2IJHA

Crystal structure analysis of cole1 rom mutant f14w
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
57
structure length
57
Chain Sequence
b'GTKQEKTALNMARWIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 28
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijhA00
1F4NA 1B6QA 1ROPA 1RPOA 1GTOA 2IJHA 2IJKA 1F4MA 1RPRA 2IJJA 4DO2A 3K79A 2GHYA 1GMGA 2IJIA 1NKDA 1PD3A
chains in the Genus database with same CATH superfamily
5KUKA 4EB6A 3AK1A 5IY5B 2DOSA 4OX9O 2UU9B 4B3TO 5EIBC 3DSQA 1Q82W 4B3SO 2A9HA 4LFCB 3FB8C 1XHZA 4JV5B 5LYJA 4H13B 1S77D 1PNKA 3STZC 3AG2C 3A2FA 4B3RB 1L8DA 1MSDA 1GM7A 3CRCA 4D7TA 2MK3A 1H2KA 3JARB 2DYRB 3JCUZ 3Q4HA 1VMGA 3ZCCA 3ETEA 2DYSB 2VQFO 2ZNIA 5KA5A 3CXHF 1I94O 1GMGA 4ABMA 5BY1A 4ZBMA 4JI4B 4JGSA 1S5LZ 3JD2A 2ZE5A 2V4DA 5EBMC 1H2MA 3IGAC 3CCQV 3K5MA 3OR6C 4MVOA 2UUAB 2BOCC 4W4LA 2BSKB 1FD9A 1SS3A 1XREA 4Z2WA 4DYLA 1K33A 4DW1A 1QQCA 5B66Z 1Q86W 1TVKA 5CA0B 1NVPD 4EEQA 1S3JA 3A0BZ 3IC7A 3F7VC 2HHHO 1U96A 4O4JA 3R66A 1GN2A 1WJZA 2PGGA 4CBCA 4E2LA 3ETDA 2P4VA 3E22A 1PV0A 2Q0OC 3VQWA 5LP6A 5LP6C 2GSMB 3I5DA 1HNXO 3OR7C 2GTSA 1AI6A 4NXNB 4JI3B 3RYHB 1XI1A 1WLEA 5EYPA 2Q67A 2E76B 2PTMA 1GN3A 2EIJC 4YJ3A 5GONB 5JJNB 3J81N 1GM8A 2RCVA 3A0HZ 4JAVA 4ZKIA 4I0XB 5IY5C 2Q6AA 5H6RA 1NJIW 1PM9A 1Y76B 4J7KA 3LSUA 3HB3B 3OEHG 4X9QA 1X4TA 4MTGA 3ZN0A 4PA4A 4DV6O 1VQ5V 3QVNA 1BQZA 1FXKA 2P5OA 2HJFC 4AQYB 3JSNA 2NR5A 1F4NA 4P9PA 5LGTA 1FJGB 2DYRC 4DV3B 1R6NA 1M93A 3K06A 1XDCA 3SPCA 3APQA 2DYSC 3OAAG 1PL4A 1M90W 2X0LA 1MMMA 5CA3A 3FB5C 3L73H 2Y0PA 4YIPA 4LF9O 2QWNB 4LFBB 4DV7B 2DWDC 5LMNB 3E8HA 4FMTA 1XNRO 3TGUH 4FFBA 4J7ZA 3J80N 2ZM6B 1B06A 3MHHC 4RQEA 2BSKA 3EVKA 2YIAA 1MOFA 3CC2V 4N21A 2YI8A 1NTKH 2P90A 1AILA 3VQYA 5B3SB 3QG5A 2IJHA 2F66C 1AVMA 3P3NA 1J5EB 1BMFG 5JVDB 2EJRA 4QE9A 5GW7A 2Y69B 2JRIA 2XAHA 3CCSV 1P4RA 5LA6B 3RYHA 2VQEB 4JYBA 1Z5VA 4LP8A 1K4DC 1GM9A 3B8MA 3G80A 2YIDA 2F93B 5KLVH 3VQXA 5GONA 4JI5O 1JQ0A 4I0XA 4JYAO 1Y76A 2V7QG 3ZHVA 5KAFZ 4N23A 5LGUA 2XT9A 1Y4MA 1R6TA 3H1IH 3RWRD 2ZE7A 3A0RA 2OTJV 4TV9B 2A7WA 1Q81W 2KSDA 4I55B 4LC1A 3ZRVA 1QHTA 4R7CA 1N33O 1ZL8B 4GYCB 4J9YB 1FFXB 3QNEA 5GTIZ 1XBLA 1L1FA 3GWOA 1K34A 1HNWO 2VQFB 1M4UA 4DRXB 1I94B 1P7BA 3CHXA 4DK0A 4LF8O 3ZMTA 2AGAA 1ZX3A 1E1RG 3ABKB 3BA9A 2ZIOA 4J80A 2X6BA 1XL4A 2WAMA 1XHXA 4PD4F 3RW0A 2GBOA 4JZGA 5HFLA 1IURA 2EBOA 4K8XA 1P84F 1H8HG 4PDRA 5B3SC 3JAMN 4KL1A 2UXXA 1MZEA 1VQ6V 3W7SA 3QO5A 3LSQA 4P30A 3RYCB 5JVDA 2Y69C 4P2ZA 1J95A 3UCSC 2HHHB 1N32B 4LH6A 4UCVA 3N2KB 4PA3A 5EK0A 4FM0A 1OV9A 1O9HA 4LF6O 5IT9N 3ZBHA 1R3JC 2CUGA 2VS0A 3IAYA 1HNXB 4PA7A 2P67A 3D8CA 2JK5C 1K7DA 3ML0A 3H1LH 3JD3A 3SJAC 3S3XA 2XAJA 5EBLC 1SRYA 4DW0A 2O57A 5L3GA 4P9OA 3F7YC 4UV8A 1R3IC 4NR1A 2JS5A 4DK1A 4ZI7B 3CC4V 4TV9A 4H44B 2N74A 5IE9A 1GH6A 2OCHA 2QDOA 4JAUA 3UT5B 2IJKA 1ZL8A 3OMIB 2CK3G 3LDEA 4UCRA 3CCJV 4J11A 1PL0A 4DV4B 2WLLB 3FB7C 1LNQA 4QE7A 3MHSC 5LBQA 4DRXA 3UO3A 3CCVV 1VQ9V 1IDSA 2F23A 2ATKC 1YCIA 2ZQMA 5KHJA 2R72A 4HNAA 5FNVB 2YI9A 1FAFA 3CP1A 3ABKC 4ZOLB 3HKCB 2UUCB 3OTOO 3C3TA 4UUJC 5KX5B 4JV5O 1BZKA 1UFIA 2YICA 2BTQB 3UKMA 1OHHG 2R9IA 3P3PA 5KHIA 3K04A 1MNGA 1X59A 2Q69A 4FZ1A 5B1OA 4FPPA 3OFNG 3OM3B 3RYCA 1D2DA 5KHGA 1SESA 2M7WA 1EZVH 5IYZB 4JI4O 1K97A 3N2KA 2CE4A 4FM2A 4F6EA 2H3OA 1QR9A 1XQ8A 1YJ9V 3LDCA 5JQGB 4O4HB 2XASA 2ZIMA 2UUAO 1WB7A 1XL6A 3FKSG 1GN4A 4X1KB 4YJ2B 2EJ7A 3JALB 2YDEA 4FIPC 1NT2B 1HNZO 1Q6IA 3JD4A 2NNUA 4ZI7A 1AB3A 2P7TC 5LHGA 2XAGA 1BGYH 3HPLC 1FKAO 2K9PA 1BSMA 4QNHB 1YJNV 3UT5A 2ZDIA 2JGDB 3K0GA 2ZDIC 4Z1MG 4NXMO 4GX2A 2Y48A 2WLLA 3FYEB 4JI3O 1N33B 4FFKA 3WB1A 3C90A 2V1DA 1XMQB 1EN5A 3SYPA 4HZ3A 3JYCA 3BVOA 2VWJA 1GO3F 3O65A 1VF7A 5FNVA 1VQ8V 4K3AA 3HKCA 4F6RB 1N0JA 2OIEA 3K58A 1ZLZA 3MDSA 2F1MA 1L0NH 2BTQA 2WLHA 5GTHZ 2C2AA 3CRMA 3CCUV 1RFYA 4AQYO 1PNLA 1EN4A 3PJSK 4JPRA 1M57B 3F5TA 3W7XA 4LF7B 3ZHQA 2LFRA 1MSWD 5DM6V 1SZXA 2B1GA 3QO8A 3RYIB 4GKKB 2XTAA 1BCCH 1WNSA 3CXCU 1W59A 5F2VO 2W6JG 3Q4HB 4FLZA 4U3FH 2YUAA 1KP2A 1AP5A 4DV7O 4I9QA 1ROPA 4KHPB 1JFFB 5IDJA 2LW7A 1V55B 5JQGA 4O4HA 1GK9A 5E1AC 4UCTA 1SQBH 4GT1A 2QSAA 4UB8Z 5LGNA 3ASOB 4CH5A 5C93A 3GB7C 1NI8A 4X1KA 4YJ2A 3SJBC 4A5UB 3JALA 1WPXA 1SQQH 2QM7A 3K5NA 2B1IA 4TOIA 3ETGA 1D5NA 1GKFA 4X64O 2ZXWB 2QR4A 2YEVA 2ARHA 4OGQB 2JGDA 2EINB 3H1JH 2Q8VA 4TQDA 3S3WA 1JJOA 5JWPA 1KD1W 4O4JB 3SYOA 3CRAA 4HAMA 2K1EA 3LNMB 2RN9A 1CPYA 2AHZA 4RAIA 3T1CA 3SPJA 4XDJA 4GKJO 4DR5B 5LHIA 3E86A 1Q6HA 3HKDB 1XMOO 4JI0O 4MVZA 1M9NA 2E5LB 1AJPA 4YIOA 1B6QA 1GN6A 2E3CA 5JH7B 5TISZ 4J42A 3L74H 2H94A 3OTOB 5EC1C 1M57C 5B1AB 4RO2A 2Y4UA 5BXZA 2RQ6A 3RYIA 2JDIG 1FXKB 1Q8IA 1YEWA 3AK3A 3LUTB 4J7JA 1EFRG 2E74B 4UB6Z 1QNMA 4I50B 3GVMA 1KUQA 2Z0AA 2OT5A 1XUQA 2QKCA 3KCXA 4JI1B 1VEWA 1JFFA 1IBKB 1V55C 2N05A 4FVMA 2B5UA 3WB0A 5CN0A 5DECA 3ASOC 3DTUB 4KXRA 2BOBC 1W2BU 3LSSA 4O4IB 1U97A 3P30A 3A8TA 4CH4A 4FLTA 4FFBB 3H1KH 2CGOA 4C7UA 4CC6A 2WSSG 4NYKA 3JAKB 2ZXWC 2GUZB 1HNZB 4J41A 3THOA 2EINC 3M8AA 2JVDA 1N32O 3BA8A 3CB2A 2YC0A 1IVSA 5J2TB 3K5LA 3CCRV 3BABA 3B09A 1F23A 1F4MA 4D6TH 3P32A 4WFFA 2HFEC 4NXMB 1PPJH 3HKEB 4TSFG 2AZ0A 2Q68A 3HKDA 4NKGB 4PDVA 3ZMVA 5IYBO 4LFAB 1YDXA 1FXVA 4Q20A 5ITZB 2L6LA 5IYCO 1QVFU 3ASNB 5JH7A 