3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
4PI2A 1YEWA 4PHZA 3CHXA 3RGBA 3RFRA 4PI0A 4O65A
chains in the Genus database with same CATH superfamily
3IKWA 2ENPA 1KCUL 2MPVA 3RVZA 1X7QA 5DRNB 1PIV1 3RWKX 3MU3A 2C9QA 4K0KB 1OF2A 3P0YL 3W11C 3P5BA 1M7DA 5JAXA 2P90A 4HA1A 3WNJA 1DEEB 3WS6C 1VBD3 1Y3TA 4HVQA 3CCSV 3NCMA 3V6OA 1GVIA 3QNYA 4KDVA 2VAUA 4XNYH 1X7NA 5B1JC 4B29A 3DVFA 1IM9B 4QKTA 1YUKB 4AHCA 1E8XA 5IT2H 5GS1C 1DVXA 1HIMH 2F6AA 2WZPA 4LF5O 3DIVA 4NNPL 4PBXA 1SCSA 2JKIS 2WNVA 2GUZA 3J7MA 4N28A 2ATFA 4LKXA 2BVPB 4JHUA 5FXCH 5H8DA 3MBED 4X6QB 3U9UA 3FN0H 2P22C 3SDXF 3ILDA 3BWAB 3FW6A 4N87A 2KG7B 5KJRH 5FUPA 3G5XA 3S3BB 4JN2A 3RS6A 3B8YA 3QDGA 2ZKLA 3JVGA 4J10A 1I4FA 2E9IA 3S37X 1GRJA 1A6VH 2DLGA 1ZA7A 1P2CA 2CXKA 5HPOA 2G9HA 1HSAB 1QY4A 1VQKV 4UV9A 4XMXA 1AANA 2HG5A 4BK5C 4C59B 2Z69A 4JFTA 4GWIA 3WT3A 4CH6A 3VHNA 4U7KA 3QUKB 4XMWA 2C9UA 1AR1B 5GGVY 2GH8A 3VWJA 1EMTH 3WE6A 1A9BB 5CVRA 4U31A 4RGGA 3N42F 1OD3A 1BZ8A 3MVSA 3S7IA 3TT3L 1NICA 3CCVV 2RGSA 4OH2A 4MZUA 3PNWA 1LP9A 2ZT9B 1IC7L 2GMPA 3JWDL 1AQKL 1UM4H 3GNMH 1UY3A 1XB6A 2R1BA 1DQMH 1KLUB 5DUJA 2PYJA 3P73A 4JRXB 5KN5A 2TNFA 5J2TB 1VF5B 1E28A 4N24A 3LIHA 1I3RB 1Z3GH 4NO5B 3JXSA 3PL0A 5FX3A 3ZDSA 1BXUA 1MFEH 2P5PA 3D06A 2K46A 1NJIW 3ZDZB 3S98A 4QRTA 4PLOA 3O1VA 2WKOF 3L95B 1M9NA 1CBJA 1IARB 5H2BB 5FO8A 1X4TA 4K3HA 1ASJ3 2IW5A 4R84A 4WWKB 5T1MA 4N85A 5F88A 3KVBA 3KBPA 2R39A 3PPEA 1SPPB 1H8TB 1CFSB 1BHAA 1ASOA 3AVRA 1OY3B 4HFWB 2HLFC 4LRNH 4NN0A 1G4MA 4AVIA 2EDFA 3P30L 1VBE3 4ELMA 1E5IA 5LCVH 4MJHA 4PA4A 1PVC1 4I8DA 3HS0C 5JOPD 4D0BB 2Y25A 3QULA 4XUQA 4EKWA 2YGVA 3EGDB 4LO4B 4LHQB 2X3BA 4IIZA 4YVSC 2PW1B 1CFBA 4X4YB 2VQTA 2DF7A 1YHQV 2EXSA 2XXZA 4Q0QA 3M1HA 5EF2A 3GSQB 4FKKA 5EIBC 1U92B 2F54B 2JGDB 3ZM8A 2PA7A 4CBPA 3VBFA 2C9RA 4FOWA 2EALA 5JZGA 2K8MA 3JSSA 5FZIA 4HPKB 2QVKA 3HG1D 1D2PA 1XMEB 1ZMYA 3BSZA 3WEMA 4AXWB 5KZCD 4QPYA 5FXZA 3HUJB 3QF7A 1U3HA 2V8MA 4NQVA 1ZT7A 4WW2A 4WFFE 5TH2A 3T0EE 3PJQA 1KYOK 1NCIA 4ICWA 1HYRC 1EV2E 1T4KB 4KXZI 5T1LB 1UKTA 1BVLA 2HUEA 3G5ZA 3KVQA 3EDKA 1TMCB 3BKYL 4X0NA 2N4IA 3NO8A 2XWJA 1J0IA 2Z31A 4TSCL 1N47A 5AWNL 1LNSA 3H1MA 5C71A 1FNHA 1JNLL 1QTPA 3JYCA 4JI4B 5DRZB 1HCZA 3GCXA 4F37F 2OMUB 3QCVH 3TBSA 1JIBA 1SXNA 4XILA 2VGLM 2AGJH 3TWIA 1HHJB 3OF6A 2Q0AA 3IXTB 3WMSA 3EH5B 3N2JA 4Q8BA 1SY6L 3FRPA 4DV7B 1OW0C 4KRLB 3FQRA 3IN0A 4OI2A 1KC8W 2FEDD 2X6VA 4K3DL 3TCLB 1B3QA 2ZEXA 2VCOA 1TYJA 3CDFA 5DJ0B 3CH8A 2NSQA 3WU1A 2I9LB 1U8KA 1HQNA 4I50A 1ODUA 2AXWA 3L9YA 4U4IA 5EBGA 5FK9A 4WF9V 1CVSC 1HOCA 1F4XH 3UTZA 2AMUA 3G6JE 1MFBH 3MV9A 1E50A 1L0PA 1N0LA 3VTAA 4P9IA 3WKPA 3W59A 5LBBA 1RUG3 5JHLA 1IAOA 4MQXC 1DVQA 3VGAC 1TZIB 1BFSA 2EE3A 4IEYA 5L2KA 4C83B 3DX6A 6FABL 1ZLZA 3N85L 4PWIA 1VPOL 2EO9A 2GC2A 5EZOL 4UM8B 4QKFA 4XF1A 4PA9A 1GMIA 4B0MM 2R9RB 1AMXA 2C1OB 5I1EH 1PM4A 5J1SC 2UXTA 5AG8A 1AILA 4LNUA 3N41B 4EI5A 4QRPA 1P84J 2WLHA 5LA9A 2G3ZA 2ZOTA 3DRQB 3TIDB 3FLRA 4ZKIA 1EO7A 1VB9A 4H1LH 3GM0A 2JCCA 4F5CA 3QRFM 1JPSH 1QFUH 1U8MB 3IDEA 4PJEA 4Q4V1 1FO0L 3SE9H 1BMV2 1XZ0B 5EYYA 5E6ZA 4MJ5B 2Z3YA 2ZONA 4JI1B 1PNDA 4WFAV 3HMXA 2VMGA 4WBNB 3B2UD 3QZBA 5TISZ 4FFIA 1GCFA 3TN0D 2QBXA 4LF7B 1LE9A 2YZ8A 2PLTA 3BZ5A 3K2KA 3UADA 5FA3A 4FFZA 2G19A 2WGNB 2NUPA 1A3RH 4LH7A 4QCIB 4LKSA 5IHUL 2ROXA 2YFUA 4Y4FD 4HFUL 4R0LB 1K5WA 4PS8A 3CCQV 1NXMA 1BPVA 1CG9B 3MIHA 1P4UA 3JD73 3JARB 4RISL 4QO1B 3MCG1 4AZUA 1IBFA 2X9YA 4GRWF 1EAH1 4QTIH 1KFAL 5SV3A 1W2BU 3RKPA 3TLRA 2GALA 2QZ2A 2CDGA 3AGWA 4G7VH 1J3QA 1AOZA 3ZL4L 1ZA4A 4WW1B 2BNNA 1J1OL 1KJVA 1W9SA 4PRBB 4IRJA 1OO2A 4XNZB 4JKPL 1NCWL 3QK0A 2AXFA 4H8UA 4PM1A 5IMLB 1N5YL 1QW8A 3AYDA 5CEZL 3AEIA 5C70A 1HNXO 3BZ4B 2ZE0A 5AYUL 1C5CH 1HKDA 1DN0A 1UD3A 1ODNA 4KY1H 1CT8B 1Q5OA 5DN2A 3OD3A 4I18A 5JOFB 2WR9A 2QMKA 3IGKA 2OTWB 4XXWC 3EIFA 4AY0A 3RWJB 1ALYA 3EZ8A 1PK6A 4F58L 1FVDA 1ILUA 2MW2B 1HXS2 3NNJA 4LR4A 3PWVB 1FIEA 2R0KH 3EXAA 4LL1A 3JCZA 4XVUD 2DOCA 3D51A 2O6PA 4YVSB 4E9KA 4Z7QB 4DN4H 2WCSA 2ORXA 4MO3M 3MN8A 4WVMA 1JYNA 3FQNB 1N8ZA 2B0SL 4UT6L 4NFDA 1V3MA 1DUYB 5IJKC 3FUKA 3SZ6A 1XHZA 4LA3A 4NZUH 5C07E 3BO8A 4P9HH 1FLTX 2GC4C 1Q9KA 4ETQB 1ADQA 1N1VA 4EUPB 2MQGA 4MAYD 3USUB 1JZHA 5FZ6A 3FUQA 2ZD0A 4YLCA 1TUBA 1PIV3 2D5HA 4WVZA 5F2WA 1JZIA 5DJCB 3T2OA 3LEXA 3K81A 3T1YB 2G60L 2ZE6A 4ZMVA 4HOXA 2EKSA 1KLFA 3SISA 3VNYA 1RITA 2ZUWA 2HCZX 4O2EA 4M4PA 2FGWH 4UQ9A 3HPJB 1IEBA 5JIHA 2XUWA 3OAZH 5K1JA 8PAZA 5K0UA 3DV4B 5GGUB 1U33A 4MNQE 4F7EA 4U6XA 4JMNA 3SQOA 4HIJB 1A6WH 4AZ8A 1Y4WA 4AIZB 1A7BA 3MRNA 2JDIG 3MRIB 3UFIA 2L7QA 4Q27A 3DV6A 2BP0B 2V9UA 3H7LA 4PSRA 2JI2A 4YFLF 2F1EA 3ZMSA 1TIUA 3F7PC 1ZL8A 5GQBA 1Z5LB 2I24N 4EVNB 1F51A 3GIZL 2ZPXA 3T8XA 4P9WA 2Q7YA 4Y1UA 2H32B 2ZWNA 3CFNA 1OE2A 1LK3H 4U6VH 4CC0A 4CN4A 2CBPA 1Y66A 4ZPTA 4ZKTB 4LESA 4RGND 2AABH 4ALAC 4GLRI 1W8HA 2P3JA 2YBRB 3UTTA 1S46A 1NCOA 5EBLC 3EBIA 3B93A 4W9FC 3I5DA 3DOIA 4BFFA 1G9ML 1LU1A 2QQUA 4YJ3A 4BCZA 5C8JB 1WTGT 5D7HA 4HIEB 2HWD1 1T5WB 4FNUA 5IVXA 1K73W 5I17A 3UAJD 3IN2A 2ZGTA 3A21A 5L3FA 