2Q68A

Crystal structure of nak channel d66a, s70e double mutants
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFEPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q68A00
1R3IC 2HFEC 3UKMA 2IH1C 4MVUA 3ASNC 2X6CA 3UM7A 4P9PA 2DYRC 4PA4A 1BL8A 1LNQA 3OUSA 5CBGA 4MTGA 4GX1A 4KFMA 2A0LA 5B1AC 3VOUA 4MSWC 3RW0A 2DWEC 1KKDA 1OCCC 1K4CC 2BOBC 4RUEA 4R7CA 4XDKA 2EIMC 4G27B 4PA6A 1K4DC 4MVQA 3K08A 1J95A 3KG2A 3STZC 3K0DA 3SPIA 1M57C 2ATKC 5EC1C 3AG2C 2HVJC 2Q68A 3FB5C 3K03A 3E8GA 3T1CA 3TCUA 3K0GA 1OCOC 4PA3A 4PA7A 1ZWIC 1R3KC 2DYSC 3ABLC 4H37A 4F4LA 3OGCC 5CBHA 2WLIA 3E8BA 3TETA 4PDRA 3OR7C 4MTOA 2EIJC 2EILC 5J9PC 3AG4C 4WFGA 3ZRSA 3K04A 4PA9A 4LCUC 2BOCC 4X89A 2IH3C 2Q67A 2WLJA 3SPCA 4MW3A 3PJSK 2WLHA 3LNMB 4MVMA 1ORQC 2WLLA 3E8HA 1S5HC 2WLKA 2WLMA 4J9ZB 4X8AA 2DWDC 2H8PC 2JK5C 3FB6C 2EINC 3F5WC 1R3LC 2NLJC 2OCCC 4MW8A 4TWKA 4PDMA 4P2ZA 3OR6C 3ABKC 4QE7A 2HG5C 3AG3C 2Q6AA 3LUTB 3F7VC 1QLEC 4JTDB 3JYCA 2P7TC 4I9WA 4QE9A 4MVRA 4HYOA 4WFFA 1JVMA 3SYQA 2HVKC 5B1BC 4LP8A 4MTFA 4PDLA 3SYCA 4BW5A 5EBWC 5KUMA 3T4ZA 1M56C 3RVYA 3K06A 2Q69A 2WLIB 2ITCC 5EBLC 3FB7C 4R6ZA 3E89A 3RBZA 3E8FA 4H33A 3SPHA 4MS2A 3FB8C 3IFXA 1XL6A 5B3SC 3HPLC 3E86A 2QKSA 3E83A 2A79B 4LBEC 5IY5C 2ITDC 2WLLB 5E1AC 2ZXWC 3WG7C 3SYPA 2X6BA 4QNHB 2Y69C 4RUFA 4J9YB 4OXSA 3EFFK 4JTAB 4GX5A 1V55C 4X88A 3SYOA 3SPGA 2AHZA 4MVOA 3SJQC 3IGAC 4WFHA 3BEHA 4P9OA 1P7BA 4P30A 3LDCA 2QTOA 4ZBMA 4PDVA 4WFEA 3F7YC 3T2MA 2W0FC 1G4YB 5BZBA 5KUKA 2ZD9A 2X6AA 4UUJC 1XL4A 2YEVA 4GX0A 4CBCA 3T4DA 4EKWA 2A9HA 2WLNA 4HZ3A 4R8CA 1OCRC 4JTCB 4RAIA 4R50A 4DXWA 4MVZA 5EBMC 3SPJA 1OCZC 3LDDA 3ABMC 4RO2A 3SYAA 2KB1A 4XDLA 5EK0A 3STLC 2AHYA 3OUFA 1V54C 3RVZA 4MVSA 3R65A 1R3JC 5CBFA 3AG1C 4XDJA 5EC2C 3ZJZA 4GX2A 2HJFC 2K1EA 3GB7C 2EIKC 3LDEA 4G28B 2R9RB 3X2QC 3ASOC
chains in the Genus database with same CATH superfamily
4YIOA 5LOVB 2IH1C 2UU9O 1B06A 2W0XA 3JD1A 3GWOA 4X66B 1I5YA 3BFRA 2IJKA 1UFIA 1Y74A 5AG2A 4HBNA 2UXBO 4U7NA 3JARB 2OCCB 2HHHO 4FFKA 4KL1A 2Z0AA 3OE7G 4JASA 3E8BA 2KKWA 3L74H 1YVWA 4I50B 2Z3YA 1IBLO 3JD4A 5EYPB 4DR6B 4UCTA 1OCOB 2XAHA 1F23A 1H38A 4FIPC 3CX5F 1DK1A 4TWKA 4I5SA 2E76B 4KXRA 4X1IB 1N34B 2UXNA 4QE9A 1PPJH 2L35A 4O2BA 2WLIB 2ITCC 2FMLA 5LHGA 2QA4V 1WA8B 4F6EA 2AXTZ 4F6RB 5LBQA 1S77D 4CH6A 4WBNB 3N2GA 1R6KA 4DUYO 1N33O 1COWG 1HR0B 5FNVB 4Z1VA 1Y4MA 1Q5OA 3F7YC 2Y69B 1VMGA 4UUJC 3T1YO 2FKXA 2A9HA 5CA1A 3DXRB 1M9NA 3OTFA 5CB4A 5CBFA 4JI8B 1ZLZA 1HWYA 3T1HB 4GX2A 1BGYH 1FAFA 1E1RG 4UB8Z 2HKOA 4DV3B 3AG2B 3BA9A 2Q9LA 3ASNC 2X6CA 4G2KA 4PA4A 2W6IG 3OTOO 3CCLV 4GX1A 1KBHA 1HDJA 2DWEC 4DV6O 1OCCC 3UQ8A 3UT5B 4ZI7A 4FLVA 3G6EV 2Z5UA 1WP7A 1X59A 2RJZA 1B6QA 5IJ0A 4L87A 4FFBB 3JAKB 4JI6O 2JGDB 4Z2WA 3ABUA 4EEQA 1XBLA 2CTWA 2M6YA 2LP7A 4WFGA 2N04A 2X0LA 1EM1A 2WLJA 4MW3A 4QGPA 3K59A 2WLLA 2BTQA 4WCEV 3CP1A 5KHKA 2PYJA 4LF6O 1SERA 1KKCA 4AQYO 5JJEB 3CC4V 4DRXB 1Z2GA 4DR5B 3ICXA 5KUMA 2PI4A 1VQ8V 3SJBC 4TV9A 4B3SO 2P4KA 5LL6Y 5K1XA 1S5JA 5IYBO 2OTJV 1XL6A 3HPLC 5IYZA 4O4LA 2VWJA 2YIAA 3ZBHA 2A79B 3I5DA 1OJHA 2X6BA 1TUBA 4IHJA 3FYEB 5EZYA 3CHXA 4QIWF 4NTXA 1PKXA 2ZM6O 1V55C 3CCMV 3QO7A 1H2GA 1GN4A 4PHZA 4LF4O 2AZ0A 1WNSA 4J10A 4HNAA 5DM6V 3ZCCA 1CXZB 3UO3A 1FPOA 3HKDA 1EBOA 1GK9A 2RNBA 4MVSA 3R65A 2ZR2A 2CTRA 3VQYA 3H1IH 1THZA 5EC2C 1MMMA 3N2KB 4FMTA 4FLZA 5KHIA 1R3IC 2AZ2A 1NR1A 1V54B 2RMKB 3R66A 3UM7A 3U10A 1VQ4V 2GV9A 2ETNA 1A32A 2FL4A 3OFNG 2EIMC 2PI5A 1MZFA 3STZC 4UB6Z 1S72V 2LW1A 4TQDA 1BZKA 4JYYA 2PTMA 2ODMA 1Q6IA 4JYAB 5LGTA 3ABLC 1VQPV 3TETA 2GUZB 2F43G 3ZMTA 2EJRA 4LCUC 2IH3C 2LFRA 4GYCB 3ZRSA 4W4KA 3ZS8C 2NLJC 4J7JA 4WF9V 4DV1B 2EIJB 3CCRV 3OR6C 1H2SB 5B1BB 3P32A 1NS1A 2EINB 3AK2A 2ZXWB 4H13B 3WU2Z 3ZRXA 3T4ZA 4LFBB 3P3NA 1QVGU 1SQGA 3VQVA 4LFAO 3RFRA 5LXTB 1AJNA 2JVDA 1H2KA 1HNXO 2QE7G 4O4HB 1SESA 1XEQA 1RPOA 4N21A 3LNNA 5DECA 1MA1A 1GM8A 2V1DA 4AILC 1HNZO 3MHSC 2UUAB 2V4DA 4RQFA 4DR1O 4LWSB 2LQTA 4PDVA 1OZ0A 2ZD9A 4E2LA 3JD0A 3ETQA 2VQFB 4JTCB 3SPJA 1OCZC 4JAUA 4XDLA 5FL7G 3MDSA 3OUFA 3RVZA 4JI3B 3CRRA 4XDJA 4IYHA 2K1EA 4CZZA 2F93B 4G28B 3ETDA 4X20B 4X9QA 1BT8A 1WB7A 3KKYA 1K8AW 5BMVB 1XNRO 3W7UA 4LF5O 4FM0A 1L8DA 1VF5B 2IM9A 1VEWA 3O65A 3S3XA 5JQGA 1FFXA 3G80A 4BIZA 3SDLA 3B40A 4O2AA 2P5OA 3T1CA 1JJ2U 1FXKB 4PA7A 3LSQA 2ZE7A 3K5MA 3CRAA 1JQ0A 2QSAA 3B8NA 2P4VA 5KAIZ 3K04A 1CPYA 5H9CA 2ZKOA 1RSOB 4MVMA 3ETEA 4X66O 1AROP 4DR7B 4JAVA 2LFSA 3A0HZ 1SQBH 4IIJB 3B8MA 2ILMA 1JX9A 2PGGA 3KCXA 1VP7A 3CSXA 5EBWC 4X64B 3K06A 3CWBH 1DTOA 3FB7C 1G6UA 3RYFB 3E2EA 2YXLA 2BSKA 3VQWA 4DR6O 3K58A 4PI0A 5E79Z 1SRYA 1MZEA 1IX9A 4U3JB 1N34O 3KZIZ 4JI2B 3KCYA 3BRCA 3CB2A 5IY5B 3HKBA 1ZTEA 4P9OA 4ZBMA 1GN6A 4NVPA 4DV7O 3T2MA 4GKKB 1FJGO 1WLEA 4B3MO 4ZHQA 2PZSA 1VIBA 1N32B 4MVZA 3CC2V 2B9ZA 4X1KA 1RP3B 1XMQO 5EK0A 4FVMA 4UCRA 4D7SA 4YHHB 1R3JC 2R72A 1VQKV 3RYIA 2FTKA 1HR0O 1KECA 3AK3A 3FAVB 3MD0A 3H01A 2VQEB 1NU1H 1B04A 2GBOA 4I0XA 2A0LA 2CH7B 3D36C 1IXBA 5C8YB 1HW7A 4MVQA 4UVAA 1SQPH 5A9GA 1QQCA 4Q20A 2HVJC 1Q7YW 3TCUA 1FFTB 4O4IB 2QJ1A 1H8HG 1NH2D 4LF8B 1M57B 2JIZG 2PUSA 4YY3B 4DV3O 3GVMA 1BQ0A 3W7SA 1Y76A 1K92A 3ML0A 1M90W 1Q8IA 3E8HA 5CA0B 4JPRA 3ZN0A 2H8PC 4LH7A 2YEVB 4EB6A 3AG4B 4NTYA 4QE7A 1U97A 4CH5A 3OM3B 1NVPD 2C2AA 2QM8A 3HKEB 1S0VA 4IGGA 1R73A 3OW2U 2LGWA 5GONB 3CD6V 1SC5B 3RBZA 3CRQA 4X62B 4LNUB 2JJ2G 1BE3H 2QKSA 2R70A 3L75H 4I9QA 5HFMA 5JH7A 5E1AC 5LHIA 3P30A 1M1KW 4U3FH 4ZOLB 2YC0A 5LA6A 5EYPA 4UXNA 4PI2A 2F4VB 2W0FC 2XNDG 1I7FA 2FB5A 3OEHG 4NTWA 4DYLA 5J2TB 4DXWA 5EBMC 1QR8A 4JI7B 5C93A 1S5LZ 5DEDA 2YXYA 2AHYA 3BA8A 3AK1A 1F4MA 3ZJZA 3DGEA 2WWWA 3CCEV 1F4NA 3Q4HB 3SJAC 3ZRWB 2R9RB 3ASOC 2QGNA 3RGBA 3FD9A 5JJNB 3C3TA 1WA8A 3BAAA 