4DV5O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv5O00
4JI0O 4LFAO 4DV4O 4YHHO 2ZKOA 3RT3C 4DV0O 4DR5O 2FKXA 3J7AU 4NXMO 4DR3O 1N33O 2DOSA 4GKKO 2UXBO 1R6TA 1X59A 2UUCO 3T1HO 2JRIA 2VQEO 3F5TA 5IT9N 4LF5O 1HNZO 4DV5O 2UUAO 4X65O 4LF9O 1FJGO 4DV2O 5LMUO 2F4VO 4AQYO 1XNQO 4DR2O 5IWAO 2E5LO 1KUQA 1J5EO 4JI6O 4OPAA 3O65A 4DV7O 2AGAA 1D2DA 4JI3O 2N74A 4DUZO 1N36O 5H5NA 4OPHA 2UXCO 4OX9O 1HNXO 4LFBO 2LW7A 5A2QN 4K0KO 4JI8O 4A5UB 4GKJO 1I94O 3SDLA 4JI2O 1G1XB 4DUYO 1HNWO 1YZBA 1DK1A 4JV5O 1HR0O 1FYJA 3JAMN 1AILA 4X64O 5FLXN 3OTOO 2UXDO 4YY3O 4DV1O 1IBMO 3T1YO 4LF7O 5BR8O 4DV3O 1N32O 4LF6O 4B3RO 4JYAO 4JI4O 2UUBO 5BXZA 1N34O 1IBLO 4DR4O 1FKAO 4KHPO 4X62O 3M8AA 3J80N 5BY1A 1NS1A 2DJVA 4NXNO 4DV6O 5LMNO 3J81N 1XEQA 4JI7O 4B3TO 2UU9O 1XNRO 4LF4O 1IBKO 4LF8O 1R1BA 1XMOO 4B3SO 4JI1O 1XMQO 5LL6Y 4JI5O 1A32A 4DR1O 3R66A 4LFCO 2ZM6O 1F7YA 4DR6O 2Z0AA 2HHHO 4B3MO 1AB3A 2VQFO 4X66O 4DR7O
chains in the Genus database with same CATH superfamily
1Q8IA 2HLDG 4MT8A 3ETGA 1G6UA 3TXSA 4PA4A 3MDSA 3UM7A 2DOSA 3ETQA 1K73W 2F93B 5JCOC 3E35A 1M90W 3JD2A 3H1JH 1K33A 2WLHA 2PYJA 1NZ6A 4JI3B 1N36B 3CXHF 5B66Z 2EBOA 1VQ4V 2IH3C 4OPAA 1QR9A 5B1AC 3CD6V 3U10A 1YIJV 3BHPA 3WB1A 4OPHA 1R6KA 3VBBA 4PDMA 1NI8A 1QBZA 2UXXA 5B1NA 4X1IB 5IDJA 4JYAB 2XAHA 5LP6C 1SQQH 1AILA 3ZMSA 1V54C 4YY3O 3F7YC 2EIKC 1YEWA 4KUMA 4X89A 1W0KG 1NH2B 4QE7A 2E3CA 5BXZA 4LBEC 3PJSK 1IBKB 2AHYA 4FIPC 3TGUH 3S3WA 3FX7A 1SKVA 5CA0A 4K8XA 5KHKA 3ZHUA 3FKSG 4PA7A 4B3SO 4MVUA 2LJ2A 2XASA 3X2QB 5LYJA 3B77A 3OAAG 2QR4A 4JTDB 4JI0B 4UB6Z 5IYZA 1IDSA 1XUQA 4H0LB 1JX9A 3O9OA 3SPCA 5LYJB 2Q0OC 4JGSA 2QE7G 3ABMC 1BHAA 4K3AA 4PA9A 3CSXA 5JJNB 1H38A 2DYSC 4GZRB 2UUAB 4ZKIA 4DR3O 3LDDA 1W59A 4KXRA 4IYHA 5LMUB 5J2UB 2EZOA 1NVPD 3SPJA 1Q6HA 1B06A 4DV0B 3DXRA 2XAQA 5IYBO 1AJNA 1S5JA 5IWAO 2E5LO 4ZI7B 2RN9A 4O4LA 2VQEB 3SJCC 4JI8B 2MW2B 2ZD9A 1RSOB 1M9NA 2F43G 3OD4A 5EC1C 3F5WC 5A2QN 4K0KO 5EBWC 4GKJO 1I94O 1CPYA 4JI6B 5H6QA 4PA3A 4BIOA 4YIOA 1E79G 3SPGA 4LFBB 3RYIB 1IBLB 4X62B 2NR5A 2OCHA 4P9OA 1WLEA 3JALB 2WLLB 3CCRV 4JI4O 2G38A 4RQFA 2P6JA 1L8DA 4UV9A 3SYOA 3AK3A 1EN5A 3AG7A 4LF4B 2YXHA 1BL8A 3ZRWA 2QM4A 3JATA 5E79Z 1VQ9V 5BMVB 5C93A 3U11A 4GCZA 2DWEC 4LF8O 3JATB 4R50A 2HHHB 4FZ0A 3MD0A 2ETNA 1XMQO 2VQFB 2Q67A 2ZM6O 1XDCA 1O9GA 4LNUB 3ZMZA 2HKOA 2IM9A 2Z0AA 4AILC 1N33B 1AB3A 5IYCO 2YDEA 3L74H 2AXTZ 1XOUA 4I4TA 3RT3C 2YI8A 4Z1MG 1AR4A 3H1IH 2QKSA 2ZINA 1EFRG 3LSUA 4PHZA 3BY6A 4P30A 5KA5A 1GN4A 1YTFB 4AHCA 3S3XA 1D5NA 2ZXWC 4J41A 1J5EO 5EZYA 1QVGU 4QJFB 1OV9A 3OR7C 3JASA 1M1KW 4G27B 3E89A 3CCJV 4LCUC 2QKCA 3WB2A 1EBOA 3A0HZ 4HNAB 5LGNA 1DF5A 3JAKA 3H1KH 2P4KA 3ZBHA 2R9RB 3TETA 3VQYA 1HR0O 4X1YA 1VP7A 4JYYA 3JAKB 2UXDO 1AR1B 4WF9V 4LF7O 2QWOB 1SZTA 1AI6A 4JAUA 4Q20A 1FXKB 3FB6C 3UQ8A 3CYOA 2CTRA 2P4VA 4TOIA 1IXBA 4U3FH 3NXSA 3CRQA 5KMGA 4MW3A 1B6QA 3CE2A 4CS4A 2ZIOA 3ZHTA 1XEQA 1FPOA 4I55A 1JR9A 3AK1A 4EKWA 3C90A 1WJZA 2E74B 2RJZA 3CP1A 2XUMA 2DN9A 4B3MB 3OR6C 2JVDA 2WAMA 4R8CA 3CC7V 1H2MA 1JFFA 3ZMUA 3A8TA 2FL4A 3DSQA 5JQGB 2XNDG 2ATKC 3UT5A 1WB7A 4UB8Z 4DV4B 1KMIZ 4DR6O 3CCQV 1VF6A 5KHHA 2F66C 1QU7A 1OCRB 4MW8A 5ITZA 4PA6A 2Y4TA 4JI5B 4CZZA 3LSSA 4TUYB 1TA8A 1DGSA 2EULA 5B5EZ 3N27A 3ZRVA 2L35A 4I50B 1EN6A 5HFMA 5K1XA 1N0JA 1CXZB 4LF5O 1KKCA 4OXSA 1JQ0A 2QWNB 2WSSG 4H33A 1I7FA 2EIMB 5GONB 3G6BA 1RP3B 3ML0A 2RMKB 3B2EE 3SGIA 1M56C 1WA8A 4CS2A 1IXMA 4DXWA 4O2BB 3HPLC 2ZT9B 5LHIA 5H2FZ 2YSUB 3QO7A 2XT9A 3I56V 4DV3B 1NTZH 3KZIZ 4ZOLA 1OCCB 1YXBA 2Q4PA 1HW7A 4GT1A 4P9PA 1IBMO 1N34B 4DK0A 3JSNA 1WN7A 5BR8O 3JAWA 4R6ZA 4I0XA 3G6EV 3FB8C 3CXCU 3ABLC 4JI7B 4B3TB 5CB4A 5EIBC 3ABTA 2CK3G 2O57A 2PGGA 3RYFA 3M8AA 4X64B 1RM1C 4I0XB 1XNRB 1NS1A 4FLYA 4FLVA 3JD3A 1WP7A 4F6RB 1L1FA 1XILA 3PN1A 3RYFB 3W7SA 5JH7A 2UU9O 1U96A 3OFNG 2LQTA 1Q5OA 2AHZA 2PI4A 2BSKB 3AG1B 5GTHZ 2QTOA 5HFLA 4BR6A 2R9IA 5JH7B 4NTWA 3CCMV 4DR7B 3B8NA 4KP4A 3F7VC 4LWSA 1SQPH 1NTKH 3BEHA 5C8YA 1GM8A 4XDLA 1QVFU 4YHHO 4PELA 4B7EA 1Y74A 2R72A 5DN6G 5C8YB 1MA1A 1PV0A 2ZE7A 3NR7A 4MVMA 1PL0A 1URFA 1BCCH 1Y74B 1KP2A 4UCRA 4X88A 4QIWF 4KL1A 4E2LA 1ZWIC 1QLNA 4UVCA 2KG7A 2F4VO 3FYEB 2V7QG 4J7JA 4XDKA 1KUQA 1AROP 3ZMTA 1VIBA 1VF6C 3W7WA 3K0DA 5B1OA 5H5NA 3HKDB 1JPXA 