1DLBA

Helical interactions in the hiv-1 gp41 core reveals structural basis for the inhibitory activity of gp41 peptides
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
63
Chain Sequence
GIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSRGGWMEWDREINNYTSLIHSLIEESQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE GLYCOPROTEIN GP41
publication title Helical interactions in the HIV-1 gp41 core reveal structural basis for the inhibitory activity of gp41 peptides.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 63
sequence length 65
ec nomenclature
pdb deposition date 1999-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1dlbA00
3B8MA 4E2LA 5KA6A 2P6JA 1MOFA 2EZPA 5CMUA 1DLBA 5H9CA 1K34A 3WFVA 2M7WA 2OT5A 1DF4A 3P30A 5CN0A 5KA5A 1Y4MA 2MK3A 3B77A 4JF3A 1JPXA 1QR8A 1QCEA 1ENVA 3B8NA 3CYOA 4N21A 1EBOA 1SZTA 4G2KA 5HFMA 1I5YA 2EBOA 3H01A 4N23A 1I5XA 1QBZA 3CP1A 4JPRA 4FJCC 2EZOA 1Y66A 3GWOA 2LP7A 3MHHC 3M99B 4FIPC 1F23A 5HFLA 1K33A 1MG1A 1DF5A 1QR9A 2X7RB 3MHSC 4FK5C 1JQ0A 4JGSA 3K9AA
chains in the Genus database with same CATH superfamily
5KA6A 4PV1B 2XTAA 3RWRD 2ARHA 3AG3B 4O4JA 2MK3A 4UB8Z 3HPLC 2Y0PA 3OM3B 1Q6HA 2BOBC 4BR6A 4UVCA 3C3SA 3N2KB 5L3EA 3CC7V 1FXKA 3OUFA 1JFFA 3IJ4A 3T1YB 3JAWB 3A8TA 4DW0A 2QTOA 2DYRC 3LNMB 1OCCC 3ZMZA 4LF5B 1OCRC 3VQXA 3CPWU 3JAKA 4DV7B 1SESA 1BL8A 4J11A 1N33B 2E74B 1QR8A 3SDLA 1I5YA 2P90A 1KP3A 1NBMG 4X1IA 1LNQA 4LF4B 2B5UA 1N32O 2JDIG 3AG3C 4NXMB 1NT2B 3FFQA 1O9HA 4GX1A 5D5QA 4IL6Z 3E89A 4WFFA 1M9NA 4JZGA 5KAFZ 1ZX3A 2RJZA 5CN0A 2CDYA 4TT3G 2IH1C 4DR4B 4LH6A 1XMQB 4JI0B 3NXSA 3LNNA 1QLNA 2JVDA 1R3JC 2QR4A 4K3AA 5JWPA 4JI5O 3CC2V 3O65A 2KB1A 3K04A 1Q7YW 2YSUB 2JEUA 2ZD9A 1UJWB 1W59A 2EZPA 4J7ZA 1W2BU 4J9ZB 1SQGA 5K1PA 2OIEA 2A06H 2ZNJA 4FLTA 4X66O 4GT1A 5LXTA 4DR2B 1UPGA 2JS3A 4NXNO 4X1YB 2Q73A 2CTRA 4I55B 1FAFA 3U11A 3CCVV 4TSFG 2QM8A 2CH7B 4JI2B 2WAMA 3EHBB 1Q86W 2V1DA 3OAAG 4MT8A 1SQFA 2HFEC 1K73W 4X65B 3A0RA 3DXRA 4P30A 5B1OA 3VQWA 2AGAA 5FNVA 3CCMV 1XREA 4ZHQA 5J2UA 1S0VA 3SJQC 4JI4B 2YXYA 3IC7A 4FFBA 1GMGA 5C8YB 1Y76B 2GBOA 3CCEV 2ZT9B 2VQFO 1PNLA 2W0FC 4DUZB 1QLEB 5IDJA 3U0ZA 3CYOA 4Z1VA 4L87A 2HG5C 2H3OA 1WA8A 1KECA 4LFCB 4JYBA 4F4LA 1YCIA 1WB7A 3K3WA 1IXBA 1N0JA 3BEHA 4UCOA 1VQ8V 3E8BA 2CE4A 1R3IC 2ZIOA 3SGIA 1XNRO 1ZUQA 3AG1C 4LF7O 2W0XA 1FD9A 1CXZB 2MW2B 2Y48A 3KKYA 4DYLA 3TCUA 4IT5A 1F51A 4K0KO 4YY3O 2GUZB 4CS2A 3SPJA 1HR0O 4DR3B 3RVYA 2K9PA 2P22C 4MVQA 3ZS8C 4JAAA 4OPHA 1NTMH 1TUBA 4PDRA 3N2GB 2Y4TA 2ZR2A 2KSDA 3ZHVA 4TQFA 1MABG 1GN6A 3CP1A 1NU1H 3BPZA 1YVWA 5FPRA 1L0NH 4U3JB 1HNWB 2RMKB 1ZSPA 2IBZH 4HZ3A 3TXQA 1L0LH 1O9GA 2PF4E 1BZKA 2EIJB 5BMVA 3UCSC 4KFMA 4LF9B 5F2VO 2ZXWB 4EFBA 3E22B 1CPYA 3T1CA 1I94O 1AJQA 1D2DA 5EIBC 5LYJA 4OXSA 2EIMC 4UVBA 2LFRA 1J95A 2F4VO 5IE9A 4DV3O 4MS2A 4X89A 5LMNO 4FJCC 3RYFA 4WBNA 2IJIA 2JJ2G 4IYIA 4B7EA 4EFEA 5KMGB 4B3SO 3L72H 3E83A 1GM9A 4ASUG 5LGTA 1WAZA 4X88A 4AI8A 2Q4PA 1BMFG 2Q7HA 2R72A 2QTSA 5KUMA 1KYOF 4FLYA 4K35A 3E35A 2CTWA 5KX5B 2HEPA 4PDLA 3SYAA 1B6QA 4DV0B 3TGUH 4TV8A 2ZKOA 1K7DA 4DV5O 4JI7B 5HFLA 2ZXWC 4I4TA 5EIBD 3JCZA 1J5EO 2CTQA 3FAVB 1JA8A 1AR5A 3OR6C 3LDEA 4JF3A 5EYPA 3ZMTA 3OFNG 4MW8A 5AG2A 1I5XA 1NVPD 1GN2A 3JSNA 2LGWA 2GDSA 2UXCB 2EX3A 1M93A 1SF9A 1GN4A 4CS3A 2R9RB 4OGQB 4PA3A 1V55B 2HKOA 2Q6AA 4MVUA 2F43G 5KUKA 3APQA 1JCHA 4TV9A 3MHSC 4U7NA 2FB5A 4JI8O 2GSMB 4QGPA 4NTWA 1Z2GA 3SYQA 3CE2A 1IDSA 1BSMA 1ORQC 1IBKO 3SPHA 4XDJA 1KUQA 2EJRA 1RPOA 3RW0A 3OMIB 1F23A 3D8CA 3CMAV 1V55C 1M56C 2Z5UA 3JD1A 4I9WA 4WFGA 4UFZA 2JRIA 4NTYA 1EN5A 1R1BA 4EB6A 1HNXB 1Y4MA 3CRMA 5IYCO 1FFXB 3E8HA 2OIGA 1LUVA 2O57A 3AG7A 5KHIA 2A79B 1WLEA 4I50B 2QEXV 2IJHA 2ADQB 2UUAO 1T5EA 4MVSA 1VMGA 1JVMA 4LNUA 1JJ2U 5IY5C 1WN7A 5IJ0B 1XDCA 5EK0A 3QTCA 3RFRA 2BTQA 2WLIB 2ZE7A 3K0GA 1Z5VA 2OCCB 4ZBMA 3WG7C 1E1QG 1SRYA 1FXKC 3B8NA 3J80N 3CRAA 1AI6A 4HNAA 2BSKA 4WCEV 1Q6UA 4AQYO 1HWYA 1W0JG 5LMUB 1KD1W 3UM7A 4CBCA 4R50A 2JEXA 4JYAB 1QU7A 3AG4B 5GTHZ 1XHZA 2AZ2A 3UO2A 1S3JA 3KCYA 4CZZA 1N4CA 1B3QA 2Q5ZA 4YJ2B 5BR8B 1VQ7V 1Q5OA 3JSLA 1MZEA 3QNEA 4XDKA 1RSOB 2A9HA 2JIZG 5JJJB 4YHHO 4CC6A 2YXLA 2OCCC 2PI4A 3BA9A 3S3WA 2UU9O 3HKBB 3GVMA 3RYCB 4O4IB 5J2TB 2D2CB 4IHJB 1XBLA 5IYZB 2FKXA 4RQEA 1IBLB 1SETA 2Q68A 3E8GA 2E5LO 4H33A 4FVMA 3RN4A 5GTIZ 4AILC 4G2KA 3AG4C 4JASA 3OEEG 1IZ3A 4I0XB 5DECA 3T1HB 2LO1A 5EZYB 1SKVA 2ZR3A 3K79A 3SJCC 3K5MA 4PELA 3P32A 2DN9A 1MOFA 3L70H 4HAMA 3I56V 3CX5F 2UUCB 1GAXA 1AI7A 3C90A 2AZ0A 4JYYA 4DV6O 4RO2A 5GONB 2A3QA 1YI2V 1LR1A 5CB4A 1Y67A 1VARA 1M4UA 3B8MA 4O4HB 3N27A 2ZIMA 3EFFK 3GB7C 4MTXA 4B3TB 2Y69B 3D3QA 1AB3A 4BIUA 4JI1O 2XOKG 4IYHA 1OCZC 3AG2B 1Z5WA 1TVKA 2AW9A 1K33A 4NR1A 1NZ6A 2NNUA 1F7YA 5KHGA 1SQBH 1V54B 3W7XA 2WWWA 1F4NA 1JJOA 4ZI7A 1AJNA 1K34A 3W7UA 2JGDB 2V4DA 1TUEB 4B3RO 2CK3G 4O4LA 2FYUH 2EILC 1DGSA 3LSUA 1XHXA 4TUYB 4JPRA 1KBHA 2LW1A 2VQEB 4UV9A 4DV4B 2IH3C 3D3IA 1VP7A 4JI3B 2Y69C 4TQDA 2A0LA 4WFEA 1FS0G 5J9PC 1N34O 3HKEA 2XAHA 3AG2C 2QE7G 1BE3H 3RBZA 2QWRB 2PTMA 5EC2C 3JALB 4PA7A 3K58A 1TAEA 3ABUA 3CCUV 4DUYO 2UUBO 1BQZA 1OCRB 5CBFA 3ABLC 3SR2C 1NR7A 1QVGU 4J80A 5BXZA 3A2FA 3ETDA 3HKDB 1XEQA 3VBBA 1VF6C 3SJBC 5E1AC 2P67A 3OTOB 1SZXA 2Q67A 4GKJO 1GM8A 2ODMA 3KZIZ 2LP7A 3M99B 1SERA 1VQ6V 1EN6A 4BIZA 2ZINA 2PYJA 1D5NA 1H2LA 1RM1B 1YEWA 2E75B 3L71H 4F6RA 2JK5C 