3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
molecule tags Membrane protein
source organism Methylosinus trichosporium
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
3RFRA 3RGBA 4PI0A 3CHXA 4O65A 4PHZA 1YEWA 4PI2A
chains in the Genus database with same CATH superfamily
5CBEB 1C28A 5K1XA 5DRWA 4YIQB 4UQ2A 5D1IA 2YPKA 4O2CB 1BF8A 3SE3C 3KM1A 1RITA 5KYYA 3EJSA 1UFUA 2HHHO 1XH1A 1CP9A 3QQ3A 4GKNA 4K7PH 4NB7A 5E95B 5I16B 5ICYB 1HSAB 2DTYA 2BVPA 3OAZK 2OJEA 2DJSA 3N85L 1MUJB 5E2TH 2FX8L 4Z7WF 3CSYA 1EO5A 4G1EB 1KKCA 1IU1A 4X7TA 1I9RH 2C1PA 3OHXA 2MPFA 4Q4X2 4OJFH 3NP4A 1HAUA 3WY1A 3K1DA 3ARXA 2VXRA 1ZL8A 3UC0L 1XWVA 4AAPA 4J11A 1MCHA 5B4MC 1L1FA 4JVPA 2Y06H 1W90A 2FWUA 1RUI1 4F8OA 4MXWA 4XMLL 1K3ZA 3T71A 2F4LA 3QFDA 4PJIB 2D40A 4MDIA 4CA9A 5ABJB 4Z78B 3N0PB 2EKSB 2PQSA 3CDZA 4MTFA 2YEZB 4ODVL 4Q2ZB 4YW7A 2JB5H 2XV3A 2PTUA 5LHHA 5MP6H 4JB9H 5KVFL 1QJY3 1O8PA 1CZ8H 5FKBA 2C3GA 7PCYA 4LFAB 1EHKB 1MHEB 4R5VA 4IW3A 1XU2A 5FZ8A 2QQNL 3K8KA 3O6ML 1INEL 2R83A 1ZTXE 2K9FB 2R0WH 2QBWA 4Q6YA 3LN5A 1MJUL 2R4SH 3TH3T 1AR72 1WA0X 1OLRA 5I1EH 3NN8A 2HMID 1PVC1 4BHUI 1XR9A 1TVHA 2OMUA 2Q7YA 4X1YB 3RZCB 4NO0A 1B0RA 3NR7A 5EZJB 4XEZA 4BYHA 1IBKB 4K94C 2UXXA 3WY4A 4MZ3A 4HKWA 4AI9A 3RZCC 2EE0A 4NQDD 3B7UX 2R4SL 4EN3A 2NXYC 1PD3A 2N1TE 5IJ0B 3NCWA 1YY9D 5CA6A 1IAOB 3UETA 1Q8VA 4DUZB 4DR3B 3DX9B 2UZIH 3QXVA 4RZCA 5F9OL 1XH0A 4FTEA 2RE9A 4FFGA 5C9AA 3QRFM 1BZDA 1Q94B 3L9JT 4R4BB 5KVFH 5MP6L 3JARB 1XNAA 1C4RA 3RG0A 4HWBH 2OW4A 2I9LB 3VH8A 2VAUA 5T55A 2BTVC 5DD5H 4OQTL 1ZOXA 2ATPA 4AQEA 4CADA 1OV8A 4F57H 2FR4B 1DQ6A 3MNMA 1ZX5A 5FQ0A 4F37F 2DMCA 2ZGKA 2LU3A 1N8ZA 4COWA 2W9LA 1X7NA 4TPRH 5CJQH 5ITBH 1RM1B 4N8CH 3WDTA 4K94L 4YAQB 1XL4A 2YAEA 2BNNA 2WWSA 3NNJA 1FNEB 1SLVA 3QRBA 2HPTA 4EN3C 3KVBA 1O6SB 3FC8A 1IBFA 3LXBA 3QNYA 1JTOA 4KU1A 3ST7A 1H8OA 4NUMA 3QA3B 4FFBB 3RVTC 3K79A 4S1QH 1QAWA 3IAGC 3DBXB 1ZV5A 3NJIA 2F8XC 4YC2C 1J9SA 2Z65C 4PJFB 5E8DH 3HAGA 3NRUA 3FTZA 2NSQA 1SRYA 25C8H 2MPAL 2H1LM 4G6AC 1U91A 3BQUA 1PAMA 5JLVA 4JAMA 2B59B 4DEWA 3AB0C 2A2QT 4ISVA 2Q30A 1C1EH 4YPJA 2UV3A 3IU3A 2UY8A 2AMGA 1MFVA 5EUOA 4EI0A 1B4TA 4HHAB 1J8HD 5CCHE 2XJUA 3SGDH 5IVYA 2I45A 2P80D 4X9YA 1DO6A 5DK3A 3H8OA 3GSVB 1LGNA 2Q4PA 3QNFA 1ZYBA 4ATTA 1AGFB 3G6JA 2J4WH 1K12A 4MVUA 4OQ9A 5KYUB 1K4DA 4M7ZC 5C07E 2VMJA 4OZ4B 2WZEA 2WA3A 4FFVD 4LSUL 4H33A 1WMXA 4JASA 2Q8AL 2HWD3 2R0HA 5D93C 4ZZFA 4R8HA 2Z3YA 3QACA 4NIDA 4JN2B 1EHAA 3MOBH 3BEVB 2YXLA 2P7TC 1EO8H 1NGPH 3C9NA 1DQ5A 4LO4B 3WE6A 4EZLA 1MWAL 3WIIH 5B66Z 3CCQV 3G5XB 4KJPD 3DPRB 4UWQB 1G9AA 1VKXA 2HLEA 1DGRA 1I94O 1EFXB 1C8NA 3ARDA 3NT0A 1NC2B 2QDOA 1DLBA 4PPTA 2VECA 4XP5H 5I0ZA 4OLVL 5ACA3 3N40P 3X2QC 4NIGA 2QELA 2IALA 3V5DB 1JSYA 3A22A 5EO1B 4KDTA 3IPFA 1I7RA 4HFWA 3C2AL 4FQHB 4S1SH 4WZFA 3GVMA 5GSRA 5JQ6L 1OWWA 4I3SH 4Z78A 3IJEB 4WM7B 3D34A 5DDHB 5IHUL 4BQ3A 2QEJA 3POYA 5LK7B 3MFFA 3BH8B 4A2UA 3DXAA 4BCYA 3RQ3A 3QJSB 1QRKA 3QXUA 5E5UB 3RL1B 4LHKA 4IU3A 3CSBA 2ZGPA 1JYVA 4W9ZA 5ICXA 5LJYH 2VUAA 4F7MA 1QOTA 1POV0 3DI3B 1CFQB 2ADIA 1BGYH 1G7JB 2OKMA 2Q3XA 1KULA 1JOYA 4NKIH 2XV0A 5F6HI 3QZWA 3OLIA 2DWDB 1S78C 2WNVA 5ACA2 3Q8BA 3JTSB 1YTFD 1V54B 2X0WA 2HKOA 4PV1B 1H8TA 2VAAA 5CCJA 4LOEA 3T8VA 2NLRA 5KAIZ 3POIA 4WV1B 5DHEA 5CFAA 4NP9A 2D3RA 1SZXA 2Q5ZA 4DAGL 3VGBA 3HNBM 4WFEA 5F3GA 3QIUB 2YIBA 4X6CE 1MFEH 5INCB 3N9GH 3QD6A 2WCGA 4ALAH 1E2ZA 4D0DB 1I31A 3KPTA 1U8MA 4OLYH 3IMTA 4Q0QA 2LGWA 2W9XA 2AEQH 2DQJH 2XVKA 3P4NA 2P45B 4O65A 3RWKX 4LULA 3HNVH 5J37A 4PGEA 4IV1A 5TSWA 4DNYA 1UUSA 2XAFA 2VO5A 1NJ9B 4WY7L 1FNSL 5ID1B 4PD4F 5EZJA 2ODHA 4ZD3H 5LXGL 1ULDA 4BB3A 1IGCL 2WVVB 1EXGA 2P4EA 4AH2B 1EZVH 5IR1B 1Q90A 1FJGO 3IDUA 1O4ZA 2XFXA 4NIYE 4DN4H 3JWOH 3W56A 1PK6C 3DTXA 3OFNG 3ILPB 4YDNA 1PO22 4JGYC 4CP0A 5D1QD 4O2EB 4PVBA 3B40A 4PWKA 3VBRC 1RZ8A 4MADA 1MQTB 4YIOA 3N1GC 1ND0B 5F96H 1S9VA 1JFHA 1EFQA 3AY4A 3PP3K 1N7ML 2WQZC 1KPUB 1MS8A 2XPJA 3EYQC 3TPKA 4AV0A 4PRDA 3ZT5A 4E9TA 5IROD 2HR3A 1ZLEA 3X2QB 2UXGA 3BP7B 5E6SB 1R1BA 4C91A 1CK0L 1ZANH 5EN3A 3NPZB 3PUHA 3FBYA 3QAQA 4NZUH 3LKSB 1RZ7L 1MAML 1FE8H 2ZT9C 1ZT1B 2XBO2 5C8CA 2VRKA 3EXLA 5L8JB 5SV3A 1N5YH 4KNQA 4CDWB 1DVTA 1OP9A 1RV6X 2LGNA 1MAMH 1QEWA 3PP3H 1C3HA 1KD7A 1NCQC 2KA3A 4ZO8A 3V52L 3HTLX 2XJVA 4YDVA 2VZRA 4QXBA 4U2ZA 2KDYA 5AVPA 1I82A 4UFJA 2Y7MA 2HRPH 3O6LL 5FZ4A 4DY3A 5JIIA 2Y4SA 2Y9RT 1XMOO 4R0LA 1F58H 1IGFL 3AQDA 4GQ9L 2APFA 4NKGB 2NYYA 2VVDA 3GYRA 3Q3GB 4PJ5B 4WUKH 3CZLA 4PJCA 1D4M3 5GJSL 1ZA3A 2Q7GA 3CCUV 1H5BA 1DVXA 1UM5L 3GEWB 5FW8A 2BCMA 4JFSA 3VU2A 5D1XE 3V0WH 3FX3A 3HBZA 2IOMA 4HIIA 1VRSA 4AJ0A 5LWYH 4XBLA 2EDYA 3GUFA 2D8KA 2QKIB 1H3UA 3H7BA 3VDDC 2JI2A 3V5KA 1Q3EA 4GXVL 2XTAA 2V8LA 4R7LA 4RYDA 4AV4A 4DXZA 1H8EG 3EH4B 2R69L 4BFJA 4QDSA 1JRHL 2X4UA 1HDKA 5CP7B 2RMU2 2GNMA 1B2WL 4DV7B 4JI4O 4JPIA 1NCRA 3PIJA 1UA3A 4GKKB 3HE6D 2X70B 2IPUK 4N9IA 3EB7A 2RQEA 3GNML 4WI4A 3LDEA 2E5LO 2CK0H 3QDME 1AL21 4MJJA 3S5LG 1BBJA 1AQMA 1HESA 3VFGL 3MROB 5FO7A 1POQA 3D52A 4NQQA 1W6QB 1CTMA 4WVWA 3QFJA 4BFIB 4ZTPL 5I0XA 