2IJHA

Crystal structure analysis of cole1 rom mutant f14w
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
57
structure length
57
Chain Sequence
GTKQEKTALNMARWIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 28
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijhA00
1PD3A 1RPRA 1F4MA 1NKDA 1ROPA 2IJJA 2GHYA 4DO2A 1GTOA 3K79A 2IJKA 2IJHA 1RPOA 1F4NA 1B6QA 2IJIA 1GMGA
chains in the Genus database with same CATH superfamily
2ODMA 2LW7A 1Q6HA 3GB7C 3DGEA 3SPJA 2CUGA 3L70H 2GTAA 2QKCA 1V55C 2GUZA 4IHJB 1SA0B 3CX5F 5H9CA 2LFRA 5CA0B 1QVGU 2UXXA 1JVMA 2ZR3A 1XQ8A 3STLC 3ETQA 1N4CA 3LSSA 3T1HO 3R66A 2WA4A 3IFXA 5KAIZ 3ZX6A 1YDXA 4DV2O 1MNGA 4GKKO 5B5EZ 1AI4A 2YXHA 4DR7O 1KKDA 2E75B 4J42A 3ABMB 3AEIA 4U3FH 4O2AB 4DK1A 1NR1A 3A0RA 4H0LB 3K79A 3G67A 1YCIA 3E8FA 4D7TA 1XHZA 4KHPB 1NZ6A 2V4DA 4B3RB 4FLZA 1R6KA 3R65A 4B3RO 5IDJA 3E89A 5LGTA 4JI0B 5JCOC 4DR3B 3E35A 3EHBB 4JI0O 4DR3O 2NLJC 3K04A 3E22B 1YITV 3ZN0A 3N2KA 5KHJA 3JD2A 3DC5A 1H2MA 2PYLA 3KCXA 2HHHO 3BHPA 4DR2B 3ZMVA 4MVQA 1BHBA 3P3PA 3JAMN 1YJNV 1PL0A 2Q69A 1K34A 2YIDA 5LYJB 1AR1B 2ZXWC 5GONB 5FNVA 3TGUH 3T4DA 5LMUB 3ZHQA 4O2BA 1IURA 3A0HZ 2P67A 1PL4A 1WPBA 3L72H 3FAVB 4CH5A 4WCEV 2QJ1A 1AP5A 4LP8A 2YSUB 4JYYA 5AG2A 4LH7A 2OWOA 3CXCU 5IYDO 3LNNA 3CXHF 3K5MA 2UXCB 2WA3A 3RGBA 1S72V 1GN2A 3E83A 1VF6C 1VARA 4UVAA 4DV6O 4GX1A 5GTHZ 4AHCA 4ZKIA 4AI8A 2JIZG 1V55B 1H2GA 2DE0X 3UO3A 1AB3A 1B3QA 4I0XA 2A79B 2OCCC 5IE9A 4BWAA 3ZHTA 3TCUA 1B04A 1G6UA 2N05A 4DR4O 2CH7A 3CE2A 4AQYO 4D7SA 4MTXA 1GO3F 5EZYA 5L3BA 1R6TA 1JJOA 4J10A 4X65B 5LXTA 1XMQB 4X20B 2XASA 2IJKA 2EINC 1L1FA 4GLXA 1JFFB 2DMXA 1F7YA 1K97A 5B1BC 1Y6XA 4DV0O 1HNWO 4P9OA 5L3EA 3DC6A 2OYQA 4RUFA 4H37A 2Y0PA 2ZDIC 4LF9O 4QPKA 1SZXA 1A32A 3RYFB 4FVMA 1Z2GA 4X8AA 2JGDB 3P30A 4R6ZA 3BA9A 3LDDA 2F23A 4PELA 4O4JA 1Y76B 1AR4A 3K59A 4X66O 3AG7A 3L75H 5EYPA 1K4DC 3QO8A 3ETDA 3Q4HB 3ABTA 2QM4A 3HKCB 1TUBB 3CCEV 1P4RA 2OTJV 3CRMA 3F5WC 2VQFB 5B1NA 1WLEA 3UT5B 2VQFO 1RM1B 2CGOA 4X64B 1VQLV 3O9OA 2ZXWB 2X0LA 1HWYA 3C3SA 1B6QA 3ZHRA 4G28B 5IY5C 2B9ZA 4H44B 3RT3C 4J80A 1VMGA 2CE4A 2PI5A 4Z2WA 2UUAO 4TUYA 2HLDG 2YDEA 4EB6B 2CAZC 1NT2B 2YEVA 3ZMZA 5FPOA 4UVBA 2JDIG 1VQ4V 1WB8A 2OTLV 2KG7A 4NB5A 4PA6A 4LC1A 5K1XA 2PYJA 2L35A 3SYQA 1YIJV 4LF5O 1YJWV 4N21A 4XBFA 2EULA 1F4MA 1H2SB 1AVMA 1U96A 4FM2A 4JGSA 4OGQB 4YJ3B 4F4LA 4B7KA 3JARB 1OCZC 3W7UA 3K06A 2OCCB 3SJBC 4CH6A 2UXBB 2BTQA 1FXKC 5CB4B 1RPRA 1OZ0A 2DQ0A 1TUEB 3B8MA 3BFRA 5EC1C 1NH2D 1KP2A 4PI2A 2WLKA 5IJ9A 1Y74B 2VS0A 4NXNO 3B4SA 3CHXA 3L9DA 2HVJC 3D36A 2UU9B 1OCCC 1NR7A 1E79G 4UB6Z 4XDJA 1DK1A 4QIWF 3P3NA 4X62O 2EINB 4UV8A 1N0JA 4X1KB 5EBMC 5B1BB 4P9PA 2P90A 1AI7A 3KKYA 1I5YA 1GRJA 3ZN1A 4J11A 4AILC 3IJ4A 4FJCC 4OX9B 2QM8A 3LDEA 1Q5OA 1Q6IA 4B3TB 4HBNA 1SZTA 4PDLA 2Q7HA 1URFA 4LNUB 1YF2A 4GX0A 1I0HA 2CTWA 1RPOA 5J2UA 1FYJA 1SRYA 1QR8A 4LFAO 2VQEB 2ADQB 2Q6AA 2RQ6A 2CTRA 4UXNA 2FYUH 4I55A 3CP1A 5CA1A 1YHQV 4L8JA 4F6RB 2W0XA 4ZOLA 5IY5B 2JGUA 1R1BA 4YIOA 5IYZA 4Q20A 1ZX3A 4UCTA 4PJ0Z 2GHYA 3MHSC 3KZIZ 4N23A 4EFEA 3SPCA 4DV5O 3IGAC 2HJDA 3TJTA 2GV9A 4BIOA 4QJFB 4Z1VA 4DR6B 1JCHA 4J7KA 4LH6A 2E5LB 2BSKB 4BW5A 3U10A 4JI1B 2E5LO 4YHHO 3JATB 3SDLA 1N36O 5IJ0B 2EJRA 4RAIA 1GKFA 2QWOB 5CN0A 1HR0B 4NR1A 2CK3G 3CCUV 4JI7O 1HR0O 3OGIB 1IBMB 3ASNC 5C93A 5JVDA 4MSWC 1OCZB 3J81N 3B8NA 3S3XA 2K1EA 3DXRA 2WLJA 4E4EA 1FXKB 3ASOC 3HKDB 1HP8A 1AI5A 3FB5C 3W7WA 5JQGA 2NR5A 1N34O 2Q73A 2EILC 5LOVB 3BVOA 3HB3B 3SYOA 3G6EV 1NJIW 4JI4B 4JI8B 1N32O 1WB7A 1J95A 2B1GA 4ZHQB 3HKBB 4DR1B 3A8TA 5HFLA 1OCCB 3QNEA 4DR1O 1S3JA 4JI6B 1K73W 3J80N 2QA4V 4JI6O 1XHXA 5IYCO 4FK5C 4ZIBA 4F6EA 4PA9A 1Q6UA 1XNQB 1SQXH 2X6CA 3SPHA 2R9RB 1FFXB 2JK5C 2YICA 3BCCH 2GUZB 2DYSC 1VP7A 1BE3H 2AZ2A 4BW9A 2F1MA 4P30A 2QE7G 4ICGA 1NH2B 2PUSA 1HNZB 5FLXN 3CJHB 2P5OA 2QGNA 2ZIOA 3FYIB 1W0KG 3SPGA 2HG5C 4I4TA 3K08A 5L3GA 4JI3B 2FB5A 4OPAA 2UUBB 1KYOF 1WP8A 2UUBO 3M8AA 3E8BA 4BIZA 5KMGB 2JS5A 3RVZA 4LF4O 4LBEC 2Y4UA 5BMVB 3UO2A 3UM7A 2ZM6O 3SJCC 1M90W 4ZBMA 3SPIA 4JYCA 2XAFA 4I9QA 5LA6B 4IIJB 1U97A 4G2KA 4IYIA 2XNDG 1CEZA 3FFQA 3HKEB 1OHHG 2F93B 3N2KB 4JAAA 4TV8B 3ASNB 4FZ0A 3RVYA 3GWKC 4KUMA 1AP6A 3EFFK 3U0ZA 3JAKB 1VQKV 2ZCEA 1SETA 1PP9H 1DLBA 3ASOB 5KUKA 5KHGA 4TV9A 4MTFA 1PNMA 2DW4A 2Q7GA 1PV0A 4NTXA 2EILB 2AHYA 5FNVB 1K33A 3FYEB 5A9GA 4O2BB 1Y4MA 5LGUA 4K0KB 1FPOA 4MS2A 1D2DA 4MVMA 1O9GA 1JJ2U 2GDSA 4DW1A 3OE7G 2RMKB 3G71V 4L87A 1Q3EA 1RSOA 1NBMG 1XUQA 2MW2B 4X1YB 4GCZA 3JCZA 4U3JA 4WBNB 1P7GA 4YJ2B 2CGNA 3E2EA 3K3WA 4JI5B 1GM8A 1CP9A 4JI5O 4KHPO 4W4KA 3G4SV 2ZNIA 2X6BA 2AW9A 1GMGA 2DYSB 4HYOA 3JD4A 1S76D 2ZQMA 1K5SA 3CC2V 5GTIZ 4G27B 4NTWA 3B77A 4X89A 5L3DA 4DR2O 4MVOA 1AI6A 3OEHG 1G8MA 3CCVV 5EZYB 4ZI7B 3GWOA 3D36C 5A2QN 5HFMA 3OUFA 1RM1C 1CPYA 1M5IA 1ZAUA 3ZRVA 5LMUO 1PNLA 2P7TC 5LGNA 1QR9A 4TSFG 4DXWA 5K1PA 1SA0A 5JH7B 1BQ0A 2E3CA 5CA0A 4YXWG 2LO1A 1R6NA 2B1IA 3K5NA 1WP7A 2R9AA 5FL7G 2UXCO 4UCOA 1EFRG 3APQA 1KQSU 1Y66A 3ZRSA 2G38A 3RYHB 2F66C 2IBZH 3CRAA 2QKAA 3B40A 1KBHA 4DRXA 4IGGA 3OAAG 3VQVA 2IU3A 2EIKC 2PF4E 2EZOA 3B09A 4I5SA 4U7NA 2RCVA 1I5XA 4MW3A 3N27A 1M9NA 4O2AA 3ZIAG 1NQTA 3ZHSA 5LHGA 5DECA 4TT3G 1V54C 1VIBA 1CXZB 4XDKA 3MDSA 1F51A 1DGSA 