2IJHA

Crystal structure analysis of cole1 rom mutant f14w
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
57
structure length
57
Chain Sequence
GTKQEKTALNMARWIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijhA00
1NKDA 1PD3A 2IJJA 2IJHA 3K79A 1RPOA 1ROPA 1B6QA 1F4MA 1GTOA 1GMGA 2GHYA 1RPRA 2IJKA 4DO2A 2IJIA 1F4NA
chains in the Genus database with same CATH superfamily
5CA0B 2UU9B 4ZIBA 1XUQA 2RCVA 4N21A 1N0NA 3SJQC 1XREA 4O4IB 3BCCH 3UO2A 1BS3A 1PL0A 1CXZB 3SPHA 3KG2A 3IFXA 2WLIB 4U3FH 2W6IG 2AHYA 5KHIA 1GN6A 2DJVA 1FJGO 1SESA 2Y69C 1EBOA 4X66B 4LR3A 3HKDA 4I0XB 4LFBB 5BMVB 3AK3A 1K33A 4R6ZA 1VQ7V 4G2KA 1M5IA 1NS1A 2XNDG 3T4ZA 3SYAA 3PJSK 4RO2A 4B3SB 3WB0A 4NB5A 3P3PA 2BTQA 1I94B 2AHZA 2X7RB 3ABLB 5B3SC 3CCJV 3OMIB 5IJ9B 1Y74B 1Z5WA 4JI6O 4D7SA 4WCEV 1XNQB 4IYIA 1WN7A 2IJJA 4UB6Z 4NXMB 4UFZA 2FL4A 4I4TB 4OPHA 3M7MX 4I55A 1SKVA 1KD1W 5BR8O 3ABTA 3O9OA 5C8YA 3J81N 1OHHG 4LWSB 3CXHF 2ZKOA 2Q0OC 3FKSG 1XMQB 3AG7A 4FFBA 5B1NA 3JARB 1KU9A 2XUMA 2ZR2A 4DR1B 2PTMA 1N34B 2BOBC 3IJ4A 1F4MA 5FNVB 4B3TO 4X88A 2CE4A 2ODMA 4DV6B 2D3OW 3ABMC 1AI5A 1M57B 2AW9A 2HG5C 2HJFC 1PV0A 4FLZA 3CCVV 1VQ6V 4O4LB 2PF4E 3WB2A 1DGSA 1O9GA 1S5HC 2XTAA 3GWOA 4FJCC 3G67A 3E8HA 1AJNA 1D5AA 3J7AU 3BPZA 3RYFA 2WLLA 1NH2B 2Y48A 1LR1A 1J95A 2XAQA 3K79A 4X89A 2YEVA 4FLYA 5EK0A 4CS2A 3S3XA 2UXDB 2A9HA 2OTJV 2Q69A 3RBZA 4KP4A 5JVDA 3L72H 1QHTA 4YIPA 4X8AA 1UFIA 4TUYA 3JASA 3LSSA 1HNZB 2LO1A 2C2AA 1V9PA 4XDJA 4LNUB 2UXCB 5LYJB 4JI8B 2QDOA 2X6BA 2EILC 4O2BB 3D3IA 2JDIG 4A5UB 1N0JA 1Q5OA 1HWYA 2DWDC 1OCCC 2E75B 3JD4A 1OCZB 3SDLA 1J5EB 5JCOC 4DRXA 1V55C 1TUEB 4H44B 3SJAC 4FK5C 2HP8A 1K5SA 4GX2A 2HHHO 3TXSA 4J7ZA 1JFFA 1M56B 3CMAV 3NR7A 1VARA 3FYEB 3RYIB 1ZSPA 4JI2O 4I50B 3DGEA 2GTSA 3CRQA 3N2GB 1FKAO 2CGNA 2DYRC 4JYCA 3L75H 1YZBA 1S5LZ 4DR3O 2F4VB 4ZHQB 4R50A 2CUGA 4UVBA 2E5LO 2Z5UA 2KG7A 3QF7A 1FS0G 5LMUO 2EZPA 5L3DA 3CMEV 1TAEA 2V7QG 1YTFD 4JYAO 1JQ0A 1E79G 4LF6O 4FMTA 1G8MA 4LF7B 4K8ZA 1F4NA 1MNGA 3T1YB 3SR2C 1NR1A 2R9RB 3E22A 4B3RO 2VQFB 3OM3B 3SPJA 2DYSB 1WP8A 3BY6A 2OCCB 4DR2O 3ZN0A 1NJIW 3THOA 3JCZA 5JH7A 2Q4PA 5EIBD 2YXYA 3AG3B 3QVNA 2Q7EA 1ENVA 1DK1A 2YIDA 4DR4O 2EIJC 2N04A 3E8BA 5JCOA 3AG2B 1P4RA 5J9PC 1Q81W 4D6TH 2UU9O 3ZMTA 5LP6A 1BGYH 5LHGA 2A06H 1FFXA 1DTOA 3A0HZ 1M90W 4KHPB 2GTAA 3J80N 3IC7A 3IC9A 3CJHB 1U97A 3RYHB 1AP6A 1WA8A 2ITCC 3ZHSA 1VIBA 1BQZA 2ZQMA 4UB8Z 1EN5A 1URFA 2ZD9A 1BSMA 4MTFA 2Y0PA 4TV8A 2BCCH 4X66O 1NKDA 3H1HH 2OT5A 2IU3A 2JIZG 4NXNB 4LFBO 2ZIMA 3B8MA 1Z5VA 4PDLA 5HFLA 4PD4F 1QVFU 1VQ8V 3G6EV 2ZIOA 4DYLA 4B3SO 3KCXA 3L9DA 4TV9B 3R66A 3ZRVA 3SPGA 4X1IB 1H2GA 2E76B 1XOUA 3DTUB 3K9SA 3OE7G 4BW9A 1XNQO 3FB7C 4WFFA 4NXMO 2CTWA 3ETDA 1QCEA 4UVAA 1Q43A 3HB3B 4U3JA 2AZ0A 3E35A 1YF2A 3LSQA 1R3LC 2IW5A 4WBNA 2Q73A 1F51A 2RNBA 3AG4C 3E89A 3C3TA 3E86A 2EZOA 1XMQO 3H01A 2ZT9B 4QIWF 5EZYB 2AGAA 4H37A 3BABA 2KKWA 1QU7A 3VOUA 3G71V 4MT8A 3I5DA 3RWRD 1K5QA 1MZFA 4XDLA 1R6TA 4DV6O 5LGTA 5FLXN 1NR7A 1OCRC 2R9AA 2ZDIA 4JI1B 2FTKA 1BCCH 5LA6B 4JAVA 2DE0X 3OUSA 1SC5B 3K59A 5GONB 3GB7C 1QR8A 5CB4B 3CC2V 4G27B 4F4LA 1K4CC 3RGBA 3UT5A 4BAYA 5EIBC 4JI7O 2ATKC 1N36B 1SQGA 4X1YA 3LDDA 1NH2D 3FB6C 1E1QG 1HNZO 4JTAB 3AK2A 4PHZA 3A0RA 1S0VA 4U7OA 4QJFB 5J2TA 4LF4B 2KQXA 3ZBHA 4J42A 3CC4V 4OX9B 2UXCO 4LFCB 3F7VC 4JI8O 1YI2V 5JQGB 1FYJA 4JZGA 5H5NA 1H2NA 1PPJH 3BRCA 3CHXA 3HPLC 4BWAA 2GV9A 1GRJA 4MVQA 4J41A 4EFEA 4JI0B 1EN6A 5IYZA 3D8CA 4MVSA 1GMGA 2IH3C 3VQXA 3ZMZA 2VWJA 4PELA 3B8NA 4WFAV 1GM8A 3LUTB 2Y4UA 2HR3A 3FAVA 2QR4A 2BE3A 2ILMA 1NVPB 3CCSV 3S3WA 3BEHA 3I56V 3VBBA 4X65O 3BA8A 2FYUH 4LH7A 5KUMA 1YEWA 2EBOA 3U10A 3ABLC 2LW7A 2BSKB 3ICXA 1R3JC 1NT2B 1KECA 2Y0IA 2QM4A 2JS3A 4H33A 4LF7O 4LBEC 1GM7A 1XNRB 2VQFO 1Z2GA 5CA3A 2X6CA 4JI4B 5IY5B 4ZOLA 4O4JA 4X1KB 2YC0A 3OGIB 4OPAA 2QKCA 1AI6A 2JGUA 1S5JA 4AHCA 2A3QA 3N27A 1VQKV 1MG1A 3IAYA 1XMOB 5KHHA 4YJ2A 1N32B 1XQ8A 2L35A 4HZ3A 5EBMC 2Q68A 1B3QA 1QLEC 3F5TA 1YJWV 1DF5A 4R8CA 4KHPO 5KHJA 1AP5A 3BHPA 5DEDA 3A8TA 4UXNA 1PP9H 1UJWB 2P7TC 4DW1A 3LSUA 3WB1A 4NYKA 3CCUV 1P7GA 5B1AB 4NXNO 4P9PA 1CP9A 4CBCA 1Q82W 4EB6A 3K57A 4CH4A 4UCTA 5CA1A 4O4HA 2LFRA 1W2BU 3FFQA 4B08A 5ITZB 1K8AW 5LHHA 2LGWA 1FXKB 1PNLA 5L3GA 3RN4A 4YJ3A 3DC6A 3JSNA 5H2FZ 5EYPA 3CRAA 2XAHA 3ETEA 1O9HA 3Q4HB 4FLVA 3CYOA 3NXSA 2EULA 1Y76A 3SGIA 5LGNA 4Z2WA 4GZRB 4JGSA 1KP3A 3E8GA 1RPOA 1H8HG 4DR6B 1S76D 4Q6GA 1JPXA 3U0ZA 1HDJA 2QKAA 1G6UA 1VMGA 2UXBB 4X20A 4F6RA 1SRYA 2RN9A 1M56C 4O4LA 1ZAUA 4DXWA 3UM7A 5IT9N 5KA6A 1SQPH 3RYCA 1AILA 2E74B 1TVKB 3JAKB 2MW2B 1Q8IA 3B40A 3ZMUA 4JI1O 1TA8A 1XI1A 2CH7B 4DV0B 2NNUA 2HVJC 4H13B 2LW1A 1XL6A 2F66C 1VQPV 4TOIA 5J2UA 4ZI7B 2CTPA 2QM7A 1SA0A 1M9NA 4GX1A 4UUJC 1G1XB 4MTXA 3OFNG 4TQFA 3FX7A 3K5LA 1KUQA 1N36O 3APOA 5IJ0A 1IXBA 5FPOA 3ZRWA 4B3MB 5L3CA 1IBLO 2RMKB 4ZKIA 3U11A 2N74A 4CH3A 2F43G 4LF4O 2YIBD 3ABKB 2X0LA 2L6LA 1PM9A 4OX9O 4LFCO 3CWBH 4TWKA 3N2KA 1GO3F 1ZWIC 3FYIB 1R1BA 3WG7B 1R73A 4O2AA 2GUZA 5JJEB 3D36C 4JI0O 5LOVB 4K3AA 4J10A 2W6JG 1K34A 5BZBA 3P30A 2QWQB 2OTLV 3FB5C 2RJZA 5FPRA 3DXRA 2VWKA 4MVMA 1MA1A 1YSCA 4GKJB 2XASA 2DOSA 4AILC 1ZL8A 4WFHA 1GN3A 1BHAA 4RQFA 3HKDB 4RAIA 1NVPD 2F23A 1H8EG 1B04A 2R70A 2BTOA 4H0LB 