2IJHA

Crystal structure analysis of cole1 rom mutant f14w
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
57
structure length
57
Chain Sequence
GTKQEKTALNMARWIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 28
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijhA00
2IJJA 3K79A 1ROPA 1B6QA 1RPRA 1F4NA 1RPOA 1PD3A 2IJHA 1F4MA 1GTOA 1GMGA 1NKDA 2IJKA 2IJIA 4DO2A 2GHYA
chains in the Genus database with same CATH superfamily
4DUYO 3JAKA 2YEVB 1KUQA 3QNEA 2EJ7A 4CC5A 1BGYH 1QQCA 2LO1A 4K0KB 1Q90D 3LDCA 4B3TB 2UU9B 1H2LA 1FFTB 2QGNA 1H8EG 4FLWA 1V54B 2EIKB 1GKFA 1QHTA 1RP3B 3HR0A 4TUYA 1HWYA 1HDJA 3UT5B 2X6CA 2WA3A 2GBOA 1NTMH 4MT8A 2PI5A 3ZMUA 3AG2C 3UT5A 4LWSB 1UJWB 1IBLB 1FXVA 1F51A 4LWSA 2W0FC 4D6TH 4O2BA 2E76B 1Q6HA 1FXKB 4WFGA 3HKDB 3ZHQA 2YXLA 1NJIW 1VQ4V 4ZIBA 3HKDA 5IJ9B 3K9SA 2A79B 5LBQA 4J9ZB 5IJ9A 2IU3A 3CC4V 3G6EV 2DYSC 4DR2B 4X66B 2GUZB 1S76D 3ABUA 1IBMO 1K92A 1ZAUA 4YHHB 2Q5ZA 1H2NA 4DW0A 2QR4A 5LOVA 1VIBA 4RWUA 1D5AA 3SJCC 2YUAA 3D36C 2GHYA 4LCUC 5KAFZ 4FFBB 3E89A 2K1EA 4PA7A 2BTOA 5B1AB 4OGQB 1VQ6V 1GM7A 2ATKC 4JPRA 4TV8B 4B3RB 1QVFU 4U3JB 5FNVA 3HKEB 1JCHA 5EIBD 5JQGB 1B3QA 2BOCC 5B3SB 2JGDB 2GSMB 1R6NA 4ZI7A 3CCQV 1W0JG 3ZHVA 4MVMA 4JI0B 2WLKA 3ZMVA 3S3WA 2P06A 1FD9A 2F4VO 2N04A 1M4UA 2JRIA 2JEXA 1JPXA 4DV0B 1SKVA 3BA8A 2GTSA 3FYEB 1AI4A 1P84F 3K5NA 2XAHA 2XT9A 5J9PC 3OMIB 2B1GA 2CTQA 1ZSPA 1BMFG 4LF8O 3ABLC 1FYJA 1AI5A 2QKAA 4TV9A 4J10A 2M7WA 4RQEA 1DF5A 4KUMA 2AHYA 2A06H 4XDKA 3OUSA 2AZ2A 4LBEC 5FL7G 1EFRG 2WSSG 3EXAA 4GX0A 1AI7A 5JVDB 3DXRA 2UXDO 5JVDA 1FJGB 4DXWA 1YSCA 1ROPA 2QKCA 3MHSC 3ZHUA 5H6QA 5LYJA 3CCVV 1NTKH 2QTOA 3ZIAG 5FLXN 1FKAO 1P7GA 4GLXA 2Z0AA 4LP8A 2F23A 1OCOB 4JZ2A 4B3MO 4HAMA 2ZR3A 3IFXA 3T1CA 4OPAA 2QA4V 4K3AA 4UCVA 4JI2O 2HVJC 2QM8A 3FYIB 1RM1C 4NXMO 2RN9A 1YITV 2XTAA 1E1QG 1Y66A 4DV4B 4EFEA 2Q7GA 2K9PA 5AG2A 2QWQB 1K5QA 3CYOA 1NTZH 3OGIB 3LNMB 1BQZA 5LGTA 3SDLA 1AJPA 1PV0A 1AB3A 1OHHG 2IJIA 3QF7A 5EBMC 5KA5A 2XAFA 4I55A 4JI5B 1PP9H 4TQDA 1S5JA 4RAIA 1VQ8V 4JYYA 4DV5B 2Q67A 2EILB 4JYAO 1JQ0A 3ML0A 2EIMC 4GX1A 1OCZC 1R6KA 3HB3B 3VOUA 4NTYA 3K03A 4JYCA 2P7TC 5LMNO 1SQGA 3F5WC 5KMGB 3BPZA 5A2QN 4TT3G 4LFBB 2PY5A 3KZIZ 4JTDB 2CTPA 4UCSA 4JYBA 3UO3A 4PDVA 1XBLA 5C93A 3RYIB 5IJ0B 1K3EA 2ZM6O 2ZDIC 2X6BA 3HPLC 4J7JA 5CA3A 2Z5UA 3RYIA 4X20A 3OE7G 2ZXWC 4GCZA 4MTOA 1DK1A 2YC0A 3FFQA 3UQ8A 4I4TB 3ASNB 3VQYA 2XNDG 2JEUA 4I4TA 3RN4A 1P4RA 1Y74B 4P9PA 4CH4A 3FD9A 1QU7A 1T5EA 1GM8A 2QDOA 4UB8Z 1KKDA 1A32A 4ASUG 3JD4A 4AQYO 3CXCU 3E8BA 4MTFA 2EIJB 1M9NA 3OMNB 1K9MW 3CWBH 1R3KC 2KQXA 5IYDO 4JV5B 3JAWA 5BR8O 2DOSA 3J7AU 4HNAB 5EC2C 1KBHA 2UXBO 3TXQA 1YTFD 4WFHA 2XUMA 1G8MA 1VQNV 2LW7A 1GN4A 2WLHA 5GONB 1AP5A 1L0NH 4PDMA 2VQFB 3SYCA 3KKYA 1GH6A 5FPOA 1RPOA 5KHKA 3A2FA 4GX2A 3E8FA 1WJZA 4X1YA 1FFXB 3BEHA 1FFXA 1NVPD 1CXZB 3KCYA 4GYCB 4KXRA 4GT1A 4D7SA 2YI8A 4IL6Z 3QO7A 1AJQA 3U11A 5IY5B 3OM3B 5EIBC 3JCUZ 3ZS8C 3ZHRA 4EKWA 1XI1A 2KG7B 4MTGA 3OD4A 2HHHB 3JD0A 1V55B 4X65O 3OAAG 1JJOA 1N0NA 3W7UA 4X1IB 2XHBA 5ITZA 3P32A 4KL1A 5CMUA 3Q4HB 1GM9A 3K04A 2RJZA 4X1IA 2W6IG 1K34A 2Z3YA 4BW5A 5DM6V 2MK3A 4CBCA 1WAZA 1K73W 1BT8A 4DK1A 3D8CA 3OEEG 4NYKA 3ZRVA 5LMUB 1KD1W 1WPBA 4U3FH 1U96A 2OTJV 4ICGA 1HR0O 2ZE7A 4LF7B 4CH6A 2PGGA 1QLEB 1NT2B 4JASA 5GTIZ 5CA0A 2DW4A 3ZN1A 2ITCC 3BVOA 2ZIOA 4RUFA 2OCCB 4J80A 4O4HB 2F93B 2FL4A 4UFZA 4CH3A 2R72A 5EC1C 4XBFA 3RVZA 3W7TA 4CS3A 4QNHB 3ETEA 3E22A 3JASB 4I5SA 4WFFA 1N34B 1Y67A 4OX9O 3JALB 1I7FA 4WBNB 1V9PA 4X1KA 3JASA 3T1HO 5L3BA 3QG5A 2IH3C 1PNLA 2P4VA 1BSMA 3CCEV 4RO2A 1L8DA 2IM9A 1KKCA 4LF5O 4DRXA 3W7WA 2V4DA 1H2MA 1D2DA 4DV7B 1XL4A 2FYUH 3LSSA 2YXHA 3AK1A 1IXBA 3G67A 4LF6B 5IDJA 1L1FA 3MHHC 2H3OA 4K8ZA 1N36O 2PYJA 2FMLA 1JVMA 1VQ5V 3CEIA 3K59A 4LFAO 4JI3O 3U10A 3N2KA 4Q6GA 4DR3B 1JR9A 5KHJA 2B1IA 1SQPH 1F7YA 2YSUB 4HBNA 4N23A 1WA8B 1NH2D 4E4EA 5CBGA 3H9VA 4O2AA 1YIJV 2DYRB 2HR3A 5B1BC 1VQ9V 3G6BA 1OCRC 4IHJB 1BHAA 4F4LA 3OR7C 5IWAB 1AROP 3CP1A 4O4JB 1BQ0A 1WP8A 1RSOB 4OXSA 4FLXA 3BHPA 5DN6G 1JOYA 4JI4B 3CD6V 1DTOA 2BSKB 4DV6B 4DV2O 1N32B 2Y69C 2BSKA 2PI4A 1Q86W 4KFMA 1EZJA 1TVKA 3CJHB 1QLNA 3ABMC 1OCCC 2CAZC 3H1IH 5LGUA 4EB6A 5LA6A 4B3RO 4UCTA 5EBWC 1K4DC 4YIPA 3M7MX 4DV3B 1NR7A 3SPCA 1N33B 2Y0PA 1TGOA 2UXNA 3LDEA 1M57C 3L74H 3K0GA 1F23A 4FLZA 4TQFA 1TUBA 4B7KA 4TUYB 5EYPA 5CA1B 2P90A 4X64B 2WAMA 4DR5B 1Y76A 4E2LA 2HP8A 2ZT9B 2JIZG 5CA1A 5JCOC 2QWPB 4EEQA 2PZSA 2P5OA 3AG2B 2JGUA 4NXNB 1LUWA 4JAAA 3ABTA 3N2GB 3SGIA 2QWOB 1K7DA 4O2BB 2H94A 3FX7A 1OZ0A 3K9AA 3N2GA 1Q81W 3B09A 4IT5A 3I5DA 3RYFA 3RGBA 2UUCB 3CRRA 1F4MA 2ZD9A 2HVKC 1XNQB 4LR3A 2RQ6A 3FB7C 2X7RB 4X62B 4CS2A 1G4YB 2Q0AA 1O9GA 4PA4A 1MSWD 2DYSB 3LNNA 1VQ7V 3WB1A 2F43G 1EM1A 5B1OA 1MG1A 5LOVB 4DR7O 2WPDG 2YI9A 1QNMA 5GTHZ 1SQXH 3AG4C 2VQEO 1XOUA 3AK3A 3B2EE 3CRCA 3B8NA 4BIUA 2ZCEA 4J42A 4GUNA 3SPJA 3D36A 3GWOA 3T1YB 2WLIB 3ZEDA 1YJWV 3RFRA 4MS2A 5FNVB 2WLIA 3DSQA 5L3FA 2W0XA 5TISZ 1NI8A 1F4NA 4ZI7B 3K0DA 2XAJA 1GN3A 4LFCB 5EBLC 4J11A 2UXCO 2A9HA 3CS5A 4XDLA 2ZQMA 1PL0A 2Y4TA 4CS4A 1Q7YW 2OWOA 3A0BZ 1VQLV 4K35A 3X2QC 2CH7A 4DV5O 2QM7A 4PA6A 3ZJZA 4DUYB 4AI8A 1HNZB 2LFRA 3ABKC 2G38A 2Q8VA 3ABLB 4TV9B 2ETNA 3UCSC 3RYCA 4I50A 3RT3C 