1Q43A 5L3DA 1FJGB 2UXCO 3APQA 2H8PC 2CTWA 2F95B 2VS0A 4JV5O 2XAGA 4O4JA 2QM8A 1V9PA 5KHJA 3STZC 3T1YO 4C7UA 3HKCA 2JJ1G 2KQXA 2E76B 3HKBB 1R3IC 1DTOA 3L73H 4IIJA 4DUYB 1Q82W 3FB7C 4O4JB 5LXTB 4EFBA 4J9YB 1Y76A 3RYCB 1MMMA 3ASOC 1AR5A 1WAZA 1N8RW 5EYPB 1Q90D 3FD9A 4MVRA 4DV6O 2YEVA 2DQ3A 2EX3A 4NKGB 3ZEDA 3CJHB 2AW9A 2KSDA 4FM1A 2P67A 2OTJV 1LR1A 2V1DA 3K5NA 4FLWA 1VQKV 3DGEA 4LFCO 5L3EA 3LSQA 2M6YA 2LO1A 1VQ7V 3ABMB 1SC5B 2OWOA 5L3GA 1K97A 2H94A 1YHQV 2DYSB 1MG1A 3ZS8C 3CRCA 3AG1C 1YITV 4FFBA 2YC0A 1ROPA 2Q9LA 2GUZA 2LFRA 2RDCA 2PY5A 1IURA 1ZL8B 2D2CB 2UXBB 3JARA 1H8HG 4DV7O 1XL6A 3CHXA 1NTMH 1GMGA 1XREA 2CGNA 3L72H 4NVPA 5JJJB 4AQYB 1XNQB 3ZMVA 4YY3B 4EFEA 2YI9A 2ZIMA 2UXNA 4MVQA 2IJHA 4ZHQA 1K7DA 2ZNIA 2OIEA 5AG2A 2GBOA 1NT2B 1S77D 1JJOA 5D5PA 1V55B 1N32O 4JZGA 3E8GA 4JI2B 3E8BA 1ZAUA 1BQ0A 3CX5F 3CCLV 3MHSC 3BA9A 4WCEV 3JD0A 2WPDG 4X1KA 1SZXA 4KHPO 4N21A 1Y4MA 2YIBD 1SQFA 1XHZA 3GB7C 1FS0G 5JVDA 2Y69C 5CA1A 2YIDA 3RVZA 2VWKA 1H2GA 4B3SB 3T4ZA 5J2TA 3DC6A 5CA1B 4HZ3A 2VWJA 1XMOO 3QTCA 3C3TA 4JI1O 2BTQA 4U3JA 3FYIB 4LR3A 5JJEB 3EVKA 4JZ2A 5H9CA 1K5SA 3A0RA 4TQFA 1JVMA 3K9SA 4XBFA 1RPOA 4ZIBA 5EK0A 5LOVA 2YIBA 1Y6XA 2JIZG 3ABKC 1OCZB 5FPOA 5TISZ 1R73A 2EIJB 3P3NA 1QLEC 1VQLV 2FKXA 5LOVB 3B09A 5CA0B 1VF7A 1AJPA 1QR8A 4FLXA 4X66B 5IWAB 1M93A 3OW2U 1HNZO 1YCIA 2OTLV 2JGUA 5EBMC 1NBMG 1GKFA 5F2VO 2P06A 4D7SA 3VOUA 5IYZB 2ZXWB 1SQVH 2A0LA 1I94B 4I7ZB 1Q81W 3E8HA 1IX9A 4DV2B 4CH4A 3T2MA 1F23A 2GHYA 4D7TA 2P90A 3AK2A 3SPIA 1EM1A 3E22A 3K57A 1FYJA 4JI4B 4DV1O 1PD3A 3K5MA 1N4CA 4IL6Z 3DXRB 1X4TA 3E22B 4QPKA 2JS5A 1H2SB 3STLC 4MTXA 2RNBA 3EFFK 4B08A 4O4LB 1FKAO 2FMLA 5BZBA 1O9HA 2DMXA 2ODMA 4YXWG 2OT5A 4D6TH 1XMQB 2DYRC 3WFVA 2Y48A 4UV8A 2ZM6B 2V4DA 3DC5A 1V55C 1E1RG 3AEIA 1P7GA 2XAJA 4N23A 1NVPB 1VEWA 1KC8W 4TV9A 1NJIW 3CRRA 1MSWD 4UVAA 1PPJH 3ASNB 3CCSV 4Z1VA 5IJ0A 3MAQA 1SESA 5K1PA 1H8EG 4E4EA 4DV0O 2ZKOA 3ZRWB 2JGDA 2E75B 1K4DC 4CBCA 1B3QA 4GKKO 1BT8A 3VQWA 4J9ZB 4LH6A 2JRIA 2VQEO 1J5EB 1H2NA 4QE9A 4DV5O 4LF9O 2WLMA 1Q6IA 5LHHA 2BCCH 3VQXA 4DR2O 2A7WA 1OCZC 4DW1A 4IHJA 4JI6O 3IC7A 2EIJC 1M56B 1MZFA 2A06H 3K59A 1LNQA 2WLNA 2CTPA 1TGOA 4BIZA 1HR0B 4IHJB 5KAIZ 4I4TB 4LFBO 5GTIZ 2UXDB 5IY5B 4K35A 3CCVV 3SDLA 4LF7B 2QSAA 1KKDA 4DUZB 2EJRA 3JAMN 4IT5A 3OTOO 1K92A 2FTKA 2M7WA 2HJFC 2YICA 2CGOA 4KFMA 1VQPV 3ABLB 4HAMA 3OMIB 4FZ1A 5EZYB 4DR4O 1Q3EA 2W6JG 1S76D 3JASB 1RM1B 1VMGA 5DM6V 4NXNO 5LA6A 3FAVA 1GN6A 1AI4A 3J81N 1GN3A 1SF9A 2LGQA 2UUBB 1EZJA 3OUFA 3I55V 4DR6B 3FB5C 5LHGA 4X1YB 3W7UA 4JTCB 4WFHA 2MK3A 5LL6Y 4GX1A 2A9HA 3WG7B 1L0NH 1F4NA 3T1CA 4UCVA 1HWYA 1Q86W 1FFXA 4L87A 4TV8A 3WB0A 3A2FA 5DECA 3N2KA 4LFAO 2ZR2A 1AP6A 1FFXB 3GWKC 3LUTB 1KD1W 4WFAV 5KMGB 4LF5B 1SETA 2ZE8A 2JK5C 2OCCB 3JCZA 4I55B 1MNGA 3B8MA 4DO2A 3T1HO 2CE4A 3F5TA 2XOKG 5CBGA 1H2LA 3SJQC 1QNMA 1JFFB 3ASNC 3H9VA 1AJQA 1PL4A 2QGNA 2DW4A 2ZE6A 3UT5B 3E8FA 3P3PA 3UO3A 1VQ8V 1EZVH 3RYHA 1ZX3A 1GK9A 4Q6GA 4K8ZA 5ITZB 4LH7A 3K79A 3HKEA 2B5UA 1MSDA 4R7CA 4QNHB 5BR8B 2P7TC 2PF4E 1HNWO 3SR2C 5B3SB 2PUSA 1HNXB 4W4KA 2EILB 2IJIA 4ABMA 4PV1B 3SJBC 3H1LH 2RQ6A 1WA8B 3IJ4A 2UU9B 5IY5C 4EB6A 2BOBC 1FAFA 1KB9F 3KCYA 1YVWA 3ASOB 4J11A 3UCSC 3U0ZA 2EZPA 5LMNO 4B3RB 1BE3H 1P49A 2XTAA 4G2KA 3QVNA 3M7MX 4DRXA 1GH6A 1JMKC 1SQXH 4LP8A 2P5OA 4ZOLB 1AVMA 2NLJC 4NTXA 4UVBA 4JI5O 3OGCC 4YHHB 2VRZA 3JAWB 4G28B 3IGAC 3D3IA 3D8CA 1UJWB 5CB4B 1ZUQA 4H37A 4WFGA 4DR1B 1CP9A 4DR5O 3ZHVA 3AG3C 2F4VB 1TVKA 2QWQB 5KAFZ 3CCUV 4GLXA 2UUCO 4MVSA 3R65A 3WG7C 5IT9N 3QG5A 2DWDC 1Q6UA 5L3CA 1ZSPA 4X65O 3K03A 2HEPA 2ADQB 1NR1A 1PNLA 2Q7EA 2UXCB 2A79B 2EINC 1BQZA 4LWSB 5KX5A 3CPWU 3OUSA 3ZIAG 1GRJA 2OCCC 1K5QA 4U7NA 4JV5B 1I08A 1YJNV 3GVMA 1YDXA 4CH6A 3T1YB 1HDJA 3EHBB 4MS2A 2W6IG 2QM7A 3JSLA 2Q6AA 4YJ3A 3N2GA 5JCOA 4X64O 4UFZA 3K3WA 2B1IA 1GTOA 2F1MA 5FL7G 4MTFA 3CS5A 4I9QA 4LF6O 4J7ZA 2KG7B 2NNUA 3SPHA 3RN4A 4DV6B 1BHBA 4DK1A 3BAAA 4EEQA 2DJVA 1QHTA 2QTSA 2Y69B 2F23A 2A3QA 4GX0A 5B3SC 4LFCB 2EILC 2CAZC 3TK1A 2HG5C 5IYDO 4O4IA 5LP6A 5IJ9A 1R3JC 1US6A 4PDVA 2QDOA 2HJDA 3THOA 4XDJA 3HKCB 4NTYA 3ZHQA 1PKXA 2Z5UA 1GN2A 4IIJB 5KHGA 2DQ0A 3ABKB 4FVMA 1Y76B 4O4HA 1QLEB 4NXMO 3RFRA 4FMTA 3JD1A 2YEVB 2GTAA 3LNNA 3ZRXA 4O4HB 1X59A 