1NC2A 4H20H 3OLGA 3QG6A 4MMZA 4NKIL 3SZKC 3ZYJA 4JJOA 3TETA 3FHAA 5F9AC 1LODA 1EXUB 4YZWA 1XH3A 4LOUC 1R3IL 4Q8LA 1RH8A 3UFIA 1Y74B 2XZCH 3CFKA 4S2FA 1J8HA 2HJFA 4HKZA 1IVTA 4B1MA 3CIHA 4F83A 3MUY1 1JGUH 3X12B 5FYIA 5AL0A 4X7FC 2X4PB 4FE9A 5GRYA 2NX5A 1JYXA 5FAXA 3WXVH 4LJHA 3ZSLA 3C8XA 4WDIA 3AS3A 1ASQA 4OGQC 3MDSA 1EGJL 2EIKC 3OR7C 2BOBB 4G11A 1N0XL 3IXAB 4L8BB 3H0TA 1B6DA 4FQ4A 1IBDA 4YLBA 1N0XH 3ZXJA 3JD0A 3UAEA 4Z1PA 2R1WA 1EGJH 4EQ3A 4OB5L 3L3KA 3SSGA 5ALCH 4WU7B 5J7MA 4G8GA 1F8TH 3PJSA 4UUJA 4YHPB 1N3PA 5SWSE 3PWLA 5B3JE 2VZPA 1Y0LB 2GJZB 5F0PB 2O8OA 1ZA6A 4JI3O 1HZLA 2IZWA 4R4ZA 3UDWA 4KKLC 5DSCB 2F5AH 4P2ZA 1WG3A 1WIOA 3QIBD 3ARFD 3TJTA 3P4MB 2DLEA 1RURH 3QDJB 4NLHA 3MW2A 5F8RC 3QOPA 1KLFB 4BE5A 4G6MH 3P6BA 4XPHL 4JZ2A 3RYCB 2ZJSL 3ARFC 1U92B 2ZS6B 3VFGH 5IJ9A 4QHUB 4Y2DA 2A77H 3UGFA 1OT1A 3P4OB 4NRQA 3ZFEA 4ZMAT 4F15B 4CDWC 2OLDA 5IKCA 5GS2D 1C8QA 2NYYD 3PP4H 4LO6B 3KVAA 2YXMA 2CE4A 1QNZH 4NN7C 4FPKA 3P73B 1NCCL 2YPLA 2H0VA 2EYRA 2VDQL 3OAYK 4IIJA 1P8JA 3DHMA 3V4PH 5FOJB 1V10A 2FH8A 4AVSA 5D7LB 3BPSA 5SWSA 3TN0B 3BPLB 1AYN3 4ANKA 1PZAA 1IBMB 1CL7I 4O51A 2G5UA 2AK1L 3G08B 5DR5L 1TME2 3IGLA 1CVRA 3BPNB 4ESKA 1A6ZB 2XN9B 4Y2LA 4O2AB 4EQ2A 4L4JA 1CXIA 4B4QA 2VXVL 2Y2YA 1JYNA 5FMDA 1ORQC 2X4SB 4UV4L 2WZPP 2C1OA 2K70A 3CFEB 4D7TA 2HWZH 1MI5D 1SPPB 2PQQA 3NIFB 3V6OC 3W9EA 3ZR6A 4HHAA 3N40F 3JTTB 1JCVA 3H56A 4PRIB 4WK0B 1MG3C 3EUDA 3E22B 2PGGA 1X7SA 4XNXL 3AX4A 2NXZB 2XG4A 5HV0A 1W8FA 5ITBL 1CGPA 3GZQA 3AFLA 3SITA 2CLZB 3BFOA 2GSMB 5BV7L 2W07A 4UMGA 4J1WA 4KG8A 1R6TA 1XB6A 3DVIA 2H32H 4JY5H 3B9KC 4OCXH 5FECB 1S1AA 3PVEA 3MRJA 1ENSA 2A6VA 3U83A 3G7TA 4OZ4A 4WJ5B 1JPGA 3IBEA 4XNYL 4NO3B 3T4DA 1FE8L 2L7EA 5KSBF 1N0LA 4JZOA 1AJQA 4AIOA 4J7ZA 1M4KA 1WFJA 3O3DB 1L0XA 3E2HB 1WFUA 4HIXL 1OCCC 3EOAB 3WNNA 5FO7B 4QRPA 4TLGA 4WVZA 4JTAB 1RAMA 2VCMA 3NV1A 2G3ZA 4ADIA 1IZ3A 4CILA 3W7UA 4M4RB 1IEBA 3MLVH 1HRI1 5EN2B 4QKTA 1HQRB 3C5SA 1OTTC 2AENA 5IREA 1NVPD 1YQVH 1NMCB 4GG8B 5C08D 3NCCB 5EIQA 3DMMC 1WCBA 4D9LL 3HPLA 3MUZ1 1NA8A 1NX9A 3Q44A 3OKEB 1QJY2 3LRLA 1OSZA 4Q0XL 3HE6C 3NRQA 4JB9L 4PJ8B 1YC8A 2F4VB 4R4ND 3AMMA 4FVVA 3IGAB 4I87A 5AAWC 4ODVH 2HWE2 1EP0A 2EVHA 5A3WA 2IU0A 4IS6A 3ARGC 3ARFA 1QKQA 3EGXA 3IS1X 2YSSB 2JLLA 2GSGA 5EU3B 1IBMO 4HCGA 3LCPA 1Y1UA 4DOHB 3UK9A 2G30A 1KCKA 2DEYX 2PI4A 4O4LB 1X7QB 1M56C 3TT3L 5FO2A 4COVA 4V2VA 5BYNA 3EJQA 1AGBB 3I02B 1S46A 3VQ2C 1NCOA 3EDEA 5TE6L 5D7HA 4SLIA 2A6DB 4Z76A 2VDMH 4BDVA 2IWEA 1EHLH 1LCLA 1D2DA 1V6OA 4JFHD 4MA3A 4NT6B 5AVTB 3OF6A 4UIMA 5I8CB 2DCTA 2RS32 3K3NA 1GM7A 1TJGL 3G6DH 2JKNA 3LKOA 3TH4T 3PWPB 5IJBC 4BQ2A 2PFWA 3UNPA 3JTTA 2WZ0A 2XCMC 2GTZA 4M7ZB 3NFSL 2ZXWC 4ZDHB 1E67A 1GSMA 3RBSA 4M7KH 1MHPL 3TL5A 1CDUA 2JJTA 3AP5A 1RB8G 2HTKC 1SPPA 2DN7A 5AOLA 4TSBH 1REFA 3R0MA 1ZT1A 1JFFB 1BEYL 2Z6FA 3HS0C 3MV8E 4OHYA 2ADPA 1MZZA 5J0BA 3BTXA 4FFYA 2XZQH 3I2JA 2Q0OC 4KRLB 1F2XK 5DO8A 4EUPA 1VAHA 4XPTL 2WLHA 3AY4C 3WAJA 1T4KB 2YQBA 3C2AH 4HK3N 3EZJB 2X4NB 3M99B 4EI5D 5KVEE 1CURA 3GZEA 5D7JD 5B1CA 1E4JA 3K6SB 5C97A 4FP8H 3ME2A 4KMQA 2Y7NA 2ZAHA 3FBKA 4YHOL 5SWZE 5TE7H 2NUPB 4LSRH 1Q90D 2D03L 3WG4A 1HW7A 4MJIE 2VMFA 4WI7A 2JKWA 1OLME 2G60H 3LEXB 2BHUA 3L9YA 1T5XB 4P5TC 1KOAA 2XWBA 4QRRB 5LAXB 5FL7G 3ZMTA 2X42A 3RVVD 2D03H 5AD0B 1EVUA 4JPKL 1WW6A 4Z82A 2GDFA 2YUZA 3CXHK 4JDEB 4KOBA 4HK3J 1ENXA 5B39G 3A8TA 1X9UA 2YR3A 4N86A 1PVC3 4X6QB 3FX7A 1MCWW 3REWB 4YZ1A 5F72S 1HS6A 1BEV2 1YJDH 2J4WL 1JHJA 2KDGA 3EYVB 3AB0B 4UT6H 2OMWA 3GMNA 5T3XH 3ENRA 3MCG1 2RR12 5LMNB 3P54A 2ZONA 3F2LA 3GHEL 1M2VB 3S35H 1DFXA 3ARDC 2VGDA 1FFOB 5CEXB 1FAKT 3D39B 4G70B 1AR92 2DJUA 4PWEA 2RCSL 2AZ0A 1F5WA 2QGDA 5KVEL 1QY4A 5J89A 2HFFB 3FL7A 1SBSH 2VC2L 3L4YA 3SDAB 1LTEA 2K46A 3BWUC 1GANA 3V4PA 2BJSA 1SA0A 1UWXH 1FPTH 4LSVL 1WF5A 1W03A 2YGNA 4JUTA 3Q5YA 4LHLA 4QHNA 3VBHC 3E8FA 4PB0H 2XY2A 3OGJA 3LQAH 1BPVA 3NCBB 2GTZB 4DK1A 4PGBA 4CP9B 4NHKA 3BCDA 3MZGB 3P2TA 1BEV3 2AJVL 3ETSA 4JY6B 3CZFA 2Y4TA 3Q4HA 1CIUA 1SYVB 3LQAL 4WI0A 1AGFA 2NW3B 3G6JB 3H3PL 5G4MA 4O4YL 4MGYE 5ALBH 5JZGC 2CALA 4AJVA 1IMHC 2EILB 4G43B 2WK2A 1X33A 5ABJC 4GJTB 5LA2A 2K9UA 4YSCA 2X38A 2EDEA 4HJJH 1PZDA 2GP5A 3O3DA 1GY2A 2ZG3A 3EYSH 3FCUB 2RCSH 5AW9B 3MF9A 3M3CA 1AZNA 2WNKA 1N70A 2YAOA 4AV5A 3HR9A 2OMVB 1R3LA 2H2PD 4DWHA 3IZOA 1YPZF 3U4EB 3AG3C 3C9NB 4IM8A 3QAZB 1PK6A 2PHUA 1PIFA 1KBVA 3DOSB 5A7WA 1CC3A 4YK4B 4X64O 4URKA 4KRPD 3RGVA 2A7WA 5CZXC 4HPOL 2CDFB 4IRJB 3DGGB 2PA7A 2PP9A 4I3RL 2HKXA 3MA9L 5DS1A 4XF9A 4ODUA 4KKPA 4KKCD 4EZ4A 5IE9A 4Y22B 5JZGB 4WW2A 4RA0A 1LWHA 5GSRB 2MNGA 1IFHL 3WG1A 3NFPA 3E2EA 4V1DB 3V5DA 1KYDA 3LKRA 2WXLA 3QXTA 2AQSA 4M03A 5BRPA 5KSAB 3NA4A 1YI9A 1VZIA 4M8QB 1O5LA 4UUJB 4BSWA 2PCPA 4F3FA 1OF2A 2UZYA 4YUEH 2ZX8A 4PJAF 3IKKA 4NTWA 2VR5A 4GUPA 4JTNA 4XUQA 3QE5A 2E7DA 4BFKA 3L2HA 2ZF9A 3USUB 3J2PA 3MLVL 3HR0A 5IM7B 2DWDA 2DICA 3SDAA 4D9QD 2WNVB 2OIIA 4CCEA 1LR5A 1NANH 1A7RL 4M6OH 1G7JA 1E6JL 2PHRA 4HUKB 4RS5A 3WSQL 2DI7A 4XURA 1W9TA 5DG1A 4LCWB 3DPDA 1E5SA 5LBEA 1E8XA 1YY9C 4QJ4B 3G5YB 