3H1LH 4MTXA 4GKKO 2XAGA 4LFBO 2IH1C 1VF7A 4LF4O 2A7WA 3KCXA 1U97A 3DXRB 1PL4A 4J7KA 4BW9A 1TAEA 5LYJB 1Q43A 3RWRD 1QVGU 1MA1A 2CK3G 2DWDC 1GN6A 3OR6C 2AGAA 1KECA 2NLJC 4J41A 3L70H 2YS8A 1XREA 1I94O 2QE7G 1US6A 3OUFA 5IYBO 5DECA 4FJCC 1RM1B 1Z5WA 2C2AA 1SQVH 1IDSA 2ITDC 2NR5A 2HEPA 1GK9A 4TWKA 4TOIA 3ZHTA 5D5QA 1NQTA 3CMAV 4RUEA 2YIAA 5LXTB 2N05A 1HW7A 3OTFA 1XQ8A 5LXTA 1AI6A 3ICXA 3QO5A 5IE9A 2JS3A 3AEIA 3R66A 3UM7A 4DR6O 4BR6A 3CCRV 3A0RA 4CZZA 4DR4O 1XMOO 2DN9A 4I55B 2R70A 2WLMA 1KC8W 4H44B 4PDRA 4ZBMA 3OW2U 1M5IA 3R65A 3IAYA 2V1DA 2EIMB 2ZIMA 5KX5A 1OCZB 2LW1A 2MW2B 2YIBD 2OCHA 4NTWA 2IJKA 4W4KA 2UUBO 2F4VB 5JH7B 4F6EA 2A0LA 1SZXA 1VQKV 1PM9A 1AJNA 3KG2A 4MW3A 4IIJA 2EZOA 5JH7A 4YJ3B 2P67A 1BCCH 1HNWB 4MSWC 5B66Z 2F66C 2ZE8A 3OT7A 4YJ3A 3JCZA 1YDXA 3B40A 2Q9LA 3ZBHA 5IYCO 2RNBA 2VWJA 4LF8B 4UV9A 5FPRA 2ARHA 1ZWIC 2EINC 4PA3A 2DQ0A 4JTCB 4X20B 3FAVB 4DUZO 4PDLA 1IBKO 2E5LO 3B77A 2ZDIA 5L3DA 2ZXWB 3FAVA 1KB9F 3CB2A 5EK0A 1QBZA 3LSUA 2QWNB 4EFBA 1SC5B 3T4DA 3APOA 3ZMSA 4LF7O 2UXDB 1Q6IA 1WLEA 2UUAB 1CP9A 2QTSA 5IYZB 1YZBA 3CRAA 4LNUB 2H8PC 5IYZA 4W4LA 4O4LB 4LNUA 4PELA 3CXHF 4CC6A 4DYLA 4G27B 3E8HA 3SPIA 3WU2Z 3E83A 1SETA 4O4LA 5J2UB 3JAWB 4ZOLA 4ABMA 5J2UA 5BY1A 2JK5C 1YXBA 2HFEC 4FM2A 4CH5A 4JI2B 1M56C 1HNXO 4NXMB 5E79Z 4QE7A 2CE4A 4WFBV 1PKXA 3SYAA 5KHGA 1IX9A 3E8GA 3CCSV 2CGOA 2FKXA 4YY3O 4NVPA 3ETGA 4BIZA 2PTMA 3CC7V 2NN4A 1KMIZ 4X1YB 3ZMZA 2WA4A 1K8AW 4PJ0Z 3CPWU 1Q6UA 2Q6AA 1VEWA 3AG3C 3BY6A 1Q5OA 3JYCA 2IJHA 3K08A 2OTLV 3STZC 4DV1B 3JD3A 3CE2A 2N74A 4LF9B 2PUSA 3OEHG 5ITZB 1XHXA 5LMNB 2YIDA 3BAAA 1Z5VA 4BAYA 1IVSA 3BRCA 3ZRSA 4DR1O 1GO3F 2E74B 1TUEB 4XDJA 3LDDA 2ZINA 5IWAO 1ZTEA 1MMMA 5CA0B 4R7CA 1SF9A 5L3EA 1O9HA 5B5EZ 3TK1A 4B3SB 1TA8A 3IJ4A 3L72H 1GN2A 4PHZA 1DGSA 4GKJB 2CDYA 5C8YB 3WG7C 3K79A 3E22B 5C8YA 1IURA 1OJHA 1XUQA 2E75B 5JWPA 2D3OW 2EJRA 1M93A 1W59A 4X1KB 5JJJB 4FIPC 2ZE6A 4KHPO 4JI8B 1Q82W 2OIEA 1MOFA 5CBHA 1NU1H 2KB1A 4DRXB 5BMVA 4G2KA 3CRMA 2DQ3A 1SZTA 4B08A 3E2EA 4K0KO 4B3TO 2UU9O 5BR8B 1ENVA 2DWEC 1EN6A 1K97A 3VBBA 4X8AA 3L71H 1XNRB 2UXBB 3CCUV 4H37A 5BXZA 3L9DA 1EBOA 1P7BA 4X64O 3STLC 4FMTA 3OTOB 1Z2GA 1R73A 5H5NA 3N2KB 1PD3A 4JI6B 3SPHA 2KSDA 2YDEA 1S3JA 3BCCH 1R3LC 2JJ1G 3E86A 1B06A 1IBLO 3ASOC 1K5SA 1SRYA 4JZGA 2Q0OC 1MZFA 3K57A 4O2AB 4UCRA 5L3CA 1N0JA 4FZ1A 2PYLA 3PJSK 1YJNV 5B1BB 3BA9A 1LNQA 1MABG 2NNUA 1OCRB 4QIWF 2R9IA 3GVMA 1X59A 2VS0A 4GX5A 4IGGA 4DR2O 1SA0B 4X66O 4X65B 4J9YB 2QM4A 1SQBH 3CX5F 1ZL8A 2QWRB 1SA0A 2YIBA 4YHHO 1S5LZ 2WLJA 4ZKIA 3ZHSA 2RDCA 1GRJA 1COWG 3H1KH 4RQFA 3H1JH 5LP6C 3JATA 2Y69B 1TVKB 3JSLA 2W6JG 1HR0B 3IC7A 4EB6B 4IYHA 3ZRWA 1B6QA 5LA6B 3JD2A 2LP7A 3ABMB 1OCCB 3S3XA 5J2TA 3K3WA 1YEWA 3ZX6A 3ZN0A 3DTUB 1AR4A 2GDSA 2OIGA 4UVBA 4Q20A 4FLTA 4JI7B 1JFFA 1KP3A 2BTQB 4NR1A 3JARA 1XMQB 3DC6A 2XASA 5KAIZ 4PI2A 5F2VO 4JI0O 1VQOV 2BTQA 3TGUH 1B04A 2KKWA 1M57B 1TUBB 3MD0A 3L73H 2JDIG 4DV0O 4A5UB 5EYPB 4BIOA 4X89A 2PF4E 2QJ1A 3JSNA 2QEXV 3T1HB 1Y76B 3WB0A 2B5UA 1FAFA 3WB2A 1HNZO 2JJ2G 4KP4A 1GTOA 1NBMG 1JJ2U 4MVZA 2YEVA 1J5EB 4LF5B 5JCOA 5EZYB 5LGNA 1I0HA 4R50A 1FS0G 2Q4PA 2VWKA 3O65A 4N21A 5EZYA 1V54C 2BCCH 2EIKC 4MVRA 2HJFC 4PI0A 4H0LB 3RYFB 4LH6A 3H01A 1GAXA 4JTAB 1N36B 3WFVA 4K8XA 1PNMA 5BZBA 1QCEA 4O4IB 4UB6Z 1YTFB 4LFAB 1R3JC 4JI3B 3CHXA 1XEQA 1N4CA 4O4IA 4JAVA 1FJGO 2IU0A 1L0LH 1QR9A 2L6LA 5JJNB 4MW8A 3EFFK 4JI1B 1GMGA 3ZMTA 5D5PA 4FFKA 1FPOA 2JVDA 1YJ9V 4B7EA 1FXKC 3RYHB 4QE9A 3AG4B 3VQXA 1K4CC 1FXKA 4X88A 3F5TA 1JA8A 3RYHA 1AP6A 3P3PA 1NVPB 4PA9A 2HJDA 1OV9A 1VF5B 3SYOA 4PD4F 4P9OA 1AILA 4DV4O 5CN0A 3CRQA 2GUZA 3JD1A 4F6RB 3P30A 3PN1A 4LC1A 4HZ3A 4R8CA 4F6RA 4H33A 1H38A 3FB6C 1E1RG 4NB5A 4DV2B 1AVMA 3TJTA 2ZKOA 4UCOA 3RW0A 5B1AC 3W7SA 4FFBA 2R9RB 4Z1VA 2E3CA 2Q7HA 1K33A 2CH7B 4JI5O 4OPHA 1UFIA 2ADQB 3CCJV 3X2QB 4TV8A 4R6ZA 4U3JA 5B3SC 1R1BA 3HKEA 3ABKB 1H2KA 5JQGA 3RYCB 2JGDA 3SJAC 4FPPA 4I50B 4Z2WA 1EN5A 3VQVA 4DO2A 2Y0IA 3OMAB 2DJVA 3OGCC 3AG7A 1THZA 4UXNA 1PNKA 1MSDA 2ZNJA 1HNWO 1NKDA 3AG1B 3AG1C 3P3NA 1ZX3A 2ZE5A 4AILC 5DEDA 3MAQA 4QPKA 4QJFB 5GW7A 3ETDA 2LFSA 1W0KG 1Y4MA 4DK0A 3CMEV 1EZVH 5L3GA 4FLYA 3JAMN 4JGSA 2V7QG 4IYIA 2WLLB 1W2BU 1SERA 3T2MA 1BL8A 1HP8A 3K58A 4WFAV 2WLLA 2UUAO 3A0HZ 3B4SA 4NTXA 1KU9A 1DLBA 1LR1A 5LHHA 4UVCA 1P49A 2LJ2A 4HYOA 3SPGA 3K5MA 4FLUA 1SQFA 2P22C 4DR7B 5HFMA 1CPYA 1IBMB 3G71V 4I9WA 1OCOC 2VQEB 1NS1A 3HKBB 1ORQC 2EZPA 4JV5O 1NH2B 1R3IC 3C90A 3HKBA 4WFEA 3FB5C 1NZ6A 1Y6XA 2YICA 1JX9A 4MVQA 2ILMA 3CC2V 1IZ3A 4QGPA 3THOA 1SS3A 2ZNIA 4DW1A 1CEZA 2HG5C 4I9QA 1UPGA 2Q68A 2F95B 2F1MA 2X6AA 5K1PA 2CGNA 5KX5B 3AK2A 2VQFO 1KYOF 4UCUA 4D7TA 3MDSA 2UXCB 1H2SB 4FM0A 5KA6A 1VARA 4IIJB 3OFNG 2EX3A 5E1AC 4ZHQB 2RCVA 1JMKC 2XOKG 1KQSU 4ZHQA 2EILC 3E35A 1BHBA 1I5XA 3QO8A 3UO2A 4DV1O 1FXHA 3LUTB 2GV9A 1QR8A 2EBOA 4LF9O 2EINB 2HHHO 4YXWG 3SR2C 3H1HH 3HKCB 4GKKB 2Q69A 3M99B 4MVOA 5KMGA 1WN7A 2Q7EA 3O9OA 2DMXA 3HKCA 3IGAC 4LF4B 5IT9N 2EULA 2JS5A 1J95A 3GB7C 2WWWA 5LMUO 1I5YA 3SJBC 3ZCCA 4G28B 1MZEA 2P6JA 4YIOA 2LGWA 1VQPV 1H8HG 3A8TA 4NKGB 2UXXA 4L8JA 5B1NA 5IJ0A 4B3SO 2ADPA 3K06A 1AR5A 4GKJO 1S77D 2OYQA 3ASNC 4ZOLB 1PPJH 4B3MB 3DGEA 1I94B 4I0XB 2BOBC 2RMKB 4L87A 1X4TA 5CB4B 1Y74A 