4JASA 1XNRO 3JD0A 2PYLA 1E1RG 2BTQB 1BHBA 2B1GA 3OMNB 4I5SA 4UCOA 3TGUH 4C7UA 1S3JA 3T1CA 5KAIZ 2QM8A 2Z0AA 4IGGA 3JD3A 4IHJA 3H9VA 1WP7A 4DUZB 4I55B 1VP7A 3JATA 1BL8A 4LC1A 4FZ1A 5C8YB 5A9GA 2VQEB 1RSOA 2Z3YA 3CJHA 5FL7G 1N32O 1K4DC 2DMXA 2WLJA 4D7TA 1Q90D 4FFBB 2Y4TA 3MAQA 3OGCC 1IXMA 4XDKA 2B9ZA 2ZINA 1Q6HA 3JAWA 2XAFA 1H2SB 1QR9A 1BMFG 5F2VO 5IYBO 4KFMA 1H2MA 1LNQA 2AZ2A 4AQYB 1H2LA 3KCYA 4QGPA 1YHQV 2QWNB 4FZ0A 2YDEA 1D2DA 2XAGA 1AI4A 2OYQA 3ZN1A 4GYCB 4LFAO 2OWOA 4MW3A 3ZEDA 4PV1B 4TQDA 3JALA 4R7CA 5IYCO 3K5MA 3RYFB 2H8PC 2WLLB 3E2EA 4IIJA 5B3SB 3B4SA 1FXVA 4HNAA 4L8JA 2YEVB 1QLNA 3ZS8C 1VQMV 4NR1A 1AR1B 1GN2A 2Q0AA 4JTCB 1VQ9V 1RM1C 1JJ2U 5JVDB 4DR6O 4TUYB 4DV1B 3JASB 1DF4A 5K1XA 2GSMB 1XILA 2UXBO 2M7WA 2CDYA 5GW7A 3R65A 4JI5B 3HKCA 4KXRA 3CPWU 1T5EA 1US6A 4E4EA 1V54B 3X2QC 3M8AA 4LF8B 2P90A 4DRXB 3ZRSA 1HR0B 3VQWA 3ABMB 3RVYA 2XOKG 3ZRXA 2YXLA 1JFFB 3MDSA 2IBZH 4QE9A 4PA4A 4PA7A 4JI3B 3QO5A 3W7SA 4DV0O 2Q8VA 1I94O 2JEXA 2N05A 1SS3A 3ZMVA 1JVMA 1I0HA 2JGDA 5LL6Y 5IWAB 4EEQA 2E3CA 4JYYA 2UUAB 3CS5A 1QQCA 4G28B 2KG7B 4DR7B 4PDRA 3ZHVA 5IY5C 3B77A 4OGQB 3T1HB 1KC8W 1NI8A 3UO3A 2ZE5A 1K92A 2PI4A 2V1DA 1BE3H 1FPOA 3CSXA 1SZTA 3E22B 3EVKA 3HR0A 4YHHB 1WJZA 3ZHQA 5DM6V 4DR1O 3HKEA 2P4VA 4JAAA 1N34O 3K0DA 3SYQA 2HJDA 1KKCA 4Q20A 3K06A 4DO2A 2P22C 4P9OA 1VQ4V 2EILB 1YIJV 2ZXWC 4MSWC 4FPPA 5LMNB 2YS8A 5JH7B 2EIKB 1U96A 2Q7HA 4MS2A 1TUBA 4FIPC 4GKKB 3OTOB 1OCCB 1SQXH 3MD0A 3VQVA 2NN4A 2HLDG 1Y66A 1NU1H 1RP3B 3AG1B 2GHYA 5LXTA 2H3OA 2ETNA 5LP6B 5B66Z 5B1AC 3IGAC 1FFXB 4FFKA 2ADPA 2DYRB 2EIMB 5H6RA 2IH1C 4NTYA 1PL4A 4BIZA 1Q7YW 1WA8B 5KMGA 5HFMA 4UCRA 1OZ0A 4J9YB 4TV8B 1FXKC 2UXDO 2RQ6A 1HP8A 4J9ZB 5IDJA 1A32A 4FM0A 2QWOB 3ASNB 4B7EA 2YSUB 3P3NA 5L3EA 3EXAA 2EINC 2PGGA 4PI0A 1Q6UA 4JPRA 4JZ2A 4EKWA 3JD2A 5KX5A 3W7XA 2QEXV 1SZXA 1OV9A 5K1PA 3ABUA 5CBHA 3H1KH 1I5YA 1JA8A 4U3JB 5E79Z 1WPXA 1J5EO 5DN6G 2DN9A 4DUZO 4DK0A 2JEUA 1SQVH 4WBNB 1Y4MA 3GWKC 4GX0A 3VQYA 2EIJB 2VQEO 1WLEA 4FLTA 2IJHA 2DWEC 4K35A 4Z1MG 3HKBA 5KHGA 3K03A 2XHBA 1QVGU 3SPIA 1N33B 2F4VO 1OJHA 2CTRA 1AJQA 5H6QA 2V4DA 4U7NA 1YDXA 1EN4A 1GTOA 3ZJZA 4AQYO 5B1BB 4UVCA 4CC5A 3ML0A 2YICA 3QO8A 4RUFA 2NR5A 3T1YO 4DV7B 1WNSA 1SETA 1Q3EA 2ZNJA 2W0FC 1AR5A 3ZMSA 1X4TA 4PA6A 3G80A 1AI7A 2IJKA 2PZSA 5CA0A 3CEIA 2ZCEA 3UT5B 2EJ7A 1THZA 2AXTZ 2M6YA 1WB8A 3P32A 4YY3B 3CRRA 4NTXA 4O4IA 4X1YB 2DQ3A 2Q6AA 2WLIA 3OAAG 3K04A 4I9WA 3SYOA 4DV1O 3H1LH 3AG4B 1M57C 5J2TB 3OMAB 1S72V 4I0XA 3I55V 5BMVA 5LGUA 3W7WA 4JTDB 5KAFZ 4JI5O 2ARHA 3UKMA 4XBFA 3C90A 2CGOA 2UUBB 3ETGA 1NQTA 3UQ8A 3WFVA 5IYZB 1XBLA 4BR6A 5IJ9A 1HR0O 1Y74A 5GTIZ 1SQQH 3CB2A 3ASOB 4AI8A 4RUEA 3D3QA 3SYPA 1HW7A 1IDSA 4JI3O 2R72A 2IJIA 4I4TA 3L70H 1LUWA 5E1AC 5JWPA 3FAVB 1K9MW 2HKOA 4J7KA 4JYAB 4LH6A 4MTGA 4JAUA 5IWAO 4LF6B 4LWSA 4WFGA 4B3RB 2LFSA 2UUAO 4DR7O 4LF9B 4FLUA 4RWUA 3OT7A 3JARA 1ROPA 4W4KA 1M93A 2JJ1G 1D5NA 1NBMG 3TXQA 1G4YB 5CBFA 4UV9A 4DR2B 1CEZA 1EZVH 5FNVA 1OCZC 2CTQA 1OCOB 1KYOF 4PI2A 4YXWG 4YHHO 2ZE8A 1L0NH 4ZOLB 2B1IA 1KKDA 3L71H 4LP8A 4O4JB 3BFRA 3UCSC 1VQ5V 4MVOA 1JCHA 1GK9A 2A0LA 5LMNO 4DV5B 2W0XA 4FM1A 2O57A 2DQ0A 1XL4A 1I08A 5KHKA 2WA4A 4GKKO 3OTOO 1JOYA 4W4LA 4YJ2B 3OUFA 4QPKA 4CC6A 3G4SV 3RVZA 5EBWC 3O65A 2BOCC 3WU2Z 3CD6V 3K08A 1VF5B 4BIUA 1VQLV 4LF5B 2QWPB 2EX3A 1N4CA 5GTHZ 4UCSA 2DYSC 3E8FA 4NTWA 2ZR3A 2VRZA 2OCCC 1WAZA 5A2QN 4LNUA 5LYJA 3OEHG 3CCLV 2OIEA 2MK3A 4O2BA 2WLNA 4EB6B 4IYHA 3SJCC 5CA1B 4O4HB 2IM9A 3AG3C 2VS0A 3KKYA 1HNXB 4CS4A 3AG2C 2UXNA 1PNKA 3RW0A 4YJ3B 1COWG 3ETQA 4GT1A 5EC2C 3RYIA 4GCZA 2K9PA 3FD9A 4I50A 5EYPB 1DLBA 3N2GA 5BY1A 3ZHUA 2P06A 1Y76B 1IBMB 5JJJB 1IURA 1K7DA 4PA3A 3OW2U 4ZHQA 1V54C 1GKFA 5IE9A 4FLWA 1XDCA 2ZM6B 1QLEB 4X20B 4N23A 3SYCA 4F6RB 3JYCA 4PJ0Z 4TSFG 1N33O 2YXHA 3CX5F 1BZKA 1L0LH 3MHHC 4QPJA 3RYCB 4YIOA 1F7YA 3SPCA 5L3FA 3K3WA 4LCUC 1GN4A 2EJRA 3BA9A 1IX9A 4DV7O 4L87A 4DR5B 1GM9A 3TCUA 1I5XA 2UUCB 4JI4O 2DW4A 4JI7B 2Q5ZA 4KUMA 4DV3B 1VF6C 5J2UB 3CC7V 4RQEA 3L73H 2PI5A 1SA0B 4F6EA 2ADQB 3K0GA 1F23A 4DV2B 1ORQC 4YY3O 1VQNV 1ZUQA 1ZX3A 1YXBA 5TISZ 5LHIA 2GDSA 3D36A 4JYBA 4HAMA 4P30A 3FB8C 5IJ0B 3ZRWB 3RFRA 1K73W 1XMOO 3RYHA 1R3IC 5KLVH 4JF3A 5D5PA 2EIKC 4J80A 1MSDA 4K0KB 2CK3G 4MVUA 5KUKA 2LP7A 4FVMA 4DUYB 1B6QA 3N2KB 3AG1C 4GLXA 4ASUG 1GH6A 5LP6C 3BAAA 3L74H 2LQTA 2UUBO 1SF9A 1MZEA 4O2AB 2GUZB 2H94A 1MABG 2Y69B 1NTZH 2EIMC 4TV9A 1AROP 1ZTEA 1VF7A 4X1IA 2WWWA 4X62B 2YI8A 1KMIZ 5L3BA 3M99B 4E2LA 3CCMV 4X65B 3K9AA 2Q67A 4DK1A 4WFBV 4WF9V 4K8XA 3B2EE 2YUAA 2B5UA 2A79B 3DXRB 1XHXA 1RPRA 2FB5A 3OEEG 2F1MA 3STLC 1MSWD 1SQFA 2PUSA 2OCHA 3MHSC 3CRMA 3BVOA 1VF6A 1ZL8B 1HNWB 3ASNC 5KA5A 1FXHA 4MVZA 1Q86W 3STZC 3RT3C 3F7YC 1FD9A 4LF9O 1VQOV 1IBKB 2JS5A 3E83A 5EZYA 1AJPA 1EFRG 2XT9A 1L1FA 3QO7A 5CBGA 3SJBC 2YIAA 4QE7A 1B06A 4GX5A 2IU0A 1BT8A 1JMKC 2JJ2G 5LA6A 1K3EA 4IHJB 1UPGA 4DV5O 1IVSA 2JRIA 1R6KA 3ZIAG 2KB1A 4B7KA 5GONA 1NZ6A 2G38A 3K5OA 3JATB 5CB4A 3KZIZ 2P67A 1RSOB 1N8RW 3OTFA 5B1OA 4KL1A 2HVKC 5B1BC 2QKSA 3APQA 4BW5A 2WSSG 4ZBMA 2ZDIC 2YIBA 3JD1A 4ICGA 3JAWB 4LF5O 1EM1A 3W7TA 4PDVA 2F93B 3T2MA 1K97A 4DV4B 5CN0A 1W59A 3TJTA 2QWRB 5JQGA 3CP1A 1KP2A 4B3MO 2GBOA 4I9QA 1MMMA 1JX9A 3DSQA 4X64B 3JALB 