1YJ9V

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yj9V00
1Q7YW 3OW2U 1M90W 1VQ7V 1W2BU 1KC8W 3CCJV 1Q81W 2QEXV 4WFBV 1JJ2U 2OTJV 2D3OW 1VQMV 1M1KW 1KD1W 1Q82W 3CCMV 1VQLV 3G71V 1Q86W 3CCQV 1VQPV 1K9MW 1YHQV 1VQ5V 3CCEV 3CC4V 1R73A 4WFAV 1VQ8V 3CMAV 1QVGU 2QA4V 3CPWU 3CCRV 1N8RW 3CXCU 3CC2V 1VQ6V 1K73W 1VQNV 4WCEV 3CCUV 1S72V 3CCVV 1YJ9V 1YI2V 3I55V 3CCLV 1VQ4V 1VQ9V 1QVFU 1VQOV 3G4SV 3G6EV 1K8AW 5DM6V 1YJWV 1NJIW 3I56V 1YJNV 1KQSU 3CD6V 3CCSV 4WF9V 3CMEV 1VQKV 1YITV 1YIJV 3CC7V 2OTLV
chains in the Genus database with same CATH superfamily
2V7QG 3BEHA 3E8GA 4G28B 2DYSB 5EC2C 4Q20A 5JQGB 1VQLV 3AG4B 4DUYB 4B3SO 1KP3A 3B8MA 2Q7EA 1XHXA 4X8AA 2WA4A 3SYQA 3U11A 2OT5A 3B40A 4UVAA 3CCSV 5C93A 2Z0AA 1LUVA 1YVWA 3JATA 1Q7YW 3DXRA 3TCUA 3G71V 2F4VB 2ADQB 4W4LA 3C3SA 3L74H 4D6TH 1N8RW 1NTMH 2MK3A 3FB7C 1OCCB 1YXBA 3T1CA 1IVSA 4H44B 1GN3A 1NS1A 4PHZA 4JYAO 3AG1C 1QR9A 4K3AA 3VQVA 1SKVA 4JTCB 5TISZ 4TQFA 2KB1A 4B3SB 1S77D 2ZR3A 1AILA 1SQXH 4MS2A 2LP7A 1JJOA 1SRYA 4HNAB 1IBLO 1PL0A 4WFAV 2XASA 4X1IB 1SA0B 3JALB 3AG3C 3VQXA 4DR4O 1P84F 4K0KB 3L73H 1NQTA 4E4EA 2WAMA 3E2EA 3SJBC 3RT3C 1Q8IA 4W4KA 4LF7O 5JCOA 4CH6A 1QLEC 3RYFA 1XNRB 1K33A 5BR8B 3OM3B 4DK0A 2B1IA 3ETGA 4DV0O 2JGDB 4I0XA 2NNUA 3ASNC 3D3QA 2ITDC 2IH1C 1F4NA 4YIPA 5IY5B 1IBLB 3HKDB 3VOUA 1VQ5V 1WLEA 5HFMA 3CMAV 2FL4A 4QNHB 2A0LA 4UCRA 2RCVA 3GVMA 4U7OA 2XNDG 4JI2O 4RWUA 2KG7B 1TUBA 1M5IA 2L6LA 4LWSB 1JVMA 4JI4O 2AW9A 2H3OA 4JI7O 5IE9A 1V9PA 1K4DC 1R6NA 4FJCC 4JI3O 5CB4A 4I7ZB 4FPPA 3CC2V 4MTFA 4DV0B 4FMTA 3TXSA 1XOUA 1PM9A 4UUJC 1TGOA 4LFCO 4KUMA 4PDLA 3OTFA 4DR7B 5EYPA 3OW2U 2HJFC 3OR7C 5EZYB 2YDEA 1GN4A 2CAZC 1BQZA 4DUZO 1L0NH 1XL6A 1MZFA 3CEIA 5BZBA 3CXHF 3OEHG 1VMGA 1N36B 1WPBA 5EBMC 4ASUG 1N33O 3E22A 4DV5B 3RYIB 1MOFA 4DRXA 1MSDA 1XMQO 5IT9N 1GO3F 1FYJA 4JZGA 5B5EZ 4YY3O 1US6A 4J42A 1SERA 3NR7A 2JS5A 1OJHA 2LO1A 5FPOA 1V54B 5B1AB 3JARB 4BW9A 1WPXA 2GDSA 4DR3O 2DYSC 1XHZA 4O4IA 4G2KA 3C3TA 5IWAB 1M90W 5B66Z 5CMUA 1KMIZ 4U3FH 1CPYA 5LL6Y 5EBLC 4JI1B 2G38A 5HFLA 1PPJH 1GKFA 4LF9O 2W0XA 1R3LC 2QM8A 4G27B 1FXVA 3TETA 4TQDA 3BVOA 1VF6C 3IGAC 5KHHA 5GONB 4DV6B 4R7CA 3ML0A 3N2GB 3WFVA 5EC1C 5KHIA 5H5NA 1J5EO 2KSDA 4DV1B 4TWKA 1N0JA 1PNLA 4YXWG 1WAZA 5KHJA 2Q68A 2Y69C 2XAFA 2IU3A 3FB5C 1FKAO 4BAYA 1IBMO 2FTKA 5LHGA 4X65O 2ZIOA 1XILA 2QKSA 1M9NA 2DN9A 4R6ZA 3ABKC 3ZRWA 4JZ2A 4B3TB 3PN1A 5KAIZ 2QA4V 1X59A 1SZTA 4MVQA 2JEXA 1FFXA 3T1YB 2IBZH 1N32B 4B3MB 4UVCA 3CMEV 4PI0A 2HVJC 3JAKA 2N05A 4N23A 4WFFA 3ICXA 2KQXA 1YZBA 2WSSG 2PYLA 3M99B 1JFFA 2RNBA 3QO5A 1QCEA 2FB5A 2XAGA 4NVPA 5JJJB 3JYCA 1AR5A 1ZTEA 3O9OA 3MDSA 2AZ2A 1O9HA 4X65B 4UCUA 5IYZA 4LC1A 4NXMO 4JI6O 3OMIB 4ZI7A 4BIOA 3J7AU 2GUZA 2ZKOA 1NZ6A 2EIJC 1NVPB 4JV5O 1XBLA 3RVYA 2RMKB 4FLXA 2X6AA 2AXTZ 2CGOA 4DV4O 1SESA 1XUQA 3K58A 2RJZA 4NXNO 1WB7A 5LOVB 3OE7G 2N04A 2ADPA 2BTQA 1S3JA 1D5NA 1QR8A 1HNWB 1AJPA 4QPJA 1NTZH 3UQ8A 3CPWU 4WFGA 1IBKO 5KAFZ 1YJ9V 5BMVA 1RP3B 1H8EG 2EULA 5EK0A 3RBZA 1YJWV 2ZT9B 4PJ0Z 3AEIA 3K0GA 4NTWA 5JH7B 4LFBO 4L8JA 3HPLC 1E79G 4X66O 2EZOA 4XBFA 1P7BA 5K1XA 4NKGB 1XMOO 4WFBV 5EIBC 4JV5B 3X2QB 4DV7O 1XEQA 3CCMV 1HNZO 2PZSA 4JTAB 4O4JB 1OV9A 2HP8A 4CBCA 3ABMB 3WG7C 2CH7B 5EIBD 4NXNB 1JX9A 1GN6A 4LCUC 3JD4A 3M7MX 2NR5A 5JCOC 2ZCEA 1Z5VA 4OX9O 4X62O 2JK5C 3D8CA 5KMGA 5L3EA 1EZJA 1N4CA 4DR1B 4IHJB 2BOCC 3K79A 2ZE6A 3FB6C 5B1NA 5JVDB 4Q6GA 2OCHA 2DE0X 1NT2B 1NBMG 1XMOB 3W7WA 3RGBA 2GSMB 4P2ZA 4O2AB 2RDCA 2QWRB 2QEXV 1XQ8A 4H33A 4NB5A 4UB8Z 2E74B 3KZIZ 5B1BB 1HP8A 1BL8A 4OX9B 4X62B 4J11A 3HKCA 4I4TA 3K57A 5GTHZ 3B8NA 2EILC 4J10A 5LGTA 1I5XA 1PNKA 2Z3YA 3LNMB 4X89A 3FD9A 2PY5A 2P90A 2Q5ZA 5JQGA 3JCZA 2YC0A 4NR1A 4UVBA 2QR4A 3EXAA 3F5TA 3OMNB 2BOBC 1FXHA 5IDJA 1AI4A 2ZD9A 3K03A 1VQ7V 3LDDA 1GM9A 1CEZA 5IYCO 4DW0A 1TUEB 1HDJA 1JCHA 1A32A 1RM1B 4RAIA 3LNNA 3F5WC 2ZQMA 1KQSU 3ASOC 3CRMA 4JI0O 5LXTB 4BIZA 3E89A 2NN4A 1R3IC 1MZEA 1FXKB 3UCSC 4HNAA 4JI5O 3DC6A 4DUYO 4X1IA 5C8YB 1SA0A 3JALA 1QVFU 2B1GA 3ZHVA 3E35A 3K59A 3BAAA 3BA8A 3OUSA 1R3KC 3K0DA 1VP7A 3OD4A 4MVMA 2HJDA 4A5UB 2YIAA 4TOIA 1BE3H 4FLZA 1Q43A 3JAWB 2F4VO 1Q6HA 4H37A 1QBZA 1S0VA 2OCCB 4ICGA 2JVDA 1YITV 1PNMA 3DSQA 4GX5A 2JGDA 4J41A 3RVZA 2AZ0A 5CA3A 5L3FA 2ODMA 2K9PA 2JJ2G 2IH3C 2YIDA 1I7FA 4JI5B 1CP9A 3HKDA 3ZRVA 2YIBA 2GTSA 2ZE7A 4MVRA 2Y48A 4PA9A 3JSLA 3KG2A 3G67A 3LSUA 3L75H 3OMAB 2Y4TA 3X2QC 4Z2WA 2KG7A 2YI8A 2UXBB 3P3PA 4K0KO 2Y0PA 1Q81W 2YEVB 1JR9A 1MNGA 4LNUB 4LWSA 4KHPO 1ZL8B 2ZXWC 3E8BA 4X64B 5LA6B 2LGWA 1JA8A 2ILMA 1SQGA 2NLJC 2QSAA 1AR1B 1XNRO 1RPOA 4J7ZA 5BR8O 5CBHA 1SF9A 3CYOA 2V1DA 3ZN0A 4GX0A 2JGUA 3FX7A 3QG5A 4NTYA 3J80N 2EZPA 2EJRA 1I0HA 4UCVA 5EZYA 1OCZB 3SPJA 4MVZA 2XUMA 1NR1A 2W0FC 3Q4HB 2DQ0A 2LFRA 3P32A 4UV8A 4XDLA 1Y76B 3ZBHA 3T2MA 2XAQA 2D2CB 1BHBA 1M57C 5FLXN 5LYJB 1UFIA 5L3BA 3RYIA 1N0NA 3W7XA 4KHPB 4FK5C 2D3OW 1AI5A 1EBOA 3G6BA 4LBEC 3DTUB 4ZOLB 1AR4A 1M56B 4CS2A 3ABTA 5KA5A 1H2MA 1EN6A 3SJAC 3WB2A 3JARA 2DW4A 2HHHB 2Q6AA 1DK1A 1BSMA 3KCXA 4DR7O 3T4ZA 3ZMUA 2XAHA 1L1FA 1RSOB 2X6BA 1E1RG 1VQ6V 1S5JA 2VS0A 4CZZA 1D2DA 3JD1A 4R8CA 3G6EV 3SJCC 3QVNA 4TUYB 1N36O 2P7TC 4WBNB 2QTOA 2DYRB 4DV5O 1K7DA 4PELA 2LW7A 4O4LB 2L35A 2BTOA 3SJQC 4LF5B 1K97A 4FFKA 5GONA 4CS3A 4FM1A 5LMUB 3E86A 3N2GA 2N74A 3R65A 2XAJA 2ETNA 4MVOA 2WA3A 