2Q68A

Crystal structure of nak channel d66a, s70e double mutants
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
b'MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFEPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Metal transport, membrane protein
source organism Bacillus cereus
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q68A00
4X8AA 4MVQA 2ATKC 4R50A 3STLC 4UUJC 3SYPA 3E8HA 4P30A 3UM7A 2ITCC 3X2QC 5J9PC 4DXWA 4MTOA 4GX1A 5EC1C 4RUEA 3IGAC 5CBFA 5KUMA 3IFXA 4H37A 4CBCA 1J95A 3TCUA 2EIJC 1XL4A 4PDRA 2WLKA 2A79B 3SYCA 3E89A 3F5WC 1P7BA 2P7TC 5EBWC 1BL8A 4MVZA 3SPGA 2Q68A 2W0FC 3AG1C 2Q69A 3ASOC 4RAIA 3SYQA 4JTDB 3T4ZA 4G28B 2EINC 5EBMC 4PDMA 4RO2A 1R3KC 4WFHA 3FB7C 4MVUA 1M57C 3OGCC 3RW0A 1KKDA 4QE9A 3AG3C 4XDKA 5B1BC 3T4DA 3LDCA 3K04A 4GX0A 3LNMB 2WLLA 3OR7C 2DWDC 3SPCA 2WLIB 3AG2C 3E8GA 3JYCA 2WLMA 3OR6C 4PDLA 2HVJC 5E1AC 3K06A 3T2MA 2HFEC 4QNHB 1LNQA 1XL6A 3BEHA 4KFMA 5EC2C 4WFGA 2X6AA 3E8BA 4MS2A 4MVOA 5B3SC 2IH1C 3SYAA 4EKWA 2BOCC 4J9YB 1R3JC 3WG7C 3F7VC 4JTCB 3ZRSA 3K08A 4P9OA 2Q67A 1OCOC 3F7YC 2KB1A 2WLJA 2ITDC 3ABLC 3R65A 4GX5A 4OXSA 3VOUA 4G27B 2HVKC 4X88A 1OCCC 2A9HA 2R9RB 3RVYA 2YEVA 4MTFA 3GB7C 5EBLC 2AHZA 4ZBMA 3E8FA 3EFFK 2ZD9A 4I9WA 4MVMA 2WLLB 2AHYA 4LCUC 3SPJA 4QE7A 2WLIA 4XDLA 3LDEA 4LBEC 2BOBC 4LP8A 4TWKA 2DWEC 4PA3A 3OUSA 1OCZC 5KUKA 4WFEA 3FB5C 2HG5C 3AG4C 1K4DC 2JK5C 4PA9A 2Q6AA 4MVRA 2EIKC 3OUFA 2K1EA 3SPHA 4J9ZB 1R3LC 4R7CA 4XDJA 4MW8A 4JTAB 4MVSA 1M56C 4HZ3A 4R6ZA 2OCCC 3RVZA 3T1CA 3LUTB 3ASNC 3UKMA 4BW5A 4MTGA 4P9PA 3ZJZA 3SJQC 1K4CC 4R8CA 1JVMA 3SPIA 3TETA 3FB8C 1R3IC 5BZBA 1ZWIC 5CBHA 3E86A 2X6CA 2DYRC 1V54C 2DYSC 2EIMC 3LDDA 5EK0A 4P2ZA 3KG2A 2EILC 3ABMC 4H33A 2NLJC 2ZXWC 2H8PC 3SYOA 2WLNA 3ABKC 2WLHA 1S5HC 5IY5C 3HPLC 4PA6A 4HYOA 2A0LA 4MW3A 4PA4A 1ORQC 4X89A 3E83A 3STZC 1QLEC 2IH3C 4WFFA 2QTOA 3RBZA 2X6BA 4PA7A 3K0GA 1OCRC 4GX2A 5B1AC 3K03A 4PDVA 2HJFC 2Y69C 5CBGA 1G4YB 1V55C 3FB6C 2QKSA 4MSWC 3PJSK 3K0DA 4RUFA 4F4LA
chains in the Genus database with same CATH superfamily
1M1KW 5J2UB 1B06A 3ZMUA 5J9PC 3WG7B 1D5NA 1WPXA 5IYCO 1GKFA 1YJNV 4PHZA 1I5YA 5CA1B 3FD9A 4UV9A 2Q4PA 5IDJA 1VARA 3HKEB 4YXWG 5LGUA 3C3TA 2R70A 3SYQA 1H8EG 4JYBA 1AB3A 4O2BB 2AXTZ 3SPCA 1Q43A 1YIJV 5EC2C 1H2KA 3CP1A 1TAEA 2GSMB 3UO2A 1SQFA 1F4NA 1R3JC 3VQYA 2JGDA 2JGDB 3F7YC 3R65A 2IM9A 4GZRB 1QBZA 3ZHSA 3QO5A 1WAZA 1MOFA 5FL7G 5TISZ 5A2QN 1NI8A 4WFAV 3D8CA 3N2GA 2BOBC 5KUKA 3AG4C 3E22B 1QQCA 2Q7GA 1KMIZ 4JI0O 1FD9A 3G6EV 4B7EA 1AILA 1HWYA 1N8RW 4B3RB 1XHXA 1G1XB 4H33A 2WLHA 2P4VA 3W7XA 2E75B 4X1YA 3ETEA 3H9VA 3CCMV 2JRIA 3KCXA 2E5LO 1XUQA 2Y69C 2YXYA 1JX9A 1NTZH 2IW5A 1US6A 3SJCC 2M7WA 1M93A 4HAMA 2DN9A 4WBNA 2YUAA 3BABA 3ABTA 2QDOA 1TUEB 2QWQB 3IFXA 4UV8A 1H2GA 3IJ4A 2ZE7A 2LW1A 5GTIZ 3I56V 1J5EO 1ZL8A 1LR1A 1M5IA 4KHPO 1JFFA 3AG1C 5JQGB 4G28B 4U3FH 5LYJB 2GTSA 1R6TA 4TT3G 1RM1B 2F93B 2LO1A 3CCLV 4U3JB 1YVWA 1N36B 4DR4B 2A3QA 4I50A 3WFVA 3H1LH 3K08A 3RYIB 3G67A 2WLJA 1WLEA 2C2AA 2P90A 2ODMA 2JIZG 1VP7A 5EBLC 4LWSB 4LF5O 2AHYA 3JASA 2P22C 3FKSG 1OCOB 4LP8A 4PA3A 1AR4A 3THOA 4GYCB 2IJIA 1VQ5V 1XNQB 3OUFA 2P67A 3CB2A 4PJ0Z 1NH2D 1IBMO 1NQTA 1DGSA 1RSOB 1SESA 4B08A 4P9PA 1K4CC 4AI8A 3SPIA 1NKDA 3K9SA 1AROP 4JAUA 5LL6Y 1V54C 3APOA 5IYBO 1BHAA 2BTOA 4JYAO 1NVPB 2UXCB 4KL1A 1FKAO 5C8YB 3HPLC 4OPAA 2Q7HA 1FXHA 4UCRA 1NS1A 4UCTA 4DV4B 4Z1MG 3N2KA 2F43G 4JI6B 4O2AB 1KP3A 5CA0B 3ZEDA 4PA7A 4WBNB 3RN4A 1Y76B 4I55A 1P84F 3FB6C 2QM4A 1SQQH 1VQMV 1XEQA 4ZHQB 4RUEA 3IGAC 1JFFB 2VS0A 5KUMA 1IXBA 2YIBA 2WLKA 3MAQA 4U7NA 2E76B 4YY3B 1GTOA 1HNZO 4LH6A 3SR2C 1FS0G 1FJGO 2F1MA 2EINC 2CAZC 2X7RB 3AEIA 4QE9A 1XMOB 3P32A 2R9AA 3L73H 5LHIA 2IH1C 1G8MA 3K9AA 3UQ8A 4LF4B 2Q67A 1H2LA 4G27B 1NR7A 1AJPA 1PL0A 3GB7C 4B3TB 2F95B 4DV4O 4JI2O 4FFKA 3BY6A 2JJ1G 3FB5C 1RPRA 1KBHA 5L3DA 4Q20A 4JTAB 4PD4F 1PNMA 1LUWA 1QHTA 5IWAB 1W59A 5L3GA 2B9ZA 2Z0AA 1SF9A 3D36C 3T1YB 3L71H 3TETA 4I9QA 4I0XA 4O4IB 5C8YA 5CBHA 3OTOO 4KXRA 4ZOLB 4TOIA 4P2ZA 4ABMA 4IHJB 1KECA 1YTFD 2O57A 4CH4A 5DEDA 2ZIMA 1A32A 2CGOA 5K1XA 4LR3A 3CCVV 4YIOA 3ABKB 3VQWA 2F66C 3K0GA 1M57B 3JAWB 4D7TA 4OX9O 1S5LZ 4B3MO 3QNEA 5LMUB 4CBCA 4IYHA 1VQ8V 4R50A 3UM7A 4JYCA 4WF9V 1IXMA 3RFRA 4GLXA 4X64B 4GKJO 2ZM6O 1HR0O 1TGOA 1UJWB 5JVDB 2XTAA 1AR5A 4I7ZB 1GK9A 5HFLA 4PV1B 1RM1C 1S0VA 1EZJA 1MA1A 2WWWA 3K04A 3OR7C 2Q7EA 4JF3A 1HNXO 2Y69B 5LMNO 1SETA 3D3IA 1JJOA 3JAMN 3JD4A 4MVOA 2PYJA 2Z3YA 2BOCC 3ZRSA 4FZ0A 4UXNA 4X65B 4HNAB 3ZMZA 1QLEB 3VOUA 4OXSA 4W4KA 1OCCC 2A9HA 2XUMA 1YI2V 2ZNJA 4ZKIA 3G6BA 4LF4O 1M56B 1PL4A 4FLUA 4XDLA 4QPKA 3OUSA 1Q3EA 1H8HG 3JSNA 2ZR2A 2FTKA 4E4EA 2V1DA 4XDJA 4NKGB 3TGUH 1N36O 1AR1B 3J7AU 3C3SA 1IBKB 2WSSG 3OMIB 2BSKA 2P5OA 1YSCA 4JI0B 2MK3A 4MTXA 2DYSC 3JD3A 1AVMA 3KG2A 2EILC 3B40A 2RJZA 3VQVA 1K33A 4FM0A 5IJ9A 4PA4A 3H1HH 2Y0IA 1GO3F 2RN9A 1SA0B 4X1KB 5IJ0B 4DV0B 2CTPA 5B1AC 1IDSA 5KMGA 4JV5B 2CH7A 2E5LB 4K0KO 1HNWO 4EB6A 2D2CB 2EIJC 1XL4A 2VQEO 4ZIBA 3C90A 1PM9A 4DUYB 3G80A 1M4UA 1S77D 2DW4A 2ZE8A 2D3OW 4H0LB 3IAYA 3AG3C 3RWRD 1B3QA 2QGNA 4CS3A 3N2KB 1F23A 1JR9A 2V7QG 2HFEC 4NR1A 4K8ZA 3ZMSA 3S3WA 3WU2Z 4YJ2A 4I4TA 3ABLB 3D36A 5H6RA 4J9YB 4X66O 1Y74A 1WP8A 2LGWA 4LFAO 3PN1A 1JA8A 2HVKC 1DF5A 3ETGA 3OMNB 5FNVA 1KB9F 3ZS8C 3JATB 2QTSA 2KQXA 4DRXA 4GKKB 4AILC 1FFXB 5BY1A 3DXRB 1N34O 4KUMA 4J9ZB 2CDYA 2EJ7A 5JVDA 4MVSA 4O2BA 3BRCA 3SJAC 1VQPV 2EIKB 4NVPA 1JVMA 1R3IC 4LF7O 4JI3O 1TUBB 4DYLA 3CSXA 1GRJA 5GW7A 4X9QA 3TK1A 4AQYB 4MW3A 3JATA 1K3EA 4LF6O 1MG1A 2OWOA 5LHGA 3KKYA 2OIGA 2HJDA 4O4LB 2PF4E 2FYUH 4JI6O 3E8HA 4UFZA 4GX1A 4JAVA 3OTOB 4PDRA 4B3RO 3CHXA 5GONA 2AGAA 4DO2A 3A8TA 4BW9A 4B3SO 3QVNA 4DV5B 4JTDB 3HKBA 4WFHA 1HNZB 5JCOC 