4HH9A 1CDJA 3GZKA 1L3JA 4XJ8A 4FQCL 1H2SB 2LJ2A 4RWYH 3ZFEB 1RJCA 1RVF2 3EHBD 2VDRH 4MXVE 1ZLZA 3SKMA 1VAVA 2GNDA 2YBSA 2PP7A 2VBDA 4GSDH 4LIUA 1EA9C 3HRZC 5DDHA 3V64A 3BUQA 1YDPB 3Q13A 4ELMB 3GBEA 4FRWA 4J3SA 4FX5A 3F5TA 4FXTA 3LZOA 4J6RL 2FT8A 4QOKD 3WNXA 2ESVD 5FM5M 5HGAA 1YMMB 5LBSH 1G4MA 2GBVA 2XIIA 4FTBA 5F5QA 3VSTA 4CNIB 1GJIA 5BW7C 3ETQA 4GKSA 3M1CA 1TPXB 2A99A 2BP0B 1QOOA 1XNQB 3CL1A 4NM8H 1KYOF 1FLTX 3QUZC 2G38A 4A63A 3WP6A 1G9CA 2YMTA 3E3QC 1FVEA 1W2OA 3L4VA 5AYUH 2VW6A 1F56A 4NGHH 2Y48A 2UUDK 1WTGT 1A3ZA 4M56A 1HE8A 3KL5A 2AQNA 3GKWL 4OZIE 2K0GA 1M93A 1H3PH 4TUUA 3C7EA 1ZZ9A 2EBOA 1RSOB 1FZOB 1KXQE 1IT9L 5CJ8A 3FLRA 4D9LH 1NLDL 4WFEE 2VOWA 2DLFH 1Q86W 2OSXA 5BNNB 2K4WA 4UQBA 1ZV9A 1QVOA 5LEKA 1S7VB 2GJ6B 4EWDA 4CUGA 1I94B 4HHWA 4NBZB 1GNYA 5H9PA 1MFCL 3IC7A 3JARA 3SQBB 2PR4L 3QEGH 1E3XA 5C7GA 1J87A 4MXWB 1W8WA 5CEZL 3SKUD 2X4QB 4X20A 3TJEH 4OZOA 3POHA 1IBLB 3S2CA 1YEFH 5L3GA 1ASOA 4B5ZA 5CEHA 3IKWA 2M83A 1KP3A 3VB8A 2Y0PA 2XTJB 2NUTB 3ZTCC 4MB5A 2ERJC 3DX6A 5DJ0B 3KLHD 3KPRD 4NQTA 5I8KL 2N7GA 3HAEH 2VCCA 1ND3B 4NC1C 2XWXA 3QDMD 1AGBA 1JHTA 1SOKA 1CFBA 2AVFA 5D4IA 2OP4H 1IM3A 1D9KA 5GKAC 4OKDA 3FULA 5FMCA 3K71A 4I85A 5LGHH 1IIIA 1QVGU 1FVCB 2JKXA 1JWMB 4PGZA 4KBBA 4KK6D 3WKMH 3H8XA 2X89A 5T3XD 5KC6A 1JUHA 4UBHA 1OCOB 3BXNA 4PH8A 5A40E 4DS0A 4V1PA 4W65A 2OK0L 2D3PA 4XO5A 1K92A 4C4BA 1PGL2 4XBFA 1SOQA 4ZJ9A 4X0KA 3WD5H 3WFCL 4NNXB 3ZE1E 1PCXA 3OKEA 4G7RB 1DJHA 3BU0A 2BTQB 4KMLB 1Q0YL 3L3IB 1TKWB 4EN2A 2KS0A 1LOAA 4OQ8A 3NIGB 1KFUL 4AM0Q 3GSRA 2XAHA 1G9NH 1S8DB 3QFGA 4N9GB 4XETA 3WG3A 4AWJC 3HRPA 1S2BA 2MEV3 2PTVA 5J48A 3K5SA 2R1DA 3GINA 4HKXB 3ZVXA 1QRNB 3WIHH 3C5JB 4K07A 2Y7LA 4Y4HB 4XBEL 3GSQB 3M88A 4QXVA 3LZZA 4JE0A 1IC7L 2A6KA 1DDHB 3ZHLA 3MRRA 1G6RL 4ZNEE 4LGRB 5EIBC 5LCVL 3JB4C 3QH6A 3O9WA 4DTGL 1TZGL 1BOGA 1ZWIA 1I1EA 2HG5A 1QJU3 1YEGH 4G71B 4YGVA 2JG9A 3UESA 1D5BB 4YLCA 1YNTF 3LTVA 3ZZLA 3U0TA 1O3SA 1YSOA 3MNZB 4JFFE 3F95A 5T5NG 2PNDA 2VXTH 2VDQB 2H41A 1UFGA 4KL1A 2YSTA 3CJIA 5FX3A 1WD9A 2Z35A 2XQRA 5DGQA 3TNPB 2HRPL 3O6LH 1S0GA 2ZKMX 1LOFC 5KX5A 4MNQD 1JWSA 2BSSA 3C6LB 3WEAA 1YJ9V 3DVNA 1OTSD 4L2YA 1R47A 2W52A 3RZHA 3OAAG 2HKHL 5HD8C 1QJY1 3FPYA 2VLJE 3T3PE 3JD71 3DURA 1PEWA 2CKNA 4LVNB 1WWWX 2XYBA 4GKSB 4QAMB 2EP6A 4TLUA 5CFCB 5JNYB 2FDHA 3TURA 1L0LH 3NSDA 3BPLC 2OYMA 1DHKB 3CSTA 4M6NL 3ROLB 5CB4B 5FYUA 5GRZA 1GAXA 1B09A 3M1OA 4HUCA 4NN5B 4FNTA 4PJIF 1MLBA 2WT2A 4Q4V2 3I9PA 1CGVA 2FO8A 2YXYA 2QTOA 4JFDB 4HVOA 5HYSG 3LS5L 1RSOA 1OB1A 3GSXB 4NSKA 1UKGA 3TA4D 1N12A 3EYPA 3MI6A 3UJTH 2PMWB 4XXCA 3AACA 3DKQA 3IN9A 3VUOA 4DP9X 1QSFB 3STZB 4DRRA 2UXBO 4OGQB 2YGPA 5HYSA 2VLMD 3IETB 3PWNA 4PR5B 2OXGA 3U75A 4DPCX 1OE1A 2H26A 5K39A 2F54A 1AQKL 2A9CA 3PUUA 2X0VA 3E6HB 3HNTL 4MHHI 3HS9A 5D9SA 3NJVA 2GP3A 4CGUB 3VBHA 4GX1A 1LM8V 3PU3A 2JDHA 4LRIA 5HCAA 5IK5A 4E5XB 3LHPL 4KVNH 4XN2A 1TMF2 4LAQL 2F1MA 1KNOA 2VISA 2VXUH 5A43C 3DBSA 3MFFB 2ZE6A 5CJ5A 1SGKA 2GUOB 4HANA 2QZ5A 1K5MA 5B1KA 5KVGH 2R9HC 4X9GA 1EXUA 3IJ4A 1N68A 5MEOA 5EH1A 2EUZA 4KXCA 3VZOA 3BIKB 3JWOL 1TZGH 4HK0A 1HB2A 2V5RA 4G8FA 2OIGA 4DV2O 1PVXA 5J1XA 5FO9A 1ZL8B 4ZFQA 2GN7A 4D0BB 2SBAA 4ENZA 1DJSA 1JPTL 2QHRH 1W80A 3K6FA 1L9TA 1OZTG 4MLIA 4D7PA 5BS0A 2DKSA 2WCSA 1VF6A 3NRFA 2W2IA 1UT9A 5IIEB 3RPBA 3CSPA 3VI4B 3WBDA 4AC2A 2VABB 4L05A 3S36X 5FS5A 4PWIA 2JCCE 4XYXA 1DVUA 4FLUA 1N0NA 4IHJA 4X62O 15C8H 4PR5A 3PWVA 3S37L 4Z3GA 4GLRI 1JGVL 3CC7V 4PFEA 1HJFA 2FMDA 5GISL 4K6BA 3VD5A 1MJJB 2OYKA 2Y5QA 4Y4FC 1CGYA 2HX9A 4JFFB 2DQIL 3ZDSA 5B1BB 4YW2A 1QI3A 5DJXA 1PL4A 2EE9A 4I1PA 1FNLA 1WLCA 3CC4V 1I4FB 4HDIA 4M8VA 5IBLD 2Z31C 3GIZL 4WWKA 2ZQMA 3U7YH 3II2A 5C07D 3WKQA 5JOFA 3I3QA 1QTYT 1DBMH 3RWIA 3LOBA 2ITCC 1I7UA 4IU2A 3SGJC 1QQP2 4XN7A 3MLUL 5CFCA 2AJZB 3AC0A 2Q1MA 1DU3D 1JODA 3TTYA 1UYXA 5FFOA 2HN7B 4RX4A 5CB4A 4HMCA 1KBGH 1C57A 4X8NA 4MAUH 1G86A 3TTSA 3KLAB 2G9KA 2ZCKH 1G84A 4H1LH 3KR3H 1F51A 1BK0A 3JAWA 5F96L 2IPTH 4K71B 2IQAA 3WFVA 3LPOA 3ZVVA 4F33B 1NMBL 1CX4A 2D4DA 2EH7L 3MA7B 1YQCA 3HZMA 2HT3D 5E23A 5FYKL 2ISDA 2FCBA 3C09C 4NHUB 4HAFA 4JZJB 3SDCC 3OVUB 1JNLH 3X13A 4E9LA 1M42A 3RVUD 4Y5TA 2R72A 1HKFA 3CFTA 1YXBA 4Y9BA 4WTXA 3SGKA 2EDTA 1BG1A 1MS5A 1JZGA 3WQ7A 1AR83 2FO4B 4NAQA 2FQPA 4ZFZB 2HKHH 4P9PA 2L7JA 4BD4A 5I2IB 1MFCH 4KDVA 5JHDA 5KSBE 2IVJA 4BR6A 1XAKA 1Y6XA 2XZAL 2FBEA 5CP3H 1PW3A 3LAFA 3Q3GA 2EDHA 4WFAV 2DQJL 2P5WE 3MGTB 4JPRA 4YY3B 5EC1B 4YFWA 1H5BB 3BVNB 2Q8DA 2BSDA 3BZFB 1EDYA 1GRWA 4O2EA 2J8OA 4TNVK 4AVCA 2CGNA 2ARAA 4C1XA 1I9JL 3CHQA 3HC3L 5AOMA 4K3HA 4MD4B 3K5LA 1A1NA 1QPKA 1SHMA 4KI5F 4LU5H 1HHJA 3QS2A 4WHCA 3UTSE 4U2AA 3L5HA 1IARB 5LCVH 3SYAA 2XWBB 4IOSD 4MGIE 5IUCA 3S36H 2Q8CA 3OJDB 4M3KB 1ADQL 4XB7A 5ESAA 5KYNA 3S34H 1UKRA 2GN3A 3AJZA 4HPKB 4IIQC 1A7NH 1LEKB 2EZOA 4F1SA 5B7MA 4BMBA 1AD0A 3ASNC 4IMKA 1S0DA 3N9PA 3QNYB 3WIHL 3NAPB 3UCSC 1J1OH 3TIDB 1REDA 1QA9A 3H1KH 4J8RB 1BCCH 3THCA 4Y24A 4M1CC 3QUMB 4ELME 4NHCL 5A3OA 1T4KA 4GMP0 4WQOA 1S0EA 5DD5L 4E9WA 1RMU3 4GI6A 2JDAA 4I4TB 2Z42A 2DM7A 4L4TB 1UD6A 