4DR2O 3WB0A 4QE7A 3CX5F 1OCRB 2CUGA 1YIJV 2EX3A 3D3IA 2GHYA 2QJ1A 5IWAO 1OCOC 4IL6Z 4F6EA 3ABLC 4X20B 4JI1O 2QGNA 1BCCH 1JPXA 4HAMA 3TXQA 4OGQB 2CTPA 2FKXA 3TJTA 1XNQO 1JOYA 3CRAA 1BT8A 3ZRSA 4WFEA 5JJNB 2UUAO 3H9VA 3O65A 2EIMB 4EKWA 1MG1A 1VQ8V 4DV6O 1S76D 4U3JB 5GW7A 5EBWC 2JJ1G 4DR2B 4J80A 3CB2A 3HKBB 4DV1O 2EIKC 5LMNB 2ZR2A 4IYHA 4LH7A 4WF9V 5B1OA 1DGSA 3CHXA 1BMFG 3AG4C 3OTOO 2VRZA 1W2BU 3NXSA 2Q73A 2P22C 2HG5C 1GM8A 3H1IH 2YICA 1JMKC 2Q0AA 4B3TO 3CRQA 1XNQB 3EFFK 3JAMN 4LF8O 3K3WA 1BGYH 2Q0OC 1V55B 1HNXB 2UUAB 3K5NA 4H0LB 3BHPA 3T1YO 5J2UB 1NH2B 3T4DA 4FLVA 5LP6B 1N32O 4B3MO 1ZAUA 3AG2B 4X1YB 3ZMVA 1LR1A 4WFHA 1OCCC 5LOVA 1M93A 4X9QA 1S5HC 3ABUA 5B3SB 3AG7A 4TT3G 3OEEG 4PA7A 3RYHB 1Z5WA 4EB6B 5D5QA 5H9CA 1DF5A 5IJ0B 3OTOB 1Q3EA 4ZKIA 1VQKV 5KUMA 4OPHA 2E3CA 4JAVA 5JH7A 5KA6A 4AQYB 1Q82W 1Y66A 4JAAA 1KECA 1GTOA 5E1AC 2ZINA 4I50B 5FNVB 4LF8B 5J9PC 3SPHA 3CE2A 4J7JA 4O4JA 5H6RA 4R50A 3OT7A 1F23A 2LGQA 4JGSA 2CH7A 1W0JG 3ZN1A 2R70A 2QWQB 3ZCCA 3HKEB 2PUSA 3FAVB 2HVKC 4LP8A 4X1KB 2QM4A 2ZIMA 2WLLB 5CA0B 3U10A 5LGNA 5L3GA 1GH6A 1M56C 3KKYA 1Y74B 1B3QA 5LGUA 2QWNB 1NTKH 1HNWO 1H2KA 1B06A 4IHJA 4DK1A 4PI2A 4TV9B 3ZJZA 2IM9A 5JVDA 1WN7A 5IY5C 1EZVH 2CDYA 4FIPC 4QPKA 1K92A 4O2AA 1T5EA 1YHQV 5L3DA 2ZDIA 4U7NA 2M6YA 3ZHSA 2YIBD 1H2NA 1YTFD 2EINB 4CC5A 2DQ3A 5LHIA 3IC9A 5GTIZ 2X0LA 3UKMA 1H8HG 1VQPV 3R66A 3BFRA 1O9GA 4WCEV 2Q69A 3CCVV 1EN5A 4DR1O 3APOA 4LF4B 3VQYA 3JD2A 2OWOA 5FPRA 2B5UA 5BY1A 4I5SA 1KU9A 3G80A 1VQMV 3RYCB 2FMLA 2A79B 1IDSA 4FLYA 1GAXA 4BWAA 1IZ3A 3I5DA 1E1QG 4I55B 1ZX3A 1K5SA 2P6JA 1VQ9V 4N21A 4DW1A 1YDXA 3STZC 1QU7A 2QTSA 2H94A 4MTOA 1B6QA 4UCSA 2OYQA 5LXTA 2ZM6B 4DV3B 2R9AA 4JI8O 1V54C 4DR5B 4CH5A 1FAFA 5B1AC 3SDLA 1FXKA 3FB8C 3SPGA 3F7VC 1YSCA 2ZE8A 3L72H 1I94O 4F6RB 2Z5UA 3CJHB 3ZEDA 3CCLV 1VQOV 2IU0A 3QO8A 5C8YA 2CTWA 3GWOA 3AG1B 2AHYA 3ZX6A 2LJ2A 1VIBA 2X6CA 3CCJV 4B7EA 1DF4A 4GUNA 5J2TB 3LDCA 3ZHUA 4YJ2B 1WNSA 2IJJA 2Q7GA 4DV2B 3QNEA 1HWYA 4YHHO 3CCUV 1S72V 1R6TA 3ETQA 4AHCA 2VWJA 1JQ0A 3JAWA 1MSWD 2UUBB 5KX5B 1YF2A 1TAEA 3ZIAG 1Y4MA 2E76B 1YEWA 4X88A 4JI8B 5JWPA 1S5LZ 1I94B 4EFEA 1WP8A 3SYPA 3OFNG 4UV9A 4DYLA 2CK3G 3N2KB 3UT5B 3JD3A 3FYEB 2E5LB 1WB8A 1QLEB 2UXXA 2BCCH 4B3RB 4KXRA 3BABA 3ASNB 1HR0B 5CA1B 1R3JC 4YHHB 2YEVA 1Q90D 3JSNA 4LNUA 4PA4A 3U0ZA 2PYJA 2RN9A 1TVKB 1GMGA 3APQA 2XOKG 1GK9A 1WA8B 1ZL8A 5DM6V 5LA6A 3CD6V 4HZ3A 1F7YA 2FYUH 1SS3A 5H6QA 2UXCB 1U97A 5IJ9B 4LF6O 4GYCB 2IJKA 4K8XA 1SQVH 1VQNV 5DEDA 1CXZB 3SR2C 1FS0G 3Q4HA 4JASA 1AJQA 1YJNV 3OAAG 1Y76A 3BY6A 4AI8A 2DWEC 4HYOA 1IXMA 4OXSA 4P9PA 4PV1B 5JJEB 1U96A 5LYJA 3UO3A 4H13B 2UXBO 4YJ3B 1VEWA 2W6JG 3FKSG 4JYYA 3K5LA 1N34O 2DOSA 4KL1A 5L3CA 2BE3A 2WLJA 2HEPA 3D36A 4ZOLA 2BSKB 1NVPD 1EN4A 1NJIW 4LFAO 4X64O 4QGPA 1NU1H 5ITZB 2LW1A 2Q9LA 4D7SA 1Q6UA 1PV0A 4MW8A 2P4KA 1D5AA 1QHTA 3LDEA 3W7SA 2M7WA 1BQ0A 4LF6B 4UCTA 2YUAA 2WLNA 2Q8VA 1J95A 4PA3A 3ZMTA 4GKKO 2Y4UA 3ETEA 2VWKA 1RSOA 4PDMA 2ATKC 3B4SA 4Z1MG 3ETDA 1WJZA 3BRCA 3K04A 3QTCA 3ZMSA 1R1BA 2DWDC 1BS3A 4TUYA 4BW5A 2AGAA 1MMMA 4FLTA 2Q67A 1N34B 4WBNA 4O4LA 1P7GA 4MVUA 3ABMC 4IIJB 3CWBH 2UUCO 5DN6G 3HB3B 5DECA 1DTOA 3JASB 4LFAB 3ZMZA 4BR6A 1NKDA 3I56V 5E79Z 1ZUQA 1IXBA 3CC7V 2CGNA 1MA1A 4GKJB 4TV8B 2HHHO 4FFBB 1W0KG 5FL7G 3SPCA 4GKKB 3CCRV 1SQFA 1G6UA 2YS8A 1NR7A 4X20A 3VQWA 2QKAA 3N27A 3E8FA 4O4HB 3SGIA 2Y69B 3K08A 4UFZA 1HW7A 2ZDIC 1SETA 4L87A 2E75B 4J9YB 1Y6XA 3L9DA 2UUCB 5CBGA 4HBNA 4O2BB 1L0LH 5B1BC 2UXDO 3FFQA 3ABKB 2HLDG 4LF5O 1KUQA 1THZA 4ABMA 4U3JA 5LMUO 3WB1A 2JEUA 1ORQC 3CRRA 3GWKC 4DR6O 2JS3A 3HKBA 2WLIB 1URFA 3K9AA 4CH3A 3BPZA 2VQFO 1GM7A 5CBFA 2LFSA 3A0RA 4B7KA 3RW0A 4MTGA 4JYAB 1OZ0A 2QWOB 1YI2V 3CRCA 1MABG 4YIOA 1VF5B 4UCOA 2UXDB 3H01A 5J2UA 1Q6IA 3OUFA 5LP6A 1RM1C 2QDOA 4EEQA 5F2VO 4DR4B 1SC5B 3C90A 1YTFB 4X1YA 4DR6B 2EIJB 2PF4E 1IURA 2CTQA 1K8AW 3RYHA 3HR0A 3JATB 2VQFB 4EB6A 3DXRB 5IJ0A 3J81N 1FXKC 1SQQH 5LMNO 4LF7B 2OTJV 1XDCA 4NTXA 2MW2B 2P4VA 4D7TA 1SQBH 4I50A 4EFBA 3M8AA 5FNVA 4OPAA 3LSQA 3GB7C 4I9WA 4MTXA 3RWRD 2R9IA 1PKXA 2UXNA 3B09A 3AK3A 2VQEO 2A3QA 2F23A 2F43G 1WP7A 1HNXO 3MHSC 1M1KW 4MSWC 3ZHTA 2W6IG 2PI4A 3HKEA 4PDRA 3FAVA 4X1KA 1QVGU 4JI2B 3H1JH 2WLLA 5CA0A 2OCCC 4GX1A 4RQFA 1Y74A 2Q7HA 4MVSA 4QIWF 5H2FZ 3CS5A 5KLVH 2QKCA 4NYKA 2JDIG 4JI4B 3WG7B 4JTDB 4TV9A 4JI7B 4JI3B 4I9QA 2OIGA 1FD9A 1B04A 1KD1W 2ZE5A 3PJSK 3CSXA 5BXZA 3RYFB 1YCIA 4LR3A 3ZHQA 2WPDG 4AQYO 4LFCB 1K73W 3IAYA 1G8MA 4I0XB 2VQEB 1G4YB 1X4TA 2R72A 4J9ZB 2WLMA 4K35A 4DUZB 1H2LA 3QO7A 3K9SA 3CC4V 1UPGA 1N33B 1I5YA 1Y67A 5A2QN 3DGEA 2PI5A 2DJVA 2HKOA 5K1PA 4GZRB 5LHHA 1TUBB 3OR6C 2WWWA 3SYCA 3G4SV 1XMQB 3RN4A 1AB3A 3QF7A 1ZWIC 4YY3B 3A0HZ 1NI8A 1OCZC 3H1LH 1H2GA 4JYBA 5IYBO 3WU2Z 5CB4B 2YXHA 1FJGO 2YSUB 3F7YC 4FLWA 2EILB 3RYCA 2DMXA 3ZRXA 1K5QA 4DR3B 5IYDO 2CE4A 4JAUA 1BZKA 3T1HO 2A06H 4I55A 5EYPB 4BIUA 2GTAA 2IJHA 2PGGA 4KFMA 4ZBMA 3STLC 4ZHQA 3ZHRA 1JJ2U 1F4MA 3D36C 2JIZG 1Q86W 1AI7A 4LF9B 2IJIA 1PL4A 1ROPA 2QM7A 3IC7A 4GCZA 3E22B 4FM0A 4CH4A 4DRXB 4F6RA 3CJHA 3MHHC 3CP1A 1DLBA 1FJGB 1J5EB 2YI9A 3KCYA 4FZ0A 4LF4O 2GV9A 2O57A 3ASOB 3UM7A 3BA9A 2F93B 4UB6Z 1LNQA 4UXNA 5J2TA 3T1HB 4GT1A 3VBBA 4YJ2A 1IBMB 1P4RA 3DC5A 5KHGA 1ENVA 4O4IB 3A2FA 3H1HH 2DYRC 1K34A 2IW5A 4DO2A 5KX5A 2A9HA 4IYIA 1K4CC 4DXWA 2XT9A 