1MZFA 3W7TA 3OW2U 2ZD9A 4UV9A 1MZEA 4TUYB 3OGCC 1GN3A 5B1OA 4X65O 4X1IA 5KX5A 2IJJA 4QGPA 1XMQO 1ORQC 4BAYA 4FM0A 3T1CA 1D5NA 3QG5A 2KG7B 1WA8B 2OIGA 5B66Z 4EFBA 1SERA 1Y67A 1R3LC 3BA8A 4MVZA 3VQWA 1M56C 3NXSA 3DTUB 3FKSG 2XTAA 1SQPH 4PDRA 1SS3A 2GTSA 4NYKA 3ZHVA 1L0NH 3OR6C 4FIPC 4NVPA 3TXQA 1MABG 3RN4A 4GX5A 1NS1A 4LFBB 4UCVA 4LFBO 2NNUA 3CRRA 1EBOA 4FLYA 3D8CA 5J9PC 1P49A 4OPHA 1S77D 5D5QA 5IJ9B 4D6TH 1EM1A 2DJVA 1BHAA 2Q0AA 3F7YC 3ZRWB 4DV3B 4DV3O 5KHKA 2OT5A 1UFIA 4X64O 1AR5A 1F4NA 3ZBHA 1GTOA 3P32A 4EEQA 2Q0OC 1BMFG 1MA1A 3EXAA 3ZRXA 2XAGA 3L73H 3T2MA 3RW0A 2Z3YA 2DOSA 3I55V 3B2EE 1AJQA 1KD1W 4GKJB 4QE7A 1DTOA 4QPJA 3BPZA 4UB8Z 4O4IB 2Q68A 4RWUA 4W4LA 2KKWA 1VQOV 4C7UA 3PN1A 2EIKB 2Y48A 1BCCH 3CCRV 5J2UB 5J2TA 1K9MW 2H94A 2ITCC 3UCSC 2UUCB 4WFFA 4DUZB 1JR9A 3FB8C 2UUCO 4DUZO 4CH3A 4FFBA 5CBFA 1V54B 2UXBO 4J41A 1QVFU 4I55B 4PDMA 2EBOA 3K5LA 3ZS8C 5JCOA 5IYZB 3ABKC 3T1YB 5LL6Y 3T1YO 4O4HB 2LP7A 4GYCB 2UXNA 1I7FA 3STZC 3CRQA 5EK0A 4MW8A 2UU9O 2RNBA 1NTMH 2K9PA 1Y76A 4JF3A 3APOA 1ZLZA 3IAYA 1NI8A 1UJWB 1RP3B 4O4LB 4YIPA 1RFYA 1SC5B 2ZE6A 3Q4HA 3VOUA 5L3CA 1TUBA 1Z5VA 2LJ2A 4KXRA 1QCEA 1M56B 2BOCC 3H1KH 3AK3A 2PGGA 5KUMA 1YSCA 5D5PA 1FS0G 4JTDB 1FJGB 3BRCA 3DSQA 1WPXA 3SJAC 1L8DA 4FLXA 1FJGO 5JVDB 4OX9O 4DV1B 4ASUG 4B3TO 5LMNB 4LF7B 4I9WA 3ICXA 2ILMA 5FPRA 4EB6A 1IBKB 3WU2Z 3E86A 2WLLA 1K92A 1PPJH 3F7VC 2Y4TA 4I50A 3U11A 5BY1A 3D3IA 4TQFA 1H8HG 2VQEO 2WLHA 1Q8IA 1ZL8B 2XHBA 1IXMA 2JJ1G 1NTZH 2BOBC 4GUNA 4LF8B 4PV1B 4MTOA 1YTFD 2GBOA 3N2GA 2YS8A 1KP3A 3MHHC 2UXDB 1FXHA 1GN6A 4RO2A 4JI2B 3OUSA 3H1HH 3JD1A 4CS2A 2LW1A 1YVWA 1S0VA 2N74A 3RWRD 1VQPV 1Q43A 3SR2C 2QTSA 2VWJA 4LCUC 4PDVA 1Y74A 3AG2C 4DR6O 4FMTA 3OMIB 2EIJC 2R9IA 1ZWIC 3WB2A 4JI1O 3K9AA 2KSDA 2YUAA 4PI0A 4JYAB 3M7MX 4JYAO 2RJZA 2IH3C 2W6JG 4X1KA 1IBMO 2RN9A 1EN5A 2DWDC 2DWEC 1GM7A 3IC7A 1KUQA 4UVCA 3JAWA 4LWSB 5LHHA 4I4TB 4FM1A 1N0NA 1BZKA 3ABKB 4UCUA 4DR5B 4DR5O 1TVKA 5LHIA 1NU1H 3ZMUA 3M99B 5BXZA 4JI4O 4JI8O 5L3FA 3J7AU 2LFSA 1G1XB 4LNUA 3SYCA 1LNQA 3TK1A 2IH1C 4J9ZB 3SJQC 2KB1A 5JJEB 1KC8W 5H6QA 3I56V 4DYLA 1S5HC 1M93A 1PKXA 1FD9A 2XOKG 2N04A 3ZMTA 1T5EA 4NXMB 1XNQO 2EX3A 4F6RA 4MTGA 1IBLB 5ITZA 5IWAB 4J9YB 3C90A 4DUYB 2XT9A 4WFHA 5E1AC 1JOYA 1H2LA 1JMKC 1KKCA 2XAJA 3W7XA 4KFMA 4TQDA 4MVSA 2JEUA 1KMIZ 4FFKA 3AG1C 3JALA 4LF6B 3K03A 2ZE8A 3HPLC 4IYHA 4WFBV 4LF6O 5F2VO 1JPXA 2QM7A 4LR3A 1HNZO 1XNRB 2BSKA 1VQNV 3F5TA 3HR0A 4E2LA 5IJ0A 4PA7A 5E79Z 2WAMA 1AJNA 5BR8B 4JI3O 3CCMV 4P2ZA 1BSMA 5BR8O 2A06H 4FLVA 3LSQA 4U3JB 2Y69C 3RYCA 2ZE7A 1FFTB 1D5AA 1BS3A 3AK2A 1FXKA 1ZTEA 1PNKA 1O9HA 1G4YB 3AG2B 1US6A 3JYCA 1EN6A 4R8CA 1VF7A 2EIJB 2W6IG 3JASA 4ZHQA 3BABA 3HKBA 5C8YA 2E74B 1FAFA 1HW7A 4LFCB 1SQBH 4LFCO 3OEEG 1KB9F 3D3QA 3H01A 3SYAA 1SQGA 4CZZA 1Q7YW 1XMOB 2XAQA 3QTCA 2FKXA 2WLIA 1XMOO 2A7WA 4JZ2A 1UPGA 1WAZA 4U7OA 4TWKA 4RQFA 1AROP 2VRZA 4QE9A 2WWWA 4MVUA 1FFXA 1LUVA 4PHZA 1GAXA 3E8GA 1YTFB 2Q7EA 2LQTA 5DN6G 2Q5ZA 5KHHA 4K0KO 2Z0AA 2AXTZ 3EVKA 1VQ6V 1W59A 4HNAA 1I94B 1I94O 1KU9A 3T1HB 1XEQA 3LUTB 3CJHA 1HDJA 4BIUA 2QWPB 5TISZ 4DV2B 3THOA 5JJJB 3A2FA 1N33B 4GKKB 2ITDC 4DRXB 1N33O 2BCCH 2AHZA 2WPDG 2KQXA 2ZNJA 4DR7B 3K58A 4FLUA 3H1JH 5KMGA 4I0XB 4JTAB 2ZT9B 1J5EB 1BQZA 5LP6A 5BMVA 3OM3B 2ADPA 1J5EO 3AG1B 1Q90D 1X59A 2W0FC 1XOUA 3RYIA 1XDCA 3QVNA 1XI1A 5LA6A 2CH7B 2R70A 4IIJA 4J7ZA 1SQQH 1QLEC 3HKEA 1IX9A 1HNXB 4FZ1A 4R50A 3VBBA 5LXTB 1M57C 1HNXO 4GZRB 4TV8A 2HHHB 4K8XA 3JCUZ 4X1IB 5KX5B 2ZINA 2ZE5A 2CDYA 3JAKA 2QDOA 2H3OA 2Y69B 3L71H 4IT5A 4DV7B 4IHJA 5B1AC 4K8ZA 1MSDA 1R73A 4DV7O 1BGYH 2YIBA 4B3SB 2HKOA 2X6AA 4B3SO 3K5OA 3AG3C 3W7SA 2V1DA 2F4VB 1FXVA 3AG4C 3MD0A 2F4VO 3NR7A 1R3IC 1QU7A 2FMLA 3BEHA 4JV5B 2Y0IA 3WB0A 4JV5O 3JSLA 4O4JB 2PTMA 3SYPA 5B3SC 2EIMC 5EYPB 2QTOA 4H13B 1OCRC 1K8AW 4X1YA 1Z5WA 4JZGA 4PA4A 1FKAO 4WBNA 1DF5A 4YJ2A 2RDCA 4TOIA 4CBCA 2HR3A 3O65A 3OT7A 4DV6B 3KG2A 2EJ7A 1LR1A 1OJHA 2ZIMA 1I08A 2WLNA 1IZ3A 2CTQA 1H38A 5KA6A 3E22A 2AZ0A 2ARHA 4DR4B 2YEVB 3CPWU 4JAVA 3H1IH 1Q81W 2Q9LA 3CS5A 4RQEA 2F95B 4AQYB 4JPRA 3RFRA 1TA8A 1R3JC 3KCYA 4ZI7A 3H9VA 3IC9A 1Q86W 4MVRA 4KP4A 1H2KA 1NVPD 5LYJA 5GONA 2E76B 1E1QG 1BL8A 3OMAB 1IDSA 2LGQA 3QO5A 2D2CB 4DO2A 5J2TB 2MK3A 4DV0B 4KL1A 1HNWB 3FAVA 2QKSA 5JH7A 2BTQB 3WB1A 1EZJA 4FFBB 4UCRA 1K7DA 2VWKA 2NN4A 2HP8A 2IW5A 4LF9B 1VEWA 1QHTA 3G6BA 3ABUA 2DYRC 3CMEV 1QLEB 2X7RB 3E8HA 2BE3A 3RYHA 4UCSA 1M57B 2QSAA 1K3EA 1GH6A 4X66B 2DQ3A 3PJSK 2ATKC 1WNSA 3CYOA 4QNHB 4R7CA 3K0DA 5B1AB 2YXYA 5H6RA 2QWRB 1IXBA 3K0GA 2YIAA 1JQ0A 3OFNG 3G80A 2PI4A 3CMAV 2P6JA 4X88A 4J7JA 1P7BA 1XL4A 3FB6C 1TAEA 1SF9A 5CBGA 3AG3B 2JRIA 3OD4A 5DEDA 3AG4B 1B06A 3OMNB 2P06A 4GKJO 1ENVA 4UFZA 3FB7C 1MOFA 5JJNB 2Q67A 2JS3A 3H1LH 2IU0A 1XL6A 3ZCCA 2UUAB 3ETGA 1YEWA 4RUEA 5IYBO 2M7WA 2LGWA 1R3KC 4X20A 1PD3A 5B3SB 2WLLB 4FPPA 2EIMB 3WG7C 1OCRB 4I50B 2XUMA 1W2BU 1JFFA 3K9SA 3C3TA 5EC2C 1WA8A 2C2AA 3UKMA 3X2QC 2L6LA 3FD9A 2HEPA 4LF5B 3WFVA 4JYBA 5CA1B 1IVSA 2A9HA 4ZOLB 3N2GB 3A0BZ 3RYFA 4K3AA 3VQYA 5EBLC 2QR4A 2A0LA 5EBWC 4DK0A 5JWPA 2JGDA 4BR6A 5BZBA 1ZUQA 1V9PA 1NTKH 2IM9A 3K57A 1YJ9V 4Z1MG 1SQFA 4X9QA 2A3QA 2QEXV 4NXNB 3HKCA 2YC0A 1P84F 2HJFC 4FLWA 3ZRWA 1SKVA 3MAQA 3UT5A 2P22C 