1F3DH 2MCMA 2GV9A 1LEDA 1A9BB 3HBKA 2VTFA 1LO5A 3HUJA 4ZQTA 4IUGA 4NFCA 2EH8L 2OTUB 3ILFA 2VLJD 1UY4A 4GBXA 2V2TB 1OLZA 1XGTB 2HFGL 3I6KB 5HHPA 1G0YR 2GMPA 1FVCA 4H8PA 1W8EA 3FFDB 4L4TD 2NPLX 4TT3G 1LYQA 2B5IC 2QQOA 3HZ3A 5F1IB 3H3KA 1I1YB 5CINL 1CLZL 1L3WA 1OCZB 4IIQB 4AW7A 1HR0O 4N3UA 3TCTA 1MVEA 3F7YA 5E9DE 4TV9B 1FNHA 4JI8O 2VGLM 4KKBD 3TCXA 1TMQA 3FCTA 1AKJB 4RD7A 5K9KA 1WEJH 3BH4A 1TNMA 2YAFA 4DR7O 3IJEA 4B9ZA 1A25A 3P1IA 4YSPA 1J9QA 3WU2Z 4XF0A 5FLIA 2BOBA 2NZIA 3IDYB 3SKJL 4AVHA 2DQTL 3TCLA 4BZ1L 1FV2A 5D71L 4JHTA 4LHUG 2QM4A 3S0MA 2B4CL 2UZIL 2VAJA 4I5SA 4WEBH 5E99H 3AS1A 5I74B 3ULVD 3JBG2 5M0TA 4NCC1 5E2VL 2XFGB 3QUMA 3HKBB 3Q9OA 4GRLA 1RC6A 4YXLL 4DW0A 4AKPA 1T83C 4XP6H 1MG1A 4C57C 5JQGB 1H6YA 1PS3A 1UKSA 3O81A 2VL5A 2JJVA 4RO2A 4CVXA 2HEVF 1D6EA 4Y4YA 4W93A 3MRIA 1QJFA 4DINB 1EFRG 4UTBL 3STLC 3VRJB 3EYFB 1VSCA 2ZE0A 2D98A 3N85H 5E2TL 2I9TB 1UW8A 4A7ZA 3ELQA 3KYNB 3Q9PA 4PJXE 4LF6B 1TFHA 3US9A 1A9VA 1SZNA 5FP9A 3ZO0B 2XR4A 1EAH1 3F6JA 4P5MB 2CWRA 4RVBA 2BSED 5GZOD 4JM2B 2VLKD 2BS71 2DQ0A 1OGAB 3KBPA 1HB1A 5FZDA 4XMLH 4YHHO 3VE0A 2QDRA 4JQRA 4NM8L 1VBA2 2DYPA 1NBVL 4M9OA 1SXAA 3UQ8A 2UXNA 5FR3A 2A0LC 1KEML 3K3QA 1Z3GH 2IFRA 3IT8D 3NKTA 1WBZB 3BKCH 4G2KA 1UZ6E 5BNNA 4L5FH 3O8XD 4JN2A 3FRPA 1CPMA 1A9BA 3WI9A 1X9TA 2HWC1 2P5BA 2W08A 3H7JA 4JO8A 1VADB 2VIRA 5EO0A 4PS4L 3FB7C 3BAIA 3ACGA 1P4UA 3ATFA 3HBPA 1OL0A 1JMUB 2BUKA 1PJWA 3QH3A 1HT6A 3TWCL 3E8UH 4EKXA 1LU1A 1A7PL 4XN4A 5E8PB 4UOJA 1F4XH 3SDCA 3BN9C 3THOA 3NJNA 4KI1A 2DI9A 2EEFA 3B9KD 3UBFA 4BV1A 3HG1E 1IPJA 3D5OF 2X7LB 5K33A 3NGBB 3P4OA 4OBRA 3L5XH 1J8KA 3H4FA 3D3VE 5H6QA 3O45A 1NOLA 1FCGA 3QRGL 4LPVA 1JCKA 1TR7A 5M94B 4M01A 5F89A 1KEXA 1VJSA 2BJML 1E8ZA 4YJ3B 2BOIA 2VNOA 1W0VB 1PGL1 3BKML 3KGSA 3UJIL 4XO8A 5KSBA 4ASMB 4GAGH 1E5BA 5D1ZC 3BPOC 2IOOA 2NCMA 5IROC 1A3KA 4GEIA 4JKWA 4PQQA 5HHOE 3VKLA 1AR5A 4A6OA 2CMRH 4H8QA 4DHLA 2WSSG 5L2KE 4ODSL 4NPYA 4R6ZA 5A2KH 4TYSA 5FPIA 4DZBA 2EICA 4URAA 4NUJB 1K5NA 1SMOA 1RPRA 4U1NA 2OSYA 2AEPH 4L4VA 1IE4A 4WWID 5F7EH 1FYTE 2JSFA 4LCWA 1US3A 4XFGA 4UAPA 3CRMA 3OJDA 4MD5B 4WENB 5ESAB 3SO3C 2RR11 1C8M2 1PBYA 4UYBA 5DTFA 3C5ZD 4AGRA 2PKDA 2F53E 4APQD 2EIJB 3UG4A 1RCYA 1QFHA 2XBDA 1T0NB 3QXAA 4UDUB 2B7YA 5C92A 3WF4A 3INAA 4RDQG 1EYBA 1SEQL 1HNWO 4AGGA 3IBOA 2F15A 4YX2H 3L72H 3ARVA 2UY9A 1SHXA 2ATPB 4N6RA 1D5NA 4LO7A 1N32O 2MH4A 1OARH 4N0YL 2MEV1 3BVUA 3R05A 1YXWA 1DZRA 3ZTJH 3PHSA 3VQWA 5K59F 4KTEL 4XOBA 2R0KH 3V7MA 5DRXB 4LCVA 4DEVA 5H37A 3VQVA 5F88A 3EYUH 4QRQA 2RMNA 2CH7A 3WW3A 5DFVC 2NY0B 1OSYA 4QPGB 3E6FB 2F74A 4TLSA 3VMOA 1G9HA 1HNYA 2PW2A 5MHSD 4DYLA 1NCTA 3TC9A 3K91A 2ZWZA 4XQ4A 5JOXA 4JUSA 4OCRH 4QR7A 3KNBB 1Q81W 3VRLE 4CSTA 5GHWH 4X1KA 1XHHA 5TE6H 1QH7A 4FS0A 4PWHA 2J8UF 3BHBB 4HFUH 3AK0A 2R0LH 5A7QA 1RUI3 3H3ZA 4OCWH 1J7VR 1L6XA 4J6IA 4TNEA 2FBJH 1MPAH 4B97A 1X4ZA 4ZQKB 3HC0B 1DGLA 3SGEI 4DV1B 3VI4A 4DFIA 3B5TA 4YL4A 1TEGA 5IB2B 2W39A 1QLRA 3OUFA 2N7SA 1G9ML 1B3IA 3WG7B 2ZX2A 4DMIA 2DMKA 4NQXA 4N6RB 4LC1A 5AOJA 2X9WA 3MLSL 3AB0A 4META 3O45B 3E89A 1ZWIC 2DM4A 5LHGA 1A6AB 1RUJ1 1A34A 1WAPA 1AS8A 1CJDA 1MRCL 4PRHB 3WP3A 4PBVC 2B15A 2Y36H 1XSIA 2R30A 4P2OA 4CCMA 3ALXA 5K8SA 2QQIA 2FJGB 2P5ED 1QTSA 3EYFA 3OTTA 5C7XH 2XXCB 2K8MA 4MVMA 4R4FL 4RAVB 4W70A 3WMSA 2QQWA 1Y67A 1K5NB 4J4PD 3MREA 4U7MA 1UXSB 3B5HA 1INQA 4PA7A 4X9FA 5SX4I 3OWRA 4UIKH 5I1IL 4FFFA 1SQMA 1HNZO 2NQ3A 4RHV2 1RU9L 4YHIB 5F7BA 1TZOA 3G3LA 3HJ0A 1FVDA 4LCUC 3ZE2E 4QQ2A 4A41A 4RETB 4QWWC 4ZSOB 3RNKA 2EO9A 4X65O 3ZYGA 4FFKA 4PLOB 2WDBA 5B4MD 3CN4A 5IWAB 3CC2V 1JYTA 4N21A 2R062 4XCNB 2YMZA 5BNQA 2LW7A 1QSVA 5F5CA 2C7UB 4MNGA 1S5IH 3FSAA 4WWNA 4FP8L 4WNQA 4APQB 5E2WL 4OCXL 2GG1A 2QADB 5C6PB 4NO4A 4TN7A 3A4UA 3V10A 5DMKA 1F18A 1OWRM 2YD6A 4C4UA 1AX2A 5AYTA 2C3HA 5A1AA 3BC9A 3WS3A 4N2NA 4MVTA 1XHXA 4TQPA 3VXOB 3DVNB 2K1EA 3P0YH 4PV8B 4BH8B 2CJUL 2PW1B 2QGBA 1YNKH 2A7BA 5E8PA 4RCAA 1I1FB 5HHNA 1XEQA 4PJ8D 3Q2CA 1ROWA 2BRTA 5H35A 2HJLB 4QRTB 4XZUA 2YUXA 4CXWA 1MXDA 5HHPB 4IYIA 1FFNA 4CUAA 1A7BA 3HPNA 1L6PA 1KIUB 3D4ZA 1QUNB 1FXKC 2RB8A 3FFDA 3SOBL 3UPCA 3UX9B 2ZGNA 3UH8A 2WNWA 3NFSH 7FABL 2ARJQ 4CEWA 1SBBA 2XTJD 1N64L 1E3ZA 4JI2B 4W4NA 4AUJA 1Q8OA 3NIFF 2W87A 1OB0A 3BHBA 3N42B 5E4AA 2DVGA 2QQPA 4AYFA 2E5LB 3TIDA 2RAMA 4A6SA 3U9PH 3H1IH 4ELKA 3EF7A 4A67A 2FEDC 1CGUA 3RPIA 3OY8A 2YARA 3PWUA 2C5DA 1JNHA 3NAPA 1PZ7A 1S77D 1O9VA 5L7XL 4AEKA 5DC9B 3J27A 3DVGA 5CLXA 3J07A 2E33A 1QD0A 3OGVA 4L3EA 2GNTA 1PGSA 2RGSA 2PWHA 3NCYS 4LLDA 3RTQD 1GYUA 2J1VA 2WVUA 3PDOA 2CWSA 4R8CA 1P6AB 2ICWA 3GTNA 3T3ME 3SBRA 1Z5WA 3VCLB 3JT0A 5AUMB 3VACA 1RXFA 5FOBA 1NUKA 2EIZB 1JDCA 1XAUA 4KI5D 4ZAKB 5A6MA 3OG2A 4L4TE 1DTUA 3JWNC 4DV6B 1T0PB 1P4BH 2ZCLL 1J0KA 1QSFE 1HRV1 4XB8A 3PRZA 4E42A 5F32A 2X3CA 1AS7A 1ULOA 5JYLA 2IOIA 2EF6A 5IQOA 4G6AD 1WC7A 1NGWA 1HWGB 2FX7L 3CHOA 4U1MB 5FPZA 2ZX0A 4FOMA 1N1TA 3J7HA 4JL2A 4MKMA 3G67A 1MR5A 4XUTA 3AW5A 1YMMD 3OEAA 2EZ0D 1XF4B 4HUUB 1I08A 2YFOA 4NZJA 1KBWA 1PAZA 3JWNE 5A3ID 5IR1A 2YSSA 3D8MA 4HWZA 5C0ND 3VX0A 