4CH3A 5B1AC 2OWOA 2DJVA 2WLMA 2GTAA 1CP9A 2RJZA 2XAQA 4D7SA 1FXKC 3IJ4A 2KKWA 1YI2V 2LFSA 5KMGB 4DV4O 3ZRSA 1S72V 4KFMA 4I50A 4LCUC 1O9GA 2DMXA 4O2AA 1SF9A 3OMAB 3CC7V 3E35A 1OZ0A 1G1XB 3ZIAG 4LF5O 4BAYA 1OCOB 2P6JA 2JEXA 4JI8O 4I9WA 2UUCO 2R9AA 3U0ZA 5JJJB 4O4IA 2HJDA 4TQFA 3RT3C 1THZA 2DQ3A 1JX9A 1QCEA 4EFEA 2MW2B 4GZRB 4MTXA 4WBNB 2LP7A 2Z5UA 2PI4A 1VF6A 3JAKA 1VF6C 2GUZA 4UVAA 3O9OA 1YSCA 4IGGA 3BHPA 1Q43A 4MVMA 2Q7EA 4FLYA 4X64B 2BTOA 3G71V 1N0NA 5J2TA 3D3QA 4GX5A 4O2BA 4K0KO 1KB9F 4DUZB 1BS3A 5B1BB 1P7GA 4R6ZA 1VARA 1N8RW 1AP6A 2IH1C 1VQNV 3NXSA 3HKEA 1WP8A 4JI2B 3FAVB 5FL7G 4GKJB 5ITZA 1EZJA 1Y74B 3ASNC 1SQXH 1XMOB 2PZSA 2UXDO 3K59A 1ENVA 3TCUA 4JI0B 1SQPH 3SDLA 1NTZH 3U10A 2ZNJA 4HBNA 1W0JG 3HR0A 1VF5B 5KMGA 1SQFA 1XILA 1IX9A 2LW1A 4B3MB 4Q6GA 4B7KA 5JCOA 3G6BA 5JCOC 1LUWA 2CTQA 1G8MA 1G4YB 1KYOF 4BWAA 1XMQO 3ICXA 1A32A 4DV2B 1OCOC 3L71H 4MVSA 4X1YB 3ZN1A 5KAIZ 5IJ9B 4K8ZA 4HNAB 1M56B 1UJWB 2P06A 1PP9H 2QWRB 2F4VO 2DQ0A 2ITDC 3RN4A 1R6KA 1CEZA 2HKOA 2QKAA 3T2MA 4LF7O 4WBNA 4FK5C 5C8YB 1RSOB 3K9AA 1JJ2U 3OUSA 4I5SA 1K8AW 4RWUA 2WA3A 3OGCC 2Y0IA 1YXBA 2Q9LA 4GKKO 4J10A 1ZAUA 4NTYA 5IYDO 3AG3B 4KHPO 5B1BC 1EM1A 4DUYB 5FLXN 1ZSPA 2ITCC 1R3KC 1DF5A 3H01A 4NB5A 1HR0B 2VRZA 1WPBA 5H6QA 3CYOA 5H9CA 3FAVA 3N2GB 1AI7A 2Q73A 1E79G 3E2EA 1RPRA 1Y74A 1R1BA 1YTFD 1R3LC 2JEUA 3T1YB 2LO1A 3E89A 1E1QG 5LXTB 2PYJA 1YTFB 4JASA 1YHQV 1NU1H 3EHBB 4GX1A 2QM8A 1KC8W 3ZX6A 4DR4O 3QO7A 3JASB 4PV1B 4DXWA 1IXBA 4DR5O 2CH7B 3UM7A 4X1YA 2PYLA 1FS0G 1H2LA 4HYOA 2FL4A 3ZJZA 3CCLV 2Q7HA 4OPAA 5H2FZ 2E5LO 4LF5B 3RYFB 5IJ9A 4WFHA 5K1PA 2WLKA 4JI8B 4O4LB 1WAZA 1M56C 2IBZH 4QPKA 1Q6UA 4MVUA 4R50A 2AHYA 5C8YA 1YF2A 1RSOA 3QF7A 1Z5WA 1PNMA 3L9DA 4I7ZB 2OCCB 2KG7B 3E8GA 4QJFB 3CD6V 1M5IA 3K08A 1K92A 3B4SA 2HEPA 1HWYA 1H2NA 3AG3C 4JI7B 5CBFA 4LH7A 2D2CB 2R9RB 3G6EV 4JI1O 4IYIA 1IBKO 3WG7B 1AI5A 1TA8A 4K35A 1D5AA 1TUBA 4K0KB 3AG1B 3DC5A 4WFEA 2WLJA 3N2GA 4MT8A 2OIGA 4PA6A 4H33A 1AJQA 1NZ6A 4RUFA 1NH2D 3K5OA 5LXTA 5JJEB 1SETA 2KB1A 2W0XA 2UXDB 1HDJA 2W0FC 1KP3A 2XAFA 2WA4A 1NH2B 2YEVB 1K9MW 4OPHA 4UVBA 1NS1A 3JASA 3R65A 3CS5A 5D5PA 2CH7A 5CBGA 1WN7A 1I5YA 4L8JA 3NR7A 4UFZA 5CA1B 4EFBA 2B9ZA 4LFAO 4UCSA 3OTFA 3TETA 2RNBA 5J9PC 3ZMUA 4JTAB 2EX3A 3RYFA 1FXHA 1R73A 4JYCA 4O4LA 2XOKG 5KA6A 3L75H 2UXCO 2D3OW 1V54B 2EIMB 2R70A 1URFA 3GWKC 5L3DA 2Y4TA 5BZBA 4LNUB 1AROP 1VP7A 4B7EA 2F4VB 2OCCC 2KG7A 1VQLV 1QLEB 1M1KW 1KECA 4YY3O 3ZEDA 4DR6O 2DN9A 4Z1VA 3JSLA 1BE3H 4ICGA 1K5SA 2CTRA 1ZWIC 3WG7C 2HG5C 5L3EA 3AG1C 4RUEA 5A2QN 1T5EA 1IXMA 1CXZB 4DV0O 1BHBA 2RMKB 5L3CA 1GRJA 1FYJA 2YXYA 3SPGA 4PELA 4DR3B 4WF9V 1B3QA 5EC2C 4MW3A 3STLC 2UUBB 1MZFA 1LR1A 1RM1B 1N34B 4QIWF 1HP8A 4CC5A 1PKXA 4JZ2A 4IIJB 3EFFK 4GLXA 3CCMV 4JTCB 4DUZO 4UCUA 4L87A 1IBLO 4DR4B 5LOVA 4I4TB 4U3JB 3K57A 4X20B 4U7OA 5CA1A 4JI2O 4FJCC 3ABLB 4X66O 4LBEC 1Q5OA 3CWBH 1Q90D 2LQTA 2CTWA 3OW2U 2LGWA 1V54C 2EIMC 4BW5A 1ZUQA 2QJ1A 2A3QA 4LNUA 2HVKC 1H8EG 5E79Z 3K0DA 1QLEC 5IJ0B 2CAZC 1BT8A 4B3MO 2YSUB 2EZPA 1MABG 5FPRA 4JTDB 3PN1A 4WFBV 1P49A 1WA8B 2AXTZ 5BR8B 4DV2O 4NVPA 1H2SB 2HLDG 4O2AB 4JI6B 2BE3A 4CZZA 4LF4B 3UQ8A 4JF3A 3OUFA 3AK2A 1OCRB 3OGIB 3T1HO 2QA4V 3OE7G 2PI5A 2IW5A 4BR6A 2LJ2A 3FYIB 5LMUO 1PD3A 2YIBA 4BIZA 3DXRB 1N4CA 1RM1C 1TAEA 2ZT9B 3M99B 1S0VA 4IIJA 3TJTA 1FFTB 3ETQA 4XDLA 5B1NA 3SYAA 5D5QA 4DR7B 4DUYO 4O2BB 4I4TA 4DV1O 4U3JA 4PDMA 4X20A 1HR0O 3CPWU 2QEXV 5L3BA 2X6AA 4UV9A 5BMVB 3ABLC 1ORQC 4UCOA 2FKXA 3AG4B 5FPOA 3T4ZA 3KZIZ 1SQGA 2GV9A 3K79A 2ZR3A 1EBOA 1S5HC 4IL6Z 3T1YO 4PHZA 1NVPB 3K3WA 2AW9A 1XOUA 5KHHA 2WLNA 1MA1A 2UXCB 5KHKA 4MW8A 2QWQB 3BPZA 5IJ0A 2QE7G 1XEQA 3KCYA 2QTOA 1I7FA 1OJHA 3C3SA 4G28B 4TUYB 1WA8A 3QTCA 1G6UA 4JAAA 4YY3B 1COWG 4DR6B 5AG2A 3CE2A 5CBHA 1QVGU 2LGQA 1Y66A 4GUNA 3KKYA 1YVWA 3FX7A 2EILB 3UO2A 4X62O 3ZMSA 1OCRC 2EIKB 3B40A 1Q3EA 3JARA 1L0LH 2E75B 2KQXA 4DV0B 2A0LA 3DXRA 2QWPB 3N27A 3SPHA 1EN6A 3ZRWB 1UPGA 1Y6XA 4X89A 4PI2A 1GAXA 3HKBB 4JI7O 3VOUA 1XNQB 1H38A 1V9PA 2JGUA 4WFAV 3SJQC 3D36A 1NR7A 3D36C 4PI0A 2ADQB 3CSXA 1K4CC 2DW4A 2FTKA 1YZBA 1MG1A 1SZTA 4PJ0Z 1I08A 5BMVA 3X2QB 1IBLB 3AG4C 5CA0A 2GHYA 2HP8A 2UXBO 2PF4E 3KG2A 5LL6Y 1JA8A 4X66B 2JIZG 1FPOA 2ILMA 1NTMH 5IWAO 4W4KA 1VQ4V 2FB5A 3BAAA 2A79B 4J9ZB 3JATB 3RGBA 4CS3A 3FD9A 5DN6G 2QKSA 4TUYA 2NN4A 2WLIB 3JAWB 5H5NA 3CCEV 3ZS8C 4DR2O 1TUEB 2BCCH 4DR1B 2EILC 4OX9B 4B3TB 2WWWA 4EKWA 1SQVH 3JD1A 4B3SB 1N36O 1WP7A 2EIKC 1ZTEA 3LDDA 3RVYA 3AG7A 3G4SV 2FYUH 4JYYA 4F4LA 3SYQA 2Q7GA 3T1HB 5J2UB 2JJ2G 1S5JA 1NKDA 2QWOB 5LMUB 1KQSU 1YITV 3K03A 3ZRWA 3B77A 1IBMO 3DC6A 1YIJV 4BIUA 1JVMA 3SGIA 2UXNA 3HKBA 1QBZA 2YXHA 4U7NA 3I55V 2ODMA 1KU9A 3CEIA 1VQKV 1DK1A 3SPIA 3VQVA 1WB8A 2VWKA 1RP3B 3H1HH 4IYHA 3X2QC 4FLXA 4AILC 4X1IB 4DV1B 1TUBB 1JOYA 1KKDA 2IJJA 2EULA 2OYQA 2Q5ZA 2ZE6A 3ZMZA 4KP4A 4DR3O 2QM4A 2UUBO 3E83A 2IU0A 1N34O 5LA6A 3JATA 4LWSB 1JPXA 2ZD9A 2N04A 5B5EZ 2XNDG 3WU2Z 2ZKOA 2XUMA 2L35A 2WLIA 3JAWA 3FFQA 2CDYA 3WFVA 1VQOV 1F51A 2QTSA 2HR3A 4MVRA 5HFMA 3W7TA 3ZRXA 4YHHO 4MSWC 4X65O 4X8AA 1JR9A 4G2KA 3OMNB 3OEEG 3APOA 4QPJA 4E4EA 1RPOA 4KUMA 1LUVA 3U11A 1SC5B 4H37A 4I55A 4DV6B 1OCCB 4DV5O 4X62B 1AR5A 2IM9A 2X7RB 1BHAA 1VIBA 1FFXA 5J2UA 3W7UA 