1N34O 4I0XA 4LH7A 1M56B 1XL6A 4AHCA 4JI8O 1WB7A 3VQWA 5CB4A 2LGQA 3U0ZA 2CTWA 1G6UA 1S5HC 2WLNA 5KHIA 4UV8A 2EIJC 3I55V 3RBZA 1XDCA 3UKMA 2M6YA 1WNSA 1ZUQA 4DV7O 3C3TA 3TCUA 3M8AA 3N27A 1XNRO 1D5NA 4LF6O 4HNAA 1BZKA 2IJJA 4DR6B 2DE0X 4DR4B 2QKSA 1XMOB 1Q8IA 3OTOO 2ODMA 3D3QA 4JI6O 3AG3B 4FM1A 2LQTA 2OT5A 5LHIA 5GONA 4JYAB 3J81N 4DR3O 4X9QA 3SJQC 4PV1B 1S0VA 5H2FZ 2UUBB 5JJEB 2O57A 1RPRA 3L75H 4WCEV 2IW5A 3TXSA 1SESA 2HKOA 5KUKA 2XAQA 5IY5C 1M1KW 1EN4A 4FZ0A 2AHZA 1YHQV 1DF4A 5A9GA 1V55C 2KG7A 4YJ2B 5HFLA 2ZM6B 3G4SV 4DUZB 2IBZH 3QVNA 1IBKB 4YJ2A 2E5LB 2QSAA 3ZRXA 4JI4O 3Q4HA 4GZRB 3NR7A 5CBFA 4DV6O 1N32O 4MVSA 3WG7B 1YVWA 1URFA 1SQQH 3FB8C 1QLEC 4C7UA 3J80N 3C3SA 3LSQA 1ZLZA 3APQA 4DV3O 5KUMA 3EVKA 5BMVB 2OCCC 4JI7O 4AQYB 3SYPA 1XMQO 3SYQA 2FB5A 4O4HA 1N33O 3DC5A 3W7XA 1E79G 1VQMV 4P30A 3CCMV 2AW9A 1YF2A 1HNXB 2X0LA 1YCIA 3NXSA 2P4KA 3JALA 4WBNA 4U7OA 4DR5O 1N8RW 4JAUA 1J5EO 1NR1A 2D2CB 4YY3B 1YI2V 2BE3A 1LUVA 3IC9A 1XILA 4P2ZA 4NXNO 3FKSG 2R9AA 3ASOB 4FLVA 5LHGA 4Z1MG 1VP7A 2CUGA 3CSXA 1KP2A 3K5OA 1WPXA 4QPJA 2L35A 2UUCO 4MVUA 1XNQO 2FTKA 2VRZA 4X62O 1G1XB 5H9CA 4H13B 3F7VC 3RVYA 2CTRA 1AR1B 4JI1O 1ZL8B 2YXYA 3TETA 2Y4UA 1IXMA 3F7YC 2ZR2A 4TSFG 1VMGA 1WP7A 1S72V 1WA8A 2A3QA 4JF3A 4UUJC 4FK5C 4DR1B 1R6TA 3JATB 2DYRC 5K1XA 2Q73A 3GWKC 1XHZA 3BABA 5LP6B 1I08A 2GTAA 3ZRWB 4WF9V 3T1YO 5KLVH 3I56V 5LP6A 1RFYA 1WB8A 1H2GA 1Q3EA 1BE3H 5J2TB 4IHJA 5H6RA 3G80A 4BWAA 2B9ZA 5LL6Y 5KHHA 3CCLV 4O4JA 4I7ZB 4U7NA 1JFFB 1RSOA 3JARB 3D3IA 2Y48A 3BFRA 4LFCO 1M90W 2AZ0A 3K5LA 1BS3A 3ETQA 4J7ZA 2HLDG 4FVMA 1VF6C 3EHBB 1MNGA 3CJHA 3T4ZA 4UVAA 4OX9B 4KHPB 2AXTZ 3B8MA 3JAKB 1VF6A 3QTCA
chains in the Genus database with same CATH topology
2OCCB 3AG1B 3AG1C 2YEVB 5EK0A 1QBZA 3QNEA 3T4DA 5EC1C 4XBFA 3ZMSA 3RVZA 3W7TA 1WLEA 4QPKA 4QJFB 5GW7A 4QNHB 3LDCA 3ETDA 3ETEA 2LFSA 1FFTB 1CP9A 1W0KG 4I5SA 1Y4MA 4WFFA 1H8EG 3CMEV 1V54B 2EIKB 5L3GA 1GKFA 5L3BA 2H8PC 2IH3C 1PNLA 4JGSA 3CCEV 4PELA 2V7QG 4RO2A 4G27B 3E8HA 1HWYA 3SPIA 3E83A 2WLLB 1SETA 1W2BU 1SERA 2X6CA 3T2MA 3W7WA 1BL8A 4WFAV 2WLLA 2PI5A 4MT8A 3ZMUA 3AG2C 2JK5C 1XL4A 2HFEC 1UJWB 1DLBA 3LSSA 1FXVA 1M56C 1F51A 4QE7A 5LHHA 4UVCA 5IDJA 2W0FC 1L1FA 4HYOA 4WFBV 3MHHC 3SPGA 1PKXA 3SYAA 1FXKB 4WFGA 1CPYA 5HFMA 3G71V 1JVMA 4I9WA 3E8GA 1VQ5V 1NJIW 1OCOC 1VQ4V 3CCSV 1ORQC 2EZPA 1NH2B 3ETGA 1R3IC 2A79B 4BIZA 5LBQA 4J9ZB 2IU3A 4WFEA 3CC4V 3CC7V 3FB5C 3G6EV 2B1IA 2DYSC 1JX9A 3ZMZA 4MVQA 2YSUB 1K8AW 3CC2V 1S76D 4N23A 3ABUA 1K92A 1CEZA 3CPWU 2HG5C 2Q6AA 1NH2D 5CBGA 2Q68A 3AG3C 3BY6A 3JYCA 2IJHA 3K08A 2X6AA 1YIJV 2OTLV 2DYRB 2GHYA 2HR3A 5B1BC 3STZC 1VQ9V 1OCRC 4LCUC 1BHAA 3E89A 2K1EA 3JD3A 4PA7A 4F4LA 3OR7C 5B1AB 5KA6A 3OEHG 1VQ6V 1GM7A 1AROP 3OFNG 2ATKC 3CP1A 5E1AC 4JPRA 4BAYA 1QVFU 4OXSA 1JCHA 2XOKG 3ZRSA 1KQSU 5DN6G 1JOYA 2BOCC 1GO3F 2EILC 3E35A 5B3SB 3CD6V 1DTOA 2GSMB 1R6NA 3CCQV 1BHBA 1I5XA 3QO8A 1FXHA 1W0JG 1TUEB 3LUTB 2Y69C 4XDJA 3LDDA 1QR8A 4MVMA 2EBOA 2PI4A 2WLKA 1Q86W 3ZMVA 2EINB 4YXWG 4KFMA 1EZJA 1QLNA 3ABMC 1OCCC 4R7CA 5LGUA 2Q69A 2JEXA 1JPXA 3M99B 4MVOA 5L3EA 3TK1A 3FYEB 1AI4A 5EBWC 1K4DC 3IGAC 2XAHA 5J9PC 3OMIB 2B1GA 1J95A 1NR7A 3GB7C 2WWWA 1BMFG 3ABLC 3WG7C 1I5YA 3K79A 3SPCA 3ZCCA 4G28B 1AI5A 2P6JA 2UXNA 1VQPV 1H8HG 2M7WA 1M57C 2EJRA 3LDEA 2D3OW 4RQEA 3K0GA 1DF5A 1F23A 2UXXA 4KUMA 5B1NA 4FIPC 2AHYA 1Q82W 4XDKA 3K06A 1MOFA 5CBHA 3OUSA 2P90A 4LBEC 2WAMA 1S77D 5FL7G 4E2LA 1EFRG 2KB1A 3ASNC 2JIZG 2WSSG 4GX0A 4G2KA 1AI7A 3DGEA 2DQ3A 1SZTA 3E2EA 2BOBC 4L87A 3AG2B 4DXWA 1ENVA 1YSCA 2DWEC 1ROPA 3MHSC 3ABTA 5H6QA 1K97A 3VBBA 4X8AA 3CCVV 2QTOA 1M56B 1XL6A 3ZIAG 1K7DA 3CCUV 2H94A 4H37A 1OZ0A 1EBOA 1P7BA 3K9AA 1Q81W 3STLC 4FMTA 1S5HC 2WLNA 4LP8A 1R73A 4UV8A 2EIJC 1OCOB 1PD3A 1F4MA 2ZD9A 2HVKC 4HAMA 3I55V 3RBZA 2ZR3A 3IFXA 3T1CA 3SPHA 3UKMA 3FB7C 2X7RB 2QA4V 1S3JA 1G4YB 1R3LC 2JJ1G 3TCUA 3E86A 2HVJC 4PA4A 2QM8A 3ASOC 1MSWD 2DYSB 3FYIB 1RM1C 1K5SA 1SRYA 1YITV 2IJJA 1VQ7V 2F43G 1E1QG 1Y66A 5B1OA 2QKSA 1MG1A 2WPDG 5L3CA 1K5QA 3CYOA 3AG4C 3AG3B 3PJSK 1YJNV 3B8NA 2OT5A 3LNMB 5LHIA 5LGTA 4BIUA 5B1BB 1LNQA 1MABG 2NNUA 1OCRB 4QIWF 2R9IA 1AJPA 3SJQC 3SPJA 1S0VA 3D36A 4GX5A 3GWOA 2WLIB 1YJWV 1OHHG 4J9YB 2IJIA 4MS2A 5EBMC 2WLIA 1RPRA 5KA5A 2XAFA 5L3FA 4WCEV 2WLJA 2IW5A 4ZKIA 4RAIA 1SESA 1VQ8V 1F4NA 3K0DA 2Q67A 2EILB 2XAJA 1COWG 1JQ0A 3ML0A 2HKOA 5KUKA 2EIMC 2XAQA 5EBLC 5IY5C 4RQFA 1M1KW 4GX1A 1OCZC 1R6KA 2AHZA 2A9HA 2Y69B 3HB3B 3VOUA 1YHQV 4XDLA 2W6JG 2ZQMA 1DF4A 1PL0A 3IC7A 3K03A 4JYCA 2P7TC 1Q7YW 3ZRWA 1B6QA 1V55C 3JD2A 2LP7A 3ABMB 3F5WC 1OCCB 5HFLA 3G4SV 3K3WA 4TT3G 1VQLV 3ZN0A 3DTUB 3X2QC 2QM7A 4UVBA 3ZRXA 4PA6A 4Q20A 3ZJZA 2LFRA 3ABKC 1KP3A 5CBFA 3ABLB 4JTDB 4MVSA 3WG7B 2XASA 1VQOV 4JYBA 4PDVA 5C93A 1K3EA 4MTXA 1M57B 3FB8C 2ZDIC 1QLEC 3MD0A 2X6BA 3HPLC 2JDIG 5CA3A 2XAGA 2Z5UA 4X89A 2IH1C 2QEXV 3OE7G 2ZXWC 4GCZA 4MTOA 3LSQA 2B5UA 5KUMA 2OCCC 3SYPA 3ASNB 2JJ2G 4KP4A 3SYQA 1GTOA 1NBMG 1JJ2U 4MVZA 2XNDG 2YEVA 2JEUA 3W7XA 1P4RA 1E79G 5LGNA 4R50A 1VQMV 4P9PA 4P30A 3CCMV 1FS0G 4N21A 1V54C 1QVGU 1GM8A 2DWDC 2CK3G 2EIKC 4MVRA 2X0LA 1KKDA 2HJFC 3NXSA 3OR6C 4ASUG 1KECA 2NLJC 3H01A 3JD4A 4U7OA 4JTAB 3E8BA 3CXCU 3WFVA 1PNMA 4MTFA 1N8RW 5BZBA 2EIJB 1QCEA 4JAUA 