4DV1O 2Z0AA 4NYKA 4KXRA 3ASNC 2P4KA 4CH5A 1Q81W 1BT8A 1LUWA 4LF6O 4LFAB 3GWOA 5H6RA 1D5AA 5LA6B 3CEIA 4GLXA 2QDOA 3E8FA 1AROP 2KQXA 4LFBB 3W7TA 1TGOA 2Q0AA 4IIJB 2HHHO 3ZHRA 4LF8O 1H8EG 4CC5A 2CAZC 3EVKA 2PGGA 4DV2O 2UXDO 4I7ZB 2UXBO 3H1LH 5A9GA 1RM1C 2WLMA 3ZEDA 2GV9A 5ITZA 1EZJA 4FLUA 1N8RW 4OX9B 2WLIA 3H1IH 1YITV 3CJHA 3P3PA 1MMMA 1SS3A 2DYSC 1XNQO 2OTJV 1WPBA 3ZRVA 4A5UB 4Q6GA 5LOVB 3JATB 1K4CC 4DR5B 5LP6A 3E86A 1WPXA 3MHHC 1GO3F 4DRXA 4QE9A 5KHJA 2YIDA 3THOA 2HJFC 2ZM6O 4ZOLB 1NTZH 5IT9N 1Q82W 2R9AA 3D36A 1MNGA 1ZTEA 4HYOA 1PKXA 1M57C 5JH7A 1YTFD 1SA0A 3BVOA 3AG1B 4QE7A 4DR7B 2XAGA 5JJNB 4BAYA 3NR7A 5A2QN 3KCXA 3CCJV 1AR4A 2X0LA 3TXSA 4GZRB 4X62O 1IBMO 3STZC 4JZ2A 1YJ9V 1FXHA 2B9ZA 1MSDA 3PN1A 2ZQMA 4O2BA 1S72V 4I5SA 3H1HH 3JASB 3ICXA 4D7TA 1K92A 3WB1A 2HR3A 2PYLA 4B3MB 1BS3A 3QO8A 1VQOV 3RVZA 4J7KA 4O2AB 3JARA 4HBNA 1HW7A 2QWQB 4X20B 4LWSA 4W4LA 4X1KA 1ZLZA 4KHPO 4YIOA 5LGUA 3SPCA 3RYIB 1YHQV 1Q43A 1NTKH 5D5PA 1EM1A 4PDVA 2X6CA 3HKCB 1AI5A 3ABTA 3LSSA 5JQGA 1Y74A 3LUTB 2WSSG 3UT5A 1G6UA 3TK1A 1VQNV 2KG7B 2BTOA 2EIMB 5B1NA 4OPAA 2Y4UA 4LP8A 4H44B 1M5IA 1R73A 1P4RA 1H2KA 3SJAC 3ZRWA 3K9SA 2YEVB 4P2ZA 3CD6V 2P4VA 3QVNA 5IJ9A 4UUJC 1NVPB 3BY6A 5DM6V 2WA3A 1XUQA 2Y0IA 2XAQA 3OD4A 1XMOB 4DR6B 3JYCA 5E79Z 2EULA 2XNDG 4JI6B 2WLLB 4MVOA 2Q9LA 5EC1C 4JTDB 2HJDA 3QO5A 3ZMUA 3IC9A 3FD9A 5HFMA 2YXHA 3G6BA 5CA1A 1IX9A 2YIAA 3FYEB 2P6JA 5IWAO 4YJ3B 5H9CA 2XUMA 4JAUA 1JPXA 1S5HC 4B08A 4GKKO 3ZRSA 3BCCH 3K06A 3ABKB 1NH2D 2VWJA 3UO3A 1ZL8B 1YZBA 2P7TC 4DXWA 1L8DA 3EXAA 4FFKA 3DGEA 4B3TO 4PA9A 1XI1A 1HNZO 3N2KA 4PD4F 3JAWA 1Y66A 4DR1O 1N32B 2NR5A 1Q6IA 1URFA 3ABKC 3STLC 3QO7A 3RYHB 1RPRA 1IXMA 3X2QC 3OUSA 2XHBA 1M56B 2FL4A 4N21A 3BA8A 4JV5B 1R3KC 2OTLV 5FL7G 2GTSA 3OR7C 4JI5B 3UKMA 5JVDB 2PI5A 4MW3A 1GH6A 5CA0B 3ETGA 5IYBO 2JGUA 2ZE5A 4UV8A 4XDLA 4QPKA 5CBGA 5IY5B 4KUMA 4X66B 1NI8A 2JJ1G 2V7QG 4O4JB 4YXWG 3BHPA 4TWKA 4NXNB 1BHAA 3AEIA 1JMKC 3WG7B 4GX0A 1FXKB 3IFXA 1JFFB 2LW7A 5JJEB 2KKWA 1YJNV 1OV9A 1AR1B 1KB9F 4H0LB 2IM9A 1Q8IA 1JR9A 2Q7GA 4MTGA 4X1YA 4I55A 3HB3B 3QG5A 3JAKB 2C2AA 3T1YO 2CH7A 4MTOA 4X1IB 2DQ3A 4J10A 5LHHA 4LF5O 5FPOA 1GN3A 3M8AA 4CS4A 2IW5A 4DW1A 4DV7O 2VQFB 2R9IA 3OT7A 1UFIA 1N33O 1AP5A 3B4SA 1WNSA 3CRRA 1KU9A 1VQ5V 5H6QA 2ZNIA 4LF4O 1AJPA 3CSXA 3K5LA 1R6TA 3H1JH 5C8YA 4NXMO 1Y76A 2ILMA 4EKWA 3VQYA 1JQ0A 2DMXA 1OHHG 1V9PA 1K97A 4RWUA 5JCOA 1XNRB 4LF7B 4W4KA 4D6TH 4WFHA 4ICGA 3P3NA 3LDDA 1MZFA 2X6AA 4DR4O 1XMQO 1QQCA 4JI0O 1N0NA 3JD4A 4MSWC 3IGAC 3ETEA 5LXTB 4K0KB 4U7OA 4YY3B 1FPOA 1US6A 2ETNA 1HR0B 5B3SB 4G27B 3F7VC 4P9OA 2BE3A 3ABMB 2N05A 3CXHF 4DR2O 1H38A 1PPJH 5TISZ 2GUZA 2EIKB 2E76B 2YIBA 4K8XA 5KHHA 3DXRB 5FNVB 5B1AC 4D7SA 2XASA 4PA6A 1PD3A 3N2GA 4P9PA 3JAMN 5J2UB 4ZHQB 2W6IG 4JI2O 1I08A 1OCZB 3CCQV 4FFBB 2F93B 2PY5A 1MSWD 1GTOA 1NS1A 4TOIA 4X65O 3APOA 1I94B 4H37A 5B3SC 4U3JA 4FLXA 4H13B 1R6KA 1WP8A 2F4VB 4DV3B 5LMNB 3ABMC 4JI4O 3OW2U 4XBFA 1H2SB 2Z3YA 1WA8B 2EILB 2QSAA 4B3SB 1ROPA 2EIKC 3E22A 4Q20A 3S3XA 2JS5A 1G4YB 1CP9A 4CH3A 2ZE6A 4DUZO 1EZVH 2RNBA 1N36B 5KMGA 5B1BC 4LFCO 1VF7A 1EFRG 1PV0A 3CRCA 1OCOC 4FIPC 4DV5B 1B04A 2EINC 4FK5C 5LHGA 3K5NA 1J5EB 3WB0A 5KX5A 1DF4A 1XOUA 2YI8A 3ABLB 2Q69A 4PJ0Z 4J7JA 1TUBB 2H94A 2ITCC 1YSCA 2EZOA 3DSQA 3T4ZA 3ZJZA 4DR3O 3FAVA 1MG1A 1HP8A 1VQ4V 3OGCC 3BRCA 4KP4A 2R70A 3L75H 1VQMV 1SQPH 4JYCA 1BCCH 3I55V 2L6LA 5BMVB 2ZDIA 4R8CA 5LYJB 1K5QA 1HNWO 2X6BA 3RYFB 4WBNB 3FYIB 4JI6O 4JI8B 3ASNB 5CMUA 2NN4A 4LF9O 3WFVA 3L73H 1DK1A 3QF7A 4QIWF 3O9OA 2QKSA 2UXNA 1IBKB 4N23A 4IGGA 3B40A 1RP3B 1GKFA 3ZN1A 4TV8B 2VRZA 4BW9A 1S76D 1DLBA 4I4TB 2AHZA 4LBEC 4X9QA 3MAQA 1YF2A 1KP2A 3PJSK 1G8MA 3M7MX 4ZIBA 3OGIB 1JOYA 1YDXA 3ZMVA 3C3TA 4DV0O 1YTFB 1P7GA 1EBOA 1VF5B 3A0HZ 5EYPB 2DYSB 3OEHG 1A32A 4NVPA 2OYQA 4JI7O 2UUAB 2G38A 1COWG 1GM7A 4GUNA 5H2FZ 4UXNA 1R6NA 2N04A 2WPDG 3K5OA 1FFXA 3G71V 1RFYA 4I50A 2HVJC 3KG2A 4PHZA 4UB6Z 5IJ0A 1S77D 1WJZA 4AQYB 2UXCO 1I0HA 1M57B 5FLXN 3TJTA 4TV9B 3G67A 1QHTA 3ZMSA 4GYCB 4LCUC 4G28B 3DTUB 1E1RG 4L8JA 4JV5O 3FB5C 1SZTA 1FJGB 1XL4A 4YHHB 2IJJA 1F4MA 3UQ8A 1PL0A 2IU0A 2L35A 3RGBA 1VQPV 2UU9B 4E2LA 4YJ2A 2QGNA 4NB5A 3J81N 1I7FA 3I5DA 1RSOA 3BABA 4BW5A 2E5LB 4EB6B 1P49A 4EEQA 3HKBA 3RYCA 1YJWV 1FKAO 4PA4A 1K8AW 3BFRA 4O4IA 5J2TA 4IHJA 5K1XA 1VIBA 5IYZA 3K9AA 2QA4V 5GW7A 1KQSU 2DJVA 4LNUB 3B2EE 4FM0A 1HNXO 3F5WC 2BTQB 4I0XA 4DV6B 1IURA 3ZHTA 5EZYA 3ZHQA 2ATKC 1JX9A 2EJ7A 2EBOA 1R3LC 1QBZA 1KC8W 3SYCA 4X64B 2BCCH 4HNAB 2BSKB 2X7RB 2B1IA 2VWKA 5LBQA 1U96A 4R7CA 1Q3EA 3JD0A 3AK3A 3SPIA 3AK2A 2Q7EA 3SYPA 1KKCA 3ZBHA 1X4TA 5GONA 1ZWIC 3ZRXA 4NKGB 1VEWA 2ITDC 4JI1B 2QKAA 1NH2B 4O4HA 3SYOA 5LMUO 4PI2A 4JYAO 4YIPA 5IYDO 1DF5A 3CXCU 4C7UA 2OWOA 1P84F 5BR8O 1FXVA 1BQ0A 2HP8A 2N74A 4B3RB 4FLVA 2H8PC 1ENVA 4FMTA 2Q8VA 4FM1A 2PZSA 3WU2Z 1CEZA 3DC5A 3AK1A 1K9MW 1QLEC 4DO2A 5JCOC 2JGDA 1M90W 1Q90D 1BGYH 1X59A 5L3CA 1YIJV 4FPPA 3F5TA 2AXTZ 1SQVH 1N34B 2FTKA 1IBLO 5LL6Y 5EBWC 4TUYA 2BOCC 4GCZA 1DTOA 1VF6A 4QJFB 3Q4HB 1EN4A 4F6EA 3JD3A 4I9QA 4JTCB 2CGOA 4UVAA 1K4DC 3ZHUA 3T1HO 5DEDA 3W7WA 3K08A 4DUYB 2UUBB 3CCSV 1VQ9V 4BIOA 5CB4B 2UUCO 2YDEA 1E79G 1FYJA 2F95B 2OT5A 3JALA 3ETQA 3LDCA 1L1FA 1H8HG 2XT9A 3FX7A 4GKJB 1VQLV 1K3EA 1G1XB 2CTPA 3HKDA 2NLJC 3X2QB 1TVKB 3H1KH 3HR0A 2HVKC 3MD0A 3F7YC 3P30A 4JTAB 4QPJA 1N36O 2CGNA 4ZI7B 2P5OA 