3CHXA

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
387
structure length
362
Chain Sequence
HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEVGKDYAFSIDLKARRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMADFKDPVTLLDGTTVDLETYGIDRIYAWHFPWMIAAAAWILYWFFKKGIIASYLRISEGKDEEQIGDDDRRVGAIVLAVTILATIIGYAVTNSTFPRTIPLQAGLQKPLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGLSTDPTPLAPGETKTIEVKVQDARWDIERLSDLAYDTDSQIGGLLMFFSPSGKRYATEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PmoB
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
total genus 50
structure length 362
sequence length 387
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3chxA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3chxA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3chxA01
4PHZA 3CHXA 4O65A 3RGBA 4PI0A 3RFRA 4PI2A 1YEWA
chains in the Genus database with same CATH superfamily
4HT1L 3QDJD 3EGSB 3QDGA 4NRXB 4IEFB 2Q2EB 4NN0A 5IMLA 4QE9A 4PVBA 2XAFA 1NJ9B 4NZRH 4AJVA 5GGUB 4BGLA 4Z5RB 2VCOA 1MFBL 3MRMB 3TP4A 4F7EA 1GGCH 4QRPE 2B42B 5JI7A 2E27L 3HJEA 1E4XI 3ZDZE 4MZ3A 4UQDA 1VLXA 4TUJB 3ASNB 2HTLD 4LF3B 3EJTA 1F4MA 1NEZG 4CKVX 4UCSA 5ALBH 2VT0A 4JMXA 3VGEA 1D5IL 3JAMN 4HCGA 4AG4L 1KPRB 3FH8A 5FOBB 5J1AB 3PLQA 2ZUYA 4JGZA 1Z5YD 2DRUA 3GHPA 5C0CD 3VFNB 4R90H 5DSCB 4MZUA 2CAZC 4HUWA 4KOCA 4GFTB 4PLJD 1BIIB 1E0OB 2D0FA 3N40F 1XMOO 1U8KB 3V0GA 3QUGA 3POWA 2IGTA 2AH2A 1KV3A 1MJUL 1M6UA 1WBXB 1NCCH 2FBJL 4O02H 4YH6A 2HWZH 4LXFA 5LUMA 5MEQA 4UVAA 5ACZA 3MFFA 4YZ5A 2ZWSA 1E43A 4MA8L 1SQFA 1SCSA 3RJRA 2WINB 2VAJA 5CEZL 2BOJA 3CJJA 2R56L 3W9EB 4GD4A 2XXGA 1UOWA 4XVSH 4A6YA 4GNKB 2EVFA 3QO0B 3FQTB 1J1PL 5KVDE 4XOGA 1CVRA 1Q8VA 4LO4B 4FADA 2P8MB 2WBJD 5CBHA 4NN5B 4XUTA 1AYM2 1DL7L 2YYOA 4KG8A 3EAKA 2X4NB 2AK1L 1NWPA 3MBED 5DHMC 1SLCA 3NQKA 1E28B 3MOAH 5LGHL 5F93C 3AK0A 3BEVA 4ZS6D 3L81A 4PJEF 4D2NA 1JJUA 3I3BA 4Z3GA 2B45X 3SQOA 2ZM6B 2X41A 3B9EA 3MOBL 4KHXL 3O9WA 5CZXD 4LOSA 3UAFA 2KLSA 5DRWA 3WKNA 5AB0A 4CE8A 5KYYB 3CDYA 3K81A 5T5FA 3KV6A 2XY1A 4WO4C 5B1OA 2G30A 2FECI 2IH3B 2PP9A 3J7HA 4RAUA 1KG0B 2CHNA 2JG8A 2HEVF 1WBYA 1DQDL 1JYWA 4OLZH 4A7KA 1M90W 1NCUA 2VITA 3CCEV 4ONGH 4AHZA 3VH8A 3IDXH 2WLNA 5IB2A 4Q0PA 5T1LB 4DGUA 2GFBB 3H9SE 3GF6A 3KJ4B 5CAZA 4XFGA 4OZGA 3GSVB 4H2CA 1MXGA 4FQQB 4JTAB 4J28A 4U1MB 4E4HA 2G5RA 1PPIA 2BJMH 4QHKJ 4ZONA 3GSNA 3KV4A 5GRZA 4KVPA 1T7VA 2MSPA 1JCHA 1N4XL 2HUHA 2KLRA 4PP2B 1HZKA 2VDQB 4OGYL 2DQ0A 2BP5M 3VXRE 4TNEA 4AGNA 3UDWC 3HJ0A 4WK4B 5A16A 3CRAA 2YD0A 7FABL 2VECA 2VNVA 4GS7B 3ON7A 4XGZA 1KPVB 3RBZA 3MYZA 4J7JA 4RFEB 5CBEB 2R1WA 1H6TA 1GFF2 2RQ6A 3HPNA 5FZ3A 4QYOA 5DJDA 1DO5A 3KPRE 1C5IA 1JVOA 2HHHO 4IV1C 4R52A 4FQHB 4L1TA 1AR4A 2VZOA 4HPOL 4EB6A 4U3SA 2ZMNA 2X5IB 1I1AA 3DSFH 5ITBH 5T5LA 3V4VB 3HAEG 4CU7A 1W2AX 3D3VD 2RIKA 3FQXA 4B9CA 4IDJH 5C33A 1O5DT 1WZ1L 4QU2A 4DPRA 3Q2VA 2X7LA 3UAJC 3I8TA 3V65A 3VXSB 3NCJL 2ZKHH 1MZFA 1GGCL 4MYWB 1HB2A 2HYMA 1RUH3 5F39A 4EZLA 3GSXB 3VI3B 4HXBH 1XMOB 1OW0A 1LHWA 3WG2A 3OHXB 1HHGA 1KYFA 3ZE1F 4A7VA 2DQFB 4PLKC 5ALBL 4ISQA 1P5VA 2JI3A 1REDA 4BQ5A 3RNSA 2UXFA 2VQ4A 4N8PA 3L1OH 1GP6A 5KWRA 2WR9A 2CA4A 5I6NA 1DQVA 2E7HA 5IWLC 3A7QA 4HJGB 3ARGB 3DBXA 4WFBV 1QVOB 1JMXA 3PUAA 3FCTA 4NJ4A 4ZTPL 2XAJA 1EJFA 1MY5A 1O7DC 4O02L 3GLEA 3B3IA 5HBBA 3TS8A 1S9KC 1WRFA 2IOIA 5HDLA 3REVB 2VUCA 4UFIA 4Y26A 1UA6H 2D3OW 1BQHG 2OXHB 5DJ0A 4XVSL 3I2GA 4PRHE 1UB5A 3BN9D 4KJWC 4XMLH 1NUGA 3G6BA 5SWZA 1Y4WA 2XKPA 2BOBA 1S2EA 1K4DB 4YDJB 4G27B 1OTUC 4LBAA 2NUPA 1RUE3 1NC4D 1R5IB 3BLKA 3QCWA 3ZPYA 3APMA 3QZWA 4G1MB 4NQEA 2IH1B 3BZ5A 4APXA 1I9RA 2PWHA 1KLGB 4XTPA 3LIZA 3DX8A 1BSIA 1I85C 1KTRL 4OLVL 4QX5A 2O4EA 4PRIB 1YEHH 5FF6B 1G0YR 4ZU7A 1F3JA 5C0FB 2UYAA 4FXTA 4ZTOH 3VN4A 2BCCH 2A9HA 2BC4B 5E94B 3M1BA 5LGJA 3GPSA 4CBZA 2Z8VC 4OLZL 5A2QN 1UNBA 3U10A 5BUAA 1OOWA 4QPKA 1H3GA 3IDXL 3STZC 2WLYA 5IMMB 1H9VA 3UGXA 3SDAD 4J39A 1HH9B 1NPJA 2YAQA 1TYEB 4CZZA 3TLRA 2JG9B 2OQ7A 2HG0A 2OW6A 3WYRA 1YO4A 3INAA 4HETA 2BJML 3S0PA 3KR3H 3P9LB 4W4KA 1DF4A 3MRNA 5HHOB 4LVNB 4ZI8A 5LK5A 2VISA 1UQSA 2HHHB 4MV2A 1I31A 4I2XA 5FYLL 3X12B 2IZWA 1H15B 2HFFB 2XVLA 4X9IA 5CEXA 2UU8A 4Q20A 5T3ZE 4Y5Z0 1L0LH 1CE6A 3HS8A 1AO7A 3OC5A 1DQ0A 2BBAA 2AEYA 1QR4A 1RJYA 1BBDH 1X5LA 4X65O 2WNWA 3CH1B 4K3UA 1X8EA 3RZHA 2Q10A 2QKIB 3QXAB 1QHTA 2H3NB 4YIPA 4G9FE 4HHAA 4QDGA 4NNPH 5GRUH 5GPRA 5JW4Q 2C9VA 1RUC2 2ZHMA 2XAQA 4U1GB 3EBRA 5D96C 4K0KO 4A5UB 4UUJA 1YJKA 1CL7L 1R1ZA 4S1SL 4GLXA 4NUJA 2G3XA 1XHZA 3K57A 4P2YA 5DHVA 3SDCC 1WLWA 5MEOB 4WSGA 2Y26A 5D7IF 1W0VA 4AJWA 4LKFA 3SISA 1TXKA 2O14A 4QR7A 5F7DB 1NAMH 5AVAA 4ZDHA 4U2AA 1H4HA 3CQFA 3WOGA 1OB1A 2ZKHL 4JFWA 1X5JA 1IAKB 1GMMA 1EEZB 1B2WL 1OAYL 1ETZA 1U3NA 4J5VA 1BKZA 1NBYB 4PJYA 2UXVA 4PGDB 2VQUA 2BUKA 4IKJA 3QRLA 1ZGLM 4X6DF 5AB2A 4J1UB 3K8LA 1I8KB 3MLJA 5SV4A 3L1OL 4RFNC 2RR11 1BD2B 1RZIA 2DMBA 2R0LH 1ENVA 3OGCC 3SDXB 1LNSA 4D6RA 1BECA 1MEC1 2YGPA 2M1KA 4FFVD 5B3SB 3JWDC 2YD1A 4M9OA 2C1FA 4XF1A 3C90A 4N9HA 1OZ0A 3HN3A 3SXWA 4X7EC 3ZTNL 3SKJH 5AVTB 1UA6L 3GJFK 2EC9U 4UCTA 4JY5L 2Q69A 3WY4A 4IIJA 1N33O 4UIMB 