2WLKA 4LH6A 3IJ4A 4MT8A 2YXYA 2ZM6O 3L70H 4DV3O 1OCRC 4QE9A 3BCCH 4DR5O 3I55V 1AVMA 1LUWA 2P5OA 1PD3A 1L8DA 2OIEA 3N2KA 3UT5A 1H38A 3K06A 4AILC 2QWPB 3OGCC 1Z2GA 3CCQV 3A8TA 5AG2A 2KKWA 5CA1A 1ZSPA 3ZS8C 5A9GA 2A7WA 3UO2A 2X7RB 4NXMB 1W59A 4XDJA 4JI6B 1AJNA 1TVKA 4DV2O 4ZHQB 1GRJA 1WA8A 2H8PC 2C2AA 2EIMC 4P9OA 2ZNIA 3ZRWB 1P49A 2UUBO 3P30A 2ITCC 2P67A 4DV4B 1FFXB 5IJ9A 4RUEA 3E8HA 4PA6A 1KBHA 2ZXWB 2EJ7A 2R9RB 3JAKB 3H1KH 3EHBB 2CTRA 2E5LO 3IFXA 1VF7A 1JFFB 2YXLA 4B08A 1RFYA 1IBKB 4B3RO 1F51A 2XTAA 3JD0A 3CCEV 5LBQA 1HR0O 1G1XB 4YJ3A 4F4LA 4J7KA 4Z1VA 4LFBB 3THOA 5IYZB 1V55C 3MD0A 4X66B 3AG3B 1TA8A 3W7TA 5LP6C 4ZI7B 3AK2A 2BSKA 4MW3A 4DV7B 3AG2C 1HNZB 3RFRA 3P3NA 5ITZA 2GUZB 4CC6A 1M57B 5D5PA 5CN0A 5B3SC 1OHHG 3SYOA 1K9MW 1NH2D 1R73A 4JYCA 1I08A 2V4DA 2RQ6A 2UXCO 4JPRA 4K8ZA 3E83A 1VQ4V 1R6KA 1KKCA 4PDVA 4KP4A 2BTQB 1VARA 3W7UA 4XDKA 2F66C 1KB9F 3B77A 1XL4A 2QE7G 3LUTB 4C7UA 2XHBA 3B2EE 3SYAA 2LQTA 4GX2A 5BMVB 4PD4F 4GLXA 1KP2A 3AK1A 2JRIA 4FM2A 1PP9H 4IIJA 3JCUZ 3LSSA 1GN2A 3JASA 2WLHA 3EVKA 1FFTB 4RUFA 1SQPH 1KC8W 4RO2A 2EBOA 2PTMA 1XREA 3TGUH 2HFEC 1M4UA 3L71H 3S3XA 4RQEA 4TV8A 4P30A 1VF6A 1RPRA 1FPOA 4FFBA 1QLNA 1QQCA 4FLUA 2Y0IA 3K5OA 1AP5A 2UU9O 4IGGA 5KHKA 1KKDA 2ZNJA 2Q4PA 4IT5A 1SZXA 2F95B 3MAQA 1XI1A 1BHAA 1EFRG 2OTLV 2F1MA 5KMGB 4O4HA 1EM1A 1AI6A 2GBOA 1IX9A 3SPIA 5KUKA 3CXCU 1OCOB 3K5MA 4TSFG 4O2BA 2EINC 3ABLB 3FYIB 3S3WA 4E2LA 4FZ1A 4QJFB 4JF3A 4ZIBA 2B9ZA 4CS4A 2P06A 2WLIA 1AP6A 1QNMA 1COWG 2ARHA 1H2SB 4FVMA 2UU9B 4GKJO 3OGIB 2K1EA 3TK1A 4JI0B 3HKCB 4I4TB 1KYOF 1Q5OA 2AHZA 1AROP 1UJWB 3A0BZ 1ZLZA 2HR3A 1K3EA 2EIKB
chains in the Genus database with same CATH topology
1FXKC 2V7QG 2GSMB 3BEHA 4P2ZA 3E8GA 4G28B 3ZCCA 2DYSB 5EC2C 2QEXV 4H33A 4LP8A 2HVKC 4Q20A 2OTJV 2WLLB 1VQLV 3AG4B 5LGNA 5L3GA 1M56C 1KP3A 5LGUA 3B8MA 5B1BB 4X8AA 3SYQA 3LSQA 3ZJZA 2OT5A 1BL8A 3GB7C 4UVAA 4I9WA 4MTXA 3CCSV 5C93A 5IY5C 2R9IA 1PKXA 2UXNA 1Q7YW 4FIPC 4QPKA 3TCUA 2F43G 3B8NA 2EILC 5LGTA 1I5XA 1K92A 3MHSC 1M1KW 1PNKA 4MSWC 2PI4A 2W6IG 3G71V 2Z3YA 3LNMB 4X89A 1YHQV 5L3DA 2ZDIA 2P90A 4PDRA 4U7NA 1QVGU 3JCZA 2WLLA 1N8RW 2OCCC 2MK3A 3FB7C 4UVBA 4GX1A 1OCCB 4RQFA 4MVSA 4QIWF 3T1CA 3OMNB 2BOBC 1FXHA 3AG1C 1QR9A 1YTFD 2EINB 2JDIG 5IDJA 3WG7B 1AI4A 4JTCB 4JTDB 2ZD9A 3K03A 2DQ3A 1VQ7V 5LHIA 3LDDA 2KB1A 1S77D 2ZR3A 4MS2A 2LP7A 1KD1W 2X0LA 1GM9A 1SRYA 3UKMA 1CEZA 1H8HG 3PJSK 1VQPV 5IYCO 1PL0A 1TUEB 4WFAV 1JCHA 2XASA 2WPDG 1RM1B 3AG3C 4RAIA 1K73W 4WCEV 2Q69A 1G8MA 3CCVV 3F5WC 2ZQMA 1NQTA 1G4YB 1KQSU 3ASOC 3JD2A 2WAMA 2B5UA 4J9ZB 3E2EA 2WLMA 4BIZA 3E89A 4I5SA 1R3IC 3QO7A 1VQMV 1FXKB 2A79B 3CC4V 1I5YA 1QLEC 3DGEA 1E1QG 1K33A 2PI5A 2HKOA 1K5SA 2P6JA 3OM3B 1VQ9V 1QVFU 4N21A 3OR6C 5LHHA 2B1IA 2WWWA 2B1GA 3ETGA 3SYCA 3G4SV 3STZC 1ZWIC 2NNUA 3ASNC 2ITDC 2H94A 2IH1C 1F4NA 3E35A 4MTOA 1OCZC 1B6QA 5IY5B 3OUSA 1H2GA 1R3KC 3K0DA 4JYBA 5IYBO 3VOUA 4MVMA 1VQ5V 2YSUB 3F7YC 1WLEA 5HFMA 1V54C 2EILB 3CMAV 5B1AC 1FXKA 3ZRXA 1K5QA 4QNHB 3FB8C 3SPGA 2A0LA 1YSCA 3F7VC 5IYDO 2Z5UA 4H37A 4JAUA 1QBZA 4U7OA 2XNDG 2OCCB 3CCLV 1S0VA 1VQOV 2IU0A 3QO8A 4BIUA 1YITV 1PNMA 2IJHA 4KFMA 4ZBMA 3STLC 3GWOA 4GX5A 3AG1B 2AHYA 3RVZA 2X6CA 5CA3A 3CCJV 1JVMA 5L3FA 1JJ2U 1DF4A 2JJ2G 1F4MA 2IH3C 3LDCA 2JIZG 1Q86W 1AI7A 2IJIA 1CP9A 1K4DC 1R6NA 4FJCC 2IJJA 3ZRVA 1ROPA 4FPPA 3CC2V 4MVRA 4MTFA 2QM7A 3IC7A 4GCZA 4FMTA 3QNEA 1HWYA 2Y48A 4PA9A 3CCUV 1S72V 3KG2A 1JQ0A 4UUJC 3MHHC 1MSWD 4KUMA 3OMAB 4PDLA 3CP1A 1DLBA 3X2QC 3ZIAG 3OW2U 1Y4MA 2HJFC 4X88A 3OR7C 3ASOB 3UM7A 1Q81W 2YEVB 1LNQA 3OFNG 3SYPA 4UXNA 4UV9A 4GT1A 1XL6A 2ZXWC 3VBBA 5BZBA 2CK3G 3E8BA 3OEHG 1P4RA 1ENVA 2NLJC 5EBMC 4ASUG 3JD3A 3FYEB 1QLEB 2DYRC 2UXXA 1K34A 1AR1B 1MOFA 1RPOA 2IW5A 4DO2A 5CBHA 3CYOA 1GO3F 2V1DA 2A9HA 1K4CC 3ZN0A 3ASNB 4GX0A 4DXWA 2EZPA 2EJRA 1R3JC 1OCZB 3SPJA 4MVZA 2WLKA 2YEVA 1SERA 1NR1A 4MT8A 2W0FC 2DQ0A 4PA4A 2LFRA 1GMGA 3P32A 1V54B 1OCRC 4UV8A 2XOKG 1K3EA 4QE9A 5B1AB 4XDLA 1GK9A 3I55V 1WPXA 1PD3A 3T2MA 2XAQA 5DM6V 1BHBA 2DYSC 3CD6V 4HZ3A 4G2KA 1H38A 1M57C 3K06A 5L3BA 1M90W 3OGCC 3W7XA 5CMUA 4FK5C 2D3OW 5H6QA 1CPYA 3CCQV 5EBLC 1AI5A 1EBOA 4LBEC 2IJKA 3DTUB 5HFLA 1VQNV 2X7RB 1GKFA 4XDJA 1M56B 1FS0G 4JASA 1AJNA 3ABTA 5KA5A 1R3LC 1AJQA 2QM8A 4G27B 1FXVA 1YJNV 3OAAG 2H8PC 2DW4A 3TETA 3BY6A 3IGAC 2C2AA 2EIMC 2DWEC 2Q6AA 4P9OA 4HYOA 1IXMA 4OXSA 4P9PA 3ZRWB 3P30A 4R7CA 3ML0A 3WFVA 2ITCC 5EC1C 3T4ZA 3ZMUA 2P67A 2XAHA 4TWKA 2W6JG 1L1FA 3FKSG 1PNLA 2X6BA 1E1RG 1VQ6V 4YXWG 4CZZA 4RUEA 2Q68A 2Y69C 5L3CA 2WLJA 2XAFA 3JD1A 3D36A 3E8HA 2IU3A 4PA6A 4R8CA 2ZXWB 3FB5C 3G6EV 1NVPD 2R9RB 1NJIW 4BAYA 2FTKA 5LHGA 3EHBB 2P7TC 4MW8A 2QTOA 2DYRB 3IFXA 1K7DA 4PELA 3LDEA 3W7SA 2QKSA 2M7WA 1M9NA 4R6ZA 3ABKC 3SJQC 1K97A 3ZRWA 1F51A 3JD0A 2WLNA 3CCEV 5LBQA 1J95A 2QA4V 3E86A 4PA3A 3ZMTA 3R65A 4F4LA 2XAJA 3ETEA 1SZTA 4MVQA 2JEXA 1V55C 4MVOA 4PDMA 3MD0A 2ATKC 4Z1MG 4QE7A 3AG3B 3W7TA 1OCRB 4UVCA 3CMEV 3ETDA 1YIJV 4MW3A 3AG2C 2HVJC 3K04A 3ZMSA 3D3IA 2GHYA 4N23A 4WFFA 2DWDC 4BW5A 1M57B 2WSSG 2Q67A 5CN0A 3M99B 5B3SC 1OHHG 3SYOA 1K9MW 1OCOC 1NH2D 3QO5A 4MVUA 1R73A 3ABMC 3ABLC 4JYCA 5DN6G 3HB3B 1QCEA 1DTOA 2XAGA 3JYCA 4JPRA 3ZMZA 3E83A 1NKDA 1VQ4V 1R6KA 4PDVA 1JPXA 4KP4A 4HAMA 3I56V 4LC1A 3CC7V 1JOYA 3OMIB 3W7UA 4XDKA 3ZRSA 4WFEA 3B77A 1XL4A 2EIMB 2QE7G 