2K9PA 1RFYA 4NYKA 4IGGA 4DV7B 1FJGO 4I9WA 2B1GA 1K8AW 5FPRA 2QEXV 4WBNA 2B9ZA 1S5LZ 3H1HH 1YF2A 3IC9A 2IW5A 1SS3A 4OX9O 3E83A 4H44B 3G4SV 2NN4A 1IZ3A 1GO3F 1KU9A 1BZKA 4DUYO 1N32B 3E2EA 3E86A 1Z2GA 4FFBB 3CCEV 1BS3A 4UCUA 2GUZB 4KHPB 3VQVA 2LFSA 2YXYA 4CS3A 3CEIA 5IE9A 1PM9A 3JARB 5KA6A 1PNMA 3OT7A 4ASUG 1XMOB 2N04A 1S0VA 1JA8A 4JI1B 4L8JA 4LC1A 2DYRB 4BIUA 2X7RB 4YJ2A 4ZHQB 2ADPA 3W7XA 2HVJC 1PP9H 4CH3A 5CBHA 1T5EA 4YJ2B 3KG2A 1CEZA 2WA3A 2Q8VA 1NU1H 1NH2D 4X1KB 1WB8A 4X20A 5JVDB 1HNZB 4F6EA 3ZN1A 4X1IA 1RPRA 2UXBO 5J2TB 1XHXA 2Q0AA 4X20B 2YS8A 2W0FC 1OZ0A 1W0JG 3WU2Z 2BTQB 4GYCB 4U3JB 4DR3B 4AQYO 1M57C 1SQBH 1XNQO 2AZ0A 2L6LA 4FLUA 3QO8A 2WA4A 5E1AC 4QGPA 4JI3O 2N74A 1N36O 4GX5A 2X6BA 1BMFG 3CRMA 3CMEV 1I5YA 4DV1B 2E5LB 3L71H 4Z2WA 2ZQMA 4JI2O 2WLIA 2GTSA 3MHHC 4PDRA 1IVSA 1WNSA 1EN4A 1OHHG 3ETDA 3SYAA 1YJWV 4K0KB 3DTUB 4FPPA 3SJAC 4GKJB 2WLIB 3L75H 2HVKC 4JYAO 3TXQA 5CMUA 2KKWA 4WFBV 5L3BA 4NB5A 1F4MA 1K3EA 4FK5C 5BY1A 3OGIB 2JEXA 5EC2C 3JCUZ 5B1BB 3IAYA 1VF5B 2W0XA 4O2AA 5J2UA 4I5SA 1LUVA 3LDEA 1UPGA 1IBKO 1R1BA 4MTOA 1VQNV 3KKYA 1GM9A 4J7KA 4O2AB 4UUJC 3JYCA 2OYQA 4CC6A 2HFEC 1OCOC 1KECA 1J95A 4NR1A 2Z3YA 4ZI7A 1F7YA 4LF8B 1G8MA 1OJHA 1RSOA 4X66O 4FM2A 2Y0PA 4GKKB 4JI0O 1YSCA 4BW9A 3RWRD 4DV5B 1YJ9V 4LF9B 4P2ZA 4FJCC 2ZR3A 1F51A 4DR2B 3BPZA 4WFFA 3B40A 1KYOF 2QKAA 3KCXA 3RGBA 1P84F 4TWKA 3RYIA 3APOA 2UUAO 3BA8A 4DV2O 1S3JA 5KHIA 5LMUO 4TV9B 3GWOA 2JS3A 4IYIA 3JALA 2WLLA 2LW1A 4QPJA 2YIAA 1ZLZA 4TSFG 1GAXA 1D2DA 1SERA 5A9GA 2ARHA 1R6NA 5IJ0B 2XAFA 3P30A 1D5AA 5BMVA 3OTOB 2AZ2A 4JI8O 2JGDB 4UCOA 3LDCA 3TJTA 4GUNA 2YUAA 1DK1A 1R3LC 4DR4B 4PI2A 1YTFD 5KUKA 4LNUA 1TUBA 1KQSU 4NXNB 4W4LA 4MVZA 1SA0A 4X8AA 4JYCA 4MVOA 5LBQA 4U7OA 1VARA 1IBLO 4X62O 1TUBB 2GV9A 5KLVH 3K5OA 1SA0B 5EIBD 2P22C 4RUEA 4HBNA 3K0GA 4LF4O 4RAIA 3QO5A 4DYLA 1XI1A 4AI8A 2Q73A 3CB2A 4ZBMA 3QNEA 1Z5VA 3X2QC 2ILMA 4FM0A 2WWWA 2BE3A 1A32A 3K04A 3ZJZA 4LFAB 3HB3B 3QF7A 2HHHO 1QQCA 5LGUA 2H3OA 4J80A 1ZTEA 2VQFO 5B1BC 3HR0A 1P4RA 1I5XA 4HNAA 3T1HB 2PYLA 5KUMA 2PZSA 5LA6B 3ABUA 3FAVB 2IH1C 1N33O 1R3KC 2PTMA 3K06A 2BOCC 3AG3B 4PJ0Z 1VQOV 5JWPA 3BVOA 2HP8A 1K34A 2WLJA 1FXKA 5FNVA 1FXHA 4JAAA 2GDSA 2CTQA 3EXAA 2ZCEA 1MABG 2EINB 1WPXA 2AGAA 4HYOA 4TV8B 1M4UA 3ICXA 5FNVB 4DUZO 1XBLA 2C2AA 1TAEA 1HNWB 3N2KB 1AI5A 2IJJA 1NR7A 3OEHG 3AG2B 4J10A 2KB1A 1VQ6V 1YI2V 1FXVA 1YZBA 3BFRA 1MOFA 1VQ5V 4MTGA 3SYPA 3CWBH 5JQGA 3A0BZ 1FFTB 3M99B 2Q68A 4TQDA 3D3QA 5L3FA 5LMNB 2IU0A 2UUBO 4H13B 1XQ8A 4GX2A 3I5DA 3J80N 1IBMB 1FD9A 2Y0IA 3RYHB 3OMAB 4TUYA 4X9QA 3ZRSA 4UCTA 4JAVA 2Q5ZA 4I50A 1AP5A 3HKEB 2JJ2G 2N05A 2R70A 3K5LA 3D36A 5GONA 4UXNA 5DEDA 1G4YB 4RUFA 5CA3A 5CN0A 4B7KA 4B3MO 4DR5B 2BTOA 4O2BA 2UUCB 2K1EA 1JJ2U 4EB6B 4DV4O 3ZHRA 4JPRA 4FLTA 1S72V 4X65B 3JD4A 4BWAA 1HP8A 4J42A 4PD4F 5D5QA 1L0LH 4DRXB 1WPBA 2CDYA 3ZN0A 4BAYA 5GW7A 4RQEA 2WLKA 3IFXA 2X6AA 2X6CA 3B4SA 2Y4UA 4JYBA 3K9AA 5LGTA 2FB5A 4F6RA 3W7TA 1SRYA 3OMNB 1MZEA 1VQMV 1HNXO 4CH5A 2LW7A 1DF4A 3AG4B 4A5UB 3G80A 5J9PC 2QA4V 1UFIA 1G1XB 2BSKA 3FFQA 1BGYH 4LF6B 3BRCA 1TVKB 2ZE5A 2IJKA 1W2BU 1JOYA 4JTAB 5FLXN 4OGQB 3L9DA 2ZDIA 4DV3O 3RBZA 1FXKC 4B3RO 2GSMB 3OTFA 2ITCC 1AI7A 3H01A 3T4DA 4MSWC 3OE7G 3AG2C 2Q7GA 5KX5B 1N34O 3ZX6A 1DLBA 1KBHA 2ZNJA 2X0LA 2CUGA 1ORQC 4JI7O 4B3TO 3BCCH 2IU3A 1QCEA 3ETEA 3OM3B 1XNRO 2R9AA 2HR3A 4RWUA 2QJ1A 3SYQA 4YJ3B 3N2GB 5CBFA 3K58A 3C3SA 2Q69A 1N0NA 4DR1O 3CC2V 3R66A 4DW0A 3ZCCA 2QWRB 2QWPB 4JASA 2YXLA 4NXMB 1OCRC 5EBLC 3HKDA 3L70H 4DR7O 1Q7YW 5B1AB 3J7AU 1THZA 1JCHA 3K08A 1R6TA 1ENVA 4F4LA 4FFKA 2FYUH 3RVYA 1LUWA 1NKDA 2RCVA 1Y66A 3D36C 2EIMC 4CC5A 4O4IB 5LP6B 5H6RA 5IJ9B 1I0HA 3HKBA 1Z5WA 1M57B 1V54B 4OX9B 1P7BA 4ICGA 1SQGA 5LXTA 4UCSA 3O65A 3RYCA 3OEEG 2EIKB 1H2KA 5EYPA 4TT3G 2XHBA 3CJHA 4FLZA 2D3OW 2JDIG 1BSMA 1M5IA 2EJ7A 1KP3A 1OCCC 4JF3A 3SYCA 2DE0X 3Q4HA 3CRAA 1K9MW 1NQTA 2JEUA 2LGWA 4RO2A 2LP7A 3Q4HB 1B04A 1PNKA 3AG4C 4WBNB 1E1QG 1Y67A 3G67A 1TUEB 2CH7A 3P32A 3G71V 3LNMB 3TCUA 2Q7HA 4WFEA 3UKMA 3RW0A 2OIGA 2CH7B 2IBZH 1K4CC 2PI5A 3BABA 1COWG 1OCOB 2ITDC 1ZL8A 3UO2A 4PI0A 1XL4A 2ZDIC 4YIPA 4BW5A 3CC4V 4PDLA 1WP8A 1U97A 1S5HC 3CMAV 3ZHSA 1GM7A
chains in the Genus database with same CATH topology
