3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
molecule keywords PmoB
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
3CHXA 3RGBA 4O65A 4PI0A 4PHZA 3RFRA 1YEWA 4PI2A
chains in the Genus database with same CATH superfamily
2XAHA 1HHGB 5KEZA 4TWTA 1DUZB 4X6CF 5BVPH 2YEVA 5BRZA 1SQBH 4JRLA 5CCJA 3SKMA 3UTQB 4MA8L 4TL5A 2XPGA 1OW0A 1BFOB 1R19A 4JQXC 3W0WA 1I1YA 5CEXA 3RYFA 2JGDB 4HUXA 2EUWA 3WF3A 4PJXA 4BZYA 2R1BA 3JBG7 4BW9A 3U2JA 1QG3A 4HKOA 5IK7A 5CG8A 3VI4B 2JDNA 3DHJA 4DXSA 1DO5A 4Q97A 5B21A 4FABL 1ETB1 4YGDA 1T03H 3MODH 2CRIA 2ZDIC 2JECA 2JENA 4M3KB 1CX4A 3APMA 1UM4L 4V11A 4P9HL 5LGHH 2W87A 3ZMNA 3GCXA 1HT6A 5H8DA 1AP6A 3R4RA 3JSNA 3FN3A 5FXVA 1RM1C 3K72A 1B3QA 1ND3C 2FDFA 1JP5A 2UXGA 4MVTA 5F9DC 5GZND 4XDLA 5IJVB 4RAHA 1A9BA 4EI5D 5EZOH 3CBNA 5I0RA 4P23A 4N5ED 4X6CA 2WO7A 2HLEB 4NUJA 4HZ1A 3DCQA 2HG5A 4ET7A 4DMIA 4WFEA 3AZWA 4WU7B 4PRBB 4YIQB 2FMDA 3L1OL 4F37K 3MJ8B 5SX5H 1OA3A 1H3VA 2O6EA 1OF3A 1CVSC 1NIBA 5IFJB 2H6PA 1R47A 2V7HB 4LHJB 1UCTA 5KYXB 2HVKC 4QE7A 5KG9B 2PABA 2W0LA 3DO3A 3F6JA 1COV2 1JRHI 4EN7B 5I5IA 3NG5A 4LCIL 4IEZA 4NRMA 2AZ0A 3D07A 5A80A 3BAEH 1LK3L 3S57A 1T2QL 3C12A 2DKMA 3LZQA 1QHOA 2WNWA 3O6FA 4FDWA 4P9IA 5KYWA 1E43A 5IMOB 4OUSA 1DJWA 1AGCA 4PB9H 1K4CB 3BVWA 2W92A 3V0VA 5BXFA 2DBNA 1Q38A 3QIUD 4JZRA 3MJWA 3RU8L 5EYXA 3THCA 3UTPD 1VE0A 4HCRA 3IN0A 1UOFA 1LP9B 1VP7A 2UXDB 3DV8A 2R1WB 3DX9B 1DBBL 1CAUA 2A6VA 4I3GA 4NJAL 1G9MC 3QAQA 1AHWC 1MCSA 3C6SA 1OTSC 4L48A 1EJ8A 4HVBA 5FJKA 4ODUB 5CISA 3JTSB 2R0LL 1WA2X 4L1SA 1VQOV 4TUYA 1AD0A 4QOKD 3W0WD 1H1IA 2P5EA 2FATL 3RI9A 5CF3A 4OFDA 1DQ5A 4PP2B 2CO2A 1N3PA 4H1LG 1VBE2 5A6MA 3ZW3A 3DUIA 3OSDA 3JD0A 4FOYA 4O4YH 4BQ1A 5F5QA 5I66B 3VGAC 3I9AA 4NIIA 5JOYA 3FCSB 1SLCA 1U8NA 2VTFA 3ASWA 3H9HB 1B88A 2CO1A 4R5XA 3CDFA 5JQ6H 4CCLA 3I02B 3FO0H 3F04A 3DKQA 4KKAC 2QSCL 1AXSB 2OTWB 1QFWI 4Z2WA 1XSJA 4M6AA 3WIIL 2H5UA 1NCUA 3FFQA 2WV3A 4E2LA 3ECWA 4MXVE 3RDTB 4BELD 1L6ZA 4CC1A 2I9TB 3CE1A 2OVUA 4CZZA 1RP8A 4Z95L 4IIQC 1ZBE1 3KF3A 2Y33A 1CJPA 3P4MB 4J3OD 3R18A 5C93A 1TQUA 4DP4X 1POV0 3B9KD 4L99A 4ZW7A 3RHWF 2CTQA 1FRGL 1E4XI 1UEMA 2DQUH 3KCYA 3ULSB 4F20A 2O61B 1UFIA 2AK4D 3TWCL 1VP6A 4UYQA 5MEPB 4GAAA 3IDGA 4NNXA 1E5RA 5E8DH 3R05A 5FA4B 4GJYA 3E2HC 2YGQA 3M1BB 1RHHA 4J1UB 2PWEA 1GZCA 2DTMH 4JF3A 3IFNL 5EMYA 3WDJA 1HRI1 4PREA 4YHLH 5AVQB 5DVLA 4BQ4A 3PMEA 1AR62 1QEWB 2WUCL 4GKSB 4WTXA 4FPYA 2FJGA 1MSWD 1FL3B 2GW5A 5CWSB 1U41A 2MCPH 4JHAL 4PJ5E 4ANVA 4YS4A 1BD2B 3TC9A 5L7XH 2OSXA 2HT3D 3P32A 3K5NA 1DF0A 3OUHA 1QLEL 1JOYA 2WYIA 1PK6B 4CDHA 3WEBA 4H8HA 3MREB 4M8VA 2GV9A 1T1YA 4JG0L 5DHEA 3C6LA 5HYSG 4LSUL 4L2NA 3QE5A 2Y36H 2PZSA 5C0AA 2IC1A 1ZRUA 2NY6B 2EXTA 5DFWH 1CVNA 2XJTA 3P4OB 3CGTA 1UC6A 2HT2D 1SUJA 1ACYH 2X9XA 4BKLA 2ZGTA 4L05A 2FBJL 2QEJA 3BZEB 1O75A 4ELMA 1VMGA 4K0KO 4RCAA 5EB9A 1UIKA 1RUNA 1UZ8A 1VZHA 3O45A 4KK6C 5K9YA 1CD1A 5EBMC 4Z6AT 2CIKB 2LU5A 2DYSC 3TZVD 5JO5A 4U6VH 4AOCA 4RA0A 2IVJA 2RS13 4L2LA 4YDNA 2YPLE 4P48A 2RM21 1YN6A 3BN9C 2J56A 3LKRB 2RDSA 3ESUF 3SD2A 4CRQA 1ZRFA 4XVJH 2X1XR 4G3YH 5JHLA 5C3OA 4AEIH 3QHZL 3BSZH 3AXIA 4WBBA 1EXUB 2O26U 1VMHA 4PWJA 1M9SA 2Q7YB 1EJ6A 4FI8A 2XX0A 4FP8H 1GGBH 3K5RA 3J2PA 2P8LA 4KKAD 4OKDA 3W39B 4KZEH 4NN5B 1GXEA 2QQJA 5EDXA 4F1ZA 1O9VA 4J42A 2J73A 3FTWA 1GM7A 4E4DX 4QKTA 3IPEA 1T89A 3J4UH 1RZIA 3AB0C 1X59A 5ETUB 3KWUA 2ARJA 4ZZ5A 4XC1L 4QDQA 1WEJH 2B1GA 4YIOA 1KPUB 2D7PA 3QUXB 1MREH 4FG4A 3WFDL 3EADA 2AJSH 5T1LD 2YFOA 3SJBC 1OD5A 2WZR2 4LFBO 1BQPA 1D5XB 2RQ8A 1O6TA 1YN7A 2WLZA 4S10A 3AVSA 2RJLA 2VRZA 2G5RA 3T4DA 2JEUA 1UKQA 1BKZA 2XFXA 3D3QA 3VQ2C 5FPZA 4RGMB 5IK3B 1R083 4N90A 4F57H 1XB3A 1KB5B 1AYM3 1A7RH 4XPBL 3KM1A 2CDPA 4OLVH 1DDHA 5I6XC 3K5OA 4XNYH 2Q7YA 3CRMA 2P3IA 1L7LA 5F2WA 5HDWA 1U97A 2DBIA 4ZXKA 3KWXA 1F1AA 3LEIA 2AHIA 3K8LA 3ZYGA 3D69B 3URFA 3MLLA 4UIMA 2R8SH 1YZBA 1A7QH 1UXSA 5TPWL 2XN9A 3GXFA 2QPUA 1ENRA 1XSOA 4O2AB 5F7EH 3I50L 1SQ2N 3NRPA 5C86A 4MKMA 2G9ZA 4DUVA 2QQLA 2GUOB 5SWZA 5DXWA 2QSVA 3CHXA 4LLFA 1AR71 3RZKA 3JYCA 2OR8A 3DTDA 4RGNB 2RR12 4WQOA 3QDJE 3VUAA 1U12A 4J4PC 3KT7A 3LFIA 4A7KA 3GSQA 1AI4A 4W9ZA 4CNIA 3VX1A 4JM4L 2A6ZA 2OYMA 1FYTA 2QGDA 2QT6A 4PGEB 4WO4B 4AZZA 3DVNA 2Q7GA 1JN2P 5T5FH 3WW1A 2FWSA 2OL3H 3DHPA 2WLYA 4JKMA 5CJ8A 5D93B 3SGEI 3SKMB 3UTQA 3VYOA 4XETA 4E41D 2CJUL 5KVFH 1QMUA 3BPLC 5KANI 2F15A 5L3GA 3ZHLA 3B6SB 4B97A 3I84A 2E46A 3P0VH 2ICEB 3TYJA 3BVVA 4AQTA 3DJZA 2K4AA 5F6IC 4OF6A 1PDKA 3FU5A 4P3WA 3LRGA 2KD7A 4CP9B 5J6HA 4KL1A 3DXAE 3VQYA 1SJMA 1N5AA 3QUZA 4OIFA 5DHYA 1CDBA 2Q4PA 2AI0L 2BFVH 3L95A 4GKNB 1NOVA 4KKNA 4WJG3 1CFBA 3MHZA 2VKXA 1C1LA 1S2KA 3RVTD 4UT9L 2F2HA 4KDTC 1P7QB 5C70A 2OIIA 4A5UB 2N0KA 4XHJD 4OBRA 1OVZA 3T04D 3J7NA 3MIDA 1UZ8B 3O45B 4HW6A 1EN6A 3OE7G 2FCVA 4XXDB 2X1PA 4FADA 5KVEE 1FYUA 4DOHE 2CXGA 1LMKA 2OSLB 2R0HA 5AYTA 5I15H 5CSZA 4D3CH 4QY8A 2FLBT 3VQWA 3ELQA 3I6LE 2AF2A 3ZJZA 2Y1ZA 3WFVA 3B1TA 3O2WH 3N5AA 4NO5A 4NZ8A 4CMHB 4B95C 2FAUA 3MRKB 1PZ9A 2YRBA 1HZKA 4ZW8A 4X4YB 3PRZA 5IB1A 3TBTA 1R24A 2MKLC 