2NLJC 4YXWG 2PY5A 5CMUA 2YS8A 2DWEC 3M7MX 4GCZA 1JMKC 1OCZB 3FB6C 4FZ0A 4XBFA 3L72H 3CJHB 3LNNA 4MTFA 1K3EA 2RDCA 5BR8O 4CS2A 1H2GA 2M6YA 4WFGA 3BY6A 3ABMB 3TXSA 2UU9O 5A9GA 1B04A 4LF9B 2IJIA 3IC9A 4JI6O 2CGNA 2Q0AA 4LFCO 4LF4O 2F95B 4MS2A 3TXQA 4BIOA 3I56V 1XNRB 4B3RO 4B08A 3L70H 1QLNA 2XHBA 4DO2A 5EZYB 1VQ7V 1DTOA 4X1IA 4G27B 3EXAA 4TV8B 2JJ1G 5KUMA 4ZHQB 2A06H 3OT7A 1K73W 2UXBB 4NTXA 5EBWC 4NTWA 3SJCC 4LWSA 1KKCA 4XDKA 4IHJB 3E8BA 3BEHA 5IWAB 4WCEV 3BRCA 1QR8A 1KBHA 5CB4B 4CS4A 4FLVA 3G67A 4DR7O 3ABTA 2AZ2A 4RQFA 3JD0A 3MAQA 4FLUA 4UVCA 3B8NA 4FLWA 4JI5B 5LHHA 4PA9A 5LOVB 1IZ3A 4JYAB 4ASUG 1NQTA 2JS3A 4DR2B 4TWKA 1YJWV 3H9VA 1OCCC 3TK1A 4OXSA 2Q4PA 5L3FA 4H0LB 1N36B 3D3IA 4AHCA 2QGNA 2ZR2A 2IU3A 1DGSA 2P4KA 4GX0A 4PDLA 4R8CA 3VBBA 4MTOA 4NXNO 3IFXA 2FMLA 3DGEA 3OD4A 1KMIZ 3CX5F 2EZOA 1BL8A 2P22C 1Y67A 1AJNA 1OCZC 2ZINA 3CJHA 1TGOA 2W6IG 3MD0A 1NR1A 1HNWB 3ABMC 4IT5A 4ZOLA 1SA0B 1IBMB 5EIBD 3SYCA 5KX5A 4LF8B 1VQPV 4UXNA 4EB6B 1F7YA 3ZHTA 3ZHSA 5EZYA 2HVJC 5LYJB 1W0KG 4QGPA 3F5WC 1FJGO 1DF4A 1AR4A 3CMEV 4DV3O 3AG2B 4TV8A 2GDSA 2DE0X 2YIBD 1NBMG 4ZHQA 2ADPA 3ZHRA 3BFRA 3BCCH 4FM1A 5IYZA 1K5QA 2G38A 1I5XA 4LFBO 4IHJA 3SR2C 5LMNO 3B2EE 2H8PC 2ZCEA 1I0HA 5CB4A 1XNQO 2F43G 3ABUA 3RFRA 1GTOA 2ZM6O 4X88A 2ZE8A 4LF6B 1AR1B 1SKVA 1JCHA 2YXLA 1SERA 2CTPA 2Z3YA 1VQMV 3CRQA 1QU7A 2IH3C 1AI4A 3K9SA 2PUSA 4LR3A 3WB2A 2OTLV 1HW7A 3CRRA 4MVQA 1J5EO 4YHHB 1TVKB 3E8FA 4AI8A 4X65B 1BQ0A 3T4DA 3RVZA 2ETNA 3J7AU 1DLBA 3W7WA 1Q7YW 2WPDG 3JCZA 3E22B 5K1XA 4DV5B 2VQEO 5LP6B 1S76D 3ZHUA 1US6A 4CH6A 5DEDA 3RBZA 4TT3G 5EYPB 1SA0A 3CMAV 3AEIA 4F6RA 1Z2GA 4ZIBA 2X6CA 2EIJB 4YJ3B 4DR1O 4BW9A
chains in the Genus database with same CATH topology
3H01A 3K0GA 2ZDIC 5KUKA 4Z1MG 5H6QA 5IY5B 3CYOA 5H9CA 3SPHA 1Q82W 3ZRWB 1AI7A 2A9HA 3FB8C 1E79G 4GX2A 4X89A 3E2EA 1RPRA 2Y48A 2WLLA 3FYEB 1S77D 1PNKA 3STZC 3AG2C 3VOUA 1GM7A 1YTFD 1R3LC 2JEUA 1H38A 2MK3A 2V1DA 3SYPA 4WFAV 3SJQC 3D36A 4HZ3A 1NR7A 2DYRB 3JYCA 3E89A 1E1QG 1GO3F 1K4CC 2DW4A 3ZCCA 2FTKA 1YTFB 1VQ8V 1MG1A 1SZTA 3ETEA 4JASA 1YHQV 2DYSB 3X2QB 5KA5A 4GX1A 3EHBB 3AG4C 2QM8A 2GHYA 1GMGA 1KC8W 4ZBMA 2WLHA 3QO7A 4JGSA 3KG2A 3JD2A 2C2AA 3CCUV 4DXWA 2JIZG 1PNLA 3PJSK 4JPRA 1M57B 3W7XA 3UM7A 5EBMC 2LFRA 1MSWD 3IGAC 5DM6V 3CCQV 2B1GA 3QO8A 1VQ4V 3OR6C 1FS0G 4MVOA 4HYOA 3ZJZA 2A79B 2BOCC 3CCLV 4J9ZB 3CXCU 4WFHA 2W6JG 1K33A 2WLKA 5DN6G 1M56C 2QKSA 4QPKA 1Q86W 4MVUA 1KP2A 2WLIB 4R50A 1NVPD 2AHYA 3CCEV 1S3JA 1ROPA 3IC7A 3F7VC 5IDJA 1V55B 1PNMA 1GK9A 1TUEB 2OCCB 5E1AC 4CBCA 4GT1A 3E8GA 4E2LA 5LGNA 3ETDA 4QJFB 3ASOB 3CD6V 5C93A 2EILC 3GB7C 2GSMB 2WWWA 3K08A 4EKWA 3JD1A 1K92A 1WPXA 3OR7C 2EIKC 2QM7A 3LDDA 1AI6A 2B1IA 3ETGA 3RVYA 1HWYA 3G4SV 3AG3C 5CBFA 1GKFA 1WLEA 2R9RB 3G6EV 4F4LA 3SYQA 3WG7B 2ZXWB 2Q67A 1AI5A 2EIJC 2JJ2G 2YEVA 1NKDA 1GM8A 2EINB 3AG1B 4JAVA 4ZKIA 4WFEA 1KQSU 1NJIW 5IY5C 2Q6AA 5H6RA 1YITV 3K03A 1KD1W 2WLJA 3B77A 3ZRWA 4MT8A 1YIJV 4BIUA 1JVMA 3HB3B 3OEHG 4PA6A 3SYOA 2UXNA 4MTGA 4HAMA 1QBZA 4H33A 4PA4A 3ZN0A 4U7NA 1VQ5V 3I55V 1AJQA 2K1EA 1FXKA 2HJFC 3LNMB 1CPYA 2AHZA 4RAIA 3T1CA 4RUFA 1VQKV 1NH2D 3SPJA 3SPIA 1F4NA 4XDJA 4P9PA 5LGTA 5LHIA 2DYRC 1SETA 1R6NA 2KB1A 3E86A 3K06A 3SPCA 2W0FC 1KP3A 4MVZA 2XAFA 2DYSC 3X2QC 3OAAG 1M90W 2X0LA 1NH2B 1M9NA 2YEVB 5CA3A 1K9MW 3FB5C 1AJPA 1B6QA 1JOYA 4UVBA 3R65A 1KKDA 2IJJA 2H94A 5EC1C 3ZMZA 4KP4A 1M57C 5B1AB 5CBGA 2DWDC 4RO2A 3E8HA 3E83A 1I5YA 4FMTA 2JDIG 1FXKB 2IU0A 3TETA 5J9PC 3ZMUA 4JTAB 3LUTB 3MHHC 4RQEA 1JPXA 2ZD9A 1EFRG 1MOFA 1FXHA 1R73A 4JYCA 3CC2V 2XNDG 5KA6A 2XOKG 4N21A 2P90A 2D3OW 1V54B 2EIMB 2WLIA 5B3SB 2OT5A 5L3DA 2IJHA 5BZBA 3WFVA 1V55C 1AROP 1VQOV 2B5UA 1F51A 2HR3A 4MVRA 5HFMA 3W7TA 2OCCC 1BMFG 1VQLV 5CN0A 2EJRA 4QE9A 5GW7A 1QLEB 2Y69B 3ASOC 3ZRXA 3DTUB 1M1KW 1KECA 2BOBC 4MSWC 3LSSA 1W2BU 4X8AA 2XAHA 3P30A 4G2KA 3OMNB 3CCSV 3OEEG 4QPJA 1RPOA 1P4RA 1K5SA 4KUMA 4H37A 1OCCB 1ZWIC 4JYBA 2X7RB 4LP8A 2WSSG 3WG7C 1BHAA 2ZXWC 1K4DC 1GM9A 3B8MA 2HG5C 3W7UA 5L3EA 2NLJC 4YXWG 5CMUA 3AG1C 2EINC 4RUEA 1JQ0A 2DWEC 4GCZA 1IXMA 2V7QG 1BHBA 4N23A 5L3CA 1OCZB 3FB6C 4XBFA 5LGUA 3CCRV 1Y4MA 4MTFA 1K3EA 3SPGA 1H2GA 1F23A 4WFGA 3BY6A 1F4MA 3ABMB 3P32A 3A0RA 2OTJV 4PELA 2IJIA 4WFFA 2HFEC 4WF9V 1Q81W 5EC2C 4MW3A 3STLC 4TSFG 4LC1A 4MS2A 3ZRVA 2Q68A 4PDVA 3I56V 4R7CA 3ZMVA 5IYBO 1RM1B 1QLNA 1FXVA 4J9YB 3QNEA 4QIWF 4DO2A 1VQ7V 1DTOA 4Q20A 5IYCO 1PKXA 1QVFU 3ASNB 3EFFK 1L1FA 3GWOA 4G27B 3CCMV 1K34A 4JTCB 4L87A 2JJ1G 5KUMA 1P7BA 5B1AC 2WLMA 1K73W 1CP9A 2XAQA 3ZMTA 5EBWC 4U7OA 1E1RG 1FXKC 3ABKB 4FJCC 1YI2V 3ABLB 2LFSA 4LBEC 2X6BA 1XL4A 4XDKA 2WAMA 3RW0A 3ZRSA 3E8BA 3BEHA 1S72V 4KFMA 4LCUC 4WCEV 5HFLA 1QR8A 2EBOA 3OW2U 3OMAB 1V54C 2EIMC 3ABTA 3CC7V 3E35A 1H8HG 1OZ0A 4PDRA 5B3SC 4RQFA 4BW5A 3ZIAG 3JD0A 2UXXA 2HVKC 1VQ6V 4BAYA 1OCOB 2P6JA 3W7SA 1H8EG 2JEXA 3QO5A 3LSQA 4I9WA 4P30A 4UVCA 3B8NA 3K0DA 1QLEC 2Y69C 4P2ZA 5LHHA 1J95A 4PA9A 1THZA 4ASUG 2YSUB 1NQTA 2EZPA 1MABG 2DQ3A 4TWKA 4JTDB 4PA3A 5EK0A 1YJWV 1JX9A 1QCEA 4WFBV 1OCCC 3TK1A 4OXSA 4MTXA 5L3FA 1R3JC 2LP7A 2Z5UA 2PI4A 3D3IA 2HLDG 4PA7A 2ZR2A 2IU3A 2P67A 4UVAA 4PDLA 4GX0A 4R8CA 2JK5C 4CZZA 1YSCA 3VBBA 4MTOA 1K7DA 3IFXA 3ML0A 3JD3A 4MVMA 3DGEA 4JF3A 2XAJA 3OUFA 