4JI0O 4LFAO 4DV4O 4YHHO 2ZKOA 3RT3C 4DV0O 4DR5O 2FKXA 3J7AU 4NXMO 4DR3O 1N33O 2DOSA 4GKKO 2UXBO 1R6TA 1X59A 2UUCO 3T1HO 2JRIA 2VQEO 3F5TA 5IT9N 4LF5O 1HNZO 4DV5O 2UUAO 4X65O 4LF9O 1FJGO 4DV2O 5LMUO 2F4VO 4AQYO 1XNQO 4DR2O 5IWAO 2E5LO 1KUQA 1J5EO 4JI6O 4OPAA 3O65A 4DV7O 2AGAA 1D2DA 4JI3O 2N74A 4DUZO 1N36O 5H5NA 4OPHA 2UXCO 4OX9O 1HNXO 4LFBO 2LW7A 5A2QN 4K0KO 4JI8O 4A5UB 4GKJO 1I94O 3SDLA 4JI2O 1G1XB 4DUYO 1HNWO 1YZBA 1DK1A 4JV5O 1HR0O 1FYJA 3JAMN 1AILA 4X64O 5FLXN 3OTOO 2UXDO 4YY3O 4DV1O 1IBMO 3T1YO 4LF7O 5BR8O 4DV3O 1N32O 4LF6O 4B3RO 4JYAO 4JI4O 2UUBO 5BXZA 1N34O 1IBLO 4DR4O 1FKAO 4KHPO 4X62O 3M8AA 3J80N 5BY1A 1NS1A 2DJVA 4NXNO 4DV6O 5LMNO 3J81N 1XEQA 4JI7O 4B3TO 2UU9O 1XNRO 4LF4O 1IBKO 4LF8O 1R1BA 1XMOO 4B3SO 4JI1O 1XMQO 5LL6Y 4JI5O 1A32A 4DR1O 3R66A 4LFCO 2ZM6O 1F7YA 4DR6O 2Z0AA 2HHHO 4B3MO 1AB3A 2VQFO 4X66O 4DR7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 O;  4LFA O;  4DV4 O;  4YHH O;  2ZKO A;  3RT3 C;  4DV0 O;  4DR5 O;  2FKX A;  3J7A U;  4NXM O;  4DR3 O;  1N33 O;  2DOS A;  4GKK O;  2UXB O;  1R6T A;  1X59 A;  2UUC O;  3T1H O;  2JRI A;  2VQE O;  3F5T A;  5IT9 N;  4LF5 O;  1HNZ O;  4DV5 O;  2UUA O;  4X65 O;  4LF9 O;  1FJG O;  4DV2 O;  5LMU O;  2F4V O;  4AQY O;  1XNQ O;  4DR2 O;  5IWA O;  2E5L O;  1KUQ A;  1J5E O;  4JI6 O;  4OPA A;  3O65 A;  4DV7 O;  2AGA A;  1D2D A;  4JI3 O;  2N74 A;  4DUZ O;  1N36 O;  5H5N A;  4OPH A;  2UXC O;  4OX9 O;  1HNX O;  4LFB O;  2LW7 A;  5A2Q N;  4K0K O;  4JI8 O;  4A5U B;  4GKJ O;  1I94 O;  3SDL A;  4JI2 O;  1G1X B;  4DUY O;  1HNW O;  1YZB A;  1DK1 A;  4JV5 O;  1HR0 O;  1FYJ A;  3JAM N;  1AIL A;  4X64 O;  5FLX N;  3OTO O;  2UXD O;  4YY3 O;  4DV1 O;  1IBM O;  3T1Y O;  4LF7 O;  5BR8 O;  4DV3 O;  1N32 O;  4LF6 O;  4B3R O;  4JYA O;  4JI4 O;  2UUB O;  5BXZ A;  1N34 O;  1IBL O;  4DR4 O;  1FKA O;  4KHP O;  4X62 O;  3M8A A;  3J80 N;  5BY1 A;  1NS1 A;  2DJV A;  4NXN O;  4DV6 O;  5LMN O;  3J81 N;  1XEQ A;  4JI7 O;  4B3T O;  2UU9 O;  1XNR O;  4LF4 O;  1IBK O;  4LF8 O;  1R1B A;  1XMO O;  4B3S O;  4JI1 O;  1XMQ O;  5LL6 Y;  4JI5 O;  1A32 A;  4DR1 O;  3R66 A;  4LFC O;  2ZM6 O;  1F7Y A;  4DR6 O;  2Z0A A;  2HHH O;  4B3M O;  1AB3 A;  2VQF O;  4X66 O;  4DR7 O; 
#chains in the Genus database with same CATH topology
 1Q8I A;  2HLD G;  4MT8 A;  3ETG A;  1G6U A;  3TXS A;  4PA4 A;  3MDS A;  3UM7 A;  2DOS A;  3ETQ A;  1K73 W;  2F93 B;  5JCO C;  3E35 A;  1M90 W;  3JD2 A;  3H1J H;  1K33 A;  2WLH A;  2PYJ A;  1NZ6 A;  4JI3 B;  1N36 B;  3CXH F;  5B66 Z;  2EBO A;  1VQ4 V;  2IH3 C;  4OPA A;  1QR9 A;  5B1A C;  3CD6 V;  3U10 A;  1YIJ V;  3BHP A;  3WB1 A;  4OPH A;  1R6K A;  3VBB A;  4PDM A;  1NI8 A;  1QBZ A;  2UXX A;  5B1N A;  4X1I B;  5IDJ A;  4JYA B;  2XAH A;  5LP6 C;  1SQQ H;  1AIL A;  3ZMS A;  1V54 C;  4YY3 O;  3F7Y C;  2EIK C;  1YEW A;  4KUM A;  4X89 A;  1W0K G;  1NH2 B;  4QE7 A;  2E3C A;  5BXZ A;  4LBE C;  3PJS K;  1IBK B;  2AHY A;  4FIP C;  3TGU H;  3S3W A;  3FX7 A;  1SKV A;  5CA0 A;  4K8X A;  5KHK A;  3ZHU A;  3FKS G;  4PA7 A;  4B3S O;  4MVU A;  2LJ2 A;  2XAS A;  3X2Q B;  5LYJ A;  3B77 A;  3OAA G;  2QR4 A;  4JTD B;  4JI0 B;  4UB6 Z;  5IYZ A;  1IDS A;  1XUQ A;  4H0L B;  1JX9 A;  3O9O A;  3SPC A;  5LYJ B;  2Q0O C;  4JGS A;  2QE7 G;  3ABM C;  1BHA A;  4K3A A;  4PA9 A;  3CSX A;  5JJN B;  1H38 A;  2DYS C;  4GZR B;  2UUA B;  4ZKI A;  4DR3 O;  3LDD A;  1W59 A;  4KXR A;  4IYH A;  5LMU B;  5J2U B;  2EZO A;  1NVP D;  3SPJ A;  1Q6H A;  1B06 A;  4DV0 B;  3DXR A;  2XAQ A;  5IYB O;  1AJN A;  1S5J A;  5IWA O;  2E5L O;  4ZI7 B;  2RN9 A;  4O4L A;  2VQE B;  3SJC C;  4JI8 B;  2MW2 B;  2ZD9 A;  1RSO B;  1M9N A;  2F43 G;  3OD4 A;  5EC1 C;  3F5W C;  5A2Q N;  4K0K O;  5EBW C;  4GKJ O;  1I94 O;  1CPY A;  4JI6 B;  5H6Q A;  4PA3 A;  4BIO A;  4YIO A;  1E79 G;  3SPG A;  4LFB B;  3RYI B;  1IBL B;  4X62 B;  2NR5 A;  2OCH A;  4P9O A;  1WLE A;  3JAL B;  2WLL B;  3CCR V;  4JI4 O;  2G38 A;  4RQF A;  2P6J A;  1L8D A;  4UV9 A;  3SYO A;  3AK3 A;  1EN5 A;  3AG7 A;  4LF4 B;  2YXH A;  1BL8 A;  3ZRW A;  2QM4 A;  3JAT A;  5E79 Z;  1VQ9 V;  5BMV B;  5C93 A;  3U11 A;  4GCZ A;  2DWE C;  4LF8 O;  3JAT B;  4R50 A;  2HHH B;  4FZ0 A;  3MD0 A;  2ETN A;  1XMQ O;  2VQF B;  2Q67 A;  