5FOBA 3BE1L 4BQ5A 2UY8A 2OXHA 4AHWA 5EN2B 1XYPA 2Z92A 3ARFC 4PV9B 3B1UA 3OEAA 1XUQA 3CDZA 4H20H 5IQ9A 4BOWA 3BRFA 3FO9A 5GISH 4FZ0A 4GS7C 3RGVB 1G0XA 4LLWB 4MB4A 2EH7L 3EGXA 4BJ0A 1DANT 2ZM6B 5F72S 4AV4A 2YA0A 2Z8SA 1GAFL 2QL1A 5D2NC 1KS4A 1CPNA 2ZPKL 3UBXA 3PNAA 5EUKB 3FHEA 3TO2B 1BAFL 3NEEA 1PMJX 2J1UA 2XBO3 3LFMA 5FPOA 5KVMC 1AP2A 1XIWC 3ULVC 5C09A 1IQWL 2CDFB 4YLBA 5AW7B 3ZYGA 4QPWA 3ILQC 3MV7D 5DJDA 3TVMD 1J48A 3WS3A 4PWEA 4AYFA 3J8F3 4Y1AE 1QSFD 3CH1B 5DEGB 1ZZ7A 1NEZG 1WWBX 2P8PA 5ACZB 2UWEE 2XACC 4P5KB 5C0CE 3DEMA 5EIIG 5A70A 4L5FL 2B3RA 1PVC3 4MZRA 2P1YA 4AEHH 4FZEH 3IEAA 3BW9A 3ZE0E 2QA4V 3IDYB 3HE6D 4HN1A 3VGFA 1VQNV 2NYYC 2P5WA 1FJ1B 4NWTL 4JM0A 3Q8EA 4K3JH 1MAMH 4O4IA 1VQ4V 4UQ2A 3GSVB 3ZDYE 3A0HZ 5FY5A 1NCCL 4HS6A 4IDJL 4UUJB 1V6JA 4Y5Z0 2ZGQA 1IX2A 5AVVB 5AZEH 2ZGRA 2JB5H 1E6OL 3PWPA 3GRGA 2XN9E 4U3CA 5I73C 1JHJA 2XJKA 3HAEA 4NHCH 2QKIC 5FZ0A 1IBYA 4PVMA 4AKOA 2G75A 3L7EA 2UXGA 4HGKC 1MZFA 5BOZG 1IKFH 4BIOA 2QMJA 2A83A 2D43A 1MELA 4EN3D 1MS5A 1LECA 2HRGA 2X4RA 2XVLA 5FLHA 5LBFA 1AGFA 5D5PA 1JPGA 2XNAA 4KJYA 1DLFL 5BNOC 3QEUA 2AEPH 3SPVB 4BQ8A 4TVUA 1IKNC 4J2QA 3ABLB 1JGEB 2ZDIA 1QSEA 4QHMA 5B3SB 2ZXBA 4K94H 1PAMA 1DZ0A 5GRUL 4ZDHB 4YSQA 1UHVA 3VD4A 4FFYA 3H3ZA 3OBTA 1JXNA 3Q05A 3C6LA 1P4IH 3QUXB 1NGQH 2FZ3A 3RL2B 1EZVH 1AQHA 4IBWA 4MGIE 1ADWA 1FGVL 1SGKA 1OKOA 3DIFA 1CJDA 4JI5B 5E8NB 4D0CB 4JCKA 3G04B 1XCXA 2P48B 1SZTA 4WY7H 4ZUWB 4Z9KB 4JL2A 4YSSA 2OBGA 5BMVA 1K8DB 4DF9A 2A70A 3GI9H 3MLXH 3G08B 4HMCA 4XHQA 2V5DA 1VIBA 2AXHA 1URFA 3F12B 5FUZL 3X29B 3UGEA 2EEAA 4TQIA 1MFUA 1SQ4A 1DUZB 1NOLA 3FT1A 2DKMA 1I7ZB 3O41A 1MHEA 2XZAL 5J9PB 4X6FA 2Q6WA 2P28B 5I8CA 1QLNA 1PY9A 3MODL 2DYPD 2GAZB 4JI2O 3FE5A 1NBZB 3D3VD 5BQ7B 2DD8L 4P4KA 3T1LA 2GHZA 2I7SA 5FGRA 4APXB 2FX7L 4BXSV 2LR4A 4I0AA 5FZGA 1NGZA 3QFGA 4A67A 5DRWA 4L18A 2IXLA 3KHBA 1QHQA 3BXNA 5DS8A 4LWSA 4XC3L 2A3XA 4OD2A 4RGOL 1NAKL 1G86A 4X8PA 3CFCL 2HKFH 2OMWA 1SCRA 1XZWA 1J5CA 4LFCB 4ZMWA 4Z3FA 4U6YB 1IBBA 3BLBA 3F7QA 1E4XI 1MFCH 5CWSB 3LV3A 2XTJE 5C0BD 5I6OA 2ZYSA 4XX5A 1BKZA 3VHRA 4OF8A 1GZWA 3IKCA 2RDQA 4QHKJ 4Y88A 2Z7WA 3FSZA 4AIEA 4QJ3B 2DBLL 1A6AB 4DINB 4U05A 3DHJA 2VQ0A 4WI4A 5HYEA 3AYAA 4NN5C 4PW4A 4Q4V3 1YNKL 2X4QB 5C08E 5B38B 4XFBA 4Y5YC 4PRHB 3X3FH 2BY1A 1URIA 2D3VA 1G0YR 1HXMB 1CU4H 2P2KA 3RA7L 1XI1A 2WXMA 3LH9A 5DTFB 2N01B 4J41A 1E90A 2OJ1A 4OBRA 2IQ9L 4YHPA 3SBRA 3VRLF 1XPWA 3OKLB 3UJJL 4ODBD 4UF0A 4HWBH 3L5XL 4BQ3A 1C9SA 5BUVA 4DO5A 2PYEB 3D85A 1IGTB 4LPTA 3VH8A 3JUUA 5IWAO 1UZ6F 2R2HB 2RDRA 2VIRA 1OARL 4CP0A 1UC6A 4KPHH 3W39B 4JDEA 4LO6B 1F4YL 3ZLQC 5BR8B 2QQNL 1EFQA 4PB9H 5G2NA 4A4AA 1RMFL 3P11L 3PGFH 1EAH3 3Q6FB 4K8RL 2G3MA 4PRAB 1U8CA 1F7YA 4AGPA 4NJAL 5KS9A 3G6BA 1AHSA 2WFPA 4Z7WB 5I19L 4O2AB 2OYKA 5J12B 3BP7A 3V4UH 1RSOB 1BBT2 4FD0A 3VKNA 4AYEC 4W4KA 2VDNH 2W60B 4WFEA 5GGRB 4JYAO 2VW4A 5DUUA 2MCG1 2UUDK 1ST8A 1EHAA 5JCTA 1M9WA 4ZOBA 4ONGH 2OYMA 5C9AC 1F58H 1KY6A 4JRYA 4PJGE 3PWUA 3WB2A 1L9MA 3SKOA 4YHZL 5I18L 4PTUB 4XF3A 5A3PA 4TL5A 1VF6C 2VXVH 5FW6A 4B3TB 2Q1EA 3KHOA 4AI7A 4WSKA 4ZYKB 1LHOA 3X13A 1F6FB 5I8SA 5TJWK 4JN1L 3RWEA 2QVMA 1HOEA 1QBBA 1LO5B 3O6FA 1BFOB 3MJ6A 1T89A 4N9OB 4LCWE 4NRZB 4YE4H 3X14B 4ZZ8A 4AQZA 4YAQA 3J80N 2YA1A 1MS9A 4IV3A 3P3RA 5ID1B 5IK7A 3DX8B 3L3GA 5FS5A 4P9PA 2P80D 3QEHA 4L9DA 3SD5A 3BAJA 4DPCX 1BVZA 5EIBD 4PJIF 5I1DA 1I8LC 2XLFA 4Y7OC 3QFDA 1V6MA 4MX7B 1XGQA 2E46A 4NIYE 3T6VA 3ZDWA 3ZE1B 4UM9A 3JALA 4DP1X 2XASA 1JUIA 1ZLUH 3V2AR 5FNVA 1ULOA 1SF9A 3NRQA 4PRIA 4CVXA 1YIPA 1Z7S2 1EAPB 1F02I 4ZO8A 2HR3A 1YY8B 1TZGL 4HHGA 1U2HA 4XPFH 3JAWB 5L0QB 3OEEG 2BZCA 2DI7A 4YM0A 1FAFA 5APAA 5L9RA 4LVHC 2PWEA 1E8ZA 3NIGE 4IOIB 1IV8A 3FJTA 1MMMA 3TC9A 1FZJA 1ENSA 1WS8A 2A9BA 3T6QC 1I7UA 1GN3A 5LN8A 1NZ6A 2X2HA 1BQHG 3B8NA 4UT9L 1JZDC 5DK2A 4U1LB 1MQTB 4HS8L 1QI4A 3I85A 3PDOB 1ZREA 3BT2H 4HEME 2C5DA 1NGYA 2ILLA 2WCPA 3ZRWA 1F8VA 3UJQA 4AHYA 4B4PA 4FQ4A 2RB8A 4AK1A 3VSVA 3ZHDA 4XCNB 4E41E 1NKDA 1FNEB 1HI6A 1OTTC 4KJPC 4DWHA 5ITFA 1SC5B 4N0CC 5A1FA 4LP8A 4IIQA 4AGVA 4ELKA 1QOSA 2ESVE 5T3ZD 5IOPB 4HZLA 5FK8A 2AK1H 5CIPB 1BLIA 5T5LA 5FP4A 3BN3B 1BXHA 3IPVB 2R16A 1WD9A 2NPIA 3NFSH 1MW0A 4ZG1A 3DYPA 3PP4H 4A2GA 2HWD3 5C3RA 5JW5B 1G7LB 3TGXA 3WKMH 1NGXA 2NW2B 3TFBA 3QS3A 4ZFOL 5BXFB 3B3BA 2L6LA 5BZXA 4R6UA 1Z9LA 3GNEA 4CYDA 3HR6A 5HVWA 4MQXD 5EPMA 5BXZA 4XCFH 4NJ9H 3ZYJA 1CICB 1GZHA 4JC1A 3VNZA 1SESA 3TAYA 3REWA 3QOPA 1YVLA 1KPVB 3LD8C 4U0RC 5CIRA 3VBUA 1HINH 5CJOH 3ZTCC 5D4JA 4ZQKA 3UKTA 3KYNB 3VDDA 4FPYA 3LFIA 5DRXB 2YICA 3A22A 3UO8B 3V5DB 1F23A 4OZIB 3TZVC 4TT3G 3QA3A 4OCXL 1IGML 4TVSa 5L9DL 4I1NB 4WCYL 3VV1A 1OJHA 3IF1B 1B0RB 3FWEA 4Q0PA 4J6GA 1IL1A 1CXIA 5IJ0A 4L1LA 4ODVL 3VFTB 1C08A 3WFDH 3OG4B 5BRQA 4BUQA 2ARCA 5CNAA 1YFUA 3PV6B 4M3CE 4TLSA 3WB1A 2Q76B 1IIKA 5I1KL 3DJRA 1XYNA 1I8IA 3BVUA 3BH9B 1I8KB 4MJIA 2R1DA 4HSAC 1CAUB 3GSUB 1E5SA 4Z3HA 3R06A 5HD8C 3CPWU 2IH3C 5IEKB 2VNOA 5KW9H 1VCBC 3ZYOA 2E5LO 2XG5B 3ZFEB 5IVNA 3WNOA 5SWSA 4LVOB 1F35A 2DM2A 2E9JA 1J3RA 3H1JH 1FL5A 