3CCQV 1WPBA 4MW8A 1HNXO 4JV5B 2QE7G 5D5QA 4IIJB 1QNMA 4I7ZB 5LBQA 1P84F 4HNAB 4J7JA 2XAJA 1KQSU 4TT3G 1JR9A 4X9QA 2F95B 1SERA 1IBMO 3C3SA 1R6NA 1V55B 1VEWA 1QBZA 1FJGB 3A0BZ 3ZCCA 4CH6A 2JVDA 2LJ2A 4OXSA 5EBLC 4UCVA 2X6AA 2BSKA 2ZM6O 2QJ1A 3CCRV 3F5WC 4MVRA 2ZE6A 1S77D 2Q7GA 4GKJO 1FAFA 1NTKH 2WA3A 3HKCB 3ASOC 3K5NA 3PN1A 5AG2A 2ITDC 1KBHA 2HFEC 3G6BA 3QTCA 1W0KG 4PDMA 4JI6B 4PA9A 4X1KA 3K58A 3GVMA 2UXXA 4NVPA 1H38A 1Y6XA 3LNMB 4DR5O 2UUCO 5B5EZ 1AR4A 1GAXA 2QTOA 4DV3O 3JSLA 2QA4V 1LUVA 1M1KW 2JGDB 5BR8B 2WLHA 2QGNA 5C93A 1IBLB 1SQBH 1YJNV 1OCOC 2FMLA 4DV2O 3EHBB 4IT5A 2CAZC 2PY5A 1FFTB 3LNNA 4CZZA 1NTMH 2LGQA 3CXCU 3ZX6A 1RM1B 4B3TB 3LDEA 3CE2A 2WAMA 4FLXA 3HKEB 4K0KO 4DUYO 3ZHRA 3LDCA 1YCIA 1P7BA 5ITZA 5BXZA 3CRCA 3TK1A 1TUBB 3X2QB 1FXKA 5DECA 3JAMN 4X62O 4EFBA 1Y67A 5LXTB 2YI9A 3CCEV 1CPYA 3Q4HA 1MOFA 1XEQA 1I7FA 5CMUA 3OR7C 2QSAA 1IZ3A 5H9CA 2RDCA 1P49A 4CS3A 4DW0A 1M4UA 1HNWO 5KMGB 3JCUZ 2R9IA 2Q9LA 3ABKC 1H2KA 4UV8A 2P5OA 1IBKO 3T4DA 3OR6C 1AB3A 1JJOA 1PNMA 3DC5A 3W7UA 2WLKA 3WG7C 1ZLZA 2ZE7A 2QTSA 1TVKA 3JAKA 2FKXA 5KX5B 2HHHB 1X59A 1R3KC 5JJNB 3QG5A 1RFYA 4JI2B 2CH7A 4BIOA 4ABMA 2P4KA 4UCUA 2OIGA 2ZXWB 4LF8O 4DR3B 2HEPA 1AVMA 4ZI7A 1YTFB 3TETA 2D2CB 3A2FA 1OCRB 2K1EA 2E5LB 3AK1A 1YITV 4WFEA 2P6JA 2PYJA 5LMUB 1Q6IA 3HKBB 3H1JH 1L8DA 1WB7A 3H1IH 4HYOA 3AEIA 4QNHB 1BQ0A 3OD4A 5EC1C 1W0JG 4NKGB 3EFFK 4IL6Z 4GUNA 4MTOA 3B09A 4LFAB 4P2ZA 1YVWA 1YJ9V 4Z1VA 4J11A 3T1HO 3QNEA 4DV4O 1PKXA 4HBNA 2WPDG 4X64O 1PD3A 2KSDA 2JK5C 1KB9F 5IYDO 4FM2A 4CH5A 1TGOA 3ZHTA 4DR4B 2A7WA 4JV5O 2NLJC 2WLMA 2EINB 1XHZA 5LOVA 2ZNIA 1EZJA
chains in the Genus database with same CATH topology
4RQEA 2JEXA 4PELA 3B8NA 2PI5A 4WFAV 3ZMVA 1GM8A 3LUTB 1JVMA 2HR3A 4N21A 3K0GA 3SJQC 1NVPB 1F23A 3CCSV 3BEHA 1PL0A 3VBBA 3I56V 3SPHA 1ORQC 4G28B 3KG2A 1VQNV 3IFXA 4PDRA 5IY5C 3B77A 5LHIA 2WLIB 3D36A 4JYBA 1KC8W 2W6IG 4HAMA 4P30A 3FB8C 2AHYA 5KUMA 2EBOA 3ZRWB 3ABLC 1K73W 1SESA 1K92A 1R3IC 2Y69C 1R3JC 2PI4A 2V1DA 1EBOA 1KECA 4JF3A 2EIKC 1SZTA 1K33A 4R6ZA 1VQ7V 2CK3G 4H33A 4MVUA 4G2KA 4LBEC 1GM7A 5KUKA 2XNDG 2LP7A 5DM6V 3T4ZA 1B6QA 3SYAA 3PJSK 3AG1C 4RO2A 5CA3A 2X6CA 4ASUG 5IY5B 3K0DA 3SYQA 4Q20A 3K06A 4DO2A 2AHZA 4P9OA 2X7RB 2EILB 1VQ4V 1YIJV 3ABLB 5B3SC 2ZXWC 3CCJV 2H94A 1MABG 2Y69B 3OMIB 4FPPA 4MSWC 2EIMC 1AI6A 4WCEV 1AROP 2EIKB 4MS2A 2WWWA 2IJJA 4FIPC 1OCCB 3MD0A 5L3BA 3M99B 4E2LA 3CCMV 3K9AA 2Q67A 4WFBV 4WF9V 2HLDG 1Y66A 2B5UA 3AG1B 2A79B 1VQKV 2GHYA 1MG1A 1RPRA 3OEEG 3STLC 1MSWD 4HZ3A 5B1AC 1KD1W 3ABTA 5EBMC 2Q68A 3IGAC 1OHHG 1QLEC 3MHSC 2DYRB 3FKSG 1YJWV 2EIMB 5H6RA 2IH1C 1DF5A 3ASNC 5KA5A 1FXHA 4MVZA 4R8CA 4BIZA 5B1NA 1Q86W 1Q7YW 3STZC 2ZR2A 3F7YC 4UXNA 5HFMA 1UJWB 2BOBC 1OZ0A 1VQOV 2P7TC 4J9YB 3E83A 1FXKC 1AJPA 1F4MA 3CCUV 4J9ZB 1EFRG 4X88A 5B1AB 1L1FA 5IDJA 3QO7A 5CBGA 4P9PA 1CP9A 2D3OW 4CBCA 3ABMC 1AI5A 1M57B 1Q82W 2HG5C 2HJFC 3ASNB 3CCVV 1VQ6V 2YSUB 4QE7A 4GX5A 2IU0A 5L3EA 2EINC 2LFRA 1W2BU 4JPRA 1K8AW 4EKWA 1S5HC 3GWOA 4FJCC 5LHHA 3JD2A 1FXKB 2JJ2G 3W7XA 2QEXV 1K3EA 3E8HA 1AJNA 1PNLA 5L3GA 3ABUA 2WLLA 5CBHA 1NH2B 1R6KA 2Y48A 3ZIAG 2KB1A 1J95A 1I5YA 2XAQA 1WPXA 3K79A 2XAHA 4X89A 2YEVA 3ETEA 5DN6G 2JEUA 2P67A 3CYOA 3NXSA 5EK0A 1N8RW 5LGNA 1Y4MA 4GX0A 5B1OA 4JGSA 1KP3A 2EIJB 1RPOA 1H8HG 3E8GA 1WLEA 2IJHA 2A9HA 2HVKC 2OTJV 2DWEC 5B1BC 2QKSA 4BW5A 1S76D 1JPXA 2Q69A 4Z1MG 2WSSG 4ZBMA 2ZDIC 3JD1A 4KP4A 3RBZA 3K03A 4X8AA 1QVGU 3SPIA 3LSSA 2C2AA 3W7TA 4PDVA 4XDJA 1SRYA 3T2MA 1AJQA 5H6QA 1K97A 1M56C 4U7NA 4DXWA 2X6BA 2EILC 5CN0A 3UM7A 3D3IA 2JDIG 5KA6A 1GTOA 3ZJZA 3CP1A 1KP2A 5B1BB 4UVCA 1JX9A 1HWYA 3ML0A 3QO8A 4RUFA 2DWDC 1OCCC 3JD4A 1OCZB 1V55C 3ZMUA 1TUEB 4FK5C 1SETA 4MW8A 1K5SA 4GX2A 3CCQV 2QE7G 2W0FC 1M56B 3CMAV 3FYEB 2NNUA 3ZMSA 5LBQA 2HVJC 3DGEA 4PA6A 1AI7A 1XL6A 1VQPV 2IJKA 2DYRC 4JYCA 2XAJA 1KQSU 4TT3G 2QM7A 4GX1A 1M9NA 1THZA 4UUJC 4MTXA 3OFNG 3P32A 1SERA 4R50A 1R6NA 1V55B 4UVBA 2Z5UA 1QBZA 2DQ3A 3ZCCA 2Q6AA 1FS0G 2WLIA 2EZPA 3OAAG 3K04A 4I9WA 4OXSA 5EBLC 5L3DA 3SYOA 3CMEV 3ZRWA 5L3CA 2V7QG 1YTFD 2X6AA 3AG4B 1JQ0A 1M57C 4ZKIA 3CCRV 1E79G 3F5WC 4MVRA 1S77D 4FMTA 1G8MA 3OMAB 1F4NA 1S72V 1NR1A 2R9RB 3I55V 3ASOC 2F43G 5LGUA 3OM3B 3W7WA 4JTDB 2ITDC 2X0LA 3ABKB 3SPJA 2DYSB 2HFEC 4XBFA 3UKMA 4TWKA 1GO3F 1ZWIC 3BY6A 2OCCB 3ETGA 3FYIB 1NQTA 1W0KG 3ZN0A 4PDMA 3WFVA 4PA9A 1NJIW 3WG7B 1R73A 2UXXA 1H38A 3JCZA 3LNMB 3AG3B 3ASOB 2W6JG 1ENVA 1K34A 2EIJC 4RUEA 3SYPA 3E8BA 2QTOA 2QA4V 5BZBA 2IJIA 3AG2B 1P4RA 3P30A 5E1AC 5J9PC 1Q81W 1M1KW 2OTLV 3FB5C 2WLHA 3ZMTA 1K9MW 2HKOA 5C93A 4MVMA 1YJNV 4MTGA 1OCOC 4JAUA 5LHGA 1YSCA 1DTOA 1M90W 2XASA 3IC7A 3EHBB 4WFGA 1FFTB 2LFSA 4WFHA 1BHAA 1ROPA 4CZZA 2JJ1G 1NBMG 2ITCC 1G4YB 4RQFA 2ZQMA 5CBFA 3CXCU 2ZD9A 4RAIA 4UV9A 4MTFA 1RM1B 1NVPD 1CEZA 3LDEA 1NKDA 2OT5A 2IU3A 2JIZG 1H8EG 2WAMA 1OCZC 4JASA 1OCOB 4YXWG 3B8MA 5HFLA 4PDLA 1QVFU 1VQ8V 3G6EV 2B1IA 1KKDA 3JD0A 1E1RG 4LP8A 1BHBA 2B1GA 3LDCA 3OMNB 4I5SA 1P7BA 1VQ5V 3ZRVA 4MVOA 1JCHA 1S3JA 1GK9A 3SPGA 3T1CA 1H2GA 2A0LA 3TK1A 3DTUB 3X2QB 1FXKA 3OE7G 2QM8A 3FB7C 3JD3A 2DQ0A 4WFFA 1XL4A 3ETDA 1QCEA 4UVAA 1JOYA 3HB3B 3OUFA 4QPKA 3E35A 3CCEV 1BL8A 1CPYA 4LC1A 3G4SV 3RVZA 1MOFA 2Z3YA 3LSQA 5FL7G 1R3LC 2IW5A 