1YJ9V

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yj9V00
3G4SV 1S72V 2QEXV 3OW2U 1VQ7V 1VQNV 3CCMV 1YITV 1Q7YW 3CD6V 2OTJV 1YI2V 1VQKV 3CC2V 1KQSU 1VQPV 3CCEV 1VQMV 1VQ6V 3CMEV 1VQOV 1W2BU 1KC8W 2OTLV 4WFBV 1KD1W 1QVGU 1M90W 3I56V 1VQ9V 3CCUV 1Q86W 3CXCU 3CC4V 1YJWV 4WFAV 2D3OW 1JJ2U 2QA4V 1YJNV 4WCEV 3CCVV 1VQ4V 1K9MW 3CCJV 1N8RW 1VQ8V 1M1KW 3CCRV 3CCSV 3CCQV 1QVFU 1R73A 1Q82W 3G6EV 1NJIW 1K8AW 5DM6V 3CPWU 3G71V 1VQLV 1VQ5V 3CCLV 3I55V 4WF9V 1K73W 3CC7V 1YIJV 1YHQV 1YJ9V 1Q81W 3CMAV
chains in the Genus database with same CATH superfamily
4TT3G 1SS3A 3E86A 4NYKA 3JAMN 4B7EA 2R9RB 1HW7A 3QO8A 2QGNA 5LMUO 4XDLA 4EFBA 3K04A 4B3RB 1RM1C 3AK3A 4ABMA 4JI5O 1XQ8A 3JAKB 1B6QA 5LOVA 4I7ZB 1X4TA 2WLIB 4LCUC 2XTAA 3M99B 3W7UA 2ZINA 1ZX3A 2QTSA 4DR4O 2ZDIC 4GX5A 2YSUB 4LBEC 5KLVH 4WCEV 3JARA 5B66Z 1H8HG 1XI1A 2YI9A 2R70A 2Z5UA 3A0RA 2Z3YA 2DN9A 3J7AU 2JJ2G 1WNSA 2BE3A 3W7TA 4JV5B 4F6RA 5IYBO 1WA8A 3L73H 2WLJA 4TUYB 3N2GB 4X20B 4JI7B 4J7KA 2ODMA 2F23A 3CRQA 4LF5O 4FM0A 4MVOA 3E8HA 4I55B 1I7FA 1RSOA 3K5OA 3RYCA 1FKAO 2IH3C 4PI0A 4DV5B 4JGSA 2KSDA 1IBMB 3IC7A 1MSWD 4JAVA 3U10A 3CCVV 1S0VA 2DYRC 2QM8A 2PYLA 4R6ZA 1K8AW 3FB7C 3T1CA 4DR2B 3CPWU 1MABG 5IJ0B 1FJGB 5H6RA 1WPBA 1ZLZA 3RWRD 5L3DA 5IWAB 4GZRB 5LA6B 3RYFB 2OCCB 3JSLA 2EJ7A 4JV5O 1AR5A 2QWNB 4X89A 1O9HA 4BAYA 1QVGU 4JI0B 5KUKA 3OTOO 2FTKA 4UCOA 5H5NA 4MW8A 5C93A 4JAAA 1M57B 1PL0A 4PELA 2V7QG 2OWOA 1JMKC 3BY6A 1XNRO 4X8AA 4JI6B 1CXZB 2PYJA 2E76B 1WLEA 3HKEB 3AG2B 1SC5B 1JQ0A 2EIJB 3RT3C 4RWUA 1SQVH 2C2AA 1VARA 5JQGA 1PM9A 5EYPA 3Q4HB 2GUZA 5CN0A 4ZOLB 3G6BA 2CTWA 4J41A 2JS5A 1R3LC 2YIBD 3ML0A 4NTXA 4U7OA 1XHXA 2ZE7A 4JTCB 5DN6G 2D3OW 1Y66A 3DXRB 1ZUQA 2UUCB 5ITZB 3GB7C 4DV0O 4U3FH 3SYAA 1NH2D 2JJ1G 1BQZA 2H3OA 2WA4A 5LMNO 4Q6GA 3AEIA 2QEXV 1AB3A 2QWRB 2P7TC 3FKSG 3PN1A 5IY5B 1E1RG 3BHPA 1K97A 3QTCA 4OX9B 1WB8A 4JI3B 2WLLB 3CE2A 1V55B 4B3TO 2DJVA 3CB2A 5BZBA 1XMOB 5CB4B 2YXYA 2X6CA 2ZNJA 4UVAA 1BHAA 4OXSA 3CC7V 3H9VA 1W0JG 4X64B 3TK1A 4Z2WA 1Q6UA 1K3EA 2EBOA 2KKWA 4X62O 5JWPA 3N2GA 2YS8A 2DYSC 1VQ4V 5JJNB 3ASNB 2WA3A 3RYFA 3E83A 2WAMA 3OMAB 2CTPA 3U0ZA 4PA9A 1TUEB 2LW7A 4FK5C 2LGWA 4X88A 1G1XB 2R9IA 5JCOC 1OCCB 4O2BA 4ZIBA 3UQ8A 2AHYA 1KB9F 2PI4A 3TXSA 3X2QC 4EB6B 3CSXA 3JAKA 4LFBO 3B8MA 4R8CA 3SJBC 3LSQA 2M7WA 4DV2B 5EZYB 3ZHUA 2XNDG 4GKJB 1JR9A 3QNEA 5ITZA 1KBHA 2ETNA 3RN4A 1AR4A 4LF6B 4DR2O 1JJOA 3L72H 4JI8O 4QJFB 4BIUA 3ABLC 4H37A 4DR4B 1HNWO 4H44B 5K1XA 1RP3B 3DXRA 4FM2A 3L75H 3ZHTA 3LNNA 4MVSA 3CMAV 2UXXA 2HHHB 3ZMUA 2UUBB 3OFNG 3S3XA 1MOFA 5CBGA 2Q67A 3CYOA 1IBMO 1PP9H 3KCXA 4PD4F 1TA8A 4U3JB 2AZ2A 1AP6A 3ZEDA 2ZKOA 1COWG 5H9CA 1NU1H 4JTAB 1Y67A 4DR6B 2LGQA 1N0JA 1LNQA 3AG3C 1YCIA 4UFZA 3OGCC 4TQDA 2QTOA 1GN4A 2DE0X 2F93B 3OW2U 3CCMV 4XDKA 1BGYH 1U96A 2BOCC 2Q73A 2IJJA 2F95B 3UCSC 1NR1A 1Q86W 2HP8A 3SR2C 1XMOO 4FLTA 2YIDA 4CH5A 2E74B 2N74A 1QNMA 4WFFA 4OX9O 1LR1A 3MAQA 2Q0OC 2P5OA 1DF4A 5KA5A 2IJHA 4F4LA 3RFRA 5KMGB 1JOYA 3K5MA 1J95A 1NZ6A 3TCUA 4UXNA 3ZBHA 1JJ2U 4IHJB 2FB5A 2ZXWB 4DV0B 3JATB 1M56C 1OCCC 3H1KH 1XEQA 4DR3O 1Q3EA 5FNVB 3A0HZ 4Z1VA 1PNLA 2CAZC 2W6IG 3E2EA 3ABMC 1I94B 1FFXA 1FXKA 4CS3A 2CK3G 5IYZA 4UCUA 4K3AA 2JK5C 2K9PA 2RJZA 2QM7A 3OT7A 3A8TA 3Q4HA 4JI2O 5H2FZ 2JGUA 4NTYA 1NBMG 4OPHA 4LF7O 3BEHA 4XDJA 4JYCA 3UO3A 4GX1A 1SERA 3KG2A 1R6TA 1WPXA 3JALA 4ASUG 1EFRG 3H1HH 4FFKA 1SA0B 1CEZA 4MVRA 3CWBH 4IIJA 1ZL8B 3ZCCA 2H8PC 2HKOA 1XNRB 1BL8A 1IZ3A 1K5QA 1Y6XA 5L3CA 4ZOLA 2LQTA 3JSNA 3CXCU 5LP6C 4BR6A 1SKVA 3OTFA 1NQTA 1OCZB 1MZFA 4X1IA 2GTAA 3BABA 3WB2A 2LW1A 3CS5A 2RN9A 1VMGA 3K08A 1S77D 2IW5A 1ZAUA 1OZ0A 1QLNA 3F5WC 4K35A 1AJNA 4X65B 4BWAA 3P3NA 3SPCA 3C3SA 1YVWA 3CCQV 1O9GA 3K0DA 5HFMA 2RCVA 4DV5O 2EULA 2P4VA 1NI8A 4KUMA 5EZYA 2B1GA 3S3WA 5BMVA 1VEWA 3T1HB 2QWPB 2UUAO 2JS3A 5KAIZ 5GONA 1FAFA 1YJWV 4LC1A 4I50A 3O65A 4DV7B 1Q82W 1HNZB 3DSQA 4EKWA 3E89A 4PDMA 3VQYA 1W2BU 3D3QA 4PDLA 1IXBA 3A2FA 1E79G 3R66A 5BR8O 1M56B 3K57A 4ZHQB 4GUNA 4NXNB 4P9PA 3JALB 4J10A 4J80A 3E35A 4YJ2A 4PHZA 2YXHA 4D7TA 4TWKA 1K9MW 1K92A 3LDDA 4MVZA 2K1EA 4DRXB 2ZE8A 1EN6A 1R73A 3FX7A 4UV8A 4KFMA 3RYHB 1IX9A 2YICA 1YJ9V 1AI7A 4GCZA 1FYJA 1YITV 1P84F 1AILA 4EB6A 4WBNA 2F66C 3STZC 3GVMA 3N2KA 1OCZC 2DYRB 5JH7B 5FNVA 2B5UA 2WLLA 2NN4A 4HAMA 2H94A 2N05A 4FLWA 1QVFU 4O2AA 1YTFD 2Q8VA 4TV9B 5DM6V 3ETQA 2FL4A 4WBNB 3OUSA 4QNHB 4B3SO 3QVNA 1FXVA 1BS3A 1VQNV 4CH6A 2HFEC 1LUVA 3RYHA 2FYUH 2FKXA 2DWDC 4HBNA 4TUYA 2CH7B 4P30A 1D5NA 2VS0A 5KX5B 2M6YA 3CX5F 1QQCA 5LXTB 1GN2A 2X0LA 1ZTEA 1XREA 4FJCC 5B1NA 4DR5B 4GLXA 3ZHQA 4YIOA 1GKFA 2DMXA 1F7YA 1Y74B 4D7SA 3AK2A 4LF9O 5IJ9B 4NTWA 4LF4O 5B1OA 4FMTA 1SETA 5JVDB 3TETA 1MA1A 2UXDB 1YHQV 1OV9A 1I08A 3WB0A 1BZKA 4E4EA 1B3QA 2F4VO 1SQFA 3T2MA 1VQPV 2Y0IA 4FPPA 2PF4E 5J2UB 2W0FC 2VRZA 1SA0A 3F5TA 5B1AB 5E79Z 5CA3A 2JGDB 3BA8A 3G80A 2ZR2A 1K5SA 1YF2A 5FLXN 2Y0PA 1AROP 3EFFK 3BFRA 1GK9A 3ZHRA 2KG7B 3WFVA 1EBOA 2GUZB 3NR7A 5LBQA 2Q7HA 3QG5A 1RPRA 2AXTZ 4DW1A 2R72A 4OPAA 4QE9A 2PGGA 4BIZA 4CC6A 1AJPA 3BPZA 3ZMTA 3JATA 4RQEA 2V4DA 1Y74A 1GH6A 4JYAO 4JI8B 3FB5C 2VQFB 2Q5ZA 2NLJC 4HNAA 3B77A 4JI4O 4U3JA 3ASOC 3C3TA 5EK0A 3OGIB 4YIPA 1NTKH 4LFBB 2JDIG 3OR7C 2HLDG 2E3CA 4EFEA 2EIKC 3G71V 3MDSA 3K79A 3WU2Z 2ITCC 1QLEB 1M5IA 3W7XA 4DXWA 3ICXA 2Y4UA 2YUAA 2QJ1A 