4OAWA 5CS7A 3UG4A 2QVSB 3IIIA 4L97A 4BQ2A 1F56A 1ZLSH 2GCYB 5BY5A 2PCFB 3AMHA 3IDUA 1DQIA 1ORSA 1YN7B 3DJ9A 3FFDB 1WLTA 3JWNG 3V4VH 5A2KH 4GINA 2VZSA 2X4TA 2VCAA 1A7RH 4W4OC 2IAMA 1BSMA 3VXMB 3V0JA 3DXAB 1N9PA 4NC0B 2AVGA 4B9JA 1AXZA 3VBOB 2BIIA 4N8VA 4MJ6A 5D8JL 3VGBA 3DXUA 4BINA 1HXS1 3AFKA 1UH2A 1TJHH 1ZBE2 1WH0A 4IMLA 5DJ8B 5CKAA 5DM6V 5FLUA 4WZCA 2O61A 3SDLA 3EO9H 5HDBE 1FV3A 4W6WA 3VSUA 3EO1A 2QGBA 1OWWA 1PKQE 4XW3A 1VERA 2BJSA 4L4TD 2FMYA 5IVEA 5IP4A 3A6OA 2P3YA 4F2ME 2CTVA 1N1TA 3TV3L 5ITBL 3P3YA 4A5UB 3NGBB 1RUAH 5DO2C 3S37H 3HMWL 4WI2A 2NXYB 4TTGA 3AAZB 4FL4C 4JO2H 1ML0A 4TV3A 2Q3AA 3MLZH 3WTWA 1OPGL 4LNVA 4A6OA 2P45B 2Y06H 3S88L 7FABH 4BZ1A 3US0A 2DIBA 2OL3H 3STZA 4JFEE 5EC1C 1KXQA 2PELA 4CNIA 3US9A 1YWKA 4DV0B 3EHBC 4H8HA 5T1JA 1HLCA 5C6WH 3M8OL 5I1HH 1BBJA 2V17H 3RWGA 3B5GA 3S3DB 5MENA 1R3IC 4P2QD 1OK0A 1SHMA 4ODUB 4PJ5E 5CU5A 4ENZA 4F7MA 3W9EB 2YO3A 2Y1VA 1QPPA 4L9LA 3CXHF 1NC4D 2FO4B 1E7UA 4P46C 4MGZE 1HE7A 1JFFB 1NU1H 4E4EA 1DSFH 1ZHKB 4K9EL 4FMFA 4RDBA 3MW4A 3UERA 4DGIH 1ROPA 4R52A 3GHNA 5HYJB 1GYVA 3ATAA 4G5AA 4IKKA 4S0SD 3WNPA 1QHDA 1W8UA 3GZAA 4LAQL 4HK0B 3QXUA 3VXPB 4DVBB 4PY8I 4N53A 1NBVL 1WW4A 3WIIH 2R30A 1GNHA 4G8GE 3DSNA 1ZSHA 5LK5A 4UF7C 5GHWH 4LT5A 1BJ1H 1IAIM 1NTMH 1BMFG 1W9XA 2VO5A 1MZ6A 3ZYIA 2PF4E 1JZJA 5DQDH 4KMTL 5IYZA 4XGZA 5DHYB 5EULV 3NAAH 5FM5O 5I15H 3MNZB 4L0YA 5HCBA 4A6YB 3VKOA 4QOKD 4UV4L 5E8EA 3QAZB 2VE6A 1JWUB 1MCPL 1UB6B 3C2AH 3POHA 2BTQB 4HUCA 4UOJA 5ANME 4ASKA 1JPFA 4D0QA 3CJIB 43CAB 5F7LB 2X6BA 3U6RB 2A0LC 2VDRB 1T6WA 4CN1A 3QEGL 2DQIH 4LLQA 4TWKA 3MJ9L 4PI2A 4H0IA 3H6JA 4IV1A 1ZIAA 3ARGA 3EJYD 4MD0A 5EXOA 3JAKA 4OPHA 2KBGA 4Y16A 1UMIA 2R51A 3K2IA 1EBAA 3OPZL 3QQDA 3ARFD 5FUCE 1XR8B 5CBGA 1M05B 2HAZA 3MRBB 1QI5A 4PA3A 1NUDA 3OG2A 1K5MB 2JNZA 3CAFA 3MJ7A 2Q8VA 2WWUA 2LABA 3TEUA 4AHXA 4KGGA 2YLHA 3WTVA 3OGGA 1R1A2 5JI7A 4M7ZB 4YJ2B 1BJ8A 4WK0B 4JFZL 4X0KA 3RYIA 3QIBA 3N2KB 2X29A 5FBJA 1H2SB 1N0XL 2GHYA 3SE4C 3UKMA 3D48R 4XACA 2WTRA 2O72A 4XDKA 2VBDA 5EHDA 5GZEA 2MCPH 4GWMA 4JJHA 4XN4A 1Z5VA 2R83A 4LO7A 1AROP 2LGQA 1YC7A 3ZN1A 2BMKB 3MRKB 4Z0BH 3BAYA 1Q0XL 3ULVD 4DKFL 1EHXA 3A4AA 5CADA 4G80A 2WJ5A 1RULL 3NIDE 1E4KA 3CU7A 1AYRA 4LPUA 4XX1G 2A4ZA 4Y4KC 2BEOA 5ICUA 4MA1B 1S9XB 4H1LA 1LEMA 4EZLA 5FDWB 3O1PA 5EDXA 2DH2A 3M1BA 3LDEA 4MMZA 2CM5A 2IPUK 2Y69B 5CA1A 3C5ZB 3IDGB 3LH2L 1AXTL 4L3CA 4OI8A 2P5BA 5A9GA 2Z93B 5E5LA 3UCQA 1O7DC 2Z8VC 4EE2A 4ADGA 4ZUUB 2OM5A 3IDMB 1LTEA 4AM0Q 2H6PA 2NYYD 5AB9A 2P4KA 1KDMA 3TXAA 3V56A 1WLWA 1M7IA 2W0KA 2F6BA 2TRHA 3GJEA 1A4KA 3I84A 5F1IB 5H35A 2FWOA 3LHPL 2IQAB 2NY3C 4I3RL 1NIBA 3N43F 4DKDC 3O9WA 3CZJA 2DFCA 5FBZA 4A7YA 3TH2T 1F31A 2QQVA 3GJFB 4MXVA 3ZFGB 2ZWYA 4G9FA 3AY4A 4R3SB 3W7WA 5LHIA 4TULH 5KXEA 2OZJA 3VYNA 3LZZA 3FHQA 1MRFH 2V9QA 3D87B 4Y8DC 2HHHB 4YW4A 5HHMD 1T20A 2VL5A 2KLTA 3RBSA 4DN3H 4YG3A 3SLIA 4CDUA 1W9FA 4RCAA 4TQEL 5IJRA 3CMGA 1J9QA 3OLIA 2NM1A 3ISRA 2FR4A 1MVFA 3ZKMC 2WYTA 1OP5K 1A7PH 4K7FA 2ADPA 1CYXA 3SBPA 3T6WA 1KB5B 3G6DH 2BRQA 2KH2B 3F7LA 1NFIB 4YWAA 1T3FB 3DUSB 2H8PC 1N4CA 4B3EA 1MS0A 4QX1A 4WKZB 3WY3A 4WTQA 1RP3B 5C8CC 4JI8B 2GJ6E 3K0YA 4NQTA 5J6HB 2E0PA 1NG0A 3BVNA 4WQOA 1FE8H 1JXJA 3WELA 3AQDA 3LIZH 3VKMA 4IBYA 2F4VB 5DT1L 1DK1A 3W0WE 3MRPB 4JZ2A 3LKQA 4R4BB 3QDME 3QQ3B 3S5YA 4HJJL 3RDTB 1HXKA 4MQ7B 2ZS6B 1KPRA 2VSKB 2VN3A 5D7LB 5T5FH 1NFDB 3UGXA 4PY7A 1I9IH 3CEIA 1MHCB 3W56A 1E2ZA 4WNQA 3CFEB 5AKRA 1D9KB 4WUKH 1LCLA 4JY6B 2IG2H 1Q38A 4U1NA 5FKPB 1GMGA 4F7CA 1KV7A 5EO0A 4MDIB 3U78A 3GMRB 4A63A 3GWKC 1N34O 3EFDL 1M4UA 5CEYB 3TWYA 4Z1PA 1E5AA 2Y7SA 4KDTA 1WAAE 3S3XA 3V4PH 4V1DE 4N1CA 5C0AA 1H1IA 1AACA 3NJXA 2B2XH 1BV8A 2DICA 3F5WA 2EDWA 4ZI7B 4JE0A 1CJPA 2AK4E 2RR12 2YXSA 3UGHA 3KPMA 1PLAA 1MQ8A 3KLHD 1IVTA 3NZHH 3D39D 5A16A 4HLJA 2NY0C 2WXRA 4GG8B 2ITDC 3IDNA 4MSWB 4QHUB 5D2LE 5DK0A 1KC5L 1SYSA 2WUCH 3EO0B 4O02L 3TA3B 5IR1B 5H5NA 1Y18B 3AWGA 3I75B 4QGTA 5CB7A 4X5XA 3C08L 1LOFA 2D6NA 3MAQA 2BINA 5T1KD 1OA4A 1JGDB 1FHGA 1V6NA 4OGQB 1K9TA 4HF5L 1WSST 4JPRA 1E27A 1BOGB 1IGOA 1DVFA 3ISYA 1AX1A 3VXSD 2W1QA 2A71A 6CGTA 3VGDA 2P6JA 5L3CA 4P5TC 4ZSOA 4BRVA 3QPQC 3VI3F 1BBT1 2VLMD 4MQSB 1UPSA 1J0HA 4QY8B 3EYFA 4UT7H 5LHHA 1ZZ8A 4LHUB 4FTVA 1XSKA 3RPKA 5JR7B 3MREA 1XNCA 1BZ7A 1CF8H 1UACH 4HULB 2G1MA 2VVEA 4NO0B 4OT1L 5H37A 2A9NH 4BSWB 1OUXA 5J98B 4GAJH 1UWYA 3FPYA 4C4KO 4DQAA 3VFWA 1HH9A 2EDOA 1F11B 2BVOA 3TM6A 3OE7G 4HKWA 5GRZA 4GUPB 3CLWA 4X7TB 2JIXD 4F6EA 5BZWA 2JVDA 4C8XA 5J89A 5KVFH 5LWYL 1HXS3 3WQ7A 4QXUH 3RNKA 1U91B 3B7SA 2R69H 3N6YA 4A7UA 1ZA6B 4I87A 1DBAH 1YITV 4PB0H 2QPDB 1E6JH 1XE7A 5H6QA 3L3OA 2BZDA 5ELIA 3O0WA 4MXWH 2OZNA 3VZNA 4JZJC 4PIBA 3KLQA 1SM3H 1YEJH 3AXLA 2PR9A 5BNOB 2XTJC 2AXJA 4YEFA 4GLRH 1CXFA 1FZOA 3MRGB 3MICA 3VBRB 2OCCC 4XBFA 3BH8A 1IZJA 2WRAA 3OC5A 1NCHA 2WDBA 3V6BR 1Z7S1 3IGAC 2V7QG 3AITA 2DQGH 1F90L 3NIFB 2H3OA 3QUGA 2XXCB 5CBEA 1PZDA 1NA1A 3APBA 1PPJH 4KX8A 4W9EC 4YMPA 4BQ6A 4YUEH 3R4DB 1O75A 5GGSA 3BUPA 1TTFA 3CVHB 1CFTB 4HNAB 1XNKA 2OPWA 4G8IA 