5CMUA 1F51A 1K4DC 3OR7C 5EBWC 2WLJA 3AG4C 2BOCC 3CD6V 3E89A 5H9CA 3OGCC 1IXMA 3E86A 3K08A 2EZOA 4XDKA 4BIUA 1VQLV 3H01A 2R9IA 4QIWF 2XAFA 3ABKC 1QR9A 4UV8A 1BMFG 2DYSC 3E8FA 4H37A 4KFMA 2ZR3A 5IYBO 3T4DA 1LNQA 3VOUA 2OCCC 3OR6C 3G71V 3OEHG 1PNMA 4MT8A 3CCLV 2MK3A 1YHQV 1K5QA 3W7UA 2WLKA 4XDLA 3WG7C 2WLNA 5LGTA 2XAGA 1NR7A 1AI4A 1OCRC 2ZDIA 3AG3C 3ZN1A 2FTKA 4MW3A 1R3KC 4R7CA 5IYCO 3AG2C 4JAVA 3OUSA 2UXNA 1PNKA 2H8PC 3RW0A 2WLLB 3E2EA 1COWG 5B3SB 2ZXWB 4GT1A 5EC2C 4GCZA 3GB7C 1DLBA 1FXVA 1QR8A 2YEVB 1QLNA 3CC2V 4G27B 1VQMV 4F4LA 1YTFB 3TETA 1AR1B 1K4CC 1K7DA 4PA3A 1OCRB 2K1EA 3OW2U 4BAYA 4JTCB 1VQ9V 1YITV 4WFEA 2P6JA 2ATKC 1V54C 1RM1C 1JJ2U 3LDDA 4HYOA 1NH2D 1GKFA 3AEIA 3FB6C 4QNHB 5EC1C 1W0JG 1DF4A 3EFFK 1QLEB 4N23A 3SYCA 2GSMB 1E1QG 3JYCA 4JTAB 4TSFG 4MTOA 3A0RA 1S0VA 2M7WA 4U7OA 4P2ZA 5GW7A 4QJFB 3R65A 1YJ9V 3CC4V 3MHHC 4QPJA 3F7VC 1YI2V 3QNEA 3CPWU 1PKXA 1V54B 3SPCA 3X2QC 5L3FA 3K3WA 4LCUC 3HPLC 2EJRA 2P90A 2WPDG 3ZRSA 4MVQA 1PD3A 3ABMB 2JK5C 3RVYA 4L87A 2XOKG 3ZRXA 1GM9A 5IYDO 3TCUA 4QE9A 1I5XA 4PA4A 4PA7A 4MVSA 2DW4A 2NLJC 2WLMA 2EINB 3QO5A 4KUMA 1GMGA 3W7SA 2IH3C 1EZJA 3ZMZA 3CC7V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKD A;  1PD3 A;  2IJJ A;  2IJH A;  3K79 A;  1RPO A;  1ROP A;  1B6Q A;  1F4M A;  1GTO A;  1GMG A;  2GHY A;  1RPR A;  2IJK A;  4DO2 A;  2IJI A;  1F4N A; 
#chains in the Genus database with same CATH topology
 5CA0 B;  2UU9 B;  4ZIB A;  1XUQ A;  2RCV A;  4N21 A;  1N0N A;  3SJQ C;  1XRE A;  4O4I B;  3BCC H;  3UO2 A;  1BS3 A;  1PL0 A;  1CXZ B;  3SPH A;  3KG2 A;  3IFX A;  2WLI B;  4U3F H;  2W6I G;  2AHY A;  5KHI A;  1GN6 A;  2DJV A;  1FJG O;  1SES A;  2Y69 C;  1EBO A;  4X66 B;  4LR3 A;  3HKD A;  4I0X B;  4LFB B;  5BMV B;  3AK3 A;  1K33 A;  4R6Z A;  1VQ7 V;  4G2K A;  1M5I A;  1NS1 A;  2XND G;  3T4Z A;  3SYA A;  3PJS K;  4RO2 A;  4B3S B;  3WB0 A;  4NB5 A;  3P3P A;  2BTQ A;  1I94 B;  2AHZ A;  2X7R B;  3ABL B;  5B3S C;  3CCJ V;  3OMI B;  5IJ9 B;  1Y74 B;  1Z5W A;  4JI6 O;  4D7S A;  4WCE V;  1XNQ B;  4IYI A;  1WN7 A;  2IJJ A;  4UB6 Z;  4NXM B;  4UFZ A;  2FL4 A;  4I4T B;  4OPH A;  3M7M X;  4I55 A;  1SKV A;  1KD1 W;  5BR8 O;  3ABT A;  3O9O A;  5C8Y A;  3J81 N;  1OHH G;  4LWS B;  3CXH F;  2ZKO A;  2Q0O C;  3FKS G;  1XMQ B;  3AG7 A;  4FFB A;  5B1N A;  3JAR B;  1KU9 A;  2XUM A;  2ZR2 A;  4DR1 B;  2PTM A;  1N34 B;  2BOB C;  3IJ4 A;  1F4M A;  5FNV B;  4B3T O;  4X88 A;  2CE4 A;  2ODM A;  4DV6 B;  2D3O W;  3ABM C;  1AI5 A;  1M57 B;  2AW9 A;  2HG5 C;  2HJF C;  1PV0 A;  4FLZ A;  3CCV V;  1VQ6 V;  4O4L B;  2PF4 E;  3WB2 A;  1DGS A;  1O9G A;  1S5H C;  2XTA A;  3GWO A;  4FJC C;  3G67 A;  3E8H A;  1AJN A;  1D5A A;  3J7A U;  3BPZ A;  3RYF A;  2WLL A;  1NH2 B;  2Y48 A;  1LR1 A;  1J95 A;  2XAQ A;  3K79 A;  4X89 A;  2YEV A;  4FLY A;  5EK0 A;  4CS2 A;  3S3X A;  2UXD B;  2A9H A;  2OTJ V;  2Q69 A;  3RBZ A;  4KP4 A;  5JVD A;  3L72 H;  1QHT A;  4YIP A;  4X8A A;  1UFI A;  4TUY A;  3JAS A;  3LSS A;  1HNZ B;  2LO1 A;  2C2A A;  1V9P A;  4XDJ A;  4LNU B;  2UXC B;  5LYJ B;  4JI8 B;  2QDO A;  2X6B A;  2EIL C;  4O2B B;  3D3I A;  2JDI G;  4A5U B;  1N0J A;  1Q5O A;  1HWY A;  2DWD C;  1OCC C;  2E75 B;  3JD4 A;  1OCZ B;  3SDL A;  1J5E B;  5JCO C;  4DRX A;  1V55 C;  1TUE B;  4H44 B;  3SJA C;  4FK5 C;  2HP8 A;  1K5S A;  4GX2 A;  2HHH O;  3TXS A;  4J7Z A;  1JFF A;  1M56 B;  3CMA V;  3NR7 A;  1VAR A;  3FYE B;  3RYI B;  1ZSP A;  4JI2 O;  4I50 B;  3DGE A;  2GTS A;  3CRQ A;  3N2G B;  1FKA O;  2CGN A;  2DYR C;  4JYC A;  3L75 H;  1YZB A;  1S5L Z;  4DR3 O;  2F4V B;  4ZHQ B;  4R50 A;  2CUG A;  4UVB A;  2E5L O;  2Z5U A;  2KG7 A;  3QF7 A;  1FS0 G;  5LMU O;  2EZP A;  5L3D A;  3CME V;  1TAE A;  2V7Q G;  1YTF D;  4JYA O;  1JQ0 A;  1E79 G;  4LF6 O;  4FMT A;  1G8M A;  4LF7 B;  4K8Z A;  1F4N A;  1MNG A;  3T1Y B;  3SR2 C;  1NR1 A;  2R9R B;  3E22 A;  4B3R O;  2VQF B;  3OM3 B;  3SPJ A;  2DYS B;  1WP8 A;  3BY6 A;  2OCC B;  4DR2 O;  3ZN0 A;  1NJI W;  3THO A;  3JCZ A;  5JH7 A;  2Q4P A;  5EIB D;  2YXY A;  3AG3 B;  3QVN A;  2Q7E A;  1ENV A;  1DK1 A;  2YID A;  4DR4 O;  2EIJ C;  2N04 A;  3E8B A;  5JCO A;  3AG2 B;  1P4R A;  5J9P C;  1Q81 W;  4D6T H;  2UU9 O;  3ZMT A;  5LP6 A;  1BGY H;  5LHG A;  2A06 H;  1FFX A;  1DTO A;  3A0H Z;  1M90 W;  4KHP B;  2GTA A;  3J80 N;  3IC7 A;  3IC9 A;  3CJH B;  1U97 A;  3RYH B;  1AP6 A;  1WA8 A;  2ITC C;  3ZHS A;  1VIB A;  1BQZ A;  2ZQM A;  4UB8 Z;  1EN5 A;  1URF A;  2ZD9 A;  1BSM A;  4MTF A;  2Y0P A;  4TV8 A;  2BCC H;  4X66 O;  1NKD A;  3H1H H;  2OT5 A;  2IU3 A;  2JIZ G;  4NXN B;  4LFB O;  2ZIM A;  3B8M A;  1Z5V A;  4PDL A;  5HFL A;  4PD4 F;  1QVF U;  1VQ8 V;  3G6E V;  2ZIO A;  4DYL A;  4B3S O;  3KCX A;  3L9D A;  4TV9 B;  3R66 A;  3ZRV A;  3SPG A;  4X1I B;  1H2G A;  2E76 B;  1XOU A;  3DTU B;  3K9S A;  3OE7 G;  4BW9 A;  1XNQ O;  3FB7 C;  4WFF A;  4NXM O;  2CTW A;  3ETD A;  1QCE A;  4UVA A;  1Q43 A;  3HB3 B;  4U3J A;  2AZ0 A;  3E35 A;  1YF2 A;  3LSQ A;  1R3L C;  2IW5 A;  4WBN A;  2Q73 A;  1F51 A;  2RNB A;  3AG4 C;  3E89 A;  3C3T A;  3E86 A;  2EZO A;  1XMQ O;  3H01 A;  2ZT9 B;  4QIW F;  5EZY B;  2AGA A;  4H37 A;  3BAB A;  2KKW A;  1QU7 A;  3VOU A;  3G71 V;  