3SB 3V6BR 4IIQB 1NBMG 5BJTB 1NYWA 4L8CA 1IGFH 2V4LA 3LRMA 5IB2B 1K42A 5IBUG 3PJNA 1WAZA 3DGCR 3KPOA 4GAYB 4P00B 3BY6A 1R6VA 2SODB 4M6MH 1IXMA 5J4MA 3POGA 8PAZA 1AAJA 2VC2H 3A6CH 3RSJA 2XTSA 4AEKA 5D6DA 5AKVA 3N35A 4JI8B 1QLFB 2E59A 3HCVB 4CS3A 1MIEH 4DOHB 4MSWA 1MS8A 3A0NA 1VMGA 3KBFA 5BV7L 5BZXA 5CZXD 5KYYA 4YZ1A 1AR4A 3C6EA 3SD2A 1H8EG 2GT9A 3NABH 3U25A 1KYUA 3MKGA 4TSCH 2E5LB 3MUJA 1GN4A 4HAMA 2DMHA 5I16B 1E4WH 4WI8A 5IF0A 3U7YL 2JG9B 1G9DA 4ISVB 1C9SA 1F4NA 1ULOA 2Y1VA 1AL22 1OP3H 1Z0MA 3RDJA 2FL4A 1QLRA 3BGAA 4XPTL 2WP3T 3RYCA 4N0UE 2NOYA 3S88L 5K1VA 4O58H 3PVBB 4B4RA 4DETA 4Q5OA 3BLKA 1QNYA 2E74C 1NLDH 1Q8OA 2UYBA 2WXQA 1HSAB 4WHYG 2WNEA 4ZK8A 1GH6A 3SYAA 1WTLA 3BXNB 3LEXA 5DZOA 4QPGB 4BU2A 1KLUA 3HE7D 5JI7A 4XP6L 3GEWB 2PN5A 1P7KB 2Y4SA 3GIZL 1DQ2A 3B83A 3RNQB 5CJOH 3KJ4C 5AYUL 3F7RA 1RUE2 5FP3A 4WWKA 5EC2B 4IDLA 4PLKD 3TO4D 4I5BA 2Z91A 4DNYA 1FPN2 2ZM6B 4X7CC 3THDA 4F91B 5FOJA 5FPAA 2WUBL 3QA3B 3ZE2E 4E41B 3CZGA 3IGKA 2MTPA 4JAMB 4P46D 5LAPA 1TUPA 4YZFF 1NY72 2VNOA 3SNMA 2CBMA 2FX9L 4R4ND 1E65A 1HVXA 3ZJAA 1UX6A 2JICA 2E76B 2XAFA 5LMUB 3A24A 1FVCA 4NWUH 1GTFA 1XU2A 3WP6A 3Q8BA 3MLSH 5BS0B 3L81A 1BQ5A 4ZFOA 4LBQB 3T1MA 4KC3B 3VD0A 3BAIA 5F3GA 1MW0A 4NZRL 3LEXB 1YJDC 4NPJA 4TV9B 4NQEB 5JIHA 4W4OA 1YHFA 1V54C 2QTVA 4GFXA 4PSRA 2UXCB 4UT6A 5SWZE 1V9U3 1QX1A 3IKCB 2DVBA 4WCYL 1TYRA 3SCFA 4DKAA 2R32A 1KP3A 1OGTB 1TQBC 2OZNA 1INEH 2ZPXA 1QP1A 1I7UB 1KTLA 1LQBC 1VERA 4FIPC 3BEWB 4DKEL 4ZFOL 1ADWA 1JTZX 3FFZA 1AQKL 4MSWB 1NGWA 1MJUH 3ZUCA 3IPEA 2D3RA 4QMEA 5ENWB 3EH4B 4QXGH 4ACTA 2XTJD 4Y16C 1T6GC 1AP5A 1FV1B 4O9GA 3ZKQD 3T1YB 2BO0A 1IZJA 5CA1A 4Y4HC 1G7IA 3NEEA 1TETH 2FYVA 2P46B 3QDGA 2AR6A 3N36A 3ML9A 5EJ3A 4N43A 1F3JB 1IIIA 4Y24A 5GRYA 2BJML 1YJDL 2HFTA 4BWAA 4MJIB 4P3DB 3S96A 3T0VA 1XD0A 2AANA 1I0HA 3ISWA 4UB0L 1OB0A 3VTTA 1LE5B 4BGLA 3CCLV 3KPRE 1JUFB 3IB4A 3DA0A 2UU8A 5E23A 1POV0 3VXNA 1UFIA 