2LLGA 5KVDE 1E5BA 3K71B 1GTNA 3ZKQD 2EYRB 1C16A 4M3CF 2A6KB 1QLEH 1ZE3C 2FJGA 5F97E 1XNBA 3SOBH 2QQWA 5JXJA 1A2YB 2EVHA 2JX9A 4LGSB 4BLIA 1M3IA 1T1XA 1Q6IA 4RMUA 5EOCH 2F95B 4GSUA 4EUPG 3QAQA 3S3SA 3JBG2 4ZW5A 4QRRB 1ZSDA 1OF2B 2R0FA 4MS2A 5GZOC 3Q5OA 1M7DB 4LARL 1F8TH 5FDBA 2XLGA 3CSFA 3HZVB 4NZTL 3OUJA 2XTLA 1D5NA 1GK9A 4JI0B 2VMHA 3IB3A 2BUKA 1YJKA 3KNBA 4L3EA 4Z7UE 1SEQL 4X4XA 2H0JA 3HRZC 2WNVB 4EJRA 4P3CL 2NY6C 4DP6X 2GUZB 4FLYA 2JB6A 2ATAA 2OUHA 3R4RA 1UT1A 3QJUB 3FFCE 3OUHA 2V4AA 3U9UB 1AR4A 3G5XB 5ILTL 3HG2A 4MMXB 4JDTL 1V9U2 1YFYA 3M3EA 4K7PX 1W72H 1I4FB 4N0CD 5DHXB 3NCJH 1RMU2 1S72V 4JFXB 3E8VA 2G9HB 3BVXA 5DJZA 2YZ4A 4I0BA 3S0PA 2DQ6A 2HG5B 4LULA 3NABL 5JMOC 2R0WL 5BNXD 4NI3A 4DV2B 2HYMA 3ZEDA 1B4TA 3GK8L 3HG3A 4H13C 1XU2A 2QQLL 4EAEA 3WP4A 3VD9A 2WLNA 1ZCRA 3H54A 4YHIB 4OZFH 4U6HA 3VWJB 2Q8BH 3KCCA 3ZHSA 2ZXDA 3S48A 5D1XE 3BIBX 4CMHB 4XPTH 1TG7A 1E65A 3D4CA 4OV5A 4HW6A 3WSQL 1RJ8A 1AQ8A 2P9RA 5E2UH 3H9SA 2XN0A 4LF3B 5J3HD 5EBMC 1WG3A 4HAKA 4PJHF 5DJXB 4AI9A 1XCTB 1GC1C 2OW7A 4HBCH 1TPXB 5KANI 2VLRB 3KEHA 3BIKA 4KK5D 3ZYBA 5D8AB 1JK9B 5A3UA 1RZKL 1V7NH 1E28B 3WIHL 4WFFD 3T0ED 1DQLH 4XF0A 1BOYA 3K5RA 4F91B 1BXXA 1KGCE 5HDOA 2AGSA 1B2WH 3IRCA 3NJJA 2FH6A 5HGDB 2VLKB 4O4HA 1DO5A 2C26A 3ZSKA 5FO8B 1IFGA 5I26A 3S4SB 1C7TA 3BUDA 3L3JA 4Z7VF 5CINL 2NNUA 1G7PB 2FHCA 4Z78B 2F9BT 5B4MC 2JG9B 1H3PH 5K33A 4HKLA 5C86A 2JENA 4PFEA 2VVFA 4Q0UA 4FLOA 1G6UA 3AG4B 3NTCH 4UIMA 4P14A 2G38A 3U1SH 2ADGB 4I0KA 1QA9A 5BUAA 1YQ5A 4RIRB 1P9MC 5HD8D 4ZPIA 3W7TA 4ELMB 1BZKA 1QYGL 4CC4A 1DFBH 4CZZA 3QULB 2ZKYA 3TBWA 5LGHL 2B8OT 2WXPA 3WAJA 3VZOA 4KBPA 1OSPL 3KW7A 1MZYA 2CKBL 4HEPG 3V52L 4CEYC 1QO3A 3LNGA 3X2QC 2D7PA 5AL0A 1IRAY 1FLRH 2A1XA 1IBMO 1OD5A 5B7EA 1AO7B 1IE4A 4E9LA 2B9UA 4MW3A 1XEUA 2XV2A 5CLWA 5JW3L 2P34A 1DR9A 2LTNA 3VBFB 3WXVL 4I0XA 3AJ7A 4Z7NB 5ABDE 1NR1A 2A06H 4E4DX 4HWBA 4FTEA 5LP6A 3FYEB 4YRDA 1YIJV 1NL0H 2ADQB 1ZHNA 3D25A 4I13B 1U3HB 4JPQA 5HHNB 1ZT7B 3PP3K 4PGZA 1K8AW 5TH2B 1E4XH 3FX7A 3N44F 5CKNA 4YSEA 3WTUA 5FKCA 1T83C 3TEYA 5FWEA 4GX2A 1BVLB 2ATKA 1YMHA 2C4FT 3OOXA 4KKLC 3LQAC 2ZCEA 3U30C 1T5XB 4LIVA 2QKDA 5IAXA 5CN0A 1NKRA 3ZDXF 1O8PA 5I9QC 4OFDA 5GJSL 4MD4A 1QJFA 3II3A 2FAUA 4EN0A 1OA2A 3CN4A 4PJ8A 3M3QA 5DO2D 3VFRA 4H25A 5AALA 2DIAA 3RB7A 4HVBA 1MN4A 4IGBC 1I8MA 4CXWA 4ZFZA 3Q4HB 4FQXB 4BUGA 3RZCC 3K5LA 1TJXA 2VC2L 3JD2A 4QRSA 1V54C 3S35L 5K9OA 4DRXB 1LGNA 3OGCB 1Q8SA 5FZHA 3FRPB 1NAML 1CFNA 1XDCA 2WQZC 3S5AA 3HIFA 3WFBH 4FPLA 2WB7A 2E86A 4NQQA 1RIUL 2MPAH 1F6AA 2EINC 1AVBA 2ARXA 4UVAA 1U8KB 3JWNE 3SJCC 5F1NB 1X3DA 3X3GH 4YDMA 5FYSA 3GRWL 5DGRA 5E1GA 3CU1A 4AVJA 4QHBA 3W9DB 1UZ8A 5GGSY 3MV9B 5D71L 1LEKA 1N0LB 1OB0A 1K4CB 2I07A 4WO4D 5EBWA 1Y0LA 5BUPA 4O4JA 1E9QB 2WW8A 5FYLE 2DLEA 3R8QA 1MW1A 4LCIH 1W9WA 1IAOB 3EOAA 5TK4A 2UWBA 1SFHA 3L4XA 4CC6A 3F3HA 1S5HA 3MUGB 3UDWC 3QG7L 3HC3L 4JI7B 3HIZA 4PN6A 1W8OA 5A6IA 2HWE2 1QATA 3DX6B 4WHYG 5C0ND 3KG2A 2DVGA 3FN3A 3RFZA 1JPST 2Y6FA 4HKXA 4JRWA 4LAJH 4F8OA 3BIWE 3IMTA 5EYPB 1RPKA 1NCQA 3EYOA 3KJ6H 5KXBA 3GMMA 2VCMA 4JTDB 2E8ZA 5F8RC 4OHXA 4QRPB 3RIAK 2VB5A 1C57A 2H7WA 4GAGL 3QUMB 3ALWA 4KMQA 2EVXA 2AJSH 3DOSA 1OF4A 2HH0L 2DQJL 3JU9A 3I55V 5IW3A 2BOCA 1NCTA 4NRYA 4XVJL 2WS92 5A3OA 5K1NA 1M90W 4NP9A 3F00A 4PJEB 2JKSA 4YFLI 4PJFF 1BMZA 3WG2A 4GMP1 1OIOA 1BWWA 4GMTH 4KJQC 5B38G 2CK3G 5T3XL 3PL6A 4QXBA 4X1YA 5GLWA 3RGHA 1R1A1 1V0AA 3FLTA 2A0LD 1X5LA 1BBT3 1XSJA 1DTOA 1MI5E 1LE9B 1PMIA 4NPYA 5GXBB 3DPDA 5EA0L 5C07D 4YX2H 3O1TA 1Q90D 4NUQA 3NG5A 4XPGH 2NUPB 5F3BA 5JPNC 2UZYB 3L6FB 1SDDA 1A4AA 3AM8A 4GQQA 1KKCA 2EACA 4X62B 2ZHMA 4LF4B 3SE8H 1Q94A 2D2CC 1U93B 1D7BA 2YD6A 3N7JA 4N9IA 3C60B 1NVPD 1MCJA 1NPJA 4J9YB 4DR7B 3PF2A 4N6QA 4HBNA 4E0RB 4MNQD 4JDMA 1HNZB 2ZAIA 4IRJB 1SJEA 1VGEH 4CILA 4DAGL 1DYPA 4MNGA 2XN1A 5EU6A 2VKWA 4BH8A 3VXTB 3KDPB 1BF8A 5KA6A 3RB5A 4YXHH 5FZCA 2YS4A 2J1YA 4JYCA 3UGUA 3ETGA 1DN0B 4KI5F 4KUCD 4JFQA 5CUSL 4ERSH 5A43C 1L0QA 2AV7A 2J5WA 1XILA 4P5MA 4I18B 4ZOAA 2UU9O 5E2VH 4MGXA 3GS7A 2K0RA 1UOGA 1M2OA 1Z7S3 2XWBA 4LXFA 5KSBA 2XFXA 1TEGA 2EIGA 1PGL2 2DRUA 1AJPA 1GGCH 1ULFA 3QNXA 4OGAC 4WVMB 1US6A 2O6DA 3MLRH 1N8ZB 4QLRA 1JJ2U 3WJLA 2MCMA 1W9YA 2A9CA 3FUFA 4EOWH 2MQ3A 4CP2A 1AYOA 4X98A 4AFMA 1HS6A 4ODSL 1HIXA 2Y3AA 4G7YH 4HPYL 4LL4A 4YBLB 3F2ZA 1VESA 3A6BL 3NJKA 3BKML 3II2A 4XVHA 5HDQH 2BHFA 1RJZB 1WBZB 1F42A 4JRXE 4L9BA 1UYWL 1D6VL 1NS1A 3GBML 4GW1B 4XN5A 3V4VA 1V6KA 4K3EL 4M5ZH 4EDXA 3SYQA 4R96A 4CGUB 1MOEA 4AK2A 4TQDA 1SEFA 1IEBB 3NQHA 3POYA 2EYSB 5KBPA 3RUGA 5JH7A 1JJUA 4YZ5A 1AJ7L 1RM1B 1HN0A 1KJLA 4AZ8B 2MRYA 4M6OH 3HB3B 5LGUA 1A21A 4OD1L 4RAUA 4YSTA 5AOIA 4ZUSA 2A9HA 2V73A 3BOPA 4XX1E 3BQVA 1OAXH 3GB7A 4ZMOA 3A8TA 1OF0A 2XWCA 4WLCA 5CN1A 4YZFE 3ZJZA 1S0IA 5EZWA 5F32A 4RL7A 3CCEV 5JVVA 4Y1AD 2DB8A 2YPLA 4YBHA 3UK9A 4RMBA 1A3KA 3CFMA 2CO3A 4Y5XA 1OP9A 3NPZB 2Q7YB 1BMGA 4XP5H 4BQCA 5FXWA 2MQCA 1C5BH 4ZPTB 5C0CD 3U6XS 1MXDA 4YSAA 1J3PA 2YI8A 4HCIA 4FOYA 1RSFA 4OUSA 1JMZA 1EO8H 4JO1H 4FMKA 4YO0B 2OL3A 