1YTFB 1M9NA 1R3JC 3OMNB 1K9MW 1NR1A 1R3KC 1YI2V 5IYDO 4JAVA 2QE7G 3OUFA 2IU0A 4P2ZA 1QR9A 5EC2C 3FKSG 5IYBO 4MW8A 3ASOB 3EFFK 4FJCC 5LHGA 1RM1B 2C2AA 1GMGA 3ZMTA 4Z1MG 1KP2A 2ITDC 1YTFD 4WFHA 1YJ9V 1WPXA 1G8MA 4QPJA 1FXKC 1VQNV 1GK9A 4QE9A 4TWKA 1NQTA 3AG4B 4MVUA 1K4CC 1FXKA 4X88A 2WLHA 3CMAV 4RUEA 2FTKA 4PDMA 1NVPB 3SYCA 4PA9A 5H9CA 1AI6A 3F7VC 3RVYA 3SYOA 3QO5A 1AR1B 4P9OA 1RPOA 3AEIA 3UM7A 4GX2A 3E8FA 3CCRV 3A0RA 4CZZA 3TETA 5CN0A 2WLMA 1IXMA 1KC8W 3F7YC 3JD1A 4PDRA 3P30A 2ZR2A 4TSFG 3BEHA 4ZBMA 1NVPD 4LC1A 1S72V 4HZ3A 3OW2U 4R8CA 4JF3A 3R65A 4UUJC 4FK5C 4H33A 4GT1A 1H38A 3FB6C 2DYRC 1E1RG 2V1DA 3QO7A 1AJQA 2EIMB 5IY5B 3OM3B 1OCZB 4EKWA 3ZRWB 4WF9V 4MTGA 2IJKA 3RW0A 3I56V 5B1AC 1H2GA 3W7SA 2R9RB 1V55B 3JD0A 5H6RA 3OAAG 3W7UA 2A0LA 1VQKV 1AJNA 3KG2A 3P32A 4MW3A 1K33A 5CMUA 2EZOA 2P67A 1GM9A 3CCLV 3K04A 3CCJV 2W6IG 3X2QB 4U7NA 4R6ZA 1K34A 2Z3YA 4MSWC 4BW5A 3D3IA 5DM6V 2MK3A 4CBCA 5B3SC 1K73W 2Y48A 3JCZA 3ABKB 5IYCO 1M90W 3OEEG 1KD1W 3ZRVA 4FPPA 2OTJV 4UV9A 1ZWIC 2EINC 4DO2A 3OMAB 4PA3A 2DQ0A 3OGCC 4JTCB 1THZA 4UXNA 2HLDG 1QLEB 4PDLA 4JASA 3EHBB 3T4ZA 1PNKA 4UVAA 3B77A 3B8MA 2DW4A 2ZDIA 3ZN1A 5L3DA 2ZXWB 2ITCC 1NKDA 4RUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJJ A;  3K79 A;  1ROP A;  1B6Q A;  1RPR A;  1F4N A;  1RPO A;  1PD3 A;  2IJH A;  1F4M A;  1GTO A;  1GMG A;  1NKD A;  2IJK A;  2IJI A;  4DO2 A;  2GHY A; 
#chains in the Genus database with same CATH topology
 4DUY O;  3JAK A;  2YEV B;  1KUQ A;  3QNE A;  2EJ7 A;  4CC5 A;  1BGY H;  1QQC A;  2LO1 A;  4K0K B;  1Q90 D;  3LDC A;  4B3T B;  2UU9 B;  1H2L A;  1FFT B;  2QGN A;  1H8E G;  4FLW A;  1V54 B;  2EIK B;  1GKF A;  1QHT A;  1RP3 B;  3HR0 A;  4TUY A;  1HWY A;  1HDJ A;  3UT5 B;  2X6C A;  2WA3 A;  2GBO A;  1NTM H;  4MT8 A;  2PI5 A;  3ZMU A;  3AG2 C;  3UT5 A;  4LWS B;  1UJW B;  1IBL B;  1FXV A;  1F51 A;  4LWS A;  2W0F C;  4D6T H;  4O2B A;  2E76 B;  1Q6H A;  1FXK B;  4WFG A;  3HKD B;  3ZHQ A;  2YXL A;  1NJI W;  1VQ4 V;  4ZIB A;  3HKD A;  5IJ9 B;  3K9S A;  2A79 B;  5LBQ A;  4J9Z B;  5IJ9 A;  2IU3 A;  3CC4 V;  3G6E V;  2DYS C;  4DR2 B;  4X66 B;  2GUZ B;  1S76 D;  3ABU A;  1IBM O;  1K92 A;  1ZAU A;  4YHH B;  2Q5Z A;  1H2N A;  4DW0 A;  2QR4 A;  5LOV A;  1VIB A;  4RWU A;  1D5A A;  3SJC C;  2YUA A;  3D36 C;  2GHY A;  4LCU C;  5KAF Z;  4FFB B;  3E89 A;  2K1E A;  4PA7 A;  2BTO A;  5B1A B;  4OGQ B;  1VQ6 V;  1GM7 A;  2ATK C;  4JPR A;  4TV8 B;  4B3R B;  1QVF U;  4U3J B;  5FNV A;  3HKE B;  1JCH A;  5EIB D;  5JQG B;  1B3Q A;  2BOC C;  5B3S B;  2JGD B;  2GSM B;  1R6N A;  4ZI7 A;  3CCQ V;  1W0J G;  3ZHV A;  4MVM A;  4JI0 B;  2WLK A;  3ZMV A;  3S3W A;  2P06 A;  1FD9 A;  2F4V O;  2N04 A;  1M4U A;  2JRI A;  2JEX A;  1JPX A;  4DV0 B;  1SKV A;  3BA8 A;  2GTS A;  3FYE B;  1AI4 A;  1P84 F;  3K5N A;  2XAH A;  2XT9 A;  5J9P C;  3OMI B;  2B1G A;  2CTQ A;  1ZSP A;  1BMF G;  4LF8 O;  3ABL C;  1FYJ A;  1AI5 A;  2QKA A;  4TV9 A;  4J10 A;  2M7W A;  4RQE A;  1DF5 A;  4KUM A;  2AHY A;  2A06 H;  4XDK A;  3OUS A;  2AZ2 A;  4LBE C;  5FL7 G;  1EFR G;  2WSS G;  3EXA A;  4GX0 A;  1AI7 A;  5JVD B;  3DXR A;  2UXD O;  5JVD A;  1FJG B;  4DXW A;  1YSC A;  1ROP A;  2QKC A;  3MHS C;  3ZHU A;  5H6Q A;  5LYJ A;  3CCV V;  1NTK H;  2QTO A;  3ZIA G;  5FLX N;  1FKA O;  1P7G A;  4GLX A;  2Z0A A;  4LP8 A;  2F23 A;  1OCO B;  4JZ2 A;  4B3M O;  4HAM A;  2ZR3 A;  3IFX A;  3T1C A;  4OPA A;  2QA4 V;  4K3A A;  4UCV A;  4JI2 O;  2HVJ C;  2QM8 A;  3FYI B;  1RM1 C;  4NXM O;  2RN9 A;  1YIT V;  2XTA A;  1E1Q G;  1Y66 A;  4DV4 B;  4EFE A;  2Q7G A;  2K9P A;  5AG2 A;  2QWQ B;  1K5Q A;  3CYO A;  1NTZ H;  3OGI B;  3LNM B;  1BQZ A;  5LGT A;  3SDL A;  1AJP A;  1PV0 A;  1AB3 A;  1OHH G;  2IJI A;  3QF7 A;  5EBM C;  5KA5 A;  2XAF A;  4I55 A;  4JI5 B;  1PP9 H;  4TQD A;  1S5J A;  4RAI A;  1VQ8 V;  4JYY A;  4DV5 B;  2Q67 A;  2EIL B;  4JYA O;  1JQ0 A;  3ML0 A;  2EIM C;  4GX1 A;  1OCZ C;  1R6K A;  3HB3 B;  3VOU A;  4NTY A;  3K03 A;  4JYC A;  2P7T C;  5LMN O;  1SQG A;  3F5W C;  5KMG B;  3BPZ A;  5A2Q N;  4TT3 G;  4LFB B;  2PY5 A;  3KZI Z;  4JTD B;  2CTP A;  4UCS A;  4JYB A;  3UO3 A;  4PDV A;  1XBL A;  5C93 A;  3RYI B;  5IJ0 B;  1K3E A;  2ZM6 O;  2ZDI C;  2X6B A;  3HPL C;  4J7J A;  5CA3 A;  2Z5U A;  3RYI A;  4X20 A;  3OE7 G;  2ZXW C;  4GCZ A;  4MTO A;  1DK1 A;  2YC0 A;  3FFQ A;  3UQ8 A;  4I4T B;  3ASN B;  3VQY A;  2XND G;  2JEU A;  4I4T A;  3RN4 A;  1P4R A;  1Y74 B;  4P9P A;  4CH4 A;  3FD9 A;  1QU7 A;  1T5E A;  1GM8 A;  2QDO A;  4UB8 Z;  1KKD A;  1A32 A;  4ASU G;  3JD4 A;  4AQY O;  3CXC U;  3E8B A;  4MTF A;  2EIJ B;  1M9N A;  3OMN B;  1K9M W;  3CWB H;  1R3K C;  2KQX A;  5IYD O;  4JV5 B;  3JAW A;  5BR8 O;  2DOS A;  3J7A U;  4HNA B;  5EC2 C;  1KBH A;  2UXB O;  3TXQ A;  1YTF D;  4WFH A;  2XUM A;  1G8M A;  1VQN V;  2LW7 A;  1GN4 A;  2WLH A;  5GON B;  1AP5 A;  1L0N H;  4PDM A;  2VQF B;  3SYC A;  3KKY A;  1GH6 A;  5FPO A;  1RPO A;  5KHK A;  3A2F A;  4GX2 A;  3E8F A;  1WJZ A;  4X1Y A;  1FFX B;  3BEH A;  1FFX A;  1NVP D;  1CXZ B;  3KCY A;  4GYC B;  4KXR A;  4GT1 A;  4D7S A;  2YI8 A;  4IL6 Z;  3QO7 A;  1AJQ A;  3U11 A;  5IY5 B;  3OM3 B;  5EIB C;  3JCU Z;  3ZS8 C;  3ZHR A;  4EKW A;  