1YJ9V

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yj9V00
1NJIW 3G71V 3CPWU 1QVGU 5DM6V 3CCRV 1YJNV 1YITV 1N8RW 1S72V 4WFAV 3CMEV 1VQ9V 3CCLV 3CMAV 1K73W 4WCEV 1YHQV 1M90W 3I55V 3I56V 1VQLV 1VQOV 3CC7V 2OTJV 1Q82W 4WF9V 1YIJV 1Q7YW 1KC8W 1Q86W 3CXCU 3CCQV 2D3OW 1VQ6V 1VQPV 1KD1W 2QEXV 3CCEV 1M1KW 2OTLV 1YJWV 1VQ5V 1JJ2U 3CCJV 1VQMV 1QVFU 3G4SV 3CCVV 3CD6V 1K8AW 3CC2V 1KQSU 1W2BU 3CCMV 1YI2V 1VQ4V 1VQ8V 3OW2U 1VQ7V 3CCUV 1Q81W 3CC4V 1R73A 2QA4V 4WFBV 1VQKV 1VQNV 3G6EV 3CCSV 1K9MW 1YJ9V
chains in the Genus database with same CATH superfamily
4RWUA 3ML0A 1VQ9V 4IT5A 3ZRXA 1J95A 3G6BA 1SRYA 3ABKB 5EYPB 1M4UA 1F7YA 2F66C 5KMGB 2UXBB 5JQGB 3M99B 1ZSPA 2BCCH 3JCZA 3KCYA 1OJHA 4LP8A 3MDSA 5B3SB 3SDLA 4JI0B 2ZE7A 1H2GA 3F7VC 3AG4B 4ABMA 4MVMA 4BIUA 1SZTA 1G1XB 4O4JB 4TV9B 1VF7A 4YHHB 3B77A 3FFQA 2KKWA 2YUAA 1ZAUA 3MD0A 3M7MX 3RYFB 5IWAB 3N2KB 3CD6V 2Q67A 3S3WA 4WFHA 1K8AW 5CA0B 1R3LC 1KP3A 5LP6B 1L0NH 1MA1A 4B3MB 3VQWA 4FK5C 1YJ9V 1GN2A 4FPPA 4MW3A 3K9SA 3DXRB 3I55V 2ITCC 4Q20A 1AJNA 5H9CA 1YIJV 3T4ZA 3N2GB 3ZHVA 1AI5A 4PA6A 4ZBMA 2KG7B 2Q73A 3CC2V 4NR1A 4B3RO 1NT2B 1OZ0A 2F4VO 1CXZB 2CGNA 1IBKB 4GYCB 2GUZB 3GWOA 2UUBB 4J9YB 4CBCA 4CS4A 1WN7A 4DV7O 2OCHA 3ETDA 2JJ2G 4FLZA 4JI5O 4J7JA 4E2LA 1QLEB 2HEPA 1PKXA 1ORQC 2Y4UA 2P4KA 3CCRV 1FFXB 4EKWA 1QR8A 5H2FZ 3RGBA 2VWKA 3T1YO 2W6IG 4JYCA 5GTHZ 3ZHTA 3LNMB 3FB6C 1FXKA 2P22C 1VMGA 4Q6GA 3I5DA 4LR3A 3VQYA 3K5NA 1VF6C 1NH2D 1UFIA 3HKCA 1G6UA 4RQEA 4LF7B 3OMIB 4TQFA 4DW1A 4H33A 3K79A 3I56V 1P7BA 4MVZA 2RJZA 2E5LB 5F2VO 4ZI7A 5CBHA 1KP2A 1T5EA 3E89A 3QVNA 2FYUH 1BSMA 2JVDA 4FLWA 2MW2B 1N34B 4DR7O 4OXSA 1TUEB 1LUVA 1PL0A 1R6TA 1RSOA 1ZWIC 2VS0A 1JR9A 5EIBC 2HHHB 1V54C 3Q4HA 2CH7A 3UO2A 4O4IA 5AG2A 1F51A 4X1YA 4A5UB 4LFCO 1DF5A 1XREA 1SERA 3JSNA 4L8JA 2WLJA 4DV3O 3WFVA 3ASNC 1N36O 3CSXA 1UPGA 2H94A 2YI8A 3JSLA 1U97A 1EZVH 4AHCA 2UUCO 5E79Z 3ZRWA 5KUKA 4J80A 1FXKC 1HR0O 2P06A 2YC0A 1FXKB 1VEWA 1QVFU 1SQFA 3LDDA 1S5HC 4HZ3A 1THZA 2XAFA 3CCUV 1MABG 3HKCB 2JIZG 3E83A 2LJ2A 4KHPO 3HPLC 4DV6B 1Y74A 4YJ2A 2DMXA 3B2EE 4JTDB 4N21A 3BA8A 5JJEB 2D3OW 3L70H 5LMNB 1AI7A 1PNKA 4ZI7B 1XNQB 5JJNB 2A9HA 5A2QN 1K4CC 5KHGA 3CWBH 3B4SA 3OAAG 4JI7B 1FS0G 4GX5A 1I5YA 1JX9A 2ZR3A 2JEUA 4R7CA 2P7TC 5LGNA 4DR1O 3OFNG 4RUEA 3SGIA 4FZ1A 2UXCB 2RQ6A 3Q4HB 4FIPC 3ZRSA 1YTFD 2CH7B 5L3EA 4O4IB 3E2EA 2IW5A 4X1YB 3BAAA 4DR4B 1VQ7V 4J42A 1K5SA 2KB1A 2Q68A 4NKGB 4U7NA 3UQ8A 5LHHA 2H3OA 4TOIA 4QPJA 3TGUH 3CMAV 3FYEB 2O57A 1GM9A 1YSCA 4PDRA 4X1IA 1QLNA 5FLXN 4R6ZA 1VQPV 1CP9A 1XILA 3CRCA 3P32A 1R6KA 3K04A 3AK2A 1XL6A 1H8HG 5LYJA 4BAYA 4K8XA 4I5SA 4JI3O 4DO2A 5H5NA 1GH6A 4DRXB 5LGTA 1VIBA 4PDLA 2LW7A 1Y74B 4AQYB 2ZQMA 4X66O 1NTZH 4MSWC 2QM4A 3QO5A 1H2SB 3VOUA 1W0KG 5D5PA 4B3TO 3LNNA 4O2BA 3OM3B 1YI2V 2UXDO 3OE7G 2QDOA 3CC4V 1YITV 2ZM6O 2QTOA 4DUZB 4TUYA 3D36A 3JD4A 2H8PC 4FLVA 3CCQV 3ZX6A 4PDMA 5LL6Y 2DQ0A 3TJTA 1P84F 4JI1O 5KHJA 5ITZA 1ZTEA 4OX9O 4X65O 4YIPA 1AJPA 2WLHA 3CP1A 2YXLA 1BQZA 3QTCA 4X1IB 3AEIA 4NXMB 2BTQB 1P49A 5KHIA 1PNMA 1N0NA 1PV0A 2LP7A 2L6LA 1AR1B 4I4TA 5GW7A 5LYJB 3SPJA 4CC5A 2ZKOA 5D5QA 2RDCA 1RFYA 5KAIZ 5GONA 5LBQA 5CA1B 1GM7A 1KB9F 1VQMV 4YJ3A 2Z0AA 4GX1A 1XMQO 4O2BB 4IIJA 4JI4O 2IH1C 1ENVA 2YIAA 4LH6A 5C93A 1B04A 1XQ8A 5EBLC 1ROPA 5J2TA 4EFBA 4TUYB 1VF5B 1OHHG 4J9ZB 4ZKIA 1HNZB 1MMMA 2L35A 2EINC 3JALB 1BGYH 2EINB 4QNHB 4DK1A 1IBMO 3K0GA 1GM8A 3EXAA 2XT9A 4DUYO 5ITZB 1OCRC 4G27B 2CTWA 2IJKA 3ABTA 4JI6O 3E8GA 2Q6AA 1M57C 1SZXA 3IC9A 2AHYA 3VQVA 5B1BB 2A0LA 5EC2C 1YJWV 1JJ2U 3ZRVA 2QWOB 3L74H 3S3XA 2XAGA 2RNBA 3D3QA 4JTAB 2F23A 5DECA 4I4TB 5CB4B 4ICGA 5FNVB 5LMUO 3RT3C 1GN3A 4GKJB 5GONB 2QGNA 5HFLA 4FLUA 1L1FA 5KAFZ 4KXRA 2K1EA 1KMIZ 3IJ4A 1AI6A 3ABMC 2YI9A 1EFRG 4NTXA 4F6EA 5CMUA 2EULA 5EYPA 3CXCU 2EJRA 4TV8A 3ZMUA 1WAZA 1JQ0A 4EFEA 1NI8A 3HKEA 3ETQA 1BHAA 5B1AC 4NXNO 1JFFA 5B1AB 1HP8A 4N23A 4WBNA 3RYIB 4I55B 1S0VA 3N27A 2ZDIC 1J5EO 1RP3B 1WPBA 3OD4A 1GK9A 3DTUB 1M56B 2PF4E 4RAIA 4JI2O 2ZD9A 2F4VB 2DQ3A 3MAQA 4JI8O 4PA3A 1B06A 4DV7B 2W0FC 3B09A 4JI5B 4EB6A 1XNRO 3OEHG 2HP8A 2GHYA 5BR8O 2RCVA 4LFBO 3OMAB 5LXTA 5IY5C 2GBOA 2LFRA 2FTKA 2HG5C 3AG2B 3F7YC 4CH5A 2QE7G 2Q0OC 4O4LA 2KG7A 4I9WA 3T1YB 1XI1A 2XUMA 3ABLC 1JOYA 4B7KA 3ABLB 1FXVA 2GUZA 5TISZ 4UXNA 3A0RA 2WSSG 4K0KO 2BSKA 4MVSA 5K1XA 1KKDA 1Q3EA 2PYJA 1VQLV 1ZLZA 5B5EZ 2CTPA 3FX7A 1H2MA 4TV8B 4NTYA 1NBMG 2Y69C 3HKEB 1Q81W 1U96A 5DEDA 1JFFB 4AILC 2JGDA 3TCUA 4WBNB 1AB3A 2HR3A 1FFXA 4JYBA 2X6BA 5CN0A 3T1HO 4DR7B 2EILC 2Y0PA 2ARHA 4DR3O 3OMNB 5EBMC 1XMOO 2F43G 1DTOA 4P9PA 3E8BA 5LHGA 4UVCA 3QO8A 4DXWA 3LUTB 1RM1C 1IX9A 1VF6A 4QPKA 4CH4A 2BE3A 3IFXA 2QSAA 4RQFA 4EB6B 4LFCB 4GKKO 1Y6XA 4X8AA 2DJVA 3BABA 3KZIZ 2UU9O 1R6NA 5LXTB 4X88A 1SQPH 4GX2A 1SQGA 4DV3B 2PTMA 2DWDC 2Q69A 3OUSA 2UUAO 3H1LH 5B66Z 5KUMA 2EIMC 4LF8O 1PL4A 4JAUA 1QBZA 4O4LB 3WU2Z 2CTQA 3ZN0A 1VQ4V 2GSMB 3OR7C 2UUCB 1CEZA 1VQKV 1FD9A 2XAJA 5L3FA 1GMGA 2WWWA 3P30A 3AG1C 2OCCC 1DK1A 4XDKA 2BSKB 4FLXA 1BHBA 1R3IC 4KHPB 2ZCEA 1TVKA 3UKMA 5EZYA 1MSDA 4UCVA 3R66A 2JGDB 4K3AA 4YXWG 4DYLA 2B9ZA 3OTOO 2YSUB 3RW0A 3BPZA 3WB2A 2N74A 3FB5C 2JDIG 4FJCC 2FMLA 4I50A 4Z2WA 2ZE8A 4X9QA 4DR1B 1BL8A 5L3BA 2PYLA 2DWEC 1N32O 3RN4A 4UCUA 3EVKA 3K57A 3CE2A 1EN4A 2OWOA 1FPOA 1MSWD 2B1GA 2WLIA 2VRZA 2RN9A 4DV4O 2AXTZ 