1VQOV 3ZIAG 4LR3A 4O4JB 3AG2C 2A79B 3SJCC 4PA6A 4ZI7B 4LF5B 1RM1B 5KHGA 4JZ2A 4FLXA 3GWOA 1RSOB 3FB8C 1T5EA 2CH7A 1SF9A 3CXHF 2DW4A 3VQVA 1DF5A 1JFFB 2QSAA 2HVKC 3AG1C 1VQ6V 2EIJC 3SYQA 3ABLB 5FL7G 1IBLB 1HR0B 4I5SA 1IURA 2QE7G 4O4JA 1OCRB 2ZIMA 3AG4B 1NS1A 4CS4A 1AP5A 4J7ZA 1YIJV 4LWSA 3U11A 1P7GA 1VQ7V 1WB7A 4RAIA 3RYIA 1L0NH 2RQ6A 3CRRA 2Q69A 1BE3H 2X6BA 1NT2B 4YHHB 5LP6A 1V54B 4DRXA 5BY1A 4G27B 2IJKA 1TVKB 5L3GA 1Q6IA 3K5NA 5LOVB 4NKGB 3ETEA 3OEHG 3MHHC 5C8YA 1F4NA 4GKKB 2WLIA 4DR1O 3LUTB 4MVQA 4GT1A 1I5YA 1S5HC 2FMLA 1XOUA 5LGTA 4BW5A 2UUAB 4DUZB 3IGAC 1Q90D 3ASOB 2ZCEA 5LP6B 1KECA 3L74H 4X66B 1KKCA 3RVZA 1ROPA 4TQFA 4DR7B 4LF8O 3SJQC 2IU0A 3RGBA 2QM4A 1R6NA 5K1PA 1GM8A 1QR8A 4MTXA 4X9QA 3THOA 1AR1B 3A0BZ 4TOIA 2PI5A 3L71H 3DC6A 4DV1B 4H33A 2ZM6B 3OAAG 4BW9A 1GO3F 3VQXA 2Y69B 4KL1A 2OYQA 2UXNA 2BOBC 4I9WA 4LF9B 2JEXA 4PI2A 4EEQA 3CRMA 1KMIZ 1FXHA 2JVDA 4D6TH 1H2SB 2HVJC 2XAFA 2R9AA 1L8DA 1KU9A 4LFCB 3UM7A 4J9ZB 1H2LA 4O4IB 3ZHVA 3K59A 4JTDB 5A2QN 1FXKC 4PA3A 2QA4V 4L87A 4FIPC 3K3WA 1ZWIC 4HZ3A 5FPOA 2IH1C 3IC9A 2KB1A 1Q7YW 1NTZH 3HKEA 1XBLA 2GSMB 1XL6A 4YY3O 5CB4A 5LHHA 1BCCH 3JAWA 1A32A 4RUEA 3ZRXA 4MTOA 3HKCB 4AI8A 1UPGA 3K9AA 4O4IA 5KHHA 3FD9A 4DR3B 4FZ1A 3TXQA 1IXMA 4JI1O 5TISZ 1P49A 1XILA 2HJFC 3JD3A 2ZNIA 5KMGA 2ZM6O 2W6JG 2RNBA 1MMMA 1E1QG 4LNUA 1KYOF 4WFBV 1V54C 4UV9A 2QWQB 5B3SC 1D2DA 4KP4A 3RBZA 4F6RB 2DWEC 3D36C 4YJ2B 4PV1B 3RVYA 4B3MO 2QKAA 2HEPA 1SQPH 1BSMA 3ABKB 3T4ZA 4DV2O 2CUGA 4LFCO 2EX3A 4X1KB 5J2TB 4B3MB 3G4SV 2OTJV 4UCRA 3SYPA 3LDEA 2OCHA 2YDEA 3CCEV 2A06H 1UFIA 3ASNC 2BTQB 4NR1A 1FD9A 4DUZO 2EJRA 4I50B 1GM9A 4LH7A 2NR5A 4X1KA 2F1MA 4UUJC 5AG2A 1THZA 1VQ5V 2DOSA 4QE7A 5L3FA 1H2GA 4CS2A 4MS2A 2UUBO 1Y76A 1M57C 1S3JA 4TV8B 2P90A 5IDJA 1MG1A 2P6JA 3IJ4A 5C8YB 1NVPD 1I94O 3BCCH 3AG3B 4JYBA 1ORQC 1N0NA 4DV4B 4NVPA 3RYCB 4O4LA 1K73W 2ZE6A 4AHCA 3W7SA 5KX5A 2IJIA 1EN5A 2PTMA 2UU9O 2GBOA 2F4VB 1KKDA 1NVPB 4LF8B 1OJHA 3KKYA 4DR7O 3HKBB 4DUYO 3UKMA 3WG7C 1R3JC 4FFBA 4ZKIA 4O4HA 3STLC 4IIJB 2WLNA 1EZVH 1H38A 1B06A 3H1JH 1QBZA 3FB6C 1RPOA 1IBKB 1TVKA 2KQXA 2CTQA 1SQQH 2B1IA 4FLUA 2QWOB 2IBZH 4LF7B 3N2KB 1YEWA 3F7YC 2EILB 2JEUA 1M90W 4DR5O 5A9GA 1FXKB 5IYZB 5GTHZ 3LSUA 2N04A 4LFAO 3CCRV 3IAYA 4WFGA 4YJ3B 4DYLA 2XUMA 4JF3A 3AG7A 1TUBA 1YSCA 3OUFA 1IBLO 4IGGA 3N27A 1JX9A 5EBWC 2ZE5A 2BSKA 2MK3A 1SQXH 4B3TB 1K34A 4AQYB 3AK1A 1H8EG 4XBFA 2AGAA 3CEIA 4FVMA 1ENVA 2W0XA 2B9ZA 4MSWC 3OEEG 3L70H 4DV6B 1S72V 1WP7A 4MTGA 3HB3B 1VF6C 4NXMB 3ABKC 4GYCB 3BA9A 1Y76B 1SQBH 5GONB 1VQ9V 4NXNO 3B09A 4IYHA 1S5JA 1YZBA 3TJTA 2X7RB 4G2KA 1G4YB 2IU3A 5BXZA 4CH4A 1BHBA 1TGOA 3CCLV 3I55V 3GWKC 1K4DC 5B1BB 1UJWB 3ZMVA 1W59A 3SDLA 4LH6A 1YTFB 1K33A 4YHHO 4FLYA 1PNKA 5GW7A 4N23A 2UXCB 1PPJH 3ZRWB 1WP8A 4DV1O 3JCUZ 1DGSA 1R3IC 3E8BA 4GX2A 2F43G 3B4SA 3FYEB 3WG7B 4RUFA 3JD0A 5J2TA 1XNQB 1NR7A 5KHIA 2L6LA 5EIBD 4YY3B 2UXBO 3ABUA 3ZRVA 4RQFA 4N21A 1Z2GA 2OT5A 1QR9A 3HKCA 2O57A 1D5AA 1AI6A 1F51A 5IYDO 3ZS8C 3VQWA 2MW2B 3M7MX 1OCOC 1PKXA 2VWJA 3OE7G 1HNZO 4MVUA 4PJ0Z 2DQ0A 3HKDA 3O9OA 5EBLC 3SPIA 4TV9A 4X1IB 4JAUA 3LDCA 1OHHG 4O2BB 3P32A 3EXAA 2X6AA 1PV0A 4MVMA 4CC5A 3ETDA 2AHZA 5B3SB 4PDVA 1EN4A 4IHJA 2XT9A 1ZL8A 3EVKA 1S5LZ 3FAVB 1KC8W 4JI7O 3ABMB 2CGOA 2Q0AA 3QO5A 3LNMB 5CA1A 3CCJV 1VQ8V 4P9OA 4X20A 1L1FA 3F7VC 4PDRA 5EBMC 2YC0A 1SQGA 1WA8B 1Q81W 2HG5C 3OMIB 4LF4B 1KUQA 4LFAB 1VQMV 3UT5B 3K06A 3T4DA 2A9HA 4HNAB 3I56V 1HNXB 5CBFA 3E8GA 5KAFZ 2G38A 4B3SB 2Q7GA 1M4UA 3MD0A 3ZHSA 3G6EV 2WPDG 4CZZA 2XAGA 2RDCA 1KP2A 3B8NA 4DR1B 1R1BA 2CGNA 2ILMA 3T1YB 1P4RA 1SZTA 4JI3O 3CC4V 2RMKB 5L3EA 4K0KB 2OIGA 2YIAA 4B3RO 2XASA 1FFTB 4TV8A 4DV7O 3K58A 2Q7EA 3D36A 4JI6O 4BIOA 1K7DA 4DV6O 1PL4A 2L35A 3E8FA 2LFSA 1BT8A 3HPLC 5CA0B 1OCRC 1I5XA 2CE4A 3BRCA 4DV3O 3SGIA 4WFHA 4YXWG 1GN3A 4WFAV 3R65A 1K4CC 1U97A 1JCHA 1GMGA 5CA0A 3DTUB 4KHPB 1AJQA 2NNUA 4YJ3A 3WB1A 3LSSA 3T1YO 1H2MA 5DECA 1MZEA 3RYIB 5IY5C 4ZI7A 1YDXA 3DGEA 2WLMA 3K5LA 2Q9LA 5IT9N 4FZ0A 5B1AC 3JD4A 3J81N 4Z1MG 3OTOB 3VOUA 2AW9A 1EM1A 2P22C 5BMVB 1Z5WA 2DQ3A 2QR4A 5LXTA 3ZX6A 1LUWA 2UU9B 4DK1A 2UXBB 3X2QB 1Y4MA 3EHBB 2E5LB 4LNUB 1TAEA 5IJ0A 4LF6O 1QU7A 3K0GA 1JVMA 3ZN0A 4TSFG 1Z5VA 1Q6HA 5LL6Y 2ZT9B 5LGUA 2E5LO 4UVBA 1I0HA 4JYAB 2P4KA 3ZN1A 5KHJA 4K8ZA 3SPHA 3JD1A 5H6QA 1VF6A 3MHSC 5EC1C 1Q5OA 3SPJA 1DTOA 3VBBA 2VQEB 3HR0A 1FPOA 5L3BA 1SESA 2VQEO 3D8CA 1XDCA 1VIBA 3D3IA 2YIBA 5KUMA 5B1BC 3RW0A 4PA4A 4O4LB 1Q43A 2EIKB 2Y4TA 5IE9A 4LWSB 4F6EA 3C90A 3I5DA 5LMNB 4P2ZA 5LYJB 1US6A 1G8MA 1B04A 2ITDC 3BAAA 4JASA 5JQGB 2EZOA 4W4KA 3CMEV 1KD1W 1DLBA 2GHYA 4UB8Z 1AVMA 4JI2B 1QHTA 1FFXB 1PD3A 2UUCO 1H2NA 1P7BA 1JFFA 2EZPA 3JCZA 4AILC 5LHGA 1XHZA 1W0KG 3BVOA 5LGNA 4K0KO 3AG4C 1HP8A 5IJ9A 4K8XA 1SZXA 2IM9A 1AI4A 4JYYA 3CC2V 2KG7A 3JD2A 5B5EZ 1GN6A 2E75B 2ZQMA 4DV3B 1IDSA 2HJDA 1DK1A 4A5UB 4G28B 2WWWA 3CRAA 2GTSA 4I0XB 4OGQB 3P30A 2XAJA 1V55C 1VF7A 1BQ0A 1MNGA 5J2UA 1RFYA 4ICGA 4J7JA 3OR6C 2Q68A 3ZJZA 1N36O 2ARHA 1XL4A 2A3QA 4JI4B 4FM1A 5JJEB 2P67A 4NXMO 1OCOB 1VP7A 3KCYA 2Y48A 2XHBA 1XMQB 4X1YB 2OIEA 5LHIA 3H1LH 4I55A 3SJAC 1FJGO 1VQKV 2Z0AA 4CBCA 4GKKO 5JCOA 1AI5A 3UT5A 3B40A 1S76D 4DW0A 3TGUH 1L0LH 1M1KW 5CBHA 1NJIW 3QO7A 2YEVA 2OCCC 2Q6AA 4X66O 3G67A 2PY5A 2HHHO 3CHXA 5LYJA 5CA1B 2ZIOA 2JGDA 2JIZG 3OD4A 5IYCO 