4XDKA 2PYLA 3ABUA 3CC4V 4GUNA 3GVMA 4EB6B 5KLVH 3AG2C 3OR6C 3OTFA 5CB4B 2LFRA 4I50B 4X62O 3F7VC 4B3TO 1P4RA 2DQ0A 2ITDC 4JI8B 2JGUA 5JCOA 1Q81W 3E35A 1XNQO 4CC6A 2M6YA 3E8FA 1O9GA 1W0JG 2WLLB 3CRMA 3JD0A 3SDLA 4LBEC 4CZZA 4F6EA 4QIWF 4NB5A 4DV0O 1VF6C 4MVRA 1KC8W 4PELA 3RYHB 2YIDA 4HZ3A 3ZMTA 2EIMB 2QKCA 3VBBA 3FB8C 3D3QA 1K5SA 2QWOB 2A7WA 3QO7A 5F2VO 2EJRA 1SRYA 3UCSC 4DV3B 2XNDG 1GN3A 2A0LA 4ZOLA 5B1OA 5LP6C 3A0HZ 1RP3B 4LNUA 1VQKV 1SQBH 2Q8VA 4J80A 3FAVA 4NYKA 1U96A 4GCZA 1V55C 3J80N 2XASA 3OW2U 5LOVA 3STLC 3RYCB 4DRXB 2ITCC 1NVPD 1BE3H 1VEWA 4JPRA 4J42A 2DYRB 1SKVA 2H94A 3K5NA 1B04A 3CMEV 5JH7B 4DK0A 4X1IA 1I7FA 2P7TC 1QR9A 1VMGA 1THZA 2Q0AA 4DR6B 4TUYB 3T4ZA 1OZ0A 3MHHC 1YF2A 2KSDA 1S3JA 3Q4HA 3TXQA 2QE7G 2X0LA 2K9PA 2WA3A 1K9MW 1TUBA 3WG7C 4LF5B 1VQNV 4O4JB 2UXNA 1WN7A 4EEQA 3I5DA 4YY3O 3ZMVA 1K8AW 5H5NA 5EIBD 2ZD9A 1L1FA 2DWEC 2VWJA 5B1NA 4YJ3A 4LFBO 1E79G 4FM1A 5LBQA 4J10A 4NXNO 2EZPA 3ZJZA 1NT2B 3MHSC 2Y48A 1R6NA 4FLXA 4IIJA 2OIEA 3S3XA 3EHBB 3F5TA 4UCSA 3RYFA 3RYFB 3DC5A 1YXBA 3K59A 2ZCEA 1N32B 1OHHG 1VF5B 3SYOA 1PPJH 1S5HC 2UUCO 1IX9A 1E1QG 2XHBA 1G6UA 4DUZB 2PUSA 4ICGA 1O9HA 3CCUV 2QTOA 3CEIA 2UXDO 4DV2O 1RSOA 3K03A 2NNUA 3OM3B 2XT9A 2IJHA 5KA5A 3N27A 4UCOA 3LNNA 4MTOA 3JAKB 5H2FZ 4JI1O 5ITZA 5KMGB 2A79B 1T5EA 2P4KA 3CC2V 5FLXN 4EFBA 1Y76A 1GM8A 1KU9A 1J5EB 1KKDA 3RW0A 5B1BC 3LDCA 3LNMB 2DWDC 5EIBC 3JYCA 3LSQA 4U7OA 4FLTA 1BSMA 1EN6A 3K06A 1LNQA 3BEHA 3E8BA 3AG2B 1KD1W 1SQVH 3JD1A 4JASA 2VRZA 2ZKOA 4MTFA 1HW7A 5KHJA 1VQLV 1GN4A 4RWUA 1I0HA 3JCUZ 1N4CA 2WLIA 5FNVB 4TWKA 3DTUB 1S5JA 3BAAA 1VIBA 4FMTA 2DJVA 3FX7A 1TA8A 2AW9A 3CPWU 3QF7A 2XAFA 3ASNC 3UKMA 4BW5A 4DV3O 3E2EA 4U3JA 2H3OA 2IU3A 1Q5OA 3E86A 4G2KA 3JALA 4D7SA 3CCQV 2HHHO 1GM9A 4HYOA 2W6JG 2UU9O 4B3MB 5JJEB 5CA3A 5IJ0A 3L9DA 1K73W 2ZQMA 2OTLV 3OAAG 4DUZO 4O4JA 3OEEG 4R8CA 4F4LA 1NTMH 3U11A 5J2TA 3K5MA 4P30A 3X2QC 4LF9O 2GUZA 5EC1C 4DR3B 1WA8B 4CH6A 2UUAB 3HKCB 5CN0A 3HKCA 1RPOA 3FYEB 3F5WC 2YIBD 1B6QA 2PTMA 3JAWA 4ZHQA 1HNXB 1Q6IA 1XREA 1YCIA 3AK3A 4JGSA 4JI4B 1ZL8B 2NN4A 1R3KC 4DV7B 1N33O 2VQEB 1YITV 1XI1A 1SA0A 4X1KA 1CPYA 5IT9N 2WLLA 4PI0A 3M8AA 2WLMA 3FFQA 5LYJA 4Z1VA 2CGNA 2DMXA 1PNKA 3AG3B 4W4LA 1HNWB 2KB1A 2IJJA 4B7KA 4X88A 2R9RB 3ZRXA 1M90W 1BMFG 4X65O 2V4DA 2AZ0A 1Z2GA 3ZRWA 3JCZA 1NR1A 2HG5C 4LF8O 4TV9B 2IBZH 4IIJB 2K1EA 3BFRA 2YXLA 5KHGA 4JI7O 2KKWA 3RVZA 3LUTB 1N32O 3BA9A 4BWAA 2YDEA 3K3WA 3CRRA 4GT1A 3QO8A 4YJ3B 1SC5B 1N34B 4JAAA 1XNRO 4L87A 1ZX3A 5LOVB 2G38A 3ABMC 3DC6A 5IWAO 4H13B 3ABKC 1PV0A 3ZIAG 3CRQA 4X1YB 2VQFO 5BR8O 1BHBA 3CCJV 3VQXA 4JZGA 4GX2A 2HJFC 3ETQA 4TUYA 3K0DA 4UB6Z 5BR8B 4DV6B 1VQ7V 3JALB 2EULA 2RMKB 3L75H 2Z5UA 2GDSA 2PGGA 3H1KH 4LFCB 2DQ3A 2ZE6A 4EFEA 2CE4A 4MVZA 1ZLZA 3AK2A 3CS5A 3JAKA 1PNLA 3W7WA 1EBOA 1IVSA 1X4TA 4BIUA 4YHHB 2LFSA 4PDMA 4YJ2B 2NR5A 3HKDB 1M57C 2WAMA 4D6TH 4DR6O 2DOSA 3B8NA 1AI6A 2P06A 5L3FA 1IBLO 1UPGA 1MMMA 2GUZB 4QNHB 2UXXA 1URFA 1N33B 1SQPH 3CX5F 3OEHG 2JEXA 3ZCCA 1AI5A 2ZM6B 1HR0B 1OCOC 1WP7A 4JI5B 3O9OA 2HP8A 3ZX6A 5LP6A 4O4IA 5D5QA 4PI2A 1DTOA 4CS4A 2CTQA 1ZAUA 2ARHA 3K57A 2QA4V 1LUVA 1EFRG 4FM2A 1BQ0A 1KP2A 1I94B 2HKOA 1K4DC 1Y74B 1H2NA 2Q6AA 2OTJV 5LGTA 4NTYA 1MSWD 2A06H 2F4VB 1YJWV 4K3AA 2R9IA 1GN6A 1N0NA 2IJKA 1SQGA 2X6CA 5BXZA 4LFCO 4DR2O 5H6QA 3K5LA 4ASUG 2P6JA 3DXRA 1Z5WA 3KZIZ 3OFNG 2H8PC 3A2FA 4HBNA 4H44B 3MD0A 5CA0A 4O2AA 1EZVH 2UUCB 4LF9B 5DN6G 2BTQB 2FMLA 2HLDG 1GH6A 5CBGA 3BVOA 3B8MA 3T1HO 4UCVA 5E79Z 3P3PA 4MVQA 2ATKC 4F6RB 4DV2B 4DXWA 1FXKA 3ML0A 2E74B 4FIPC 1VQOV 3U10A 2AZ2A 1XHZA 3T1HB 2Q73A 3SYCA 1EM1A 3BPZA 2HHHB 2OT5A 4TV8B 4HNAA 2Q68A 3ETDA 2Q69A 3ASOC 2IU0A 1HDJA 5B3SB 2QEXV 2FL4A 3CJHB 1VQ9V 5KX5A 4MVUA 4J11A 2PZSA 1XQ8A 3OD4A 2GTAA 2WLIB 2MW2B 3E8GA 3T2MA 1NBMG 1Q8IA 4OGQB 2LJ2A 1D5AA 4IT5A 3TXSA 3WB2A 2X6AA 5B3SC 2ZNIA 2B5UA 5LMUO 4TQDA 4BIOA 2XAJA 4FLVA 3CRCA 3JASB 2EIJB 3H01A 1JCHA 5JQGA 1W2BU 1WB7A 3ZBHA 2YS8A 3J81N 4MVMA 4FVMA 3OMAB 5DECA 3CCSV 1YTFB 4IGGA 1OV9A 1NZ6A 2RCVA 5GONB 3SPHA 2EIKC 3H1IH 1XNRB 3WB0A 1IZ3A 4R6ZA 1AP5A 2OCCC 1AJQA 4E2LA 3OT7A 3SJQC 1VF6A 3P3NA 2W0XA 2WPDG 3BHPA 4IYIA 1R1BA 5KA6A 4X62B 1ZUQA 1ZWIC 4UVAA 1Q90D 1Y67A 3OE7G 5LA6A 1QNMA 1KQSU 5J2UA 1R6KA 2RQ6A 1Q82W 3WB1A 4DR7O 3LSUA 4J7KA 1K97A 1ORQC 4FJCC 1ENVA 4QGPA 4F6RA 2Q5ZA 2X6BA 3W7SA 2PY5A 2Y4TA 1IURA 5IJ9B 5KHIA 1U97A 4DR1B 4UUJC 4LF7B 1EN4A 5IE9A 1X59A 5ITZB 1CP9A 4LC1A 1I08A 1P7BA 3RYHA 3GWOA 1BZKA 4FLZA 3HB3B 3M7MX 4RAIA 4DK1A 3R66A 1Q7YW 2EZOA 2B1GA 3W7UA 2YICA 2F4VO 3SYAA 5L3CA 1GAXA 2OYQA 4OPHA 3IC7A 4J7JA 5H9CA 5B1BB 4JI1B 2YXHA 1I94O 2BE3A 1SERA 2Y4UA 4QJFB 3AK1A 3RVYA 4GKKO 4MT8A 4O4LA 1QVGU 3EFFK 4LF8B 5IYDO 1I5XA 2CTWA 1OCZC 2QWNB 4I55B 4PA9A 3UO3A 4CS2A 3I55V 1JMKC 4X20B 3CCRV 2VWKA 4YHHO 1OCZB 1SS3A 1YEWA 1EN5A 5FPRA 5BZBA 1MNGA 4JI7B 2EIMC 2L35A 4JI4O 1IBKO 2EBOA 3JARB 5B1AB 5IY5C 3ZHRA 4JI5O 2N74A 2PI5A 1TVKA 1NU1H 5LXTA 2ZIOA 3JD2A 5B5EZ 4WFFA 4QPJA 4K0KB 5JJJB 1K92A 1IBLB 2QM7A 1PD3A 4PDVA 1XMOO 2E3CA 4X1IB 4O4HA 5JJNB 4RUFA 4X8AA 5KHHA 3U0ZA 3SYPA 1OJHA 2BTQA 1S76D 2ETNA 5CBFA 3ZN1A 4B3SB 1YDXA 2YI9A 5CA1A 3GWKC 1J95A 2RDCA 2QSAA 3M99B 4DV1B 1SQXH 3B09A 2WA4A 3RYCA 5EBWC 1F7YA 3X2QB 1Y66A 3RYIA 2W0FC 3L74H 4UVCA 4TV9A 1Q6HA 1K5QA 1MZFA 2UUAO 2XOKG 1F4MA 5KAFZ 4FFBA 1H38A 5EZYB 1V55B 2XAHA 3B4SA 1SZTA 1FPOA 5L3BA 5A9GA 4GX5A 1QVFU 4DR5O 1MZEA 4CH5A 2UXCO 2YEVA 1H2SB 4I9WA 4QE7A 4DR3O 4FK5C 1QLNA 3ZRWB 1W0KG 3CXCU 2PI4A 1DLBA 1XMQO 4WCEV 2FB5A 3E22A 5LA6B 1K34A 3CRAA 4JI3B 1COWG 1XOUA 4MW8A 3BA8A 1P49A 1NTKH 1P7GA 4JYAB 2KG7A 3QTCA 2LQTA 4DV1O 4KP4A 1TVKB 5LXTB 4LFBB 4XBFA 3CE2A 4NXNB 2ZDIA 1HP8A 4YIPA 2EX3A 1UFIA 4J41A 4N21A 5JH7A 3E83A 1WB8A 1FXVA 