5JOEA 1DGWX 4XMLL 1OP4A 4XDPA 2HH9A 3NXSA 4Y1AE 4JYAO 4XMUA 4PG2A 3DGGA 1YVWA 4FXKB 1HTYA 3AQYA 3CN2A 4QDQA 3PDOA 1OKEA 2BS71 2ZONA 3QAQA 1M2OA 1TZHA 2C5DA 4CBCA 3R1GH 5FXWA 1TSRA 3N27A 1N0LB 1T5XB 3E8VA 2DVBA 1KGYE 3GDCA 2CLVB 4CADA 4ZTOL 1AOHA 1KENH 5E6YA 5LK7B 3GJEB 4Z8BA 1QSFE 4KQ4L 3ME2A 1KIQA 4G6JH 1XJAA 3EFDH 3AMMA 2PW2A 2HWE2 2EUXA 3QZOA 5JXEA 4OI4A 1JYTA 4YVWB 5EF2A 1TVHA 2H0EA 3B37A 4JI6O 5IZ7A 2UY7A 3ZVXA 3MBWA 1N32O 3SE3A 4QXTA 2YQBA 1AP5A 3I6LE 4MVRA 1IM3A 1SY6H 1O5LA 5DZAA 5T1KD 1NEZA 2EIEA 1HI6A 4GKOA 2WWKT 5EUKB 5GRWA 2EDTA 1W0NA 3I9GH 2ORZA 4WM8C 2K4WA 1R3IC 4KXDA 1HNXB 1JTOA 2WYTA 5L8KB 1AJOA 2VPVA 3WO4B 3HB3C 3KR3L 3KLLA 1WCUA 4QXBA 2QE7G 3MLVH 3P0GB 1XCQB 1FZOA 1QYGH 4DGIL 3GXUA 3PGCB 5D70H 3NQIA 4IRZA 5LNEA 1IM3D 5I0UA 1BCXA 4M48H 1GM9A 5FZMA 5CFCA 5IUCA 4MDIA 4NLAA 2YSSA 3CE2A 2FX9H 4KHPB 1M1SA 1J12A 4Q0XH 2IO5A 2EADA 5JMOC 1BBDL 1S3RA 2W65A 4M8VA 1V6JA 3TJTA 3ZHSA 4KGLA 4UQ2A 5F9JB 5I16B 1OSPH 2GNDA 1OT1A 4NNPL 3TVMD 2BX5A 4PP1C 4BJLA 5D4QA 2K9PA 4DETA 4ADIA 1SBSH 1XGQA 4R5VA 1GZHC 2Y38A 5E5MA 4DKEH 1OALA 4JDTL 1A1NB 4YGDA 3TNNA 3GT6A 2OYZA 3RDIA 2CO7A 5FDYA 2DD8L 3ZXGA 5F88B 1FYHB 1NAML 3HQXA 1Q72H 1FAIH 1LEIA 2D7OA 3HQRA 2EDEA 1PL3A 1JI6A 1VJ2A 5FL7G 5EH1A 1DYPA 1J8SA 1WMFA 4TQ8A 3BDYH 5CFHA 1CGSL 3W0WD 3EFOB 2J7MA 5ICXB 4P4RB 4LOTA 3ZYBA 1S3JA 3NSXA 3WHXA 5JHDE 1HSAB 2QQNH 2C7FA 3QJSB 3CC7V 4XX5A 2R0LL 3J8F2 1HQ4A 1KJ2B 3D39A 1WFIA 4O2CA 2R2BA 1FS0G 2LO1A 3O0RH 3V0JA 2OCFD 5EOCH 3SDLA 2H32B 2ZIDA 4DR3B 1XGUB 3HN5A 4M9PA 4WVRA 4AWJC 4XNYL 2EO1A 3SH4A 5BV6A 5K1PA 3NT0A 5FDBA 2RDQA 5IV2A 4PDLA 1ET7A 3SKJL 3M1OA 4KXCA 5EPMB 2B5HA 4OPAA 5IYCO 3W7WA 4HU2A 1LU1A 3EJRA 1HXYA 2AJZB 1JF6A 2DM3A 3KPSD 3F84A 1Q56A 4XPHH 4LUMA 4WI3A 3O3EB 4IW4C 4OM0H 1I7RA 4YAQA 3SYAA 2ZKXA 3OSDA 1OVZA 3NV4A 3VUOA 2DLIA 4NO5A 1HP8A 1ZXKA 2X88A 5FGCB 4DB5A 1Q8IA 2Q7YA 3VXQB 3V52L 2MEV1 4JDEA 2RJLA 4JUSA 3S2CA 2DJMA 3DPBA 3R1GL 5ESQB 5FEBA 1BLZA 5DEFB 3NUKA 5FO7A 4BQ4A 1N6UA 2NY6C 1XUQA 4G6JL 3DHPA 1KXTA 2FHBA 2WQWA 2B20A 4AVIA 4PJEA 5C0EA 1NKRA 5HYJB 1R0AH 3CXHK 3L9YA 5EO1B 5K7PA 3D87B 2QVFB 3N0PB 1IDSA 1SYVA 4KNSA 1SG3A 3GBGA 1MCSA 2ZPKH 1LP9A 3GWJA 3QK0A 5BUPA 3KF3A 3ZIXA 1H8LA 3QIBD 2QUOA 2ADJA 4KBZA 2AP2A 4AYSA 4CP1A 2ICCA 3S0MA 4PAZA 1SDWA 1UX6A 4NQVB 1JPEA 2K45A 2ZHNA 4Q6IB 2R042 1ZTMA 3LPFA 4LVHC 1IC1A 5LY2A 5EB9A 1DDLA 5EZLA 1OCOC 1DJZA 4OJYA 4GINA 5T3XH 2UZXB 1XIWB 2EDLA 2XTJC 4NUQA 2BNQE 4GMTH 5J7MA 5ICUA 5KANI 2E9QA 3D3AA 2YEVA 4XF3A 3NJXA 1AD0A 4LCIH 5HHME 5LW9A 2GJ6A 2PR4L 2FX9L 4MD5A 3L48A 1EZVY 2DL9A 4FLOA 1N36O 4GQZA 2BWQA 2M83A 4OJEH 5GS0L 3OX8A 4DW0A 2V2TB 2ESVB 3QDJE 1S4CA 1OZUA 4Q8BA 4AZZA 3HS0B 1OSPL 2IANB 2NY1B 2XN9B 5FZLA 1KZQA 1W16A 5C4WA 3S5QA 4XO9A 1EGJH 3RZCB 2V7NA 3LZNA 3WXWH 2OZ4A 4FNLH 1MREH 1G7HB 4RGKA 2ALAA 5DJCB 2GJ6D 1KZYA 4F33A 3OXSA 4Z1PA 2GTSA 4JI3O 2I7OA 3QXDA 4PREB 3QG6B 4QKTA 3MZGB 3P0YL 3TBSA 1V7NH 4B7IA 1CIUA 3PVOA 1AQMA 3CLEH 5D8AB 3T0EA 2EE6A 5C0CE 1UB6A 3ZTDC 4Q4Y3 3EGDB 1Q72L 1A8MA 1QKZH 3QORC 4JHAH 1MELA 1ND3A 1FH5H 4U1LB 4JV5B 1HCYA 1R3JA 5LLIC 3U6RB 1E65A 1I5YA 4GYCB 4AILC 5D93B 5FV2A 3RWHB 3BDYL 4ABQA 4EOWH 4YSSA 1UY2A 4RHV1 1GHFH 4UWDA 4P5MB 1ZRRA 4MQXD 1E2ZA 1YNLH 1EZLA 2FSDA 2M8XA 2QQNL 1QBLH 4HUCA 1O5PA 1UU5A 1K5NA 1AI4A 2VC2H 1JPST 3VI4B 1JZ7A 1TFHA 4BIOA 2ICWB 5I6XB 4C56A 2P5OA 5DDJ2 5FY0A 5EOCL 3CJIA 5GONA 4CH3A 1YEEH 3RE0A 5DZNA 5GS0H 4LPUA 2BWAA 1UURA 4LULA 1FV3A 2BTVC 2TNFA 1DSYA 4M8QA 1QA9B 5GISH 2UXXA 5H9SA 4QB2A 1SGKA 4AL8H 4AVHA 1CFQA 5DUJA 1UZ8B 2WD0A 1AMXA 1H1MA 1PO12 4W6WB 3SCMA 4XF9A 3ACIA 4XPHL 1DGRA 3VBSB 1RIRA 1GIGH 3K5OA 1XNBA 1SMAA 1BVLA 1SEQH 2X4QB 2VR7A 3J07A 2QGBA 1XGTB 1RZGA 4LUKA 2JX9A 3RX7A 4W65A 5LA2A 4BWTA 4J80A 3UBFA 1G1CA 1OSEA 2HVJB 3K4ZA 4HA1A 2VGLM 2BSKA 1XBRA 4NR1A 2FDHA 2H41A 2R2EA 1TUBB 3CSBA 1WC7A 1UEMA 3SCMD 2COVD 4JLRB 5EU3B 1PVXA 2DYRC 4XACA 4FG6C 3VSVA 4B27A 3ZOIA 1FWXA 1M7UA 1ODNA 2XV2A 2R043 1QFUH 5L2JA 1RUKH 1LK3H 4R7CA 1RLWA 5A3MA 1UM6L 2NXZD 1K2DA 5J6SA 4TULH 1R0AL 1YXWA 4UQ9A 3V4LA 1VFAB 5IW6A 4Q9RL 2EXJA 5JA8B 2E75B 1QLNA 1QJU1 4KO9A 4OZGE 4JQIA 3PU3A 1POV0 4FMTA 2IADB 4BK5C 1UATA 1WK0A 4BLJA 1DLBA 4IDZA 4FM0A 3N04A 2BDRA 2Y1AA 2ICWI 1CC3A 3BD5A 2WZPD 1IS3A 4AEHH 3OR7A 3C7FA 2PCFB 5T3XL 2GJRA 1HRI2 2JDNA 4O51B 5DWUH 4XAWL 1PGW1 5C5UA 4MVSA 1RP9A 1CTNA 1S78C 3C6LB 4LCIL 2V5YA 4Y2NA 3S4SG 5HVWA 3WX5A 3QEGH 3EBAA 4NS0A 5I9QC 3MBXH 1O6SA 3CSYA 2EYRA 3D3VE 4HKXA 4MMZA 4BZ1A 1NGXB 4PRAB 4LLWB 3FB7B 4WJ5A 1BZWA 3JD1A 3SHRA 3VBFC 5EBWC 4PJ9A 5BRZD 5IT2H 4RGAA 3OPZL 3KPPB 5L3FA 3QZMA 4FNLL 4HK0A 4LOFA 5CLXA 3F95A 2WKOF 5DD6B 1K7DA 4Y5VB 5IW1A 4UB8Z 4QF1A 4L3CB 4J41A 1I1FA 1TF4A 4NIKB 3KEHA 3ARDC 3QT2A 5DCCA 4F20A 1K5QA 3DGTA 3CLEL 1L5GB 4QPJA 3LZRA 3MRIB 5HXMA 2BVUA 1QKZL 4JHAL 5DDJ3 1RMFH 1HJBC 2JK5A 3E5XA 4XFAA 1G6RA 1LO0L 4X8AA 2CE6A 2GHWB 3FT3B 3LXAA 3QI9C 3ABTA 4PYGA 3RTLA 3QUZD 3IVKA 1H8TA 1WCKA 3GTVA 4ZZ8A 3GNEA 3W3BA 1AC6A 5F7WC 1GHFL 1RUF2 4J7KA 5CKQA 3NCWA 1A6TB 4LPWA 4L0ZA 2EDRA 1NZCA 3HFFA 3QNXA 3B2UD 1OCZB 4JASA 3Q2CA 4QRUB 1JK8A 2NNFA 4ONOA 2AMGA 2CMRH 