4QPKA 4CS2A 4WBNA 4I55A 4GT1A 2Q8VA 2DYRB 3KG2A 3JATB 1P4RA 1BMFG 2IJHA 2F1MA 3SPIA 2DQ3A 1QNMA 4N23A 4X65O 4X1YB 2QWRB 1NT2B 1YXBA 3PJSK 3LNMB 2XAJA 3RYHB 2N74A 1B3QA 2EILB 3D3QA 1J5EB 2HEPA 5EIBC 4DR2O 4CH3A 4DV2B 4MVRA 4HYOA 3LSUA 1US6A 2WA3A 4KUMA 1Q81W 1N36O 1M56C 3OMIB 1M93A 2Q7GA 1QVFU 1PV0A 3RYCB 2UUCB 3UT5A 4J41A 3P3PA 1BCCH 3U11A 1YHQV 1L0LH 2ITDC 2JDIG 2YSUB 4BW9A 1I5XA 4DV1O 4FLTA 1IBMB 4I4TA 3JAKA 2WAMA 3L70H 4FK5C 1TUEB 3CS5A 3JSNA 4X88A 2A7WA 1YJNV 3WG7B 4WFHA 1GTOA 4P30A 2QTOA 1AI4A 4UCVA 4LFBO 3WB0A 3E22B 2R9IA 5L3DA 2LGQA 3F5TA 3SJCC 1KP3A 3AG1C 2HJFC 2IJIA 4FJCC 1SA0B 3K0DA 2UUAO 1XUQA 4NXMB 1GN3A 4KFMA 5B1AC 3FKSG 3WB1A 3K5NA 5IE9A 4XDKA 1PNMA 2ZT9B 5IYDO 3ZN1A 1J95A 1IDSA 4JV5B 2Q68A 3JASB 4JI3O 1PL0A 4J7ZA 3L71H 1YITV 1PNKA 2UXXA 2DYSC 2UUBB 4TV8B 1K73W 5JVDB 1YI2V 3BABA 2VWKA 5J2UA 5KX5A 5KA6A 2WLMA 2WA4A 2N05A 1GM9A 2RCVA 3IC9A 3VBBA 4DO2A 5CA3A 1RPRA 1ZX3A 1RM1B 3AG3C 1N0NA 1LR1A 2JRIA 4LP8A 3SYCA 4BW5A 2OTLV 1W2BU 3BVOA 3J7AU 4YIPA 2JS5A 4MS2A 5B3SC 2P22C 3RT3C 4DR3B 4GZRB 3OD4A 1GM7A 1LUVA 1W59A 2XOKG 4DR7O 1QR9A 3CPWU 1XNQB 1N8RW 2GUZA 2ADQB 4GX5A 4B3RB 1T5EA 1O9HA 2AHZA 2YICA 2ZDIA 4LF7B 4X64O 2UXCB 2ZIMA 2D2CB 4O2BB 5IWAB 1XL4A 4GX0A 3T4DA 5KHGA 2QWQB 3ABMC 2NN4A 5B1OA 3CXCU 1UPGA 3D36A 1MABG 4LH6A 2CTPA 3N2GB 1GMGA 4JI2O 2GTAA 4W4LA 3X2QC 5JJJB 4NKGB 1EFRG 4KHPB 1KMIZ 5DN6G 5LXTA 5H5NA 1NJIW 1LNQA 1K7DA 3K79A 4TUYA 3ABTA 3OAAG 4GKKO 2LW7A 1KKDA 2RDCA 1G8MA 1N32O 1K4DC 1KYOF 2CTQA 3FB5C 5CB4B 4YHHO 4LWSA 5IJ9A 1OCOC 1YZBA 1KB9F 5JCOA 3BY6A 1NH2B 5GTIZ 5J9PC 2VQEO 2BOCC 1FXVA 1SQQH 4FPPA 1ORQC 1AP6A 2JK5C 2K9PA 3G71V 5GW7A 1YTFD 4X20A 3QTCA 3ZHSA 1NVPB 1R6NA 2QR4A 4WFFA 5IJ0B 1AJPA 4PELA 3K3WA 4LF8O 5CN0A 5K1PA 3OT7A 5L3EA 5EBLC 4YY3O 3E89A 3IFXA 3ZMVA 3JAWB 2WLLB 2BTQB 1WPBA 5ITZB 3I55V 3K9AA 1FXKA 2JJ1G 4DK1A 1VQLV 4B7KA 2Y69C 2E5LB 2Y0IA 2ARHA 4L8JA 4MVOA 2QWNB 1P7BA 4DV5O 5B1NA 4WFEA 2F66C 3JALA 4EKWA 1I94B 1K33A 4O4LB 3CRCA 4IIJA 3JD2A 4CC5A 1IXMA 5IT9N 3D8CA 2YS8A 2FYUH 2DN9A 5L3FA 1VQ7V 3AEIA 2UXDB 3RYFA 4MVUA 1K5SA 2EIKB 4UV8A 1SQVH 2GHYA 3J80N 1K4CC 3IAYA 1N33B 4YXWG 4FLXA 4JI7O 4C7UA 3JAMN 5BXZA 3K03A 4JF3A 1BHBA 2F95B 2QKAA 4PDRA 3OR7C 5IDJA 1BQZA 4JGSA 1DF5A 4ABMA 4O4JA 1IBKB 1R6TA 1WJZA 1PL4A 4UVBA 2DWDC 1AI7A 1EZVH 1ROPA 3F5WC 1FYJA 4PDMA 5TISZ 4EFBA 2HG5C 4K35A 3LUTB 3CCUV 3APOA 2YIBD 2DQ0A 2ADPA 4D7TA 5LP6B 2AGAA 1QHTA 4U7OA 4JZGA 3CRMA 3ABKB 2CH7A 3HR0A 1HNWB 1EN6A 4DV0B 4MTXA 3W7TA 1QLEB 4RQEA 2W6JG 4PJ0Z 5C8YA 3SPHA 1YJWV 5D5QA 4JI5B 4UCOA 1WPXA 1J5EO 4O4IA 1TAEA 3QO5A 1MSWD 4RUFA 1R1BA 3EFFK 4DV2O 3O9OA 2OIGA 2OIEA 3BEHA 1CEZA 5CA0A 4D6TH 2YEVA 2WLNA 1AI5A 2UUCO 3A0BZ 4YJ3A 2H3OA 4AQYB 4FZ0A 1WAZA 1SZXA 1V54C 1OCRB 1IBMO 1FS0G 5GONA 4B3SB 5BY1A 2QWOB 2X7RB 4P9PA 2GTSA 3H1JH 1D5NA 3VOUA 2B1IA 5IYCO 4OGQB 3HKCB 4PA6A 4YJ2B 2ATKC 4ZOLA 4DW0A 2Y0PA 3CEIA 2ZDIC 5CBHA 4NR1A 2PYLA 4BWAA 1DGSA 1K9MW 1BSMA 2NR5A 3BCCH 5KLVH 2EIJC 3ZMUA 3OMNB 5J2TA 1ZUQA 3CJHB 4NXMO 5B1BC 2DMXA 2EINC 1R3LC 1Q3EA 2DJVA 5KMGB 3ZHUA 1GH6A 2IJJA 3ZRWA 2P7TC 2OCHA 4JI8O 4O2AB 2CK3G 3T1HO 2B1GA 2UUBO 3ZHTA 2XHBA 1IZ3A 2XAGA 3ZHRA 3N27A 3ZX6A 1W0JG 2P6JA 2JS3A 4UVCA 2EULA 5JCOC 3B2EE 5JWPA 1VQ9V 1EN4A 4BIOA 5LOVA 2Y4UA 3IGAC 3SJQC 2CGOA 5KAFZ 4J42A 2LJ2A 4JI4B 2EBOA 4FM1A 1SS3A 5LMUB 3FFQA 5LYJB 2D3OW 4DR3O 4OPAA 1GO3F 1NTKH 4B08A 2CE4A 3JARA 5GTHZ 4E4EA 3A0RA 1Q6HA 4JI1B 1YCIA 2Q7EA 3CYOA 1XNQO 5L3CA 4I50A 3W7WA 4XBFA 4LFAB 4B3RO 3RYCA 3UO2A 4DR5O 4AI8A 1YIJV 4LF7O 3H1LH 4ZIBA 3CC7V 1UJWB 3CCQV 3GWKC 1K5QA 2XAQA 2BOBC 4R7CA 1XHZA 4X1IA 1FXKC 1PP9H 1V9PA 3ASNB 4JYCA 2YI8A 3SR2C 5EC1C 1ZL8B 1OCCB 1KD1W 4PA3A 4OPHA 1ZWIC 2KG7B 3CE2A 4F4LA 2P06A 2WLIA 5KHHA 3E22A 4KHPO 2Q67A 3MHHC 4F6RA 3FB6C 5FPRA 1VQOV 1KC8W 5FNVA 1ZAUA 1SA0A 1YTFB 2KQXA 2XAFA 3NXSA 1S76D 1JFFB 1Q43A 3K9SA 3RN4A 1AR4A 1TVKB 1D2DA 3FB8C 5H6QA 1YF2A 3DXRA 5LMNB 5IY5C 4JZ2A 4WFAV 2P67A 2OT5A 4NB5A 3BPZA 4J9YB 4OXSA 4TV8A 3SYOA 5JVDA 1BS3A 1NKDA 4JYAO 3FYIB 1G4YB 1IVSA 4TQFA 3X2QB 1V55B 2EZPA 5LGNA 2Q4PA 4FM2A 5JH7B 4OX9B 4FFBA 3CCSV 3OGIB 2JGDA 3GB7C 3ZMZA 2QM7A 2E5LO 2M7WA 4J7KA 3D3IA 4LF9B 5LA6B 2RN9A 1URFA 5CBGA 4K3AA 2HLDG 4G27B 4JYBA 1XHXA 1O9GA 2CGNA 4FZ1A 1I94O 4DR4B 2MW2B 4DRXA 1M57C 4LR3A 1VQ6V 2EIMB 4DV7B 1FJGB 4ZKIA 2UXDO 4MTOA 4B3MB 2V7QG 3CCJV 3AG4C 4PA9A 1JMKC 3M7MX 3QG5A 1YJ9V 2GDSA 3ABLB 1MOFA 3J81N 1XMQB 2OWOA 1KUQA 2VQFO 1P84F 4I55B 2MK3A 1L1FA 2Q6AA 1JR9A 2PY5A 2Q73A 1NBMG 4MTFA 1K3EA 2E74B 4K0KB 5EIBD 4J80A 3B09A 2Q69A 1NQTA 2AW9A 4R6ZA 2QM4A 2ZIOA 2ZE6A 4DUZB 1IBKO 3E86A 3DC6A 5KA5A 3JCZA 1TGOA 1FD9A 3N2KA 3NR7A 1Y74B 1CP9A 2YIDA 1Z5VA 4DW1A 4JTAB 1I0HA 3DSQA 3TGUH 3QO8A 4UCUA 1HNWO 4DV0O 4PD4F 1MSDA 3JD3A 1VQ5V 4CH4A 1XOUA 4MT8A 3ETGA 4JI5O 4CS4A 2EZOA 2Q7HA 1H8EG 4I4TB 1GKFA 3CXHF 1OCZB 3FX7A 3IC7A 3ZIAG 3OEEG 1AR1B 1YDXA 1BHAA 3EVKA 2XTAA 2DYRC 4MTGA 4JAAA 2DOSA 3ZHVA 3JAWA 4MSWC 5ITZA 2BTOA 1MG1A 3WFVA 2E3CA 3K08A 5FLXN 1L0NH 4UCSA 3L9DA 1VARA 1AI6A 1XMOB 4UV9A 2Y48A 4Q6GA 3QF7A 1NTZH 1GN2A 3E35A 4JI0B 1JA8A 1WN7A 2EILC 5LGUA 2BCCH 2RQ6A 2QWPB 2WLHA 4O4HA 1S5HC 2Q0AA 3A2FA 4X8AA 2R9AA 4HAMA 1JJOA 2OCCC 5L3BA 2DW4A 5A2QN 4B3TB 5CA1B 1Z5WA 4QPJA 4DV4B 2Q0OC 3CMAV 3F7VC 4GKJB 1KU9A 5D5PA 3B77A 1H2LA 4K8XA 4NXNB 1U96A 2CDYA 2IU3A 3QNEA 4H33A 1EZJA 1DLBA 3BHPA 2XUMA 2O57A 4LBEC 5BR8B 5J2UB 5KX5B 1QLNA 3H1KH 2F23A 3WG7C 3K5LA 4LFCB 4ZI7B 1E1QG 2OYQA 1SKVA 1Q6UA 2QTSA 4X65B 2UU9B 3K5OA 1PNLA 5BMVA 4FLYA 1QU7A 4RAIA 3M99B 4FLWA 4H0LB 1K97A 1NTMH 1TA8A 4DR2B 1K34A 2UXBB 3S3WA 2VRZA 1S3JA 2G38A 1RFYA 1WP8A 2HHHB 5LP6A 3PN1A 2P90A 2L6LA 1N36B 1GAXA 4DK0A 4I7ZB 1IBLB 2HFEC 1PD3A 1RSOA 4BAYA 