2PZSA 4XDLA 1GK9A 4X62B 1AILA 2BTOA 2F43G 2GSMB 2H8PC 3JSNA 2PY5A 3LSUA 3DXRB 2Q8VA 4DV1O 2CTPA 2Q4PA 3ZMSA 4YY3B 4YY3O 4ABMA 5LMNO 4LF7O 3CC4V 3BAAA 3JAWB 3L74H 5CA3A 1IBKO 5JQGB 1VQ9V 4OXSA 1H2NA 1H8EG 1XILA 1X4TA 4O4IA 1TVKB 4WFGA 2DYRB 4DV4B 1W0JG 4JAUA 4Q6GA 4DV4O 1MMMA 1VF6A 2IJIA 4LF8O 1BT8A 4GX2A 2EZPA 3GVMA 3ZHUA 1ROPA 3ZJZA 4LFAB 1OCOC 2UXDO 2B5UA 4B08A 4YJ3A 3JARA 4JI2O 2YIBD 5CB4A 1MG1A 3S3WA 1GM9A 3QO7A 5KA5A 4HZ3A 5DM6V 1QQCA 4GT1A 5ITZB 1GN4A 1NVPB 3TXSA 2HFEC 1DF4A 1VF5B 4O4HA 4WF9V 2ETNA 5H5NA 4CH4A 2FTKA 4DV5B 1JX9A 3ABLC 5LP6C 3WG7B 4H33A 1N8RW 3JALB 4O4LA 2IJHA 4EKWA 2V7QG 3X2QB 1AJPA 1F23A 1NKDA 5GW7A 1QLNA 4PD4F 1VQMV 4YHHB 1N36B 2M6YA 4MT8A 5KAFZ 4JI7B 3LNMB 3CWBH 4HAMA 1WJZA 5CBHA 2ZDIA 4I7ZB 1XBLA 4UUJC 3SGIA 4B3MB 3QF7A 1THZA 4WFEA 5EIBD 3RYCB 4B3MO 1S5JA 2R72A 3OTOB 3OTOO 1N34B 2JEXA 1S5LZ 1K5QA 2OIEA 3UQ8A 2JJ2G 1N32B 2OCHA 2D3OW 1WN7A 2FL4A 3TETA 3JASB 1EN4A 1EZVH 1ZL8A 1MSWD 5C8YB 4K35A 2P4KA 2YI8A 3I5DA 3ML0A 4WFAV 3CRCA 3VQXA 5KHIA 4NXMO 3BY6A 3CCSV 1VQ5V 1IBLO 5IWAO 3CC7V 1TGOA 3OR7C 3CCQV 4DUYO 2WLIB 4CC6A 3ABMC 3CEIA 1XREA 3LDCA 3CD6V 1QNMA 1SQVH 4TV9B 4JTCB 5IT9N 1QBZA 1JA8A 2QWQB 2XAHA 3T4ZA 3ZEDA 4CS3A 4CS4A 1XNRO 3JATA 4CC5A 1M4UA 1YXBA 4NTYA 2Z5UA 2WSSG 5EIBC 2WLMA 1SESA 2JVDA 2YI9A 1M1KW 3ETEA 1OCOB 3JD3A 4HNAB 2DN9A 1RSOB 3CCLV 3CCJV 1K4CC 3OTFA 1ZSPA 3RBZA 1E1RG 5H2FZ 3HKDA 1YZBA 4NKGB 4PA3A 1OV9A 2AGAA 4FLTA 4JASA 4LWSA 5CMUA 3JD0A 2QWNB 5LOVA 4A5UB 4IL6Z 4B7EA 2YXLA 1VQ7V 4LF4B 2HVKC 1YI2V 3FX7A 2P4VA 1Q82W 1COWG 3CSXA 5LBQA 2O57A 1PM9A 3CB2A 3ABLB 5LP6B 2ZM6B 3AK1A 1LUWA 2ZKOA 3RYIB 1L0LH 5KLVH 1KECA 2ZR2A 1VQ8V 4DW0A
chains in the Genus database with same CATH topology
1GKFA 5CN0A 4PA4A 3CCRV 3CCUV 2CK3G 1DF5A 1K9MW 2H94A 3ASNC 2ITCC 3GB7C 5C93A 4CBCA 3DGEA 2HR3A 4WFFA 3SPJA 3FB8C 3KG2A 4MSWC 1OCZB 3B8NA 2K1EA 5CBFA 1V54B 1V55C 1QVFU 2WLJA 1FXKB 2WLNA 3ASOC 4PDMA 2EBOA 1H38A 1AI5A 5H9CA 3FB5C 3W7WA 3ABKC 5KA6A 2LFRA 2EILC 1QVGU 2LP7A 2UXXA 3HB3B 3SYOA 2UXNA 3G6EV 1NJIW 1JVMA 3STZC 1J95A 2B1GA 2YEVB 2ZR3A 5EK0A 3CPWU 3STLC 4MW8A 3LSSA 4JAVA 5HFLA 1OCCB 3QNEA 4RQEA 1Q81W 4JF3A 4JPRA 1UJWB 1S3JA 3IFXA 1R3JC 3VOUA 1K73W 5L3CA 2QA4V 1QCEA 5IYCO 1Q86W 1M56B 4FK5C 1AI4A 2BOCC 4KP4A 4MVRA 1NVPD 1KKDA 1E1QG 1BL8A 3ABMB 3OMAB 4PA9A 3AEIA 4DO2A 3QO5A 5KUMA 1YSCA 1FS0G 2X6CA 2MK3A 4JTDB 1NR1A 3A0RA 3SPHA 2R9RB 3K79A 1WPXA 3E8FA 2JK5C 2QKSA 1EZJA 1R6KA 3R65A 4ASUG 1K7DA 5IDJA 3E89A 5LGTA 2IW5A 2DYSC 4I9WA 3E35A 3EHBB 3E86A 2WLLA 2NLJC 3ABUA 1K92A 3F7VC 3K04A 2DYRC 3CMEV 1YITV 3ZN0A 3D3IA 1QLEB 3JD2A 1H8HG 2X7RB 3E8HA 4P30A 2QE7G 2WLHA 1M57B 1NH2B 1K3EA 1IXMA 2JJ1G 2BOBC 2DQ3A 3ZMVA 4MVQA 1BHBA 3PJSK 2ATKC 4MTOA 1YTFD 3CYOA 3FYIB 1W0KG 3SPGA 1KP3A 2HG5C 3MHHC 4QNHB 4R7CA 3K0DA 5B1AB 5H6RA 1FXHA 3K08A 5L3GA 1YJNV 4RO2A 3K0GA 3OUSA 1JQ0A 3OFNG 1PL0A 3CMAV 2PI4A 3JD1A 2P6JA 4X88A 2Q69A 1K34A 1P7BA 1XL4A 3FB6C 1AR1B 5CBGA 2ZXWC 3T4DA 3AG3B 1S0VA 3E8BA 4BIZA 1VQPV 3RVZA 2P67A 3AG4B 4LBEC 3OMNB 1ENVA 3FB7C 1MOFA 2Q67A 4LCUC 4PDVA 3UM7A 2IU0A 1XL6A 3AG2C 3ZCCA 1M90W 3ETGA 4ZBMA 4FMTA 3OMIB 2EIJC 3SPIA 4JYCA 2XAFA 4RUEA 4WCEV 2R9IA 1ZWIC 5IYBO 2M7WA 2YSUB 1R3KC 3K9AA 4G2KA 4LP8A 3CXCU 1PD3A 5B3SB 5IYDO 2XNDG 2WLLB 4FPPA 2EIMB 3WG7C 1CEZA 1OCRB 1OHHG 1W2BU 5EC2C 3UKMA 2C2AA 1S72V 3X2QC 2IH3C 2W6JG 3E83A 3ASNB 2DWDC 3RVYA 4UVAA 4GX1A 4KUMA 3EFFK 3WFVA 2DWEC 4JYBA 4ZKIA 1GM7A 1VQKV 3IC7A 2JIZG 2A9HA 1V55B 1SETA 4UVCA 1H2GA 1DLBA 3ASOB 5KUKA 5LHHA 5EBLC 4MTFA 2A79B 1PNMA 3ABKB 2A0LA 2OCCC 5EBWC 2DW4A 3TCUA 2EILB 2AHYA 5LHIA 3ZMUA 3M99B 1K33A 3FYEB 5BZBA 5L3FA 2LFSA 1Y4MA 5LGUA 4MS2A 4MVMA 1YJ9V 4Z1MG 3SYCA 1LNQA 1JJ2U 3TK1A 4MTXA 1GO3F 2IH1C 4J9ZB 2QEXV 3SJQC 2KB1A 1KC8W 5H6QA 5L3BA 3OE7G 3I56V 2HJFC 3ZRWA 3G71V 4L87A 1S5HC 1NBMG 1PKXA 2XASA 2IJKA 2XOKG 2EINC 4GCZA 1GK9A 3JCZA 4XDLA 1L1FA 3ZMTA 2F43G 2GSMB 2H8PC 3E2EA 1K97A 3K3WA 1GM8A 5B1BC 1CP9A 4MTGA 4P9OA 4J9YB 5L3EA 3G4SV 3ZMSA 4WFHA 5E1AC 1JOYA 2X6BA 4RUFA 4H37A 2XAJA 3W7XA 2ZDIC 3CC4V 4KFMA 1GMGA 2DYSB 4QPKA 4MVSA 5CA3A 1VQ9V 4HYOA 3JD4A 2JEUA 1S76D 2ZQMA 4OXSA 1H8EG 3AG1C 4X8AA 3K03A 2DYRB 3HPLC 1K5SA 4WFGA 3P30A 4WFBV 1JPXA 1W0JG 4JAUA 4R6ZA 3CC2V 2EJRA 3LDDA 4PELA 4G27B 2QM7A 3B77A 4X89A 5L3DA 2IJIA 4MVOA 1AI6A 1VQNV 4GX2A 2EZPA 4E2LA 1K4DC 3OEHG 3QO8A 1G8MA 1ROPA 3ETDA 2WAMA 4PA7A 3ABTA 3ZJZA 3CCVV 1OCOC 1AJNA 2B5UA 3CCEV 3GWOA 1P4RA 2OTJV 5HFMA 3OUFA 1RM1C 3F5WC 3CCMV 4P2ZA 5B1NA 1WLEA 1CPYA 3LSQA 1RM1B 1VQLV 2Y69C 1FFTB 3ZRVA 2ZXWB 1MG1A 1HWYA 2X0LA 1PNLA 1B6QA 1GM9A 2P7TC 3QO7A 1FXKA 4G28B 5IY5C 5KA5A 5LGNA 4HZ3A 1PNKA 1QR9A 5DM6V 4TSFG 4DXWA 1G4YB 4GT1A 1NVPB 2HFEC 1DF4A 2PI5A 3AG2B 4WF9V 2HLDG 4YXWG 3JYCA 1R6NA 4R8CA 2B1IA 2EIJB 2FTKA 2W6IG 1JX9A 2YEVA 3ZMZA 4UVBA 3ABLC 2JDIG 1VQ4V 5FL7G 3WG7B 2OTLV 4H33A 1N8RW 4PA6A 1EFRG 1KQSU 2IJHA 4LC1A 1Y66A 4EKWA 3ZRSA 3OEEG 2V7QG 3X2QB 1AJPA 1F23A 3SYQA 3H01A 3SYAA 1NKDA 5GW7A 1YIJV 1QLNA 3OAAG 4CZZA 1VQMV 1YJWV 1Q7YW 2IU3A 2XAQA 4N21A 2EIKC 4XBFA 2WLIA 1F4MA 2EZOA 4I5SA 4MT8A 4U7NA 1I5XA 4MW3A 3LNMB 4JGSA 4HAMA 5CBHA 2ZDIA 1M9NA 4U7OA 3ZIAG 4TWKA 4RQFA 1AROP 4QE9A 4F4LA 1NQTA 5LHGA 2WWWA 1OCZC 4MVUA 4UUJC 3W7UA 3K06A 