4Y2OB 1KBHA 1MFAH 1OGAA 2QADD 4AY0A 3EF4A 2BSRA 1WBLA 4LLDB 4Z8BA 4PBWD 3V5DA 1N26A 5D5ME 4EQVA 5K1VA 4BQBA 1H8TA 3IXTA 4GOSA 5E2VL 4IKJA 1WKYA 2Q9LA 5F1NB 1FNLA 1ZVYA 3OKNB 1UJ3C 3NSJA 4G7YL 4A7YA 1HRV1 3QFGA 1NCWH 4HX1B 3AW5A 3ZLIA 4CE8A 2YGOA 4L2YA 2QKCA 4E2SA 4HPKA 2H0FA 1E28B 1G6RH 5DWUH 1AGCB 1VPHA 1OHHG 2IFRA 3DF0A 5JCTA 4N20A 2Y7NA 2ICWI 1PSKL 2A9ML 5HJBA 1BYPA 2X09A 1RHI1 1F4AA 4DT2A 4GXUM 4JG0H 5E99H 2Q4SA 4RL7A 3SE6A 3VBFC 3DOIA 4OLWH 5FY4A 4JJHA 2DQTL 2ZP0T 2VZ1A 4AEFA 2HFFB 1SFPA 1I1AA 4MGKE 2ZCZA 4FAGA 4QGTA 2IANE 5KHKA 2Y2WA 4FEIA 1UWEL 1OP5K 5KSBE 4XHBA 1S78C 1M2VA 3T30A 2A9HA 4JASA 4XVTH 2BM3A 5FWRA 2E7QA 2KLSA 1I1FB 2XMLA 3G7DA 4QQ2A 1LVEA 4BLIA 2FLRT 1T2XA 3X3FH 2R29A 1WA8A 4ZFOA 4U0QB 2BVBA 1JA8A 4U05A 4LCWA 4XEZA 2ZZUT 1XJAA 3K46A 1ACXA 3LPGA 4GB32 2OZNA 2D7NA 1JPSH 2DF7A 1SFDA 3LX9A 3VXUA 3BC9A 3UAJC 5ID0A 5ADPH 3PP3K 1SVZA 1THAA 1UY2A 4LBAA 3VZJA 4OM1L 5I75B 2NZ9C 4YPGA 2GTSA 2XJSA 4XHJC 2MCMA 2HWE1 5JR7B 2HKXA 3GF8A 1JGIA 3IGAA 4LF4B 3M8OH 4NWTH 1DFQA 2E9WA 5ABDE 3RI5F 5JQGA 2XZCL 2LFRA 2UUAB 4DEPC 1BV8A 2XAQA 2GFBA 2JKTM 4WWOA 3J26N 3N9PA 2P4VA 5CN0A 1KLUA 1EMTL 3DSNA 4C8XA 4EDWH 4QHNA 1XCTB 1J5CA 1RFDL 3B3BA 4QRAA 1KDMA 1HKDA 2V4AA 2ZGRA 3ARGD 4M6OL 4O4HA 2IOIA 1JF6A 1MVQA 4AC4A 2QUOA 1FQ9C 2WT2A 2Y3AA 3A0KA 5JXGA 3Q8EA 2QQPA 4L8DB 1CAVA 3US9A 1J58A 5L3BA 4N2DA 5A6ZA 2EXYC 4DR3O 2Z92B 1ZHBB 4CEYC 1BBJB 2Q0AA 4WNSA 2GPZA 2N59A 2R51A 4JFDA 4WF9V 4BV1A 3L71H 2IH8A 1ZHBA 3BZFB 1OCWL 3QUYD 2K1MA 4YGAB 1QHPA 1ZLWK 3E2EA 4EJ1C 4I3PA 5EU7E 4AZUA 5I8CB 2CR0A 5H4YA 5FYYA 2HFEA 4GW1B 1ECYA 2EX3A 3WF4A 3TBVA 1P0SE 2BCMA 1Y3TA 2WRAA 2A6IA 4PV9B 4JFED 1QH7A 3G6JA 3DMMD 1W0WB 2KSDA 1UWGH 2ZXCA 4BYHA 4PY7B 4GY4A 2OX0A 1K4DC 1XNRO 1PY0A 1NL0L 3H53A 4NAQA 3GK8H 1CD0A 5ENWA 1HH6B 2A0LC 4XVUC 4X6CB 1G6VK 1L9OA 2ZOWA 2JKJA 1H5BC 1IAKB 1D5MB 1L9QA 3ARPA 3DUUA 3NJHA 4DR5O 3HPLA 1B35C 1Y43B 3APBA 3DA0A 3TN92 4CH6A 1ZGLA 4NKIH 4W4NA 2YHGA 3DXUA 4FK5C 3WU2Z 2O30A 3VTMA 1BZQK 1WP7A 3GWKC 1BZ7B 3WHXB 3G04B 3L3IB 5C4WC 4L4VE 2IANB 5KSBB 4W81A 3QQDB 3QG7H 3MOQA 4PUBL 4AFBA 4WFHA 3QIBC 5GSRB 3ZOIA 4YHHB 3T3PE 4P04A 4TTDC 4KV5E 4KKBC 2R063 3H1YA 2BY1A 3VI3A 2XR4A 1CK0L 3HNVH 4NQDA 1KITA 2PHFA 4XMWA 1IB5A 4UNTA 1WS7A 4TQHA 4MOAA 3NJVA 1LDPH 1P7BA 3QEHB 3BX7C 5L4JA 4E2GA 1EXGA 4X6DF 2RQ6A 2IU0A 1RJLB 1IGIH 3SBWA 4L8BB 3MV9E 5AVZB 1MPXA 3JV6A 5GHWH 4OQ8A 4JO1H 1GPOL 3PGCA 4JFZH 1R3IH 1UA3A 3H6AA 1ZL8B 5CBHA 2AJ3A 1F5FA 2AVFA 2YUZA 1KQRA 2HWB3 2TBVA 4Z5RA 1QSFB 1V3LA 1PNKA 1CD8A 2XDHA 1N2RB 2VUYA 4MCZA 4TSCL 1RUPL 4JV4A 1HAWA 1OZ0A 1MPAH 1QFOA 5D8AA 1BD2E 4PB0H 1RK0A 4NJ9H 4KJWD 4L1BA 1Y18B 1L0XA 5IQLA 3P9LB 3L4ZA 4H8QA 5KG9A 5EDSA 2D3SA 1Q86W 4G27B 2XLLA 4PDMA 2VNGA 3ZDVA 5EPMA 4O4LA 3C8HA 3BSZA 5GGTA 1OUXA 3GHMA 3HNBM 1AR2A 1TZIB 2WNKA 5ESAA 1MS8A 1VGKB 3AL6A 1VQ4V 1GQGA 4EXKA 1JVOA 1Q9OA 1OGTB 2ARHA 3STLB 4LAQH 4WFGA 3W38A 2XL9A 3MLVL 4FM0A 4UFJA 3QFJE 3U25A 2KXLA 1G6RL 4JI4O 2CMRL 3DSFL 3P2TA 1PQZB 4MMZA 1EP0A 1ZLSH 1KULA 1MS1A 1T3FA 1U8QA 4LQ1A 5IVNA 4U1HB 1RJYB 2VITA 1HNFA 5C08B 2B3RA 1FG2A 2BCKB 2JELH 1ZK9A 4OKVB 4N43B 2Z0UA 5JA9A 3DC0A 3CZFA 4PVLA 3MCLH 4RHV2 3ZYIA 1YDPA 1H38A 4QPEA 4A6YL 1N8RW 3B6SA 1UYWH 4JI0B 5C0EA 4UT7H 4BKTC 5JJEB 1FC2D 5BO1H 5I8KH 5JDJA 4AE2A 5LRSA 3B43A 2XGXA 4G6AC 3VFTA 4I09A 2RD0A 4RGNE 4QCIB 5DEGA 3VXRE 3MSPA 4I9WA 4ATWA 3SZ6A 4JY6B 4JYAB 2CALA 2EKSA 3AY4C 1NVPD 5FA3B 3KWVA 1ICTA 2GAZB 4GXVL 4NFBA 4FFKA 4B5ZA 3EVKA 4BHPA 4NXNB 4AXWB 4IEWA 2Q8CA 3QO0B 3WIHA 2Z8SA 3HOGA 9PCYA 3OD0A 2BSCA 3S6PA 3FE5A 2A77H 3CFNA 4GO8A 3BPNB 5DVOA 3J27A 4PTTB 1DGRA 5C07B 1X9QA 4FOVA 1HDMA 1EDYA 1SXSA 5H35B 4HIIB 1ZBA1 3AROA 4KG0A 4DW2H 5BS0A 2J1AA 1T22B 1XF3A 4NWTL 4PF5A 2Y07H 4NQXA 1JYXA 4K3GA 3QIWC 1T83C 3WX5A 4OV5B 4GRLD 3PYCA 5GLWA 2KKWA 2CLVA 1DP0A 1NC4D 1OFSA 1JTPA 3AMKA 4A6YB 1VQ7V 1A4CA 1KTDB 3PQYE 1EN5A 1ZXQA 3ROLA 1CXEA 4JGYC 5IK5A 1ASPA 3R6SA 3LKNA 4LOUC 4FZ0A 1FD9A 1KEMH 1NGYB 2FDHA 5EBMA 3L4CA 4P5RA 1IAII 1AE6H 4YH6A 1R3HB 1QASA 1U92B 3Q8FA 5DU7A 3TO4C 5K0UC 1S5HC 1OCWH 2WXFA 2XXGA 4OCRH 2OW4A 3OR7C 3WIAA 4LARL 4OT1L 1OARH 3EO1A 5FZ3A 2KYIA 2XN2A 1KPUA 4UCVA 4F2ME 2Z64C 5HVGB 3TA3A 4CYDA 1U95A 2Q86A 4L4TA 1SDWA 1U4FA 2UXNA 5HHOD 4UIKL 1P7QD 4ELKB 1TZHB 1T22A 3QYMA 5CR8A 2C6SA 1K2DB 1J1PL 2HN7A 5L8JB 4YNYA 2AQTA 3ATAA 3VFSB 4DPAX 5IV2B 1U93A 2MNWA 1TQBB 2VCMA 1SQMA 4K94C 4X7DC 3HKCA 5GGUB 3LDBA 1J84A 1K33A 5D1ZD 5E08L 5LBBA 2HKFH 4R9HA 4WJ5B 1ZE3C 2GSGB 2XYCA 4RFT0 4MZIA 4ZS6D 2JE8A 4JFHE 5A2JH 4XZPA 1MEXL 5DS8A 3B56A 2ZX0A 5DAVA 2KB1A 3ACFA 1PG7X 2K0RA 4P4KA 3ZFGA 5KXEA 4J3XA 2PHDA 1HESA 2EDDA 4I8DA 1S1AA 2ZGUA 2Y6HA 3RN4A 1I7ZB 4ZUSB 4HG4J 2Y0OA 2QVMA 4MQ7A 1EDQA 3O4OC 3QQDA 5C6TL 5FZBA 3Q06A 4NZTH 1YEEH 4GKZB 5HPMA 1MSPA 1NG0A 1XYPA 1FCGA 2VOKA 5D7IB 2PHRA 4AEHH 4FI9A 1CFQB 1ONQA 1YQ2A 1BYOA 4XF3A 3MFAA 3RYHA 4MLOA 5I30L 4IOFD 4FE9A 4ALAH 1IQDB 5JHDB 3KL5A 4UB0L 4KRPD 1NCBL 3MBXH 5K9KA 1M6OA 5D7EA 4BE5A 3MNZB 1ZA3B 2P80D 2ALAA 4U36A 1EANA 4HXBH 2Y06L 