4DV5O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv5O00
4DV1O 4B3RO 4DV6O 5H5NA 2UUBO 3RT3C 2Z0AA 4NXNO 1A32A 2E5LO 4LFCO 4NXMO 4DV3O 4DV2O 5BR8O 5LL6Y 1N34O 4JYAO 5IT9N 2F4VO 1N33O 2UXCO 4DUYO 4OPHA 4DV4O 5BY1A 1HNXO 5LMNO 2N74A 4DR5O 4X66O 3T1HO 4DR3O 3JAMN 1R1BA 4JI5O 4AQYO 1D2DA 4JI1O 4GKJO 4JV5O 4DUZO 1NS1A 4YY3O 2UUCO 4DR4O 1FKAO 4X65O 4YHHO 4LF6O 1IBMO 1N36O 4B3SO 2UUAO 2ZKOA 4DR7O 3R66A 1HNZO 5IWAO 5BXZA 4X64O 1I94O 1AB3A 2VQFO 4LFBO 3J7AU 1FJGO 2DOSA 1XNQO 4LF5O 1KUQA 3J80N 1N32O 4KHPO 4X62O 3OTOO 4LFAO 2UXDO 4DR1O 3T1YO 2ZM6O 1G1XB 4LF9O 1HNWO 3F5TA 1XEQA 1J5EO 1IBLO 4LF4O 1F7YA 2FKXA 4JI3O 2VQEO 4GKKO 4A5UB 1AILA 4JI4O 1R6TA 4JI0O 4LF7O 4K0KO 1FYJA 5LMUO 3M8AA 1XMQO 4JI2O 2UXBO 4DR2O 4DV5O 1YZBA 2HHHO 5FLXN 5A2QN 1HR0O 2JRIA 4B3MO 3SDLA 2UU9O 2AGAA 4JI6O 2LW7A 1XMOO 4JI7O 4DV7O 4OX9O 4DR6O 2DJVA 3J81N 4LF8O 1IBKO 4B3TO 4DV0O 4JI8O 1DK1A 1X59A 4OPAA 1XNRO 3O65A
chains in the Genus database with same CATH superfamily
4ZOLB 2KSDA 2X0LA 1IBMB 1XDCA 2YDEA 5B1AB 4DR7B 1JX9A 2E5LO 1VQ9V 4DV3O 5LL6Y 5LHGA 2W0XA 3CB2A 1OZ0A 4DUYO 3QO7A 5IJ9B 2XT9A 2E3CA 2HP8A 2EILC 4WFHA 5JQGB 4DUZO 1NTZH 2UUCO 4X20A 3DC5A 1Q8IA 1SQFA 3FAVA 4UCRA 3LUTB 3JARA 1I5XA 3JD0A 2QR4A 2R72A 3R65A 2IJIA 1THZA 2V1DA 4JAVA 2YEVB 3OR7C 1KP3A 2Q68A 1DLBA 3DXRA 5LA6A 4K0KB 1QCEA 3J80N 1N32O 3JASA 1AI7A 1IXBA 3T1YO 1K4DC 1BHBA 1W2BU 3LDCA 4UCUA 3OT7A 3GWOA 3OM3B 2ATKC 4PI0A 2JS3A 5EBWC 4FM0A 5KA5A 2A3QA 1QR8A 4I9WA 3CMEV 4UV9A 3RFRA 2UXBO 4PA4A 2HHHO 3K04A 1VQPV 3E8BA 1LUWA 1YJNV 1W59A 3E86A 3J81N 3ZMVA 1Q5OA 5FL7G 4FLUA 2EIJB 4B3TO 4X9QA 1JCHA 1H8EG 5IJ0A 5C8YA 1BT8A 1G8MA 2DYRC 4JTCB 2ZT9B 1PL4A 3A0RA 1MABG 1Q86W 1SETA 1Z5WA 5FNVA 1Q3EA 1TA8A 1KKCA 3ABLC 3KG2A 5LGUA 3E35A 2UUBO 3JARB 4O4IA 5LGTA 1ZWIC 4WFBV 4LFCO 4P9OA 1R73A 2CTRA 2E76B 2RDCA 3H1IH 4MVOA 2NLJC 1VQ4V 5EK0A 1JMKC 1GTOA 4DR5O 2BE3A 4PV1B 3K9AA 5J2TA 5L3GA 3ZCCA 2RMKB 2B5UA 2F43G 1PNKA 3JASB 4LNUB 2BOBC 4DR1B 2EIKC 1FKAO 1VQ8V 3ABKB 1J5EB 5JCOC 4LF8B 5IYCO 5GTHZ 1V54B 3SGIA 4Z2WA 3SPJA 1S5LZ 4WFEA 2H8PC 1PL0A 1RSOA 4DRXA 2EJRA 1KB9F 3STLC 3OTOO 1K34A 4BIZA 2ZM6O 1B6QA 4AHCA 1WLEA 1XEQA 4DW1A 2QM7A 3K9SA 2GTAA 3X2QC 4JI8B 2VWKA 3ZRWB 1GN2A 5KHIA 2HR3A 3OUSA 4XDKA 3OFNG 3CD6V 1VEWA 5EC1C 4BR6A 2CE4A 3WB1A 4JI0O 1MA1A 3BPZA 4OXSA 2BCCH 2QWPB 2JJ1G 2FTKA 1QLEB 1AVMA 3E2EA 2H3OA 2MW2B 1YF2A 4K8XA 4PJ0Z 2ZXWC 2P90A 1Q6HA 1P7GA 2HVJC 5KHKA 4LWSA 4O4JB 1N4CA 4U3FH 5L3DA 1JA8A 3ETDA 4OPAA 4JI1B 3HKBB 4HBNA 3CC4V 5L3FA 1XREA 3FB7C 3BRCA 1FPOA 3SYAA 2ITCC 3E8FA 4KUMA 1GO3F 3WB2A 5BMVB 1I94B 4UCOA 1PNMA 4X1IB 1H8HG 2Y69C 2UXCO 3B2EE 1FD9A 3JAWA 2N74A 5DN6G 1K3EA 2UXDB 3CCEV 3NXSA 3SYPA 5LYJA 1N0NA 4PA3A 1IBLB 2Y4UA 5LGNA 4BAYA 1OCOC 3OTFA 2DWEC 4JZGA 1FXKB 2LGWA 4G2KA 4LFBO 1ZX3A 3SJAC 3WFVA 1NVPD 1XNQO 1HWYA 5CB4A 1XILA 5H6QA 1EN4A 2Q9LA 2MK3A 3T4DA 4DO2A 3U0ZA 3CP1A 2LW1A 4WBNA 1KQSU 1RM1B 5BZBA 2YIDA 4J42A 4X1YA 4B7EA 2QM8A 5D5PA 3CS5A 5LXTB 3IC9A 4PDMA 3HB3B 3K03A 5HFMA 4JI3O 2PTMA 4B08A 4R50A 2EINB 5JJNB 4WFAV 4DV1B 4LF7O 1KECA 1FYJA 4DV6B 3PN1A 5JWPA 4CZZA 3W7WA 5CBHA 1NR1A 3BA8A 3RYCA 2LFRA 3OMAB 1S5HC 4AI8A 1WPBA 4OX9O 4LC1A 2D3OW 1HNXB 1FJGB 1IBKO 4R6ZA 3FYIB 3T1HB 1YIJV 5CA1A 5LP6A 3LNNA 4KHPB 1BMFG 1ZAUA 5IYZB 1K4CC 1EZVH 3ZS8C 3OE7G 3S3WA 1QQCA 3SYOA 5JVDB 2IM9A 3VBBA 3UCSC 5LYJB 4LF4B 1SQXH 2ZIMA 2RQ6A 5CMUA 3K5MA 1VQOV 4DV2O 5EZYB 1S72V 2VS0A 1OCRC 1KP2A 3N27A 2F4VO 4TV8B 3ZHQA 4QE7A 3CX5F 1H38A 3EHBB 1GM9A 1N0JA 2R9IA 4OPHA 1US6A 3ABMC 2A79B 3JAMN 3FX7A 2W6JG 4JF3A 4UVCA 4CS3A 3ZHTA 5KMGB 4W4KA 4HNAB 4LF9B 4HYOA 2GUZA 1WNSA 4RQEA 3L71H 2PI4A 3C3SA 3LDDA 2Z5UA 4X64O 1KC8W 3I5DA 3OR6C 1FFTB 2IJKA 4JTDB 4CH3A 2WPDG 5KUKA 4G28B 1P4RA 1FFXA 3VQWA 1NZ6A 4YJ2A 4GX5A 2R70A 1ZL8A 4I55B 1B06A 3ZHUA 2V7QG 1Q7YW 1Q82W 5H2FZ 2HG5C 1VQMV 2IU3A 2N04A 5CA1B 5LP6B 2JS5A 1J95A 3O9OA 3ZX6A 3JALA 5LMUO 5CA0A 1XMQO 1D5NA 2QKSA 3HKEA 5A2QN 3U11A 1HR0O 2RJZA 4B3MO 5IYBO 3OGIB 4JI7O 4DV7O 3ASOC 4DR6O 2KG7A 1OCCC 1BCCH 1OJHA 1BL8A 2GUZB 4NTWA 5CBFA 1PV0A 1WA8B 3CJHB 4FLTA 5E79Z 1N34O 4X1KA 4FJCC 1NT2B 4OGQB 4PHZA 5EBLC 1NQTA 2E74B 2NNUA 1LUVA 1FAFA 3AG3C 2ZR3A 3N2KA 2ADPA 4X65O 5LP6C 1HNWB 5E1AC 3G71V 2Q7HA 3T2MA 4FVMA 