4MT8 A;  3I5D A;  3RWR D;  1K5Q A;  1MZF A;  4XDL A;  1R6T A;  4DV6 O;  5LGT A;  5FLX N;  1NR7 A;  1OCR C;  2R9A A;  2ZDI A;  4JI1 B;  2FTK A;  1BCC H;  5LA6 B;  4JAV A;  2DE0 X;  3OUS A;  1SC5 B;  3K59 A;  5GON B;  3GB7 C;  1QR8 A;  5CB4 B;  3CC2 V;  4G27 B;  4F4L A;  1K4C C;  3RGB A;  3UT5 A;  4BAY A;  5EIB C;  4JI7 O;  2ATK C;  1N36 B;  1SQG A;  4X1Y A;  3LDD A;  1NH2 D;  3FB6 C;  1E1Q G;  1HNZ O;  4JTA B;  3AK2 A;  4PHZ A;  3A0R A;  1S0V A;  4U7O A;  4QJF B;  5J2T A;  4LF4 B;  2KQX A;  3ZBH A;  4J42 A;  3CC4 V;  4OX9 B;  2UXC O;  4LFC B;  3F7V C;  4JI8 O;  1YI2 V;  5JQG B;  1FYJ A;  4JZG A;  5H5N A;  1H2N A;  1PPJ H;  3BRC A;  3CHX A;  3HPL C;  4BWA A;  2GV9 A;  1GRJ A;  4MVQ A;  4J41 A;  4EFE A;  4JI0 B;  1EN6 A;  5IYZ A;  3D8C A;  4MVS A;  1GMG A;  2IH3 C;  3VQX A;  3ZMZ A;  2VWJ A;  4PEL A;  3B8N A;  4WFA V;  1GM8 A;  3LUT B;  2Y4U A;  2HR3 A;  3FAV A;  2QR4 A;  2BE3 A;  2ILM A;  1NVP B;  3CCS V;  3S3W A;  3BEH A;  3I56 V;  3VBB A;  4X65 O;  3BA8 A;  2FYU H;  4LH7 A;  5KUM A;  1YEW A;  2EBO A;  3U10 A;  3ABL C;  2LW7 A;  2BSK B;  3ICX A;  1R3J C;  1NT2 B;  1KEC A;  2Y0I A;  2QM4 A;  2JS3 A;  4H33 A;  4LF7 O;  4LBE C;  1GM7 A;  1XNR B;  2VQF O;  1Z2G A;  5CA3 A;  2X6C A;  4JI4 B;  5IY5 B;  4ZOL A;  4O4J A;  4X1K B;  2YC0 A;  3OGI B;  4OPA A;  2QKC A;  1AI6 A;  2JGU A;  1S5J A;  4AHC A;  2A3Q A;  3N27 A;  1VQK V;  1MG1 A;  3IAY A;  1XMO B;  5KHH A;  4YJ2 A;  1N32 B;  1XQ8 A;  2L35 A;  4HZ3 A;  5EBM C;  2Q68 A;  1B3Q A;  1QLE C;  3F5T A;  1YJW V;  1DF5 A;  4R8C A;  4KHP O;  5KHJ A;  1AP5 A;  3BHP A;  5DED A;  3A8T A;  4UXN A;  1PP9 H;  1UJW B;  2P7T C;  4DW1 A;  3LSU A;  3WB1 A;  4NYK A;  3CCU V;  1P7G A;  5B1A B;  4NXN O;  4P9P A;  1CP9 A;  4CBC A;  1Q82 W;  4EB6 A;  3K57 A;  4CH4 A;  4UCT A;  5CA1 A;  4O4H A;  2LFR A;  1W2B U;  3FFQ A;  4B08 A;  5ITZ B;  1K8A W;  5LHH A;  2LGW A;  1FXK B;  1PNL A;  5L3G A;  3RN4 A;  4YJ3 A;  3DC6 A;  3JSN A;  5H2F Z;  5EYP A;  3CRA A;  2XAH A;  3ETE A;  1O9H A;  3Q4H B;  4FLV A;  3CYO A;  3NXS A;  2EUL A;  1Y76 A;  3SGI A;  5LGN A;  4Z2W A;  4GZR B;  4JGS A;  1KP3 A;  3E8G A;  1RPO A;  1H8H G;  4DR6 B;  1S76 D;  4Q6G A;  1JPX A;  3U0Z A;  1HDJ A;  2QKA A;  1G6U A;  1VMG A;  2UXB B;  4X20 A;  4F6R A;  1SRY A;  2RN9 A;  1M56 C;  4O4L A;  1ZAU A;  4DXW A;  3UM7 A;  5IT9 N;  5KA6 A;  1SQP H;  3RYC A;  1AIL A;  2E74 B;  1TVK B;  3JAK B;  2MW2 B;  1Q8I A;  3B40 A;  3ZMU A;  4JI1 O;  1TA8 A;  1XI1 A;  2CH7 B;  4DV0 B;  2NNU A;  2HVJ C;  4H13 B;  2LW1 A;  1XL6 A;  2F66 C;  1VQP V;  4TOI A;  5J2U A;  4ZI7 B;  2CTP A;  2QM7 A;  1SA0 A;  1M9N A;  4GX1 A;  4UUJ C;  1G1X B;  4MTX A;  3OFN G;  4TQF A;  3FX7 A;  3K5L A;  1KUQ A;  1N36 O;  3APO A;  5IJ0 A;  1IXB A;  5FPO A;  3ZRW A;  4B3M B;  5L3C A;  1IBL O;  2RMK B;  4ZKI A;  3U11 A;  2N74 A;  4CH3 A;  2F43 G;  4LF4 O;  2YIB D;  3ABK B;  2X0L A;  2L6L A;  1PM9 A;  4OX9 O;  4LFC O;  3CWB H;  4TWK A;  3N2K A;  1GO3 F;  1ZWI C;  3FYI B;  1R1B A;  3WG7 B;  1R73 A;  4O2A A;  2GUZ A;  5JJE B;  3D36 C;  4JI0 O;  5LOV B;  4K3A A;  4J10 A;  2W6J G;  1K34 A;  5BZB A;  3P30 A;  2QWQ B;  2OTL V;  3FB5 C;  2RJZ A;  5FPR A;  3DXR A;  2VWK A;  4MVM A;  1MA1 A;  1YSC A;  4GKJ B;  2XAS A;  2DOS A;  4AIL C;  1ZL8 A;  4WFH A;  1GN3 A;  1BHA A;  4RQF A;  3HKD B;  4RAI A;  1NVP D;  2F23 A;  1H8E G;  1B04 A;  2R70 A;  2BTO A;  4H0L B;  4JAS A;  1XNR O;  3JD0 A;  2PYL A;  1E1R G;  2BTQ B;  1BHB A;  2B1G A;  3OMN B;  4I5S A;  4UCO A;  3TGU H;  4C7U A;  1S3J A;  3T1C A;  5KAI Z;  2QM8 A;  2Z0A A;  4IGG A;  3JD3 A;  4IHJ A;  3H9V A;  1WP7 A;  4DUZ B;  4I55 B;  1VP7 A;  3JAT A;  1BL8 A;  4LC1 A;  4FZ1 A;  5C8Y B;  5A9G A;  2VQE B;  1RSO A;  2Z3Y A;  3CJH A;  5FL7 G;  1N32 O;  1K4D C;  2DMX A;  2WLJ A;  4D7T A;  1Q90 D;  4FFB B;  2Y4T A;  3MAQ A;  3OGC C;  1IXM A;  4XDK A;  2B9Z A;  2ZIN A;  1Q6H A;  3JAW A;  2XAF A;  1H2S B;  1QR9 A;  1BMF G;  5F2V O;  5IYB O;  4KFM A;  1H2M A;  1LNQ A;  2AZ2 A;  4AQY B;  1H2L A;  3KCY A;  4QGP A;  1YHQ V;  2QWN B;  4FZ0 A;  2YDE A;  1D2D A;  2XAG A;  1AI4 A;  2OYQ A;  3ZN1 A;  4GYC B;  4LFA O;  2OWO A;  4MW3 A;  3ZED A;  4PV1 B;  4TQD A;  3JAL A;  4R7C A;  5IYC O;  3K5M A;  3RYF B;  2H8P C;  2WLL B;  3E2E A;  4IIJ A;  5B3S B;  3B4S A;  1FXV A;  4HNA A;  4L8J A;  2YEV B;  1QLN A;  3ZS8 C;  1VQM V;  4NR1 A;  1AR1 B;  1GN2 A;  2Q0A A;  4JTC B;  1VQ9 V;  1RM1 C;  1JJ2 U;  5JVD B;  4DR6 O;  4TUY B;  4DV1 B;  3JAS B;  1DF4 A;  5K1X A;  2GSM B;  1XIL A;  2UXB O;  2M7W A;  2CDY A;  5GW7 A;  3R65 A;  4JI5 B;  3HKC A;  4KXR A;  3CPW U;  1T5E A;  1US6 A;  4E4E A;  1V54 B;  3X2Q C;  3M8A A;  4LF8 B;  2P90 A;  4DRX B;  3ZRS A;  1HR0 B;  3VQW A;  3ABM B;  3RVY A;  2XOK G;  3ZRX A;  2YXL A;  1JFF B;  3MDS A;  2IBZ H;  4QE9 A;  4PA4 A;  4PA7 A;  4JI3 B;  3QO5 A;  3W7S A;  4DV0 O;  2Q8V A;  1I94 O;  2JEX A;  2N05 A;  1SS3 A;  3ZMV A;  1JVM A;  1I0H A;  2JGD A;  5LL6 Y;  5IWA B;  4EEQ A;  2E3C A;  4JYY A;  2UUA B;  3CS5 A;  1QQC A;  4G28 B;  2KG7 B;  4DR7 B;  4PDR A;  3ZHV A;  5IY5 C;  3B77 A;  4OGQ B;  3T1H B;  1KC8 W;  1NI8 A;  3UO3 A;  2ZE5 A;  1K92 A;  2PI4 A;  2V1D A;  