5J2TB 4X64O 3OGIB 4IHJA 3A0RA 1L0NH 4X66B 2UXBB 2VQFB 1YHQV 3EVKA 2BCCH 3FAVB 1N0JA 1AI4A 3ZHTA 3AG4B 2XAQA 3E89A 4NTWA 4DV7O 3ZRVA 3SPGA 1KKCA 1Q86W 3W7TA 1MABG 5EBMC 4FZ1A 4RO2A 3FB7C 3H1JH 1OCRB 1GM7A 1FXKC 1BS3A 5GTHZ 3SJBC 2JVDA 1XL6A 3NXSA 5KX5B 2RNBA 3EXAA 4DR1O 1FFTB 4TQFA 3RT3C 3HKEA 3P30A 2ZINA 2ILMA 4LWSA 2QM8A 4ZBMA 2CK3G 4TSFG 3SPJA 2Q9LA 3HR0A 4BR6A 1L8DA 2N04A 5JWPA 2JJ2G 4WFEA 2B1IA 3CC7V 4UVBA 4JI2B 2JK5C 2YI8A 3ASNB 4J7ZA 2Y0PA 4LH7A 1ROPA 3BCCH 4GKJB 1YZBA 1RFYA 1NH2B 5EYPA 2ZT9B 2GV9A 4DR7B 1OCCB 1XBLA 4C7UA 3L70H 4X20A 3CMAV 2YSUB 1FFXA 3MDSA 1ZTEA 2DYSB 2ZXWC 4L8JA 4PA6A 1AJNA 3DGEA 1YJ9V 4UCUA 4X89A 3STZC 1VQ4V 4FLWA 4K35A 1MSDA 1QU7A 4Q6GA 4BAYA 3ZN0A 2LW7A 2HR3A 2QWPB 3NR7A 3ICXA 4K8XA 2UU9B 2QKAA 4OX9B 3L72H 4JI8O 2R72A 4LFAB 4ZI7B 2EINB 4ZI7A 5IYZB 5IYZA 3ZHQA 2EILB 3HKDA 2OCCB 2CH7B 1BL8A 4RQEA 1CEZA 2UUBB 3LSSA 3SGIA 1Y4MA 3OGCC 3B2EE 2JS5A 3T4DA 1DF4A 4AHCA 4GX0A 1XMQB 3IC9A 3Q4HB 1V9PA 3CYOA 5B66Z 4IL6Z 4PDLA 5E1AC 1SZXA 4FPPA 3TJTA 3ASOB 2YEVB 2QJ1A 4MS2A 2LP7A 4DV6O 4P9OA 3A0BZ 3ABLC 1FYJA 1JPXA 4RQFA 4JV5O 2AHZA 1KUQA 2BSKB 1XILA 4AQYO 1VF7A 3CWBH 3T1YO 1BT8A 2Q0OC 4JYYA 3UT5B 2ADPA 1GN2A 5C93A 5CMUA 1XDCA 3K5OA 2YC0A 1R3LC 1WPBA 3CXHF 3K79A 1CXZB 3N2GB 3T1CA 2OCHA 4MTGA 1L0LH 4NXMO 2DE0X 2GHYA 4CH3A 1AP6A 1IBMB 3G4SV 1H2MA 1K7DA 1WJZA 5D5PA 2UUBO 2NLJC 5EZYA 2CTRA 4KHPB 4I5SA 1AI7A 2N05A 3CD6V 2F23A 1WA8A 1GMGA 1QLEC 2IH3C 2JS3A 3RBZA 1OCRC 2W6IG 3CCEV 2FKXA 2ADQB 3B77A 1BQZA 5LMNB 5FPOA 2ZR3A 1WNSA 1G4YB 2QKSA 3AG7A 3ZHUA 5EYPB 2JDIG 1QR8A 4DW1A 1VQ6V 4NTXA 4FLYA 4DR5B 1JQ0A 3DSQA 4H37A 4I4TB 1FJGB 1QCEA 2XAGA 4I0XB 3TCUA 1Z5VA 4UB8Z 2KG7B 3O65A 1Y6XA 3ABMB 4DR2B 2QR4A 4N23A 5KAIZ 2QWRB 1S72V 4WFBV 4LNUB 5LGNA 5CB4A 3APQA 5LHHA 2ZE5A 1BGYH 2JEUA 1FAFA 5BMVB 2HEPA 4DUYO 4Z2WA 2HVJC 1FXKB 5IY5B 4KFMA 4WFGA 3HKBB 1BCCH 4EKWA 5KHKA 1Q6UA 4JTCB 4TV8A 2L6LA 4DR4O 3K58A 1KYOF 1DK1A 2YIAA 2UXBO 1M9NA 2ZDIC 3AG1B 3CJHA 1E1RG 4LCUC 3FYIB 2LGQA 4LF6B 3QG5A 3RGBA 3LDEA 1R73A 2UXDB 4A5UB 1NJIW 4R7CA 5BMVA 1M56C 1V54B 2CUGA 3ZHVA 2DYRC 3KCYA 1D2DA 1JJ2U 3LDDA 5AG2A 1PP9H 5EK0A 3G71V 4BIZA 4CC5A 4NXMB 5HFMA 3UT5A 3JARA 5K1PA 4DV5O 1JOYA 2WLNA 5DM6V 1F51A 2ZXWB 3JSLA 4DW0A 1ZSPA 4JZ2A 4FFBB 5LP6B 1PKXA 2GBOA 4MSWC 3PJSK 5L3EA 4O4HB
chains in the Genus database with same CATH topology
4X8AA 1M1KW 3SYPA 4P30A 3ZMUA 5J9PC 3X2QC 3WG7B 1S76D 1WPXA 5EC1C 5IYCO 5CBFA 1GKFA 3ZN1A 1YJNV 1I5YA 1J95A 2EIJC 1XL4A 4UV9A 3M99B 5CN0A 1RPOA 3FYEB 5IDJA 3F5WC 1B6QA 4YXWG 5EBWC 5LGUA 3X2QB 1Y66A 2W0FC 3SYQA 1H8EG 4JGSA 4UVCA 4JYBA 1S77D 2DW4A 1K5QA 1R3KC 2D3OW 1YITV 2XOKG 1F4MA 3AG3C 1H38A 1CPYA 2WLLA 1F23A 3SPCA 1V55B 2WLMA 2XAHA 1YIJV 2V7QG 2HFEC 1SZTA 5EC2C 3ZMSA 3CP1A 2GSMB 3ABLB 3D36A 5H6RA 4J9YB 1F4NA 1R3JC 5L3BA 1PNKA 3AG3B 3F7YC 2KB1A 3R65A 2IJJA 4GX5A 1QVFU 1QBZA 4X88A 2HVKC 1DF5A 2R9RB 3ETGA 3OMNB 3ZRXA 1M90W 2YEVA 3QO5A 1BMFG 1MOFA 5FL7G 4I9WA 4WFAV 4QE7A 4FK5C 1QLNA 2BOBC 3ZRWB 3ZRWA 1W0KG 5KUKA 3CXCU 2PI4A 1DLBA 1NR1A 2HG5C 3AG4C 3JCZA 4KUMA 4WCEV 2K1EA 1K34A 4J9ZB 1COWG 4MW8A 4MVSA 3RVZA 1VQPV 3LUTB 2EIKB 3G6EV 3K3WA 1JVMA 4GT1A 3QO8A 1R3IC 1HWYA 4KP4A 1N8RW 4L87A 4XBFA 3ABMC 4H33A 3ABKC 2WLHA 2ZDIA 5GW7A 3TK1A 3ZIAG 3W7XA 4MW3A 3ETEA 1K3EA 4N21A 1MG1A 3CCMV 3E83A 1BHBA 1FXVA 3CCJV 5LHGA 4GX2A 2HJFC 2Y69C 3A0RA 1JX9A 3K0DA 2IW5A 2M7WA 1VQ7V 1YHQV 3E8HA 4HAMA 3ABTA 4GX1A 1TUEB 3IFXA 1AI4A 2Z5UA 4UV8A 1H2GA 3AG4B 4JAVA 4PDRA 2XAQA 3E89A 3I56V 4DO2A 2DQ3A 4MVZA 3ZRVA 3SPGA 3AG1C 1Q86W 1PNLA 3W7WA 1EBOA 4JTDB 3W7TA 4G28B 1MABG 4BIUA 5EBMC 2LFSA 4PDMA 4RO2A 4WFHA 3FB7C 4TT3G 1M57C 1OCRB 1GM7A 2WAMA 1RM1B 4XDKA 1FXKC 3ABUA 3CC4V 3CCLV 3B8NA 1AI6A 3AG2C 5L3FA 3OR6C 4QNHB 1XL6A 3NXSA 2UXXA 2LFRA 1FFTB 3OEHG 2JEXA 3F7VC 3WFVA 3ZCCA 1AI5A 3K08A 1P4RA 2DQ0A 1OCOC 2WLJA 1WLEA 2ITDC 2C2AA 2P90A 3P30A 1Q81W 2JIZG 3E35A 5EBLC 2QM8A 1DTOA 4ZBMA 2CK3G 3E8FA 2QA4V 4TSFG 1W0JG 2WLLB 2AHYA 1EFRG 3SPJA 3FKSG 1OCOB 3JD0A 1KP2A 4LBEC 4LP8A 4PA3A 4CZZA 2JJ2G 4WFEA 4QIWF 2B1IA 2HKOA 2IJIA 4UVBA 3CC7V 1K4DC 2JK5C 1VQ5V 2OTJV 2Q6AA 4MVRA 3ASNB 3OUFA 5LGTA 2P67A 1KC8W 1MSWD 4PELA 1NH2D 4HZ3A 1NQTA 3ZMTA 1YJWV 1SESA 4P9PA 1ROPA 1K4CC 2EIMB 4R8CA 3SPIA 1NH2B 2R9IA 1NKDA 3VBBA 3FB8C 1AROP 2IJKA 4JAUA 2X6CA 1K5SA 1V54C 1OCCB 5H6QA 5IYBO 3QO7A 4ASUG 1BHAA 3CMAV 2YSUB 2P6JA 1NVPB 2EJRA 1SRYA 2DYSB 2ZXWC 3OFNG 2H8PC 2XNDG 3HPLC 4PA6A 1AJNA 3DGEA 2A0LA 1FXHA 1YJ9V 5B1OA 3MD0A 4Z1MG 4X89A 3STZC 1VQ4V 2F43G 1KP3A 4PA7A 5DN6G 1VQKV 4BAYA 3ZN0A 2HLDG 2HR3A 4GCZA 5CBGA 3B8MA 1V55C 3FB6C 2XASA 1VQMV 4MVQA 2ATKC 3OW2U 3STLC 2ITCC 1NVPD 4DXWA 1FXKA 3ML0A 4JPRA 4FIPC 1VQOV 2DYRB 4RUEA 3IGAC 5KUMA 2H94A 2EINB 3CMEV 2WLKA 3SYCA 2EILB 4U7NA 1GTOA 2P7TC 2OCCB 1QR9A 2OT5A 1BL8A 1THZA 4RQEA 1CEZA 1FS0G 2Q68A 3LSSA 3ETDA 2Q69A 3ASOC 2IU0A 3T4ZA 5B3SB 2QEXV 2EINC 1OZ0A 1VQ9V 3MHHC 2X7RB 4MVUA 1Y4MA 3AEIA 3OGCC 4QE9A 3T4DA 1DF4A 1S3JA 4GX0A 3CYOA 2WLIB 4PDLA 3E8GA 3P32A 5E1AC 4FPPA 2QE7G 2X0LA 3T2MA 1NBMG 3ASOB 2YEVB 5LHIA 1K9MW 2X6AA 4MS2A 5B3SC 2B5UA 1G8MA 2IH1C 2LP7A 3WG7C 1VQNV 3K9AA 4P9OA 2Q67A 2UXNA 2XAJA 3ABLC 2EIJB 3H01A 1JCHA 4G27B 1W2BU 1NR7A 1AJPA 1JPXA 1PL0A 4MSWC 4RQFA 3GB7C 2AHZA 3ZMVA 1K8AW 2ZD9A 4MVMA 3OMAB 3BY6A 1L1FA 3CCSV 2DWEC 1YTFB 2JJ1G 3FB5C 1RPRA 5B1NA 5C93A 5CMUA 3SPHA 2EIKC 1E79G 1R3LC 5L3DA 3K79A 4Q20A 4JTAB 5LBQA 1PNMA 4R6ZA 3T1CA 2OCCC 1AJQA 4E2LA 5L3GA 2EZPA 4MTGA 3ZJZA 3SJQC 3MHSC 2WPDG 2Y48A 2GHYA 3TETA 1R6NA 5KA6A 1ZWIC 4UVAA 5CBHA 3OE7G 3EHBB 3G4SV 4P2ZA 1KQSU 1R6KA 1K7DA 1KECA 2NLJC 1Q82W 1YTFD 1OHHG 3SYOA 1S5HC 4I5SA 1AI7A 3CCVV 1K97A 1E1QG 3CD6V 1ORQC 3ABKB 4FJCC 1ENVA 1GMGA 1QLEC 2IH3C 3CCUV 3RBZA 2QTOA 