4WF9V 4PI0A 4HAMA 4DR6O 4YY3O 2EIJC 2EIJB 1K4DC 4J7KA 1PM9A 1TA8A 3OT7A 3JAMN 2A06H 3H1JH 3H9VA 3SPGA 1VQNV 4PA7A 3SJBC 1P7GA 2Q4PA 4JV5O 2WAMA 3SR2C 2CTRA 2Y0IA 3CXHF 2CDYA 2ZXWC 2ZXWB 3CS5A 1V54B 2HJDA 4JI3B 1OV9A 4K8ZA 3SYQA 4C7UA 2WLKA 1R3JC 1TVKB 1VQ6V 5EZYB 1N33O 2DYRC 2DYRB 4QJFB 4UFZA 3B8MA 2R72A 4WFAV 5C8YA 4B3TB 2UXDB 5B1OA 3ASNB 2WPDG 4CC6A 1H38A 5JH7B 4I50B 4MVOA 3FAVA 3ZMTA 1I94O 3MHHC 1KECA 4BW5A 4H44B 1WB8A 2OYQA 3JAKA 4YIOA 2JS3A 3FD9A 3BA9A 3UO3A 1COWG 3PJSK 1S5JA 4JI1B 3LSSA 1I7FA 4G2KA 4DRXA 2WLIB 3STZC 4OX9B 1H2LA 1XHZA 1GKFA 1G8MA 4X65B 1SQVH 3NR7A 4UVBA 1MZFA 5LA6B 1I0HA 1BS3A 4X64O 1YXBA 2ZNIA 4CS3A 1PP9H 3QF7A 3K5MA 3ZN1A 3UCSC 2QKAA 1SF9A 3F5TA 2X6AA 1Q8IA 4LF6O 2Z3YA 4H0LB 3IAYA 2DYSC 3GVMA 1OCCC 1R73A 4UCOA 5DN6G 4XDLA 1ZX3A 5C8YB 1XMQB 4PA9A 4DV2O 4JI4B 4KP4A 2F95B 4FLYA 1F4NA 2BTQA 3GB7C 1OCOC 3FAVB 2ZR2A 2N05A 4G28B 3DSQA 1NS1A 5L3GA 3JAKB 3O9OA 1A32A 1BCCH 4LNUA 3K59A 3G71V 4OPAA 1AP5A 3NXSA 3ZHQA 3TK1A 2QKSA 4DUYB 1HNWO 4CS2A 1L0LH 5CA1A 2GTAA 4LFAO 4GUNA 4JI6B 2B5UA 1FAFA 1Q90D 5IYBO 4O2AA 4JPRA 2B1IA 3P3PA 4PHZA 3ZBHA 4F6RA 3K03A 4HYOA 4IYIA 4JZGA 1AROP 1IZ3A 1NR1A 4UCRA 3E22A 3D3IA 4UB6Z 1NZ6A 1WNSA 3JALA 5LMUB 1GRJA 3WB0A 5JCOC 3SYCA 1D2DA 4PDVA 1I5XA 2M7WA 3L73H 2XAQA 4WFEA 3J7AU 4JF3A 1B3QA 1DLBA 1D5AA 3ZJZA 1NJIW 1FXHA 2YXYA 2PI4A 2EBOA 3K08A 1S77D 1YHQV 5LOVA 1HDJA 1WB7A 1KYOF 4FFBA 3A0BZ 1K3EA 3E8HA 1GO3F 4DV6O 4JAVA 2WA4A 1B6QA 3CCSV 5CB4A 1Q5OA 4LNUB 5E1AC 5LMNO 5FNVA 3CMEV 2ADPA 5IYCO 1AP6A 4NXNB 2JGUA 4FVMA 3D8CA 3B8NA 4JZ2A 2CAZC 3SYPA 3K5OA 4JI7O 3H01A 1J5EB 1Z5WA 4R8CA 4BR6A 3T1CA 3CCEV 3BRCA 5KA5A 2GDSA 4DV1O 4JGSA 4O2AB 4FM1A 4JI2B 1H2KA 1MOFA 4F6RB 4JI8B 4XDJA 2P5OA 2ADQB 1S3JA 1LR1A 3KCXA 1YDXA 1SA0A 4QE9A 3ICXA 4ZOLA 3A0HZ 4ASUG 3E22B 4DR2B 1ZUQA 2OTJV 2QR4A 1Q86W 1K7DA 1R3KC 1XNRB 5BR8B 4AI8A 1Y66A 1IXBA 3FYIB 1M1KW 3PN1A 4JAAA 1EN5A 3CRRA 3ZEDA 5IYDO 3KG2A 3RYIA 4JTCB 4I55A 1F23A 3K0DA 1QU7A 1OCRB 2ZDIA 1JMKC 4TT3G 3U11A 4D7SA 2FB5A 2BTOA 1M90W 4TQDA 2Q5ZA 4DV5O 5LOVB 4FM2A 1M57B 1KD1W 4FFBB 2YEVA 4K0KB 3FB8C 1E1QG 2DN9A 4BIOA 3OW2U 5J9PC 4PI2A 4DK0A 2V1DA 4JYAO 4MVQA 3KKYA 1WP8A 3JYCA 5CBGA 3VBBA 1H8EG 3QG5A 5EK0A 3T1HB 3ETEA 3RVYA 3JD3A 4DR3B 2Q8VA 4LF4O 3W7TA 3CCVV 4PD4F 3W7SA 1QCEA 1WPXA 2QWQB 2QA4V 3CX5F 5J2UA 3P3NA 4GZRB 1FYJA 1K9MW 4MVRA 2QWPB 3ABMB 1AVMA 1SS3A 1K73W 3U0ZA 1SA0B 4ZOLB 1SC5B 1M93A 4LBEC 4W4KA 1QNMA 2CK3G 1X59A 3C90A 4GKKB 3O65A 5JJJB 4LF9O 2W6JG 5EIBD 3RBZA 2AZ2A 2C2AA 2MK3A 1ZL8A 2UU9B 1K5QA 2E75B 1BQ0A 4I7ZB 1YTFB 2QTSA 2UUAB 4R50A 1QVGU 3JATA 4LF8B 4H13B 1CPYA 4B3RB 4RO2A 5IJ0A 4ZHQB 3JARB 4D7TA 3SPHA 2YEVB 2X6CA 1RPRA 1YVWA 1D5NA 1O9HA 2PZSA 3ETGA 4KFMA 1TGOA 2R70A 2P6JA 1IBLO 4B3SO 2X7RB 1VQOV 1Q82W 3K5LA 5IY5B 1P4RA 3SJQC 3OTOB 1M9NA 4BIZA 4I0XA 5LGUA 5IT9N 1YF2A 1Z2GA 1PPJH 2WLLA 2ITDC 2CUGA 2HLDG 1HNZO 4MW8A 5J2UB 3AK1A 4GX0A 1N32B 2ETNA 3AG3C 4O4HA 3W7XA 1BE3H 2VQEO 2XTAA 2EIKC 1SESA 2EIKB 3J80N 3IGAC 3A2FA 3ZMSA 2UXNA 2D2CB 4J7ZA 4DV4B 4QE7A 1ZL8B 2E74B 2G38A 2Y69B 4DR6B 4YY3B 2P4VA 2YIBA 5HFMA 3BCCH 3JATB 3ABKC 2GTSA 5FPRA 2EILB 2IJIA 1FKAO 2XASA 1MG1A 5IJ0B 5JVDA 5IYZA 4IL6Z 4JV5B 5L3CA 1LNQA 4MTFA 3ZMZA 5B3SC 3CRMA 1Y4MA 3T4DA 1EBOA 4GKJO 3ZHRA 4U3FH 2GV9A 2ILMA 1RM1B 1K34A 4MT8A 3AG4C 5L3DA 3K9AA 4NYKA 4X20A 1N33B 4E4EA 1XDCA 1SETA 4X89A 2PY5A 4NB5A 3OGCC 1DF4A 2QEXV 1N36B 5LP6C 3STLC 4I0XB 2ODMA 3BFRA 2EIMB 2IH3C 2WLLB 3WG7C 1KKCA 1WLEA 2HJFC 4J41A 3HR0A 3WG7B 2VQFO 3SYAA 1I94B 3DGEA 2QJ1A 1HR0B 1HNXO 1YCIA 2DOSA 4GLXA 3G80A 2FKXA 5H6QA 4O4HB 2IJJA 2OCCB 3AG1B 2QWNB 4MTOA 2Y4TA 4GCZA 3QNEA 5GTIZ 5H6RA 3EHBB 4PELA 1KQSU 3U10A 3B40A 2AZ0A 1JCHA 1Q6IA 2PI5A 1IURA 2YXHA 2OIEA 4PV1B 4FM0A 4X62O 2M6YA 5JH7A 1AJQA 4X64B 5JVDB 5IYZB 3UT5A 1QLEC 2ZIOA 1VQ5V 3ABUA 1X4TA 3THOA 2EX3A 4UV8A 1KBHA 1L8DA 1Y76A 1FJGO 4DV0O 4NVPA 1NTKH 4LF6B 4LF5O 3SPIA 3JAWA 1PNLA 4DR5O 4X20B 2A7WA 2HVKC 4KL1A 4XBFA 3CC7V 4UCSA 4PJ0Z 1SQXH 3E35A 4DV2B 5LA6A 4OGQB 3L72H 2NR5A 2NLJC 4ZIBA 2UXBO 4W4LA 5KX5A 2Z5UA 4QIWF 3W7UA 2QM8A 4WFFA 2ZNJA 1NQTA 1EZJA 3CYOA 1IVSA 2ZT9B 3H1IH 4JI0O 2OTLV 2ZE5A 1AILA 1HNWB 1W59A 4LFAB 1IDSA 2R9AA 5LHIA 4X66B 4YHHO 4P9OA 2XNDG 3MHSC 1YJNV 2WLMA 3W7WA 4HBNA 1WA8A 2KQXA 5IWAO 1F4MA 4L87A 1R1BA 1QR9A 4B3MO 2QWRB 2DW4A 2XAHA 2ZM6B 2IBZH 3A8TA 3UT5B 1UJWB 1H2NA 4U3JA 1XOUA 1GN6A 4TWKA 4P2ZA 2BOCC 4H37A 3RYHA 4J11A 1Y76B 2XHBA 1WJZA 3JAWB 5IDJA 4BW9A 2CE4A 1NVPB 3C3TA 3CEIA 1W0JG 1IBKO 2UUBO 3CCJV 2V7QG 4B7EA 1V9PA 4NTWA 2JK5C 3JD0A 4DW0A 1DGSA 2E3CA 2JJ1G 2X0LA 3WB1A 5KX5B 1TUBA 3LDCA 3QO7A 3SYOA 2A3QA 4D6TH 4UV9A 2AHZA 3APOA 3K06A 1Y67A 2IU3A 4I9QA 1OCZC 1S76D 1HW7A 1KU9A 3OUFA 5JCOA 1OCZB 4QGPA 2ZE6A 2DYSB 2HFEC 1OCCB 3IC7A 1RSOB 2LGWA 1NTMH 4X1KA 1MNGA 2HKOA 5B1NA 4DV1B 1VP7A 1WA8B 4LWSA 2YICA 3G67A 4IHJA 4RUFA 3M8AA 3L71H 2PGGA 4KUMA 4LF7O 3OEEG 3HKBA 3RFRA 1TAEA 1OCOB 1Q6UA 4U3JB 2QM7A 2WA3A 1S5LZ 1G4YB 4MTXA 1QQCA 3SJCC 3G6EV 3C3SA 2E5LO 2ATKC 4FMTA 3RYHB 1K33A 4OPHA 1EN6A 2YDEA 1IBMB 1N34O 4JYYA 5EC1C 2IU0A 1JA8A 3JD2A 3ZHUA 1Q7YW 2EZOA 4TSFG 3ZRWB 4MTGA 1I08A 1W2BU 4DV5B 2HHHO 1XEQA 3OGIB 2YS8A 2DE0X 3JCUZ 2LFSA 4Z1VA 4UB8Z 5KLVH 4YJ2B 1TUBB 1BT8A 3H1HH 1Q6HA 2Q7GA 3VQXA 3BY6A 4JYAB 3AG7A 1WP7A 5IJ9A 3BVOA 3L9DA 3ZIAG 4J10A 2F93B 