3W7SA 1WB8A 4GX5A 4DV1B 3CCRV 2EIJC 4LR3A 4O4LB 2LFSA 2YIBD 3TETA 5KLVH 4LF6B 3CMEV 1PM9A 3MDSA 4J41A 1VQKV 4MVRA 2XAFA 4FZ1A 3T4DA 2HHHB 3ZHSA 1YXBA 4LF8B 1THZA 4Z1MG 3HKEB 2ZCEA 5H5NA 5LA6A 4DV2B 2UXDB 2RQ6A 2VQEO 2UXBB 3K0DA 4DV4O 3G4SV 2B1GA 4IIJA 4JI3O 2IJKA 3DC6A 4GX2A 5L3BA 3B09A 4RUEA 1XNQB 1H2NA 2VS0A 3B77A 4WFAV 1P7BA 4WF9V 1H2GA 3CS5A 2WLJA 3SPGA 3ASOB 4J42A 2WLNA 4NTXA 1W0KG 3K03A 4JGSA 2LQTA 4UCRA 1OJHA 1AI4A 3FKSG 2ZM6B 2ZE8A 5LOVA 3OTOO 3JATA 2Q0OC 2ZDIC 2P06A 2GHYA 1WP7A 5KAIZ 4RAIA 1TA8A 2W6JG 4F6RB 1PNMA 4CH6A 2QM7A 3R65A 4MVMA 4ZOLA 1NQTA 1IVSA 1QR9A 3ZX6A 2YICA 4J9YB 1PP9H 2DW4A 3JD2A 4X62B 1IBMB 5EBMC 5BY1A 2RN9A 3FB8C 5LGNA 3ASOC 3OMNB 2A7WA 1QCEA 2AHYA 4LFAO 5KHKA 3K59A 3L9DA 4LFBO 1SQQH 4BWAA 2QWNB 5ITZB 1FFTB 4RUFA 4MTFA 2ADPA 3CJHB 2K1EA 1KMIZ 1PL4A 3JASA 4KHPB 2YI9A 5B1AB 4U3FH 2QM4A 2DQ0A 4OX9O 4O2AA 1SC5B 5B66Z 1XILA 2OCHA 4RQFA 4X20A 4LH7A 4PI0A 3GWKC 5LP6B 3J7AU 2DWEC 3RYIA 4DRXB 4AHCA 3CHXA 4UCSA 3E2EA 4FZ0A 3HKCA 1U97A 5L3FA 1FJGO 4R6ZA 1KKDA 4B7KA 4DR5O 2KG7A 1K5SA 3L74H 4ABMA 5JH7B 1HDJA 2XAJA 1SA0B 3G80A 3ZN0A 2LGQA 3WB2A 3FB7C 3CRQA 3OE7G 5B1BB 3CC4V 4PDMA 5BZBA 2WLKA 2YEVA 1OCOB 3JCUZ 1M1KW 2EINB 2YS8A 2F66C 3VQVA 2GTAA 3H9VA 4K8ZA 5LP6C 1NKDA 4DR7O 2PUSA 1NR1A 3FB6C 4O2BB 1BHBA 2RDCA 2D3OW 1XL6A 1H2MA 2WLLA 3D36C 5IWAB 3Q4HA 2F23A 2M7WA 2M6YA 3JARB 2DOSA 5L3DA 5KA5A 3ZIAG 4LWSB 4X1KB 2F1MA 3K57A 4B3MO 4LC1A 4X64O 4FLWA 4GKKB 4DK1A 1AVMA 3LSQA 1QVFU 2UXXA 4Z2WA 4WFBV 2E3CA 4YJ3A 4X8AA 5JQGB 2QWPB 4UCUA 1Y74B 3UT5B 5LHIA 3A0BZ 4JAVA 1AP6A 2FMLA 4KL1A 3T2MA 5B5EZ 1OZ0A 1HNZB 1AILA 3ZCCA 1ZL8A 5C93A 4UCTA 3ZRWB 2RCVA 3U10A 3H01A 3IAYA 2WA4A 1ZAUA 2WLHA 4QNHB 3OMAB 2LJ2A 5IJ9B 4DR1B 4E4EA 3CB2A 5EBLC 3G6EV 4FM2A 1SQXH 4ZKIA 1S5LZ 1NJIW 5L3GA 3R66A 1GRJA 2QWOB 3BAAA 1XQ8A 1GK9A 2DWDC 1QNMA 1MA1A 2YC0A 2YUAA 3CWBH 1PNKA 2QJ1A 3VOUA 1XMOO 4DR6O 5CA1B 3OTFA 4FLZA 2DE0X 3RT3C 1Y6XA 2CUGA 3RYHA 5CA3A 3ML0A 2IU3A 4CH4A 2HLDG 3CCLV 2DYRB 1OCCB 1S5JA 1V54C 1B06A 4DK0A 5JVDA 5CA0A 5DN6G 4UCVA 2QKCA 4MVZA 5CBHA
chains in the Genus database with same CATH topology
5KA6A 4R7CA 3JD0A 3SPIA 3SYPA 3ABKC 3STLC 4RQEA 3AG3B 3QO7A 1SETA 2MK3A 2Q68A 1RPRA 1ZWIC 3HPLC 3OM3B 1IXMA 3X2QC 3E8GA 3OUSA 2BOBC 4H33A 3ZRXA 1M56B 4N21A 4UVCA 4G2KA 3AG4C 2ITDC 1R3KC 3OEEG 4JASA 2OTLV 5FL7G 5L3EA 1NH2B 3CC7V 1FXKA 3OUFA 3OR7C 3SYOA 2ZR3A 5IYDO 3UKMA 3K79A 1DF5A 3CXCU 4PELA 2PI5A 3P32A 4MW3A 1MOFA 2QTOA 2DYRC 3LNMB 1OCCC 3ETGA 4HAMA 3I56V 5IYBO 4UV8A 1FXVA 3ZMZA 1OCRC 1AI7A 4XDLA 5LBQA 3CPWU 4QPKA 5CBGA 4RO2A 5IY5B 4KUMA 1SESA 1BL8A 2H8PC 1QR8A 1ENVA 4FMTA 1I5YA 2P90A 2JJ1G 1KP3A 2V7QG 4YXWG 1NBMG 1YI2V 1CEZA 1LNQA 4TWKA 1BHAA 2B5UA 3AEIA 3WG7B 2JDIG 3AG3C 1K9MW 4GX0A 1QLEC 4DO2A 1FXKB 3B8MA 1M90W 4GX1A 3IFXA 5L3CA 3E89A 4WFFA 1YIJV 3EFFK 1M9NA 4FPPA 1YJNV 1AR1B 2FTKA 3GB7C 5EBWC 4MTXA 5CN0A 2Y69B 2BOCC 4GCZA 1DTOA 4MTGA 4QJFB 4BIUA 4TT3G 2IH1C 3JD3A 2XOKG 3HB3B 4JTCB 3NXSA 1OCZC 1K4DC 3AG2B 4UVAA 1QLNA 2C2AA 3W7WA 1R3JC 3K08A 3CCSV 3CC2V 1K33A 4MTOA 2KB1A 2NNUA 2DQ3A 3K04A 1Q7YW 2YSUB 2JEUA 5LHHA 2ZD9A 1VQ9V 1UJWB 2EZPA 1V54B 3W7XA 1W2BU 1E79G 1F4NA 2WWWA 4J9ZB 1AJNA 1K34A 2OT5A 3W7UA 2IW5A 1TUEB 2R9IA 3LDCA 1L1FA 1H8HG 2CK3G 2EILC 4GT1A 1VQLV 1VQ5V 1K3EA 5H6QA 4JPRA 1AJPA 4UV9A 2IH3C 3D3IA 2Y69C 4EKWA 2NLJC 1JQ0A 3X2QB 2HVKC 3CCVV 2A0LA 4TSFG 1OHHG 2QM8A 4WFEA 1FS0G 5J9PC 1K97A 2WAMA 2XAHA 3EHBB 3AG2C 1Q86W 2QE7G 2V1DA 3OAAG 4MT8A 3MD0A 4WFHA 3F7YC 3P30A 4JTAB 2HFEC 3RBZA 4QPJA 3LDDA 2X6AA 1K73W 5EC2C 3W7SA 4GX5A 4PA7A 3A0RA 3CCRV 4P30A 5B1OA 3JD4A 4MSWC 2EIJC 3IGAC 3ETEA 3ABUA 3CCMV 3CCUV 4U7OA 2LFSA 1OCRB 3TETA 1S0VA 3CMEV 3SJQC 5CBFA 3ABLC 1NR7A 5B3SB 3IC7A 4G27B 1GMGA 3F7VC 4MVRA 4P9OA 1VQKV 2XAFA 1QVGU 3ETDA 3T4DA 3CCEV 3ABMB 3VBBA 1THZA 1PNLA 5E1AC 1H38A 2P67A 2W0FC 4Z1MG 1QLEB 5IDJA 2Q67A 2EIKB 1GM8A 3CYOA 4L87A 2HG5C 1KECA 3K0DA 4JYBA 3G4SV 4F4LA 2B1GA 2LP7A 3M99B 1SERA 1VQ6V 4BIZA 2IJKA 3K3WA 3BEHA 5B1AC 4GX2A 2XASA 4PA6A 1PD3A 1VQ8V 5L3BA 3E8BA 4P9PA 1R3IC 1RM1B 2W6IG 3AG1C 1OCZB 4RUEA 3CCQV 1MSWD 1GTOA 3B77A 2JK5C 2Y48A 4WFAV 1P7BA 3TCUA 4WF9V 4H37A 5B3SC 3ASNC 1Q81W 1H2GA 1F51A 1R6KA 2WLJA 3GWOA 5H6RA 3ABMC 3SPGA 3OW2U 3SPJA 3ASOB 4XBFA 2Z3YA 2WLNA 3E8FA 1AROP 3RVYA 2EILB 1W0KG 3K03A 4JGSA 1ROPA 3W7TA 2EIKC 4Q20A 1AI4A 4MVQA 3FKSG 1G4YB 1CP9A 1H8EG 4PDRA 2ZDIC 2ZR2A 2GHYA 4RAIA 1MABG 5B1BC 2W6JG 3CP1A 1RM1C 2WLMA 1PNMA 1EFRG 1EZJA 2QM7A 1N8RW 3R65A 1OCOC 4MVMA 4FIPC 2WLIA 1NQTA 2EINC 1YITV 1QR9A 4FK5C 4HZ3A 5LHGA 2EIJB 4J9YB 2DYSC 2OTJV 1DF4A 2DW4A 3JD2A 4KFMA 5EBMC 2ZXWB 3FB8C 5LGNA 1CPYA 3T1CA 3ABLB 3ASOC 2Q69A 1AJQA 3OMNB 3ZRVA 4OXSA 2EIMC 4UVBA 1QCEA 2LFRA 1J95A 2H94A 2ITCC 1K4CC 4MS2A 4X89A 2AHYA 4FJCC 1YSCA 2EZOA 3T4ZA 2IJIA 3ZJZA 2JJ2G 3E86A 1WPXA 3MHHC 1GO3F 1MG1A 1VQ4V 4QE9A 3OGCC 3E83A 1FFTB 4KP4A 1GM9A 4RUFA 2HJFC 4ASUG 5LGTA 4MTFA 4X88A 1VQMV 1Q82W 2K1EA 1BMFG 3D36A 4JYCA 3I55V 5KUMA 3E35A 5B1AB 4HYOA 1PKXA 1M57C 4PDLA 1YTFD 3SYAA 1B6QA 2ZDIA 3AG1B 2DQ0A 4R8CA 4QE7A 1K7DA 2XAGA 1K5QA 4BAYA 4RQFA 5HFLA 2ZXWC 2X6BA 3CCJV 3JCZA 3FYIB 2X0LA 3ASNB 2DWEC 5CMUA 3STZC 3WFVA 1YJ9V 3E2EA 1FXHA 3OR6C 3LDEA 4JF3A 3ZMTA 3OFNG 2ZQMA 4MW8A 5L3FA 4R6ZA 1S72V 1KKDA 4QIWF 4I5SA 2QKSA 2UXNA 4N23A 1I5XA 1K5SA 1K92A 2HR3A 1NVPD 3QO8A 1VQOV 2XAJA 3RVZA 1GKFA 3ZN0A 3ZN1A 