3CYOA 3QNEA 4ASUG 1YI2V 4FLYA 5H6RA 4GKKB 2WWWA 1VQKV 2CGNA 2CAZC 4KL1A 5JH7B 4ZOLA 1HP8A 1IVSA 3JALB 2WSSG 4IIJB 1XMOB 3SJCC 5AG2A 4U7NA 2GSMB 2R9AA 1KMIZ 1VF6A 3JCZA 4BIUA 1Q90D 5GTIZ 4AQYB 1PNLA 3M7MX 5IJ9A 1R3IC 3OEHG 4R8CA 2EBOA 3E83A 3ASNB 1RPRA 1SA0A 3T4ZA 5C93A 5JQGA 4K35A 1RFYA 3P30A 3OGCC 2LQTA 4DR2O 2YICA 4DV5O 4N23A 5IWAB 4WFGA 3ZN1A 2EIMB 2P6JA 3B4SA 1TUEB 3H1LH 1XNRO 1K33A 4HAMA 4B3RO 3NR7A 4IGGA 2IH1C 4RO2A 4LF6B 3N2KB 4J41A 4U3JB 2B1IA 1Y67A 3HKDB 1VMGA 2DW4A 2DQ0A 4JYAO 2R9RB 3F7VC 5CBGA 3JATB 2ZE8A 2VQFB 1IZ3A 1V55C 1QVGU 1YEWA 4JTAB 1R6NA 2JK5C 2XTAA 2YSUB 1COWG 3SR2C 4R7CA 1ZLZA 1IXMA 3H1KH 3LDEA 1Y74B 1IBMO 4DW0A 4B3SO 1SESA 4DR7O 3R66A 2VQEB 2OCCC 2XASA 2X6AA 1L0NH 4Q20A 3J7AU 5B5EZ 1YSCA 3G4SV 1SA0B 3K5LA 1BGYH 1Y4MA 4UXNA 4GZRB 3IJ4A 1HW7A 4CS4A 4PELA 4DYLA 1G1XB 2WLNA 1RP3B 4L8JA 3JD3A 1M4UA 3EVKA 2DYSC 1AR5A 4DUYB 3TK1A 1LR1A 1K7DA 3OUFA 4MTOA 3K79A 1AROP 1AP5A 3RGBA 4NVPA 4YIPA 2QJ1A 2UUCB 4K0KO 3FFQA 4LNUA 1M5IA 1VF7A 2KQXA 3UO2A 2WLIB 3KCYA 1SS3A 3HR0A 3SPIA 3ETEA 3HKCA 1G4YB 5LBQA 5B1AC 2ODMA 3TJTA 1WAZA 2Q6AA 1EBOA 2H94A 4DR4B 1VF6C 4B7KA 3SPGA 2FMLA 3MHHC 2ZE6A 3E22B 1QU7A 3I55V 1TGOA 3ZRWA 2FB5A 4FZ0A 1VP7A 4DV4O 2ETNA 5LOVB 4MVQA 1YTFB 2CGOA 3SPCA 3CCJV 2HJFC 4ZBMA 1NS1A 3VQXA 4YY3O 3IC7A 4LBEC 2ILMA 3L74H 3ZMTA 3K06A 3ZRSA 3G6EV 4KP4A 1SC5B 4JAUA 2IU0A 3W7TA 2EJ7A 3CSXA 5KX5B 2HLDG 1R6KA 1LNQA 4MTFA 4O4JA 1AB3A 2PI5A 1Q81W 1VQNV 2CDYA 3HKBA 3ZMZA 4EB6B 3AG1B 3CRRA 2UUBB 4QPJA 3B8MA 4DR1O 3GWKC 2LJ2A 3VOUA 1J5EO 1S0VA 5BMVA 1NJIW 4RQFA 4X1IA 1YVWA 2JEUA 1FXVA 3HKCB 3TETA 3WG7B 2HVKC 3N2GA 2X7RB 1VF5B 3F5WC 4MW3A 2WLJA 1TUBB 4X88A 2EIJC 3A0HZ 1GN3A 3E89A 4LH7A 4NXNB 1JR9A 3SYQA 5FLXN 5EBMC 1WP8A 2ZE5A 1GRJA 4I7ZB 2LGQA 1N33B 5JJEB 3CE2A 5D5QA 1FXKA 4JI8O 1X59A 5KA6A 3OEEG 1YHQV 2PUSA 3P3NA 3OTOB 1DF5A 2JDIG 1WB8A 4I0XA 1AI6A 2UUAB 2AW9A 1A32A 1K5QA 4J10A 3F7YC 5LXTA 5IT9N 1AI5A 1NKDA 1F51A 2Q0AA 4LH6A 3C90A 2PYJA 4MSWC 3ABKC 4UB6Z 1W0JG 4GX2A 2JEXA 1MG1A 3TXQA 3RYHB 2ZCEA 1NBMG 4JI1O 4CH5A 3UT5B 2O57A 1WPXA 4FFKA 1V54C 4MT8A 1GAXA 2YXHA 1YJ9V 1YXBA 3Q4HA 3K0DA 2GBOA 4CC5A 4JYBA 1I94O 1R3KC 1OCZB 3AG2B 2ITDC 3N2GB 1SERA 1M56B 2FL4A 4TSFG 4JI2B 5IYZA 4XBFA 3RYFA 4QGPA 5JVDA 2WA4A 1DGSA 2IW5A 2UU9B 2UXDO 2A0LA 1M57B 5EZYA 4GCZA 1IBLO 1NI8A 2UXCB 1XL6A 4PD4F 4TV8A 1QLEC 2GV9A 4FM2A 2FKXA 3UO3A 1KKDA 4F6RB 2QDOA 2RN9A 2OWOA 1AILA 2JIZG 1N8RW 3CRAA 5FPOA 1ENVA 3ETGA 3M8AA 5KMGA 4YJ3B 2JJ2G 4HNAA 2A06H 4I0XB 2JRIA 5BR8B 3CC2V 4JI6O 1E1RG 3H01A 4O2BA 3K5NA 3K08A 2JGDA 3ABTA 2QE7G 1DK1A 2X6BA 1XNQB 4L87A 4JI5B 1VQ7V 2Y0IA 2Q7GA 2Q69A 3QO5A 4JGSA 3QVNA 4DV1O 1ZTEA 3SJBC 4DV6O 3L70H 1OCZC 1SQPH 4Z1VA 2Z0AA 4I4TB 1M56C 2FYUH 3G6BA 4W4LA 3KKYA 3Q4HB 4I55A 4MTGA 3OW2U 1MZFA 3LSUA 3WU2Z 4WF9V 3W7XA 1BSMA 1EZJA 1SQVH 3L75H 5ITZB 4YIOA 4I5SA 1Q6UA 4FZ1A 4LF7B 1HNXO 3T1HO 5L3CA 4O4LB 4JV5O 3RYFB 5KHJA 4LFAB 1FXKC 2Y4TA 1XL4A 4NTXA 4OX9B 4UV8A 1L1FA 1PPJH 4ZI7B 4TQFA 4WFFA 2LFSA 2BTOA 4JI4B 4UFZA 3K0GA 2QKCA 1RM1C 1BQZA 1F4NA 4CS2A 4UVBA 1SQQH 4CBCA 1X4TA 2EINC 1D5AA 4LCUC 1WB7A 2YXYA 1GK9A 4E4EA 2F4VB 1JJOA 4LF9O 2ZIOA 1R3JC 1WA8A 3CJHA 5TISZ 5CA3A 1NTKH 4MTXA 4O2BB 2JGDB 3AK2A 2W6IG 1MZEA 3BEHA 1FS0G 2NR5A 5IY5B 3B8NA 1SKVA 5B1OA 2ZQMA 1JJ2U 2XHBA 2QWOB 1F4MA 4IL6Z 1TVKB 2BSKB 3B09A 1QR9A 1Q43A 1DTOA 4JZ2A 1I08A 5LMNB 3FB8C 4P9PA 4X66B 4DV0O 5KHGA 3CRMA 2A9HA 2L6LA 3APQA 3CXHF 4PDRA 1UJWB 4GKJB 3P3PA 5JH7A 1XBLA 1FXHA 5B3SB 3QG5A 4IIJA 5GONB 3QO8A 2F95B 4XDLA 4FPPA 4GLXA 2G38A 4JYYA 4NTYA 3D3IA 2XAGA 4LF5B 4MVMA 1CXZB 1R1BA 3CC7V 4D6TH 4X62B 1D2DA 2EX3A 2WLHA 1HR0B 4EFBA 4B3MB 5B66Z 4J7JA 5K1PA 2XUMA 1N36O 4ZKIA 2XOKG 1CEZA 4GT1A 4EEQA 1HNZO 4H0LB 3DGEA 3H9VA 3ABUA 1AR1B 1M90W 1KUQA 3OAAG 4J7KA 2B9ZA 4H44B 3ZIAG 2YIAA 4QPKA 4U3JA 3TGUH 1N34B 3S3XA 5GW7A 3HKDA 3W7UA 1HNWO 3K3WA 4FLWA 3LNMB 5IE9A 3VQYA 1IURA 3JATA 2QGNA 3BVOA 3U10A 1S3JA 4PDVA 4NR1A 4GKKO 4I50B 3G80A 4ZIBA 1PD3A 4IYIA 1VQ5V 3AG4B 1EM1A 4NXMB 1CP9A 1Y74A 4TUYB 3SDLA 1XMOO 4AILC 2HJDA 1NTMH 3JSNA 3CCUV 2IJHA 1VARA 1QVFU 4DR3B 3MHSC 3JD4A 3JD1A 4ICGA 2Y0PA 3CCQV 1MNGA 1EFRG 4CC6A 5H9CA 4LR3A 3JAKB 1GH6A 2YXLA 2Q8VA 4O2AB 5JJJB 3D3QA 4PA7A 3KZIZ 4H33A 2QA4V 