5BZBA 4X1KB 3DC5A 2W0XA 4LF4B 2AW9A 5BY1A 1K92A 3K58A 3CRAA 4LWSB 2LO1A 1XL4A 4IHJB 3BHPA 3T2MA 3HKBB 1Q43A 3ZHSA 3CCMV 3UM7A 2R9IA 3HKDA 3L75H 3E8FA 3DC6A 4LF9B 3R65A 3LDEA 3EFFK 3ZS8C 2Y48A 3ZCCA 2JRIA 1XNQO 4K35A 2Q0AA 2NN4A 2Q9LA 1NH2B 4HNAA 5IE9A 3SJAC 2ZINA 2JS5A 1XBLA 2UXCO 1PD3A 1JVMA 3CJHA 4JASA 1GAXA 1BZKA 1RPOA 1E79G 2PUSA 1US6A 5BMVA 1V55C 3TETA 2IM9A 4DR4O 1V55B 4BWAA 2AGAA 3TXQA 3FB7C 3JASA 1BMFG 4WFGA 4LC1A 1IBLB 3JD1A 4LFBB 4B3SB 3AK3A 5IJ9B 2JEXA 2WLNA 3FKSG 3D36C 1N4CA 5JWPA 4U7OA 4IGGA 4UVAA 3ASOC 4ZHQA 2YIBD 1FFTB 3ASOB 3JARA 1Z5VA 5BXZA 2V4DA 1NR7A 2IJHA 4GT1A 4LH7A 2VQEB 3HKDB 4AQYO 1MZEA 5CBFA 2RMKB 2E76B 2KSDA 1E1RG 3F5WC 1JPXA 1HWYA 4WCEV 2NNUA 2Q7HA 4P30A 1K97A 1KC8W 3GWKC 2LW1A 5B1BC 3RWRD 2BOBC 4HNAB 1VARA 1IXMA 3OTFA 4DUZO 2QKCA 2OT5A 3G4SV 3OR6C 1YEWA 4UCTA 1XMOB 1AR5A 3CJHB 3TXSA 1XHXA 3CPWU 5DM6V 3CHXA 2N04A 1KUQA 2XOKG 4EEQA 5BMVB 2P90A 3H1KH 3JASB 4MS2A 4YJ3B 1VQ8V 1NKDA 4IIJB 2ZIMA 3RYCA 1GN4A 1SKVA 2FL4A 4WFBV 2LGQA 4NXMO 1S72V 5J2TB 4MVUA 3CCLV 5EBWC 2K9PA 5KMGA 5JQGA 2VQFB 4Z1MG 1HNXB 3LSQA 3J81N 2CGOA 2F1MA 1AR4A 2P67A 1O9GA 3RVZA 3SPCA 3CRQA 1SQBH 5K1PA 2OIGA 5FPOA 1NU1H 1N8RW 1QHTA 1M56C 2HVJC 5FL7G 5KA6A 4O4JA 2A79B 4TV9A 3X2QC 3X2QB 4IYHA 3LSUA 1URFA 3K3WA 1SQQH 3BEHA 1N0JA 1XUQA 3RYFA 5KHKA 1LUWA 1GTOA 3N2KA 4FZ0A 5KHHA 4X62B 1NVPD 5CA0A 5LP6A 1JJOA 3APQA 5CA3A 3CB2A 4DR2O 2Q7EA 2EJ7A 2EZPA 2UXXA 4FFKA 4UUJC 5A9GA 2LQTA 3DXRA 4LCUC 3HB3B 4B08A 3AG3B 1FJGB 4DV0B 1EM1A 3N2GA 3AG2C 4CZZA 4LF5B 4CH6A 4DR5B 1AI4A 1YZBA 2R9RB 2VWJA 4CH3A 1M5IA 4FLTA 3ZMVA 3E86A 4F4LA 3RYCB 4PA4A 2YIDA
chains in the Genus database with same CATH topology
4G27B 3G71V 3ML0A 2IJKA 3ABTA 3NXSA 3TK1A 1VQ9V 3ZRXA 1J95A 2QKSA 2Z5UA 3E8GA 4QIWF 3W7UA 2QM8A 1SRYA 3ABKB 4WFFA 2Q6AA 1NQTA 1M57C 1EZJA 2AHYA 3CYOA 3M99B 2OTLV 5B1BB 2B5UA 2A0LA 5EC2C 1YJWV 1JJ2U 3ZRVA 5IYBO 3JCZA 4JPRA 2B1IA 2XAGA 4LP8A 5B3SB 3K03A 5LHIA 4JTAB 4HYOA 4P9OA 2XNDG 3MHSC 1AROP 1YJNV 1H2GA 2WLMA 3F7VC 3AG4B 3W7WA 4BIUA 4MVMA 1NR1A 1SZTA 1F4MA 4L87A 3D3IA 1QR9A 2DW4A 2XAHA 3B77A 5HFLA 1L1FA 1UJWB 3MD0A 3SYCA 3CD6V 2Q67A 4TWKA 4WFHA 1K8AW 4P2ZA 4PDVA 1R3LC 1KP3A 2K1EA 2BOCC 1I5XA 2M7WA 2XAQA 4H37A 4FK5C 4WFEA 4JF3A 1AI6A 1DLBA 3ABMC 1YJ9V 1EFRG 3ZJZA 1NJIW 1FXHA 2PI4A 2EBOA 3K08A 4FPPA 4MW3A 1S77D 1YHQV 5IDJA 5CMUA 3I55V 2ITCC 4Q20A 1NVPB 1AJNA 5H9CA 1YIJV 3CXCU 1W0JG 3T4ZA 2EJRA 1K3EA 3ZMUA 1JQ0A 1AI5A 4PA6A 3E8HA 4ZBMA 1GO3F 2V7QG 3CCJV 3CC2V 1BHAA 5B1AC 4JAVA 5B1AB 4N23A 1B6QA 2JK5C 1OZ0A 3JD0A 3CCSV 5E1AC 1S0VA 2ZDIC 3GWOA 3CMEV 4J9YB 5IYCO 4CBCA 1GK9A 2JJ1G 2X0LA 3DTUB 1M56B 3QO7A 3LDCA 3B8NA 4RAIA 3SYOA 2ZD9A 4UV9A 3ETDA 3SYPA 2DQ3A 2JJ2G 2AHZA 3H01A 4R8CA 4E2LA 3T1CA 3CCEV 3K06A 4PA3A 2IU3A 1QLEB 1OCZC 1S76D 3OUFA 5KA5A 1OCZB 1PKXA 4JGSA 1ORQC 1MOFA 2W0FC 2DYSB 2HFEC 1OCCB 3IC7A 4XDJA 1S3JA 2HKOA 3OEHG 5B1NA 2GHYA 3CCRV 4EKWA 1QR8A 4QE9A 3OMAB 2W6IG 4ASUG 2OTJV 4JYCA 5IY5C 4RUFA 2LFRA 1Q86W 1K7DA 1R3KC 2FTKA 1Y66A 3FYIB 3LNMB 3FB6C 4KUMA 1FXKA 1M1KW 2HG5C 3OEEG 3AG2B 3F7YC 2QE7G 1OCOB 2QM7A 4I9WA 1G4YB 4MTXA 1NH2D 5IYDO 3ABLC 1JOYA 3KG2A 4JTCB 3G6EV 3ABLB 1FXVA 1F23A 4RQEA 2ATKC 3K0DA 4FMTA 3OMIB 1OCRB 2ZDIA 4UXNA 3A0RA 4TT3G 2WSSG 1K33A 4H33A 3K79A 4MVSA 1KKDA 5EC1C 1M90W 3I56V 2IU0A 3JD2A 1VQLV 1Q7YW 2EZOA 1P7BA 4MVZA 1M57B 5CBHA 1KD1W 1KP2A 4TSFG 2YEVA 3ZRWB 3E89A 4MTGA 3FB8C 1E1QG 1NBMG 2Y69C 4OXSA 1W2BU 1TUEB 1PL0A 3OW2U 1Q81W 5J9PC 1ZWIC 3TCUA 2HR3A 2V1DA 4JYBA 2X6BA 4MVQA 5CN0A 2LFSA 2EILC 3JYCA 3OMNB 5CBGA 1V54C 5EBMC 3VBBA 1H8EG 2F43G 1DTOA 4P9PA 3E8BA 5LHGA 4UVCA 3BY6A 5EK0A 3QO8A 1F51A 3ETEA 3RVYA 3JD3A 4DXWA 1DF5A 3W7TA 3CCVV 3LUTB 1RM1C 1SERA 3W7SA 1QCEA 1WPXA 4QPKA 2QA4V 3ZIAG 2WLJA 1K9MW 4MVRA 3IFXA 5BZBA 4RQFA 3WFVA 3ABMB 3ASNC 4X8AA 1K73W 1K92A 2H94A 1R6NA 4LBEC 4X88A 2CK3G 4GX2A 1XL4A 2DWDC 3ZRWA 5KUKA 2Q69A 3OUSA 1FXKC 3T2MA 2W6JG 1FXKB 3RBZA 1QVFU 5KUMA 2EIMC 4JAUA 1QBZA 3ZN0A 2C2AA 2MK3A 3UM7A 3CCMV 1VQ4V 2GSMB 1S5HC 2R9IA 1THZA 2XAFA 1K5QA 3LDDA 3OR7C 4HZ3A 3CCUV 3E8FA 1CEZA 1VQKV 1MABG 2XAJA 2JIZG 5L3FA 1YTFB 3E83A 1GMGA 2WWWA 4R50A 3R65A 3LDEA 3EFFK 1QVGU 2Y48A 3ZCCA 3HPLC 3P30A 1CPYA 2OCCC 3AG1C 4XDKA 4RO2A 4JTDB 4N21A 1BHBA 1NH2B 2D3OW 1R3IC 1AI7A 1PNKA 3SPHA 2YEVB 3UKMA 2X6CA 1RPRA 2A9HA 1K4CC 1PD3A 3OAAG 1JVMA 1FS0G 3ETGA 1I5YA 4GX5A 4JASA 1JX9A 4YXWG 2ZR3A 2JEUA 4R7CA 2P7TC 4KFMA 1RPOA 5LGNA 1E79G 2YSUB 3OFNG 3RW0A 2P6JA 3FB5C 2JDIG 4FJCC 1V55C 4RUEA 3TETA 1V55B 2X7RB 1VQOV 3ZRSA 4FIPC 1Q82W 1YTFD 3FB7C 5L3EA 1BMFG 4WFGA 1P4RA 3SJQC 5IY5B 3E2EA 1BL8A 1M9NA 2IW5A 4BIZA 4LC1A 5L3BA 5LGUA 3JD1A 2DWEC 1VQ7V 2WLLA 2ITDC 2JEXA 1K5SA 2HLDG 2KB1A 2Q68A 2WLNA 4U7NA 4MW8A 5LHHA 3FKSG 4GX0A 4QPJA 1MSWD 2B1GA 2WLIA 3FYEB 3CMAV 4U7OA 1GM9A 1YSCA 4PDRA 3AG3C 4UVAA 3W7XA 3ASOC 1QLNA 1FFTB 3ASOB 4WF9V 4HAMA 2EIKC 4R6ZA 1SESA 2EIJC 2EIKB 1VQPV 3IGAC 2EIJB 1CP9A 1K4DC 3P32A 3ZMSA 1NR7A 2IJHA 4GT1A 2UXNA 1R6KA 3K04A 1XL6A 4QE7A 2Y69B 3SPGA 1H8HG 4BAYA 1VQNV 4PA7A 5CBFA 4I5SA 4DO2A 2WAMA 5HFMA 1E1RG 3F5WC 1JPXA 3ABKC 1HWYA 4WCEV 2ZXWC 2EILB 2IJIA 5LGTA 2NNUA 2ZXWB 4PDLA 2XASA 4P30A 1K97A 2ZQMA 1KC8W 1MG1A 1V54B 5B1BC 2BOBC 4MSWC 3SYQA 2WLKA 1IXMA 3QO5A 1LNQA 4MTFA 3ZMZA 1R3JC 3VOUA 1W0KG 5L3CA 5B3SC 2OT5A 3G4SV 1VQ6V 1Y4MA 