1NBVH 3M17A 3NKTA 4N90D 1E4HA 2DL9A 5BPPA 5HYJE 2QQKL 2LOEA 3ZE0B 5JPMC 1I8MB 1EAH3 2BU9A 3CZSA 4U1IB 4Z7VA 4P9WA 4G42A 4P5TC 4NM8H 4CGUB 4FGMA 4K73A 3RWJA 3VXOA 4X6FB 5IJRA 4XCNB 2BIIA 1O0VA 4FQQA 5AVYB 3TCLA 3IB4A 4CKQA 2J6EA 4PRPB 2P6CA 2DQIH 4QGPA 3SGJC 5BNNA 1OQDA 2EIJC 2QM7A 1CF8H 2MOQA 4YJ2B 4UT6L 4EN3C 4D6QA 2XAFA 3AG4B 2K9UA 2PCPA 3J8F3 1SZXA 4JRXA 3HNMA 5EXOA 5I1CL 3WDHA 1A9EB 3QPQD 2XXFA 3CDGA 4PJGA 5J06A 3H3ZA 5BV7H 4OBSA 1A1OA 3ON7A 3RJ2X 4TXWA 5T1LB 3FQUA 5EBLB 1H9DA 2GK2A 3LB9A 4J1WA 4HVQA 5DM6V 3K80A 3IVKB 5KW9H 3PHMA 4HMCA 1DQ4A 3T0EC 1E5YA 3AU1A 3IDJB 4B7EA 3ZMSA 3IJSA 1WIUA 3O2DH 2YV8A 3DGTA 2DTYA 4FQXA 2IBZX 5FO9B 1DZBA 3H4HA 2Y7LA 2BVQA 3H6JA 5CN3A 5TK4A 3SHRA 1BVNT 1SA0B 4M5ZH 1PKQB 2IPTH 2VBBA 2V9UA 5HSFA 3VBSA 1OK8A 2APBA 2VXVH 2ZSVB 3BFRA 1T1XB 3IDYC 4OH2A 5ACLA 2A7BA 3S8GB 2HT3C 2BSRB 2GSIB 1MHPH 3MLVH 1HH9B 5E56A 4CN6A 2CRMA 5FKBA 1U4EA 5LDUA 3S34L 3FO1A 3MRIA 3KJ6H 3DSFH 5EUOF 5ID1B 2VLRA 4G6JH 4X4YA 1PCXA 3HLKA 1P84K 1BS3A 3AREA 3O2VH 4KXBA 3N41F 5CO1A 1W6PB 1WQVT 1JJUA 4KVPA 3OGRA 4WI7A 3O6FD 3ZO0B 1IGFL 1OF2B 4FNRA 1L7QA 4ZOAA 1NFDB 5GIRB 5C6WH 1IL1B 5IB4A 3GHBL 4K3DL 3CCLV 1IC4H 2PCYA 1OGSA 1Q9WA 2FVNA 3T3ME 4HN1A 1FE8L 2WN2A 3O9WA 2F7QA 1FYHB 4DOHB 1LEIA 1IS5A 1VB2A 1S77D 1Z5WA 2BC4A 2C7UA 3WW2A 3TGUH 4LHQB 4R7LA 2QKDA 3FPXA 1GHFH 1Q9LB 4R7XA 3T0WA 1US3A 4YGVB 2UURA 5F89B 4CP9A 1D4M1 2XJVA 4LF6B 3NABL 4ZKIA 4A44A 3EOTH 1BEYH 2YXVA 1YC7A 3GI9H 5C3IA 4MSWB 3I2KA 3ZDZF 4ZX3A 1XGTA 1OKOA 3Q4HB 3PHQA 4Q9RH 3DIDA 2G1MA 1IBDA 1HEJC 3IC7A 3AX4A 4FFBA 3LKJA 5C0BD 3P11H 4JZJA 5IB3A 5H37G 3A7QA 4P9OA 5F93C 1ULFA 3GHNA 3VQ1C 4RAVA 4Q6IC 1BZEA 1HKFA 3WW4A 3OBZA 3MAQA 3ZHQA 5JMOA 1RMU2 4C90A 4MVQA 3I54A 1YPZA 2DBJA 2NY4C 3QXUA 4Y9GA 1MHEA 1KXHA 2BSED 5A2IH 1VBA1 1BG9A 3F95A 2G9HA 3JD1A 4Q58C 2AITA 1GICA 1MUJA 1ZPUA 2EE6A 3S3JA 5EIBD 4PHXA 4KV5F 4LLWA 4FQLL 4B9YA 4EI0A 5JHDA 1XIWB 3MLSH 3SPVB 5LGJB 1AAJA 1RUD3 5DVKA 5FGRA 3K57A 3GUTA 3RWDB 3HKDA 3MNVA 3WTUA 1NR1A 1Z66A 3K6FA 2QADB 3FUFA 4KO6A 1TJGH 3IDYB 3C7FA 3RZMA 4FM1A 5FV2A 3JBG2 4J12A 4PAZA 3GRWL 2BTVC 3QDMD 2R9AA 4U3FH 5DHVA 5CJXA 3MUGB 1HNXO 1FYJA 1LESA 3ZYBA 3ZBMA 3ARFC 4UYPA 5A7SA 1KB5A 2DV6A 2Y6TE 3BAEL 4DY5A 1N34O 2XWJB 2BVPA 5LBSH 5FM5M 4RSYA 4APQB 2FX8H 5FZ7A 5E6ID 1TJXA 2A6IB 4IJTA 4PV9A 4B8EA 4G9FB 5KC5A 1JVLA 3IS0X 1ENVA 2GJ6B 3O6FC 5C0JA 5HXMA 2CNAA 3VI3F 4S2SB 3ZHSA 3GKWL 4M6NH 4ZYKB 1YRZA 1H6XA 1CE6A 2LLLA 4PJ6A 1MQTC 1LHOA 3W82A 2EULA 4F7MB 5I6LA 4WVMB 4OI1A 4AITA 1PGW1 2VBPA 2XWTB 4EEQA 3C5ZB 4PJCE 4X80H 3T4HB 2Y25A 2EACA 5I1KL 3ALQA 3ZOAA 3TYGH 3HTLX 3O1RA 3POYA 1FZMA 1MDTA 4M1GH 5CB4A 3Q2WA 3O12A 2BIQA 1YCSA 1LE5A 5D70L 2VC9A 2ZEYA 32C2A 5JDSA 4C4UA 4NWWA 1HXS2 4YYOA 4ZNEA 2EIBA 1G1CA 5MEND 4WNQA 3TV3H 4Z7NF 4HANA 4AAPA 5I6OA 3K71A 3NV2A 1FH2A 5GGSY 5EEYA 1SHMA 4KH9A 3MXVH 1QPXA 2YC1A 3NIDE 5DHVB 5HHOA 2CHHA 4IE0A 4NHMA 4AFAA 4XB3A 1DQ1A 5L7OA 1GZWA 5E8AA 4JI6B 2DQHL 3OR7B 2NW2B 3TT1H 4HIPA 3PVBB 3WKPA 1BIIA 3N85H 2IDFA 3O6KH 5DHVH 5JQ6L 4KHPO 1MHCA 4TULH 2MPAH 1BQLH 1HDJA 4QXKA 1D5RA 4H7VA 3AREB 4GI8A 3TFKC 5AB9A 5DMKB 3D0JA 1EZVX 3R8QA 3QBQA 1BQHB 3KWTA 3I2FA 4JDVB 4QM8A 2PCXA 1J59A 1JPST 5CGTA 3NJYA 5IQMA 5T50A 5A3LA 1R6KA 2V2WA 4ZX5A 4LCCB 3F7QA 3OF6A 5FRAA 1RUMH 4YM0A 4PJAA 2WFPA 1GYUA 2JG8A 1RPQA 2BOCB 2CGPA 4BEIA 4DTGH 3B02A 1K3EA 2GCYA 4PTUA 4XBPB 1WAPA 4HUWA 1S6NA 3LN9A 3TZVB 1ZSDA 4R83A 5ICZA 2BUKA 1UXLA 3VFOB 4P2OA 4Y16D 3V4LA 2DWEB 4NP4L 5C0CE 1RPRA 5JXED 1ZRIA 3RAJL 2QADC 2VZRA 4UYBA 1ZANH 3KXFE 4QDSA 2KQNA 2HBUA 1OT2A 2HRLA 4PLNC 3BPZA 3HC0A 5B7FA 3ZRXA 2W8CA 4GZRB 1TETL 1TNRA 1QGLA 4CDUA 1E9QB 3AZVA 3LY6A 1UEYA 2XG4A 5SWQB 2ODMA 5JHAA 5E5MA 1C08B 1FOD2 2FZ1A 5B4MC 5E5UB 3PGFH 1T0MB 4OVVA 1A8JH 4PJBA 3QJFA 3RWGB 4GRWF 3W39A 2VO5A 4UV7H 4KRMB 3CPWU 1S7RB 2VXVL 3FTGA 2ZX3A 1QACA 2EZ0D 2HEPA 1IGJB 2WR9A 4PDLA 5LWYL 5FJHA 3NGBB 1GNHA 2WO3B 3TVMD 1WAAE 3L3JA 3UBXA 1JZ4A 2UY9A 3DKHA 1ZWIC 5ES4B 4Q4W1 2VW1A 5EC1C 3VSVA 5EU4B 5LWBA 1I9RL 2FD8A 1EFQA 3KS0J 4B9CA 6PAZA 4Y3OA 1G9DA 5A6LA 3VBUA 4B27A 3C60B 2EO1A 2X7RB 3J7MA 2MSPA 3OKOA 3S7GA 4H5SB 4MYWB 5K9KB 5JOZA 4M62H 2A74B 1EH9A 1IX9A 4PQ9A 1FL6B 1MEC2 2J5LB 4JM2C 3WY3A 1XPWA 2XTJD 3RX7A 4Q4EA 4AYFB 4UBGA 4A7GA 2FUTA 1DE4B 4CVXB 3ASNB 2YOCA 3SH4A 4WV1B 2Y4TA 2UUAO 5KTEH 2LW1A 1ZT7A 2PETA 4CA9A 4DIXA 2PXYC 1L4IA 5IP4A 2HZHA 4L37B 4LXFA 5EUKA 2AJZB 1B4TA 1ZLVK 5LJYH 1YFXA 4NOBA 5IBUB 3MRQA 3CSTA 1QXJA 1YEIH 4O2EB 1KQSU 5E70A 4AEKA 4YDLB 1N2RA 2XQYG 4KVNH 3MAWA 2H94A 5A1AA 3C3VA 2OBGA 3BDYL 5JOEA 4IEVA 2SLIA 1LO4H 1EIBA 3F05A 4FFWD 2ADPA 3WF0A 5FY1A 1HR0O 4K7PL 2GSYA 5I6MA 3CDGB 4PJGB 1ZX3A 3U9PL 1WK0A 1KYAA 4HS3A 3HUJE 5A2QN 3ZZ1A 2Z65C 8PAZA 1YMHA 1Z7S3 4DHLA 1IAMA 1CGYA 2WNOA 4AEMA 2AEQL 3JASB 1D6EA 2FX9L 3ORJA 5I6PA 1K9TA 4GRWB 3TN0C 3ENRA 3K5LA 2B4KA 1J0YA 1IBMO 4IE6A 3A0RA 1HXS3 1VHPA 1VGKA 3JXSA 3RVYA 3CZGA 4CDQC 1D5ZB 1ITCA 1EZLA 3T0EB 2W88A 3PWNA 3FWEA 3JQOB 1TYJA 3CH8A 4JKKA 3L2MA 2XHNA 1HEHC 1T6GC 4NYKA 5DUVA 2JJTC 3BI3A 