2MCAA 4WDIA 4NBYB 3H1WA 4QRSB 1MY7A 2P28B 5C8CB 4KUMA 4HS3B 1E6OH 1YEEL 5DGRA 5IK3A 4HW6A 3UL2A 5KXCA 5DZFA 2Y0PA 2ILMA 4G3YL 2N59A 2CKBH 4Y4KA 4MB1A 1GP5A 3F7VA 2IFFL 3O3UN 2XQBL 5TPWL 4AL8L 4U6TA 1UYWH 4X1YA 4K3DL 5L7OC 2JLLA 2AEQH 2AERT 3R8QA 2PYJA 4KPHH 3IN2A 2HT2D 4ZSOE 3M7AA 4PSRA 5IB1B 4NBXB 4JGNA 2YICA 1GIGL 5K5YA 3COOA 4RH4A 1NTKH 4LITA 3MCYA 3SJBC 2ZQMA 1T21B 1QNMA 2BWIA 3NA9L 3EDDA 4Y4KD 5DJXB 2F43G 3HI5L 4YHIB 1KBVA 1TA8A 4JTCB 4K94C 1D5MB 3UYPB 5IEHA 4PGZA 1HU8A 3GB7A 5BV7B 1AYRA 5KX5B 2Z7ZA 1BX2A 1MCCA 3T8VA 2D7TH 4ZX6A 4WRLA 4YHYC 5DXWA 1C8M2 2VCBA 4CCKA 4AHCA 1EZVH 1QFUL 5FZOB 3AUWB 3T3PB 5FUZH 1FFOA 3JTTA 3ARYA 1SDYA 1NCRB 5DECA 3A6BH 3RGVC 2ARHA 3D2UD 1TEFA 2SEBA 2KERA 2DQCH 4Y0GA 4TNFA 5IFHL 1EAH3 3NJYA 4QHBA 3O4LB 3ZQWA 5T1MA 5ACA1 1CICB 4WGWB 3UT5B 1CFNB 3KYOB 3OAYH 5DLMH 3JB8A 2Y7QB 2B15A 1VFBB 2J1YA 3EBGA 3X14A 5I1JH 4QRAA 5KANG 4AENB 1DR9A 4L5FE 3U25A 1JK9B 4CDHA 4XFCA 1G0XA 2EO9A 1V55B 5T1LD 4AI1A 5I8YA 2DQHL 2YU2A 1T0PB 5DD1H 4F2MB 1TEGA 2FLRT 2CWSA 2XG3A 4IEQA 3VZOA 4D7PA 3TH2T 4ODWA 3V7MA 3BP5B 5KHHA 3EBIA 1EV13 3OGVA 4KKPA 5FGSA 1IGTB 2NYYD 3ECVA 4BFEA 4ODVH 5F9OH 4OUMA 4Q4V1 1GSKA 3WDVA 1FPOA 3FB8C 5EIBC 1WIOA 1YEKH 4FTVB 1OF3A 5TK2A 1OT2A 3FHAA 4AT6A 2E33A 1MCDA 5DLLA 2XJUA 2WO3B 4Q6KA 5K9KB 2AV7B 5TTRA 1VBD1 4K1ZA 5JH7A 2HVKB 1DUYA 2MPAH 4O2BA 5J2UA 3P4NA 4DPCX 2D5FA 4N0CD 1UMIA 1XV8A 4MNHB 1QF3A 1EX0A 2YQGA 1HKDA 5FMDA 4I8DA 1IKNA 4JGYA 4N7UA 1RUF3 4X6EA 1YF2A 5IMKA 3N91A 5AZ2H 1R091 2IAMB 2WGXA 1LEKA 4DP5X 5A3PA 3UGHA 4P2QA 1C5HA 2WBWB 3S3WA 4X64O 4JTOA 4ZOAA 4O61A 5DQDL 2BINA 4PR5B 2XFGB 1OGTB 2NR6C 4GWIA 2ZYIA 4ZU4A 5CKGA 4V2WA 1SRYA 3CCRV 3MV9B 1S4IA 3NIDB 4R0LA 2BM3A 2DQTL 2XWRA 5CBAA 2Z0AA 1TETH 1X9QA 4RQQA 3LSOB 4H33A 3CXHJ 2FDKA 3ME0B 2QTEA 4N43A 1B0WA 1PX8A 2CJUH 1VHPA 2AI0H 2CMRL 5ACLA 4DR5B 5TDOB 3SYQA 4RYDA 4ZUTB 1FIEA 2B1HL 3DPRA 4F91B 1VIWB 1X7QA 2EXSA 5MP6H 3OKOB 1YMHB 4P23A 4WHCA 1NC2D 1ZCRA 1DE4A 1WO2A 2XWTA 3CPLB 2YD6A 3UTTA 1UYWL 4GYBA 5KWYC 2J1XA 3ZE2E 2GT9A 4TSCH 4PJHE 2WO2B 4KU1A 4ONHA 3RVVC 4AEDA 2VH9A 3N2KB 3WGVB 3GXIA 1C8NA 1DUZA 4P23D 2XIIA 2WXIA 1BMV2 3JZ7A 1NKGA 5LXGL 3BFQG 2NYKA 2YRZA 3ATFA 3ARUA 3FTXA 4E9WA 4JX0A 4M1GL 2X53A 1W06A 5FZBA 4CC4A 4OLWH 1MFEL 5ANMA 3ECBA 3RPIB 3X1FA 1LULA 3MIBA 1FFNA 2D7TL 5FO8A 2CWMA 2HFGH 2GUYA 1ADWA 1SQBH 4U3HA 5A6LA 2NNXA 1SQVH 2HX9A 3QS3A 5JOFB 1RHHB 1FZKA 4JZOA 1TYJA 1A3RH 1KJVA 5FUZL 4Q52A 5A2LH 1K4CA 4UZGA 1MCLA 4Y2DC 5FKPA 3A6BL 2LQTA 3RL1A 1BGXH 4A7TA 5K9QI 5LB6A 4LKCA 1EHXA 3DMMD 3FO2B 5ABJA 2HP8A 2CUAA 2Y3NA 3T5WA 1KYAA 1JX9A 2DEYX 4YHHO 3MXWH 4KZDL 2CAKA 1G9DA 4W68A 3NPSC 5A7BA 5FUOL 1SLIA 3QDGB 2BW4A 4GSDH 4M1CC 5IMLB 4MX3A 2R0ZL 4RBPK 1M56C 2WAAA 5JZGB 3P0VH 4F7EB 5E6ID 2ZE7A 1MW1A 5F44A 5DD1L 2HLAA 2HJFB 1B35A 5FRAA 3IXTA 3QTCA 4XIKA 3IAYA 3HI6L 4DV2B 4LDCA 4V11A 4ZW8A 4LBOA 1UFIA 1WHOA 1Q1PA 4FPCA 1APNA 3V4PH 5MHSD 5DD3L 5TQ2L 4FFWC 1DZTA 4HUWB 4EMZA 2NLJA 3UCSC 2NX5A 3LSQA 1WZKA 2BIPA 4QXVA 3HNTH 3GMLB 4AC2A 2MPAL 4GXVH 2UWEE 1AL0G 5MEQB 3J8F7 4X64B 4PA3A 3BAEH 3GSRB 2QEJA 4QY8B 1N12A 3K80A 2V9UA 2W6IG 3D36A 4X6CA 3W0WE 2VW1A 3K06A 3OBRA 1IBLO 4I7ZB 43CAA 5CGMA 4U1JA 3AJZA 4P04A 4RNRA 3NZSA 3CRRA 4HGKC 4FNPA 3BCWA 4Y4FC 4ES9A 3O1VA 3WY3A 2VUKA 3ATEA 3O3BA 3VD4A 3WNMA 2ENSA 4GAAA 2KQXA 4GKYA 4CCMA 4AGLA 4XE9A 1IBYA 2W60A 2XJVA 2EDWA 1NTMH 1W0KG 3PL6D 4Z18A 5JPMC 4QX1A 3BEVB 4YPGA 1DBAH 4EVNA 5KC6A 2B08A 3M17A 2VAAA 1RITA 3JAWB 4P4KD 3O9WB 3LX9A 5I74C 3CZGA 2C0ZA 3K6IA 4NGHL 1I7FA 1GKFA 4KKLC 1B4JH 5HJ3A 4NTXA 3U4AA 2CJUL 2HH0L 5EUOA 5GHWH 5CZRA 2A83A 3KPTA 4BLIA 1PZ2A 2BV4A 1N47A 4NTWA 1G9EA 5MP6L 1UOFA 2XJTA 5TF1L 2CCVA 3BVDB 2E32A 2VITB 4MAYB 3VH8B 5KAQF 1E2WA 4MNGE 2OYPA 5TDPA 3TJHD 1JNNL 3LN5B 1NZRA 3EHBB 4NO3A 2ZOEB 4X42A 3KGTA 1T80A 3HBQA 3LCPA 4OZFH 4WHTA 2NTSP 3F8UB 3OKKB 5FYKU 1SXBA 2VSKB 1XQNA 2Y25A 3KJ6L 1QGLA 3QPXL 3POSA 1UFGA 1VRH1 4YC2C 5LASA 3JD3A 1B0GA 1A3ZA 2CK0H 3F6LA 2R1WB 3MCG1 1W0OA 2RDSA 3OUIA 5EU6A 2J1TA 3K0YA 4QYOB 3P30H 5DJDB 5HI0A 4NXNO 2JB5H 2WMPB 2NMSA 3MMEA 4MAUL 2VR3A 3K2UL 1EY2A 5GALA 4PJEE 5IBTH 4LMQI 3EJCA 4FMFA 1G4YB 3KVPA 1R082 5AVUB 5HCAA 1BGXL 3GS0A 1I1AB 2K3TA 5DUMH 5DFTA 3U82B 4BM7A 3B9KA 1RINA 4K7PX 2CWRA 4O9HH 4PA9A 3S98A 1YLBB 3WO3B 4QQOA 3MXWL 1K45A 2I07A 2RBLA 3GHEH 5EF1A 1X9LA 1I1EA 1G7PA 4XMAA 2WSDA 5B8CA 4OFYD 4F8OA 4X5LA 3VXMA 1CYXA 3D12B 4WUKH 5IQ7H 1HEJC 4MMXB 1GQHA 4DV7O 1NCGA 4AQ6A 3P0VL 1N0XH 4A39A 4AMKH 5EF0A 3C7EA 2VVDA 1T5KA 1RV6X 1JZ2A 1W6OA 2JXMA 2LLLA 4HIXL 4P9JA 3ABKB 1I8UA 3SBRA 2GJ6E 2ARJB 1VMJA 3V4PL 1HHHB 1KIUA 1WICA 3OAUH 4X8XA 2MNJB 3BA8A 5BXFA 3UESA 3VHNA 1JFHA 1L6ZA 1BEYH 5L4JA 3A21A 1GR7A 4L8CB 1MHCB 2G9ZA 3DBXB 4FAAB 5A7EA 5JNYA 3BAAA 4G80A 1W28A 1JOYA 1QSEA 3FCTB 5HYQA 1T6VN 5KAQG 4GXVL 4OX9B 2GK0A 4K3EH 1UCTA 1IGYB 1QP1A 1D2PA 1O7SA 4A2MA 5GS1C 1JN2P 2PLV1 5I8CA 4HMZA 3L5HA 4OFVA 2AGJH 4GAJH 2E7TA 2VRAA 1WT5A 4ZHQA 5B66Z 2WA3A 3FZUC 3HHSA 3S3JA 4Z7NB 4I1PA 1THCA 1JOJA 1TNRA 4EF3A 4YXHL 5JDBA 2BOBB 2BSDA 2K7QA 4OD2B 2IPTH 5AVVB 4U6YA 5KSAB 2YG0A 5ITFB 3RL2B 2NUPB 2LTQC 4OR1A 