1MG1A 1W0KG 3LUTB 5FL7G 3SPCA 4EKWA 3SYAA 1VQ8V 4GX2A 2EIJC 1S76D 1NVPB 3CCRV 5GW7A 5EBWC 3RVYA 2JJ1G 1KP2A 3LSSA 2X6AA 2EIKC 1NR7A 2ZR2A 2WLHA 1SESA 3E8FA 2Y69B 3K08A 4WF9V 5B1OA 2ZDIC 1SETA 4L87A 1FFTB 4J9YB 4RUFA 1BMFG 3AG4C 1W2BU 1KC8W 4RO2A 3OE7G 2EBOA 3NXSA 1S3JA 5CBGA 1QR8A 2HFEC 4RQEA 4P30A 2HG5C 5B1BC 1AJPA 4QPJA 1RPRA 3ABKB 3CPWU 1QLNA 2HLDG 1GM8A 4WFGA 1THZA 1YJ9V 2JEUA 1ORQC 1H8EG 5EK0A 3EFFK 3RBZA 1YJWV 1KKDA 3K0GA 3AEIA 3K3WA 1BHAA 2WLIB 1EFRG 1V55B 3K9AA 2OTLV 1NH2B 3T4DA 3HPLC 1E79G 2EZOA 4XBFA 1P7BA 1GM7A 5CBFA 4WFBV 3AG2B 1AI6A 3X2QB 2LFSA 3A0RA 3CCMV 3ZMVA 4WFHA 1OCCC 3SPIA 1S5HC 5KUKA 3RW0A 4JTAB 3ABUA 4MTGA 5B3SB 3CXCU 4TT3G 1OZ0A 3OEEG 1OCOB 4TSFG 4CBCA 4PA7A 2EINC 3ABMB 3ABLB 3WG7C 1YI2V 3FYIB 5H9CA 1DF5A 4E2LA 1JX9A 1MABG 4LCUC 4QJFB 4JF3A 4ZKIA 1VQKV 3JD4A 5KUMA 2JK5C 4JAVA 2WLIA 5KA6A 3H01A 3OUFA 1Q82W 1COWG 1RM1C 1Y66A 5L3EA 1EZJA 1KECA 1GTOA 5E1AC 1YTFB 2K1EA 2BOCC 3K79A 3FB6C 3TK1A 5B1NA 5J9PC 3SPHA 2EIJB 5H6RA 4R50A 1K8AW 2AHZA 1F23A 1AROP 1UJWB 4JGSA 1NBMG 3W7WA 2HR3A 1W0JG 2EIKB 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y W;  3OW2 U;  1M90 W;  1VQ7 V;  1W2B U;  1KC8 W;  3CCJ V;  1Q81 W;  2QEX V;  4WFB V;  1JJ2 U;  2OTJ V;  2D3O W;  1VQM V;  1M1K W;  1KD1 W;  1Q82 W;  3CCM V;  1VQL V;  3G71 V;  1Q86 W;  3CCQ V;  1VQP V;  1K9M W;  1YHQ V;  1VQ5 V;  3CCE V;  3CC4 V;  1R73 A;  4WFA V;  1VQ8 V;  3CMA V;  1QVG U;  2QA4 V;  3CPW U;  3CCR V;  1N8R W;  3CXC U;  3CC2 V;  1VQ6 V;  1K73 W;  1VQN V;  4WCE V;  3CCU V;  1S72 V;  3CCV V;  1YJ9 V;  1YI2 V;  3I55 V;  3CCL V;  1VQ4 V;  1VQ9 V;  1QVF U;  1VQO V;  3G4S V;  3G6E V;  1K8A W;  5DM6 V;  1YJW V;  1NJI W;  3I56 V;  1YJN V;  1KQS U;  3CD6 V;  3CCS V;  4WF9 V;  3CME V;  1VQK V;  1YIT V;  1YIJ V;  3CC7 V;  2OTL V; 
#chains in the Genus database with same CATH topology
 2V7Q G;  3BEH A;  3E8G A;  4G28 B;  2DYS B;  5EC2 C;  4Q20 A;  5JQG B;  1VQL V;  3AG4 B;  4DUY B;  4B3S O;  1KP3 A;  3B8M A;  2Q7E A;  1XHX A;  4X8A A;  2WA4 A;  3SYQ A;  3U11 A;  2OT5 A;  3B40 A;  4UVA A;  3CCS V;  5C93 A;  2Z0A A;  1LUV A;  1YVW A;  3JAT A;  1Q7Y W;  3DXR A;  3TCU A;  3G71 V;  2F4V B;  2ADQ B;  4W4L A;  3C3S A;  3L74 H;  4D6T H;  1N8R W;  1NTM H;  2MK3 A;  3FB7 C;  1OCC B;  1YXB A;  3T1C A;  1IVS A;  4H44 B;  1GN3 A;  1NS1 A;  4PHZ A;  4JYA O;  3AG1 C;  1QR9 A;  4K3A A;  3VQV A;  1SKV A;  4JTC B;  5TIS Z;  4TQF A;  2KB1 A;  4B3S B;  1S77 D;  2ZR3 A;  1AIL A;  1SQX H;  4MS2 A;  2LP7 A;  1JJO A;  1SRY A;  4HNA B;  1IBL O;  1PL0 A;  4WFA V;  2XAS A;  4X1I B;  1SA0 B;  3JAL B;  3AG3 C;  3VQX A;  4DR4 O;  1P84 F;  4K0K B;  3L73 H;  1NQT A;  4E4E A;  2WAM A;  3E2E A;  3SJB C;  3RT3 C;  1Q8I A;  4W4K A;  4LF7 O;  5JCO A;  4CH6 A;  1QLE C;  3RYF A;  1XNR B;  1K33 A;  5BR8 B;  3OM3 B;  4DK0 A;  2B1I A;  3ETG A;  4DV0 O;  2JGD B;  4I0X A;  2NNU A;  3ASN C;  3D3Q A;  2ITD C;  2IH1 C;  1F4N A;  4YIP A;  5IY5 B;  1IBL B;  3HKD B;  3VOU A;  1VQ5 V;  1WLE A;  5HFM A;  3CMA V;  2FL4 A;  4QNH B;  2A0L A;  4UCR A;  2RCV A;  3GVM A;  4U7O A;  2XND G;  4JI2 O;  4RWU A;  2KG7 B;  1TUB A;  1M5I A;  2L6L A;  4LWS B;  1JVM A;  4JI4 O;  2AW9 A;  2H3O A;  4JI7 O;  5IE9 A;  1V9P A;  1K4D C;  1R6N A;  4FJC C;  4JI3 O;  5CB4 A;  4I7Z B;  4FPP A;  3CC2 V;  4MTF A;  4DV0 B;  4FMT A;  3TXS A;  1XOU A;  1PM9 A;  4UUJ C;  1TGO A;  4LFC O;  4KUM A;  4PDL A;  3OTF A;  4DR7 B;  5EYP A;  3OW2 U;  2HJF C;  3OR7 C;  5EZY B;  2YDE A;  1GN4 A;  2CAZ C;  1BQZ A;  4DUZ O;  1L0N H;  1XL6 A;  1MZF A;  3CEI A;  5BZB A;  3CXH F;  3OEH G;  1VMG A;  1N36 B;  1WPB A;  5EBM C;  4ASU G;  1N33 O;  3E22 A;  4DV5 B;  3RYI B;  1MOF A;  4DRX A;  1MSD A;  1XMQ O;  5IT9 N;  1GO3 F;  1FYJ A;  4JZG A;  5B5E Z;  4YY3 O;  1US6 A;  4J42 A;  1SER A;  3NR7 A;  2JS5 A;  1OJH A;  2LO1 A;  5FPO A;  1V54 B;  5B1A B;  3JAR B;  4BW9 A;  1WPX A;  2GDS A;  4DR3 O;  2DYS C;  1XHZ A;  4O4I A;  4G2K A;  3C3T A;  5IWA B;  1M90 W;  5B66 Z;  5CMU A;  1KMI Z;  4U3F H;  1CPY A;  5LL6 Y;  5EBL C;  4JI1 B;  2G38 A;  5HFL A;  1PPJ H;  1GKF A;  4LF9 O;  2W0X A;  1R3L C;  2QM8 A;  4G27 B;  1FXV A;  3TET A;  4TQD A;  3BVO A;  1VF6 C;  3IGA C;  5KHH A;  5GON B;  4DV6 B;  4R7C A;  3ML0 A;  3N2G B;  3WFV A;  5EC1 C;  5KHI A;  5H5N A;  1J5E O;  2KSD A;  4DV1 B;  4TWK A;  1N0J A;  1PNL A;  4YXW G;  1WAZ A;  5KHJ A;  2Q68 A;  2Y69 C;  2XAF A;  2IU3 A;  3FB5 C;  1FKA O;  4BAY A;  1IBM O;  2FTK A;  5LHG A;  4X65 O;  2ZIO A;  1XIL A;  2QKS A;  1M9N A;  2DN9 A;  4R6Z A;  3ABK C;  3ZRW A;  4JZ2 A;  4B3T B;  3PN1 A;  5KAI Z;  2QA4 V;  1X59 A;  1SZT A;  4MVQ A;  2JEX A;  1FFX A;  3T1Y B;  2IBZ H;  1N32 B;  4B3M B;  4UVC A;  3CME V;  4PI0 A;  2HVJ C;  3JAK A;  2N05 A;  4N23 A;  4WFF A;  3ICX A;  2KQX A;  1YZB A;  2WSS G;  2PYL A;  3M99 B;  1JFF A;  2RNB A;  3QO5 A;  1QCE A;  2FB5 A;  2XAG A;  4NVP A;  5JJJ B;  3JYC A;  1AR5 A;  1ZTE A;  3O9O A;  3MDS A;  2AZ2 A;  1O9H A;  4X65 B;  4UCU A;  5IYZ A;  4LC1 A;  4NXM O;  4JI6 O;  3OMI B;  4ZI7 A;  4BIO A;  3J7A U;  2GUZ A;  2ZKO A;  1NZ6 A;  2EIJ C;  1NVP B;  4JV5 O;  1XBL A;  3RVY A;  2RMK B;  4FLX A;  2X6A A;  2AXT Z;  2CGO A;  4DV4 O;  1SES A;  1XUQ A;  3K58 A;  2RJZ A;  4NXN O;  1WB7 A;  5LOV B;  3OE7 G;  2N04 A;  