4AMXA 1X5ZA 2HN7A 3ZKNC 1LHOA 4FQPA 4ZUTA 3WSOA 3RYFB 1FAIL 3QFDA 4M7JH 5HI3C 3THCA 3UXFA 1OHFA 1T66D 3W7XA 3HUJE 4X20B 5LHHA 4Z07A 4DO0A 4WVVA 4M7LT 1OVSA 4KJQD 1R1CA 4DEWA 3LSDA 4A1RA 4XCEA 3BODA 3PDGA 2JEMA 4CVZB 4GEJA 2X2YA 4NJAL 4NKDA 3CHRA 5D9SB 3CIAA 5ENWA 3CFCH 1BQPA 3M86A 4CDQB 3KPQB 1U41A 3MACH 2AK4B 3BIWE 3UJIH 3IDIA 4NUJB 1N19A 4XAKD 2WVSA 1G4MA 2QEXV 1WVZA 4J28A 5CJOL 4DQOL 5KVFL 1Z9MA 2X88A 2JKNA 2ZKHL 1JPTH 2AERT 3E3QC 5TQ0H 3WY2A 3PIJA 1C08A 4JV4A 1XX9C 4NCDA 5E8OB 2EIKC 2WPDG 1QLEL 4TOYH 3NNJA 3MVSA 4LOSA 1R5WA 2CRIA 3EBHA 2J2ZA 1TJMA 2IBZX 3ZYGA 1LJMA 3L1EA 3EJZC 5KSVB 1JXDA 2XV0A 3ZMVA 4J3BA 5ECJE 5IGXL 5LGJA 1NC2B 4W9LC 4DGVH 1CGSL 4LLUA 5FLVA 1V9U1 3MLSL 2HLFC 4FRWA 5FM8A 2F4PA 4CDQC 3V0BA 1CLOL 5KVGH 1G6RA 35C8H 5AB9A 4K7FA 4DV0B 4PA4A 1OGTA 5A40E 2O30A 2MHAA 4XF4A 4X5PA 2VNGA 2CGPA 4BHUI 3ARDD 3X2QB 1X5HA 2D31A 1TZGH 4F80A 2GHYA 3AQXA 4ZODA 1J1OL 4Y5VB 1HXS1 1IAOB 3OR7C 2K7PA 4YC2B 4ZIBA 1VFOA 2D9QB 2YD9A 1FPTH 4ZUVB 3N27A 4OF5A 5EOCJ 4O2EA 1BD2A 1S5HB 2JF1A 3GYRA 2AQ1A 3QISA 3KYMA 1OLZA 3L3OB 1HWGB 1TVGA 3O0VA 2VT0A 4EN8B 4JQXC 4ANKA 1QMUA 1W0VB 3MYJA 4WTWA 1P7HL 4XFCA 5GGTA 3E86A 1ZE3H 3NSCA 4RGOL 3IDNB 2WLQA 2XN9B 1MCDA 1CD9B 2EH7L 4OIIH 1LO0L 4R7NB 5CZKA 2HEYF 4FG4A 1YI7A 1US6A 3BYWA 2DLFL 4CBZA 1ONAA 4LARH 2W94A 5BVJB 2W81C 5HVHC 4N1HB 1JN2P 3WP4A 3BFWA 5BNQA 1DG6A 4LHUG 1OSEA 4P4KB 1HXMA 2HRGA 3II2A 3PXHA 2GJZA 1TQWA 1U8QB 1X7QA 2EC9T 3HFFA 3QUMH 2RD0A 3MRLA 4LCCC 1DP0A 1W8HA 1F1DA 1IG3A 5C09B 2OMXA 3P9WB 3THML 4FQLL 1FGNL 2ZXEB 4P49A 1NKGA 1KGCE 1VESA 2AXJA 3DOSB 1HHGA 4GP5B 4N1EA 3W5NA 1APNA 5HCFA 2X7RB 3L3OA 4J3OG 2NNUA 2W0FB 3F12B 4KTYA 3O6FD 3P40A 4G6ML 3ZSMA 5FGBA 5MI0B 2F8OA 2HRHA 2WFF1 4J3XA 5IJVB 2W60B 2X4RB 2PPCA 2XN9A 3VXPB 1A47A 1EZJA 3ZR5A 4CKVX 3LV3B 5FOJB 2NTSP 2R9HC 2YPLE 4Z7UE 4B9IA 1M1XA 3B93A 1EJ6A 1VADB 3KLHC 1E9QB 2KZBA 3HBGA 4XP5L 2ERJB 3MJ7A 