2Q68A

Crystal structure of nak channel d66a, s70e double mutants
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFEPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q68A00
2BOCC 2ITDC 3LUTB 4MVZA 4GX1A 1BL8A 2ITCC 4XDLA 3E8BA 4PDRA 2WLMA 2YEVA 3EFFK 4HYOA 4BW5A 3K03A 3OR7C 2DYRC 3T2MA 3TCUA 4PA7A 4KFMA 4MVMA 4UUJC 4MTGA 3SYAA 3LDDA 4MVSA 2WLIA 4GX5A 3K0GA 4MTOA 1XL6A 2EIKC 4WFFA 4JTAB 3FB6C 3K06A 4RAIA 2DWEC 2HFEC 3VOUA 4MS2A 1V55C 2ZXWC 3OUSA 4MVRA 4TWKA 2WLJA 3ABLC 4XDJA 4PA3A 3GB7C 3LDEA 3E89A 1R3IC 4MVQA 3F7VC 5EK0A 2WLLA 3OR6C 2WLHA 3ASNC 3T4DA 4R6ZA 4J9ZB 3ASOC 2IH3C 2JK5C 4H37A 4MW3A 3SPCA 4MSWC 3R65A 2A9HA 3HPLC 4X88A 1OCZC 5B1AC 4MVUA 1LNQA 5CBGA 4DXWA 3ZJZA 3SJQC 3AG4C 3K04A 4H33A 2HVKC 1OCOC 5IY5C 2X6CA 1R3JC 4OXSA 4X8AA 4X89A 4RO2A 3ZRSA 3SPIA 3SYCA 5CBFA 3SYQA 2IH1C 2HJFC 3IFXA 1JVMA 3PJSK 3STLC 3SPHA 5EC1C 4P2ZA 3SPJA 2AHYA 2HVJC 2X6BA 2R9RB 3RBZA 2H8PC 4LCUC 2BOBC 1P7BA 3ABMC 2Q6AA 3E8HA 1OCCC 1S5HC 4GX2A 3BEHA 2ZD9A 3T1CA 3UKMA 2Y69C 4WFGA 2K1EA 1R3LC 2NLJC 5EC2C 3T4ZA 3WG7C 3F7YC 3JYCA 2P7TC 3E83A 2OCCC 1M57C 2KB1A 1M56C 5KUMA 4EKWA 3FB8C 5B1BC 4CBCA 5EBMC 4ZBMA 3E8FA 5BZBA 3RW0A 1J95A 3OUFA 1OCRC 2WLIB 2A79B 2AHZA 3E86A 4JTDB 2QKSA 2EIMC 4PA6A 4P9OA 3RVZA 4GX0A 4PA4A 4P9PA 2EINC 3AG1C 5EBLC 3F5WC 4QNHB 5B3SC 2EILC 4R50A 3UM7A 3SYPA 4PA9A 4WFEA 2DWDC 4MTFA 4P30A 3FB5C 2EIJC 2DYSC 4PDLA 2Q68A 2W0FC 3IGAC 1K4CC 2WLKA 5E1AC 5KUKA 2Q69A 3E8GA 5EBWC 1ORQC 2Q67A 3RVYA 2A0LA 3K08A 4PDMA 1KKDA 3X2QC 4QE7A 3LDCA 4RUFA 3SPGA 2ATKC 1QLEC 4QE9A 3STZC 4XDKA 5CBHA 2HG5C 3AG2C 3LNMB 4HZ3A 4J9YB 1K4DC 4G27B 1ZWIC 3SYOA 1G4YB 4MW8A 3FB7C 4R8CA 4WFHA 3K0DA 4R7CA 4PDVA 2QTOA 3OGCC 5J9PC 1V54C 4F4LA 4LBEC 1XL4A 4LP8A 4JTCB 3AG3C 2X6AA 3ABKC 4I9WA 2WLLB 3KG2A 4RUEA 4MVOA 3TETA 4G28B 2WLNA 1R3KC
chains in the Genus database with same CATH superfamily
1BHAA 3AK1A 5BR8B 2Q7HA 3RYIB 3EVKA 3CCVV 4MVMA 5J2UB 3H9VA 3LDDA 1XHZA 4GX5A 2PY5A 3K0GA 1JFFB 4JGSA 1K7DA 1XL6A 4MTOA 4JTAB 4RAIA 2HFEC 2WLJA 3GWKC 2EILB 4UV9A 3VQYA 2CK3G 5FNVB 1MOFA 1LNQA 5KHIA 4NXNO 3K04A 4CS3A 4MTXA 2EINB 3KCXA 4WFAV 1QBZA 2CTPA 2DQ0A 3CX5F 3BA9A 3VBBA 1KECA 2X6BA 2JVDA 3THOA 1U96A 2R72A 4GKJB 3E2EA 3AG3B 2Q73A 1PP9H 1YF2A 1IURA 1MG1A 3U11A 2JEXA 4ICGA 4NYKA 4CC6A 3E8FA 4AQYB 3J7AU 3RYHA 2Z5UA 1Q7YW 5LYJA 4GX0A 1NVPD 4DR2B 2EILC 2YIBD 2UU9O 3D3QA 3CXCU 5KUKA 3AK2A 3BCCH 4IYIA 5ITZB 4TV8A 4X1YB 3RVYA 1BZKA 3EHBB 1KKDA 2GSMB 4Q6GA 3RYCA 4DV1B 3L73H 1EZJA 4TQDA 5B1OA 2UUCO 2PI5A 1N32O 2WLNA 1BL8A 3RYHB 4FMTA 2WLIA 1K5SA 4NTWA 1KD1W 2ZXWC 4MVRA 4PA3A 2IM9A 2N04A 1VQPV 4IHJB 4LR3A 3HKDB 3CC7V 2R70A 5LMUO 1P7GA 4JI7B 4B3RB 4YJ3A 1G1XB 2UXXA 1MSDA 1YCIA 3OMIB 3RYCB 1IBKO 4X89A 3S3XA 5A2QN 1TGOA 1HP8A 1KC8W 4FZ1A 1K5QA 4I50A 3RGBA 2EZPA 3DC5A 4FFKA 5H2FZ 4F6EA 1IBMB 1A32A 2CTQA 2MW2B 1Q86W 4LFCB 4GT1A 4YXWG 1BT8A 2GV9A 1MABG 3QF7A 3RYIA 4J7ZA 4UCVA 4QGPA 4LF7O 1K97A 4IHJA 3JATA 4ZBMA 1QR8A 3W7SA 1Q6UA 2Y48A 1OHHG 2YIBA 5C93A 1PKXA 5LXTA 4W4LA 5H5NA 3QO5A 4PDLA 2LO1A 4KUMA 4DV4O 1JR9A 3HR0A 4DO2A 1S77D 2QWPB 1ZWIC 4X9QA 4DR1B 3T1HO 1XQ8A 1AP6A 2JJ1G 1O9HA 2JDIG 2WLLB 2RN9A 3TETA 4LF4B 2BOCC 1Q90D 3QTCA 3OR7C 2DYRC 4O2AA 1R6TA 2QEXV 1JJOA 1QLEB 1XNQB 1TUBB 3HKBB 5E79Z 3HKEB 3N2GA 3BA8A 1JMKC 5IY5B 1V9PA 3FYIB 1Y66A 1YIJV 4TOIA 4UCUA 1EN5A 5J2TB 2IH3C 2ZR2A 2CTRA 2B9ZA 4FFBA 1GN2A 2UXBB 5ITZA 2JS3A 2ZM6B 2HVKC 1OCOC 2KG7B 2M7WA 3STLC 5KA5A 2F66C 1NT2B 4TT3G 3LSQA 4JI6B 3JCZA 2CH7A 1THZA 5BXZA 4DV1O 2ZD9A 2YI8A 3T1CA 1HNXO 3OEHG 3E22A 2IBZH 1HNXB 1L8DA 1YZBA 3ZHVA 3P3PA 4UCTA 2WAMA 1XMQB 3MDSA 4JI2B 5JH7A 3BY6A 2JIZG 4FM0A 3RW0A 1FAFA 4LC1A 1D5NA 2DJVA 2E76B 4K8XA 4PA6A 3TGUH 3KCYA 4LF6O 4DR7O 2UUBB 5CA1A 2WLKA 1XUQA 2UXDO 1YDXA 2ZCEA 4HBNA 2XUMA 1BHBA 4OX9O 1BQZA 4DV0B 2E5LB 1TAEA 4B3SB 1XHXA 3AG2C 4LH7A 1M93A 2B1GA 1U97A 4JYYA 1W2BU 5JJNB 4FLYA 4BAYA 1OJHA 2G38A 2GTSA 3AEIA 5JJEB 4MVOA 1S0VA 4GUNA 4YY3O 1R3KC 4LFCO 2Y0IA 1N34O 3N2GB 4O4JA 4BW5A 5C8YB 4BIOA 1VQ7V 3UQ8A 5LA6A 3GVMA 3ZHRA 2EIKC 1F23A 4U3JA 4XBFA 1QVGU 4PD4F 2PGGA 4ZOLA 1XNRO 3W7TA 3F7VC 3SR2C 4U7OA 1FYJA 1VF7A 3T4DA 5LOVB 1VF5B 4FLUA 4UB8Z 2XASA 1H8EG 4MW3A 2GBOA 1UJWB 2OYQA 2PTMA 2YEVB 3ETQA 4DXWA 4H33A 1JPXA 2QWNB 5CA0A 1ZAUA 1VIBA 2NNUA 2KSDA 5IYZB 5EC1C 4FLXA 5HFMA 1LR1A 3T1HB 1FFXA 1R6KA 3BABA 4K3AA 2CTWA 2MK3A 1OCCC 4DK1A 4YHHB 1RM1C 3BRCA 4WF9V 3TXQA 3B8NA 3T4ZA 4U3JB 3F7YC 3B8MA 4NVPA 5LHGA 4FZ0A 2O57A 4CBCA 1UFIA 4JTDB 2PF4E 3MD0A 1SERA 5KHHA 4PA4A 2EINC 2JGDA 3O9OA 1AVMA 3K9AA 3SGIA 4Z1VA 2A3QA 4Q20A 3X2QB 4TUYB 4EFEA 3OGIB 1H38A 5HFLA 3ZHUA 3K08A 1AI7A 2F95B 3SPGA 3STZC 1SETA 5IJ9A 2EBOA 1PM9A 4X1KB 4CH6A 2YS8A 3WG7B 1ZL8B 4LF5O 2FB5A 5EZYA 4JI3O 2P90A 1M90W 1M4UA 5TISZ 1JCHA 3KKYA 5FL7G 5LA6B 3ABKC 4JI1O 1CEZA 4RUEA 3FB6C 3QO8A 4K0KO 2LW7A 5B3SB 1AI6A 5A9GA 3SJCC 3WU2Z 3JD4A 1N36B 3S3WA 4CC5A 3ZN0A 1SC5B 2WWWA 4GKKB 5L3CA 5EK0A 4DR4B 2VRZA 1JOYA 2Y0PA 4DR7B 4KHPO 2JK5C 3SPCA 2Y4TA 3ZHSA 1YJWV 1HR0B 4NXNB 1N4CA 2ZE6A 1HR0O 2HJDA 2RMKB 4X1KA 4U3FH 1JQ0A 2JJ2G 3ABMB 5EIBC 2FKXA 5DN6G 1N33O 2IH1C 2HJFC 4C7UA 3CRQA 3VQWA 1XBLA 1US6A 5L3BA 4JF3A 1S5LZ 4B3MB 2QA4V 1QVFU 3A2FA 2EX3A 4GLXA 2YDEA 1KB9F 1HNZO 4YY3B 5EC2C 4DV3O 1JJ2U 2JGDB 1YITV 2KB1A 1CPYA 1WP8A 4DR6B 4FK5C 5BZBA 3OD4A 1QHTA 3JAKA 3HKDA 2BSKB 3IAYA 4DR2O 3CSXA 3TJTA 3L72H 3UM7A 1QQCA 1VQOV 1PNMA 1YXBA 3M99B 4BW9A 4I4TA 3JAWB 2L35A 4AI8A 4QPJA 2P6JA 1GRJA 3ABTA 4BIUA 1KU9A 3FB7C 4DRXA 2V1DA 1BS3A 4EEQA 1EBOA 2JRIA 4I9QA 1Q8IA 5LP6C 1ZTEA 1KP2A 3JAKB 4PDRA 3Q4HB 1E1QG 1PL4A 4D6TH 3BFRA 4KXRA 3FAVA 2A06H 4LF9O 2PZSA 4DV6B 3OFNG 1KBHA 3H1JH 3BVOA 2GDSA 4OX9B 1X59A 1ZUQA 1HNWO 4O4IA 1PD3A 