3TCUA 1XHZA 2UXXA 1U96A 2HFEC 4QE9A 2CTPA 1Y66A 2P22C 1GKFA 4YHHO 4LF6O 1B3QA 2Q67A 2WLIA 4IHJA 3CRQA 4FM1A 1AJPA 3RN4A 3MAQA 2QTOA 2PF4E 2EILB 5B1BB 2DE0X 1NH2B 2JGUA 1W0KG 4RWUA 2YI8A 2OCHA 4DXWA 2VQFO 4BW5A 1GN4A 4CH4A 4IYHA 1H2SB 2YIBA 3EFFK 5DM6V 2Q73A 1WN7A 3E22A 3KCXA 4JYAB 1HDJA 3ASNC 2UXNA 1QBZA 1F7YA 1Y76A 2VQEO 3ZBHA 4ZHQA 3BFRA 5LOVA 2VRZA 4BWAA 2CK3G 2M7WA 3CRCA 1V9PA 5B1NA 5EYPB 4B3SB 1G6UA 4KFMA 2E5LB 4DV3B 2KB1A 2EIMC 3BHPA 4UCSA 1GMGA 2LW7A 3A2FA 3OMIB 3L9DA 4TV9B 5KX5A 1MSDA 2OIEA 2X6CA 3H1JH 4D7TA 4FLXA 1Z2GA 2E75B 2ZINA 3GB7C 4RUFA 5A9GA 4DUZB 5B1BC 4EB6A 2QKAA 3BY6A 5K1XA 3K59A 4H13B 4DK0A 2Q0OC 2HKOA 1SQGA 2YUAA 2DYRB 4IHJB 2K1EA 3L73H 4QNHB 2XAQA 3ABLB 5BY1A 4K3AA 1N32B 2C2AA 2CTWA 2WLLA 3RBZA 1OV9A 3L72H 4J7ZA 1TUBA 3FB6C 3T1YB 4DR4O 3ML0A 3FKSG 4O4HB 1VQLV 5IYDO 4J11A 2ZDIA 1M1KW 2YS8A 1L8DA 3B40A 2QEXV 1B04A 1Y76B 2EIKB 4GX0A 4ZHQB 3OMNB 4FFBB 3BAAA 2DOSA 1AJNA 4MS2A 1QHTA 2F93B 2YC0A 1JQ0A 2UXBB 2HHHB 2OT5A 1H2LA 1H2MA 2Q4PA 4UCVA 4DK1A 4UCTA 3F5TA 5HFLA 4DV4B 4B3TB 3K57A 1K73W 2P5OA 3DTUB 4HZ3A 1ORQC 3UM7A 4WCEV 3RYHA 4YY3B 2AXTZ 4LP8A 3UT5A 3X2QB 1QNMA 1DF4A 3RWRD 4X20B 4BW9A 3FAVB 4LFCB 4D7SA 4X89A 4K8ZA 4X8AA 1PP9H 5EIBD 4LF8O 2EULA 4DR5B 3RYIA 3UKMA 3FB5C 3BABA 3DXRB 5CN0A 5LA6B 1M9NA 4Z1MG 1AI4A 2WLLB 1P7BA 2LO1A 1S77D 1JPXA 5J2UA 1SQBH 2PYLA 3A8TA 1H2KA 2ZXWB 2P7TC 2ZR2A 4NXNO 2WLMA 1N33O 1XQ8A 3CCRV 1PM9A 4F6RA 3MD0A 5DECA 2Z3YA 3THOA 1SZTA 4YJ3A 3CHXA 2Y69B 2ZM6B 4UVAA 5J9PC 3CCMV 3MDSA 1XHXA 4FLZA 2JVDA 2CUGA 2UUAO 2ZKOA 3AG1C 3WB0A 1NU1H 2PZSA 5BXZA 4RAIA 2GHYA 4JI0B 3ZMSA 3SPHA 1P49A 5IJ0B 5C8YB 1OCOB 2CH7A 4JAAA 1GN6A 4PA6A 5FNVB 4PA9A 4RUEA 3WG7C 4GX1A 4O4IB 4I4TA 4U7OA 1AR4A 4JYCA 5ITZA 3DSQA 3RYIB 1MSWD 5KHHA 1GM7A 2PGGA 2CTQA 5J2TB 1K92A 4O4LA 2ZDIC 2EZPA 1L0LH 2ZNJA 3AEIA 1S76D 5J2UB 4XDJA 4JI2O 4J9ZB 1I0HA 3UQ8A 4J9YB 2P4KA 1H2GA 2F23A 2UU9O 2AGAA 3ZEDA 1BS3A 4QIWF 4ZI7A 1JFFA 2P4VA 2DJVA 2AHYA 2DMXA 2RCVA 2WAMA 3ZHRA 3LSSA 3QTCA 3ZMUA 2QTSA 3CXCU 1RSOB 4DRXB 2WA3A 2ZD9A 4NB5A 1IX9A 1NR7A 2KKWA 4JASA 4CH6A 4TOIA 5BR8O 2XAJA 4PDLA 4I9QA 1XUQA 2OYQA 4LFBB 1SZXA 4BIOA 1Q6IA 3ZJZA 1P84F 4JI5O 4FMTA 1S5JA 4MVRA 3SYCA 2CH7B 1OCRB 4MVZA 2W0FC 1TAEA 4JI6B 3FD9A 2GDSA 3AG2C 1TVKA 3ABMB 2BSKA 5KUMA 2BOCC 1XI1A 4TWKA 1VIBA 4JI3B 3DC6A 4PI2A 4FIPC 4LWSB 5LHHA 1FJGO 1M57C 4KHPO 1KBHA 3JD2A 1E79G 4JPRA 3G67A 1AJQA 3FYEB 4LFAO 5GONA 3VQVA 1ZSPA 2DQ3A 3AK1A 2NN4A 2OIGA 4LF4O 1IBKB 1JFFB 3OD4A 2WLKA 3CCLV 1BQ0A 3JAWB 4A5UB 1CPYA 4JV5B 4JI4O 1R6TA 4NYKA 1AP6A 1JOYA 1VQ6V 1Z5VA 2ADQB 4DV2B 3HPLC 3A0BZ 1UPGA 3ETQA 3I56V 1BE3H 5IDJA 4KXRA 3PJSK 2QM4A 3ZRVA 3RW0A 1EN5A 2P67A 2DWDC 5CB4B 2ZE7A 1MMMA 3ASOB 5EIBC 3W7SA 1I7FA 1U97A 2XNDG 2B1GA 2ZNIA 2ARHA 4WBNB 2V4DA 1ROPA 4X1YB 1OCCB 1SRYA 2A7WA 1NH2D 4X64B 3AK3A 2Q7EA 5DEDA 1I5YA 1IDSA 2P06A 2LP7A 4I50A 4ABMA 4QJFB 2M6YA 5LMNO 2QSAA 4X66O 1E1QG 5KAFZ 1PKXA 2BTQA 2OTLV 4GKJO 4UB8Z 1MOFA 3E8HA 4TQDA 3K5OA 3RYCB 4TUYA 2OTJV 2F66C 2IH3C 4EKWA 2PY5A 4DV0B 3AG3B 3D36A 2XAFA 3SJQC 3B77A 3CCSV 1ZUQA 4GUNA 3AG7A 3JYCA 2XAHA 4F6EA 3ZN0A 3CMAV 5LMUB 3IFXA 1XMQB 4LF5O 4X62O 2GTSA 1Y6XA 1RPOA 5L3BA 2VWJA 5IY5C 4JI7B 4N21A 3JAKA 4DV7B 4O2AA 4DR6B 4TT3G 2Q5ZA 3E8GA 3APOA 2QWNB 5F2VO 4H37A 3RVYA 2AHZA 3C3TA 1NVPB 1O9GA 1N36B 3LSQA 1R3LC 1YZBA 3T1CA 1HNZB 1QLNA 4IT5A 2RNBA 5B3SC 1YJWV 1K97A 4J80A 1WJZA 2Y48A 2EZOA 3K58A 1SF9A 1BHAA 1WP7A 4Q6GA 3BA9A 1K9MW 4GYCB 3TXSA 3ZHVA 4FLVA 3D8CA 3O65A 2BTQB 2YIBD 1T5EA 4X65B 4C7UA 4E2LA 4P2ZA 5H5NA 1FFXB 1XOUA 1OHHG 4YJ2B 3GVMA 1URFA 3M99B 2K9PA 3QF7A 3RT3C 1JVMA 5KAIZ 4NXMO 1EN6A 1YCIA 1H2NA 4MVSA 5LHIA 1KD1W 1ZL8B 2IJJA 3CPWU 1O9HA 4DR3O 2QWQB 1YTFD 4AQYO 4MW8A 5EYPA 3STZC 5CA0B 3BCCH 1K5SA 3ZRXA 5FPRA 2QWRB 1V55B 3HKEB 3JSLA 4G27B 5KLVH 1YDXA 1KYOF 4FK5C 3IGAC 4TV9A 4P30A 5IWAO 3JCUZ 1F23A 2L35A 4NKGB 1M93A 2KG7B 2N05A 5EC2C 4DR2B 4DV5B 5L3EA 2OCCB 1BZKA 4EFEA 4MVUA 2DN9A 4F4LA 2IBZH 2YI9A 2YEVA 3AG4C 2AZ2A 4X1KB 2HEPA 1YITV 1K8AW 3EXAA 3P32A 1XNRB 3CCVV 4B3RB 1GM8A 3ICXA 1KU9A 2DYSB 2F1MA 3D36C 4YHHB 3RVZA 1UFIA 2D2CB 4UUJC 3CWBH 2AZ0A 4O4HA 4YXWG 3ZHSA 5JCOA 3H1HH 4FFBA 3IAYA 3CEIA
chains in the Genus database with same CATH topology