2ZM6 O;  1XDC A;  1O9G A;  4LNU B;  3ZMZ A;  2HKO A;  2IM9 A;  2Z0A A;  4AIL C;  1N33 B;  1AB3 A;  5IYC O;  2YDE A;  3L74 H;  2AXT Z;  1XOU A;  4I4T A;  3RT3 C;  2YI8 A;  4Z1M G;  1AR4 A;  3H1I H;  2QKS A;  2ZIN A;  1EFR G;  3LSU A;  4PHZ A;  3BY6 A;  4P30 A;  5KA5 A;  1GN4 A;  1YTF B;  4AHC A;  3S3X A;  1D5N A;  2ZXW C;  4J41 A;  1J5E O;  5EZY A;  1QVG U;  4QJF B;  1OV9 A;  3OR7 C;  3JAS A;  1M1K W;  4G27 B;  3E89 A;  3CCJ V;  4LCU C;  2QKC A;  3WB2 A;  1EBO A;  3A0H Z;  4HNA B;  5LGN A;  1DF5 A;  3JAK A;  3H1K H;  2P4K A;  3ZBH A;  2R9R B;  3TET A;  3VQY A;  1HR0 O;  4X1Y A;  1VP7 A;  4JYY A;  3JAK B;  2UXD O;  1AR1 B;  4WF9 V;  4LF7 O;  2QWO B;  1SZT A;  1AI6 A;  4JAU A;  4Q20 A;  1FXK B;  3FB6 C;  3UQ8 A;  3CYO A;  2CTR A;  2P4V A;  4TOI A;  1IXB A;  4U3F H;  3NXS A;  3CRQ A;  5KMG A;  4MW3 A;  1B6Q A;  3CE2 A;  4CS4 A;  2ZIO A;  3ZHT A;  1XEQ A;  1FPO A;  4I55 A;  1JR9 A;  3AK1 A;  4EKW A;  3C90 A;  1WJZ A;  2E74 B;  2RJZ A;  3CP1 A;  2XUM A;  2DN9 A;  4B3M B;  3OR6 C;  2JVD A;  2WAM A;  4R8C A;  3CC7 V;  1H2M A;  1JFF A;  3ZMU A;  3A8T A;  2FL4 A;  3DSQ A;  5JQG B;  2XND G;  2ATK C;  3UT5 A;  1WB7 A;  4UB8 Z;  4DV4 B;  1KMI Z;  4DR6 O;  3CCQ V;  1VF6 A;  5KHH A;  2F66 C;  1QU7 A;  1OCR B;  4MW8 A;  5ITZ A;  4PA6 A;  2Y4T A;  4JI5 B;  4CZZ A;  3LSS A;  4TUY B;  1TA8 A;  1DGS A;  2EUL A;  5B5E Z;  3N27 A;  3ZRV A;  2L35 A;  4I50 B;  1EN6 A;  5HFM A;  5K1X A;  1N0J A;  1CXZ B;  4LF5 O;  1KKC A;  4OXS A;  1JQ0 A;  2QWN B;  2WSS G;  4H33 A;  1I7F A;  2EIM B;  5GON B;  3G6B A;  1RP3 B;  3ML0 A;  2RMK B;  3B2E E;  3SGI A;  1M56 C;  1WA8 A;  4CS2 A;  1IXM A;  4DXW A;  4O2B B;  3HPL C;  2ZT9 B;  5LHI A;  5H2F Z;  2YSU B;  3QO7 A;  2XT9 A;  3I56 V;  4DV3 B;  1NTZ H;  3KZI Z;  4ZOL A;  1OCC B;  1YXB A;  2Q4P A;  1HW7 A;  4GT1 A;  4P9P A;  1IBM O;  1N34 B;  4DK0 A;  3JSN A;  1WN7 A;  5BR8 O;  3JAW A;  4R6Z A;  4I0X A;  3G6E V;  3FB8 C;  3CXC U;  3ABL C;  4JI7 B;  4B3T B;  5CB4 A;  5EIB C;  3ABT A;  2CK3 G;  2O57 A;  2PGG A;  3RYF A;  3M8A A;  4X64 B;  1RM1 C;  4I0X B;  1XNR B;  1NS1 A;  4FLY A;  4FLV A;  3JD3 A;  1WP7 A;  4F6R B;  1L1F A;  1XIL A;  3PN1 A;  3RYF B;  3W7S A;  5JH7 A;  2UU9 O;  1U96 A;  3OFN G;  2LQT A;  1Q5O A;  2AHZ A;  2PI4 A;  2BSK B;  3AG1 B;  5GTH Z;  2QTO A;  5HFL A;  4BR6 A;  2R9I A;  5JH7 B;  4NTW A;  3CCM V;  4DR7 B;  3B8N A;  4KP4 A;  3F7V C;  4LWS A;  1SQP H;  1NTK H;  3BEH A;  5C8Y A;  1GM8 A;  4XDL A;  1QVF U;  4YHH O;  4PEL A;  4B7E A;  1Y74 A;  2R72 A;  5DN6 G;  5C8Y B;  1MA1 A;  1PV0 A;  2ZE7 A;  3NR7 A;  4MVM A;  1PL0 A;  1URF A;  1BCC H;  1Y74 B;  1KP2 A;  4UCR A;  4X88 A;  4QIW F;  4KL1 A;  4E2L A;  1ZWI C;  1QLN A;  4UVC A;  2KG7 A;  2F4V O;  3FYE B;  2V7Q G;  4J7J A;  4XDK A;  1KUQ A;  1ARO P;  3ZMT A;  1VIB A;  1VF6 C;  3W7W A;  3K0D A;  5B1O A;  5H5N A;  3HKD B;  1JPX A;  1Q43 A;  5L3D A;  1FJG B;  2UXC O;  3APQ A;  2H8P C;  2CTW A;  2F95 B;  2VS0 A;  4JV5 O;  2XAG A;  4O4J A;  2QM8 A;  1V9P A;  5KHJ A;  3STZ C;  3T1Y O;  4C7U A;  3HKC A;  2JJ1 G;  2KQX A;  2E76 B;  3HKB B;  1R3I C;  1DTO A;  3L73 H;  4IIJ A;  4DUY B;  1Q82 W;  3FB7 C;  4O4J B;  5LXT B;  4EFB A;  4J9Y B;  1Y76 A;  3RYC B;  1MMM A;  3ASO C;  1AR5 A;  1WAZ A;  1N8R W;  5EYP B;  1Q90 D;  3FD9 A;  4MVR A;  4DV6 O;  2YEV A;  2DQ3 A;  2EX3 A;  4NKG B;  3ZED A;  3CJH B;  2AW9 A;  2KSD A;  4FM1 A;  2P67 A;  2OTJ V;  1LR1 A;  2V1D A;  3K5N A;  4FLW A;  1VQK V;  3DGE A;  4LFC O;  5L3E A;  3LSQ A;  2M6Y A;  2LO1 A;  1VQ7 V;  3ABM B;  1SC5 B;  2OWO A;  5L3G A;  1K97 A;  2H94 A;  1YHQ V;  2DYS B;  1MG1 A;  3ZS8 C;  3CRC A;  3AG1 C;  1YIT V;  4FFB A;  2YC0 A;  1ROP A;  2Q9L A;  2GUZ A;  2LFR A;  2RDC A;  2PY5 A;  1IUR A;  1ZL8 B;  2D2C B;  2UXB B;  3JAR A;  1H8H G;  4DV7 O;  1XL6 A;  3CHX A;  1NTM H;  1GMG A;  1XRE A;  2CGN A;  3L72 H;  4NVP A;  5JJJ B;  4AQY B;  1XNQ B;  3ZMV A;  4YY3 B;  4EFE A;  2YI9 A;  2ZIM A;  2UXN A;  4MVQ A;  2IJH A;  4ZHQ A;  1K7D A;  2ZNI A;  2OIE A;  5AG2 A;  2GBO A;  1NT2 B;  1S77 D;  1JJO A;  5D5P A;  1V55 B;  1N32 O;  4JZG A;  3E8G A;  4JI2 B;  3E8B A;  1ZAU A;  1BQ0 A;  3CX5 F;  3CCL V;  3MHS C;  3BA9 A;  4WCE V;  3JD0 