3JALA 2VWJA 3E35A 3MHSC 1AJQA 2XAFA 4O2BA 1VQ6V 4JI5O 4YJ2A 3RFRA 2R9RB 4JZ2A 5KX5A 1S5HC 3F5TA 4GX2A 1IBMO 5EIBD 3WG7C 2IJIA 1Q6HA 4FLVA 4QJFB 3W7WA 4NTYA 3FB8C 3D8CA 5EBMC 4J10A 1K3EA 2P4VA 4DV2B 2A79B 2AHZA 5LP6B 1YEWA 3N2KA 3RYFA 3AG1C 1EFRG 1I7FA 1WNSA 4A5UB 2QM7A 3A0HZ 1AR4A 3QVNA 4LF8B 4I0XB 4DR4O 3W7UA 5GONA 4WFBV 4LFBB 4LF8O 5L3EA 4LFBO 2JS5A 4BIZA 3CCQV 1MMMA 5CB4B 2OCHA 1S76D 2ZT9B 2QDOA 1VMGA 4PDMA 1W59A 4MT8A 4FLWA 3CRMA 4I7ZB 1M9NA 2DN9A 1VQ5V 1P4RA 2Q0AA 5J9PC 2K9PA 4B3MO 3CXHF 4GKJO 4LF4O 1TVKB 3MAQA 4G28B 5CMUA 2XAHA 2IJHA 3JCUZ 5FNVA 1HNZB 2ZIOA 3T2MA 1FFTB 2DOSA 3RYFB 5B1NA 4EB6A 4JI0B 4WBNB 2VQEB 2BTQB 4FJCC 4TWKA 4XDJA 1RPOA 1N0JA 3CMAV 2Q9LA 3OEEG 4TSFG 1K92A 4YJ2B 2WSSG 1J5EB 3AG1B 1J5EO 2R9AA 3SPIA 4NXMB 2UUAB 1UPGA 4IYHA 2Q7GA 4DRXB 1XMOB 3SDLA 5LGTA 4X1IB 3BAAA 4JI1B 1WPXA 3JARA 1KP3A 4X64B 1SESA 4DV5B 2BCCH 1IDSA 2FL4A 2Y69C 4EB6B 5BR8O 5LP6A 3C90A 2BTQA 4JI2O 1NS1A 3GWOA 3H01A 4DV7B 3WB2A 1RM1B 2ADPA 4I5SA 4TV9A 3U0ZA 4DR5O 4LF6B 1NBMG 4E4EA 2ZDIC 3CCJV 4E2LA 3F5WC 2YI9A 5B3SC 4I50B 3CJHA 1NTMH 1T5EA 3DC6A 3ABUA 1P49A 4O4IB 2Z0AA 2LGQA 1IBLO 3LSUA 3OTFA 4X65B 4JI7O 3UCSC 1OV9A 2PUSA 2A0LA 1GN4A 4O2BB 5JJJB 3U10A 1IBKB 2E75B 2W0XA 3JARB 4HZ3A 1AR5A 4WFHA 1GN3A 3B4SA 4JTCB 3ASOB 2EULA 5FLXN 5LXTB 1AR1B 3CC2V 4CS4A 5LYJB 1DF4A 3G71V 3K03A 4KFMA 4UUJC 3ZMUA 4J41A 3L9DA 4WFFA 1OCOB 1NKDA 2QE7G 3G6EV 5KHJA 4H37A 1K8AW 3ZRVA 4D7TA 4ZHQA 1E1RG 5CBGA 5IY5C 4I55A 1M5IA 1I5YA 2P06A 3K5MA 3CD6V 3SPHA 3DTUB 3OAAG 1S5JA 5H9CA 4LCUC 2BOBC 4L8JA 2EIJB 1VF6C 1N32B 4UV8A 5J2TA 4JI4O 3ETGA 3R66A 4PV1B 1NH2D 3IJ4A 4X66O 2PYLA 4FFBB 2P22C 1M56C 2LW1A 4L87A 1G8MA 5KHGA 2EIKB 3L74H 1RPRA 2IU0A 2AXTZ 1KQSU 3SJBC 3JASA 4R50A 1RSOB 4B7KA 1H2KA 1Q43A 5LMUB 1K34A 2V7QG 1YVWA 3ZEDA 2L6LA 1GO3F 1DLBA 1FKAO 5BMVA 5CBHA 2BE3A 4JI5B 2D3OW 3OTOB 4F6RA 1K4DC 4LH6A 3T1YO 3KZIZ 1GKFA 5K1XA 4PDVA 3OGCC 1Y4MA 2LQTA 1IXBA 1AB3A 2UXNA 3DXRB 4DV5O 3ABLB 3E8BA 3ZX6A 4K0KB 2H94A 4TV9B 2HLDG 5H6QA 3JD1A 3OUSA 2H3OA 1GTOA 4FM2A 2QWOB 1YSCA 3UO2A 2HKOA 3M8AA 3K5OA 4AILC 3HPLC 2UXDB 1EN4A 4X65O 2AW9A 4OXSA 4X8AA 1Y74A 3SYCA 1Q6IA 5DM6V 3QNEA 1K73W 5KAIZ 1XDCA 2HVJC 1WPBA 2UXCO 5F2VO 4ZOLB 3CCSV 5AG2A 2FYUH 3ZHTA 1TUBA 2VS0A 5JCOC 2Y69B 5LOVA 2NLJC 1FXVA 5EYPA 4NB5A 3E83A 2OCCC 1XNQO 1VP7A 1WB8A 1CP9A 5JCOA 3ZMZA 2OIEA 4X20B 1URFA 5K1PA 4Z2WA 2OTJV 2CGNA 5IYZA 3ZHQA 1Q5OA 2UU9B 2Q68A 1FFXB 2QKCA 2X0LA 4I55B 3CS5A 3X2QC 5KMGB 1KMIZ 1D5AA 1MA1A 4DW1A 3SYOA 4K8ZA 3FX7A 3ZN1A 4R8CA 4U7NA 5FPRA 2OCCB 5IT9N 3OW2U 4F4LA 1F51A 3JD3A 3AG3C 4TUYA 4JAVA 1Y6XA 2ITCC 2WLMA 2YEVA 2PYJA 3FKSG 4DV7O 1H2SB 4MTGA 1OCCB 4MVSA 3A0BZ 3VOUA 1M1KW 1O9GA 1Y76B 1MNGA 1RSOA 2ADQB 4MVQA 5IJ9B 3IC9A 2Q4PA 1FJGO 4PI2A 1ZL8A 2HR3A 4MVUA 4EFBA 1MZEA 1WN7A 1R3JC 3ZRSA 4RO2A 1M57B 2JEUA 3PJSK 1SRYA 2YIAA 3SPJA 5IJ0B 3CCMV 1VQ9V 1FXHA 3ABMC 2ZINA 4G2KA 1L1FA 3BEHA 2DQ3A 4CS2A 2Q0OC 1NU1H 3D3IA 3DSQA 2XT9A 1QU7A 4EKWA 2ZNJA 4H44B 4N21A 1XNRB 1VF6A 4GYCB 4P9OA 4B3TO 4DV2O 1GK9A 2M6YA 1YTFB 3ICXA 1PV0A 3H1KH 4WFEA 2EJRA 1SQFA 1HW7A 3BPZA 3IGAC 1FD9A 5EZYB 4DR3B 5E1AC 2Q69A 1AI5A 1VQNV 4JV5B 1Y74B 3OMAB 3OMNB 5LHHA 4CZZA 1B3QA 4RUFA 5B1BB 1QLEC 1N33B 3MHHC 4DR1O 1DTOA 1GH6A 3JD2A 1V54B 2Q5ZA 1H8HG 1V54C 4LP8A 1YI2V 4HNAB 2X6AA 4GCZA 3KG2A 1ROPA 4LFAO 1OCRB 5EYPB 3LUTB 1EN6A 1Y76A 2RDCA 3EFFK 3O65A 3AG7A 1BQ0A 3IC7A 4HAMA 1NJIW 2YICA 3APOA 3E22B 2F1MA 1WP7A 3OR6C 3ZS8C 4NR1A 1XREA 4JAUA 4R6ZA 1NR1A 3APQA 3L75H 2ZM6O 3AG4C 4Z1MG 5KMGA 3K9SA 5IYCO 4JI8B 5H6RA 4UB6Z 3IFXA 1FS0G 2UUAO 1JVMA 4JI8O 1XMOO 2GUZA 5IYBO 4LF5B 4LNUA 4PHZA 2VQFB 3LSSA 3B77A 4K35A 2H8PC 4PI0A 4TV8B 4X1YA 4DUYB 5JQGA 4RQEA 2ARHA 3HKEA 5D5QA 1R3LC 3JD0A 4WCEV 3K5NA 3K3WA 4X62B 5DEDA 5B5EZ 1M57C 1X4TA 2QTSA 1FXKB 1SKVA 2GHYA 3NR7A 1VEWA 3A8TA 4ZI7B 5C8YA 3OE7G 3ETDA 1YJNV 2UUBO 2W0FC 1DGSA 3D36A 3M7MX 3FFQA 3CP1A 2YIDA 1SQQH 4DV0O 2E5LO 2P4KA 1QR9A 2OWOA 1F4NA 3CCRV 2F4VO 2CDYA 1HNWB 3G80A 2P5OA 5DECA 1VQLV 1JA8A 1I94B 1NTKH 2ZIMA 4RQFA 4MW8A 3AG4B 2IW5A 2UXCB 3ZRWA 2QSAA 1NVPB 4I9WA 5CA0B 3VQVA 4UXNA 1OZ0A 1H2GA 1FXKA 2ETNA 2WA3A 2BSKA 4GX1A 4PELA 1N34B 3SYAA 1WLEA 3JASB 1CXZB 4JYCA 1GN6A 1TUEB 4N23A 3ZRXA 2XNDG 4JASA 2EJ7A 3C3TA 3JATB 1H2NA 3J80N 2A9HA 5BMVB 3C3SA 4X88A 2NN4A 1IVSA 3I56V 4J7KA 1B04A 4CH4A 4JV5O 3QO7A 2HHHO 5CBFA 2YC0A 1Y67A 4P2ZA 2A7WA 2ZXWB 1MSWD 1WA8B 1BMFG 1DF5A 1SZTA 2KKWA 4NKGB 4WBNA 1GM8A 1AI4A 1P84F 2QGNA 3A0RA 3WB0A 1K9MW 1WJZA 4I0XA 4LFAB 3K5LA 4JI4B 3CMEV 4ZI7A 1QCEA 2P7TC 4TQFA 5KUMA 4UCOA 5LHIA 4UVCA 2Q7EA 3UT5A 3OUFA 2W6IG 5IWAO 2LGWA 1AROP 2CGOA 2VQEO 1I08A 4QNHB 1JX9A 2QR4A 4MTFA 4UVBA 4P30A 3B09A 4O2AB 3P30A 5CN0A 3H1LH 4B08A 2X7RB 5EBWC 1YTFD 4FPPA 1LUWA 3P3NA 1SA0A 5FPOA 2IJJA 1VQMV 2GUZB 1BE3H 2W6JG 4OPHA 3OTOO 3K58A 4QE9A 4B7EA 2AZ0A 2HG5C 3T1YB 1ZSPA 4LNUB 1G4YB 4R7CA 1D2DA 1IX9A 4JI3B 4UCRA 1YHQV 4CH5A 4KP4A 1YJ9V 2RJZA 3CJHB 1Z5WA 4X64O 3K79A 1SQGA 3N2KB 4XDLA 2QM4A 1GM7A 2NR5A 3TCUA 1N36O 5GTIZ 1EM1A 3CRRA 3P32A 2XAJA 3OT7A 3CRCA 1XI1A 1LUVA 2WA4A 1R3IC 3E89A 4GKKO 3EXAA 2WLLA 2ZQMA 4DR3O 2LJ2A 1Z5VA 3CC4V 4DV4B 1S72V 3NXSA 2OTLV 3K59A 3SJQC 1HDJA 1IBLB 1WA8A 1I0HA 1RP3B 5KA6A 2ZNIA 1IXMA 2VWKA 4FLTA 4IGGA 3ZRWB 1B6QA 2BTOA 2ZE7A 4I4TB 4IT5A 2Q6AA 1GMGA 3QG5A 5IDJA 3UT5B 3J81N 2AGAA 2ODMA 3ZIAG 4CH3A 4DV3B 2N05A 1L0NH 3JSNA 5KAFZ 3SJAC 3CE2A 1XOUA 3I55V 4J7JA 4DR6O 1J95A 5JWPA 4ASUG 2CH7B 2QKSA 4O4JB 3ZCCA 1EZVH 3PN1A 1F4MA 2P67A 2QWQB 2YXHA 2DYSB 2DYSC 1DK1A 2KQXA 3ZBHA 3G6BA 1AILA 4H0LB 4QPKA 4KL1A 2Q67A 4YIPA 4QE7A 5IYDO 2CAZC 1H2MA 4XDKA 3LNMB 1KYOF 4G27B 4JI6O 2DYRB 3ZMTA 4DYLA 2LFRA 3JALB 2KG7A 4FIPC 1ZX3A 4MVZA 2EIMB 1XMQO 