3DC5A 4X65O 4DK0A 1N34O 1R3KC 4U7NA 3JASA 1M9NA 4O4HB 3P3PA 3APOA 2EIMC 2VQFO 1X59A 2LO1A 5JH7A 4J42A 3CJHA 4FLVA 3E22B 2EINB 5F2VO 4GKJO 2XAHA 3UO2A 1GM7A 3CJHB 3ZMSA 2AZ0A 3SYOA 2ADPA 4WFEA 5EC2C 3CCSV 1WN7A 2V1DA 4B08A 1J5EO 4JI0O 4I9QA 4JZGA 1HNWB 2LJ2A 4DV4O 1SRYA 2A7WA 2XOKG 1WJZA 3JASB 3SYCA 5EIBC 4NB5A 1N33O 4W4LA 4KHPO 4JI1B 3FFQA 1CPYA 1F23A 2VWKA 3PJSK 5EYPB 4IL6Z 4RO2A 3T1HO 1GTOA 3FAVA 2UXCO 3JARB 2LFRA 3SPGA 4WF9V 1M93A 2PUSA 2QKSA 1G6UA 1HWYA 4IT5A 2EILC 1YI2V 1XMQO 1HDJA 1N32O 3ZRWA 4J9YB 4UCTA 5LMUB 4X62B 2P06A 4R7CA 5BR8B 5KHKA 4MT8A 4UCSA 4E2LA 1N4CA 2ZD9A 1GRJA 2ZXWC 5JJJB 4FLZA 2Q4PA 3K9SA 2ATKC 4IYIA 2YEVB 4H0LB 2CDYA 5E1AC 2QDOA 3ZRSA 1IBKO 3W7WA 4DO2A 2DYSB 1HNXO 1R6KA 5D5PA 2HR3A 1N8RW 1IVSA 4QPKA 3NXSA 2A0LA 1V9PA 4QPJA 4DUYB 3L9DA 1N33B 2BTQA 5GTIZ 2ZDIA 4HYOA 5DEDA 4DR6O 1F4MA 1NKDA 1KQSU 2D2CB 4QIWF 4ZBMA 3ZMZA 4J11A 1N34B 4MTFA 1MSDA 1WAZA 4KXRA 1BMFG 4JI5B 2WLHA 2GV9A 4UB6Z 2Y69C 1HR0O 1TUBB 4I4TB 1KP3A 4R50A 1J5EB 3B2EE 3CD6V 4UCVA 1JPXA 3ABTA 5KA6A 2WLKA 1PNMA 1FS0G 1NTMH 2EINC 3JAWB 2PZSA 1QLEC 2QKCA 3HKDB 3ETGA 4PA7A 2BCCH 4I4TA 4L8JA 5LA6A 5HFLA 3E22A 2EIMB 3CP1A 3AG1B 4GX0A 3HKBA 1H2KA 1NH2B 3IFXA 4AQYO 4FFBB 4O2AB 4H13B 4Q20A 5J9PC 4LP8A 3FYIB 2CTRA 2OTLV 1JA8A 1QCEA 1YXBA 3CCUV 1N36B 1XUQA 1YJNV 2ZR3A 5IWAO 4QGPA 5CMUA 2LP7A 3OMNB 3APQA 1VQLV 4I0XA 3H01A 3H1IH 4JPRA 1XNQO 2XAQA 1CP9A 3OM3B 3JYCA 4ZHQA 1VF5B 2UXDO 1URFA 4B7KA 4MW3A 5D5QA 4X64O 2YXLA 5JVDA 2ADQB 4C7UA 4X1YA 4CH3A 3M8AA 1ZSPA 2WSSG 2YI8A 2BTOA 2JRIA 2BSKB 1EZJA 3KZIZ 4UVCA 3J80N 3QF7A 5FPRA 2GDSA 1N32B 3CRCA 3K03A 1Q8IA 1GAXA
chains in the Genus database with same CATH topology
4TT3G 2KB1A 2IW5A 3EHBB 1Q7YW 3E86A 1OZ0A 3K0GA 1JVMA 2GSMB 2R9RB 1XL6A 3ZN0A 4TSFG 1QLNA 3F5WC 3QO8A 5LHHA 4XDLA 1S77D 4RUEA 3ZRXA 4MTOA 5LGUA 3K04A 4UVBA 1AJNA 1RM1C 3SPCA 3K9AA 3CCQV 1B6QA 3ZN1A 3K0DA 5HFMA 2WLIB 4LCUC 1IXMA 3SPHA 3JD1A 3M99B 3W7UA 5H6QA 3MHSC 5EC1C 3SPJA 1DTOA 3VBBA 2HJFC 3JD3A 4KUMA 2B1GA 2W6JG 1E1QG 5L3BA 2ZDIC 4GX5A 4WFBV 1V54C 2YSUB 4UV9A 1SESA 4LBEC 5B3SC 4KP4A 3RBZA 1YJWV 3D3IA 4WCEV 4LC1A 2DWEC 5KUMA 5B1BC 3RW0A 4PA4A 3RVYA 2EIKB 1H8HG 1Q82W 2Z5UA 4EKWA 3E89A 3ABKB 4PDMA 3T4ZA 3A0RA 1W2BU 4PDLA 2Z3YA 4P2ZA 3G4SV 1G8MA 2OTJV 2ITDC 3SYPA 1E79G 4JASA 2EZOA 2JJ2G 3LDEA 3W7TA 3CCEV 3CMEV 1M56B 3ASNC 1KD1W 1DLBA 2GHYA 5IYBO 4P9PA 2EJRA 3E35A 1GM9A 4TWKA 2WLJA 1K9MW 1K92A 3LDDA 4MVZA 2K1EA 1PD3A 1R73A 1P7BA 4UUJC 4UV8A 1THZA 2EZPA 3JCZA 4KFMA 5LHGA 1VQ5V 1W0KG 4QE7A 5L3FA 1YJ9V 1H2GA 5LGNA 4MVOA 4MS2A 3AG4C 1AI7A 3E8HA 4GCZA 1YITV 1M57C 1S3JA 1AI4A 3CC2V 3JD2A 2P90A 3STZC 5IDJA 2IH3C 1MG1A 4JGSA 2ZQMA 3IC7A 1MSWD 1OCZC 2P6JA 2DYRB 4JAVA 2B5UA 1NVPD 4G28B 2WLLA 2WWWA 3CCVV 1S0VA 2DYRC 2QM8A 4HAMA 2H94A 3AG3B 4JYBA 1QVFU 1ORQC 4R6ZA 1YTFD 1K8AW 3FB7C 3P30A 3T1CA 2XAJA 1V55C 5DM6V 3CPWU 1MABG 3OUSA 1K73W 4QNHB 5H6RA 3W7SA 1FXVA 1VQNV 5L3DA 2IJIA 3OR6C 2HFEC 2OCCB 2Q68A 3ZJZA 4X89A 4BAYA 1KKDA 1NVPB 1QVGU 1XL4A 3UKMA 2P67A 2DWDC 1R3JC 3WG7C 4ZKIA 4P30A 3STLC 5KUKA 1OCOB 2FTKA 2WLNA 1H38A 4MW8A 5C93A 1M57B 1QBZA 1PL0A 3FB6C 4PELA 1RPOA 2Y48A 2V7QG 2X0LA 4FJCC 5B1NA 5LHIA 2B1IA 3BY6A 1VQKV 4X8AA 4CBCA 1GKFA 3F7YC 2EILB 2JEUA 1AI5A 1M90W 1S76D 1WLEA 1FXKB 3AG2B 1M1KW 5B1OA 3CCRV 4FMTA 1SETA 4WFGA 5CBHA 1JQ0A 2EIJB 3TETA 1NJIW 3QO7A 2YEVA 4JF3A 2OCCC 2Q6AA 2C2AA 1YHQV 1YSCA 3OUFA 5CN0A 3T2MA 1VQPV 2JIZG 5IYCO 1JX9A 1R3LC 5EBWC 4FPPA 3ML0A 4U7OA 2W0FC 1R3KC 4U7NA 2MK3A 4JTCB 5DN6G 1K34A 2D3OW 1M9NA 1Y66A 5B1AB 5CA3A 1H8EG 4XBFA 2ZR2A 3GB7C 1ENVA 1K5SA 2EIMC 3SYAA 1NH2D 4MSWC 2JJ1G 3OEEG 1S72V 1AROP 4MTGA 3HB3B 3AEIA 2QEXV 3EFFK 1GK9A 2EINB 2P7TC 3ABKC 3WFVA 1EBOA 3FKSG 2XAHA 5IY5B 1GM7A 3ZMSA 1E1RG 1VQ9V 1K97A 5LBQA 3SYOA 2WLLB 4WFEA 5EC2C 1RPRA 1V55B 3CCSV 5BZBA 2V1DA 2X7RB 4G2KA 1G4YB 4QE9A 2IU3A 4BIZA 2X6CA 1SRYA 1AJPA 1BHBA 3CCLV 2XOKG 4UVAA 3ZMTA 3I55V 4RQEA 4OXSA 1K4DC 3CC7V 5B1BB 1BHAA 3FB5C 3SYCA 1UJWB 3ZMVA 1YTFB 1K33A 1W0JG 3TK1A 1PNKA 1K3EA 2EBOA 5GW7A 2NLJC 1CPYA 1F23A 3PJSK 4N23A 3ZRWB 3B77A 4RO2A 5EK0A 3ASOC 1GTOA 2DYSC 1VQ4V 3ASNB 1R3IC 2JDIG 3E83A 3E8BA 3OR7C 2LFRA 2WAMA 4GX2A 2HLDG 2F43G 3OMAB 3SPGA 2EIKC 4PA9A 3G71V 1TUEB 3K79A 2ITCC 4WF9V 4FK5C 3FYEB 1QLEB 2QKSA 3WG7B 4X88A 3W7XA 1HWYA 4RUFA 3JD0A 4DXWA 2EILC 2R9IA 1YI2V 1NR7A 1OCCB 3ZRWA 1VQOV 3ZIAG 4J9YB 3AG2C 2A79B 4PA6A 2AHYA 2PI4A 3ABUA 1RM1B 3ZRVA 4R7CA 3X2QC 4MT8A 3GWOA 4RQFA 3FB8C 4N21A 2OT5A 3B8MA 4R8CA 4E2LA 1QR9A 2ZD9A 3LSQA 2M7WA 2ZXWC 2ATKC 2YEVB 2DW4A 1AI6A 1DF5A 1F51A 2XNDG 2HVKC 5IYDO 3AG1C 3QNEA 1VQ6V 1OCOC 2EIJC 5E1AC 1PKXA 3SYQA 3OE7G 3ABLB 5FL7G 3ZRSA 3W7WA 4MVUA 4DO2A 2DYSB 4QJFB 1R6KA 2DQ0A 2HR3A 3ABLC 4I5SA 5EBLC 4H37A 3SPIA 4BIUA 1N8RW 4QPKA 4JAUA 2QE7G 3NXSA 2A0LA 3LDCA 1OHHG 1OCRB 4QPJA 3P32A 3AG4B 2X6AA 4MVMA 3ETDA 1YIJV 4MVSA 3CMAV 2UXXA 2AHZA 5B3SB 2ZDIA 1VQ7V 3ZMUA 4PDVA 3OFNG 4HYOA 1F4MA 1MOFA 1NKDA 4RAIA 5CBGA 1KQSU 2Q67A 3CYOA 1KC8W 4QIWF 4ZBMA 2Q69A 3ZMZA 3ABMB 2X6BA 1COWG 3QO5A 4MTFA 5H9CA 4JTAB 1BMFG 3LNMB 3CCJV 2WLHA 1VQ8V 4P9OA 2Y69C 1LNQA 1V54B 1L1FA 3F7VC 4PDRA 3AG3C 2IJKA 4G27B 5EBMC 3OGCC 5L3GA 2QTOA 1Q81W 2HG5C 1KP3A 3OMIB 4R50A 3OW2U 3CCMV 3CD6V 1JPXA 4XDKA 1VQMV 3ETEA 3OEHG 2BOCC 3K06A 2A9HA 3T4DA 2IJJA 3ABTA 3MHHC 3I56V 