2ADP A;  2BTQ A;  1S3J A;  1D5N A;  1QR8 A;  1HNW B;  1AJP A;  4QPJ A;  1NTZ H;  3UQ8 A;  3CPW U;  4WFG A;  1IBK O;  5KAF Z;  1YJ9 V;  5BMV A;  1RP3 B;  1H8E G;  2EUL A;  5EK0 A;  3RBZ A;  1YJW V;  2ZT9 B;  4PJ0 Z;  3AEI A;  3K0G A;  4NTW A;  5JH7 B;  4LFB O;  4L8J A;  3HPL C;  1E79 G;  4X66 O;  2EZO A;  4XBF A;  1P7B A;  5K1X A;  4NKG B;  1XMO O;  4WFB V;  5EIB C;  4JV5 B;  3X2Q B;  4DV7 O;  1XEQ A;  3CCM V;  1HNZ O;  2PZS A;  4JTA B;  4O4J B;  1OV9 A;  2HP8 A;  4CBC A;  3ABM B;  3WG7 C;  2CH7 B;  5EIB D;  4NXN B;  1JX9 A;  1GN6 A;  4LCU C;  3JD4 A;  3M7M X;  2NR5 A;  5JCO C;  2ZCE A;  1Z5V A;  4OX9 O;  4X62 O;  2JK5 C;  3D8C A;  5KMG A;  5L3E A;  1EZJ A;  1N4C A;  4DR1 B;  4IHJ B;  2BOC C;  3K79 A;  2ZE6 A;  3FB6 C;  5B1N A;  5JVD B;  4Q6G A;  2OCH A;  2DE0 X;  1NT2 B;  1NBM G;  1XMO B;  3W7W A;  3RGB A;  2GSM B;  4P2Z A;  4O2A B;  2RDC A;  2QWR B;  2QEX V;  1XQ8 A;  4H33 A;  4NB5 A;  4UB8 Z;  2E74 B;  3KZI Z;  5B1B B;  1HP8 A;  1BL8 A;  4OX9 B;  4X62 B;  4J11 A;  3HKC A;  4I4T A;  3K57 A;  5GTH Z;  3B8N A;  2EIL C;  4J10 A;  5LGT A;  1I5X A;  1PNK A;  2Z3Y A;  3LNM B;  4X89 A;  3FD9 A;  2PY5 A;  2P90 A;  2Q5Z A;  5JQG A;  3JCZ A;  2YC0 A;  4NR1 A;  4UVB A;  2QR4 A;  3EXA A;  3F5T A;  3OMN B;  2BOB C;  1FXH A;  5IDJ A;  1AI4 A;  2ZD9 A;  3K03 A;  1VQ7 V;  3LDD A;  1GM9 A;  1CEZ A;  5IYC O;  4DW0 A;  1TUE B;  1HDJ A;  1JCH A;  1A32 A;  1RM1 B;  4RAI A;  3LNN A;  3F5W C;  2ZQM A;  1KQS U;  3ASO C;  3CRM A;  4JI0 O;  5LXT B;  4BIZ A;  3E89 A;  2NN4 A;  1R3I C;  1MZE A;  1FXK B;  3UCS C;  4HNA A;  4JI5 O;  3DC6 A;  4DUY O;  4X1I A;  5C8Y B;  1SA0 A;  3JAL A;  1QVF U;  2B1G A;  3ZHV A;  3E35 A;  3K59 A;  3BAA A;  3BA8 A;  3OUS A;  1R3K C;  3K0D A;  1VP7 A;  3OD4 A;  4MVM A;  2HJD A;  4A5U B;  2YIA A;  4TOI A;  1BE3 H;  4FLZ A;  1Q43 A;  3JAW B;  2F4V O;  1Q6H A;  4H37 A;  1QBZ A;  1S0V A;  2OCC B;  4ICG A;  2JVD A;  1YIT V;  1PNM A;  3DSQ A;  4GX5 A;  2JGD A;  4J41 A;  3RVZ A;  2AZ0 A;  5CA3 A;  5L3F A;  2ODM A;  2K9P A;  2JJ2 G;  2IH3 C;  2YID A;  1I7F A;  4JI5 B;  1CP9 A;  3HKD A;  3ZRV A;  2YIB A;  2GTS A;  2ZE7 A;  4MVR A;  2Y48 A;  4PA9 A;  3JSL A;  3KG2 A;  3G67 A;  3LSU A;  3L75 H;  3OMA B;  2Y4T A;  3X2Q C;  4Z2W A;  2KG7 A;  2YI8 A;  2UXB B;  3P3P A;  4K0K O;  2Y0P A;  1Q81 W;  2YEV B;  1JR9 A;  1MNG A;  4LNU B;  4LWS A;  4KHP O;  1ZL8 B;  2ZXW C;  3E8B A;  4X64 B;  5LA6 B;  2LGW A;  1JA8 A;  2ILM A;  1SQG A;  2NLJ C;  2QSA A;  1AR1 B;  1XNR O;  1RPO A;  4J7Z A;  5BR8 O;  5CBH A;  1SF9 A;  3CYO A;  2V1D A;  3ZN0 A;  4GX0 A;  2JGU A;  3FX7 A;  3QG5 A;  4NTY A;  3J80 N;  2EZP A;  2EJR A;  1I0H A;  4UCV A;  5EZY A;  1OCZ B;  3SPJ A;  4MVZ A;  2XUM A;  1NR1 A;  2W0F C;  3Q4H B;  2DQ0 A;  2LFR A;  3P32 A;  4UV8 A;  4XDL A;  1Y76 B;  3ZBH A;  3T2M A;  2XAQ A;  2D2C B;  1BHB A;  1M57 C;  5FLX N;  5LYJ B;  1UFI A;  5L3B A;  3RYI A;  1N0N A;  3W7X A;  4KHP B;  4FK5 C;  2D3O W;  1AI5 A;  1EBO A;  3G6B A;  4LBE C;  3DTU B;  4ZOL B;  1AR4 A;  1M56 B;  4CS2 A;  3ABT A;  5KA5 A;  1H2M A;  1EN6 A;  3SJA C;  3WB2 A;  3JAR A;  2DW4 A;  2HHH B;  2Q6A A;  1DK1 A;  1BSM A;  3KCX A;  4DR7 O;  3T4Z A;  3ZMU A;  2XAH A;  1L1F A;  1RSO B;  2X6B A;  1E1R G;  1VQ6 V;  1S5J A;  2VS0 A;  4CZZ A;  1D2D A;  3JD1 A;  4R8C A;  3G6E V;  3SJC C;  3QVN A;  4TUY B;  1N36 O;  2P7T C;  4WBN B;  2QTO A;  2DYR B;  4DV5 O;  1K7D A;  4PEL A;  2LW7 A;  4O4L B;  2L35 A;  2BTO A;  3SJQ C;  4LF5 B;  1K97 A;  4FFK A;  5GON A;  4CS3 A;  4FM1 A;  5LMU B;  3E86 A;  3N2G A;  2N74 A;  3R65 A;  2XAJ A;  2ETN A;  4MVO A;  2WA3 A;  4DR2 O;  3WB0 A;  4QE7 A;  3CX5 F;  1OCR B;  2CUG A;  1YIJ V;  2EX3 A;  3D3I A;  2GHY A;  2QJ1 A;  5IWA O;  1OCO C;  4IL6 Z;  4F6E A;  3ABL C;  4X20 B;  4JI1 O;  2QGN A;  1BCC H;  1JPX A;  4HAM A;  3TXQ A;  4OGQ B;  2CTP A;  2FKX A;  3TJT A;  1XNQ O;  1JOY A;  3CRA A;  1BT8 A;  3ZRS A;  4WFE A;  5JJN B;  2UUA O;  3H9V A;  3O65 A;  2EIM B;  4EKW A;  1MG1 A;  1VQ8 V;  4DV6 O;  1S76 D;  4U3J B;  5GW7 A;  5EBW C;  2JJ1 G;  4DR2 B;  4J80 A;  3CB2 A;  3HKB B;  4DV1 O;  2EIK C;  5LMN B;  2ZR2 A;  4IYH A;  4LH7 A;  4WF9 V;  5B1O A;  1DGS A;  3CHX A;  1BMF G;  3AG4 C;  3OTO O;  2VRZ A;  1W2B U;  3NXS A;  2Q73 A;  2P22 C;  2HG5 C;  1GM8 A;  3H1I H;  2YIC A;  1JMK C;  2Q0A A;  4B3T O;  3CRQ A;  1XNQ B;  3EFF K;  3JAM N;  4LF8 O;  3K3W A;  1BGY H;  2Q0O C;  1V55 B;  1HNX B;  2UUA B;  3K5N A;  4H0L B;  3BHP A;  3T1Y O;  5J2U B;  1NH2 B;  3T4D A;  4FLV A;  5LP6 B;  1N32 O;  4B3M O;  1ZAU A;  3AG2 B;  4X1Y B;  3ZMV A;  1LR1 A;  4WFH A;  1OCC C;  5LOV A;  1M93 A;  4X9Q A;  1S5H C;  3ABU A;  5B3S B;  3AG7 A;  4TT3 G;  3OEE G;  4PA7 A;  3RYH B;  1Z5W A;  4EB6 B;  5D5Q A;  5H9C A;  1DF5 A;  5IJ0 B;  3OTO B;  1Q3E A;  4ZKI A;  1VQK V;  5KUM A;  4OPH A;  2E3C A;  4JAV A;  5JH7 A;  5KA6 A;  4AQY B;  1Q82 W;  1Y66 A;  4JAA A;  1KEC A;  1GTO A;  5E1A C;  2ZIN A;  4I50 B;  5FNV B;  4LF8 B;  5J9P C;  3SPH A;  3CE2 A;  4J7J A;  4O4J A;  5H6R A;  4R50 A;  3OT7 A;  1F23 A;  2LGQ A;  4JGS A;  2CH7 A;  1W0J G;  3ZN1 A;  2R70 A;  2QWQ B;  3ZCC A;  3HKE B;  2PUS A;  3FAV B;  2HVK C;  4LP8 A;  4X1K B;  2QM4 A;  2ZIM A;  2WLL B;  5CA0 B;  3U10 A;  5LGN A;  5L3G A;  1GH6 A;  