3D5OA 2RR11 2P7TC 1MCFA 2B4CL 2ZOUA 2I26N 2BC4A 3C8XA 3KR3H 2VISB 2ZOKA 3HE7C 1ONQA 5DA4A 1SMAA 3WNMA 2W0XA 1MG1A 5I17B 4QGMA 1DGRN 5TE7H 4Q4X2 2Q6AA 1U58A 2O5YH 2OXHB 1IM3D 4X6CF 1DJGA 2FL4A 1FWXA 1IBLO 4IRZH 3ETDA 5KWYC 1LWRA 2XN9D 4N0FA 3LMJL 3ZW3A 2GK2A 4ORZC 5IQ9B 3CJXA 4HCRH 3SPGA 4WSJA 3ACLA 1AS7A 3FO9B 4NXMO 5IJ9B 2HFGL 3IDJA 3PJNA 1NZIA 1LO4H 3HI5L 1NZCA 4GRLA 4JFHE 5AOLA 3ZSEA 3ZXFA 4I0PC 3K79A 5JQGB 4ZZKA 3NMBA 3HAGA 4RDQG 4LKCB 4FI8A 3UBXB 2VPVA 1IBKB 5B8CA 4JKKA 2D6LX 1Y74A 2PP8A 1A14L 4GQRA 4W65A 2NY0D 1DE4A 4JCWA 4IQHA 2RS52 5TQ2H 2F08A 5DJDB 2LQRA 4AYFB 4DW2L 1U4FA 2DWDC 1SOXA 3NJMA 5DJAB 7TAAA 3R18A 2AHIA 5HHOA 4Z7UF 3EVKA 1CIUA 3LS5L 2VQEB 3O4LB 4P5SA 4X6DA 3R66A 2KI6A 5C97A 5G05L 1LESA 3E6CC 2ETNA 2ED6A 4N2KA 1W2AX 4G3YC 4IE5A 5MEOA 3ZBMA 4P2OC 1Y76A 3T4ZA 3Q1EA 4FXGA 3OQ3B 1S0GA 4FLQA 1QBZA 3D7PA 3QPQD 4C8DA 1OTUC 1EH9A 3S36X 3W5MA 2BWIA 4PRPB 3WW1A 2BBAA 3QRGH 4GIQA 3S2CA 3AXHA 1IPSA 4ASLA 4O4IB 2XPGA 3IFPA 4OW6A 2FWLB 5IBUB 4HK9A 2E51A 2WT1A 4Y26A 5IVJA 1JX9A 1QWHA 3SE3A 1JCKA 2EP6A 3VYOA 5FZKA 2XX1A 3V6OC 1CL7L 1UVQA 1G9NC 2A9ML 1SUHA 3HAEB 4IXLA 1XBRA 4NKIL 1UX6A 3TXSA 4KP4A 1F5FA 1I5XA 1VEOA 2EUWA 2VTFA 4EYUA 1XGTA 3E86A 1FL3A 4FNTA 4DERA 1F4MA 3AK1A 2P8MB 1A6UL 1KIPB 1RLBA 2XNAB 4KJYB 3E0GA 1YHPA 4X66O 2W95A 3QEUB 4M5YH 4ATTA 4NEHB 1EEZA 1NEPA 2EDDA 5IM7B 4AQ1B 1K6QL 2XTJD 4HXBL 2K70A 2PETA 3KWUA 1UADC 4M0HA 1U8LA 1GJIA 4W9ZA 3G80A 4BK8A 4GUCA 5DFTA 5JDSA 2XKOA 1AYN1 1FFTB 4J6IA 3C6LB 3JBG1 2WSDA 2FZ3B 4EZHA 1F3JA 3O4OB 5IF0A 2CTWA 3ZHQA 1GGYA 3DIFB 1KUQA 4TF4A 4YGAB 5C08D 4RFEA 2YKLL 4Q6KA 2O0OA 5SWZE 1D5RA 3F2LA 2WLJA 3RT3C 3NCYP 4Q26A 2WUHA 4LC1A 3MYZA 4ES9A 3BAEH 2QUOA 3O41B 3O7OA 3CLFH 3L75H 3I6KB 3K3QA 1WFNA 1CF1A 3CZEA 1NPUA 4TQ8A 2WSVA 3IBOA 1ETZB 3OPUA 3LEYL 4FXKB 3ZYHA 2FCTA 1EN5A 3PQYA 4OVEA 5DZVA 1IILE 1Y6MR 3KV4A 2HT4C 3RU8H 1YYNA 1CEZA 1KCSL 2V2WA 2Y64A 2N1TE 4P4KB 5GZOD 5I1JH 1E5HA 3DPRB 2VNCA 1V9U1 3EUDA 2X6AA 1L9RA 1NGZB 4JZOB 4KO7A 5HGAA 5EQUA 3U79A 1RMU1 3CX5F 1J12A 3GHBL 4J3VA 2JWPA 1N4XH 2ZGKA 1PAZA 3LAGA 5DS8B 4LWSB 2D2OA 5ALBH 1Y43B 4C1XA 5E1RA 2RCSL 3OMIB 4OUUB 4R26L 5FM4A 3I6LE 3DUIA 2GITB 1I9JH 2ICCA 2NY6D 5JHAA 2E32A 1ZTXE 1YYLL 4H26B 4TN7A 2JDYA 4JI3O 3LV3B 5CF3A 1GP5A 4H0LC 3S97C 1BREA 4PELA 5JIDA 4Y1VA 1YEWA 3GVMA 1BQKA 2JJUA 4ZUVA 3IAPA 3ATFA 1CBVH 1GYCA 4KQ3L 2J1TA 2BFUS 5KC6A 1JAEA 2DWRA 1X5ZA 4YSOA 1J5IA 3SH5A 4Z7QE 1ACXA 1EAJA 1DJXA 4HK8A 4GMP3 3QJTB 3MDPA 3BGMA 3GBEA 3IE9A 4I2XA 1BBDL 5A7EA 4AGQA 4D6TH 1D5BA 2YOCA 5K8SA 1R1A3 4LCWD 2FHFA 5E6SB 4YHPB 2ADJB 3TBYA 4MKMA 3CXDH 2YA2A 1U5ZA 4X99A 1S5IL 2VYRE 4P49A 2QHLA 5DGQA 3DDGA 3WL9A 5A7BA 4YM2A 4AI1A 2OS7A 2BFVL 4P8QA 2OSLA 3BVWA 2V2XB 2ZXQA 4NDMA 4NRXA 4YDIL 5T5FA 3VH8B 4J1UB 2F53E 4FT8A 1VRBA 5EPAA 3ROUA 2LQTA 2HVJB 3BCDA 1B35A 4OCNC 1JYCA 4U3JA 2W3JA 1GGIL 5GS3A 3IE4A 5EEXA 5JXAH 5IGXH 1I1AA 3BWUF 2G9GA 1F00I 3L74H 1M4WA 5A6YA 2VN7A 3V10A 1U8CB 2Z31C 4G72B 2NN4A 3ES6A 1WUNT 4AH2A 5INDA 3GEFA 3BP7B 2DYSC 1RJ7A 5H9CA 4PBPA 3RYPA 4AFDA 1ZWIA 1Q1JH 4HH9A 1NOFA 4PF1A 2OCHA 2HPTA 5FZ4A 4HSCX 4QT6A 3H9ZA 1UJ3C 3HOGA 4Q8KA 4QHOA 1RLWA 4M6NH 3N36A 2FNBA 2Q30A 3AM2A 1SF5A 2CUIA 3I6GA 4FNLH 4EO5A 5HPMA 2XJPA 3KS0J 3DV8A 5A33B 3UNPA 5DMJB 4E41D 2ET7A 5ABJC 5IJVA 1HQLA 1FMD2 3X13B 1FAIL 5LQBL 4R9CA 3VFUA 1YEDA 4JLRB 3C75A 3RWEB 1KEGH 4WV8A 3SPCA 1J8RA 1T7VA 1LO3H 2ESVD 3O6FB 3BLPX 4J8QA 1S4IA 3HI1A 4G8FA 4KWUA 5HYQA 2XMLA 1KLGA 2R2CA 4YAQB 1MWAL 2X4PB 3VRIA 2APWA 4PJDA 5C4WC 2FZ1A 3FQTB 5D1ZC 5GS0C 2C9VA 3PWJA 3T1CA 5T3ZH 5C3LD 5I1DB 3E1ZA 3K8MA 3QFDB 4GXUM 5HDWA 5ICYA 3G6AA 4CCCA 1HFUA 3AKRA 1W6QA 2WLKA 4UM9B 1FH2A 2YD0A 4TLGA 5FNVB 1QACA 4FNPA 2VSDA 3F64A 4MA7H 5FO7A 2VVDA 3NN8A 1GU3A 4PJ0Z 3WUDA 1Q72L 2H6CA 1OCCB 1E4WL 1U96A 1BA9A 3ZFFA 5JSOA 2Y07L 2KPWA 3U7YL 3WO4B 1Q8MA 3ZXDA 1FGNH 3IPFA 4N25A 4EI5C 1C5IA 2JJSC 2ZUUA 4BFOA 1W0JG 4MA8H 4N0YH 2ROYA 2Z6FA 3EYPA 1NCDL 2R69A 1WJZA 1WUZA 2IU3A 2VDPB 3C6SB 5DK2B 1AE6H 4HMEA 3D1MC 1AHWB 1MJJB 4P4RB 5TPWH 3U9PL 3VXRB 4BWWA 5HHXH 1GWKA 5BRPA 2HWZL 1NGYB 3IDIB 3K2UL 3ZRWB 4HX1A 3HLKA 4IGBD 4LIQE 4PS3A 4MXWA 3O1UA 2GFBB 3RZCD 4PJ9C 5JOXA 5ITFB 1HI6B 3HKDA 4JM4H 1JL8A 3RYCB 2Z5WA 1AXSA 2X7LA 3L2NA 4MBOA 4CDQB 2HWE1 4F8NA 4HZLB 2XBDA 4RMSA 1OHFA 1G7HA 4X7DC 2D97A 3MBEA 5F89A 2B9BA 1LRHA 3MO4A 2RR13 3SCFA 4BFEA 1AD9A 1GSMA 5E9DB 4A68A 1ZHBA 4CRPA 3LQCA 2YUVA 1RIVL 4RESB 1LE5B 3KJ4B 3BWZA 1NGXB 1TCMA 3THMH 1QXRA 2ZGNA 1F1GA 4D7SA 1HHGA 3OKNA 4G9SB 5EPMB 1FJGO 2V7HA 3DSFL 2BM3A 2JJVA 3L1FA 3NRFA 2EJ7A 2HKHH 4OSUL 3ZYJB 2WVSA 2WS91 4RAVA 3REWB 1ZRRA 5AB0A 3IAQA 2E9WA 1GZPA 3S5LA 3LB6C 4U0QB 5EFIA 4Y20A 1KBGH 4JDZB 1HHHB 3D4YA 1GQPA 5J1XA 3KLAA 3QA3B 3CGTA 1NMAH 2JS3A 1IAKA 3Q8FA 4NIIA 4GQPH 4D0DA 3EOTL 5GIRA 1PZCA 3ZT6A 1IL1B 3VGEA 5IJ0B 4K5NA 1PK6C 1XMQB 2JICA 4ZW8A 1ORQA 5F9WC 3ZDZF 2QDWA 2C3WA 4EQVA 5D7JB 1I8IB 5CFCC 4UIKL 5FWJA 2A77H 2JQMA 2AH2A 2VAJA 3M88A 3LEMA 4FEMA 4JFED 1CIDA 3WE1A 1SQGA 1H9WA 1JG9A 5SWSB 4Y4HC 