5KA6A 2WLKA 1NR1A 1PNMA 1FS0G 2EINC 1Q86W 1QLEC 5CBFA 1F4NA 3E8GA 3ETGA 4PA7A 2WLIA 3LUTB 3MD0A 4MVQA 5HFLA 4GT1A 1I5YA 3G6EV 2WPDG 1S5HC 2EIMB 3CP1A 4CZZA 3AG1B 4GX0A 4BW5A 5LGTA 4WFFA 3IGAC 2XAGA 1KP2A 3ASOB 3B8NA 1NH2B 1KECA 3IFXA 1DF4A 4Q20A 1P4RA 5J9PC 4LP8A 3X2QB 5KA5A 2IJHA 3FYIB 2OTLV 4F4LA 1JOYA 3RVZA 1ROPA 1SZTA 1QCEA 1J95A 3SJQC 3CCUV 3TCUA 3CC4V 4UXNA 2IU0A 1JJ2U 5L3EA 1YJNV 1R6NA 2ZR3A 2XASA 2ZXWB 1FFTB 1M56C 5CMUA 1GM8A 3D36A 1OCCC 2LP7A 3OMNB 1QR8A 1VQLV 4MTXA 1K7DA 3H01A 1PNLA 3E8FA 2W6IG 3E2EA 3ABMC 2LFSA 1AR1B 2PI5A 4JPRA 2XAQA 3HPLC 4H33A 1OCRC 1I5XA 3OAAG 1GO3F 1FXKA 2Y69B 1CP9A 2CK3G 3OM3B 4WFHA 2UXNA 2JK5C 4YXWG 4WFAV 2QM7A 3R65A 3JYCA 1K4CC 2BOBC 4I9WA 1JCHA 1GMGA 2JEXA 4MW3A 3DTUB 1AJQA 2NNUA 1NBMG 1FXHA 3BEHA 4XDJA 4JYCA 4GX1A 1SERA 3KG2A 2HVJC 2XAFA 1WPXA 4ASUG 3LSSA 1EFRG 4J9ZB 3UM7A 1CEZA 2WSSG 4MVRA 3ZCCA 5IY5C 2H8PC 2HKOA 3DGEA 2WLMA 1BL8A 1K5QA 1EZJA 5L3CA 4JTDB 3CXCU 1FXKC 5B1AC 3JD4A 4PA3A 4Z1MG 4UVCA 1NQTA 4L87A 2QA4V 3VOUA 4FIPC 1OCZB 3K3WA 1ZWIC 2DQ3A 4HZ3A 2IH1C 3K08A 3K03A 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  1S72 V;  2QEX V;  3OW2 U;  1VQ7 V;  1VQN V;  3CCM V;  1YIT V;  1Q7Y W;  3CD6 V;  2OTJ V;  1YI2 V;  1VQK V;  3CC2 V;  1KQS U;  1VQP V;  3CCE V;  1VQM V;  1VQ6 V;  3CME V;  1VQO V;  1W2B U;  1KC8 W;  2OTL V;  4WFB V;  1KD1 W;  1QVG U;  1M90 W;  3I56 V;  1VQ9 V;  3CCU V;  1Q86 W;  3CXC U;  3CC4 V;  1YJW V;  4WFA V;  2D3O W;  1JJ2 U;  2QA4 V;  1YJN V;  4WCE V;  3CCV V;  1VQ4 V;  1K9M W;  3CCJ V;  1N8R W;  1VQ8 V;  1M1K W;  3CCR V;  3CCS V;  3CCQ V;  1QVF U;  1R73 A;  1Q82 W;  3G6E V;  1NJI W;  1K8A W;  5DM6 V;  3CPW U;  3G71 V;  1VQL V;  1VQ5 V;  3CCL V;  3I55 V;  4WF9 V;  1K73 W;  3CC7 V;  1YIJ V;  1YHQ V;  1YJ9 V;  1Q81 W;  3CMA V; 
#chains in the Genus database with same CATH topology
 4TT3 G;  1SS3 A;  3E86 A;  4NYK A;  3JAM N;  4B7E A;  2R9R B;  1HW7 A;  3QO8 A;  2QGN A;  5LMU O;  4XDL A;  4EFB A;  3K04 A;  4B3R B;  1RM1 C;  3AK3 A;  4ABM A;  4JI5 O;  1XQ8 A;  3JAK B;  1B6Q A;  5LOV A;  4I7Z B;  1X4T A;  2WLI B;  4LCU C;  2XTA A;  3M99 B;  3W7U A;  2ZIN A;  1ZX3 A;  2QTS A;  4DR4 O;  2ZDI C;  4GX5 A;  2YSU B;  4LBE C;  5KLV H;  4WCE V;  3JAR A;  5B66 Z;  1H8H G;  1XI1 A;  2YI9 A;  2R70 A;  2Z5U A;  3A0R A;  2Z3Y A;  2DN9 A;  3J7A U;  2JJ2 G;  1WNS A;  2BE3 A;  3W7T A;  4JV5 B;  4F6R A;  5IYB O;  1WA8 A;  3L73 H;  2WLJ A;  4TUY B;  3N2G B;  4X20 B;  4JI7 B;  4J7K A;  2ODM A;  2F23 A;  3CRQ A;  4LF5 O;  4FM0 A;  4MVO A;  3E8H A;  4I55 B;  1I7F A;  1RSO A;  3K5O A;  3RYC A;  1FKA O;  2IH3 C;  4PI0 A;  4DV5 B;  4JGS A;  2KSD A;  1IBM B;  3IC7 A;  1MSW D;  4JAV A;  3U10 A;  3CCV V;  1S0V A;  2DYR C;  2QM8 A;  2PYL A;  4R6Z A;  1K8A W;  3FB7 C;  3T1C A;  4DR2 B;  3CPW U;  1MAB G;  5IJ0 B;  1FJG B;  5H6R A;  1WPB A;  1ZLZ A;  3RWR D;  5L3D A;  5IWA B;  4GZR B;  5LA6 B;  3RYF B;  2OCC B;  3JSL A;  2EJ7 A;  4JV5 O;  1AR5 A;  2QWN B;  4X89 A;  1O9H A;  4BAY A;  1QVG U;  4JI0 B;  5KUK A;  3OTO O;  2FTK A;  4UCO A;  5H5N A;  4MW8 A;  5C93 A;  4JAA A;  1M57 B;  1PL0 A;  4PEL A;  2V7Q G;  2OWO A;  1JMK C;  3BY6 A;  1XNR O;  4X8A A;  4JI6 B;  1CXZ B;  2PYJ A;  2E76 B;  1WLE A;  3HKE B;  3AG2 B;  1SC5 B;  1JQ0 A;  2EIJ B;  3RT3 C;  4RWU A;  1SQV H;  2C2A A;  1VAR A;  5JQG A;  1PM9 A;  5EYP A;  3Q4H B;  2GUZ A;  5CN0 A;  4ZOL B;  3G6B A;  2CTW A;  4J41 A;  2JS5 A;  1R3L C;  2YIB D;  3ML0 A;  4NTX A;  4U7O A;  1XHX A;  2ZE7 A;  4JTC B;  5DN6 G;  2D3O W;  1Y66 A;  3DXR B;  1ZUQ A;  2UUC B;  5ITZ B;  3GB7 C;  4DV0 O;  4U3F H;  3SYA A;  1NH2 D;  2JJ1 G;  1BQZ A;  2H3O A;  2WA4 A;  5LMN O;  4Q6G A;  3AEI A;  2QEX V;  1AB3 A;  2QWR B;  2P7T C;  3FKS G;  3PN1 A;  5IY5 B;  1E1R G;  3BHP A;  1K97 A;  3QTC A;  4OX9 B;  1WB8 A;  4JI3 B;  2WLL B;  3CE2 A;  1V55 B;  4B3T O;  2DJV A;  3CB2 A;  5BZB A;  1XMO B;  5CB4 B;  2YXY A;  2X6C A;  2ZNJ A;  4UVA A;  1BHA A;  4OXS A;  3CC7 V;  3H9V A;  1W0J G;  4X64 B;  3TK1 A;  4Z2W A;  1Q6U A;  1K3E A;  2EBO A;  2KKW A;  4X62 O;  5JWP A;  3N2G A;  2YS8 A;  2DYS C;  1VQ4 V;  5JJN B;  3ASN B;  2WA3 A;  3RYF A;  3E83 A;  2WAM A;  3OMA B;  2CTP A;  3U0Z A;  4PA9 A;  1TUE B;  2LW7 A;  4FK5 C;  2LGW A;  4X88 A;  1G1X B;  2R9I A;  5JCO C;  1OCC B;  4O2B A;  4ZIB A;  3UQ8 A;  2AHY A;  1KB9 F;  2PI4 A;  3TXS A;  3X2Q C;  4EB6 B;  3CSX A;  3JAK A;  4LFB O;  3B8M A;  4R8C A;  3SJB C;  3LSQ A;  2M7W A;  4DV2 B;  5EZY B;  3ZHU A;  2XND G;  4GKJ B;  1JR9 A;  3QNE A;  5ITZ A;  1KBH A;  2ETN A;  3RN4 A;  1AR4 A;  4LF6 B;  4DR2 O;  1JJO A;  3L72 H;  4JI8 O;  4QJF B;  4BIU A;  3ABL C;  4H37 A;  4DR4 B;  1HNW O;  4H44 B;  5K1X A;  1RP3 B;  3DXR A;  4FM2 A;  3L75 H;  3ZHT A;  3LNN A;  4MVS A;  3CMA V;  2UXX A;  2HHH B;  3ZMU A;  2UUB B;  3OFN G;  3S3X A;  1MOF A;  5CBG A;  2Q67 A;  3CYO A;  1IBM O;  1PP9 H;  3KCX A;  4PD4 F;  1TA8 A;  4U3J B;  2AZ2 A;  1AP6 A;  3ZED A;  2ZKO A;  1COW G;  5H9C A;  1NU1 H;  4JTA B;  1Y67 A;  4DR6 B;  2LGQ A;  1N0J A;  1LNQ A;  3AG3 C;  1YCI A;  4UFZ A;  3OGC C;  4TQD A;  2QTO A;  1GN4 A;  2DE0 X;  2F93 B;  3OW2 U;  3CCM V;  4XDK A;  1BGY H;  1U96 A;  2BOC C;  2Q73 A;  2IJJ A;  2F95 B;  3UCS C;  1NR1 A;  1Q86 W;  2HP8 A;  3SR2 C;  1XMO O;  