1M56 C;  3KKY A;  1Y74 B;  1B3Q A;  5LGU A;  2QWN B;  1NTK H;  1HNW O;  1H2K A;  1B06 A;  4IHJ A;  4DK1 A;  4PI2 A;  4TV9 B;  3ZJZ A;  2IM9 A;  5JVD A;  1WN7 A;  5IY5 C;  1EZV H;  2CDY A;  4FIP C;  4QPK A;  1K92 A;  4O2A A;  1T5E A;  1YHQ V;  5L3D A;  2ZDI A;  4U7N A;  2M6Y A;  3ZHS A;  2YIB D;  1H2N A;  1YTF D;  2EIN B;  4CC5 A;  2DQ3 A;  5LHI A;  3IC9 A;  5GTI Z;  2X0L A;  3UKM A;  1H8H G;  1VQP V;  3R66 A;  3BFR A;  1O9G A;  4WCE V;  2Q69 A;  3CCV V;  1EN5 A;  4DR1 O;  3APO A;  4LF4 B;  3VQY A;  3JD2 A;  2OWO A;  5FPR A;  2B5U A;  5BY1 A;  4I5S A;  1KU9 A;  3G80 A;  1VQM V;  3RYC B;  2FML A;  2A79 B;  1IDS A;  4FLY A;  1GAX A;  4BWA A;  1IZ3 A;  3I5D A;  1E1Q G;  4I55 B;  1ZX3 A;  1K5S A;  2P6J A;  1VQ9 V;  4N21 A;  4DW1 A;  1YDX A;  3STZ C;  1QU7 A;  2QTS A;  2H94 A;  4MTO A;  1B6Q A;  4UCS A;  2OYQ A;  5LXT A;  2ZM6 B;  4DV3 B;  2R9A A;  4JI8 O;  1V54 C;  4DR5 B;  4CH5 A;  1FAF A;  5B1A C;  3SDL A;  1FXK A;  3FB8 C;  3SPG A;  3F7V C;  1YSC A;  2ZE8 A;  3L72 H;  1I94 O;  4F6R B;  2Z5U A;  3CJH B;  3ZED A;  3CCL V;  1VQO V;  2IU0 A;  3QO8 A;  5C8Y A;  2CTW A;  3GWO A;  3AG1 B;  2AHY A;  3ZX6 A;  2LJ2 A;  1VIB A;  2X6C A;  3CCJ V;  4B7E A;  1DF4 A;  4GUN A;  5J2T B;  3LDC A;  3ZHU A;  4YJ2 B;  1WNS A;  2IJJ A;  2Q7G A;  4DV2 B;  3QNE A;  1HWY A;  4YHH O;  3CCU V;  1S72 V;  1R6T A;  3ETQ A;  4AHC A;  2VWJ A;  1JQ0 A;  3JAW A;  1MSW D;  2UUB B;  5KX5 B;  1YF2 A;  1TAE A;  3ZIA G;  1Y4M A;  2E76 B;  1YEW A;  4X88 A;  4JI8 B;  5JWP A;  1S5L Z;  1I94 B;  4EFE A;  1WP8 A;  3SYP A;  3OFN G;  4UV9 A;  4DYL A;  2CK3 G;  3N2K B;  3UT5 B;  3JD3 A;  3FYE B;  2E5L B;  1WB8 A;  1QLE B;  2UXX A;  2BCC H;  4B3R B;  4KXR A;  3BAB A;  3ASN B;  1HR0 B;  5CA1 B;  1R3J C;  4YHH B;  2YEV A;  1Q90 D;  3JSN A;  4LNU A;  4PA4 A;  3U0Z A;  2PYJ A;  2RN9 A;  1TVK B;  1GMG A;  3APQ A;  2XOK G;  1GK9 A;  1WA8 B;  1ZL8 A;  5DM6 V;  5LA6 A;  3CD6 V;  4HZ3 A;  1F7Y A;  2FYU H;  1SS3 A;  5H6Q A;  2UXC B;  1U97 A;  5IJ9 B;  4LF6 O;  4GYC B;  2IJK A;  4K8X A;  1SQV H;  1VQN V;  5DED A;  1CXZ B;  3SR2 C;  1FS0 G;  3Q4H A;  4JAS A;  1AJQ A;  1YJN V;  3OAA G;  1Y76 A;  3BY6 A;  4AI8 A;  2DWE C;  4HYO A;  1IXM A;  4OXS A;  4P9P A;  4PV1 B;  5JJE B;  1U96 A;  5LYJ A;  3UO3 A;  4H13 B;  2UXB O;  4YJ3 B;  1VEW A;  2W6J G;  3FKS G;  4JYY A;  3K5L A;  1N34 O;  2DOS A;  4KL1 A;  5L3C A;  2BE3 A;  2WLJ A;  2HEP A;  3D36 A;  4ZOL A;  2BSK B;  1NVP D;  1EN4 A;  1NJI W;  4LFA O;  4X64 O;  4QGP A;  1NU1 H;  5ITZ B;  2LW1 A;  2Q9L A;  4D7S A;  1Q6U A;  1PV0 A;  4MW8 A;  2P4K A;  1D5A A;  1QHT A;  3LDE A;  3W7S A;  2M7W A;  1BQ0 A;  4LF6 B;  4UCT A;  2YUA A;  2WLN A;  2Q8V A;  1J95 A;  4PA3 A;  3ZMT A;  4GKK O;  2Y4U A;  3ETE A;  2VWK A;  1RSO A;  4PDM A;  2ATK C;  3B4S A;  4Z1M G;  3ETD A;  1WJZ A;  3BRC A;  3K04 A;  3QTC A;  3ZMS A;  1R1B A;  2DWD C;  1BS3 A;  4TUY A;  4BW5 A;  2AGA A;  1MMM A;  4FLT A;  2Q67 A;  1N34 B;  4WBN A;  4O4L A;  1P7G A;  4MVU A;  3ABM C;  4IIJ B;  3CWB H;  2UUC O;  5DN6 G;  3HB3 B;  5DEC A;  1DTO A;  3JAS B;  4LFA B;  3ZMZ A;  4BR6 A;  1NKD A;  3I56 V;  5E79 Z;  1ZUQ A;  1IXB A;  3CC7 V;  2CGN A;  1MA1 A;  4GKJ B;  4TV8 B;  2HHH O;  4FFB B;  1W0K G;  5FL7 G;  3SPC A;  4GKK B;  3CCR V;  1SQF A;  1G6U A;  2YS8 A;  1NR7 A;  4X20 A;  3VQW A;  2QKA A;  3N27 A;  3E8F A;  4O4H B;  3SGI A;  2Y69 B;  3K08 A;  4UFZ A;  1HW7 A;  2ZDI C;  1SET A;  4L87 A;  2E75 B;  4J9Y B;  1Y6X A;  3L9D A;  2UUC B;  5CBG A;  4HBN A;  4O2B B;  1L0L H;  5B1B C;  2UXD O;  3FFQ A;  3ABK B;  2HLD G;  4LF5 O;  1KUQ A;  1THZ A;  4ABM A;  4U3J A;  5LMU O;  3WB1 A;  2JEU A;  1ORQ C;  3CRR A;  3GWK C;  4DR6 O;  2JS3 A;  3HKB A;  2WLI B;  1URF A;  3K9A A;  4CH3 A;  3BPZ A;  2VQF O;  1GM7 A;  5CBF A;  2LFS A;  3A0R A;  4B7K A;  3RW0 A;  4MTG A;  4JYA B;  1OZ0 A;  2QWO B;  1YI2 V;  3CRC A;  1MAB G;  4YIO A;  1VF5 B;  4UCO A;  2UXD B;  3H01 A;  5J2U A;  1Q6I A;  3OUF A;  5LP6 A;  1RM1 C;  2QDO A;  4EEQ A;  5F2V O;  4DR4 B;  1SC5 B;  3C90 A;  1YTF B;  4X1Y A;  4DR6 B;  2EIJ B;  2PF4 E;  1IUR A;  2CTQ A;  1K8A W;  3RYH A;  3HR0 A;  3JAT B;  2VQF B;  4EB6 A;  3DXR B;  5IJ0 A;  3J81 N;  1FXK C;  1SQQ H;  5LMN O;  4LF7 B;  2OTJ V;  1XDC A;  4NTX A;  2MW2 B;  2P4V A;  4D7T A;  1SQB H;  4I50 A;  4EFB A;  3M8A A;  5FNV A;  4OPA A;  3LSQ A;  3GB7 C;  4I9W A;  4MTX A;  3RWR D;  2R9I A;  1PKX A;  2UXN A;  3B09 A;  3AK3 A;  2VQE O;  2A3Q A;  2F23 A;  2F43 G;  1WP7 A;  1HNX O;  3MHS C;  1M1K W;  4MSW C;  3ZHT A;  2W6I G;  2PI4 A;  3HKE A;  4PDR A;  3FAV A;  4X1K A;  1QVG U;  4JI2 B;  3H1J H;  2WLL A;  5CA0 A;  2OCC C;  4GX1 A;  4RQF A;  1Y74 A;  2Q7H A;  4MVS A;  4QIW F;  5H2F Z;  3CS5 A;  5KLV H;  2QKC A;  4NYK A;  2JDI G;  4JI4 B;  3WG7 B;  4JTD B;  4TV9 A;  4JI7 B;  4JI3 B;  4I9Q A;  2OIG A;  1FD9 A;  1B04 A;  1KD1 W;  2ZE5 A;  3PJS K;  3CSX A;  5BXZ A;  3RYF B;  1YCI A;  4LR3 A;  3ZHQ A;  2WPD G;  4AQY O;  4LFC B;  1K73 W;  3IAY A;  1G8M A;  4I0X B;  2VQE B;  1G4Y B;  1X4T A;  2R72 A;  4J9Z B;  2WLM A;  4K35 A;  4DUZ B;  1H2L A;  3QO7 A;  3K9S A;  3CC4 V;  1UPG A;  1N33 B;  1I5Y A;  1Y67 A;  5A2Q N;  3DGE A;  2PI5 A;  2DJV A;  2HKO A;  5K1P A;  4GZR B;  5LHH A;  1TUB B;  3OR6 C;  2WWW A;  3SYC