4DV1O 4B3RO 4DV6O 5H5NA 2UUBO 3RT3C 2Z0AA 4NXNO 1A32A 2E5LO 4LFCO 4NXMO 4DV3O 4DV2O 5BR8O 5LL6Y 1N34O 4JYAO 5IT9N 2F4VO 1N33O 2UXCO 4DUYO 4OPHA 4DV4O 5BY1A 1HNXO 5LMNO 2N74A 4DR5O 4X66O 3T1HO 4DR3O 3JAMN 1R1BA 4JI5O 4AQYO 1D2DA 4JI1O 4GKJO 4JV5O 4DUZO 1NS1A 4YY3O 2UUCO 4DR4O 1FKAO 4X65O 4YHHO 4LF6O 1IBMO 1N36O 4B3SO 2UUAO 2ZKOA 4DR7O 3R66A 1HNZO 5IWAO 5BXZA 4X64O 1I94O 1AB3A 2VQFO 4LFBO 3J7AU 1FJGO 2DOSA 1XNQO 4LF5O 1KUQA 3J80N 1N32O 4KHPO 4X62O 3OTOO 4LFAO 2UXDO 4DR1O 3T1YO 2ZM6O 1G1XB 4LF9O 1HNWO 3F5TA 1XEQA 1J5EO 1IBLO 4LF4O 1F7YA 2FKXA 4JI3O 2VQEO 4GKKO 4A5UB 1AILA 4JI4O 1R6TA 4JI0O 4LF7O 4K0KO 1FYJA 5LMUO 3M8AA 1XMQO 4JI2O 2UXBO 4DR2O 4DV5O 1YZBA 2HHHO 5FLXN 5A2QN 1HR0O 2JRIA 4B3MO 3SDLA 2UU9O 2AGAA 4JI6O 2LW7A 1XMOO 4JI7O 4DV7O 4OX9O 4DR6O 2DJVA 3J81N 4LF8O 1IBKO 4B3TO 4DV0O 4JI8O 1DK1A 1X59A 4OPAA 1XNRO 3O65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 O;  4B3R O;  4DV6 O;  5H5N A;  2UUB O;  3RT3 C;  2Z0A A;  4NXN O;  1A32 A;  2E5L O;  4LFC O;  4NXM O;  4DV3 O;  4DV2 O;  5BR8 O;  5LL6 Y;  1N34 O;  4JYA O;  5IT9 N;  2F4V O;  1N33 O;  2UXC O;  4DUY O;  4OPH A;  4DV4 O;  5BY1 A;  1HNX O;  5LMN O;  2N74 A;  4DR5 O;  4X66 O;  3T1H O;  4DR3 O;  3JAM N;  1R1B A;  4JI5 O;  4AQY O;  1D2D A;  4JI1 O;  4GKJ O;  4JV5 O;  4DUZ O;  1NS1 A;  4YY3 O;  2UUC O;  4DR4 O;  1FKA O;  4X65 O;  4YHH O;  4LF6 O;  1IBM O;  1N36 O;  4B3S O;  2UUA O;  2ZKO A;  4DR7 O;  3R66 A;  1HNZ O;  5IWA O;  5BXZ A;  4X64 O;  1I94 O;  1AB3 A;  2VQF O;  4LFB O;  3J7A U;  1FJG O;  2DOS A;  1XNQ O;  4LF5 O;  1KUQ A;  3J80 N;  1N32 O;  4KHP O;  4X62 O;  3OTO O;  4LFA O;  2UXD O;  4DR1 O;  3T1Y O;  2ZM6 O;  1G1X B;  4LF9 O;  1HNW O;  3F5T A;  1XEQ A;  1J5E O;  1IBL O;  4LF4 O;  1F7Y A;  2FKX A;  4JI3 O;  2VQE O;  4GKK O;  4A5U B;  1AIL A;  4JI4 O;  1R6T A;  4JI0 O;  4LF7 O;  4K0K O;  1FYJ A;  5LMU O;  3M8A A;  1XMQ O;  4JI2 O;  2UXB O;  4DR2 O;  4DV5 O;  1YZB A;  2HHH O;  5FLX N;  5A2Q N;  1HR0 O;  2JRI A;  4B3M O;  3SDL A;  2UU9 O;  2AGA A;  4JI6 O;  2LW7 A;  1XMO O;  4JI7 O;  4DV7 O;  4OX9 O;  4DR6 O;  2DJV A;  3J81 N;  4LF8 O;  1IBK O;  4B3T O;  4DV0 O;  4JI8 O;  1DK1 A;  1X59 A;  4OPA A;  1XNR O;  3O65 A; 
#chains in the Genus database with same CATH topology
 4ZOL B;  2KSD A;  2X0L A;  1IBM B;  1XDC A;  2YDE A;  5B1A B;  4DR7 B;  1JX9 A;  2E5L O;  1VQ9 V;  4DV3 O;  5LL6 Y;  5LHG A;  2W0X A;  3CB2 A;  1OZ0 A;  4DUY O;  3QO7 A;  5IJ9 B;  2XT9 A;  2E3C A;  2HP8 A;  2EIL C;  4WFH A;  5JQG B;  4DUZ O;  1NTZ H;  2UUC O;  4X20 A;  3DC5 A;  1Q8I A;  1SQF A;  3FAV A;  4UCR A;  3LUT B;  3JAR A;  1I5X A;  3JD0 A;  2QR4 A;  2R72 A;  3R65 A;  2IJI A;  1THZ A;  2V1D A;  4JAV A;  2YEV B;  3OR7 C;  1KP3 A;  2Q68 A;  1DLB A;  3DXR A;  5LA6 A;  4K0K B;  1QCE A;  3J80 N;  1N32 O;  3JAS A;  1AI7 A;  1IXB A;  3T1Y O;  1K4D C;  1BHB A;  1W2B U;  3LDC A;  4UCU A;  3OT7 A;  3GWO A;  3OM3 B;  2ATK C;  4PI0 A;  2JS3 A;  5EBW C;  4FM0 A;  5KA5 A;  2A3Q A;  1QR8 A;  4I9W A;  3CME V;  4UV9 A;  3RFR A;  2UXB O;  4PA4 A;  2HHH O;  3K04 A;  1VQP V;  3E8B A;  1LUW A;  1YJN V;  1W59 A;  3E86 A;  3J81 N;  3ZMV A;  1Q5O A;  5FL7 G;  4FLU A;  2EIJ B;  4B3T O;  4X9Q A;  1JCH A;  1H8E G;  5IJ0 A;  5C8Y A;  1BT8 A;  1G8M A;  2DYR C;  4JTC B;  2ZT9 B;  1PL4 A;  3A0R A;  1MAB G;  1Q86 W;  1SET A;  1Z5W A;  5FNV A;  1Q3E A;  1TA8 A;  1KKC A;  3ABL C;  3KG2 A;  5LGU A;  3E35 A;  2UUB O;  3JAR B;  4O4I A;  5LGT A;  1ZWI C;  4WFB V;  4LFC O;  4P9O A;  1R73 A;  2CTR A;  2E76 B;  2RDC A;  3H1I H;  4MVO A;  2NLJ C;  1VQ4 V;  5EK0 A;  1JMK C;  1GTO A;  4DR5 O;  2BE3 A;  4PV1 B;  3K9A A;  5J2T A;  5L3G A;  3ZCC A;  2RMK B;  2B5U A;  2F43 G;  1PNK A;  3JAS B;  4LNU B;  2BOB C;  4DR1 B;  2EIK C;  1FKA O;  1VQ8 V;  3ABK B;  1J5E B;  5JCO C;  4LF8 B;  5IYC O;  5GTH Z;  1V54 B;  3SGI A;  4Z2W A;  3SPJ A;  1S5L Z;  4WFE A;  2H8P C;  1PL0 A;  1RSO A;  4DRX A;  2EJR A;  1KB9 F;  3STL C;  3OTO O;  1K34 A;  4BIZ A;  2ZM6 O;  1B6Q A;  4AHC A;  1WLE A;  1XEQ A;  4DW1 A;  2QM7 A;  3K9S A;  2GTA A;  3X2Q C;  4JI8 B;  2VWK A;  3ZRW B;  1GN2 A;  5KHI A;  2HR3 A;  3OUS A;  4XDK A;  3OFN G;  3CD6 V;  1VEW A;  5EC1 C;  4BR6 A;  2CE4 A;  