3FB7C 3OE7G 1S76D 1DLBA 5B1BB 3CC4V 4PDMA 5BZBA 4LBEC 2AHZA 2WLKA 2YEVA 1KP2A 3PJSK 1G8MA 1OCOB 5LGUA 3SPCA 2R9RB 1M1KW 2EINB 1JOYA 4PA3A 1YHQV 3ZMVA 1V55B 2HKOA 1YTFB 2Q6AA 4PDVA 2X6CA 1EBOA 1NKDA 4MVUA 1AI5A 3ABTA 2DYSB 3LSSA 1NR1A 2F43G 3FB6C 3OEHG 3LUTB 2WSSG 1BHBA 5KUKA 1XL6A 2D3OW 3TK1A 1JCHA 1VQNV 1COWG 3MHSC 2WLLA 4U7NA 2GSMB 1GM7A 2EIMB 5B1NA 1R6NA 4UXNA 2WPDG 4LP8A 2M7WA 3G71V 1R73A 1P4RA 5L3DA 3SYQA 3ZRWA 5KA5A 3ZIAG 2HVJC 3KG2A 2YEVB 1ORQC 4P2ZA 3CD6V 3SPHA 4XDJA 4LC1A 2EJRA 4UUJC 1NVPB 3LSQA 1QVFU 1RPOA 2UXXA 3RW0A 3BY6A 4WFBV 5DM6V 3OMIB 1F23A 1S77D 2XAQA 3CMAV 4X8AA 1M57B 1V55C 3JYCA 1M56C 2Z5UA 3JD1A 5LHIA 4JAVA 2XNDG 3ZMSA 2WLLB 4I9WA 3T2MA 4WFGA 4LCUC 4MVOA 4G28B 5EC1C 3DTUB 4JTDB 1Y4MA 1OZ0A 3QO5A 1E1RG 3ZCCA 5IYCO 3FB5C 3ZMUA 3E8HA 5C93A 1SZTA 5HFMA 3ZRWB 3H01A 1XL4A 2A79B 1WLEA 2QEXV 2IJHA 2IJJA 2WLHA 4MVSA 1F4MA 4QNHB 1JVMA 1PL0A 2IU0A 5IY5C 3OMAB 1JJ2U 3FYEB 1VQPV 4E2LA 5EK0A 2P6JA 5EBLC 5H9CA 3G6EV 2WLIB 3K0GA 4ZKIA 2OCCB 1NJIW 5L3GA 4JAUA 4ZBMA 3WG7C 1E1QG 1JPXA 1SRYA 4BW5A 1GK9A 1FXKC 1S5HC 2DWDC 3B8NA 4WCEV 1AI6A 3ZRSA 3K06A 3ABKB 1PNKA 1NH2D 1YJWV 4PA4A 1K8AW 1HWYA 1W0JG 3VOUA 1KD1W 3UM7A 4CBCA 2P7TC 2JEXA 4R50A 4DXWA 2QA4V 3K9AA 5GW7A 3AG4B 1KQSU 1S3JA 4CZZA 3DGEA 5CA3A 3ML0A 4PA9A 2IU3A 2HLDG 1VQ7V 3F5WC 3QNEA 3CCLV 2DYRB 4XDKA 1OCCB 2ATKC 1JX9A 1V54C 2A9HA 2EBOA 1R3LC 2JIZG 1QBZA 1KC8W 3SYCA 1Y66A 2OCCC 2PI4A 5DN6G 4MVZA 2X7RB 5CBHA 2B1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  4E2L A;  5KA6 A;  2P6J A;  1MOF A;  2EZP A;  5CMU A;  1DLB A;  5H9C A;  1K34 A;  3WFV A;  2M7W A;  2OT5 A;  1DF4 A;  3P30 A;  5CN0 A;  5KA5 A;  1Y4M A;  2MK3 A;  3B77 A;  4JF3 A;  1JPX A;  1QR8 A;  1QCE A;  1ENV A;  3B8N A;  3CYO A;  4N21 A;  1EBO A;  1SZT A;  4G2K A;  5HFM A;  1I5Y A;  2EBO A;  3H01 A;  4N23 A;  1I5X A;  1QBZ A;  3CP1 A;  4JPR A;  4FJC C;  2EZO A;  1Y66 A;  3GWO A;  2LP7 A;  3MHH C;  3M99 B;  4FIP C;  1F23 A;  5HFL A;  1K33 A;  1MG1 A;  1DF5 A;  1QR9 A;  2X7R B;  3MHS C;  4FK5 C;  1JQ0 A;  4JGS A;  3K9A A; 
#chains in the Genus database with same CATH topology
 5KA6 A;  4PV1 B;  2XTA A;  3RWR D;  2ARH A;  3AG3 B;  4O4J A;  2MK3 A;  4UB8 Z;  3HPL C;  2Y0P A;  3OM3 B;  1Q6H A;  2BOB C;  4BR6 A;  4UVC A;  3C3S A;  3N2K B;  5L3E A;  3CC7 V;  1FXK A;  3OUF A;  1JFF A;  3IJ4 A;  3T1Y B;  3JAW B;  3A8T A;  4DW0 A;  2QTO A;  2DYR C;  3LNM B;  1OCC C;  3ZMZ A;  4LF5 B;  1OCR C;  3VQX A;  3CPW U;  3JAK A;  4DV7 B;  1SES A;  1BL8 A;  4J11 A;  1N33 B;  2E74 B;  1QR8 A;  3SDL A;  1I5Y A;  2P90 A;  1KP3 A;  1NBM G;  4X1I A;  1LNQ A;  4LF4 B;  2B5U A;  1N32 O;  2JDI G;  3AG3 C;  4NXM B;  1NT2 B;  3FFQ A;  1O9H A;  4GX1 A;  5D5Q A;  4IL6 Z;  3E89 A;  4WFF A;  1M9N A;  4JZG A;  5KAF Z;  1ZX3 A;  2RJZ A;  5CN0 A;  2CDY A;  4TT3 G;  2IH1 C;  4DR4 B;  4LH6 A;  1XMQ B;  4JI0 B;  3NXS A;  3LNN A;  1QLN A;  2JVD A;  1R3J C;  2QR4 A;  4K3A A;  5JWP A;  4JI5 O;  3CC2 V;  3O65 A;  2KB1 A;  3K04 A;  1Q7Y W;  2YSU B;  2JEU A;  2ZD9 A;  1UJW B;  1W59 A;  2EZP A;  4J7Z A;  1W2B U;  4J9Z B;  1SQG A;  5K1P A;  2OIE A;  2A06 H;  2ZNJ A;  4FLT A;  4X66 O;  4GT1 A;  5LXT A;  4DR2 B;  1UPG A;  2JS3 A;  4NXN O;  4X1Y B;  2Q73 A;  2CTR A;  4I55 B;  1FAF A;  3U11 A;  3CCV V;  4TSF G;  2QM8 A;  2CH7 B;  4JI2 B;  2WAM A;  3EHB B;  1Q86 W;  2V1D A;  3OAA G;  4MT8 A;  1SQF A;  2HFE C;  1K73 W;  4X65 B;  3A0R A;  3DXR A;  4P30 A;  5B1O A;  3VQW A;  2AGA A;  5FNV A;  3CCM V;  1XRE A;  4ZHQ A;  5J2U A;  1S0V A;  3SJQ C;  4JI4 B;  2YXY A;  3IC7 A;  4FFB A;  1GMG A;  5C8Y B;  1Y76 B;  2GBO A;  3CCE V;  2ZT9 B;  2VQF O;  1PNL A;  2W0F C;  4DUZ B;  1QLE B;  5IDJ A;  3U0Z A;  3CYO A;  4Z1V A;  4L87 A;  2HG5 C;  2H3O A;  1WA8 A;  1KEC A;  4LFC B;  4JYB A;  4F4L A;  1YCI A;  1WB7 A;  3K3W A;  1IXB A;  1N0J A;  3BEH A;  4UCO A;  1VQ8 V;  3E8B A;  2CE4 A;  1R3I C;  2ZIO A;  3SGI A;  1XNR O;  1ZUQ A;  3AG1 C;  4LF7 O;  2W0X A;  1FD9 A;  1CXZ B;  2MW2 B;  2Y48 A;  3KKY A;  4DYL A;  3TCU A;  4IT5 A;  1F51 A;  4K0K O;  4YY3 O;  2GUZ B;  4CS2 A;  3SPJ A;  1HR0 O;  4DR3 B;  3RVY A;  2K9P A;  2P22 C;  4MVQ A;  3ZS8 C;  4JAA A;  4OPH A;  1NTM H;  1TUB A;  4PDR A;  3N2G B;  2Y4T A;  2ZR2 A;  2KSD A;  3ZHV A;  4TQF A;  1MAB G;  1GN6 A;  3CP1 A;  1NU1 H;  3BPZ A;  1YVW A;  5FPR A;  1L0N H;  4U3J B;  1HNW B;  2RMK B;  1ZSP A;  2IBZ H;  4HZ3 A;  3TXQ A;  1L0L H;  1O9G A;  2PF4 E;  1BZK A;  2EIJ B;  5BMV A;  3UCS C;  4KFM A;  4LF9 B;  5F2V O;  2ZXW B;  4EFB A;  3E22 B;  1CPY A;  3T1C A;  1I94 O;  1AJQ A;  1D2D A;  5EIB C;  5LYJ A;  4OXS A;  2EIM C;  4UVB A;  2LFR A;  1J95 A;  2F4V O;  5IE9 A;  4DV3 O;  4MS2 A;  4X89 A;  5LMN O;  4FJC C;  3RYF A;  4WBN A;  2IJI A;  2JJ2 G;  4IYI A;  4B7E A;  4EFE A;  5KMG B;  4B3S O;  3L72 H;  3E83 A;  1GM9 A;  4ASU G;  5LGT A;  1WAZ A;  4X88 A;  4AI8 A;  2Q4P A;  1BMF G;  2Q7H A;  2R72 A;  2QTS A;  5KUM A;  1KYO F;  4FLY A;  4K35 A;  3E35 A;  2CTW A;  5KX5 B;  2HEP A;  4PDL A;  3SYA A;  1B6Q A;  4DV0 B;  3TGU H;  4TV8 A;  2ZKO A;  1K7D A;  4DV5 O;  4JI7 B;  5HFL A;  2ZXW C;  4I4T A;  5EIB D;  3JCZ A;  1J5E O;  2CTQ A;  3FAV B;  1JA8 A;  1AR5 A;  3OR6 C;  3LDE A;  4JF3 A;  5EYP A;  3ZMT A;  3OFN G;  4MW8 A;  5AG2 A;  1I5X A;  1NVP D;  1GN2 A;  3JSN A;  2LGW A;  2GDS A;  2UXC