1BE3 H;  1FPO A;  3CSX A;  1SZT A;  3E22 B;  3EVK A;  3HR0 A;  4YHH B;  1WJZ A;  3ZHQ A;  5DM6 V;  4DR1 O;  3HKE A;  2P4V A;  4JAA A;  1N34 O;  3K0D A;  3SYQ A;  2HJD A;  1KKC A;  4Q20 A;  3K06 A;  4DO2 A;  2P22 C;  4P9O A;  1VQ4 V;  2EIL B;  1YIJ V;  2ZXW C;  4MSW C;  4FPP A;  5LMN B;  2YS8 A;  5JH7 B;  2EIK B;  1U96 A;  2Q7H A;  4MS2 A;  1TUB A;  4FIP C;  4GKK B;  3OTO B;  1OCC B;  1SQX H;  3MD0 A;  3VQV A;  2NN4 A;  2HLD G;  1Y66 A;  1NU1 H;  1RP3 B;  3AG1 B;  2GHY A;  5LXT A;  2H3O A;  2ETN A;  5LP6 B;  5B66 Z;  5B1A C;  3IGA C;  1FFX B;  4FFK A;  2ADP A;  2DYR B;  2EIM B;  5H6R A;  2IH1 C;  4NTY A;  1PL4 A;  4BIZ A;  1Q7Y W;  1WA8 B;  5KMG A;  5HFM A;  4UCR A;  1OZ0 A;  4J9Y B;  4TV8 B;  1FXK C;  2UXD O;  2RQ6 A;  1HP8 A;  4J9Z B;  5IDJ A;  1A32 A;  4FM0 A;  2QWO B;  3ASN B;  4B7E A;  2YSU B;  3P3N A;  5L3E A;  3EXA A;  2EIN C;  2PGG A;  4PI0 A;  1Q6U A;  4JPR A;  4JZ2 A;  4EKW A;  3JD2 A;  5KX5 A;  3W7X A;  2QEX V;  1SZX A;  1OV9 A;  5K1P A;  3ABU A;  5CBH A;  3H1K H;  1I5Y A;  1JA8 A;  4U3J B;  5E79 Z;  1WPX A;  1J5E O;  5DN6 G;  2DN9 A;  4DUZ O;  4DK0 A;  2JEU A;  1SQV H;  4WBN B;  1Y4M A;  3GWK C;  4GX0 A;  3VQY A;  2EIJ B;  2VQE O;  1WLE A;  4FLT A;  2IJH A;  2DWE C;  4K35 A;  4Z1M G;  3HKB A;  5KHG A;  3K03 A;  2XHB A;  1QVG U;  3SPI A;  1N33 B;  2F4V O;  1OJH A;  2CTR A;  1AJQ A;  5H6Q A;  2V4D A;  4U7N A;  1YDX A;  1EN4 A;  1GTO A;  3ZJZ A;  4AQY O;  5B1B B;  4UVC A;  4CC5 A;  3ML0 A;  2YIC A;  3QO8 A;  4RUF A;  2NR5 A;  3T1Y O;  4DV7 B;  1WNS A;  1SET A;  1Q3E A;  2ZNJ A;  2W0F C;  1AR5 A;  3ZMS A;  1X4T A;  4PA6 A;  3G80 A;  1AI7 A;  2IJK A;  2PZS A;  5CA0 A;  3CEI A;  2ZCE A;  3UT5 B;  2EJ7 A;  1THZ A;  2AXT Z;  2M6Y A;  1WB8 A;  3P32 A;  4YY3 B;  3CRR A;  4NTX A;  4O4I A;  4X1Y B;  2DQ3 A;  2Q6A A;  2WLI A;  3OAA G;  3K04 A;  4I9W A;  3SYO A;  4DV1 O;  3H1L H;  3AG4 B;  1M57 C;  5J2T B;  3OMA B;  1S72 V;  4I0X A;  3I55 V;  5BMV A;  5LGU A;  3W7W A;  4JTD B;  5KAF Z;  4JI5 O;  2ARH A;  3UKM A;  4XBF A;  3C90 A;  2CGO A;  2UUB B;  3ETG A;  1NQT A;  3UQ8 A;  3WFV A;  5IYZ B;  1XBL A;  4BR6 A;  5IJ9 A;  1HR0 O;  1Y74 A;  5GTI Z;  1SQQ H;  3CB2 A;  3ASO B;  4AI8 A;  4RUE A;  3D3Q A;  3SYP A;  1HW7 A;  1IDS A;  4JI3 O;  2R72 A;  2IJI A;  4I4T A;  3L70 H;  1LUW A;  5E1A C;  5JWP A;  3FAV B;  1K9M W;  2HKO A;  4J7K A;  4JYA B;  4LH6 A;  4MTG A;  4JAU A;  5IWA O;  4LF6 B;  4LWS A;  4WFG A;  4B3R B;  2LFS A;  2UUA O;  4DR7 O;  4LF9 B;  4FLU A;  4RWU A;  3OT7 A;  3JAR A;  1ROP A;  4W4K A;  1M93 A;  2JJ1 G;  1D5N A;  1NBM G;  3TXQ A;  1G4Y B;  5CBF A;  4UV9 A;  4DR2 B;  1CEZ A;  1EZV H;  5FNV A;  1OCZ C;  2CTQ A;  1OCO B;  1KYO F;  4PI2 A;  4YXW G;  4YHH O;  2ZE8 A;  1L0N H;  4ZOL B;  2B1I A;  1KKD A;  3L71 H;  4LP8 A;  4O4J B;  3BFR A;  3UCS C;  1VQ5 V;  4MVO A;  1JCH A;  1GK9 A;  2A0L A;  5LMN O;  4DV5 B;  2W0X A;  4FM1 A;  2O57 A;  2DQ0 A;  1XL4 A;  1I08 A;  5KHK A;  2WA4 A;  4GKK O;  3OTO O;  1JOY A;  4W4L A;  4YJ2 B;  3OUF A;  4QPK A;  4CC6 A;  3G4S V;  3RVZ A;  5EBW C;  3O65 A;  2BOC C;  3WU2 Z;  3CD6 V;  3K08 A;  1VF5 B;  4BIU A;  1VQL V;  4LF5 B;  2QWP B;  2EX3 A;  1N4C A;  5GTH Z;  4UCS A;  2DYS C;  3E8F A;  4NTW A;  2ZR3 A;  2VRZ A;  2OCC C;  1WAZ A;  5A2Q N;  4LNU A;  5LYJ A;  3OEH G;  3CCL V;  2OIE A;  2MK3 A;  4O2B A;  2WLN A;  4EB6 B;  4IYH A;  3SJC C;  5CA1 B;  4O4H B;  2IM9 A;  3AG3 C;  2VS0 A;  3KKY A;  1HNX B;  4CS4 A;  3AG2 C;  2UXN A;  1PNK A;  3RW0 A;  4YJ3 B;  1COW G;  3ETQ A;  4GT1 A;  5EC2 C;  3RYI A;  4GCZ A;  2K9P A;  3FD9 A;  4I50 A;  5EYP B;  1DLB A;  3N2G A;  5BY1 A;  3ZHU A;  2P06 A;  1Y76 B;  1IBM B;  5JJJ B;  1IUR A;  1K7D A;  4PA3 A;  3OW2 U;  4ZHQ A;  1V54 C;  1GKF A;  5IE9 A;  4FLW A;  1XDC A;  2ZM6 B;  1QLE B;  4X20 B;  4N23 A;  3SYC A;  4F6R B;  3JYC A;  4PJ0 Z;  4TSF G;  1N33 O;  2YXH A;  3CX5 F;  1BZK A;  1L0L H;  3MHH C;  4QPJ A;  3RYC B;  4YIO A;  1F7Y A;  3SPC A;  5L3F A;  3K3W A;  4LCU C;  1GN4 A;  2EJR A;  3BA9 A;  1IX9 A;  4DV7 O;  4L87 A;  4DR5 B;  1GM9 A;  3TCU A;  1I5X A;  2UUC B;  4JI4 O;  2DW4 A;  4JI7 B;  2Q5Z A;  4KUM A;  4DV3 B;  1VF6 C;  5J2U B;  3CC7 V;  4RQE A;  3L73 H;  2PI5 A;  1SA0 B;  4F6E A;  2ADQ B;  3K0G A;  1F23 A;  4DV2 B;  1ORQ C;  4YY3 O;  1VQN V;  1ZUQ A;  1ZX3 A;  1YXB A;  5TIS Z;  5LHI A;  2GDS A;  3D36 A;  4JYB A;  4HAM A;  4P30 A;  3FB8 C;  5IJ0 B;  3ZRW B;  3RFR A;  1K73 W;  1XMO O;  3RYH A;  1R3I C;  5KLV H;  4JF3 A;  5D5P A;  2EIK C;  4J80 A;  1MSD A;  4K0K B;  2CK3 G;  4MVU A;  5KUK A;  2LP7 A;  4FVM A;  4DUY B;  1B6Q A;  3N2K B;  3AG1 C;  4GLX A;  4ASU G;  1GH6 A;  5LP6 C;  3BAA A;  3L74 H;  2LQT A;  2UUB O;  1SF9 A;  1MZE A;  4O2A B;  2GUZ B;  2H94 A;  1MAB G;  2Y69 B;  1NTZ H;  2EIM C;  4TV9 A;  1ARO P;  1ZTE A;  1VF7 A;  4X1I A;  2WWW A;  4X62 B;  2YI8 A;  1KMI Z;  5L3B A;  3M99 B;  4E2L A;  3CCM V;  4X65 B;  3K9A A;  2Q67 A;  4DK1 A;  4WFB V;  4WF9 V;  4K8X A;  3B2E E;  2YUA A;  2B5U A;  2A79 B;  3DXR B;  1XHX A;  1RPR A;  2FB5 A;  3OEE G;  2F1M A;  3STL C;  1MSW D;  1SQF A;  2PUS A;  2OCH A;  3MHS C;  3CRM A;  3BVO A;  1VF6 A;  1ZL8 B;  1HNW B;  3ASN C;  5KA5 