A;  2WPD G;  4X1K A;  1SZX A;  4KHP O;  4N21 A;  1Y4M A;  2YIB D;  1SQF A;  1XHZ A;  3GB7 C;  1FS0 G;  5JVD A;  2Y69 C;  5CA1 A;  2YID A;  3RVZ A;  2VWK A;  1H2G A;  4B3S B;  3T4Z A;  5J2T A;  3DC6 A;  5CA1 B;  4HZ3 A;  2VWJ A;  1XMO O;  3QTC A;  3C3T A;  4JI1 O;  2BTQ A;  4U3J A;  3FYI B;  4LR3 A;  5JJE B;  3EVK A;  4JZ2 A;  5H9C A;  1K5S A;  3A0R A;  4TQF A;  1JVM A;  3K9S A;  4XBF A;  1RPO A;  4ZIB A;  5EK0 A;  5LOV A;  2YIB A;  1Y6X A;  2JIZ G;  3ABK C;  1OCZ B;  5FPO A;  5TIS Z;  1R73 A;  2EIJ B;  3P3N A;  1QLE C;  1VQL V;  2FKX A;  5LOV B;  3B09 A;  5CA0 B;  1VF7 A;  1AJP A;  1QR8 A;  4FLX A;  4X66 B;  5IWA B;  1M93 A;  3OW2 U;  1HNZ O;  1YCI A;  2OTL V;  2JGU A;  5EBM C;  1NBM G;  1GKF A;  5F2V O;  2P06 A;  4D7S A;  3VOU A;  5IYZ B;  2ZXW B;  1SQV H;  2A0L A;  1I94 B;  4I7Z B;  1Q81 W;  3E8H A;  1IX9 A;  4DV2 B;  4CH4 A;  3T2M A;  1F23 A;  2GHY A;  4D7T A;  2P90 A;  3AK2 A;  3SPI A;  1EM1 A;  3E22 A;  3K57 A;  1FYJ A;  4JI4 B;  4DV1 O;  1PD3 A;  3K5M A;  1N4C A;  4IL6 Z;  3DXR B;  1X4T A;  3E22 B;  4QPK A;  2JS5 A;  1H2S B;  3STL C;  4MTX A;  2RNB A;  3EFF K;  4B08 A;  4O4L B;  1FKA O;  2FML A;  5BZB A;  1O9H A;  2DMX A;  2ODM A;  4YXW G;  2OT5 A;  4D6T H;  1XMQ B;  2DYR C;  3WFV A;  2Y48 A;  4UV8 A;  2ZM6 B;  2V4D A;  3DC5 A;  1V55 C;  1E1R G;  3AEI A;  1P7G A;  2XAJ A;  4N23 A;  1NVP B;  1VEW A;  1KC8 W;  4TV9 A;  1NJI W;  3CRR A;  1MSW D;  4UVA A;  1PPJ H;  3ASN B;  3CCS V;  4Z1V A;  5IJ0 A;  3MAQ A;  1SES A;  5K1P A;  1H8E G;  4E4E A;  4DV0 O;  2ZKO A;  3ZRW B;  2JGD A;  2E75 B;  1K4D C;  4CBC A;  1B3Q A;  4GKK O;  1BT8 A;  3VQW A;  4J9Z B;  4LH6 A;  2JRI A;  2VQE O;  1J5E B;  1H2N A;  4QE9 A;  4DV5 O;  4LF9 O;  2WLM A;  1Q6I A;  5LHH A;  2BCC H;  3VQX A;  4DR2 O;  2A7W A;  1OCZ C;  4DW1 A;  4IHJ A;  4JI6 O;  3IC7 A;  2EIJ C;  1M56 B;  1MZF A;  2A06 H;  3K59 A;  1LNQ A;  2WLN A;  2CTP A;  1TGO A;  4BIZ A;  1HR0 B;  4IHJ B;  5KAI Z;  4I4T B;  4LFB O;  5GTI Z;  2UXD B;  5IY5 B;  4K35 A;  3CCV V;  3SDL A;  4LF7 B;  2QSA A;  1KKD A;  4DUZ B;  2EJR A;  3JAM N;  4IT5 A;  3OTO O;  1K92 A;  2FTK A;  2M7W A;  2HJF C;  2YIC A;  2CGO A;  4KFM A;  1VQP V;  3ABL B;  4HAM A;  3OMI B;  4FZ1 A;  5EZY B;  4DR4 O;  1Q3E A;  2W6J G;  1S76 D;  3JAS B;  1RM1 B;  1VMG A;  5DM6 V;  4NXN O;  5LA6 A;  3FAV A;  1GN6 A;  1AI4 A;  3J81 N;  1GN3 A;  1SF9 A;  2LGQ A;  2UUB B;  1EZJ A;  3OUF A;  3I55 V;  4DR6 B;  3FB5 C;  5LHG A;  4X1Y B;  3W7U A;  4JTC B;  4WFH A;  2MK3 A;  5LL6 Y;  4GX1 A;  2A9H A;  3WG7 B;  1L0N H;  1F4N A;  3T1C A;  4UCV A;  1HWY A;  1Q86 W;  1FFX A;  4L87 A;  4TV8 A;  3WB0 A;  3A2F A;  5DEC A;  3N2K A;  4LFA O;  2ZR2 A;  1AP6 A;  1FFX B;  3GWK C;  3LUT B;  1KD1 W;  4WFA V;  5KMG B;  4LF5 B;  1SET A;  2ZE8 A;  2JK5 C;  2OCC B;  3JCZ A;  4I55 B;  1MNG A;  3B8M A;  4DO2 A;  3T1H O;  2CE4 A;  3F5T A;  2XOK G;  5CBG A;  1H2L A;  3SJQ C;  1QNM A;  1JFF B;  3ASN C;  3H9V A;  1AJQ A;  1PL4 A;  2QGN A;  2DW4 A;  2ZE6 A;  3UT5 B;  3E8F A;  3P3P A;  3UO3 A;  1VQ8 V;  1EZV H;  3RYH A;  1ZX3 A;  1GK9 A;  4Q6G A;  4K8Z A;  5ITZ B;  4LH7 A;  3K79 A;  3HKE A;  2B5U A;  1MSD A;  4R7C A;  4QNH B;  5BR8 B;  2P7T C;  2PF4 E;  1HNW O;  3SR2 C;  5B3S B;  2PUS A;  1HNX B;  4W4K A;  2EIL B;  2IJI A;  4ABM A;  4PV1 B;  3SJB C;  3H1L H;  2RQ6 A;  1WA8 B;  3IJ4 A;  2UU9 B;  5IY5 C;  4EB6 A;  2BOB C;  1FAF A;  1KB9 F;  3KCY A;  1YVW A;  3ASO B;  4J11 A;  3UCS C;  3U0Z A;  2EZP A;  5LMN O;  4B3R B;  1BE3 H;  1P49 A;  2XTA A;  4G2K A;  3QVN A;  3M7M X;  4DRX A;  1GH6 A;  1JMK C;  1SQX H;  4LP8 A;  2P5O A;  4ZOL B;  1AVM A;  2NLJ C;  4NTX A;  4UVB A;  4JI5 O;  3OGC C;  4YHH B;  2VRZ A;  3JAW B;  4G28 B;  3IGA C;  3D3I A;  3D8C A;  1UJW B;  5CB4 B;  1ZUQ A;  4H37 A;  4WFG A;  4DR1 B;  1CP9 A;  4DR5 O;  3ZHV A;  3AG3 C;  2F4V B;  1TVK A;  2QWQ B;  5KAF Z;  3CCU V;  4GLX A;  2UUC O;  4MVS A;  3R65 A;  3WG7 C;  5IT9 N;  3QG5 A;  2DWD C;  1Q6U A;  5L3C A;  1ZSP A;  4X65 O;  3K03 A;  2HEP A;  2ADQ B;  1NR1 A;  1PNL A;  2Q7E A;  2UXC B;  2A79 B;  2EIN C;  1BQZ A;  4LWS B;  5KX5 A;  3CPW U;  3OUS A;  3ZIA G;  1GRJ A;  2OCC C;  1K5Q A;  4U7N A;  4JV5 B;  1I08 A;  1YJN V;  3GVM