B;  2EX3 A;  1M93 A;  1SF9 A;  1GN4 A;  4CS3 A;  2R9R B;  4OGQ B;  4PA3 A;  1V55 B;  2HKO A;  2Q6A A;  4MVU A;  2F43 G;  5KUK A;  3APQ A;  1JCH A;  4TV9 A;  3MHS C;  4U7N A;  2FB5 A;  4JI8 O;  2GSM B;  4QGP A;  4NTW A;  1Z2G A;  3SYQ A;  3CE2 A;  1IDS A;  1BSM A;  1ORQ C;  1IBK O;  3SPH A;  4XDJ A;  1KUQ A;  2EJR A;  1RPO A;  3RW0 A;  3OMI B;  1F23 A;  3D8C A;  3CMA V;  1V55 C;  1M56 C;  2Z5U A;  3JD1 A;  4I9W A;  4WFG A;  4UFZ A;  2JRI A;  4NTY A;  1EN5 A;  1R1B A;  4EB6 A;  1HNX B;  1Y4M A;  3CRM A;  5IYC O;  1FFX B;  3E8H A;  2OIG A;  1LUV A;  2O57 A;  3AG7 A;  5KHI A;  2A79 B;  1WLE A;  4I50 B;  2QEX V;  2IJH A;  2ADQ B;  2UUA O;  1T5E A;  4MVS A;  1VMG A;  1JVM A;  4LNU A;  1JJ2 U;  5IY5 C;  1WN7 A;  5IJ0 B;  1XDC A;  5EK0 A;  3QTC A;  3RFR A;  2BTQ A;  2WLI B;  2ZE7 A;  3K0G A;  1Z5V A;  2OCC B;  4ZBM A;  3WG7 C;  1E1Q G;  1SRY A;  1FXK C;  3B8N A;  3J80 N;  3CRA A;  1AI6 A;  4HNA A;  2BSK A;  4WCE V;  1Q6U A;  4AQY O;  1HWY A;  1W0J G;  5LMU B;  1KD1 W;  3UM7 A;  4CBC A;  4R50 A;  2JEX A;  4JYA B;  1QU7 A;  3AG4 B;  5GTH Z;  1XHZ A;  2AZ2 A;  3UO2 A;  1S3J A;  3KCY A;  4CZZ A;  1N4C A;  1B3Q A;  2Q5Z A;  4YJ2 B;  5BR8 B;  1VQ7 V;  1Q5O A;  3JSL A;  1MZE A;  3QNE A;  4XDK A;  1RSO B;  2A9H A;  2JIZ G;  5JJJ B;  4YHH O;  4CC6 A;  2YXL A;  2OCC C;  2PI4 A;  3BA9 A;  3S3W A;  2UU9 O;  3HKB B;  3GVM A;  3RYC B;  4O4I B;  5J2T B;  2D2C B;  4IHJ B;  1XBL A;  5IYZ B;  2FKX A;  4RQE A;  1IBL B;  1SET A;  2Q68 A;  3E8G A;  2E5L O;  4H33 A;  4FVM A;  3RN4 A;  5GTI Z;  4AIL C;  4G2K A;  3AG4 C;  4JAS A;  3OEE G;  1IZ3 A;  4I0X B;  5DEC A;  3T1H B;  2LO1 A;  5EZY B;  1SKV A;  2ZR3 A;  3K79 A;  3SJC C;  3K5M A;  4PEL A;  3P32 A;  2DN9 A;  1MOF A;  3L70 H;  4HAM A;  3I56 V;  3CX5 F;  2UUC B;  1GAX A;  1AI7 A;  3C90 A;  2AZ0 A;  4JYY A;  4DV6 O;  4RO2 A;  5GON B;  2A3Q A;  1YI2 V;  1LR1 A;  5CB4 A;  1Y67 A;  1VAR A;  1M4U A;  3B8M A;  4O4H B;  3N27 A;  2ZIM A;  3EFF K;  3GB7 C;  4MTX A;  4B3T B;  2Y69 B;  3D3Q A;  1AB3 A;  4BIU A;  4JI1 O;  2XOK G;  4IYH A;  1OCZ C;  3AG2 B;  1Z5W A;  1TVK A;  2AW9 A;  1K33 A;  4NR1 A;  1NZ6 A;  2NNU A;  1F7Y A;  5KHG A;  1SQB H;  1V54 B;  3W7X A;  2WWW A;  1F4N A;  1JJO A;  4ZI7 A;  1AJN A;  1K34 A;  3W7U A;  2JGD B;  2V4D A;  1TUE B;  4B3R O;  2CK3 G;  4O4L A;  2FYU H;  2EIL C;  1DGS A;  3LSU A;  1XHX A;  4TUY B;  4JPR A;  1KBH A;  2LW1 A;  2VQE B;  4UV9 A;  4DV4 B;  2IH3 C;  3D3I A;  1VP7 A;  4JI3 B;  2Y69 C;  4TQD A;  2A0L A;  4WFE A;  1FS0 G;  5J9P C;  1N34 O;  3HKE A;  2XAH A;  3AG2 C;  2QE7 G;  1BE3 H;  3RBZ A;  2QWR B;  2PTM A;  5EC2 C;  3JAL B;  4PA7 A;  3K58 A;  1TAE A;  3ABU A;  3CCU V;  4DUY O;  2UUB O;  1BQZ A;  1OCR B;  5CBF A;  3ABL C;  3SR2 C;  1NR7 A;  1QVG U;  4J80 A;  5BXZ A;  3A2F A;  3ETD A;  3HKD B;  1XEQ A;  3VBB A;  1VF6 C;  3SJB C;  5E1A C;  2P67 A;  3OTO B;  1SZX A;  2Q67 A;  4GKJ O;  1GM8 A;  2ODM A;  3KZI Z;  2LP7 A;  3M99 B;  1SER A;  1VQ6 V;  1EN6 A;  4BIZ A;  2ZIN A;  2PYJ A;  1D5N A;  1H2L A;  1RM1 B;  1YEW A;  2E75 B;  3L71 H;  4F6R A;  2JK5 C;  4DV1 O;  2Z0A A;  4NYK A;  4KXR A;  3ASN C;  2P4K A;  4CH5 A;  1Q81 W;  1BT8 A;  1LUW A;  4LF6 O;  4LFA B;  3GWO A;  5H6R A;  1D5A A;  5LA6 B;  3CEI A;  4GLX A;  2QDO A;  3E8F A;  1ARO P;  2KQX A;  4LFB B;  3W7T A;  1TGO A;  2Q0A A;  4IIJ B;  2HHH O;  3ZHR A;  4LF8 O;  1H8E G;  4CC5 A;  2CAZ C;  3EVK A;  2PGG A;  4DV2 O;  2UXD O;  4I7Z B;  2UXB O;  3H1L H;  5A9G A;  1RM1 C;  2WLM A;  3ZED A;  2GV9 A;  5ITZ A;  1EZJ A;  4FLU A;  1N8R W;  4OX9 B;  2WLI A;  3H1I H;  1YIT V;  3CJH A;  3P3P A;  1MMM A;  1SS3 A;  2DYS C;  1XNQ O;  2OTJ V;  1WPB A;  3ZRV A;  4A5U B;  4Q6G A;  5LOV B;  3JAT B;  1K4C C;  4DR5 B;  5LP6 A;  3E86 A;  1WPX A;  3MHH C;  1GO3 F;  4DRX A;  4QE9 A;  5KHJ A;  2YID A;  3THO A;  2HJF C;  2ZM6 O;  4ZOL B;  1NTZ H;  5IT9 N;  1Q82 W;  2R9A A;  3D36 A;  1MNG A;  1ZTE A;  4HYO A;  1PKX A;  1M57 C;  5JH7 A;  1YTF D;  1SA0 A;  3BVO A;  3AG1 B;  4QE7 A;  4DR7 B;  2XAG A;  5JJN B;  4BAY A;  3NR7 A;  5A2Q N;  3KCX A;  3CCJ V;  1AR4 A;  2X0L A;  3TXS A;  4GZR B;  4X62 O;  1IBM O;  3STZ C;  4JZ2 A;  1YJ9 V;  1FXH A;  2B9Z A;  1MSD A;  3PN1 A;  2ZQM A;  4O2B A;  1S72 V;  4I5S A;  3H1H H;  3JAS B;  3ICX A;  4D7T A;  1K92 A;  3WB1 A;  2HR3 A;  2PYL A;  4B3M B;  1BS3 A;  3QO8 A;  1VQO V;  3RVZ A;  4J7K A;  4O2A B;  3JAR A;  4HBN A;  1HW7 A;  2QWQ B;  4X20 B;  4LWS A;  4W4L A;  4X1K A;  1ZLZ A;  4KHP O;  4YIO A;  5LGU A;  3SPC A;  3RYI B;  1YHQ V;  1Q43 A;  1NTK H;  5D5P A;  1EM1 A;  4PDV A;  2X6C A;  3HKC B;  1AI5 A;  3ABT A;  3LSS A;  5JQG A;  1Y74 A;  3LUT B;  2WSS G;  3UT5 A;  1G6U A;  3TK1 A;  1VQN V;  2KG7 B;  2BTO A;  2EIM B;  5B1N A;  4OPA A;  2Y4U A;  4LP8 A;  4H44 B;  1M5I A;  1R73 A;  1P4R A;  1H2K A;  3SJA C;  3ZRW A;  3K9S A;  2YEV B;  4P2Z A;  3CD6 V;  2P4V A;  3QVN A;  5IJ9 A;  4UUJ C;  1NVP B;  3BY6 A;  5DM6 V;  2WA3 A;  1XUQ A;  2Y0I A;  2XAQ A;  3OD4 A;  1XMO B;  4DR6 B;  3JYC A;  5E79 Z;  2EUL A;  2XND G;  4JI6 B;  2WLL B;  4MVO A;  2Q9L A;  5EC1 C;  4JTD B;  2HJD A;  3QO5 A;  3ZMU A;  3IC9 A;  3FD9 A;  5HFM A;  2YXH A;  3G6B A;  5CA1 A;  1IX9 A;  2YIA A;  3FYE B;  2P6J A;  5IWA O;  4YJ3 B;  5H9C A;  2XUM A;  4JAU A;  1JPX A;  1S5H C;  4B08 A;  4GKK O;  3ZRS