5EBLC 2EZOA 1BL8A 1SRYA 3G71V 1OCRB 1AJNA 5L3GA 1OCZC 4P9OA 2QA4V 3OE7G 3F7YC 4GX5A 4UV8A 2W6IG 3MD0A 1R3IC 1NR1A 2PI5A 2IW5A 3FYIB 3ABMC 3CC4V 5B1BB 4R6ZA 1PD3A 3SYCA 1N8RW 4BIZA 2IH1C 1VQNV 3NXSA 1VQPV 4JAUA 4UXNA 2IJKA 1RM1C 3OMIB 2CK3G 3LDEA 3CCJV 3M99B 5FL7G 1S0VA 2HVJC 1PL0A 1W0KG 3F5WC 1EZJA 3ASNC 1DF4A 3CMEV 2WLLB 3FB7C 3AG2B 1LNQA 1FFTB 4QE7A 3MHSC 1ENVA 4XDLA 3TCUA 5B1NA 5LBQA 3SYAA 1NBMG 3CCVV 1VQ9V 4PDMA 2ATKC 1W0JG 2ZQMA 3CPWU 2QEXV 1K5QA 5L3BA 3CP1A 2X6AA 3ABKC 1I5XA 4UV9A 4UUJC 3ABLC 1ORQC 3AG4B 3T4ZA 2H8PC 3UKMA 1OHHG 2R9IA 2F43G 3ABUA 3K79A 2ZR3A 1G8MA 1G4YB 1EBOA 3K04A 1GTOA 1S5HC 4X88A 1NVPB 2Q69A 1AR1B 3K3WA 5B1OA 4FPPA 3OFNG 1OCOC 3OM3B 4MVSA 2WLNA 3ZN1A 1JCHA 4MW8A 1SERA 2Z3YA 1VQMV 2IH3C 1SESA 2M7WA 1AI4A 2QE7G 1K97A 2QTOA 2OTLV 4MVQA 1M56B 1UJWB 4G28B 2DQ0A 2ITDC 1R6KA 3E8FA 1CEZA 2HKOA 1QR9A 3T2MA 4FK5C 3T4DA 1COWG 3RVZA 1DLBA 5CBHA 3W7WA 1YJ9V 3K9AA 3LDCA 1QVGU 1JJ2U 3OUSA 4I5SA 1Q7YW 1Y66A 2WPDG 1K8AW 2XASA 3JCZA 3OGCC 1XL6A 2EILB 3FKSG 1S76D 3ZMSA 1OCRC 2EIKB 4FIPC 3JD4A 3RBZA 5IYDO 3AG3B 4TT3G 2NNUA 2P7TC 5LHGA 2XAGA 3CMAV 5B1BC 2A0LA 3AEIA 3HPLC 4QNHB 2X6CA 2EIJB 1YJNV 2ITCC 1R3KC 1DF5A 2ZDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4N A;  1B6Q A;  1ROP A;  1RPO A;  1GTO A;  2IJH A;  2IJK A;  1F4M A;  1RPR A;  2IJJ A;  4DO2 A;  3K79 A;  2GHY A;  1GMG A;  2IJI A;  1NKD A;  1PD3 A; 
#chains in the Genus database with same CATH topology
 5KUK A;  4EB6 A;  3AK1 A;  5IY5 B;  2DOS A;  4OX9 O;  2UU9 B;  4B3T O;  5EIB C;  3DSQ A;  1Q82 W;  4B3S O;  2A9H A;  4LFC B;  3FB8 C;  1XHZ A;  4JV5 B;  5LYJ A;  4H13 B;  1S77 D;  1PNK A;  3STZ C;  3AG2 C;  3A2F A;  4B3R B;  1L8D A;  1MSD A;  1GM7 A;  3CRC A;  4D7T A;  2MK3 A;  1H2K A;  3JAR B;  2DYR B;  3JCU Z;  3Q4H A;  1VMG A;  3ZCC A;  3ETE A;  2DYS B;  2VQF O;  2ZNI A;  5KA5 A;  3CXH F;  1I94 O;  1GMG A;  4ABM A;  5BY1 A;  4ZBM A;  4JI4 B;  4JGS A;  1S5L Z;  3JD2 A;  2ZE5 A;  2V4D A;  5EBM C;  1H2M A;  3IGA C;  3CCQ V;  3K5M A;  3OR6 C;  4MVO A;  2UUA B;  2BOC C;  4W4L A;  2BSK B;  1FD9 A;  1SS3 A;  1XRE A;  4Z2W A;  4DYL A;  1K33 A;  4DW1 A;  1QQC A;  5B66 Z;  1Q86 W;  1TVK A;  5CA0 B;  1NVP D;  4EEQ A;  1S3J A;  3A0B Z;  3IC7 A;  3F7V C;  2HHH O;  1U96 A;  4O4J A;  3R66 A;  1GN2 A;  1WJZ A;  2PGG A;  4CBC A;  4E2L A;  3ETD A;  2P4V A;  3E22 A;  1PV0 A;  2Q0O C;  3VQW A;  5LP6 A;  5LP6 C;  2GSM B;  3I5D A;  1HNX O;  3OR7 C;  2GTS A;  1AI6 A;  4NXN B;  4JI3 B;  3RYH B;  1XI1 A;  1WLE A;  5EYP A;  2Q67 A;  2E76 B;  2PTM A;  1GN3 A;  2EIJ C;  4YJ3 A;  5GON B;  5JJN B;  3J81 N;  1GM8 A;  2RCV A;  3A0H Z;  4JAV A;  4ZKI A;  4I0X B;  5IY5 C;  2Q6A A;  5H6R A;  1NJI W;  1PM9 A;  1Y76 B;  4J7K A;  3LSU A;  3HB3 B;  3OEH G;  4X9Q A;  1X4T A;  4MTG A;  3ZN0 A;  4PA4 A;  4DV6 O;  1VQ5 V;  3QVN A;  1BQZ A;  1FXK A;  2P5O A;  2HJF C;  4AQY B;  3JSN A;  2NR5 A;  1F4N A;  4P9P A;  5LGT A;  1FJG B;  2DYR C;  4DV3 B;  1R6N A;  1M93 A;  3K06 A;  1XDC A;  3SPC A;  3APQ A;  2DYS C;  3OAA G;  1PL4 A;  1M90 W;  2X0L A;  1MMM A;  5CA3 A;  3FB5 C;  3L73 H;  2Y0P A;  4YIP A;  4LF9 O;  2QWN B;  4LFB B;  4DV7 B;  2DWD C;  5LMN B;  3E8H A;  4FMT A;  1XNR O;  3TGU H;  4FFB A;  4J7Z A;  3J80 N;  2ZM6 B;  1B06 A;  3MHH C;  4RQE A;  2BSK A;  3EVK A;  2YIA A;  1MOF A;  3CC2 V;  4N21 A;  2YI8 A;  1NTK H;  2P90 A;  1AIL A;  3VQY A;  5B3S B;  3QG5 A;  2IJH A;  2F66 C;  1AVM A;  3P3N A;  1J5E B;  1BMF G;  5JVD B;  2EJR A;  4QE9 A;  5GW7 A;  2Y69 B;  2JRI A;  2XAH A;  3CCS V;  1P4R A;  5LA6 B;  3RYH A;  2VQE B;  4JYB A;  1Z5V A;  4LP8 A;  1K4D C;  1GM9 A;  3B8M A;  3G80 A;  2YID A;  2F93 B;  5KLV H;  3VQX A;  5GON A;  4JI5 O;  1JQ0 A;  4I0X A;  4JYA O;  1Y76 A;  2V7Q G;  3ZHV A;  5KAF Z;  4N23 A;  5LGU A;  2XT9 A;  1Y4M A;  1R6T A;  3H1I H;  3RWR D;  2ZE7 A;  3A0R A;  2OTJ V;  4TV9 B;  2A7W A;  1Q81 W;  2KSD A;  4I55 B;  4LC1 A;  3ZRV A;  1QHT A;  4R7C A;  1N33 O;  1ZL8 B;  4GYC B;  4J9Y B;  1FFX B;  3QNE A;  5GTI Z;  1XBL A;  1L1F A;  3GWO A;  1K34 A;  1HNW O;  2VQF B;  1M4U A;  4DRX B;  1I94 B;  1P7B A;  3CHX A;  4DK0 A;  4LF8 O;  3ZMT A;  2AGA A;  1ZX3 A;  1E1R G;  3ABK B;  3BA9 A;  2ZIO A;  4J80 A;  2X6B A;  1XL4 A;  2WAM A;  1XHX A;  4PD4 F;  3RW0 A;  2GBO A;  4JZG A;  5HFL A;  1IUR A;  2EBO A;  4K8X A;  1P84 F;  1H8H G;  4PDR A;  5B3S C;  3JAM N;  4KL1 A;  2UXX A;  1MZE A;  1VQ6 V;  3W7S A;  3QO5 A;  3LSQ A;  4P30 A;  3RYC B;  5JVD A;  2Y69 C;  4P2Z A;  1J95 A;  3UCS C;  2HHH B;  1N32 B;  4LH6 A;  4UCV A;  3N2K B;  4PA3 A;  5EK0 A;  4FM0 A;  1OV9 A;  1O9H A;  4LF6 O;  5IT9 N;  3ZBH A;  1R3J C;  2CUG A;  2VS0 A;  3IAY A;  1HNX B;  4PA7 A;  2P67 A;  3D8C A;  2JK5 C;  1K7D A;  3ML0 A;  3H1L H;  3JD3 A;  3SJA C;  3S3X A;  2XAJ A;  5EBL C;  1SRY A;  4DW0 A;  2O57 A;  5L3G A;  4P9O A;  3F7Y C;  4UV8 A;  1R3I C;  4NR1 A;  2JS5 A;  4DK1 A;  4ZI7 B;  3CC4 V;  4TV9 A;  4H44 B;  2N74 A;  5IE9 A;  1GH6 A;  2OCH A;  2QDO A;  4JAU A;  3UT5 B;  2IJK A;  1ZL8 A;  3OMI B;  2CK3 G;  3LDE A;  4UCR A;  3CCJ V;  4J11 A;  1PL0 A;  4DV4 B;  2WLL B;  3FB7 C;  1LNQ A;  4QE7 A;  3MHS C;  5LBQ A;  4DRX A;  3UO3 A;  3CCV V;  1VQ9 