1I7ZA 1SZBA 4NQEB 4APXB 4JI1O 3F5TA 2V4VA 3DX8B 4HEPG 1N6VA 3IJYB 5G5DA 1JVKA 4BQ3A 3MHSC 1T22A 2PLTA 4NRQA 1DQKA 1F3JB 4HWUA 5IY5B 4XP6L 5E70A 1RM1B 6FABH 1ZBA3 1GQGA 1B4JL 4AQTA 4QJ4B 1ND0A 2ZKYA 3NRPA 5GS2D 4DRVA 5LGJB 4C56E 3M1BB 3WTTA 4P5HA 1BPVA 3ZE1E 4I0PA 4WTZA 1V8HA 3F05A 3SCFA 5A40E 2F93B 1Q82W 1BF2A 2J88H 3RTQC 1ZXQA 3AQXA 2E4TA 2DBJA 2G4GA 4OZOA 3WN5A 3QDAA 4JFDA 1UM5L 1HNWO 3AGVA 3DUSA 2FO1A 1ID5I 2Y2YA 4NFCA 1OAQH 3U4KA 4Q4W3 1TENA 4R7LA 1TJMA 4I0PD 5IHBA 3JB4C 5J3HC 5JVDB 2WCSA 3VFVA 4P2ZA 3MRNB 2ZJSH 3KYMA 3EO1A 5D7JC 2CL2A 4K8XA 2NW2B 2VISB 3LPGA 3W9DA 1UQSB 2D8KA 2CU9A 1R3KA 4I2XB 2YIAA 1A1MA 2FYVA 4WFFD 1XGZA 1S9YB 1CE6B 1AO7B 1TQBC 5K9QG 1R9FA 2FBEA 4J25A 4JI8B 1RJYB 5A3UA 2R7EA 5BNPC 1CBVL 1RZKH 1UGNA 2P8LA 3P30L 4X6BA 1YECH 2XA8H 1U93A 4DV3O 4NN6C 2CLRA 4A2HA 3MD0A 3H6JA 4HHAB 5IBTL 2WIMA 2F53A 4QNPF 4XRCB 2VLMD 4UUJB 5DUML 5FYJL 4QTHA 2PHXA 4X9HA 2F5BH 3DX2A 2D4FA 4ORGB 4O9HL 2X53S 5C08A 1GZWA 3OYWB 1NL0H 2PR9A 4AYFA 1BE3H 1CJYA 1SS3A 4UQIM 3GXFA 1H9DA 4IRSD 1ZVYA 4NKMA 4Q4EA 3VDDA 4C90A 2K1MA 4ZDHB 2OXGB 4XAAA 3ZN6A 3QR1A 4NUGL 5CLWA 1OB1B 2QGEA 4XBLA 1N0XL 1ORQA 2C9AA 4FFYH 1ETZB 4DUWA 3UTSA 4MS2A 4AYGA 5BRZE 1T4KA 1VQMV 2X10A 3AM8A 4HCIA 2O8OA 1CVNA 4DY5A 3UCRA 1M9WA 5C6PB 4PS7A 2A3YA 4WIQA 2VDRH 2JRIA 1USQA 4A3XA 2D3NA 4I1RA 3KS7A 3FUIA 5E8OA 3OGJA 3NAPC 3UGFA 1RZIB 3CCLV 1BEYL 1TIUA 2JE9A 1RVFH 1EERB 2CDGA 4X4MA 3VX1A 3NW4A 4KK9C 1XU2A 3SE9L 2JICA 3V0IA 3UTSD 4YM3A 4W9LC 3HIFA 3BUBA 4K3EL 2ZGRA 4L8BA 4KDWA 4KKQA 4WTQA 5SWQA 2RG4A 3CDZA 4J1XA 3AG7A 4GQ9H 2E74C 2DYPA 4NRZA 5FXZA 1L4IA 5E8EA 1UKRA 4NQXA 3ETPA 1M05A 2L3BA 4IIJB 1WCQA 4LR4A 2PETA 5HCHA 2AFNA 3L72H 3QA3B 2XV0A 4I3RL 3ATGA 3DGGB 3P6BA 4M7LH 2WYFA 1TTCA 3VDAA 1C12B 3GKZA 4GX0A 4FPLA 3PUIA 3PDOB 1Y18A 2FD6H 4YJ2A 4P05A 2F15A 2H6PA 5D7IE 5E89A 1ONQA 1TZHB 4LF6B 3NFSL 1KB3A 4QGTA 1HDMA 4IBWA 2P26A 1JGVL 4CADB 4K23H 5DT1H 3AZUA 1KIQB 1OP5K 2PW2B 1LOFC 4HKJA 1WAAF 1OGAD 4NP4L 4X80H 1W72L 2UY7B 4X6DE 3WLBA 3MBWB 2Y72A 2QMJA 3DIDA 3QUXB 4Y16C 3IS0X 5BZDB 2J1KA 1F2XK 3UCQA 3BTYA 3DEMA 2V7QG 4NERA 5C07A 4XMKL 4B9KC 4H7MA 4FS0A 1IXBA 3IGKA 1ZHNA 4NIAA 4QIRA 1OAQL 4CCCA 2Y07H 5J2TB 4DV0O 3C12A 1VENA 4I48A 2EXYD 3MIFA 2P4VA 1P9MC 1BZ8A 1FZOB 3TN0B 3GXUB 4GZ9A 4OMDA 3THPA 4Y2LA 4N26A 2PO6C 3QFDB 4N2OA 4BZYA 5CFCB 4HS8L 4MDIB 2YSSB 1RK0A 4XXWA 2PHTA 4LBEA 2GIMA 2Y6LA 2J6EH 3DC0A 4N4YB 3LRSA 1DBBH 4BFRA 2XJLA 4FHJA 5IVEA 2W65B 1RZ7H 3NNJA 2HFEC 4NAMA 4WM7A 4P48A 3VRIB 4UQ2B 4LF7O 1A9BA 1TJGL 3GNML 1EAQA 5CEZD 4BYHA 4FLHA 2Z31C 3BGFC 3FQYA 1JI2A 5D5QA 1NL0L 1Q94A 3MODH 5E5MB 1DQLH 5FK8A 4MSVA 4H3WA 5EYYA 4XH2A 1KKDA 3TNNB 4HEMA 4MTMA 2CO7B 3LF7A 1LODA 3MRCA 3CUPA 1HEZB 1CZ8H 3BIKB 4AQ2A 1LEIB 2JQAA 1F23A 4GO6B 1W99A 3VVWA 1AGFA 1UENA 4L92A 4FFYL 1DHKA 2VLJA 3RWJA 4K3JH 1BZDA 1FNFA 2CHZA 4K35A 4H7LA 3JWDH 4LQ1A 2QL1A 1FJ1B 2YGOA 2VDRL 4IJ3C 2AABH 3KZ8A 5AC91 2X09A 1T66C 4QQLA 4LFAO 4BQWA 3PE9A 1MCHA 1OAKH 2GMPA 1RVFL 1C16A 1G43A 3D39B 1B4LA 3UPRA 1EHLH 1LE5A 2R2BB 3LNFA 4W9DC 2Y1ZA 3S88L 4B6ZA 5CWSA 4NHKA 3RSJA 4R5TA 1ZRIA 4W4NA 4F9PA 1LHOA 4KGGA 3U11A 5DMIH 1FE8L 2E7MA 3PCYA 4FGMA 4GQ9L 1YNKL 4DFHA 1IGIH 3OKMA 5HYIA 2K9FB 1LLAA 3G5VB 4FFFA 4LOVA 1V54B 4G8IB 1AGBA 1CF8H 4WUUD 1Q5OA 1I7RB 2X4OB 1N18A 3MUHL 4M7LL 4YAQB 5C0ND 4DP9X 1LE9A 1OSGA 1THZA 4NO5B 4XE5B 5IJKA 2GNBA 4OJFH 2Q7YB 3G6DH 5IF0A 3VBRA 2WO1A 5FB8B 1Q0XL 4JDEB 1DLFH 5LJYH 2D44A 1X9RA 5F6HI 1WJZA 2NZ9D 3DPBB 4YDNA 4NOBA 4IRJD 3LA2A 5FO7B 4A2DA 4QRQA 2FNBA 4K23L 1G84A 5DT1L 1AKJD 4Z1VA 4HAFA 1UD4A 3EB7A 3HZVA 2YMOA 3LFIA 1KXTB 3DI3B 3EW3B 4P2OD 4CJ0A 1XF4A 3H42H 5C0EB 3OGOE 1O8PA 3CZEA 4ICWA 3FJTA 4H44B 3LD8C 5H9QA 4OGAC 2IMNA 1ZT4B 1MS4A 3VBUA 5I30L 2VCMA 3J81N 1LP9B 3AK3A 4O4HB 1CR9H 1YUKB 2YPKB 1CFMA 3IYLW 3M8OH 1ITBB 1E79G 1QXPA 4F5CE 4FPEA 3D4ZA 1HB4A 2QNKA 1RUMH 4ZBMA 4DRXA 1I1RA 2Y07L 3CXDH 1BBT1 4HK3N 3ULUL 1JXDA 4FJZA 2Y1VA 2J5LC 1KFXL 3FHQA 4JPIA 3R7QA 1U8PB 1R75A 4D94A 4BH9A 3JQOB 1QD0A 3VZJA 5E2WH 4JQXC 1FCGA 2CY6A 1EAPA 2YEVB 2BP8B 2J8UF 2Y3AA 4LSTH 4DVBA 2I45A 4J6GA 5IHRA 3MLPA 5EFIA 4XMZA 4KAQH 4MD5B 5C92A 1LCLA 3NO8A 2Y6TE 1DBBL 1U3HC 2H6CA 5BS0D 3INUH 2A6VA 4PRPA 3FQNB 4GP5B 4AQAA 2NXYB 1WISA 4X8GA 3S36X 5F7EL 1I3RA 1A6UH 1NA8A 2V7NB 2IVFC 2WS91 2K2SA 4FPPA 3I2HA 4XP4L 2VDMH 5GLUA 2CHDA 2IU3A 2ICWJ 3MODL 4F33B 1UTDA 3OXSB 1J84A 1DQLL 4DFSA 4OQTA 3WFEH 2H9GA 4LEJA 3TBSB 4BUGA 2MEV2 4GAGL 5MHSE 5DRNA 2DQDH 2WQSA 3BP4B 1UB6B 4GQPH 4LNUB 4S1DC 3T0EB 5ICYA 5IJVB 1AX0A 5GZCA 1F4AA 2FEJA 5KBLA 1ND3B 4AIOA 1WFNA 4XAKD 1QI3A 2BH0A 5FO2A 4LHKA 4IK7A 1R3JB 5FHAH 4U0QB 4PVMA 5KTEH 1Z66A 2AABL 2WFPA 1SJMA 2ZS6B 3IGAC 1LK2A 4FFZH 3WKQA 1K5NB 1H3TA 5JO5A 1EHLL 1UD8A 5IW0A 1XWVA 3W57A 2H8PA 4PHZA 1KNOA 3LSUA 5H94A 3FYIB 2VSCA 5GONB 2HSIA 2OK0L 1W0PA 2DOCA 3L4UA 4IOFC 4JFPA 4JZNA 1XNTA 3CJHB 1A9EA 2D5HA 3OZ9L 4AVTA 3RYFA 5D5MF 3SQBA 5GZOC 1JBJA 3VKOA 2UWCA 4AHXA 2WZAA 1CFQB 1BYPA 3RKPA 3SGDH 1UXSB 5CEYB 1WA0X 1UMHA 1HAWA 3TWCH 1XBFA 1T2QH 5IMOB 4MADA 1BVLB 4N2DA 3LKSA 5AB1A 5FY8A 1GWMA 4XVHA 4OJFL 2DM4A 1WLHA 2FEEI 4K55A 