3WB1 A;  4JI0 O;  1MA1 A;  3BPZ A;  4OXS A;  2BCC H;  2QWP B;  2JJ1 G;  2FTK A;  1QLE B;  1AVM A;  3E2E A;  2H3O A;  2MW2 B;  1YF2 A;  4K8X A;  4PJ0 Z;  2ZXW C;  2P90 A;  1Q6H A;  1P7G A;  2HVJ C;  5KHK A;  4LWS A;  4O4J B;  1N4C A;  4U3F H;  5L3D A;  1JA8 A;  3ETD A;  4OPA A;  4JI1 B;  3HKB B;  4HBN A;  3CC4 V;  5L3F A;  1XRE A;  3FB7 C;  3BRC A;  1FPO A;  3SYA A;  2ITC C;  3E8F A;  4KUM A;  1GO3 F;  3WB2 A;  5BMV B;  1I94 B;  4UCO A;  1PNM A;  4X1I B;  1H8H G;  2Y69 C;  2UXC O;  3B2E E;  1FD9 A;  3JAW A;  2N74 A;  5DN6 G;  1K3E A;  2UXD B;  3CCE V;  3NXS A;  3SYP A;  5LYJ A;  1N0N A;  4PA3 A;  1IBL B;  2Y4U A;  5LGN A;  4BAY A;  1OCO C;  3OTF A;  2DWE C;  4JZG A;  1FXK B;  2LGW A;  4G2K A;  4LFB O;  1ZX3 A;  3SJA C;  3WFV A;  1NVP D;  1XNQ O;  1HWY A;  5CB4 A;  1XIL A;  5H6Q A;  1EN4 A;  2Q9L A;  2MK3 A;  3T4D A;  4DO2 A;  3U0Z A;  3CP1 A;  2LW1 A;  4WBN A;  1KQS U;  1RM1 B;  5BZB A;  2YID A;  4J42 A;  4X1Y A;  4B7E A;  2QM8 A;  5D5P A;  3CS5 A;  5LXT B;  3IC9 A;  4PDM A;  3HB3 B;  3K03 A;  5HFM A;  4JI3 O;  2PTM A;  4B08 A;  4R50 A;  2EIN B;  5JJN B;  4WFA V;  4DV1 B;  4LF7 O;  1KEC A;  1FYJ A;  4DV6 B;  3PN1 A;  5JWP A;  4CZZ A;  3W7W A;  5CBH A;  1NR1 A;  3BA8 A;  3RYC A;  2LFR A;  3OMA B;  1S5H C;  4AI8 A;  1WPB A;  4OX9 O;  4LC1 A;  2D3O W;  1HNX B;  1FJG B;  1IBK O;  4R6Z A;  3FYI B;  3T1H B;  1YIJ V;  5CA1 A;  5LP6 A;  3LNN A;  4KHP B;  1BMF G;  1ZAU A;  5IYZ B;  1K4C C;  1EZV H;  3ZS8 C;  3OE7 G;  3S3W A;  1QQC A;  3SYO A;  5JVD B;  2IM9 A;  3VBB A;  3UCS C;  5LYJ B;  4LF4 B;  1SQX H;  2ZIM A;  2RQ6 A;  5CMU A;  3K5M A;  1VQO V;  4DV2 O;  5EZY B;  1S72 V;  2VS0 A;  1OCR C;  1KP2 A;  3N27 A;  2F4V O;  4TV8 B;  3ZHQ A;  4QE7 A;  3CX5 F;  1H38 A;  3EHB B;  1GM9 A;  1N0J A;  2R9I A;  4OPH A;  1US6 A;  3ABM C;  2A79 B;  3JAM N;  3FX7 A;  2W6J G;  4JF3 A;  4UVC A;  4CS3 A;  3ZHT A;  5KMG B;  4W4K A;  4HNA B;  4LF9 B;  4HYO A;  2GUZ A;  1WNS A;  4RQE A;  3L71 H;  2PI4 A;  3C3S A;  3LDD A;  2Z5U A;  4X64 O;  1KC8 W;  3I5D A;  3OR6 C;  1FFT B;  2IJK A;  4JTD B;  4CH3 A;  2WPD G;  5KUK A;  4G28 B;  1P4R A;  1FFX A;  3VQW A;  1NZ6 A;  4YJ2 A;  4GX5 A;  2R70 A;  1ZL8 A;  4I55 B;  1B06 A;  3ZHU A;  2V7Q G;  1Q7Y W;  1Q82 W;  5H2F Z;  2HG5 C;  1VQM V;  2IU3 A;  2N04 A;  5CA1 B;  5LP6 B;  2JS5 A;  1J95 A;  3O9O A;  3ZX6 A;  3JAL A;  5LMU O;  5CA0 A;  1XMQ O;  1D5N A;  2QKS A;  3HKE A;  5A2Q N;  3U11 A;  1HR0 O;  2RJZ A;  4B3M O;  5IYB O;  3OGI B;  4JI7 O;  4DV7 O;  3ASO C;  4DR6 O;  2KG7 A;  1OCC C;  1BCC H;  1OJH A;  1BL8 A;  2GUZ B;  4NTW A;  5CBF A;  1PV0 A;  1WA8 B;  3CJH B;  4FLT A;  5E79 Z;  1N34 O;  4X1K A;  4FJC C;  1NT2 B;  4OGQ B;  4PHZ A;  5EBL C;  1NQT A;  2E74 B;  2NNU A;  1LUV A;  1FAF A;  3AG3 C;  2ZR3 A;  3N2K A;  2ADP A;  4X65 O;  5LP6 C;  1HNW B;  5E1A C;  3G71 V;  2Q7H A;  3T2M A;  4FVM A;  3CYO A;  3QNE A;  4ASU G;  1YI2 V;  4FLY A;  5H6R A;  4GKK B;  2WWW A;  1VQK V;  2CGN A;  2CAZ C;  4KL1 A;  5JH7 B;  4ZOL A;  1HP8 A;  1IVS A;  3JAL B;  2WSS G;  4IIJ B;  1XMO B;  3SJC C;  5AG2 A;  4U7N A;  2GSM B;  2R9A A;  1KMI Z;  1VF6 A;  3JCZ A;  4BIU A;  1Q90 D;  5GTI Z;  4AQY B;  1PNL A;  3M7M X;  5IJ9 A;  1R3I C;  3OEH G;  4R8C A;  2EBO A;  3E83 A;  3ASN B;  1RPR A;  1SA0 A;  3T4Z A;  5C93 A;  5JQG A;  4K35 A;  1RFY A;  3P30 A;  3OGC C;  2LQT A;  4DR2 O;  2YIC A;  4DV5 O;  4N23 A;  5IWA B;  4WFG A;  3ZN1 A;  2EIM B;  2P6J A;  3B4S A;  1TUE B;  3H1L H;  1XNR O;  1K33 A;  4HAM A;  4B3R O;  3NR7 A;  4IGG A;  2IH1 C;  4RO2 A;  4LF6 B;  3N2K B;  4J41 A;  4U3J B;  2B1I A;  1Y67 A;  3HKD B;  1VMG A;  2DW4 A;  2DQ0 A;  4JYA O;  2R9R B;  3F7V C;  5CBG A;  3JAT B;  2ZE8 A;  2VQF B;  1IZ3 A;  1V55 C;  1QVG U;  1YEW A;  4JTA B;  1R6N A;  2JK5 C;  2XTA A;  2YSU B;  1COW G;  3SR2 C;  4R7C A;  1ZLZ A;  1IXM A;  3H1K H;  3LDE A;  1Y74 B;  1IBM O;  4DW0 A;  4B3S O;  1SES A;  4DR7 O;  3R66 A;  2VQE B;  2OCC C;  2XAS A;  2X6A A;  1L0N H;  4Q20 A;  3J7A U;  5B5E Z;  1YSC A;  3G4S V;  1SA0 B;  3K5L A;  1BGY H;  1Y4M A;  4UXN A;  4GZR B;  3IJ4 A;  1HW7 A;  4CS4 A;  4PEL A;  4DYL A;  1G1X B;  2WLN A;  1RP3 B;  4L8J A;  3JD3 A;  1M4U A;  3EVK A;  2DYS