1XI1 A;  2KG7 B;  4MTG A;  3OD4 A;  2HHH B;  3JD0 A;  1V55 B;  4X65 O;  3OAA G;  1JJO A;  1N0N A;  3W7U A;  4X1I B;  2XHB A;  5ITZ A;  3P32 A;  4KL1 A;  5CMU A;  3Q4H B;  1GM9 A;  3K04 A;  2RJZ A;  4X1I A;  2W6I G;  1K34 A;  2Z3Y A;  4BW5 A;  5DM6 V;  2MK3 A;  4CBC A;  1WAZ A;  1K73 W;  1BT8 A;  4DK1 A;  3D8C A;  3OEE G;  4NYK A;  3ZRV A;  5LMU B;  1KD1 W;  1WPB A;  4U3F H;  1U96 A;  2OTJ V;  4ICG A;  1HR0 O;  2ZE7 A;  4LF7 B;  4CH6 A;  2PGG A;  1QLE B;  1NT2 B;  4JAS A;  5GTI Z;  5CA0 A;  2DW4 A;  3ZN1 A;  2ITC C;  3BVO A;  2ZIO A;  4RUF A;  2OCC B;  4J80 A;  4O4H B;  2F93 B;  2FL4 A;  4UFZ A;  4CH3 A;  2R72 A;  5EC1 C;  4XBF A;  3RVZ A;  3W7T A;  4CS3 A;  4QNH B;  3ETE A;  3E22 A;  3JAS B;  4I5S A;  4WFF A;  1N34 B;  1Y67 A;  4OX9 O;  3JAL B;  1I7F A;  4WBN B;  1V9P A;  4X1K A;  3JAS A;  3T1H O;  5L3B A;  3QG5 A;  2IH3 C;  1PNL A;  2P4V A;  1BSM A;  3CCE V;  4RO2 A;  1L8D A;  2IM9 A;  1KKC A;  4LF5 O;  4DRX A;  3W7W A;  2V4D A;  1H2M A;  1D2D A;  4DV7 B;  1XL4 A;  2FYU H;  3LSS A;  2YXH A;  3AK1 A;  1IXB A;  3G67 A;  4LF6 B;  5IDJ A;  1L1F A;  3MHH C;  2H3O A;  4K8Z A;  1N36 O;  2PYJ A;  2FML A;  1JVM A;  1VQ5 V;  3CEI A;  3K59 A;  4LFA O;  4JI3 O;  3U10 A;  3N2K A;  4Q6G A;  4DR3 B;  1JR9 A;  5KHJ A;  2B1I A;  1SQP H;  1F7Y A;  2YSU B;  4HBN A;  4N23 A;  1WA8 B;  1NH2 D;  4E4E A;  5CBG A;  3H9V A;  4O2A A;  1YIJ V;  2DYR B;  2HR3 A;  5B1B C;  1VQ9 V;  3G6B A;  1OCR C;  4IHJ B;  1BHA A;  4F4L A;  3OR7 C;  5IWA B;  1ARO P;  3CP1 A;  4O4J B;  1BQ0 A;  1WP8 A;  1RSO B;  4OXS A;  4FLX A;  3BHP A;  5DN6 G;  1JOY A;  4JI4 B;  3CD6 V;  1DTO A;  2BSK B;  4DV6 B;  4DV2 O;  1N32 B;  2Y69 C;  2BSK A;  2PI4 A;  1Q86 W;  4KFM A;  1EZJ A;  1TVK A;  3CJH B;  1QLN A;  3ABM C;  1OCC C;  2CAZ C;  3H1I H;  5LGU A;  4EB6 A;  5LA6 A;  4B3R O;  4UCT A;  5EBW C;  1K4D C;  4YIP A;  3M7M X;  4DV3 B;  1NR7 A;  3SPC A;  1N33 B;  2Y0P A;  1TGO A;  2UXN A;  3LDE A;  1M57 C;  3L74 H;  3K0G A;  1F23 A;  4FLZ A;  4TQF A;  1TUB A;  4B7K A;  4TUY B;  5EYP A;  5CA1 B;  2P90 A;  4X64 B;  2WAM A;  4DR5 B;  1Y76 A;  4E2L A;  2HP8 A;  2ZT9 B;  2JIZ G;  5CA1 A;  5JCO C;  2QWP B;  4EEQ A;  2PZS A;  2P5O A;  3AG2 B;  2JGU A;  4NXN B;  1LUW A;  4JAA A;  3ABT A;  3N2G B;  3SGI A;  2QWO B;  1K7D A;  4O2B B;  2H94 A;  3FX7 A;  1OZ0 A;  3K9A A;  3N2G A;  1Q81 W;  3B09 A;  4IT5 A;  3I5D A;  3RYF A;  3RGB A;  2UUC B;  3CRR A;  1F4M A;  2ZD9 A;  2HVK C;  1XNQ B;  4LR3 A;  2RQ6 A;  3FB7 C;  2X7R B;  4X62 B;  4CS2 A;  1G4Y B;  2Q0A A;  1O9G A;  4PA4 A;  1MSW D;  2DYS B;  3LNN A;  1VQ7 V;  3WB1 A;  2F43 G;  1EM1 A;  5B1O A;  1MG1 A;  5LOV B;  4DR7 O;  2WPD G;  2YI9 A;  1QNM A;  5GTH Z;  1SQX H;  3AG4 C;  2VQE O;  1XOU A;  3AK3 A;  3B2E E;  3CRC A;  3B8N A;  4BIU A;  2ZCE A;  4J42 A;  4GUN A;  3SPJ A;  3D36 A;  3GWO A;  3T1Y B;  2WLI B;  3ZED A;  1YJW V;  3RFR A;  4MS2 A;  5FNV B;  2WLI A;  3DSQ A;  5L3F A;  2W0X A;  5TIS Z;  1NI8 A;  1F4N A;  4ZI7 B;  3K0D A;  2XAJ A;  1GN3 A;  4LFC B;  5EBL C;  4J11 A;  2UXC O;  2A9H A;  3CS5 A;  4XDL A;  2ZQM A;  1PL0 A;  2Y4T A;  4CS4 A;  1Q7Y W;  2OWO A;  3A0B Z;  1VQL V;  4K35 A;  3X2Q C;  2CH7 A;  4DV5 O;  2QM7 A;  4PA6 A;  3ZJZ A;  4DUY B;  4AI8 A;  1HNZ B;  2LFR A;  3ABK C;  2G38 A;  2Q8V A;  3ABL B;  4TV9 B;  2ETN A;  3UCS C;  3RYC A;  4I50 A;  3RT3 C;  3H1L H;  4MTX A;  4GKK O;  2XAG A;  4LFB O;  2IH1 C;  1VF7 A;  4LF4 O;  2A7W A;  3KCX A;  1U97 A;  3DXR B;  1PL4 A;  4J7K A;  4BW9 A;  1TAE A;  5LYJ B;  1Q43 A;  3RWR D;  1QVG U;  1MA1 A;  2CK3 G;  2DWD C;  1GN6 A;  3OR6 C;  2AGA A;  1KEC A;  2NLJ C;  4J41 A;  3L70 H;  2YS8 A;  1XRE A;  1I94 O;  2QE7 G;  1US6 A;  3OUF A;  5IYB O;  5DEC A;  4FJC C;  1RM1 B;  1Z5W A;  2C2A A;  1SQV H;  1IDS A;  2ITD C;  2NR5 A;  2HEP A;  1GK9 A;  4TWK A;  4TOI A;  3ZHT A;  5D5Q A;  1NQT A;  3CMA V;  4RUE A;  2YIA A;  5LXT B;  2N05 A;  1HW7 A;  3OTF A;  1XQ8 A;  5LXT A;  1AI6 A;  3ICX A;  3QO5 A;  5IE9 A;  2JS3 A;  3AEI A;  3R66 A;  3UM7 A;  4DR6 O;  4BR6 A;  3CCR V;  3A0R A;  4CZZ A;  4DR4 O;  1XMO O;  2DN9 A;  4I55 B;  2R70 A;  2WLM A;  1KC8 W;  4H44 B;  4PDR A;  4ZBM A;  3OW2 U;  1M5I A;  3R65 A;  3IAY A;  2V1D A;  2EIM B;  2ZIM A;  5KX5 A;  1OCZ B;  2LW1 A;  2MW2 B;  2YIB D;  2OCH A;  4NTW A;  2IJK A;  4W4K A;  2UUB O;  2F4V B;  5JH7 B;  4F6E A;  2A0L A;  1SZX A;  1VQK V;  1PM9 A;  1AJN A;  3KG2 A;  4MW3 A;  4IIJ A;  2EZO A;  5JH7 A;  4YJ3 B;  2P67 A;  1BCC H;  1HNW B;  4MSW C;  5B66 Z;  2F66 C;  2ZE8 A;  3OT7 A;  4YJ3 A;  3JCZ A;  1YDX A;  3B40 A;  2Q9L A;  3ZBH A;  5IYC O;  2RNB A;  2VWJ A;  4LF8 B;  4UV9 A;  5FPR A;  2ARH A;  1ZWI C;  2EIN C;  4PA3 A;  2DQ0 A;  4JTC B;  4X20 B;  3FAV B;  4DUZ O;  4PDL A;  1IBK O;  2E5L O;  3B77 A;  2ZDI A;  5L3D A;  2ZXW B;  3FAV A;  1KB9 F;  3CB2 A;  5EK0 A;  1QBZ A;  3LSU A;  2QWN B;  4EFB A;  1SC5 B;  3T4D A;  3APO A;  3ZMS A;  4LF7 O;  2UXD B;  1Q6I A;  1WLE A;  2UUA B;  1CP9 A;  2QTS A;  5IYZ B;  1YZB A;  3CRA A;  4LNU B;  2H8P C;  5IYZ A;  4W4L A;  4O4L B;  4LNU A;  4PEL A;  3CXH F;  4CC6 A;  4DYL A;  4G27 B;  3E8H A;  3SPI A;  3WU2 Z;  3E83 A;  1SET A;  4O4L A;  5J2U B;  3JAW B;  