3T4DA 1EBOA 2DYRC 3OM3B 3OR6C 1YI2V 2DYRB 3OE7G 4QJFB 3CC4V 1RM1B 3B8MA 1YITV 1K34A 2QTOA 4MT8A 3AG4C 3CPWU 5DM6V 5L3DA 3K9AA 4WFAV 3D36A 3JD4A 2XOKG 5B1OA 3ASNB 2WPDG 1SETA 1H38A 4X89A 2H8PC 2P90A 3OGCC 3CCQV 4MVOA 1DF4A 3ZMTA 2QEXV 4MS2A 4PDMA 2DQ0A 3STLC 3MHHC 1KECA 4BW5A 1VQ8V 1NKDA 2EIMB 2IH3C 2WLLB 4WFBV 3WG7C 1WLEA 2HJFC 3WG7B 1COWG 3PJSK 1AJPA 3SYAA 2WLHA 3CP1A 3DGEA 1S72V 4MVUA 3LSSA 3CCLV 4G2KA 5EBWC 2WLIB 3STZC 5H6QA 1GKFA 1G8MA 2IJJA 2OCCB 3AEIA 3AG1B 4MTOA 4GCZA 4Z1MG 3QNEA 5H6RA 3LSQA 3EHBB 4UVBA 1PNMA 4PELA 1KQSU 2LP7A 1AR1B 2P67A 3RVZA 3SPCA 1JCHA 5GW7A 2PI5A 3SPJA 1N8RW 1M56C 2HVJC 5FL7G 5KA6A 3ZN1A 2A79B 3X2QC 1AJQA 3X2QB 5LBQA 1GM7A 3K3WA 1QLEC 2X6AA 3BEHA 1VQ5V 1GTOA 1VQMV 1NVPD 2Z3YA 3ABUA 2DYSC 1OCCC 4GX1A 5CA3A 4UV8A 1R73A 2IH1C 1ENVA 5DN6G 5C93A 4XDLA 5EBLC 1ROPA 2EZPA 2UXXA 3SPIA 4UUJC 1PNLA 4LCUC 4PA9A 3HB3B 2HVKC 4XBFA 1OHHG 4J9ZB 4ZKIA 3CC7V 4KP4A 3AG3B 1F4NA 4CZZA 3AG2C 3GB7C 1OCOC 2EINC 2ZR2A 2EINB 4QNHB 3E35A 1AI4A 2R9RB 4G28B 3K0GA 1GM8A 5L3GA 3ZMVA 2NLJC 3E86A 4F4LA 1OCRC 4PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI W;  3G71 V;  3CPW U;  1QVG U;  5DM6 V;  3CCR V;  1YJN V;  1YIT V;  1N8R W;  1S72 V;  4WFA V;  3CME V;  1VQ9 V;  3CCL V;  3CMA V;  1K73 W;  4WCE V;  1YHQ V;  1M90 W;  3I55 V;  3I56 V;  1VQL V;  1VQO V;  3CC7 V;  2OTJ V;  1Q82 W;  4WF9 V;  1YIJ V;  1Q7Y W;  1KC8 W;  1Q86 W;  3CXC U;  3CCQ V;  2D3O W;  1VQ6 V;  1VQP V;  1KD1 W;  2QEX V;  3CCE V;  1M1K W;  2OTL V;  1YJW V;  1VQ5 V;  1JJ2 U;  3CCJ V;  1VQM V;  1QVF U;  3G4S V;  3CCV V;  3CD6 V;  1K8A W;  3CC2 V;  1KQS U;  1W2B U;  3CCM V;  1YI2 V;  1VQ4 V;  1VQ8 V;  3OW2 U;  1VQ7 V;  3CCU V;  1Q81 W;  3CC4 V;  1R73 A;  2QA4 V;  4WFB V;  1VQK V;  1VQN V;  3G6E V;  3CCS V;  1K9M W;  1YJ9 V; 
#chains in the Genus database with same CATH topology
 4RWU A;  3ML0 A;  1VQ9 V;  4IT5 A;  3ZRX A;  1J95 A;  3G6B A;  1SRY A;  3ABK B;  5EYP B;  1M4U A;  1F7Y A;  2F66 C;  5KMG B;  2UXB B;  5JQG B;  3M99 B;  1ZSP A;  2BCC H;  3JCZ A;  3KCY A;  1OJH A;  4LP8 A;  3MDS A;  5B3S B;  3SDL A;  4JI0 B;  2ZE7 A;  1H2G A;  3F7V C;  3AG4 B;  4ABM A;  4MVM A;  4BIU A;  1SZT A;  1G1X B;  4O4J B;  4TV9 B;  1VF7 A;  4YHH B;  3B77 A;  3FFQ A;  2KKW A;  2YUA A;  1ZAU A;  3MD0 A;  3M7M X;  3RYF B;  5IWA B;  3N2K B;  3CD6 V;  2Q67 A;  3S3W A;  4WFH A;  1K8A W;  5CA0 B;  1R3L C;  1KP3 A;  5LP6 B;  1L0N H;  1MA1 A;  4B3M B;  3VQW A;  4FK5 C;  1YJ9 V;  1GN2 A;  4FPP A;  4MW3 A;  3K9S A;  3DXR B;  3I55 V;  2ITC C;  4Q20 A;  1AJN A;  5H9C A;  1YIJ V;  3T4Z A;  3N2G B;  3ZHV A;  1AI5 A;  4PA6 A;  4ZBM A;  2KG7 B;  2Q73 A;  3CC2 V;  4NR1 A;  4B3R O;  1NT2 B;  1OZ0 A;  2F4V O;  1CXZ B;  2CGN A;  1IBK B;  4GYC B;  2GUZ B;  3GWO A;  2UUB B;  4J9Y B;  4CBC A;  4CS4 A;  1WN7 A;  4DV7 O;  2OCH A;  3ETD A;  2JJ2 G;  4FLZ A;  4JI5 O;  4J7J A;  4E2L A;  1QLE B;  2HEP A;  1PKX A;  1ORQ C;  2Y4U A;  2P4K A;  3CCR V;  1FFX B;  4EKW A;  1QR8 A;  5H2F Z;  3RGB A;  2VWK A;  3T1Y O;  2W6I G;  4JYC A;  5GTH Z;  3ZHT A;  3LNM B;  3FB6 C;  1FXK A;  2P22 C;  1VMG A;  4Q6G A;  3I5D A;  4LR3 A;  3VQY A;  3K5N A;  1VF6 C;  1NH2 D;  1UFI A;  3HKC A;  1G6U A;  4RQE A;  4LF7 B;  3OMI B;  4TQF A;  4DW1 A;  4H33 A;  3K79 A;  3I56 V;  1P7B A;  4MVZ A;  2RJZ A;  2E5L B;  5F2V O;  4ZI7 A;  5CBH A;  1KP2 A;  1T5E A;  3E89 A;  3QVN A;  2FYU H;  1BSM A;  2JVD A;  4FLW A;  2MW2 B;  1N34 B;  4DR7 O;  4OXS A;  1TUE B;  1LUV A;  1PL0 A;  1R6T A;  1RSO A;  1ZWI C;  2VS0 A;  1JR9 A;  5EIB C;  2HHH B;  1V54 C;  3Q4H A;  2CH7 A;  3UO2 A;  4O4I A;  5AG2 A;  1F51 A;  4X1Y A;  4A5U B;  4LFC O;  1DF5 A;  1XRE A;  1SER A;  3JSN A;  4L8J A;  2WLJ A;  4DV3 O;  3WFV A;  3ASN C;  1N36 O;  3CSX A;  1UPG A;  2H94 A;  2YI8 A;  3JSL A;  1U97 A;  1EZV H;  4AHC A;  2UUC O;  5E79 Z;  3ZRW A;  5KUK A;  4J80 A;  1FXK C;  1HR0 O;  2P06 A;  2YC0 A;  1FXK B;  1VEW A;  1QVF U;  1SQF A;  3LDD A;  1S5H C;  4HZ3 A;  1THZ A;  2XAF A;  3CCU V;  1MAB G;  3HKC B;  2JIZ G;  3E83 A;  2LJ2 A;  4KHP O;  3HPL C;  4DV6 B;  1Y74 A;  4YJ2 A;  2DMX A;  3B2E E;  4JTD B;  4N21 A;  3BA8 A;  5JJE B;  2D3O W;  3L70 H;  5LMN B;  1AI7 A;  1PNK A;  4ZI7 B;  1XNQ B;  5JJN B;  2A9H A;  5A2Q N;  1K4C C;  5KHG A;  3CWB H;  3B4S A;  3OAA G;  4JI7 B;  1FS0 G;  4GX5 A;  1I5Y A;  1JX9 A;  2ZR3 A;  2JEU A;  4R7C A;  2P7T C;  5LGN A;  4DR1 O;  3OFN G;  4RUE A;  3SGI A;  4FZ1 A;  2UXC B;  2RQ6 A;  3Q4H B;  4FIP C;  3ZRS A;  1YTF D;  2CH7 B;  5L3E A;  4O4I B;  3E2E A;  2IW5 A;  4X1Y B;  3BAA A;  4DR4 B;  1VQ7 V;  4J42 A;  1K5S A;  2KB1 A;  2Q68 A;  4NKG B;  4U7N A;  3UQ8 A;  5LHH A;  2H3O A;  4TOI A;  4QPJ A;  3TGU H;  3CMA V;  3FYE B;  2O57 A;  1GM9 A;  1YSC A;  4PDR A;  4X1I A;  1QLN A;  5FLX N;  4R6Z A;  1VQP V;  1CP9 A;  1XIL A;  3CRC A;  3P32 A;  1R6K A;  3K04 A;  3AK2 A;  1XL6 A;  1H8H G;  5LYJ A;  4BAY A;  4K8X A;  4I5S A;  4JI3 O;  4DO2 A;  5H5N A;  1GH6 A;  4DRX B;  5LGT A;  1VIB A;  4PDL A;  2LW7 A;  1Y74 B;  4AQY B;  2ZQM A;  4X66 O;  1NTZ H;  4MSW C;  2QM4 A;  3QO5 A;  1H2S B;  3VOU A;  1W0K G;  5D5P A;  4B3T O;  3LNN A;  4O2B A;  3OM3 B;  1YI2 V;  2UXD O;  3OE7 G;  2QDO A;  3CC4 V;  1YIT V;  2ZM6 O;  2QTO A;  4DUZ B;  4TUY A;  3D36 A;  3JD4 A;  