A;  3BCC H;  3K06 A;  3ABK B;  1NH2 D;  2VWJ A;  3UO3 A;  1ZL8 B;  1YZB A;  2P7T C;  4DXW A;  1L8D A;  3EXA A;  4FFK A;  3DGE A;  4B3T O;  4PA9 A;  1XI1 A;  1HNZ O;  3N2K A;  4PD4 F;  3JAW A;  1Y66 A;  4DR1 O;  1N32 B;  2NR5 A;  1Q6I A;  1URF A;  3ABK C;  3STL C;  3QO7 A;  3RYH B;  1RPR A;  1IXM A;  3X2Q C;  3OUS A;  2XHB A;  1M56 B;  2FL4 A;  4N21 A;  3BA8 A;  4JV5 B;  1R3K C;  2OTL V;  5FL7 G;  2GTS A;  3OR7 C;  4JI5 B;  3UKM A;  5JVD B;  2PI5 A;  4MW3 A;  1GH6 A;  5CA0 B;  3ETG A;  5IYB O;  2JGU A;  2ZE5 A;  4UV8 A;  4XDL A;  4QPK A;  5CBG A;  5IY5 B;  4KUM A;  4X66 B;  1NI8 A;  2JJ1 G;  2V7Q G;  4O4J B;  4YXW G;  3BHP A;  4TWK A;  4NXN B;  1BHA A;  3AEI A;  1JMK C;  3WG7 B;  4GX0 A;  1FXK B;  3IFX A;  1JFF B;  2LW7 A;  5JJE B;  2KKW A;  1YJN V;  1OV9 A;  1AR1 B;  1KB9 F;  4H0L B;  2IM9 A;  1Q8I A;  1JR9 A;  2Q7G A;  4MTG A;  4X1Y A;  4I55 A;  3HB3 B;  3QG5 A;  3JAK B;  2C2A A;  3T1Y O;  2CH7 A;  4MTO A;  4X1I B;  2DQ3 A;  4J10 A;  5LHH A;  4LF5 O;  5FPO A;  1GN3 A;  3M8A A;  4CS4 A;  2IW5 A;  4DW1 A;  4DV7 O;  2VQF B;  2R9I A;  3OT7 A;  1UFI A;  1N33 O;  1AP5 A;  3B4S A;  1WNS A;  3CRR A;  1KU9 A;  1VQ5 V;  5H6Q A;  2ZNI A;  4LF4 O;  1AJP A;  3CSX A;  3K5L A;  1R6T A;  3H1J H;  5C8Y A;  4NXM O;  1Y76 A;  2ILM A;  4EKW A;  3VQY A;  1JQ0 A;  2DMX A;  1OHH G;  1V9P A;  1K97 A;  4RWU A;  5JCO A;  1XNR B;  4LF7 B;  4W4K A;  4D6T H;  4WFH A;  4ICG A;  3P3N A;  3LDD A;  1MZF A;  2X6A A;  4DR4 O;  1XMQ O;  1QQC A;  4JI0 O;  1N0N A;  3JD4 A;  4MSW C;  3IGA C;  3ETE A;  5LXT B;  4K0K B;  4U7O A;  4YY3 B;  1FPO A;  1US6 A;  2ETN A;  1HR0 B;  5B3S B;  4G27 B;  3F7V C;  4P9O A;  2BE3 A;  3ABM B;  2N05 A;  3CXH F;  4DR2 O;  1H38 A;  1PPJ H;  5TIS Z;  2GUZ A;  2EIK B;  2E76 B;  2YIB A;  4K8X A;  5KHH A;  3DXR B;  5FNV B;  5B1A C;  4D7S A;  2XAS A;  4PA6 A;  1PD3 A;  3N2G A;  4P9P A;  3JAM N;  5J2U B;  4ZHQ B;  2W6I G;  4JI2 O;  1I08 A;  1OCZ B;  3CCQ V;  4FFB B;  2F93 B;  2PY5 A;  1MSW D;  1GTO A;  1NS1 A;  4TOI A;  4X65 O;  3APO A;  1I94 B;  4H37 A;  5B3S C;  4U3J A;  4FLX A;  4H13 B;  1R6K A;  1WP8 A;  2F4V B;  4DV3 B;  5LMN B;  3ABM C;  4JI4 O;  3OW2 U;  4XBF A;  1H2S B;  2Z3Y A;  1WA8 B;  2EIL B;  2QSA A;  4B3S B;  1ROP A;  2EIK C;  3E22 A;  4Q20 A;  3S3X A;  2JS5 A;  1G4Y B;  1CP9 A;  4CH3 A;  2ZE6 A;  4DUZ O;  1EZV H;  2RNB A;  1N36 B;  5KMG A;  5B1B C;  4LFC O;  1VF7 A;  1EFR G;  1PV0 A;  3CRC A;  1OCO C;  4FIP C;  4DV5 B;  1B04 A;  2EIN C;  4FK5 C;  5LHG A;  3K5N A;  1J5E B;  3WB0 A;  5KX5 A;  1DF4 A;  1XOU A;  2YI8 A;  3ABL B;  2Q69 A;  4PJ0 Z;  4J7J A;  1TUB B;  2H94 A;  2ITC C;  1YSC A;  2EZO A;  3DSQ A;  3T4Z A;  3ZJZ A;  4DR3 O;  3FAV A;  1MG1 A;  1HP8 A;  1VQ4 V;  3OGC C;  3BRC A;  4KP4 A;  2R70 A;  3L75 H;  1VQM V;  1SQP H;  4JYC A;  1BCC H;  3I55 V;  2L6L A;  5BMV B;  2ZDI A;  4R8C A;  5LYJ B;  1K5Q A;  1HNW O;  2X6B A;  3RYF B;  4WBN B;  3FYI B;  4JI6 O;  4JI8 B;  3ASN B;  5CMU A;  2NN4 A;  4LF9 O;  3WFV A;  3L73 H;  1DK1 A;  3QF7 A;  4QIW F;  3O9O A;  2QKS A;  2UXN A;  1IBK B;  4N23 A;  4IGG A;  3B40 A;  1RP3 B;  1GKF A;  3ZN1 A;  4TV8 B;  2VRZ A;  4BW9 A;  1S76 D;  1DLB A;  4I4T B;  2AHZ A;  4LBE C;  4X9Q A;  3MAQ A;  1YF2 A;  1KP2 A;  3PJS K;  1G8M A;  3M7M X;  4ZIB A;  3OGI B;  1JOY A;  1YDX A;  3ZMV A;  3C3T A;  4DV0 O;  1YTF B;  1P7G A;  1EBO A;  1VF5 B;  3A0H Z;  5EYP B;  2DYS B;  3OEH G;  1A32 A;  4NVP A;  2OYQ A;  4JI7 O;  2UUA B;  2G38 A;  1COW G;  1GM7 A;  4GUN A;  5H2F Z;  4UXN A;  1R6N A;  2N04 A;  2WPD G;  3K5O A;  1FFX A;  3G71 V;  1RFY A;  4I50 A;  2HVJ C;  3KG2 A;  4PHZ A;  4UB6 Z;  5IJ0 A;  1S77 D;  1WJZ A;  4AQY B;  2UXC O;  1I0H A;  1M57 B;  5FLX N;  3TJT A;  4TV9 B;  3G67 A;  1QHT A;  3ZMS A;  4GYC B;  4LCU C;  4G28 B;  3DTU B;  1E1R G;  4L8J A;  4JV5 O;  3FB5 C;  1SZT A;  1FJG B;  1XL4 A;  4YHH B;  2IJJ A;  1F4M A;  3UQ8 A;  1PL0 A;  2IU0 A;  2L35 A;  3RGB A;  1VQP V;  2UU9 B;  4E2L A;  4YJ2 A;  2QGN A;  4NB5 A;  3J81 N;  1I7F A;  3I5D A;  1RSO A;  3BAB A;  4BW5 A;  2E5L B;  4EB6 B;  1P49 A;  4EEQ A;  3HKB A;  3RYC A;  1YJW V;  1FKA O;  4PA4 A;  1K8A W;  3BFR A;  4O4I A;  5J2T A;  4IHJ A;  5K1X A;  1VIB A;  5IYZ A;  3K9A A;  2QA4 V;  5GW7 A;  1KQS U;  2DJV A;  4LNU B;  3B2E E;  4FM0 A;  1HNX O;  3F5W C;  2BTQ B;  4I0X A;  4DV6 B;  1IUR A;  3ZHT A;  5EZY A;  3ZHQ A;  2ATK C;  1JX9 A;  2EJ7 A;  2EBO A;  1R3L C;  1QBZ A;  1KC8 W;  3SYC A;  4X64 B;  2BCC H;  4HNA B;  2BSK B;  2X7R B;  2B1I A;  2VWK A;  5LBQ A;  1U96 A;  4R7C A;  1Q3E A;  3JD0 A;  3AK3 A;  3SPI A;  3AK2 A;  2Q7E A;  3SYP A;  1KKC A;  3ZBH A;  1X4T A;  5GON A;  1ZWI C;  3ZRX A;  4NKG B;  1VEW A;  2ITD C;  4JI1 B;  2QKA A;  1NH2 B;  4O4H A;  3SYO A;  5LMU O;  4PI2 A;  4JYA O;  4YIP A;  5IYD O;  1DF5 A;  3CXC U;  4C7U A;  2OWO A;  1P84 F;  5BR8 O;  1FXV A;  1BQ0 A;  2HP8 A;  2N74 A;  4B3R B;  4FLV A;  2H8P C;  1ENV A;  4FMT A;  2Q8V A;  4FM1 A;  2PZS A;  3WU2 Z;  1CEZ A;  3DC5 A;  3AK1 A;  1K9M W;  1QLE C;  4DO2 A;  5JCO C;  2JGD A;  1M90 W;  1Q90 D;  1BGY H;  1X59 A;  5L3C A;  1YIJ V;  4FPP A;  3F5T A;  2AXT Z;  1SQV H;  1N34 B;  2FTK A;  1IBL O;  5LL6 Y;  5EBW C;  4TUY A;  2BOC C;  4GCZ A;  1DTO A;  1VF6 A;  4QJF B;  3Q4H B;  1EN4 A;  4F6E A;  3JD3 A;  4I9Q A;  4JTC B;  2CGO A;  4UVA