4ZHQB 2CUGA 1ZLZA 2LFSA 3B2EE 1SQPH 4DR5B 3UO3A 3CEIA 1B06A 4LF9B 1V55C 3LNNA 3ABLC 1N0NA 3W7XA 4F6RB 1FJGB 1HWYA 2WLHA 1SQBH 4DV6O 1WB7A 2LP7A 3R65A 1PL0A 3CCLV 1SA0B 3RWRD 5B1AC 5JH7B 1PPJH 2ZKOA 4J42A 3DXRA 5GTHZ 2X6CA 3CYOA 1BSMA 5CA1B 1AJNA 3RBZA 2OIGA 5B66Z 4UVAA 4DUZO 3UKMA 4JPRA 2K1EA 4FVMA 4OPAA 2ZE5A 1F7YA 1Q81W 4LF7B 5L3GA 2ZE8A 1K33A 1OCRC 3L71H 1OCZB 3RN4A 3E86A 1L0LH 3HB3B 2EIMC 5LMNB 1Q82W 2ZDIA 4P9PA 5LMNO 4BR6A 1BCCH 5LBQA 5LL6Y 2DWDC 4RWUA 3FB5C 2EIJC 4O4LB 4KHPB 1PNKA 4JYBA 4BWAA 1FPOA 1W0JG 2DE0X 1W0KG 3H1IH 5KX5B 2HHHB 3JAMN 5JVDA 3LDCA 4DW0A 2RQ6A 2V4DA 3TXSA 4GZRB 4J9YB 2WPDG 5JQGB 4X20A 4QIWF 2C2AA 1NZ6A 2D2CB 3CRAA 3AG2B 4DK0A 2JGUA 1E79G 4HYOA 1TA8A 2HEPA 2QWRB 4PA7A 5GONB 1H2LA 4JI0O 1VARA 4O4LA 4MS2A 5GW7A 4IIJA 1S3JA 4AQYO 4O4HB 3LDEA 3K57A 3AK3A 2PI4A 3G67A 1RFYA 5CA3A 3OM3B 3ASOC 4LWSA 1PNLA 2F43G 1ENVA 1OCZC 2QM8A 3ZJZA 1GAXA 1GM9A 4FLZA 3ZMSA 1G6UA 3DGEA 3SYQA 1XILA 4NXMO 3D36C 1SF9A 1N8RW 2VQFO 4DUYO 3E8HA 1Z2GA 2UUCB 3B40A 4WFGA 3CPWU 2IU3A 2F23A 2Q8VA 2Z3YA 4W4KA 1COWG 1VQ8V 4J11A 4J80A 1QLNA 3JYCA 4O4HA 1KKCA 4FM1A 4X62O 3CCUV 2CE4A 1AP5A 2Y4UA 3L70H 2YXYA 5J2UA 2RCVA 3N27A 2OT5A 4LWSB 1SQVH 3RVZA 5LGUA 5EBLC 3Q4HA 3HKBA 2F93B 3SYPA 2IJKA 5JVDB 1K4CC 3FAVB 2XOKG 4JYAB 4AHCA 1V55B 4X1IA 3CCEV 3I5DA 2E74B 4JYAO 1NI8A 2F4VB 1M56B 1VQ4V 1FXKC 2ATKC 4B3SO 5D5PA 1I94O 1VQKV 2AZ2A 4UCSA 1R6NA 2GTAA 4UFZA 2N74A 1XL4A 3HKCA 1Q3EA 3BHPA 1SS3A 3FD9A 4DUZB 2FMLA 2B1IA 2ITDC 4IIJB 4H13B 3H1HH 4JZGA 5L3DA 2QJ1A 1NR7A 2ZR3A 3K06A 2DWEC 2B5UA 3WB1A 2HP8A 1KUQA 1R73A 3G4SV 3GB7C 3CHXA 4B3TB 5IJ0A 1XEQA 4ZKIA 4IL6Z 3ASNC 2YXLA 3ASNB 4J9ZB 5KLVH 4MSWC 5B1AB 1BGYH 3ZMVA 1I5XA 1MZFA 3JSLA 2XAGA 2E3CA 2YUAA 3HKCB 4D7SA 4YIOA 3ETEA 2AHYA 2XHBA 1P7BA 4JAAA 3JAWA 4YHHO 5L3FA 1SQXH 2QKAA 2XAQA 5LGNA 3FYEB 4X66B 2EZOA 5B1BC 2FTKA 1TVKA 5IWAB 2WLIB 1QNMA 1NTZH 4PA9A 1JFFA 1NH2B 3WFVA 3ML0A 4B3RO 2R9IA 4HNAA 3E8GA 4NTXA 1AJPA 1ORQC 3CB2A 2UXBO 3VQXA 2DMXA 1NQTA 2ILMA 5BY1A 3TK1A 3CWBH 4YJ3B 2DW4A 4ZIBA 2XTAA 4OGQB 3RT3C 2RNBA 1IZ3A 3K0DA 1SZXA 5IE9A 2QTOA 4LBEC 1R1BA 2YSUB 4ABMA 5KHKA 3ABKB 4PJ0Z 5CB4A 1WAZA
chains in the Genus database with same CATH topology
3QO8A 3ABLB 1BHAA 4XDLA 3E8BA 1GM7A 5B3SB 3CCVV 1AI6A 3TCUA 2H94A 4MVMA 3JD4A 3LDDA 4GX5A 2HLDG 3K0GA 3P32A 4JGSA 1K7DA 1XL6A 4MTOA 3ZN0A 2XAJA 4JTAB 4RAIA 2HFEC 5H6QA 3JD1A 2WWWA 3OUSA 2WLJA 5L3CA 1GTOA 1YSCA 3E89A 1R3IC 2EILB 5EK0A 2WLLA 2HKOA 1JOYA 2ZQMA 4UV9A 2JK5C 3SPCA 3CC4V 1YJWV 2CK3G 3HPLC 1MOFA 3NXSA 1S72V 2OTLV 1LNQA 3SJQC 3K04A 4MTXA 2EINB 4WFAV 4OXSA 1QBZA 5KA6A 1JQ0A 2DQ0A 2JJ2G 4X8AA 1IXMA 3ABMB 3SYCA 5DN6G 5DM6V 3QNEA 1K73W 2IH1C 2HJFC 3ZRWB 1B6QA 3VBBA 1KECA 2HVJC 2X6BA 5L3BA 4JF3A 2Q6AA 3E2EA 1GMGA 2QA4V 5IDJA 1QVFU 3CCSV 3AG3B 2Y69B 3ZIAG 1MG1A 2NLJC 5EC2C 1FXVA 2JEXA 1JJ2U 1YITV 3E83A 2OCCC 2KB1A 1CPYA 1CP9A 3I55V 4FK5C 3ZMZA 3E8FA 5BZBA 1J95A 4ASUG 1Q7YW 2Z5UA 2QKSA 4GX0A 3ZCCA 2OTJV 1NVPD 1F4MA 2P67A 2EILC 3UM7A 1VQOV 1PNMA 2DYSB 2DYSC 3M99B 2Q68A 3CXCU 2X0LA 5KUKA 4QPKA 4QPJA 2P6JA 2Q67A 3RVYA 3EHBB 1KKDA 3X2QC 4QE7A 5IYDO 2GSMB 3ABTA 4XDKA 4BIUA 3LNMB 4G27B 3SYOA 3FB7C 3ZN1A 4R8CA 4U7NA 2V1DA 2OCCB 2DYRB 1EZJA 3ZMTA 3OW2U 5B1OA 1EBOA 1F51A 4F4LA 3JD3A 3AG3C 2LFRA 2PI5A 2WLNA 4FIPC 4MVZA 4JAVA 2EIMB 1BL8A 2ITCC 1KP2A 2WLMA 2YEVA 2LFSA 4PDRA 1E1QG 3FKSG 4FMTA 4MTGA 1OCCB 4MVSA 2WLIA 1K5SA 3VOUA 1M1KW 1V55C 2ZXWC 4MVRA 1KD1W 3ABLC 4PA3A 3W7XA 1VQPV 4MVQA 1HWYA 2WLHA 3OFNG 2HR3A 3CC7V 2LP7A 3R65A 1PL0A 3CCLV 5B1AC 4MVUA 2UXXA 2X6CA 1R3JC 3CYOA 3OMIB 1PD3A 4X89A 4RO2A 3ZRSA 1M57B 1KC8W 3E35A 3MHSC 1AJQA 2XAFA 2JEUA 1VQ6V 3PJSK 1K5QA 1SRYA 3SPJA 3CCMV 1VQ9V 1FXHA 2EZPA 1AJNA 2R9RB 3RBZA 3ABMC 4G2KA 1L1FA 1S5HC 4GX2A 4UVAA 3BEHA 1Q86W 2DQ3A 4GT1A 4YXWG 3UKMA 4JPRA 1MABG 2K1EA 3WG7C 2IJIA 3D3IA 1Q81W 4QJFB 3W7WA 4EKWA 1K97A 5L3GA 3FB8C 5EBMC 4ZBMA 1K33A 1K3EA 1OCRC 1QR8A 4N21A 3W7SA 1OCZB 2A79B 2AHZA 3E86A 2Y48A 1OHHG 2EIMC 3HB3B 4P9OA 2ZDIA 5C93A 1Q82W 4P9PA 1GK9A 1PKXA 1YTFB 3AG1C 1EFRG 5LBQA 2QM7A 4WFEA 2DWDC 3QO5A 2EJRA 3FB5C 2EIJC 3W7UA 4WFBV 4PDLA 3IGAC 5L3EA 5E1AC 1PNKA 2Q69A 1AI5A 4JYBA 4BIZA 1W0JG 4KUMA 1VQNV 1W0KG 3CCQV 3OMAB 3OMNB 1S76D 4DO2A 4PDMA 5LHHA 4CZZA 3LDCA 4RUFA 5B1BB 4MT8A 1S77D 1QLEC 3MHHC 4J9YB 2WPDG 1ZWIC 1M9NA 1VQ5V 1DTOA 1P4RA 2JJ1G 5J9PC 4QIWF 1V54B 2C2AA 3JD2A 1H8HG 1V54C 4LP8A 1YI2V 2X6AA 2JDIG 2WLLB 4GCZA 3KG2A 1ROPA 3TETA 3AG2B 4G28B 1OCRB 5CMUA 2XAHA 2BOCC 3LUTB 2IJHA 1E79G 3EFFK 4HYOA 3OR7C 2DYRC 3T2MA 1FFTB 4PA7A 5B1NA 2QEXV 1QLEB 3IC7A 4HAMA 1NJIW 4MS2A 4FJCC 4TWKA 5GW7A 1S3JA 4XDJA 5IY5B 1RPOA 3LDEA 3FYIB 2PI4A 1Y66A 1YIJV 3OR6C 5CA3A 3OM3B 4JAUA 3ASOC 2IH3C 2ZR2A 1NR1A 4R6ZA 3CMAV 1PNLA 3OEEG 2F43G 4TSFG 1ENVA 1OCZC 1K92A 2QM8A 3ZJZA 3AG4C 2WSSG 1GM9A 1OCOC 2HVKC 3AG1B 3ZMSA 4Z1MG 3DGEA 3SPIA 2M7WA 5IYCO 5H6RA 3SYQA 3IFXA 1FS0G 3STLC 1JVMA 5KA5A 4TT3G 3LSQA 1N8RW 5IYBO 3JCZA 5LGTA 3LSSA 3B77A 1THZA 2H8PC 3E8HA 1WPXA 4RQEA 1KP3A 2ZD9A 3T1CA 1SESA 3CPWU 2Y69C 4WFGA 2IU3A 3OEHG 1R3LC 2Z3YA 3JD0A 4WCEV 1COWG 1VQ8V 3K3WA 1QLNA 2WAMA 3JYCA 3GWOA 3H01A 1M57C 3CCUV 3BY6A 2JIZG 1FXKB 1RM1B 4I5SA 3RW0A 2OT5A 2GHYA 4LC1A 3RVZA 1NBMG 4PA6A 2ZDIC 5LGUA 3CCJV 5EBLC 4E2LA 3F5WC 5B3SC 3SYPA 3OE7G 2IJKA 3ETDA 1YJNV 2W0FC 1K4CC 2WLKA 3D36A 2XOKG 3ABUA 3CP1A 1V55B 3CCEV 1BHBA 1QR9A 1F4NA 3CCRV 2A0LA 1M56B 1VQLV 1VQ4V 1FXKC 2ATKC 3AG2C 4HZ3A 4RQFA 2B1GA 4MW8A 3AG4B 2IW5A 1VQKV 1W2BU 4WFHA 3ZRWA 1R6NA 4BAYA 1NVPB 1XL4A 4JTCB 3ASOB 4I9WA 3AEIA 4MVOA 4UXNA 1AR1B 1OZ0A 1H2GA 1FXKA 3CC2V 1R3KC 1S0VA 2B1IA 2ITDC 4GX1A 4BW5A 1DF4A 1VQ7V 4PELA 3G71V 3K03A 5L3DA 4KFMA 4UUJC 3ZMUA 3SYAA 2EIKC 