4JO3L 4J6RL 3T4DA 1FGVH 2DJ4A 3SZKC 5KVEL 4FN0A 3OZLA 1WH0A 1ZBE2 1ZBE3 4J9ZB 1OSYA 4HDIB 5DFVC 4JDMA 5GLTA 3AS1A 1SLBA 2LAAA 3C5ZD 4YS4A 4OF3A 3GXDA 1MZ6A 3ZKYA 1CCZA 1RZ8A 3FFQA 4OZIF 4PJ5D 5JORB 5C07E 3COOA 2UZYB 3N06B 3KW8A 1Z66A 2QSTA 3LZOA 5IB1A 4HH9A 3ZM8A 4Q9RH 2RJ2A 1NVPB 4KXAA 3AACA 4MWFA 2DKUA 3MRBB 4MAUH 3HN1A 5D72L 3OXRA 4WFFD 1LO4L 2G5UA 1ENVA 3H1LH 5JWPA 4ICWA 4AYFA 1H8NA 4O2EB 5EN2B 3KZIZ 1OOPA 2WQXA 4H0LC 1L6XA 2R15A 1C4RA 1CIUA 2W9DH 1IFRA 1VBC1 1N0LB 4I50B 2K3HA 5DJCA 3VE0A 4AILC 5B8CA 1J9RA 1Y1UA 3U83A 1PD6A 1XFPA 4MSVA 2XG5B 1H2MA 2HFGL 2WQSA 4DEUA 1BQUA 1Q6HA 5IAVA 4QM9A 5KW9L 1TSHA 1K12A 1ZJBA 5G4OA 1W6WA 5FRAA 1NCNA 3UZQB 2XQYG 5DD1H 5JHDE 4LLQB 5D7JA 3KV9A 4FQQA 2ZF9A 1T0OA 2AQPA 5D70L 5IJKA 5KBMA 1IOAA 4V1DD 3HB3C 2BOCA 2HJFB 4WFFA 1Q9LA 3KWTA 5ANNA 2CLVA 3IRPX 4DSYA 1R3IL 2AQQA 4P2QE 5FWJA 1PSKL 3TBWB 4I7ZC 1Q94A 3MHZA 3TA3A 3WN5C 4Q9CA 3PJQA 4PWEA 1NH2B 2WWSA 2E5LO 5A3IC 5J12B 4FADA 1ZLEA 4R2GD 3B9KC 4KUMA 1L3JA 1OB1B 4JG9A 1PVHA 1T6WA 1GYUA 1H1MA 5BNNA 3IU4H 4I9WA 1AH1A 2DL9A 4MMYA 2AUYA 2P34A 4HSLA 3ULVC 2YG0A 5CB4A 3RVZA 1FAKT 3JWDH 5I1GL 2XWJB 3UAJD 2WSSG 4H7LA 4DP2X 4BSWA 1I31A 2VDQL 3N1FC 2CJTA 5CFDB 4PRHB 3V52H 3ZN6B 4L3EB 1I9RL 4QRRE 4G4FA 1QDCA 2B7YA 2WY3B 2AXFA 3BPLB 2EA7A 3CFMA 3O1SA 4PJ7B 1O6UA 2R1YB 3LOWA 1NE4A 4B5EA 1BEYH 4R5VA 3W39B 4IEOA 1AHWC 1EAPA 2YGPA 3RTQB 3MV9E 4YZ4A 1FV2A 1BQSA 1YAZA 1OP9A 1GGBH 4CH5A 1QDOA 2DCKA 1ZLSL 3HB3B 4RX4A 1Q8MA 1V3JA 2OXGA 1O7FA 1O3RA 1ZRRA 2OQ6A 3ZPDA 2AQTA 4EN7B 4B7IA 4H44B 1BQHB 4HMEA 5BNNC 3SGJC 3FB7B 2VGLM 4AYSA 3MLTA 1KPUA 2WKLA 3BIAX 1VBD1 3ZXFA 5AVVB 1I7RA 5MEQB 2XJQA 5SWZB 5LASA 2F54A 1AZUA 3H1JH 1MI5E 1UQSB 4KHPB 1JXKA 4MXWH 1ZV2A 3JSNA 2IVFC 3FQRA 5JIKA 3SDAC 1XMQO 2IGLA 3MGOB 2J1SA 5KMGB 4K8ZA 2ZGUA 2ZSWA 1YAIA 3E2EA 4XP4H 1BEV3 4FE9A 1N64L 1PZSA 4LESA 4PIYA 4LNRB 2WWNA 2ZP0T 3A67L 2D7PA 4Y16A 4OD3H 3RZGA 4IRSA 2ENYA 4X0KA 1YEJH 2VH5L 3RWGA 4QHUB 2Z1KA 5I6LA 1XCQA 4V1PA 5L8KB 1JXFA 4AGVA 1HIML 4NM4H 1J5OH 3FT2B 5H9QA 2ATKA 2O72A 2VZUA 3HI5L 3KLKA 1UOGA 4TZDA 5DJ6A 4IKIA 5EIYB 1FZMB 4P2RB 1RP9A 4Q8BA 3MJ8B 1IDSA 4A6OA 3T6XA 1SJVA 1BM7A 1DDLA 5IV2A 5DWUL 5GISL 3CXFA 3GQFA 3RWIB 4YDVA 4F7KA 3ZYIA 3ABLC 2XWTB 1KIRA 7TAAA 3OAYK 1W8TA 1NLBL 3GLDA 4UB0H 2VXVH 1UOKA 4GRWE 4KNTA 3TJPA 1VGKB 1JU4A 2Z9TA 3FBMA 5E99H 5B4NA 5L9VA 5C0DA 1RERA 2PF6A 2D0GA 4BRVA 1EYBA 3VXMA 1OHQA 3GJFK 1NKDA 4PS3A 2OW6A 2WFF3 3BISA 2DQTL 2O14A 2GUZA 2X09A 2GAZA 2VDLB 2EXWD 3DK2A 2CHZA 1R3LC 1AGCB 1IU1A 5AD0A 2PHFA 2BSEA 5EIBC 4DKEH 1QI4A 3WV0A 2VB5A 4UMGA 1L9SA 3GUTA 2WSUA 3GBDA 1HWWA 4CN4A 4EB6A 3PWPD 5CWSA 1IXBA 3CFCL 1DQQA 5ACA1 4AVKA 3SN6N 3U46B 2HRPL 4P57A 3N40F 1FX5A 3JTSA 3KPSA 3JATB 4DCQB 3RVVD 4MNGB 3A0OA 3FT1A 4G8GA 1RI8A 1GTOA 2BX5A 4KKAC 4LCWA 1EHXA 2ZCLH 5CD3A 5EEZA 2IAMD 1JHTB 2R0HA 3JARB 2NMNA 1MEXH 2VUAA 4HEME 1V10A 4HIJA 1GCYA 2ZDIA 2CBOA 2Q5BA 4JO2H 5H4ZA 1I08A 3Q2VA 2W59A 4EQ2A 4QX0A 1MIMH 2VUYA 1CU4L 4PJYA 5IR1A 1S2KA 1WAEA 2G9ZA 1BGXL 3K6SB 4Z7IA 4RESB 1IS3A 1ET7A 3N7LA 3SOBH 3HZYB 4N2DA 3BYTA 4Y1ZA 4ORGA 2XWZA 3FONB 2GJPA 4FXGB 1ROPA 2Y36L 5GS0D 2XX1A 4OCWH 1MJ8L 3WYRA 4P9ML 4FAAB 2A70A 2Z5WA 2HUHA 4XI5D 5DJXA 4ZOAA 4B1LA 3BKML 1UCBL 3CHPA 2OQ7A 4BRJA 2NLJA 4IHJA 1R3LB 2G5BA 3BH8A 5I0DA 5JXHA 1IGJB 3GMRB 1ROWA 3RX9A 3KGSA 4KQ4L 2QGDA 4ODHH 3WXVL 5SV8A 1MXDA 4RO2A 2DQFB 2R7EB 5IBUB 2FX7L 3E6HA 4ADIA 2G19A 3ZHQA 1BD2E 1Z3GL 1NCHA 4PUBH 2OSXA 1AL23 2YI8A 3V7AG 4PWFA 5DJXB 2ZWLT 3OKDB 1E4XH 1MF2H 1XZ0A 4YSDA 2Z65C 5JAXA 3ATBA 4AJWA 3CRAA 4UOW0 1JPSL 4R9CA 1R9FA 4AYFB 3QFJB 4DH2A 2QQPA 2YSUB 3VZOA 1NLRA 3TBTB 1RIVH 3UO8B 5EDSA 4JDEA 4MJID 2XQBH 3ZQWA 4PN6A 2OV0A 4GQQA 5EUKB 2D3SA 1KACB 1YNTB 1K4DB 1KFGA 3VKFC 3I49A 2M8XA 1FRGH 2DIAA 2P8LA 2IV8A 5ABJC 3S7IA 3JBG1 4TM9A 1C8NA 3GI8H 4YGCA 1UXSB 4PJDA 4OIFA 5FK9B 4NZUH 