4NYKA 4TV9B 4JI4O 5B66Z 2Q5ZA 1P7GA 3B4SA 2ZINA 3THOA 4X62O 5LMUO 5IYZB 4TSFG 3EXAA 2ZNIA 1SQXH 3AG2C 1PM9A 2ZE5A 4IL6Z 1VQNV 1XILA 4A5UB 3ZMSA 1TUBB 4IHJB 5EZYB 1F7YA 4JI1O 4H37A 3OGCC 1H2NA 3DTUB 1VF6A 4QJFB 1RM1C 3SPCA 2F4VO 1LUWA 2WLKA 4TUYB 4HNAB 4DUYB 2YDEA 2HR3A 1JCHA 4P2ZA 4U3JA 1D5AA 2ZQMA 1SZTA 3HKDB 3JYCA 5KHJA 2WSSG 1SF9A 4ASUG 5IJ9B 3RVYA 4GLXA 1F51A 2XT9A 3T1YB 3E8FA 3HKCA 3SGIA 1W0KG 4YJ2A 2IBZH 4CC6A 4UFZA 1XI1A 5L3GA 3SYPA 2JGUA 4GUNA 3U0ZA 4PV1B 3FAVA 3OTOB 2ZCEA 3CJHA 1AVMA 3H1HH 5KUKA 2X6AA 4DV6B 4IT5A 3C3SA 4CBCA 3JCUZ 4HZ3A 4IYIA 4R8CA 5KMGA 1DF4A 1N4CA 3SYAA 5LMNO 1QCEA 2XASA 3EHBB 3STLC 2A3QA 1AILA 1Y6XA 4JI6B 2EJ7A 4J9ZB 5LHHA 1Y66A 3HB3B 2B5UA 1SETA 3ZRVA 4H44B 5CMUA 1BL8A 3OUSA 2WPDG 1AJQA 4RWUA 2GSMB 3JALB 3RW0A 2HP8A 3ASOB 1GRJA 4RUEA 4LF6B 1AR5A 5HFLA 2IW5A 3TXSA 1Q90D 3HKEA 1YSCA 4OX9O 4BR6A 3E8GA 3K0GA 1Q82W 1R3KC 2IU0A 3K57A 5H6RA 4LNUA 4X89A 5LYJA 3M8AA 4LF9O 3OMAB 1VF7A 4FLUA 1M5IA 4K8ZA 4MW8A 1QBZA 2YI9A 1IURA 3DC5A 3QVNA 4DR4O 2ZM6B 4AHCA 3SYQA 1JVMA 4LF4B 2QDOA 3CCVV 4PDLA 4TOIA 2CUGA 4TT3G 3L72H 1XDCA 4ICGA 4O4JB 1FKAO 2HJDA 1M56B 1WB8A 1ZL8A 2ZXWC 1KQSU 2JEXA 3I56V 4QNHB 2KG7A 1N0JA 3Q4HA 1M4UA 5JQGB 2LO1A 1FFXB 4BIUA 4JV5O 1E79G 3W7XA 2EX3A 3LDCA 4K0KO 1SQFA 3LSSA 3ZEDA 1EN5A 1NR7A 4DUZO 3JATA 1KP2A 2NNUA 4RO2A 1P49A 2JEUA 2H94A 1OV9A 3G4SV 1JFFA 2EIKC 1JPXA 4X1YA 3UKMA 3CMEV 1TVKA 3AG1B 2E75B 3RYHA 1FXHA 1XQ8A 3H9VA 2QKCA 3JSLA 4CS3A 2ZE8A 2VS0A 2BSKB 5B5EZ 5B1AB 3RWRD 4YJ3B 1G1XB 1OHHG 1NZ6A 2A06H 3AG7A 4DV5B 3WB2A 3HKBB 4EFEA 1AB3A 1ZSPA 1HNXB 2UXCO 3C90A 2DYSB 5IWAO 1MNGA 5LP6C 4ZHQB 4J11A 2CAZC 1HP8A 3ABKC 4X1KB 5F2VO 1QLEC 4JTDB 1HNZB 4I9WA 1XMOO 2YUAA 1Y67A 4DR1B 2HVKC 3ZHQA 1XREA 4B7EA 3RYIB 3TK1A 1NI8A 3G6BA 3AG3B 4JI0O 3L73H 2DE0X 2BE3A 1I08A 3TJTA 4I0XB 2QEXV 3E83A 5FPOA 1X4TA 1H2MA 3APQA 3G67A 5B3SB 4Z1MG 3IJ4A 2ZNJA 4B3TO 1JOYA 1YEWA 1Q86W 4DV4O 5H2FZ 2Y4TA 3UCSC 3SPGA 1VF6C 4GKJO 3A8TA 2KSDA 3TXQA 3MAQA 1ENVA 2YXHA 5BZBA 1XNRB 2ZR3A 1VQMV 4LF5B 3VQXA 4NXNO 1OCRC 1Y76B 1AP5A 4R50A 3LDDA 4WFBV 2KB1A 5BR8O 3JASA 4GCZA 2YIBA 4EB6B 2PF4E 4KP4A 4LFCO 3LDEA 3ABMB 4LC1A
chains in the Genus database with same CATH topology
1AR1B 3MD0A 1BHAA 2IH1C 3H01A 4MVUA 2DYRC 4MTGA 3JD1A 1K5SA 2A0LA 2EIKB 3GWOA 4MSWC 4UV8A 2GHYA 1K4CC 1I5YA 1MG1A 3WFVA 2IJKA 4MVQA 3K08A 4UVAA 4YXWG 4Q20A 1AI6A 2HVJC 4UV9A 4U7NA 3K03A 2OCCB 1Q7YW 4JF3A 3TCUA 2Y48A 1BHBA 1FFTB 3E35A 1H8HG 3OE7G 1NH2D 4JASA 3E8BA 4PDRA 3OR7C 5IDJA 1M57B 2JIZG 4JGSA 1DF5A 2Z3YA 2EILC 3JD4A 5LGUA 3W7SA 1K92A 3ML0A 1M90W 1OCOB 2WLHA 2XAHA 3E8HA 1F23A 1S5HC 4JPRA 4X8AA 3ZN0A 4UVBA 2DWDC 1AI7A 2H8PC 4HAMA 3F5WC 1ROPA 2OCCC 4FIPC 5L3BA 1H38A 2DW4A 2YEVB 4TWKA 4PDMA 3AG4B 4I5SA 4QE7A 4QPJA 2HG5C 3OM3B 3LUTB 1NVPD 3CMAV 3CCUV 3F7VC 2C2AA 2QM8A 2UXNA 2DQ0A 4QE9A 4LC1A 1S0VA 4U7OA 3B77A 1R73A 3OW2U 3ABKB 3CD6V 2WLIB 4MTXA 2ITCC 1QLEB 2IU3A 3QNEA 3W7TA 4RQEA 3RBZA 2W6JG 4H33A 3SPHA 1YJWV 1EZJA 1DLBA 5LHGA 2QA4V 2JJ2G 2QKSA 4LBEC 5HFMA 1QLNA 5E1AC 5LHIA 5LBQA 1S77D 3P30A 3WG7C 1M1KW 1R6KA 1WPXA 1E1QG 1COWG 3QO5A 1MSWD 4RUFA 3EFFK 1Y4MA 3BEHA 1CEZA 1PNLA 4UXNA 3F7YC 2W0FC 2XNDG 2Y69B 3OEHG 4UUJC 2YEVA 2A9HA 2WLNA 1AI5A 4RAIA 4DXWA 3M99B 5EBMC 1QR8A 1K97A 5C93A 1K34A 1S3JA 2AHYA 1M9NA 1V54C 5CBFA 2P90A 1F4MA 1OCRB 1HWYA 3ZJZA 4GX2A 1FS0G 2WWWA 1E1RG 3DGEA 3CCEV 1F4NA 3ZRWB 2HKOA 2R9RB 3ASOC 2HFEC 3AG2B 1PD3A 2X7RB 3ASNC 2X6CA 4P9PA 4G2KA 4PA4A 2W6IG 3CCLV 4GX1A 4BAYA 4QPKA 3VOUA 2B1IA 5IYCO 2DWEC 1OCCC 4GT1A 4PA6A 2DYRB 3KG2A 4TSFG 1P4RA 1BMFG 2IJHA 3SPIA 2Z5UA 3G6EV 2ATKC 3AG2C 1B6QA 4L87A 1VQNV 2DQ3A 3ZMSA 2ZDIC 4H37A 5CBHA 3ABUA 3OGCC 4N23A 1K9MW 3DTUB 2LP7A 2EIJC 3ZMUA 3OMNB 4WFGA 2X0LA 4QJFB 1RM1C 2WLJA 3SPCA 4MW3A 3PJSK 3LNMB 5B1BC 2XAJA 2WLLA 2WLKA 2EINC 1R3LC 4WCEV 3CP1A 2EILB 2HR3A 1JCHA 4P2ZA 2IJJA 1SERA 2ZQMA 3ZRWA 1SZTA 3CC4V 3JYCA 2P7TC 2WSSG 4MVRA 4HYOA 2CK3G 4KUMA 1Q81W 2B1GA 5KUMA 4ASUG 1VQ8V 2PI4A 1M56C 3RVYA 3OMIB 1F51A 5IYBO 2XAGA 3E8FA 1QVFU 2OTJV 1XL6A 3HPLC 1W0KG 2A79B 1YHQV 2ITDC 2JDIG 2YSUB 1W0JG 2P6JA 5L3GA 1I5XA 3SYPA 2X6BA 4UVCA 3FYEB 2WAMA 4FK5C 1TUEB 4QIWF 1VQ9V 1PKXA 1V55C 4X88A 3CCMV 3QO7A 1YJNV 1H2GA 3WG7B 3SJQC 3IGAC 4WFHA 1GTOA 4P30A 2QTOA 1AI4A 5KUKA 2X6AA 2EBOA 4CBCA 5DM6V 4HZ3A 4R8CA 3ZCCA 1DF4A 2R9IA 3SYAA 2D3OW 1QCEA 2XASA 3EHBB 5L3DA 1GO3F 1EBOA 1GK9A 3STLC 4MVSA 1KP3A 2ZR2A 3R65A 3AG1C 1THZA 5EC2C 3A0RA 2HJFC 2IJIA 3CYOA 4FMTA 4J9ZB 5L3CA 4FJCC 3K0DA 3W7WA 1R3IC 4XBFA 5LHHA 1NR1A 1V54B 1Y66A 2B5UA 1SETA 3HB3B 3ZRVA 1YIJV 3UM7A 5CMUA 1BL8A 3OUSA 1VQ4V 2WPDG 4KFMA 3CC7V 1AJQA 1UJWB 5B1AC 3CCQV 2GSMB 3RW0A 3FKSG 3ASOB 1K5QA 2XAQA 2BOBC 4RUEA 3OFNG 4R7CA 1PNMA 4XDKA 2EIMC 5IYDO 2PI5A 1FXKC 3ASNB 4JYCA 5HFLA 3ZN1A 2IW5A 1J95A 3STZC 1S72V 5EC1C 1YSCA 2Q68A 1OCCB 1PL0A 3E8GA 1KD1W 3K0GA 1Q82W 4PA3A 1YITV 1PNKA 1R3KC 1ZWIC 2DYSC 2UXXA 3ABLC 4F4LA 5LGTA 3TETA 2WLIA 1VQPV 2F43G 2IU0A 3ZMTA 1K73W 2EJRA 5H6RA 4X89A 4LCUC 2IH3C 2LFRA 2Q67A 1YI2V 3OMAB 3MHHC 3ZRSA 5KA6A 2WLMA 3FB6C 1GM9A 2NLJC 4MW8A 4WF9V 1VQOV 1QBZA 2EIJB 3VBBA 4DO2A 1KC8W 5CA3A 3CCRV 1RPRA 1RM1B 3OR6C 3AG3C 5B1BB 3P32A 1YTFB 2EINB 2XAFA 2ZXWB 3SYQA 1JVMA 3NXSA 3CCVV 4LP8A 3SYCA 4PDLA 4BW5A 1S76D 3ZRXA 3T4ZA 2OTLV 1W2BU 4TT3G 1QVGU 4MS2A 3FB8C 5H6QA 1AJNA 5B3SC 2QE7G 5IY5C 1M56B 1GM7A 4WFAV 2ZXWC 1SESA 2P67A 1KQSU 2JEXA 2OT5A 2XOKG 1RPOA 3I56V 1QR9A 4QNHB 4N21A 3CPWU 1N8RW 1GM8A 4J9YB 4OXSA 2V1DA 4GX5A 3SYOA 4BIUA 1E79G 3MHSC 2AHZA 3W7XA 4RQFA 2ZDIA 1NKDA 3LDCA 4PDVA 3FYIB 1OZ0A 1G4YB 2ZD9A 3LSSA 4E2LA 3JD0A 1XL4A 4GX0A 3X2QB 1V55B 1NR7A 3T4DA 2EZPA 4JTCB 5LGNA 1KP2A 2NNUA 1OCZC 3SPJA 3ABMC 4JAUA 4RO2A 