1SRYA 1KV3A 5DURB 3IDCB 3M45A 5AW2B 4OZGE 3QUKB 1UCBL 1KCVL 1CPYA 2BOCA 4ZS7L 5FYJH 5IHUL 1AL21 3O0XA 3WGVB 1PM7A 2P8LB 5F7EL 4HKLA 1KNOB 1V3KA 2D5HA 1G7QB 3I6SA 5FW6A 2EDFA 2F58L 1I3GL 2D73A 3EDJA 4N2GA 1PO11 2Y26A 4CDXC 3SCMC 4IETA 4ZS2A 1DSFL 1ZL8A 1AJQA 4CKVX 1J8HE 1Y9MA 4I3SL 1IAOA 4MMXA 3SQOH 2CIKA 3DYPA 3VBHA 4MJIE 1AF9A 4BU2A 4M8RA 4GFXA 4FC3E 5JPMB 3WCSA 3CCQV 2E5EA 3UPAA 3A6CH 5IQ7L 3OZLA 5A9GA 1VB4A 2X3AA 3LXAA 4H8WC 3ZE1F 3RVVD 3I2HA 4WJ5A 4WV8A 4GX0A 4XNXH 2MPFA 2MCAA 5GLTA 4DPNA 2QGNA 1FHGA 1MFCH 3SPHA 1GTFA 1O4TA 3T3PB 3ASIA 4Q14A 3UK9A 5FB8A 1KUMA 1GN2A 4I3RL 32C2B 3O6LL 4XC3L 3RY5A 5JDSB 1K5JA 3MRCA 3SKJH 3OZKA 3VWJA 1CL7I 1JF1B 3RTQB 2APVA 5KC6A 2O5XH 1Q94A 1RZIB 4OGZA 5DD0H 3P3YA 4NPYB 1AYM1 1GKBA 2RM22 4DW0A 1MCRA 4OZFG 3SD5A 4Y5SA 1N67A 3VFUA 4EQ3A 3THPA 3H42B 3WVJA 2HKOA 1W28A 4MG2A 1TU2A 4BJ0A 1AOHA 3QORD 3ZSMA 1AC0A 4FYRA 2XVLA 3HJRA 5D72H 3BZDA 4M7ZB 4JZOA 1X5HA 3W2DH 2BDRA 4S2DA 5D8AC 2B5UA 4WO4D 2JJTA 5DDHB 2XWBB 2W80C 3UO1L 3H1WA 4JG5A 2I5YH 1ULEA 3V0AB 4D3CL 4TF4A 4ZONA 2FSDA 2W0XA 4WU7A 5IJDC 4LBEC 1Q8OA 2GJ6E 3ZFFC 1AL0G 3VO0A 1RIUH 3ZDXB 1Q8SA 3S35X 3ETTA 3F6IA 3SOBH 3OF1A 4UILL 4V2BA 2D6OX 3N40P 4IHJA 4U6HB 4KHTL 2PELA 3ESVF 5C0AD 1SF3A 3VFVA 4P9XA 2X9WA 4MNQB 3EJZD 2HKAA 2ERJB 3AG3C 2Z93A 5T3XE 4FNUA 1OB1A 5HDRA 4QOKB 4YHIA 3FZ3A 3TCUA 1QQP2 3WG3A 1XB9A 1MFEL 2YIBD 4P3CH 2W0FC 2K9FB 3MREA 1GGIL 2OXGA 3BAXA 2DU0A 2YGPA 5FYZA 2VC2B 3CH1B 4QXUL 4IBVA 4BH8A 1KGYA 2ADDA 4XF0A 2GC2A 5H9CA 5CEZD 4LQFH 4Z9KB 3B3IB 5EU6D 2EDKA 2GBAA 2QGBA 2P5WE 4MHHG 1UJTA 1A4JA 4DK3A 2V4DA 2Q0OC 1UQSA 5A16B 1S7QA 4ES8A 2PF4E 3I9GH 1MCWW 3IS1X 4B60A 1QJY3 1XNTA 2Y1YA 3Q4HA 2PP7A 2WXNA 3PHQB 5TDNA 1ID2A 2ZCWA 4DV1B 1N7ML 2P5EB 1BIHA 2ZMNA 3D36C 5IYZB 1SN2A 3RNQA 4AGQA 1JI1A 2VWJA 3HG1B 2JS3A 2LW7A 1DBJH 3T1CA 3B8MA 2WBWB 1RP3B 3KYOB 4JRXD 4Y5VC 5EN3A 2AC0A 3KPPA 2BNMA 3ZPOA 1MLBA 1NCAL 4XN7A 1XIWD 1AX2A 1KS5A 1E42A 2F5AH 1IPKA 3LRSA 5TD4A 4JJ5A 3AYAA 3VXRB 3L54A 4F2FA 2VXUL 4TUUA 3UDWA 1W03A 2UXBO 5EA0H 2EIMB 1QLFA 3MGTA 4X5WB 2DTWA 1KYFA 4TV9A 1AO7E 3POHA 5CAZA 2QSAA 3OB8A 1WAAF 3MLWL 5LXGL 5ABZA 4O61A 2K6WA 1JSYA 2QEXV 2DD8H 1WWYA 4L11A 3EYUL 5C3QA 4LPXA 3TIDA 4BXFA 2NXZB 3V0BB 4PA4A 1K3ZA 4AJYV 1DQKA 4XNMA 5F96H 4AUYA 1OJHA 2Y69B 3C5ZC 1NEPA 3B37A 3MRKA 4JFXA 4L8JA 4J7ZA 1FVEB 4Q20A 3H1ZA 4G1EB 4G8GB 3CRCA 1HOCB 5E6ZA 2WKKA 4OZIF 1Q5OA 5DD6A 1A5FL 2B4CH 1TMF2 4MW8A 1AMXA 3ZL4H 3FQYA 1Q0XL 4MCYB 1OUSA 3MDPA 4HBCL 3SDYL 2OFQA 4Q6GA 1AD0B 4AGVA 2AEZA 4XPFH 3IDNB 3SDCB 2ZUXA 3WJLC 2K9PA 2Q7EA 2BZDA 4Z8FH 1PGW2 1RHI3 2NY5C 4FCAA 1EV12 1PIV1 2CPUA 1A6VH 2UZIL 4R52A 5F7AA 3W11C 2ZWKA 5DUPL 2EAKA 4LOUD 3MD0A 1SJXA 4ONFH 2OI9C 2G4IA 2XKPA 3MTRA 3GINA 5FFOC 3RURA 2FO1A 2ED8A 2Z35A 2MK3A 2YQ2A 4BXVA 1ZPLA 3DXRA 3QDJD 2PLV2 5GJTL 5B38A 2E6PA 5BMVB 3QEHA 2E7DA 1VKXB 4LBNA 4AUUA 4LKSA 2AV1B 3QH3B 3S37X 3ZVVA 2A9BA 4WDIA 3EHBC 5JW4Q 2Z6FA 4K3EL 3UYPA 5IMMA 4OZIA 1CFMA 1L9TA 4IEQA 4XFCA 5AYUH 1QJU1 5DRZB 3H1KH 5HI5C 1OV8A 3GC3A 4QTFA 1XF2A 3DSNB 4LO9A 2ZCKL 2PUSA 4H8UA 3S98A 2ZKMX 1JBJA 2TRYA 2C1OA 1U5ZA 2VOXA 4M7LH 3QI9C 1DQ0A 5LVEA 3C60A 2C9UA 1QNYA 1F15A 4F5CA 2VWKA 1IBGH 3N1FC 3TJPA 4RGNC 3T65B 1RUC2 3MUUA 3EG9A 2VD7A 1UH3A 4M3CA 4TLUA 2LW8A 1NCQA 3IWUA 3BGFB 2C9RA 2FDBP 3JARA 5KVDE 3LIZH 4MGZE 4J7JA 4IMKC 1TME2 1G0XA 3IWZA 2W1QA 1A0QL 1COWG 1GL4B 4JVWA 1NFDF 4P2QB 1T5EA 2HUEA 4KQ3L 4P2CG 3UJOA 3MLZL 3ZN5A 4AQ8C 1UU4A 2OUHA 2IDCA 2C9PA 3M3CA 5A7QA 3C5ZD 1XD1A 1OSPH 1X9LA 1QXRA 4HFWA 1OQXA 5JXJA 2EJ7A 1MNUH 2NY5H 5AAMC 3NQIA 5LYJB 3K5MA 5IB3B 5LGHL 4GWIA 4H40A 5HGAB 4MD4A 4LHLA 3MX0A 2ZAGA 1JZ6A 4GA9A 1TSRA 1UZZA 2QBXA 1G7MB 3IMTA 1NCRC 4P99A 1PLGH 1AHMA 1WD3A 4JO8A 1GBGA 5T5JA 2ARBA 1J9QA 5D7SL 4PJ7A 3RGHA 3U2SB 3UACA 4JHBA 2WO4A 1AD9B 3FN0L 1MCPL 3RWFB 3TL5A 2VDKB 3WXVL 4B6ZA 2GP5A 2OZ6A 5DZFA 3TH2T 1IQWL 2QQKA 1FZJA 2GU9A 3BIKB 3BT2H 2Z2SB 3UYRH 1F11A 3CCJV 4N87A 3WEXB 2AQPA 4ZFFA 5BR8B 5JIIA 2J44A 5LAXB 1S7WB 2VZQA 1F1GA 3NNJA 2I85A 3RPBA 4CXWA 4PGCA 5KSVB 4E9RA 1XILA 4GT1A 4UCTA 1BP3B 1MJUH 3ESPA 1SZNA 4BDVA 4Y20A 1M5IA 2R1XA 2IJIA 1X33A 1OIOA 3LKNB 4QWWC 3Q2LA 3PABA 5EWIH 3QTCA 3LZZA 2VLJA 4GMP3 3D3VD 1BQUA 2UVFA 4HGWB 4LAQL 5HYSA 2P4EA 1GGIH 3LMJL 4ODXB 2MKWA 4LLVA 2OJEA 1U8LB 3WIHH 1J10A 5AZEL 5IBUG 1D5XA 1XX9C 4R4NC 3ZDZE 1KIUA 2ZKHL 3HMXL 4NHCH 2EZOA 4QD2A 5CSZB 2NQCA 2VN7A 3RU8H 5FUIA 3MHSC 5LATA 1EZJA 4CDQB 3RFZA 2IMNA 3FSOA 4XAWL 2Z8VC 5FGSA 3T6WA 3WMPA 1EVUA 4WHTA 5C08E 2NYYA 3ILNA 1A7OL 1NMAL 2MQCA 4JHAH 4PW9A 4QHPA 4L4VD 2MCPL 2RHPA 2JK5A 2NM1A 2BPBA 1UH4A 2WSDA 3X12A 2DEXX 4HS3B 4Z7UB 2PLV1 4EIGB 2W46A 1E90A 2R0LH 1CZSA 2KT6A 2GIYA 4FMFA 2EH8H 3EXLA 4CDWC 4N8CH 1TMF1 2XHBA 3S3XA 1AQDA 1CZTA 4XPAL 5ANHA 1WAZA 4IBYA 3W5MA 2R1DA 1U8JB 1MCCA 3BUPA 3LOWA 3ZIMA 1R0AH 3L3DA 3AK0A 1UJ3B 4IMLB 4M8QB 3SCMB 4PIZA 3OT7A 3ZYHA 1DYZA 3V6OE 4JI5O 1AACA 1Q8VA 1KDKA 2XG4B 3EH4B 3BP4B 4GMSL 4FJ6A 1ZGLP 1OD3A 3OUJA 1T7YA 2Z1KA 3AWGA 3B9AA 3HNTL 1QFWH 1IMHC 4CILA 3FQRA 4MA1C 