4RGGA 3S96B 3U78A 4AXWA 1JOPA 2XLFA 3O3EA 4LXLA 1NQTA 1GL4B 1VENA 4WGWB 4WU5B 1B6UA 3TIEA 4AENA 2HWC2 4UOW0 3S5QA 5DM6V 2C4FU 4B7LA 1YQ6A 2DVDA 1HXYA 5BNPB 3AG2B 1H0BA 2JCWA 2CO7A 3WXVL 4NM4L 2QWPB 2LOEA 4JHUA 2PW1A 1ULFA 1UGNA 5IT2H 1LOEA 1QQDB 2XPGB 3O4LA 3KH3A 1MUJA 1H2GA 2RJZA 1KJMA 3OTFA 4LF6O 4XHXA 2MKLC 1XCQB 2C4FT 1JA8A 2JD9A 3L9RA 1DQKA 4B3EA 3ECWA 1F1GA 2OMTA 4W6XB 4ZTPH 1LGBA 1U58A 3ETPA 4IXLA 3TZVB 2OFQA 1ZEAL 4FL4B 3VM5A 2AJZA 1OH4A 5KSAC 5LXTB 1F3RB 5LVEA 1R33A 2X10A 3K0DA 1RHI3 3WHE1 4IEOA 3RIKA 1CN1A 5EIIA 1BKZA 3ARFB 3PJSK 2VXVH 3K4AA 4Z7VE 4EIZC 2PTMA 3VFTB 4LOTA 1BSMA 4UCSA 1UCBL 2YPVH 3NOIA 4RR3B 4KJQD 1MCLA 3JV4A 5FLXN 1DZBA 2VJXA 1H0DB 1HHHA 5ADOH 4X66B 1CFVL 5G55A 4FQXA 4RESB 3CS5A 1SCSA 4EKWA 2P4VA 1HB4A 2YD3A 3O0RL 1J9RA 4WKXA 4JKPH 4FFBA 4PJ9C 3SGEH 3UABA 4CPBD 1QDCA 2Q8EA 5D8JL 2FECI 2K7PA 3VTAA 4DR7B 1AP5A 3DX6B 3QQ4A 5C08A 4J3TA 2E63A 3CCJV 1KN4H 4FO9A 1WBZA 2YI8A 1OZUA 1U3HC 2WXGA 5IMOB 2GMMA 1CN4A 4D0BA 1MSWD 3KPNA 5CMAB 1WITA 3ZQXA 1L4IA 4LLVB 2D3SA 1KELH 4X5WB 5BS0B 2VBPA 5ACZA 3KGRA 3Q9QA 3WO4C 3C7HA 5FYKD 2RS52 3BVNA 1JGEA 3IU3B 1E28A 3L4UA 4N2GA 1GN3A 2VN3A 3ZYIB 3ZXEA 3ZIYA 4UFHA 1XGRB 4GQ9H 4FOQA 2DLGA 4AJWA 3BEHA 4XC1L 1IGFH 1JXDA 2B1GA 4KH9A 2ZUUA 2XKOA 3SDLA 1PD0A 2E9GA 4L3ED 2C4XA 3T3MB 4UB0L 4H13C 2XIDA 1HWWA 4PIZA 4JFFA 4N2OA 4FA7B 2W0XA 1UACH 1TJHL 2CA3A 1HL4A 1XB8A 2PYEA 3BUTA 3KGTA 3AG1B 3TJPA 4IBLT 2WZPA 4A04A 4QPIC 3AKPA 4NHUA 3X13B 2I27N 5FA4A 1DYPA 5DDJ1 3P30L 3JV4B 4FLQA 4ZNEA 5GS1C 5BO1L 1CMOA 1ZBA3 2H8PB 5B3NA 4TQ8A 3RDIA 1XH3B 3FB7A 2BP0A 3OPZL 1BQRA 1CYGA 2GCYB 2J57A 4CVUA 4K1ZA 2NLJA 3MD0A 3CVIL 3X1GA 3QCVH 3IMRA 5FXZA 2X4PA 3SMHA 2ZAIA 2HWD1 4UCVA 3S7IA 1V00A 3VXSA 1B04A 5D1XA 3U48A 1S7WB 3L1OH 3P9MB 5C3QA 3KJ6H 4HPOH 3K5NA 1TSHA 4CS2A 2PYEE 2LVEA 2VSDA 4FYRA 3U9PL 3D39D 1VBB3 4MX3A 2JKRM 3HKEA 1FQ9C 4OLUH 1VF5C 4P5KB 2UWCA 3HE7D 3I6GA 4EMZA 5BOJA 5IYCO 3B43A 4Q4EA 5FMBA 1G7MA 4LLQA 4RAIA 1T0NA 3CN0A 3TU6A 1HQNA 3L3KB 1DGWA 3I85A 1FFXB 2C7FA 3ZE2F 4IEYA 4FC3E 1XOUA 1G6RA 5G4OA 1FORL 5IBTH 4XC9A 4DR5O 1A5FH 2OMYB 2XA8L 5CF3A 1RMFH 3MU3A 5BCAA 2MMXA 3CH1A 5SX5K 3VBUB 4DETA 2VR6A 1WP8A 3IJ8A 5DAPA 2Y5EA 1HHGA 3PPSA 1R17A 4A6YH 2QDNA 3VXQA 4PJDE 1LDSA 2N1KA 2VLME 4WBBA 3ARBA 5J6GA 5DC0A 4FI9A 4HYOA 3BAJA 1J5OL 3QDGB 4YR6A 1AXKA 5HHVL 1JU4A 5LQBH 1A3RL 3D07A 1EN5A 2VKXA 3O9WB 3ACHA 5FWEA 1CG9A 3ZL4L 5C33A 5LZ6A 1WPXA 1IAIH 4OZIF 1D5BA 3Q4HB 4YHLL 3ULVH 3TXAA 4YARA 3N43B 2EZ0C 1GOHA 2VSMB 1JV5B 3F05A 3VD3A 2ZHMA 4P9XA 4QWNA 1DQMH 1BK1A 3IMBA 1GWLA 2NPIA 5E89A 2QT6A 4QTHB 5JVDB 1DVFC 5T1KD 3EGSB 1MF2L 4FK5C 1M9SA 1LQSR 1WCQA 5JDSA 1VBA3 1UM6L 3SCMC 1QLEL 2DPKA 5C8CB 4XB3A 1UOFA 5FWJA 2JRIA 1JWSB 2BSSB 2F54B 2CKBL 3S35L 1L9NA 2A6IA 2ADEA 4A5UB 1R1ZA 2MOQA 4LNVA 3LMJH 4QGLA 1DZ0A 2KPWA 4GKNB 5ICYA 4N9GA 2WSUA 4G6KL 1KENL 3UGEA 4OZIA 1PK6B 2X8KA 4WW1B 4F27A 2ORZA 1MFUA 4IOFC 2PXYD 3LKQB 2YXWA 2VUJA 2I5YL 2ETEA 2XX0A 4B3RB 4AFAA 4XP5L 3E1F1 3UAJD 2HXAA 4LF3B 1VBD2 1GYKA 2BU9A 1EAPB 1P5VA 4JI5B 3PDGA 1IS4A 3GI8H 5IGXL 3HZKB 1QKZH 3PG2A 3PYCA 3TK1A 4DO5A 5HCHA 1RUC1 1KIUA 5EG6C 1RZJC 3ZRWB 1F6LL 4QX7A 1EO8L 1J3PA 2G60L 3ALQA 4W6WA 3N2GB 4P23A 1G9MH 2BIIA 3ARGA 5LO7A 2C3VA 2W0FB 3RWFA 3B1TA 1KSRA 4WI5A 4GI9A 1UKQA 2W9DL 5DUXA 3OZKA 1ND2B 3WUWB 1KXTB 3PGFH 3ZO0A 1VB2A 2ICEA 4XJ9A 1J9TA 4U0QB 4XT1C 1QR9A 1DF0A 4XFAA 3U0PA 2WS92 1OLMA 2X53S 4FFIA 4MLOA 3W81A 1I1AD 1YC61 2Z69A 3OJ2C 3ON7A 2NN4A 1W9FA 3FLTA 4X6DF 1CDYA 1AC6A 5D1XD 1NQDA 4HD9A 1XNCA 1X82A 1DJGA 3O2DA 4JGMA 3PNWB 1MFAL 4L37A 4PF1A 1UT2A 4G42B 1V7MH 5EBMC 2UXBB 1OM3L 5I15L 4LO8A 3L3GA 5LBFA 3RBZA 2Z4QB 1MHPH 3N9GL 5IVEA 1GZHA 2YWYA 3VXQB 2ALAA 5KSUA 1E6OL 4DN3L 1XILA 2WSPA 1OSZB 1MQTA 4PJAA 4QGMA 1WWBX 3CX5K 4R2GB 1ACYL 3QCUL 2AQRA 4JZJC 2OXHA 1DVFB 2W0FC 2UWEB 3KXFB 4N90D 2NNAA 1FV1A 3C6LD 5LN8A 4BOWA 3GMOB 1EEZA 1QR8A 4N2LA 4YX2L 4QI3A 4J12A 3PUCA 1JGDB 3NCFB 1DQVA 5GZND 3OAUL 3V4VH 1RUPH 3QF7A 2R2EA 3BCWA 4YQXH 1HXKA 2DCKA 4DCQB 2E6QA 3M17B 1TTRA 1O7FA 4TPRL 5EOTA 5FEBA 1MCDA 2DWSA 1NOAA 3HG0A 1C8M1 5GALA 3TM6A 3B94A 4WHTA 4J80A 1TTUA 4MCYA 2Z0AA 4WU5A 3RNQB 1XH2A 2OX5A 1AYN2 1G7PB 4L1LA 5LNDA 4MA3B 4JRYB 4NT6A 1LE5B 3DV4B 4CN4A 2Z1PA 4TOYH 4BUHA 1AXYA 1TQVA 2L35A 4FJ6A 3UL4A 2BNRD 4OQ1A 1ETB1 2BRRH 4E4EA 5TISZ 4D3CH 4AVVA 5IVBA 3WFZA 3ZRXA 5FZBA 2E9QA 1PZ5A 1OXYA 4IRSA 2VXQL 2XN9D 3N44F 3QNXB 4Z95L 1RUI2 1YIJV 1AIFA 3QUKB 2A6XA 4Q4Y1 2YQ2A 4ZMZA 2BC4B 4N2FA 4EZKA 4NKOB 3SJAC 3DSNB 4K9EC 5AZ2H 1E40A 1L9SA 3ESUF 3LB6C 1KF9B 5CSZA 3IKCA 3MUGA 2E7AA 2VCBA 1LQBC 4JGZB 1AI1H 1PLGL 3VHOA 1LK2B 2BDNH 3SDDB 4Q29A 3U25A 1YMMA 5DXDA 3TP4A 2BBAA 1GJWA 4UF0B 3Q1SL 4RDQF 2GFBB 4XNDA 1VFAB 3D1MC 1R1A1 1UQSA 3IFXA 2YKKA 4N53C 2LABA 1Q9KA 3MV11 2D3LA 2EX3A 3KV6A 4QOKE 4B9KC 5KUMA 5JW5B 3INOA 5IUQA 1DQ2A 1QFOA 2ZUXA 4KUMA 3KCPB 1M9NA 4UNVA 3THPA 2F7PA 2RJLA 1AQDB 1QNMA 2HVJB 4FLYA 2YRZA 2NYYC 3E7JA 4P3CL 5DS8B 4K0OA 5EBLB 3O0WA 1S5HA 3GDBA 3H54A 4Z7WA 5DTFB 3QSKB 4YQXL 5ISZE 3GHMA 1MACA 