5GW7A 2YWYA 5DYOA 5FIEA 3WF1A 4OAWB 5CD5C 4KWKA 4N0UA 3JWNC 3DGTA 5H9QA 3IWVA 2YGMA 5FP9A 2OSWA 1MHHB 3HQXA 2WVUA 2X2JA 2GJZA 3FCTA 5L4FA 1O7FA 4M7JL 4WBBA 1V3LA 2VR7A 2IFFL 4PJ5D 4NN6C 3POFA 5JIIA 3QXWA 4QKXB 3ARDB 4PJYA 3MEPA 3IMWA 4ZTOH 2NY4C 1RUNA 1VIWA 3BN9C 4FM0A 5DMIL 1W9TA 4PW3A 3U7AA 5TGBB 4GAYA 4TMPA 5HXVA 4N8VB 4UB0L 5JHDE 1OM3L 3WHE0 4UW3A 1Z9MA 4TXWA 1KB3A 3TGUH 2OWOA 4IDZA 2BU9A 4HGMA 4LSTH 5FF6B 1PGL1 4QQ2A 1EIBA 2O61B 4UAPA 2Z8RA 2W6JG 3GT6A 3O3DB 2VXUH 1AY1L 3UIYA 4B95C 5A2AA 4IBLT 3IAGC 3EO1B 2VTXA 3HUJF 2PPDA 4FZ1A 1CAVA 2C9SA 4G8GD 4MCZA 4ODWB 1DSYA 1YTFB 1CGVA 1XX9C 3HG1A 3KPNB 4UZSA 5TD4A 3LIUA 2H47C 3O2VL 4Q9RH 1JODA 4K7PH 5ESAA 4MH0E 1U97A 4ZNEE 4HIXL 4UTAL 4RS5C 3H6AA 1AYN3 3LRLA 1FC1A 1U8OB 4RMQA 4PRHE 4UAOC 2GTWB 5FHAL 4F9LA 1R082 2XJTA 5FYYA 4B4RA 12E8L 3O3AB 4DUYO 1XD0A 2UYLB 4KKCC 3STZB 1P8JA 2B39A 4AFAA 2NT1A 2Z1PA 5CLTA 3FUMA 2DBIA 4WVVA 3U14A 4OGAD 5MEPB 4AEDB 3T09A 1Q9OA 4ZOEA 1KEMH 2WQSA 1QP1A 4JQIL 3QPXL 3CBKB 1XF5B 5ACA2 3T9WA 4IE4A 3RWGB 2PYEE 1CR9L 1UIKA 2QTEA 5E1AA 4ALAH 1PM7A 2WANA 3JQOB 5I76A 2D3NA 3VFMA 3TBBA 1DP0A 1TME2 4I01A 3K5MA 2Q20A 1ERNA 2VXJA 1SBSH 3F62A 3L4CA 4L9LB 4LSPH 2WZ8A 5C3TA 1G8MA 2EIKC 2EDBA 2X0WA 2FT7A 2J57A 5AVRB 3STLA 1V9U3 1W0PA 2JG8A 3LTVA 4Q5OA 2OTUB 3IRZA 3VI4A 4WNSA 3OSKA 1HL9A 4Z7WE 1T03L 2EECA 3JV5A 1RMU3 5DD3L 3LKOA 2KUTA 4HVOA 1CLOH 4JPIA 1AD0A 2X0LA 2QTOA 3D4ZA 3SBQA 1SN2A 3CFJA 5CKQA 1NOAA 3N04A 1JA8A 2BNUA 3MXVH 1L3NA 3H3UA 3ECWA 3ZRSA 1VQPV 2Z9TA 3NZUA 4NO3A 3OKYA 1FYHB 1XF2A 2D9CA 4OCYL 1W6PB 4AFBA 1W03A 1S9KC 4B9KC 4PG9B 3MIDA 2YU1A 4P57B 4EWAA 1L1FA 4B3MB 1R3KC 2AHZA 2AJVH 4KVCL 3N41F 1DYZA 3U0TA 4Q4X1 4XUOA 5E8EB 3ULVH 1C12A 4GG6A 1K34A 1MCCA 4JFFB 3H85A 4U2YA 1KCUH 1KKDA 2DU0A 2WABA 1LO2L 4ZMPA 3X1NA 1CK0H 2XICA 3KGSA 3B7UX 4Y5VB 5DR5L 2VRAA 5HJ3B 4KZDL 3V0AB 2F8VA 4JPVL 3A4UA 4MG2A 2X4NA 3ZE1E 5IFJB 1NLQA 3M3IA 5FYKE 1ZSPA 3HE7D 2R1XB 3ARGB 5E00B 5FZLA 1JN6A 4Z8FL 1H4GA 3NH7H 4NNPH 4DVRL 4PWKA 3WNLA 3FSVA 2MWCA 2RS51 1OB1A 3QO7A 5IWLA 4AVVA 2NXZD 4GRWH 5EZIL 1QASA 4OHWA 1Z32X 4KK8D 2E7CA 2MTAA 4AYGA 4GBXC 1FV1A 4U1IA 2ZUVA 1YC61 2CHHA 2DVFA 3TN0A 4GALA 3ZUCA 4I2OA 1OBNA 1MKFA 2OKXA 3K72B 1CZTA 1MCOL 4FVVA 5CEHA 1R1BA 4HHWA 5C0FA 1QOOA 3RYIB 3QIBB 3QC6X 4I0PD 1CDUA 4B60A 2F5BL 5FMCA 2Y0PA 1T0NA 2WIMA 3WTSA 3H8NA 4K71B 5F7UA 4Y4FA 3SDDB 4BE3A 4HXAL 1NINA 4FAHA 4GKJO 4LEOB 4MNHB 1YEFH 3BKCH 1X8EA 1FYUA 3S4SG 2BSDA 3MD0A 1YEIL 1O8SA 2MEV2 4BXVA 5ID0A 5SV5A 4G80B 2OJEA 2R9AA 4PSPA 2A5ZA 4UAHA 4XAAA 3ZTNH 3REVA 3TA4D 2A6YA 3M4FA 3FAVA 2GJ6D 3ML8A 3D2UD 4AMXA 3DX7B 4YS4A 4HOMA 2J8UF 4NNYA 3ARBB 2SEBB 4GXVL 1LGCA 1BCIA 1NCNA 4COYA 1BZEA 1XSQA 4MMZB 2ED7A 3K7UA 3PNRB 3W0WD 5EU3A 2PQQA 4P2OD 4Y0GA 4L3CB 3QDMD 3MUUA 3V6ZA 5BV7C 3FTGA 2QQKL 4FJZA 4ONGL 3O1RA 2H6PB 1OTUD 2H3NA 1U5YA 1Y6KR 5TE6H 5BXXA 5GJTL 1HHKB 4G6MH 1EXHA 3GJEB 3T2NL 2YGPA 5H35B 2BXYA 4O7XA 3WN5A 3HZ3A 5J57B 1SDAB 4BUHA 1OHZA 2OMTA 4HU2A 5LO7A 2HJFB 4KBZA 3O9WB 4NBXB 4YXWG 3MZTA 3PUCA 4LSSH 4KI1A 4G9FB 2P5EE 4XNQA 1G9FA 3ENRA 3B2VL 3RZMA 4ZX3A 5CN3A 1TT6A 1Z3RA 1WBYA 3ETSA 1S7XA 5JUEH 4PYGA 4GRMA 1T20B 4V1DD 5KSAB 4CDUB 4Y3OA 2FO8A 2WUBL 3P30H 3H0OA 3GM8A 3F84A 4MAYA 4QU2A 2AK4D 3FQWA 1VQMV 1UOWA 1GW6A 2CO2A 1LHZA 1FCCA 2A74A 2B5IB 1A9EB 2R4SL 3BSHA 1N6QL 3N7LA 1KN2H 3LZRA 1J87A 3QZWB 3CB2A 4JQXA 1L7LA 1N64H 1TVDA 3SDXB 2QGNA 5J2UA 1P53A 3L4UA 1KGYA 4Q1RA 1XQ4A 4JX0A 4KTDL 1F2QA 3FT3A 3DXRA 3HQRA 3BVNB 2W47A 5L7OA 1UXWA 3COOA 3ME0A 5ESVB 5A6MA 4GEJA 3US1A 2B42B 3V7MA 3UO3A 3KF5A 3O6KH 2HWE3 1O6VA 1KRIA 2PWFA 3LKQB 1AZZC 3QWOA 5K9QI 5CILH 2M26A 2D40A 4M43L 4AVSA 4JREB 1HXYA 4PY7B 4H40A 3RPBA 2YD5A 4P99A 1AZRA 3HFML 1OFSA 4QM8A 2CO4A 2OR9H 2A75A 1ET5A 1A4JA 3VXME 4XXPA 4TSAH 1XB8A 3DXAE 1WBXA 3VTMA 4BH7B 1UN1A 3VD1A 3QLQA 4TSCH 4P3WA 2HT4D 1JNLH 3SC7X 3ULUL 4YR6A 1FXKC 4WV1A 1QMUA 2WS93 1IJ9A 1BM7A 5E70A 2WNXA 3WF0A 3HPLA 2ADFH 4GSDL 5EUOF 5C0AB 2FCBA 2FYYA 1NT2B 1EGJH 1N59A 1SY6H 1SUJA 3UBHA 4BIUA 2BZ7A 1K4DA 4PRDA 4R2GC 3T08A 3WMPA 5EF3A 3UAJA 1JNJA 1GKBA 4RMTA 2BP8B 2YXHA 2UUDH 4LKEA 4CUGA 1U8NB 4ICXA 5A16B 5F3HA 4M93C 5F8PA 3FU9A 3PJSA 1SYSB 5FGBA 1TTBA 3WEBA 3RWCA 3U82B 2R4RL 4X5XB 2BV4A 5DEDA 2EDJA 5F70A 3D0VA 4DESA 1Y6NR 3TBVA 3AROA 9CGTA 5B1AC 3OHXA 3QJVB 2BCMA 2IANE 3WFEL 3VDBA 1CFVH 1J5OL 3ZPDA 1E2VA 5J96B 1W2KT 3LN5A 4N6RA 4BEIA 1R1ZA 4ZSOB 6FABH 2YRZA 5IBLC 4C7UA 4WSGA 3MV7A 3EYFB 4M7KH 3TVMA 1DANU 1QSFA 3F65A 1HWYA 1E4HA 4OYUA 1BZ7B 4R0LC 5BPXA 4F9PA 2QZQA 4FHBD 2JEXA 5C92A 2OR7A 4Y1TA 1AKPA 1OCRC 1FN4A 3FMGL 5CZXC 3VFWB 5IW1B 4W6XA 4YWGH 2BVOB 4XQ4A 1XH1A 3U46B 2BCKA 4C58B 2Z0AA 3TEZA 1AI5A 5HYJE 5BZWB 3OR7B 5AZ2L 2H4EA 3HE6A 1QVFU 3RNKB 1FMD1 1QJY2 2XVKA 1A8DA 2R2EA 3J4UH 3ILRA 1FO0H 1WZKA 1TU2B 1S7RB 1T7ZA 4BD4A 5B66Z 2C5DC 3OC8A 4FP8H 5DMKB 2WAAA 4HCRA 3MQIA 5TDPA 2DDUA 1FNAA 5AVQB 1BX2B 5I75C 3FO2A 4OZGE 2YMXH 3R4SA 2J20A 3CCUV 4XP1H 5FMDA 2J12B 2QZ3A 3FFCD 4IIQC 3EGSA 2DUPA 4Z1VA 3BOVA 3E2HB 4NZ8A 3WIAA 5BCAA 