2UXFA 1SLAA 1KKCA 1HCYA 5JUVA 1US6A 4BK4A 4CNIB 1LO0L 1WE5A 5E4EB 3FFCA 3DGGB 2A74A 4JDOA 1UIJA 3WFZA 1P5VA 4X1IB 1NA8A 1VENA 3DETD 3LKPA 4IRJB 2WLNA 1QSFE 4KMTH 1L0YA 5CEZH 5LG6A 2O6CA 2ZHLA 4DP1X 2JG8B 3UZQA 3N9GL 2ZCLH 1VF7A 2HRHA 4Q89A 4JW3A 1REFA 1FL6A 4F92B 4HPOL 2ZUUA 1MRFL 6TAAA 5KHJA 1O4ZA 2GABA 1RPKA 2X40A 5FKAB 3TNMB 3BN9D 4U1SA 3WUZA 2KERA 1SERA 4TNVF 1YG9A 5BUPA 5KJRH 3IFXA 1WRFA 3ZYJB 3BP7B 4XNUH 3VD2A 2ADYA 1BCXA 1SOSA 1ZDSA 1ROWA 5HTSA 1XYNA 4FTVE 4U1SB 1CGTA 1KC5L 4PA3A 1AKJA 2ZXBA 4PBXA 1E9PB 1SYVA 1J0ZA 3DV4A 3HPJB 3EXAA 3HNVL 4AIOA 5BW7A 3DROB 2B9AA 2WOYA 1AJ7H 2V9TA 3GBFA 5D8AB 2OTLV 5SWQA 5A3PA 2OLDA 1NFIB 1UOWA 3P1IA 1AQHA 4GQ7A 2XWBA 4M93C 3P3RA 2DWXA 3UO8B 1KP3A 1EY2A 1DZQA 1WUVA 2V09A 1MRCL 5ACMA 1NUKA 3MV8A 3EIFA 4DEQA 4A6OA 2E3VA 1GGYA 5F1SA 5TE4L 2UXXA 3ABMB 1FMD2 4M5SA 4OGAC 3KLLA 2H3KA 1NWOA 3AP5A 1KCSL 2YD8A 3E8VA 4V1DE 4I1PA 3MRJB 3HN1A 2IADA 2J55A 3SPCA 1AXZA 2IDQA 4Q9BA 4M7LL 2WHVA 4W9IC 2EE2A 3CCMV 3BFOA 3DGCR 3QF7A 1HE7A 4IL7A 4HHWA 2QV4A 2BNUB 3ALWA 1R3IC 2WWWA 1EERB 4Q4V2 2DCJA 2ZONA 3SDXF 1VBB2 5H4ZA 4A6YA 3S9DB 2OJEB 2X0WA 3H8XA 1PTZA 2F17A 1ZSDB 3AYDA 1VQKV 5I17A 2AK4E 1UYYA 4TUOA 1U58A 3M8AA 1NCOA 1BLNB 3CFQA 4OM0H 3WIIH 1W90A 1J8RA 1A6WL 4XQ4A 2KQXA 3S3SA 4P00B 3J8F7 1R46A 4BQXA 1CEZA 1A6AB 2YFZA 4UCOA 3H3BC 5DZNA 2D2CC 4PJIA 1IGTB 4ONHA 1WZ1L 5FYKE 2OSWA 3JD4A 4N85A 3U0PB 3TTYA 2FUQA 1MXGA 3FX3A 4UCSA 5SX4I 3WHTA 3LZPA 3O41B 3OC8A 3QI9A 2EVJA 3X13A 5JIDA 3W56A 1G9FA 2UV3A 3UTOA 5CZKA 3HZKA 4GKXA 3IFNH 1JMUB 2ZX5A 4R84A 3ZO9A 2B2XL 2N04A 3T0EA 1OCOC 1V54C 2R69H 5EN2B 4OGQB 2YO3A 1W6MA 3PU3A 4LF5O 1F2XK 1A7RL 1W0WA 4XPBH 3KLHC 5J3UA 3J8F2 3HVDA 2V7HA 3GNMH 3OGCB 1R092 4JZJB 1IQWH 2GTAA 4UNVA 1JGDA 3P4NB 1E9OA 3QJZA 3LVEA 3RKDC 1YJKA 4HC1A 4UV4L 3OGCA 2AUYA 2WK2A 3S4SG 4ORGB 1KJMB 2RG4A 4RGKA 3NEEA 4KZCA 5GXBB 4LF3B 1HHJB 4QXWA 3CP1A 3QJSB 5A3NA 3CU7A 4DKFL 1RIHH 1A3KA 1KIQB 1IS6A 2ERFA 1T6VN 2V8MA 2ILMA 3II1A 3WEMA 5AALA 3IBOA 3PHSA 1P53A 1ZA3A 3GSVA 4I7ZB 1NUDA 4NAMA 1YJDC 5DR5H 4AF9A 3BUYA 3SDXB 1H6YA 3MIEA 1KN4H 1JDDA 2XYBA 4YHOL 4HJEA 5DXDA 5HY9A 4Y1SA 4ARYA 2CRZA 4OGAD 2W2IA 5D6DA 2WZR1 2WINB 3QD6A 5E2VH 2ZKHH 4MTGA 1K8IA 4E2OA 3CFTA 1W72L 4N0RA 4B3NA 4K8ZA 5LYJA 2IH1C 3PWPA 2AXJA 4NZRL 4Y5YB 3NPSB 3F12A 3AY4A 4JM4H 1X5JA 2BJML 3QUGA 3U6RB 5AVUB 2D7FA 2DUQA 2F93B 1U8HB 2YD6A 4OCMC 5MP6H 1E0OB 4NYLB 2YS8A 2N56A 4HALA 4LCYA 3WIFA 4C4KO 1BJMA 4OLXH 4ATEA 3VXSB 3FRUA 1QLEC 3GXDA 1JMXA 4QRSA 1PPJH 4YUEL 3RNKA 2ZOEB 3CEWA 4RGGA 3QO8A 4JRYE 4QIRA 1QA9A 2UWEE 2A9MH 2HJLB 3VG9C 3VVWA 3N7KA 4PJ5B 1GJIA 3BH8A 4KI5M 4R9CA 3D39D 3D39E 4FQCH 2HVKA 3ZHUA 1B9ZA 2CGNA 2CO7B 3MBWB 1BFOA 2R1YA 4M61B 4JK0D 1UGNA 2QLVB 3QR1A 5DGRA 3CFIC 4L23A 4FNSA 1RUH1 3POSA 3N7MA 2AK4B 4GAGL 4Y2DB 4LBQA 2AI0H 2XT1B 1W2NA 3B2MA 1RZJL 1X9RA 2Q5ZA 4I2XE 3BPOC 4CVWA 4JLRB 5JSOA 2XWEA 1R3JC 1S55A 1V00A 3H9VA 1CLOL 4JI7O 1UWXH 2WQVA 1TQVA 4LARH 4Y4FA 4Y4HB 2PW2B 2FGZA 3FLPA 1S7SA 2GC4C 2L04A 2IV9A 2XQ0A 1VFUA 2P4KA 3RTQD 4YHML 3I3MA 3LF7A 1GM8A 1NPJA 2VL5A 4KFZC 2DVBA 3CFEB 2P1BA 5DAQA 4R4ND 2HSIA 4HOXA 1GR3A 4YJ3B 4F3FA 1U8MA 2MPVA 1E5UI 1ZLUH 3GMQA 2EE9A 4CSZA 3T0DA 3Q6GL 5JVDB 1S78D 1OM3L 3DNKA 3N43F 1RM1B 1ZEAL 2CK2A 2F53E 4QT5A 5EH1A 5APAA 4N2EA 1ET5A 1GKFA 8FABB 4I0PD 3KLHD 1IILE 5I0VA 3KQ4B 2RDNA 2L7UA 5K0UA 4I4TB 5I9QB 3T1WA 4N2FA 4CBZA 3GJEA 4O9GA 1HSBB 4BK8A 3V0BA 2JDUA 1Z6JT 1YQCA 2JI3A 2VE6B 2VE1A 4XCNA 4EROA 1TJHL 2D7QA 4QO1A 2BTQB 4RQQB 3VGFA 3KBEA 2RE9A 2WLJA 2CA3A 4AYUA 1YNKH 3R0RA 1ZVHA 3EO0A 5EEWA 2ZSVA 4AI2A 3H9HA 1VGEL 4KRLB 5SWSA 2ZXWC 3TO4B 3T1HB 2W08A 4X98A 1EZUA 5F9OH 4PTTA 3WJJA 2VLRB 3IPBA 5BJTA 2L0DA 1PSKH 3ZN0A 2K6YA 2WANA 3QEGH 4FQXB 1NCBH 3MBXL 4N2CA 5I1EH 5ERLA 2DQJL 4BSWB 4MCYA 1VQ8V 4TN7A 1PD1A 2Q3XA 4OUOA 1BK1A 3WINE 2C4FT 2FX8L 3QIUC 1AR1D 2OL3L 2IGFH 2Q2EB 2DY2A 5DJXA 2ZAIA 5IVJA 1J9RA 1TQBC 2X4SB 4KK8C 4LSPL 2B14A 4OY9A 4PJ7F 2BHZA 2YA0A 4XMLH 4WTZG 4X6DA 1VQ9V 1JJOA 3J7AU 1KN2L 1KFXL 4DQAA 4FF9A 3DJRA 4UV8A 1GNYA 5HI0A 1U8JA 3DARA 1N5AB 4Q56A 2VN6A 2R6QA 3VBSB 5AC93 3BUYB 3S3BB 5LHGA 3UERA 2GNBA 4AK3A 4E8CA 4KK9C 2K7PA 2CNZA 3BVNA 2FJHA 3VACA 2ZOKA 3U0TB 4OUEA 4KGGA 1DN2A 2XPGB 3W0WB 5E1RA 5CFAA 4JY5H 1PVC3 2I32A 6FABL 5BV7L 1XMOO 4IGPA 3K0WA 1WISA 1KMIZ 4YAQA 4AQAA 2EUZA 5A2AA 4BINA 4IKKA 3QG5A 2NPLX 2WNVB 1DBML 1KFAL 4L87A 1T20B 2A0LD 4PJDB 4X6BA 5BV7C 1LO3L 5I1JH 4FQQB 1AZBA 1N8OE 4LLYA 4PJCF 1DQML 5JR2A 2J4WH 1MVUB 1T4KB 2ALWA 5BNOA 5IFHL 1FT9A 4EDWL 3RZLA 1Q0YL 1WYJA 2Z4QB 3CZKA 3SGEH 5I73C 1GYKA 2E7LA 4LLVB 3F3HA 2HG5B 2X87A 4B96A 4TQFA 3ZXJA 4X4KA 3RP1A 4M7JL 4GB31 4QKDA 4I0PC 2B1IA 4FHBD 2NQYA 5BOPA 5MHSE 5IJVA 3GXIA 3NJLA 4J23A 3C60D 3PWUB 5CR1A 1OI6A 4XGZB 1VBC3 1Q81W 3VBOA 5JOXA 2R39A 1JE6A 1KJ3H 4U1KB 4V2CB 3ULVD 3NNFA 4AGNA 2CHNA 2PUQT 1NCCH 1CJYA 4P9HH 4OD2A 5D7IA 5K5YA 3S3DB 4G7RB 1EHLL 4GKZA 7PAZA 3EOBB 1CD9B 4FZ8H 3HZVB 4BWTA 4QKFA 1H8LA 4MGSA 4H14A 5BNQA 1YVWA 1DEEB 2F61A 1A02N 4UQ2A 2WL1A 1YPZB 3HB3C 2YXMA 2LLGA 