A;  1YDX A;  4CH6 A;  3T1Y B;  1HDJ A;  3EHB B;  4MS2 A;  2W6I G;  2QM7 A;  3JSL A;  2Q6A A;  4YJ3 A;  3N2G A;  5JCO A;  4X64 O;  4UFZ A;  3K3W A;  2B1I A;  1GTO A;  2F1M A;  5FL7 G;  4MTF A;  3CS5 A;  4I9Q A;  4LF6 O;  4J7Z A;  2KG7 B;  2NNU A;  3SPH A;  3RN4 A;  4DV6 B;  1BHB A;  4DK1 A;  3BAA A;  4EEQ A;  2DJV A;  1QHT A;  2QTS A;  2Y69 B;  2F23 A;  2A3Q A;  4GX0 A;  5B3S C;  4LFC B;  2EIL C;  2CAZ C;  3TK1 A;  2HG5 C;  5IYD O;  4O4I A;  5LP6 A;  5IJ9 A;  1R3J C;  1US6 A;  4PDV A;  2QDO A;  2HJD A;  3THO A;  4XDJ A;  3HKC B;  4NTY A;  3ZHQ A;  1PKX A;  2Z5U A;  1GN2 A;  4IIJ B;  5KHG A;  2DQ0 A;  3ABK B;  4FVM A;  1Y76 B;  4O4H A;  1QLE B;  4NXM O;  3RFR A;  4FMT A;  3JD1 A;  2YEV B;  2GTA A;  3LNN A;  3ZRX A;  4O4H B;  1X59 A;  2K9P A;  1RFY A;  4NYK A;  4IGG A;  4DV7 B;  1FJG O;  4I9W A;  2B1G A;  1K8A W;  5FPR A;  2QEX V;  4WBN A;  2B9Z A;  1S5L Z;  3H1H H;  1YF2 A;  3IC9 A;  2IW5 A;  1SS3 A;  4OX9 O;  3E83 A;  4H44 B;  3G4S V;  2NN4 A;  1IZ3 A;  1GO3 F;  1KU9 A;  1BZK A;  4DUY O;  1N32 B;  3E2E A;  3E86 A;  1Z2G A;  4FFB B;  3CCE V;  1BS3 A;  4UCU A;  2GUZ B;  4KHP B;  3VQV A;  2LFS A;  2YXY A;  4CS3 A;  3CEI A;  5IE9 A;  1PM9 A;  3JAR B;  5KA6 A;  1PNM A;  3OT7 A;  4ASU G;  1XMO B;  2N04 A;  1S0V A;  1JA8 A;  4JI1 B;  4L8J A;  4LC1 A;  2DYR B;  4BIU A;  2X7R B;  4YJ2 A;  4ZHQ B;  2ADP A;  3W7X A;  2HVJ C;  1PP9 H;  4CH3 A;  5CBH A;  1T5E A;  4YJ2 B;  3KG2 A;  1CEZ A;  2WA3 A;  2Q8V A;  1NU1 H;  1NH2 D;  4X1K B;  1WB8 A;  4X20 A;  5JVD B;  1HNZ B;  4F6E A;  3ZN1 A;  4X1I A;  1RPR A;  2UXB O;  5J2T B;  1XHX A;  2Q0A A;  4X20 B;  2YS8 A;  2W0F C;  1OZ0 A;  1W0J G;  3WU2 Z;  2BTQ B;  4GYC B;  4U3J B;  4DR3 B;  4AQY O;  1M57 C;  1SQB H;  1XNQ O;  2AZ0 A;  2L6L A;  4FLU A;  3QO8 A;  2WA4 A;  5E1A C;  4QGP A;  4JI3 O;  2N74 A;  1N36 O;  4GX5 A;  2X6B A;  1BMF G;  3CRM A;  3CME V;  1I5Y A;  4DV1 B;  2E5L B;  3L71 H;  4Z2W A;  2ZQM A;  4JI2 O;  2WLI A;  2GTS A;  3MHH C;  4PDR A;  1IVS A;  1WNS A;  1EN4 A;  1OHH G;  3ETD A;  3SYA A;  1YJW V;  4K0K B;  3DTU B;  4FPP A;  3SJA C;  4GKJ B;  2WLI B;  3L75 H;  2HVK C;  4JYA O;  3TXQ A;  5CMU A;  2KKW A;  4WFB V;  5L3B A;  4NB5 A;  1F4M A;  1K3E A;  4FK5 C;  5BY1 A;  3OGI B;  2JEX A;  5EC2 C;  3JCU Z;  5B1B B;  3IAY A;  1VF5 B;  2W0X A;  4O2A A;  5J2U A;  4I5S A;  1LUV A;  3LDE A;  1UPG A;  1IBK O;  1R1B A;  4MTO A;  1VQN V;  3KKY A;  1GM9 A;  4J7K A;  4O2A B;  4UUJ C;  3JYC A;  2OYQ A;  4CC6 A;  2HFE C;  1OCO C;  1KEC A;  1J95 A;  4NR1 A;  2Z3Y A;  4ZI7 A;  1F7Y A;  4LF8 B;  1G8M A;  1OJH A;  1RSO A;  4X66 O;  4FM2 A;  2Y0P A;  4GKK B;  4JI0 O;  1YSC A;  4BW9 A;  3RWR D;  4DV5 B;  1YJ9 V;  4LF9 B;  4P2Z A;  4FJC C;  2ZR3 A;  1F51 A;  4DR2 B;  3BPZ A;  4WFF A;  3B40 A;  1KYO F;  2QKA A;  3KCX A;  3RGB A;  1P84 F;  4TWK A;  3RYI A;  3APO A;  2UUA O;  3BA8 A;  4DV2 O;  1S3J A;  5KHI A;  5LMU O;  4TV9 B;  3GWO A;  2JS3 A;  4IYI A;  3JAL A;  2WLL A;  2LW1 A;  4QPJ A;  2YIA A;  1ZLZ A;  4TSF G;  1GAX A;  1D2D A;  1SER A;  5A9G A;  2ARH A;  1R6N A;  5IJ0 B;  2XAF A;  3P30 A;  1D5A A;  5BMV A;  3OTO B;  2AZ2 A;  4JI8 O;  2JGD B;  4UCO A;  3LDC A;  3TJT A;  4GUN A;  2YUA A;  1DK1 A;  1R3L C;  4DR4 B;  4PI2 A;  1YTF D;  5KUK A;  4LNU A;  1TUB A;  1KQS U;  4NXN B;  4W4L A;  4MVZ A;  1SA0 A;  4X8A A;  4JYC A;  4MVO A;  5LBQ A;  4U7O A;  1VAR A;  1IBL O;  4X62 O;  1TUB B;  2GV9 A;  5KLV H;  3K5O A;  1SA0 B;  5EIB D;  2P22 C;  4RUE A;  4HBN A;  3K0G A;  4LF4 O;  4RAI A;  3QO5 A;  4DYL A;  1XI1 A;  4AI8 A;  2Q73 A;  3CB2 A;  4ZBM A;  3QNE A;  1Z5V A;  3X2Q C;  2ILM A;  4FM0 A;  2WWW A;  2BE3 A;  1A32 A;  3K04 A;  3ZJZ A;  4LFA B;  3HB3 B;  3QF7 A;  2HHH O;  1QQC A;  5LGU A;  2H3O A;  4J80 A;  1ZTE A;  2VQF O;  5B1B C;  3HR0 A;  1P4R A;  1I5X A;  4HNA A;  3T1H B;  2PYL A;  5KUM A;  2PZS A;  5LA6 B;  3ABU A;  3FAV B;  2IH1 C;  1N33 O;  1R3K C;  2PTM A;  3K06 A;  2BOC C;  3AG3 B;  4PJ0 Z;  1VQO V;  5JWP A;  3BVO A;  2HP8 A;  1K34 A;  2WLJ A;  1FXK A;  5FNV A;  1FXH A;  4JAA A;  2GDS A;  2CTQ A;  3EXA A;  2ZCE A;  1MAB G;  2EIN B;  1WPX A;  2AGA A;  4HYO A;  4TV8 B;  1M4U A;  3ICX A;  5FNV B;  4DUZ O;  1XBL A;  