4TT3G 1V54C 2OCCB 3E8GA 1YTFB 4WFEA 1THZA 1FXKC 4XDKA 1RPRA 5DN6G 1OZ0A 2DQ0A 1F51A 1TUEB 3B8MA 5EC1C 1NH2D 3W7TA 3OW2U 1KP2A 2ZD9A 2WLKA 4UV9A 2JEXA 1K5QA 2JJ2G 1VQ6V 3OGCC 2D3OW 5B1OA 2HVJC 3D36A 1OCCC 3TETA 2IJJA 1ORQC 3LUTB 1MSWD 1NR7A 4BAYA 1E79G 4XDJA 4QIWF 3T1CA 2EINB 3ML0A 4BIUA 4WFAV 4UV8A 1SERA 3BY6A 3CCSV 5EBMC 1R3LC 1VQ5V 4MVZA 2ITDC 5B1BB 4P9PA 1M56C 2AHZA 2P90A 3DTUB 3NXSA 3CC7V 1AI7A 3FKSG 3OR7C 4PDRA 3CCQV 1I5YA 2WPDG 2WLIB 3ZN1A 3ABMC 3LDCA 3CD6V 3OR6C 4FIPC 1MABG 4JTCB 4GX5A 4JTAB 4FJCC 1QBZA 3OM3B 2QM8A 3AG1B 2NNUA 1EBOA 3LDEA 2W0FC 2XAHA 3T4ZA 5J9PC 1SZTA 4PDLA 4GX0A 1S77D 2Z5UA 2WSSG 1RPOA 2WLMA 1QLEC 1SESA 1SRYA 1QR8A 1BHAA 1M1KW 3ETEA 4R50A 1OCOB 3JD3A 3F7YC 3VBBA 1M57C 3ZRWB 3CCLV 3CCJV 1K4CC 2OT5A 2Q6AA 3RBZA 1F4NA 4UXNA 1E1RG 3CP1A 2Y69B 1YHQV 4PA3A 5B1AC 1GTOA 5IY5B 1R73A 3P32A 4JASA 5CMUA 4Q20A 3JD0A 2HKOA 2X6AA 1BMFG 2GHYA 3ZRXA 3AG3C 2XAGA 3MHSC 4N23A 3W7SA 2V1DA 1FXVA 3SPCA 3T2MA 3RW0A 3AG4C 3MD0A 1VQ7V 2Z3YA 2HVKC 1YI2V 3IGAC 3I55V 1Q82W 1COWG 1AJQA 1KD1W 5LBQA 4QE7A 1DTOA 4QPJA 1R3IC 3ABLB 2Q68A 4QJFB 3BEHA 1JCHA 4BW5A 3SYPA 5B3SC 1KECA 1VQOV 2EIMC 2QTOA 2ZR2A 1OCRC 1K8AW 1VQ8V 2EIKB 2Y48A 4RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1RPR A;  1F4M A;  1NKD A;  1ROP A;  2IJJ A;  2GHY A;  4DO2 A;  1GTO A;  3K79 A;  2IJK A;  2IJH A;  1RPO A;  1F4N A;  1B6Q A;  2IJI A;  1GMG A; 
#chains in the Genus database with same CATH topology
 2ODM A;  2LW7 A;  1Q6H A;  3GB7 C;  3DGE A;  3SPJ A;  2CUG A;  3L70 H;  2GTA A;  2QKC A;  1V55 C;  2GUZ A;  4IHJ B;  1SA0 B;  3CX5 F;  5H9C A;  2LFR A;  5CA0 B;  1QVG U;  2UXX A;  1JVM A;  2ZR3 A;  1XQ8 A;  3STL C;  3ETQ A;  1N4C A;  3LSS A;  3T1H O;  3R66 A;  2WA4 A;  3IFX A;  5KAI Z;  3ZX6 A;  1YDX A;  4DV2 O;  1MNG A;  4GKK O;  5B5E Z;  1AI4 A;  2YXH A;  4DR7 O;  1KKD A;  2E75 B;  4J42 A;  3ABM B;  3AEI A;  4U3F H;  4O2A B;  4DK1 A;  1NR1 A;  3A0R A;  4H0L B;  3K79 A;  3G67 A;  1YCI A;  3E8F A;  4D7T A;  1XHZ A;  4KHP B;  1NZ6 A;  2V4D A;  4B3R B;  4FLZ A;  1R6K A;  3R65 A;  4B3R O;  5IDJ A;  3E89 A;  5LGT A;  4JI0 B;  5JCO C;  4DR3 B;  3E35 A;  3EHB B;  4JI0 O;  4DR3 O;  2NLJ C;  3K04 A;  3E22 B;  1YIT V;  3ZN0 A;  3N2K A;  5KHJ A;  3JD2 A;  3DC5 A;  1H2M A;  2PYL A;  3KCX A;  2HHH O;  3BHP A;  4DR2 B;  3ZMV A;  4MVQ A;  1BHB A;  3P3P A;  3JAM N;  1YJN V;  1PL0 A;  2Q69 A;  1K34 A;  2YID A;  5LYJ B;  1AR1 B;  2ZXW C;  5GON B;  5FNV A;  3TGU H;  3T4D A;  5LMU B;  3ZHQ A;  4O2B A;  1IUR A;  3A0H Z;  2P67 A;  1PL4 A;  1WPB A;  3L72 H;  3FAV B;  4CH5 A;  4WCE V;  2QJ1 A;  1AP5 A;  4LP8 A;  2YSU B;  4JYY A;  5AG2 A;  4LH7 A;  2OWO A;  3CXC U;  5IYD O;  3LNN A;  3CXH F;  3K5M A;  2UXC B;  2WA3 A;  3RGB A;  1S72 V;  1GN2 A;  3E83 A;  1VF6 C;  1VAR A;  4UVA A;  4DV6 O;  4GX1 A;  5GTH Z;  4AHC A;  4ZKI A;  4AI8 A;  2JIZ G;  1V55 B;  1H2G A;  2DE0 X;  3UO3 A;  1AB3 A;  1B3Q A;  4I0X A;  2A79 B;  2OCC C;  5IE9 A;  4BWA A;  3ZHT A;  3TCU A;  1B04 A;  1G6U A;  2N05 A;  4DR4 O;  2CH7 A;  3CE2 A;  4AQY O;  4D7S A;  4MTX A;  1GO3 F;  5EZY A;  5L3B A;  1R6T A;  1JJO A;  4J10 A;  4X65 B;  5LXT A;  1XMQ B;  4X20 B;  2XAS A;  2IJK A;  2EIN C;  1L1F A;  4GLX A;  1JFF B;  2DMX A;  1F7Y A;  1K97 A;  5B1B C;  1Y6X A;  4DV0 O;  1HNW O;  4P9O A;  5L3E A;  3DC6 A;  2OYQ A;  4RUF A;  4H37 A;  2Y0P A;  2ZDI C;  4LF9 O;  4QPK A;  1SZX A;  1A32 A;  3RYF B;  4FVM A;  1Z2G A;  4X8A A;  2JGD B;  3P30 A;  4R6Z A;  3BA9 A;  3LDD A;  2F23 A;  4PEL A;  4O4J A;  1Y76 B;  1AR4 A;  3K59 A;  4X66 O;  3AG7 A;  3L75 H;  5EYP A;  1K4D C;  3QO8 A;  3ETD A;  3Q4H B;  3ABT A;  2QM4 A;  3HKC B;  1TUB B;  3CCE V;  1P4R A;  2OTJ V;  3CRM A;  3F5W C;  2VQF B;  5B1N A;  1WLE A;  3UT5 B;  2VQF O;  1RM1 B;  2CGO A;  4X64 B;  1VQL V;  3O9O A;  2ZXW B;  2X0L A;  1HWY A;  3C3S A;  1B6Q A;  3ZHR A;  4G28 B;  5IY5 C;  2B9Z A;  4H44 B;  3RT3 C;  4J80 A;  1VMG A;  2CE4 A;  2PI5 A;  4Z2W A;  2UUA O;  4TUY A;  2HLD G;  2YDE A;  4EB6 B;  2CAZ C;  1NT2 B;  2YEV A;  3ZMZ A;  5FPO A;  4UVB A;  2JDI G;  1VQ4 V;  1WB8 A;  2OTL V;  2KG7 A;  4NB5 A;  4PA6 A;  4LC1 A;  5K1X A;  2PYJ A;  2L35 A;  3SYQ A;  1YIJ V;  4LF5 O;  1YJW V;  4N21 A;  4XBF A;  2EUL A;  1F4M A;  1H2S B;  1AVM A;  1U96 A;  4FM2 A;  4JGS A;  4OGQ B;  4YJ3 B;  4F4L A;  4B7K A;  3JAR B;  1OCZ C;  3W7U A;  3K06 A;  2OCC B;  3SJB C;  4CH6 A;  2UXB B;  2BTQ A;  1FXK C;  5CB4 B;  1RPR A;  1OZ0 A;  2DQ0 A;  1TUE B;  3B8M A;  3BFR A;  5EC1 C;  1NH2 D;  1KP2 A;  4PI2 A;  2WLK A;  5IJ9 A;  1Y74 B;  2VS0 A;  4NXN O;  3B4S A;  3CHX A;  3L9D A;  2HVJ C;  3D36 A;  2UU9 B;  1OCC C;  1NR7 A;  1E79 G;  4UB6 Z;  4XDJ A;  1DK1 A;  4QIW F;  3P3N A;  4X62 O;  2EIN B;  4UV8 A;  1N0J A;  4X1K B;  5EBM C;  5B1B B;  4P9P A;  2P90 A;  1AI7 A;  3KKY A;  1I5Y A;  1GRJ A;  3ZN1 A;  4J11 A;  4AIL C;  3IJ4 A;  4FJC C;  4OX9 B;  2QM8 A;  3LDE A;  1Q5O A;  1Q6I A;  4B3T B;  4HBN A;  1SZT A;  4PDL A;  2Q7H A;  1URF A;  4LNU B;  1YF2 A;  4GX0 A;  1I0H A;  2CTW A;  1RPO A;  5J2U A;  1FYJ A;  1SRY A;  1QR8 A;  4LFA O;  2VQE B;  2ADQ B;  2Q6A A;  2RQ6 A;  2CTR A;  4UXN A;  2FYU H;  4I55 A;  3CP1 A;  5CA1 A;  1YHQ V;  