3WS3B 3UK9A 2E0PA 4JPWL 5KHJA 1DLFL 3RWGA 3FU9A 2BSKB 3BVOA 2WQAA 4F8TA 2R2EB 3S96A 2YQ3A 5CB7A 5GJTH 3CMEV 2A3TA 2AJXL 3OGRA 4DYLA 1E7UA 1SJXA 2NY3D 5DJ2A 3RIAF 2DLGA 4ZZKA 2CALA 4MLIA 5HP5A 1XL4A 3FOLA 3G6AA 1QPKA 3P2TA 1SHMA 3OAWA 4L05A 2XNDG 1SOQA 4OJCA 3WW3A 5FPOA 1OTSD 3ZYZA 1T03H 1EK3A 1RUE1 4P9HC 2XL7A 5EWSA 3D09A 4EN3C 2ZX3A 3OQ3B 3AREC 1F7YA 2X40A 3TIEA 3FQRA 5I0ZA 5IW6B 1SN5A 1NR7A 4HIPA 3M8OL 5E4AA 4WEMB 2CGRH 2HLFD 2VDLH 3CXDL 5TGBA 5M95B 2HMID 1U36A 1QQP1 3OR7B 3TBTA 5J4MA 3W21A 4WI4A 5LCVH 5H2BA 1D2QA 3H2PA 4H14A 5E2WL 3LKPA 4XHJD 1NA1B 3O3AA 1S0CA 1VBC2 3DVNA 3KCYA 4LSTL 3BI9X 3K2MC 5FX3A 3FB6A 1Z7S2 4KAQL 3VMPA 3CL1A 5DS8B 4ZS3A 3BYYA 2YUVA 4JM2F 4S2SA 4ZQKB 4DERA 2MEV3 3POBA 4GMP1 2WVVA 1XSKA 1LEGA 3OPUA 4RGMC 4U4BA 3F7YC 4WJ5B 5ILTL 4LCYB 3PUHA 3HR6A 3P73B 4PJ9B 4AVJA 3DTXB 3ILPA 4KKCC 3OJDA 2O57A 5EBMA 4HK0B 4C55A 2VDML 3BW9A 3DETC 1HW5A 2OJZH 4PU2A 1UXXX 4O2FA 4QF1B 5BQ7A 1WA6X 3P3PA 1I1FB 3VXME 1TMCB 5F1RA 3MUGA 4ELMF 1XL6A 3MLYL 2DQDL 3IXAA 2W08A 4ICXA 4F92B 4XNUH 2BSBA 4LLVA 4QX2A 1TME3 2JK5B 2E76B 3NYKA 2JEMA 5I5RA 4P9YA 4LF5O 3T8XA 2ITCA 2HTLC 3APFA 4DCQA 4UV9A 1KOAA 3IVKB 4TQEL 1H8TB 1DVXA 3U7WH 5KTEL 5A2JH 32C2A 3ZSEA 1VAHA 4FN0A 3IDMB 5BY1A 4FMVA 3PAVA 4DP7X 2C9QA 4YE4L 3SCGA 4PLJC 4H8HA 4XC1L 5EORH 1UOGA 1JK8B 4NSKA 3K71A 1V00A 1WUVA 5EC1C 2P7TB 4K71C 4WWID 4YJZL 5JZ7D 2XXZA 3D52A 5GQBA 2R8SH 2W9DL 4J8QA 3LQAC 3Q6GL 5IK3B 2KZ1B 4JGZC 1VZHA 2WL1A 3PPEA 5FPZA 3V10A 3O41B 4KRLB 2Q8OA 3C60A 1JCKA 4CXWA 1S5HA 1K73W 4X1YB 1R3LA 3ZOAA 4A2EA 2WBJC 4IV1A 1HV1A 5CBFA 1HV0A 3VXUD 1PVC3 5GS3A 3TWCL 3MBEC 3AP6A 5DMJB 3T77B 3E35A 4TNGA 5JOZA 4R3SA 4WEBL 4ZS6C 3MCKB 4AV5A 1BJQA 5DYOA 2ODMA 4G43B 5JCTA 3A0HZ 1FL6A 1JV5B 4GJTB 5CZXC 1OPMA 5IEHB 2BWDA 3I02A 1L7QA 3APOA 1O6TA 1VFOA 3GB7B 3NV1A 2G5UA 2Q3ZA 4HISA 1BX2B 5GJTL 1EO7A 4XO5A 5EPAA 1ZA3A 4JGMA 3N9NA 3ZDXE 5IVFA 3LIGA 2NY0D 4OSUH 2R072 4W50A 3RI5F 1KQSU 5J9PC 3ACGA 4YWAA 2YI9A 3GBFA 4NRPA 2Y36H 3JTTB 2QQUA 1T03L 2JI2A 2K7PA 2WCPA 3JWOL 3HW7A 1UZWA 2ZZJA 2GUZA 2OMZA 3SYCA 2SEBB 4AZUA 4CEWC 3DF0A 1Y9MA 4TVPH 2XVKA 3C2SA 4Z2WA 4P46A 4ODHL 4WFFE 5FGCE 3SGEH 3T6QC 2QDRA 2QKDA 1N8RW 4WV1A 1OOPC 4B3EA 5DS1A 3X14B 1I75A 2XWCA 3SPGA 1EH9A 1F4HA 4XZUA 2G9FA 5FP8A 3MRPA 3PRZA 3RVHA 2P9RA 1U6AH 4L2YA 2DVDA 2BY0A 2BMKA 4JW3A 4P5SA 3LJ3A 4ODWB 2VLME 2MPVA 1WWCA 4MJ4A 5AD0B 1FAYA 1ZLUK 1LMIA 2F58L 5EEWA 2W0FA 4I18C 3IDNA 2Q6WA 5F5QA 2ADIA 2CD0A 5FKCA 4L8DB 4AT6B 3IMTA 3UYRL 2SBAA 5C0BD 4ATEA 3P11L 1KB5L 1JXGA 2L8AA 3BKJH 5JH7B 2F53E 4O4JB 3P4NB 4FM1A 4O00A 3ZZQA 2Z93A 3EBHA 1LOEA 4JGYB 3MROA 1GM8A 2ZINA 3QJZA 1YY8A 4HIJA 3JWNC 4R7VA 1U8NA 4P2QB 4KI5C 3D69A 1XE8A 1F00I 4LDOB 4WWPA 3RVXD 4L3AA 2ROYA 2Y0IA 1X6NA 4XNUL 4E9QA 1TQCB 3UTSE 1PTZA 1RUQL 1TPXC 1X7SA 1QLEH 1V9U2 4WWKA 2ZE5A 4R0LB 2EALA 4LLFA 1AJQA 3LS5L 4PV8A 5PAZA 3MJ7B 2PW1B 5E95B 1SQMA 3PTYA 3FTSA 4GOSA 3BQUA 2YOCA 3BPZA 3OMZA 1JZEA 2JI1A 1RIHH 4QPGB 4BSVA 3ZHKA 5I26A 3AS2A 3KLQA 1PY9A 4NUMA 3H9AA 5E8DH 2CTRA 2XH6A 2A9NL 1OEZW 4I9WA 2BERA 3OWRA 1T1WA 1X7QB 4MJ5B 3U9PH 3WF3A 1VEOA 4JJ5B 3IMMA 3FT2A 1TSHA 1JGLL 1A2YA 4IU3B 4KUCF 4L3EA 3L3IA 3E89A 3BN9C 3I6KA 2X29A 5A1FA 4N68A 4W9GC 4QHUA 3UTTB 1UOBA 3ZXLA 1MQTA 1ZL8A 3MZHA 3V9EA 1XMEB 2PHUA 5GTHZ 2GT9B 4KTGA 1J95A 3C7OA 1KXVA 3MPCA 4XHQA 2WSPA 2H3KA 4AEDB 5SWSD 3O8XA 4NQCA 2PHRA 4U0RB 2P52A 2FUQA 4DR4B 1DUZB 2FO4A 1OGAE 3SYOA 1M3JA 4PI0A 1ZSHA 2XETA 3L17A 5D2AA 4IIZA 2VUOA 1I4FA 3LXUX 2HG5C 4EN0A 5ANMB 3ZXDA 3ECBB 2EJ7A 3MDPA 4OCNC 4JR9H 1QHPA 1VBE1 1VQPV 3CVHA 5KYNA 5D7EA 4OSUL 4JFSA 4HKZA 5H6RA 3RIAK 1U8HB 5FKPB 4KKNA 1X3DA 5C2BH 4AF9A 2CDEB 4Z78B 1GZTA 2W81C 5FZ8A 3WB2A 3SDAC 3ATBA 2QQPA 4QMEA 5FXVA 5BY5A 3I5DA 5HVHB 4Q2ZA 1J8RA 2R0HA 5TQ0H 4S2GA 5DUPH 1Q38A 1V3KA 3HVDA 1K9MW 2ZSWA 5I1KH 5HHXH 1SLVA 3BIBX 4P5TA 2AQ2A 5IHZA 4ZFZB 1Q3EA 1Z9LA 3I3EA 1ESOA 3H1MA 1PG7X 3KZ4C 4WGVB 4MSWC 2HLAB 4KWUA 1U6AL 3IXTB 3K72A 1ZY9A 5JIIA 5FZKA 3KLAA 5IK5A 5CEZE 2YI8A 3SO3B 1Y9GA 1YFYA 2HB0A 1W72B 1CN1A 4BAYA 3ATDA 3H8NA 4L4JA 1BXXA 3WTSA 4NT6A 3AP7A 1AGEB 1XF2A 3HKFA 4IBQA 1JD7A 2HJLA 2D9CA 2NX5B 2FCVA 3VGIA 1OM9A 2CDYA 1N64L 2J8UA 1VACA 2WIIA 3L9EA 4AQ1A 3L5WA 2WLPA 1R1A3 5IVVA 3V9FA 3V0AA 4QT5A 5F2SA 2AKRA 3HKBA 4XUNA 3NJMA 1OSYA 4ISVA 2ADEA 3V64A 2OIGA 4OXSA 2EACA 4X6CB 5BNNC 3PHQA 3OPTA 4LOEA 4X9GA 2ALWA 5HJGA 1JYNA 4RNRB 1NMCC 3PWUA 1XXDC 3WJJA 3IJSA 1R24B 4NC1E 5BRQA 3OEHG 5DN6G 4TT3G 3O3BB 4H26A 3MRRA 2OUHA 4NNYA 3CCQV 2G5BA 1ORSA 3PJSA 4Z7VF 2Q5ZA 2W60B 1FMD1 1ADQH 1QLEL 5IFTA 1B09A 1ODAA 5AENA 3IMSA 3TO4B 2WKGA 2B8MA 3M17B 2QZQA 4TOIA 2JDHA 4MS8D 3TYFB 3WLUA 1M57C 1MSWD 4M7JL 3AMPA 1RIHL 5I2IB 4JGUA 4XI5D 3L5JA 3PP3K 4FFVC 1IQWH 3ZR6A 3EJYD 4WUUE 3T6WA 3BAXA 4Q4Y1 4NO2A 2Z5WA 3OKEB 4P07A 4Q4X2 3T8MA 2E3VA 1IG3A 2IWFA 3MLXL 3CCJV 5F7YC 1WBFA 1VBB2 4GSXA 1HDJA 3D4YA 1MKFA 3F7KA 4PJBF 3QR2A 2X4SB 5E9NA 2E51A 2FDIA 5DJYA 3WY1A 5TISZ 1DSFH 3LUTB 3RWEA 1J5EO 3Q44A 3CDGB 4WHTB 4XNZB 5AYUH 5T3XD 4FABL 4WNJA 3GYDA 1PSKH 3I2CL 5D5MA 3PAZA 2J1UA 3CP1A 1EGJA 2FQFA 2JJTA 2WVTA 3DVFA 3QYNA 1T6GC 1M3IA 4WI7A 