3NMBA 5C8JB 1HINL 1HB4A 3O0RL 4A68A 1OTUD 1I8MA 3UETA 3H4HA 5KSBB 2ZACA 2G4GA 1SXBA 4GG6E 1CLVA 3KPPB 4HOMA 4A7GA 1ZBA3 4HPOH 2QTWB 5LHDA 2BVQB 2XN9E 2RDRA 4XIOA 1X5KA 3ZX7A 4QHKI 4Y1AD 2IC1A 1ULVA 3DURB 4NZTL 2AK1L 3LD8B 3OM3B 2FEDC 3GBLA 3ZKMC 1AS8A 3Q6FB 4NEHB 1K3ZA 1S0EA 4NUGH 1AXSA 2AV7A 2VRZA 2OMYB 1X5XA 5IP4A 5CAZA 1OD7A 5F7LB 1BVLB 3STLC 4HS8L 2J42A 3ZOAA 5IY5C 4J1UB 2VXTH 4N7UA 1R46A 5CGMA 1LEKA 3ZL4L 4W9ZA 1CDHA 3VWKB 4OYUA 4X4YA 2ICEA 2E63A 3NSFA 4CDWC 5C07A 1J0YA 4KUCF 4TNFA 2E6QA 3QYNA 4O4IB 1CUOA 3LS4L 3VFMB 2YWYA 2DV9A 5LA0A 5GRVK 1TZIB 3WVJA 1KNOA 2FWOA 3F7VA 2WTRA 1TZHB 2XL7A 4XPBH 4NWWA 1IGYA 4DO6A 1AZRA 4BFBD 3L5WA 4IEXA 2QQKA 1ZE3C 2BOLA 3KL5A 2IQ9L 1QXPA 2NZIA 1C5HA 3BUDA 5DJAB 2MHAB 3H9VA 2MPFA 5HHPB 3I6LE 2OQJA 4QNPE 4ODWA 3J8F3 4FFFA 3CFDB 3OLEA 3GPEA 5CJXA 4ODSH 3ZO0A 4EIUA 5MEQA 2MQGA 3UCRA 3FFCB 4KX7A 4ZBJA 5CLTA 1IS6A 3OPZL 3KYNA 3GWKC 5DR5L 1JNLL 3ZPOA 1A7PL 5A2BA 1CFNB 1SY6L 2KSDA 1Q8IA 2ZGSA 2PHWA 1ZZCA 1B0RA 2XHBA 3WDYA 1PNMA 2VVDA 1E6OL 1F6AB 4UT9L 1YUHA 4DPBX 4PDWB 2LFGA 3L3HB 2HVJC 4F8OA 2DFBA 1HAUA 2AJVL 2JG9A 4QX5A 3ACGA 3HE7C 3FAXA 4NQTA 2VL5B 4WU7B 1OA2A 4LFCB 3MOBL 3GO1H 3HR9A 4HUXA 4Y0GA 1YJWV 2ISDA 4F8LA 1F90H 3VBBA 1IC1A 3BTXA 5FO9A 2ITCB 4XPAL 1QPKA 4LF5B 4Y4HD 1XNQO 3ZE1F 2FDKA 5E9NA 5FWRA 5IEKB 1CVNA 1C5DA 1IM3D 3UTZA 5IT2L 2VL5A 2Q8EA 3WR0A 2ATKC 3QNXA 2AV1B 2PXYB 4MVTA 4JG5A 4ZMQA 3FCSB 1PVC2 3ZLIA 1X9LA 1GWKA 4R4FH 2N1KA 2YV8A 4JCLA 4IOSD 4NO0D 1OH3A 5CAYB 1ZTXE 4URAA 2X0WA 1SQMA 5IVZB 4NE9A 4YIOA 3QIWC 5FF6A 2YBPA 5E2WH 2X4PA 2ZICA 3HE6B 1Y74B 4BISA 5CJQH 3N3EA 3HKBB 4OCXH 1NLSA 1RUD2 1T4KA 4X0NA 5FYKU 1I8LC 2YFUA 1NZRA 3U30B 5IWLA 3HNBM 1HNZO 2W92A 2CJUH 3DYPA 5C08B 1P69B 3U0TA 1OP3K 2XKUA 4YJ2B 3C09C 1KY6A 4UIKH 4ZZFA 2WZ8A 3AB0C 1F3JA 2AAVA 1MRFH 4PQ9A 1ASJ2 5F2SA 1ZSHA 3SHRA 1JFQL 1BQLH 4KI5F 1SLTA 1GKEA 3HKBA 4WTZA 5FUCC 4JGZA 4Y22B 3KPSB 