4L8J A;  4F6R B;  2W0X A;  4ZOL A;  5IY5 B;  2JGU A;  1R1B A;  4YIO A;  5IYZ A;  4Q20 A;  1ZX3 A;  4UCT A;  4PJ0 Z;  2GHY A;  3MHS C;  3KZI Z;  4N23 A;  4EFE A;  3SPC A;  4DV5 O;  3IGA C;  2HJD A;  3TJT A;  2GV9 A;  4BIO A;  4QJF B;  4Z1V A;  4DR6 B;  1JCH A;  4J7K A;  4LH6 A;  2E5L B;  2BSK B;  4BW5 A;  3U10 A;  4JI1 B;  2E5L O;  4YHH O;  3JAT B;  3SDL A;  1N36 O;  5IJ0 B;  2EJR A;  4RAI A;  1GKF A;  2QWO B;  5CN0 A;  1HR0 B;  4NR1 A;  2CK3 G;  3CCU V;  4JI7 O;  1HR0 O;  3OGI B;  1IBM B;  3ASN C;  5C93 A;  5JVD A;  4MSW C;  1OCZ B;  3J81 N;  3B8N A;  3S3X A;  2K1E A;  3DXR A;  2WLJ A;  4E4E A;  1FXK B;  3ASO C;  3HKD B;  1HP8 A;  1AI5 A;  3FB5 C;  3W7W A;  5JQG A;  2NR5 A;  1N34 O;  2Q73 A;  2EIL C;  5LOV B;  3BVO A;  3HB3 B;  3SYO A;  3G6E V;  1NJI W;  4JI4 B;  4JI8 B;  1N32 O;  1WB7 A;  1J95 A;  2B1G A;  4ZHQ B;  3HKB B;  4DR1 B;  3A8T A;  5HFL A;  1OCC B;  3QNE A;  4DR1 O;  1S3J A;  4JI6 B;  1K73 W;  3J80 N;  2QA4 V;  4JI6 O;  1XHX A;  5IYC O;  4FK5 C;  4ZIB A;  4F6E A;  4PA9 A;  1Q6U A;  1XNQ B;  1SQX H;  2X6C A;  3SPH A;  2R9R B;  1FFX B;  2JK5 C;  2YIC A;  3BCC H;  2GUZ B;  2DYS C;  1VP7 A;  1BE3 H;  2AZ2 A;  4BW9 A;  2F1M A;  4P30 A;  2QE7 G;  4ICG A;  1NH2 B;  2PUS A;  1HNZ B;  5FLX N;  3CJH B;  2P5O A;  2QGN A;  2ZIO A;  3FYI B;  1W0K G;  3SPG A;  2HG5 C;  4I4T A;  3K08 A;  5L3G A;  4JI3 B;  2FB5 A;  4OPA A;  2UUB B;  1KYO F;  1WP8 A;  2UUB O;  3M8A A;  3E8B A;  4BIZ A;  5KMG B;  2JS5 A;  3RVZ A;  4LF4 O;  4LBE C;  2Y4U A;  5BMV B;  3UO2 A;  3UM7 A;  2ZM6 O;  3SJC C;  1M90 W;  4ZBM A;  3SPI A;  4JYC A;  2XAF A;  4I9Q A;  5LA6 B;  4IIJ B;  1U97 A;  4G2K A;  4IYI A;  2XND G;  1CEZ A;  3FFQ A;  3HKE B;  1OHH G;  2F93 B;  3N2K B;  4JAA A;  4TV8 B;  3ASN B;  4FZ0 A;  3RVY A;  3GWK C;  4KUM A;  1AP6 A;  3EFF K;  3U0Z A;  3JAK B;  1VQK V;  2ZCE A;  1SET A;  1PP9 H;  1DLB A;  3ASO B;  5KUK A;  5KHG A;  4TV9 A;  4MTF A;  1PNM A;  2DW4 A;  2Q7G A;  1PV0 A;  4NTX A;  2EIL B;  2AHY A;  5FNV B;  1K33 A;  3FYE B;  5A9G A;  4O2B B;  1Y4M A;  5LGU A;  4K0K B;  1FPO A;  4MS2 A;  1D2D A;  4MVM A;  1O9G A;  1JJ2 U;  2GDS A;  4DW1 A;  3OE7 G;  2RMK B;  3G71 V;  4L87 A;  1Q3E A;  1RSO A;  1NBM G;  1XUQ A;  2MW2 B;  4X1Y B;  4GCZ A;  3JCZ A;  4U3J A;  4WBN B;  1P7G A;  4YJ2 B;  2CGN A;  3E2E A;  3K3W A;  4JI5 B;  1GM8 A;  1CP9 A;  4JI5 O;  4KHP O;  4W4K A;  3G4S V;  2ZNI A;  2X6B A;  2AW9 A;  1GMG A;  2DYS B;  4HYO A;  3JD4 A;  1S76 D;  2ZQM A;  1K5S A;  3CC2 V;  5GTI Z;  4G27 B;  4NTW A;  3B77 A;  4X89 A;  5L3D A;  4DR2 O;  4MVO A;  1AI6 A;  3OEH G;  1G8M A;  3CCV V;  5EZY B;  4ZI7 B;  3GWO A;  3D36 C;  5A2Q N;  5HFM A;  3OUF A;  1RM1 C;  1CPY A;  1M5I A;  1ZAU A;  3ZRV A;  5LMU O;  1PNL A;  2P7T C;  5LGN A;  1QR9 A;  4TSF G;  4DXW A;  5K1P A;  1SA0 A;  5JH7 B;  1BQ0 A;  2E3C A;  5CA0 A;  4YXW G;  2LO1 A;  1R6N A;  2B1I A;  3K5N A;  1WP7 A;  2R9A A;  5FL7 G;  2UXC O;  4UCO A;  1EFR G;  3APQ A;  1KQS U;  1Y66 A;  3ZRS A;  2G38 A;  3RYH B;  2F66 C;  2IBZ H;  3CRA A;  2QKA A;  3B40 A;  1KBH A;  4DRX A;  4IGG A;  3OAA G;  3VQV A;  2IU3 A;  2EIK C;  2PF4 E;  2EZO A;  3B09 A;  4I5S A;  4U7N A;  2RCV A;  1I5X A;  4MW3 A;  3N27 A;  1M9N A;  4O2A A;  3ZIA G;  1NQT A;  3ZHS A;  5LHG A;  5DEC A;  4TT3 G;  1V54 C;  1VIB A;  1CXZ B;  4XDK A;  3MDS A;  1F51 A;  1DGS A;  1MZF A;  3W7T A;  3OW2 U;  2ZD9 A;  4UV9 A;  1MZE A;  4TUY B;  3OGC C;  1GN3 A;  5B1O A;  4X65 O;  4X1I A;  5KX5 A;  2IJJ A;  4QGP A;  1XMQ O;  1ORQ C;  4BAY A;  4FM0 A;  3T1C A;  1D5N A;  3QG5 A;  2KG7 B;  1WA8 B;  2OIG A;  5B66 Z;  4EFB A;  1SER A;  1Y67 A;  1R3L C;  3BA8 A;  4MVZ A;  3VQW A;  1M56 C;  3NXS A;  3DTU B;  3FKS G;  2XTA A;  1SQP H;  4PDR A;  1SS3 A;  2GTS A;  4NYK A;  3ZHV A;  1L0N H;  3OR6 C;  4FIP C;  4NVP A;  3TXQ A;  1MAB G;  3RN4 A;  4GX5 A;  1NS1 A;  4LFB B;  4UCV A;  4LFB O;  2NNU A;  3CRR A;  1EBO A;  4FLY A;  3D8C A;  5J9P C;  1P49 A;  4OPH A;  1S77 D;  5D5Q A;  5IJ9 B;  4D6T H;  1EM1 A;  2DJV A;  1BHA A;  2Q0A A;  3F7Y C;  3ZRW B;  4DV3 B;  4DV3 O;  5KHK A;  2OT5 A;  1UFI A;  4X64 O;  1AR5 A;  1F4N A;  3ZBH A;  1GTO A;  3P32 A;  4EEQ A;  2Q0O C;  1BMF G;  1MA1 A;  3EXA A;  3ZRX A;  2XAG A;  3L73 H;  3T2M A;  3RW0 A;  2Z3Y A;  2DOS A;  3I55 V;  3B2E E;  1AJQ A;  1KD1 W;  4GKJ B;  4QE7 A;  1DTO A;  4QPJ A;  3BPZ A;  4UB8 Z;  4O4I B;  2Q68 A;  4RWU A;  4W4L A;  2KKW A;  1VQO V;  4C7U A;  3PN1 A;  2EIK B;  2Y48 A;  1BCC H;  3CCR V;  5J2U B;  5J2T A;  1K9M W;  2H94 A;  2ITC C;  3UCS C;  2UUC B;  4WFF A;  4DUZ B;  1JR9 A;  3FB8 C;  2UUC O;  4DUZ O;  4CH3 A;  4FFB A;  5CBF A;  1V54 B;  2UXB O;  4J41 A;  1QVF U;  4I55 B;  4PDM A;  2EBO A;  3K5L A;  3ZS8 C;  5JCO A;  5IYZ B;  3ABK C;  3T1Y B;  5LL6 Y;  3T1Y O;  4O4H B;  2LP7 A;  4GYC B;  2UXN A;  1I7F A;  3STZ C;  3CRQ A;  5EK0 A;  4MW8 A;  2UU9 O;  2RNB A;  1NTM H;  2K9P A;  1Y76 A;  4JF3 A;  3APO A;  1ZLZ A;  3IAY A;  1NI8 A;  1UJW B;  1RP3 B;  4O4L B;  4YIP A;  1RFY A;  1SC5 B;  2ZE6 A;  3Q4H A;  3VOU A;  5L3C A;  1TUB A;  1Z5V A;  2LJ2 A;  4KXR A;  1QCE A;  1M56 B;  2BOC C;  3H1K H;  3AK3 A;  2PGG A;  5KUM A;  1YSC A;  5D5P A;  1FS0 G;  4JTD B;  1FJG B;  3BRC A;  3DSQ A;  1WPX A;  3SJA C;  1L8D A;  4FLX A;  1FJG O;  5JVD B;  4OX9 O;  4DV1 B;  4ASU G;  4B3T O;  5LMN B;  4LF7 B;  4I9W A;  3ICX A;  2ILM A;  5FPR A;  4EB6 A;  1IBK B;  3WU2 Z;  3E86 A;  2WLL A;  1K92 A;  1PPJ H;  3F7V C;  2Y4T A;  4I50 A;  3U11 A;  5BY1 A;  3D3I A;  4TQF A;  1H8H G;  2VQE O;  2WLH A;  1Q8I A;  1ZL8 B;  2XHB A;  1IXM A;  2JJ1 G;  1NTZ H;  2BOB C;  4GUN A;  4LF8 B;  4PV1 B;  4MTO A;  1YTF D;  2GBO A;  3N2G A;  2YS8 A;  1KP3 A;  3MHH C;  2UXD B;  1FXH A;  1GN6 A;  4RO2 A;  4JI2 B;  3OUS A;  3H1H H;  3JD1 A;  4CS2 A;  2LW1 A;  1YVW A;  1S0V A;  2N74 A;  3RWR D;  1VQP V;  1Q43 A;  3SR2 C;  2QTS A;  2VWJ A;  4LCU C;  4PDV A;  1Y74 A;  3AG2 C;  4DR6 O;  4FMT A;  3OMI B;  2EIJ C;  2R9I A;  1ZWI C;  3WB2 A;  4JI1 O;  3K9A A;  2KSD A;  2YUA A;  4PI0 A;  4JYA B;  3M7M X;  4JYA O;  2RJZ A;  2IH3 C;  2W6J G;  4X1K A;  1IBM O;  2RN9 A;  1EN5 A;  2DWD C;  2DWE C;  1GM7 A;  3IC7 A;  1KUQ A;  4UVC A;  3JAW A;  4LWS B;  5LHH A;  4I4T B;  4FM1 A;  1N0N A;  1BZK A;  3ABK B;  4UCU A;  4DR5 B;  4DR5 O;  1TVK A;  5LHI A;  1NU1 H;  3ZMU A;  3M99 B;  5BXZ A;  4JI4 O;  4JI8 O;  5L3F A;  3J7A U;  2LFS A;  1G1X B;  4LNU A;  3SYC A;  1LNQ A;  3TK1 A;  2IH1 C;  4J9Z B;  3SJQ C;  2KB1 A;  5JJE B;  1KC8 W;  5H6Q A;  3I56 V;  4DYL A;  1S5H C;  1M93 A;  1PKX A;  1FD9 A;  2XOK G;  2N04 A;  3ZMT A;  1T5E A;  4NXM B;  1XNQ O;  2EX3 A;  4F6R A;  4MTG A;  1IBL B;  5ITZ A;  5IWA B;  4J9Y B;  3C90 A;  4DUY B;  2XT9 A;  4WFH A;  5E1A C;  1JOY A;  1H2L A;  1JMK C;  1KKC A;  2XAJ A;  3W7X A;  4KFM A;  4TQD A;  4MVS A;  2JEU A;  1KMI Z;  4FFK A;  3AG1 C;  3JAL A;  4LF6 B;  3K03 A;  2ZE8 A;  3HPL C;  4IYH A;  4WFB V;  4LF6 O;  5F2V O;  1JPX A;  2QM7 A;  4LR3 A;  1HNZ O;  1XNR B;  2BSK A;  1VQN V;  3F5T A;  3HR0 A;  4E2L A;  5IJ0 A;  4PA7 A;  5E79 Z;  2WAM A;  1AJN A;  5BR8 B;  4JI3 O;  3CCM V;  4P2Z A;  1BSM A;  5BR8 O;  2A06 H;  4FLV A;  3LSQ A;  4U3J B;  2Y69 C;  3RYC A;  2ZE7 A;  1FFT B;  1D5A A;  1BS3 A;  3AK2 A;  1FXK A;  1ZTE A;  1PNK A;  1O9H A;  1G4Y B;  3AG2 B;  1US6 A;  3JYC A;  1EN6 A;  4R8C A;  1VF7 A;  2EIJ B;  2W6I G;  3JAS A;  4ZHQ A;  3BAB A;  3HKB A;  5C8Y A;  2E74 B;  1FAF A;  1HW7 A;  4LFC B;  1SQB H;  4LFC O;  3OEE G;  1KB9 F;  3D3Q A;  3H01 A;  3SYA A;  1SQG A;  4CZZ A;  1Q7Y W;  1XMO B;  2XAQ A;  3QTC A;  2FKX A;  2WLI A;  1XMO O;  2A7W A;  4JZ2 A;  1UPG A;  1WAZ A;  4U7O A;  4TWK A;  4RQF A;  1ARO P;  2VRZ A;  4QE9 A;  2WWW A;  4MVU A;  1FFX A;  1LUV A;  4PHZ A;  1GAX A;  3E8G A;  1YTF B;  2Q7E A;  2LQT A;  5DN6 G;  2Q5Z A;  5KHH A;  4K0K O;  2Z0A A;  2AXT Z;  3EVK A;  1VQ6 V;  1W59 A;  4HNA A;  1I94 B;  1I94 O;  1KU9 A;  3T1H B;  1XEQ A;  3LUT B;  3CJH A;  1HDJ A;  4BIU A;  2QWP B;  5TIS Z;  4DV2 B;  3THO A;  5JJJ B;  3A2F A;  1N33 B;  4GKK B;  2ITD C;  4DRX B;  1N33 O;  2BCC H;  2AHZ A;  2WPD G;  2KQX A;  2ZNJ A;  4DR7 B;  3K58 A;  4FLU A;  3H1J H;  5KMG A;  4I0X B;  4JTA B;  2ZT9 B;  1J5E B;  1BQZ A;  5LP6 A;  5BMV A;  3OM3 B;  2ADP A;  1J5E O;  3AG1 B;  1Q90 D;  1X59 A;  2W0F C;  1XOU A;  3RYI A;  1XDC A;  3QVN A;  1XI1 A;  5LA6 A;  2CH7 B;  2R70 A;  4IIJ A;  4J7Z A;  1SQQ H;  1QLE C;  3HKE A;  1IX9 A;  1HNX B;  4FZ1 A;  4R50 A;  3VBB A;  5LXT B;  1M57 C;  1HNX O;  4GZR B;  4TV8 A;  2HHH B;  4K8X A;  3JCU Z;  4X1I B;  5KX5 B;  2ZIN A;  2ZE5 A;  2CDY A;  3JAK A;  2QDO A;  2H3O A;  2Y69 B;  3L71 H;  4IT5 A;  4DV7 B;  4IHJ A;  5B1A C;  4K8Z A;  1MSD A;  1R73 A;  4DV7 O;  1BGY H;  2YIB A;  4B3S B;  2HKO A;  2X6A A;  4B3S O;  3K5O A;  3AG3 C;  3W7S A;  2V1D A;  2F4V B;  1FXV A;  3AG4 C;  3MD0 A;  2F4V O;  3NR7 A;  1R3I C;  1QU7 A;  2FML A;  3BEH A;  4JV5 B;  2Y0I A;  3WB0 A;  4JV5 O;  3JSL A;  4O4J B;  2PTM A;  3SYP A;  5B3S C;  2EIM C;  5EYP B;  2QTO A;  4H13 B;  1OCR C;  1K8A W;  4X1Y A;  1Z5W A;  4JZG A;  4PA4 A;  1FKA O;  4WBN A;  1DF5 A;  4YJ2 A;  2RDC A;  4TOI A;  4CBC A;  2HR3 A;  3O65 A;  3OT7 A;  4DV6 B;  3KG2 A;  2EJ7 A;  1LR1 A;  1OJH A;  2ZIM A;  1I08 A;  2WLN A;  1IZ3 A;  2CTQ A;  1H38 A;  5KA6 A;  3E22 A;  2AZ0 A;  2ARH A;  4DR4 B;  2YEV B;  3CPW U;  4JAV A;  3H1I H;  1Q81 W;  2Q9L A;  3CS5 A;  4RQE A;  2F95 B;  4AQY B;  4JPR A;  3RFR A;  1TA8 A;  1R3J C;  3KCY A;  4ZI7 A;  3H9V A;  3IC9 A;  1Q86 W;  4MVR A;  4KP4 A;  1H2K A;  1NVP D;  5LYJ A;  5GON A;  2E76 B;  1E1Q G;  1BL8 A;  3OMA B;  1IDS A;  2LGQ A;  3QO5 A;  2D2C B;  4DO2 A;  5J2T B;  2MK3 A;  4DV0 B;  4KL1 A;  1HNW B;  3FAV A;  2QKS A;  5JH7 A;  2BTQ B;  3WB1 A;  1EZJ A;  4FFB B;  4UCR A;  1K7D A;  2VWK A;  2NN4 A;  2HP8 A;  2IW5 A;  4LF9 B;  1VEW A;  1QHT A;  3G6B A;  3ABU A;  2DYR C;  3CME V;  1QLE B;  2X7R B;  3E8H A;  2BE3 A;  3RYH A;  4UCS A;  1M57 B;  2QSA A;  1K3E A;  1GH6 A;  4X66 B;  2DQ3 A;  3PJS K;  2ATK C;  1WNS A;  3CYO A;  4QNH B;  4R7C A;  3K0D A;  5B1A B;  2YXY A;  5H6R A;  2QWR B;  1IXB A;  3K0G A;  2YIA A;  1JQ0 A;  3OFN G;  3G80 A;  2PI4 A;  3CMA V;  2P6J A;  4X88 A;  4J7J A;  1P7B A;  1XL4 A;  3FB6 C;  1TAE A;  1SF9 A;  5CBG A;  3AG3 B;  2JRI A;  3OD4 A;  5DED A;  3AG4 B;  1B06 A;  3OMN B;  2P06 A;  4GKJ O;  1ENV A;  4UFZ A;  3FB7 C;  