2Q68A

Crystal structure of nak channel d66a, s70e double mutants
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGAGNFEPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q68A00
4MS2A 3E8BA 1XL6A 2HJFC 2WLIA 2ATKC 2A0LA 2BOBC 3OGCC 4MVSA 2HVJC 4QE9A 2DWEC 4GX2A 4RUFA 3OR7C 4XDJA 3RVYA 3FB7C 4PDMA 2EIJC 2HFEC 1JVMA 4DXWA 3K08A 2WLKA 1XL4A 4EKWA 2IH3C 4MW3A 4P9OA 3ASNC 3R65A 1J95A 4XDKA 2Q68A 3JYCA 2R9RB 4G28B 4MVQA 1K4CC 3EFFK 1V55C 2A79B 2QKSA 4R50A 1R3IC 3F7VC 4X88A 2WLLA 4MW8A 2NLJC 1M56C 1OCOC 2Q69A 4PA9A 4WFEA 4BW5A 1OCRC 5B3SC 2QTOA 4WFHA 3TCUA 1BL8A 4HZ3A 2BOCC 4PA7A 5B1BC 1R3LC 1S5HC 1V54C 2DYRC 4LBEC 3X2QC 4J9YB 3K0GA 3K06A 2WLJA 3ABKC 3FB8C 4JTAB 1QLEC 4PDVA 4QE7A 3SPJA 2ITDC 3TETA 4PA6A 4RUEA 2Q6AA 1G4YB 3OUSA 5KUMA 3SYPA 3UKMA 2OCCC 2WLNA 4I9WA 1LNQA 4PDRA 4R7CA 5EC1C 3SPIA 3BEHA 5B1AC 3PJSK 3AG4C 3SYCA 4P2ZA 2YEVA 3E89A 4JTDB 4MVOA 5CBFA 3KG2A 4KFMA 3IFXA 2WLMA 4F4LA 3F5WC 4MVZA 2HG5C 5EK0A 3GB7C 1R3JC 3E8FA 4MVUA 3T1CA 2WLIB 4MTGA 3AG1C 4LCUC 4HYOA 4MVRA 5EBMC 1P7BA 3ZJZA 2ZXWC 4GX5A 4PA3A 2EIKC 2IH1C 2Q67A 4H33A 4TWKA 4G27B 3E86A 1K4DC 3T4ZA 2W0FC 3ASOC 4LP8A 1M57C 4PA4A 1ZWIC 4P9PA 2AHZA 5E1AC 3AG2C 4MTOA 2WLLB 3SPCA 4OXSA 2Y69C 3E8HA 1R3KC 3SYAA 4RAIA 4PDLA 1ORQC 2DYSC 3ABLC 3LNMB 3AG3C 2WLHA 5EC2C 3ZRSA 4MSWC 3LDCA 3SPGA 3OR6C 4ZBMA 4MTFA 5IY5C 2JK5C 2DWDC 5EBLC 3RVZA 4UUJC 2K1EA 4H37A 4RO2A 2X6CA 4J9ZB 4R6ZA 3IGAC 2H8PC 3UM7A 2EINC 3HPLC 3LDDA 4GX0A 2AHYA 3SYQA 4QNHB 3T4DA 4GX1A 4XDLA 3T2MA 3VOUA 2P7TC 4WFFA 3OUFA 2KB1A 4MVMA 4P30A 3ABMC 5CBHA 5EBWC 3SPHA 1KKDA 2ZD9A 3SYOA 4WFGA 1OCCC 2ITCC 4X8AA 3RBZA 4CBCA 3K0DA 5CBGA 4JTCB 3K04A 2HVKC 3RW0A 5J9PC 4X89A 3FB5C 4R8CA 3LDEA 3F7YC 2X6AA 3SJQC 3LUTB 2A9HA 2EILC 3FB6C 1OCZC 3STZC 2X6BA 3K03A 5BZBA 3E8GA 3E83A 5KUKA 2EIMC 3STLC 3WG7C
chains in the Genus database with same CATH superfamily
5D5PA 2R9IA 2ATKC 5JH7B 2HVJC 2AGAA 1SERA 4JYAB 1ENVA 4LF6O 4FLUA 4P9OA 3R65A 3ABTA 2FL4A 5LA6B 4DV3O 3JYCA 4JF3A 2A79B 5JJNB 2WLLA 4PA9A 4DYLA 4WFHA 3TCUA 1AJQA 5LP6C 1YZBA 4LF6B 5L3GA 2RN9A 4LBEC 1HNZB 3SJAC 4X1YA 1XNRO 3K79A 3B4SA 1D5AA 3QVNA 1EZVH 1KP3A 3RWRD 4LF5O 5GTHZ 2WLIB 4UFZA 2PGGA 2YIAA 2GBOA 1OZ0A 1XEQA 2Y0IA 4LWSB 5JVDB 4TSFG 3ZHUA 3E22A 4TQFA 3SYAA 2EIJB 2F93B 4X62O 1I08A 2DMXA 2JDIG 4DV0O 1YITV 3PN1A 5C93A 3IGAC 4LC1A 1DTOA 4IYHA 2HEPA 4GX1A 1EZJA 4DV0B 5HFLA 1SQQH 3VOUA 2LFRA 3APOA 1QQCA 1GRJA 3JASA 1L8DA 1FFTB 1ZLZA 4DR5O 1FKAO 3C3TA 3K04A 3H01A 4R8CA 3SJQC 2A9HA 3WFVA 1T5EA 5FNVA 2KKWA 2N05A 2X6BA 1H2LA 1GM9A 4DV5O 3N2KA 3OR7C 3FB7C 2EIKB 2EIJC 4J80A 3CS5A 5LBQA 3TK1A 4TOIA 4G28B 1UFIA 3EFFK 1S5JA 2Y4TA 3P3NA 4R50A 4X88A 3WB2A 1F23A 4WFEA 2QWOB 4PA7A 4B3RB 2M6YA 2QEXV 1P4RA 1M9NA 1GMGA 1DF4A 3HKEA 4O4LA 4H13B 5DM6V 2BTQA 4BIOA 3CCRV 4KHPO 1AILA 3SYPA 1N36B 4UCOA 2WSSG 3C3SA 3D8CA 3OEEG 2UXXA 2PYJA 5CBFA 3L71H 3OW2U 4TUYA 2PZSA 4DV7B 2EIKC 2IU3A 1FYJA 2Q67A 4TWKA 1MG1A 5A9GA 2WA3A 5LOVA 2ARHA 4I0XB 2BCCH 2IJIA 2EIMB 4FVMA 4ZHQA 4OXSA 2Z5UA 3GVMA 1AR1B 1Q86W 4JV5B 3OR6C 4LH7A 2YI8A 1U96A 1HNWB 2Y0PA 3JCUZ 1V55B 4R6ZA 1NVPD 3CYOA 3RGBA 3HPLC 2XAHA 1CEZA 5LMNO 4IGGA 1K92A 4FJCC 1UJWB 3K59A 1R73A 3ETGA 1PNKA 1X4TA 3FAVB 1V54B 4P30A 3SYOA 3ASOB 3ZIAG 2ITCC 2JGDA 2GDSA 1SC5B 4N23A 1MNGA 2XAGA 3FB5C 3LDEA 2VWJA 3LSUA 1WLEA 2P22C 3JD0A 2EIMC 1QR9A 1URFA 4U3FH 3P3PA 2XUMA 4JI6O 1IDSA 4JI0O 3ZHRA 2IH3C 3D36C 5BR8B 2VWKA 1D2DA 1HR0O 1V55C 4C7UA 3AG2B 4LF4B 1MSDA 4W4LA 1WP8A 1SF9A 2VQEO 3P32A 4FFKA 2DN9A 5J2TA 4DR6B 1V54C 3JAWB 3JSLA 4ICGA 3S3WA 4KL1A 2W0XA 2OIEA 4X1IA 4JI7O 1BZKA 2XAFA 3L70H 1P7BA 3OD4A 2P5OA 4B08A 5CA0B 2XASA 2G38A 4FIPC 2P90A 1EN4A 1ZAUA 1YI2V 4LP8A 4CS2A 5C8YB 3OEHG 3I55V 3AG2C 1RFYA 3IJ4A 2YDEA 3W7TA 1GH6A 3SPGA 3NR7A 3T1HO 1MOFA 1L0LH 3ASNB 4X9QA 3ZRVA 3ETEA 4H37A 1VF6C 3WB0A 2H8PC 5DN6G 1XNQB 1MMMA 3OMIB 2AHYA 4J7JA 2Q5ZA 3T1HB 3D3IA 3B8NA 2Q9LA 4WFFA 5KMGA 3OTOO 1NI8A 4WFGA 5H6RA 4GLXA 1XOUA 1DK1A 2CGOA 3CD6V 2OIGA 3EHBB 1NQTA 2F4VO 4EB6B 1XL6A 2HJFC 1TUBB 2ZIMA 2DWEC 1SQXH 2YEVB 2RCVA 5LHIA 4CC5A 1O9GA 3ASNC 2DQ3A 2OWOA 1Q7YW 4MVQA 1IBMO 3UT5B 1NZ6A 2F1MA 5IWAB 3RYCB 4NTYA 4FFBA 2BSKA 3SPJA 2XTAA 1P84F 3TETA 1GN3A 4GYCB 3I56V 4DR7B 2QDOA 4PDRA 3UQ8A 3G71V 1SQPH 1KC8W 2HG5C 2X0LA 3GB7C 5EK0A 1P49A 2Q73A 3ZMZA 4BAYA 4JAVA 4J42A 4WBNA 4O4JB 2UUBO 3UO3A 2B9ZA 2QKAA 1KB9F 2A3QA 3DSQA 1VEWA 4DUYO 3CSXA 2JRIA 4CZZA 4MSWC 3LDCA 2CDYA 1K5QA 5KHGA 3CEIA 2E5LB 3HKCB 4FM0A 4UCSA 4Z2WA 4LNUA 3JAMN 1M56B 5B3SB 1WN7A 1IZ3A 4JI3B 1WA8A 3CE2A 4MT8A 4X20B 2YI9A 4PJ0Z 2HP8A 5L3EA 2QM8A 1VF5B 4GZRB 1F4NA 1QCEA 3L75H 3FB6C 3LSQA 5BZBA 3E8GA 5LHGA 4DV2B 4NXMB 3AG1B 1N34B 2A0LA 3UCSC 4GX2A 3QTCA 5EIBC 3JARA 2LJ2A 2VQFO 3E2EA 2ETNA 4FZ1A 2CTRA 4ABMA 1FJGB 1J95A 1SA0A 3CWBH 2QR4A 2DOSA 2R72A 1NTKH 1YTFD 1M56C 5B3SC 4LFBO 4CH6A 3ABLB 1JCHA 3CCVV 1VF7A 5IDJA 1R3LC 3HKDB 2QKCA 3OMNB 1JA8A 2QGNA 1L1FA 1N32O 1VARA 3UO2A 4O4HA 5E79Z 4I55B 3BEHA 3T1YB 4GKKB 4LFAB 2AZ2A 3BY6A 3E8FA 3AG1C 1XILA 3THOA 4JI1O 3K5MA 5KX5B 1WP7A 2CE4A 5EZYA 2PI4A 4U3JB 4JAAA 2EILB 2Q8VA 4PV1B 4JGSA 1B04A 1BGYH 1XDCA 3SDLA 4P9PA 1CPYA 2YSUB 3WG7B 2WLLB 3CXCU 4YY3B 5JWPA 5CB4A 4JI1B 3U0ZA 4QGPA 4RAIA 3ABLC 1PL4A 3SR2C 1H8EG 3CRMA 1RSOB 2XOKG 3QF7A 2E74B 2XNDG 3CHXA 3VQYA 4J11A 5B1BB 4PD4F 4U7OA 5CBHA 2DYRB 3DC6A 3BA8A 3A0RA 4E2LA 3Q4HA 5KAFZ 2PTMA 3ML0A 2X6AA 2EILC 3JD2A 4YHHB 3RYIA 4B3MO 3WG7C 5LGUA 2L35A 4LF9O 4K3AA 1HNXB 2UXCO 4PDMA 2OT5A 4JI2O 5EYPA 4I4TB 2AW9A 4K8XA 4GKJO 1KP2A 1CXZB 1M57B 1LR1A 1JJ2U 4JI4O 4DUZO 4LF9B 1X59A 1Q5OA 4BW5A 5LL6Y 4JI2B 3NXSA 4PI2A 3G6BA 5L3CA 2XHBA 4DR1B 3AG3B 5B1BC 1N0NA 1R6NA 1S5HC 2DYRC 3ZMUA 1FXKA 4AI8A 4DV4O 