5B1OA 4XDLA 3CXCU 5FL7G 3D36A 2JEUA 3OUFA 2H94A 3RVZA 3CCSV 1MABG 4XDJA 3G4SV 3GB7C 2K1EA 4CZZA 2EIKC 1GMGA 4G28B 3ZMZA 2QM7A 3X2QC 1JPXA 3ETDA 2M7WA 3UKMA 3CMEV 1EFRG 5DN6G 3D3IA 3AG1B 1NJIW 1LNQA 5CBGA 1K8AW 1K7DA 1FXHA 3K79A 3ABTA 3W7UA 3OAAG 1KKDA 1G8MA 2HLDG 4G27B 4JYBA 1K4DC 5B1AB 1M57C 4BIZA 1OHHG 3FB5C 1VQ6V 3T1CA 2EIMB 1JJ2U 1FXKB 1OCOC 4PA7A 3LSQA 3BY6A 1NH2B 4ZKIA 4MTOA 1JQ0A 2V7QG 5J9PC 3CCJV 3AG4C 3B8NA 3K04A 4PA9A 2BOCC 1CPYA 1FXVA 5H9CA 4FPPA 4MVMA 1YJ9V 1ORQC 2DYSB 3ABLB 1MOFA 3ETEA 2JK5C 1AROP 3G71V 2MK3A 5GW7A 4JAVA 1L1FA 3ABKC 2Q6AA 2LFSA 1YTFD 1QLEC 3B8MA 4JTDB 1NVPB 1JX9A 4I9WA 1R6NA 4WFFA 1NBMG 2HVKC 4MTFA 1K3EA 1AJPA 5EBWC 4PELA 3TK1A 3K06A 3AG3B 3K3WA 2Q69A 5CN0A 1DTOA 1NQTA 5L3EA 5EBLC 3FB7C 4R6ZA 3E89A 3E2EA 3IFXA 3E86A 3ZMVA 2QEXV 3E83A 5KA5A 3JCZA 2WLLB 1SRYA 3I55V 3K9AA 1FXKA 2JJ1G 1VQLV 5B3SB 4Z1MG 1JOYA 1Q86W 2Y69C 1CP9A 5IY5B 4JTAB 3SPGA 4MVOA 4P9OA 1P7BA 4ZBMA 5B1NA 4WFEA 3T2MA 1ENVA 3QO8A 5BZBA 2ZR3A 1VQMV 1WLEA 4EKWA 3JD3A 1VQ5V 1OCRC 4R50A 4MVZA 4MT8A 3CC2V 3LDDA 4WFBV 1K33A 2KB1A 5EK0A 3ETGA 3JD2A 4GCZA 1R3JC 1IXMA 4KP4A 2EZOA 1VQKV 1H8EG 5L3FA 1GKFA 2FTKA 1OCZB 3IC7A 3ABMB 3LDEA 3ZIAG 1VQ7V 1KECA 3AEIA 3OEEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3I C;  2HFE C;  3UKM A;  2IH1 C;  4MVU A;  3ASN C;  2X6C A;  3UM7 A;  4P9P A;  2DYR C;  4PA4 A;  1BL8 A;  1LNQ A;  3OUS A;  5CBG A;  4MTG A;  4GX1 A;  4KFM A;  2A0L A;  5B1A C;  3VOU A;  4MSW C;  3RW0 A;  2DWE C;  1KKD A;  1OCC C;  1K4C C;  2BOB C;  4RUE A;  4R7C A;  4XDK A;  2EIM C;  4G27 B;  4PA6 A;  1K4D C;  4MVQ A;  3K08 A;  1J95 A;  3KG2 A;  3STZ C;  3K0D A;  3SPI A;  1M57 C;  2ATK C;  5EC1 C;  3AG2 C;  2HVJ C;  2Q68 A;  3FB5 C;  3K03 A;  3E8G A;  3T1C A;  3TCU A;  3K0G A;  1OCO C;  4PA3 A;  4PA7 A;  1ZWI C;  1R3K C;  2DYS C;  3ABL C;  4H37 A;  4F4L A;  3OGC C;  5CBH A;  2WLI A;  3E8B A;  3TET A;  4PDR A;  3OR7 C;  4MTO A;  2EIJ C;  2EIL C;  5J9P C;  3AG4 C;  4WFG A;  3ZRS A;  3K04 A;  4PA9 A;  4LCU C;  2BOC C;  4X89 A;  2IH3 C;  2Q67 A;  2WLJ A;  3SPC A;  4MW3 A;  3PJS K;  2WLH A;  3LNM B;  4MVM A;  1ORQ C;  2WLL A;  3E8H A;  1S5H C;  2WLK A;  2WLM A;  4J9Z B;  4X8A A;  2DWD C;  2H8P C;  2JK5 C;  3FB6 C;  2EIN C;  3F5W C;  1R3L C;  2NLJ C;  2OCC C;  4MW8 A;  4TWK A;  4PDM A;  4P2Z A;  3OR6 C;  3ABK C;  4QE7 A;  2HG5 C;  3AG3 C;  2Q6A A;  3LUT B;  3F7V C;  1QLE C;  4JTD B;  3JYC A;  2P7T C;  4I9W A;  4QE9 A;  4MVR A;  4HYO A;  4WFF A;  1JVM A;  3SYQ A;  2HVK C;  5B1B C;  4LP8 A;  4MTF A;  4PDL A;  3SYC A;  4BW5 A;  5EBW C;  5KUM A;  3T4Z A;  1M56 C;  3RVY A;  3K06 A;  2Q69 A;  2WLI B;  2ITC C;  5EBL C;  3FB7 C;  4R6Z A;  3E89 A;  3RBZ A;  3E8F A;  4H33 A;  3SPH A;  4MS2 A;  3FB8 C;  3IFX A;  1XL6 A;  5B3S C;  3HPL C;  3E86 A;  2QKS A;  3E83 A;  2A79 B;  4LBE C;  5IY5 C;  2ITD C;  2WLL B;  5E1A C;  2ZXW C;  3WG7 C;  3SYP A;  2X6B A;  4QNH B;  2Y69 C;  4RUF A;  4J9Y B;  4OXS A;  3EFF K;  4JTA B;  4GX5 A;  1V55 C;  4X88 A;  3SYO A;  3SPG A;  2AHZ A;  4MVO A;  3SJQ C;  3IGA C;  4WFH A;  3BEH A;  4P9O A;  1P7B A;  4P30 A;  3LDC A;  2QTO A;  4ZBM A;  4PDV A;  4WFE A;  3F7Y C;  3T2M A;  2W0F C;  1G4Y B;  5BZB A;  5KUK A;  2ZD9 A;  2X6A A;  4UUJ C;  1XL4 A;  2YEV A;  4GX0 A;  4CBC A;  3T4D A;  4EKW A;  2A9H A;  2WLN A;  4HZ3 A;  4R8C A;  1OCR C;  4JTC B;  4RAI A;  4R50 A;  4DXW A;  4MVZ A;  5EBM C;  3SPJ A;  1OCZ C;  3LDD A;  3ABM C;  4RO2 A;  3SYA A;  2KB1 A;  4XDL A;  5EK0 A;  3STL C;  2AHY A;  3OUF A;  1V54 C;  3RVZ A;  4MVS A;  3R65 A;  1R3J C;  5CBF A;  3AG1 C;  4XDJ A;  5EC2 C;  3ZJZ A;  4GX2 A;  2HJF C;  2K1E A;  3GB7 C;  2EIK C;  3LDE A;  4G28 B;  2R9R B;  3X2Q C;  3ASO C; 
#chains in the Genus database with same CATH topology
 4YIO A;  5LOV B;  2IH1 C;  2UU9 O;  1B06 A;  2W0X A;  3JD1 A;  3GWO A;  4X66 B;  1I5Y A;  3BFR A;  2IJK A;  1UFI A;  1Y74 A;  5AG2 A;  4HBN A;  2UXB O;  4U7N A;  3JAR B;  2OCC B;  2HHH O;  4FFK A;  4KL1 A;  2Z0A A;  3OE7 G;  4JAS A;  3E8B A;  2KKW A;  3L74 H;  1YVW A;  4I50 B;  2Z3Y A;  1IBL O;  3JD4 A;  5EYP B;  4DR6 B;  4UCT A;  1OCO B;  2XAH A;  1F23 A;  1H38 A;  4FIP C;  3CX5 F;  1DK1 A;  4TWK A;  4I5S A;  2E76 B;  4KXR A;  4X1I B;  1N34 B;  2UXN A;  4QE9 A;  1PPJ H;  2L35 A;  4O2B A;  2WLI B;  2ITC C;  2FML A;  5LHG A;  2QA4 V;  1WA8 B;  4F6E A;  2AXT Z;  4F6R B;  5LBQ A;  1S77 D;  4CH6 A;  4WBN B;  3N2G A;  1R6K A;  4DUY O;  1N33 O;  1COW G;  1HR0 B;  5FNV B;  4Z1V A;  1Y4M A;  1Q5O A;  3F7Y C;  2Y69 B;  1VMG A;  4UUJ C;  3T1Y O;  2FKX A;  2A9H A;  5CA1 A;  3DXR B;  1M9N A;  3OTF A;  5CB4 A;  5CBF A;  4JI8 B;  1ZLZ A;  1HWY A;  3T1H B;  4GX2 A;  1BGY H;  1FAF A;  1E1R G;  4UB8 Z;  2HKO A;  4DV3 B;  3AG2 B;  3BA9 A;  2Q9L A;  3ASN C;  2X6C A;  4G2K A;  4PA4 A;  2W6I G;  3OTO O;  3CCL V;  4GX1 A;  1KBH A;  1HDJ A;  2DWE C;  4DV6 O;  1OCC C;  3UQ8 A;  3UT5 B;  4ZI7 A;  4FLV A;  3G6E V;  2Z5U A;  1WP7 A;  1X59 A;  2RJZ A;  1B6Q A;  5IJ0 A;  4L87 A;  4FFB B;  3JAK B;  4JI6 O;  2JGD B;  4Z2W A;  3ABU A;  4EEQ A;  1XBL A;  2CTW A;  2M6Y A;  2LP7 A;  4WFG A;  2N04 A;  2X0L A;  1EM1 A;  2WLJ A;  4MW3 A;  4QGP A;  3K59 A;  2WLL A;  2BTQ A;  4WCE V;  3CP1 A;  5KHK A;  2PYJ A;  4LF6 O;  1SER A;  1KKC A;  4AQY O;  5JJE B;  3CC4 V;  4DRX B;  1Z2G A;  4DR5 B;  3ICX A;  5KUM A;  2PI4 A;  1VQ8 V;  3SJB C;  4TV9 A;  4B3S O;  2P4K A;  5LL6 Y;  5K1X A;  1S5J A;  5IYB O;  2OTJ V;  1XL6 A;  3HPL C;  5IYZ A;  4O4L A;  2VWJ A;  2YIA A;  3ZBH A;  2A79 B;  3I5D A;  1OJH A;  2X6B A;  1TUB A;  4IHJ A;  3FYE B;  5EZY A;  3CHX A;  4QIW F;  4NTX A;  1PKX A;  2ZM6 O;  1V55 C;  3CCM