A;  1K4D C;  3ZHU A;  3T1H O;  5DED A;  3W7W A;  3K08 A;  4DUY B;  2UUB B;  3CCS V;  1VQ9 V;  4BIO A;  5CB4 B;  2UUC O;  2YDE A;  1E79 G;  1FYJ A;  2F95 B;  2OT5 A;  3JAL A;  3ETQ A;  3LDC A;  1L1F A;  1H8H G;  2XT9 A;  3FX7 A;  4GKJ B;  1VQL V;  1K3E A;  1G1X B;  2CTP A;  3HKD A;  2NLJ C;  3X2Q B;  1TVK B;  3H1K H;  3HR0 A;  2HVK C;  3MD0 A;  3F7Y C;  3P30 A;  4JTA B;  4QPJ A;  1N36 O;  2CGN A;  4ZI7 B;  2P5O A;  3W7S A;  1WB8 A;  4GX5 A;  4DV1 B;  3CCR V;  2EIJ C;  4LR3 A;  4O4L B;  2LFS A;  2YIB D;  3TET A;  5KLV H;  4LF6 B;  3CME V;  1PM9 A;  3MDS A;  4J41 A;  1VQK V;  4MVR A;  2XAF A;  4FZ1 A;  3T4D A;  2HHH B;  3ZHS A;  1YXB A;  4LF8 B;  1THZ A;  4Z1M G;  3HKE B;  2ZCE A;  5H5N A;  5LA6 A;  4DV2 B;  2UXD B;  2RQ6 A;  2VQE O;  2UXB B;  3K0D A;  4DV4 O;  3G4S V;  2B1G A;  4IIJ A;  4JI3 O;  2IJK A;  3DC6 A;  4GX2 A;  5L3B A;  3B09 A;  4RUE A;  1XNQ B;  1H2N A;  2VS0 A;  3B77 A;  4WFA V;  1P7B A;  4WF9 V;  1H2G A;  3CS5 A;  2WLJ A;  3SPG A;  3ASO B;  4J42 A;  2WLN A;  4NTX A;  1W0K G;  3K03 A;  4JGS A;  2LQT A;  4UCR A;  1OJH A;  1AI4 A;  3FKS G;  2ZM6 B;  2ZE8 A;  5LOV A;  3OTO O;  3JAT A;  2Q0O C;  2ZDI C;  2P06 A;  2GHY A;  1WP7 A;  5KAI Z;  4RAI A;  1TA8 A;  2W6J G;  4F6R B;  1PNM A;  4CH6 A;  2QM7 A;  3R65 A;  4MVM A;  4ZOL A;  1NQT A;  1IVS A;  1QR9 A;  3ZX6 A;  2YIC A;  4J9Y B;  1PP9 H;  2DW4 A;  3JD2 A;  4X62 B;  1IBM B;  5EBM C;  5BY1 A;  2RN9 A;  3FB8 C;  5LGN A;  3ASO C;  3OMN B;  2A7W A;  1QCE A;  2AHY A;  4LFA O;  5KHK A;  3K59 A;  3L9D A;  4LFB O;  1SQQ H;  4BWA A;  2QWN B;  5ITZ B;  1FFT B;  4RUF A;  4MTF A;  2ADP A;  3CJH B;  2K1E A;  1KMI Z;  1PL4 A;  3JAS A;  4KHP B;  2YI9 A;  5B1A B;  4U3F H;  2QM4 A;  2DQ0 A;  4OX9 O;  4O2A A;  1SC5 B;  5B66 Z;  1XIL A;  2OCH A;  4RQF A;  4X20 A;  4LH7 A;  4PI0 A;  3GWK C;  5LP6 B;  3J7A U;  2DWE C;  3RYI A;  4DRX B;  4AHC A;  3CHX A;  4UCS A;  3E2E A;  4FZ0 A;  3HKC A;  1U97 A;  5L3F A;  1FJG O;  4R6Z A;  1KKD A;  4B7K A;  4DR5 O;  2KG7 A;  1K5S A;  3L74 H;  4ABM A;  5JH7 B;  1HDJ A;  2XAJ A;  1SA0 B;  3G80 A;  3ZN0 A;  2LGQ A;  3WB2 A;  3FB7 C;  3CRQ A;  3OE7 G;  5B1B B;  3CC4 V;  4PDM A;  5BZB A;  2WLK A;  2YEV A;  1OCO B;  3JCU Z;  1M1K W;  2EIN B;  2YS8 A;  2F66 C;  3VQV A;  2GTA A;  3H9V A;  4K8Z A;  5LP6 C;  1NKD A;  4DR7 O;  2PUS A;  1NR1 A;  3FB6 C;  4O2B B;  1BHB A;  2RDC A;  2D3O W;  1XL6 A;  1H2M A;  2WLL A;  3D36 C;  5IWA B;  3Q4H A;  2F23 A;  2M7W A;  2M6Y A;  3JAR B;  2DOS A;  5L3D A;  5KA5 A;  3ZIA G;  4LWS B;  4X1K B;  2F1M A;  3K57 A;  4B3M O;  4LC1 A;  4X64 O;  4FLW A;  4GKK B;  4DK1 A;  1AVM A;  3LSQ A;  1QVF U;  2UXX A;  4Z2W A;  4WFB V;  2E3C A;  4YJ3 A;  4X8A A;  5JQG B;  2QWP B;  4UCU A;  1Y74 B;  3UT5 B;  5LHI A;  3A0B Z;  4JAV A;  1AP6 A;  2FML A;  4KL1 A;  3T2M A;  5B5E Z;  1OZ0 A;  1HNZ B;  1AIL A;  3ZCC A;  1ZL8 A;  5C93 A;  4UCT A;  3ZRW B;  2RCV A;  3U10 A;  3H01 A;  3IAY A;  2WA4 A;  1ZAU A;  2WLH A;  4QNH B;  3OMA B;  2LJ2 A;  5IJ9 B;  4DR1 B;  4E4E A;  3CB2 A;  5EBL C;  3G6E V;  4FM2 A;  1SQX H;  4ZKI A;  1S5L Z;  1NJI W;  5L3G A;  3R66 A;  1GRJ A;  2QWO B;  3BAA A;  1XQ8 A;  1GK9 A;  2DWD C;  1QNM A;  1MA1 A;  2YC0 A;  2YUA A;  3CWB H;  1PNK A;  2QJ1 A;  3VOU A;  1XMO O;  4DR6 O;  5CA1 B;  3OTF A;  4FLZ A;  2DE0 X;  3RT3 C;  1Y6X A;  2CUG A;  3RYH A;  5CA3 A;  3ML0 A;  2IU3 A;  4CH4 A;  2HLD G;  3CCL V;  2DYR B;  1OCC B;  1S5J A;  1V54 C;  1B06 A;  4DK0 A;  5JVD A;  5CA0 A;  5DN6 G;  4UCV A;  2QKC A;  4MVZ A;  5CBH A; 
#chains in the Genus database with same CATH homology
 5KA6 A;  4R7C A;  3JD0 A;  3SPI A;  3SYP A;  3ABK C;  3STL C;  4RQE A;  3AG3 B;  3QO7 A;  1SET A;  2MK3 A;  2Q68 A;  1RPR A;  1ZWI C;  3HPL C;  3OM3 B;  1IXM A;  3X2Q C;  3E8G A;  3OUS A;  2BOB C;  4H33 A;  3ZRX A;  1M56 B;  4N21 A;  4UVC A;  4G2K A;  3AG4 C;  2ITD C;  1R3K C;  3OEE G;  4JAS A;  2OTL V;  5FL7 G;  5L3E A;  1NH2 B;  3CC7 V;  1FXK A;  3OUF A;  3OR7 C;  3SYO A;  2ZR3 A;  5IYD O;  3UKM A;  3K79 A;  1DF5 A;  3CXC U;  4PEL A;  2PI5 A;  3P32 A;  4MW3 A;  1MOF A;  2QTO A;  2DYR C;  3LNM B;  1OCC C;  3ETG A;  4HAM A;  3I56 V;  5IYB O;  4UV8 A;  1FXV A;  3ZMZ A;  1OCR C;  1AI7 A;  4XDL A;  5LBQ A;  3CPW U;  4QPK A;  5CBG A;  4RO2 A;  5IY5 B;  4KUM A;  1SES A;  1BL8 A;  2H8P C;  1QR8 A;  1ENV A;  4FMT A;  1I5Y A;  2P90 A;  2JJ1 G;  1KP3 A;  2V7Q G;  4YXW G;  1NBM G;  1YI2 V;  1CEZ A;  1LNQ A;  4TWK A;  1BHA A;  2B5U A;  3AEI A;  3WG7 B;  2JDI G;  3AG3 C;  1K9M W;  4GX0 A;  1QLE C;  4DO2 A;  1FXK B;  3B8M A;  1M90 W;  4GX1 A;  3IFX A;  5L3C A;  3E89 A;  4WFF A;  1YIJ V;  3EFF K;  1M9N A;  4FPP A;  1YJN V;  1AR1 B;  2FTK A;  3GB7 C;  5EBW C;  4MTX A;  5CN0 A;  2Y69 B;  2BOC C;  4GCZ A;  1DTO A;  4MTG A;  4QJF B;  4BIU A;  4TT3 G;  2IH1 C;  3JD3 A;  2XOK G;  3HB3 B;  4JTC B;  3NXS A;  1OCZ C;  1K4D C;  3AG2 B;  4UVA A;  1QLN A;  2C2A A;  3W7W A;  1R3J C;  3K08 A;  3CCS V;  3CC2 V;  1K33 A;  4MTO A;  2KB1 A;  2NNU A;  2DQ3 A;  3K04 A;  1Q7Y W;  2YSU B;  2JEU A;  5LHH A;  2ZD9 A;  1VQ9 V;  1UJW B;  2EZP A;  1V54 B;  3W7X A;  1W2B U;  1E79 G;  1F4N A;  2WWW A;  4J9Z B;  1AJN A;  1K34 A;  2OT5 A;  3W7U A;  2IW5 A;  1TUE B;  2R9I A;  3LDC A;  1L1F A;  1H8H G;  2CK3 G;  2EIL C;  4GT1 A;  1VQL V;  1VQ5 V;  1K3E A;  5H6Q