4WFFA 1WLEA 1NR7A 2ZR3A 3K06A 2DWEC 2B5UA 1F23A 4XBFA 1QVGU 4JYCA 1R73A 3G4SV 1OCOB 1TUEB 3GB7C 3W7TA 1NKDA 4N23A 3ZRXA 3F7VC 2XNDG 4JASA 4U7OA 4ZKIA 2QE7G 3ASNC 3T4DA 3ASNB 4J9ZB 3G6EV 4H37A 2XASA 1H8EG 4MW3A 4MSWC 1UJWB 2A9HA 1K8AW 3ZRVA 2YEVB 4X88A 1E1RG 5CBGA 5B1AB 4DXWA 3ZMVA 4H33A 3I56V 1I5XA 5IY5C 1JPXA 3QO7A 5CBFA 1I5YA 2XAGA 3CD6V 2NNUA 3SPHA 5EC1C 3DTUB 4P2ZA 5HFMA 3ETEA 2ZXWB 3OAAG 2AHYA 1MSWD 5H9CA 1BMFG 1DF5A 1SZTA 4LCUC 1R6KA 2BOBC 1GM8A 1P7BA 1AI4A 2MK3A 1OCCC 2EIJB 3A0RA 1RM1C 4UV8A 1K9MW 5L3FA 4WF9V 3ETGA 1NH2D 3B8NA 3T4ZA 2XAQA 5LGNA 3F7YC 3FYEB 3CMEV 3B8MA 1QCEA 2P7TC 5LHGA 2EZOA 5KUMA 1M56C 5LHIA 4L87A 1G8MA 4UVCA 5B1BC 4CBCA 2FTKA 2EIKB 3OUFA 2W6IG 2WLIB 1RPRA 4JTDB 3MD0A 2IU0A 1AROP 1SERA 4PA4A 1KQSU 2EINC 4QNHB 1JX9A 3K9AA 4R50A 4PA9A 1NH2B 4MTFA 4P30A 4Q20A 4UVBA 3WFVA 3X2QB 1K34A 2V7QG 3P30A 5CN0A 3ML0A 2R9IA 3E8GA 1AJPA 1YTFD 2X7RB 5EBWC 1ORQC 5HFLA 4FPPA 1GO3F 1H38A 1DLBA 1NQTA 2IJJA 3K08A 3TK1A 1AI7A 2DW4A 1VQMV 3SPGA 2W6JG 4QE9A 5CBHA 3STZC 2D3OW 1SETA 2HG5C 2EBOA 1K4DC 1G4YB 3WG7B 1GKFA 3K0DA 4R7CA 4PDVA 2QTOA 3OGCC 1YHQV 2P90A 4KP4A 1Y4MA 4LBEC 1M90W 1JCHA 2YSUB 5FL7G 2UXNA 3ABKC 3ABKB 1YJ9V 1CEZA 4RUEA 3K79A 3FB6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOC C;  2ITD C;  3LUT B;  4MVZ A;  4GX1 A;  1BL8 A;  2ITC C;  4XDL A;  3E8B A;  4PDR A;  2WLM A;  2YEV A;  3EFF K;  4HYO A;  4BW5 A;  3K03 A;  3OR7 C;  2DYR C;  3T2M A;  3TCU A;  4PA7 A;  4KFM A;  4MVM A;  4UUJ C;  4MTG A;  3SYA A;  3LDD A;  4MVS A;  2WLI A;  4GX5 A;  3K0G A;  4MTO A;  1XL6 A;  2EIK C;  4WFF A;  4JTA B;  3FB6 C;  3K06 A;  4RAI A;  2DWE C;  2HFE C;  3VOU A;  4MS2 A;  1V55 C;  2ZXW C;  3OUS A;  4MVR A;  4TWK A;  2WLJ A;  3ABL C;  4XDJ A;  4PA3 A;  3GB7 C;  3LDE A;  3E89 A;  1R3I C;  4MVQ A;  3F7V C;  5EK0 A;  2WLL A;  3OR6 C;  2WLH A;  3ASN C;  3T4D A;  4R6Z A;  4J9Z B;  3ASO C;  2IH3 C;  2JK5 C;  4H37 A;  4MW3 A;  3SPC A;  4MSW C;  3R65 A;  2A9H A;  3HPL C;  4X88 A;  1OCZ C;  5B1A C;  4MVU A;  1LNQ A;  5CBG A;  4DXW A;  3ZJZ A;  3SJQ C;  3AG4 C;  3K04 A;  4H33 A;  2HVK C;  1OCO C;  5IY5 C;  2X6C A;  1R3J C;  4OXS A;  4X8A A;  4X89 A;  4RO2 A;  3ZRS A;  3SPI A;  3SYC A;  5CBF A;  3SYQ A;  2IH1 C;  2HJF C;  3IFX A;  1JVM A;  3PJS K;  3STL C;  3SPH A;  5EC1 C;  4P2Z A;  3SPJ A;  2AHY A;  2HVJ C;  2X6B A;  2R9R B;  3RBZ A;  2H8P C;  4LCU C;  2BOB C;  1P7B A;  3ABM C;  2Q6A A;  3E8H A;  1OCC C;  1S5H C;  4GX2 A;  3BEH A;  2ZD9 A;  3T1C A;  3UKM A;  2Y69 C;  4WFG A;  2K1E A;  1R3L C;  2NLJ C;  5EC2 C;  3T4Z A;  3WG7 C;  3F7Y C;  3JYC A;  2P7T C;  3E83 A;  2OCC C;  1M57 C;  2KB1 A;  1M56 C;  5KUM A;  4EKW A;  3FB8 C;  5B1B C;  4CBC A;  5EBM C;  4ZBM A;  3E8F A;  5BZB A;  3RW0 A;  1J95 A;  3OUF A;  1OCR C;  2WLI B;  2A79 B;  2AHZ A;  3E86 A;  4JTD B;  2QKS A;  2EIM C;  4PA6 A;  4P9O A;  3RVZ A;  4GX0 A;  4PA4 A;  4P9P A;  2EIN C;  3AG1 C;  5EBL C;  3F5W C;  4QNH B;  5B3S C;  2EIL C;  4R50 A;  3UM7 A;  3SYP A;  4PA9 A;  4WFE A;  2DWD C;  4MTF A;  4P30 A;  3FB5 C;  2EIJ C;  2DYS C;  4PDL A;  2Q68 A;  2W0F C;  3IGA C;  1K4C C;  2WLK A;  5E1A C;  5KUK A;  2Q69 A;  3E8G A;  5EBW C;  1ORQ C;  2Q67 A;  3RVY A;  2A0L A;  3K08 A;  4PDM A;  1KKD A;  3X2Q C;  4QE7 A;  3LDC A;  4RUF A;  3SPG A;  2ATK C;  1QLE C;  4QE9 A;  3STZ C;  4XDK A;  5CBH A;  2HG5 C;  3AG2 C;  3LNM B;  4HZ3 A;  4J9Y B;  1K4D C;  4G27 B;  1ZWI C;  3SYO A;  1G4Y B;  4MW8 A;  3FB7 C;  4R8C A;  4WFH A;  3K0D A;  4R7C A;  4PDV A;  2QTO A;  3OGC C;  5J9P C;  1V54 C;  4F4L A;  4LBE C;  1XL4 A;  4LP8 A;  4JTC B;  3AG3 C;  2X6A A;  3ABK C;  4I9W A;  2WLL B;  3KG2 A;  4RUE A;  4MVO A;  3TET A;  4G28 B;  2WLN A;  1R3K C; 
#chains in the Genus database with same CATH topology
 1BHA A;  3AK1 A;  5BR8 B;  2Q7H A;  3RYI B;  3EVK A;  3CCV V;  4MVM A;  5J2U B;  3H9V A;  3LDD A;  1XHZ A;  4GX5 A;  2PY5 A;  3K0G A;  1JFF B;  4JGS A;  1K7D A;  1XL6 A;  4MTO A;  4JTA B;  4RAI A;  2HFE C;  2WLJ A;  3GWK C;  2EIL B;  4UV9 A;  3VQY A;  2CK3 G;  5FNV B;  1MOF A;  1LNQ A;  5KHI A;  4NXN O;  3K04 A;  4CS3 A;  4MTX A;  2EIN B;  3KCX A;  4WFA V;  1QBZ A;  2CTP A;  2DQ0 A;  3CX5 F;  3BA9 A;  3VBB A;  1KEC A;  2X6B A;  2JVD A;  3THO A;  1U96 A;  2R72 A;  4GKJ B;  3E2E A;  3AG3 B;  2Q73 A;  1PP9 H;  1YF2 A;  1IUR A;  1MG1 A;  3U11 A;  2JEX A;  4ICG A;  4NYK A;  4CC6 A;  3E8F A;  4AQY B;  3J7A U;  3RYH A;  2Z5U A;  1Q7Y W;  5LYJ A;  4GX0 A;  1NVP D;  4DR2 B;  2EIL C;  2YIB D;  2UU9 O;  3D3Q A;  3CXC U;  5KUK A;  3AK2 A;  3BCC H;  4IYI A;  5ITZ B;  4TV8 A;  4X1Y B;  3RVY A;  1BZK A;  3EHB B;  1KKD A;  2GSM B;  4Q6G A;  3RYC A;  4DV1 B;  3L73 H;  1EZJ A;  4TQD A;  5B1O A;  2UUC O;  2PI5 A;  1N32 O;  2WLN A;  1BL8 A;  3RYH B;  4FMT A;  2WLI A;  1K5S A;  4NTW A;  1KD1 W;  2ZXW C;  4MVR A;  4PA3 A;  2IM9 A;  2N04 A;  1VQP V;  4IHJ B;  4LR3 A;  3HKD B;  3CC7 V;  2R70 A;  5LMU O;  1P7G A;  4JI7 B;  4B3R B;  4YJ3 A;  1G1X B;  2UXX A;  1MSD A;  1YCI A;  3OMI B;  3RYC B;  1IBK O;  4X89 A;  3S3X A;  5A2Q N;  1TGO A;  1HP8 A;  1KC8 W;  4FZ1 A;  1K5Q A;  4I50 A;  3RGB A;  2EZP A;  3DC5 A;  4FFK A;  5H2F Z;  4F6E A;  1IBM B;  1A32 A;  2CTQ A;  2MW2 B;  1Q86 W;  4LFC B;  4GT1 A;  4YXW G;  1BT8 A;  2GV9 A;  1MAB G;  3QF7 A;  3RYI A;  4J7Z A;  4UCV A;  4QGP A;  4LF7 O;  1K97 A;  4IHJ A;  3JAT A;  4ZBM A;  1QR8 A;  3W7S A;  1Q6U A;  2Y48 A;  1OHH G;  2YIB A;  5C93 A;  1PKX A;  5LXT A;  4W4L A;  5H5N A;  3QO5 A;  4PDL A;  2LO1 A;  4KUM A;  4DV4 O;  1JR9 A;  3HR0 A;  4DO2 A;  1S77 D;  2QWP B;  1ZWI C;  4X9Q A;  4DR1 B;  3T1H O;  1XQ8 A;  1AP6 A;  2JJ1 G;  1O9H A;  2JDI