V;  3QO7 A;  1H2G A;  1GN4 A;  4PHZ A;  4LF4 O;  2AZ0 A;  1WNS A;  4J10 A;  4HNA A;  5DM6 V;  3ZCC A;  1CXZ B;  3UO3 A;  1FPO A;  3HKD A;  1EBO A;  1GK9 A;  2RNB A;  4MVS A;  3R65 A;  2ZR2 A;  2CTR A;  3VQY A;  3H1I H;  1THZ A;  5EC2 C;  1MMM A;  3N2K B;  4FMT A;  4FLZ A;  5KHI A;  1R3I C;  2AZ2 A;  1NR1 A;  1V54 B;  2RMK B;  3R66 A;  3UM7 A;  3U10 A;  1VQ4 V;  2GV9 A;  2ETN A;  1A32 A;  2FL4 A;  3OFN G;  2EIM C;  2PI5 A;  1MZF A;  3STZ C;  4UB6 Z;  1S72 V;  2LW1 A;  4TQD A;  1BZK A;  4JYY A;  2PTM A;  2ODM A;  1Q6I A;  4JYA B;  5LGT A;  3ABL C;  1VQP V;  3TET A;  2GUZ B;  2F43 G;  3ZMT A;  2EJR A;  4LCU C;  2IH3 C;  2LFR A;  4GYC B;  3ZRS A;  4W4K A;  3ZS8 C;  2NLJ C;  4J7J A;  4WF9 V;  4DV1 B;  2EIJ B;  3CCR V;  3OR6 C;  1H2S B;  5B1B B;  3P32 A;  1NS1 A;  2EIN B;  3AK2 A;  2ZXW B;  4H13 B;  3WU2 Z;  3ZRX A;  3T4Z A;  4LFB B;  3P3N A;  1QVG U;  1SQG A;  3VQV A;  4LFA O;  3RFR A;  5LXT B;  1AJN A;  2JVD A;  1H2K A;  1HNX O;  2QE7 G;  4O4H B;  1SES A;  1XEQ A;  1RPO A;  4N21 A;  3LNN A;  5DEC A;  1MA1 A;  1GM8 A;  2V1D A;  4AIL C;  1HNZ O;  3MHS C;  2UUA B;  2V4D A;  4RQF A;  4DR1 O;  4LWS B;  2LQT A;  4PDV A;  1OZ0 A;  2ZD9 A;  4E2L A;  3JD0 A;  3ETQ A;  2VQF B;  4JTC B;  3SPJ A;  1OCZ C;  4JAU A;  4XDL A;  5FL7 G;  3MDS A;  3OUF A;  3RVZ A;  4JI3 B;  3CRR A;  4XDJ A;  4IYH A;  2K1E A;  4CZZ A;  2F93 B;  4G28 B;  3ETD A;  4X20 B;  4X9Q A;  1BT8 A;  1WB7 A;  3KKY A;  1K8A W;  5BMV B;  1XNR O;  3W7U A;  4LF5 O;  4FM0 A;  1L8D A;  1VF5 B;  2IM9 A;  1VEW A;  3O65 A;  3S3X A;  5JQG A;  1FFX A;  3G80 A;  4BIZ A;  3SDL A;  3B40 A;  4O2A A;  2P5O A;  3T1C A;  1JJ2 U;  1FXK B;  4PA7 A;  3LSQ A;  2ZE7 A;  3K5M A;  3CRA A;  1JQ0 A;  2QSA A;  3B8N A;  2P4V A;  5KAI Z;  3K04 A;  1CPY A;  5H9C A;  2ZKO A;  1RSO B;  4MVM A;  3ETE A;  4X66 O;  1ARO P;  4DR7 B;  4JAV A;  2LFS A;  3A0H Z;  1SQB H;  4IIJ B;  3B8M A;  2ILM A;  1JX9 A;  2PGG A;  3KCX A;  1VP7 A;  3CSX A;  5EBW C;  4X64 B;  3K06 A;  3CWB H;  1DTO A;  3FB7 C;  1G6U A;  3RYF B;  3E2E A;  2YXL A;  2BSK A;  3VQW A;  4DR6 O;  3K58 A;  4PI0 A;  5E79 Z;  1SRY A;  1MZE A;  1IX9 A;  4U3J B;  1N34 O;  3KZI Z;  4JI2 B;  3KCY A;  3BRC A;  3CB2 A;  5IY5 B;  3HKB A;  1ZTE A;  4P9O A;  4ZBM A;  1GN6 A;  4NVP A;  4DV7 O;  3T2M A;  4GKK B;  1FJG O;  1WLE A;  4B3M O;  4ZHQ A;  2PZS A;  1VIB A;  1N32 B;  4MVZ A;  3CC2 V;  2B9Z A;  4X1K A;  1RP3 B;  1XMQ O;  5EK0 A;  4FVM A;  4UCR A;  4D7S A;  4YHH B;  1R3J C;  2R72 A;  1VQK V;  3RYI A;  2FTK A;  1HR0 O;  1KEC A;  3AK3 A;  3FAV B;  3MD0 A;  3H01 A;  2VQE B;  1NU1 H;  1B04 A;  2GBO A;  4I0X A;  2A0L A;  2CH7 B;  3D36 C;  1IXB A;  5C8Y B;  1HW7 A;  4MVQ A;  4UVA A;  1SQP H;  5A9G A;  1QQC A;  4Q20 A;  2HVJ C;  1Q7Y W;  3TCU A;  1FFT B;  4O4I B;  2QJ1 A;  1H8H G;  1NH2 D;  4LF8 B;  1M57 B;  2JIZ G;  2PUS A;  4YY3 B;  4DV3 O;  3GVM A;  1BQ0 A;  3W7S A;  1Y76 A;  1K92 A;  3ML0 A;  1M90 W;  1Q8I A;  3E8H A;  5CA0 B;  4JPR A;  3ZN0 A;  2H8P C;  4LH7 A;  2YEV B;  4EB6 A;  3AG4 B;  4NTY A;  4QE7 A;  1U97 A;  4CH5 A;  3OM3 B;  1NVP D;  2C2A A;  2QM8 A;  3HKE B;  1S0V A;  4IGG A;  1R73 A;  3OW2 U;  2LGW A;  5GON B;  3CD6 V;  1SC5 B;  3RBZ A;  3CRQ A;  4X62 B;  4LNU B;  2JJ2 G;  1BE3 H;  2QKS A;  2R70 A;  3L75 H;  4I9Q A;  5HFM A;  5JH7 A;  5E1A C;  5LHI A;  3P30 A;  1M1K W;  4U3F H;  4ZOL B;  2YC0 A;  5LA6 A;  5EYP A;  4UXN A;  4PI2 A;  2F4V B;  2W0F C;  2XND G;  1I7F A;  2FB5 A;  3OEH G;  4NTW A;  4DYL A;  5J2T B;  4DXW A;  5EBM C;  1QR8 A;  4JI7 B;  5C93 A;  1S5L Z;  5DED A;  2YXY A;  2AHY A;  3BA8 A;  3AK1 A;  1F4M A;  3ZJZ A;  3DGE A;  2WWW A;  3CCE V;  1F4N A;  3Q4H B;  3SJA C;  3ZRW B;  2R9R B;  3ASO C;  2QGN A;  3RGB A;  3FD9 A;  5JJN B;  3C3T A;  1WA8 A;  3BAA A;  4QPK A;  4CS2 A;  4WBN A;  4I55 A;  4GT1 A;  2Q8V A;  2DYR B;  3KG2 A;  3JAT B;  1P4R A;  1BMF G;  2IJH A;  2F1M A;  3SPI A;  2DQ3 A;  1QNM A;  4N23 A;  4X65 O;  4X1Y B;  2QWR B;  1NT2 B;  1YXB A;  3PJS K;  3LNM B;  2XAJ A;  3RYH B;  2N74 A;  1B3Q A;  2EIL B;  3D3Q A;  1J5E B;  2HEP A;  5EIB C;  4DR2 O;  4CH3 A;  4DV2 B;  4MVR A;  4HYO A;  3LSU A;  1US6 A;  2WA3 A;  4KUM A;  1Q81 W;  1N36 O;  1M56 C;  3OMI B;  1M93 A;  2Q7G A;  1QVF U;  1PV0 A;  3RYC B;  2UUC B;  3UT5 A;  4J41 A;  3P3P A;  1BCC H;  3U11 A;  1YHQ V;  1L0L H;  2ITD C;  2JDI G;  2YSU B;  4BW9 A;  1I5X A;  4DV1 O;  4FLT A;  1IBM B;  4I4T A;  3JAK A;  2WAM A;  3L70 H;  4FK5 C;  1TUE B;  3CS5 A;  3JSN A;  4X88 A;  2A7W A;  1YJN V;  3WG7 B;  4WFH A;  1GTO A;  4P30 A;  2QTO A;  1AI4 A;  4UCV A;  4LFB O;  3WB0 A;  3E22 B;  2R9I A;  5L3D A;  2LGQ A;  3F5T A;  3SJC C;  1KP3 A;  3AG1 C;  2HJF C;  2IJI A;  4FJC C;  1SA0 B;  3K0D A;  2UUA O;  1XUQ A;  4NXM B;  1GN3 A;  4KFM A;  5B1A C;  3FKS G;  3WB1 A;  3K5N A;  5IE9 A;  4XDK A;  1PNM A;  2ZT9 B;  5IYD O;  3ZN1 A;  1J95 A;  1IDS A;  4JV5 B;  2Q68 A;  3JAS B;  4JI3 O;  1PL0 A;  4J7Z A;  3L71 H;  1YIT V;  1PNK A;  2UXX A;  2DYS C;  2UUB B;  4TV8 B;  1K73 W;  5JVD B;  1YI2 V;  3BAB A;  2VWK A;  5J2U A;  5KX5 A;  5KA6 A;  2WLM A;  2WA4 A;  2N05 A;  1GM9 A;  2RCV A;  3IC9 A;  3VBB A;  4DO2 A;  5CA3 A;  1RPR A;  1ZX3 A;  1RM1 B;  3AG3 C;  1N0N A;  1LR1 A;  2JRI A;  4LP8 A;  3SYC A;  4BW5 A;  2OTL V;  1W2B U;  3BVO A;  3J7A U;  4YIP A;  2JS5 A;  4MS2 A;  5B3S C;  2P22 C;  3RT3 C;  4DR3 B;  4GZR B;  3OD4 A;  1GM7 A;  1LUV A;  1W59 A;  2XOK G;  4DR7 O;  1QR9 A;  3CPW U;  1XNQ B;  1N8R W;  2GUZ A;  2ADQ B;  4GX5 A;  4B3R B;  1T5E A;  1O9H A;  2AHZ A;  2YIC A;  2ZDI A;  4LF7 B;  4X64 O;  2UXC B;  2ZIM A;  2D2C B;  4O2B B;  5IWA B;  1XL4 A;  4GX0 A;  3T4D