4FLT A;  2YID A;  4CH5 A;  2E74 B;  2N74 A;  1QNM A;  4WFF A;  4OX9 O;  1LR1 A;  3MAQ A;  2Q0O C;  2P5O A;  1DF4 A;  5KA5 A;  2IJH A;  4F4L A;  3RFR A;  5KMG B;  1JOY A;  3K5M A;  1J95 A;  1NZ6 A;  3TCU A;  4UXN A;  3ZBH A;  1JJ2 U;  4IHJ B;  2FB5 A;  2ZXW B;  4DV0 B;  3JAT B;  1M56 C;  1OCC C;  3H1K H;  1XEQ A;  4DR3 O;  1Q3E A;  5FNV B;  3A0H Z;  4Z1V A;  1PNL A;  2CAZ C;  2W6I G;  3E2E A;  3ABM C;  1I94 B;  1FFX A;  1FXK A;  4CS3 A;  2CK3 G;  5IYZ A;  4UCU A;  4K3A A;  2JK5 C;  2K9P A;  2RJZ A;  2QM7 A;  3OT7 A;  3A8T A;  3Q4H A;  4JI2 O;  5H2F Z;  2JGU A;  4NTY A;  1NBM G;  4OPH A;  4LF7 O;  3BEH A;  4XDJ A;  4JYC A;  3UO3 A;  4GX1 A;  1SER A;  3KG2 A;  1R6T A;  1WPX A;  3JAL A;  4ASU G;  1EFR G;  3H1H H;  4FFK A;  1SA0 B;  1CEZ A;  4MVR A;  3CWB H;  4IIJ A;  1ZL8 B;  3ZCC A;  2H8P C;  2HKO A;  1XNR B;  1BL8 A;  1IZ3 A;  1K5Q A;  1Y6X A;  5L3C A;  4ZOL A;  2LQT A;  3JSN A;  3CXC U;  5LP6 C;  4BR6 A;  1SKV A;  3OTF A;  1NQT A;  1OCZ B;  1MZF A;  4X1I A;  2GTA A;  3BAB A;  3WB2 A;  2LW1 A;  3CS5 A;  2RN9 A;  1VMG A;  3K08 A;  1S77 D;  2IW5 A;  1ZAU A;  1OZ0 A;  1QLN A;  3F5W C;  4K35 A;  1AJN A;  4X65 B;  4BWA A;  3P3N A;  3SPC A;  3C3S A;  1YVW A;  3CCQ V;  1O9G A;  3K0D A;  5HFM A;  2RCV A;  4DV5 O;  2EUL A;  2P4V A;  1NI8 A;  4KUM A;  5EZY A;  2B1G A;  3S3W A;  5BMV A;  1VEW A;  3T1H B;  2QWP B;  2UUA O;  2JS3 A;  5KAI Z;  5GON A;  1FAF A;  1YJW V;  4LC1 A;  4I50 A;  3O65 A;  4DV7 B;  1Q82 W;  1HNZ B;  3DSQ A;  4EKW A;  3E89 A;  4PDM A;  3VQY A;  1W2B U;  3D3Q A;  4PDL A;  1IXB A;  3A2F A;  1E79 G;  3R66 A;  5BR8 O;  1M56 B;  3K57 A;  4ZHQ B;  4GUN A;  4NXN B;  4P9P A;  3JAL B;  4J10 A;  4J80 A;  3E35 A;  4YJ2 A;  4PHZ A;  2YXH A;  4D7T A;  4TWK A;  1K9M W;  1K92 A;  3LDD A;  4MVZ A;  2K1E A;  4DRX B;  2ZE8 A;  1EN6 A;  1R73 A;  3FX7 A;  4UV8 A;  4KFM A;  3RYH B;  1IX9 A;  2YIC A;  1YJ9 V;  1AI7 A;  4GCZ A;  1FYJ A;  1YIT V;  1P84 F;  1AIL A;  4EB6 A;  4WBN A;  2F66 C;  3STZ C;  3GVM A;  3N2K A;  1OCZ C;  2DYR B;  5JH7 B;  5FNV A;  2B5U A;  2WLL A;  2NN4 A;  4HAM A;  2H94 A;  2N05 A;  4FLW A;  1QVF U;  4O2A A;  1YTF D;  2Q8V A;  4TV9 B;  5DM6 V;  3ETQ A;  2FL4 A;  4WBN B;  3OUS A;  4QNH B;  4B3S O;  3QVN A;  1FXV A;  1BS3 A;  1VQN V;  4CH6 A;  2HFE C;  1LUV A;  3RYH A;  2FYU H;  2FKX A;  2DWD C;  4HBN A;  4TUY A;  2CH7 B;  4P30 A;  1D5N A;  2VS0 A;  5KX5 B;  2M6Y A;  3CX5 F;  1QQC A;  5LXT B;  1GN2 A;  2X0L A;  1ZTE A;  1XRE A;  4FJC C;  5B1N A;  4DR5 B;  4GLX A;  3ZHQ A;  4YIO A;  1GKF A;  2DMX A;  1F7Y A;  1Y74 B;  4D7S A;  3AK2 A;  4LF9 O;  5IJ9 B;  4NTW A;  4LF4 O;  5B1O A;  4FMT A;  1SET A;  5JVD B;  3TET A;  1MA1 A;  2UXD B;  1YHQ V;  1OV9 A;  1I08 A;  3WB0 A;  1BZK A;  4E4E A;  1B3Q A;  2F4V O;  1SQF A;  3T2M A;  1VQP V;  2Y0I A;  4FPP A;  2PF4 E;  5J2U B;  2W0F C;  2VRZ A;  1SA0 A;  3F5T A;  5B1A B;  5E79 Z;  5CA3 A;  2JGD B;  3BA8 A;  3G80 A;  2ZR2 A;  1K5S A;  1YF2 A;  5FLX N;  2Y0P A;  1ARO P;  3EFF K;  3BFR A;  1GK9 A;  3ZHR A;  2KG7 B;  3WFV A;  1EBO A;  2GUZ B;  3NR7 A;  5LBQ A;  2Q7H A;  3QG5 A;  1RPR A;  2AXT Z;  4DW1 A;  2R72 A;  4OPA A;  4QE9 A;  2PGG A;  4BIZ A;  4CC6 A;  1AJP A;  3BPZ A;  3ZMT A;  3JAT A;  4RQE A;  2V4D A;  1Y74 A;  1GH6 A;  4JYA O;  4JI8 B;  3FB5 C;  2VQF B;  2Q5Z A;  2NLJ C;  4HNA A;  3B77 A;  4JI4 O;  4U3J A;  3ASO C;  3C3T A;  5EK0 A;  3OGI B;  4YIP A;  1NTK H;  4LFB B;  2JDI G;  3OR7 C;  2HLD G;  2E3C A;  4EFE A;  2EIK C;  3G71 V;  3MDS A;  3K79 A;  3WU2 Z;  2ITC C;  1QLE B;  1M5I A;  3W7X A;  4DXW A;  3ICX A;  2Y4U A;  2YUA A;  2QJ1 A;  1VQO V;  3ZIA G;  4LR3 A;  4O4J B;  3AG2 C;  2A79 B;  3SJC C;  4PA6 A;  4ZI7 B;  4LF5 B;  1RM1 B;  5KHG A;  4JZ2 A;  4FLX A;  3GWO A;  1RSO B;  3FB8 C;  1T5E A;  2CH7 A;  1SF9 A;  3CXH F;  2DW4 A;  3VQV A;  1DF5 A;  1JFF B;  2QSA A;  2HVK C;  3AG1 C;  1VQ6 V;  2EIJ C;  3SYQ A;  3ABL B;  5FL7 G;  1IBL B;  1HR0 B;  4I5S A;  1IUR A;  2QE7 G;  4O4J A;  1OCR B;  2ZIM A;  3AG4 B;  1NS1 A;  4CS4 A;  1AP5 A;  4J7Z A;  1YIJ V;  4LWS A;  3U11 A;  1P7G A;  1VQ7 V;  1WB7 A;  4RAI A;  3RYI A;  1L0N H;  2RQ6 A;  3CRR A;  2Q69 A;  1BE3 H;  2X6B A;  1NT2 B;  4YHH B;  5LP6 A;  1V54 B;  4DRX A;  5BY1 A;  4G27 B;  2IJK A;  1TVK B;  5L3G A;  1Q6I A;  3K5N A;  5LOV B;  4NKG B;  3ETE A;  3OEH G;  3MHH C;  5C8Y A;  1F4N A;  4GKK B;  2WLI A;  4DR1 O;  3LUT B;  4MVQ A;  4GT1 A;  1I5Y A;  1S5H C;  2FML A;  1XOU A;  5LGT A;  4BW5 A;  2UUA B;  4DUZ B;  3IGA C;  1Q90 D;  3ASO B;  2ZCE A;  5LP6 B;  1KEC A;  3L74 H;  4X66 B;  1KKC A;  3RVZ A;  1ROP A;  4TQF A;  4DR7 B;  4LF8 O;  3SJQ C;  2IU0 A;  3RGB A;  2QM4 A;  1R6N A;  5K1P A;  1GM8 A;  1QR8 A;  4MTX A;  4X9Q A;  3THO A;  1AR1 B;  3A0B Z;  4TOI A;  2PI5 A;  3L71 H;  3DC6 A;  4DV1 B;  4H33 A;  2ZM6 B;  3OAA G;  4BW9 A;  1GO3 F;  3VQX A;  2Y69 B;  4KL1 A;  2OYQ A;  2UXN A;  2BOB C;  4I9W A;  4LF9 B;  2JEX A;  4PI2 A;  4EEQ A;  3CRM A;  1KMI Z;  1FXH A;  2JVD A;  4D6T H;  1H2S B;  2HVJ C;  2XAF A;  2R9A A;  1L8D A;  1KU9 A;  4LFC B;  3UM7 A;  4J9Z B;  1H2L A;  4O4I B;  3ZHV A;  3K59 A;  4JTD B;  5A2Q N;  1FXK C;  4PA3 A;  2QA4 V;  4L87 A;  4FIP C;  3K3W A;  1ZWI C;  4HZ3 A;  5FPO A;  2IH1 C;  3IC9 A;  2KB1 A;  1Q7Y W;  1NTZ H;  3HKE A;  1XBL A;  2GSM B;  1XL6 A;  4YY3 O;  5CB4 A;  5LHH A;  1BCC H;  3JAW A;  1A32 A;  4RUE A;  3ZRX A;  4MTO A;  3HKC B;  4AI8 A;  1UPG A;  3K9A A;  4O4I A;  5KHH A;  3FD9 A;  4DR3 B;  4FZ1 A;  3TXQ A;  1IXM A;  4JI1 O;  5TIS Z;  1P49 A;  1XIL A;  2HJF C;  3JD3 A;  2ZNI A;  5KMG A;  2ZM6 O;  2W6J G;  2RNB A;  1MMM A;  1E1Q G;  4LNU A;  1KYO F;  4WFB V;  1V54 C;  4UV9 A;  2QWQ B;  5B3S C;  1D2D A;  4KP4 A;  3RBZ A;  4F6R B;  2DWE C;  3D36 C;  4YJ2 B;  4PV1 B;  3RVY A;  4B3M O;  2QKA A;  2HEP A;  1SQP H;  1BSM A;  3ABK B;  3T4Z A;  4DV2 O;  2CUG A;  4LFC O;  2EX3 A;  4X1K B;  5J2T B;  4B3M B;  3G4S V;  2OTJ V;  4UCR A;  3SYP A;  3LDE A;  2OCH A;  2YDE A;  3CCE V;  2A06 H;  1UFI A;  3ASN C;  2BTQ B;  4NR1 A;  1FD9 A;  4DUZ O;  2EJR A;  4I50 B;  1GM9 A;  4LH7 A;  2NR5 A;  4X1K A;  2F1M A;  4UUJ C;  5AG2 A;  1THZ A;  1VQ5 V;  2DOS A;  4QE7 A;  5L3F A;  1H2G A;  4CS2 A;  4MS2 A;  2UUB O;  1Y76 A;  1M57 C;  1S3J A;  4TV8 B;  2P90 A;  5IDJ A;  1MG1 A;  2P6J A;  3IJ4 A;  5C8Y B;  1NVP D;  1I94 O;  3BCC H;  3AG3 B;  4JYB A;  1ORQ C;  1N0N A;  4DV4 B;  4NVP A;  3RYC B;  4O4L A;  1K73 W;  2ZE6 A;  4AHC A;  3W7S A;  5KX5 A;  2IJI A;  1EN5 A;  2PTM A;  2UU9 O;  2GBO A;  2F4V B;  1KKD A;  1NVP B;  4LF8 B;  1OJH A;  3KKY A;  4DR7 O;  3HKB B;  4DUY O;  3UKM A;  3WG7 C;  1R3J C;  4FFB A;  4ZKI A;  4O4H A;  3STL C;  4IIJ B;  2WLN A;  1EZV H;  1H38 A;  1B06 A;  3H1J H;  1QBZ A;  3FB6 C;  1RPO A;  1IBK B;  1TVK A;  2KQX A;  2CTQ A;  1SQQ H;  2B1I A;  4FLU A;  2QWO B;  2IBZ H;  4LF7 B;  3N2K B;  1YEW A;  3F7Y C;  2EIL B;  2JEU A;  1M90 W;  4DR5 O;  5A9G A;  1FXK B;  5IYZ B;  5GTH Z;  3LSU A;  2N04 A;  4LFA O;  3CCR V;  3IAY A;  4WFG A;  4YJ3 B;  4DYL A;  2XUM A;  4JF3 A;  3AG7 A;  1TUB A;  1YSC A;  3OUF A;  1IBL O;  4IGG A;  3N27 A;  1JX9 A;  5EBW C;  2ZE5 A;  2BSK A;  2MK3 A;  1SQX H;  4B3T B;  1K34 A;  4AQY B;  3AK1 A;  1H8E G;  4XBF A;  2AGA A;  3CEI A;  4FVM A;  1ENV A;  2W0X A;  2B9Z A;  4MSW C;  3OEE G;  3L70 H;  4DV6 B;  1S72 V;  1WP7 A;  4MTG A;  3HB3 B;  1VF6 C;  4NXM B;  3ABK C;  4GYC B;  3BA9 A;  1Y76 B;  1SQB H;  5GON B;  1VQ9 V;  4NXN O;  3B09 A;  4IYH A;  1S5J A;  1YZB A;  3TJT A;  2X7R B;  4G2K A;  1G4Y B;  2IU3 A;  5BXZ A;  4CH4 A;  1BHB A;  1TGO A;  3CCL V;  3I55 V;  3GWK C;  1K4D C;  5B1B B;  1UJW B;  3ZMV A;  1W59 A;  3SDL A;  4LH6 A;  1YTF B;  1K33 A;  4YHH O;  4FLY A;  1PNK A;  5GW7 A;  4N23 A;  2UXC B;  1PPJ H;  3ZRW B;  1WP8 A;  4DV1 O;  3JCU Z;  1DGS A;  1R3I C;  3E8B A;  4GX2 A;  2F43 G;  3B4S A;  3FYE B;  3WG7 B;  4RUF A;  3JD0 A;  5J2T A;  1XNQ B;  1NR7 A;  5KHI A;  2L6L A;  5EIB D;  4YY3 B;  2UXB O;  3ABU A;  3ZRV A;  4RQF A;  4N21 A;  1Z2G A;  2OT5 A;  1QR9 A;  3HKC A;  2O57 A;  1D5A A;  1AI6 A;  1F51 A;  5IYD O;  3ZS8 C;  3VQW A;  2MW2 B;  3M7M X;  1OCO C;  1PKX A;  2VWJ A;  3OE7 G;  1HNZ O;  4MVU A;  4PJ0 Z;  2DQ0 A;  3HKD A;  3O9O A;  5EBL C;  3SPI A;  4TV9 A;  4X1I B;  4JAU A;  3LDC A;  1OHH G;  4O2B B;  3P32 A;  3EXA A;  2X6A A;  1PV0 A;  4MVM A;  4CC5 A;  3ETD A;  2AHZ A;  5B3S B;  4PDV A;  1EN4 A;  4IHJ A;  2XT9 A;  1ZL8 A;  3EVK A;  1S5L Z;  3FAV B;  1KC8 W;  4JI7 O;  3ABM B;  2CGO A;  2Q0A A;  3QO5 A;  3LNM B;  5CA1 A;  3CCJ V;  1VQ8 V;  4P9O A;  4X20 A;  1L1F A;  3F7V C;  4PDR A;  5EBM C;  2YC0 A;  1SQG A;  1WA8 B;  1Q81 W;  2HG5 C;  3OMI B;  4LF4 B;  1KUQ A;  4LFA B;  1VQM V;  3UT5 B;  3K06 A;  3T4D A;  2A9H A;  4HNA B;  3I56 V;  1HNX B;  5CBF A;  3E8G A;  5KAF Z;  2G38 A;  4B3S B;  2Q7G A;  1M4U A;  3MD0 A;  3ZHS A;  3G6E V;  2WPD G;  4CZZ A;  2XAG A;  2RDC A;  1KP2 A;  3B8N A;  4DR1 B;  1R1B A;  2CGN A;  2ILM A;  3T1Y B;  1P4R A;  1SZT A;  4JI3 O;  3CC4 V;  2RMK B;  5L3E A;  4K0K B;  2OIG A;  2YIA A;  4B3R O;  2XAS A;  1FFT B;  4TV8 A;  4DV7 O;  3K58 A;  2Q7E A;  3D36 A;  4JI6 O;  4BIO A;  1K7D A;  4DV6 O;  1PL4 A;  2L35 A;  3E8F A;  2LFS A;  1BT8 A;  3HPL C;  5CA0 B;  1OCR C;  1I5X A;  2CE4 A;  3BRC A;  4DV3 O;  3SGI A;  4WFH A;  4YXW G;  1GN3 A;  4WFA V;  3R65 A;  1K4C C;  1U97 A;  1JCH A;  1GMG A;  5CA0 A;  3DTU B;  4KHP B;  1AJQ A;  2NNU A;  4YJ3 A;  3WB1 A;  3LSS A;  3T1Y O;  1H2M A;  5DEC A;  1MZE A;  3RYI B;  5IY5 C;  4ZI7 A;  1YDX A;  3DGE A;  2WLM A;  3K5L A;  2Q9L A;  5IT9 N;  4FZ0 A;  5B1A C;  3JD4 A;  3J81 N;  4Z1M G;  3OTO B;  3VOU A;  2AW9 A;  1EM1 A;  2P22 C;  5BMV B;  1Z5W A;  2DQ3 A;  2QR4 A;  5LXT A;  3ZX6 A;  1LUW A;  2UU9 B;  4DK1 A;  2UXB B;  3X2Q B;  1Y4M A;  3EHB B;  2E5L B;  4LNU B;  1TAE A;  5IJ0 A;  4LF6 O;  1QU7 A;  3K0G A;  1JVM A;  3ZN0 A;  4TSF G;  1Z5V A;  1Q6H A;  5LL6 Y;  2ZT9 B;  5LGU A;  2E5L O;  4UVB A;  1I0H A;  4JYA B;  2P4K A;  3ZN1 A;  5KHJ A;  4K8Z A;  3SPH A;  3JD1 A;  5H6Q A;  1VF6 A;  3MHS C;  5EC1 C;  1Q5O A;  3SPJ A;  1DTO A;  3VBB A;  2VQE B;  3HR0 A;  1FPO A;  5L3B A;  1SES A;  2VQE O;  3D8C A;  1XDC A;  1VIB A;  3D3I A;  2YIB A;  5KUM A;  5B1B C;  3RW0 A;  4PA4 A;  4O4L B;  1Q43 A;  2EIK B;  2Y4T A;  5IE9 A;  4LWS B;  4F6E A;  3C90 A;  3I5D A;  5LMN B;  4P2Z A;  5LYJ B;  1US6 A;  1G8M A;  1B04 A;  2ITD C;  3BAA A;  4JAS A;  5JQG B;  2EZO A;  4W4K A;  3CME V;  1KD1 W;  1DLB A;  2GHY A;  4UB8 Z;  1AVM A;  4JI2 B;  1QHT A;  1FFX B;  1PD3 A;  2UUC