2AAAA 5DA4A 5BZDB 1F6AA 3ELNA 3D6EA 1G7HA 1HJBC 4WW2C 3C8KA 4UQDA 4CC4A 5L2KB 4OCSH 2B9ZA 4JFHD 4R7NB 3RL1A 3QO1B 4C7UA 3LUTB 5LEJA 4Y1TA 1KXGA 2BJSA 1O9GA 2VQ0A 4X5XB 1TAEA 2AEOA 2ROYA 5GS0L 1PYWA 3TLRA 2W1UA 1T0NB 2EINC 2APSA 1G9MH 4YDIH 3D06A 4LRIA 3BHBA 4FVMA 4A38A 5HVHC 3U14A 1DDTA 1O9WA 3GM0A 3HBPA 4FG0A 1KS4A 4BOWA 3FUJA 2XBO3 3GSWA 1N6UA 4XACA 2PWFA 1K12A 4FG6D 2NY6D 1FV3A 2AC1A 3MO4A 3B5HA 3BQUC 4LCIH 1S0VA 3H54A 5D1QD 3DO4A 1HS6A 4OPHA 2F4VO 2B1OA 2XVKA 4KJWC 4AQEB 4EZKA 1DLLA 3TNPB 4AGOA 3FQWB 5IIEA 1WUNT 5IVXA 1PX4A 3CLWA 4DV2B 1SYSB 1SHWB 1D2PA 1NKGA 1CFTA 4HCGA 5E2UL 1V55B 5G55A 3C2UA 3UFIA 3PU8A 1ZRDA 3H55A 3IAGC 1H30A 1YN6B 3KGUA 3LKRA 2QWRB 1WGVA 2OMYB 1NY72 5IW3A 5BOJA 5I8TA 1SXZA 2YD4A 1M7DA 3CU1A 4JFFA 2A5UA 1OPGL 5ACA2 3EYFA 2ZWYA 1J8HB 4X5XA 1DTOA 4CDWB 2OZ4H 3JATA 3PJSB 1CDHA 4EAEA 5KBPA 3DPDA 1L5GA 1YWKA 3QOPA 1GC1C 3CK0H 5BQ7B 2PYFA 1I8LA 2FL5A 4MWFA 3APFA 5DUBA 3JQXA 4R26H 1MF2H 2YPVH 4XCCH 2WQWA 3X2QB 1HINH 1TJGL 4NTXA 3KYKL 3WLUA 3U0ZA 1UD6A 1SACA 1UD1A 4LSSH 3GRWH 3QAZC 1G6RA 3C9NA 4K2UH 5LRRA 3CFKA 3T2LA 3FCGA 1FOD3 1CXZB 3BZFA 2G2NA 1OCOB 1V54B 5J9PC 1S9WB 2EDWA 1YNTA 4IBLT 4PRHB 3MPCA 4PW3A 3HHMA 4LSVL 1WHOA 5DT1L 4UFLA 4Y5TA 3T1YO 1AZZC 2Q67A 5IYDO 1NLDH 4XCEB 4EI6B 4U1NA 3MW3A 3PUQA 3OHXA 3QDMB 1QIQA 3ARTA 2AJYL 3EMRA 2CHWA 5EFIA 4BIZA 3LFMA 3S88L 3I5DA 5FYVA 4TWKA 3ACGA 1BW8A 1KYOK 2VLKA 3CVHL 4I85A 1S5LZ 3FU9A 4N0FB 5ICXA 1Y6XA 2P44B 1KYUA 2W65A 1ENSA 3USUA 4UNUA 1O3TA 4G9DB 4G9FD 1WLCA 2JDMA 2WN3A 1WBXA 3FMGL 5E4IA 5I1KH 1FNEB 4EIUA 2YK1H 4X9QA 4AMWA 4HOZA 3KS7A 3JWNC 4YBHA 3IM0A 2ZR3A 2FYYB 1UU6A 4DV1O 2IO5A 4CDXB 4Y4FD 1DCSA 4MO3M 3TV3L 1PM9A 1IVSA 2BNQB 3KLSA 5F9OL 4FPEA 3NMEA 3UT5B 1X5FA 5BJTB 3BEVA 3RPIB 2QCSB 1E57A 1D5NA 1OAJA 2J6EH 3A4DA 3RGVB 4NQTA 2VSMB 3BRCA 4C54A 2IGTA 1UD2A 4HLEA 4PJ8A 4Z23A 5B3JE 3QZPA 2NY2C 2QQMA 4W68A 1RUAL 6CGTA 1NAMB 2DPKA 1F13A 1I5XA 3QCVH 1JV5A 1POQA 5DG1A 5DZVA 3G5YA 5C8JB 5EPMB 4J9YB 2EKJA 5FS5A 5T1KD 1WB8A 4APXB 5DAXA 4JS7A 1AGEA 3TEWA 1W8ZA 3K2UL 1WLDA 3VA2C 1F4MA 1S7RA 2F19L 1NAMH 1L1FA 2EAEA 4JJ5B 2EC9T 3NIGB 3REVB 5FLHA 1AVBA 1KTJA 3BP6B 3L3HA 2KHAA 4PGZA 2GY7B 2QJVA 3CWBH 3DO7A 1SBBA 1UD3A 2ETWA 5FHAL 2ADGA 4A45A 2FBJH 2ITFA 4ASUG 3PGCB 2AFNA 4JY5L 2JE7A 2VDPB 4R8CA 3MFGB 2OYPA 3OJBA 3EO9H 3B9DA 2BNQE 4KQ0A 1TZOA 1LR1A 1HX0A 4K3AA 5L8LB 5LOVA 4CEWA 5EU5A 4RFOH 1NCWL 2EEDA 5MEPA 3BKJH 3GJFK 2CDYA 4Y16B 5C0BA 1JU4A 3UTSA 4AEHL 4FNLL 2DIEA 3A67H 4AXOA 5LQBL 1NGPH 3OEAA 2YG0A 1PEZA 3LZLA 4LKXA 2B5IC 4GULA 2BNRB 4JFEA 5D96B 1UKSA 4I4TA 1YLBB 1AL23 5JH7B 4HYOA 1YHPA 5FYJU 4AQEA 4AGGA 3BE1L 4UM8A 5ESVB 4ISRA 1JMKC 1R3LB 3B7UX 1CICA 1FVCA 3ZGHA 5IWLA 3AZYA 4AG4A 4XMKH 3QQNA 1UXMA 1BFVL 3BH4A 3C08L 3MVSA 4HAFA 3ECUA 2NTSP 3DX6B 4NM8L 1O3RA 2WMPA 1RUI2 2ZX4A 1MREL 5C09E 4P9LA 5KMGA 2ARXA 3FB6A 3RZGA 2R0ZL 5F9WB 4P8QA 3IPVB 5DS2A 4JDMA 5L7OB 2R7EA 4DNLA 3SDDC 2BS9A 4FLZA 1G9NC 4M62L 4K20A 3MBEC 5DZJA 4PGDB 1R1ZA 1W6NA 5C8CC 3DJTA 3KVDD 4KP4A 4J3SA 2PQQA 2E47A 4HOWA 1HQ4B 4PS3A 2OTJV 1AJPA 4IESA 3GB7B 5I0DA 3POFA 5D4IA 3ZDXE 4OFGA 2TRHA 3KNBB 1HL8A 5JHBA 2Q8BL 1S9VA 3V4VA 1Q3EA 4JDVA 2R0WL 1DVYA 1KIQA 2BDNL 4AHZA 1PMIA 4XX1G 2DQFA 2KG7B 1XOUA 1KZQA 1YEIL 5E1QA 2O72A 3CIHA 4RA0C 3O4LB 3H9SD 4OQ9A 4PGEA 2QPDB 4JGYB 2WKGA 2Y6SD 4A6SA 4J7KA 5K1PA 4DV6B 2YN3A 4XRCB 5IG7A 1YMMA 1FLRL 4LRNH 3ULVF 1GQHA 4D7BA 2MNGA 1TJIL 4HJ0C 5A33A 3LDCA 1JYCA 1KXVC 2YFUA 2HTLC 4JZNA 4DO4A 3ABTA 3AZXA 3O4LE 2XPZA 3NA9H 4XPVA 3PTYA 1N5YL 3AC0A 1VLNA 5A33B 1H6FA 2ZX6A 4UOW1 1ZT4B 2VWEE 4JPQA 1LYQA 3QXDB 4PJFF 5DHMC 1C4RA 1U8OB 4UFHA 5C6CA 3V79C 5D5PA 3MRGA 4ZW5A 2CJUH 1AY1L 5KVFL 2L9LA 2DJSA 1H19A 3D69A 3C5XA 4HG6B 4K23L 1C16A 4E4SA 2PA7A 4EN2A 1I85A 1A7PL 2ZCHL 1RQ5A 4UQEA 2PTTA 2ZOLB 3ZU8A 4IERA 1JAEA 2Y7QA 5DK3A 2NX5D 3DXAD 3OKEB 4XAAA 5EZYA 1OGTA 1LWJA 1RZKH 1I08A 4IE7A 1S0GA 5CADA 1NGQL 3LQAC 4YVSB 2JDYA 5ADOL 2F58H 4FG6C 5IHZB 1S3KH 4Y2OA 3WG1A 1S4CA 2FO4A 4MQSB 3FUOA 2CWRA 1SNRA 4O58L 5AW3B 3QHFH 5AW8B 3NN8A 2O1QA 2JIXD 2ADJB 4QNPF 3GMOA 5IVXF 1K9MW 3O9WD 1PP9H 1XMWA 3Q5YA 1RUE1 2HWB1 4EJRA 1BM3H 4HJIA 3T1YB 3AG1B 3V7AE 4U3JA 3PNAA 2B0SL 1MUJB 4FQIL 1EEQA 1QVOA 1WLWA 1F4XH 2VERA 1MJ7H 1D2DA 1E40A 4LKEA 3N42B 1OP5H 4WEBH 3TVMC 1O7SA 4XBFA 3MLTA 3SKJL 2HT4D 3OYWA 1JNHB 3A23A 1HYSC 4N1CA 4K4KA 4Y4FB 3AGVA 4EBQH 4MVRA 1J3PA 1SOQA 1CN4A 4IIJB 5HJDA 15C8H 4PGBA 4PCKA 1EAH2 3K58A 1V9U3 3WG7B 5A3TA 2GHWB 2J6EL 1W2KT 2WYFA 4L8QA 2QTVA 2ATAA 1AKJB 5T1MA 2XZZA 5C0DA 1A4KB 3ZIWA 3MPBA 1HHIA 3U10A 1AMYA 1MNNA 2ORXA 1Q1JL 1FA4A 1ZNPA 4QT5B 1A4JB 1SBSL 4AKPA 3K3WA 3U30B 4HT1T 4YSFA 4A2FA 1ZRCA 2ZICA 1FDLH 3DPBB 1YYCA 4LMQE 3RNKB 2ZIDA 3QWRD 1EZSA 2GSIA 5T1KB 5GS0C 3I59B 2NYYD 2XQXA 2DTSA 4L3AA 1E1QG 3ZHDA 3F8UB 3K3OA 2WA3A 4Y4YA 2EYTB 1FYTD 1OGAB 2CA4A 2EXWC 2VLLB 5FYLL 1R6VA 1C5DB 4I18B 3DXTA 4B3MO 1A0QH 1R24B 3KL0A 4M7KH 4I0XA 5CBGA 1LM8V 2QTEA 2E33A 4NQCA 1ZT1B 4J11A 2YOAA 3Q1SL 4J39A 2Y7SA 1NFDA 3CUPA 1RL1A 5D7JA 5F7KC 3ZKND 1A34A 