G;  2WLL B;  2RN9 A;  3TET A;  4LF4 B;  2BOC C;  1Q90 D;  3QTC A;  3OR7 C;  2DYR C;  4O2A A;  1R6T A;  2QEX V;  1JJO A;  1QLE B;  1XNQ B;  1TUB B;  3HKB B;  5E79 Z;  3HKE B;  3N2G A;  3BA8 A;  1JMK C;  5IY5 B;  1V9P A;  3FYI B;  1Y66 A;  1YIJ V;  4TOI A;  4UCU A;  1EN5 A;  5J2T B;  2IH3 C;  2ZR2 A;  2CTR A;  2B9Z A;  4FFB A;  1GN2 A;  2UXB B;  5ITZ A;  2JS3 A;  2ZM6 B;  2HVK C;  1OCO C;  2KG7 B;  2M7W A;  3STL C;  5KA5 A;  2F66 C;  1NT2 B;  4TT3 G;  3LSQ A;  4JI6 B;  3JCZ A;  2CH7 A;  1THZ A;  5BXZ A;  4DV1 O;  2ZD9 A;  2YI8 A;  3T1C A;  1HNX O;  3OEH G;  3E22 A;  2IBZ H;  1HNX B;  1L8D A;  1YZB A;  3ZHV A;  3P3P A;  4UCT A;  2WAM A;  1XMQ B;  3MDS A;  4JI2 B;  5JH7 A;  3BY6 A;  2JIZ G;  4FM0 A;  3RW0 A;  1FAF A;  4LC1 A;  1D5N A;  2DJV A;  2E76 B;  4K8X A;  4PA6 A;  3TGU H;  3KCY A;  4LF6 O;  4DR7 O;  2UUB B;  5CA1 A;  2WLK A;  1XUQ A;  2UXD O;  1YDX A;  2ZCE A;  4HBN A;  2XUM A;  1BHB A;  4OX9 O;  1BQZ A;  4DV0 B;  2E5L B;  1TAE A;  4B3S B;  1XHX A;  3AG2 C;  4LH7 A;  1M93 A;  2B1G A;  1U97 A;  4JYY A;  1W2B U;  5JJN B;  4FLY A;  4BAY A;  1OJH A;  2G38 A;  2GTS A;  3AEI A;  5JJE B;  4MVO A;  1S0V A;  4GUN A;  4YY3 O;  1R3K C;  4LFC O;  2Y0I A;  1N34 O;  3N2G B;  4O4J A;  4BW5 A;  5C8Y B;  4BIO A;  1VQ7 V;  3UQ8 A;  5LA6 A;  3GVM A;  3ZHR A;  2EIK C;  1F23 A;  4U3J A;  4XBF A;  1QVG U;  4PD4 F;  2PGG A;  4ZOL A;  1XNR O;  3W7T A;  3F7V C;  3SR2 C;  4U7O A;  1FYJ A;  1VF7 A;  3T4D A;  5LOV B;  1VF5 B;  4FLU A;  4UB8 Z;  2XAS A;  1H8E G;  4MW3 A;  2GBO A;  1UJW B;  2OYQ A;  2PTM A;  2YEV B;  3ETQ A;  4DXW A;  4H33 A;  1JPX A;  2QWN B;  5CA0 A;  1ZAU A;  1VIB A;  2NNU A;  2KSD A;  5IYZ B;  5EC1 C;  4FLX A;  5HFM A;  1LR1 A;  3T1H B;  1FFX A;  1R6K A;  3BAB A;  4K3A A;  2CTW A;  2MK3 A;  1OCC C;  4DK1 A;  4YHH B;  1RM1 C;  3BRC A;  4WF9 V;  3TXQ A;  3B8N A;  3T4Z A;  4U3J B;  3F7Y C;  3B8M A;  4NVP A;  5LHG A;  4FZ0 A;  2O57 A;  4CBC A;  1UFI A;  4JTD B;  2PF4 E;  3MD0 A;  1SER A;  5KHH A;  4PA4 A;  2EIN C;  2JGD A;  3O9O A;  1AVM A;  3K9A A;  3SGI A;  4Z1V A;  2A3Q A;  4Q20 A;  3X2Q B;  4TUY B;  4EFE A;  3OGI B;  1H38 A;  5HFL A;  3ZHU A;  3K08 A;  1AI7 A;  2F95 B;  3SPG A;  3STZ C;  1SET A;  5IJ9 A;  2EBO A;  1PM9 A;  4X1K B;  4CH6 A;  2YS8 A;  3WG7 B;  1ZL8 B;  4LF5 O;  2FB5 A;  5EZY A;  4JI3 O;  2P90 A;  1M90 W;  1M4U A;  5TIS Z;  1JCH A;  3KKY A;  5FL7 G;  5LA6 B;  3ABK C;  4JI1 O;  1CEZ A;  4RUE A;  3FB6 C;  3QO8 A;  4K0K O;  2LW7 A;  5B3S B;  1AI6 A;  5A9G A;  3SJC C;  3WU2 Z;  3JD4 A;  1N36 B;  3S3W A;  4CC5 A;  3ZN0 A;  1SC5 B;  2WWW A;  4GKK B;  5L3C A;  5EK0 A;  4DR4 B;  2VRZ A;  1JOY A;  2Y0P A;  4DR7 B;  4KHP O;  2JK5 C;  3SPC A;  2Y4T A;  3ZHS A;  1YJW V;  1HR0 B;  4NXN B;  1N4C A;  2ZE6 A;  1HR0 O;  2HJD A;  2RMK B;  4X1K A;  4U3F H;  1JQ0 A;  2JJ2 G;  3ABM B;  5EIB C;  2FKX A;  5DN6 G;  1N33 O;  2IH1 C;  2HJF C;  4C7U A;  3CRQ A;  3VQW A;  1XBL A;  1US6 A;  5L3B A;  4JF3 A;  1S5L Z;  4B3M B;  2QA4 V;  1QVF U;  3A2F A;  2EX3 A;  4GLX A;  2YDE A;  1KB9 F;  1HNZ O;  4YY3 B;  5EC2 C;  4DV3 O;  1JJ2 U;  2JGD B;  1YIT V;  2KB1 A;  1CPY A;  1WP8 A;  4DR6 B;  4FK5 C;  5BZB A;  3OD4 A;  1QHT A;  3JAK A;  3HKD A;  2BSK B;  3IAY A;  4DR2 O;  3CSX A;  3TJT A;  3L72 H;  3UM7 A;  1QQC A;  1VQO V;  1PNM A;  1YXB A;  3M99 B;  4BW9 A;  4I4T A;  3JAW B;  2L35 A;  4AI8 A;  4QPJ A;  2P6J A;  1GRJ A;  3ABT A;  4BIU A;  1KU9 A;  3FB7 C;  4DRX A;  2V1D A;  1BS3 A;  4EEQ A;  1EBO A;  2JRI A;  4I9Q A;  1Q8I A;  5LP6 C;  1ZTE A;  1KP2 A;  3JAK B;  4PDR A;  3Q4H B;  1E1Q G;  1PL4 A;  4D6T H;  3BFR A;  4KXR A;  3FAV A;  2A06 H;  4LF9 O;  2PZS A;  4DV6 B;  3OFN G;  1KBH A;  3H1J H;  3BVO A;  2GDS A;  4OX9 B;  1X59 A;  1ZUQ A;  1HNW O;  4O4I A;  1PD3 A;  3JAL A;  2VWJ A;  3E35 A;  3MHS C;  1AJQ A;  2XAF A;  4O2B A;  1VQ6 V;  4JI5 O;  4YJ2 A;  3RFR A;  2R9R B;  4JZ2 A;  5KX5 A;  1S5H C;  3F5T A;  4GX2 A;  1IBM O;  5EIB D;  3WG7 C;  2IJI A;  1Q6H A;  4FLV A;  4QJF B;  3W7W A;  4NTY A;  3FB8 C;  3D8C A;  5EBM C;  4J10 A;  1K3E A;  2P4V A;  4DV2 B;  2A79 B;  2AHZ A;  5LP6 B;  1YEW A;  3N2K A;  3RYF A;  3AG1 C;  1EFR G;  1I7F A;  1WNS A;  4A5U B;  2QM7 A;  3A0H Z;  1AR4 A;  3QVN A;  4LF8 B;  4I0X B;  4DR4 O;  3W7U A;  5GON A;  4WFB V;  4LFB B;  4LF8 O;  5L3E A;  4LFB O;  2JS5 A;  4BIZ A;  3CCQ V;  1MMM A;  5CB4 B;  2OCH A;  1S76 D;  2ZT9 B;  2QDO A;  1VMG A;  4PDM A;  1W59 A;  4MT8 A;  4FLW A;  3CRM A;  4I7Z B;  1M9N A;  2DN9 A;  1VQ5 V;  1P4R A;  2Q0A A;  5J9P C;  2K9P A;  4B3M O;  3CXH F;  4GKJ O;  4LF4 O;  1TVK B;  3MAQ A;  4G28 B;  5CMU A;  2XAH A;  2IJH A;  3JCU Z;  5FNV A;  1HNZ B;  2ZIO A;  3T2M A;  1FFT B;  2DOS A;  3RYF B;  5B1N A;  4EB6 A;  4JI0 B;  4WBN B;  2VQE B;  2BTQ B;  4FJC C;  4TWK A;  4XDJ A;  1RPO A;  1N0J A;  3CMA V;  2Q9L A;  3OEE G;  4TSF G;  1K92 A;  4YJ2 B;  2WSS G;  1J5E B;  3AG1 B;  1J5E O;  2R9A A;  3SPI A;  4NXM B;  2UUA B;  1UPG A;  4IYH A;  2Q7G A;  4DRX B;  1XMO B;  3SDL A;  5LGT A;  4X1I B;  3BAA A;  4JI1 B;  1WPX A;  3JAR A;  1KP3 A;  4X64 B;  1SES A;  4DV5 B;  2BCC H;  1IDS A;  2FL4 A;  2Y69 C;  4EB6 B;  5BR8 O;  5LP6 A;  3C90 A;  2BTQ A;  4JI2 O;  1NS1 A;  3GWO A;  3H01 A;  4DV7 B;  3WB2 A;  1RM1 B;  2ADP A;  4I5S A;  4TV9 A;  3U0Z A;  4DR5 O;  4LF6 B;  1NBM G;  4E4E A;  2ZDI C;  3CCJ V;  4E2L A;  3F5W C;  2YI9 A;  5B3S C;  4I50 B;  3CJH A;  1NTM H;  1T5E A;  3DC6 A;  3ABU A;  1P49 A;  4O4I B;  2Z0A A;  2LGQ A;  1IBL O;  3LSU A;  3OTF A;  4X65 B;  4JI7 O;  3UCS C;  1OV9 A;  2PUS A;  2A0L A;  1GN4 A;  4O2B B;  5JJJ B;  3U10 A;  1IBK B;  2E75 B;  2W0X A;  3JAR B;  4HZ3 