C;  1AR5 A;  4DUY B;  3TK1 A;  1LR1 A;  1K7D A;  3OUF A;  4MTO A;  3K79 A;  1ARO P;  1AP5 A;  3RGB A;  4NVP A;  4YIP A;  2QJ1 A;  2UUC B;  4K0K O;  3FFQ A;  4LNU A;  1M5I A;  1VF7 A;  2KQX A;  3UO2 A;  2WLI B;  3KCY A;  1SS3 A;  3HR0 A;  3SPI A;  3ETE A;  3HKC A;  1G4Y B;  5LBQ A;  5B1A C;  2ODM A;  3TJT A;  1WAZ A;  2Q6A A;  1EBO A;  2H94 A;  4DR4 B;  1VF6 C;  4B7K A;  3SPG A;  2FML A;  3MHH C;  2ZE6 A;  3E22 B;  1QU7 A;  3I55 V;  1TGO A;  3ZRW A;  2FB5 A;  4FZ0 A;  1VP7 A;  4DV4 O;  2ETN A;  5LOV B;  4MVQ A;  1YTF B;  2CGO A;  3SPC A;  3CCJ V;  2HJF C;  4ZBM A;  1NS1 A;  3VQX A;  4YY3 O;  3IC7 A;  4LBE C;  2ILM A;  3L74 H;  3ZMT A;  3K06 A;  3ZRS A;  3G6E V;  4KP4 A;  1SC5 B;  4JAU A;  2IU0 A;  3W7T A;  2EJ7 A;  3CSX A;  5KX5 B;  2HLD G;  1R6K A;  1LNQ A;  4MTF A;  4O4J A;  1AB3 A;  2PI5 A;  1Q81 W;  1VQN V;  2CDY A;  3HKB A;  3ZMZ A;  4EB6 B;  3AG1 B;  3CRR A;  2UUB B;  4QPJ A;  3B8M A;  4DR1 O;  3GWK C;  2LJ2 A;  3VOU A;  1J5E O;  1S0V A;  5BMV A;  1NJI W;  4RQF A;  4X1I A;  1YVW A;  2JEU A;  1FXV A;  3HKC B;  3TET A;  3WG7 B;  2HVK C;  3N2G A;  2X7R B;  1VF5 B;  3F5W C;  4MW3 A;  2WLJ A;  1TUB B;  4X88 A;  2EIJ C;  3A0H Z;  1GN3 A;  3E89 A;  4LH7 A;  4NXN B;  1JR9 A;  3SYQ A;  5FLX N;  5EBM C;  1WP8 A;  2ZE5 A;  1GRJ A;  4I7Z B;  2LGQ A;  1N33 B;  5JJE B;  3CE2 A;  5D5Q A;  1FXK A;  4JI8 O;  1X59 A;  5KA6 A;  3OEE G;  1YHQ V;  2PUS A;  3P3N A;  3OTO B;  1DF5 A;  2JDI G;  1WB8 A;  4I0X A;  1AI6 A;  2UUA B;  2AW9 A;  1A32 A;  1K5Q A;  4J10 A;  3F7Y C;  5LXT A;  5IT9 N;  1AI5 A;  1NKD A;  1F51 A;  2Q0A A;  4LH6 A;  3C90 A;  2PYJ A;  4MSW C;  3ABK C;  4UB6 Z;  1W0J G;  4GX2 A;  2JEX A;  1MG1 A;  3TXQ A;  3RYH B;  2ZCE A;  1NBM G;  4JI1 O;  4CH5 A;  3UT5 B;  2O57 A;  1WPX A;  4FFK A;  1V54 C;  4MT8 A;  1GAX A;  2YXH A;  1YJ9 V;  1YXB A;  3Q4H A;  3K0D A;  2GBO A;  4CC5 A;  4JYB A;  1I94 O;  1R3K C;  1OCZ B;  3AG2 B;  2ITD C;  3N2G B;  1SER A;  1M56 B;  2FL4 A;  4TSF G;  4JI2 B;  5IYZ A;  4XBF A;  3RYF A;  4QGP A;  5JVD A;  2WA4 A;  1DGS A;  2IW5 A;  2UU9 B;  2UXD O;  2A0L A;  1M57 B;  5EZY A;  4GCZ A;  1IBL O;  1NI8 A;  2UXC B;  1XL6 A;  4PD4 F;  4TV8 A;  1QLE C;  2GV9 A;  4FM2 A;  2FKX A;  3UO3 A;  1KKD A;  4F6R B;  2QDO A;  2RN9 A;  2OWO A;  1AIL A;  2JIZ G;  1N8R W;  3CRA A;  5FPO A;  1ENV A;  3ETG A;  3M8A A;  5KMG A;  4YJ3 B;  2JJ2 G;  4HNA A;  2A06 H;  4I0X B;  2JRI A;  5BR8 B;  3CC2 V;  4JI6 O;  1E1R G;  3H01 A;  4O2B A;  3K5N A;  3K08 A;  2JGD A;  3ABT A;  2QE7 G;  1DK1 A;  2X6B A;  1XNQ B;  4L87 A;  4JI5 B;  1VQ7 V;  2Y0I A;  2Q7G A;  2Q69 A;  3QO5 A;  4JGS A;  3QVN A;  4DV1 O;  1ZTE A;  3SJB C;  4DV6 O;  3L70 H;  1OCZ C;  1SQP H;  4Z1V A;  2Z0A A;  4I4T B;  1M56 C;  2FYU H;  3G6B A;  4W4L A;  3KKY A;  3Q4H B;  4I55 A;  4MTG A;  3OW2 U;  1MZF A;  3LSU A;  3WU2 Z;  4WF9 V;  3W7X A;  1BSM A;  1EZJ A;  1SQV H;  3L75 H;  5ITZ B;  4YIO A;  4I5S A;  1Q6U A;  4FZ1 A;  4LF7 B;  1HNX O;  3T1H O;  5L3C A;  4O4L B;  4JV5 O;  3RYF B;  5KHJ A;  4LFA B;  1FXK C;  2Y4T A;  1XL4 A;  4NTX A;  4OX9 B;  4UV8 A;  1L1F A;  1PPJ H;  4ZI7 B;  4TQF A;  4WFF A;  2LFS A;  2BTO A;  4JI4 B;  4UFZ A;  3K0G A;  2QKC A;  1RM1 C;  1BQZ A;  1F4N A;  4CS2 A;  4UVB A;  1SQQ H;  4CBC A;  1X4T A;  2EIN C;  1D5A A;  4LCU C;  1WB7 A;  2YXY A;  1GK9 A;  4E4E A;  2F4V B;  1JJO A;  4LF9 O;  2ZIO A;  1R3J C;  1WA8 A;  3CJH A;  5TIS Z;  5CA3 A;  1NTK H;  4MTX A;  4O2B B;  2JGD B;  3AK2 A;  2W6I G;  1MZE A;  3BEH A;  1FS0 G;  2NR5 A;  5IY5 B;  3B8N A;  1SKV A;  5B1O A;  2ZQM A;  1JJ2 U;  2XHB A;  2QWO B;  1F4M A;  4IL6 Z;  1TVK B;  2BSK B;  3B09 A;  1QR9 A;  1Q43 A;  1DTO A;  4JZ2 A;  1I08 A;  5LMN B;  3FB8 C;  4P9P A;  4X66 B;  4DV0 O;  5KHG A;  3CRM A;  2A9H A;  2L6L A;  3APQ A;  3CXH F;  4PDR A;  1UJW B;  4GKJ B;  3P3P A;  5JH7 A;  1XBL A;  1FXH A;  5B3S B;  3QG5 A;  4IIJ A;  5GON B;  3QO8 A;  2F95 B;  4XDL A;  4FPP A;  4GLX A;  2G38 A;  4JYY A;  4NTY A;  3D3I A;  2XAG A;  4LF5 B;  4MVM A;  1CXZ B;  1R1B A;  3CC7 V;  4D6T H;  4X62 B;  1D2D A;  2EX3 A;  2WLH A;  1HR0 B;  4EFB A;  4B3M B;  5B66 Z;  4J7J A;  5K1P A;  2XUM A;  1N36 O;  4ZKI A;  2XOK G;  1CEZ A;  4GT1 A;  4EEQ A;  1HNZ O;  4H0L B;  3DGE A;  3H9V A;  3ABU A;  1AR1 B;  1M90 W;  1KUQ A;  3OAA G;  4J7K A;  2B9Z A;  4H44 B;  3ZIA G;  2YIA A;  4QPK A;  4U3J A;  3TGU H;  1N34 B;  3S3X A;  5GW7 A;  3HKD A;  3W7U A;  1HNW O;  3K3W A;  4FLW A;  3LNM B;  5IE9 A;  3VQY A;  1IUR A;  3JAT A;  2QGN A;  3BVO A;  3U10 A;  1S3J A;  4PDV A;  4NR1 A;  4GKK O;  4I50 B;  3G80 A;  4ZIB A;  1PD3 A;  4IYI A;  1VQ5 V;  3AG4 B;  1EM1 A;  4NXM B;  1CP9 A;  1Y74 A;  4TUY B;  3SDL A;  1XMO O;  4AIL C;  2HJD A;  1NTM H;  3JSN A;  3CCU V;  2IJH A;  1VAR A;  1QVF U;  4DR3 B;  3MHS C;  3JD4 A;  3JD1 A;  4ICG A;  2Y0P A;  3CCQ V;  1MNG A;  1EFR G;  4CC6 A;  5H9C A;  4LR3 A;  3JAK B;  1GH6 A;  2YXL A;  2Q8V A;  4O2A B;  5JJJ B;  3D3Q A;  4PA7 A;  3KZI Z;  4H33 A;  2QA4 V;  3TCU A;  1XHZ A;  2UXX A;  1U96 A;  2HFE C;  4QE9 A;  2CTP A;  1Y66 A;  2P22 C;  1GKF A;  4YHH O;  4LF6 O;  1B3Q A;  2Q67 A;  2WLI A;  4IHJ A;  3CRQ A;  4FM1 A;  1AJP A;  3RN4 A;  3MAQ A;  2QTO A;  2PF4 E;  2EIL B;  5B1B B;  2DE0 X;  1NH2 B;  2JGU A;  1W0K G;  4RWU A;  2YI8 A;  2OCH A;  4DXW A;  2VQF O;  4BW5 A;  1GN4 A;  4CH4 A;  4IYH A;  1H2S B;  2YIB A;  3EFF K;  5DM6 V;  2Q73 A;  1WN7 A;  3E22 A;  3KCX A;  4JYA B;  1HDJ A;  3ASN C;  2UXN A;  1QBZ A;  1F7Y A;  1Y76 A;  2VQE O;  3ZBH A;  4ZHQ A;  3BFR A;  5LOV A;  2VRZ A;  4BWA A;  2CK3 G;  2M7W A;  3CRC A;  1V9P A;  5B1N A;  5EYP B;  4B3S B;  1G6U A;  4KFM A;  2E5L B;  4DV3 B;  2KB1 A;  2EIM C;  3BHP A;  4UCS A;  1GMG A;  2LW7 A;  3A2F A;  3OMI B;  3L9D A;  4TV9 B;  5KX5 A;  1MSD A;  2OIE A;  2X6C A;  3H1J H;  4D7T A;  4FLX A;  1Z2G A;  2E75 B;  2ZIN A;  3GB7 C;  4RUF A;  5A9G A;  4DUZ B;  5B1B C;  4EB6 A;  2QKA A;  3BY6 A;  5K1X A;  3K59 A;  4H13 B;  4DK0 A;  2Q0O C;  2HKO A;  1SQG A;  2YUA A;  2DYR B;  4IHJ B;  2K1E A;  3L73 H;  4QNH B;  2XAQ A;  3ABL B;  5BY1 A;  4K3A A;  1N32 B;  2C2A A;  2CTW A;  2WLL A;  3RBZ A;  1OV9 A;  3L72 H;  4J7Z A;  1TUB A;  3FB6 C;  3T1Y B;  4DR4 O;  3ML0 A;  3FKS G;  4O4H B;  1VQL V;  5IYD O;  4J11 A;  2ZDI A;  1M1K W;  2YS8 A;  1L8D A;  3B40 A;  2QEX V;  1B04 A;  1Y76 B;  2EIK B;  4GX0 A;  4ZHQ B;  3OMN B;  4FFB B;  3BAA A;  2DOS A;  1AJN A;  4MS2 A;  1QHT A;  2F93 B;  2YC0 A;  1JQ0 A;  2UXB B;  2HHH B;  2OT5 A;  1H2L A;  1H2M A;  2Q4P A;  4UCV A;  4DK1 A;  4UCT A;  3F5T A;  5HFL A;  4DV4 B;  4B3T B;  3K57 A;  1K73 W;  2P5O A;  3DTU B;  4HZ3 A;  1ORQ C;  3UM7 A;  4WCE V;  3RYH A;  4YY3 B;  2AXT Z;  4LP8 A;  3UT5 A;  3X2Q B;  1QNM A;  1DF4 A;  3RWR D;  4X20 B;  4BW9 A;  3FAV B;  4LFC B;  4D7S A;  4X89 A;  4K8Z A;  4X8A A;  1PP9 H;  5EIB D;  4LF8 O;  2EUL A;  4DR5 B;  3RYI A;  3UKM A;  3FB5 C;  3BAB A;  3DXR B;  5CN0 A;  5LA6 B;  1M9N A;  4Z1M G;  1AI4 A;  2WLL B;  1P7B A;  2LO1 A;  1S77 D;  1JPX A;  5J2U A;  1SQB H;  2PYL A;  3A8T A;  1H2K A;  2ZXW B;  2P7T C;  2ZR2 A;  4NXN O;  2WLM A;  1N33 O;  1XQ8 A;  3CCR V;  1PM9 A;  4F6R A;  3MD0 A;  5DEC A;  2Z3Y A;  3THO A;  1SZT A;  4YJ3 A;  3CHX A;  2Y69 B;  2ZM6 B;  4UVA A;  5J9P C;  3CCM V;  3MDS A;  1XHX A;  4FLZ A;  2JVD A;  2CUG A;  2UUA O;  2ZKO A;  3AG1 C;  3WB0 A;  1NU1 H;  2PZS A;  5BXZ A;  4RAI A;  2GHY A;  4JI0 B;  3ZMS A;  3SPH A;  1P49 A;  5IJ0 B;  5C8Y B;  1OCO B;  2CH7 A;  4JAA A;  1GN6 A;  4PA6 A;  5FNV B;  4PA9 A;  4RUE A;  3WG7 C;  4GX1 A;  4O4I B;  4I4T A;  4U7O A;  1AR4 A;  4JYC A;  5ITZ A;  3DSQ A;  3RYI B;  1MSW D;  5KHH A;  1GM7 A;  2PGG A;  2CTQ A;  5J2T B;  1K92 A;  4O4L A;  2ZDI C;  2EZP A;  1L0L H;  2ZNJ A;  3AEI A;  1S76 D;  5J2U B;  4XDJ A;  4JI2 O;  4J9Z B;  1I0H A;  3UQ8 A;  4J9Y B;  2P4K A;  1H2G A;  2F23 A;  2UU9 O;  2AGA A;  3ZED A;  1BS3 A;  4QIW F;  4ZI7 A;  1JFF A;  2P4V A;  2DJV A;  2AHY A;  2DMX A;  2RCV A;  2WAM A;  3ZHR A;  3LSS A;  3QTC A;  3ZMU A;  2QTS A;  3CXC U;  1RSO B;  4DRX B;  2WA3 A;  2ZD9 A;  4NB5 A;  1IX9 A;  1NR7 A;  2KKW A;  4JAS A;  4CH6 A;  4TOI A;  5BR8 O;  2XAJ A;  4PDL A;  4I9Q A;  1XUQ A;  2OYQ A;  4LFB B;  1SZX A;  4BIO A;  1Q6I A;  3ZJZ A;  1P84 F;  4JI5 O;  4FMT A;  1S5J A;  4MVR A;  3SYC A;  2CH7 B;  1OCR B;  4MVZ A;  2W0F C;  1TAE A;  4JI6 B;  3FD9 A;  2GDS A;  3AG2 C;  1TVK A;  3ABM B;  2BSK A;  5KUM A;  2BOC C;  