V;  1IDS A;  2F23 A;  2ATK C;  1YCI A;  2ZQM A;  5KHJ A;  2R72 A;  4HNA A;  5FNV B;  2YI9 A;  1FAF A;  3CP1 A;  3ABK C;  4ZOL B;  3HKC B;  2UUC B;  3OTO O;  3C3T A;  4UUJ C;  5KX5 B;  4JV5 O;  1BZK A;  1UFI A;  2YIC A;  2BTQ B;  3UKM A;  1OHH G;  2R9I A;  3P3P A;  5KHI A;  3K04 A;  1MNG A;  1X59 A;  2Q69 A;  4FZ1 A;  5B1O A;  4FPP A;  3OFN G;  3OM3 B;  3RYC A;  1D2D A;  5KHG A;  1SES A;  2M7W A;  1EZV H;  5IYZ B;  4JI4 O;  1K97 A;  3N2K A;  2CE4 A;  4FM2 A;  4F6E A;  2H3O A;  1QR9 A;  1XQ8 A;  1YJ9 V;  3LDC A;  5JQG B;  4O4H B;  2XAS A;  2ZIM A;  2UUA O;  1WB7 A;  1XL6 A;  3FKS G;  1GN4 A;  4X1K B;  4YJ2 B;  2EJ7 A;  3JAL B;  2YDE A;  4FIP C;  1NT2 B;  1HNZ O;  1Q6I A;  3JD4 A;  2NNU A;  4ZI7 A;  1AB3 A;  2P7T C;  5LHG A;  2XAG A;  1BGY H;  3HPL C;  1FKA O;  2K9P A;  1BSM A;  4QNH B;  1YJN V;  3UT5 A;  2ZDI A;  2JGD B;  3K0G A;  2ZDI C;  4Z1M G;  4NXM O;  4GX2 A;  2Y48 A;  2WLL A;  3FYE B;  4JI3 O;  1N33 B;  4FFK A;  3WB1 A;  3C90 A;  2V1D A;  1XMQ B;  1EN5 A;  3SYP A;  4HZ3 A;  3JYC A;  3BVO A;  2VWJ A;  1GO3 F;  3O65 A;  1VF7 A;  5FNV A;  1VQ8 V;  4K3A A;  3HKC A;  4F6R B;  1N0J A;  2OIE A;  3K58 A;  1ZLZ A;  3MDS A;  2F1M A;  1L0N H;  2BTQ A;  2WLH A;  5GTH Z;  2C2A A;  3CRM A;  3CCU V;  1RFY A;  4AQY O;  1PNL A;  1EN4 A;  3PJS K;  4JPR A;  1M57 B;  3F5T A;  3W7X A;  4LF7 B;  3ZHQ A;  2LFR A;  1MSW D;  5DM6 V;  1SZX A;  2B1G A;  3QO8 A;  3RYI B;  4GKK B;  2XTA A;  1BCC H;  1WNS A;  3CXC U;  1W59 A;  5F2V O;  2W6J G;  3Q4H B;  4FLZ A;  4U3F H;  2YUA A;  1KP2 A;  1AP5 A;  4DV7 O;  4I9Q A;  1ROP A;  4KHP B;  1JFF B;  5IDJ A;  2LW7 A;  1V55 B;  5JQG A;  4O4H A;  1GK9 A;  5E1A C;  4UCT A;  1SQB H;  4GT1 A;  2QSA A;  4UB8 Z;  5LGN A;  3ASO B;  4CH5 A;  5C93 A;  3GB7 C;  1NI8 A;  4X1K A;  4YJ2 A;  3SJB C;  4A5U B;  3JAL A;  1WPX A;  1SQQ H;  2QM7 A;  3K5N A;  2B1I A;  4TOI A;  3ETG A;  1D5N A;  1GKF A;  4X64 O;  2ZXW B;  2QR4 A;  2YEV A;  2ARH A;  4OGQ B;  2JGD A;  2EIN B;  3H1J H;  2Q8V A;  4TQD A;  3S3W A;  1JJO A;  5JWP A;  1KD1 W;  4O4J B;  3SYO A;  3CRA A;  4HAM A;  2K1E A;  3LNM B;  2RN9 A;  1CPY A;  2AHZ A;  4RAI A;  3T1C A;  3SPJ A;  4XDJ A;  4GKJ O;  4DR5 B;  5LHI A;  3E86 A;  1Q6H A;  3HKD B;  1XMO O;  4JI0 O;  4MVZ A;  1M9N A;  2E5L B;  1AJP A;  4YIO A;  1B6Q A;  1GN6 A;  2E3C A;  5JH7 B;  5TIS Z;  4J42 A;  3L74 H;  2H94 A;  3OTO B;  5EC1 C;  1M57 C;  5B1A B;  4RO2 A;  2Y4U A;  5BXZ A;  2RQ6 A;  3RYI A;  2JDI G;  1FXK B;  1Q8I A;  1YEW A;  3AK3 A;  3LUT B;  4J7J A;  1EFR G;  2E74 B;  4UB6 Z;  1QNM A;  4I50 B;  3GVM A;  1KUQ A;  2Z0A A;  2OT5 A;  1XUQ A;  2QKC A;  3KCX A;  4JI1 B;  1VEW A;  1JFF A;  1IBK B;  1V55 C;  2N05 A;  4FVM A;  2B5U A;  3WB0 A;  5CN0 A;  5DEC A;  3ASO C;  3DTU B;  4KXR A;  2BOB C;  1W2B U;  3LSS A;  4O4I B;  1U97 A;  3P30 A;  3A8T A;  4CH4 A;  4FLT A;  4FFB B;  3H1K H;  2CGO A;  4C7U A;  4CC6 A;  2WSS G;  4NYK A;  3JAK B;  2ZXW C;  2GUZ B;  1HNZ B;  4J41 A;  3THO A;  2EIN C;  3M8A A;  2JVD A;  1N32 O;  3BA8 A;  3CB2 A;  2YC0 A;  1IVS A;  5J2T B;  3K5L A;  3CCR V;  3BAB A;  3B09 A;  1F23 A;  1F4M A;  4D6T H;  3P32 A;  4WFF A;  2HFE C;  4NXM B;  1PPJ H;  3HKE B;  4TSF G;  2AZ0 A;  2Q68 A;  3HKD A;  4NKG B;  4PDV A;  3ZMV A;  5IYB O;  4LFA B;  1YDX A;  1FXV A;  4Q20 A;  5ITZ B;  2L6L A;  5IYC O;  1QVF U;  3ASN B;  5JH7 A;  4CH3 A;  5B1A C;  2OWO A;  2DJV A;  2WLM A;  2GTA A;  1CP9 A;  2RJZ A;  2XAQ A;  4D7S A;  1FXK C;  3IJ4 A;  2KKW A;  1YI2 V;  2LFS A;  5KMG B;  4DV4 O;  3ZRS A;  1S72 V;  4KFM A;  4I50 A;  4LCU C;  1O9G A;  2DMX A;  4O2A A;  1SF9 A;  3OMA B;  3CC7 V;  3E35 A;  1OZ0 A;  1G1X B;  3ZIA G;  4LF5 O;  4BAY A;  1OCO B;  2P6J A;  2JEX A;  4JI8 O;  4I9W A;  2UUC O;  2R9A A;  3U0Z A;  5JJJ B;  4O4I A;  2HJD A;  4TQF A;  3RT3 C;  1THZ A;  2DQ3 A;  1JX9 A;  1QCE A;  4EFE A;  2MW2 B;  4GZR B;  4MTX A;  4WBN B;  2LP7 A;  2Z5U A;  2PI4 A;  1VF6 A;  3JAK A;  1VF6 C;  2GUZ A;  4UVA A;  3O9O A;  1YSC A;  4IGG A;  3BHP A;  1Q43 A;  4MVM A;  2Q7E A;  4FLY A;  4X64 B;  2BTO A;  3G71 V;  1N0N A;  5J2T A;  3D3Q A;  4GX5 A;  4O2B A;  4K0K O;  1KB9 F;  4DUZ B;  1BS3 A;  5B1B B;  1P7G A;  4R6Z A;  1VAR A;  1N8R W;  1AP6 A;  2IH1 C;  1VQN V;  3NXS A;  3HKE A;  1WP8 A;  4JI2 B;  3FAV B;  5FL7 G;  4GKJ B;  5ITZ A;  1EZJ A;  1Y74 B;  3ASN C;  1SQX H;  1XMO B;  2PZS A;  2UXD O;  3K59 A;  1ENV A;  3TCU A;  4JI0 B;  1SQP H;  3SDL A;  1NTZ H;  3U10 A;  2ZNJ A;  4HBN A;  1W0J G;  3HR0 A;  1VF5 B;  5KMG A;  1SQF A;  1XIL A;  1IX9 A;  2LW1 A;  4B3M B;  4Q6G A;  4B7K A;  5JCO A;  3G6B A;  5JCO C;  1LUW A;  2CTQ A;  1G8M A;  1G4Y B;  1KYO F;  4BWA A;  1XMQ O;  3ICX A;  1A32 A;  4DV2 B;  1OCO C;  3L71 H;  4MVS A;  4X1Y B;  3ZN1 A;  5KAI Z;  5IJ9 B;  4K8Z A;  4HNA B;  1M56 B;  1UJW B;  2P06 A;  1PP9 H;  2QWR B;  2F4V O;  2DQ0 A;  2ITD C;  3RN4 A;  1R6K A;  1CEZ A;  2HKO A;  2QKA A;  3T2M A;  4LF7 O;  4WBN A;  4FK5 C;  5C8Y B;  1RSO B;  3K9A A;  1JJ2 U;  3OUS A;  4I5S A;  1K8A W;  4RWU A;  2WA3 A;  3OGC C;  2Y0I A;  1YXB A;  2Q9L A;  4GKK O;  4J10 A;  1ZAU A;  4NTY A;  5IYD O;  3AG3 B;  4KHP O;  5B1B C;  1EM1 A;  4DUY B;  5FLX N;  1ZSP A;  2ITC