A;  1AR5 A;  4WFH A;  1GN3 A;  3B4S A;  4JTC B;  3ASO B;  2EUL A;  5FLX N;  5LXT B;  1AR1 B;  3CC2 V;  4CS4 A;  5LYJ B;  1DF4 A;  3G71 V;  3K03 A;  4KFM A;  4UUJ C;  3ZMU A;  4J41 A;  3L9D A;  4WFF A;  1OCO B;  1NKD A;  2QE7 G;  3G6E V;  5KHJ A;  4H37 A;  1K8A W;  3ZRV A;  4D7T A;  4ZHQ A;  1E1R G;  5CBG A;  5IY5 C;  4I55 A;  1M5I A;  1I5Y A;  2P06 A;  3K5M A;  3CD6 V;  3SPH A;  3DTU B;  3OAA G;  1S5J A;  5H9C A;  4LCU C;  2BOB C;  4L8J A;  2EIJ B;  1VF6 C;  1N32 B;  4UV8 A;  5J2T A;  4JI4 O;  3ETG A;  3R66 A;  4PV1 B;  1NH2 D;  3IJ4 A;  4X66 O;  2PYL A;  4FFB B;  2P22 C;  1M56 C;  2LW1 A;  4L87 A;  1G8M A;  5KHG A;  2EIK B;  3L74 H;  1RPR A;  2IU0 A;  2AXT Z;  1KQS U;  3SJB C;  3JAS A;  4R50 A;  1RSO B;  4B7K A;  1H2K A;  1Q43 A;  5LMU B;  1K34 A;  2V7Q G;  1YVW A;  3ZED A;  2L6L A;  1GO3 F;  1DLB A;  1FKA O;  5BMV A;  5CBH A;  2BE3 A;  4JI5 B;  2D3O W;  3OTO B;  4F6R A;  1K4D C;  4LH6 A;  3T1Y O;  3KZI Z;  1GKF A;  5K1X A;  4PDV A;  3OGC C;  1Y4M A;  2LQT A;  1IXB A;  1AB3 A;  2UXN A;  3DXR B;  4DV5 O;  3ABL B;  3E8B A;  3ZX6 A;  4K0K B;  2H94 A;  4TV9 B;  2HLD G;  5H6Q A;  3JD1 A;  3OUS A;  2H3O A;  1GTO A;  4FM2 A;  2QWO B;  1YSC A;  3UO2 A;  2HKO A;  3M8A A;  3K5O A;  4AIL C;  3HPL C;  2UXD B;  1EN4 A;  4X65 O;  2AW9 A;  4OXS A;  4X8A A;  1Y74 A;  3SYC A;  1Q6I A;  5DM6 V;  3QNE A;  1K73 W;  5KAI Z;  1XDC A;  2HVJ C;  1WPB A;  2UXC O;  5F2V O;  4ZOL B;  3CCS V;  5AG2 A;  2FYU H;  3ZHT A;  1TUB A;  2VS0 A;  5JCO C;  2Y69 B;  5LOV A;  2NLJ C;  1FXV A;  5EYP A;  4NB5 A;  3E83 A;  2OCC C;  1XNQ O;  1VP7 A;  1WB8 A;  1CP9 A;  5JCO A;  3ZMZ A;  2OIE A;  4X20 B;  1URF A;  5K1P A;  4Z2W A;  2OTJ V;  2CGN A;  5IYZ A;  3ZHQ A;  1Q5O A;  2UU9 B;  2Q68 A;  1FFX B;  2QKC A;  2X0L A;  4I55 B;  3CS5 A;  3X2Q C;  5KMG B;  1KMI Z;  1D5A A;  1MA1 A;  4DW1 A;  3SYO A;  4K8Z A;  3FX7 A;  3ZN1 A;  4R8C A;  4U7N A;  5FPR A;  2OCC B;  5IT9 N;  3OW2 U;  4F4L A;  1F51 A;  3JD3 A;  3AG3 C;  4TUY A;  4JAV A;  1Y6X A;  2ITC C;  2WLM A;  2YEV A;  2PYJ A;  3FKS G;  4DV7 O;  1H2S B;  4MTG A;  1OCC B;  4MVS A;  3A0B Z;  3VOU A;  1M1K W;  1O9G A;  1Y76 B;  1MNG A;  1RSO A;  2ADQ B;  4MVQ A;  5IJ9 B;  3IC9 A;  2Q4P A;  1FJG O;  4PI2 A;  1ZL8 A;  2HR3 A;  4MVU A;  4EFB A;  1MZE A;  1WN7 A;  1R3J C;  3ZRS A;  4RO2 A;  1M57 B;  2JEU A;  3PJS K;  1SRY A;  2YIA A;  3SPJ A;  5IJ0 B;  3CCM V;  1VQ9 V;  1FXH A;  3ABM C;  2ZIN A;  4G2K A;  1L1F A;  3BEH A;  2DQ3 A;  4CS2 A;  2Q0O C;  1NU1 H;  3D3I A;  3DSQ A;  2XT9 A;  1QU7 A;  4EKW A;  2ZNJ A;  4H44 B;  4N21 A;  1XNR B;  1VF6 A;  4GYC B;  4P9O A;  4B3T O;  4DV2 O;  1GK9 A;  2M6Y A;  1YTF B;  3ICX A;  1PV0 A;  3H1K H;  4WFE A;  2EJR A;  1SQF A;  1HW7 A;  3BPZ A;  3IGA C;  1FD9 A;  5EZY B;  4DR3 B;  5E1A C;  2Q69 A;  1AI5 A;  1VQN V;  4JV5 B;  1Y74 B;  3OMA B;  3OMN B;  5LHH A;  4CZZ A;  1B3Q A;  4RUF A;  5B1B B;  1QLE C;  1N33 B;  3MHH C;  4DR1 O;  1DTO A;  1GH6 A;  3JD2 A;  1V54 B;  2Q5Z A;  1H8H G;  1V54 C;  4LP8 A;  1YI2 V;  4HNA B;  2X6A A;  4GCZ A;  3KG2 A;  1ROP A;  4LFA O;  1OCR B;  5EYP B;  3LUT B;  1EN6 A;  1Y76 A;  2RDC A;  3EFF K;  3O65 A;  3AG7 A;  1BQ0 A;  3IC7 A;  4HAM A;  1NJI W;  2YIC A;  3APO A;  3E22 B;  2F1M A;  1WP7 A;  3OR6 C;  3ZS8 C;  4NR1 A;  1XRE A;  4JAU A;  4R6Z A;  1NR1 A;  3APQ A;  3L75 H;  2ZM6 O;  3AG4 C;  4Z1M G;  5KMG A;  3K9S A;  5IYC O;  4JI8 B;  5H6R A;  4UB6 Z;  3IFX A;  1FS0 G;  2UUA O;  1JVM A;  4JI8 O;  1XMO O;  2GUZ A;  5IYB O;  4LF5 B;  4LNU A;  4PHZ A;  2VQF B;  3LSS A;  3B77 A;  4K35 A;  2H8P C;  4PI0 A;  4TV8 B;  4X1Y A;  4DUY B;  5JQG A;  4RQE A;  2ARH A;  3HKE A;  5D5Q A;  1R3L C;  3JD0 A;  4WCE V;  3K5N A;  3K3W A;  4X62 B;  5DED A;  5B5E Z;  1M57 C;  1X4T A;  2QTS A;  1FXK B;  1SKV A;  2GHY A;  3NR7 A;  1VEW A;  3A8T A;  4ZI7 B;  5C8Y A;  3OE7 G;  3ETD A;  1YJN V;  2UUB O;  2W0F C;  1DGS A;  3D36 A;  3M7M X;  3FFQ A;  3CP1 A;  2YID A;  1SQQ H;  4DV0 O;  2E5L O;  2P4K A;  1QR9 A;  2OWO A;  1F4N A;  3CCR V;  2F4V O;  2CDY A;  1HNW B;  3G80 A;  2P5O A;  5DEC A;  1VQL V;  1JA8 A;  1I94 B;  1NTK H;  2ZIM A;  4RQF A;  4MW8 A;  3AG4 B;  2IW5 A;  2UXC B;  3ZRW A;  2QSA A;  1NVP B;  4I9W A;  5CA0 B;  3VQV A;  4UXN A;  1OZ0 A;  1H2G A;  1FXK A;  2ETN A;  2WA3 A;  2BSK A;  4GX1 A;  4PEL A;  1N34 B;  3SYA A;  1WLE A;  3JAS B;  1CXZ B;  4JYC A;  1GN6 A;  1TUE B;  4N23 A;  3ZRX A;  2XND G;  4JAS A;  2EJ7 A;  3C3T A;  3JAT B;  1H2N A;  3J80 N;  2A9H A;  5BMV B;  3C3S A;  4X88 A;  2NN4 A;  1IVS A;  3I56 V;  4J7K A;  1B04 A;  4CH4 A;  4JV5 O;  3QO7 A;  2HHH O;  5CBF A;  2YC0 A;  1Y67 A;  4P2Z A;  2A7W A;  2ZXW B;  1MSW D;  1WA8 B;  1BMF G;  1DF5 A;  1SZT A;  2KKW A;  4NKG B;  4WBN A;  1GM8 A;  1AI4 A;  1P84 F;  2QGN A;  3A0R A;  3WB0 A;  1K9M W;  1WJZ A;  4I0X A;  4LFA B;  3K5L A;  4JI4 B;  3CME V;  4ZI7 A;  1QCE A;  2P7T C;  4TQF A;  5KUM A;  4UCO A;  5LHI A;  4UVC A;  2Q7E A;  3UT5 A;  3OUF A;  2W6I G;  5IWA O;  2LGW A;  1ARO P;  2CGO A;  2VQE O;  1I08 A;  4QNH B;  1JX9 A;  2QR4 A;  4MTF A;  4UVB A;  4P30 A;  3B09 A;  4O2A B;  3P30 A;  5CN0 A;  3H1L H;  4B08 A;  2X7R B;  5EBW C;  1YTF D;  4FPP A;  1LUW A;  3P3N A;  1SA0 A;  5FPO A;  2IJJ A;  1VQM V;  2GUZ B;  1BE3 H;  2W6J G;  4OPH A;  3OTO O;  3K58 A;  4QE9 A;  4B7E A;  2AZ0 A;  2HG5 C;  3T1Y B;  1ZSP A;  4LNU B;  1G4Y B;  4R7C A;  1D2D A;  1IX9 A;  4JI3 B;  4UCR A;  1YHQ V;  4CH5 A;  4KP4 A;  1YJ9 V;  2RJZ A;  3CJH B;  1Z5W A;  4X64 O;  3K79 A;  1SQG A;  3N2K B;  4XDL A;  2QM4 A;  1GM7 A;  2NR5 A;  3TCU A;  1N36 O;  5GTI Z;  1EM1 A;  3CRR A;  3P32 A;  2XAJ A;  3OT7 A;  3CRC A;  