2TSBA 2ZZQA 5E8AA 3IJHA 2APBA 2NNRA 1M53A 3SCMA 3OAYH 1A7OH 1RIHH 5FAAA 4DY5A 1JOIA 2Q7HA 1U2CA 3M86A 3ULUD 2QR0A 3HEIA 5ERLA 3VD0A 3O1VA 3PTRB 2Y5TA 1Y9GA 5ESQA 2G19A 4MSWC 3VHPA 1QSEE 4JI7O 4PY7B 2X2UA 3RVWD 4Q9QL 4PSPA 1U8JA 4KITB 1AR4A 3SE4C 3LIZH 4Q4IA 4UTBH 5AC91 3H9SE 3LKRB 3KPSB 1QR4A 4JFZH 5E6IA 3VDCA 2QSCH 1NT2B 4O51B 1QSEA 1P7BA 3BKYH 3LH9A 1A7NL 1JGLH 1A9EB 5GSVA 5ABAA 1EIBA 2BO0A 4TUKL 2GTSA 1JWUB 4HLZH 4YVSB 1VQPV 4UT6A 4Y5VB 1SVZA 3EO6A 2AABH 3FSWA 3H1MA 4M3CE 4YSOA 1QI5A 2HVJC 3N9OA 1LK3H 3G71V 2DQMA 2PP8A 2YMOA 3HHSA 3NH7H 3CZFB 4WI0B 1YCSA 2Y72A 2E76C 4L3EE 4YHIA 4XPHH 3QR2A 1IKQA 2XJTA 1KCSH 3OKYA 2PCFA 4WJKB 1OAUH 4PIRF 4UVCA 3IPVA 4KK5C 5BRZD 1M1KW 1DCSA 1W3XA 3ZDZB 1KGWA 3N3HA 1JPXA 5FY7A 3BPCA 3BO8B 3RZZA 1RJYB 4DW2L 3V0GA 3G5ZA 5T5FA 5I6MA 1LP9E 4UCFA 4XP9H 1QKZL 5DAXA 2YEZA 1T7XA 3KXFD 4P8QA 5E4IA 4U1SA 2X5IC 2FAUA 2YG0A 4Q0VA 2VQTA 3FZUD 3KSCA 5IYYA 2EIMC 1OGAA 1JZIA 4IRSD 2B9UA 3MLZL 5EOTB 4GXFA 1AXTH 3T65A 3WIFA 2J2ZA 1QHPA 5DJZB 5FZ7A 4CCCA 3KWWA 4PA3A 1W9XA 2I26N 1INEH 5T5OA 3WQBA 2VG9A 2J56A 4XAEA 5MI0C 5J09A 2UZXB 4I13B 4XO9A 3MLPA 1ZPLA 3J81N 1GHFH 4ALAC 1ZV2A 3BODA 1PYWB 3H9HA 5I6PA 1DCLA 5DZLA 1FBIL 1AHKA 4PJ5D 4DESA 3W7WA 4BH9A 5DC2A 3ZO9A 1O6UA 4GXLA 4HS6B 1DQML 4I5BB 2CGYA 2VL5B 1MS1A 4IGOA 2R042 1AJOA 3NCYP 4C90A 2WBJA 4PRAA 1BEV1 5L9RA 1SETA 3S34L 1GM8A 1PJ9A 4ZS6C 1MCNA 4JO4L 1EXHA 1V3KA 2XA3A 5CILL 1RZKH 3NMBA 2MJWA 3FT9A 1MHCA 4NJ9H 1ACYH 3QCUH 2WLPA 1NL0H 4GS7C 1O8SA 4H0HB 3NSFA 2DJ4A 2OJ1A 1XPWA 1T1YA 1IZKA 4IERA 2IAAC 3VXRD 3ZKYA 1F00I 4AFMA 2O14A 2B08A 5F3HB 2CM6A 2GW5A 15C8L 4O9HL 4YDJB 3AKTA 2TRYA 4AVAA 1FJ1A 5MEOB 1OM3H 1HCVA 1JZJA 1E3FA 1JPST 4LR3A 1DLFH 2ZXEB 3D09A 1MRFL 3FTGB 3HBGA 3QHZL 4JS7A 2WO1A 4MA8L 4C7UA 3UGUA 3WMQA 4OSUH 5K93A 1QLFB 4LIQE 1ND3C 4EJRA 5EC2C 1ZMYA 2AHIA 4KQ4H 5KJ4A 1RMU1 2BIMA 3EO0B 3ZKMD 5CFDC 2BSTA 3PS6A 3U7WH 2GABA 4WF7A 5D7IE 1LEGA 3QQ9D 4UW6A 5LWYL 4P59H 2F54D 4G8EB 3QUYB 5KVDL 3WENA 4PW3A 2RH0A 4YOKA 1QI4A 2MRYA 4LPYA 3T1MA 5CA3A 4AZUA 3TOPA 1FGVL 3IETA 1K5JA 1EV2E 3N9NA 1WC7B 3NRPA 4B4RA 2VM3A 4FQJH 2XUWA 4ZAKC 2W1NA 3TFKC 3QIUC 2DOSA 5DDJ3 2YC4A 4BK4A 3QO8A 2ZXDA 1WFOA 3MV7E 3OPZH 1L7IH 3SDYH 5KXBA 3QIUD 5CU5A 5DQDH 2E75B 5IESL 3SJVB 4NQCE 1HKLH 4Z0BL 3ZFFC 4NQEB 3QK0A 3KM5A 4YH6A 1VFBA 5H35B 4PREA 4OT1H 5EDXA 5EOCJ 4ISRA 1L7IL 4FM2A 3MLYH 4XVOA 3SDYL 3V4LA 4AVIA 1O7DC 1TQWA 3BAEL 3B7SA 4BINA 1NFKA 1H15A 3FYEB 4BFGA 4B9YA 4HKLA 4UIMB 5FGBC 3D7PA 4HIJB 5T1DH 5C3OA 2HP8A 2TNFA 2CKBH 4XO3A 3DGCR 3L3HA 3VFSA 4BK8A 4U49A 1L9RA 4U1LA 1ZHLA 5TQ0L 4QY8B 2ZNJA 2YXSA 1ONAA 1BZ7A 3WHUA 4X4ZA 3L9DA 2XJRA 4NQDA 2FQDA 1YEGL 1OPMA 5DLLA 3JTBA 3WTTA 3EOTH 5GZOC 1RUG1 1FHGA 1KIPA 3VXNA 1WKYA 4YXHH 4OPHA 4F91B 3ZMZA 4MDJB 3H9AA 5L0QB 2ZJCA 2NM1A 4L3CA 1ZJAA 4KO7A 3BJLA 2ZIMA 3PUIA 4I30A 3VBFA 2Q86A 1PLCA 4FADA 5IVFA 1VCAA 1QFPA 4IYKA 1OHHG 1AC0A 2YIHA 2Q0ZX 4ZS6D 5C0AE 2CJTA 3P30A 5DPNA 1GZPB 1AI7A 2VXQA 3K6NA 3NEEA 4RMTA 5E8EA 1C5HA 2RDSA 3KV5A 1BQZA 2VMCA 2VN6A 1ODMA 4EEQA 4MGZE 2FJGA 1NIAA 2WLQA 4XRCB 5ADPH 2RN9A 3B3IB 4ZXEA 5F7DA 3JV6A 5A2FA 1UOVA 4WKZA 3MO1A 4AI8A 2VQEB 3J7AU 1KXVC 3BP5B 2EDLA 2YBGA 1XCWA 3DHJA 5KANI 2BTQA 1IBGL 2IWFA 2UVFA 1S0IA 3IDMA 4D9RE 1W2AX 4GAAA 3ILPA 5BXFA 2A9AA 3S8WA 5L9DL 3K2OA 4XP1H 1Q1PA 4V33A 4YXHL 1LXMA 4TQHA 2MCAA 3VWJB 2QJDA 5IUSA 5CYYA 3F5WC 4XUNA 4L29A 2WUCL 1SMAA 4AQSA 4I55B 5DECA 2JDKA 4KRPC 2Y69B 2CK2A 1X50A 5J1AA 5DO2D 4DP2X 2APSA 5JI9A 1NAKH 2P5EE 4MA1B 4OZGE 4RZKA 3ZL2A 1CAXB 1MNGA 4ABQA 3T4AB 3D85A 1CGXA 2O6DA 2BWCA 2H2PC 5D9SB 2E7HA 3N4MA 4PM1A 5LCWL 1XMWA 2W9EL 3F6IA 5FLUA 5HYIA 5LHDA 4AVTA 3CE2A 2VUCA 3CH1B 4E9XA 3L5WB 2OULB 4P99A 2GSIA 2YC0A 2XQ0A 3ELAT 4XGZB 4ERSH 1RUC3 1VAKA 4JPWL 1FNZA 1W39A 4PQ9A 2V37A 1GZCA 3CHRA 2DD8L 1NCDL 2ZEXA 2H8PC 3QXDB 4PMEA 3I2IA 3CMEV 3TT1L 3DMMD 1H9PA 2WN3A 5TPWL 4U1IB 1OK8A 2IJHA 1W2KT 4Q6GA 2CBMA 1ZVSA 3BAKA 3H7LA 3R8QA 3WT3A 1PNKA 5EORH 5LBCA 4N1EA 5BZZA 1IT9H 4YHLH 1GGBL 2JVDA 4IRZA 1YDPA 5FNVB 4H13B 1N18A 4FMKA 4PGDA 4AEIH 4LFBO 5C0CA 4LDEB 1Q8PA 4HLJA 2UZPA 4NXKA 4TRPH 3DURB 3GWJA 5ICUA 1LK2A 3HVDA 1OAZL 3HC4L 5JHLL 4LA3A 3OX8A 4JM2D 3ROOA 1MREH 1QOSA 2D7TL 4YK4C 3QQ4B 5C08B 5CD5C 4AM0B 2WZ8A 4UZSA 3NBNA 3N9MA 4ZMNA 4JYBA 3POSA 3ZFFA 1LHOA 2FH6A 3CFJB 4YSQA 5D5MA 4TUKH 4C83B 4NC2B 2IDFA 1SDWA 3HG2A 2ZR2A 1S5HB 2F4VO 1U8NB 2WKGA 3QUZA 4XN8A 5C07A 3CJHA 5ES4B 5LBSL 3E1ZA 3ACFA 3GMLA 5KEZA 1BBDH 3F3HA 3KCPA 4J6RH 2ZE8A 2HT4C 4IRSB 1P5UB 1UD3A 5TE4H 3RL2B 3N7KA 1IE5A 3VBFC 4OFVA 4ZU7A 1NC4A 3PJLA 5ADOL 5B38G 4DR4B 1BG9A 4Z7QE 2NNFA 4HJEA 3ISYA 5FYVA 5FPOA 1NBQA 1Q94A 4LE4A 5IEKB 1FOD3 3GMPB 1M6OA 2VW4A 2V1DA 2IV9A 1Z5VA 4K8FA 4EUPG 1L7RA 2HFTA 4L97A 5GTIZ 1L0PA 4X62B 1X6LA 1PNDA 1ZAUA 4UYQA 5E4OA 2HX7A 4CKVX 2C24A 2VC2B 5E9DA 1GAFL 1VAMA 2YA1A 2X1WL 5LDUA 2E7LA 1HRI2 4I2XE 3GRWA 1RK1B 2E9BA 4P3CH 3UAFA 2YIBD 2B46X 2X70A 3C3VA 4XQWA 2Y07H 3G5VB 2PYJA 4PRID 5K69A 5LKNA 4OI7A 4QXUL 4HAMA 1SF3A 2MQGA 2MTPA 4LHUA 5BY1A 4NCC2 5HDRA 3ROOB 