A;  1FXH A;  4MVZ A;  1Q86 W;  3STZ C;  3RT3 C;  3F7Y C;  1FD9 A;  4LF9 O;  1VQO V;  1IBK B;  2JS5 A;  3E83 A;  5EZY A;  1AJP A;  1EFR G;  2XT9 A;  1L1F A;  3QO7 A;  5CBG A;  3SJB C;  2YIA A;  4QE7 A;  1B06 A;  4GX5 A;  2IU0 A;  1BT8 A;  1JMK C;  2JJ2 G;  5LA6 A;  1K3E A;  4IHJ B;  1UPG A;  4DV5 O;  1IVS A;  2JRI A;  1R6K A;  3ZIA G;  2KB1 A;  4B7K A;  5GON A;  1NZ6 A;  2G38 A;  3K5O A;  3JAT B;  5CB4 A;  3KZI Z;  2P67 A;  1RSO B;  1N8R W;  3OTF A;  5B1O A;  4KL1 A;  2HVK C;  5B1B C;  2QKS A;  3APQ A;  4BW5 A;  2WSS G;  4ZBM A;  2ZDI C;  2YIB A;  3JD1 A;  4ICG A;  3JAW B;  4LF5 O;  1EM1 A;  3W7T A;  4PDV A;  2F93 B;  3T2M A;  1K97 A;  4DV4 B;  5CN0 A;  1W59 A;  3TJT A;  2QWR B;  5JQG A;  3CP1 A;  1KP2 A;  4B3M O;  2GBO A;  4I9Q A;  1MMM A;  1JX9 A;  3DSQ A;  4X64 B;  3JAL B;  3CCQ V;  1WPB A;  4MW8 A;  1HNX O;  4JV5 B;  2QE7 G;  5D5Q A;  4IIJ B;  1QNM A;  4I7Z B;  5LBQ A;  1P84 F;  4HNA B;  4J7J A;  2XAJ A;  1KQS U;  4TT3 G;  1JR9 A;  4X9Q A;  2F95 B;  1SER A;  1IBM O;  3C3S A;  1R6N A;  1V55 B;  1VEW A;  1QBZ A;  1FJG B;  3A0B Z;  3ZCC A;  4CH6 A;  2JVD A;  2LJ2 A;  4OXS A;  5EBL C;  4UCV A;  2X6A A;  2BSK A;  2ZM6 O;  2QJ1 A;  3CCR V;  3F5W C;  4MVR A;  2ZE6 A;  1S77 D;  2Q7G A;  4GKJ O;  1FAF A;  1NTK H;  2WA3 A;  3HKC B;  3ASO C;  3K5N A;  3PN1 A;  5AG2 A;  2ITD C;  1KBH A;  2HFE C;  3G6B A;  3QTC A;  1W0K G;  4PDM A;  4JI6 B;  4PA9 A;  4X1K A;  3K58 A;  3GVM A;  2UXX A;  4NVP A;  1H38 A;  1Y6X A;  3LNM B;  4DR5 O;  2UUC O;  5B5E Z;  1AR4 A;  1GAX A;  2QTO A;  4DV3 O;  3JSL A;  2QA4 V;  1LUV A;  1M1K W;  2JGD B;  5BR8 B;  2WLH A;  2QGN A;  5C93 A;  1IBL B;  1SQB H;  1YJN V;  1OCO C;  2FML A;  4DV2 O;  3EHB B;  4IT5 A;  2CAZ C;  2PY5 A;  1FFT B;  3LNN A;  4CZZ A;  1NTM H;  2LGQ A;  3CXC U;  3ZX6 A;  1RM1 B;  4B3T B;  3LDE A;  3CE2 A;  2WAM A;  4FLX A;  3HKE B;  4K0K O;  4DUY O;  3ZHR A;  3LDC A;  1YCI A;  1P7B A;  5ITZ A;  5BXZ A;  3CRC A;  3TK1 A;  1TUB B;  3X2Q B;  1FXK A;  5DEC A;  3JAM N;  4X62 O;  4EFB A;  1Y67 A;  5LXT B;  2YI9 A;  3CCE V;  1CPY A;  3Q4H A;  1MOF A;  1XEQ A;  1I7F A;  5CMU A;  3OR7 C;  2QSA A;  1IZ3 A;  5H9C A;  2RDC A;  1P49 A;  4CS3 A;  4DW0 A;  1M4U A;  1HNW O;  5KMG B;  3JCU Z;  2R9I A;  2Q9L A;  3ABK C;  1H2K A;  4UV8 A;  2P5O A;  1IBK O;  3T4D A;  3OR6 C;  1AB3 A;  1JJO A;  1PNM A;  3DC5 A;  3W7U A;  2WLK A;  3WG7 C;  1ZLZ A;  2ZE7 A;  2QTS A;  1TVK A;  3JAK A;  2FKX A;  5KX5 B;  2HHH B;  1X59 A;  1R3K C;  5JJN B;  3QG5 A;  1RFY A;  4JI2 B;  2CH7 A;  4BIO A;  4ABM A;  2P4K A;  4UCU A;  2OIG A;  2ZXW B;  4LF8 O;  4DR3 B;  2HEP A;  1AVM A;  4ZI7 A;  1YTF B;  3TET A;  2D2C B;  3A2F A;  1OCR B;  2K1E A;  2E5L B;  3AK1 A;  1YIT V;  4WFE A;  2P6J A;  2PYJ A;  5LMU B;  1Q6I A;  3HKB B;  3H1J H;  1L8D A;  1WB7 A;  3H1I H;  4HYO A;  3AEI A;  4QNH B;  1BQ0 A;  3OD4 A;  5EC1 C;  1W0J G;  4NKG B;  3EFF K;  4IL6 Z;  4GUN A;  4MTO A;  3B09 A;  4LFA B;  4P2Z A;  1YVW A;  1YJ9 V;  4Z1V A;  4J11 A;  3T1H O;  3QNE A;  4DV4 O;  1PKX A;  4HBN A;  2WPD G;  4X64 O;  1PD3 A;  2KSD A;  2JK5 C;  1KB9 F;  5IYD O;  4FM2 A;  4CH5 A;  1TGO A;  3ZHT A;  4DR4 B;  2A7W A;  4JV5 O;  2NLJ C;  2WLM A;  2EIN B;  1XHZ A;  5LOV A;  2ZNI A;  1EZJ A; 
#chains in the Genus database with same CATH homology
 4RQE A;  2JEX A;  4PEL A;  3B8N A;  2PI5 A;  4WFA V;  3ZMV A;  1GM8 A;  3LUT B;  1JVM A;  2HR3 A;  4N21 A;  3K0G A;  3SJQ C;  1NVP B;  1F23 A;  3CCS V;  3BEH A;  1PL0 A;  3VBB A;  3I56 V;  3SPH A;  1ORQ C;  4G28 B;  3KG2 A;  1VQN V;  3IFX A;  4PDR A;  5IY5 C;  3B77 A;  5LHI A;  2WLI B;  3D36 A;  4JYB A;  1KC8 W;  2W6I G;  4HAM A;  4P30 A;  3FB8 C;  2AHY A;  5KUM A;  2EBO A;  3ZRW B;  3ABL C;  1K73 W;  1SES A;  1K92 A;  1R3I C;  2Y69 C;  1R3J C;  2PI4 A;  2V1D A;  1EBO A;  1KEC A;  4JF3 A;  2EIK C;  1SZT A;  1K33 A;  4R6Z A;  1VQ7 V;  2CK3 G;  4H33 A;  4MVU A;  4G2K A;  4LBE C;  1GM7 A;  5KUK A;  2XND G;  2LP7 A;  5DM6 V;  3T4Z A;  1B6Q A;  3SYA A;  3PJS K;  3AG1 C;  4RO2 A;  5CA3 A;  2X6C A;  4ASU G;  5IY5 B;  3K0D A;  3SYQ A;  4Q20 A;  3K06 A;  4DO2 A;  2AHZ A;  4P9O A;  2X7R B;  2EIL B;  1VQ4 V;  1YIJ V;  3ABL B;  5B3S C;  2ZXW C;  3CCJ V;  2H94 A;  1MAB G;  2Y69 B;  3OMI B;  4FPP A;  4MSW C;  2EIM C;  1AI6 A;  4WCE V;  1ARO P;  2EIK B;  4MS2 A;  2WWW A;  2IJJ A;  4FIP C;  1OCC B;  3MD0 A;  5L3B A;  3M99 B;  4E2L A;  3CCM V;  3K9A A;  2Q67 A;  4WFB V;  4WF9 V;  2HLD G;  1Y66 A;  2B5U A;  3AG1 B;  2A79 B;  1VQK V;  2GHY A;  1MG1 A;  1RPR A;  3OEE G;  3STL C;  1MSW D;  4HZ3 A;  5B1A C;  1KD1 W;  3ABT A;  5EBM C;  2Q68 A;  3IGA C;  1OHH G;  1QLE C;  3MHS C;  2DYR B;  3FKS G;  1YJW V;  2EIM B;  5H6R A;  2IH1 C;  1DF5 A;  3ASN C;  5KA5 A;  1FXH A;  4MVZ A;  4R8C A;  4BIZ A;  5B1N A;  1Q86 W;  1Q7Y W;  3STZ C;  2ZR2 A;  3F7Y C;  4UXN A;  5HFM A;  1UJW B;  2BOB C;  1OZ0 A;  1VQO V;  2P7T C;  4J9Y B;  3E83 A;  1FXK C;  1AJP A;  1F4M A;  3CCU V;  4J9Z B;  1EFR G;  4X88 A;  5B1A B;  1L1F A;  5IDJ A;  3QO7 A;  5CBG A;  4P9P A;  1CP9 A;  2D3O W;  4CBC A;  3ABM C;  1AI5 A;  1M57 B;  1Q82 W;  2HG5 C;  2HJF C;  3ASN B;  3CCV V;  1VQ6 V;  2YSU B;  4QE7 A;  4GX5 