A;  3G4S V;  1XMQ B;  3RN4 A;  1AB3 A;  3QF7 A;  1ZWI C;  4YY3 B;  3A0H Z;  1NI8 A;  1OCZ C;  3H1L H;  1H2G A;  4JYB A;  5IYB O;  3WU2 Z;  5CB4 B;  2YXH A;  1FJG O;  2YSU B;  3F7Y C;  4FLW A;  2EIL B;  3RYC A;  2DMX A;  3ZRX A;  1K5Q A;  4DR3 B;  5IYD O;  2CE4 A;  4JAU A;  1BZK A;  3T1H O;  2A06 H;  4I55 A;  5EYP B;  4BIU A;  2GTA A;  2IJH A;  2PGG A;  4KFM A;  4ZBM A;  3STL C;  4ZHQ A;  3ZHR A;  1JJ2 U;  1F4M A;  3D36 C;  2JIZ G;  1Q86 W;  1AI7 A;  4LF9 B;  2IJI A;  1PL4 A;  1ROP A;  2QM7 A;  3IC7 A;  4GCZ A;  3E22 B;  4FM0 A;  4CH4 A;  4DRX B;  4F6R A;  3CJH A;  3MHH C;  3CP1 A;  1DLB A;  1FJG B;  1J5E B;  2YI9 A;  3KCY A;  4FZ0 A;  4LF4 O;  2GV9 A;  2O57 A;  3ASO B;  3UM7 A;  3BA9 A;  2F93 B;  4UB6 Z;  1LNQ A;  4UXN A;  5J2T A;  3T1H B;  4GT1 A;  3VBB A;  4YJ2 A;  1IBM B;  1P4R A;  3DC5 A;  5KHG A;  1ENV A;  4O4I B;  3A2F A;  3H1H H;  2DYR C;  1K34 A;  2IW5 A;  4DO2 A;  5KX5 A;  2A9H A;  4IYI A;  1K4C C;  4DXW A;  2XT9 A;  2WLK A;  4LH6 A;  3IJ4 A;  4MT8 A;  2YXY A;  2ZM6 O;  3L70 H;  4DV3 O;  1OCR C;  4QE9 A;  3BCC H;  4DR5 O;  3I55 V;  1AVM A;  1LUW A;  2P5O A;  1PD3 A;  1L8D A;  2OIE A;  3N2K A;  3UT5 A;  1H38 A;  3K06 A;  4AIL C;  2QWP B;  3OGC C;  1Z2G A;  3CCQ V;  3A8T A;  5AG2 A;  2KKW A;  5CA1 A;  1ZSP A;  3ZS8 C;  5A9G A;  2A7W A;  3UO2 A;  2X7R B;  4NXM B;  1W59 A;  4XDJ A;  4JI6 B;  1AJN A;  1TVK A;  4DV2 O;  4ZHQ B;  1GRJ A;  1WA8 A;  2H8P C;  2C2A A;  2EIM C;  4P9O A;  2ZNI A;  3ZRW B;  1P49 A;  2UUB O;  3P30 A;  2ITC C;  2P67 A;  4DV4 B;  1FFX B;  5IJ9 A;  4RUE A;  3E8H A;  4PA6 A;  1KBH A;  2ZXW B;  2EJ7 A;  2R9R B;  3JAK B;  3H1K H;  3EHB B;  2CTR A;  2E5L O;  3IFX A;  1VF7 A;  1JFF B;  2YXL A;  4B08 A;  1RFY A;  1IBK B;  4B3R O;  1F51 A;  2XTA A;  3JD0 A;  3CCE V;  5LBQ A;  1HR0 O;  1G1X B;  4YJ3 A;  4F4L A;  4J7K A;  4Z1V A;  4LFB B;  3THO A;  5IYZ B;  1V55 C;  3MD0 A;  4X66 B;  3AG3 B;  1TA8 A;  3W7T A;  5LP6 C;  4ZI7 B;  3AK2 A;  2BSK A;  4MW3 A;  4DV7 B;  3AG2 C;  1HNZ B;  3RFR A;  3P3N A;  5ITZ A;  2GUZ B;  4CC6 A;  1M57 B;  5D5P A;  5CN0 A;  5B3S C;  1OHH G;  3SYO A;  1K9M W;  1NH2 D;  1R73 A;  4JYC A;  1I08 A;  2V4D A;  2RQ6 A;  2UXC O;  4JPR A;  4K8Z A;  3E83 A;  1VQ4 V;  1R6K A;  1KKC A;  4PDV A;  4KP4 A;  2BTQ B;  1VAR A;  3W7U A;  4XDK A;  2F66 C;  1KB9 F;  3B77 A;  1XL4 A;  2QE7 G;  3LUT B;  4C7U A;  2XHB A;  3B2E E;  3SYA A;  2LQT A;  4GX2 A;  5BMV B;  4PD4 F;  4GLX A;  1KP2 A;  3AK1 A;  2JRI A;  4FM2 A;  1PP9 H;  4IIJ A;  3JCU Z;  3LSS A;  1GN2 A;  3JAS A;  2WLH A;  3EVK A;  1FFT B;  4RUF A;  1SQP H;  1KC8 W;  4RO2 A;  2EBO A;  2PTM A;  1XRE A;  3TGU H;  2HFE C;  1M4U A;  3L71 H;  3S3X A;  4RQE A;  4TV8 A;  4P30 A;  1VF6 A;  1RPR A;  1FPO A;  4FFB A;  1QLN A;  1QQC A;  4FLU A;  2Y0I A;  3K5O A;  1AP5 A;  2UU9 O;  4IGG A;  5KHK A;  1KKD A;  2ZNJ A;  2Q4P A;  4IT5 A;  1SZX A;  2F95 B;  3MAQ A;  1XI1 A;  1BHA A;  1EFR G;  2OTL V;  2F1M A;  5KMG B;  4O4H A;  1EM1 A;  1AI6 A;  2GBO A;  1IX9 A;  3SPI A;  5KUK A;  3CXC U;  1OCO B;  3K5M A;  4TSF G;  4O2B A;  2EIN C;  3ABL B;  3FYI B;  3S3W A;  4E2L A;  4FZ1 A;  4QJF B;  4JF3 A;  4ZIB A;  2B9Z A;  4CS4 A;  2P06 A;  2WLI A;  1AP6 A;  1QNM A;  1COW G;  2ARH A;  1H2S B;  4FVM A;  2UU9 B;  4GKJ O;  3OGI B;  2K1E A;  3TK1 A;  4JI0 B;  3HKC B;  4I4T B;  1KYO F;  1Q5O A;  2AHZ A;  1ARO P;  1UJW B;  3A0B Z;  1ZLZ A;  2HR3 A;  1K3E A;  2EIK B; 
#chains in the Genus database with same CATH homology
 1FXK C;  2V7Q G;  2GSM B;  3BEH A;  4P2Z A;  3E8G A;  4G28 B;  3ZCC A;  2DYS B;  5EC2 C;  2QEX V;  4H33 A;  4LP8 A;  2HVK C;  4Q20 A;  2OTJ V;  2WLL B;  1VQL V;  3AG4 B;  5LGN A;  5L3G A;  1M56 C;  1KP3 A;  5LGU A;  3B8M A;  5B1B B;  4X8A A;  3SYQ A;  3LSQ A;  3ZJZ A;  2OT5 A;  1BL8 A;  3GB7 C;  4UVA A;  4I9W A;  4MTX A;  3CCS V;  5C93 A;  5IY5 C;  2R9I A;  1PKX A;  2UXN A;  1Q7Y W;  4FIP C;  4QPK A;  3TCU A;  2F43 G;  3B8N A;  2EIL C;  5LGT A;  1I5X A;  1K92 A;  3MHS C;  1M1K W;  1PNK A;  4MSW C;  2PI4 A;  2W6I G;  3G71 V;  2Z3Y A;  3LNM B;  4X89 A;  1YHQ V;  5L3D A;  2ZDI A;  2P90 A;  4PDR A;  4U7N A;  1QVG U;  3JCZ A;  2WLL A;  1N8R W;  2OCC C;  2MK3 A;  3FB7 C;  4UVB A;  4GX1 A;  1OCC B;  4RQF A;  4MVS A;  4QIW F;  3T1C A;  3OMN B;  2BOB C;  1FXH A;  3AG1 C;  1QR9 A;  1YTF D;  2EIN B;  2JDI G;  5IDJ A;  3WG7 B;  1AI4 A;  4JTC B;  4JTD B;  2ZD9 A;  3K03 A;  2DQ3 A;  1VQ7 V;  5LHI A;  3LDD A;  2KB1 A;  1S77 D;  2ZR3 A;  4MS2 A;  2LP7 A;  1KD1 W;  2X0L A;  1GM9 A;  1SRY A;  3UKM A;  1CEZ A;  1H8H G;  3PJS K;  1VQP V;  5IYC O;  1PL0 A;  1TUE B;  4WFA V;  1JCH A;  2XAS A;  2WPD G;  1RM1 B;  3AG3 C;  4RAI A;  1K73 W;  4WCE V;  2Q69 A;  1G8M A;  3CCV V;  3F5W C;  2ZQM A;  1NQT A;  1G4Y B;  1KQS U;  3ASO C;  3JD2 A;  2WAM A;  2B5U A;  4J9Z B;  3E2E A;  2WLM A;  4BIZ A;  3E89 A;  4I5S A;  1R3I C;  3QO7 A;  1VQM V;  1FXK B;  2A79 B;  3CC4 V;  1I5Y A;  1QLE C;  3DGE A;  1E1Q G;  1K33 A;  2PI5 A;  2HKO A;  1K5S A;  2P6J A;  3OM3 B;  1VQ9 V;  1QVF U;  4N21 A;  3OR6 C;  5LHH A;  2B1I A;  2WWW A;  2B1G A;  3ETG A;  3SYC A;  3G4S V;  3STZ C;  1ZWI C;  2NNU A;  3ASN C;  2ITD C;  2H94 A;  2IH1 C;  1F4N A;  3E35 A;  4MTO A;  1OCZ C;  1B6Q A;  5IY5 B;  3OUS A;  1H2G A;  1R3K