4ZOL A;  4ABM A;  5J2U A;  5BY1 A;  2JK5 C;  1YXB A;  2HFE C;  4FM2 A;  4CH5 A;  4JI2 B;  1M56 C;  1HNX O;  4NXM B;  5E79 Z;  4QE7 A;  2CE4 A;  4WFB V;  1PKX A;  3SYA A;  5KHG A;  1IX9 A;  3E8G A;  3CCS V;  2CGO A;  2FKX A;  4YY3 O;  4NVP A;  3ETG A;  4BIZ A;  2PTM A;  3CC7 V;  2NN4 A;  1KMI Z;  4X1Y B;  3ZMZ A;  2WA4 A;  1K8A W;  4PJ0 Z;  3CPW U;  1Q6U A;  2Q6A A;  1VEW A;  3AG3 C;  3BY6 A;  1Q5O A;  3JYC A;  2IJH A;  3K08 A;  2OTL V;  3STZ C;  4DV1 B;  3JD3 A;  3CE2 A;  2N74 A;  4LF9 B;  2PUS A;  3OEH G;  5ITZ B;  1XHX A;  5LMN B;  2YID A;  3BAA A;  1Z5V A;  4BAY A;  1IVS A;  3BRC A;  3ZRS A;  4DR1 O;  1GO3 F;  2E74 B;  1TUE B;  4XDJ A;  3LDD A;  2ZIN A;  5IWA O;  1ZTE A;  1MMM A;  5CA0 B;  4R7C A;  1SF9 A;  5L3E A;  1O9H A;  5B5E Z;  3TK1 A;  4B3S B;  1TA8 A;  3IJ4 A;  3L72 H;  1GN2 A;  4PHZ A;  1DGS A;  4GKJ B;  2CDY A;  5C8Y B;  3WG7 C;  3K79 A;  3E22 B;  5C8Y A;  1IUR A;  1OJH A;  1XUQ A;  2E75 B;  5JWP A;  2D3O W;  2EJR A;  1M93 A;  1W59 A;  4X1K B;  5JJJ B;  4FIP C;  2ZE6 A;  4KHP O;  4JI8 B;  1Q82 W;  2OIE A;  1MOF A;  5CBH A;  1NU1 H;  2KB1 A;  4DRX B;  5BMV A;  4G2K A;  3CRM A;  2DQ3 A;  1SZT A;  4B08 A;  3E2E A;  4K0K O;  4B3T O;  2UU9 O;  5BR8 B;  1ENV A;  2DWE C;  1EN6 A;  1K97 A;  3VBB A;  4X8A A;  3L71 H;  1XNR B;  2UXB B;  3CCU V;  4H37 A;  5BXZ A;  3L9D A;  1EBO A;  1P7B A;  4X64 O;  3STL C;  4FMT A;  3OTO B;  1Z2G A;  1R73 A;  5H5N A;  3N2K B;  1PD3 A;  4JI6 B;  3SPH A;  2KSD A;  2YDE A;  1S3J A;  3BCC H;  1R3L C;  2JJ1 G;  3E86 A;  1B06 A;  1IBL O;  3ASO C;  1K5S A;  1SRY A;  4JZG A;  2Q0O C;  1MZF A;  3K57 A;  4O2A B;  4UCR A;  5L3C A;  1N0J A;  4FZ1 A;  2PYL A;  3PJS K;  1YJN V;  5B1B B;  3BA9 A;  1LNQ A;  1MAB G;  2NNU A;  1OCR B;  4QIW F;  2R9I A;  3GVM A;  1X59 A;  2VS0 A;  4GX5 A;  4IGG A;  4DR2 O;  1SA0 B;  4X66 O;  4X65 B;  4J9Y B;  2QM4 A;  1SQB H;  3CX5 F;  1ZL8 A;  2QWR B;  1SA0 A;  2YIB A;  4YHH O;  1S5L Z;  2WLJ A;  4ZKI A;  3ZHS A;  2RDC A;  1GRJ A;  1COW G;  3H1K H;  4RQF A;  3H1J H;  5LP6 C;  3JAT A;  2Y69 B;  1TVK B;  3JSL A;  2W6J G;  1HR0 B;  3IC7 A;  4EB6 B;  4IYH A;  3ZRW A;  1B6Q A;  5LA6 B;  3JD2 A;  2LP7 A;  3ABM B;  1OCC B;  3S3X A;  5J2T A;  3K3W A;  1YEW A;  3ZX6 A;  3ZN0 A;  3DTU B;  1AR4 A;  2GDS A;  2OIG A;  4UVB A;  4Q20 A;  4FLT A;  4JI7 B;  1JFF A;  1KP3 A;  2BTQ B;  4NR1 A;  3JAR A;  1XMQ B;  3DC6 A;  2XAS A;  5KAI Z;  4PI2 A;  5F2V O;  4JI0 O;  1VQO V;  2BTQ A;  3TGU H;  1B04 A;  2KKW A;  1M57 B;  1TUB B;  3MD0 A;  3L73 H;  2JDI G;  4DV0 O;  4A5U B;  5EYP B;  4BIO A;  4X89 A;  2PF4 E;  2QJ1 A;  3JSN A;  2QEX V;  3T1H B;  1Y76 B;  3WB0 A;  2B5U A;  1FAF A;  3WB2 A;  1HNZ O;  2JJ2 G;  4KP4 A;  1GTO A;  1NBM G;  1JJ2 U;  4MVZ A;  2YEV A;  1J5E B;  4LF5 B;  5JCO A;  5EZY B;  5LGN A;  1I0H A;  4R50 A;  1FS0 G;  2Q4P A;  2VWK A;  3O65 A;  4N21 A;  5EZY A;  1V54 C;  2BCC H;  2EIK C;  4MVR A;  2HJF C;  4PI0 A;  4H0L B;  3RYF B;  4LH6 A;  3H01 A;  1GAX A;  4JTA B;  1N36 B;  3WFV A;  4K8X A;  1PNM A;  5BZB A;  1QCE A;  4O4I B;  4UB6 Z;  1YTF B;  4LFA B;  1R3J C;  4JI3 B;  3CHX A;  1XEQ A;  1N4C A;  4O4I A;  4JAV A;  1FJG O;  2IU0 A;  1L0L H;  1QR9 A;  2L6L A;  5JJN B;  4MW8 A;  3EFF K;  4JI1 B;  1GMG A;  3ZMT A;  5D5P A;  4FFK A;  1FPO A;  2JVD A;  1YJ9 V;  4B7E A;  1FXK C;  3RYH B;  4QE9 A;  3AG4 B;  3VQX A;  1K4C C;  1FXK A;  4X88 A;  3F5T A;  1JA8 A;  3RYH A;  1AP6 A;  3P3P A;  1NVP B;  4PA9 A;  2HJD A;  1OV9 A;  1VF5 B;  3SYO A;  4PD4 F;  4P9O A;  1AIL A;  4DV4 O;  5CN0 A;  3CRQ A;  2GUZ A;  3JD1 A;  4F6R B;  3P30 A;  3PN1 A;  4LC1 A;  4HZ3 A;  4R8C A;  4F6R A;  4H33 A;  1H38 A;  3FB6 C;  1E1R G;  4NB5 A;  4DV2 B;  1AVM A;  3TJT A;  2ZKO A;  4UCO A;  3RW0 A;  5B1A C;  3W7S A;  4FFB A;  2R9R B;  4Z1V A;  2E3C A;  2Q7H A;  1K33 A;  2CH7 B;  4JI5 O;  4OPH A;  1UFI A;  2ADQ B;  3CCJ V;  3X2Q B;  4TV8 A;  4R6Z A;  4U3J A;  5B3S C;  1R1B A;  3HKE A;  3ABK B;  1H2K A;  5JQG A;  3RYC B;  2JGD A;  3SJA C;  4FPP A;  4I50 B;  4Z2W A;  1EN5 A;  3VQV A;  4DO2 A;  2Y0I A;  3OMA B;  2DJV A;  3OGC C;  3AG7 A;  1THZ A;  4UXN A;  1PNK A;  1MSD A;  2ZNJ A;  1HNW O;  1NKD A;  3AG1 B;  3AG1 C;  3P3N A;  1ZX3 A;  2ZE5 A;  4AIL C;  5DED A;  3MAQ A;  4QPK A;  4QJF B;  5GW7 A;  3ETD A;  2LFS A;  1W0K G;  1Y4M A;  4DK0 A;  3CME V;  1EZV H;  5L3G A;  4FLY A;  3JAM N;  4JGS A;  2V7Q G;  4IYI A;  2WLL B;  1W2B U;  1SER A;  3T2M A;  1BL8 A;  1HP8 A;  3K58 A;  4WFA V;  2WLL A;  2UUA O;  3A0H Z;  3B4S A;  4NTX A;  1KU9 A;  1DLB A;  1LR1 A;  5LHH A;  4UVC A;  1P49 A;  2LJ2 A;  4HYO A;  3SPG A;  3K5M A;  4FLU A;  1SQF A;  2P22 C;  4DR7 B;  5HFM A;  1CPY A;  1IBM B;  3G71 V;  4I9W A;  1OCO C;  2VQE B;  1NS1 A;  3HKB B;  1ORQ C;  2EZP A;  4JV5 O;  1NH2 B;  1R3I C;  3C90 A;  3HKB A;  4WFE A;  3FB5 C;  1NZ6 A;  1Y6X A;  2YIC A;  1JX9 A;  4MVQ A;  2ILM A;  3CC2 V;  1IZ3 A;  4QGP A;  3THO A;  1SS3 A;  2ZNI A;  4DW1 A;  1CEZ A;  2HG5 C;  4I9Q A;  1UPG A;  2Q68 A;  2F95 B;  2F1M A;  2X6A A;  5K1P A;  2CGN A;  5KX5 B;  3AK2 A;  2VQF O;  1KYO F;  4UCU A;  4D7T A;  3MDS A;  2UXC B;  1H2S B;  4FM0 A;  5KA6 A;  1VAR A;  4IIJ B;  3OFN G;  2EX3 