2H8P C;  4FLV A;  3CCQ V;  3ZX6 A;  4PDM A;  5LL6 Y;  2DQ0 A;  3TJT A;  1P84 F;  4JI1 O;  5KHJ A;  5ITZ A;  1ZTE A;  4OX9 O;  4X65 O;  4YIP A;  1AJP A;  2WLH A;  3CP1 A;  2YXL A;  1BQZ A;  3QTC A;  4X1I B;  3AEI A;  4NXM B;  2BTQ B;  1P49 A;  5KHI A;  1PNM A;  1N0N A;  1PV0 A;  2LP7 A;  2L6L A;  1AR1 B;  4I4T A;  5GW7 A;  5LYJ B;  3SPJ A;  4CC5 A;  2ZKO A;  5D5Q A;  2RDC A;  1RFY A;  5KAI Z;  5GON A;  5LBQ A;  5CA1 B;  1GM7 A;  1KB9 F;  1VQM V;  4YJ3 A;  2Z0A A;  4GX1 A;  1XMQ O;  4O2B B;  4IIJ A;  4JI4 O;  2IH1 C;  1ENV A;  2YIA A;  4LH6 A;  5C93 A;  1B04 A;  1XQ8 A;  5EBL C;  1ROP A;  5J2T A;  4EFB A;  4TUY B;  1VF5 B;  1OHH G;  4J9Z B;  4ZKI A;  1HNZ B;  1MMM A;  2L35 A;  2EIN C;  3JAL B;  1BGY H;  2EIN B;  4QNH B;  4DK1 A;  1IBM O;  3K0G A;  1GM8 A;  3EXA A;  2XT9 A;  4DUY O;  5ITZ B;  1OCR C;  4G27 B;  2CTW A;  2IJK A;  3ABT A;  4JI6 O;  3E8G A;  2Q6A A;  1M57 C;  1SZX A;  3IC9 A;  2AHY A;  3VQV A;  5B1B B;  2A0L A;  5EC2 C;  1YJW V;  1JJ2 U;  3ZRV A;  2QWO B;  3L74 H;  3S3X A;  2XAG A;  2RNB A;  3D3Q A;  4JTA B;  2F23 A;  5DEC A;  4I4T B;  5CB4 B;  4ICG A;  5FNV B;  5LMU O;  3RT3 C;  1GN3 A;  4GKJ B;  5GON B;  2QGN A;  5HFL A;  4FLU A;  1L1F A;  5KAF Z;  4KXR A;  2K1E A;  1KMI Z;  3IJ4 A;  1AI6 A;  3ABM C;  2YI9 A;  1EFR G;  4NTX A;  4F6E A;  5CMU A;  2EUL A;  5EYP A;  3CXC U;  2EJR A;  4TV8 A;  3ZMU A;  1WAZ A;  1JQ0 A;  4EFE A;  1NI8 A;  3HKE A;  3ETQ A;  1BHA A;  5B1A C;  4NXN O;  1JFF A;  5B1A B;  1HP8 A;  4N23 A;  4WBN A;  3RYI B;  4I55 B;  1S0V A;  3N27 A;  2ZDI C;  1J5E O;  1RP3 B;  1WPB A;  3OD4 A;  1GK9 A;  3DTU B;  1M56 B;  2PF4 E;  4RAI A;  4JI2 O;  2ZD9 A;  2F4V B;  2DQ3 A;  3MAQ A;  4JI8 O;  4PA3 A;  1B06 A;  4DV7 B;  2W0F C;  3B09 A;  4JI5 B;  4EB6 A;  1XNR O;  3OEH G;  2HP8 A;  2GHY A;  5BR8 O;  2RCV A;  4LFB O;  3OMA B;  5LXT A;  5IY5 C;  2GBO A;  2LFR A;  2FTK A;  2HG5 C;  3AG2 B;  3F7Y C;  4CH5 A;  2QE7 G;  2Q0O C;  4O4L A;  2KG7 A;  4I9W A;  3T1Y B;  1XI1 A;  2XUM A;  3ABL C;  1JOY A;  4B7K A;  3ABL B;  1FXV A;  2GUZ A;  5TIS Z;  4UXN A;  3A0R A;  2WSS G;  4K0K O;  2BSK A;  4MVS A;  5K1X A;  1KKD A;  1Q3E A;  2PYJ A;  1VQL V;  1ZLZ A;  5B5E Z;  2CTP A;  3FX7 A;  1H2M A;  4TV8 B;  4NTY A;  1NBM G;  2Y69 C;  3HKE B;  1Q81 W;  1U96 A;  5DED A;  1JFF B;  4AIL C;  2JGD A;  3TCU A;  4WBN B;  1AB3 A;  2HR3 A;  1FFX A;  4JYB A;  2X6B A;  5CN0 A;  3T1H O;  4DR7 B;  2EIL C;  2Y0P A;  2ARH A;  4DR3 O;  3OMN B;  5EBM C;  1XMO O;  2F43 G;  1DTO A;  4P9P A;  3E8B A;  5LHG A;  4UVC A;  3QO8 A;  4DXW A;  3LUT B;  1RM1 C;  1IX9 A;  1VF6 A;  4QPK A;  4CH4 A;  2BE3 A;  3IFX A;  2QSA A;  4RQF A;  4EB6 B;  4LFC B;  4GKK O;  1Y6X A;  4X8A A;  2DJV A;  3BAB A;  3KZI Z;  2UU9 O;  1R6N A;  5LXT B;  4X88 A;  1SQP H;  4GX2 A;  1SQG A;  4DV3 B;  2PTM A;  2DWD C;  2Q69 A;  3OUS A;  2UUA O;  3H1L H;  5B66 Z;  5KUM A;  2EIM C;  4LF8 O;  1PL4 A;  4JAU A;  1QBZ A;  4O4L B;  3WU2 Z;  2CTQ A;  3ZN0 A;  1VQ4 V;  2GSM B;  3OR7 C;  2UUC B;  1CEZ A;  1VQK V;  1FD9 A;  2XAJ A;  5L3F A;  1GMG A;  2WWW A;  3P30 A;  3AG1 C;  2OCC C;  1DK1 A;  4XDK A;  2BSK B;  4FLX A;  1BHB A;  1R3I C;  4KHP B;  2ZCE A;  1TVK A;  3UKM A;  5EZY A;  1MSD A;  4UCV A;  3R66 A;  2JGD B;  4K3A A;  4YXW G;  4DYL A;  2B9Z A;  3OTO O;  2YSU B;  3RW0 A;  3BPZ A;  3WB2 A;  2N74 A;  3FB5 C;  2JDI G;  4FJC C;  2FML A;  4I50 A;  4Z2W A;  2ZE8 A;  4X9Q A;  4DR1 B;  1BL8 A;  5L3B A;  2PYL A;  2DWE C;  1N32 O;  3RN4 A;  4UCU A;  3EVK A;  3K57 A;  3CE2 A;  1EN4 A;  2OWO A;  1FPO A;  1MSW D;  2B1G A;  2WLI A;  2VRZ A;  2RN9 A;  4DV4 O;  2AXT Z;  4WF9 V;  4PI0 A;  4HAM A;  4DR6 O;  4YY3 O;  2EIJ C;  2EIJ B;  1K4D C;  4J7K A;  1PM9 A;  1TA8 A;  3OT7 A;  3JAM N;  2A06 H;  3H1J H;  3H9V A;  3SPG A;  1VQN V;  4PA7 A;  3SJB C;  1P7G A;  2Q4P A;  4JV5 O;  2WAM A;  3SR2 C;  2CTR A;  2Y0I A;  3CXH F;  2CDY A;  2ZXW C;  2ZXW B;  3CS5 A;  1V54 B;  2HJD A;  4JI3 B;  1OV9 A;  4K8Z A;  3SYQ A;  4C7U A;  2WLK A;  1R3J C;  1TVK B;  1VQ6 V;  5EZY B;  1N33 O;  2DYR C;  2DYR B;  4QJF B;  4UFZ A;  3B8M A;  2R72 A;  4WFA V;  5C8Y A;  4B3T B;  2UXD B;  5B1O A;  3ASN B;  2WPD G;  4CC6 A;  1H38 A;  5JH7 B;  4I50 B;  4MVO A;  3FAV A;  3ZMT A;  1I94 O;  3MHH C;  1KEC A;  4BW5 A;  4H44 B;  1WB8 A;  2OYQ A;  3JAK A;  4YIO A;  2JS3 A;  3FD9 A;  3BA9 A;  3UO3 A;  1COW G;  3PJS K;  1S5J A;  4JI1 B;  3LSS A;  1I7F A;  4G2K A;  4DRX A;  2WLI B;  3STZ C;  4OX9 B;  1H2L A;  1XHZ A;  1GKF A;  1G8M A;  4X65 B;  1SQV H;  3NR7 A;  4UVB A;  1MZF A;  5LA6 B;  1I0H A;  1BS3 A;  4X64 O;  1YXB A;  2ZNI A;  4CS3 A;  1PP9 H;  3QF7 A;  3K5M A;  3ZN1 A;  3UCS C;  2QKA A;  1SF9 A;  3F5T A;  2X6A A;  1Q8I A;  4LF6 O;  2Z3Y A;  4H0L B;  3IAY A;  2DYS C;  3GVM A;  1OCC C;  1R73 A;  4UCO A;  5DN6 G;  4XDL A;  1ZX3 A;  5C8Y B;  1XMQ B;  4PA9 A;  4DV2 O;  4JI4 B;  4KP4 A;  2F95 B;  4FLY A;  1F4N A;  2BTQ A;  3GB7 C;  1OCO C;  3FAV B;  2ZR2 A;  2N05 A;  4G28 B;  3DSQ A;  1NS1 A;  5L3G A;  3JAK B;  3O9O A;  1A32 A;  1BCC H;  4LNU A;  3K59 A;  3G71 V;  4OPA A;  1AP5 A;  3NXS A;  3ZHQ A;  3TK1 A;  2QKS A;  4DUY B;  1HNW O;  4CS2 A;  1L0L H;  5CA1 A;  2GTA A;  4LFA O;  4GUN A;  4JI6 B;  2B5U A;  1FAF A;  1Q90 D;  5IYB O;  4O2A A;  4JPR