2X6BA 3W7SA 3K0GA 1M57B 1OCRC 2W6IG 3CCEV 3B77A 3K03A 2NNUA 2ZR3A 1G4YB 2QKSA 3QNEA 3OM3B 4CBCA 2IJHA 1VQ8V 4R50A 2JDIG 1QR8A 1VQ6V 4UUJC 3UM7A 5KA5A 4JYCA 4WF9V 1IXMA 4MTOA 1JQ0A 4H37A 1QCEA 2XAGA 3TCUA 2A79B 1CP9A 1UJWB 3ABMB 4LC1A 4N23A 1P7BA 3CC2V 3GWOA 1S72V 1GK9A 3HB3B 5HFLA 4WFBV 4RAIA 1RM1C 5LGNA 1S0VA 1EZJA 1Q7YW 5LHHA 1GM8A 2EZOA 1KKDA 3RW0A 2JEUA 5B1BC 2WWWA 3LDCA 3K04A 3LNMB 3OR7C 4JF3A 2DWDC 2Y69B 2B1GA 3JYCA 3LSQA 1SETA 4U7OA 2HVJC 3K06A 1FXKB 3D3IA 5IY5B 1LNQA 3BEHA 4KFMA 3W7UA 3JD4A 4WFGA 3E8BA 4MVOA 3AG2B 2Z3YA 3SYAA 4EKWA 2BOCC 5L3CA 1KD1W 3ZRSA 4JTCB 4UXNA 3IC7A 5H9CA 5B1BB 3ZMZA 1QLEB 3JD1A 4JASA 3VOUA 4OXSA 1SERA 1OCCC 2A9HA 3RVYA 4QJFB 1YI2V 4MTFA 4ZKIA 4MT8A 1M9NA 2ZDIC 1VQLV 1QVGU 3EFFK 3AG1B 1E1RG 4LCUC 3FYIB 2WLIA 1M56B 5IYDO 4XDLA 1I5XA 3LDEA 4QPKA 1R73A 4TWKA 3DTUB 3OUSA 1OCZC 1H8HG 4FMTA 2ZR2A 4PA9A 2FTKA 3I55V 2V1DA 1NJIW 3CPWU 4R7CA 4XDJA 3CCRV 1M56C 1AR1B 2XAFA 3ASNC 2WSSG 3OMIB 3UKMA 4BW5A 3E2EA 1V54B 1OCZB 2IU3A 5BZBA 1YSCA 2MK3A 3E86A 2DYRC 4G2KA 4MTXA 2EIMC 2DYSC 3LDDA 1JJ2U 3JD3A 5EK0A 3G71V 4BIZA 5HFMA 3KG2A 2EILC 2EBOA 3CCQV 1JOYA 5B1AB 2WLNA 5IY5C 1K33A 5DM6V 1GM9A 4HYOA 1F51A 2W6JG 2PI5A 4PA4A 2ZXWB 3JD2A 1GO3F 5CA3A 4WFFA 4QPJA 1K92A 1PKXA 5B1AC 2QM7A 1K73W 1PD3A 2ZQMA 4PDVA 2OTLV 3OAAG 3OEEG 3PJSK 5L3EA 4RUFA 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8A A;  4MVQ A;  2ATK C;  4R50 A;  3STL C;  4UUJ C;  3SYP A;  3E8H A;  4P30 A;  3UM7 A;  2ITC C;  3X2Q C;  5J9P C;  4DXW A;  4MTO A;  4GX1 A;  5EC1 C;  4RUE A;  3IGA C;  5CBF A;  5KUM A;  3IFX A;  4H37 A;  4CBC A;  1J95 A;  3TCU A;  2EIJ C;  1XL4 A;  4PDR A;  2WLK A;  2A79 B;  3SYC A;  3E89 A;  3F5W C;  1P7B A;  2P7T C;  5EBW C;  1BL8 A;  4MVZ A;  3SPG A;  2Q68 A;  2W0F C;  3AG1 C;  2Q69 A;  3ASO C;  4RAI A;  3SYQ A;  4JTD B;  3T4Z A;  4G28 B;  2EIN C;  5EBM C;  4PDM A;  4RO2 A;  1R3K C;  4WFH A;  3FB7 C;  4MVU A;  1M57 C;  3OGC C;  3RW0 A;  1KKD A;  4QE9 A;  3AG3 C;  4XDK A;  5B1B C;  3T4D A;  3LDC A;  3K04 A;  4GX0 A;  3LNM B;  2WLL A;  3OR7 C;  2DWD C;  3SPC A;  2WLI B;  3AG2 C;  3E8G A;  3JYC A;  2WLM A;  3OR6 C;  4PDL A;  2HVJ C;  5E1A C;  3K06 A;  3T2M A;  2HFE C;  4QNH B;  1LNQ A;  1XL6 A;  3BEH A;  4KFM A;  5EC2 C;  4WFG A;  2X6A A;  3E8B A;  4MS2 A;  4MVO A;  5B3S C;  2IH1 C;  3SYA A;  4EKW A;  2BOC C;  4J9Y B;  1R3J C;  3WG7 C;  3F7V C;  4JTC B;  3ZRS A;  3K08 A;  4P9O A;  2Q67 A;  1OCO C;  3F7Y C;  2KB1 A;  2WLJ A;  2ITD C;  3ABL C;  3R65 A;  4GX5 A;  4OXS A;  3VOU A;  4G27 B;  2HVK C;  4X88 A;  1OCC C;  2A9H A;  2R9R B;  3RVY A;  2YEV A;  4MTF A;  3GB7 C;  5EBL C;  2AHZ A;  4ZBM A;  3E8F A;  3EFF K;  2ZD9 A;  4I9W A;  4MVM A;  2WLL B;  2AHY A;  4LCU C;  3SPJ A;  4QE7 A;  2WLI A;  4XDL A;  3LDE A;  4LBE C;  2BOB C;  4LP8 A;  4TWK A;  2DWE C;  4PA3 A;  3OUS A;  1OCZ C;  5KUK A;  4WFE A;  3FB5 C;  2HG5 C;  3AG4 C;  1K4D C;  2JK5 C;  4PA9 A;  2Q6A A;  4MVR A;  2EIK C;  3OUF A;  2K1E A;  3SPH A;  4J9Z B;  1R3L C;  4R7C A;  4XDJ A;  4MW8 A;  4JTA B;  4MVS A;  1M56 C;  4HZ3 A;  4R6Z A;  2OCC C;  3RVZ A;  3T1C A;  3LUT B;  3ASN C;  3UKM A;  4BW5 A;  4MTG A;  4P9P A;  3ZJZ A;  3SJQ C;  1K4C C;  4R8C A;  1JVM A;  3SPI A;  3TET A;  3FB8 C;  1R3I C;  5BZB A;  1ZWI C;  5CBH A;  3E86 A;  2X6C A;  2DYR C;  1V54 C;  2DYS C;  2EIM C;  3LDD A;  5EK0 A;  4P2Z A;  3KG2 A;  2EIL C;  3ABM C;  4H33 A;  2NLJ C;  2ZXW C;  2H8P C;  3SYO A;  2WLN A;  3ABK C;  2WLH A;  1S5H C;  5IY5 C;  3HPL C;  4PA6 A;  4HYO A;  2A0L A;  4MW3 A;  4PA4 A;  1ORQ C;  4X89 A;  3E83 A;  3STZ C;  1QLE C;  2IH3 C;  4WFF A;  2QTO A;  3RBZ A;  2X6B A;  4PA7 A;  3K0G A;  1OCR C;  4GX2 A;  5B1A C;  3K03 A;  4PDV A;  2HJF C;  2Y69 C;  5CBG A;  1G4Y B;  1V55 C;  3FB6 C;  2QKS A;  4MSW C;  3PJS K;  3K0D A;  4RUF A;  4F4L A; 
#chains in the Genus database with same CATH topology
 1M1K W;  5J2U B;  1B06 A;  3ZMU A;  5J9P C;  3WG7 B;  1D5N A;  1WPX A;  5IYC O;  1GKF A;  1YJN V;  4PHZ A;  1I5Y A;  5CA1 B;  3FD9 A;  4UV9 A;  2Q4P A;  5IDJ A;  1VAR A;  3HKE B;  4YXW G;  5LGU A;  3C3T A;  2R70 A;  3SYQ A;  1H8E G;  4JYB A;  1AB3 A;  4O2B B;  2AXT Z;  3SPC A;  1Q43 A;  1YIJ V;  5EC2 C;  1H2K A;  3CP1 A;  1TAE A;  2GSM B;  3UO2 A;  1SQF A;  1F4N A;  1R3J C;  3VQY A;  2JGD A;  2JGD B;  3F7Y C;  3R65 A;  2IM9 A;  4GZR B;  1QBZ A;  3ZHS A;  3QO5 A;  1WAZ A;  1MOF A;  5FL7 G;  5TIS Z;  5A2Q N;  1NI8 A;  4WFA V;  3D8C A;  3N2G A;  2BOB C;  5KUK A;  3AG4 C;  3E22 B;  1QQC A;  2Q7G A;  1KMI Z;  4JI0 O;  1FD9 A;  3G6E V;  4B7E A;  1AIL A;  1HWY A;  1N8R W;  4B3R B;  1XHX A;  1G1X B;  4H33 A;  2WLH A;  2P4V A;  3W7X A;  2E75 B;  4X1Y A;  3ETE A;  3H9V A;  3CCM V;  2JRI A;  3KCX A;  2E5L O;  1XUQ A;  2Y69 C;  2YXY A;  1JX9 A;  1NTZ H;  2IW5 A;  1US6 A;  3SJC C;  2M7W A;  1M93 A;  4HAM A;  2DN9 A;  4WBN A;  2YUA A;  3BAB A;  3ABT A;  2QDO A;  1TUE B;  2QWQ B;  3IFX A;  4UV8 A;  1H2G A;  3IJ4 A;  2ZE7 A;  2LW1 A;  5GTI Z;  3I56 V;  1J5E O;  1ZL8 A;  1LR1 A;  1M5I A;  4KHP O;  1JFF A;  3AG1 C;  5JQG B;  4G28 B;  4U3F H;  5LYJ B;  2GTS A;  1R6T A;  4TT3 G;  1RM1 B;  2F93 B;  2LO1 A;  3CCL V;  4U3J B;  1YVW A;  1N36 B;  4DR4 B;  2A3Q A;  4I50 A;  3WFV A;  3H1L H;  3K08 A;  3RYI B;  3G67 A;  2WLJ A;  1WLE A;  2C2A A;  2P90 A;  2ODM A;  2JIZ G;  1VP7 A;  5EBL C;  4LWS B;  4LF5 O;  2AHY A;  3JAS A;  2P22 C;  3FKS G;  1OCO B;  4LP8 A;  4PA3 A;  1AR4 A;  3THO A;  4GYC B;  2IJI A;  1VQ5 V;  1XNQ B;  3OUF A;  2P67 A;  3CB2 A;  4PJ0 Z;  1NH2 D;  1IBM O;  1NQT A;  1DGS A;  1RSO B;  1SES A;  4B08 A;  4P9P A;  1K4C C;  4AI8 A;  3SPI A;  1NKD A;  3K9S A;  1ARO P;  4JAU A;  5LL6 