2C2A A;  1TAE A;  1HNW B;  3N2K B;  1AI5 A;  2IJJ A;  1NR7 A;  3OEH G;  3AG2 B;  4J10 A;  2KB1 A;  1VQ6 V;  1YI2 V;  1FXV A;  1YZB A;  3BFR A;  1MOF A;  1VQ5 V;  4MTG A;  3SYP A;  3CWB H;  5JQG A;  3A0B Z;  1FFT B;  3M99 B;  2Q68 A;  4TQD A;  3D3Q A;  5L3F A;  5LMN B;  2IU0 A;  2UUB O;  4H13 B;  1XQ8 A;  4GX2 A;  3I5D A;  3J80 N;  1IBM B;  1FD9 A;  2Y0I A;  3RYH B;  3OMA B;  4TUY A;  4X9Q A;  3ZRS A;  4UCT A;  4JAV A;  2Q5Z A;  4I50 A;  1AP5 A;  3HKE B;  2JJ2 G;  2N05 A;  2R70 A;  3K5L A;  3D36 A;  5GON A;  4UXN A;  5DED A;  1G4Y B;  4RUF A;  5CA3 A;  5CN0 A;  4B7K A;  4B3M O;  4DR5 B;  2BTO A;  4O2B A;  2UUC B;  2K1E A;  1JJ2 U;  4EB6 B;  4DV4 O;  3ZHR A;  4JPR A;  4FLT A;  1S72 V;  4X65 B;  3JD4 A;  4BWA A;  1HP8 A;  4J42 A;  4PD4 F;  5D5Q A;  1L0L H;  4DRX B;  1WPB A;  2CDY A;  3ZN0 A;  4BAY A;  5GW7 A;  4RQE A;  2WLK A;  3IFX A;  2X6A A;  2X6C A;  3B4S A;  2Y4U A;  4JYB A;  3K9A A;  5LGT A;  2FB5 A;  4F6R A;  3W7T A;  1SRY A;  3OMN B;  1MZE A;  1VQM V;  1HNX O;  4CH5 A;  2LW7 A;  1DF4 A;  3AG4 B;  4A5U B;  3G80 A;  5J9P C;  2QA4 V;  1UFI A;  1G1X B;  2BSK A;  3FFQ A;  1BGY H;  4LF6 B;  3BRC A;  1TVK B;  2ZE5 A;  2IJK A;  1W2B U;  1JOY A;  4JTA B;  5FLX N;  4OGQ B;  3L9D A;  2ZDI A;  4DV3 O;  3RBZ A;  1FXK C;  4B3R O;  2GSM B;  3OTF A;  2ITC C;  1AI7 A;  3H01 A;  3T4D A;  4MSW C;  3OE7 G;  3AG2 C;  2Q7G A;  5KX5 B;  1N34 O;  3ZX6 A;  1DLB A;  1KBH A;  2ZNJ A;  2X0L A;  2CUG A;  1ORQ C;  4JI7 O;  4B3T O;  3BCC H;  2IU3 A;  1QCE A;  3ETE A;  3OM3 B;  1XNR O;  2R9A A;  2HR3 A;  4RWU A;  2QJ1 A;  3SYQ A;  4YJ3 B;  3N2G B;  5CBF A;  3K58 A;  3C3S A;  2Q69 A;  1N0N A;  4DR1 O;  3CC2 V;  3R66 A;  4DW0 A;  3ZCC A;  2QWR B;  2QWP B;  4JAS A;  2YXL A;  4NXM B;  1OCR C;  5EBL C;  3HKD A;  3L70 H;  4DR7 O;  1Q7Y W;  5B1A B;  3J7A U;  1THZ A;  1JCH A;  3K08 A;  1R6T A;  1ENV A;  4F4L A;  4FFK A;  2FYU H;  3RVY A;  1LUW A;  1NKD A;  2RCV A;  1Y66 A;  3D36 C;  2EIM C;  4CC5 A;  4O4I B;  5LP6 B;  5H6R A;  5IJ9 B;  1I0H A;  3HKB A;  1Z5W A;  1M57 B;  1V54 B;  4OX9 B;  1P7B A;  4ICG A;  1SQG A;  5LXT A;  4UCS A;  3O65 A;  3RYC A;  3OEE G;  2EIK B;  1H2K A;  5EYP A;  4TT3 G;  2XHB A;  3CJH A;  4FLZ A;  2D3O W;  2JDI G;  1BSM A;  1M5I A;  2EJ7 A;  1KP3 A;  1OCC C;  4JF3 A;  3SYC A;  2DE0 X;  3Q4H A;  3CRA A;  1K9M W;  1NQT A;  2JEU A;  2LGW A;  4RO2 A;  2LP7 A;  3Q4H B;  1B04 A;  1PNK A;  3AG4 C;  4WBN B;  1E1Q G;  1Y67 A;  3G67 A;  1TUE B;  2CH7 A;  3P32 A;  3G71 V;  3LNM B;  3TCU A;  2Q7H A;  4WFE A;  3UKM A;  3RW0 A;  2OIG A;  2CH7 B;  2IBZ H;  1K4C C;  2PI5 A;  3BAB A;  1COW G;  1OCO B;  2ITD C;  1ZL8 A;  3UO2 A;  4PI0 A;  1XL4 A;  2ZDI C;  4YIP A;  4BW5 A;  3CC4 V;  4PDL A;  1WP8 A;  1U97 A;  1S5H C;  3CMA V;  3ZHS A;  1GM7 A; 
#chains in the Genus database with same CATH homology
 4JI0 O;  4LFA O;  4DV4 O;  4YHH O;  2ZKO A;  3RT3 C;  4DV0 O;  4DR5 O;  2FKX A;  3J7A U;  4NXM O;  4DR3 O;  1N33 O;  2DOS A;  4GKK O;  2UXB O;  1R6T A;  1X59 A;  2UUC O;  3T1H O;  2JRI A;  2VQE O;  3F5T A;  5IT9 N;  4LF5 O;  1HNZ O;  4DV5 O;  2UUA O;  4X65 O;  4LF9 O;  1FJG O;  4DV2 O;  5LMU O;  2F4V O;  4AQY O;  1XNQ O;  4DR2 O;  5IWA O;  2E5L O;  1KUQ A;  1J5E O;  4JI6 O;  4OPA A;  3O65 A;  4DV7 O;  2AGA A;  1D2D A;  4JI3 O;  2N74 A;  4DUZ O;  1N36 O;  5H5N A;  4OPH A;  2UXC O;  4OX9 O;  1HNX O;  4LFB O;  2LW7 A;  5A2Q N;  4K0K O;  4JI8 O;  4A5U B;  4GKJ O;  1I94 O;  3SDL A;  4JI2 O;  1G1X B;  4DUY O;  1HNW O;  1YZB A;  1DK1 A;  4JV5 O;  1HR0 O;  1FYJ A;  3JAM N;  1AIL A;  4X64 O;  5FLX N;  3OTO O;  2UXD O;  4YY3 O;  4DV1 O;  1IBM O;  3T1Y O;  4LF7 O;  5BR8 O;  4DV3 O;  1N32 O;  4LF6 O;  4B3R O;  4JYA O;  4JI4 O;  2UUB O;  5BXZ A;  1N34 O;  1IBL O;  4DR4 O;  1FKA O;  4KHP O;  4X62 O;  3M8A A;  3J80 N;  5BY1 A;  1NS1 A;  2DJV A;  4NXN O;  4DV6 O;  5LMN O;  3J81 N;  1XEQ A;  4JI7 O;  4B3T O;  2UU9 O;  1XNR O;  4LF4 O;  1IBK O;  4LF8 O;  1R1B A;  1XMO O;  4B3S O;  4JI1 O;  1XMQ O;  5LL6 Y;  4JI5 O;  1A32 A;  4DR1 O;  3R66 A;  4LFC O;  2ZM6 O;  1F7Y A;  4DR6 O;  2Z0A A;  2HHH O;  4B3M O;  1AB3 A;  2VQF O;  4X66 O;  4DR7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...