1MOF A;  5JJN B;  2Q67 A;  2JS3 A;  3H1L H;  2IU0 A;  1XL6 A;  3ZCC A;  2UUA B;  3ETG A;  1YEW A;  4RUE A;  5IYB O;  2M7W A;  2LGW A;  1R3K C;  4X20 A;  1PD3 A;  5B3S B;  2WLL B;  4FPP A;  2EIM B;  3WG7 C;  1OCR B;  4I50 B;  2XUM A;  1W2B U;  1JFF A;  3K9S A;  3C3T A;  5EC2 C;  1WA8 A;  2C2A A;  3UKM A;  3X2Q C;  2L6L A;  3FD9 A;  2HEP A;  4LF5 B;  3WFV A;  4JYB A;  5CA1 B;  1IVS A;  2A9H A;  4ZOL B;  3N2G B;  3A0B Z;  3RYF A;  4K3A A;  3VQY A;  5EBL C;  2QR4 A;  2A0L A;  5EBW C;  4DK0 A;  5JWP A;  2JGD A;  4BR6 A;  5BZB A;  1ZUQ A;  1V9P A;  1NTK H;  2IM9 A;  3K57 A;  1YJ9 V;  4Z1M G;  1SQF A;  4X9Q A;  2A3Q A;  2QEX V;  4NXN B;  3HKC A;  2YC0 A;  1P84 F;  2HJF C;  4FLW A;  3ZRW A;  1SKV A;  3MAQ A;  3UT5 A;  2P22 C;  2PZS A;  4XDL A;  1GK9 A;  4X62 B;  1AIL A;  2BTO A;  2F43 G;  2GSM B;  2H8P C;  3JSN A;  2PY5 A;  3LSU A;  3DXR B;  2Q8V A;  4DV1 O;  2CTP A;  2Q4P A;  3ZMS A;  4YY3 B;  4YY3 O;  4ABM A;  5LMN O;  4LF7 O;  3CC4 V;  3BAA A;  3JAW B;  3L74 H;  5CA3 A;  1IBK O;  5JQG B;  1VQ9 V;  4OXS A;  1H2N A;  1H8E G;  1XIL A;  1X4T A;  4O4I A;  1TVK B;  4WFG A;  2DYR B;  4DV4 B;  1W0J G;  4JAU A;  4Q6G A;  4DV4 O;  1MMM A;  1VF6 A;  2IJI A;  4LF8 O;  1BT8 A;  4GX2 A;  2EZP A;  3GVM A;  3ZHU A;  1ROP A;  3ZJZ A;  4LFA B;  1OCO C;  2UXD O;  2B5U A;  4B08 A;  4YJ3 A;  3JAR A;  4JI2 O;  2YIB D;  5CB4 A;  1MG1 A;  3S3W A;  1GM9 A;  3QO7 A;  5KA5 A;  4HZ3 A;  5DM6 V;  1QQC A;  4GT1 A;  5ITZ B;  1GN4 A;  1NVP B;  3TXS A;  2HFE C;  1DF4 A;  1VF5 B;  4O4H A;  4WF9 V;  2ETN A;  5H5N A;  4CH4 A;  2FTK A;  4DV5 B;  1JX9 A;  3ABL C;  5LP6 C;  3WG7 B;  4H33 A;  1N8R W;  3JAL B;  4O4L A;  2IJH A;  4EKW A;  2V7Q G;  3X2Q B;  1AJP A;  1F23 A;  1NKD A;  5GW7 A;  1QLN A;  4PD4 F;  1VQM V;  4YHH B;  1N36 B;  2M6Y A;  4MT8 A;  5KAF Z;  4JI7 B;  3LNM B;  3CWB H;  4HAM A;  1WJZ A;  5CBH A;  2ZDI A;  4I7Z B;  1XBL A;  4UUJ C;  3SGI A;  4B3M B;  3QF7 A;  1THZ A;  4WFE A;  5EIB D;  3RYC B;  4B3M O;  1S5J A;  2R72 A;  3OTO B;  3OTO O;  1N34 B;  2JEX A;  1S5L Z;  1K5Q A;  2OIE A;  3UQ8 A;  2JJ2 G;  1N32 B;  2OCH A;  2D3O W;  1WN7 A;  2FL4 A;  3TET A;  3JAS B;  1EN4 A;  1EZV H;  1ZL8 A;  1MSW D;  5C8Y B;  4K35 A;  2P4K A;  2YI8 A;  3I5D A;  3ML0 A;  4WFA V;  3CRC A;  3VQX A;  5KHI A;  4NXM O;  3BY6 A;  3CCS V;  1VQ5 V;  1IBL O;  5IWA O;  3CC7 V;  1TGO A;  3OR7 C;  3CCQ V;  4DUY O;  2WLI B;  4CC6 A;  3ABM C;  3CEI A;  1XRE A;  3LDC A;  3CD6 V;  1QNM A;  1SQV H;  4TV9 B;  4JTC B;  5IT9 N;  1QBZ A;  1JA8 A;  2QWQ B;  2XAH A;  3T4Z A;  3ZED A;  4CS3 A;  4CS4 A;  1XNR O;  3JAT A;  4CC5 A;  1M4U A;  1YXB A;  4NTY A;  2Z5U A;  2WSS G;  5EIB C;  2WLM A;  1SES A;  2JVD A;  2YI9 A;  1M1K W;  3ETE A;  1OCO B;  3JD3 A;  4HNA B;  2DN9 A;  1RSO B;  3CCL V;  3CCJ V;  1K4C C;  3OTF A;  1ZSP A;  3RBZ A;  1E1R G;  5H2F Z;  3HKD A;  1YZB A;  4NKG B;  4PA3 A;  1OV9 A;  2AGA A;  4FLT A;  4JAS A;  4LWS A;  5CMU A;  3JD0 A;  2QWN B;  5LOV A;  4A5U B;  4IL6 Z;  4B7E A;  2YXL A;  1VQ7 V;  4LF4 B;  2HVK C;  1YI2 V;  3FX7 A;  2P4V A;  1Q82 W;  1COW G;  3CSX A;  5LBQ A;  2O57 A;  1PM9 A;  3CB2 A;  3ABL B;  5LP6 B;  2ZM6 B;  3AK1 A;  1LUW A;  2ZKO A;  3RYI B;  1L0L H;  5KLV H;  1KEC A;  2ZR2 A;  1VQ8 V;  4DW0 A; 
#chains in the Genus database with same CATH homology
 1GKF A;  5CN0 A;  4PA4 A;  3CCR V;  3CCU V;  2CK3 G;  1DF5 A;  1K9M W;  2H94 A;  3ASN C;  2ITC C;  3GB7 C;  5C93 A;  4CBC A;  3DGE A;  2HR3 A;  4WFF A;  3SPJ A;  3FB8 C;  3KG2 A;  4MSW C;  1OCZ B;  3B8N A;  2K1E A;  5CBF A;  1V54 B;  1V55 C;  1QVF U;  2WLJ A;  1FXK B;  2WLN A;  3ASO C;  4PDM A;  2EBO A;  1H38 A;  1AI5 A;  5H9C A;  3FB5 C;  3W7W A;  3ABK C;  5KA6 A;  2LFR A;  2EIL C;  1QVG U;  2LP7 A;  2UXX A;  3HB3 B;  3SYO A;  2UXN A;  3G6E V;  1NJI W;  1JVM A;  3STZ C;  1J95 A;  2B1G A;  2YEV B;  2ZR3 A;  5EK0 A;  3CPW U;  3STL C;  4MW8 A;  3LSS A;  4JAV A;  5HFL A;  1OCC B;  3QNE A;  4RQE A;  1Q81 W;  4JF3 A;  4JPR A;  1UJW B;  1S3J A;  3IFX A;  1R3J C;  3VOU A;  1K73 W;  5L3C A;  2QA4 V;  1QCE A;  5IYC O;  1Q86 W;  1M56 B;  4FK5 C;  1AI4 A;  2BOC C;  4KP4 A;  4MVR A;  1NVP D;  1KKD A;  1E1Q G;  1BL8 A;  3ABM B;  3OMA B;  4PA9 A;  3AEI A;  4DO2 A;  3QO5 A;  5KUM A;  1YSC A;  1FS0 G;  2X6C A;  2MK3 A;  4JTD B;  1NR1 A;  3A0R A;  3SPH A;  2R9R B;  3K79 A;  1WPX A;  3E8F A;  2JK5 C;  2QKS A;  1EZJ A;  1R6K A;  3R65 A;  4ASU G;  1K7D A;  5IDJ A;  3E89 A;  5LGT A;  2IW5 A;  2DYS C;  4I9W A;  3E35 A;  3EHB B;  3E86 A;  2WLL A;  2NLJ C;  3ABU A;  1K92 A;  3F7V C;  3K04 A;  2DYR C;  3CME V;  1YIT V;  3ZN0 A;  3D3I A;  1QLE B;  3JD2 A;  1H8H G;  2X7R B;  3E8H A;  4P30 A;  2QE7 G;  2WLH A;  1M57 B;  1NH2 B;  1K3E A;  1IXM A;  2JJ1 G;  2BOB C;  2DQ3 A;  3ZMV A;  4MVQ A;  1BHB A;  3PJS K;  2ATK C;  4MTO A;  1YTF D;  3CYO A;  3FYI B;  1W0K G;  3SPG A;  1KP3 A;  2HG5 C;  3MHH C;  4QNH B;  4R7C A;  3K0D A;  5B1A B;  5H6R A;  1FXH A;  3K08 A;  5L3G A;  1YJN V;  4RO2 A;  3K0G A;  3OUS A;  1JQ0 A;  3OFN G;  1PL0 A;  3CMA V;  2PI4 A;  3JD1 A;  2P6J A;  4X88 A;  2Q69 A;  1K34 A;  1P7B A;  1XL4 A;  3FB6 C;  1AR1 B;  5CBG A;  2ZXW C;  3T4D A;  3AG3 B;  1S0V