Y;  1V54 C;  3APO A;  5IYB O;  1BHA A;  2BTO A;  4JYA O;  1NVP B;  2UXC B;  4KL1 A;  1FKA O;  5C8Y B;  3HPL C;  4OPA A;  2Q7H A;  1FXH A;  4UCR A;  1NS1 A;  4UCT A;  4DV4 B;  4Z1M G;  3N2K A;  2F43 G;  4JI6 B;  4O2A B;  1KP3 A;  5CA0 B;  3ZED A;  4PA7 A;  4WBN B;  3RN4 A;  1Y76 B;  4I55 A;  1P84 F;  3FB6 C;  2QM4 A;  1SQQ H;  1VQM V;  1XEQ A;  4ZHQ B;  4RUE A;  3IGA C;  1JFF B;  2VS0 A;  5KUM A;  1IXB A;  2YIB A;  2WLK A;  3MAQ A;  4U7N A;  2E76 B;  4YY3 B;  1GTO A;  1HNZ O;  4LH6 A;  3SR2 C;  1FS0 G;  1FJG O;  2F1M A;  2EIN C;  2CAZ C;  2X7R B;  3AEI A;  4QE9 A;  1XMO B;  3P32 A;  2R9A A;  3L73 H;  5LHI A;  2IH1 C;  1G8M A;  3K9A A;  3UQ8 A;  4LF4 B;  2Q67 A;  1H2L A;  4G27 B;  1NR7 A;  1AJP A;  1PL0 A;  3GB7 C;  4B3T B;  2F95 B;  4DV4 O;  4JI2 O;  4FFK A;  3BY6 A;  2JJ1 G;  3FB5 C;  1RPR A;  1KBH A;  5L3D A;  4Q20 A;  4JTA B;  4PD4 F;  1PNM A;  1LUW A;  1QHT A;  5IWA B;  1W59 A;  5L3G A;  2B9Z A;  2Z0A A;  1SF9 A;  3D36 C;  3T1Y B;  3L71 H;  3TET A;  4I9Q A;  4I0X A;  4O4I B;  5C8Y A;  5CBH A;  3OTO O;  4KXR A;  4ZOL B;  4TOI A;  4P2Z A;  4ABM A;  4IHJ B;  1KEC A;  1YTF D;  2O57 A;  4CH4 A;  5DED A;  2ZIM A;  1A32 A;  2CGO A;  5K1X A;  4LR3 A;  3CCV V;  4YIO A;  3ABK B;  3VQW A;  2F66 C;  3K0G A;  1M57 B;  3JAW B;  4D7T A;  4OX9 O;  1S5L Z;  4B3M O;  3QNE A;  5LMU B;  4CBC A;  4IYH A;  1VQ8 V;  4R50 A;  3UM7 A;  4JYC A;  4WF9 V;  1IXM A;  3RFR A;  4GLX A;  4X64 B;  4GKJ O;  2ZM6 O;  1HR0 O;  1TGO A;  1UJW B;  5JVD B;  2XTA A;  1AR5 A;  4I7Z B;  1GK9 A;  5HFL A;  4PV1 B;  1RM1 C;  1S0V A;  1EZJ A;  1MA1 A;  2WWW A;  3K04 A;  3OR7 C;  2Q7E A;  4JF3 A;  1HNX O;  2Y69 B;  5LMN O;  1SET A;  3D3I A;  1JJO A;  3JAM N;  3JD4 A;  4MVO A;  2PYJ A;  2Z3Y A;  2BOC C;  3ZRS A;  4FZ0 A;  4UXN A;  4X65 B;  4HNA B;  3ZMZ A;  1QLE B;  3VOU A;  4OXS A;  4W4K A;  1OCC C;  2A9H A;  2XUM A;  1YI2 V;  2ZNJ A;  4ZKI A;  3G6B A;  4LF4 O;  1M56 B;  1PL4 A;  4FLU A;  4XDL A;  4QPK A;  3OUS A;  1Q3E A;  1H8H G;  3JSN A;  2ZR2 A;  2FTK A;  4E4E A;  2V1D A;  4XDJ A;  4NKG B;  3TGU H;  1N36 O;  1AR1 B;  3J7A U;  3C3S A;  1IBK B;  2WSS G;  3OMI B;  2BSK A;  2P5O A;  1YSC A;  4JI0 B;  2MK3 A;  4MTX A;  2DYS C;  3JD3 A;  1AVM A;  3KG2 A;  2EIL C;  3B40 A;  2RJZ A;  3VQV A;  1K33 A;  4FM0 A;  5IJ9 A;  4PA4 A;  3H1H H;  2Y0I A;  1GO3 F;  2RN9 A;  1SA0 B;  4X1K B;  5IJ0 B;  4DV0 B;  2CTP A;  5B1A C;  1IDS A;  5KMG A;  4JV5 B;  2CH7 A;  2E5L B;  4K0K O;  1HNW O;  4EB6 A;  2D2C B;  2EIJ C;  1XL4 A;  2VQE O;  4ZIB A;  3C90 A;  1PM9 A;  4DUY B;  3G80 A;  1M4U A;  1S77 D;  2DW4 A;  2ZE8 A;  2D3O W;  4H0L B;  3IAY A;  3AG3 C;  3RWR D;  1B3Q A;  2QGN A;  4CS3 A;  3N2K B;  1F23 A;  1JR9 A;  2V7Q G;  2HFE C;  4NR1 A;  4K8Z A;  3ZMS A;  3S3W A;  3WU2 Z;  4YJ2 A;  4I4T A;  3ABL B;  3D36 A;  5H6R A;  4J9Y B;  4X66 O;  1Y74 A;  1WP8 A;  2LGW A;  4LFA O;  3PN1 A;  1JA8 A;  2HVK C;  1DF5 A;  3ETG A;  3OMN B;  5FNV A;  1KB9 F;  3ZS8 C;  3JAT B;  2QTS A;  2KQX A;  4DRX A;  4GKK B;  4AIL C;  1FFX B;  5BY1 A;  3DXR B;  1N34 O;  4KUM A;  4J9Z B;  2CDY A;  2EJ7 A;  5JVD A;  4MVS A;  4O2B A;  3BRC A;  3SJA C;  1VQP V;  2EIK B;  4NVP A;  1JVM A;  1R3I C;  4LF7 O;  4JI3 O;  1TUB B;  4DYL A;  3CSX A;  1GRJ A;  5GW7 A;  4X9Q A;  3TK1 A;  4AQY B;  4MW3 A;  3JAT A;  1K3E A;  4LF6 O;  1MG1 A;  2OWO A;  5LHG A;  3KKY A;  2OIG A;  2HJD A;  4O4L B;  2PF4 E;  2FYU H;  4JI6 O;  3E8H A;  4UFZ A;  4GX1 A;  4JAV A;  3OTO B;  4PDR A;  4B3R O;  3CHX A;  5GON A;  2AGA A;  4DO2 A;  3A8T A;  4BW9 A;  4B3S O;  3QVN A;  4DV5 B;  4JTD B;  3HKB A;  4WFH A;  1HNZ B;  5JCO C;  4XDK A;  2PYL A;  3ABU A;  3CC4 V;  4GUN A;  3GVM A;  4EB6 B;  5KLV H;  3AG2 C;  3OR6 C;  3OTF A;  5CB4 B;  2LFR A;  4I50 B;  4X62 O;  3F7V C;  4B3T O;  1P4R A;  2DQ0 A;  2ITD C;  4JI8 B;  2JGU A;  5JCO A;  1Q81 W;  3E35 A;  1XNQ O;  4CC6 A;  2M6Y A;  3E8F A;  1O9G A;  1W0J G;  2WLL B;  3CRM A;  3JD0 A;  3SDL A;  4LBE C;  4CZZ A;  4F6E A;  4QIW F;  4NB5 A;  4DV0 O;  1VF6 C;  4MVR A;  1KC8 W;  4PEL A;  3RYH B;  2YID A;  4HZ3 A;  3ZMT A;  2EIM B;  2QKC A;  3VBB A;  3FB8 C;  3D3Q A;  1K5S A;  2QWO B;  2A7W A;  3QO7 A;  5F2V O;  2EJR A;  1SRY A;  3UCS C;  4DV3 B;  2XND G;  1GN3 A;  2A0L A;  4ZOL A;  5B1O A;  5LP6 C;  3A0H Z;  1RP3 B;  4LNU A;  1VQK V;  1SQB H;  2Q8V A;  4J80 A;  3FAV A;  4NYK A;  1U96 A;  4GCZ A;  1V55 C;  3J80 N;  2XAS A;  3OW2 U;  5LOV A;  3STL C;  3RYC B;  4DRX B;  2ITC C;  1NVP D;  1BE3 H;  1VEW A;  4JPR A;  4J42 A;  2DYR B;  1SKV A;  2H94 A;  3K5N A;  1B04 A;  3CME V;  5JH7 B;  4DK0 A;  4X1I A;  1I7F A;  2P7T C;  1QR9 A;  1VMG A;  1THZ A;  2Q0A A;  4DR6 B;  4TUY B;  3T4Z A;  1OZ0 A;  3MHH C;  1YF2 A;  2KSD A;  1S3J A;  3Q4H A;  3TXQ A;  2QE7 G;  2X0L A;  2K9P A;  2WA3 A;  1K9M W;  1TUB A;  3WG7 C;  4LF5 B;  1VQN V;  4O4J B;  2UXN A;  1WN7 A;  4EEQ A;  3I5D A;  4YY3 O;  3ZMV A;  1K8A W;  5H5N A;  5EIB D;  2ZD9 A;  1L1F A;  2DWE C;  2VWJ A;  5B1N A;  4YJ3 A;  4LFB O;  1E79 G;  4FM1 A;  5LBQ A;  4J10 A;  4NXN O;  2EZP A;  3ZJZ A;  1NT2 B;  3MHS C;  2Y48 A;  1R6N A;  4FLX A;  4IIJ A;  2OIE A;  3S3X A;  3EHB B;  3F5T A;  4UCS A;  3RYF A;  3RYF B;  3DC5 A;  1YXB A;  3K59 A;  2ZCE A;  1N32 B;  1OHH G;  1VF5 B;  3SYO A;  1PPJ H;  1S5H C;  2UUC O;  1IX9 A;  1E1Q G;  2XHB A;  1G6U A;  4DUZ B;  2PUS A;  4ICG A;  1O9H A;  3CCU V;  2QTO A;  3CEI A;  2UXD O;  4DV2 O;  1RSO A;  3K03 A;  2NNU A;  3OM3 B;  2XT9 A;  2IJH A;  5KA5 A;  3N27 A;  4UCO A;  3LNN A;  4MTO A;  3JAK B;  5H2F Z;  4JI1 O;  5ITZ A;  5KMG B;  2A79 B;  1T5E A;  2P4K A;  3CC2 V;  5FLX N;  4EFB A;  1Y76 A;  1GM8 A;  1KU9 A;  1J5E B;  1KKD A;  