A;  5E1A C;  4ZHQ B;  2RCV A;  1JMK C;  2XOK G;  1KQS U;  4ZHQ A;  2EIL C;  3E35 A;  1BHB A;  1I5X A;  3QO8 A;  3UO2 A;  4DV1 O;  1FXH A;  3LUT B;  2GV9 A;  1QR8 A;  2EBO A;  4LF9 O;  2EIN B;  2HHH O;  4YXW G;  3SR2 C;  3H1H H;  3HKC B;  4GKK B;  2Q69 A;  3M99 B;  4MVO A;  5KMG A;  1WN7 A;  2Q7E A;  3O9O A;  2DMX A;  3HKC A;  3IGA C;  4LF4 B;  5IT9 N;  2EUL A;  2JS5 A;  1J95 A;  3GB7 C;  2WWW A;  5LMU O;  1I5Y A;  3SJB C;  3ZCC A;  4G28 B;  1MZE A;  2P6J A;  4YIO A;  2LGW A;  1VQP V;  1H8H G;  3A8T A;  4NKG B;  2UXX A;  4L8J A;  5B1N A;  5IJ0 A;  4B3S O;  2ADP A;  3K06 A;  1AR5 A;  4GKJ O;  1S77 D;  2OYQ A;  3ASN C;  4ZOL B;  1PPJ H;  4B3M B;  3DGE A;  1I94 B;  4I0X B;  2BOB C;  2RMK B;  4L87 A;  1X4T A;  5CB4 B;  1Y74 A;  1N34 O;  4I0X A;  4LH7 A;  1M56 B;  1XL6 A;  4AHC A;  4JI8 O;  1WB7 A;  3VQW A;  5CB4 A;  2LGQ A;  3U0Z A;  2CTW A;  1G6U A;  1S5H C;  2WLN A;  5KHI A;  4UV8 A;  2EIJ C;  3I55 V;  3RBZ A;  1XDC A;  3UKM A;  2M6Y A;  1WNS A;  1ZUQ A;  4DV7 O;  3C3T A;  3TCU A;  3M8A A;  3N27 A;  1XNR O;  1D5N A;  4LF6 O;  4HNA A;  1BZK A;  2IJJ A;  4DR6 B;  2DE0 X;  4DR4 B;  2QKS A;  1XMO B;  1Q8I A;  3OTO O;  2ODM A;  3D3Q A;  4JI6 O;  3AG3 B;  4FM1 A;  2LQT A;  2OT5 A;  5LHI A;  5GON A;  4JYA B;  3J81 N;  4DR3 O;  4X9Q A;  3SJQ C;  4PV1 B;  1S0V A;  5H2F Z;  2UUB B;  5JJE B;  2O57 A;  1RPR A;  3L75 H;  4WCE V;  2IW5 A;  3TXS A;  1SES A;  2HKO A;  5KUK A;  2XAQ A;  5IY5 C;  1M1K W;  1EN4 A;  4FZ0 A;  2AHZ A;  1YHQ V;  1DF4 A;  5A9G A;  1V55 C;  2KG7 A;  4YJ2 B;  5HFL A;  2ZM6 B;  3G4S V;  4DUZ B;  2IBZ H;  3QVN A;  1IBK B;  4YJ2 A;  2E5L B;  2QSA A;  3ZRX A;  4JI4 O;  3Q4H A;  4GZR B;  3NR7 A;  5CBF A;  4DV6 O;  1N32 O;  4MVS A;  3WG7 B;  1YVW A;  1URF A;  1SQQ H;  3FB8 C;  1QLE C;  4C7U A;  3J80 N;  3C3S A;  3LSQ A;  1ZLZ A;  3APQ A;  4DV3 O;  5KUM A;  3EVK A;  5BMV B;  2OCC C;  4JI7 O;  4AQY B;  3SYP A;  1XMQ O;  3SYQ A;  2FB5 A;  4O4H A;  1N33 O;  3DC5 A;  3W7X A;  1E79 G;  1VQM V;  4P30 A;  3CCM V;  2AW9 A;  1YF2 A;  1HNX B;  2X0L A;  1YCI A;  3NXS A;  2P4K A;  3JAL A;  4WBN A;  4U7O A;  4DR5 O;  1N8R W;  4JAU A;  1J5E O;  1NR1 A;  2D2C B;  4YY3 B;  1YI2 V;  2BE3 A;  1LUV A;  3IC9 A;  1XIL A;  4P2Z A;  4NXN O;  3FKS G;  2R9A A;  3ASO B;  4FLV A;  5LHG A;  4Z1M G;  1VP7 A;  2CUG A;  3CSX A;  1KP2 A;  3K5O A;  1WPX A;  4QPJ A;  2L35 A;  2UUC O;  4MVU A;  1XNQ O;  2FTK A;  2VRZ A;  4X62 O;  1G1X B;  5H9C A;  4H13 B;  3F7V C;  3RVY A;  2CTR A;  1AR1 B;  4JI1 O;  1ZL8 B;  2YXY A;  3TET A;  2Y4U A;  1IXM A;  3F7Y C;  2ZR2 A;  4TSF G;  1VMG A;  1WP7 A;  1S72 V;  1WA8 A;  2A3Q A;  4JF3 A;  4UUJ C;  4FK5 C;  4DR1 B;  1R6T A;  3JAT B;  2DYR C;  5K1X A;  2Q73 A;  3GWK C;  1XHZ A;  3BAB A;  5LP6 B;  1I08 A;  2GTA A;  3ZRW B;  4WF9 V;  3T1Y O;  5KLV H;  3I56 V;  5LP6 A;  1RFY A;  1WB8 A;  1H2G A;  1Q3E A;  1BE3 H;  5J2T B;  4IHJ A;  5H6R A;  3G80 A;  4BWA A;  2B9Z A;  5LL6 Y;  5KHH A;  3CCL V;  4O4J A;  4I7Z B;  4U7N A;  1JFF B;  1RSO A;  3JAR B;  3D3I A;  2Y48 A;  3BFR A;  4LFC O;  1M90 W;  2AZ0 A;  3K5L A;  1BS3 A;  3ETQ A;  4J7Z A;  2HLD G;  4FVM A;  1VF6 C;  3EHB B;  1MNG A;  3CJH A;  3T4Z A;  4UVA A;  4OX9 B;  4KHP B;  2AXT Z;  3B8M A;  3JAK B;  1VF6 A;  3QTC A; 
#chains in the Genus database with same CATH homology
 2OCC B;  3AG1 B;  3AG1 C;  2YEV B;  5EK0 A;  1QBZ A;  3QNE A;  3T4D A;  5EC1 C;  4XBF A;  3ZMS A;  3RVZ A;  3W7T A;  1WLE A;  4QPK A;  4QJF B;  5GW7 A;  4QNH B;  3LDC A;  3ETD A;  3ETE A;  2LFS A;  1FFT B;  1CP9 A;  1W0K G;  4I5S A;  1Y4M A;  4WFF A;  1H8E G;  3CME V;  1V54 B;  2EIK B;  5L3G A;  1GKF A;  5L3B A;  2H8P C;  2IH3 C;  1PNL A;  4JGS A;  3CCE V;  4PEL A;  2V7Q G;  4RO2 A;  4G27 B;  3E8H A;  1HWY A;  3SPI A;  3E83 A;  2WLL B;  1SET A;  1W2B U;  1SER A;  2X6C A;  3T2M A;  3W7W A;  1BL8 A;  4WFA V;  2WLL A;  2PI5 A;  4MT8 A;  3ZMU A;  3AG2 C;  2JK5 C;  1XL4 A;  2HFE C;  1UJW B;  1DLB A;  3LSS A;  1FXV A;  1M56 C;  1F51 A;  4QE7 A;  5LHH A;  4UVC A;  5IDJ A;  2W0F C;  1L1F A;  4HYO A;  4WFB V;  3MHH C;  3SPG A;  1PKX A;  3SYA A;  1FXK B;  4WFG A;  1CPY A;  5HFM A;  3G71 V;  1JVM A;  4I9W A;  3E8G A;  1VQ5 V;  1NJI W;  1OCO C;  1VQ4 V;  3CCS V;  1ORQ C;  2EZP A;  1NH2 B;  3ETG A;  1R3I C;  2A79 B;  4BIZ A;  5LBQ A;  4J9Z B;  2IU3 A;  4WFE A;  3CC4 V;  3CC7 V;  3FB5 C;  3G6E V;  2B1I A;  2DYS C;  1JX9 A;  3ZMZ A;  4MVQ A;  2YSU B;  1K8A W;  3CC2 V;  1S76 D;  4N23 A;  3ABU A;  1K92 A;  1CEZ A;  3CPW U;  2HG5 C;  2Q6A A;  1NH2 D;  5CBG A;  2Q68 A;  3AG3 C;  3BY6 A;  3JYC A;  2IJH A;  3K08 A;  2X6A A;  1YIJ V;  2OTL V;  2DYR B;  2GHY A;  2HR3 A;  5B1B C;  3STZ C;  1VQ9 V;  1OCR C;  4LCU C;  1BHA A;  3E89 A;  2K1E A;  3JD3 A;  4PA7 A;  4F4L A;  3OR7 C;  5B1A B;  5KA6 A;  3OEH G;  1VQ6 V;  1GM7 A;  1ARO P;  3OFN G;  2ATK C;  3CP1 A;  5E1A C;  4JPR A;  4BAY A;  1QVF U;  4OXS A;  1JCH A;  2XOK G;  3ZRS A;  1KQS U;  5DN6 G;  1JOY A;  2BOC C;  1GO3 F;  2EIL C;  3E35 A;  5B3S B;  3CD6 V;  1DTO A;  2GSM B;  1R6N A;  3CCQ V;  1BHB A;  1I5X A;  3QO8 A;  1FXH A;  1W0J G;  1TUE B;  3LUT B;  2Y69 C;  4XDJ A;  3LDD A;  1QR8 A;  4MVM A;  2EBO A;  2PI4 