1XI1 A;  1LUV A;  2WA4 A;  1R3I C;  3E89 A;  4GKK O;  3EXA A;  2WLL A;  2ZQM A;  4DR3 O;  2LJ2 A;  1Z5V A;  3CC4 V;  4DV4 B;  1S72 V;  3NXS A;  2OTL V;  3K59 A;  3SJQ C;  1HDJ A;  1IBL B;  1WA8 A;  1I0H A;  1RP3 B;  5KA6 A;  2ZNI A;  1IXM A;  2VWK A;  4FLT A;  4IGG A;  3ZRW B;  1B6Q A;  2BTO A;  2ZE7 A;  4I4T B;  4IT5 A;  2Q6A A;  1GMG A;  3QG5 A;  5IDJ A;  3UT5 B;  3J81 N;  2AGA A;  2ODM A;  3ZIA G;  4CH3 A;  4DV3 B;  2N05 A;  1L0N H;  3JSN A;  5KAF Z;  3SJA C;  3CE2 A;  1XOU A;  3I55 V;  4J7J A;  4DR6 O;  1J95 A;  5JWP A;  4ASU G;  2CH7 B;  2QKS A;  4O4J B;  3ZCC A;  1EZV H;  3PN1 A;  1F4M A;  2P67 A;  2QWQ B;  2YXH A;  2DYS B;  2DYS C;  1DK1 A;  2KQX A;  3ZBH A;  3G6B A;  1AIL A;  4H0L B;  4QPK A;  4KL1 A;  2Q67 A;  4YIP A;  4QE7 A;  5IYD O;  2CAZ C;  1H2M A;  4XDK A;  3LNM B;  1KYO F;  4G27 B;  4JI6 O;  2DYR B;  3ZMT A;  4DYL A;  2LFR A;  3JAL B;  2KG7 A;  4FIP C;  1ZX3 A;  4MVZ A;  2EIM B;  1XMQ O;  4ZHQ B;  2CUG A;  1ZLZ A;  2LFS A;  3B2E E;  1SQP H;  4DR5 B;  3UO3 A;  3CEI A;  1B06 A;  4LF9 B;  1V55 C;  3LNN A;  3ABL C;  1N0N A;  3W7X A;  4F6R B;  1FJG B;  1HWY A;  2WLH A;  1SQB H;  4DV6 O;  1WB7 A;  2LP7 A;  3R65 A;  1PL0 A;  3CCL V;  1SA0 B;  3RWR D;  5B1A C;  5JH7 B;  1PPJ H;  2ZKO A;  4J42 A;  3DXR A;  5GTH Z;  2X6C A;  3CYO A;  1BSM A;  5CA1 B;  1AJN A;  3RBZ A;  2OIG A;  5B66 Z;  4UVA A;  4DUZ O;  3UKM A;  4JPR A;  2K1E A;  4FVM A;  4OPA A;  2ZE5 A;  1F7Y A;  1Q81 W;  4LF7 B;  5L3G A;  2ZE8 A;  1K33 A;  1OCR C;  3L71 H;  1OCZ B;  3RN4 A;  3E86 A;  1L0L H;  3HB3 B;  2EIM C;  5LMN B;  1Q82 W;  2ZDI A;  4P9P A;  5LMN O;  4BR6 A;  1BCC H;  5LBQ A;  5LL6 Y;  2DWD C;  4RWU A;  3FB5 C;  2EIJ C;  4O4L B;  4KHP B;  1PNK A;  4JYB A;  4BWA A;  1FPO A;  1W0J G;  2DE0 X;  1W0K G;  3H1I H;  5KX5 B;  2HHH B;  3JAM N;  5JVD A;  3LDC A;  4DW0 A;  2RQ6 A;  2V4D A;  3TXS A;  4GZR B;  4J9Y B;  2WPD G;  5JQG B;  4X20 A;  4QIW F;  2C2A A;  1NZ6 A;  2D2C B;  3CRA A;  3AG2 B;  4DK0 A;  2JGU A;  1E79 G;  4HYO A;  1TA8 A;  2HEP A;  2QWR B;  4PA7 A;  5GON B;  1H2L A;  4JI0 O;  1VAR A;  4O4L A;  4MS2 A;  5GW7 A;  4IIJ A;  1S3J A;  4AQY O;  4O4H B;  3LDE A;  3K57 A;  3AK3 A;  2PI4 A;  3G67 A;  1RFY A;  5CA3 A;  3OM3 B;  3ASO C;  4LWS A;  1PNL A;  2F43 G;  1ENV A;  1OCZ C;  2QM8 A;  3ZJZ A;  1GAX A;  1GM9 A;  4FLZ A;  3ZMS A;  1G6U A;  3DGE A;  3SYQ A;  1XIL A;  4NXM O;  3D36 C;  1SF9 A;  1N8R W;  2VQF O;  4DUY O;  3E8H A;  1Z2G A;  2UUC B;  3B40 A;  4WFG A;  3CPW U;  2IU3 A;  2F23 A;  2Q8V A;  2Z3Y A;  4W4K A;  1COW G;  1VQ8 V;  4J11 A;  4J80 A;  1QLN A;  3JYC A;  4O4H A;  1KKC A;  4FM1 A;  4X62 O;  3CCU V;  2CE4 A;  1AP5 A;  2Y4U A;  3L70 H;  2YXY A;  5J2U A;  2RCV A;  3N27 A;  2OT5 A;  4LWS B;  1SQV H;  3RVZ A;  5LGU A;  5EBL C;  3Q4H A;  3HKB A;  2F93 B;  3SYP A;  2IJK A;  5JVD B;  1K4C C;  3FAV B;  2XOK G;  4JYA B;  4AHC A;  1V55 B;  4X1I A;  3CCE V;  3I5D A;  2E74 B;  4JYA O;  1NI8 A;  2F4V B;  1M56 B;  1VQ4 V;  1FXK C;  2ATK C;  4B3S O;  5D5P A;  1I94 O;  1VQK V;  2AZ2 A;  4UCS A;  1R6N A;  2GTA A;  4UFZ A;  2N74 A;  1XL4 A;  3HKC A;  1Q3E A;  3BHP A;  1SS3 A;  3FD9 A;  4DUZ B;  2FML A;  2B1I A;  2ITD C;  4IIJ B;  4H13 B;  3H1H H;  4JZG A;  5L3D A;  2QJ1 A;  1NR7 A;  2ZR3 A;  3K06 A;  2DWE C;  2B5U A;  3WB1 A;  2HP8 A;  1KUQ A;  1R73 A;  3G4S V;  3GB7 C;  3CHX A;  4B3T B;  5IJ0 A;  1XEQ A;  4ZKI A;  4IL6 Z;  3ASN C;  2YXL A;  3ASN B;  4J9Z B;  5KLV H;  4MSW C;  5B1A B;  1BGY H;  3ZMV A;  1I5X A;  1MZF A;  3JSL A;  2XAG A;  2E3C A;  2YUA A;  3HKC B;  4D7S A;  4YIO A;  3ETE A;  2AHY A;  2XHB A;  1P7B A;  4JAA A;  3JAW A;  4YHH O;  5L3F A;  1SQX H;  2QKA A;  2XAQ A;  5LGN A;  3FYE B;  4X66 B;  2EZO A;  5B1B C;  2FTK A;  1TVK A;  5IWA B;  2WLI B;  1QNM A;  1NTZ H;  4PA9 A;  1JFF A;  1NH2 B;  3WFV A;  3ML0 A;  4B3R O;  2R9I A;  4HNA A;  3E8G A;  4NTX A;  1AJP A;  1ORQ C;  3CB2 A;  2UXB O;  3VQX A;  2DMX A;  1NQT A;  2ILM A;  5BY1 A;  3TK1 A;  3CWB H;  4YJ3 B;  2DW4 A;  4ZIB A;  2XTA A;  4OGQ B;  3RT3 C;  2RNB A;  1IZ3 A;  3K0D A;  1SZX A;  5IE9 A;  2QTO A;  4LBE C;  1R1B A;  2YSU B;  4ABM A;  5KHK A;  3ABK B;  4PJ0 Z;  5CB4 A;  1WAZ A; 
#chains in the Genus database with same CATH homology
 3QO8 A;  3ABL B;  1BHA A;  4XDL A;  3E8B A;  1GM7 A;  5B3S B;  3CCV V;  1AI6 A;  3TCU A;  2H94 A;  4MVM A;  3JD4 A;  3LDD A;  4GX5 A;  2HLD G;  3K0G A;  3P32 A;  4JGS A;  1K7D A;  1XL6 A;  4MTO A;  3ZN0 A;  2XAJ A;  4JTA B;  4RAI A;  2HFE C;  5H6Q A;  3JD1 A;  2WWW A;  3OUS A;  2WLJ A;  5L3C A;  1GTO A;  1YSC A;  3E89 A;  1R3I C;  2EIL B;  5EK0 A;  2WLL A;  2HKO A;  1JOY A;  2ZQM A;  4UV9 A;  2JK5 C;  3SPC A;  3CC4 V;  1YJW V;  2CK3 G;  3HPL C;  1MOF A;  3NXS A;  1S72 V;  2OTL V;  1LNQ A;  3SJQ C;  3K04 A;  4MTX A;  2EIN B;  4WFA V;  4OXS A;  1QBZ A;  5KA6 A;  1JQ0 A;  2DQ0 A;  2JJ2 G;  4X8A A;  1IXM A;  3ABM B;  3SYC A;  5DN6 G;  5DM6 V;  3QNE A;  1K73 W;  2IH1 C;  2HJF C;  3ZRW B;  1B6Q A;  3VBB A;  1KEC A;  2HVJ C;  2X6B A;  5L3B A;  4JF3 A;  2Q6A A;  3E2E A;  1GMG A;  2QA4 V;  5IDJ A;  1QVF U;  3CCS V;  3AG3 B;  2Y69 B;  3ZIA G;  1MG1 A;  2NLJ C;  5EC2 C;  1FXV A;  2JEX A;  1JJ2 U;  1YIT V;  3E83 A;  2OCC C;  2KB1 A;  1CPY A;  1CP9 A;  3I55 V;  4FK5 C;  3ZMZ A;  3E8F A;  5BZB A;  1J95 A;  4ASU G;  1Q7Y W;  2Z5U A;  2QKS A;  4GX0 A;  3ZCC A;  2OTJ V;  1NVP D;  1F4M A;  2P67 A;  2EIL C;  3UM7 A;  1VQO V;  1PNM A;  2DYS B;  2DYS C;  3M99 B;  2Q68 A;  3CXC U;  2X0L A;  5KUK A;  4QPK A;  4QPJ A;  2P6J A;  2Q67 A;  3RVY A;  3EHB B;  1KKD A;  3X2Q C;  4QE7 A;  5IYD O;  2GSM B;  3ABT A;  4XDK A;  4BIU A;  3LNM B;  