3W7WA 4RUEA 1VQ5V 2WPDG 2XT9A 4OX9O 3P30A 2WAMA 4GUNA 2RNBA 3HKBA 4MVOA 2MK3A 3R66A 3TGUH 2LP7A 3TXSA 4DV4B 3N2GA 4JZGA 1H8HG 1SQGA 1YVWA 3H1HH 2UUAO 2F43G 3OFNG 4GT1A 4DV3B 1M57C 4PA4A 4FLWA 4NTXA 2Q0AA 3JCZA 3U10A 1K7DA 4MTOA 2Q0OC 3SPCA 3CRCA 1QBZA 1R3KC 1TA8A 3JAKB 4Q6GA 2UUAB 5L3FA 3AG3C 3ZRSA 4A5UB 3CXHF 3U11A 2XAJA 4XBFA 1O9HA 2DWDC 2F66C 1XNRB 2B1IA 2BE3A 4QJFB 4LF8O 3CRRA 1OCRB 1MZEA 4CH4A 3M8AA 3RN4A 4D7TA 4LF5B 3JATB 5JQGA 4YJ3A 3K57A 4IHJA 3SPHA 1U97A 3ABKB 3VQWA 1Q82W 1HP8A 4UVAA 1IVSA 5LOVB 1ZTEA 3RYFB 1NT2B 3DXRB 3HR0A 1VQMV 1UPGA 1KD1W 1THZA 2ZXWB 5K1PA 4X62B 1TVKB 2KG7A 4MTXA 1K33A 4EKWA 2LW7A 5LP6A 5GONB 1DGSA 4NB5A 4YIOA 3JD1A 4FK5C 2N04A 3J7AU 1GN2A 2R70A 1W0JG 1OCRC 2AZ0A 1JFFA 4Q20A 4FLVA 2ZE6A 1QVGU 5FLXN 4JI8O 3ABKC 4DR5B 1I94O 1G6UA 3QO8A 2IM9A 3WU2Z 4ZI7A 2FB5A 3UKMA 4RWUA 5JH7A 2PY5A 4BIZA 3E89A 4JTDB 2WLMA 4JI8B 3G80A 1XQ8A 4F6EA 4DV5B 1AP5A 4JZ2A 1K73W 4MTGA 3RYHB 5LA6A 1GAXA 2ZXWC 1VQ6V 1Y66A 3ZHQA 1ROPA 1FXVA 4NYKA 3B2EE 2ZR2A 2ZDIA 1M90W 5CA3A 1B6QA 4UCUA 3FKSG 4TV8B 1PD3A 2ODMA 1YF2A 4GCZA 5J2TB 5CA1A 4DRXB 1VQLV 2P4VA 2YXLA 4KHPB 2X6CA 3WB1A 3UM7A 1RPRA 3VBBA 2GV9A 2OTLV 4FM2A 4LWSA 2IJJA 2P7TC 5JVDA 1W2BU 2KB1A 1ZUQA 5IYCO 4X8AA 3ZHVA 5JCOC 4I5SA 5CBGA 4FLXA 5IYZB 3OE7G 3J81N 1PKXA 4AILC 5FPRA 5KAIZ 1YXBA 1NKDA 2CUGA 4RUFA 3RVYA 3H1KH 2C2AA 4UCRA 4J10A 2JJ1G 2PUSA 5IYBO 4NKGB 3G67A 4E4EA 4X66O 2ZT9B 4DR2O 5LMNB 4MW8A 3L73H 3KKYA 2GUZB 3A8TA 5FPOA 1M1KW 2BOCC 3CC4V 3DTUB 4FMTA 1Y4MA 3KCYA 1K8AW 5KMGB 5KHHA 3ICXA 3FX7A 1JR9A 3ZBHA 1G4YB 1E79G 4AQYO 2IU0A 3GWOA 2IW5A 4LFCO 5IE9A 3F5WC 2YIDA 3ABMB 4MVZA 1GM8A 4JI6B 4JI0B 2W6IG 4DR4O 1WPBA 5H5NA 3W7XA 3ASOC 4W4KA 5LYJB 2WA4A 1HR0B 3CC7V 4IIJA 1LUVA 2CAZC 4PI0A 2VQEB 5LXTB 1SETA 2ZE8A 2EZPA 5K1XA 4DR4B 5D5QA 2JJ2G 1JJOA 1FS0G 1PL0A 4ZIBA 4HBNA 5IJ9B 3J80N 4J9ZB 1B3QA 1OCOB 4X1KA 3CCJV 3O65A 2H94A 4DV6O 1BMFG 4QNHB 2ZINA 4JI7B 1AJPA 3ABMC 4UB8Z 1WAZA 1GN6A 3OTFA 4I0XA 4JYBA 4K35A 3ZCCA 2JS5A 2H3OA 1VP7A 3CJHB 3D36A 1Y76A 5EBWC 2XAQA 1VQKV 4XDJA 5H2FZ 1JVMA 2VS0A 4X65O 1NTMH 3H9VA 1XL4A 2JEUA 1NH2B 1K34A 2E76B 3OAAG 3ETQA 1XMOO 1K9MW 1OCOC 4X65B 4HZ3A 4O4IB 3OTOB 4ASUG 4J9YB 2ZCEA 1XMOB 5ITZB 1Y74B 5KUMA 4JI5O 4UV8A 1NBMG 5EC1C 1YJ9V 1FXHA 1COWG 3OMAB 2Q7EA 1S3JA 2UUCO 4KFMA 2F4VB 4CS3A 3AG7A 1OJHA 2E75B 2UUCB 1I5XA 2ILMA 1BCCH 4ZKIA 1IBMB 1VQ8V 3JAWA 3H1JH 4OPAA 4KXRA 1H2SB 3CCLV 3ZX6A 1W59A 4TV9B 3JALB 2QJ1A 2HHHO 1XUQA 2OYQA 4YJ2A 2FMLA 1PV0A 1KECA 5IJ0B 3K5OA 4UUJC 3MD0A 3IC7A 2LFSA 2HHHB 1W0KG 5JJEB 2Z0AA 4MVMA 1J5EO 2JEXA 1Q6IA 2V1DA 2UUBB 4JASA 1AR5A 2DJVA 2UXBO 1M93A 4WF9V 1VQNV 2YXHA 3KCXA 1FAFA 4DUYB 1VMGA 2ZNJA 4CS4A 2CH7B 2Q4PA 1FFXA 4DXWA 2UXBB 2AXTZ 3LSSA 4MW3A 4CH5A 1H2GA 4FLTA 2LGQA 1BE3H 5BMVA 1Q3EA 4HNAB 4TT3G 4QPKA 3SGIA 1Q90D 4UVBA 5H9CA 3K5NA 1S76D 4UCVA 5B1NA 1HWYA 2RDCA 2A06H 3Q4HB 5KUKA 1TUBA 3A0HZ 2YEVA 1SQBH 3ZRWB 1IBLO 4B3SO 1HDJA 1YIJV 4PHZA 4F6RB 5EYPB 4D6TH 2VQFB 4I50B 1NJIW 2ADQB 3RYCA 4B3SB 1SRYA 2AHZA 3FD9A 2CTPA 2QWPB 4LFBB 1P7GA 1ZL8B 4DV1O 1Z5WA 2HKOA 2L6LA 5KA5A 1IX9A 4ZOLA 1N32B 2YS8A 3ZS8C 4X64O 2WWWA 1H2MA 1AI5A 1WJZA 2CGNA 3T4DA 5L3DA 2ZIOA 1S5LZ 3LNNA 3OUFA 3X2QB 3B40A 1N8RW 5BXZA 1EFRG 1AB3A 4DR3O 3K0DA 1IURA 4JPRA 4O2BA 4FLYA 3F7YC 1Q43A 3LUTB 1TUEB 1R1BA 4LF7O 2RQ6A 3K03A 1E1RG 2QWQB 4X1YB 1D5NA 3E8BA 4DO2A 3HKCA 3C90A 3BFRA 3F5TA 4J41A 2R9AA 3OGIB 1YCIA 1SZXA 2ZQMA 2R9RB 4X20A 5B66Z 2BTOA 3F7VC 5EC2C 4JYYA 1N33O 2DYSB 3X2QC 4IHJB 3E22B 2ITDC 2UU9O 4RQFA 1N33B 3BPZA 4FZ0A 4I9WA 4IL6Z 2LW1A 2ZR3A 1OHHG 5FL7G 4B3MB 3L72H 3T1CA 5BY1A 1OCCB 5LHHA 3BA9A 1NR7A 1VQOV 1YJNV 2UXCB 4B7EA 4GKJB 5LGTA 1KQSU 4H33A 4NXNO 1XMQO 4QIWF 5A2QN 4BR6A 4YXWG 4JI4B 1AP6A 1NU1H 3JASB 4DUZB 2DW4A 3ETDA 3HKDA 1PP9H 1XHZA 1V9PA 5H6QA 2IBZH 3OT7A 1WB8A 2DYSC 1ZX3A 5FNVB 1QR8A 4G2KA 4I55A 4MTFA 5B1OA 2JK5C 2O57A 2K1EA 3N2KB 4OX9B 3APQA 3CCUV 3BVOA 4XDLA 5KX5A 3CP1A 4U3JA 1OCCC 4CC6A 1WPXA 1SS3A 1HNZO 1F4MA 2HVKC 1R6KA 2Y4UA 2OCCB 2EX3A 1KU9A 2ZNIA 3MHSC 3STZC 3HKEB 3AK1A 1RSOA 4O4LB 1XHXA 2BTQB 3QO5A 2V7QG 1FPOA 4MS2A 4UVCA 2OCHA 3BRCA 2MW2B 2BOBC 3K9AA 1AI6A 1FD9A 5CA1B 3H1IH 1MA1A 1I5YA 1VQPV 1AJNA 4TUYB 2Y48A 4LF8B 1DLBA 1NVPB 1M4UA 1Q6HA 4NVPA 3AK2A 1IXMA 1H38A 2FYUH 2QM4A 4ZHQB 2HLDG 1H2KA 2QA4V 2Q6AA 3CCQV 4BWAA 4EFBA 2OCCC 5F2VO 1QHTA 5J2UA 3KG2A 4I4TA 2ZDIC 4F4LA 3SJBC 1PM9A 1AI7A 4PA3A 4O2AA 1PNLA 1JQ0A 4DW0A 4QPJA 1OCZB 2JGDB 5DECA 2YIBA 3BHPA 1VQ4V 1XREA 4CH3A 3BAAA 1ORQC 1KKCA 3L74H 1BHBA 4Z1MG 1I94B 4UCTA 4K8ZA 2Z3YA 4RO2A 3GWKC 3QG5A 3QO7A 4EEQA 2NNUA 2YIBD 5JJJB 4B3RO 3CRQA 5KHKA 4L87A 3RBZA 3BABA 4JAUA 2KQXA 4X89A 1LUWA 3JAKA 1N36O 3AG4B 3IAYA 1OCZC 1K5SA 4IIJB 3E83A 3RFRA 3S3XA 2WLIA 1G1XB 3OGCC 1WNSA 2HFEC 4KP4A 5LGNA 3AK3A 3CCSV 4DV7O 4X1IB 3DGEA 2QE7G 3JATA 4XDKA 2YC0A 4NR1A 1BS3A 4UV9A 2NLJC 3D3QA 4X1KB 3TJTA 1SESA 2QTOA 1SQFA 1I0HA 4BW9A 3ABUA 2EBOA 4JV5O 3K06A 3RYFA 5IY5B 4JTAB 3DXRA 4DK0A 1HNWO 5HFMA 4BIUA 5AG2A 4WCEV 2WLNA 1PPJH 3AG4C 1B06A 4KUMA 1TVKA 2E3CA 3G6EV 4RQEA 4EFEA 1MSWD 3B77A 3HB3B 1R3JC 1Y76B 5GONA 3ZJZA 1XBLA 2LQTA 2JGUA 4GX5A 1Q81W 3QNEA 4G27B 2QWNB 2FKXA 2DE0X 2ZM6O 1JOYA 1K3EA 2W6JG 2QSAA 4X66B 4DR2B 1AI4A 1US6A 1GO3F 3B09A 5E1AC 2QM7A 2EZOA 4I9QA 2YICA 4TQDA 2P67A 1RM1B 3FFQA 4PDLA 3IC9A 3LNMB 3K3WA 3CRAA 2Q7HA 2B5UA 4FPPA 2ZM6B 4ZBMA 5IY5C 2YUAA 3MHHC 5KHJA 3VQVA 4AQYB 2JS3A 2UXDO 5BR8O 2PF4E 1JX9A 3RYHA 3LDDA 4GX0A 4LF4O 5JCOA 4LFCB 4L8JA 4NTWA 1BT8A 1L0NH 3T2MA 3ZN1A 2D2CB 4DR6O 3B8MA 1AROP 1S0VA 3A2FA 1N4CA 2UXDB 1QLEB 4CBCA 3K5LA 2JIZG 2GTAA 3RW0A 1BHAA 3K9SA 1GK9A 4FFBB 3SJCC 4TV8A 1EBOA 3OM3B 2BSKB 1CP9A 4DRXA 2RMKB 1BSMA 4MVSA 3BCCH 1RM1C 