1XI1 A;  4TWK A;  1VIB A;  4JI3 B;  3DC6 A;  4PI2 A;  4FIP C;  4LWS B;  5LHH A;  1FJG O;  1M57 C;  4KHP O;  1KBH A;  3JD2 A;  1E79 G;  4JPR A;  3G67 A;  1AJQ A;  3FYE B;  4LFA O;  5GON A;  3VQV A;  1ZSP A;  2DQ3 A;  3AK1 A;  2NN4 A;  2OIG A;  4LF4 O;  1IBK B;  1JFF B;  3OD4 A;  2WLK A;  3CCL V;  1BQ0 A;  3JAW B;  4A5U B;  1CPY A;  4JV5 B;  4JI4 O;  1R6T A;  4NYK A;  1AP6 A;  1JOY A;  1VQ6 V;  1Z5V A;  2ADQ B;  4DV2 B;  3HPL C;  3A0B Z;  1UPG A;  3ETQ A;  3I56 V;  1BE3 H;  5IDJ A;  4KXR A;  3PJS K;  2QM4 A;  3ZRV A;  3RW0 A;  1EN5 A;  2P67 A;  2DWD C;  5CB4 B;  2ZE7 A;  1MMM A;  3ASO B;  5EIB C;  3W7S A;  1I7F A;  1U97 A;  2XND G;  2B1G A;  2ZNI A;  2ARH A;  4WBN B;  2V4D A;  1ROP A;  4X1Y B;  1OCC B;  1SRY A;  2A7W A;  1NH2 D;  4X64 B;  3AK3 A;  2Q7E A;  5DED A;  1I5Y A;  1IDS A;  2P06 A;  2LP7 A;  4I50 A;  4ABM A;  4QJF B;  2M6Y A;  5LMN O;  2QSA A;  4X66 O;  1E1Q G;  5KAF Z;  1PKX A;  2BTQ A;  2OTL V;  4GKJ O;  4UB8 Z;  1MOF A;  3E8H A;  4TQD A;  3K5O A;  3RYC B;  4TUY A;  2OTJ V;  2F66 C;  2IH3 C;  4EKW A;  2PY5 A;  4DV0 B;  3AG3 B;  3D36 A;  2XAF A;  3SJQ C;  3B77 A;  3CCS V;  1ZUQ A;  4GUN A;  3AG7 A;  3JYC A;  2XAH A;  4F6E A;  3ZN0 A;  3CMA V;  5LMU B;  3IFX A;  1XMQ B;  4LF5 O;  4X62 O;  2GTS A;  1Y6X A;  1RPO A;  5L3B A;  2VWJ A;  5IY5 C;  4JI7 B;  4N21 A;  3JAK A;  4DV7 B;  4O2A A;  4DR6 B;  4TT3 G;  2Q5Z A;  3E8G A;  3APO A;  2QWN B;  5F2V O;  4H37 A;  3RVY A;  2AHZ A;  3C3T A;  1NVP B;  1O9G A;  1N36 B;  3LSQ A;  1R3L C;  1YZB A;  3T1C A;  1HNZ B;  1QLN A;  4IT5 A;  2RNB A;  5B3S C;  1YJW V;  1K97 A;  4J80 A;  1WJZ A;  2Y48 A;  2EZO A;  3K58 A;  1SF9 A;  1BHA A;  1WP7 A;  4Q6G A;  3BA9 A;  1K9M W;  4GYC B;  3TXS A;  3ZHV A;  4FLV A;  3D8C A;  3O65 A;  2BTQ B;  2YIB D;  1T5E A;  4X65 B;  4C7U A;  4E2L A;  4P2Z A;  5H5N A;  1FFX B;  1XOU A;  1OHH G;  4YJ2 B;  3GVM A;  1URF A;  3M99 B;  2K9P A;  3QF7 A;  3RT3 C;  1JVM A;  5KAI Z;  4NXM O;  1EN6 A;  1YCI A;  1H2N A;  4MVS A;  5LHI A;  1KD1 W;  1ZL8 B;  2IJJ A;  3CPW U;  1O9H A;  4DR3 O;  2QWQ B;  1YTF D;  4AQY O;  4MW8 A;  5EYP A;  3STZ C;  5CA0 B;  3BCC H;  1K5S A;  3ZRX A;  5FPR A;  2QWR B;  1V55 B;  3HKE B;  3JSL A;  4G27 B;  5KLV H;  1YDX A;  1KYO F;  4FK5 C;  3IGA C;  4TV9 A;  4P30 A;  5IWA O;  3JCU Z;  1F23 A;  2L35 A;  4NKG B;  1M93 A;  2KG7 B;  2N05 A;  5EC2 C;  4DR2 B;  4DV5 B;  5L3E A;  2OCC B;  1BZK A;  4EFE A;  4MVU A;  2DN9 A;  4F4L A;  2IBZ H;  2YI9 A;  2YEV A;  3AG4 C;  2AZ2 A;  4X1K B;  2HEP A;  1YIT V;  1K8A W;  3EXA A;  3P32 A;  1XNR B;  3CCV V;  4B3R B;  1GM8 A;  3ICX A;  1KU9 A;  2DYS B;  2F1M A;  3D36 C;  4YHH B;  3RVZ A;  1UFI A;  2D2C B;  4UUJ C;  3CWB H;  2AZ0 A;  4O4H A;  4YXW G;  3ZHS A;  5JCO A;  3H1H H;  4FFB A;  3IAY A;  3CEI A; 
#chains in the Genus database with same CATH homology
 4DV1 O;  4B3R O;  4DV6 O;  5H5N A;  2UUB O;  3RT3 C;  2Z0A A;  4NXN O;  1A32 A;  2E5L O;  4LFC O;  4NXM O;  4DV3 O;  4DV2 O;  5BR8 O;  5LL6 Y;  1N34 O;  4JYA O;  5IT9 N;  2F4V O;  1N33 O;  2UXC O;  4DUY O;  4OPH A;  4DV4 O;  5BY1 A;  1HNX O;  5LMN O;  2N74 A;  4DR5 O;  4X66 O;  3T1H O;  4DR3 O;  3JAM N;  1R1B A;  4JI5 O;  4AQY O;  1D2D A;  4JI1 O;  4GKJ O;  4JV5 O;  4DUZ O;  1NS1 A;  4YY3 O;  2UUC O;  4DR4 O;  1FKA O;  4X65 O;  4YHH O;  4LF6 O;  1IBM O;  1N36 O;  4B3S O;  2UUA O;  2ZKO A;  4DR7 O;  3R66 A;  1HNZ O;  5IWA O;  5BXZ A;  4X64 O;  1I94 O;  1AB3 A;  2VQF O;  4LFB O;  3J7A U;  1FJG O;  2DOS A;  1XNQ O;  4LF5 O;  1KUQ A;  3J80 N;  1N32 O;  4KHP O;  4X62 O;  3OTO O;  4LFA O;  2UXD O;  4DR1 O;  3T1Y O;  2ZM6 O;  1G1X B;  4LF9 O;  1HNW O;  3F5T A;  1XEQ A;  1J5E O;  1IBL O;  4LF4 O;  1F7Y A;  2FKX A;  4JI3 O;  2VQE O;  4GKK O;  4A5U B;  1AIL A;  4JI4 O;  1R6T A;  4JI0 O;  4LF7 O;  4K0K O;  1FYJ A;  5LMU O;  3M8A A;  1XMQ O;  4JI2 O;  2UXB O;  4DR2 O;  4DV5 O;  1YZB A;  2HHH O;  5FLX N;  5A2Q N;  1HR0 O;  2JRI A;  4B3M O;  3SDL A;  2UU9 O;  2AGA A;  4JI6 O;  2LW7 A;  1XMO O;  4JI7 O;  4DV7 O;  4OX9 O;  4DR6 O;  2DJV A;  3J81 N;  4LF8 O;  1IBK O;  4B3T O;  4DV0 O;  4JI8 O;  1DK1 A;  1X59 A;  4OPA A;  1XNR O;  3O65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...