3RW0 A;  5B1B C;  3LDC A;  3LNM B;  2DWD C;  5EIB C;  3JYC A;  3LSQ A;  4U7O A;  4FLT A;  1BSM A;  1EN6 A;  3K06 A;  1LNQ A;  3BEH A;  3E8B A;  3AG2 B;  1KD1 W;  1SQV H;  3JD1 A;  4JAS A;  2VRZ A;  2ZKO A;  4MTF A;  1HW7 A;  5KHJ A;  1VQL V;  1GN4 A;  4RWU A;  1I0H A;  3JCU Z;  1N4C A;  2WLI A;  5FNV B;  4TWK A;  3DTU B;  1S5J A;  3BAA A;  1VIB A;  4FMT A;  2DJV A;  3FX7 A;  1TA8 A;  2AW9 A;  3CPW U;  3QF7 A;  2XAF A;  3ASN C;  3UKM A;  4BW5 A;  4DV3 O;  3E2E A;  4U3J A;  2H3O A;  2IU3 A;  1Q5O A;  3E86 A;  4G2K A;  3JAL A;  4D7S A;  3CCQ V;  2HHH O;  1GM9 A;  4HYO A;  2W6J G;  2UU9 O;  4B3M B;  5JJE B;  5CA3 A;  5IJ0 A;  3L9D A;  1K73 W;  2ZQM A;  2OTL V;  3OAA G;  4DUZ O;  4O4J A;  3OEE G;  4R8C A;  4F4L A;  1NTM H;  3U11 A;  5J2T A;  3K5M A;  4P30 A;  3X2Q C;  4LF9 O;  2GUZ A;  5EC1 C;  4DR3 B;  1WA8 B;  4CH6 A;  2UUA B;  3HKC B;  5CN0 A;  3HKC A;  1RPO A;  3FYE B;  3F5W C;  2YIB D;  1B6Q A;  2PTM A;  3JAW A;  4ZHQ A;  1HNX B;  1Q6I A;  1XRE A;  1YCI A;  3AK3 A;  4JGS A;  4JI4 B;  1ZL8 B;  2NN4 A;  1R3K C;  4DV7 B;  1N33 O;  2VQE B;  1YIT V;  1XI1 A;  1SA0 A;  4X1K A;  1CPY A;  5IT9 N;  2WLL A;  4PI0 A;  3M8A A;  2WLM A;  3FFQ A;  5LYJ A;  4Z1V A;  2CGN A;  2DMX A;  1PNK A;  3AG3 B;  4W4L A;  1HNW B;  2KB1 A;  2IJJ A;  4B7K A;  4X88 A;  2R9R B;  3ZRX A;  1M90 W;  1BMF G;  4X65 O;  2V4D A;  2AZ0 A;  1Z2G A;  3ZRW A;  3JCZ A;  1NR1 A;  2HG5 C;  4LF8 O;  4TV9 B;  2IBZ H;  4IIJ B;  2K1E A;  3BFR A;  2YXL A;  5KHG A;  4JI7 O;  2KKW A;  3RVZ A;  3LUT B;  1N32 O;  3BA9 A;  4BWA A;  2YDE A;  3K3W A;  3CRR A;  4GT1 A;  3QO8 A;  4YJ3 B;  1SC5 B;  1N34 B;  4JAA A;  1XNR O;  4L87 A;  1ZX3 A;  5LOV B;  2G38 A;  3ABM C;  3DC6 A;  5IWA O;  4H13 B;  3ABK C;  1PV0 A;  3ZIA G;  3CRQ A;  4X1Y B;  2VQF O;  5BR8 O;  1BHB A;  3CCJ V;  3VQX A;  4JZG A;  4GX2 A;  2HJF C;  3ETQ A;  4TUY A;  3K0D A;  4UB6 Z;  5BR8 B;  4DV6 B;  1VQ7 V;  3JAL B;  2EUL A;  2RMK B;  3L75 H;  2Z5U A;  2GDS A;  2PGG A;  3H1K H;  4LFC B;  2DQ3 A;  2ZE6 A;  4EFE A;  2CE4 A;  4MVZ A;  1ZLZ A;  3AK2 A;  3CS5 A;  3JAK A;  1PNL A;  3W7W A;  1EBO A;  1IVS A;  1X4T A;  4BIU A;  4YHH B;  2LFS A;  4PDM A;  4YJ2 B;  2NR5 A;  3HKD B;  1M57 C;  2WAM A;  4D6T H;  4DR6 O;  2DOS A;  3B8N A;  1AI6 A;  2P06 A;  5L3F A;  1IBL O;  1UPG A;  1MMM A;  2GUZ B;  4QNH B;  2UXX A;  1URF A;  1N33 B;  1SQP H;  3CX5 F;  3OEH G;  2JEX A;  3ZCC A;  1AI5 A;  2ZM6 B;  1HR0 B;  1OCO C;  1WP7 A;  4JI5 B;  3O9O A;  2HP8 A;  3ZX6 A;  5LP6 A;  4O4I A;  5D5Q A;  4PI2 A;  1DTO A;  4CS4 A;  2CTQ A;  1ZAU A;  2ARH A;  3K57 A;  2QA4 V;  1LUV A;  1EFR G;  4FM2 A;  1BQ0 A;  1KP2 A;  1I94 B;  2HKO A;  1K4D C;  1Y74 B;  1H2N A;  2Q6A A;  2OTJ V;  5LGT A;  4NTY A;  1MSW D;  2A06 H;  2F4V B;  1YJW V;  4K3A A;  2R9I A;  1GN6 A;  1N0N A;  2IJK A;  1SQG A;  2X6C A;  5BXZ A;  4LFC O;  4DR2 O;  5H6Q A;  3K5L A;  4ASU G;  2P6J A;  3DXR A;  1Z5W A;  3KZI Z;  3OFN G;  2H8P C;  3A2F A;  4HBN A;  4H44 B;  3MD0 A;  5CA0 A;  4O2A A;  1EZV H;  2UUC B;  4LF9 B;  5DN6 G;  2BTQ B;  2FML A;  2HLD G;  1GH6 A;  5CBG A;  3BVO A;  3B8M A;  3T1H O;  4UCV A;  5E79 Z;  3P3P A;  4MVQ A;  2ATK C;  4F6R B;  4DV2 B;  4DXW A;  1FXK A;  3ML0 A;  2E74 B;  4FIP C;  1VQO V;  3U10 A;  2AZ2 A;  1XHZ A;  3T1H B;  2Q73 A;  3SYC A;  1EM1 A;  3BPZ A;  2HHH B;  2OT5 A;  4TV8 B;  4HNA A;  2Q68 A;  3ETD A;  2Q69 A;  3ASO C;  2IU0 A;  1HDJ A;  5B3S B;  2QEX V;  2FL4 A;  3CJH B;  1VQ9 V;  5KX5 A;  4MVU A;  4J11 A;  2PZS A;  1XQ8 A;  3OD4 A;  2GTA A;  2WLI B;  2MW2 B;  3E8G A;  3T2M A;  1NBM G;  1Q8I A;  4OGQ B;  2LJ2 A;  1D5A A;  4IT5 A;  3TXS A;  3WB2 A;  2X6A A;  5B3S C;  2ZNI A;  2B5U A;  5LMU O;  4TQD A;  4BIO A;  2XAJ A;  4FLV A;  3CRC A;  3JAS B;  2EIJ B;  3H01 A;  1JCH A;  5JQG A;  1W2B U;  1WB7 A;  3ZBH A;  2YS8 A;  3J81 N;  4MVM A;  4FVM A;  3OMA B;  5DEC A;  3CCS V;  1YTF B;  4IGG A;  1OV9 A;  1NZ6 A;  2RCV A;  5GON B;  3SPH A;  2EIK C;  3H1I H;  1XNR B;  3WB0 A;  1IZ3 A;  4R6Z A;  1AP5 A;  2OCC C;  1AJQ A;  4E2L A;  3OT7 A;  3SJQ C;  1VF6 A;  3P3N A;  2W0X A;  2WPD G;  3BHP A;  4IYI A;  1R1B A;  5KA6 A;  4X62 B;  1ZUQ A;  1ZWI C;  4UVA A;  1Q90 D;  1Y67 A;  3OE7 G;  5LA6 A;  1QNM A;  1KQS U;  5J2U A;  1R6K A;  2RQ6 A;  1Q82 W;  3WB1 A;  4DR7 O;  3LSU A;  4J7K A;  1K97 A;  1ORQ C;  4FJC C;  1ENV A;  4QGP A;  4F6R A;  2Q5Z A;  2X6B A;  3W7S A;  2PY5 A;  2Y4T A;  1IUR A;  5IJ9 B;  5KHI A;  1U97 A;  4DR1 B;  4UUJ C;  4LF7 B;  1EN4 A;  5IE9 A;  1X59 A;  5ITZ B;  1CP9 A;  4LC1 A;  1I08 A;  1P7B A;  3RYH A;  3GWO A;  1BZK A;  4FLZ A;  3HB3 B;  3M7M X;  4RAI A;  4DK1 A;  3R66 A;  1Q7Y W;  2EZO A;  2B1G A;  3W7U A;  2YIC A;  2F4V O;  3SYA A;  5L3C A;  1GAX A;  2OYQ A;  4OPH A;  3IC7 A;  4J7J A;  5H9C A;  5B1B B;  4JI1 B;  2YXH A;  1I94 O;  2BE3 A;  1SER A;  2Y4U A;  4QJF B;  3AK1 A;  3RVY A;  4GKK O;  4MT8 A;  4O4L A;  1QVG U;  3EFF K;  4LF8 B;  5IYD O;  1I5X A;  2CTW A;  1OCZ C;  2QWN B;  4I55 B;  4PA9 A;  3UO3 A;  4CS2 A;  3I55 V;  1JMK C;  4X20 B;  3CCR V;  2VWK A;  4YHH O;  1OCZ B;  1SS3 A;  1YEW A;  1EN5 A;  5FPR A;  5BZB A;  1MNG A;  4JI7 B;  2EIM C;  2L35 A;  4JI4 O;  1IBK O;  2EBO A;  3JAR B;  5B1A B;  5IY5 C;  3ZHR A;  4JI5 O;  2N74 A;  2PI5 A;  1TVK A;  1NU1 H;  5LXT A;  2ZIO A;  3JD2 A;  5B5E Z;  4WFF A;  4QPJ A;  4K0K B;  5JJJ B;  1K92 A;  1IBL B;  2QM7 A;  1PD3 A;  4PDV A;  1XMO O;  2E3C A;  4X1I B;  4O4H A;  5JJN B;  4RUF A;  4X8A A;  5KHH A;  3U0Z A;  3SYP A;  1OJH A;  2BTQ A;  1S76 D;  2ETN A;  5CBF A;  3ZN1 A;  4B3S B;  1YDX A;  2YI9 A;  5CA1 A;  3GWK C;  1J95 A;  2RDC A;  2QSA A;  3M99 B;  4DV1 B;  1SQX H;  3B09 A;  