4YJ2B 2JVDA 3A0BZ 3G4SV 4OGQB 1K4CC 4WBNB 1R3IC 2A7WA 4DV6B 1Q8IA 2LO1A 1BL8A 1IXBA 3EVKA 3CMEV 2GTSA 1RPOA 5IYZA 3K0GA 3FB8C 1QLEC 1VQ9V 5LMUO 3OUSA 4FLZA 5KA6A 2Q7GA 3SYCA 1S72V 1XNQO 3H1LH 1QU7A 3CB2A 1IBKO 2CK3G 2OTJV 3FAVA 4LNUB 4MVUA 5LMUB 1I7FA 4LCUC 5EBMC 4FM1A 2NN4A 1FFXB 1WA8B 2ADPA 2IJKA 2QWRB 2GUZA 4H44B 3T4ZA 1IBKB 2FTKA 5BMVB 2B1GA 2YXYA 1YTFB 2VRZA 3N27A 2K9PA 3W7SA 2WLHA 3CMAV 2EULA 3RVZA 1GKFA 4JI5B 1Y67A 3JARB 3AEIA 1MABG 2HJDA 1AR4A 2F95B 3JD3A 3MAQA 1SA0B 5KLVH 1F7YA 1E1QG 5IWAO 3ZMTA 1VIBA 1EN5A 5LYJA 4I7ZB 1VF6A 5TISZ 4DR7O 5LXTA 3ZMSA 1GN4A 5B1AB 2CTWA 3ZMVA 3ZHSA 1TGOA 4O4HB 2V4DA 5GTIZ 5IJ9A 1G8MA 2D3OW 3O9OA 5CA0A 4ZOLB 1SZTA 1NTZH 4J7ZA 5C8YA 2QKSA 1SQVH 4K0KO 5EZYB 2Y69B 3I5DA 3ZEDA 1J5EB 3W7UA 4YIPA 2WLJA 4PDVA 2E5LO 3CJHA 1NS1A 4PA6A 1ZSPA 2N74A 5CB4B 3CCEV 4K0KB 4B3TO 4O2BB 2KSDA 4R7CA 5KHIA 5B1AC 3K58A 3PJSK 4P2ZA 3M99B 3IFXA 4JYCA 4JI3O 1BQ0A 2DQ0A 4HYOA 4N21A 1PNMA 4B3TB 1EM1A 1NR1A 1QLNA 2IH1C 1HW7A 1GM7A 2P06A 4HAMA 4WFBV 4O4IA 1ZWIC 4UB6Z 1A32A 3KZIZ 3EXAA 4EB6A 3DC5A 4DV2O 4NXMO 2Y69C 3E8HA 5ITZA 1GTOA 1N34O 1Y74A 3M7MX 3VQXA 5B5EZ 3RT3C 1S77D 3RYIB 3FYIB 1NH2D 3ZHTA 1EN6A 1FJGO 1KBHA 1Z5VA 1SKVA 1QNMA 3UT5A 3SYQA 4PELA 1H2NA 2ZE7A 3MDSA 1IBLB 3L9DA 1KKDA 3CX5F 2IJHA 4JTCB 2F23A 1MZFA 5J9PC 2HR3A 1KUQA 4UXNA 4IT5A 2X7RB 4TV9A 1VQ7V 1FXKB 3JALA 3T1YO 4GKKO 3STLC 4LFAO 5IJ0A 4DV1B 1DF5A 4QE9A 2PYLA 4H0LB 2P4KA 2NR5A 3HKBB 2M7WA 4J7KA 4O4JA 1KMIZ 3K08A 5IT9N 2WLKA 2ZE5A 3N2GB 3CCMV 4D7SA 2Q68A 4X64B 4DK1A 2QTSA 2Q69A 3JSNA 2ZKOA 4YY3O 1RP3B 4AHCA 2EJRA 1XI1A 2GSMB 4IYIA 4DR3B 4QE7A 2CTQA 5CMUA 5L3BA 1R6TA 1QVFU 3ZRXA 1JMKC 1Q6UA 2EINB 3SPIA 2CH7A 1LNQA 4Z1VA 4LF7B 1Y6XA 1FXKC 2GHYA 3E35A 3TXQA 1JPXA 4U7NA 1KYOF 3ZN0A 4HNAA 3FYEB 5EIBD 3JD4A 4WFAV 1YJWV 5JQGB 4YJ3B 1YHQV 1BQZA 3E86A 1K4DC 1TAEA 2W0FC 4LH6A 5GW7A 2EJ7A 4B7KA 3CC2V 4YHHO 2P6JA 5DEDA 1AVMA 1Z2GA 1YEWA 1HNXO 1WB7A 1F51A 1K97A 3CPWU 2UU9B 5EBLC 3ZRWA 2EINC 2KG7B 2UXNA 4F6RA 2RJZA 1OV9A 5J2UB 5LP6B 4DR1O 4DW1A 5CN0A 1YDXA 4I50A 2PI5A 2ZD9A 1N0JA 1JFFB 4NXNB 4O2AB 1M5IA 1XMQB 2LGWA 4JYAO 1ZL8A 4LR3A 5IYDO 4OPHA 4MVRA 4ZI7B 1YSCA
chains in the Genus database with same CATH topology
3D36A 2R9IA 2WLIA 2ATKC 2A0LA 3AG1B 3OGCC 5EBWC 2HVJC 2XAQA 4GX2A 4XDJA 1VQKV 1SERA 2HFEC 4KP4A 1JVMA 1ENVA 5LGNA 3CCSV 1XL4A 2JEUA 3E2EA 4P9OA 3R65A 1NH2B 3ABTA 1J95A 2QE7G 3DGEA 1K34A 4XDKA 3OAAG 3JYCA 4JF3A 1K9MW 2A79B 4UV9A 2WLLA 2NLJC 1M56C 1OCOC 4PA9A 5B3SC 1YTFD 1SESA 2QTOA 4WFHA 3TCUA 3ABLB 1AJQA 4HZ3A 1JCHA 3CCVV 5L3GA 5IDJA 1R3LC 4ASUG 3ABUA 2EBOA 4LBEC 4J9YB 3K06A 3OMNB 5IY5B 1L1FA 4JTAB 5KUMA 3K79A 5HFMA 4BIUA 4WCEV 2WLNA 4UV8A 1NBMG 5EC1C 3BEHA 1YJ9V 3AG4C 1FXHA 1COWG 3OMAB 1KP3A 4KUMA 1S3JA 4KFMA 3G6EV 4RQEA 1MSWD 3B77A 3HB3B 1R3JC 3BY6A 3E8FA 2WLIB 3AG1C 3ZJZA 4GX5A 1Q81W 1OZ0A 3QNEA 4G27B 2PI4A 1I5XA 2EILB 4JGSA 1JOYA 1K3EA 2W6JG 4ZKIA 1VQ8V 4P9PA 1AI4A 1CPYA 2YSUB 4TSFG 1GO3F 5E1AC 3WG7B 2QM7A 2WLLB 3CXCU 2EZOA 3CCLV 2P67A 1RM1B 3SYAA 4RAIA 4PDLA 3ABLC 3LNMB 2EIJB 1H8EG 3K3WA 2B5UA 4FPPA 2XOKG 4ZBMA 1KECA 2JDIG 1YITV 5IY5C 3MHHC 5C93A 4UUJC 3MD0A 3IC7A 3IGAC 4LC1A 2LFSA 1JX9A 2XNDG 3LDDA 4GX0A 1DTOA 1W0KG 4GX1A 5B1BB 1EZJA 3T2MA 3ZN1A 4U7OA 5HFLA 3VOUA 5CBHA 2LFRA 4MVMA 2DYRB 3B8MA 1AROP 2JEXA 1S0VA 2V1DA 1QLEB 4CBCA 1FFTB 2JIZG 3A0RA 3K04A 4E2LA 3RW0A 1BHAA 1GK9A 3H01A 4JASA 4R8CA 3ML0A 2X6AA 3SJQC 2A9HA 1EBOA 2EILC 3JD2A 3OM3B 3WFVA 4WF9V 2X6BA 1CP9A 1VQNV 3WG7C 5LGUA 1GM9A 4MVSA 1RM1C 3OR7C 3FB7C 4PDMA 2EIKB 2EIJC 2OT5A 4DXWA 1KP2A 5LBQA 3LSSA 4MW3A 3TK1A 3G4SV 1H2GA 1M57B 1JJ2U 4G28B 4TT3G 1K4CC 4QPKA 3EFFK 4R50A 4X88A 1R3IC 1F23A 4WFEA 4BW5A 4UVBA 3NXSA 5H9CA 1BL8A 5L3CA 3AG3B 3CMEV 4PA7A 5B1BC 1RPOA 2QEXV 1P4RA 1M9NA 1R6NA 1GMGA 1S76D 1S5HC 2DYRC 3ZMUA 3K0GA 1FXKA 3FB8C 1DF4A 1QLEC 3W7WA 1VQ9V 4RUEA 1HWYA 5B1NA 1VQ5V 5DM6V 3CCRV 3OUSA 2WPDG 3SYPA 3P30A 5KA6A 5KUKA 2WSSG 2WAMA 3SYCA 1S72V 3OEEG 2YEVA 2UXXA 4MVOA 2MK3A 5CBFA 2CK3G 2OTJV 2LP7A 3ZRWB 4MVUA 1YIJV 4LCUC 3OW2U 5EBMC 2EIKC 2IU3A 1H8HG 2Q67A 2IJKA 2F43G 3OFNG 4TWKA 4GT1A 1MG1A 3T4ZA 1NJIW 2FTKA 1M57C 4PA4A 1SRYA 2AHZA 2IJIA 2EIMB 3JCZA 2B1GA 1K7DA 4MTOA 3SPCA 1YTFB 4OXSA 2Z5UA 1QBZA 1R3KC 3W7SA 1AR1B 5L3FA 2HKOA 2WLHA 3AG3C 3ZRSA 5KA5A 3CMAV 1Q86W 3OR6C 2XAJA 4XBFA 2DWDC 3RVZA 1GKFA 2B1IA 1V55B 4R6ZA 1NVPD 3CYOA 3AEIA 4QJFB 2WWWA 3HPLC 1MABG 2XAHA 1CEZA 1OCRB 1AI5A 3JD3A 1K92A 4FJCC 3T4DA 1UJWB 1R73A 5L3DA 3ETGA 1PNKA 1E1QG 3OUFA 1V54B 4P30A 3X2QB 3ZMTA 1N8RW 3SPHA 1EFRG 3SYOA 3ASOB 3ABKB 3ZIAG 2ITCC 3K0DA 4N23A 4JPRA 1Q82W 2XAGA 3FB5C 4UVAA 3ZMSA 3LDEA 3F7YC 5B1AB 3LUTB 1TUEB 3ZMVA 3K03A 1WLEA 1E1RG 3JD0A 2EIMC 1VQMV 3E8BA 4DO2A 1QR9A 1KD1W 1G8MA 1THZA 2ZXWB 2D3OW 4MTXA 1K33A 1SZTA 4EKWA 2IH3C 2ZQMA 2R9RB 3JD1A 4FK5C 1V55C 2QKSA 3AG2B 3F7VC 5EC2C 1W0JG 1OCRC 2Y69B 3P32A 2DYSB 4Q20A 1V54C 3X2QC 1QVGU 3W7UA 2WLJA 3ABKC 4PDVA 2ITDC 3CCEV 4PA6A 4RQFA 3QO8A 3UKMA 4I9WA 4R7CA 5B1AC 3PJSK 4BIZA 4P2ZA 3M99B 3E89A 2ZR3A 1OHHG 4JTDB 5FL7G 3IFXA 2WLMA 4JYCA 2DQ0A 2XAFA 3T1CA 1K73W 4MTGA 1OCCB 5LHHA 4HYOA 1NR7A 1PNMA 4N21A 1P7BA 1VQOV 1YJNV 1NR1A 2ZXWC 1QLNA 1VQ6V 1Y66A 2IH1C 5LGTA 2XASA 1KQSU 4H33A 1ROPA 4FIPC 1GM7A 2P90A 1FXVA 4QIWF 4HAMA 4YXWG 4WFBV 1YI2V 4LP8A 2DW4A 1ZWIC 2ZR2A 3ETDA 2ZDIA 1M90W 3OEHG 5CA3A 3I55V 1B6QA 3AG2C 5H6QA 3FKSG 2Y69C 3E8HA 1GTOA 3W7TA 2DYSC 1PD3A 4GCZA 1QR8A 4G2KA 3SPGA 1S77D 3FYIB 1MOFA 4MTFA 5B1OA 1VQLV 3ASNB 1NH2D 2JK5C 3ZRVA 2K1EA 3ETEA 4H37A 2X6CA 2H8PC 5DN6G 3UM7A 1RPRA 3CCUV 3OMIB 2AHYA 3VBBA 2OTLV 3SYQA 4PELA 4XDLA 3CP1A 3D3IA 3B8NA 2IJJA 2P7TC 4WFFA 1W2BU 2KB1A 1KKDA 5IYCO 4WFGA 1OCCC 4X8AA 2IJHA 4I5SA 