A;  2IU0 A;  5L3E A;  2EIN C;  2LFR A;  1W2B U;  4JPR A;  1K8A W;  4EKW A;  1S5H C;  3GWO A;  4FJC C;  5LHH A;  3JD2 A;  1FXK B;  2JJ2 G;  3W7X A;  2QEX V;  1K3E A;  3E8H A;  1AJN A;  1PNL A;  5L3G A;  3ABU A;  2WLL A;  5CBH A;  1NH2 B;  1R6K A;  2Y48 A;  3ZIA G;  2KB1 A;  1J95 A;  1I5Y A;  2XAQ A;  1WPX A;  3K79 A;  2XAH A;  4X89 A;  2YEV A;  3ETE A;  5DN6 G;  2JEU A;  2P67 A;  3CYO A;  3NXS A;  5EK0 A;  1N8R W;  5LGN A;  1Y4M A;  4GX0 A;  5B1O A;  4JGS A;  1KP3 A;  2EIJ B;  1RPO A;  1H8H G;  3E8G A;  1WLE A;  2IJH A;  2A9H A;  2HVK C;  2OTJ V;  2DWE C;  5B1B C;  2QKS A;  4BW5 A;  1S76 D;  1JPX A;  2Q69 A;  4Z1M G;  2WSS G;  4ZBM A;  2ZDI C;  3JD1 A;  4KP4 A;  3RBZ A;  3K03 A;  4X8A A;  1QVG U;  3SPI A;  3LSS A;  2C2A A;  3W7T A;  4PDV A;  4XDJ A;  1SRY A;  3T2M A;  1AJQ A;  5H6Q A;  1K97 A;  1M56 C;  4U7N A;  4DXW A;  2X6B A;  2EIL C;  5CN0 A;  3UM7 A;  3D3I A;  2JDI G;  5KA6 A;  1GTO A;  3ZJZ A;  3CP1 A;  1KP2 A;  5B1B B;  4UVC A;  1JX9 A;  1HWY A;  3ML0 A;  3QO8 A;  4RUF A;  2DWD C;  1OCC C;  3JD4 A;  1OCZ B;  1V55 C;  3ZMU A;  1TUE B;  4FK5 C;  1SET A;  4MW8 A;  1K5S A;  4GX2 A;  3CCQ V;  2QE7 G;  2W0F C;  1M56 B;  3CMA V;  3FYE B;  2NNU A;  3ZMS A;  5LBQ A;  2HVJ C;  3DGE A;  4PA6 A;  1AI7 A;  1XL6 A;  1VQP V;  2IJK A;  2DYR C;  4JYC A;  2XAJ A;  1KQS U;  4TT3 G;  2QM7 A;  4GX1 A;  1M9N A;  1THZ A;  4UUJ C;  4MTX A;  3OFN G;  3P32 A;  1SER A;  4R50 A;  1R6N A;  1V55 B;  4UVB A;  2Z5U A;  1QBZ A;  2DQ3 A;  3ZCC A;  2Q6A A;  1FS0 G;  2WLI A;  2EZP A;  3OAA G;  3K04 A;  4I9W A;  4OXS A;  5EBL C;  5L3D A;  3SYO A;  3CME V;  3ZRW A;  5L3C A;  2V7Q G;  1YTF D;  2X6A A;  3AG4 B;  1JQ0 A;  1M57 C;  4ZKI A;  3CCR V;  1E79 G;  3F5W C;  4MVR A;  1S77 D;  4FMT A;  1G8M A;  3OMA B;  1F4N A;  1S72 V;  1NR1 A;  2R9R B;  3I55 V;  3ASO C;  2F43 G;  5LGU A;  3OM3 B;  3W7W A;  4JTD B;  2ITD C;  2X0L A;  3ABK B;  3SPJ A;  2DYS B;  2HFE C;  4XBF A;  3UKM A;  4TWK A;  1GO3 F;  1ZWI C;  3BY6 A;  2OCC B;  3ETG A;  3FYI B;  1NQT A;  1W0K G;  3ZN0 A;  4PDM A;  3WFV A;  4PA9 A;  1NJI W;  3WG7 B;  1R73 A;  2UXX A;  1H38 A;  3JCZ A;  3LNM B;  3AG3 B;  3ASO B;  2W6J G;  1ENV A;  1K34 A;  2EIJ C;  4RUE A;  3SYP A;  3E8B A;  2QTO A;  2QA4 V;  5BZB A;  2IJI A;  3AG2 B;  1P4R A;  3P30 A;  5E1A C;  5J9P C;  1Q81 W;  1M1K W;  2OTL V;  3FB5 C;  2WLH A;  3ZMT A;  1K9M W;  2HKO A;  5C93 A;  4MVM A;  1YJN V;  4MTG A;  1OCO C;  4JAU A;  5LHG A;  1YSC A;  1DTO A;  1M90 W;  2XAS A;  3IC7 A;  3EHB B;  4WFG A;  1FFT B;  2LFS A;  4WFH A;  1BHA A;  1ROP A;  4CZZ A;  2JJ1 G;  1NBM G;  2ITC C;  1G4Y B;  4RQF A;  2ZQM A;  5CBF A;  3CXC U;  2ZD9 A;  4RAI A;  4UV9 A;  4MTF A;  1RM1 B;  1NVP D;  1CEZ A;  3LDE A;  1NKD A;  2OT5 A;  2IU3 A;  2JIZ G;  1H8E G;  2WAM A;  1OCZ C;  4JAS A;  1OCO B;  4YXW G;  3B8M A;  5HFL A;  4PDL A;  1QVF U;  1VQ8 V;  3G6E V;  2B1I A;  1KKD A;  3JD0 A;  1E1R G;  4LP8 A;  1BHB A;  2B1G A;  3LDC A;  3OMN B;  4I5S A;  1P7B A;  1VQ5 V;  3ZRV A;  4MVO A;  1JCH A;  1S3J A;  1GK9 A;  3SPG A;  3T1C A;  1H2G A;  2A0L A;  3TK1 A;  3DTU B;  3X2Q B;  1FXK A;  3OE7 G;  2QM8 A;  3FB7 C;  3JD3 A;  2DQ0 A;  4WFF A;  1XL4 A;  3ETD A;  1QCE A;  4UVA A;  1JOY A;  3HB3 B;  3OUF A;  4QPK A;  3E35 A;  3CCE V;  1BL8 A;  1CPY A;  4LC1 A;  3G4S V;  3RVZ A;  1MOF A;  2Z3Y A;  3LSQ A;  5FL7 G;  1R3L C;  2IW5 A;  5CMU A;  1F51 A;  1K4D C;  3OR7 C;  5EBW C;  2WLJ A;  3AG4 C;  2BOC C;  3CD6 V;  3E89 A;  5H9C A;  3OGC C;  1IXM A;  3E86 A;  3K08 A;  2EZO A;  4XDK A;  4BIU A;  1VQL V;  3H01 A;  2R9I A;  4QIW F;  2XAF A;  3ABK C;  1QR9 A;  4UV8 A;  1BMF G;  2DYS C;  3E8F A;  4H37 A;  4KFM A;  2ZR3 A;  5IYB O;  3T4D A;  1LNQ A;  3VOU A;  2OCC C;  3OR6 C;  3G71 V;  3OEH G;  1PNM A;  4MT8 A;  3CCL V;  2MK3 A;  1YHQ V;  1K5Q A;  3W7U A;  2WLK A;  4XDL A;  3WG7 C;  2WLN A;  5LGT A;  2XAG A;  1NR7 A;  1AI4 A;  1OCR C;  2ZDI A;  3AG3 C;  3ZN1 A;  2FTK A;  4MW3 A;  1R3K C;  4R7C A;  5IYC O;  3AG2 C;  4JAV A;  3OUS A;  2UXN A;  1PNK A;  2H8P C;  3RW0 A;  2WLL B;  3E2E A;  1COW G;  5B3S B;  2ZXW B;  4GT1 A;  5EC2 C;  4GCZ A;  3GB7 C;  1DLB A;  1FXV A;  1QR8 A;  2YEV B;  1QLN A;  3CC2 V;  4G27 B;  1VQM V;  4F4L A;  1YTF B;  3TET A;  1AR1 B;  1K4C C;  1K7D A;  4PA3 A;  1OCR B;  2K1E A;  3OW2 U;  4BAY A;  4JTC B;  1VQ9 V;  1YIT V;  4WFE A;  2P6J A;  2ATK C;  1V54 C;  1RM1 C;  1JJ2 U;  3LDD A;  4HYO A;  1NH2 D;  1GKF A;  3AEI A;  3FB6 C;  4QNH B;  5EC1 C;  1W0J G;  1DF4 A;  3EFF K;  1QLE B;  4N23 A;  3SYC A;  2GSM B;  1E1Q G;  3JYC A;  4JTA B;  4TSF G;  4MTO A;  3A0R A;  1S0V A;  2M7W A;  4U7O A;  4P2Z A;  5GW7 A;  4QJF B;  3R65 A;  1YJ9 V;  3CC4 V;  3MHH C;  4QPJ A;  3F7V C;  1YI2 V;  3QNE A;  3CPW U;  1PKX A;  1V54 B;  3SPC A;  3X2Q C;  5L3F A;  3K3W A;  4LCU C;  3HPL C;  2EJR A;  2P90 A;  2WPD G;  3ZRS A;  4MVQ A;  1PD3 A;  3ABM B;  2JK5 C;  3RVY A;  4L87 A;  2XOK G;  3ZRX A;  1GM9 A;  5IYD O;  3TCU A;  4QE9 A;  1I5X A;  4PA4 A;  4PA7 A;  4MVS A;  2DW4 A;  2NLJ C;  2WLM A;  2EIN B;  3QO5 A;  4KUM A;  1GMG A;  3W7S A;  2IH3 C;  1EZJ A;  3ZMZ A;  3CC7 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...