4DUZB 4G5AA 2HBTA 4X88A 3E38A 1CD1B 5TFSH 5IYZA 4LT7A 4DK3A 2VE1A 2UXCO 3VW3H 3H42L 1LO2H 3UP1A 1COBA 1NFDE 2V4VA 3VHRA 4Q7DA 3J7AU 3DXAB 4BSVA 3NJGA 1TME3 3IFNL 1G84A 2EAKA 1PZAA 2R2BB 3BU7A 3UYJA 2ODHA 3T1CA 3SGJA 1ZZBA 3OXRB 5D7IF 3DV8A 2WV3A 4OD3L 3WN5B 1EAJA 3I75A 1A6WL 1DQTA 1WAAA 1U8CB 5BV7C 1UYWL 5HYSG 4UW6A 2YEVB 1EXGA 1QKZH 1V7NL 1IC0A 1XTLA 3F05A 4RGND 3P4OB 4X80L 1EAQA 2J57A 1F2QA 5FYJL 2B3RA 1O5PA 3O9WB 3QP3A 1N0LA 4C8XA 3N40P 5H37H 4WV8A 1N0NA 5FO2A 4X7FC 1CE1L 1PX8A 3VI4E 5T3ZE 5BV7B 5BVPL 1T03H 1C8PA 3BGMA 1QQCA 2BFVH 5EH1A 5GZNA 4AJYV 4UOZA 4XJ8A 1NCAH 1P9MC 2X89D 5EP9A 1N0XH 4G8IA 1COV2 2BSTB 1G7JA 5L9RA 4PBXA 3D3VD 2D3NA 3FW6A 2GTZA 4KO5A 1XF2A 4OHZA 5A3OA 2H0VA 4CU9A 2W8CA 3O4OB 2Y7OA 1TKWB 2P8MB 4U6VH 5GSVA 3V95A 3PDOB 1CD3G 5CSZA 1I1RA 4N8PA 3SOTA 3MNMA 3UTSA 5J06A 2XLGA 5K9OB 4WI2A 3ATEA 5FM4A 2GP5A 1G6RL 3SPGA 4I3PA 2OXGB 1OOPC 4PPTA 3D82A 3I3EA 1BBT1 1W3VA 2UXDO 1EHLL 2EH7H 3E6BA 2A3QA 2DJVA 5A3LA 2NXYC 5JW4R 5E6UB 4UF0A 2NW2B 1MHCA 3LKQA 4S1RL 2AJ3B 3PWVB 2HLEB 4M6ML 3SSGA 5F3BB 1A4BA 3AM2A 3ETBJ 3B40A 2ARAA 3W9DA 4XYXA 1BW8A 1VA9A 5BNOB 3R8BB 4P2AA 2XVGA 3ZFGA 4D9LL 1O3QA 4I02A 2WXFA 1FP5A 1BSMA 4NBXB 4PYGA 4R7NA 3QJSB 1FJ1B 5IDJA 1OV8A 3C9NB 3LN5B 1RZFH 4L1SA 5I24A 4QD2A 2YPDA 5F9TA 4HK0A 5IQLA 3IK2A 4QRBA 3V4VB 1Y6KR 4N53C 3IMBA 4EKWA 5C9JB 3JUZA 5AC92 2CO2A 2XFXB 3T0AA 3X14A 1EV12 1P53A 1XR8A 4YSRA 4Q4W3 4KKAD 1VBD3 2JIGA 5CA3A 2FD8A 1YEKH 4XVJL 3ZTNH 5LW9A 4Y19E 3L48A 4FMFA 4MD5A 4YW2A 4KWLA 3NIDE 4LSUL 3BCCH 2F8IA 2CKBL 5I18L 4S1DD 4WLCA 4X5RA 4H13B 4H0HB 4JZOA 1IAMA 4I3SL 4JQXA 2I26N 1FFNA 2JKBA 3DVNA 5BUVA 4AVSA 3FLRA 1VQ8V 5LP6A 3D3IA 1NAKH 3KYMB 5KTEL 2HRLA 4KBBA 3VMPA 1EHKB 3FU5A 5F9JB 2PETA 4Y5XB 5IQNA 1OF3A 4FDWA 3WFCH 1KTDB 2WO1A 4UFKA 5I93A 4UM9B 4R8HA 2AEPH 3F01A 1BZ9A 1XEQA 4NHYA 5E8OA 1QR4A 1XF5A 2Q8VA 1ZK9A 3P77B 1G7MB 1EZVX 3FHIB 3DX4A 4KK8D 2HG5B 