4X7SL 5CINH 2EABA 3JBG7 2AITA 3TETA 3WL9B 4XCAA 3AKTA 2FT8A 5I1CH 4TXWA 1SRDA 3EGXA 2VLRD 3NSDA 5EU6B 4JR9L 2EEAA 3N43B 3CBNA 1LHZA 4FG2A 2VXVH 1OM3H 1Y9QA 1JHTA 4UBHA 1EQWA 1ZS8B 4MB3A 5KYXA 1ZGLB 1QU7A 1QBAA 2WLLA 2FIKA 1F6AA 3V0VA 3RI5K 5C2BL 2FEDD 3QGVA 4YVUA 4EXPX 5J13C 3GPEA 3B9KB 1N1SA 5EO0A 3JCUZ 5E88A 3SMHA 4W93A 2I07B 4OB5H 3UTZA 5TQ0L 4M3CF 5FMCA 1G7PB 1U8CB 2CHXA 5DUPL 4X9FA 2QM7A 5B8CB 2DWRA 4AEEA 2OQJA 3VTAA 2LVCA 5I1KL 3QUXD 4HUVB 3DRTB 3QFJA 4YHLH 4YHNB 2ORXA 5AG9A 1FP5A 4XPAH 5BS0E 3VE0A 3EO6A 2E31A 1AJ7L 4B3VA 2VR9A 4J2QA 2AXHA 2AJ3A 3KVDD 4A04A 1A6PA 1W6OB 2JXMB 3Q3GA 1BVZA 4R9HA 4QGYA 3K2IA 4L0YA 1F15A 1AXIB 1IBKB 4O2AB 4Y1SA 1WN7A 3QFJD 3WEXA 1KULA 4AEMA 4NNXA 2JJ2G 4NPYA 4PRPE 1AXTL 1TJIH 1PBYA 5DEGA 1NEPA 5HHNA 2GP3A 3NDYE 4TSVA 3TVMC 1BZEA 5DQ0A 4G80B 1QSEB 3V0BB 2AK4A 1E5UI 2BHYA 4OAWB 2GK0B 1UY0A 2IDCA 2Z35A 4XAKE 1U30A 3F5WC 1X44A 2WXFA 3GXMA 4JG5A 5JPNC 5I8CB 3AX4A 2QKCA 5FV3A 3WZ1A 4JM2A 4QKXB 5JUEL 2I24N 4YBQD 3QP3A 4RQPA 2Q5BA 3FAVA 3CFJB 2R2HA 1F86A 3TBVA 5H37H 4LOUD 5J6HA 1FT9A 1Z0HA 4RMQA 3NK3A 5E6SB 4B9PA 2GAZA 4U6YB 4G9SB 3MI6A 1RKRA 5J12B 2IC2A 1RHI2 3HE6A 1IQDB 4YBLC 5LBVA 3S8WA 4LIVA 1I7ZB 3DIVA 3OAYK 2JJ6A 1V9PA 1NAKH 1FDLH 4JM2D 3T04D 5C9KA 2E7LA 1ASQA 1T0NA 4OFQA 2NN4A 5BPXA 2VCCA 5BNPB 5FM5O 4CC6A 4AFAA 4ELMA 1WNSA 4H13B 5C09D 3KS0H 4F1ZA 1MCRA 4IW3A 1GANA 1EVTC 1SLBA 4X6FA 3JD73 1P7GA 1ND0B 2J4WH 3HE6D 3FO9A 1WPXA 3MGTB 5EOCJ 3VD2A 1SQ4A 4RA0C 4R84A 4IBVA 3ZZLA 3GGWA 4OV5A 4FAGA 2JENA 2EC9T 2D4DA 2VOTA 3II3A 1S7XB 4N3UA 1OBNA 3O14A 3UKNA 2KDYA 3WN5B 4NQDB 3ZKXB 4DKFH 5ES4B 1H8VA 3K3NA 1CIWA 5D1ZB 1ZZ6A 4QB6A 2G60L 4FQXA 2IQ9H 1DSFL 2PYEA 4PRBA 4ZTEA 1HW7A 2B9UA 3CSPA 2FDBP 3UPAA 5K59F 2V17H 2EVXA 2BTQA 1PO23 1F4YH 3VFVB 4PJ7F 1W9FA 3OD3A 5B22A 3EO1B 3QQ3A 3W9DB 4OULA 5CINL 2IJJA 1R3KB 4XYXA 4CZSA 1A1MB 5I1CL 1KV7A 3QDMD 1MHHA 5GGTA 2PYED 4K7JA 3ET9F 1ZEAH 1KJ3H 2R7EB 4FHBD 2VXVL 4X5RA 4G7RB 2P8LB 4X6BB 1OHHG 1I53A 2VZSA 1OM3L 1XZWA 5KXBA 1NZ6A 2CLRB 5I0WA 1YHPA 2XOMA 1CS6A 3DBSA 4FYQA 4Y1YA 3WHE1 5D1QA 2Z65C 3ZKYA 2ATKC 3OG6B 2ZG3A 3WMSA 3WT3A 1P7KA 5C08B 3QIBC 3FONA 1PD6A 4LHJB 4OB5L 4AYFB 3LEIA 4K9EH 1Z0NA 4U33A 4WW2F 5F3BA 5DHXB 4PJIF 2XASA 5AW6B 4YHLL 4NKMB 5E8AA 1BYNA 1KXGA 4XPAL 3AS3A 3QEHA 4LNVA 4BUQA 1ORQB 1WP8A 3UZVA 1Z0MA 1B2YA 1T4KB 3D0LB 4M5ZL 2MCPL 4ZMAT 1Q8PA 1R3HB 5F71A 3VHPA 2CKBA 3D18A 3FSVA 4RGNB 2K78A 3FUNA 4TRPL 4JI7O 3FB5A 4OKVB 4WF9V 5JR1H 3RY6A 1SBBA 2CQVA 2A75A 3NCEB 2COQA 2H3OA 4FRWA 5D1ZI 3JVFC 1YTFB 4FIPC 4PJCB 1GYKA 2P80A 3MA9L 5CCKH 2H0JA 3MV7A 4UTAH 3GBNH 3IT8D 1QU0A 3PVNA 1JD9A 4ZO9A 4YK4B 1MQKH 4JZJA 1TE1B 2Z69A 3LZZA 3CDZB 3QNEA 2ZE8A 7CGTA 2DYPB 2ZX1A 4NQXB 2O72A 2VR5A 2YBKA 2X0VA 4XNMB 2R0WL 2HTKC 3E1F1 1QWNA 2NNCA 4G8AC 2N1KA 4QM9A 4QNPE 2FHCA 4GWMA 4ZMWA 3LKJA 2XTLA 3QJFA 3PNRB 3L3JA 1Q8QA 1NAKL 1Y18B 4LLYA 2H6PB 1CWVA 4MQXC 3SY0A 4MZRA 1ONQB 1YEFH 1EXGA 3QW9A 1B6QA 3MV8A 3LOBA 2XT9A 2J1ZA 4KZEH 4LH7A 1HDMB 1WA2X 3W7TA 3U1PA 3U0WH 1R64A 4PF5A 4ZHNA 4P00B 1E4KC 3RB7A 3U7YH 2J4WL 2F4VB 1QDCA 1PKQA 3VXUE 3FU8A 3MLZH 2VCAA 5FK9A 4DK0A 4OLUH 1YHQV 2HWC1 3WLBB 4BDVA 2KKQA 5J6GA 4WNSA 4Z3JA 5EZWA 3QJVB 2C26A 2UU9B 5DEDA 1QJEA 5KUMA 5C07B 4DKFL 2Y2WA 2JKRM 1NLBL 5LMNB 4LMQE 1ROWA 5GGQL 3U9UA 5DM6V 5JOWA 4JFFA 5E6UB 1UA7A 1UZ6F 2R69H 1R4XA 2IQ9L 3WHE0 12E8H 1F56A 5DVOA 4PQXA 3ELQA 4CXYA 1QWUA 3A3YB 5F6HJ 3GSOA 2V17L 4HUXB 2R1DA 2L4OA 4JI4B 2P3JA 5L36A 1F4YL 2JV6A 5L88H 1X9PA 4FKEA 1U41A 3SBQA 4BK8A 5F97E 2RHEA 3KVQA 3NJJA 3Q48A 4NENB 4OF7A 1CAXB 2RDCA 2EEXA 4JFFD 2KMWA 4MYPA 4D0BA 4BXFA 2VD7A 5C3SA 2JIGA 2D3LA 2W9LA 3WW1A 1ZEAL 3QXUA 3P77A 4NHCH 4AUYA 1D5NA 1CMOA 4WM7B 4KUCD 2NXZC 1HINL 3UJTL 1KELL 1ZSDA 1A9BB 1EAJA 3ARBA 3T0XA 4M62H 4UQBA 1B4RA 1AYN2 1AZVA 2G9HB 4TQHA 2HEWF 3KBPA 4HCFA 5ISZA 2ED9A 3UC0H 5D5PA 1Q94B 4NWWA 4AM0Q 4BKTC 4K9EL 3TBWA 3HC4H 2FX7H 4XH2B 3A4EA 5JVVA 3OOXA 4TQDA 3QO1A 1IARB 1WAAE 3MUJA 3WLWD 4UT6A 3CUPB 3PDGA 4F7KA 4FI9A 1QRKA 2NDFA 2PPAA 2XX0A 4LVOB 2YD7A 2ZCZA 4EE2A 1AGFB 1D7CA 2Z8SA 5C0BE 3ABLC 3ULSA 1DHKB 2VLJB 3RWJB 5ISZD 2LUWA 2QVSB 4ZIBA 3ZN5A 2B1AH 3LKNA 1O5UA 3SKJE 2DI9A 3DK0A 1NSNH 3FU7A 5I17A 1KEML 4IV3B 4B4PA 5J8OA 1JRHH 4YHZH 5FIEA 2F6AA 2UXCB 3EJJX 2GI0A 2VDOH 2JDIG 4WENB 1W2TA 3HJRA 1IEAA 1YQ2A 1C16B 3L7FA 5ETUA 1CLOH 5G4OA 5I15L 3T6XA 1NCHA 1LE5B 3WG7B 2QQOA 5FBJA 5CCKL 3T4YA 1OZTG 3FTGA 3GBNL 5FGBA 4GY4A 5E24E 4NAJA 4TUYA 1OCRC 1IT9H 1P7QA 2DWDC 2XG4A 5A7WA 1QWHA 3EJZD 1X7TA 2FGWL 4J3TA 5MEPA 1T1XB 3OKMB 3WR0A 1J8HD 4TV8A 3SBWC 3MICA 1ULCA 3MCLH 3LKQA 1RJ8A 3O0WA 4IEXA 5GTIZ 1AGBB 4JFXA 3IJHA 3K08A 2EVJA 4KX7A 2G9GA 4OGQC 5C8WA 1MZ6A 3QG5A 3O2VH 1LE9B 1D7PM 4AAPA 3QCTL 3QUZC 3U07A 4KRPD 1V3MA 4NZUH 1FPTH 4YDVB 3ZFFA 5IF0B 3DSQA 3VZNA 3LKOA 1X5YA 1SHWA 3LRLA 1YEFL 3OVUB 4HOMA 1OQ1A 1DN0A 2N74A 1QQDA 3NCMA 3B2UC 4KZEL 15C8H 4H8WH 2XL9A 3BWAA 1HXMB 1JZHA 4FCHA 4JRXA 5F72S 2M2DA 2XJSA 1EEQA 2N0MA 2AXGA 3CN4A 1G7QA 3ZHFA 4LB8A 2Z4QB 4I9WE 5JJEB 1X36A 4FZEH 5SWSE 5EBGA 3TCLB 1MJ7L 4EI0A 1COV2 2CIIA 2R063 1EP0A 1WS8A 2GMMA 3BAIA 2WZR2 2ZTNA 1SM3H 2OMXA 