4A2EA 4QXCA 3ZMOA 4YN3A 3H85A 3USUA 4DV2B 1UOWA 1HEZA 4TUOB 1MHHB 2V7NB 2ZPXA 5C5TA 5JQGA 4LFCB 3FZUC 3TBWA 3A4EA 1FV3A 4Z1MG 1ODUA 3BP6B 1K6QH 2W0LA 3HUJE 4OM0L 1MJ7H 1CICA 1PG7X 1RIUH 4QHMB 4UDTA 3KL3A 5GQBA 3PE9A 1GWMA 2EE6A 3MDJA 1J11A 2P8PB 2VLKA 1ZGLB 1OZ0A 5IQNA 4LBEC 2QDVA 4Z07A 3N42F 5AUMA 4KWLA 3D85D 5C2BH 4UVBA 4ODTL 1X9QA 4CS4A 4I0BA 4XCFL 1PY9A 1TG7A 4X6CF 2PHLA 3PXLA 3AMKA 3D48R 1G4YB 3MBEC 5JYMA 4P5TB 1MDAA 3T1FB 2R0WL 4TUYB 1ZTMA 5FV2A 4B7EA 4RRPG 4H26B 3UTPD 2LUWA 4GT7A 1F13A 3VGHA 1YIPA 1H0DA 4DKDC 4K1YA 1Y18A 4EXKA 4KPHL 4TOYL 4O9GA 4OGXH 4N1HB 3H01A 2BCKB 5A7BA 3MLKA 4FPFA 4PJHA 5CKMA 4HULB 3L3GB 3RGBA 2HLAA 3FB8A 1R3HB 1NDTA 2VLJA 1E79G 1NEZB 4WHYG 3QIBB 1U8QA 1IS3A 5KA5A 2LALA 1I75A 3TA3B 3RY6C 4JANA 4W81A 1RZFL 2F1EA 1NH2B 3IRCA 2XAGA 4KVPA 1N1VA 4OJFL 1FH5H 1OD9A 1KLGA 4LDOB 3CFNA 4FLSA 3OW2U 1ECZA 4RFOH 3REWA 4E42B 3VZNA 4NQVA 3KVPA 2OR8A 4IJ3B 5JH7A 1KJ2H 3GSNB 4J42A 4JHWH 3STLB 3U6XS 1OOPA 4ZW6A 1P49A 4U3JA 2YAQA 5ERWB 3NV2A 4I0KA 3HNMA 4NHXA 1O7DE 3I3DA 4HEPG 1IKOP 2HZHA 4GH4A 3MYZA 5D7EA 4DCQA 2NTFB 1N67A 4B95C 3CLPA 1K9TA 1V7ML 2P4AB 3OKOA 4JQXC 3ZHKA 3RWJA 4AXWB 2NR6A 4F37K 3VFOB 3DX1A 1Q8QA 3V4PB 3WSQH 2Z4QA 1E9PB 4P46B 3FTYA 4EIUA 3DROA 5EOQH 4BBWA 3VWJD 2LGQA 1DUZB 1GC1L 3C5ZA 3L3JA 3RJ2X 1W72A 3IDYC 1FG2A 1VBC2 5DQ0A 3MRFB 5IQ7H 1CJYA 4KTDH 4G6JH 4IEFB 2PR9A 3QUXC 1H8TB 3M3QA 3HMXH 4CDQA 1B0GA 5KBDA 5DUUA 3IMSA 3TNMB 4EXPX 2DE0X 5E9DD 2GC1A 1PZSA 2FECL 2EO7A 3MV7D 3QJUB 3MMEA 1UENA 1SJHA 1VMHA 5E6RB 3I7DA 3PGFL 4XN1A 4QGNA 1DBKL 4QX3A 4FNSA 2NY4C 1NR7A 4NZRL 5GRUH 3VFPA 2B5IB 5F2VO 3ZZ1A 1IVLA 2G0LA 4J3OH 2Z64C 4HJGB 4ASUG 1QATA 3JCIA 1WIPA 1S3RA 1YMHB 2FD6H 3CJJA 1HRV3 2LRPA 1GRJA 1BD2D 2GJJA 5LYJB 1I3VA 3T4YB 1NMCC 4R5XA 2W1SA 4PGEB 4IV1B 1WCDJ 3TBDA 1WFTA 5TE7L 3VG0H 4HX1A 4QYOA 1GP4A 5DMIL 2JIZG 1GZTA 1UUNA 3K81A 4DPAX 1KQRA 4N25A 4QX0A 1MAJA 2RALA 3OG4B 2MW2B 1DVYA 4RGMB 3PVNA 5BY5A 3E2HC 1N32B 2Z34A 1HHIB 2FL5A 3MYJA 4AFBA 1WLHA 4X80L 4EUPB 1PCSA 3FQRA 3BUBA 3VD4A 1ZHBA 1W72H 1RTVA 1X7QA 1D5ZB 3RZKA 4F80A 3ITQA 4KHPO 1ND0A 4FM1A 4HCIA 3JD73 5IBUG 5C9KA 4LVOB 4Y22A 4QE9A 2DL9A 3L5XL 1K4CC 1CT8B 1ERNA 1SLUA 1EK3A 1J59A 2XAJA 3GGWA 1ZK5A 2HP4A 3RNKB 4CH3A 4PRPB 4YGVB 4YFEA 2G4IA 2JIJA 2E56A 1XGQB 3KWXA 3PHOB 5F2SA 1ZA4A 1X5KA 1VIBA 4DR4O 2Q6WB 1DBJL 5C0CD 4UQ9A 3M2MA 3JQXA 4F7PA 2X4OA 4I0PC 4RGND 3AADB 5F1NA 1DN0B 2NXZC 3KXFE 1OALA 3NZ8A 3OC8A 4F15C 2FGWL 1WA4A 5JVDA 2B9VA 2EXJA 5IAXA 5ISLA 1IQWH 4A7YA 5BZWB 4C1WA 3ZXGA 4PWFA 3AG4B 3VGFA 3ZN1A 2KLRA 3IM0A 4TL5A 3WF0A 4JDZB 4L5FL 1MXGA 2FGWH 3QUZD 1WISA 1U5ZA 4JG1H 4PRHA 2HWB2 4ZPTA 3ECBB 2Z31B 1VA9A 4JM4L 5EOQL 3QDGE 4WUUE 5A3TA 1JFQL 2JKJA 3IF1A 1GTNA 2DVFA 4ZYKB 3B6SB 5EU7E 3ZKQD 5AYQA 4POYA 3PQYE 5DFTA 3O3BB 4MCZA 3GXPA 2JTYA 3BIKA 4K7FB 3P11H 5E8NA 2GU9A 2VCAA 3W0WD 3ZXKA 4AL9A 32C2A 1WLTA 5IFHL 5IHWA 3NJGA 2Z7YA 1H2NA 1A6CA 3RLSA 5CB7A 3ZN0A 1BGXH 5FZKA 5D2NE 4AT6A 4NUJA 1TVGA 2A0LD 4O7XA 2Y5TB 2A83A 1O0VA 4X80H 5IT6A 4EOWH 4QWWD 1YF2A 3MV9D 3WY6A 3ZN6B 3UADA 1R083 5D7IA 2HKAA 4RFEB 2Q6WA 2Q1ZB 5JIAA 5FGRA 1Z0MA 2QHLA 5DUJA 1OVPA 4AYUA 5AG2A 4P9GA 2AHZA 4P2AA 3VQLA 4UM8B 2WP3O 4AEMA 2VNGA 3LQZB 5BVPH 5GGQL 4NO5A 1XDCA 4QEGA 4WK4B 3H0OA 4PIXA 4LLWB 2E6VA 4HUWA 4OFGA 3GMNB 3ZFGB 1AR2A 2GIXA 1WA8A 3T65B 3UDWC 2B4CH 5KSBB 4WNJA 1EAH2 2CMRL 5A3PA 4ZPTB 1LNUB 4MYWB 4NX0A 4URTB 1YCIA 1O5UA 3QCWA 1V9U1 5BNOA 4N2MA 3AG1C 1XMQO 1KJMB 1GKBA 3AZVA 2I5YH 4ZFGL 5AAWA 1QH6A 3PV7A 4K3DL 3Q6FB 1TNFA 3LEXA 2H3XC 4V2BA 4QRRA 3FRPG 4J7JA 5J9PB 1W6MB 3BDYL 1TVKA 3FKSG 5F7WC 2LP7A 2WQAA 4QMAA 5FLHA 2WQ8A 2VOXA 1ROPA 1X36A 3Q8AA 2XGXA 1MCOH 2RA1A 1KYFA 3AZUA 1U4FA 4PLNC 2LVCA 3L7EB 1VBB1 2FD6L 3S96A 1BEXA 4AVJA 4P9YA 5C9JB 3OX8B 3AQYA 3ZBHA 4NROA 1WIUA 1MJ7L 4DUXA 3FCBA 4MAYB 1FAYA 2XQXA 5D96B 5KS9E 2ZMKA 1CXZB 2LAGB 3N36A 3FTSA 2BP8A 1W72B 4ENED 4LF5B 2QVSB 4JHWL 2JELL 3LZRA 5EBMA 5EBLC 1KPRB 1MLCB 2HPOA 3ATEA 3HMXL 4QXUH 3ZZSA 1R24A 1HU8A 4BA8A 3RTQC 1B3QA 1JNNH 3CGTA 1NT0A 3F12B 1HH9A 4L8DA 1HLCA 4PCTA 4E41D 2J1KA 1S9XB 3KWTA 2R073 4WF9V 1ORSA 3A47A 1J10A 1UXMA 3L16A 1Z66A 1E9QA 2DMHA 2C34A 4N2HA 1N6UA 4M1CD 4DP4X 2D3OW 4TULH 2BXZA 1JYCA 4RGKA 2X6MA 1AE6L 1ULEA 4C56D 2X2YA 2ARHA 3QJVB 1FPN1 4CL7A 3SCFA 3SH5A 2EYSA 1XZ0B 4N2KA 4BWUA 4Y2DC 3SPIA 5GGSA 3O1SA 1CLOL 3FQNA 1JNJA 3K0WA 4ZHQA 1LNQA 3KWUA 4K8ZA 3PY9A 1FZJB 3KPSD 1V0AA 3U4XA 2KHAA 4KJYB 1FH5L 2LR4A 3JSSA 1QNZL 4QXTA 4KOCA 4M8QA 4JFEA 4NM4H 3ULUC 4W4ZA 2WO7A 5HDLA 2GJ6D 4MCYB 1JHKH 4CS3A 5I1GH 2VMDA 3SCHA 3GQFA 2YD2A 1P84J 3JV0A 1KGYA 3VBOB 3ZFGA 4LLYA 1MRDL 4MJIA 2A77L 4I9WA 3MSPA 4O2FA 2EUWA 3OHXB 2C1PB 1ADQA 1I1FA 3S3JA 4IBYA 2YY1A 3MFCA 4XDQA 1NCQB 5H2FZ 4IV1C 3VBSA 3VI3F 1GGBH 4K8XA 2BC4A 2Z7ZA 4XRCA 3CCSV 3U6RA 2E59A 1BF5A 4IEPA 2IJJA 2NDGA 4NC0B 2VOKA 1RUH2 1QLEC 3EOYG 4ZXBD 3QJHB 2W60A 1MZFA 4FNPA 5EU6E 4JFXB 3DX7A 5E6ZA 4Y4KA 4HCRH 4L1SA 4LOFA 1CU4L 1SLBA 2R23B 1Z2GA 4LVOC 5B39A 3K6OA 1B9KA 2PWEA 2H45A 4JZOB 3ZYFA 1A6UH 3H2PA 3QUXB 1FZMB 