A;  5KHG A;  2QWQ B;  3ABM C;  2NN4 A;  5B1O A;  3CXC U;  1UPG A;  3D36 A;  1MAB G;  4LH6 A;  2CTP A;  3N2G B;  1GMG A;  4JI2 O;  2GTA A;  4W4L A;  3X2Q C;  5JJJ B;  4NKG B;  1EFR G;  4KHP B;  1KMI Z;  5DN6 G;  5LXT A;  5H5N A;  1NJI W;  1LNQ A;  1K7D A;  3K79 A;  4TUY A;  3ABT A;  3OAA G;  4GKK O;  2LW7 A;  1KKD A;  2RDC A;  1G8M A;  1N32 O;  1K4D C;  1KYO F;  2CTQ A;  3FB5 C;  5CB4 B;  4YHH O;  4LWS A;  5IJ9 A;  1OCO C;  1YZB A;  1KB9 F;  5JCO A;  3BY6 A;  1NH2 B;  5GTI Z;  5J9P C;  2VQE O;  2BOC C;  1FXV A;  1SQQ H;  4FPP A;  1ORQ C;  1AP6 A;  2JK5 C;  2K9P A;  3G71 V;  5GW7 A;  1YTF D;  4X20 A;  3QTC A;  3ZHS A;  1NVP B;  1R6N A;  2QR4 A;  4WFF A;  5IJ0 B;  1AJP A;  4PEL A;  3K3W A;  4LF8 O;  5CN0 A;  5K1P A;  3OT7 A;  5L3E A;  5EBL C;  4YY3 O;  3E89 A;  3IFX A;  3ZMV A;  3JAW B;  2WLL B;  2BTQ B;  1WPB A;  5ITZ B;  3I55 V;  3K9A A;  1FXK A;  2JJ1 G;  4DK1 A;  1VQL V;  4B7K A;  2Y69 C;  2E5L B;  2Y0I A;  2ARH A;  4L8J A;  4MVO A;  2QWN B;  1P7B A;  4DV5 O;  5B1N A;  4WFE A;  2F66 C;  3JAL A;  4EKW A;  1I94 B;  1K33 A;  4O4L B;  3CRC A;  4IIJ A;  3JD2 A;  4CC5 A;  1IXM A;  5IT9 N;  3D8C A;  2YS8 A;  2FYU H;  2DN9 A;  5L3F A;  1VQ7 V;  3AEI A;  2UXD B;  3RYF A;  4MVU A;  1K5S A;  2EIK B;  4UV8 A;  1SQV H;  2GHY A;  3J80 N;  1K4C C;  3IAY A;  1N33 B;  4YXW G;  4FLX A;  4JI7 O;  4C7U A;  3JAM N;  5BXZ A;  3K03 A;  4JF3 A;  1BHB A;  2F95 B;  2QKA A;  4PDR A;  3OR7 C;  5IDJ A;  1BQZ A;  4JGS A;  1DF5 A;  4ABM A;  4O4J A;  1IBK B;  1R6T A;  1WJZ A;  1PL4 A;  4UVB A;  2DWD C;  1AI7 A;  1EZV H;  1ROP A;  3F5W C;  1FYJ A;  4PDM A;  5TIS Z;  4EFB A;  2HG5 C;  4K35 A;  3LUT B;  3CCU V;  3APO A;  2YIB D;  2DQ0 A;  2ADP A;  4D7T A;  5LP6 B;  2AGA A;  1QHT A;  4U7O A;  4JZG A;  3CRM A;  3ABK B;  2CH7 A;  3HR0 A;  1HNW B;  1EN6 A;  4DV0 B;  4MTX A;  3W7T A;  1QLE B;  4RQE A;  2W6J G;  4PJ0 Z;  5C8Y A;  3SPH A;  1YJW V;  5D5Q A;  4JI5 B;  4UCO A;  1WPX A;  1J5E O;  4O4I A;  1TAE A;  3QO5 A;  1MSW D;  4RUF A;  1R1B A;  3EFF K;  4DV2 O;  3O9O A;  2OIG A;  2OIE A;  3BEH A;  1CEZ A;  5CA0 A;  4D6T H;  2YEV A;  2WLN A;  1AI5 A;  2UUC O;  3A0B Z;  4YJ3 A;  2H3O A;  4AQY B;  4FZ0 A;  1WAZ A;  1SZX A;  1V54 C;  1OCR B;  1IBM O;  1FS0 G;  5GON A;  4B3S B;  5BY1 A;  2QWO B;  2X7R B;  4P9P A;  2GTS A;  3H1J H;  1D5N A;  3VOU A;  2B1I A;  5IYC O;  4OGQ B;  3HKC B;  4PA6 A;  4YJ2 B;  2ATK C;  4ZOL A;  4DW0 A;  2Y0P A;  3CEI A;  2ZDI C;  5CBH A;  4NR1 A;  2PYL A;  4BWA A;  1DGS A;  1K9M W;  1BSM A;  2NR5 A;  3BCC H;  5KLV H;  2EIJ C;  3ZMU A;  3OMN B;  5J2T A;  1ZUQ A;  3CJH B;  4NXM O;  5B1B C;  2DMX A;  2EIN C;  1R3L C;  1Q3E A;  2DJV A;  5KMG B;  3ZHU A;  1GH6 A;  2IJJ A;  3ZRW A;  2P7T C;  2OCH A;  4JI8 O;  4O2A B;  2CK3 G;  3T1H O;  2B1G A;  2UUB O;  3ZHT A;  2XHB A;  1IZ3 A;  2XAG A;  3ZHR A;  3N27 A;  3ZX6 A;  1W0J G;  2P6J A;  2JS3 A;  4UVC A;  2EUL A;  5JCO C;  3B2E E;  5JWP A;  1VQ9 V;  1EN4 A;  4BIO A;  5LOV A;  2Y4U A;  3IGA C;  3SJQ C;  2CGO A;  5KAF Z;  4J42 A;  2LJ2 A;  4JI4 B;  2EBO A;  4FM1 A;  1SS3 A;  5LMU B;  3FFQ A;  5LYJ B;  2D3O W;  4DR3 O;  4OPA A;  1GO3 F;  1NTK H;  4B08 A;  2CE4 A;  3JAR A;  5GTH Z;  4E4E A;  3A0R A;  1Q6H A;  4JI1 B;  1YCI A;  2Q7E A;  3CYO A;  1XNQ O;  5L3C A;  4I50 A;  3W7W A;  4XBF A;  4LFA B;  4B3R O;  3RYC A;  3UO2 A;  4DR5 O;  4AI8 A;  1YIJ V;  4LF7 O;  3H1L H;  4ZIB A;  3CC7 V;  1UJW B;  3CCQ V;  3GWK C;  1K5Q A;  2XAQ A;  2BOB C;  4R7C A;  1XHZ A;  4X1I A;  1FXK C;  1PP9 H;  1V9P A;  3ASN B;  4JYC A;  2YI8 A;  3SR2 C;  5EC1 C;  1ZL8 B;  1OCC B;  1KD1 W;  4PA3 A;  4OPH A;  1ZWI C;  2KG7 B;  3CE2 A;  4F4L A;  2P06 A;  2WLI A;  5KHH A;  3E22 A;  4KHP O;  2Q67 A;  3MHH C;  4F6R A;  3FB6 C;  5FPR A;  1VQO V;  1KC8 W;  5FNV A;  1ZAU A;  1SA0 A;  1YTF B;  2KQX A;  2XAF A;  3NXS A;  1S76 D;  1JFF B;  1Q43 A;  3K9S A;  3RN4 A;  1AR4 A;  1TVK B;  1D2D A;  3FB8 C;  5H6Q A;  1YF2 A;  3DXR A;  5LMN B;  5IY5 C;  4JZ2 A;  4WFA V;  2P67 A;  2OT5 A;  4NB5 A;  3BPZ A;  4J9Y B;  4OXS A;  4TV8 A;  3SYO A;  5JVD A;  1BS3 A;  1NKD A;  4JYA O;  3FYI B;  1G4Y B;  1IVS A;  4TQF A;  3X2Q B;  1V55 B;  2EZP A;  5LGN A;  2Q4P A;  4FM2 A;  5JH7 B;  4OX9 B;  4FFB A;  3CCS V;  3OGI B;  2JGD A;  3GB7 C;  3ZMZ A;  2QM7 A;  2E5L O;  2M7W A;  4J7K A;  3D3I A;  4LF9 B;  5LA6 B;  2RN9 A;  1URF A;  5CBG A;  4K3A A;  2HLD G;  4G27 B;  4JYB A;  1XHX A;  1O9G A;  2CGN A;  4FZ1 A;  1I94 O;  4DR4 B;  2MW2 B;  4DRX A;  1M57 C;  4LR3 A;  1VQ6 V;  2EIM B;  4DV7 B;  1FJG B;  4ZKI A;  2UXD O;  4MTO A;  4B3M B;  2V7Q G;  3CCJ V;  3AG4 C;  4PA9 A;  1JMK C;  3M7M X;  3QG5 A;  1YJ9 V;  2GDS A;  3ABL B;  1MOF A;  3J81 N;  1XMQ B;  2OWO A;  1KUQ A;  2VQF O;  1P84 F;  4I55 B;  2MK3 A;  1L1F A;  2Q6A A;  1JR9 A;  2PY5 A;  2Q73 A;  1NBM G;  4MTF A;  1K3E A;  2E74 B;  4K0K B;  5EIB D;  4J80 A;  3B09 A;  2Q69 A;  1NQT A;  2AW9 A;  4R6Z A;  2QM4 A;  2ZIO A;  2ZE6 A;  4DUZ B;  1IBK O;  3E86 A;  3DC6 A;  5KA5 A;  3JCZ A;  1TGO A;  1FD9 A;  3N2K A;  3NR7 A;  1Y74 B;  1CP9 A;  2YID A;  1Z5V A;  4DW1 A;  4JTA B;  1I0H A;  3DSQ A;  3TGU H;  3QO8 A;  4UCU A;  1HNW O;  4DV0 O;  4PD4 F;  1MSD A;  3JD3 A;  1VQ5 V;  4CH4 A;  1XOU A;  4MT8 A;  3ETG A;  4JI5 O;  4CS4 A;  2EZO A;  2Q7H A;  1H8E G;  4I4T B;  1GKF A;  3CXH F;  1OCZ B;  3FX7 A;  3IC7 A;  3ZIA G;  3OEE G;  1AR1 B;  1YDX A;  1BHA A;  3EVK A;  2XTA A;  2DYR C;  4MTG A;  4JAA A;  2DOS A;  3ZHV A;  3JAW A;  4MSW C;  5ITZ A;  2BTO A;  1MG1 A;  3WFV A;  2E3C A;  3K08 A;  5FLX N;  1L0N H;  4UCS A;  3L9D A;  1VAR A;  1AI6 A;  1XMO B;  4UV9 A;  2Y48 A;  4Q6G A;  3QF7 A;  