3BH8B 3T65A 3J9SA 5AVTB 4MTFA 5IHUH 5FTTC 1F4WL 4EN3A 2UUAB 2WA4A 4JM2D 2JWYA 5L8KB 1SNRA 1CGPA 1UFIA 3E8BA 4J80A 3D69B 2UWCA 3UGFA 5DZAA 1NSNH 1A25A 2UXXA 1KJRA 3LS4H 4HGWA 5F1OB 1E43A 4G6KH 5D1ZD 3TYFB 4XAWH 4PRNA 5D1XD 1J1OH 3BFOA 1T1XB 4ZPVA 5D96C 4AEEA 4NUJA 1GZHC 3L1OL 3P2TA 4QX0A 3TU6A 2E59A 5CSGA 1MQKH 3OYWA 1R0AL 4QQLA 5CZKA 2WWNA 4DY5A 5AYUH 2CA3A 1KXVA 4WCEV 4QYOA 4YH6A 5BZZA 2F68X 2OCJA 3KV5A 2XKPA 4CE8A 3SGKC 4M9OA 3BESR 2ZF8A 4B96A 3GLAA 1KGCD 5F96H 5G5DB 3KNBB 1QOTA 1IT9H 4L3EB 4TSVA 1D5AA 1BVKA 3KPLB 5DAWA 2DYPA 4LPXA 5DUWA 1TDQA 3F04A 5CR8A 3H3PL 1UQSA 2B0SH 3D3VA 3K46A 4UT6H 5EHFA 2WLIA 1UZYA 1MJ8H 2CBOA 2E31A 1JI1A 4Z0XA 5F2VO 3WS6A 4R4ZA 5JJEB 5FO2A 3QCWA 1M06G 1CXKA 2I2SA 2PPCA 1S3KH 4Q74A 5BW7C 4Q4X3 2BSBA 4PJ9D 3GBFA 3CQFA 2WT0A 5AFBA 5FYJE 4UV8A 4M8QB 4NUBA 3IZOA 3AS2A 2BRRL 3NVQA 5E4EB 4CW1B 5GS1A 5J3UA 3S36H 3EJJX 4FZ8H 4TTDC 4DT2A 1GTFA 2A6DA 3P6BA 1T6BX 4KKAC 3DX0A 5C0BA 2RFXB 5E4OA 3RYHA 4J3OF 3LEVH 3E6HB 3VAEA 4U6HB 4CCEA 1RK0B 2W68A 1YRKA 1ULVA 4NBZB 4RETB 2GDSA 5IV2B 2VR9A 2WXFA 3FCUB 4RFNB 3H9SB 4AJYV 2RS53 4XJ8A 1TUEB 4OZFG 1E4JA 3D82A 3CLPA 2YZ1A 1US2A 4BK5A 2NNAA 2N04A 5IFPA 3BIKB 3K5OA 1P4LA 4LASL 3RGVC 2P6HA 1GZQA 3KWWB 3D52A 1AIFB 4Y1SA 2YG0A 3LB6D 1T1WA 3TTYA 2ZQKA 4I77H 2PO6B 1PZSA 3VZLA 3A6CH 1IS6A 4MADA 4R97B 4DW1A 1LGVA 2Y7QB 2CTQA 4FFHA 2RDCA 5LW9A 5LGJA 4R4FL 2AJXH 2Q5BA 4NAQA 1W2OA 2NMSA 3TP4A 1ONAA 4UXAA 4NIDA 2F4PA 3WV0A 2P24B 1G9MH 3BDBA 5JNYA 4NMIA 3V0VA 4BE6A 1S0CA 4WU7A 5DAPA 1P4BL 4P9ML 3TCXA 1KP2A 4QNPF 3RVYA 4N2FA 3ZIYA 1G6RL 1AHMA 2RMNA 1RV6X 4HD9A 2Z4QA 3O81A 3GHEH 4PD4K 2F2HA 1Y9QA 1OPOA 2J5LB 5KYYA 3AKTA 3BAWA 4K21A 3PAZA 2VLJB 1S9YA 4J3XA 3U07A 2GJJA 3MLTB 1NFDE 2NZIA 4DP4X 4JNXA 3DVGA 2V37A 4Y4HD 4P9XA 2CUHA 1LDPL 3BPOB 2VL4A 3E80A 2A79B 2EIMB 4P00B 1FFXA 3ULUF 4YVWA 5DFAA 5FPVA 2I5YL 4AZZA 1QO3B 1PZ5A 1IGIH 4JG5A 4DP8X 5JYMA 1WP8A 4OFPA 5C7ZA 1AQDA 1VHPA 5I8YA 1W0VB 4KROC 4ZAKB 5HYIA 4FPOB 1N70A 2V2TB 5FYLD 4WKXA 2BX5A 2NY4D 1ZLWK 2BWCA 4A6YL 5IBUG 1IKOP 3AG1B 1LD9A 3OAYK 4LLMA 4X7SL 5JHMA 1WK0A 1ZYBA 3MGTA 4AKPA 4GI8A 4G9DA 4QGLA 4HISA 2P80A 4YNYA 2QQPA 3VFOA 2FMLA 2WQRA 1PLGL 2VDRL 1SBEA 2BFUL 3VFSA 4HKZB 1U21A 1DGLA 2KMWA 4R50A 2DWTA 2X10A 4FP2A 1PZAA 3X12A 3Q8AA 1LEIA 3RVTC 1TME1 3BVCA 1ZRCA 2FDHA 5B21A 5C0JB 5HDLA 5IMMA 1AL22 3UYOD 4RR3C 4U36A 2AXTZ 1FORH 4P23D 4U3SA 1I8MB 3LN9A 4EJ1C 1F41A 5C3PA 2K9FB 1RSYA 1NCCH 1Z9PA 4IDJH 5DSCA 3DURA 4KKCD 4GXLA 4CRQA 1XT5A 3M46A 3NAPC 4QPGC 1YQ8A 3WHUA 2CTPA 2YK1L 2UYAA 1YHFA 1P84F 1F6AB 3MV8B 2P49B 1JU4A 2VMIA 5DI8A 4N2IA 1K5JA 2K9ZA 1MOFA 2X4UA 1RP9A 3LNFA 4Y16C 5JIAA 2NTSP 4MTMA 5J9PC 3SCMD 3X1FA 5DUVA 1MI5D 1WZXA 2ZAGA 1IBZA 1UZ8B 2B16A 3QNZA 1AR72 4WVRA 1LEKB 2D3JA 3II1A 2I07B 4XDJA 4XMKL 3BEVA 2F23A 4O4JB 1DLFH 3QO0B 2CDEA 1OW0A 1ETA1 1OOWA 1H9PA 2AYHA 4PIZA 4DV4B 1KJ2H 3NCEB 4NKOA 5IFHL 5BS0B 4AV0A 4QR7A 3SDAB 5FP7A 2D3LA 1NBYA 3DGGB 2Q3ZA 1W2NA 1PX3A 2XAQA 1Q9LB 1S5HB 4DXRA 3AKPA 3ZYPA 1AX2A 3TV8A 4S1RL 2X70A 4GI6A 3OD0A 5EMYA 1FGVH 1A1MA 1RHHA 5TF1L 5JW4Q 4FPCA 4OZ4A 1RPUA 1M1SA 3WKNA 5IB2B 3RKDC 1BEV2 1H3XA 2AQ3A 2K8QA 3AS0A 2WWMD 3GMMB 1IQDB 3P77A 1YUDA 2ZE5A 3GGWB 1KN4H 1SXAA 3GHPA 1F0LA 4QHNA 4Q7DA 2LE9A 4XP4L 5DD0H 4OZIF 3NIFE 1PQZB 5IVZA 4O00A 3ZMVA 5D4IA 3R7QA 3TOPA 4DW0A 4NRYB 3GJAA 5A7NA 3I9GL 3I2CH 1STMA 1QJU2 3FUJA 3IU4H 3WJMA 1JN2P 5JXHA 2WINA 4X42A 4F8QA 3ACFA 1Z9OA 3CFKB 2JD9A 2Y5EA 1VADA 2R23A 3C5SB 3BZDA 4XO3A 4D3CL 1AR1D 4ZODA 3PL6B 4JDOA 1E5UI 3VXUB 5A6QA 3LRSA 3TNMB 1I7TA 2WVVA 4FC3E 4NPYB 3JV4B 3LZOA 5TQ0L 4P9YA 1FDLH 4H8PA 1KB5L 3BPNB 3LX9A 4FLRA 1OLME 4Z3IA 2O8OA 1BYHA 4QRRE 1UG9A 4CADB 4QNHB 4AW4A 2HBUA 5EOCJ 1SDDB 2OZ4L 2UVEA 4KOCA 1HZKA 2KM2A 2MEV1 3KZ4C 5GGVL 4JTNA 1ND0A 4NAJA 5F7EL 5EP9A 4JYYA 1HCYA 4JRXD 1Q94B 1EFXB 4GBXD 2JJ2G 1NMCB 4N1EA 1ZJAA 1VKXB 4NERA 4I09A 3D18A 1S8DA 1FMD3 2DLHA 4BR6A 5I0RA 4PJ7A 5KX5B 1XQNA 1YNTA 1QRKA 1QUNB 5FZ3A 4B7EA 3KCWA 5LBSL 4XBQA 3PLQA 2DYCA 3CSGA 3H3LA 1OP5H 2NNFA 3WDYA 1X5MA 1HT6A 2CXGA 4OKVA 3CFUA 3ZS8C 1HEZA 4XXCA 3ASNB 3DI2B 5IMKA 2FDGA 3PUUA 2NCEA 1AI6A 2B77A 2WXOA 3INUH 2LUWA 3UJJH 2ZUYA 5B1OA 1FC2D 3APDA 3K08A 2H1PL 4JFQB 1OVZA 1WV7T 2BVTA 2IMMA 1NIAA 2EDMA 3FB8B 2BGPA 2NQ3A 1TKWA 5KSBB 1KWGA 4M0NA 5ACLA 1R3JB 5CFHA 4L4TA 1NUFA 4XH2B 2D3RA 1RMFH 4KWJA 4OI4A 4A2UA 1MFAL 3KSCA 2PHRA 5BNNB 2WIIA 3QWRD 4NLHA 4Y1ZA 5EU4A 4YPGB 1WLHA 4OI1A 4X98B 1HX0A 4OLUL 2WK2A 3V65A 4UILL 2AMGA 4XXWA 4P5RA 1RUML 4GMSL 4KDTC 2K1MA 2QJVA 2TAAA 1IE5A 3ZQXA 3ACHA 2VLRE 4LBEB 2AKRB 3GBNL 2UZXA 3B4NA 4NHXA 3SDCB 1V70A 2WLLB 1XXDC 2ORBH 1U6AL 4POZC 1SDYA 3L3KA 3F5WC 32C2A 1YQVL 4Q4IA 3V4VB 4F7TA 4M48L 2WM0A 4YHZH 4XN1A 1Z9SB 3N9GL 4R96B 5T1LD 2VLKE 5IJKA 4DXZA 2PYFA 5IIEA 3N2GA 3H50A 2Q68A 4J3WA 1UURA 2QGEA 3BAIA 4P2QA 3RHWK 4JASA 1WQVT 2KHAA 4JFHD 2PF6A 4M1CC 3RUGB 5JH7B 4X80L 1NCRC 1WB7A 1DQQB 3FB5C 2XWEA 1MQTC 2ZX6A 2GJRA 5DD6A 5D7SH 2VABB 1NC4A 2IF7A 3KXFB 3O45A 2AQRA 4QAMB 1BZDA 1WAZA 3BPLB 2W1SA 5IVVA 