4LIQH 4GEIA 3D33A 4PS3A 2HT2C 4UDTA 4ZRGA 2FD8A 2GNMA 1BZQK 12E8L 4DRXB 2QHRL 1IVLA 5CJ8A 1AR73 2CPUA 1YNTF 1HRV3 5GGVL 4I02A 4NWVA 1BAWA 2V2XB 3G5YA 1K8DA 1VPHA 2MPFA 3CE1A 3V6OE 3MJ9H 4Q2FA 2CCWA 4AWDA 1AYN3 2GY5A 1T1YB 1NGZA 4GJZA 3AVSA 3ZIAG 1NDGB 5HV4A 2Z0BA 2Y69B 4UTBH 4X5XA 1LHVA 4RDBA 1SFYA 1VR3A 3WIIH 5LXTA 4DN4L 1ZBE2 2DDUA 1IURA 5L3CA 3L2MA 3SE6A 2EAEA 4K7FA 2JKJA 4AQAB 4G8GA 1YMMA 5LGKA 2HAZA 5FLUA 2A38A 1OUXA 1WCDJ 1PMHX 2VXQH 1YG9A 4WFED 1I3RB 2ZIOA 2IH3C 2KR2A 3EYFA 4N53B 2WN3A 1T3FB 3UC0L 4Q9BA 4JKKA 4BQCA 1XE0A 4UXNA 3AXDA 5DI8A 3W37A 3B01A 2NY2D 1XDCA 3NAAH 4LF9O 4IS6B 3TJPA 1BMWA 3P1IA 1RYYA 3GMNA 4G8GD 4PJCF 5FZFA 2DMGA 2EEBA 4JO5A 2WYSA 3F62A 3KJ4C 2R6QA 4BQ8A 1OCCC 1KBPA 2E9BA 1BVKA 1HEHC 3V0HA 2BGPA 4BIUA 1PIV1 4DJMA 4AMXA 4JRYA 2WY3B 4PH8A 2NYYC 4EI5D 1LO5A 3O4OC 5TE7H 3SZ6A 2EO7A 3BVNA 3U30B 1CZVA 3AB0B 2ENJA 2VDOL 3R7RA 5L0QB 4QX8A 2P49B 2WWUA 4CSZA 1SHXA 2KQNA 1OCWH 2H8PB 2X89D 4ZPVB 4OZFA 5LY1A 1CGTA 4N0CC 5H94B 5KVGL 2J8UE 4KX8A 1IT9L 3EYSH 1GM7A 2WNVB 4MVQA 2A3XA 4RRPM 1A9EB 3NJHA 3ZDYB 1P1ZB 3NCYP 1EBAA 3RYFB 4ZUWA 3SKNA 1DK1A 5ESAB 4ENZA 1J83A 4UINH 3BOVA 5BOZG 3E8HA 2HN7A 4W4LA 3DVIA 1T04A 1XX9C 5D7HA 2A5ZA 3O2VL 3IS1X 3JALA 2ZAGA 5I6OA 3LKSB 4X0KB 4DZBB 3QVNA 3QFGA 1H2LA 3ZIMA 4M93B 3NMBA 3RWGB 2VS0A 1DVFB 1H5BA 1L9NA 4U1SA 1EPZA 4FFGA 2DIAA 1INQA 1T1ZA 2ZAIA 3PHOB 4X99A 4EWAA 5KA6A 1AS6A 15C8L 1J87A 2LT9A 4H8WL 4R7NA 5FHBL 3S96B 2WC7A 1Z2KA 4KVNH 3GSUB 5DJ2B 2W0KA 4S2FA 1AQ8A 1PX4A 1W2BU 3FOLB 3G6AB 4HC1H 3K3WA 4F37F 1HJGA 3KGRA 5T3XE 2Y7SA 1KC8W 4YEFA 4B95C 1NTDA 4N43C 5E00B 5LG1A 5BYNA 4X4YA 5KVEH 1Y07A 2UXBB 3TF7C 4NKDB 4WEEA 5D6DC 5TE4L 3K9SA 3TIEB 2YD9A 4N2GA 1DLCA 2VLLB 5IUSA 1CAVA 2VXJA 1T0OA 2VLRE 3QIWB 4YGBA 4GBXD 4QPEA 1DZ0A 1DBJL 5IT6A 3EYOA 5TGBB 1TNMA 4P23C 3Q01A 3GRWH 4N20A 3ZTJH 1ZBA1 5L4FA 3ES6B 5D5ME 2ATFA 3SN6N 1BQLH 4OCMC 3SGEI 4G83A 1K4DC 5KSBA 3ABUA 1D5ZB 2ZIMA 5H2BB 1FL3A 4UCRA 1RP8A 1W03A 4IEOA 1U3YA 3CXCU 3RYHA 3IJEB 3LKPB 7PCYA 5EIYB 5AVZB 2X6CA 3DVNB 5ADOH 4AE0A 3FB6B 2ZWZA 4UTBL 2OPCA 3WIIL 1MWAA 4W4OC 4AAXA 2R30A 2WVVB 4ATWA 4FZ8L 4LF9B 3EH1A 4A7ZA 4Q4W1 3JV0A 4WO4A 4FQCL 3DMMC 4NC0B 4GUPA 2F54D 2NOYA 4PWKA 4Q14A 4TUUA 3OJDB 4UIKH 4OCYH 2ICEC 1B9ZA 3O6FB 4BZ2H 4CDGC 3BW9B 5A6YA 5PCYA 3C7GA 3RB5A 2XQYG 2OFQA 1RPKA 4JGJA 2AAAA 3LHAA 4H1LH 4O2FB 3L95B 5BQ7B 4YSAA 3NAAL 2FRGP 4AFDA 3MUGB 1N34O 3QFJE 4Y1UA 4BMBA 1NXD1 2X6VA 2XC8A 5E6IC 4Q6YA 2BK8A 4ISRA 4LLVB 4N6RA 5FY9A 4QUOA 4BEIA 5DUWA 2OMYA 2B59A 3T8XB 5FZ6A 1YAZA 3B43A 5AZUA 1LDSA 4DCQB 1HZHH 4QQHA 4MA3B 2R29H 32C2B 4Q29A 4FLVA 4GKJB 3B6SB 2OJEB 3UDWA 3OD0A 3WP3A 3VDBA 3IIAA 4EFEA 2PXJA 3LDEA 1I8LC 1F45A 1PIFA 2X4PB 4HAGA 4E2OA 3ZMRA 3LOWA 4PTTA 4NSKB 3K71B 5EZPA 1QJX3 4AVVA 2VQEB 3MIHA 3MTRA 2VQFO 4AUJA 2QR0A 4CH6A 1Z9SA 2QKIC 1COBA 1PNCA 1V5JA 3EYSL 3ILEA 1QEWB 2Y5EA 5FWRA 5JHMA 3L75H 2BVOA 2VW4A 5IREA 1D6VL 1W2UA 3EFFB 1IMHC 5BUVA 3D8CA 3C60B 4UINL 3DXRA 1FCCA 2YD4A 1YUHB 1SFPA 3T2MA 5FP7A 4N0YL 1IGML 1WAZA 3LZLA 5C09E 3L6FA 2PA7A 2XWZA 2JELH 2ZG2A 3F83A 2Q67A 3PL6C 3UAJA 4V1DA 1DBNA 4FDWA 1MCKA 3VWJB 4ZPTB 3OGSA 1CYGA 4P4KC 2WQZC 5F7LB 25C8H 3FFDA 3HUJF 4P9HH 1YCSA 3I02B 3HE7B 4U6VH 5HGGS 4ELME 5A6XA 4HKOA 3QQDA 1BM7A 5FMOL 4KVNL 4N8VB 2RHPA 3TO4D 4C4UA 3QC5X 5ENWB 1Q6IA 5LBSH 1MCOH 4GWJA 2XTAA 2JLPA 4V1DD 2OTJV 4CA4A 5IWLA 1NQTA 2I5YH 4LXLA 1U3JA 4L4VA 3U6XS 1T7YA 1MCJA 5LBFA 2GUZB 2BIHA 2OMZB 2WAHA 5DR5H 3MREA 5INCA 5KVEL 3LZFH 3O6ML 5CJXC 3TJHC 3ZFGC 4X20B 3HT1A 3THMH 4P46B 3QDME 2BGOA 2QSAA 2PYEE 4WV1B 2BNOA 2WLJA 4MWFA 1CAUA 2YAOA 4XETA 4YDLB 3GRWL 3HPLB 4XZUB 3IB3A 3MRPB 3FXIC 4JM4L 4MNQA 4PJ8B 3VSTA 2Y24A 3GLZA 4FXKC 2ZSVB 1VF7A 4JGSA 3MOQA 4CNIA 5BO1H 5KG9A 2D0HA 2V8MA 2UY6A 3ENEA 5ADOL 1Z5VA 2GTWA 1LM8V 1ECYA 1Q8MA 2W0FB 1I85A 2J56A 3IDNB 2Q6WB 4BRJA 1F90L 1I9IL 2ADIB 2MKLC 1IG0A 1SVCP 2MNUA 1OH3A 2G1MA 1U58A 4MLSA 4W9FC 2DYSC 5CZKA 2C3GA 3SGKC 4PG9A 1OTUD 3H7BB 3U4XA 3FRPA 1A6WL 4GRLD 4FAHA 2V4LA 5A33B 2Z93B 5IVXB 5BMFH 4OCYL 2OMTA 4ZD3H 2B77A 5IESL 5FYCA 3MROB 2ZHKA 3LDBC 3RDTA 1YY8B 2ZWNA 3CFMA 4HIJB 2E5LO 3LSSA 2V1DA 2YS8A 4GW5B 1PEWA 2A74C 4PJ5A 3RZJA 4V1PA 1I94O 3B4SA 2FZ3A 5EOTA 4GAFB 2FMDA 1Z5LB 3MW4A 3UABA 1XSRA 4DK5A 4G6FB 3KBEA 1JCVA 1JAEA 4QRFA 4UV8A 4AM0A 1US2A 3L1FA 2F8XC 2ZMKA 3Q8EA 4E4ZA 3RDTD 1HZHL 3IPVA 3BC9A 2XWXA 3ETQA 4P5RA 4PV8B 4RISL 2VQFB 1X7NA 1OB0A 3M3CA 3AW5A 4CPBD 3M4FA 4NHYA 4R4FH 4GB32 4XJ9A 3FH5A 4RAVB 4BSVB 5GIRA 5I28A 1ZD6A 4B29A 3OE7G 1L9PA 5DHEA 4QTIH 5T33H 3ZGHA 3WTUA 1T1WB 1G8MA 2WNGA 3BSZL 2A7BA 5K0UB 3FT2B 1A2YB 4N2CA 4L3EB 3MRLA 3IU3A 4FA6A 2FCUA 3RP1A 2QLVB 5C0AB 3SYPA 2B9ZA 4JKLA 4QHUB 4Y89A 4AVKA 4FQLL 4DK6A 4UNVA 3VL8A 4BXVA 2J6EA 3PFQA 1A4JA 4WU5A 3SDCA 3TNMA 3QCVH 2VW0A 5LEKA 3IU4L 1S7VB 5I24A 3L5XH 1HX0A 5LWYH 3O8XB 1N67A 2P47B 4KK8D 2XQYK 2ADQB 4LASL 4M7ZB 4NQCB 1WCBA 1S7UA 3TFKD 3IWZA 1A78A 3S97C 1WMEA 1XFPA 1TO4A 2IFRA 4QX0A 1IOAA 2DURA 2APFA 1I4FB 2KZWA 3MV8E 5JXJA 1J1OH 2BPBA 4WZ9A 1OC1A 2H4EA 1ULEA 3QD6A 5BQDA 5JOPD 1QX1A 2G2PA 2QSCL 4GP8B 5LBSL 3CVHB 2YLKA 5B1AC 1RJLA 2AQSA 