A;  4JPR A;  1AJP A;  4UV9 A;  2IH3 C;  3D3I A;  2Y69 C;  4EKW A;  2NLJ C;  1JQ0 A;  3X2Q B;  2HVK C;  3CCV V;  2A0L A;  4TSF G;  1OHH G;  2QM8 A;  4WFE A;  1FS0 G;  5J9P C;  1K97 A;  2WAM A;  2XAH A;  3EHB B;  3AG2 C;  1Q86 W;  2QE7 G;  2V1D A;  3OAA G;  4MT8 A;  3MD0 A;  4WFH A;  3F7Y C;  3P30 A;  4JTA B;  2HFE C;  3RBZ A;  4QPJ A;  3LDD A;  2X6A A;  1K73 W;  5EC2 C;  3W7S A;  4GX5 A;  4PA7 A;  3A0R A;  3CCR V;  4P30 A;  5B1O A;  3JD4 A;  4MSW C;  2EIJ C;  3IGA C;  3ETE A;  3ABU A;  3CCM V;  3CCU V;  4U7O A;  2LFS A;  1OCR B;  3TET A;  1S0V A;  3CME V;  3SJQ C;  5CBF A;  3ABL C;  1NR7 A;  5B3S B;  3IC7 A;  4G27 B;  1GMG A;  3F7V C;  4MVR A;  4P9O A;  1VQK V;  2XAF A;  1QVG U;  3ETD A;  3T4D A;  3CCE V;  3ABM B;  3VBB A;  1THZ A;  1PNL A;  5E1A C;  1H38 A;  2P67 A;  2W0F C;  4Z1M G;  1QLE B;  5IDJ A;  2Q67 A;  2EIK B;  1GM8 A;  3CYO A;  4L87 A;  2HG5 C;  1KEC A;  3K0D A;  4JYB A;  3G4S V;  4F4L A;  2B1G A;  2LP7 A;  3M99 B;  1SER A;  1VQ6 V;  4BIZ A;  2IJK A;  3K3W A;  3BEH A;  5B1A C;  4GX2 A;  2XAS A;  4PA6 A;  1PD3 A;  1VQ8 V;  5L3B A;  3E8B A;  4P9P A;  1R3I C;  1RM1 B;  2W6I G;  3AG1 C;  1OCZ B;  4RUE A;  3CCQ V;  1MSW D;  1GTO A;  3B77 A;  2JK5 C;  2Y48 A;  4WFA V;  1P7B A;  3TCU A;  4WF9 V;  4H37 A;  5B3S C;  3ASN C;  1Q81 W;  1H2G A;  1F51 A;  1R6K A;  2WLJ A;  3GWO A;  5H6R A;  3ABM C;  3SPG A;  3OW2 U;  3SPJ A;  3ASO B;  4XBF A;  2Z3Y A;  2WLN A;  3E8F A;  1ARO P;  3RVY A;  2EIL B;  1W0K G;  3K03 A;  4JGS A;  1ROP A;  3W7T A;  2EIK C;  4Q20 A;  1AI4 A;  4MVQ A;  3FKS G;  1G4Y B;  1CP9 A;  1H8E G;  4PDR A;  2ZDI C;  2ZR2 A;  2GHY A;  4RAI A;  1MAB G;  5B1B C;  2W6J G;  3CP1 A;  1RM1 C;  2WLM A;  1PNM A;  1EFR G;  1EZJ A;  2QM7 A;  1N8R W;  3R65 A;  1OCO C;  4MVM A;  4FIP C;  2WLI A;  1NQT A;  2EIN C;  1YIT V;  1QR9 A;  4FK5 C;  4HZ3 A;  5LHG A;  2EIJ B;  4J9Y B;  2DYS C;  2OTJ V;  1DF4 A;  2DW4 A;  3JD2 A;  4KFM A;  5EBM C;  2ZXW B;  3FB8 C;  5LGN A;  1CPY A;  3T1C A;  3ABL B;  3ASO C;  2Q69 A;  1AJQ A;  3OMN B;  3ZRV A;  4OXS A;  2EIM C;  4UVB A;  1QCE A;  2LFR A;  1J95 A;  2H94 A;  2ITC C;  1K4C C;  4MS2 A;  4X89 A;  2AHY A;  4FJC C;  1YSC A;  2EZO A;  3T4Z A;  2IJI A;  3ZJZ A;  2JJ2 G;  3E86 A;  1WPX A;  3MHH C;  1GO3 F;  1MG1 A;  1VQ4 V;  4QE9 A;  3OGC C;  3E83 A;  1FFT B;  4KP4 A;  1GM9 A;  4RUF A;  2HJF C;  4ASU G;  5LGT A;  4MTF A;  4X88 A;  1VQM V;  1Q82 W;  2K1E A;  1BMF G;  3D36 A;  4JYC A;  3I55 V;  5KUM A;  3E35 A;  5B1A B;  4HYO A;  1PKX A;  1M57 C;  4PDL A;  1YTF D;  3SYA A;  1B6Q A;  2ZDI A;  3AG1 B;  2DQ0 A;  4R8C A;  4QE7 A;  1K7D A;  2XAG A;  1K5Q A;  4BAY A;  4RQF A;  5HFL A;  2ZXW C;  2X6B A;  3CCJ V;  3JCZ A;  3FYI B;  2X0L A;  3ASN B;  2DWE C;  5CMU A;  3STZ C;  3WFV A;  1YJ9 V;  3E2E A;  1FXH A;  3OR6 C;  3LDE A;  4JF3 A;  3ZMT A;  3OFN G;  2ZQM A;  4MW8 A;  5L3F A;  4R6Z A;  1S72 V;  1KKD A;  4QIW F;  4I5S A;  2QKS A;  2UXN A;  4N23 A;  1I5X A;  1K5S A;  1K92 A;  2HR3 A;  1NVP D;  3QO8 A;  1VQO V;  2XAJ A;  3RVZ A;  1GKF A;  3ZN0 A;  3ZN1 A;  3FB7 C;  3OE7 G;  1S76 D;  1DLB A;  5B1B B;  3CC4 V;  4PDM A;  5BZB A;  4LBE C;  2AHZ A;  2WLK A;  2YEV A;  1KP2 A;  3PJS K;  1G8M A;  1OCO B;  5LGU A;  3SPC A;  2R9R B;  1M1K W;  2EIN B;  1JOY A;  4PA3 A;  1YHQ V;  3ZMV A;  1V55 B;  2HKO A;  1YTF B;  2Q6A A;  4PDV A;  2X6C A;  1EBO A;  1NKD A;  4MVU A;  1AI5 A;  3ABT A;  2DYS B;  3LSS A;  1NR1 A;  2F43 G;  3FB6 C;  3OEH G;  3LUT B;  2WSS G;  1BHB A;  5KUK A;  1XL6 A;  2D3O W;  3TK1 A;  1JCH A;  1VQN V;  1COW G;  3MHS C;  2WLL A;  4U7N A;  2GSM B;  1GM7 A;  2EIM B;  5B1N A;  1R6N A;  4UXN A;  2WPD G;  4LP8 A;  2M7W A;  3G71 V;  1R73 A;  1P4R A;  5L3D A;  3SYQ A;  3ZRW A;  5KA5 A;  3ZIA G;  2HVJ C;  3KG2 A;  2YEV B;  1ORQ C;  4P2Z A;  3CD6 V;  3SPH A;  4XDJ A;  4LC1 A;  2EJR A;  4UUJ C;  1NVP B;  3LSQ A;  1QVF U;  1RPO A;  2UXX A;  3RW0 A;  3BY6 A;  4WFB V;  5DM6 V;  3OMI B;  1F23 A;  1S77 D;  2XAQ A;  3CMA V;  4X8A A;  1M57 B;  1V55 C;  3JYC A;  1M56 C;  2Z5U A;  3JD1 A;  5LHI A;  4JAV A;  2XND G;  3ZMS A;  2WLL B;  4I9W A;  3T2M A;  4WFG A;  4LCU C;  4MVO A;  4G28 B;  5EC1 C;  3DTU B;  4JTD B;  1Y4M A;  1OZ0 A;  3QO5 A;  1E1R G;  3ZCC A;  5IYC O;  3FB5 C;  3ZMU A;  3E8H A;  5C93 A;  1SZT A;  5HFM A;  3ZRW B;  3H01 A;  1XL4 A;  2A79 B;  1WLE A;  2QEX V;  2IJH A;  2IJJ A;  2WLH A;  4MVS A;  1F4M A;  4QNH B;  1JVM A;  1PL0 A;  2IU0 A;  5IY5 C;  3OMA B;  1JJ2 U;  3FYE B;  1VQP V;  4E2L A;  5EK0 A;  2P6J A;  5EBL C;  5H9C A;  3G6E V;  2WLI B;  3K0G A;  4ZKI A;  2OCC B;  1NJI W;  5L3G A;  4JAU A;  4ZBM A;  3WG7 C;  1E1Q G;  1JPX A;  1SRY A;  4BW5 A;  1GK9 A;  1FXK C;  1S5H C;  2DWD C;  3B8N A;  4WCE V;  1AI6 A;  3ZRS A;  3K06 A;  3ABK B;  1PNK A;  1NH2 D;  1YJW V;  4PA4 A;  1K8A W;  1HWY A;  1W0J G;  3VOU A;  1KD1 W;  3UM7 A;  4CBC A;  2P7T C;  2JEX A;  4R50 A;  4DXW A;  2QA4 V;  3K9A A;  5GW7 A;  3AG4 B;  1KQS U;  1S3J A;  4CZZ A;  3DGE A;  5CA3 A;  3ML0 A;  4PA9 A;  2IU3 A;  2HLD G;  1VQ7 V;  3F5W C;  3QNE A;  3CCL V;  2DYR B;  4XDK A;  1OCC B;  2ATK C;  1JX9 A;  1V54 C;  2A9H A;  2EBO A;  1R3L C;  2JIZ G;  1QBZ A;  1KC8 W;  3SYC A;  1Y66 A;  2OCC C;  2PI4 A;  5DN6 G;  4MVZ A;  2X7R B;  5CBH A;  2B1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...