C;  1R3K C;  1DF5 A;  3H01 A;  4NB5 A;  1HR0 B;  2VRZ A;  1WPB A;  5H6Q A;  3CYO A;  5H9C A;  3FAV A;  3N2G B;  1AI7 A;  2Q73 A;  1E79 G;  3E2E A;  1RPR A;  1Y74 A;  1R1B A;  1YTF D;  1R3L C;  2JEU A;  3T1Y B;  2LO1 A;  3E89 A;  1E1Q G;  5LXT B;  2PYJ A;  1YTF B;  4JAS A;  1YHQ V;  1NU1 H;  3EHB B;  4GX1 A;  2QM8 A;  1KC8 W;  3ZX6 A;  4DR4 O;  3QO7 A;  3JAS B;  4PV1 B;  4DXW A;  1IXB A;  4DR5 O;  2CH7 B;  3UM7 A;  4X1Y A;  2PYL A;  1FS0 G;  1H2L A;  4HYO A;  2FL4 A;  3ZJZ A;  3CCL V;  2Q7H A;  4OPA A;  5H2F Z;  2E5L O;  4LF5 B;  3RYF B;  5IJ9 A;  4WFH A;  5K1P A;  2WLK A;  4JI8 B;  4O4L B;  1WAZ A;  1M56 C;  2IBZ H;  4QPK A;  1Q6U A;  4MVU A;  4R50 A;  2AHY A;  5C8Y A;  1YF2 A;  1RSO A;  3QF7 A;  1Z5W A;  1PNM A;  3L9D A;  4I7Z B;  2OCC B;  2KG7 B;  3E8G A;  4QJF B;  3CD6 V;  1M5I A;  3K08 A;  1K92 A;  3B4S A;  2HEP A;  1HWY A;  1H2N A;  3AG3 C;  4JI7 B;  5CBF A;  4LH7 A;  2D2C B;  2R9R B;  3G6E V;  4JI1 O;  4IYI A;  1IBK O;  3WG7 B;  1AI5 A;  1TA8 A;  4K35 A;  1D5A A;  1TUB A;  4K0K B;  3AG1 B;  3DC5 A;  4WFE A;  2WLJ A;  3N2G A;  4MT8 A;  2OIG A;  4PA6 A;  4H33 A;  1AJQ A;  1NZ6 A;  4RUF A;  1NH2 D;  3K5O A;  5LXT A;  5JJE B;  1SET A;  2KB1 A;  2W0X A;  2UXD B;  1HDJ A;  2W0F C;  1KP3 A;  2XAF A;  2WA4 A;  1NH2 B;  2YEV B;  1K9M W;  4OPH A;  4UVB A;  1NS1 A;  3JAS A;  3R65 A;  3CS5 A;  5D5P A;  2CH7 A;  5CBG A;  1WN7 A;  1I5Y A;  4L8J A;  3NR7 A;  4UFZ A;  5CA1 B;  4EFB A;  2B9Z A;  4LFA O;  4UCS A;  3OTF A;  3TET A;  2RNB A;  5J9P C;  3ZMU A;  4JTA B;  2EX3 A;  3RYF A;  1FXH A;  1R73 A;  4JYC A;  4O4L A;  2XOK G;  5KA6 A;  3L75 H;  2UXC O;  2D3O W;  1V54 B;  2EIM B;  2R70 A;  1URF A;  3GWK C;  5L3D A;  2Y4T A;  5BZB A;  4LNU B;  1ARO P;  1VP7 A;  4B7E A;  2F4V B;  2OCC C;  2KG7 A;  1VQL V;  1QLE B;  1M1K W;  1KEC A;  4YY3 O;  3ZED A;  4DR6 O;  2DN9 A;  4Z1V A;  3JSL A;  1BE3 H;  4ICG A;  1K5S A;  2CTR A;  1ZWI C;  3WG7 C;  2HG5 C;  5L3E A;  3AG1 C;  4RUE A;  5A2Q N;  1T5E A;  1IXM A;  1CXZ B;  4DV0 O;  1BHB A;  2RMK B;  5L3C A;  1GRJ A;  1FYJ A;  2YXY A;  3SPG A;  4PEL A;  4DR3 B;  4WF9 V;  1B3Q A;  5EC2 C;  4MW3 A;  3STL C;  2UUB B;  1MZF A;  1LR1 A;  1RM1 B;  1N34 B;  4QIW F;  1HP8 A;  4CC5 A;  1PKX A;  4JZ2 A;  4IIJ B;  3EFF K;  4GLX A;  3CCM V;  4JTC B;  4DUZ O;  4UCU A;  4L87 A;  1IBL O;  4DR4 B;  5LOV A;  4I4T B;  4U3J B;  3K57 A;  4X20 B;  4U7O A;  5CA1 A;  4JI2 O;  4FJC C;  3ABL B;  4X66 O;  4LBE C;  1Q5O A;  3CWB H;  1Q90 D;  2LQT A;  2CTW A;  3OW2 U;  2LGW A;  1V54 C;  2EIM C;  4BW5 A;  1ZUQ A;  2QJ1 A;  2A3Q A;  4LNU A;  2HVK C;  1H8E G;  5E79 Z;  3K0D A;  1QLE C;  5IJ0 B;  2CAZ C;  1BT8 A;  4B3M O;  2YSU B;  2EZP A;  1MAB G;  5FPR A;  4JTD B;  3PN1 A;  4WFB V;  1P49 A;  1WA8 B;  2AXT Z;  5BR8 B;  4DV2 O;  4NVP A;  1H2S B;  2HLD G;  4O2A B;  4JI6 B;  2BE3 A;  4CZZ A;  4LF4 B;  3UQ8 A;  4JF3 A;  3OUF A;  3AK2 A;  1OCR B;  3OGI B;  3T1H O;  2QA4 V;  3OE7 G;  2PI5 A;  2IW5 A;  4BR6 A;  2LJ2 A;  3FYI B;  5LMU O;  1PD3 A;  2YIB A;  4BIZ A;  3DXR B;  1N4C A;  1RM1 C;  1TAE A;  2ZT9 B;  3M99 B;  1S0V A;  4IIJ A;  3TJT A;  1FFT B;  3ETQ A;  4XDL A;  5B1N A;  3SYA A;  5D5Q A;  4DR7 B;  4DUY O;  4O2B B;  4I4T A;  4DV1 O;  4U3J A;  4PDM A;  4X20 A;  1HR0 O;  3CPW U;  2QEX V;  5L3B A;  2X6A A;  4UV9 A;  5BMV B;  3ABL C;  1ORQ C;  4UCO A;  2FKX A;  3AG4 B;  5FPO A;  3T4Z A;  3KZI Z;  1SQG A;  2GV9 A;  3K79 A;  2ZR3 A;  1EBO A;  1S5H C;  4IL6 Z;  3T1Y O;  4PHZ A;  1NVP B;  3K3W A;  2AW9 A;  1XOU A;  5KHH A;  2WLN A;  1MA1 A;  2UXC B;  5KHK A;  4MW8 A;  2QWQ B;  3BPZ A;  5IJ0 A;  2QE7 G;  1XEQ A;  3KCY A;  2QTO A;  1I7F A;  1OJH A;  3C3S A;  4G28 B;  4TUY B;  1WA8 A;  3QTC A;  1G6U A;  4JAA A;  4YY3 B;  1COW G;  4DR6 B;  5AG2 A;  3CE2 A;  5CBH A;  1QVG U;  2LGQ A;  1Y66 A;  4GUN A;  3KKY A;  1YVW A;  3FX7 A;  2EIL B;  3UO2 A;  4X62 O;  3ZMS A;  1OCR C;  2EIK B;  3B40 A;  1Q3E A;  3JAR A;  1L0L H;  2E75 B;  2KQX A;  4DV0 B;  2A0L A;  3DXR A;  2QWP B;  3N27 A;  3SPH A;  1EN6 A;  3ZRW B;  1UPG A;  1Y6X A;  4X89 A;  4PI2 A;  1GAX A;  3HKB B;  4JI7 O;  3VOU A;  1XNQ B;  1H38 A;  1V9P A;  2JGU A;  4WFA V;  3SJQ C;  3D36 A;  1NR7 A;  3D36 C;  4PI0 A;  2ADQ B;  3CSX A;  1K4C C;  2DW4 A;  2FTK A;  1YZB A;  1MG1 A;  1SZT A;  4PJ0 Z;  1I08 A;  5BMV A;  3X2Q B;  1IBL B;  3AG4 C;  5CA0 A;  2GHY A;  2HP8 A;  2UXB O;  2PF4 E;  3KG2 A;  5LL6 Y;  1JA8 A;  4X66 B;  2JIZ G;  1FPO A;  2ILM A;  1NTM H;  5IWA O;  4W4K A;  1VQ4 V;  2FB5 A;  3BAA A;  2A79 B;  4J9Z B;  3JAT B;  3RGB A;  4CS3 A;  3FD9 A;  5DN6 G;  2QKS A;  4TUY A;  2NN4 A;  2WLI B;  3JAW B;  5H5N A;  3CCE V;  3ZS8 C;  4DR2 O;  1TUE B;  2BCC H;  4DR1 B;  2EIL C;  4OX9 B;  4B3T B;  2WWW A;  4EKW A;  1SQV H;  3JD1 A;  4B3S B;  1N36 O;  1WP7 A;  2EIK C;  1ZTE A;  3LDD A;  3RVY A;  3AG7 A;  3G4S V;  2FYU H;  4JYY A;  4F4L A;  3SYQ A;  2Q7G A;  3T1H B;  5J2U B;  2JJ2 G;  1S5J A;  1NKD A;  2QWO B;  5LMU B;  1KQS U;  1YIT V;  3K03 A;  3ZRW A;  3B77 A;  1IBM O;  3DC6 A;  1YIJ V;  4BIU A;  1JVM A;  3SGI A;  2UXN A;  3HKB A;  1QBZ A;  2YXH A;  4U7N A;  3I55 V;  2ODM A;  1KU9 A;  3CEI A;  1VQK V;  1DK1 A;  3SPI A;  3VQV