3LIUA 3D3VA 1OE1A 3OR6C 4XO4A 5DDJ3 2CD0A 5B4XA 4K15A 4JY4B 2GKIA 4QPIA 1I8UA 1KENL 1GWKA 3FFZA 1MELA 2LUWA 1RIRA 1JNNH 3H85A 3HIFA 2UX7A 2WS92 1ROPA 4LVNC 1BBDH 4NDMA 2Q2LA 1RPOA 5FZCA 4XOEA 1FX5A 5TQ2H 3T08A 2CBQA 2CLZA 2VYRE 1RXGA 1E9OB 4LKDA 4AEDA 4QPKA 1K34A 2P7TB 3OR6A 2GITB 2J42A 1TSHA 3ES6A 3DTUB 3FU3A 4D8PB 3PURA 4S0TD 2OCFD 1F8TL 4Z7UA 2PYEE 1KKDA 1HC1A 3O3AB 2Z69A 3L3OC 4TVUA 4FAAB 1NDMB 4ANUA 2EYRB 1NA1C 3KGTA 3O1TA 2ZX7A 3ARDD 3KHBA 4DGVL 3VWJB 2FCUA 1NOLA 1RUJ2 2RJ2A 4G7QB 4DVBB 2JIXB 5J9PB 2Q76B 5FC9A 1Z9SB 4GLXA 1W04A 1XU1A 2AZ2A 5IVZA 3QAZB 5CA0B 3VCLA 3D4YA 1N3NA 1CFQA 1ONQB 4NERA 4NHKA 4IOSD 4N86A 3UCSC 1Y7BA 2NN4A 2DF3A 3N1GC 5SWZB 3T8XB 3ZK0A 4LA3A 5HCAA 5BW7C 2E76B 4LBEB 1D7PM 2G60L 5AD0A 1BAWA 3QYCA 2ZXEB 3TEZA 4JGYA 4OUMA 1PO22 1VBE3 4G6KH 3V0AC 2C9XA 4X5LA 4DR7O 1HKLH 2CGYA 3F7YA 3C8XA 1RUI3 3GSUA 5TH2A 1Z5LA 5ICYA 3DJSA 5HFMA 1S7WA 2OMWA 3LZOA 1KXQE 4PRID 1CU4L 1YEGH 4BE6A 3I8TA 4HK0A 5CMUA 2VXSL 5C33A 2NXZD 3MNZA 1F90H 5DQDL 4NO4A 1YJLA 5IDJA 2YD5A 5A6IA 4Z0BL 3CMAV 1PAZA 3H3UA 1GY1A 1OKEA 3CZUB 3WLBB 1K5MA 3CQFA 1ZZBA 2DCTA 2M1KA 3ABGA 4K7FB 1EGJL 43CAA 4DCQA 1UL9A 2OXBA 1EAJA 4ODTL 3EJCA 4P0DA 3P02A 1D3CA 4TPRH 4K6BA 1QTSA 4S1RL 2XBZA 2VISA 3H8NA 4KDWA 5C5TA 1N0JA 1D6VL 3FB8A 1M4UA 4OQTH 5C09D 5LN8A 2OPCA 4G11A 1N47A 4XAKD 4DN4H 4G28B 5ALBL 3CXCU 4WZCA 3IJ4A 1XO8A 4FOMA 4TULL 5AD0B 4G2KA 4A1RA 3LNGA 1INQA 2WZ6A 4K23H 1SPPA 4LF9O 2EIZA 1JHNA 4CS4A 1O5LA 2E32A 1FJ1B 1J1PH 2I69A 3O3EA 4L0YA 1DF5A 4RX4D 4HZLB 1PIV2 1CLYL 3CLFL 5GRJH 3TIEA 1NZCA 1JZFA 2Z31A 1LDPL 2MEJB 1TUEB 4CS2A 3AXLB 2B9UA 3JVFC 1IU1A 2E53A 1VF5B 3B9KB 1GSLA 4LBQD 4JRYD 2HLDG 4JVUA 4OJCA 3ZIXA 2OCHA 3M46A 3MNVB 1BF2A 5DJDB 3FQNA 4AIEA 1V9U1 1JGVH 3R65A 2NQ3A 3CUPB 5BZDA 4NP4H 2DQCL 5FOJA 3LJ3A 4MDJA 3PAZA 2V72A 2DEYX 4KXAA 4GG6E 4Q4Y2 4HSLA 1GSKA 4OZGB 5HJ3B 1AGDA 4L29B 4P23C 1N3QA 3PLQA 1ZLDA 2VW4A 1L0PA 5ANMB 1ORSA 3RY6C 5I1IH 1YEEL 1DLBA 4OMCA 1HU8A 1PIGA 2IQAA 2PXYD 4N8VB 5D96C 2PAEA 1I3RB 3RVTC 1KPVA 4FQIH 4QRRE 2VLMD 2BS8A 2WNXA 1N59B 4NQSB 4OU3A 4E41A 4A04A 5IAVA 1QSEA 2H0JA 5GZEA 1BHAA 2J71A 2KI6A 1WICA 3RYFB 2XVBA 3A6BH 4ZMOA 2NXYB 3SGJA 4KQ3H 7PCYA 1REEA 2D6MA 1UAIA 2Q7HA 4CCOA 4CCJA 1I53A 4MJHA 4DZ8B 2YB7A 3EBGA 1MVUA 4N2KA 4KTGA 1XQNA 1AZCA 1NINA 1CIYA 1XIWC 5ABJB 5DJ8B 1JF5A 4JE4B 5LLIC 3VBRC 4LESA 5GLUA 4KTDH 3VHPA 2J1XA 1AR61 2BRQA 1XREA 2ZZQA 4XMPH 2WQSA 1NA1A 3HAGA 1MCIA 3EGDB 4P59H 2LHAA 2HA1A 3KPLA 3MBEA 3SBWC 1PNDA 3D85B 1CL7L 1U3HC 3WQ7A 2DM2A 3DI2B 4FYSA 4MRCA 4UB8Z 5FW7A 1MCOL 4N53C 3SJCC 2B3IA 2VT0A 1KT2B 1LOEA 1OA4A 3CX2A 4QGNA 4CDQA 1SF9A 5BMFH 4Y5Z0 4N3UA 2AAVA 5DEDA 4OLYL 4WFFE 1VERA 5I8KL 4Q4W2 2GUZA 3F7LA 5C92A 2IDTA 3KF5A 5CIPA 3BA8A 4DP2X 4TNGA 2BSKB 3ARGA 4D9LL 4DK1A 2VMHA 2OCJA 2ZEWA 1NDGB 4G8EA 4MSVA 3KHQA 1W3XA 1KJRA 4O2AA 1UZVA 3LEKA 5T3XH 3IMSA 4LEJA 4WHDA 3L5IA 4XPHH 3BLPX 1S9WA 3RW0A 3HG1D 2G5UA 3KJ6L 3RVXC 3CQOA 2G2RB 4OI8A 4JRFA 3THDA 4P4KD 2FX9H 3D0AA 4KU1A 3HRZA 4UMSA 2AZAA 3B7TA 1HX6A 2ZACA 3UJTL 4RGMC 1SBEA 3FLRA 2IOOA 3WKMH 5FZMA 3KYOA 5EC2C 3LXBA 1VBE1 4JQIL 1U3NA 3GNML 3QHTC 2ETNA 3JV6B 4AQ6A 1J0KA 4GMP1 5FMOL 1KBGH 1TUBB 3IJ9A 4KBBA 5JZGC 3AXHA 1OHQA 1J5HA 1OSYA 4S0SD 5FO7A 3NSYA 4TLGA 5A3WA 3BKYH 2ZGNA 3N2KA 3U4XA 3U4BL 1EPZA 5L2JA 4WV1C 2HFEC 4UT9A 5FYJD 1HQRB 5I26A 2C26A 3SE4A 4FXKA 4K9EH 5F7MC 3OPTA 4Y1YA 3HE6B 1OCCC 5GS2H 5CB4B 4WWKC 1WFNA 4B3SO 1W0PA 2K78A 3ZTJG 3MFCA 2IAMA 1W72B 4PS4H 1LGVA 4YFLF 1BXHA 1QF3A 3FL7A 3EOTL 3GI9L 4HD9A 4K5PA 4U3HA 5KZCB 4JO4H 4Y4HC 2BSSA 5E4AA 1AYOA 4W4ZA 4OGXL 2R041 2Z42A 3VXME 4HF5L 1MFEH 3SE3C 4LP5A 1G7PB 4N8UA 1GWLA 3U2SA 3MNDA 3FT1A 4KWUA 5C07D 2RALA 3NTCL 3MNMA 1XNAA 1V9U2 4Z3EA 5TDNB 3AZZA 4EOWH 2MHFA 4U4IA 3EYVB 2VXSH 4I3RH 5DD5L 1Z1WA 3D18A 2B39A 4XH2B 3TASA 3E1ZA 1YI2V 4OFIA 5EIIG 3THML 3ISWA 4G6FB 2UY7A 4B3VA 4B5EA 2JJSA 3C7OA 3T4ZA 3UL4A 2JG9B 5B22A 3LKQA 2L7QA 4BMBA 4PR5B 2X89A 3M6DA 2JG9A 1JHJA 3RYMA 4QQOA 3TYFA 1IO4C 5FZ6A 1I7TA 3MMEA 2XG5A 4KHXL 1K8IB 3IRZA 4BKSC 1XT5A 3L9RA 4BHUA 1J1XH 4WZ9A 4FOWA 4MAYD 1AZDA 4Y8DC 3N91A 5TDOB 1SCSA 3J8F1 1QQDB 1HZLA 1AKJD 3EFFB 5HY9B 3MLRH 4MRBA 1IGYA 5B66Z 1WCKA 2DQDL 5ICUA 3VD3A 4GAJL 1PVC2 1JF1A 3QJRB 3ZGIA 1E79G 1XMQO 5DC0A 4Q6IB 1B0RB 1W8OA 4JM2F 2ZNXA 3FHAA 3PQYD 4JM2D 4F80A 4D6RA 3BZ4A 4GSUA 1IBLO 3ZUNC 4AENB 3E86A 1MIEH 4X66O 1AX0A 3PJLA 4JQIA 4YK4C 3R06A 1CFNA 1RZPA 2QQNH 5AVXB 4IHBA 4MJID 3KPTA 1CXHA 2NY0B 3HS0A 4XZ4A 2HFEB 2TAAA 4GW1A 3QWOB 4LWSB 3B7YA 5BZXA 2AV1A 3WN5C 1OXCA 4QQPA 1SM3H 1CO1A 3D8CA 2XTAA 1WH0A 5GGRB 4IYKA 2R9HD 2WA4A 2QHRH 4ONOA 4PG9B 4CP1A 4L8DA 4XWOC 4ZX4A 3L72H 5JHLH 1CAVB 2HJKB 1NAMA 1O9ZA 3JT2A 4PRDB 5DUPH 5JXEA 1T5XB 1OP3H 5GJSL 4I5SA 4IJ3C 1XVSA 1YEHL 3HBZA 4AVJA 4LF7B 1NC2A 4Q4V3 4NZFA 4RGND 1WCBA 3QEUB 2NX5A 1E5ZA 5FF6B 1KSRA 1MCDA 1F5JA 1V70A 3LIGA 3WXPA 4R9BA 1FS0G 1Z3GH 2O6PA 5CBAB 3VD0A 1DANU 5JXAL 5D7LA 3AWFA 1EEYA 2WZPD 1MSDA 1FGNH 4EKWA 5EOQL 1BQ0A 3RIKA 4IOIA 3ZTCC 3RQ0A 5E8OA 4ATFA 1D4M3 1YNLH 