C;  3K0D A;  4JYB A;  5IYB O;  3VOU A;  4MVM A;  1VQ5 V;  2YSU B;  3F7Y C;  1WLE A;  5HFM A;  1V54 C;  2EIL B;  3CMA V;  5B1A C;  1FXK A;  3ZRX A;  1K5Q A;  4QNH B;  3FB8 C;  3SPG A;  2A0L A;  1YSC A;  3F7V C;  5IYD O;  2Z5U A;  4H37 A;  4JAU A;  1QBZ A;  4U7O A;  2XND G;  2OCC B;  3CCL V;  1S0V A;  1VQO V;  2IU0 A;  3QO8 A;  4BIU A;  1YIT V;  1PNM A;  2IJH A;  4KFM A;  4ZBM A;  3STL C;  3GWO A;  4GX5 A;  3AG1 B;  2AHY A;  3RVZ A;  2X6C A;  5CA3 A;  3CCJ V;  1JVM A;  5L3F A;  1JJ2 U;  1DF4 A;  2JJ2 G;  1F4M A;  2IH3 C;  3LDC A;  2JIZ G;  1Q86 W;  1AI7 A;  2IJI A;  1CP9 A;  1K4D C;  1R6N A;  4FJC C;  2IJJ A;  3ZRV A;  1ROP A;  4FPP A;  3CC2 V;  4MVR A;  4MTF A;  2QM7 A;  3IC7 A;  4GCZ A;  4FMT A;  3QNE A;  1HWY A;  2Y48 A;  4PA9 A;  3CCU V;  1S72 V;  3KG2 A;  1JQ0 A;  4UUJ C;  3MHH C;  1MSW D;  4KUM A;  3OMA B;  4PDL A;  3CP1 A;  1DLB A;  3X2Q C;  3ZIA G;  3OW2 U;  1Y4M A;  2HJF C;  4X88 A;  3OR7 C;  3ASO B;  3UM7 A;  1Q81 W;  2YEV B;  1LNQ A;  3OFN G;  3SYP A;  4UXN A;  4UV9 A;  4GT1 A;  1XL6 A;  2ZXW C;  3VBB A;  5BZB A;  2CK3 G;  3E8B A;  3OEH G;  1P4R A;  1ENV A;  2NLJ C;  5EBM C;  4ASU G;  3JD3 A;  3FYE B;  1QLE B;  2DYR C;  2UXX A;  1K34 A;  1AR1 B;  1MOF A;  1RPO A;  2IW5 A;  4DO2 A;  5CBH A;  3CYO A;  1GO3 F;  2V1D A;  2A9H A;  1K4C C;  3ZN0 A;  3ASN B;  4GX0 A;  4DXW A;  2EZP A;  2EJR A;  1R3J C;  1OCZ B;  3SPJ A;  4MVZ A;  2WLK A;  2YEV A;  1SER A;  1NR1 A;  4MT8 A;  2W0F C;  2DQ0 A;  4PA4 A;  2LFR A;  1GMG A;  3P32 A;  1V54 B;  1OCR C;  4UV8 A;  2XOK G;  1K3E A;  4QE9 A;  5B1A B;  4XDL A;  1GK9 A;  3I55 V;  1WPX A;  1PD3 A;  3T2M A;  2XAQ A;  5DM6 V;  1BHB A;  2DYS C;  3CD6 V;  4HZ3 A;  4G2K A;  1H38 A;  1M57 C;  3K06 A;  5L3B A;  1M90 W;  3OGC C;  3W7X A;  5CMU A;  4FK5 C;  2D3O W;  5H6Q A;  1CPY A;  3CCQ V;  5EBL C;  1AI5 A;  1EBO A;  4LBE C;  2IJK A;  3DTU B;  5HFL A;  1VQN V;  2X7R B;  1GKF A;  4XDJ A;  1M56 B;  1FS0 G;  4JAS A;  1AJN A;  3ABT A;  5KA5 A;  1R3L C;  1AJQ A;  2QM8 A;  4G27 B;  1FXV A;  1YJN V;  3OAA G;  2H8P C;  2DW4 A;  3TET A;  3BY6 A;  3IGA C;  2C2A A;  2EIM C;  2DWE C;  2Q6A A;  4P9O A;  4HYO A;  1IXM A;  4OXS A;  4P9P A;  3ZRW B;  3P30 A;  4R7C A;  3ML0 A;  3WFV A;  2ITC C;  5EC1 C;  3T4Z A;  3ZMU A;  2P67 A;  2XAH A;  4TWK A;  2W6J G;  1L1F A;  3FKS G;  1PNL A;  2X6B A;  1E1R G;  1VQ6 V;  4YXW G;  4CZZ A;  4RUE A;  2Q68 A;  2Y69 C;  5L3C A;  2WLJ A;  2XAF A;  3JD1 A;  3D36 A;  3E8H A;  2IU3 A;  4PA6 A;  4R8C A;  2ZXW B;  3FB5 C;  3G6E V;  1NVP D;  2R9R B;  1NJI W;  4BAY A;  2FTK A;  5LHG A;  3EHB B;  2P7T C;  4MW8 A;  2QTO A;  2DYR B;  3IFX A;  1K7D A;  4PEL A;  3LDE A;  3W7S A;  2QKS A;  2M7W A;  1M9N A;  4R6Z A;  3ABK C;  3SJQ C;  1K97 A;  3ZRW A;  1F51 A;  3JD0 A;  2WLN A;  3CCE V;  5LBQ A;  1J95 A;  2QA4 V;  3E86 A;  4PA3 A;  3ZMT A;  3R65 A;  4F4L A;  2XAJ A;  3ETE A;  1SZT A;  4MVQ A;  2JEX A;  1V55 C;  4MVO A;  4PDM A;  3MD0 A;  2ATK C;  4Z1M G;  4QE7 A;  3AG3 B;  3W7T A;  1OCR B;  4UVC A;  3CME V;  3ETD A;  1YIJ V;  4MW3 A;  3AG2 C;  2HVJ C;  3K04 A;  3ZMS A;  3D3I A;  2GHY A;  4N23 A;  4WFF A;  2DWD C;  4BW5 A;  1M57 B;  2WSS G;  2Q67 A;  5CN0 A;  3M99 B;  5B3S C;  1OHH G;  3SYO A;  1K9M W;  1OCO C;  1NH2 D;  3QO5 A;  4MVU A;  1R73 A;  3ABM C;  3ABL C;  4JYC A;  5DN6 G;  3HB3 B;  1QCE A;  1DTO A;  2XAG A;  3JYC A;  4JPR A;  3ZMZ A;  3E83 A;  1NKD A;  1VQ4 V;  1R6K A;  4PDV A;  1JPX A;  4KP4 A;  4HAM A;  3I56 V;  4LC1 A;  3CC7 V;  1JOY A;  3OMI B;  3W7U A;  4XDK A;  3ZRS A;  4WFE A;  3B77 A;  1XL4 A;  2EIM B;  2QE7 G;  1MG1 A;  1W0K G;  3LUT B;  5FL7 G;  3SPC A;  4EKW A;  3SYA A;  1VQ8 V;  4GX2 A;  2EIJ C;  1S76 D;  1NVP B;  3CCR V;  5GW7 A;  5EBW C;  3RVY A;  2JJ1 G;  1KP2 A;  3LSS A;  2X6A A;  2EIK C;  1NR7 A;  2ZR2 A;  2WLH A;  1SES A;  3E8F A;  2Y69 B;  3K08 A;  4WF9 V;  5B1O A;  2ZDI C;  1SET A;  4L87 A;  1FFT B;  4J9Y B;  4RUF A;  1BMF G;  3AG4 C;  1W2B U;  1KC8 W;  4RO2 A;  3OE7 G;  2EBO A;  3NXS A;  1S3J A;  5CBG A;  1QR8 A;  2HFE C;  4RQE A;  4P30 A;  2HG5 C;  5B1B C;  1AJP A;  4QPJ A;  1RPR A;  3ABK B;  3CPW U;  1QLN A;  2HLD G;  1GM8 A;  4WFG A;  1THZ A;  1YJ9 V;  2JEU A;  1ORQ C;  1H8E G;  5EK0 A;  3EFF K;  3RBZ A;  1YJW V;  1KKD A;  3K0G A;  3AEI A;  3K3W A;  1BHA A;  2WLI B;  1EFR G;  1V55 B;  3K9A A;  2OTL V;  1NH2 B;  3T4D A;  3HPL C;  1E79 G;  2EZO A;  4XBF A;  1P7B A;  1GM7 A;  5CBF A;  4WFB V;  3AG2 B;  1AI6 A;  3X2Q B;  2LFS A;  3A0R A;  3CCM V;  3ZMV A;  4WFH A;  1OCC C;  3SPI A;  1S5H C;  5KUK A;  3RW0 A;  4JTA B;  3ABU A;  4MTG A;  5B3S B;  3CXC U;  4TT3 G;  1OZ0 A;  3OEE G;  1OCO B;  4TSF G;  4CBC A;  4PA7 A;  2EIN C;  3ABM B;  3ABL B;  3WG7 C;  1YI2 V;  3FYI B;  5H9C A;  1DF5 A;  4E2L A;  1JX9 A;  1MAB G;  4LCU C;  4QJF B;  4JF3 A;  4ZKI A;  1VQK V;  3JD4 A;  5KUM A;  2JK5 C;  4JAV A;  2WLI A;  5KA6 A;  3H01 A;  3OUF A;  1Q82 W;  1COW G;  1RM1 C;  1Y66 A;  5L3E A;  1EZJ A;  1KEC A;  1GTO A;  5E1A C;  1YTF B;  2K1E A;  2BOC C;  3K79 A;  3FB6 C;  3TK1 A;  5B1N A;  5J9P C;  3SPH A;  2EIJ B;  5H6R A;  4R50 A;  1K8A W;  2AHZ A;  1F23 A;  1ARO P;  1UJW B;  4JGS A;  1NBM G;  3W7W A;  2HR3 A;  1W0J G;  2EIK B;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...