A;  2B1I A;  3P3P A;  4PHZ A;  3ZBH A;  4F6R A;  3K03 A;  4HYO A;  4IYI A;  4JZG A;  1ARO P;  1IZ3 A;  1NR1 A;  4UCR A;  3E22 A;  3D3I A;  4UB6 Z;  1NZ6 A;  1WNS A;  3JAL A;  5LMU B;  1GRJ A;  3WB0 A;  5JCO C;  3SYC A;  1D2D A;  4PDV A;  1I5X A;  2M7W A;  3L73 H;  2XAQ A;  4WFE A;  3J7A U;  4JF3 A;  1B3Q A;  1DLB A;  1D5A A;  3ZJZ A;  1NJI W;  1FXH A;  2YXY A;  2PI4 A;  2EBO A;  3K08 A;  1S77 D;  1YHQ V;  5LOV A;  1HDJ A;  1WB7 A;  1KYO F;  4FFB A;  3A0B Z;  1K3E A;  3E8H A;  1GO3 F;  4DV6 O;  4JAV A;  2WA4 A;  1B6Q A;  3CCS V;  5CB4 A;  1Q5O A;  4LNU B;  5E1A C;  5LMN O;  5FNV A;  3CME V;  2ADP A;  5IYC O;  1AP6 A;  4NXN B;  2JGU A;  4FVM A;  3D8C A;  3B8N A;  4JZ2 A;  2CAZ C;  3SYP A;  3K5O A;  4JI7 O;  3H01 A;  1J5E B;  1Z5W A;  4R8C A;  4BR6 A;  3T1C A;  3CCE V;  3BRC A;  5KA5 A;  2GDS A;  4DV1 O;  4JGS A;  4O2A B;  4FM1 A;  4JI2 B;  1H2K A;  1MOF A;  4F6R B;  4JI8 B;  4XDJ A;  2P5O A;  2ADQ B;  1S3J A;  1LR1 A;  3KCX A;  1YDX A;  1SA0 A;  4QE9 A;  3ICX A;  4ZOL A;  3A0H Z;  4ASU G;  3E22 B;  4DR2 B;  1ZUQ A;  2OTJ V;  2QR4 A;  1Q86 W;  1K7D A;  1R3K C;  1XNR B;  5BR8 B;  4AI8 A;  1Y66 A;  1IXB A;  3FYI B;  1M1K W;  3PN1 A;  4JAA A;  1EN5 A;  3CRR A;  3ZED A;  5IYD O;  3KG2 A;  3RYI A;  4JTC B;  4I55 A;  1F23 A;  3K0D A;  1QU7 A;  1OCR B;  2ZDI A;  1JMK C;  4TT3 G;  3U11 A;  4D7S A;  2FB5 A;  2BTO A;  1M90 W;  4TQD A;  2Q5Z A;  4DV5 O;  5LOV B;  4FM2 A;  1M57 B;  1KD1 W;  4FFB B;  2YEV A;  4K0K B;  3FB8 C;  1E1Q G;  2DN9 A;  4BIO A;  3OW2 U;  5J9P C;  4PI2 A;  4DK0 A;  2V1D A;  4JYA O;  4MVQ A;  3KKY A;  1WP8 A;  3JYC A;  5CBG A;  3VBB A;  1H8E G;  3QG5 A;  5EK0 A;  3T1H B;  3ETE A;  3RVY A;  3JD3 A;  4DR3 B;  2Q8V A;  4LF4 O;  3W7T A;  3CCV V;  4PD4 F;  3W7S A;  1QCE A;  1WPX A;  2QWQ B;  2QA4 V;  3CX5 F;  5J2U A;  3P3N A;  4GZR B;  1FYJ A;  1K9M W;  4MVR A;  2QWP B;  3ABM B;  1AVM A;  1SS3 A;  1K73 W;  3U0Z A;  1SA0 B;  4ZOL B;  1SC5 B;  1M93 A;  4LBE C;  4W4K A;  1QNM A;  2CK3 G;  1X59 A;  3C90 A;  4GKK B;  3O65 A;  5JJJ B;  4LF9 O;  2W6J G;  5EIB D;  3RBZ A;  2AZ2 A;  2C2A A;  2MK3 A;  1ZL8 A;  2UU9 B;  1K5Q A;  2E75 B;  1BQ0 A;  4I7Z B;  1YTF B;  2QTS A;  2UUA B;  4R50 A;  1QVG U;  3JAT A;  4LF8 B;  4H13 B;  1CPY A;  4B3R B;  4RO2 A;  5IJ0 A;  4ZHQ B;  3JAR B;  4D7T A;  3SPH A;  2YEV B;  2X6C A;  1RPR A;  1YVW A;  1D5N A;  1O9H A;  2PZS A;  3ETG A;  4KFM A;  1TGO A;  2R70 A;  2P6J A;  1IBL O;  4B3S O;  2X7R B;  1VQO V;  1Q82 W;  3K5L A;  5IY5 B;  1P4R A;  3SJQ C;  3OTO B;  1M9N A;  4BIZ A;  4I0X A;  5LGU A;  5IT9 N;  1YF2 A;  1Z2G A;  1PPJ H;  2WLL A;  2ITD C;  2CUG A;  2HLD G;  1HNZ O;  4MW8 A;  5J2U B;  3AK1 A;  4GX0 A;  1N32 B;  2ETN A;  3AG3 C;  4O4H A;  3W7X A;  1BE3 H;  2VQE O;  2XTA A;  2EIK C;  1SES A;  2EIK B;  3J80 N;  3IGA C;  3A2F A;  3ZMS A;  2UXN A;  2D2C B;  4J7Z A;  4DV4 B;  4QE7 A;  1ZL8 B;  2E74 B;  2G38 A;  2Y69 B;  4DR6 B;  4YY3 B;  2P4V A;  2YIB A;  5HFM A;  3BCC H;  3JAT B;  3ABK C;  2GTS A;  5FPR A;  2EIL B;  2IJI A;  1FKA O;  2XAS A;  1MG1 A;  5IJ0 B;  5JVD A;  5IYZ A;  4IL6 Z;  4JV5 B;  5L3C A;  1LNQ A;  4MTF A;  3ZMZ A;  5B3S C;  3CRM A;  1Y4M A;  3T4D A;  1EBO A;  4GKJ O;  3ZHR A;  4U3F H;  2GV9 A;  2ILM A;  1RM1 B;  1K34 A;  4MT8 A;  3AG4 C;  5L3D A;  3K9A A;  4NYK A;  4X20 A;  1N33 B;  4E4E A;  1XDC A;  1SET A;  4X89 A;  2PY5 A;  4NB5 A;  3OGC C;  1DF4 A;  2QEX V;  1N36 B;  5LP6 C;  3STL C;  4I0X B;  2ODM A;  3BFR A;  2EIM B;  2IH3 C;  2WLL B;  3WG7 C;  1KKC A;  1WLE A;  2HJF C;  4J41 A;  3HR0 A;  3WG7 B;  2VQF O;  3SYA A;  1I94 B;  3DGE A;  2QJ1 A;  1HR0 B;  1HNX O;  1YCI A;  2DOS A;  4GLX A;  3G80 A;  2FKX A;  5H6Q A;  4O4H B;  2IJJ A;  2OCC B;  3AG1 B;  2QWN B;  4MTO A;  2Y4T A;  4GCZ A;  3QNE A;  5GTI Z;  5H6R A;  3EHB B;  4PEL A;  1KQS U;  3U10 A;  3B40 A;  2AZ0 A;  1JCH A;  1Q6I A;  2PI5 A;  1IUR A;  2YXH A;  2OIE A;  4PV1 B;  4FM0 A;  4X62 O;  2M6Y A;  5JH7 A;  1AJQ A;  4X64 B;  5JVD B;  5IYZ B;  3UT5 A;  1QLE C;  2ZIO A;  1VQ5 V;  3ABU A;  1X4T A;  3THO A;  2EX3 A;  4UV8 A;  1KBH A;  1L8D A;  1Y76 A;  1FJG O;  4DV0 O;  4NVP A;  1NTK H;  4LF6 B;  4LF5 O;  3SPI A;  3JAW A;  1PNL A;  4DR5 O;  4X20 B;  2A7W A;  2HVK C;  4KL1 A;  4XBF A;  3CC7 V;  4UCS A;  4PJ0 Z;  1SQX H;  3E35 A;  4DV2 B;  5LA6 A;  4OGQ B;  3L72 H;  2NR5 A;  2NLJ C;  4ZIB A;  2UXB O;  4W4L A;  5KX5 A;  2Z5U A;  4QIW F;  3W7U A;  2QM8 A;  4WFF A;  2ZNJ A;  1NQT A;  1EZJ A;  3CYO A;  1IVS A;  2ZT9 B;  3H1I H;  4JI0 O;  2OTL V;  2ZE5 A;  1AIL A;  1HNW B;  1W59 A;  4LFA B;  1IDS A;  2R9A A;  5LHI A;  4X66 B;  4YHH O;  4P9O A;  2XND G;  3MHS C;  1YJN V;  2WLM A;  3W7W A;  4HBN A;  1WA8 A;  2KQX A;  5IWA O;  1F4M A;  4L87 A;  1R1B A;  1QR9 A;  4B3M O;  2QWR B;  2DW4 A;  2XAH A;  2ZM6 B;  2IBZ H;  3A8T A;  3UT5 B;  1UJW B;  1H2N A;  4U3J A;  1XOU A;  1GN6 A;  4TWK A;  4P2Z A;  2BOC C;  4H37 A;  3RYH A;  4J11 A;  1Y76 B;  2XHB A;  1WJZ A;  3JAW B;  5IDJ A;  4BW9 A;  2CE4 A;  1NVP B;  3C3T A;  3CEI A;  1W0J G;  1IBK O;  2UUB O;  3CCJ V;  2V7Q G;  4B7E A;  1V9P A;  4NTW A;  2JK5 C;  3JD0 A;  4DW0 A;  1DGS A;  2E3C A;  2JJ1 G;  2X0L A;  3WB1 A;  5KX5 B;  1TUB A;  3LDC A;  3QO7 A;  3SYO A;  2A3Q A;  4D6T H;  4UV9 A;  2AHZ A;  