2WA4 A;  3RYC A;  5EBW C;  1F7Y A;  3X2Q B;  1Y66 A;  3RYI A;  2W0F C;  3L74 H;  4UVC A;  4TV9 A;  1Q6H A;  1K5Q A;  1MZF A;  2UUA O;  2XOK G;  1F4M A;  5KAF Z;  4FFB A;  1H38 A;  5EZY B;  1V55 B;  2XAH A;  3B4S A;  1SZT A;  1FPO A;  5L3B A;  5A9G A;  4GX5 A;  1QVF U;  4DR5 O;  1MZE A;  4CH5 A;  2UXC O;  2YEV A;  1H2S B;  4I9W A;  4QE7 A;  4DR3 O;  4FK5 C;  1QLN A;  3ZRW B;  1W0K G;  3CXC U;  2PI4 A;  1DLB A;  1XMQ O;  4WCE V;  2FB5 A;  3E22 A;  5LA6 B;  1K34 A;  3CRA A;  4JI3 B;  1COW G;  1XOU A;  4MW8 A;  3BA8 A;  1P49 A;  1NTK H;  1P7G A;  4JYA B;  2KG7 A;  3QTC A;  2LQT A;  4DV1 O;  4KP4 A;  1TVK B;  5LXT B;  4LFB B;  4XBF A;  3CE2 A;  4NXN B;  2ZDI A;  1HP8 A;  4YIP A;  2EX3 A;  1UFI A;  4J41 A;  4N21 A;  5JH7 A;  3E83 A;  1WB8 A;  1FXV A;  5J2T B;  4X64 O;  3OGI B;  4IHJ A;  3A0R A;  1L0N H;  4X66 B;  2UXB B;  2VQF B;  1YHQ V;  3EVK A;  2BCC H;  3FAV B;  1N0J A;  1AI4 A;  3ZHT A;  3AG4 B;  2XAQ A;  3E89 A;  4NTW A;  4DV7 O;  3ZRV A;  3SPG A;  1KKC A;  1Q86 W;  3W7T A;  1MAB G;  5EBM C;  4FZ1 A;  4RO2 A;  3FB7 C;  3H1J H;  1OCR B;  1GM7 A;  1FXK C;  1BS3 A;  5GTH Z;  3SJB C;  2JVD A;  1XL6 A;  3NXS A;  5KX5 B;  2RNB A;  3EXA A;  4DR1 O;  1FFT B;  4TQF A;  3RT3 C;  3HKE A;  3P30 A;  2ZIN A;  2ILM A;  4LWS A;  2QM8 A;  4ZBM A;  2CK3 G;  4TSF G;  3SPJ A;  2Q9L A;  3HR0 A;  4BR6 A;  1L8D A;  2N04 A;  5JWP A;  2JJ2 G;  4WFE A;  2B1I A;  3CC7 V;  4UVB A;  4JI2 B;  2JK5 C;  2YI8 A;  3ASN B;  4J7Z A;  2Y0P A;  4LH7 A;  1ROP A;  3BCC H;  4GKJ B;  1YZB A;  1RFY A;  1NH2 B;  5EYP A;  2ZT9 B;  2GV9 A;  4DR7 B;  1OCC B;  1XBL A;  4C7U A;  3L70 H;  4X20 A;  3CMA V;  2YSU B;  1FFX A;  3MDS A;  1ZTE A;  2DYS B;  2ZXW C;  4L8J A;  4PA6 A;  1AJN A;  3DGE A;  1YJ9 V;  4UCU A;  4X89 A;  3STZ C;  1VQ4 V;  4FLW A;  4K35 A;  1MSD A;  1QU7 A;  4Q6G A;  4BAY A;  3ZN0 A;  2LW7 A;  2HR3 A;  2QWP B;  3NR7 A;  3ICX A;  4K8X A;  2UU9 B;  2QKA A;  4OX9 B;  3L72 H;  4JI8 O;  2R72 A;  4LFA B;  4ZI7 B;  2EIN B;  4ZI7 A;  5IYZ B;  5IYZ A;  3ZHQ A;  2EIL B;  3HKD A;  2OCC B;  2CH7 B;  1BL8 A;  4RQE A;  1CEZ A;  2UUB B;  3LSS A;  3SGI A;  1Y4M A;  3OGC C;  3B2E E;  2JS5 A;  3T4D A;  1DF4 A;  4AHC A;  4GX0 A;  1XMQ B;  3IC9 A;  3Q4H B;  1V9P A;  3CYO A;  5B66 Z;  4IL6 Z;  4PDL A;  5E1A C;  1SZX A;  4FPP A;  3TJT A;  3ASO B;  2YEV B;  2QJ1 A;  4MS2 A;  2LP7 A;  4DV6 O;  4P9O A;  3A0B Z;  3ABL C;  1FYJ A;  1JPX A;  4RQF A;  4JV5 O;  2AHZ A;  1KUQ A;  2BSK B;  1XIL A;  4AQY O;  1VF7 A;  3CWB H;  3T1Y O;  1BT8 A;  2Q0O C;  4JYY A;  3UT5 B;  2ADP A;  1GN2 A;  5C93 A;  5CMU A;  1XDC A;  3K5O A;  2YC0 A;  1R3L C;  1WPB A;  3CXH F;  3K79 A;  1CXZ B;  3N2G B;  3T1C A;  2OCH A;  4MTG A;  1L0L H;  4NXM O;  2DE0 X;  2GHY A;  4CH3 A;  1AP6 A;  1IBM B;  3G4S V;  1H2M A;  1K7D A;  1WJZ A;  5D5P A;  2UUB O;  2NLJ C;  5EZY A;  2CTR A;  4KHP B;  4I5S A;  1AI7 A;  2N05 A;  3CD6 V;  2F23 A;  1WA8 A;  1GMG A;  1QLE C;  2IH3 C;  2JS3 A;  3RBZ A;  1OCR C;  2W6I G;  3CCE V;  2FKX A;  2ADQ B;  3B77 A;  1BQZ A;  5LMN B;  5FPO A;  2ZR3 A;  1WNS A;  1G4Y B;  2QKS A;  3AG7 A;  3ZHU A;  5EYP B;  2JDI G;  1QR8 A;  4DW1 A;  1VQ6 V;  4NTX A;  4FLY A;  4DR5 B;  1JQ0 A;  3DSQ A;  4H37 A;  4I4T B;  1FJG B;  1QCE A;  2XAG A;  4I0X B;  3TCU A;  1Z5V A;  4UB8 Z;  2KG7 B;  3O65 A;  1Y6X A;  3ABM B;  4DR2 B;  2QR4 A;  4N23 A;  5KAI Z;  2QWR B;  1S72 V;  4WFB V;  4LNU B;  5LGN A;  5CB4 A;  3APQ A;  5LHH A;  2ZE5 A;  1BGY H;  2JEU A;  1FAF A;  5BMV B;  2HEP A;  4DUY O;  4Z2W A;  2HVJ C;  1FXK B;  5IY5 B;  4KFM A;  4WFG A;  3HKB B;  1BCC H;  4EKW A;  5KHK A;  1Q6U A;  4JTC B;  4TV8 A;  2L6L A;  4DR4 O;  3K58 A;  1KYO F;  1DK1 A;  2YIA A;  2UXB O;  1M9N A;  2ZDI C;  3AG1 B;  3CJH A;  1E1R G;  4LCU C;  3FYI B;  2LGQ A;  4LF6 B;  3QG5 A;  3RGB A;  3LDE A;  1R73 A;  2UXD B;  4A5U B;  1NJI W;  4R7C A;  5BMV A;  1M56 C;  1V54 B;  2CUG A;  3ZHV A;  2DYR C;  3KCY A;  1D2D A;  1JJ2 U;  3LDD A;  5AG2 A;  1PP9 H;  5EK0 A;  3G71 V;  4BIZ A;  4CC5 A;  4NXM B;  5HFM A;  3UT5 A;  3JAR A;  5K1P A;  4DV5 O;  1JOY A;  2WLN A;  5DM6 V;  1F51 A;  2ZXW B;  3JSL A;  4DW0 A;  1ZSP A;  4JZ2 A;  4FFB B;  5LP6 B;  1PKX A;  2GBO A;  4MSW C;  3PJS K;  5L3E A;  4O4H B; 
#chains in the Genus database with same CATH homology
 4X8A A;  1M1K W;  3SYP A;  4P30 A;  3ZMU A;  5J9P C;  3X2Q C;  3WG7 B;  1S76 D;  1WPX A;  5EC1 C;  5IYC O;  5CBF A;  1GKF A;  3ZN1 A;  1YJN V;  1I5Y A;  1J95 A;  2EIJ C;  1XL4 A;  4UV9 A;  3M99 B;  5CN0 A;  1RPO A;  3FYE B;  5IDJ A;  3F5W C;  1B6Q A;  4YXW G;  5EBW C;  5LGU A;  3X2Q B;  1Y66 A;  2W0F C;  3SYQ A;  1H8E G;  4JGS A;  4UVC A;  4JYB A;  1S77 D;  2DW4 A;  1K5Q A;  1R3K C;  2D3O W;  1YIT V;  2XOK G;  1F4M A;  3AG3 C;  1H38 A;  1CPY A;  2WLL A;  1F23 A;  3SPC A;  1V55 B;  2WLM A;  2XAH A;  1YIJ V;  2V7Q G;  2HFE C;  1SZT A;  5EC2 C;  3ZMS A;  3CP1 A;  2GSM B;  3ABL B;  3D36 A;  5H6R A;  4J9Y B;  1F4N A;  1R3J C;  5L3B A;  1PNK A;  3AG3 B;  3F7Y C;  2KB1 A;  3R65 A;  2IJJ A;  4GX5 A;  1QVF U;  1QBZ A;  4X88 A;  2HVK C;  1DF5 A;  2R9R B;  3ETG A;  3OMN B;  3ZRX A;  1M90 W;  2YEV A;  3QO5 A;  1BMF G;  1MOF A;  5FL7 G;  4I9W A;  4WFA V;  4QE7 A;  4FK5 C;  1QLN A;  2BOB C;  3ZRW B;  3ZRW A;  1W0K G;  5KUK A;  3CXC U;  2PI4 A;  1DLB A;  1NR1 A;  2HG5 C;  3AG4 C;  3JCZ A;  4KUM A;  4WCE V;  2K1E A;  1K34 A;  4J9Z B;  1COW G;  4MW8 A;  4MVS A;  3RVZ A;  1VQP V;  3LUT B;  2EIK B;  3G6E V;  3K3W A;  1JVM A;  4GT1 A;  3QO8 A;  1R3I C;  1HWY A;  4KP4 A;  1N8R W;  4L87 A;  4XBF A;  3ABM C;  4H33 A;  3ABK C;  2WLH A;  2ZDI A;  5GW7 A;  3TK1 A;  3ZIA G;  3W7X A;  4MW3 A;  3ETE A;  1K3E A;  