3EH3B 2R27A 2EDHA 3DIFA 1FPN2 3DBSA 4YRDA 3QO5A 25C8H 3O0RL 1I75A 3QUZC 4ZUTB 3X3GH 2ZG3A 4RESB 2PHWA 2R9IA 1MFUA 1IKOP 2ZE8A 1CGXA 3K51A 4QU1A 3EO0B 4WFFD 5A16A 4WRLA 1WZXA 5AW9B 3U1SH 3CZFB 3WN5A 2CAUA 2DD8L 2IALB 3GSXA 4LPYA 5B7EA 3WV0A 2YBKA 4WO0A 4EVNB 5F96L 3PWJB 4NQEB 5A32B 1QEXA 5TGBB 4LQRA 3X1GA 1RZFL 4PBDA 1ZBE2 2HHHB 4D9LH 4RLDA 4AEIL 2VABB 3LGRA 4YQXH 1Q0YH 3ZT5A 4MD0B 3ESOA 4HJ1A 1MLBB 5E00A 1JPEA 1VPOH 3CVHA 4NCDA 3CHOA 5IB2B 1PJWA 4NRYA 2Q6WB 2J7MA 2OXHA 1TVBA 3ZHVA 4DKDC 1BEYL 4IGBB 4LDEB 1JXKA 5L6YL 3UM7A 2G5BB 1CBVL 4FEMA 3SO3B 5F7LB 4F15B 4AHCA 3T09A 5FYKD 4YBLC 5JCOC 1BZ8A 3HRZB 4YGCA 4M3CF 4H0GA 4IE4A 3CJHB 1BVOA 1XU2A 1A1NA 2MFNA 5FKPB 2P42B 5AWNL 5HYFA 2A7AA 1HQLA 3VBHC 1VFBA 3PP4L 3OCPA 1T1WA 2VW7A 4R4BB 4CSPA 4HP5A 3AWEA 3MROA 1ZLSL 2DQ3A 4PV1C 3ZYZA 4UM9B 2WTRB 5GJTH 2AJZA 3CQPA 2CNYA 2VRAA 3ETBF 3ZPDA 1ND2C 1N33O 2WZR3 4FQCL 3I9GL 2Q7NA 5IJKC 1ZAGA 4OCYL 4TV8A 3DGEA 1CXFA 1NTZH 1BVLA 2FWOB 4K9EL 2NTFB 1LEKB 4LIQE 1BAFL 4NP9A 3LDRA 1A7NH 5CILH 1ULCA 4BA6A 4EUPB 2XLFA 3FHEA 2NNFA 4O51A 3PIGA 3WV6A 1FP5A 5HDOA 2VNVA 4OHWA 2KPNA 3ZKXB 1ZHKA 2MTPA 1RVF1 1W39A 2WXIA 3BPOB 3ZSLA 1WP8A 4K0KB 2Q3AA 3F12B 3IMVA 2QZ3A 4O4YL 5C0DB 2JD4A 5FB8B 1KBKA 4XXWC 4NGHH 2WXPA 4MDJB 1OP9A 2H0VA 2AGSA 2HYKA 5EOTA 1GTOA 4RGAA 1VIWA 2QQLH 4I02A 3PGDA 4PJ8D 4S1QL 4P46C 5GRUL 2Q1MA 3IJ8A 1OA2A 3PUIA 3HI1A 5IUCA 1CPNA 1SLXA 2XONA 1I8KA 3KH4A 3SISA 2X7LA 3FLTA 3FTGB 3T2QA 3MRHA 3CC5A 3L4VA 4Y4KB 4XO3A 4XBEH 4GRMB 1EPWA 1F02I 2J57A 2LP7A 3H3LA 2A71A 4WUKH 1HB3A 1J9CT 4RMBA 4PWFA 2BNQD 1U30A 3M86A 2C3HA 4N8VG 4C56B 2RDQA 1OT1A 3I6GB 3B8YA 1PM4A 4Z7UF 5T3ZD 5CLWA 4GWNA 1M4KA 2NY5L 2R2CA 1RLWA 4D9QD 1AOZA 2VDPL 2EILB 2Z4FA 1FAKT 2CH7A 3C3TA 3IDUA 1ZTXL 2ICWA 4BISA 4HDIB 3T1FB 2DTML 2BFVL 1MFVA 3ZRCC 5FEBA 1J7VR 1DBKH 1TZGL 4MNQE 2DQDH 3DK2A 3CEIA 4FQ2H 4I4WA 4U6XB 1KEGL 1ET8A 2BOBB 5L4FA 2HKHL 1KIPA 3P4LA 4CAGA 3O0VA 1UNBA 4K0OA 1S9XA 3LB6D 4UQ2B 3PQYB 1BK0A 1M3IA 1SQVH 1ZWIA 3I75B 2R15A 3STZA 4UVCA 2VS0A 2APFA 3RWKX 4Q9CA 3ACIA 3E22A 3QBTB 3B9KA 1VZIA 4ZYKA 5F37A 3LKSA 1YYMH 1FMD3 3VHRA 3ZFEC 3UPRB 3TCTA 2C1PA 2X6AA 4BB3A 3FMGH 2Y4SA 1IG3A 1EEUA 1BLNA 3BIBX 4G9FA 4OFYD 1VQNV 1JNLH 4QXHA 2JE9A 2YLHA 4DXWA 1GR7A 3PY9A 1KOAA 5HHOB 1XE0A 2DDQH 3TT3H 3L3KB 2OKXA 5CA0A 3VCLB 1GK9A 3GGLA 4PJHE 1CAWA 1FATA 4MD4B 4S2HA 3JWNE 1DL7H 3WQBA 4D6TH 1CG9A 1E2VA 4DJMA 1M7XA 1KG0B 3WDVA 4NLHA 4XVOA 4O9HL 4JTCB 2FEJA 1GGCL 3IFPA 4XWGH 3Q2NA 2IADB 5I71B 3RWDA 1PKXA 4ZNCD 4NIAA 4LKCB 3FAVB 5LCVL 3WLBA 2Z7ZA 3OOXA 1ONAA 3DPRA 2W95A 4NC1E 3L7EA 3QNEA 4AL8C 2KPWA 4IRZA 3QNYA 1QXPA 3NV1A 3WAJA 2WXGA 3OGGA 4QX0A 1OAUH 3AFKA 3SE3A 4NUGH 3B7MA 2NXYD 4HXBL 4TLFA 3OLDA 2EBOA 4W6WB 4L9LC 4HG4K 5GS0D 1NGZB 1OAYL 4M1DL 4JPVH 2P22C 5D7JB 5TE4H 1RUG3 4O00A 1MHHB 3L4XA 1F4NA 4JI1O 3IRPX 2WIMA 1GGTA 4AYSA 2JLPA 4XAEA 4JN2A 3PL6C 3SCGA 3RTQC 3MUGA 3T2OA 2AJSL 2OR9L 5FUNA 2X6VA 2WWMD 3MV7D 3GQFA 1U6AH 1KELH 1VFOA 3CPLB 4GAZA 5J1XA 2X6BA 2UX6A 5CZXC 3BD4A 1UVQB 2VC2L 3Q3GB 5HDQH 1LHWA 5LA9A 4MNGA 4BMEA 5L7OC 1QSEB 2FO8A 2WAAA 1VIBA 4IL6Z 1OBNA 4AYGA 2JEXA 1CZ8H 1LO5A 1C08A 1ZY9A 4Z1PA 1RUF3 4ZPIA 3VOUA 4FQXD 1J0HA 4JTDB 1CS6A 2BHUA 3M99B 2IPUG 3IF1A 4LU5L 4MCZB 5CD3A 3RL2A 4H20L 2HVBA 4IRJA 5EC2A 4EE2A 5CEZL 3U0WL 2RS33 5F1IB 3HZMA 3N1MC 2KZ1B 3LB6C 4O2FA 4P3DB 4ZIBA 2H8PC 3DDGA 1HK6A 2M6YA 3STBA 3IXTB 1JQ0A 5C9JA 3VYNA 5MI0C 4COUA 1NC2D 4KO5A 2J8HA 4LF7O 3EHKA 2IJHA 4LLQA 5AWNH 2YUWA 1A6ZB 1DYOA 4PJFA 1OPMA 1NCAH 4S11A 2DYPB 4QQLA 4DUZO 3DIFB 1RUE3 4B1MA 1NCRB 4NSKB 4GUPA 4HJTA 3E80A 4OZHF 5IJBC 4FLHA 3B2DC 1LO5B 4NXNO 4YJ3A 3ULSA 5E9AA 3SJVE 1XYOA 5F7UA 4PJEF 1MRCH 5AQ0A 3EJRA 4JANB 4JYAO 2ZHKA 2YSSB 3P4MA 2F53B 4J8RA 5INDA 4ZMPA 5KBFA 3EB7A 4FHKA 2NX5B 1DIWA 1ZXKA 4FBFA 1H3XA 1QVOB 2Q8BH 4B0MB 4IEPA 3IKWA 4IJ3B 3VXSE 1KCSH 2XKOA 2OMTA 3S5LG 4YIPA 3Q13A 3CVBA 3WO4C 4DKFH 3FU7B 1IZJA 4FRWA 5IGXH 2K2SA 3MJ6A 5D1XE 1M7UA 1K5MB 3CZUA 2W68A 1JCKA 1SFHA 1E4KC 5EBWC 2W0FB 3U4KA 4X2UA 1QDCA 2CK0L 4QXVA 4IV1C 4NKIL 1Z32X 3L9YA 1E5BA 2VDNL 4JI7B 2DS4A 3BH8B 4FQJH 5A1FA 4Y1ZA 5GRUH 3OMNB 4AL9A 4AW7A 5G4OA 2DYPA 1R6NA 4RFNB 3P3SA 4W6YB 5GS1C 3FX7A 1HHIB 4AW4A 1PO23 4OHXA 1AQKL 4F7PA 1ND0A 4J5VA 4OM0L 1XSIA 5J13B 5ERWB 2NNAA 2DWYA 4H0HB 1LO0H 4OZFB 4PI2A 2BSEA 3A6CL 2HRPL 1YQVH 2SODB 4J3UA 4ADIA 5F9JB 3D5OA 4JTOA 3EYQD 3B34A 4RRPA 2BVQB 2F1MA 3N04A 4U1IA 2X5PA 1KCRL 4RGOH 4X20A 5DD3L 4OZFH 1DVQA 3N0PB 3O4LD 4UZSA 2FQFA 3O2DA 1REIA 1YIPA 3KV6A 4GQ9H 1HFUA 5HD8D 5C97A 5ACA1 3EBAA 1XF5A 4YG6A 4FQ1L 4R8HA 3EBRA 5EWSA 5L88H 3QJVB 3VWKB 3ZM8A 5I18L 1HHHA 4JCWA 3S4SB 3L9RB 2WLIA 4FMKA 4ZHQB 3LTVA 4HNAA 2ESVA 3QG6B 2EYSB 3CSYA 4AMXA 4DK0A 2GH2A 2QPEB 2N7BA 4P2QE 3W11D 4BFIB 4RN5A 4KZDH 1IBMB 1RUAH 3QHFL 1AVMA 2EIMC 1AJ7L 2B8OT 2J1YA 4QPIC 4XJAA 3OFNG 4XPGL 2LVCA 3RDTD 3VRLF 5E9NA 1WIOA 4JGNA 3QUYB 5L3DA 2UY7B 3G6EV 1QSFD 3ZFFB 1C1EH 3K2IA 4S1DC 4ENZA 1DU3D 1JWMA 2F0CA 4JM0A 4M93B 2G4GA 3EYFB 4QRFA 1X9UA 3HS8A 3SOBL 4XABA 3LXCA 2GMPA 4YEFA