O;  1H2N A;  1P7B A;  1JFF A;  2EZP A;  3JCZ A;  4AIL C;  5LHG A;  1XHZ A;  1W0K G;  3BVO A;  5LGN A;  4K0K O;  3AG4 C;  1HP8 A;  5IJ9 A;  4K8X A;  1SZX A;  2IM9 A;  1AI4 A;  4JYY A;  3CC2 V;  2KG7 A;  3JD2 A;  5B5E Z;  1GN6 A;  2E75 B;  2ZQM A;  4DV3 B;  1IDS A;  2HJD A;  1DK1 A;  4A5U B;  4G28 B;  2WWW A;  3CRA A;  2GTS A;  4I0X B;  4OGQ B;  3P30 A;  2XAJ A;  1V55 C;  1VF7 A;  1BQ0 A;  1MNG A;  5J2U A;  1RFY A;  4ICG A;  4J7J A;  3OR6 C;  2Q68 A;  3ZJZ A;  1N36 O;  2ARH A;  1XL4 A;  2A3Q A;  4JI4 B;  4FM1 A;  5JJE B;  2P67 A;  4NXM O;  1OCO B;  1VP7 A;  3KCY A;  2Y48 A;  2XHB A;  1XMQ B;  4X1Y B;  2OIE A;  5LHI A;  3H1L H;  4I55 A;  3SJA C;  1FJG O;  1VQK V;  2Z0A A;  4CBC A;  4GKK O;  5JCO A;  1AI5 A;  3UT5 A;  3B40 A;  1S76 D;  4DW0 A;  3TGU H;  1L0L H;  1M1K W;  5CBH A;  1NJI W;  3QO7 A;  2YEV A;  2OCC C;  2Q6A A;  4X66 O;  3G67 A;  2PY5 A;  2HHH O;  3CHX A;  5LYJ A;  5CA1 B;  2ZIO A;  2JGD A;  2JIZ G;  3OD4 A;  5IYC O;  3DC5 A;  4X65 O;  4DK0 A;  1N34 O;  1R3K C;  4U7N A;  3JAS A;  1M9N A;  4O4H B;  3P3P A;  3APO A;  2EIM C;  2VQF O;  1X59 A;  2LO1 A;  5JH7 A;  4J42 A;  3CJH A;  4FLV A;  3E22 B;  2EIN B;  5F2V O;  4GKJ O;  2XAH A;  3UO2 A;  1GM7 A;  3CJH B;  3ZMS A;  2AZ0 A;  3SYO A;  2ADP A;  4WFE A;  5EC2 C;  3CCS V;  1WN7 A;  2V1D A;  4B08 A;  1J5E O;  4JI0 O;  4I9Q A;  4JZG A;  1HNW B;  2LJ2 A;  4DV4 O;  1SRY A;  2A7W A;  2XOK G;  1WJZ A;  3JAS B;  3SYC A;  5EIB C;  4NB5 A;  1N33 O;  4W4L A;  4KHP O;  4JI1 B;  3FFQ A;  1CPY A;  1F23 A;  2VWK A;  3PJS K;  5EYP B;  4IL6 Z;  4RO2 A;  3T1H O;  1GTO A;  3FAV A;  2UXC O;  3JAR B;  2LFR A;  3SPG A;  4WF9 V;  1M93 A;  2PUS A;  2QKS A;  1G6U A;  1HWY A;  4IT5 A;  2EIL C;  1YI2 V;  1XMQ O;  1HDJ A;  1N32 O;  3ZRW A;  4J9Y B;  4UCT A;  5LMU B;  4X62 B;  2P06 A;  4R7C A;  5BR8 B;  5KHK A;  4MT8 A;  4UCS A;  4E2L A;  1N4C A;  2ZD9 A;  1GRJ A;  2ZXW C;  5JJJ B;  4FLZ A;  2Q4P A;  3K9S A;  2ATK C;  4IYI A;  2YEV B;  4H0L B;  2CDY A;  5E1A C;  2QDO A;  3ZRS A;  1IBK O;  3W7W A;  4DO2 A;  2DYS B;  1HNX O;  1R6K A;  5D5P A;  2HR3 A;  1N8R W;  1IVS A;  4QPK A;  3NXS A;  2A0L A;  1V9P A;  4QPJ A;  4DUY B;  3L9D A;  1N33 B;  2BTQ A;  5GTI Z;  2ZDI A;  4HYO A;  5DED A;  4DR6 O;  1F4M A;  1NKD A;  1KQS U;  2D2C B;  4QIW F;  4ZBM A;  3ZMZ A;  4J11 A;  1N34 B;  4MTF A;  1MSD A;  1WAZ A;  4KXR A;  1BMF G;  4JI5 B;  2WLH A;  2GV9 A;  4UB6 Z;  2Y69 C;  1HR0 O;  1TUB B;  4I4T B;  1KP3 A;  4R50 A;  1J5E B;  3B2E E;  3CD6 V;  4UCV A;  1JPX A;  3ABT A;  5KA6 A;  2WLK A;  1PNM A;  1FS0 G;  1NTM H;  2EIN C;  3JAW B;  2PZS A;  1QLE C;  2QKC A;  3HKD B;  3ETG A;  4PA7 A;  2BCC H;  4I4T A;  4L8J A;  5LA6 A;  5HFL A;  3E22 A;  2EIM B;  3CP1 A;  3AG1 B;  4GX0 A;  3HKB A;  1H2K A;  1NH2 B;  3IFX A;  4AQY O;  4FFB B;  4O2A B;  4H13 B;  4Q20 A;  5J9P C;  4LP8 A;  3FYI B;  2CTR A;  2OTL V;  1JA8 A;  1QCE A;  1YXB A;  3CCU V;  1N36 B;  1XUQ A;  1YJN V;  2ZR3 A;  5IWA O;  4QGP A;  5CMU A;  2LP7 A;  3OMN B;  3APQ A;  1VQL V;  4I0X A;  3H01 A;  3H1I H;  4JPR A;  1XNQ O;  2XAQ A;  1CP9 A;  3OM3 B;  3JYC A;  4ZHQ A;  1VF5 B;  2UXD O;  1URF A;  4B7K A;  4MW3 A;  5D5Q A;  4X64 O;  2YXL A;  5JVD A;  2ADQ B;  4C7U A;  4X1Y A;  4CH3 A;  3M8A A;  1ZSP A;  2WSS G;  2YI8 A;  2BTO A;  2JRI A;  2BSK B;  1EZJ A;  3KZI Z;  4UVC A;  3J80 N;  3QF7 A;  5FPR A;  2GDS A;  1N32 B;  3CRC A;  3K03 A;  1Q8I A;  1GAX A; 
#chains in the Genus database with same CATH homology
 4TT3 G;  2KB1 A;  2IW5 A;  3EHB B;  1Q7Y W;  3E86 A;  1OZ0 A;  3K0G A;  1JVM A;  2GSM B;  2R9R B;  1XL6 A;  3ZN0 A;  4TSF G;  1QLN A;  3F5W C;  3QO8 A;  5LHH A;  4XDL A;  1S77 D;  4RUE A;  3ZRX A;  4MTO A;  5LGU A;  3K04 A;  4UVB A;  1AJN A;  1RM1 C;  3SPC A;  3K9A A;  3CCQ V;  1B6Q A;  3ZN1 A;  3K0D A;  5HFM A;  2WLI B;  4LCU C;  1IXM A;  3SPH A;  3JD1 A;  3M99 B;  3W7U A;  5H6Q A;  3MHS C;  5EC1 C;  3SPJ A;  1DTO A;  3VBB A;  2HJF C;  3JD3 A;  4KUM A;  2B1G A;  2W6J G;  1E1Q G;  5L3B A;  2ZDI C;  4GX5 A;  4WFB V;  1V54 C;  2YSU B;  4UV9 A;  1SES A;  4LBE C;  5B3S C;  4KP4 A;  3RBZ A;  1YJW V;  3D3I A;  4WCE V;  4LC1 A;  2DWE C;  5KUM A;  5B1B C;  3RW0 A;  4PA4 A;  3RVY A;  2EIK B;  1H8H G;  1Q82 W;  2Z5U A;  4EKW A;  3E89 A;  3ABK B;  4PDM A;  3T4Z A;  3A0R A;  1W2B U;  4PDL A;  2Z3Y A;  4P2Z A;  3G4S V;  1G8M A;  2OTJ V;  2ITD C;  3SYP A;  1E79 G;  4JAS A;  2EZO A;  2JJ2 G;  3LDE A;  3W7T A;  3CCE V;  3CME V;  1M56 B;  3ASN C;  1KD1 W;  1DLB A;  2GHY A;  5IYB O;  4P9P A;  2EJR A;  3E35 A;  1GM9 A;  4TWK A;  2WLJ A;  1K9M W;  1K92 A;  3LDD A;  4MVZ A;  2K1E A;  1PD3 A;  1R73 A;  1P7B A;  4UUJ C;  4UV8 A;  1THZ A;  2EZP A;  3JCZ A;  4KFM A;  5LHG A;  1VQ5 V;  1W0K G;  4QE7 A;  5L3F A;  1YJ9 V;  1H2G A;  5LGN A;  4MVO A;  4MS2 A;  3AG4 C;  1AI7 A;  3E8H A;  4GCZ A;  1YIT V;  1M57 C;  1S3J A;  1AI4 A;  3CC2 V;  3JD2 A;  2P90 A;  3STZ C;  5IDJ A;  2IH3 C;  1MG1 A;  4JGS A;  2ZQM A;  3IC7 A;  1MSW D;  1OCZ C;  2P6J A;  2DYR B;  4JAV A;  2B5U A;  1NVP D;  4G28 B;  2WLL A;  2WWW A;  3CCV V;  1S0V A;  2DYR C;  2QM8 A;  4HAM A;  2H94 A;  3AG3 B;  4JYB A;  1QVF U;  1ORQ C;  4R6Z A;  1YTF D;  1K8A W;  3FB7 C;  3P30 A;  3T1C A;  2XAJ A;  1V55 C;  5DM6 V;  3CPW U;  1MAB