1LB2A 1J5OH 3OGCA 3IDJA 3RIFF 2I5YL 3QO8A 5AVWB 2Q8BH 2D3SA 4F37K 2R27A 4ZNEE 3D0VA 2PI4A 1FLRH 4AE2A 4KP4A 2XVGA 5EZOL 4Q2ZB 1M7DA 2D7NA 2VDNH 4OCSL 4JFFE 3THML 1YLLA 1K9TA 3DJ9A 1UT1A 2W5FA 1ANUA 4MO3M 4HP5A 4U2YA 5IB4A 5C3QA 1KP3A 4AVSA 3P3RA 4P9MH 2BDNL 3D25A 5IHZB 3M7OA 5EIIB 5IBUG 2GBAA 1CX4A 4ZQTA 1CFVL 5D1ZD 4YGEA 3GGLA 1GPOL 5BO1L 5EA0L 3DURA 3KLAB 1N59A 3U9WA 2NUTB 3JXSA 5F1KC 5TE6H 1XF5A 3TEWA 1OLLA 4XJWA 1W6QA 3JWNH 3C5SA 4NT6B 4L2NA 3CB2A 4JFOA 2Q7EA 1XF2B 4OQ8A 3L5IA 2B3IA 4I89A 3SGIA 4LPCA 3F65A 3O11A 5IB5A 2B4CH 3PJNA 4LESA 2VKWA 3KPLA 4CVXB 1IM9A 2WIIB 1W0WA 1YI7A 4ZD3L 5ISZE 3V0AB 4QT5B 3HEIA 2AKRB 4G7VL 2C1PA 4ZFGH 1SQQH 2EKJA 1URXA 4K0OA 4PDRA 4IRSC 4XO4A 1Q9LA 3VFWA 4E41D 4DN3L 1FGVH 2GKIA 2ITEA 2CTPA 4WLCA 2XBZA 3EOAA 5F7AA 1CI3M 2Z79A 5GW7A 4XFBA 4CH5A 2GBVA 4Q9CA 4WM8A 3E3QE 5F3HA 1JW6A 2E6JA 3MRRB 2DYCA 3AG4C 4NNYB 2CR6A 4Q6IC 1ORSB 2OZJA 1FYTA 2X9XA 4B3RO 1OF0A 3OWEA 4UDUA 5B39A 1WCSA 1BQUA 3OBZA 2X9ZA 1AL21 1CAVB 4G6MH 1J8HE 1DEDA 3C2AH 1OVPA 1FFPA 2VLKA 4JG9A 1GWLA 4XUQA 4UCOA 2YBGA 5HVGB 3NFPA 3Q6FA 5JMOA 2XBO3 3U36B 1J05B 5I1AA 4NO2B 1F58H 1K72A 3FTWA 1NCAH 1YTFD 3ZDSA 1UXWB 4B9FA 3RWKX 5F1IB 3SDYH 3VA6A 1WS7A 3RZCC 1GOFA 5L6YH 2QVTA 3ZT7A 2YPVL 1GGTA 1GZHA 2JIJA 1UCBL 4UAOB 1AI1L 1IFHH 4HLZH 5DJYB 4A2LA 4M00A 5KSUA 3QCVL 5JOXA 1WLCA 3RWEB 3L5XL 5SX5K 2OTUA 1SJEA 3FMGL 3DOSB 5H9RA 1NFDA 4DUZO 2AV1A 4X8NA 3S7EA 3L3DB 3QJUB 1BMZA 4PP1D 1IGOA 1RZ8A 2XYBA 3UX9B 2ZHLA 2NZ1A 3C9NB 2Y2TA 5LHIA 1DTUA 5CN1A 3EGXB 3EYUH 5E08H 2GITA 4DMIA 5E99L 5AFBA 4ETYA 4JRXE 3MIEA 2V7HB 4XIOA 1FL5A 4Z7VE 3H8OA 2OR8A 1LO2H 1JDAA 3S5LA 5KYXB 1X82A 4LLDB 2EYTA 1OSZA 3JASA 2WLLB 2A9ML 1INEH 4JS7A 5CUSH 3V0VB 1ZPLA 5F6IB 2RR12 4PUBH 1UGKA 4MJIB 2ZOTA 1FLRL 4NO0D 3M3OA 2XY2A 1C8PA 3OG2A 2XLGA 4FFZA 2OQJB 2VDKL 1N5YH 5KXEA 2EXYC 1P4UA 5LKNA 2XWDA 4ZW6A 4XFHA 3X2QB 3IFXA 4P9ML 4ZX5A 2OBGA 4POUB 3VE0B 2ZA9A 2BE3A 3NGBB 4WVZA 4XJZA 3UT0A 4LWSA 4YZ2A 5K4LA 2AJ3B 3Q9QA 4PJBE 2IW5A 5FW7A 5I8KH 3O2WL 1GS8A 1RH8A 3PIQA 1SPPA 1QVFU 3WEXB 3U0PA 1IE4A 4A45A 1A65A 1MHPH 2IOOA 4OCLC 4YXKL 1STMA 1IL1A 3GM0A 2VZRA 4NPYB 5A1AA 5HHNB 5FA3A 2OCCB 1YMME 3CCHA 4G8GE 1G5GA 5EU7E 4JL2A 3S3DB 3X11B 3OLEA 1JMUB 5I66B 2AK4B 4L4TD 2B4CL 2MFNA 4K5PA 3LEMA 3RYPA 2A9AA 3T2QA 4COYA 4Y9CA 1TFPA 4N8VG 5CMAA 2ENPA 1IPSA 4L48A 1OA2A 2LJ2A 2X9YA 3W38A 3X3FH 1QXRA 2VMFA 1DTOA 3ZLIA 2XZAH 2DM2A 1L1FA 2DQEH 3VM7A 4YXLL 4RQPB 1HIML 3PDQA 3FAVB 4TN9A 3TBVB 5I0VA 4XCBA 3TEUA 5DHYA 4PV1B 2GAZB 3IDIA 1MRDH 2J73A 2WQ8A 2WWOA 1SDDB 4HIEA 4LEOB 4MXVF 3R4UA 4JV4A 3F64A 1E6JH 3NJFA 4JRYE 1ZV5A 4M3CE 4FSJA 2CUMA 3QPQD 5K8SA 1T0NB 3DYPA 4L9LB 5E9DA 1DQJA 5M0TA 2DCKA 3GINA 1KBGH 4MOAA 3AY2A 3R6SA 2VZVA 4GUOA 4G6ML 2KT6A 5EEVA 1JGUL 4UU9A 4X6FB 3WMQA 5FP4A 2H0BA 3FO9B 2Y6FA 3N3HA 1E4WH 1YFWA 1QI5A 1SYSB 4XC3L 1XF1A 4Y3OA 1F58L 1XDTT 3BLBA 5LCVA 4XCFH 2XTJD 1TME1 3GXDA 1N26A 2Z8RA 2YUAA 4ZUUB 2FKXA 2RNBA 1DQQA 4X9YA 3QWOA 2HKOA 1RY7B 3TA3B 1KCRH 5CIPH 3VFUB 5K9OB 4Y5VC 1J8KA 2Q7HA 1FN4A 4FQXB 4PRBB 3FCUB 5C0NC 4HL0A 1ML0A 5KJ4A 3IMWA 3ES1A 1LOBA 3WTXA 3VRJA 2IV9A 3NCCB 4PCRA 2FHRA 3QO5A 1SMOA 2I74A 3QORA 5KMGA 2PYFA 2AQTA 3DHMA 3DDFA 3UACA 1NE6A 2RR13 2NTFB 3IGUA 4MGKE 3FD9A 3GI8H 1L3NA 4C54A 2PF4E 2NZ9C 4GP4B 1WD8A 2VXTL 2A6IB 4IRJC 1NY71 1PNGA 4K3AA 5KHKA 1PCXA 2Z7WA 3CFCL 4IHOB 5E08L 1MEC3 2JS5A 3FLRA 1H8OA 3HG1A 3GEWB 3MXVH 3SITA 3BESR 1WE5A 3PWPA 1D4M2 2JS3A 2CO6A 3MNWA 1XVSA 4JN2B 4P2OC 4XPGH 3T0DA 3MYJB 3TBBA 1J59A 3UEZA 1LGNA 1PVC1 5D1QB 1INEL 4XEZA 4E2SA 1R6KA 1NCTA 3ZE0F 5E1RA 3RIFK 4PUBL 3DNKA 1P7KB 1PQZA 2R59A 3LEYH 5DZGA 1KBBA 3AZYA 3JTSB 5AKVA 5CJOL 4PJXA 1N5YL 2JCCF 2X1OA 2J20A 2BVQA 2H1PH 4FNQA 4HLEA 2DQIH 3FHEA 4J3BA 4UILH 1VB2A 4IE6A 3MLSH 3QUMH 4KY1H 4RD7A 1WB8A 3H9VA 3WEZA 4RMWA 3AT8A 1R6VA 3UZVB 5FJKA 4DFIA 3M8LA 5MERA 2F54E 1BCCH 1CGVA 3D18B 1PPJH 4HQQH 4MH0E 2G3MA 2EJRA 4V33A 3FB5B 4Z8FH 3LSDA 2FMYA 4KJYA 4JVAA 3R0RA 1QMUA 3B2EE 1UUSA 2APTA 2ZXWC 4PJ7E 1R1BA 4XCCL 2K3HA 2PTVA 4GCZA 5BZWB 4Y22A 5FKBA 3B3QE 1W6NA 4PCKA 1WW7A 5FFOC 3B2VH 4P57A 3FT4A 3UROR 2YXSA 1WMDA 2YGLA 1DVZA 4JO3L 2F4LA 2YD5A 4FFBB 4HDIA 3ILQD 2AQPA 2B3RA 2DWTA 4BGDA 4QMAA 2DWEC 5F0LB 2V5RA 3ZHDA 4HT1T 1TVBA 2BNRA 4M1DL 4KMTH 3R05A 1LL1A 2DQEL 3MUUA 4GG8A 4KKZA 1ASJ2 3R4SA 2IXHA 3W59A 4FG6D 4HJEA 5L9VA 2QEXV 4EKXA 1VADA 1OK0A 2NCEA 4W9IC 2J5WA 4E68A 1QFWH 4ODBD 1SC5B 1XCXA 4X6RB 3KT4A 2UZYB 4QAWA 1E6JL 1ZLEA 2E59A 3SDDB 2YKLH 3WIHH 3DHUA 4BQBA 2ADYA 1AJKA 3B5LB 3N3EA 4I5BB 4LLYB 1GTNA 1J9RA 4PJIE 3JSLA 1NIDA 4GMSH 1YYLL 4NB7A 3M3QA 5EIIG 3EFFK 1KBGL 1TG8A 4FYSA 5H35A 3T1YB 3B56A 2XQXA 1A3KA 2WLHA 4PRNA 1Y1DA 4MFHA 4QOKB 3VFSB 3B9DA 4JTNA 4PVLA 1FVEA 1H0DA 3C3VA 1PKQB 4JN1L 1GZ9A 1E4WL 2DU1A 4Z7WB 4CDXB 5DC2A 5DWPA 2P5ED 4HBQA 4BDVB 3NQHA 4XCFL 4AGVA 3FW6A 3E6FA 2HVKC 4PDVA 3D1MC 5EBWA 3FUFA 3RA7L 2ZGLA 3VBFA 3TCTA 3L08A 4COVA 5DS2A 3HKEA 5FYMA 3C09C 3TCXA 3U9UB 4OHXA 4F8NA 4HWBH 4ADJA 2ARBA 3D4KA 2GN3A 1AZCA 4O4YH 4LKEA 1AYM1 2F95B 2Q6AA 1II4E 3GJFH 3Q5YA 2EXWD 4IIQB 3ARDA 5AOLA 4QPWA 2LVEA 5T55A 4YGAB 3I9AA 3H9YA