A;  2WLK A;  1Q86 W;  3ZMV A;  2EIN B;  4YXW G;  4KFM A;  1EZJ A;  1QLN A;  3ABM C;  1OCC C;  4R7C A;  5LGU A;  2Q69 A;  2JEX A;  1JPX A;  3M99 B;  4MVO A;  5L3E A;  3TK1 A;  3FYE B;  1AI4 A;  5EBW C;  1K4D C;  3IGA C;  2XAH A;  5J9P C;  3OMI B;  2B1G A;  1J95 A;  1NR7 A;  3GB7 C;  2WWW A;  1BMF G;  3ABL C;  3WG7 C;  1I5Y A;  3K79 A;  3SPC A;  3ZCC A;  4G28 B;  1AI5 A;  2P6J A;  2UXN A;  1VQP V;  1H8H G;  2M7W A;  1M57 C;  2EJR A;  3LDE A;  2D3O W;  4RQE A;  3K0G A;  1DF5 A;  1F23 A;  2UXX A;  4KUM A;  5B1N A;  4FIP C;  2AHY A;  1Q82 W;  4XDK A;  3K06 A;  1MOF A;  5CBH A;  3OUS A;  2P90 A;  4LBE C;  2WAM A;  1S77 D;  5FL7 G;  4E2L A;  1EFR G;  2KB1 A;  3ASN C;  2JIZ G;  2WSS G;  4GX0 A;  4G2K A;  1AI7 A;  3DGE A;  2DQ3 A;  1SZT A;  3E2E A;  2BOB C;  4L87 A;  3AG2 B;  4DXW A;  1ENV A;  1YSC A;  2DWE C;  1ROP A;  3MHS C;  3ABT A;  5H6Q A;  1K97 A;  3VBB A;  4X8A A;  3CCV V;  2QTO A;  1M56 B;  1XL6 A;  3ZIA G;  1K7D A;  3CCU V;  2H94 A;  4H37 A;  1OZ0 A;  1EBO A;  1P7B A;  3K9A A;  1Q81 W;  3STL C;  4FMT A;  1S5H C;  2WLN A;  4LP8 A;  1R73 A;  4UV8 A;  2EIJ C;  1OCO B;  1PD3 A;  1F4M A;  2ZD9 A;  2HVK C;  4HAM A;  3I55 V;  3RBZ A;  2ZR3 A;  3IFX A;  3T1C A;  3SPH A;  3UKM A;  3FB7 C;  2X7R B;  2QA4 V;  1S3J A;  1G4Y B;  1R3L C;  2JJ1 G;  3TCU A;  3E86 A;  2HVJ C;  4PA4 A;  2QM8 A;  3ASO C;  1MSW D;  2DYS B;  3FYI B;  1RM1 C;  1K5S A;  1SRY A;  1YIT V;  2IJJ A;  1VQ7 V;  2F43 G;  1E1Q G;  1Y66 A;  5B1O A;  2QKS A;  1MG1 A;  2WPD G;  5L3C A;  1K5Q A;  3CYO A;  3AG4 C;  3AG3 B;  3PJS K;  1YJN V;  3B8N A;  2OT5 A;  3LNM B;  5LHI A;  5LGT A;  4BIU A;  5B1B B;  1LNQ A;  1MAB G;  2NNU A;  1OCR B;  4QIW F;  2R9I A;  1AJP A;  3SJQ C;  3SPJ A;  1S0V A;  3D36 A;  4GX5 A;  3GWO A;  2WLI B;  1YJW V;  1OHH G;  4J9Y B;  2IJI A;  4MS2 A;  5EBM C;  2WLI A;  1RPR A;  5KA5 A;  2XAF A;  5L3F A;  4WCE V;  2WLJ A;  2IW5 A;  4ZKI A;  4RAI A;  1SES A;  1VQ8 V;  1F4N A;  3K0D A;  2Q67 A;  2EIL B;  2XAJ A;  1COW G;  1JQ0 A;  3ML0 A;  2HKO A;  5KUK A;  2EIM C;  2XAQ A;  5EBL C;  5IY5 C;  4RQF A;  1M1K W;  4GX1 A;  1OCZ C;  1R6K A;  2AHZ A;  2A9H A;  2Y69 B;  3HB3 B;  3VOU A;  1YHQ V;  4XDL A;  2W6J G;  2ZQM A;  1DF4 A;  1PL0 A;  3IC7 A;  3K03 A;  4JYC A;  2P7T C;  1Q7Y W;  3ZRW A;  1B6Q A;  1V55 C;  3JD2 A;  2LP7 A;  3ABM B;  3F5W C;  1OCC B;  5HFL A;  3G4S V;  3K3W A;  4TT3 G;  1VQL V;  3ZN0 A;  3DTU B;  3X2Q C;  2QM7 A;  4UVB A;  3ZRX A;  4PA6 A;  4Q20 A;  3ZJZ A;  2LFR A;  3ABK C;  1KP3 A;  5CBF A;  3ABL B;  4JTD B;  4MVS A;  3WG7 B;  2XAS A;  1VQO V;  4JYB A;  4PDV A;  5C93 A;  1K3E A;  4MTX A;  1M57 B;  3FB8 C;  2ZDI C;  1QLE C;  3MD0 A;  2X6B A;  3HPL C;  2JDI G;  5CA3 A;  2XAG A;  2Z5U A;  4X89 A;  2IH1 C;  2QEX V;  3OE7 G;  2ZXW C;  4GCZ A;  4MTO A;  3LSQ A;  2B5U A;  5KUM A;  2OCC C;  3SYP A;  3ASN B;  2JJ2 G;  4KP4 A;  3SYQ A;  1GTO A;  1NBM G;  1JJ2 U;  4MVZ A;  2XND G;  2YEV A;  2JEU A;  3W7X A;  1P4R A;  1E79 G;  5LGN A;  4R50 A;  1VQM V;  4P9P A;  4P30 A;  3CCM V;  1FS0 G;  4N21 A;  1V54 C;  1QVG U;  1GM8 A;  2DWD C;  2CK3 G;  2EIK C;  4MVR A;  2X0L A;  1KKD A;  2HJF C;  3NXS A;  3OR6 C;  4ASU G;  1KEC A;  2NLJ C;  3H01 A;  3JD4 A;  4U7O A;  4JTA B;  3E8B A;  3CXC U;  3WFV A;  1PNM A;  4MTF A;  1N8R W;  5BZB A;  2EIJ B;  1QCE A;  4JAU A;  1YTF B;  1M9N A;  1R3J C;  3OMN B;  1K9M W;  1NR1 A;  1R3K C;  1YI2 V;  5IYD O;  4JAV A;  2QE7 G;  3OUF A;  2IU0 A;  4P2Z A;  1QR9 A;  5EC2 C;  3FKS G;  5IYB O;  4MW8 A;  3ASO B;  3EFF K;  4FJC C;  5LHG A;  1RM1 B;  2C2A A;  1GMG A;  3ZMT A;  4Z1M G;  1KP2 A;  2ITD C;  1YTF D;  4WFH A;  1YJ9 V;  1WPX A;  1G8M A;  4QPJ A;  1FXK C;  1VQN V;  1GK9 A;  4QE9 A;  4TWK A;  1NQT A;  3AG4 B;  4MVU A;  1K4C C;  1FXK A;  4X88 A;  2WLH A;  3CMA V;  4RUE A;  2FTK A;  4PDM A;  1NVP B;  3SYC A;  4PA9 A;  5H9C A;  1AI6 A;  3F7V C;  3RVY A;  3SYO A;  3QO5 A;  1AR1 B;  4P9O A;  1RPO A;  3AEI A;  3UM7 A;  4GX2 A;  3E8F A;  3CCR V;  3A0R A;  4CZZ A;  3TET A;  5CN0 A;  2WLM A;  1IXM A;  1KC8 W;  3F7Y C;  3JD1 A;  4PDR A;  3P30 A;  2ZR2 A;  4TSF G;  3BEH A;  4ZBM A;  1NVP D;  4LC1 A;  1S72 V;  4HZ3 A;  3OW2 U;  4R8C A;  4JF3 A;  3R65 A;  4UUJ C;  4FK5 C;  4H33 A;  4GT1 A;  1H38 A;  3FB6 C;  2DYR C;  1E1R G;  2V1D A;  3QO7 A;  1AJQ A;  2EIM B;  5IY5 B;  3OM3 B;  1OCZ B;  4EKW A;  3ZRW B;  4WF9 V;  4MTG A;  2IJK A;  3RW0 A;  3I56 V;  5B1A C;  1H2G A;  3W7S A;  2R9R B;  1V55 B;  3JD0 A;  5H6R A;  3OAA G;  3W7U A;  2A0L A;  1VQK V;  1AJN A;  3KG2 A;  3P32 A;  4MW3 A;  1K33 A;  5CMU A;  2EZO A;  2P67 A;  1GM9 A;  3CCL V;  3K04 A;  3CCJ V;  2W6I G;  3X2Q B;  4U7N A;  4R6Z A;  1K34 A;  2Z3Y A;  4MSW C;  4BW5 A;  3D3I A;  5DM6 V;  2MK3 A;  4CBC A;  5B3S C;  1K73 W;  2Y48 A;  3JCZ A;  3ABK B;  5IYC O;  1M90 W;  3OEE G;  1KD1 W;  3ZRV A;  4FPP A;  2OTJ V;  4UV9 A;  1ZWI C;  2EIN C;  4DO2 A;  3OMA B;  4PA3 A;  2DQ0 A;  3OGC C;  4JTC B;  1THZ A;  4UXN A;  2HLD G;  1QLE B;  4PDL A;  4JAS A;  3EHB B;  3T4Z A;  1PNK A;  4UVA A;  3B77 A;  3B8M A;  2DW4 A;  2ZDI A;  3ZN1 A;  5L3D A;  2ZXW B;  2ITC C;  1NKD A;  4RUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...