A;  1WB8 A;  2VWK A;  1RP3 B;  3H1H H;  4IYH A;  3X2Q C;  4FLX A;  4AIL C;  4X1I B;  4DV1 B;  1TUB B;  1JOY A;  1KKD A;  2IJJ A;  2EUL A;  2OYQ A;  2Q5Z A;  2ZE6 A;  3ZMZ A;  4KP4 A;  4DR3 O;  2QM4 A;  2UUB O;  3E83 A;  2IU0 A;  1N34 O;  5LA6 A;  3JAT A;  4LWS B;  1JPX A;  2ZD9 A;  2N04 A;  5B5E Z;  2XND G;  3WU2 Z;  2ZKO A;  2XUM A;  2L35 A;  2WLI A;  3JAW A;  3FFQ A;  2CDY A;  3WFV A;  1VQO V;  1F51 A;  2QTS A;  2HR3 A;  4MVR A;  5HFM A;  3W7T A;  3ZRX A;  4YHH O;  4MSW C;  4X65 O;  4X8A A;  1JR9 A;  4G2K A;  3OMN B;  3OEE G;  3APO A;  4QPJ A;  4E4E A;  1RPO A;  4KUM A;  1LUV A;  3U11 A;  1SC5 B;  4H37 A;  4I55 A;  4DV6 B;  1OCC B;  4DV5 O;  4X62 B;  1AR5 A;  2IM9 A;  2X7R B;  1BHA A;  1VIB A;  1FFX A;  5J2U A;  3W7U A;  2NLJ C;  4YXW G;  2PY5 A;  5CMU A;  2YS8 A;  2DWE C;  3M7M X;  4GCZ A;  1JMK C;  1OCZ B;  3FB6 C;  4FZ0 A;  4XBF A;  3L72 H;  3CJH B;  3LNN A;  4MTF A;  1K3E A;  2RDC A;  5BR8 O;  4CS2 A;  1H2G A;  2M6Y A;  4WFG A;  3BY6 A;  3ABM B;  3TXS A;  2UU9 O;  5A9G A;  1B04 A;  4LF9 B;  2IJI A;  3IC9 A;  4JI6 O;  2CGN A;  2Q0A A;  4LFC O;  4LF4 O;  2F95 B;  4MS2 A;  3TXQ A;  4BIO A;  3I56 V;  1XNR B;  4B3R O;  4B08 A;  3L70 H;  1QLN A;  2XHB A;  4DO2 A;  5EZY B;  1VQ7 V;  1DTO A;  4X1I A;  4G27 B;  3EXA A;  4TV8 B;  2JJ1 G;  5KUM A;  4ZHQ B;  2A06 H;  3OT7 A;  1K73 W;  2UXB B;  4NTX A;  5EBW C;  4NTW A;  3SJC C;  4LWS A;  1KKC A;  4XDK A;  4IHJ B;  3E8B A;  3BEH A;  5IWA B;  4WCE V;  3BRC A;  1QR8 A;  1KBH A;  5CB4 B;  4CS4 A;  4FLV A;  3G67 A;  4DR7 O;  3ABT A;  2AZ2 A;  4RQF A;  3JD0 A;  3MAQ A;  4FLU A;  4UVC A;  3B8N A;  4FLW A;  4JI5 B;  5LHH A;  4PA9 A;  5LOV B;  1IZ3 A;  4JYA B;  4ASU G;  1NQT A;  2JS3 A;  4DR2 B;  4TWK A;  1YJW V;  3H9V A;  1OCC C;  3TK1 A;  4OXS A;  2Q4P A;  5L3F A;  4H0L B;  1N36 B;  3D3I A;  4AHC A;  2QGN A;  2ZR2 A;  2IU3 A;  1DGS A;  2P4K A;  4GX0 A;  4PDL A;  4R8C A;  3VBB A;  4MTO A;  4NXN O;  3IFX A;  2FML A;  3DGE A;  3OD4 A;  1KMI Z;  3CX5 F;  2EZO A;  1BL8 A;  2P22 C;  1Y67 A;  1AJN A;  1OCZ C;  2ZIN A;  3CJH A;  1TGO A;  2W6I G;  3MD0 A;  1NR1 A;  1HNW B;  3ABM C;  4IT5 A;  4ZOL A;  1SA0 B;  1IBM B;  5EIB D;  3SYC A;  5KX5 A;  4LF8 B;  1VQP V;  4UXN A;  4EB6 B;  1F7Y A;  3ZHT A;  3ZHS A;  5EZY A;  2HVJ C;  5LYJ B;  1W0K G;  4QGP A;  3F5W C;  1FJG O;  1DF4 A;  1AR4 A;  3CME V;  4DV3 O;  3AG2 B;  4TV8 A;  2GDS A;  2DE0 X;  2YIB D;  1NBM G;  4ZHQ A;  2ADP A;  3ZHR A;  3BFR A;  3BCC H;  4FM1 A;  5IYZ A;  1K5Q A;  2G38 A;  1I5X A;  4LFB O;  4IHJ A;  3SR2 C;  5LMN O;  3B2E E;  2H8P C;  2ZCE A;  1I0H A;  5CB4 A;  1XNQ O;  2F43 G;  3ABU A;  3RFR A;  1GTO A;  2ZM6 O;  4X88 A;  2ZE8 A;  4LF6 B;  1AR1 B;  1SKV A;  1JCH A;  2YXL A;  1SER A;  2CTP A;  2Z3Y A;  1VQM V;  3CRQ A;  1QU7 A;  2IH3 C;  1AI4 A;  3K9S A;  2PUS A;  4LR3 A;  3WB2 A;  2OTL V;  1HW7 A;  3CRR A;  4MVQ A;  1J5E O;  4YHH B;  1TVK B;  3E8F A;  4AI8 A;  4X65 B;  1BQ0 A;  3T4D A;  3RVZ A;  2ETN A;  3J7A U;  1DLB A;  3W7W A;  1Q7Y W;  2WPD G;  3JCZ A;  3E22 B;  5K1X A;  4DV5 B;  2VQE O;  5LP6 B;  1S76 D;  3ZHU A;  1US6 A;  4CH6 A;  5DED A;  3RBZ A;  4TT3 G;  5EYP B;  1SA0 A;  3CMA V;  3AEI A;  4F6R A;  1Z2G A;  4ZIB A;  2X6C A;  2EIJ B;  4YJ3 B;  4DR1 O;  4BW9 A; 
#chains in the Genus database with same CATH homology
 3H01 A;  3K0G A;  2ZDI C;  5KUK A;  4Z1M G;  5H6Q A;  5IY5 B;  3CYO A;  5H9C A;  3SPH A;  1Q82 W;  3ZRW B;  1AI7 A;  2A9H A;  3FB8 C;  1E79 G;  4GX2 A;  4X89 A;  3E2E A;  1RPR A;  2Y48 A;  2WLL A;  3FYE B;  1S77 D;  1PNK A;  3STZ C;  3AG2 C;  3VOU A;  1GM7 A;  1YTF D;  1R3L C;  2JEU A;  1H38 A;  2MK3 A;  2V1D A;  3SYP A;  4WFA V;  3SJQ C;  3D36 A;  4HZ3 A;  1NR7 A;  2DYR B;  3JYC A;  3E89 A;  1E1Q G;  1GO3 F;  1K4C C;  2DW4 A;  3ZCC A;  2FTK A;  1YTF B;  1VQ8 V;  1MG1 A;  1SZT A;  3ETE A;  4JAS A;  1YHQ V;  2DYS B;  3X2Q B;  5KA5 A;  4GX1 A;  3EHB B;  3AG4 C;  2QM8 A;  2GHY A;  1GMG A;  1KC8 W;  4ZBM A;  2WLH A;  3QO7 A;  4JGS A;  3KG2 A;  3JD2 A;  2C2A A;  3CCU V;  4DXW A;  2JIZ G;  1PNL A;  3PJS K;  4JPR A;  1M57 B;  3W7X A;  3UM7 A;  5EBM C;  2LFR A;  1MSW D;  3IGA C;  5DM6 V;  3CCQ V;  2B1G A;  3QO8 A;  1VQ4 V;  3OR6 C;  1FS0 G;  4MVO A;  4HYO A;  3ZJZ A;  2A79 B;  2BOC C;  3CCL V;  4J9Z B;  3CXC U;  4WFH A;  2W6J G;  1K33 A;  2WLK A;  5DN6 G;  1M56 C;  2QKS A;  4QPK A;  1Q86 W;  4MVU A;  1KP2 A;  2WLI B;  4R50 A;  1NVP D;  2AHY A;  3CCE V;  1S3J A;  1ROP A;  3IC7 A;  3F7V C;  5IDJ A;  1V55 B;  1PNM A;  1GK9 A;  1TUE B;  2OCC B;  5E1A C;  4CBC A;  4GT1 A;  3E8G A;  4E2L A;  5LGN A;  3ETD A;  4QJF B;  3ASO B;  3CD6 V;  5C93 A;  2EIL C;  3GB7 C;  2GSM B;  2WWW A;  3K08 A;  4EKW A;  3JD1 A;  1K92 A;  1WPX A;  3OR7 C;  2EIK C;  2QM7 A;  3LDD A;  1AI6 A;  2B1I A;  3ETG A;  3RVY A;  1HWY A;  3G4S V;  3AG3 C;  5CBF A;  1GKF A;  1WLE A;  2R9R B;  3G6E V;  4F4L A;  3SYQ A;  3WG7 B;  2ZXW B;  2Q67 A;  1AI5 A;  2EIJ C;  2JJ2 G;  2YEV A;  1NKD A;  1GM8 A;  2EIN B;  3AG1 B;  4JAV A;  4ZKI A;  4WFE A;  1KQS U;  1NJI W;  5IY5 C;  2Q6A A;  5H6R A;  1YIT V;  3K03 A;  1KD1 W;  2WLJ A;  3B77 A;  3ZRW A;  4MT8 A;  1YIJ V;  4BIU A;  1JVM A;  3HB3 B;  3OEH