4ITCA 1AR1C 2AP2A 2H1PL 4PJ9D 5L4MA 1F4NA 4K7FA 5E8NB 2N0KA 4F8NA 1QNWA 4YSFA 5F0LB 5CADA 1VACB 3LSOB 3GNMH 5F5IA 2LW1A 1ZHKB 3VXTB 4N7IA 4LASL 4AYGA 3IAYA 2XQBH 2DEWX 4WTQA 1K5MC 1VBD3 5GLWA 2X1PA 3EHBB 3I9GL 2ZSVA 1K97A 3CTTA 1MS0A 3WEBA 3JV6B 3MRNB 3N04A 1YWKA 2JJ2G 1FNAA 4OKVB 4ZTOL 1QTPA 4YSUA 1VERA 2VDLH 3HHSB 1BLZA 1Y9MA 3C87A 2QPSA 4JFQA 3S3CB 3U1SL 1IO4C 4YHZH 2ICWB 3VCLA 1JUFA 3ARDD 3WV6A 5DI8A 2QHRL 1C8M3 3B34A 4NVPA 5GZEA 3A4FA 3ASNB 4MNGB 3U2SB 4QTHA 2X9ZA 5L88L 5T3ZE 4JN1L 4Y7OC 2HJFC 2XWCA 4E2SA 1BYPA 4JRYD 2P22C 2Q2LA 4LU5L 4PY7A 3EJYC 4U1JB 1A78A 3BE1L 1AR73 1F6AA 1A6TB 1C12A 4G1MA 5B1JC 4S2DA 4CDUB 1MQKH 4GSUA 3X3GH 5CNAA 5TDOB 1XB9A 5H94A 4MAYA 1KGXA 5DRZB 1B2WH 4C56E 4IETA 3CSGA 4GKJO 3LSSA 4Y19A 5AW6B 2Y6HA 2GT9B 4PBWD 2P48B 3ATAA 5JMOC 5JO5A 4KY2A 2FL5B 3MYJB 1H6FA 4YW4A 3OKLB 3RMYA 2F5AL 3SH3A 5AW4B 4C56A 2FBOJ 2AH2A 4GXVH 3HR5B 1U9KA 4AM0A 2PHFA 3ZIWA 1CLYH 2QQMA 3DRQA 3BESR 4G8IB 5GRXG 5JOWA 1YNTA 3AU1A 2L04A 4O4IA 2CTRA 3QJOA 3LDBA 3SYCA 2Q5TA 3N2GA 4P23B 4P5SA 5AW8B 4WCYL 2VUOA 2DUQA 5EP9A 4OZXA 2VZSA 2EH7H 4DT2A 5C3LD 3ETTA 2XASA 3D50A 3EYOB 4A2GA 35C8L 1MY5A 4FNUA 3HW7A 1MWAB 5FDWB 5IYZB 4HIEA 2UY7A 3GJFH 4YO0A 4GAYA 3RFZA 1E4WL 1N4XL 5GS0H 4WWPA 2IXQB 2NQCA 1QU0A 2XLGA 4WFHE 3FYIB 1HCYA 3ULUL 3O9WC 3KYOA 1QBBA 1R3IH 3VSQA 4ONOA 2MQ0A 3TV8A 4JV5B 2ZE7A 1U8NA 3MOQA 3QUZB 4I0PD 1I8MA 1NCDH 1OV9A 1MH5A 2FT6A 3TYGL 1Y6NR 1CD9B 1E9QB 1UURA 3A4AA 4M7JH 3TWIA 5H2BB 4IESA 3R66A 2WQXA 3TVMC 3VBUC 1N26A 3POFA 2XNDG 4XBGB 3VOUA 2W88A 2R56L 1Y6MR 4N24A 4TNFA 5JSOA 2Y6TE 4HC1A 5F0JB 3V4UH 2ADYA 4B4PA 3G6AA 4X8JB 5C0CB 4JTDB 4OD3L 1SDDB 3KYAA 5E1IA 2IAMD 1Q8IA 2R7EA 4JM0A 3OR6A 4X4XB 5EU6A 5FHAH 3ASIA 1Q0XH 3NTCH 4QCIB 5F1OB 2A9HA 1COV2 4E9KA 4OFKA 4PDLA 2CRIA 1I7RB 2WUCH 4HFWB 3MLTA 4LBEB 1T6GC 4YHKL 1ASJ3 3EYOA 3CCRV 4KX7A 1MA1A 2DY2A 4S2HA 3TASA 3M17A 2VMHA 3WHE0 4HKJB 4FZ1A 3BQUC 3IEAA 1R3KA 4JFDD 4QTIH 1JDAA 5BMFL 2J5WA 1N33O 2ADJA 2AJYH 1QG3A 1GXEA 4FPGA 4OSUL 1BHBA 4HXCA 4MRCA 5ISZA 3U36B 4DOUA 2F1BA 4GG6A 3L5WA 4JYYA 1NTZH 1OGSA 4OCLC 1KTJA 4Z77B 1DUYA 4XNQB 2P7TA 3K2UL 1BA9A 4PT6A 3VHNA 3I6SA 2ADIB 3ARSA 5F8QC 3WTXA 4FAHA 2D5FA 1B0WA 3RHWF 4Q4X1 3D51A 4NXNB 4G3YL 2AK4B 3K59A 1T1WA 2WB7A 3AREA 2FVNA 3ML9A 4XMKL 4MTOA 4GW4A 3W0WE 4IKNA 3E6DA 4KV5F 4JFOB 3H9YA 3V55A 1GLHA 3BAEH 3GGWB 2R39A 3V52H 3VFTA 5FZCA 5L3EA 3THDA 2WLIB 2Q87A 3TYGH 2DQ6A 3S5AA 3ZYIA 3FB6B 2RFXA 1H3TA 4NSKB 4BEIA 4QX2A 4Z7QB 1OC1A 4G43A 1B3JA 1N2RA 3EADA 4E9SA 4A7TA 4K0KB 2BNQE 3LQZA 4FAGA 3BA9A 2V7QG 1G7IB 4MASA 4XHQA 3ES6B 4N8VB 5E8OB 1N1YA 5IVJA 3D6GA 1ZIBA 1OK0A 4TTDD 4Y0GA 3X1NA 5A6LA 2VNCA 3P9LB 3F7VC 4C0BA 3KCYA 1RU9H 2DWEA 3QAZC 5D1ZB 2I07A 2OKXA 5EIIG 4PDWC 1O3QA 4I4WA 3CDGB 5CZKA 3SDAC 1QXPA 4AHXA 3L5JA 4KXAA 4NQEA 3INUL 3ZHTA 4OZHE 2ZCHH 2E32A 5HPMA 4XZPA 4BFNA 1RUF2 2GH2A 3FFOA 3HE7B 2WVTA 3AYEA 2XJPA 3WINE 3A6BH 2Q6AA 2A5UA 1GP6A 2ZKYA 1OQ1A 5DJDB 5ID0A 5FJKA 1KPUA 5CBAB 1O7SA 1ST8A 3QDMA 1SBDA 4Z7NE 3L5IA 5T3ZH 2F8IA 5B3SB 2ZYSA 2JTDA 3NJXA 4OD1L 4ZOEA 2XXMB 1KG0A 4ANUA 4J2XA 1WMDA 4Z1VA 2NRDA 2GNBA 5FUZH 5SX5H 5HJ3B 4Z7OF 1AHSA 5GGUB 2ZABA 3UXFA 5FZ6A 3DDGA 4IMLB 2BSBA 1E2WA 1MZ5A 1MPAL 1LJ7A 2CUHA 3J7LA 4PJAE 3F2ZA 4QNHB 2R071 4DO0A 4NE9A 2XL9A 3T2QA 3ZE2B 1ZGLP 4ZS3A 4QHLB 1CBVH 3MXWH 4HJ1A 1ZD6A 4J39A 2NMSA 4OCRL 3V6FA 2Z91B 4BQBA 2YXVA 4GAJL 4LMFA 2R6QA 3LEGA 4Q89A 1NAEA 1DCEA 1P9MA 3DVFA 4YHZL 2CO6A 2RJMA 2DU1A 1RUML 1CFTB 1K2DB 2E7CA 3QYCA 3WY2A 2VUYA 3MMEB 2ZD0A 3MRMA 1AGEB 4HKOA 4X6FB 1MAKA 2HUEA 3QNXA 4N85A 4E8CA 3JWDC 1I8IB 1B0GB 2CM5A 5CP3A 4LBMA 4J10A 3NKGA 4HPYL 5F6IB 1U8IA 2ED8A 4HHGA 3OBAA 3HFFA 2ED7A 2AXHA 4RWYL 3M3OA 4COUA 4OI1A 4OVEA 4N0UE 3MRGB 3IFNL 4NRYA 1HIXA 1U2YA 4Y19E 1EEUA 2FE0A 3QDHA 5D2NA 4R7VA 5EF1A 1H1MA 1VE0A 4BCXA 3VFOA 2R8SL 2VWEE 4R9DA 4OF7A 4P4KB 1JOJA 5E5MA 3QBQA 5LYJA 2KLSA 2ZXGA 3IDXH 5ITFB 3WMPA 4Z5RB 3NVCA 2X3BA 2NNCA 3KT1A 2F1AA 4FTVB 3LNDA 3A0HZ 4BFRA 4BQWA 1P7GA 1CD1A 5I1EL 3NEOA 4DW2H 4NN6C 4ZXBC 1MDTA 1P1VA 3D18B 4OU3A 4JW3A 2F08A 4WI3A 5JW4Q 4OQTH 4K23L 1YO8A 4C8DA 2WLZA 4LLUB 2Z5WA 1GW6A 2WO3A 3ULSA 4N43C 5F7YC 4X7DC 1Q6UA 2MCG1 1V7NL 2VDOB 4WFGD 5JMRA 1U36A 4ZONA 3CN2A 1RFDH 3BZFA 4H7VA 2BVBA 3RZGA 3V0AA 4CSSA 4HKZB 2HJFB 4XMZA 5G4NA 4FPJA 1PM7A 3TJEL 2OPWA 5ELIA 4IE6A 3F58H 3G5ZB 1JQ0A 1RLBA 3GM8A 5E6ID 4WZ9A 2HX8A 3LZNA 5LGNA 5JCTA 1TLKA 2WJ7A 1PHMA 3RYMA 1V8HA 3OGCA 3ZHFA 5L8KB 3N55A 4Q52A 4M43H 1T20A 1TTGA 1U6AH 3Q8EA 5E94B 2HMIC 1AH1A 5F3EA 1IC1A 2BZDA 4KHXH 4HJ0D 3B37A 3WAKA 4Q9QH 3DXTA 3GIVA 4HT1T 1IGIL 1ZLWK 1SF5A 1BVLA 3WOGA 1D5MB 4M7LH 4K73A 4OFQA 3RAJH 5IVCA 3KHBA 2UZXA 5A2IH 4FMFA 3GKWH 1IHMA 3QZPA 1CFMA 5IJRA 4Y5VA 1IGOA 4BRJA 3VHRA 2B1HH 2QZQA 4AEDC 4B7IA 5J06A 4KGQA 5EC1A 3JZVA 4K5OA 5CKQA 4KQ3L 1JERA 3ARGB 1EFXA 1JD7A 1GS8A 3MN8A 4FEMA 5EUOB 1AGEA 4DP8X 3GCXA 4QHKJ 5A3UA 3VG9C 4JAUA 4PV9A 3OB0K 2WAOA 4N9OB 3JASB 1I3RB 5CJQL 3ZSMA 1G7HB 4KQ3H 5JPMA 3HI1A 3TJHC 3ABGA 1I3UA 1XF3B 4QM8A 3DMMB 1N3QA 3I50L 1R3JB 3B02A