5CBGA 4JTCB 1WPXA 5H6RA 1F4MA 2HVKC 5J9PC 1R6KA 2HR3A 2OCCB 4UXNA 3OE7G 1PKXA 2X7RB 1VQ7V 1FXKB 3MHSC 3STZC 1NKDA 3CD6V 3EHBB 3STLC 3QO5A 1NQTA 2V7QG 4MS2A 4UVCA 1XL6A 2HJFC 1DF5A 4QE9A 2BOBC 3K9AA 4RUFA 2DWEC 3RVYA 2YEVB 1AI6A 2M7WA 5LHIA 2C2AA 3K08A 2WLKA 1I5YA 2JJ1G 3ASNC 2DQ3A 1VQPV 1AJNA 3CCMV 2Q68A 2Y48A 5IYBO 1Q7YW 4MVQA 1DLBA 1NVPB 4MW8A 2Q69A 1M1KW 1IXMA 1H38A 2BOCC 3CC4V 3DTUB 2EJRA 4FMTA 1Y4MA 1K8AW 2GSMB 3SPJA 4QE7A 2HLDG 5CMUA 3TETA 2QA4V 5L3BA 3I56V 2Q6AA 1G4YB 1E79G 3ZRXA 1QVFU 2IU0A 3CCQV 2EINB 2OCCC 3SPIA 1LNQA 3GWOA 4PDRA 3G71V 1KC8W 1FXKC 3KG2A 2GHYA 2IW5A 3E35A 1JPXA 2ZDIC 4F4LA 4U7NA 3F5WC 3ABMB 2HG5C 2X0LA 3GB7C 4MVZA 5EK0A 3ZMZA 3ZN0A 4BAYA 1GM8A 1AI7A 4JAVA 4PA3A 3FYEB 2W6IG 3JD4A 4WFAV 1YJWV 1YHQV 3E86A 1K4DC 1PNLA 1JQ0A 2W0FC 4QPJA 1OCZB 3ASOC 3W7XA 5GW7A 3CC7V 3CC2V 1VQ4V 2P6JA 1SETA 2EZPA 1ORQC 4CZZA 4MSWC 3LDCA 2JJ2G 1K5QA 1BHBA 1F51A 4Z1MG 1FS0G 1K97A 3CPWU 1PL0A 5EBLC 2Z3YA 4RO2A 4J9ZB 3ZRWA 1M56B 1OCOB 2EINC 5B3SB 3QO7A 2UXNA 2NNUA 3CCJV 2H94A 1BMFG 4QNHB 4MT8A 1AJPA 5CN0A 3ABMC 2PI5A 2ZD9A 4L87A 3RBZA 4JAUA 5L3EA 2QM8A 4JYBA 4X89A 3ZCCA 1F4NA 1QCEA 3AG4B 3FB6C 1OCZC 3LSQA 5IYDO 1K5SA 5BZBA 3E8GA 3E83A 4MVRA 5LHGA 1YSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MS2 A;  3E8B A;  1XL6 A;  2HJF C;  2WLI A;  2ATK C;  2A0L A;  2BOB C;  3OGC C;  4MVS A;  2HVJ C;  4QE9 A;  2DWE C;  4GX2 A;  4RUF A;  3OR7 C;  4XDJ A;  3RVY A;  3FB7 C;  4PDM A;  2EIJ C;  2HFE C;  1JVM A;  4DXW A;  3K08 A;  2WLK A;  1XL4 A;  4EKW A;  2IH3 C;  4MW3 A;  4P9O A;  3ASN C;  3R65 A;  1J95 A;  4XDK A;  2Q68 A;  3JYC A;  2R9R B;  4G28 B;  4MVQ A;  1K4C C;  3EFF K;  1V55 C;  2A79 B;  2QKS A;  4R50 A;  1R3I C;  3F7V C;  4X88 A;  2WLL A;  4MW8 A;  2NLJ C;  1M56 C;  1OCO C;  2Q69 A;  4PA9 A;  4WFE A;  4BW5 A;  1OCR C;  5B3S C;  2QTO A;  4WFH A;  3TCU A;  1BL8 A;  4HZ3 A;  2BOC C;  4PA7 A;  5B1B C;  1R3L C;  1S5H C;  1V54 C;  2DYR C;  4LBE C;  3X2Q C;  4J9Y B;  3K0G A;  3K06 A;  2WLJ A;  3ABK C;  3FB8 C;  4JTA B;  1QLE C;  4PDV A;  4QE7 A;  3SPJ A;  2ITD C;  3TET A;  4PA6 A;  4RUE A;  2Q6A A;  1G4Y B;  3OUS A;  5KUM A;  3SYP A;  3UKM A;  2OCC C;  2WLN A;  4I9W A;  1LNQ A;  4PDR A;  4R7C A;  5EC1 C;  3SPI A;  3BEH A;  5B1A C;  3PJS K;  3AG4 C;  3SYC A;  4P2Z A;  2YEV A;  3E89 A;  4JTD B;  4MVO A;  5CBF A;  3KG2 A;  4KFM A;  3IFX A;  2WLM A;  4F4L A;  3F5W C;  4MVZ A;  2HG5 C;  5EK0 A;  3GB7 C;  1R3J C;  3E8F A;  4MVU A;  3T1C A;  2WLI B;  4MTG A;  3AG1 C;  4LCU C;  4HYO A;  4MVR A;  5EBM C;  1P7B A;  3ZJZ A;  2ZXW C;  4GX5 A;  4PA3 A;  2EIK C;  2IH1 C;  2Q67 A;  4H33 A;  4TWK A;  4G27 B;  3E86 A;  1K4D C;  3T4Z A;  2W0F C;  3ASO C;  4LP8 A;  1M57 C;  4PA4 A;  1ZWI C;  4P9P A;  2AHZ A;  5E1A C;  3AG2 C;  4MTO A;  2WLL B;  3SPC A;  4OXS A;  2Y69 C;  3E8H A;  1R3K C;  3SYA A;  4RAI A;  4PDL A;  1ORQ C;  2DYS C;  3ABL C;  3LNM B;  3AG3 C;  2WLH A;  5EC2 C;  3ZRS A;  4MSW C;  3LDC A;  3SPG A;  3OR6 C;  4ZBM A;  4MTF A;  5IY5 C;  2JK5 C;  2DWD C;  5EBL C;  3RVZ A;  4UUJ C;  2K1E A;  4H37 A;  4RO2 A;  2X6C A;  4J9Z B;  4R6Z A;  3IGA C;  2H8P C;  3UM7 A;  2EIN C;  3HPL C;  3LDD A;  4GX0 A;  2AHY A;  3SYQ A;  4QNH B;  3T4D A;  4GX1 A;  4XDL A;  3T2M A;  3VOU A;  2P7T C;  4WFF A;  3OUF A;  2KB1 A;  4MVM A;  4P30 A;  3ABM C;  5CBH A;  5EBW C;  3SPH A;  1KKD A;  2ZD9 A;  3SYO A;  4WFG A;  1OCC C;  2ITC C;  4X8A A;  3RBZ A;  4CBC A;  3K0D A;  5CBG A;  4JTC B;  3K04 A;  2HVK C;  3RW0 A;  5J9P C;  4X89 A;  3FB5 C;  4R8C A;  3LDE A;  3F7Y C;  2X6A A;  3SJQ C;  3LUT B;  2A9H A;  2EIL C;  3FB6 C;  1OCZ C;  3STZ C;  2X6B A;  3K03 A;  5BZB A;  3E8G A;  3E83 A;  5KUK A;  2EIM C;  3STL C;  3WG7 C; 
#chains in the Genus database with same CATH topology
 5D5P A;  2R9I A;  2ATK C;  5JH7 B;  2HVJ C;  2AGA A;  1SER A;  4JYA B;  1ENV A;  4LF6 O;  4FLU A;  4P9O A;  3R65 A;  3ABT A;  2FL4 A;  5LA6 B;  4DV3 O;  3JYC A;  4JF3 A;  2A79 B;  5JJN B;  2WLL A;  4PA9 A;  4DYL A;  4WFH A;  3TCU A;  1AJQ A;  5LP6 C;  1YZB A;  4LF6 B;  5L3G A;  2RN9 A;  4LBE C;  1HNZ B;  3SJA C;  4X1Y A;  1XNR O;  3K79 A;  3B4S A;  1D5A A;  3QVN A;  1EZV H;  1KP3 A;  3RWR D;  4LF5 O;  5GTH Z;  2WLI B;  4UFZ A;  2PGG A;  2YIA A;  2GBO A;  1OZ0 A;  1XEQ A;  2Y0I A;  4LWS B;  5JVD B;  4TSF G;  3ZHU A;  3E22 A;  4TQF A;  3SYA A;  2EIJ B;  2F93 B;  4X62 O;  1I08 A;  2DMX A;  2JDI G;  4DV0 O;  1YIT V;  3PN1 A;  5C93 A;  3IGA C;  4LC1 A;  1DTO A;  4IYH A;  2HEP A;  4GX1 A;  1EZJ A;  4DV0 B;  5HFL A;  1SQQ H;  3VOU A;  2LFR A;  3APO A;  1QQC A;  1GRJ A;  3JAS A;  1L8D A;  1FFT B;  1ZLZ A;  4DR5 O;  1FKA O;  3C3T A;  3K04 A;  3H01 A;  4R8C A;  3SJQ C;  2A9H A;  3WFV A;  1T5E A;  5FNV A;  2KKW A;  2N05 A;  2X6B A;  1H2L A;  1GM9 A;  4DV5 O;  3N2K A;  3OR7 C;  3FB7 C;  2EIK B;  2EIJ C;  4J80 A;  3CS5 A;  5LBQ A;  3TK1 A;  4TOI A;  4G28 B;  1UFI A;  3EFF K;  1S5J A;  2Y4T A;  3P3N A;  4R50 A;  4X88 A;  3WB2 A;  1F23 A;  4WFE A;  2QWO B;  4PA7 A;  4B3R B;  2M6Y A;  2QEX V;  1P4R A;  1M9N A;  1GMG A;  1DF4 A;  3HKE A;  4O4L A;  4H13 B;  5DM6 V;  2BTQ A;  4BIO A;  3CCR V;  4KHP O;  1AIL A;  3SYP A;  1N36 B;  4UCO A;  2WSS G;  3C3S A;  3D8C A;  3OEE G;  2UXX A;  2PYJ A;  5CBF A;  3L71 H;  3OW2 U;  4TUY A;  2PZS A;  4DV7 B;  2EIK C;  2IU3 A;  1FYJ A;  2Q67 A;  4TWK A;  1MG1 A;  5A9G A;  2WA3 A;  5LOV A;  2ARH A;  4I0X B;  2BCC H;  2IJI A;  2EIM B;  4FVM A;  4ZHQ A;  4OXS A;  2Z5U A;  3GVM A;  1AR1 B;  1Q86 W;  4JV5 B;  3OR6 C;  4LH7 A;  2YI8 A;  1U96 A;  1HNW B;  2Y0P A;  3JCU Z;  1V55 B;  4R6Z A;  1NVP D;  3CYO A;  3RGB A;  3HPL C;  2XAH A;  1CEZ A;  5LMN