1MAJA 4JZNA 4KJYA 1QY4A 1DR9A 3WCYA 3PV7A 5DJYB 3NAPB 2IH1C 2VCAA 3K5NA 5IVVA 3L3OC 1G87A 3ZK0A 5GZNC 1NZCA 5GZFA 5J2TA 2HG0A 4U6VL 4G3YH 1G7PA 4PJDE 2JI2A 3U6RA 1JOJA 3QG7H 5KSAC 4KROC 1ULEA 4Y88A 4DXZA 5J48A 4P5TA 4GG8B 4IMKC 4NXNB 1NANH 4J42A 2HWD3 5LB1A 3RL1A 1X59A 3VFTB 2NT0A 5FQ0A 4JLRB 4YHOH 2V7HB 3RU8H 4W9EC 5EZIH 4A3ZA 4JN2B 4WHCA 3WX5A 4LMFA 1VBB3 4L9BA 2BY2A 1CDGA 3HZ3A 3VWJA 4F9PC 4F5CE 4HS3B 4UM8A 2DIEA 1W9WA 4HHAB 3P5BA 2IAND 3B7TA 1PAMA 4DKDC 2PCYA 1G4YB 3FTZA 1HK6A 2WLJA 1CGVA 2P8PB 4F20A 4DUVA 2YU2A 4GBXD 2NY5C 2BCKB 3FN0H 4NR1A 2YS4A 4IOFC 2RJLA 5FK7A 3QNZA 4NQUA 3BIBX 1GMEA 1ADQH 2IVJA 5DPNA 3RPBA 2ZABA 4QMAA 3QI9D 2PMWB 4JKKA 5C0RL 1OLMA 4QGMA 5A7WB 3WEAA 1W99A 1IBLO 1L7TH 3B01A 3O4LE 5F7EL 1N33O 1W59A 3BMVA 1HKLH 3I50H 3N41B 1VEPA 4AQZA 2D7QA 1AR93 5EUOB 5F97E 3VHNA 1K4DC 3QLQA 3W58A 4C7UA 3LNMB 4E9RA 4Q2ZB 2KERA 4Q89A 2QV2A 3S0PA 3F12A 3IJHB 4X83A 4AW4A 5A2JH 5EF3A 2ZMKA 4PDWC 3B2UD 4QWNA 2J8OA 4D0BB 1PGL2 4LCUC 3E80A 4BFGA 4K71C 2ZOEB 4IJ3B 4O7XA 3HS0B 4NOFA 3P32A 3HVNA 1RGSA 4P23B 3WE6A 1E6JL 1Q1JL 3DX9A 5AUMA 5JW4M 5CMAB 2HLDG 1Y18B 5EIIB 1XYOA 2VZVA 1O7DC 2IXQB 4W9GC 2DW4A 5L7OA 3LSQA 1QJFA 2M2DA 1G1CA 2OT7A 3ARFD 4O02L 4QRFA 3LKOA 2Y33A 3HOBA 2WO4A 1CZ8L 2KG7A 2ZOLB 4WHTA 2GMEA 3AYCA 5LXVA 1C12A 1QZ1A 3F84A 1ZZ7A 4FP3A 4MLSA 4PM1A 5I8KH 4OZHE 4HC1H 3ZFEC 5ISZD 2R1WB 2NNXA 2XV3A 5F44A 4LIVA 3LYRA 1CZSA 1V6IA 2Q7NA 4BQCA 2NNCA 4JFEA 4Z3JA 3GGLA 3N9QA 5T33H 3QJHB 4XODA 5H37A 3ZFEB 1WPBA 3RWEA 4JRXD 4I88A 3QIBA 2GKIA 43C9B 1S3RA 3LSOB 1J1TA 1N9PA 3KDPB 4FQ2H 1OTSD 1EGJL 4EN3A 4BSWB 1C7SA 3OAZK 4H1LA 3N55A 2XSKA 2QKIC 3QORB 4QRPE 4KQ7A 2DW5A 3RFZA 5IHUH 1L5GB 5KSUA 3VH8B 3PP4L 4G8EA 4DR6O 4L2YA 2PNDA 1A6VH 5B39B 3GNMH 3TIDB 5KXDA 4BDVA 4ZXBD 3SDDD 2CGZA 3DVGA 2NNFA 3FU0A 4S1SH 4XX5A 4IMKA 2W88A 5FYJE 1IBKB 5DHVB 2GJJA 4TMPA 1XF3B 4O4HB 3EZJB 3KWVA 1FZKB 3AUWB 5CN2A 4ZUWA 4Z1PA 