A;  3E8B A;  4BIZ A;  1VQP V;  3RVZ A;  2P67 A;  3AG4 B;  4LBE C;  3OMN B;  1ENV A;  3FB7 C;  1MOF A;  2Q67 A;  4LCU C;  4PDV A;  3UM7 A;  2IU0 A;  1XL6 A;  3AG2 C;  3ZCC A;  1M90 W;  3ETG A;  4ZBM A;  4FMT A;  3OMI B;  2EIJ C;  3SPI A;  4JYC A;  2XAF A;  4RUE A;  4WCE V;  2R9I A;  1ZWI C;  5IYB O;  2M7W A;  2YSU B;  1R3K C;  3K9A A;  4G2K A;  4LP8 A;  3CXC U;  1PD3 A;  5B3S B;  5IYD O;  2XND G;  2WLL B;  4FPP A;  2EIM B;  3WG7 C;  1CEZ A;  1OCR B;  1OHH G;  1W2B U;  5EC2 C;  3UKM A;  2C2A A;  1S72 V;  3X2Q C;  2IH3 C;  2W6J G;  3E83 A;  3ASN B;  2DWD C;  3RVY A;  4UVA A;  4GX1 A;  4KUM A;  3EFF K;  3WFV A;  2DWE C;  4JYB A;  4ZKI A;  1GM7 A;  1VQK V;  3IC7 A;  2JIZ G;  2A9H A;  1V55 B;  1SET A;  4UVC A;  1H2G A;  1DLB A;  3ASO B;  5KUK A;  5LHH A;  5EBL C;  4MTF A;  2A79 B;  1PNM A;  3ABK B;  2A0L A;  2OCC C;  5EBW C;  2DW4 A;  3TCU A;  2EIL B;  2AHY A;  5LHI A;  3ZMU A;  3M99 B;  1K33 A;  3FYE B;  5BZB A;  5L3F A;  2LFS A;  1Y4M A;  5LGU A;  4MS2 A;  4MVM A;  1YJ9 V;  4Z1M G;  3SYC A;  1LNQ A;  1JJ2 U;  3TK1 A;  4MTX A;  1GO3 F;  2IH1 C;  4J9Z B;  2QEX V;  3SJQ C;  2KB1 A;  1KC8 W;  5H6Q A;  5L3B A;  3OE7 G;  3I56 V;  2HJF C;  3ZRW A;  3G71 V;  4L87 A;  1S5H C;  1NBM G;  1PKX A;  2XAS A;  2IJK A;  2XOK G;  2EIN C;  4GCZ A;  1GK9 A;  3JCZ A;  4XDL A;  1L1F A;  3ZMT A;  2F43 G;  2GSM B;  2H8P C;  3E2E A;  1K97 A;  3K3W A;  1GM8 A;  5B1B C;  1CP9 A;  4MTG A;  4P9O A;  4J9Y B;  5L3E A;  3G4S V;  3ZMS A;  4WFH A;  5E1A C;  1JOY A;  2X6B A;  4RUF A;  4H37 A;  2XAJ A;  3W7X A;  2ZDI C;  3CC4 V;  4KFM A;  1GMG A;  2DYS B;  4QPK A;  4MVS A;  5CA3 A;  1VQ9 V;  4HYO A;  3JD4 A;  2JEU A;  1S76 D;  2ZQM A;  4OXS A;  1H8E G;  3AG1 C;  4X8A A;  3K03 A;  2DYR B;  3HPL C;  1K5S A;  4WFG A;  3P30 A;  4WFB V;  1JPX A;  1W0J G;  4JAU A;  4R6Z A;  3CC2 V;  2EJR A;  3LDD A;  4PEL A;  4G27 B;  2QM7 A;  3B77 A;  4X89 A;  5L3D A;  2IJI A;  4MVO A;  1AI6 A;  1VQN V;  4GX2 A;  2EZP A;  4E2L A;  1K4D C;  3OEH G;  3QO8 A;  1G8M A;  1ROP A;  3ETD A;  2WAM A;  4PA7 A;  3ABT A;  3ZJZ A;  3CCV V;  1OCO C;  1AJN A;  2B5U A;  3CCE V;  3GWO A;  1P4R A;  2OTJ V;  5HFM A;  3OUF A;  1RM1 C;  3F5W C;  3CCM V;  4P2Z A;  5B1N A;  1WLE A;  1CPY A;  3LSQ A;  1RM1 B;  1VQL V;  2Y69 C;  1FFT B;  3ZRV A;  2ZXW B;  1MG1 A;  1HWY A;  2X0L A;  1PNL A;  1B6Q A;  1GM9 A;  2P7T C;  3QO7 A;  1FXK A;  4G28 B;  5IY5 C;  5KA5 A;  5LGN A;  4HZ3 A;  1PNK A;  1QR9 A;  5DM6 V;  4TSF G;  4DXW A;  1G4Y B;  4GT1 A;  1NVP B;  2HFE C;  1DF4 A;  2PI5 A;  3AG2 B;  4WF9 V;  2HLD G;  4YXW G;  3JYC A;  1R6N A;  4R8C A;  2B1I A;  2EIJ B;  2FTK A;  2W6I G;  1JX9 A;  2YEV A;  3ZMZ A;  4UVB A;  3ABL C;  2JDI G;  1VQ4 V;  5FL7 G;  3WG7 B;  2OTL V;  4H33 A;  1N8R W;  4PA6 A;  1EFR G;  1KQS U;  2IJH A;  4LC1 A;  1Y66 A;  4EKW A;  3ZRS A;  3OEE G;  2V7Q G;  3X2Q B;  1AJP A;  1F23 A;  3SYQ A;  3H01 A;  3SYA A;  1NKD A;  5GW7 A;  1YIJ V;  1QLN A;  3OAA G;  4CZZ A;  1VQM V;  1YJW V;  1Q7Y W;  2IU3 A;  2XAQ A;  4N21 A;  2EIK C;  4XBF A;  2WLI A;  1F4M A;  2EZO A;  4I5S A;  4MT8 A;  4U7N A;  1I5X A;  4MW3 A;  3LNM B;  4JGS A;  4HAM A;  5CBH A;  2ZDI A;  1M9N A;  4U7O A;  3ZIA G;  4TWK A;  4RQF A;  1ARO P;  4QE9 A;  4F4L A;  1NQT A;  5LHG A;  2WWW A;  1OCZ C;  4MVU A;  4UUJ C;  3W7U A;  3K06 A;  4TT3 G;  1V54 C;  2OCC B;  3E8G A;  1YTF B;  4WFE A;  1THZ A;  1FXK C;  4XDK A;  1RPR A;  5DN6 G;  1OZ0 A;  2DQ0 A;  1F51 A;  1TUE B;  3B8M A;  5EC1 C;  1NH2 D;  3W7T A;  3OW2 U;  1KP2 A;  2ZD9 A;  2WLK A;  4UV9 A;  2JEX A;  1K5Q A;  2JJ2 G;  1VQ6 V;  3OGC C;  2D3O W;  5B1O A;  2HVJ C;  3D36 A;  1OCC C;  3TET A;  2IJJ A;  1ORQ C;  3LUT B;  1MSW D;  1NR7 A;  4BAY A;  1E79 G;  4XDJ A;  4QIW F;  3T1C A;  2EIN B;  3ML0 A;  4BIU A;  4WFA V;  4UV8 A;  1SER A;  3BY6 A;  3CCS V;  5EBM C;  1R3L C;  1VQ5 V;  4MVZ A;  2ITD C;  5B1B B;  4P9P A;  1M56 C;  2AHZ A;  2P90 A;  3DTU B;  3NXS A;  3CC7 V;  1AI7 A;  3FKS G;  3OR7 C;  4PDR A;  3CCQ V;  1I5Y A;  2WPD G;  2WLI B;  3ZN1 A;  3ABM C;  3LDC A;  3CD6 V;  3OR6 C;  4FIP C;  1MAB G;  4JTC B;  4GX5 A;  4JTA B;  4FJC C;  1QBZ A;  3OM3 B;  2QM8 A;  3AG1 B;  2NNU A;  1EBO A;  3LDE A;  2W0F C;  2XAH A;  3T4Z A;  5J9P C;  1SZT A;  4PDL A;  4GX0 A;  1S77 D;  2Z5U A;  2WSS G;  1RPO A;  2WLM A;  1QLE C;  1SES A;  1SRY A;  1QR8 A;  1BHA A;  1M1K W;  3ETE A;  4R50 A;  1OCO B;  3JD3 A;  3F7Y C;  3VBB A;  1M57 C;  3ZRW B;  3CCL V;  3CCJ V;  1K4C C;  2OT5 A;  2Q6A A;  3RBZ A;  1F4N A;  4UXN A;  1E1R G;  3CP1 A;  2Y69 B;  1YHQ V;  4PA3 A;  5B1A C;  1GTO A;  5IY5 B;  1R73 A;  3P32 A;  4JAS A;  5CMU A;  4Q20 A;  3JD0 A;  2HKO A;  2X6A A;  1BMF G;  2GHY A;  3ZRX A;  3AG3 C;  2XAG A;  3MHS C;  4N23 A;  3W7S A;  2V1D A;  1FXV A;  3SPC A;  3T2M A;  3RW0 A;  3AG4 C;  3MD0 A;  1VQ7 V;  2Z3Y A;  2HVK C;  1YI2 V;  3IGA C;  3I55 V;  1Q82 W;  1COW G;  1AJQ A;  1KD1 W;  5LBQ A;  4QE7 A;  1DTO A;  4QPJ A;  1R3I C;  3ABL B;  2Q68 A;  4QJF B;  3BEH A;  1JCH A;  4BW5 A;  3SYP A;  5B3S C;  1KEC A;  1VQO V;  2EIM C;  2QTO A;  2ZR2 A;  1OCR C;  1K8A W;  1VQ8 V;  2EIK B;  2Y48 A;  4RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...