O;  4IGG A;  1K92 A;  4FJC C;  1UJW B;  3K59 A;  1R73 A;  3ETG A;  1PNK A;  1X4T A;  3FAV B;  1V54 B;  4P30 A;  3SYO A;  3ASO B;  3ZIA G;  2ITC C;  2JGD A;  2GDS A;  1SC5 B;  4N23 A;  1MNG A;  2XAG A;  3FB5 C;  3LDE A;  2VWJ A;  3LSU A;  1WLE A;  2P22 C;  3JD0 A;  2EIM C;  1QR9 A;  1URF A;  4U3F H;  3P3P A;  2XUM A;  4JI6 O;  1IDS A;  4JI0 O;  3ZHR A;  2IH3 C;  3D36 C;  5BR8 B;  2VWK A;  1D2D A;  1HR0 O;  1V55 C;  4C7U A;  3AG2 B;  4LF4 B;  1MSD A;  4W4L A;  1WP8 A;  1SF9 A;  2VQE O;  3P32 A;  4FFK A;  2DN9 A;  5J2T A;  4DR6 B;  1V54 C;  3JAW B;  3JSL A;  4ICG A;  3S3W A;  4KL1 A;  2W0X A;  2OIE A;  4X1I A;  4JI7 O;  1BZK A;  2XAF A;  3L70 H;  1P7B A;  3OD4 A;  2P5O A;  4B08 A;  5CA0 B;  2XAS A;  2G38 A;  4FIP C;  2P90 A;  1EN4 A;  1ZAU A;  1YI2 V;  4LP8 A;  4CS2 A;  5C8Y B;  3OEH G;  3I55 V;  3AG2 C;  1RFY A;  3IJ4 A;  2YDE A;  3W7T A;  1GH6 A;  3SPG A;  3NR7 A;  3T1H O;  1MOF A;  1L0L H;  3ASN B;  4X9Q A;  3ZRV A;  3ETE A;  4H37 A;  1VF6 C;  3WB0 A;  2H8P C;  5DN6 G;  1XNQ B;  1MMM A;  3OMI B;  2AHY A;  4J7J A;  2Q5Z A;  3T1H B;  3D3I A;  3B8N A;  2Q9L A;  4WFF A;  5KMG A;  3OTO O;  1NI8 A;  4WFG A;  5H6R A;  4GLX A;  1XOU A;  1DK1 A;  2CGO A;  3CD6 V;  2OIG A;  3EHB B;  1NQT A;  2F4V O;  4EB6 B;  1XL6 A;  2HJF C;  1TUB B;  2ZIM A;  2DWE C;  1SQX H;  2YEV B;  2RCV A;  5LHI A;  4CC5 A;  1O9G A;  3ASN C;  2DQ3 A;  2OWO A;  1Q7Y W;  4MVQ A;  1IBM O;  3UT5 B;  1NZ6 A;  2F1M A;  5IWA B;  3RYC B;  4NTY A;  4FFB A;  2BSK A;  3SPJ A;  2XTA A;  1P84 F;  3TET A;  1GN3 A;  4GYC B;  3I56 V;  4DR7 B;  2QDO A;  4PDR A;  3UQ8 A;  3G71 V;  1SQP H;  1KC8 W;  2HG5 C;  2X0L A;  3GB7 C;  5EK0 A;  1P49 A;  2Q73 A;  3ZMZ A;  4BAY A;  4JAV A;  4J42 A;  4WBN A;  4O4J B;  2UUB O;  3UO3 A;  2B9Z A;  2QKA A;  1KB9 F;  2A3Q A;  3DSQ A;  1VEW A;  4DUY O;  3CSX A;  2JRI A;  4CZZ A;  4MSW C;  3LDC A;  2CDY A;  1K5Q A;  5KHG A;  3CEI A;  2E5L B;  3HKC B;  4FM0 A;  4UCS A;  4Z2W A;  4LNU A;  3JAM N;  1M56 B;  5B3S B;  1WN7 A;  1IZ3 A;  4JI3 B;  1WA8 A;  3CE2 A;  4MT8 A;  4X20 B;  2YI9 A;  4PJ0 Z;  2HP8 A;  5L3E A;  2QM8 A;  1VF5 B;  4GZR B;  1F4N A;  1QCE A;  3L75 H;  3FB6 C;  3LSQ A;  5BZB A;  3E8G A;  5LHG A;  4DV2 B;  4NXM B;  3AG1 B;  1N34 B;  2A0L A;  3UCS C;  4GX2 A;  3QTC A;  5EIB C;  3JAR A;  2LJ2 A;  2VQF O;  3E2E A;  2ETN A;  4FZ1 A;  2CTR A;  4ABM A;  1FJG B;  1J95 A;  1SA0 A;  3CWB H;  2QR4 A;  2DOS A;  2R72 A;  1NTK H;  1YTF D;  1M56 C;  5B3S C;  4LFB O;  4CH6 A;  3ABL B;  1JCH A;  3CCV V;  1VF7 A;  5IDJ A;  1R3L C;  3HKD B;  2QKC A;  3OMN B;  1JA8 A;  2QGN A;  1L1F A;  1N32 O;  1VAR A;  3UO2 A;  4O4H A;  5E79 Z;  4I55 B;  3BEH A;  3T1Y B;  4GKK B;  4LFA B;  2AZ2 A;  3BY6 A;  3E8F A;  3AG1 C;  1XIL A;  3THO A;  4JI1 O;  3K5M A;  5KX5 B;  1WP7 A;  2CE4 A;  5EZY A;  2PI4 A;  4U3J B;  4JAA A;  2EIL B;  2Q8V A;  4PV1 B;  4JGS A;  1B04 A;  1BGY H;  1XDC A;  3SDL A;  4P9P A;  1CPY A;  2YSU B;  3WG7 B;  2WLL B;  3CXC U;  4YY3 B;  5JWP A;  5CB4 A;  4JI1 B;  3U0Z A;  4QGP A;  4RAI A;  3ABL C;  1PL4 A;  3SR2 C;  1H8E G;  3CRM A;  1RSO B;  2XOK G;  3QF7 A;  2E74 B;  2XND G;  3CHX A;  3VQY A;  4J11 A;  5B1B B;  4PD4 F;  4U7O A;  5CBH A;  2DYR B;  3DC6 A;  3BA8 A;  3A0R A;  4E2L A;  3Q4H A;  5KAF Z;  2PTM A;  3ML0 A;  2X6A A;  2EIL C;  3JD2 A;  4YHH B;  3RYI A;  4B3M O;  3WG7 C;  5LGU A;  2L35 A;  4LF9 O;  4K3A A;  1HNX B;  2UXC O;  4PDM A;  2OT5 A;  4JI2 O;  5EYP A;  4I4T B;  2AW9 A;  4K8X A;  4GKJ O;  1KP2 A;  1CXZ B;  1M57 B;  1LR1 A;  1JJ2 U;  4JI4 O;  4DUZ O;  4LF9 B;  1X59 A;  1Q5O A;  4BW5 A;  5LL6 Y;  4JI2 B;  3NXS A;  4PI2 A;  3G6B A;  5L3C A;  2XHB A;  4DR1 B;  3AG3 B;  5B1B C;  1N0N A;  1R6N A;  1S5H C;  2DYR C;  3ZMU A;  1FXK A;  4AI8 A;  4DV4 O;  3W7W A;  4RUE A;  1VQ5 V;  2WPD G;  2XT9 A;  4OX9 O;  3P30 A;  2WAM A;  4GUN A;  2RNB A;  3HKB A;  4MVO A;  2MK3 A;  3R66 A;  3TGU H;  2LP7 A;  3TXS A;  4DV4 B;  3N2G A;  4JZG A;  1H8H G;  1SQG A;  1YVW A;  3H1H H;  2UUA O;  2F43 G;  3OFN G;  4GT1 A;  4DV3 B;  1M57 C;  4PA4 A;  4FLW A;  4NTX A;  2Q0A A;  3JCZ A;  3U10 A;  1K7D A;  4MTO A;  2Q0O C;  3SPC A;  3CRC A;  1QBZ A;  1R3K C;  1TA8 A;  3JAK B;  4Q6G A;  2UUA B;  5L3F A;  3AG3 C;  3ZRS A;  4A5U B;  3CXH F;  3U11 A;  2XAJ A;  4XBF A;  1O9H A;  2DWD C;  2F66 C;  1XNR B;  2B1I A;  2BE3 A;  4QJF B;  4LF8 O;  3CRR A;  1OCR B;  1MZE A;  4CH4 A;  3M8A A;  3RN4 A;  4D7T A;  4LF5 B;  3JAT B;  5JQG A;  4YJ3 A;  3K57 A;  4IHJ A;  3SPH A;  1U97 A;  3ABK B;  3VQW A;  1Q82 W;  1HP8 A;  4UVA A;  1IVS A;  5LOV B;  1ZTE A;  3RYF B;  1NT2 B;  3DXR B;  3HR0 A;  1VQM V;  1UPG A;  1KD1 W;  1THZ A;  2ZXW B;  5K1P A;  4X62 B;  1TVK B;  2KG7 A;  4MTX A;  1K33 A;  4EKW A;  2LW7 A;  5LP6 A;  5GON B;  1DGS A;  4NB5 A;  4YIO A;  3JD1 A;  4FK5 C;  2N04 A;  3J7A U;  1GN2 A;  2R70 A;  1W0J G;  1OCR C;  2AZ0 A;  1JFF A;  4Q20 A;  4FLV A;  2ZE6 A;  1QVG U;  5FLX N;  4JI8 O;  3ABK C;  4DR5 B;  1I94 O;  1G6U A;  3QO8 A;  2IM9 A;  3WU2 Z;  4ZI7 A;  2FB5 A;  3UKM A;  4RWU A;  5JH7 A;  2PY5 A;  4BIZ A;  3E89 A;  4JTD B;  2WLM A;  4JI8 B;  3G80 A;  1XQ8 A;  4F6E A;  4DV5 B;  1AP5 A;  4JZ2 A;  1K73 W;  4MTG A;  3RYH B;  5LA6 A;  1GAX A;  2ZXW C;  1VQ6 V;  1Y66 A;  3ZHQ A;  1ROP A;  1FXV A;  4NYK A;  3B2E E;  2ZR2 A;  2ZDI A;  1M90 W;  5CA3 A;  1B6Q A;  4UCU A;  3FKS G;  4TV8 B;  1PD3 A;  2ODM A;  1YF2 A;  4GCZ A;  5J2T B;  5CA1 A;  4DRX B;  1VQL V;  2P4V A;  2YXL A;  4KHP B;  2X6C A;  3WB1 A;  3UM7 A;  1RPR A;  3VBB A;  2GV9 A;  2OTL V;  4FM2 A;  4LWS A;  2IJJ A;  2P7T C;  5JVD A;  1W2B U;  2KB1 A;  1ZUQ A;  5IYC O;  4X8A A;  3ZHV A;  