G;  3OUS A;  1K73 W;  4QNH B;  5H6R A;  3W7S A;  1FXV A;  1VQN V;  5L3D A;  2IJI A;  3OR6 C;  2HFE C;  2OCC B;  2Q68 A;  3ZJZ A;  4X89 A;  4BAY A;  1KKD A;  1NVP B;  1QVG U;  1XL4 A;  3UKM A;  2P67 A;  2DWD C;  1R3J C;  3WG7 C;  4ZKI A;  4P30 A;  3STL C;  5KUK A;  1OCO B;  2FTK A;  2WLN A;  1H38 A;  4MW8 A;  5C93 A;  1M57 B;  1QBZ A;  1PL0 A;  3FB6 C;  4PEL A;  1RPO A;  2Y48 A;  2V7Q G;  2X0L A;  4FJC C;  5B1N A;  5LHI A;  2B1I A;  3BY6 A;  1VQK V;  4X8A A;  4CBC A;  1GKF A;  3F7Y C;  2EIL B;  2JEU A;  1AI5 A;  1M90 W;  1S76 D;  1WLE A;  1FXK B;  3AG2 B;  1M1K W;  5B1O A;  3CCR V;  4FMT A;  1SET A;  4WFG A;  5CBH A;  1JQ0 A;  2EIJ B;  3TET A;  1NJI W;  3QO7 A;  2YEV A;  4JF3 A;  2OCC C;  2Q6A A;  2C2A A;  1YHQ V;  1YSC A;  3OUF A;  5CN0 A;  3T2M A;  1VQP V;  2JIZ G;  5IYC O;  1JX9 A;  1R3L C;  5EBW C;  4FPP A;  3ML0 A;  4U7O A;  2W0F C;  1R3K C;  4U7N A;  2MK3 A;  4JTC B;  5DN6 G;  1K34 A;  2D3O W;  1M9N A;  1Y66 A;  5B1A B;  5CA3 A;  1H8E G;  4XBF A;  2ZR2 A;  3GB7 C;  1ENV A;  1K5S A;  2EIM C;  3SYA A;  1NH2 D;  4MSW C;  2JJ1 G;  3OEE G;  1S72 V;  1ARO P;  4MTG A;  3HB3 B;  3AEI A;  2QEX V;  3EFF K;  1GK9 A;  2EIN B;  2P7T C;  3ABK C;  3WFV A;  1EBO A;  3FKS G;  2XAH A;  5IY5 B;  1GM7 A;  3ZMS A;  1E1R G;  1VQ9 V;  1K97 A;  5LBQ A;  3SYO A;  2WLL B;  4WFE A;  5EC2 C;  1RPR A;  1V55 B;  3CCS V;  5BZB A;  2V1D A;  2X7R B;  4G2K A;  1G4Y B;  4QE9 A;  2IU3 A;  4BIZ A;  2X6C A;  1SRY A;  1AJP A;  1BHB A;  3CCL V;  2XOK G;  4UVA A;  3ZMT A;  3I55 V;  4RQE A;  4OXS A;  1K4D C;  3CC7 V;  5B1B B;  1BHA A;  3FB5 C;  3SYC A;  1UJW B;  3ZMV A;  1YTF B;  1K33 A;  1W0J G;  3TK1 A;  1PNK A;  1K3E A;  2EBO A;  5GW7 A;  2NLJ C;  1CPY A;  1F23 A;  3PJS K;  4N23 A;  3ZRW B;  3B77 A;  4RO2 A;  5EK0 A;  3ASO C;  1GTO A;  2DYS C;  1VQ4 V;  3ASN B;  1R3I C;  2JDI G;  3E83 A;  3E8B A;  3OR7 C;  2LFR A;  2WAM A;  4GX2 A;  2HLD G;  2F43 G;  3OMA B;  3SPG A;  2EIK C;  4PA9 A;  3G71 V;  1TUE B;  3K79 A;  2ITC C;  4WF9 V;  4FK5 C;  3FYE B;  1QLE B;  2QKS A;  3WG7 B;  4X88 A;  3W7X A;  1HWY A;  4RUF A;  3JD0 A;  4DXW A;  2EIL C;  2R9I A;  1YI2 V;  1NR7 A;  1OCC B;  3ZRW A;  1VQO V;  3ZIA G;  4J9Y B;  3AG2 C;  2A79 B;  4PA6 A;  2AHY A;  2PI4 A;  3ABU A;  1RM1 B;  3ZRV A;  4R7C A;  3X2Q C;  4MT8 A;  3GWO A;  4RQF A;  3FB8 C;  4N21 A;  2OT5 A;  3B8M A;  4R8C A;  4E2L A;  1QR9 A;  2ZD9 A;  3LSQ A;  2M7W A;  2ZXW C;  2ATK C;  2YEV B;  2DW4 A;  1AI6 A;  1DF5 A;  1F51 A;  2XND G;  2HVK C;  5IYD O;  3AG1 C;  3QNE A;  1VQ6 V;  1OCO C;  2EIJ C;  5E1A C;  1PKX A;  3SYQ A;  3OE7 G;  3ABL B;  5FL7 G;  3ZRS A;  3W7W A;  4MVU A;  4DO2 A;  2DYS B;  4QJF B;  1R6K A;  2DQ0 A;  2HR3 A;  3ABL C;  4I5S A;  5EBL C;  4H37 A;  3SPI A;  4BIU A;  1N8R W;  4QPK A;  4JAU A;  2QE7 G;  3NXS A;  2A0L A;  3LDC A;  1OHH G;  1OCR B;  4QPJ A;  3P32 A;  3AG4 B;  2X6A A;  4MVM A;  3ETD A;  1YIJ V;  4MVS A;  3CMA V;  2UXX A;  2AHZ A;  5B3S B;  2ZDI A;  1VQ7 V;  3ZMU A;  4PDV A;  3OFN G;  4HYO A;  1F4M A;  1MOF A;  1NKD A;  4RAI A;  5CBG A;  1KQS U;  2Q67 A;  3CYO A;  1KC8 W;  4QIW F;  4ZBM A;  2Q69 A;  3ZMZ A;  3ABM B;  2X6B A;  1COW G;  3QO5 A;  4MTF A;  5H9C A;  4JTA B;  1BMF G;  3LNM B;  3CCJ V;  2WLH A;  1VQ8 V;  4P9O A;  2Y69 C;  1LNQ A;  1V54 B;  1L1F A;  3F7V C;  4PDR A;  3AG3 C;  2IJK A;  4G27 B;  5EBM C;  3OGC C;  5L3G A;  2QTO A;  1Q81 W;  2HG5 C;  1KP3 A;  3OMI B;  4R50 A;  3OW2 U;  3CCM V;  3CD6 V;  1JPX A;  4XDK A;  1VQM V;  3ETE A;  3OEH G;  2BOC C;  3K06 A;  2A9H A;  3T4D A;  2IJJ A;  3ABT A;  3MHH C;  3I56 V;  5KA6 A;  2WLK A;  1NR1 A;  1PNM A;  1FS0 G;  2EIN C;  1Q86 W;  1QLE C;  5CBF A;  1F4N A;  3E8G A;  3ETG A;  4PA7 A;  2WLI A;  3LUT B;  3MD0 A;  4MVQ A;  5HFL A;  4GT1 A;  1I5Y A;  3G6E V;  2WPD G;  1S5H C;  2EIM B;  3CP1 A;  4CZZ A;  3AG1 B;  4GX0 A;  4BW5 A;  5LGT A;  4WFF A;  3IGA C;  2XAG A;  1KP2 A;  3ASO B;  3B8N A;  1NH2 B;  1KEC A;  3IFX A;  1DF4 A;  4Q20 A;  1P4R A;  5J9P C;  4LP8 A;  3X2Q B;  5KA5 A;  2IJH A;  3FYI B;  2OTL V;  4F4L A;  1JOY A;  3RVZ A;  1ROP A;  1SZT A;  1QCE A;  1J95 A;  3SJQ C;  3CCU V;  3TCU A;  3CC4 V;  4UXN A;  2IU0 A;  1JJ2 U;  5L3E A;  1YJN V;  1R6N A;  2ZR3 A;  2XAS A;  2ZXW B;  1FFT B;  1M56 C;  5CMU A;  1GM8 A;  3D36 A;  1OCC C;  2LP7 A;  3OMN B;  1QR8 A;  1VQL V;  4MTX A;  1K7D A;  3H01 A;  1PNL A;  3E8F A;  2W6I G;  3E2E A;  3ABM C;  2LFS A;  1AR1 B;  2PI5 A;  4JPR A;  2XAQ A;  3HPL C;  4H33 A;  1OCR C;  1I5X A;  3OAA G;  1GO3 F;  1FXK A;  2Y69 B;  1CP9 A;  2CK3 G;  3OM3 B;  4WFH A;  2UXN A;  2JK5 C;  4YXW G;  4WFA V;  2QM7 A;  3R65 A;  3JYC A;  1K4C C;  2BOB C;  4I9W A;  1JCH A;  1GMG A;  2JEX A;  4MW3 A;  3DTU B;  1AJQ A;  2NNU A;  1NBM G;  1FXH A;  3BEH A;  4XDJ A;  4JYC A;  4GX1 A;  1SER A;  3KG2 A;  2HVJ C;  2XAF A;  1WPX A;  4ASU G;  3LSS A;  1EFR G;  4J9Z B;  3UM7 A;  1CEZ A;  2WSS G;  4MVR A;  3ZCC A;  5IY5 C;  2H8P C;  2HKO A;  3DGE A;  2WLM A;  1BL8 A;  1K5Q A;  1EZJ A;  5L3C A;  4JTD B;  3CXC U;  1FXK C;  5B1A C;  3JD4 A;  4PA3 A;  4Z1M G;  4UVC A;  1NQT A;  4L87 A;  2QA4 V;  3VOU A;  4FIP C;  1OCZ B;  3K3W A;  1ZWI C;  2DQ3 A;  4HZ3 A;  2IH1 C;  3K08 A;  3K03 A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...