1NTZ H;  1GN2 A;  3E35 A;  4JI0 B;  1JA8 A;  1WN7 A;  2EIL C;  5LGU A;  2BCC H;  2RQ6 A;  2QWP B;  2WLH A;  4O4H A;  1S5H C;  2Q0A A;  3A2F A;  4X8A A;  2R9A A;  4HAM A;  1JJO A;  2OCC C;  5L3B A;  2DW4 A;  5A2Q N;  4B3T B;  5CA1 B;  1Z5W A;  4QPJ A;  4DV4 B;  2Q0O C;  3CMA V;  3F7V C;  4GKJ B;  1KU9 A;  5D5P A;  3B77 A;  1H2L A;  4K8X A;  4NXN B;  1U96 A;  2CDY A;  2IU3 A;  3QNE A;  4H33 A;  1EZJ A;  1DLB A;  3BHP A;  2XUM A;  2O57 A;  4LBE C;  5BR8 B;  5J2U B;  5KX5 B;  1QLN A;  3H1K H;  2F23 A;  3WG7 C;  3K5L A;  4LFC B;  4ZI7 B;  1E1Q G;  2OYQ A;  1SKV A;  1Q6U A;  2QTS A;  4X65 B;  2UU9 B;  3K5O A;  1PNL A;  5BMV A;  4FLY A;  1QU7 A;  4RAI A;  3M99 B;  4FLW A;  4H0L B;  1K97 A;  1NTM H;  1TA8 A;  4DR2 B;  1K34 A;  2UXB B;  3S3W A;  2VRZ A;  1S3J A;  2G38 A;  1RFY A;  1WP8 A;  2HHH B;  5LP6 A;  3PN1 A;  2P90 A;  2L6L A;  1N36 B;  1GAX A;  4DK0 A;  4I7Z B;  1IBL B;  2HFE C;  1PD3 A;  1RSO A;  4BAY A;  4NYK A;  4TV9 B;  4JI4 O;  5B66 Z;  2Q5Z A;  1P7G A;  3B4S A;  2ZIN A;  3THO A;  4X62 O;  5LMU O;  5IYZ B;  4TSF G;  3EXA A;  2ZNI A;  1SQX H;  3AG2 C;  1PM9 A;  2ZE5 A;  4IL6 Z;  1VQN V;  1XIL A;  4A5U B;  3ZMS A;  1TUB B;  4IHJ B;  5EZY B;  1F7Y A;  4JI1 O;  4H37 A;  3OGC C;  1H2N A;  3DTU B;  1VF6 A;  4QJF B;  1RM1 C;  3SPC A;  2F4V O;  1LUW A;  2WLK A;  4TUY B;  4HNA B;  4DUY B;  2YDE A;  2HR3 A;  1JCH A;  4P2Z A;  4U3J A;  1D5A A;  2ZQM A;  1SZT A;  3HKD B;  3JYC A;  5KHJ A;  2WSS G;  1SF9 A;  4ASU G;  5IJ9 B;  3RVY A;  4GLX A;  1F51 A;  2XT9 A;  3T1Y B;  3E8F A;  3HKC A;  3SGI A;  1W0K G;  4YJ2 A;  2IBZ H;  4CC6 A;  4UFZ A;  1XI1 A;  5L3G A;  3SYP A;  2JGU A;  4GUN A;  3U0Z A;  4PV1 B;  3FAV A;  3OTO B;  2ZCE A;  3CJH A;  1AVM A;  3H1H H;  5KUK A;  2X6A A;  4DV6 B;  4IT5 A;  3C3S A;  4CBC A;  3JCU Z;  4HZ3 A;  4IYI A;  4R8C A;  5KMG A;  1DF4 A;  1N4C A;  3SYA A;  5LMN O;  1QCE A;  2XAS A;  3EHB B;  3STL C;  2A3Q A;  1AIL A;  1Y6X A;  4JI6 B;  2EJ7 A;  4J9Z B;  5LHH A;  1Y66 A;  3HB3 B;  2B5U A;  1SET A;  3ZRV A;  4H44 B;  5CMU A;  1BL8 A;  3OUS A;  2WPD G;  1AJQ A;  4RWU A;  2GSM B;  3JAL B;  3RW0 A;  2HP8 A;  3ASO B;  1GRJ A;  4RUE A;  4LF6 B;  1AR5 A;  5HFL A;  2IW5 A;  3TXS A;  1Q90 D;  3HKE A;  1YSC A;  4OX9 O;  4BR6 A;  3E8G A;  3K0G A;  1Q82 W;  1R3K C;  2IU0 A;  3K57 A;  5H6R A;  4LNU A;  4X89 A;  5LYJ A;  3M8A A;  4LF9 O;  3OMA B;  1VF7 A;  4FLU A;  1M5I A;  4K8Z A;  4MW8 A;  1QBZ A;  2YI9 A;  1IUR A;  3DC5 A;  3QVN A;  4DR4 O;  2ZM6 B;  4AHC A;  3SYQ A;  1JVM A;  4LF4 B;  2QDO A;  3CCV V;  4PDL A;  4TOI A;  2CUG A;  4TT3 G;  3L72 H;  1XDC A;  4ICG A;  4O4J B;  1FKA O;  2HJD A;  1M56 B;  1WB8 A;  1ZL8 A;  2ZXW C;  1KQS U;  2JEX A;  3I56 V;  4QNH B;  2KG7 A;  1N0J A;  3Q4H A;  1M4U A;  5JQG B;  2LO1 A;  1FFX B;  4BIU A;  4JV5 O;  1E79 G;  3W7X A;  2EX3 A;  3LDC A;  4K0K O;  1SQF A;  3LSS A;  3ZED A;  1EN5 A;  1NR7 A;  4DUZ O;  3JAT A;  1KP2 A;  2NNU A;  4RO2 A;  1P49 A;  2JEU A;  2H94 A;  1OV9 A;  3G4S V;  1JFF A;  2EIK C;  1JPX A;  4X1Y A;  3UKM A;  3CME V;  1TVK A;  3AG1 B;  2E75 B;  3RYH A;  1FXH A;  1XQ8 A;  3H9V A;  2QKC A;  3JSL A;  4CS3 A;  2ZE8 A;  2VS0 A;  2BSK B;  5B5E Z;  5B1A B;  3RWR D;  4YJ3 B;  1G1X B;  1OHH G;  1NZ6 A;  2A06 H;  3AG7 A;  4DV5 B;  3WB2 A;  3HKB B;  4EFE A;  1AB3 A;  1ZSP A;  1HNX B;  2UXC O;  3C90 A;  2DYS B;  5IWA O;  1MNG A;  5LP6 C;  4ZHQ B;  4J11 A;  2CAZ C;  1HP8 A;  3ABK C;  4X1K B;  5F2V O;  1QLE C;  4JTD B;  1HNZ B;  4I9W A;  1XMO O;  2YUA A;  1Y67 A;  4DR1 B;  2HVK C;  3ZHQ A;  1XRE A;  4B7E A;  3RYI B;  3TK1 A;  1NI8 A;  3G6B A;  3AG3 B;  4JI0 O;  3L73 H;  2DE0 X;  2BE3 A;  1I08 A;  3TJT A;  4I0X B;  2QEX V;  3E83 A;  5FPO A;  1X4T A;  1H2M A;  3APQ A;  3G67 A;  5B3S B;  4Z1M G;  3IJ4 A;  2ZNJ A;  4B3T O;  1JOY A;  1YEW A;  1Q86 W;  4DV4 O;  5H2F Z;  2Y4T A;  3UCS C;  3SPG A;  1VF6 C;  4GKJ O;  3A8T A;  2KSD A;  3TXQ A;  3MAQ A;  1ENV A;  2YXH A;  5BZB A;  1XNR B;  2ZR3 A;  1VQM V;  4LF5 B;  3VQX A;  4NXN O;  1OCR C;  1Y76 B;  1AP5 A;  4R50 A;  3LDD A;  4WFB V;  2KB1 A;  5BR8 O;  3JAS A;  4GCZ A;  2YIB A;  4EB6 B;  2PF4 E;  4KP4 A;  4LFC O;  3LDE A;  3ABM B;  4LC1 A; 
#chains in the Genus database with same CATH homology
 1AR1 B;  3MD0 A;  1BHA A;  2IH1 C;  3H01 A;  4MVU A;  2DYR C;  4MTG A;  3JD1 A;  1K5S A;  2A0L A;  2EIK B;  3GWO A;  4MSW C;  4UV8 A;  2GHY A;  1K4C C;  1I5Y A;  1MG1 A;  3WFV A;  2IJK A;  4MVQ A;  3K08 A;  4UVA A;  4YXW G;  4Q20 A;  1AI6 A;  2HVJ C;  4UV9 A;  4U7N A;  3K03 A;  2OCC B;  1Q7Y W;  4JF3 A;  3TCU A;  2Y48 A;  1BHB A;  1FFT B;  3E35 A;  1H8H G;  3OE7 G;  1NH2 D;  4JAS A;  3E8B A;  4PDR A;  3OR7 C;  5IDJ A;  1M57 B;  2JIZ G;  4JGS A;  1DF5 A;  2Z3Y A;  2EIL C;  3JD4 A;  5LGU A;  3W7S A;  1K92 A;  3ML0 A;  1M90 W;  1OCO B;  2WLH A;  2XAH A;  3E8H A;  1F23 A;  1S5H C;  4JPR A;  4X8A A;  3ZN0 A;  4UVB A;  2DWD C;  1AI7 A;  2H8P C;  4HAM A;  3F5W C;  1ROP A;  2OCC C;  4FIP C;  5L3B A;  1H38 A;  2DW4 A;  2YEV B;  4TWK A;  4PDM A;  3AG4 B;  4I5S A;  4QE7 A;  4QPJ A;  2HG5 C;  3OM3 B;  3LUT B;  1NVP D;  3CMA V;  3CCU V;  3F7V C;  2C2A A;  2QM8 A;  2UXN A;  2DQ0 A;  4QE9 A;  4LC1 A;  1S0V A;  4U7O A;  3B77 A;  1R73 A;  3OW2 U;  3ABK B;  3CD6 V;  2WLI B;  4MTX A;  2ITC C;  1QLE B;  2IU3 A;  3QNE A;  3W7T A;  4RQE A;  3RBZ A;  2W6J G;  4H33 A;  3SPH A;  1YJW V;  1EZJ A;  1DLB A;  5LHG A;  2QA4 V;  2JJ2 G;  2QKS A;  4LBE C;  5HFM A;  1QLN A;  5E1A C;  5LHI A;  5LBQ A;  1S77 D;  3P30 A;  3WG7 C;  1M1K W;  1R6K A;  1WPX A;  1E1Q G;  1COW G;  3QO5 A;  1MSW D;  4RUF A;  3EFF K;  1Y4M A;  3BEH A;  1CEZ A;  1PNL A;  