5JCO C;  4I5S A;  5CBG A;  4FLX A;  5IYZ B;  3OE7 G;  3J81 N;  1PKX A;  4AIL C;  5FPR A;  5KAI Z;  1YXB A;  1NKD A;  2CUG A;  4RUF A;  3RVY A;  3H1K H;  2C2A A;  4UCR A;  4J10 A;  2JJ1 G;  2PUS A;  5IYB O;  4NKG B;  3G67 A;  4E4E A;  4X66 O;  2ZT9 B;  4DR2 O;  5LMN B;  4MW8 A;  3L73 H;  3KKY A;  2GUZ B;  3A8T A;  5FPO A;  1M1K W;  2BOC C;  3CC4 V;  3DTU B;  4FMT A;  1Y4M A;  3KCY A;  1K8A W;  5KMG B;  5KHH A;  3ICX A;  3FX7 A;  1JR9 A;  3ZBH A;  1G4Y B;  1E79 G;  4AQY O;  2IU0 A;  3GWO A;  2IW5 A;  4LFC O;  5IE9 A;  3F5W C;  2YID A;  3ABM B;  4MVZ A;  1GM8 A;  4JI6 B;  4JI0 B;  2W6I G;  4DR4 O;  1WPB A;  5H5N A;  3W7X A;  3ASO C;  4W4K A;  5LYJ B;  2WA4 A;  1HR0 B;  3CC7 V;  4IIJ A;  1LUV A;  2CAZ C;  4PI0 A;  2VQE B;  5LXT B;  1SET A;  2ZE8 A;  2EZP A;  5K1X A;  4DR4 B;  5D5Q A;  2JJ2 G;  1JJO A;  1FS0 G;  1PL0 A;  4ZIB A;  4HBN A;  5IJ9 B;  3J80 N;  4J9Z B;  1B3Q A;  1OCO B;  4X1K A;  3CCJ V;  3O65 A;  2H94 A;  4DV6 O;  1BMF G;  4QNH B;  2ZIN A;  4JI7 B;  1AJP A;  3ABM C;  4UB8 Z;  1WAZ A;  1GN6 A;  3OTF A;  4I0X A;  4JYB A;  4K35 A;  3ZCC A;  2JS5 A;  2H3O A;  1VP7 A;  3CJH B;  3D36 A;  1Y76 A;  5EBW C;  2XAQ A;  1VQK V;  4XDJ A;  5H2F Z;  1JVM A;  2VS0 A;  4X65 O;  1NTM H;  3H9V A;  1XL4 A;  2JEU A;  1NH2 B;  1K34 A;  2E76 B;  3OAA G;  3ETQ A;  1XMO O;  1K9M W;  1OCO C;  4X65 B;  4HZ3 A;  4O4I B;  3OTO B;  4ASU G;  4J9Y B;  2ZCE A;  1XMO B;  5ITZ B;  1Y74 B;  5KUM A;  4JI5 O;  4UV8 A;  1NBM G;  5EC1 C;  1YJ9 V;  1FXH A;  1COW G;  3OMA B;  2Q7E A;  1S3J A;  2UUC O;  4KFM A;  2F4V B;  4CS3 A;  3AG7 A;  1OJH A;  2E75 B;  2UUC B;  1I5X A;  2ILM A;  1BCC H;  4ZKI A;  1IBM B;  1VQ8 V;  3JAW A;  3H1J H;  4OPA A;  4KXR A;  1H2S B;  3CCL V;  3ZX6 A;  1W59 A;  4TV9 B;  3JAL B;  2QJ1 A;  2HHH O;  1XUQ A;  2OYQ A;  4YJ2 A;  2FML A;  1PV0 A;  1KEC A;  5IJ0 B;  3K5O A;  4UUJ C;  3MD0 A;  3IC7 A;  2LFS A;  2HHH B;  1W0K G;  5JJE B;  2Z0A A;  4MVM A;  1J5E O;  2JEX A;  1Q6I A;  2V1D A;  2UUB B;  4JAS A;  1AR5 A;  2DJV A;  2UXB O;  1M93 A;  4WF9 V;  1VQN V;  2YXH A;  3KCX A;  1FAF A;  4DUY B;  1VMG A;  2ZNJ A;  4CS4 A;  2CH7 B;  2Q4P A;  1FFX A;  4DXW A;  2UXB B;  2AXT Z;  3LSS A;  4MW3 A;  4CH5 A;  1H2G A;  4FLT A;  2LGQ A;  1BE3 H;  5BMV A;  1Q3E A;  4HNA B;  4TT3 G;  4QPK A;  3SGI A;  1Q90 D;  4UVB A;  5H9C A;  3K5N A;  1S76 D;  4UCV A;  5B1N A;  1HWY A;  2RDC A;  2A06 H;  3Q4H B;  5KUK A;  1TUB A;  3A0H Z;  2YEV A;  1SQB H;  3ZRW B;  1IBL O;  4B3S O;  1HDJ A;  1YIJ V;  4PHZ A;  4F6R B;  5EYP B;  4D6T H;  2VQF B;  4I50 B;  1NJI W;  2ADQ B;  3RYC A;  4B3S B;  1SRY A;  2AHZ A;  3FD9 A;  2CTP A;  2QWP B;  4LFB B;  1P7G A;  1ZL8 B;  4DV1 O;  1Z5W A;  2HKO A;  2L6L A;  5KA5 A;  1IX9 A;  4ZOL A;  1N32 B;  2YS8 A;  3ZS8 C;  4X64 O;  2WWW A;  1H2M A;  1AI5 A;  1WJZ A;  2CGN A;  3T4D A;  5L3D A;  2ZIO A;  1S5L Z;  3LNN A;  3OUF A;  3X2Q B;  3B40 A;  1N8R W;  5BXZ A;  1EFR G;  1AB3 A;  4DR3 O;  3K0D A;  1IUR A;  4JPR A;  4O2B A;  4FLY A;  3F7Y C;  1Q43 A;  3LUT B;  1TUE B;  1R1B A;  4LF7 O;  2RQ6 A;  3K03 A;  1E1R G;  2QWQ B;  4X1Y B;  1D5N A;  3E8B A;  4DO2 A;  3HKC A;  3C90 A;  3BFR A;  3F5T A;  4J41 A;  2R9A A;  3OGI B;  1YCI A;  1SZX A;  2ZQM A;  2R9R B;  4X20 A;  5B66 Z;  2BTO A;  3F7V C;  5EC2 C;  4JYY A;  1N33 O;  2DYS B;  3X2Q C;  4IHJ B;  3E22 B;  2ITD C;  2UU9 O;  4RQF A;  1N33 B;  3BPZ A;  4FZ0 A;  4I9W A;  4IL6 Z;  2LW1 A;  2ZR3 A;  1OHH G;  5FL7 G;  4B3M B;  3L72 H;  3T1C A;  5BY1 A;  1OCC B;  5LHH A;  3BA9 A;  1NR7 A;  1VQO V;  1YJN V;  2UXC B;  4B7E A;  4GKJ B;  5LGT A;  1KQS U;  4H33 A;  4NXN O;  1XMQ O;  4QIW F;  5A2Q N;  4BR6 A;  4YXW G;  4JI4 B;  1AP6 A;  1NU1 H;  3JAS B;  4DUZ B;  2DW4 A;  3ETD A;  3HKD A;  1PP9 H;  1XHZ A;  1V9P A;  5H6Q A;  2IBZ H;  3OT7 A;  1WB8 A;  2DYS C;  1ZX3 A;  5FNV B;  1QR8 A;  4G2K A;  4I55 A;  4MTF A;  5B1O A;  2JK5 C;  2O57 A;  2K1E A;  3N2K B;  4OX9 B;  3APQ A;  3CCU V;  3BVO A;  4XDL A;  5KX5 A;  3CP1 A;  4U3J A;  1OCC C;  4CC6 A;  1WPX A;  1SS3 A;  1HNZ O;  1F4M A;  2HVK C;  1R6K A;  2Y4U A;  2OCC B;  2EX3 A;  1KU9 A;  2ZNI A;  3MHS C;  3STZ C;  3HKE B;  3AK1 A;  1RSO A;  4O4L B;  1XHX A;  2BTQ B;  3QO5 A;  2V7Q G;  1FPO A;  4MS2 A;  4UVC A;  2OCH A;  3BRC A;  2MW2 B;  2BOB C;  3K9A A;  1AI6 A;  1FD9 A;  5CA1 B;  3H1I H;  1MA1 A;  1I5Y A;  1VQP V;  1AJN A;  4TUY B;  2Y48 A;  4LF8 B;  1DLB A;  1NVP B;  1M4U A;  1Q6H A;  4NVP A;  3AK2 A;  1IXM A;  1H38 A;  2FYU H;  2QM4 A;  4ZHQ B;  2HLD G;  1H2K A;  2QA4 V;  2Q6A A;  3CCQ V;  4BWA A;  4EFB A;  2OCC C;  5F2V O;  1QHT A;  5J2U A;  3KG2 A;  4I4T A;  2ZDI C;  4F4L A;  3SJB C;  1PM9 A;  1AI7 A;  4PA3 A;  4O2A A;  1PNL A;  1JQ0 A;  4DW0 A;  4QPJ A;  1OCZ B;  2JGD B;  5DEC A;  2YIB A;  3BHP A;  1VQ4 V;  1XRE A;  4CH3 A;  3BAA A;  1ORQ C;  1KKC A;  3L74 H;  1BHB A;  4Z1M G;  1I94 B;  4UCT A;  4K8Z A;  2Z3Y A;  4RO2 A;  3GWK C;  3QG5 A;  3QO7 A;  4EEQ A;  2NNU A;  2YIB D;  5JJJ B;  4B3R O;  3CRQ A;  5KHK A;  4L87 A;  3RBZ A;  3BAB A;  4JAU A;  2KQX A;  4X89 A;  1LUW A;  3JAK A;  1N36 O;  3AG4 B;  3IAY A;  1OCZ C;  1K5S A;  4IIJ B;  3E83 A;  3RFR A;  3S3X A;  2WLI A;  1G1X B;  3OGC C;  1WNS A;  2HFE C;  4KP4 A;  5LGN A;  3AK3 A;  3CCS V;  4DV7 O;  4X1I B;  3DGE A;  2QE7 G;  3JAT A;  4XDK A;  2YC0 A;  4NR1 A;  1BS3 A;  4UV9 A;  2NLJ C;  3D3Q A;  4X1K B;  3TJT A;  1SES A;  2QTO A;  1SQF A;  1I0H A;  4BW9 A;  3ABU A;  2EBO A;  4JV5 O;  3K06 A;  3RYF A;  5IY5 B;  4JTA B;  3DXR A;  4DK0 A;  1HNW O;  5HFM A;  4BIU A;  5AG2 A;  4WCE V;  2WLN A;  1PPJ H;  3AG4 C;  1B06 A;  4KUM A;  1TVK A;  2E3C A;  3G6E V;  4RQE A;  