1ZX5A 3QXVA 2WC2A 1N3PA 5D8AB 4ZYKA 4NBZB 4QOKB 2KKWA 1XE7A 1U6AH 4YM0A 3NP3A 1BMWA 5HYJA 1ZT4B 1JYCA 4WTXA 2BYVE 4F57H 2YICA 4UIMB 3PAZA 4U1MA 4GO9A 3UPAA 2J12B 1SM3H 5CIRA 1AE6L 4N43B 1B9KA 1F6AA 1AR1B 3G6DH 4A2GA 3E5XA 3IWVA 5ALCL 2DU0A 1UF2C 1DDTA 5JOPE 3E35A 3PNRB 2J7LA 3GMNB 2FO8A 4M93B 1ZAUA 5IBLC 3TBYA 2HJFA 2NX5A 4NNXA 1KXTA 2A77H 3S3DB 3NCYP 4WVZA 1DBJH 1UZ8A 3PPSA 3QFDB 2EIZB 5L3DA 4FQ1H 3UMTA 4JPIB 4MMZC 4NO0B 3DJRA 1QJY1 5EZYB 4F4LA 1KCRL 1X3DA 2GDSA 5E51A 2NY0B 2D0HA 3UTOA 2UXXA 5JOYA 4JI4O 4GUPB 2H41A 2NYYD 2ZNXA 1KFAL 1LRHA 4XCBA 2EUXA 1FH5H 3RG0A 4OLWL 3LPFA 5FK8A 4Y1YA 5BQ7A 1C5CH 4I2OA 1EWHA 2UY7B 4LLMA 2MEV3 1U8NB 2F5BH 1QXJA 3ZO0B 3QULA 4I4WA 4LVEA 1J0HA 4IW4C 1LR5A 3L4YA 3DVNB 3A0HZ 3EGSA 5KC5A 2WJ7A 5GRWA 5A7OA 3RWEB 2UX6A 4G80B 1NJIW 4WDIA 2XKOA 5FUPA 2CAZC 1UVQB 5F9JA 4IESA 2CAKA 1K8IA 5IATA 2KS0A 3RNSA 2P6HA 1VMJA 3B4NA 4UILL 2ZXWB 5EBLA 1AZNA 2CHDA 4DZGA 4BIFA 5EU4B 4NFBA 1AGCA 1H8SA 1DVQA 1HX0A 2YAPA 3TURA 4JB9L 1MJUL 3QCVL 1LO5A 4OLYH 4YR6B 4ZW6A 2WVTA 1JVKA 15C8L 2ORBL 2IPTH 3S98A 4ZNEA 3F5WC 3KLHD 1YPZA 2HFGH 3APOA 4HUCA 2AJUH 1SBBA 3L8QA 4BBWA 4EZLA 3K71A 4FF9A 1XBDA 1D5BA 1BT8A 3MBWB 1ACXA 2R9HD 3BAEH 3UACA 1U2YA 1BVVA 4OHXA 4YSPA 3C87A 2ENPA 1BBJB 4ONFL 3DO7A 2X5IA 2E27L 3M99B 2Y5TA 1F13A 3DL3A 1U5ZA 1EFXB 1NFAA 4FA6A 4LKXB 3T1WA 4YO0A 4XAAA 3D07A 2VW7A 1HN0A 1TVBA 1B6DA 1K4CB 3KL0A 1OP5K 4JI1B 4TSBH 1RJCA 3KCXA 1YY9D 3F83A 4RAUA 4AQOA 1UA7A 4QRSA 3K3NA 1L6ZA 3QJVB 1ZRFA 5E1AA 3STZC 4B9FA 1LUVA 4CP2A 2WT1A 1B6UA 3JSLA 1NJ9B 1XF1A 4JN1H 4M6AA 2ZT9B 4X9YA 5D1ZB 1NCQB 2VGDA 5FW7A 1AR83 2G60H 3RNQA 1CI3M 1C1FA 4MVOA 2RS52 4X6FB 1HXMB 1T7ZA 1BZQK 4HXBL 2PHRA 3QH6A 3RYPA 2VERA 4J3UA 3RPKA 1JBCA 4N25A 2FKXA 1PNFA 3A4AA 5BPPA 3S2CA 4RRPG 4G71B 4JQVA 4L9DA 5ICXB 4AVVA 1V9PA 1H8LA 1Y66A 3FB7A 2A79B 4QRTA 4J80A 1D2QA 3T1FB 4QKNA 1VBC2 1R73A 2DLTA 5FPRA 4XWGH 5DRZA 4AUUA