3APO A;  3K06 A;  1Y67 A;  2IU3 A;  4I9Q A;  1OCZ C;  1S76 D;  1HW7 A;  1KU9 A;  3OUF A;  5JCO A;  1OCZ B;  4QGP A;  2ZE6 A;  2DYS B;  2HFE C;  1OCC B;  3IC7 A;  1RSO B;  2LGW A;  1NTM H;  4X1K A;  1MNG A;  2HKO A;  5B1N A;  4DV1 B;  1VP7 A;  1WA8 B;  4LWS A;  2YIC A;  3G67 A;  4IHJ A;  4RUF A;  3M8A A;  3L71 H;  2PGG A;  4KUM A;  4LF7 O;  3OEE G;  3HKB A;  3RFR A;  1TAE A;  1OCO B;  1Q6U A;  4U3J B;  2QM7 A;  2WA3 A;  1S5L Z;  1G4Y B;  4MTX A;  1QQC A;  3SJC C;  3G6E V;  3C3S A;  2E5L O;  2ATK C;  4FMT A;  3RYH B;  1K33 A;  4OPH A;  1EN6 A;  2YDE A;  1IBM B;  1N34 O;  4JYY A;  5EC1 C;  2IU0 A;  1JA8 A;  3JD2 A;  3ZHU A;  1Q7Y W;  2EZO A;  4TSF G;  3ZRW B;  4MTG A;  1I08 A;  1W2B U;  4DV5 B;  2HHH O;  1XEQ A;  3OGI B;  2YS8 A;  2DE0 X;  3JCU Z;  2LFS A;  4Z1V A;  4UB8 Z;  5KLV H;  4YJ2 B;  1TUB B;  1BT8 A;  3H1H H;  1Q6H A;  2Q7G A;  3VQX A;  3BY6 A;  4JYA B;  3AG7 A;  1WP7 A;  5IJ9 A;  3BVO A;  3L9D A;  3ZIA G;  4J10 A;  2F93 B;  5BZB A;  4X1K B;  3DC5 A;  2W0X A;  4LF4 B;  2AW9 A;  5BY1 A;  1K92 A;  3K58 A;  3CRA A;  4LWS B;  2LO1 A;  1XL4 A;  4IHJ B;  3BHP A;  3T2M A;  3HKB B;  1Q43 A;  3ZHS A;  3CCM V;  3UM7 A;  2R9I A;  3HKD A;  3L75 H;  3E8F A;  3DC6 A;  4LF9 B;  3R65 A;  3LDE A;  3EFF K;  3ZS8 C;  2Y48 A;  3ZCC A;  2JRI A;  1XNQ O;  4K35 A;  2Q0A A;  2NN4 A;  2Q9L A;  1NH2 B;  4HNA A;  5IE9 A;  3SJA C;  2ZIN A;  2JS5 A;  1XBL A;  2UXC O;  1PD3 A;  1JVM A;  3CJH A;  4JAS A;  1GAX A;  1BZK A;  1RPO A;  1E79 G;  2PUS A;  1US6 A;  5BMV A;  1V55 C;  3TET A;  2IM9 A;  4DR4 O;  1V55 B;  4BWA A;  2AGA A;  3TXQ A;  3FB7 C;  3JAS A;  1BMF G;  4WFG A;  4LC1 A;  1IBL B;  3JD1 A;  4LFB B;  4B3S B;  3AK3 A;  5IJ9 B;  2JEX A;  2WLN A;  3FKS G;  3D36 C;  1N4C A;  5JWP A;  4U7O A;  4IGG A;  4UVA A;  3ASO C;  4ZHQ A;  2YIB D;  1FFT B;  3ASO B;  3JAR A;  1Z5V A;  5BXZ A;  2V4D A;  1NR7 A;  2IJH A;  4GT1 A;  4LH7 A;  2VQE B;  3HKD B;  4AQY O;  1MZE A;  5CBF A;  2RMK B;  2E76 B;  2KSD A;  1E1R G;  3F5W C;  1JPX A;  1HWY A;  4WCE V;  2NNU A;  2Q7H A;  4P30 A;  1K97 A;  1KC8 W;  3GWK C;  2LW1 A;  5B1B C;  3RWR D;  2BOB C;  4HNA B;  1VAR A;  1IXM A;  3OTF A;  4DUZ O;  2QKC A;  2OT5 A;  3G4S V;  3OR6 C;  1YEW A;  4UCT A;  1XMO B;  1AR5 A;  3CJH B;  3TXS A;  1XHX A;  3CPW U;  5DM6 V;  3CHX A;  2N04 A;  1KUQ A;  2XOK G;  4EEQ A;  5BMV B;  2P90 A;  3H1K H;  3JAS B;  4MS2 A;  4YJ3 B;  1VQ8 V;  1NKD A;  4IIJ B;  2ZIM A;  3RYC A;  1GN4 A;  1SKV A;  2FL4 A;  4WFB V;  2LGQ A;  4NXM O;  1S72 V;  5J2T B;  4MVU A;  3CCL V;  5EBW C;  2K9P A;  5KMG A;  5JQG A;  2VQF B;  4Z1M G;  1HNX B;  3LSQ A;  3J81 N;  2CGO A;  2F1M A;  1AR4 A;  2P67 A;  1O9G A;  3RVZ A;  3SPC A;  3CRQ A;  1SQB H;  5K1P A;  2OIG A;  5FPO A;  1NU1 H;  1N8R W;  1QHT A;  1M56 C;  2HVJ C;  5FL7 G;  5KA6 A;  4O4J A;  2A79 B;  4TV9 A;  3X2Q C;  3X2Q B;  4IYH A;  3LSU A;  1URF A;  3K3W A;  1SQQ H;  3BEH A;  1N0J A;  1XUQ A;  3RYF A;  5KHK A;  1LUW A;  1GTO A;  3N2K A;  4FZ0 A;  5KHH A;  4X62 B;  1NVP D;  5CA0 A;  5LP6 A;  1JJO A;  3APQ A;  5CA3 A;  3CB2 A;  4DR2 O;  2Q7E A;  2EJ7 A;  2EZP A;  2UXX A;  4FFK A;  4UUJ C;  5A9G A;  2LQT A;  3DXR A;  4LCU C;  3HB3 B;  4B08 A;  3AG3 B;  1FJG B;  4DV0 B;  1EM1 A;  3N2G A;  3AG2 C;  4CZZ A;  4LF5 B;  4CH6 A;  4DR5 B;  1AI4 A;  1YZB A;  2R9R B;  2VWJ A;  4CH3 A;  1M5I A;  4FLT A;  3ZMV A;  3E86 A;  4F4L A;  3RYC B;  4PA4 A;  2YID A; 
#chains in the Genus database with same CATH homology
 4G27 B;  3G71 V;  3ML0 A;  2IJK A;  3ABT A;  3NXS A;  3TK1 A;  1VQ9 V;  3ZRX A;  1J95 A;  2QKS A;  2Z5U A;  3E8G A;  4QIW F;  3W7U A;  2QM8 A;  1SRY A;  3ABK B;  4WFF A;  2Q6A A;  1NQT A;  1M57 C;  1EZJ A;  2AHY A;  3CYO A;  3M99 B;  2OTL V;  5B1B B;  2B5U A;  2A0L A;  5EC2 C;  1YJW V;  1JJ2 U;  3ZRV A;  5IYB O;  3JCZ A;  4JPR A;  2B1I A;  2XAG A;  4LP8 A;  5B3S B;  3K03 A;  5LHI A;  4JTA B;  4HYO A;  4P9O A;  2XND G;  3MHS C;  1ARO P;  1YJN V;  1H2G A;  2WLM A;  3F7V C;  3AG4 B;  3W7W A;  4BIU A;  4MVM A;  1NR1 A;  1SZT A;  1F4M A;  4L87 A;  3D3I A;  1QR9 A;  2DW4 A;  2XAH A;  3B77 A;  5HFL A;  1L1F A;  1UJW B;  3MD0 A;  3SYC A;  3CD6 V;  2Q67 A;  4TWK A;  4WFH A;  1K8A W;  4P2Z A;  4PDV A;  1R3L C;  1KP3 A;  2K1E A;  2BOC C;  1I5X A;  2M7W A;  2XAQ A;  4H37 A;  4FK5 C;  4WFE A;  4JF3 A;  1AI6 A;  1DLB A;  3ABM C;  1YJ9 V;  1EFR G;  3ZJZ A;  1NJI W;  1FXH A;  2PI4 A;  2EBO A;  3K08 A;  4FPP A;  4MW3 A;  1S77 D;  1YHQ V;  5IDJ A;  5CMU A;  3I55 V;  2ITC C;  4Q20 A;  1NVP B;  1AJN A;  5H9C A;  1YIJ V;  3CXC U;  1W0J G;  3T4Z A;  2EJR A;  1K3E A;  3ZMU A;  1JQ0 A;  1AI5 A;  4PA6 A;  3E8H A;  4ZBM A;  1GO3 F;  2V7Q G;  3CCJ V;  3CC2 V;  1BHA A;  5B1A C;  4JAV A;  5B1A B;  4N23 A;  1B6Q A;  2JK5 C;  1OZ0 A;  3JD0 A;  3CCS V;  5E1A C;  1S0V A;  2ZDI C;  3GWO A;  3CME V;  4J9Y B;  5IYC O;  4CBC A;  1GK9 A;  2JJ1 G;  2X0L A;  3DTU B;  1M56 B;  3QO7 A;  3LDC A;  3B8N A;  4RAI A;  3SYO A;  2ZD9 A;  4UV9 A;  3ETD A;  3SYP A;  2DQ3 A;  2JJ2 G;  2AHZ A;  3H01 A;  4R8C A;  4E2L A;  3T1C A;  3CCE V;  3K06 A;  4PA3 A;  2IU3 A;  1QLE B;  1OCZ C;  1S76 D;  3OUF A;  5KA5 A;  1OCZ B;  1PKX A;  4JGS A;  1ORQ C;  1MOF A;  2W0F C;  2DYS B;  2HFE C;  1OCC B;  3IC7 A;  4XDJ A;  1S3J A;  