4EFE A;  1MSW D;  3B77 A;  3HB3 B;  1R3J C;  1Y76 B;  5GON A;  3ZJZ A;  1XBL A;  2LQT A;  2JGU A;  4GX5 A;  1Q81 W;  3QNE A;  4G27 B;  2QWN B;  2FKX A;  2DE0 X;  2ZM6 O;  1JOY A;  1K3E A;  2W6J G;  2QSA A;  4X66 B;  4DR2 B;  1AI4 A;  1US6 A;  1GO3 F;  3B09 A;  5E1A C;  2QM7 A;  2EZO A;  4I9Q A;  2YIC A;  4TQD A;  2P67 A;  1RM1 B;  3FFQ A;  4PDL A;  3IC9 A;  3LNM B;  3K3W A;  3CRA A;  2Q7H A;  2B5U A;  4FPP A;  2ZM6 B;  4ZBM A;  5IY5 C;  2YUA A;  3MHH C;  5KHJ A;  3VQV A;  4AQY B;  2JS3 A;  2UXD O;  5BR8 O;  2PF4 E;  1JX9 A;  3RYH A;  3LDD A;  4GX0 A;  4LF4 O;  5JCO A;  4LFC B;  4L8J A;  4NTW A;  1BT8 A;  1L0N H;  3T2M A;  3ZN1 A;  2D2C B;  4DR6 O;  3B8M A;  1ARO P;  1S0V A;  3A2F A;  1N4C A;  2UXD B;  1QLE B;  4CBC A;  3K5L A;  2JIZ G;  2GTA A;  3RW0 A;  1BHA A;  3K9S A;  1GK9 A;  4FFB B;  3SJC C;  4TV8 A;  1EBO A;  3OM3 B;  2BSK B;  1CP9 A;  4DRX A;  2RMK B;  1BSM A;  4MVS A;  3BCC H;  1RM1 C;  4YJ2 B;  2JVD A;  3A0B Z;  3G4S V;  4OGQ B;  1K4C C;  4WBN B;  1R3I C;  2A7W A;  4DV6 B;  1Q8I A;  2LO1 A;  1BL8 A;  1IXB A;  3EVK A;  3CME V;  2GTS A;  1RPO A;  5IYZ A;  3K0G A;  3FB8 C;  1QLE C;  1VQ9 V;  5LMU O;  3OUS A;  4FLZ A;  5KA6 A;  2Q7G A;  3SYC A;  1S72 V;  1XNQ O;  3H1L H;  1QU7 A;  3CB2 A;  1IBK O;  2CK3 G;  2OTJ V;  3FAV A;  4LNU B;  4MVU A;  5LMU B;  1I7F A;  4LCU C;  5EBM C;  4FM1 A;  2NN4 A;  1FFX B;  1WA8 B;  2ADP A;  2IJK A;  2QWR B;  2GUZ A;  4H44 B;  3T4Z A;  1IBK B;  2FTK A;  5BMV B;  2B1G A;  2YXY A;  1YTF B;  2VRZ A;  3N27 A;  2K9P A;  3W7S A;  2WLH A;  3CMA V;  2EUL A;  3RVZ A;  1GKF A;  4JI5 B;  1Y67 A;  3JAR B;  3AEI A;  1MAB G;  2HJD A;  1AR4 A;  2F95 B;  3JD3 A;  3MAQ A;  1SA0 B;  5KLV H;  1F7Y A;  1E1Q G;  5IWA O;  3ZMT A;  1VIB A;  1EN5 A;  5LYJ A;  4I7Z B;  1VF6 A;  5TIS Z;  4DR7 O;  5LXT A;  3ZMS A;  1GN4 A;  5B1A B;  2CTW A;  3ZMV A;  3ZHS A;  1TGO A;  4O4H B;  2V4D A;  5GTI Z;  5IJ9 A;  1G8M A;  2D3O W;  3O9O A;  5CA0 A;  4ZOL B;  1SZT A;  1NTZ H;  4J7Z A;  5C8Y A;  2QKS A;  1SQV H;  4K0K O;  5EZY B;  2Y69 B;  3I5D A;  3ZED A;  1J5E B;  3W7U A;  4YIP A;  2WLJ A;  4PDV A;  2E5L O;  3CJH A;  1NS1 A;  4PA6 A;  1ZSP A;  2N74 A;  5CB4 B;  3CCE V;  4K0K B;  4B3T O;  4O2B B;  2KSD A;  4R7C A;  5KHI A;  5B1A C;  3K58 A;  3PJS K;  4P2Z A;  3M99 B;  3IFX A;  4JYC A;  4JI3 O;  1BQ0 A;  2DQ0 A;  4HYO A;  4N21 A;  1PNM A;  4B3T B;  1EM1 A;  1NR1 A;  1QLN A;  2IH1 C;  1HW7 A;  1GM7 A;  2P06 A;  4HAM A;  4WFB V;  4O4I A;  1ZWI C;  4UB6 Z;  1A32 A;  3KZI Z;  3EXA A;  4EB6 A;  3DC5 A;  4DV2 O;  4NXM O;  2Y69 C;  3E8H A;  5ITZ A;  1GTO A;  1N34 O;  1Y74 A;  3M7M X;  3VQX A;  5B5E Z;  3RT3 C;  1S77 D;  3RYI B;  3FYI B;  1NH2 D;  3ZHT A;  1EN6 A;  1FJG O;  1KBH A;  1Z5V A;  1SKV A;  1QNM A;  3UT5 A;  3SYQ A;  4PEL A;  1H2N A;  2ZE7 A;  3MDS A;  1IBL B;  3L9D A;  1KKD A;  3CX5 F;  2IJH A;  4JTC B;  2F23 A;  1MZF A;  5J9P C;  2HR3 A;  1KUQ A;  4UXN A;  4IT5 A;  2X7R B;  4TV9 A;  1VQ7 V;  1FXK B;  3JAL A;  3T1Y O;  4GKK O;  3STL C;  4LFA O;  5IJ0 A;  4DV1 B;  1DF5 A;  4QE9 A;  2PYL A;  4H0L B;  2P4K A;  2NR5 A;  3HKB B;  2M7W A;  4J7K A;  4O4J A;  1KMI Z;  3K08 A;  5IT9 N;  2WLK A;  2ZE5 A;  3N2G B;  3CCM V;  4D7S A;  2Q68 A;  4X64 B;  4DK1 A;  2QTS A;  2Q69 A;  3JSN A;  2ZKO A;  4YY3 O;  1RP3 B;  4AHC A;  2EJR A;  1XI1 A;  2GSM B;  4IYI A;  4DR3 B;  4QE7 A;  2CTQ A;  5CMU A;  5L3B A;  1R6T A;  1QVF U;  3ZRX A;  1JMK C;  1Q6U A;  2EIN B;  3SPI A;  2CH7 A;  1LNQ A;  4Z1V A;  4LF7 B;  1Y6X A;  1FXK C;  2GHY A;  3E35 A;  3TXQ A;  1JPX A;  4U7N A;  1KYO F;  3ZN0 A;  4HNA A;  3FYE B;  5EIB D;  3JD4 A;  4WFA V;  1YJW V;  5JQG B;  4YJ3 B;  1YHQ V;  1BQZ A;  3E86 A;  1K4D C;  1TAE A;  2W0F C;  4LH6 A;  5GW7 A;  2EJ7 A;  4B7K A;  3CC2 V;  4YHH O;  2P6J A;  5DED A;  1AVM A;  1Z2G A;  1YEW A;  1HNX O;  1WB7 A;  1F51 A;  1K97 A;  3CPW U;  2UU9 B;  5EBL C;  3ZRW A;  2EIN C;  2KG7 B;  2UXN A;  4F6R A;  2RJZ A;  1OV9 A;  5J2U B;  5LP6 B;  4DR1 O;  4DW1 A;  5CN0 A;  1YDX A;  4I50 A;  2PI5 A;  2ZD9 A;  1N0J A;  1JFF B;  4NXN B;  4O2A B;  1M5I A;  1XMQ B;  2LGW A;  4JYA O;  1ZL8 A;  4LR3 A;  5IYD O;  4OPH A;  4MVR A;  4ZI7 B;  1YSC A; 
#chains in the Genus database with same CATH homology
 3D36 A;  2R9I A;  2WLI A;  2ATK C;  2A0L A;  3AG1 B;  3OGC C;  5EBW C;  2HVJ C;  2XAQ A;  4GX2 A;  4XDJ A;  1VQK V;  1SER A;  2HFE C;  4KP4 A;  1JVM A;  1ENV A;  5LGN A;  3CCS V;  1XL4 A;  2JEU A;  3E2E A;  4P9O A;  3R65 A;  1NH2 B;  3ABT A;  1J95 A;  2QE7 G;  3DGE A;  1K34 A;  4XDK A;  3OAA G;  3JYC A;  4JF3 A;  1K9M W;  2A79 B;  4UV9 A;  2WLL A;  2NLJ C;  1M56 C;  1OCO C;  4PA9 A;  5B3S C;  1YTF D;  1SES A;  2QTO A;  4WFH A;  3TCU A;  3ABL B;  1AJQ A;  4HZ3 A;  1JCH A;  3CCV V;  5L3G A;  5IDJ A;  1R3L C;  4ASU G;  3ABU A;  2EBO A;  4LBE C;  4J9Y B;  3K06 A;  3OMN B;  5IY5 B;  1L1F A;  4JTA B;  5KUM A;  3K79 A;  5HFM A;  4BIU A;  4WCE V;  2WLN A;  4UV8 A;  1NBM G;  5EC1 C;  3BEH A;  1YJ9 V;  3AG4 C;  1FXH A;  1COW G;  3OMA B;  1KP3 A;  4KUM A;  1S3J A;  4KFM A;  3G6E V;  4RQE A;  1MSW D;  3B77 A;  3HB3 B;  1R3J C;  3BY6 A;  3E8F A;  2WLI B;  3AG1 C;  3ZJZ A;  4GX5 A;  1Q81 W;  1OZ0 A;  3QNE A;  4G27 B;  2PI4 A;  1I5X A;  2EIL B;  4JGS A;  1JOY A;  1K3E A;  2W6J G;  4ZKI A;  1VQ8 V;  4P9P A;  1AI4 A;  1CPY A;  2YSU B;  4TSF G;  1GO3 F;  5E1A C;  3WG7 B;  2QM7 A;  2WLL B;  3CXC U;  2EZO A;  3CCL V;  2P67 A;  1RM1 B;  3SYA A;  4RAI A;  4PDL A;  3ABL C;  3LNM B;  2EIJ B;  1H8E G;  3K3W A;  2B5U A;  4FPP A;  2XOK G;  4ZBM A;  1KEC A;  2JDI G;  1YIT V;  5IY5 C;  3MHH C;  5C93 A;  4UUJ C;  3MD0 A;  3IC7 A;  3IGA