4G27 B;  3SYO A;  3FB7 C;  3ZN1 A;  4R8C A;  4U7N A;  2V1D A;  2OCC B;  2DYR B;  1EZJ A;  3ZMT A;  3OW2 U;  5B1O A;  1EBO A;  1F51 A;  4F4L A;  3JD3 A;  3AG3 C;  2LFR A;  2PI5 A;  2WLN A;  4FIP C;  4MVZ A;  4JAV A;  2EIM B;  1BL8 A;  2ITC C;  1KP2 A;  2WLM A;  2YEV A;  2LFS A;  4PDR A;  1E1Q G;  3FKS G;  4FMT A;  4MTG A;  1OCC B;  4MVS A;  2WLI A;  1K5S A;  3VOU A;  1M1K W;  1V55 C;  2ZXW C;  4MVR A;  1KD1 W;  3ABL C;  4PA3 A;  3W7X A;  1VQP V;  4MVQ A;  1HWY A;  2WLH A;  3OFN G;  2HR3 A;  3CC7 V;  2LP7 A;  3R65 A;  1PL0 A;  3CCL V;  5B1A C;  4MVU A;  2UXX A;  2X6C A;  1R3J C;  3CYO A;  3OMI B;  1PD3 A;  4X89 A;  4RO2 A;  3ZRS A;  1M57 B;  1KC8 W;  3E35 A;  3MHS C;  1AJQ A;  2XAF A;  2JEU A;  1VQ6 V;  3PJS K;  1K5Q A;  1SRY A;  3SPJ A;  3CCM V;  1VQ9 V;  1FXH A;  2EZP A;  1AJN A;  2R9R B;  3RBZ A;  3ABM C;  4G2K A;  1L1F A;  1S5H C;  4GX2 A;  4UVA A;  3BEH A;  1Q86 W;  2DQ3 A;  4GT1 A;  4YXW G;  3UKM A;  4JPR A;  1MAB G;  2K1E A;  3WG7 C;  2IJI A;  3D3I A;  1Q81 W;  4QJF B;  3W7W A;  4EKW A;  1K97 A;  5L3G A;  3FB8 C;  5EBM C;  4ZBM A;  1K33 A;  1K3E A;  1OCR C;  1QR8 A;  4N21 A;  3W7S A;  1OCZ B;  2A79 B;  2AHZ A;  3E86 A;  2Y48 A;  1OHH G;  2EIM C;  3HB3 B;  4P9O A;  2ZDI A;  5C93 A;  1Q82 W;  4P9P A;  1GK9 A;  1PKX A;  1YTF B;  3AG1 C;  1EFR G;  5LBQ A;  2QM7 A;  4WFE A;  2DWD C;  3QO5 A;  2EJR A;  3FB5 C;  2EIJ C;  3W7U A;  4WFB V;  4PDL A;  3IGA C;  5L3E A;  5E1A C;  1PNK A;  2Q69 A;  1AI5 A;  4JYB A;  4BIZ A;  1W0J G;  4KUM A;  1VQN V;  1W0K G;  3CCQ V;  3OMA B;  3OMN B;  1S76 D;  4DO2 A;  4PDM A;  5LHH A;  4CZZ A;  3LDC A;  4RUF A;  5B1B B;  4MT8 A;  1S77 D;  1QLE C;  3MHH C;  4J9Y B;  2WPD G;  1ZWI C;  1M9N A;  1VQ5 V;  1DTO A;  1P4R A;  2JJ1 G;  5J9P C;  4QIW F;  1V54 B;  2C2A A;  3JD2 A;  1H8H G;  1V54 C;  4LP8 A;  1YI2 V;  2X6A A;  2JDI G;  2WLL B;  4GCZ A;  3KG2 A;  1ROP A;  3TET A;  3AG2 B;  4G28 B;  1OCR B;  5CMU A;  2XAH A;  2BOC C;  3LUT B;  2IJH A;  1E79 G;  3EFF K;  4HYO A;  3OR7 C;  2DYR C;  3T2M A;  1FFT B;  4PA7 A;  5B1N A;  2QEX V;  1QLE B;  3IC7 A;  4HAM A;  1NJI W;  4MS2 A;  4FJC C;  4TWK A;  5GW7 A;  1S3J A;  4XDJ A;  5IY5 B;  1RPO A;  3LDE A;  3FYI B;  2PI4 A;  1Y66 A;  1YIJ V;  3OR6 C;  5CA3 A;  3OM3 B;  4JAU A;  3ASO C;  2IH3 C;  2ZR2 A;  1NR1 A;  4R6Z A;  3CMA V;  1PNL A;  3OEE G;  2F43 G;  4TSF G;  1ENV A;  1OCZ C;  1K92 A;  2QM8 A;  3ZJZ A;  3AG4 C;  2WSS G;  1GM9 A;  1OCO C;  2HVK C;  3AG1 B;  3ZMS A;  4Z1M G;  3DGE A;  3SPI A;  2M7W A;  5IYC O;  5H6R A;  3SYQ A;  3IFX A;  1FS0 G;  3STL C;  1JVM A;  5KA5 A;  4TT3 G;  3LSQ A;  1N8R W;  5IYB O;  3JCZ A;  5LGT A;  3LSS A;  3B77 A;  1THZ A;  2H8P C;  3E8H A;  1WPX A;  4RQE A;  1KP3 A;  2ZD9 A;  3T1C A;  1SES A;  3CPW U;  2Y69 C;  4WFG A;  2IU3 A;  3OEH G;  1R3L C;  2Z3Y A;  3JD0 A;  4WCE V;  1COW G;  1VQ8 V;  3K3W A;  1QLN A;  2WAM A;  3JYC A;  3GWO A;  3H01 A;  1M57 C;  3CCU V;  3BY6 A;  2JIZ G;  1FXK B;  1RM1 B;  4I5S A;  3RW0 A;  2OT5 A;  2GHY A;  4LC1 A;  3RVZ A;  1NBM G;  4PA6 A;  2ZDI C;  5LGU A;  3CCJ V;  5EBL C;  4E2L A;  3F5W C;  5B3S C;  3SYP A;  3OE7 G;  2IJK A;  3ETD A;  1YJN V;  2W0F C;  1K4C C;  2WLK A;  3D36 A;  2XOK G;  3ABU A;  3CP1 A;  1V55 B;  3CCE V;  1BHB A;  1QR9 A;  1F4N A;  3CCR V;  2A0L A;  1M56 B;  1VQL V;  1VQ4 V;  1FXK C;  2ATK C;  3AG2 C;  4HZ3 A;  4RQF A;  2B1G A;  4MW8 A;  3AG4 B;  2IW5 A;  1VQK V;  1W2B U;  4WFH A;  3ZRW A;  1R6N A;  4BAY A;  1NVP B;  1XL4 A;  4JTC B;  3ASO B;  4I9W A;  3AEI A;  4MVO A;  4UXN A;  1AR1 B;  1OZ0 A;  1H2G A;  1FXK A;  3CC2 V;  1R3K C;  1S0V A;  2B1I A;  2ITD C;  4GX1 A;  4BW5 A;  1DF4 A;  1VQ7 V;  4PEL A;  3G71 V;  3K03 A;  5L3D A;  4KFM A;  4UUJ C;  3ZMU A;  3SYA A;  2EIK C;  4WFF A;  1WLE A;  1NR7 A;  2ZR3 A;  3K06 A;  2DWE C;  2B5U A;  1F23 A;  4XBF A;  1QVG U;  4JYC A;  1R73 A;  3G4S V;  1OCO B;  1TUE B;  3GB7 C;  3W7T A;  1NKD A;  4N23 A;  3ZRX A;  3F7V C;  2XND G;  4JAS A;  4U7O A;  4ZKI A;  2QE7 G;  3ASN C;  3T4D A;  3ASN B;  4J9Z B;  3G6E V;  4H37 A;  2XAS A;  1H8E G;  4MW3 A;  4MSW C;  1UJW B;  2A9H A;  1K8A W;  3ZRV A;  2YEV B;  4X88 A;  1E1R G;  5CBG A;  5B1A B;  4DXW A;  3ZMV A;  4H33 A;  3I56 V;  1I5X A;  5IY5 C;  1JPX A;  3QO7 A;  5CBF A;  1I5Y A;  2XAG A;  3CD6 V;  2NNU A;  3SPH A;  5EC1 C;  3DTU B;  4P2Z A;  5HFM A;  3ETE A;  2ZXW B;  3OAA G;  2AHY A;  1MSW D;  5H9C A;  1BMF G;  1DF5 A;  1SZT A;  4LCU C;  1R6K A;  2BOB C;  1GM8 A;  1P7B A;  1AI4 A;  2MK3 A;  1OCC C;  2EIJ B;  3A0R A;  1RM1 C;  4UV8 A;  1K9M W;  5L3F A;  4WF9 V;  3ETG A;  1NH2 D;  3B8N A;  3T4Z A;  2XAQ A;  5LGN A;  3F7Y C;  3FYE B;  3CME V;  3B8M A;  1QCE A;  2P7T C;  5LHG A;  2EZO A;  5KUM A;  1M56 C;  5LHI A;  4L87 A;  1G8M A;  4UVC A;  5B1B C;  4CBC A;  2FTK A;  2EIK B;  3OUF A;  2W6I G;  2WLI B;  1RPR A;  4JTD B;  3MD0 A;  2IU0 A;  1ARO P;  1SER A;  4PA4 A;  1KQS U;  2EIN C;  4QNH B;  1JX9 A;  3K9A A;  4R50 A;  4PA9 A;  1NH2 B;  4MTF A;  4P30 A;  4Q20 A;  4UVB A;  3WFV A;  3X2Q B;  1K34 A;  2V7Q G;  3P30 A;  5CN0 A;  3ML0 A;  2R9I A;  3E8G A;  1AJP A;  1YTF D;  2X7R B;  5EBW C;  1ORQ C;  5HFL A;  4FPP A;  1GO3 F;  1H38 A;  1DLB A;  1NQT A;  2IJJ A;  3K08 A;  3TK1 A;  1AI7 A;  2DW4 A;  1VQM V;  3SPG A;  2W6J G;  4QE9 A;  5CBH A;  3STZ C;  2D3O W;  1SET A;  2HG5 C;  2EBO A;  1K4D C;  1G4Y B;  3WG7 B;  1GKF A;  3K0D A;  4R7C A;  4PDV A;  2QTO A;  3OGC C;  1YHQ V;  2P90 A;  4KP4 A;  1Y4M A;  4LBE C;  1M90 W;  1JCH A;  2YSU B;  5FL7 G;  2UXN A;  3ABK C;  3ABK B;  1YJ9 V;  1CEZ A;  4RUE A;  3K79 A;  3FB6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...