2HKO A;  3OEH G;  5B1N A;  2GHY A;  3CCR V;  4EKW A;  1QR8 A;  4QE9 A;  3OMA B;  2W6I G;  4ASU G;  2OTJ V;  4JYC A;  5IY5 C;  4RUF A;  2LFR A;  1Q86 W;  1K7D A;  1R3K C;  2FTK A;  1Y66 A;  3FYI B;  3LNM B;  3FB6 C;  4KUM A;  1FXK A;  1M1K W;  2HG5 C;  3OEE G;  3AG2 B;  3F7Y C;  2QE7 G;  1OCO B;  2QM7 A;  4I9W A;  1G4Y B;  4MTX A;  1NH2 D;  5IYD O;  3ABL C;  1JOY A;  3KG2 A;  4JTC B;  3G6E V;  3ABL B;  1FXV A;  1F23 A;  4RQE A;  2ATK C;  3K0D A;  4FMT A;  3OMI B;  1OCR B;  2ZDI A;  4UXN A;  3A0R A;  4TT3 G;  2WSS G;  1K33 A;  4H33 A;  3K79 A;  4MVS A;  1KKD A;  5EC1 C;  1M90 W;  3I56 V;  2IU0 A;  3JD2 A;  1VQL V;  1Q7Y W;  2EZO A;  1P7B A;  4MVZ A;  1M57 B;  5CBH A;  1KD1 W;  1KP2 A;  4TSF G;  2YEV A;  3ZRW B;  3E89 A;  4MTG A;  3FB8 C;  1E1Q G;  1NBM G;  2Y69 C;  4OXS A;  1W2B U;  1TUE B;  1PL0 A;  3OW2 U;  1Q81 W;  5J9P C;  1ZWI C;  3TCU A;  2HR3 A;  2V1D A;  4JYB A;  2X6B A;  4MVQ A;  5CN0 A;  2LFS A;  2EIL C;  3JYC A;  3OMN B;  5CBG A;  1V54 C;  5EBM C;  3VBB A;  1H8E G;  2F43 G;  1DTO A;  4P9P A;  3E8B A;  5LHG A;  4UVC A;  3BY6 A;  5EK0 A;  3QO8 A;  1F51 A;  3ETE A;  3RVY A;  3JD3 A;  4DXW A;  1DF5 A;  3W7T A;  3CCV V;  3LUT B;  1RM1 C;  1SER A;  3W7S A;  1QCE A;  1WPX A;  4QPK A;  2QA4 V;  3ZIA G;  2WLJ A;  1K9M W;  4MVR A;  3IFX A;  5BZB A;  4RQF A;  3WFV A;  3ABM B;  3ASN C;  4X8A A;  1K73 W;  1K92 A;  2H94 A;  1R6N A;  4LBE C;  4X88 A;  2CK3 G;  4GX2 A;  1XL4 A;  2DWD C;  3ZRW A;  5KUK A;  2Q69 A;  3OUS A;  1FXK C;  3T2M A;  2W6J G;  1FXK B;  3RBZ A;  1QVF U;  5KUM A;  2EIM C;  4JAU A;  1QBZ A;  3ZN0 A;  2C2A A;  2MK3 A;  3UM7 A;  3CCM V;  1VQ4 V;  2GSM B;  1S5H C;  2R9I A;  1THZ A;  2XAF A;  1K5Q A;  3LDD A;  3OR7 C;  4HZ3 A;  3CCU V;  3E8F A;  1CEZ A;  1VQK V;  1MAB G;  2XAJ A;  2JIZ G;  5L3F A;  1YTF B;  3E83 A;  1GMG A;  2WWW A;  4R50 A;  3R65 A;  3LDE A;  3EFF K;  1QVG U;  2Y48 A;  3ZCC A;  3HPL C;  3P30 A;  1CPY A;  2OCC C;  3AG1 C;  4XDK A;  4RO2 A;  4JTD B;  4N21 A;  1BHB A;  1NH2 B;  2D3O W;  1R3I C;  1AI7 A;  1PNK A;  3SPH A;  2YEV B;  3UKM A;  2X6C A;  1RPR A;  2A9H A;  1K4C C;  1PD3 A;  3OAA G;  1JVM A;  1FS0 G;  3ETG A;  1I5Y A;  4GX5 A;  4JAS A;  1JX9 A;  4YXW G;  2ZR3 A;  2JEU A;  4R7C A;  2P7T C;  4KFM A;  1RPO A;  5LGN A;  1E79 G;  2YSU B;  3OFN G;  3RW0 A;  2P6J A;  3FB5 C;  2JDI G;  4FJC C;  1V55 C;  4RUE A;  3TET A;  1V55 B;  2X7R B;  1VQO V;  3ZRS A;  4FIP C;  1Q82 W;  1YTF D;  3FB7 C;  5L3E A;  1BMF G;  4WFG A;  1P4R A;  3SJQ C;  5IY5 B;  3E2E A;  1BL8 A;  1M9N A;  2IW5 A;  4BIZ A;  4LC1 A;  5L3B A;  5LGU A;  3JD1 A;  2DWE C;  1VQ7 V;  2WLL A;  2ITD C;  2JEX A;  1K5S A;  2HLD G;  2KB1 A;  2Q68 A;  2WLN A;  4U7N A;  4MW8 A;  5LHH A;  3FKS G;  4GX0 A;  4QPJ A;  1MSW D;  2B1G A;  2WLI A;  3FYE B;  3CMA V;  4U7O A;  1GM9 A;  1YSC A;  4PDR A;  3AG3 C;  4UVA A;  3W7X A;  3ASO C;  1QLN A;  1FFT B;  3ASO B;  4WF9 V;  4HAM A;  2EIK C;  4R6Z A;  1SES A;  2EIJ C;  2EIK B;  1VQP V;  3IGA C;  2EIJ B;  1CP9 A;  1K4D C;  3P32 A;  3ZMS A;  1NR7 A;  2IJH A;  4GT1 A;  2UXN A;  1R6K A;  3K04 A;  1XL6 A;  4QE7 A;  2Y69 B;  3SPG A;  1H8H G;  4BAY A;  1VQN V;  4PA7 A;  5CBF A;  4I5S A;  4DO2 A;  2WAM A;  5HFM A;  1E1R G;  3F5W C;  1JPX A;  3ABK C;  1HWY A;  4WCE V;  2ZXW C;  2EIL B;  2IJI A;  5LGT A;  2NNU A;  2ZXW B;  4PDL A;  2XAS A;  4P30 A;  1K97 A;  2ZQM A;  1KC8 W;  1MG1 A;  1V54 B;  5B1B C;  2BOB C;  4MSW C;  3SYQ A;  2WLK A;  1IXM A;  3QO5 A;  1LNQ A;  4MTF A;  3ZMZ A;  1R3J C;  3VOU A;  1W0K G;  5L3C A;  5B3S C;  2OT5 A;  3G4S V;  1VQ6 V;  1Y4M A;  3T4D A;  1EBO A;  2DYR C;  3OM3 B;  3OR6 C;  1YI2 V;  2DYR B;  3OE7 G;  4QJF B;  3CC4 V;  1RM1 B;  3B8M A;  1YIT V;  1K34 A;  2QTO A;  4MT8 A;  3AG4 C;  3CPW U;  5DM6 V;  5L3D A;  3K9A A;  4WFA V;  3D36 A;  3JD4 A;  2XOK G;  5B1O A;  3ASN B;  2WPD G;  1SET A;  1H38 A;  4X89 A;  2H8P C;  2P90 A;  3OGC C;  3CCQ V;  4MVO A;  1DF4 A;  3ZMT A;  2QEX V;  4MS2 A;  4PDM A;  2DQ0 A;  3STL C;  3MHH C;  1KEC A;  4BW5 A;  1VQ8 V;  1NKD A;  2EIM B;  2IH3 C;  2WLL B;  4WFB V;  3WG7 C;  1WLE A;  2HJF C;  3WG7 B;  1COW G;  3PJS K;  1AJP A;  3SYA A;  2WLH A;  3CP1 A;  3DGE A;  1S72 V;  4MVU A;  3LSS A;  3CCL V;  4G2K A;  5EBW C;  2WLI B;  3STZ C;  5H6Q A;  1GKF A;  1G8M A;  2IJJ A;  2OCC B;  3AEI A;  3AG1 B;  4MTO A;  4GCZ A;  4Z1M G;  3QNE A;  5H6R A;  3LSQ A;  3EHB B;  4UVB A;  1PNM A;  4PEL A;  1KQS U;  2LP7 A;  1AR1 B;  2P67 A;  3RVZ A;  3SPC A;  1JCH A;  5GW7 A;  2PI5 A;  3SPJ A;  1N8R W;  1M56 C;  2HVJ C;  5FL7 G;  5KA6 A;  3ZN1 A;  2A79 B;  3X2Q C;  1AJQ A;  3X2Q B;  5LBQ A;  1GM7 A;  3K3W A;  1QLE C;  2X6A A;  3BEH A;  1VQ5 V;  1GTO A;  1VQM V;  1NVP D;  2Z3Y A;  3ABU A;  2DYS C;  1OCC C;  4GX1 A;  5CA3 A;  4UV8 A;  1R73 A;  2IH1 C;  1ENV A;  5DN6 G;  5C93 A;  4XDL A;  5EBL C;  1ROP A;  2EZP A;  2UXX A;  3SPI A;  4UUJ C;  1PNL A;  4LCU C;  4PA9 A;  3HB3 B;  2HVK C;  4XBF A;  1OHH G;  4J9Z B;  4ZKI A;  3CC7 V;  4KP4 A;  3AG3 B;  1F4N A;  4CZZ A;  3AG2 C;  3GB7 C;  1OCO C;  2EIN C;  2ZR2 A;  2EIN B;  4QNH B;  3E35 A;  1AI4 A;  2R9R B;  4G28 B;  3K0G A;  1GM8 A;  5L3G A;  3ZMV A;  2NLJ C;  3E86 A;  4F4L A;  1OCR C;  4PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...