C;  4LC1 A;  2LFS A;  1JX9 A;  2XND G;  3LDD A;  4GX0 A;  1DTO A;  1W0K G;  4GX1 A;  5B1B B;  1EZJ A;  3T2M A;  3ZN1 A;  4U7O A;  5HFL A;  3VOU A;  5CBH A;  2LFR A;  4MVM A;  2DYR B;  3B8M A;  1ARO P;  2JEX A;  1S0V A;  2V1D A;  1QLE B;  4CBC A;  1FFT B;  2JIZ G;  3A0R A;  3K04 A;  4E2L A;  3RW0 A;  1BHA A;  1GK9 A;  3H01 A;  4JAS A;  4R8C A;  3ML0 A;  2X6A A;  3SJQ C;  2A9H A;  1EBO A;  2EIL C;  3JD2 A;  3OM3 B;  3WFV A;  4WF9 V;  2X6B A;  1CP9 A;  1VQN V;  3WG7 C;  5LGU A;  1GM9 A;  4MVS A;  1RM1 C;  3OR7 C;  3FB7 C;  4PDM A;  2EIK B;  2EIJ C;  2OT5 A;  4DXW A;  1KP2 A;  5LBQ A;  3LSS A;  4MW3 A;  3TK1 A;  3G4S V;  1H2G A;  1M57 B;  1JJ2 U;  4G28 B;  4TT3 G;  1K4C C;  4QPK A;  3EFF K;  4R50 A;  4X88 A;  1R3I C;  1F23 A;  4WFE A;  4BW5 A;  4UVB A;  3NXS A;  5H9C A;  1BL8 A;  5L3C A;  3AG3 B;  3CME V;  4PA7 A;  5B1B C;  1RPO A;  2QEX V;  1P4R A;  1M9N A;  1R6N A;  1GMG A;  1S76 D;  1S5H C;  2DYR C;  3ZMU A;  3K0G A;  1FXK A;  3FB8 C;  1DF4 A;  1QLE C;  3W7W A;  1VQ9 V;  4RUE A;  1HWY A;  5B1N A;  1VQ5 V;  5DM6 V;  3CCR V;  3OUS A;  2WPD G;  3SYP A;  3P30 A;  5KA6 A;  5KUK A;  2WSS G;  2WAM A;  3SYC A;  1S72 V;  3OEE G;  2YEV A;  2UXX A;  4MVO A;  2MK3 A;  5CBF A;  2CK3 G;  2OTJ V;  2LP7 A;  3ZRW B;  4MVU A;  1YIJ V;  4LCU C;  3OW2 U;  5EBM C;  2EIK C;  2IU3 A;  1H8H G;  2Q67 A;  2IJK A;  2F43 G;  3OFN G;  4TWK A;  4GT1 A;  1MG1 A;  3T4Z A;  1NJI W;  2FTK A;  1M57 C;  4PA4 A;  1SRY A;  2AHZ A;  2IJI A;  2EIM B;  3JCZ A;  2B1G A;  1K7D A;  4MTO A;  3SPC A;  1YTF B;  4OXS A;  2Z5U A;  1QBZ A;  1R3K C;  3W7S A;  1AR1 B;  5L3F A;  2HKO A;  2WLH A;  3AG3 C;  3ZRS A;  5KA5 A;  3CMA V;  1Q86 W;  3OR6 C;  2XAJ A;  4XBF A;  2DWD C;  3RVZ A;  1GKF A;  2B1I A;  1V55 B;  4R6Z A;  1NVP D;  3CYO A;  3AEI A;  4QJF B;  2WWW A;  3HPL C;  1MAB G;  2XAH A;  1CEZ A;  1OCR B;  1AI5 A;  3JD3 A;  1K92 A;  4FJC C;  3T4D A;  1UJW B;  1R73 A;  5L3D A;  3ETG A;  1PNK A;  1E1Q G;  3OUF A;  1V54 B;  4P30 A;  3X2Q B;  3ZMT A;  1N8R W;  3SPH A;  1EFR G;  3SYO A;  3ASO B;  3ABK B;  3ZIA G;  2ITC C;  3K0D A;  4N23 A;  4JPR A;  1Q82 W;  2XAG A;  3FB5 C;  4UVA A;  3ZMS A;  3LDE A;  3F7Y C;  5B1A B;  3LUT B;  1TUE B;  3ZMV A;  3K03 A;  1WLE A;  1E1R G;  3JD0 A;  2EIM C;  1VQM V;  3E8B A;  4DO2 A;  1QR9 A;  1KD1 W;  1G8M A;  1THZ A;  2ZXW B;  2D3O W;  4MTX A;  1K33 A;  1SZT A;  4EKW A;  2IH3 C;  2ZQM A;  2R9R B;  3JD1 A;  4FK5 C;  1V55 C;  2QKS A;  3AG2 B;  3F7V C;  5EC2 C;  1W0J G;  1OCR C;  2Y69 B;  3P32 A;  2DYS B;  4Q20 A;  1V54 C;  3X2Q C;  1QVG U;  3W7U A;  2WLJ A;  3ABK C;  4PDV A;  2ITD C;  3CCE V;  4PA6 A;  4RQF A;  3QO8 A;  3UKM A;  4I9W A;  4R7C A;  5B1A C;  3PJS K;  4BIZ A;  4P2Z A;  3M99 B;  3E89 A;  2ZR3 A;  1OHH G;  4JTD B;  5FL7 G;  3IFX A;  2WLM A;  4JYC A;  2DQ0 A;  2XAF A;  3T1C A;  1K73 W;  4MTG A;  1OCC B;  5LHH A;  4HYO A;  1NR7 A;  1PNM A;  4N21 A;  1P7B A;  1VQO V;  1YJN V;  1NR1 A;  2ZXW C;  1QLN A;  1VQ6 V;  1Y66 A;  2IH1 C;  5LGT A;  2XAS A;  1KQS U;  4H33 A;  1ROP A;  4FIP C;  1GM7 A;  2P90 A;  1FXV A;  4QIW F;  4HAM A;  4YXW G;  4WFB V;  1YI2 V;  4LP8 A;  2DW4 A;  1ZWI C;  2ZR2 A;  3ETD A;  2ZDI A;  1M90 W;  3OEH G;  5CA3 A;  3I55 V;  1B6Q A;  3AG2 C;  5H6Q A;  3FKS G;  2Y69 C;  3E8H A;  1GTO A;  3W7T A;  2DYS C;  1PD3 A;  4GCZ A;  1QR8 A;  4G2K A;  3SPG A;  1S77 D;  3FYI B;  1MOF A;  4MTF A;  5B1O A;  1VQL V;  3ASN B;  1NH2 D;  2JK5 C;  3ZRV A;  2K1E A;  3ETE A;  4H37 A;  2X6C A;  2H8P C;  5DN6 G;  3UM7 A;  1RPR A;  3CCU V;  3OMI B;  2AHY A;  3VBB A;  2OTL V;  3SYQ A;  4PEL A;  4XDL A;  3CP1 A;  3D3I A;  3B8N A;  2IJJ A;  2P7T C;  4WFF A;  1W2B U;  2KB1 A;  1KKD A;  5IYC O;  4WFG A;  1OCC C;  4X8A A;  2IJH A;  4I5S A;  5CBG A;  4JTC B;  1WPX A;  5H6R A;  1F4M A;  2HVK C;  5J9P C;  1R6K A;  2HR3 A;  2OCC B;  4UXN A;  3OE7 G;  1PKX A;  2X7R B;  1VQ7 V;  1FXK B;  3MHS C;  3STZ C;  1NKD A;  3CD6 V;  3EHB B;  3STL C;  3QO5 A;  1NQT A;  2V7Q G;  4MS2 A;  4UVC A;  1XL6 A;  2HJF C;  1DF5 A;  4QE9 A;  2BOB C;  3K9A A;  4RUF A;  2DWE C;  3RVY A;  2YEV B;  1AI6 A;  2M7W A;  5LHI A;  2C2A A;  3K08 A;  2WLK A;  1I5Y A;  2JJ1 G;  3ASN C;  2DQ3 A;  1VQP V;  1AJN A;  3CCM V;  2Q68 A;  2Y48 A;  5IYB O;  1Q7Y W;  4MVQ A;  1DLB A;  1NVP B;  4MW8 A;  2Q69 A;  1M1K W;  1IXM A;  1H38 A;  2BOC C;  3CC4 V;  3DTU B;  2EJR A;  4FMT A;  1Y4M A;  1K8A W;  2GSM B;  3SPJ A;  4QE7 A;  2HLD G;  5CMU A;  3TET A;  2QA4 V;  5L3B A;  3I56 V;  2Q6A A;  1G4Y B;  1E79 G;  3ZRX A;  1QVF U;  2IU0 A;  3CCQ V;  2EIN B;  2OCC C;  3SPI A;  1LNQ A;  3GWO A;  4PDR A;  3G71 V;  1KC8 W;  1FXK C;  3KG2 A;  2GHY A;  2IW5 A;  3E35 A;  1JPX A;  2ZDI C;  4F4L A;  4U7N A;  3F5W C;  3ABM B;  2HG5 C;  2X0L A;  3GB7 C;  4MVZ A;  5EK0 A;  3ZMZ A;  3ZN0 A;  4BAY A;  1GM8 A;  1AI7 A;  4JAV A;  4PA3 A;  3FYE B;  2W6I G;  3JD4 A;  4WFA V;  1YJW V;  1YHQ V;  3E86 A;  1K4D C;  1PNL A;  1JQ0 A;  2W0F C;  4QPJ A;  1OCZ B;  3ASO C;  3W7X A;  5GW7 A;  3CC7 V;  3CC2 V;  1VQ4 V;  2P6J A;  1SET A;  2EZP A;  1ORQ C;  4CZZ A;  4MSW C;  3LDC A;  2JJ2 G;  1K5Q A;  1BHB A;  1F51 A;  4Z1M G;  1FS0 G;  1K97 A;  3CPW U;  1PL0 A;  5EBL C;  2Z3Y A;  4RO2 A;  4J9Z B;  3ZRW A;  1M56 B;  1OCO B;  2EIN C;  5B3S B;  3QO7 A;  2UXN A;  2NNU A;  3CCJ V;  2H94 A;  1BMF G;  4QNH B;  4MT8 A;  1AJP A;  5CN0 A;  3ABM C;  2PI5 A;  2ZD9 A;  4L87 A;  3RBZ A;  4JAU A;  5L3E A;  2QM8 A;  4JYB A;  4X89 A;  3ZCC A;  1F4N A;  1QCE A;  3AG4 B;  3FB6 C;  1OCZ C;  3LSQ A;  5IYD O;  1K5S A;  5BZB A;  3E8G A;  3E83 A;  4MVR A;  5LHG A;  1YSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...