4UXN A;  3F7Y C;  2W0F C;  2XND G;  2Y69 B;  3OEH G;  4UUJ C;  2YEV A;  2A9H A;  2WLN A;  1AI5 A;  4RAI A;  4DXW A;  3M99 B;  5EBM C;  1QR8 A;  1K97 A;  5C93 A;  1K34 A;  1S3J A;  2AHY A;  1M9N A;  1V54 C;  5CBF A;  2P90 A;  1F4M A;  1OCR B;  1HWY A;  3ZJZ A;  4GX2 A;  1FS0 G;  2WWW A;  1E1R G;  3DGE A;  3CCE V;  1F4N A;  3ZRW B;  2HKO A;  2R9R B;  3ASO C;  2HFE C;  3AG2 B;  1PD3 A;  2X7R B;  3ASN C;  2X6C A;  4P9P A;  4G2K A;  4PA4 A;  2W6I G;  3CCL V;  4GX1 A;  4BAY A;  4QPK A;  3VOU A;  2B1I A;  5IYC O;  2DWE C;  1OCC C;  4GT1 A;  4PA6 A;  2DYR B;  3KG2 A;  4TSF G;  1P4R A;  1BMF G;  2IJH A;  3SPI A;  2Z5U A;  3G6E V;  2ATK C;  3AG2 C;  1B6Q A;  4L87 A;  1VQN V;  2DQ3 A;  3ZMS A;  2ZDI C;  4H37 A;  5CBH A;  3ABU A;  3OGC C;  4N23 A;  1K9M W;  3DTU B;  2LP7 A;  2EIJ C;  3ZMU A;  3OMN B;  4WFG A;  2X0L A;  4QJF B;  1RM1 C;  2WLJ A;  3SPC A;  4MW3 A;  3PJS K;  3LNM B;  5B1B C;  2XAJ A;  2WLL A;  2WLK A;  2EIN C;  1R3L C;  4WCE V;  3CP1 A;  2EIL B;  2HR3 A;  1JCH A;  4P2Z A;  2IJJ A;  1SER A;  2ZQM A;  3ZRW A;  1SZT A;  3CC4 V;  3JYC A;  2P7T C;  2WSS G;  4MVR A;  4HYO A;  2CK3 G;  4KUM A;  1Q81 W;  2B1G A;  5KUM A;  4ASU G;  1VQ8 V;  2PI4 A;  1M56 C;  3RVY A;  3OMI B;  1F51 A;  5IYB O;  2XAG A;  3E8F A;  1QVF U;  2OTJ V;  1XL6 A;  3HPL C;  1W0K G;  2A79 B;  1YHQ V;  2ITD C;  2JDI G;  2YSU B;  1W0J G;  2P6J A;  5L3G A;  1I5X A;  3SYP A;  2X6B A;  4UVC A;  3FYE B;  2WAM A;  4FK5 C;  1TUE B;  4QIW F;  1VQ9 V;  1PKX A;  1V55 C;  4X88 A;  3CCM V;  3QO7 A;  1YJN V;  1H2G A;  3WG7 B;  3SJQ C;  3IGA C;  4WFH A;  1GTO A;  4P30 A;  2QTO A;  1AI4 A;  5KUK A;  2X6A A;  2EBO A;  4CBC A;  5DM6 V;  4HZ3 A;  4R8C A;  3ZCC A;  1DF4 A;  2R9I A;  3SYA A;  2D3O W;  1QCE A;  2XAS A;  3EHB B;  5L3D A;  1GO3 F;  1EBO A;  1GK9 A;  3STL C;  4MVS A;  1KP3 A;  2ZR2 A;  3R65 A;  3AG1 C;  1THZ A;  5EC2 C;  3A0R A;  2HJF C;  2IJI A;  3CYO A;  4FMT A;  4J9Z B;  5L3C A;  4FJC C;  3K0D A;  3W7W A;  1R3I C;  4XBF A;  5LHH A;  1NR1 A;  1V54 B;  1Y66 A;  2B5U A;  1SET A;  3HB3 B;  3ZRV A;  1YIJ V;  3UM7 A;  5CMU A;  1BL8 A;  3OUS A;  1VQ4 V;  2WPD G;  4KFM A;  3CC7 V;  1AJQ A;  1UJW B;  5B1A C;  3CCQ V;  2GSM B;  3RW0 A;  3FKS G;  3ASO B;  1K5Q A;  2XAQ A;  2BOB C;  4RUE A;  3OFN G;  4R7C A;  1PNM A;  4XDK A;  2EIM C;  5IYD O;  2PI5 A;  1FXK C;  3ASN B;  4JYC A;  5HFL A;  3ZN1 A;  2IW5 A;  1J95 A;  3STZ C;  1S72 V;  5EC1 C;  1YSC A;  2Q68 A;  1OCC B;  1PL0 A;  3E8G A;  1KD1 W;  3K0G A;  1Q82 W;  4PA3 A;  1YIT V;  1PNK A;  1R3K C;  1ZWI C;  2DYS C;  2UXX A;  3ABL C;  4F4L A;  5LGT A;  3TET A;  2WLI A;  1VQP V;  2F43 G;  2IU0 A;  3ZMT A;  1K73 W;  2EJR A;  5H6R A;  4X89 A;  4LCU C;  2IH3 C;  2LFR A;  2Q67 A;  1YI2 V;  3OMA B;  3MHH C;  3ZRS A;  5KA6 A;  2WLM A;  3FB6 C;  1GM9 A;  2NLJ C;  4MW8 A;  4WF9 V;  1VQO V;  1QBZ A;  2EIJ B;  3VBB A;  4DO2 A;  1KC8 W;  5CA3 A;  3CCR V;  1RPR A;  1RM1 B;  3OR6 C;  3AG3 C;  5B1B B;  3P32 A;  1YTF B;  2EIN B;  2XAF A;  2ZXW B;  3SYQ A;  1JVM A;  3NXS A;  3CCV V;  4LP8 A;  3SYC A;  4PDL A;  4BW5 A;  1S76 D;  3ZRX A;  3T4Z A;  2OTL V;  1W2B U;  4TT3 G;  1QVG U;  4MS2 A;  3FB8 C;  5H6Q A;  1AJN A;  5B3S C;  2QE7 G;  5IY5 C;  1M56 B;  1GM7 A;  4WFA V;  2ZXW C;  1SES A;  2P67 A;  1KQS U;  2JEX A;  2OT5 A;  2XOK G;  1RPO A;  3I56 V;  1QR9 A;  4QNH B;  4N21 A;  3CPW U;  1N8R W;  1GM8 A;  4J9Y B;  4OXS A;  2V1D A;  4GX5 A;  3SYO A;  4BIU A;  1E79 G;  3MHS C;  2AHZ A;  3W7X A;  4RQF A;  2ZDI A;  1NKD A;  3LDC A;  4PDV A;  3FYI B;  1OZ0 A;  1G4Y B;  2ZD9 A;  3LSS A;  4E2L A;  3JD0 A;  1XL4 A;  4GX0 A;  3X2Q B;  1V55 B;  1NR7 A;  3T4D A;  2EZP A;  4JTC B;  5LGN A;  1KP2 A;  2NNU A;  1OCZ C;  3SPJ A;  3ABM C;  4JAU A;  4RO2 A;  5B1O A;  4XDL A;  3CXC U;  5FL7 G;  3D36 A;  2JEU A;  3OUF A;  2H94 A;  3RVZ A;  3CCS V;  1MAB G;  4XDJ A;  3G4S V;  3GB7 C;  2K1E A;  4CZZ A;  2EIK C;  1GMG A;  4G28 B;  3ZMZ A;  2QM7 A;  3X2Q C;  1JPX A;  3ETD A;  2M7W A;  3UKM A;  3CME V;  1EFR G;  5DN6 G;  3D3I A;  3AG1 B;  1NJI W;  1LNQ A;  5CBG A;  1K8A W;  1K7D A;  1FXH A;  3K79 A;  3ABT A;  3W7U A;  3OAA G;  1KKD A;  1G8M A;  2HLD G;  4G27 B;  4JYB A;  1K4D C;  5B1A B;  1M57 C;  4BIZ A;  1OHH G;  3FB5 C;  1VQ6 V;  3T1C A;  2EIM B;  1JJ2 U;  1FXK B;  1OCO C;  4PA7 A;  3LSQ A;  3BY6 A;  1NH2 B;  4ZKI A;  4MTO A;  1JQ0 A;  2V7Q G;  5J9P C;  3CCJ V;  3AG4 C;  3B8N A;  3K04 A;  4PA9 A;  2BOC C;  1CPY A;  1FXV A;  5H9C A;  4FPP A;  4MVM A;  1YJ9 V;  1ORQ C;  2DYS B;  3ABL B;  1MOF A;  3ETE A;  2JK5 C;  1ARO P;  3G71 V;  2MK3 A;  5GW7 A;  4JAV A;  1L1F A;  3ABK C;  2Q6A A;  2LFS A;  1YTF D;  1QLE C;  3B8M A;  4JTD B;  1NVP B;  1JX9 A;  4I9W A;  1R6N A;  4WFF A;  1NBM G;  2HVK C;  4MTF A;  1K3E A;  1AJP A;  5EBW C;  4PEL A;  3TK1 A;  3K06 A;  3AG3 B;  3K3W A;  2Q69 A;  5CN0 A;  1DTO A;  1NQT A;  5L3E A;  5EBL C;  3FB7 C;  4R6Z A;  3E89 A;  3E2E A;  3IFX A;  3E86 A;  3ZMV A;  2QEX V;  3E83 A;  5KA5 A;  3JCZ A;  2WLL B;  1SRY A;  3I55 V;  3K9A A;  1FXK A;  2JJ1 G;  1VQL V;  5B3S B;  4Z1M G;  1JOY A;  1Q86 W;  2Y69 C;  1CP9 A;  5IY5 B;  4JTA B;  3SPG A;  4MVO A;  4P9O A;  1P7B A;  4ZBM A;  5B1N A;  4WFE A;  3T2M A;  1ENV A;  3QO8 A;  5BZB A;  2ZR3 A;  1VQM V;  1WLE A;  4EKW A;  3JD3 A;  1VQ5 V;  1OCR C;  4R50 A;  4MVZ A;  4MT8 A;  3CC2 V;  3LDD A;  4WFB V;  1K33 A;  2KB1 A;  5EK0 A;  3ETG A;  3JD2 A;  4GCZ A;  1R3J C;  1IXM A;  4KP4 A;  2EZO A;  1VQK V;  1H8E G;  5L3F A;  1GKF A;  2FTK A;  1OCZ B;  3IC7 A;  3ABM B;  3LDE A;  3ZIA G;  1VQ7 V;  1KEC A;  3AEI A;  3OEE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...