3GB7B 3JUZA 1NM9A 5EC2B 2GC1A 2MKLC 5HCFA 2EEDA 5T5NF 2IH1B 1MS1A 4CBZA 1ZA3B 5I91A 2RMKB 4OGXL 1BZWA 2NX5B 2BSKB 4NZJA 3MGOA 4TS6A 4YGEA 1P7GA 4LF5B 1CDGA 2XBTA 3F6JA 1B3JA 5CA0A 1UPGA 1D5XB 4JFDB 4L8CA 2XZCL 1KFUL 2BOBC 2OL3B 5IE9A 1AO7E 3PHQA 1HZHL 3WIFA 4QF1A 5IQLA 2N3JA 4U1HA 4F15B 2X53A 3FS9A 1FNGA 1SVBA 4LK6A 4QOKA 3S34H 1JU3A 3HHSB 1HJCA 2OYLA 1TA8A 4IYHA 4LITA 4FNSA 5BVJA 4TYSA 4YFZA 4YDLB 1H9DA 2Z7UA 3U0PB 5BO1L 4HWZA 4N0FB 3ZO0A 2A1WH 2Q7AA 3RIFF 1DDTA 2OYQA 2LGNA 4MYEA 1V6LA 3QNEA 1PNLA 2ALWA 3CVHL 3QZMA 3X1BA 5JMRA 4XJAA 3IDJB 3K6FA 4N43A 3V5KA 3LDDA 1G7IB 1IGYB 1LNUB 1N3NB 3SPJA 4OIIL 3RZHA 3KDMA 4ZFGL 4NXNO 4ACTA 1C4RA 4QGNA 2IPKB 3HC2A 3ARFA 1Y74B 1AI1L 1DE4B 1NGPL 1UA6L 3B9CA 3JB8A 3SODB 4E9QA 3M7AA 5EWIH 4QB6A 2V5SA 2PAKA 1OT1A 5JW4N 2XOTA 4HKJB 2UUBO 1A8MA 4ZS2A 2WMPA 3A67L 3B02A 3ZE2F 5J37A 3N1GC 4X1IB 1OT5A 1LEGA 2ICEC 4JGZA 4NBYB 4E5XG 1FFOB 3IFXA 2IPTL 3K4ZA 4O2CA 2LTQB 4BAYA 5FUOH 1M71B 4GY4A 5D2NA 1BLNA 1G9NL 3UTQB 5T8IA 2LOEA 4QPKA 4NM8L 3AZWA 4KAQL 5MEOB 2BSSA 3FRUB 1Y76B 2YQGA 1QJY1 3OLGA 5SWZD 1CI3M 2WY3B 4FXGB 2DTMH 1WCQA 5CEXB 3TESA 1UZZA 2Q67A 2DLTA 5IBLD 4CDXA 4NUGL 5HFLA 1H15B 1U0AA 1CZ8H 2VDML 5DAXA 3IFPB 4DQOL 5GALA 1PGSA 1IGMH 5L9DH 2QPFA 1NIFA 4QI3A 4N8PA 3NV4A 1H38A 4R5XA 2ZCWA 4XC9A 3DARA 1BVVA 3ZX6A 5CZXD 4ODVH 3ARVA 1UVQB 2ARJA 4L4VE 1JZ4A 3WF4A 4JDNA 1L9NA 4XZUA 3QZOA 5FY9A 2IOMA 5IYDO 4X9IA 1R6NA 4N5ED 4DIQA 4GWJA 3UXFA 4UTBH 3ARXA 3B6SB 2BSEA 2PCXA 2CWSA 2NYYA 4F80A 3A23A 4FFFA 4HANA 1FL3B 5AENA 5FV1L 2PXYB 2JKNA 3VXNA 3DC6A 1S0JA 5D72L 4I9WE 2VOWA 3QIWB 2EDRA 3I6LD 4YFDB 3UEQA 1YSOA 2ZE8A 1QFWH 3OZ9H 4IGGA 1DBKL 4XMPL 5D4QA 4MWFA 2QKIA 1Q0YL 4NN7B 4X8CA 2ZNJA 5LOVA 1U8LB 3QYMA 1AXIB 2EEFA 1HVXA 4Z76B 3AYEA 3GMQB 3WP6A 4ODTL 4CPBA 4OMDA 1F3JB 1VFAB 5DZOA 5IF0B 4YGBA 2I27N 2FBRA 4NENA 2D73A 4GO8A 4OZHF 2CGZA 4HHAA 5FYTA 5BNOA 2XA8L 5FAAA 5E0FA 2OA2A 1MF2H 1MHPL 4HAFA 3UZEC 2VC9A 5B1KA 1WLEA 1NEUA 2DJUA 2NY7L 2R0ZL 4NHYA 3JSLA 1PSKL 2WYHA 3S57A 4U1MA 3QORC 1DBNA 1KFXL 1NH2B 5KYUB 4M29A 4P02B 2F53D 2PKDA 4Z7OB 1BM3L 1EANA 5FCSH 4P5HA 3JD3A 2BOLA 1ZV5A 4BFIA 1NXD1 3RI5K 1T22B 4Q14A 1JPTH 4OLWH 4QD2E 1KITA 3HOBA 2OMXB 3HPNA 3UYRH 4MDJA 3D08A 2LRPA 4JV4A 1GC1H 1BG1A 3S88H 3W7SA 1PMYA 3WEAA 2UXBO 1GRWA 4GKZA 1BEYL 1ZV2A 2AANA 4M5SA 4BE5A 1WWCA 4FSJA 4IK6A 1HTYA 2PFWA 3GSOA 3QS2A 2OKMA 1F4HA 4F8TA 5D5MF 1TVBB 4CKVX 3I2JA 3M8OH 1DGWX 3TBTA 1OPMA 1Z2KA 3NNMA 4BCYA 5GPRA 3ARPA 4A38A 4JZNA 2MNUA 3BAAA 4J5VA 4DKEL 4CC4C 2XJSA 5JHBA 4QRQB 4Y2OB 3BSZL 3QAZC 4HFSA 4AQTA 3JT0A 5IHBA 1BMWA 1A5FH 2J6EH 4I0WB 1MEXL 4NPJA 2AP2A 4DTGH 1P5UB 1RJLA 4PLKC 5A2JH 3KT1A 4D8PA 4QGYA 3KYOA 4GZ9A 1D5BB 5DHDA 3AZVA 1ZEAH 3D39A 4KKAD 1Z1WA 3AFLA 4LSUL 4NT6B 4AQ8A 4I55B 3GBLA 4YHMH 1RY7B 2GSGB 1H3GA 1I5YA 1S2KA 3GQFA 1XC6A 1KCBA 1FOD2 1CL7I 4LF6O 4LAQH 5T1KA 1HDKA 3U0WH 2ZGLA 5KWRA 4Y5YA 1N5AA 3ERXA 1TOXA 5L88H 1AGCA 2MEV3 1HWHB 5I6PA 1B35B 3VXSA 2H94A 4U3JB 5KUKA 3H7BA 4XPAL 1VAMA 2J1AA 3PP3H 4KMTH 4EF3A 2QR0A 3RGVD 2ERJC 1MJUL 3WUZA 3THOA 3ZHNA 4M7ZC 3BQUC 5EN3A 5I28A 3Q6GL 1SMVA 1DQ0A 3ZRCC 4PCTA 5CFDB 4XBPB 4IL6Z 2IFWA 3ES6B 4AH2B 5INDB 1XL4A 1MCPH 2FLRT 4IEFA 4PJ8C 3D9AL 4G5ZL 4XHXA 5L9VA 25C8H 5GZND 4HH9B 1QHPA 2DJSA 1OHQA 3CCMV 2V72A 1WZLA 3EG9A 3DTUB 2YEZA 3GMPA 4UB8Z 1EGJA 1IG0A 1DTUA 2E26A 5GRXG 3KE0A 3LQAH 2JIXA 2OW4A 1JXGA 4AJ0A 5JHLL 2IVFC 4LIUA 4D7YA 1OAZH 4HPOL 4DGVL 5HPMB 2F58L 3L08A 1M9SA 4CUCA 5IJVB 1JBCA 1L5GA 4TNEA 2Y69C 1WDAA 3EDJA 1JV2A 2G9FA 2YV8A 4CH3A 1Z0NA 2UY6A 3VGIA 3GMNA 2UXVA 5DUPH 2OMYA 1VZGA 3AMLA 3RWNA 1TCRB 3CDCA 3KBFA 1HNXB 5DD1L 5HYQB 4AEMA 3FTYA 5EBWC 4I85A 1W8WA 2J1RA 2CPCA 3LZFH 3DOHA 4RAHA 5G04L 2JJWA 1XL6A 3GXFA 4PJDB 1S5LZ 3IXAA 4WU5B 4B8EA 1H5BC 3PWJB 2HG0A 4K8RB 1SERA 5E8DL 2JLPA 1N0XH 4Y2DC 3G6AB 1VF6A 4KROD 1W6QB 5FAXA 1NC2B 2DMHA 2OJZH 5BPPA 1DL7H 2H26A 3LXAA 3L9DA 2CCWA 1VAVA 5FO7B 4RQFA 3MBWA 1AL21 4XZ4A 3RFZC 1RYYA 1BSIA 4RFOL 3UCRA 1A6ZB 5DQJB 1USQA 2VMJA 1NCQC 1ZRUA 3HMXL 2ZOWA 1RULH 2YB7A 4PQXA 3GJFK 1I8LA 5F3EA 2BW5A 3OXSB 4WM7B 1U8HA 1A6TB 3MROA 4YK4B 4ZHQA 3LH2H 1AXTH 4WFHE 4FFZL 4IEXA 4FS0A 3K6SB 4UDUB 35C8H 1IFHL 3AXDA 4P9JA 1QVOA 4GB9A 4JI4O 3WLBA 4CU8A 1AR71 1TFPA 5FM5M 1E8YA 2NP0A 3QUXD 3MLYL 4HX1B 3VSQA 3O4LE 4IE6A 3QZWG 3FUDA 4LRIA 5IFTA 2PABA 3HKDB 4DV7O 4BQYA 3URFA 3G6EV 4B6ZA 1CIYA 2BP5M 1W05A 2FHRA 2B1GA 2X7LB 1RUH2 4MVMA 4GEIA 4HD5A 5BUGA 4PRPE 3CVCA 3KPPB 3QHTC 1O91A 4LBJA 1VEMA 1JDCA 3FK3A 4IERA 3E83A 3HRPA 1BEV1 1XD1A 3WG7C 3H0TB 4JHVA 1XMOO 3POCA 2CE4A 1Z78A 1K7DA 2V3FA 1BXAA 2UXNA 2OTJV 3HTLX 1QLEB 1OFNA 5A3MA 3QXAA 2DQFA 1HHGB 1LILA 2I9TA 5EORH 3F83A 2R062 5IK5A 1UWWA 3LIGA 1QJU1 5JHDD 4RAVB 3VXOA 2BWAA 2JKRM 2CO6A 5JORA 5F3IA 1GZPB 3QI9B 5D6DC 4XO4A 1LP9F 4CEWC 1PS3A 2YPKA 2ED9A 3WN6A 4M03A 2AJ3B 3TN93 3IETA 3JATA 5KVEL 3KLAB 3MNVB 4H8WC 3RKDD 1PIGA 3LSDA 4IW3A 1TEYA 4PHXA 3OY8A 1AR92 4PBVC 3ABMB 1ADQL 5GIRB 1OGTA 1ZLVK 2VDOL 2HYXA 4MSWC 1QNIA 4PJCE 2BTVC 5LNGA 3NUKA 3T6ZA 4QXCA