4N21 A;  1MG1 A;  3CCM V;  3E83 A;  1BHB A;  1FXV A;  3CCJ V;  5LHG A;  4GX2 A;  2HJF C;  2Y69 C;  3A0R A;  1JX9 A;  3K0D A;  2IW5 A;  2M7W A;  1VQ7 V;  1YHQ V;  3E8H A;  4HAM A;  3ABT A;  4GX1 A;  1TUE B;  3IFX A;  1AI4 A;  2Z5U A;  4UV8 A;  1H2G A;  3AG4 B;  4JAV A;  4PDR A;  2XAQ A;  3E89 A;  3I56 V;  4DO2 A;  2DQ3 A;  4MVZ A;  3ZRV A;  3SPG A;  3AG1 C;  1Q86 W;  1PNL A;  3W7W A;  1EBO A;  4JTD B;  3W7T A;  4G28 B;  1MAB G;  4BIU A;  5EBM C;  2LFS A;  4PDM A;  4RO2 A;  4WFH A;  3FB7 C;  4TT3 G;  1M57 C;  1OCR B;  1GM7 A;  2WAM A;  1RM1 B;  4XDK A;  1FXK C;  3ABU A;  3CC4 V;  3CCL V;  3B8N A;  1AI6 A;  3AG2 C;  5L3F A;  3OR6 C;  4QNH B;  1XL6 A;  3NXS A;  2UXX A;  2LFR A;  1FFT B;  3OEH G;  2JEX A;  3F7V C;  3WFV A;  3ZCC A;  1AI5 A;  3K08 A;  1P4R A;  2DQ0 A;  1OCO C;  2WLJ A;  1WLE A;  2ITD C;  2C2A A;  2P90 A;  3P30 A;  1Q81 W;  2JIZ G;  3E35 A;  5EBL C;  2QM8 A;  1DTO A;  4ZBM A;  2CK3 G;  3E8F A;  2QA4 V;  4TSF G;  1W0J G;  2WLL B;  2AHY A;  1EFR G;  3SPJ A;  3FKS G;  1OCO B;  3JD0 A;  1KP2 A;  4LBE C;  4LP8 A;  4PA3 A;  4CZZ A;  2JJ2 G;  4WFE A;  4QIW F;  2B1I A;  2HKO A;  2IJI A;  4UVB A;  3CC7 V;  1K4D C;  2JK5 C;  1VQ5 V;  2OTJ V;  2Q6A A;  4MVR A;  3ASN B;  3OUF A;  5LGT A;  2P67 A;  1KC8 W;  1MSW D;  4PEL A;  1NH2 D;  4HZ3 A;  1NQT A;  3ZMT A;  1YJW V;  1SES A;  4P9P A;  1ROP A;  1K4C C;  2EIM B;  4R8C A;  3SPI A;  1NH2 B;  2R9I A;  1NKD A;  3VBB A;  3FB8 C;  1ARO P;  2IJK A;  4JAU A;  2X6C A;  1K5S A;  1V54 C;  1OCC B;  5H6Q A;  5IYB O;  3QO7 A;  4ASU G;  1BHA A;  3CMA V;  2YSU B;  2P6J A;  1NVP B;  2EJR A;  1SRY A;  2DYS B;  2ZXW C;  3OFN G;  2H8P C;  2XND G;  3HPL C;  4PA6 A;  1AJN A;  3DGE A;  2A0L A;  1FXH A;  1YJ9 V;  5B1O A;  3MD0 A;  4Z1M G;  4X89 A;  3STZ C;  1VQ4 V;  2F43 G;  1KP3 A;  4PA7 A;  5DN6 G;  1VQK V;  4BAY A;  3ZN0 A;  2HLD G;  2HR3 A;  4GCZ A;  5CBG A;  3B8M A;  1V55 C;  3FB6 C;  2XAS A;  1VQM V;  4MVQ A;  2ATK C;  3OW2 U;  3STL C;  2ITC C;  1NVP D;  4DXW A;  1FXK A;  3ML0 A;  4JPR A;  4FIP C;  1VQO V;  2DYR B;  4RUE A;  3IGA C;  5KUM A;  2H94 A;  2EIN B;  3CME V;  2WLK A;  3SYC A;  2EIL B;  4U7N A;  1GTO A;  2P7T C;  2OCC B;  1QR9 A;  2OT5 A;  1BL8 A;  1THZ A;  4RQE A;  1CEZ A;  1FS0 G;  2Q68 A;  3LSS A;  3ETD A;  2Q69 A;  3ASO C;  2IU0 A;  3T4Z A;  5B3S B;  2QEX V;  2EIN C;  1OZ0 A;  1VQ9 V;  3MHH C;  2X7R B;  4MVU A;  1Y4M A;  3AEI A;  3OGC C;  4QE9 A;  3T4D A;  1DF4 A;  1S3J A;  4GX0 A;  3CYO A;  2WLI B;  4PDL A;  3E8G A;  3P32 A;  5E1A C;  4FPP A;  2QE7 G;  2X0L A;  3T2M A;  1NBM G;  3ASO B;  2YEV B;  5LHI A;  1K9M W;  2X6A A;  4MS2 A;  5B3S C;  2B5U A;  1G8M A;  2IH1 C;  2LP7 A;  3WG7 C;  1VQN V;  3K9A A;  4P9O A;  2Q67 A;  2UXN A;  2XAJ A;  3ABL C;  2EIJ B;  3H01 A;  1JCH A;  4G27 B;  1W2B U;  1NR7 A;  1AJP A;  1JPX A;  1PL0 A;  4MSW C;  4RQF A;  3GB7 C;  2AHZ A;  3ZMV A;  1K8A W;  2ZD9 A;  4MVM A;  3OMA B;  3BY6 A;  1L1F A;  3CCS V;  2DWE C;  1YTF B;  2JJ1 G;  3FB5 C;  1RPR A;  5B1N A;  5C93 A;  5CMU A;  3SPH A;  2EIK C;  1E79 G;  1R3L C;  5L3D A;  3K79 A;  4Q20 A;  4JTA B;  5LBQ A;  1PNM A;  4R6Z A;  3T1C A;  2OCC C;  1AJQ A;  4E2L A;  5L3G A;  2EZP A;  4MTG A;  3ZJZ A;  3SJQ C;  3MHS C;  2WPD G;  2Y48 A;  2GHY A;  3TET A;  1R6N A;  5KA6 A;  1ZWI C;  4UVA A;  5CBH A;  3OE7 G;  3EHB B;  3G4S V;  4P2Z A;  1KQS U;  1R6K A;  1K7D A;  1KEC A;  2NLJ C;  1Q82 W;  1YTF D;  1OHH G;  3SYO A;  1S5H C;  4I5S A;  1AI7 A;  3CCV V;  1K97 A;  1E1Q G;  3CD6 V;  1ORQ C;  3ABK B;  4FJC C;  1ENV A;  1GMG A;  1QLE C;  2IH3 C;  3CCU V;  3RBZ A;  2QTO A;  2X6B A;  3W7S A;  3K0G A;  1M57 B;  1OCR C;  2W6I G;  3CCE V;  3B77 A;  3K03 A;  2NNU A;  2ZR3 A;  1G4Y B;  2QKS A;  3QNE A;  3OM3 B;  4CBC A;  2IJH A;  1VQ8 V;  4R50 A;  2JDI G;  1QR8 A;  1VQ6 V;  4UUJ C;  3UM7 A;  5KA5 A;  4JYC A;  4WF9 V;  1IXM A;  4MTO A;  1JQ0 A;  4H37 A;  1QCE A;  2XAG A;  3TCU A;  2A79 B;  1CP9 A;  1UJW B;  3ABM B;  4LC1 A;  4N23 A;  1P7B A;  3CC2 V;  3GWO A;  1S72 V;  1GK9 A;  3HB3 B;  5HFL A;  4WFB V;  4RAI A;  1RM1 C;  5LGN A;  1S0V A;  1EZJ A;  1Q7Y W;  5LHH A;  1GM8 A;  2EZO A;  1KKD A;  3RW0 A;  2JEU A;  5B1B C;  2WWW A;  3LDC A;  3K04 A;  3LNM B;  3OR7 C;  4JF3 A;  2DWD C;  2Y69 B;  2B1G A;  3JYC A;  3LSQ A;  1SET A;  4U7O A;  2HVJ C;  3K06 A;  1FXK B;  3D3I A;  5IY5 B;  1LNQ A;  3BEH A;  4KFM A;  3W7U A;  3JD4 A;  4WFG A;  3E8B A;  4MVO A;  3AG2 B;  2Z3Y A;  3SYA A;  4EKW A;  2BOC C;  5L3C A;  1KD1 W;  3ZRS A;  4JTC B;  4UXN A;  3IC7 A;  5H9C A;  5B1B B;  3ZMZ A;  1QLE B;  3JD1 A;  4JAS A;  3VOU A;  4OXS A;  1SER A;  1OCC C;  2A9H A;  3RVY A;  4QJF B;  1YI2 V;  4MTF A;  4ZKI A;  4MT8 A;  1M9N A;  2ZDI C;  1VQL V;  1QVG U;  3EFF K;  3AG1 B;  1E1R G;  4LCU C;  3FYI B;  2WLI A;  1M56 B;  5IYD O;  4XDL A;  1I5X A;  3LDE A;  4QPK A;  1R73 A;  4TWK A;  3DTU B;  3OUS A;  1OCZ C;  1H8H G;  4FMT A;  2ZR2 A;  4PA9 A;  2FTK A;  3I55 V;  2V1D A;  1NJI W;  3CPW U;  4R7C A;  4XDJ A;  3CCR V;  1M56 C;  1AR1 B;  2XAF A;  3ASN C;  2WSS G;  3OMI B;  3UKM A;  4BW5 A;  3E2E A;  1V54 B;  1OCZ B;  2IU3 A;  5BZB A;  1YSC A;  2MK3 A;  3E86 A;  2DYR C;  4G2K A;  4MTX A;  2EIM C;  2DYS C;  3LDD A;  1JJ2 U;  3JD3 A;  5EK0 A;  3G71 V;  4BIZ A;  5HFM A;  3KG2 A;  2EIL C;  2EBO A;  3CCQ V;  1JOY A;  5B1A B;  2WLN A;  5IY5 C;  1K33 A;  5DM6 V;  1GM9 A;  4HYO A;  1F51 A;  2W6J G;  2PI5 A;  4PA4 A;  2ZXW B;  3JD2 A;  1GO3 F;  5CA3 A;  4WFF A;  4QPJ A;  1K92 A;  1PKX A;  5B1A C;  2QM7 A;  1K73 W;  1PD3 A;  2ZQM A;  4PDV A;  2OTL V;  3OAA G;  3OEE G;  3PJS K;  5L3E A;  4RUF A;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...