G;  4PA6 A;  3SYO A;  2UXN A;  4MTG A;  4HAM A;  1QBZ A;  4H33 A;  4PA4 A;  3ZN0 A;  4U7N A;  1VQ5 V;  3I55 V;  1AJQ A;  2K1E A;  1FXK A;  2HJF C;  3LNM B;  1CPY A;  2AHZ A;  4RAI A;  3T1C A;  4RUF A;  1VQK V;  1NH2 D;  3SPJ A;  3SPI A;  1F4N A;  4XDJ A;  4P9P A;  5LGT A;  5LHI A;  2DYR C;  1SET A;  1R6N A;  2KB1 A;  3E86 A;  3K06 A;  3SPC A;  2W0F C;  1KP3 A;  4MVZ A;  2XAF A;  2DYS C;  3X2Q C;  3OAA G;  1M90 W;  2X0L A;  1NH2 B;  1M9N A;  2YEV B;  5CA3 A;  1K9M W;  3FB5 C;  1AJP A;  1B6Q A;  1JOY A;  4UVB A;  3R65 A;  1KKD A;  2IJJ A;  2H94 A;  5EC1 C;  3ZMZ A;  4KP4 A;  1M57 C;  5B1A B;  5CBG A;  2DWD C;  4RO2 A;  3E8H A;  3E83 A;  1I5Y A;  4FMT A;  2JDI G;  1FXK B;  2IU0 A;  3TET A;  5J9P C;  3ZMU A;  4JTA B;  3LUT B;  3MHH C;  4RQE A;  1JPX A;  2ZD9 A;  1EFR G;  1MOF A;  1FXH A;  1R73 A;  4JYC A;  3CC2 V;  2XND G;  5KA6 A;  2XOK G;  4N21 A;  2P90 A;  2D3O W;  1V54 B;  2EIM B;  2WLI A;  5B3S B;  2OT5 A;  5L3D A;  2IJH A;  5BZB A;  3WFV A;  1V55 C;  1ARO P;  1VQO V;  2B5U A;  1F51 A;  2HR3 A;  4MVR A;  5HFM A;  3W7T A;  2OCC C;  1BMF G;  1VQL V;  5CN0 A;  2EJR A;  4QE9 A;  5GW7 A;  1QLE B;  2Y69 B;  3ASO C;  3ZRX A;  3DTU B;  1M1K W;  1KEC A;  2BOB C;  4MSW C;  3LSS A;  1W2B U;  4X8A A;  2XAH A;  3P30 A;  4G2K A;  3OMN B;  3CCS V;  3OEE G;  4QPJ A;  1RPO A;  1P4R A;  1K5S A;  4KUM A;  4H37 A;  1OCC B;  1ZWI C;  4JYB A;  2X7R B;  4LP8 A;  2WSS G;  3WG7 C;  1BHA A;  2ZXW C;  1K4D C;  1GM9 A;  3B8M A;  2HG5 C;  3W7U A;  5L3E A;  2NLJ C;  4YXW G;  5CMU A;  3AG1 C;  2EIN C;  4RUE A;  1JQ0 A;  2DWE C;  4GCZ A;  1IXM A;  2V7Q G;  1BHB A;  4N23 A;  5L3C A;  1OCZ B;  3FB6 C;  4XBF A;  5LGU A;  3CCR V;  1Y4M A;  4MTF A;  1K3E A;  3SPG A;  1H2G A;  1F23 A;  4WFG A;  3BY6 A;  1F4M A;  3ABM B;  3P32 A;  3A0R A;  2OTJ V;  4PEL A;  2IJI A;  4WFF A;  2HFE C;  4WF9 V;  1Q81 W;  5EC2 C;  4MW3 A;  3STL C;  4TSF G;  4LC1 A;  4MS2 A;  3ZRV A;  2Q68 A;  4PDV A;  3I56 V;  4R7C A;  3ZMV A;  5IYB O;  1RM1 B;  1QLN A;  1FXV A;  4J9Y B;  3QNE A;  4QIW F;  4DO2 A;  1VQ7 V;  1DTO A;  4Q20 A;  5IYC O;  1PKX A;  1QVF U;  3ASN B;  3EFF K;  1L1F A;  3GWO A;  4G27 B;  3CCM V;  1K34 A;  4JTC B;  4L87 A;  2JJ1 G;  5KUM A;  1P7B A;  5B1A C;  2WLM A;  1K73 W;  1CP9 A;  2XAQ A;  3ZMT A;  5EBW C;  4U7O A;  1E1R G;  1FXK C;  3ABK B;  4FJC C;  1YI2 V;  3ABL B;  2LFS A;  4LBE C;  2X6B A;  1XL4 A;  4XDK A;  2WAM A;  3RW0 A;  3ZRS A;  3E8B A;  3BEH A;  1S72 V;  4KFM A;  4LCU C;  4WCE V;  5HFL A;  1QR8 A;  2EBO A;  3OW2 U;  3OMA B;  1V54 C;  2EIM C;  3ABT A;  3CC7 V;  3E35 A;  1H8H G;  1OZ0 A;  4PDR A;  5B3S C;  4RQF A;  4BW5 A;  3ZIA G;  3JD0 A;  2UXX A;  2HVK C;  1VQ6 V;  4BAY A;  1OCO B;  2P6J A;  3W7S A;  1H8E G;  2JEX A;  3QO5 A;  3LSQ A;  4I9W A;  4P30 A;  4UVC A;  3B8N A;  3K0D A;  1QLE C;  2Y69 C;  4P2Z A;  5LHH A;  1J95 A;  4PA9 A;  1THZ A;  4ASU G;  2YSU B;  1NQT A;  2EZP A;  1MAB G;  2DQ3 A;  4TWK A;  4JTD B;  4PA3 A;  5EK0 A;  1YJW V;  1JX9 A;  1QCE A;  4WFB V;  1OCC C;  3TK1 A;  4OXS A;  4MTX A;  5L3F A;  1R3J C;  2LP7 A;  2Z5U A;  2PI4 A;  3D3I A;  2HLD G;  4PA7 A;  2ZR2 A;  2IU3 A;  2P67 A;  4UVA A;  4PDL A;  4GX0 A;  4R8C A;  2JK5 C;  4CZZ A;  1YSC A;  3VBB A;  4MTO A;  1K7D A;  3IFX A;  3ML0 A;  3JD3 A;  4MVM A;  3DGE A;  4JF3 A;  2XAJ A;  3OUF A;  5EBL C;  2EZO A;  1BL8 A;  1SRY A;  3G71 V;  1OCR B;  1AJN A;  5L3G A;  1OCZ C;  4P9O A;  2QA4 V;  3OE7 G;  3F7Y C;  4GX5 A;  4UV8 A;  2W6I G;  3MD0 A;  1R3I C;  1NR1 A;  2PI5 A;  2IW5 A;  3FYI B;  3ABM C;  3CC4 V;  5B1B B;  4R6Z A;  1PD3 A;  3SYC A;  1N8R W;  4BIZ A;  2IH1 C;  1VQN V;  3NXS A;  1VQP V;  4JAU A;  4UXN A;  2IJK A;  1RM1 C;  3OMI B;  2CK3 G;  3LDE A;  3CCJ V;  3M99 B;  5FL7 G;  1S0V A;  2HVJ C;  1PL0 A;  1W0K G;  3F5W C;  1EZJ A;  3ASN C;  1DF4 A;  3CME V;  2WLL B;  3FB7 C;  3AG2 B;  1LNQ A;  1FFT B;  4QE7 A;  3MHS C;  1ENV A;  4XDL A;  3TCU A;  5B1N A;  5LBQ A;  3SYA A;  1NBM G;  3CCV V;  1VQ9 V;  4PDM A;  2ATK C;  1W0J G;  2ZQM A;  3CPW U;  2QEX V;  1K5Q A;  5L3B A;  3CP1 A;  2X6A A;  3ABK C;  1I5X A;  4UV9 A;  4UUJ C;  3ABL C;  1ORQ C;  3AG4 B;  3T4Z A;  2H8P C;  3UKM A;  1OHH G;  2R9I A;  2F43 G;  3ABU A;  3K79 A;  2ZR3 A;  1G8M A;  1G4Y B;  1EBO A;  3K04 A;  1GTO A;  1S5H C;  4X88 A;  1NVP B;  2Q69 A;  1AR1 B;  3K3W A;  5B1O A;  4FPP A;  3OFN G;  1OCO C;  3OM3 B;  4MVS A;  2WLN A;  3ZN1 A;  1JCH A;  4MW8 A;  1SER A;  2Z3Y A;  1VQM V;  2IH3 C;  1SES A;  2M7W A;  1AI4 A;  2QE7 G;  1K97 A;  2QTO A;  2OTL V;  4MVQ A;  1M56 B;  1UJW B;  4G28 B;  2DQ0 A;  2ITD C;  1R6K A;  3E8F A;  1CEZ A;  2HKO A;  1QR9 A;  3T2M A;  4FK5 C;  3T4D A;  1COW G;  3RVZ A;  1DLB A;  5CBH A;  3W7W A;  1YJ9 V;  3K9A A;  3LDC A;  1QVG U;  1JJ2 U;  3OUS A;  4I5S A;  1Q7Y W;  1Y66 A;  2WPD G;  1K8A W;  2XAS A;  3JCZ A;  3OGC C;  1XL6 A;  2EIL B;  3FKS G;  1S76 D;  3ZMS A;  1OCR C;  2EIK B;  4FIP C;  3JD4 A;  3RBZ A;  5IYD O;  3AG3 B;  4TT3 G;  2NNU A;  2P7T C;  5LHG A;  2XAG A;  3CMA V;  5B1B C;  2A0L A;  3AEI A;  3HPL C;  4QNH B;  2X6C A;  2EIJ B;  1YJN V;  2ITC C;  1R3K C;  1DF5 A;  2ZDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...