4DV5O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv5O00
1N33O 4DV2O 4JI7O 4GKJO 4JI4O 1YZBA 2E5LO 2Z0AA 2DOSA 1N36O 4K0KO 4JV5O 1FYJA 3F5TA 1IBLO 4DR5O 1XEQA 4JI8O 1HNWO 2ZM6O 4OPAA 4DV1O 2DJVA 4DR7O 4JYAO 1AB3A 3O65A 1G1XB 1XMOO 4GKKO 1N34O 2JRIA 5IWAO 4JI0O 1HNZO 1N32O 4LF5O 3J81N 4DR6O 1A32A 3SDLA 1XNRO 4B3RO 2VQFO 4X65O 3RT3C 4LF8O 1KUQA 4YHHO 5A2QN 1D2DA 5BR8O 1R6TA 4DV3O 4LFAO 1J5EO 5LMUO 4B3TO 5IT9N 2UU9O 2FKXA 4JI3O 3J80N 3J7AU 4DR2O 4DV0O 4DV6O 4DR3O 2UUCO 4JI6O 4JI2O 4LF7O 1DK1A 1FKAO 4LFCO 3JAMN 2F4VO 5H5NA 4LF6O 4DUZO 3R66A 2UXDO 4JI5O 4OPHA 2N74A 3T1HO 4DUYO 3M8AA 4KHPO 4DV7O 1FJGO 4DV4O 4JI1O 5LMNO 1NS1A 4X66O 2LW7A 1XNQO 5FLXN 4DR4O 1IBKO 5LL6Y 1F7YA 4NXMO 4LFBO 2UUBO 1HNXO 2HHHO 1X59A 4OX9O 3T1YO 1IBMO 5BY1A 4B3MO 4DR1O 4B3SO 1R1BA 1XMQO 2AGAA 1HR0O 4YY3O 2UUAO 4LF4O 1I94O 3OTOO 4X64O 5BXZA 4DV5O 2VQEO 4LF9O 2ZKOA 4AQYO 2UXBO 4NXNO 4A5UB 2UXCO 4X62O 1AILA
chains in the Genus database with same CATH superfamily
2ZIOA 3P3NA 5IYZA 1M1KW 4DV0B 4GX5A 4I4TA 3UM7A 1XQ8A 1Q6UA 2UXXA 1CXZB 3ETDA 1MABG 2WLLA 5F2VO 1N0JA 1EBOA 1KP3A 4O4JB 4DR1B 3CCQV 5FNVB 5CB4B 1MMMA 2VQFB 4DW1A 3E83A 5IE9A 1PL0A 4GCZA 3CX5F 3BA8A 1IBLB 2IJJA 1JMKC 3C3TA 3L73H 2ZE6A 4YIPA 3SR2C 5IDJA 4HBNA 5KHKA 3ZS8C 1OJHA 2F23A 2BSKB 3ZN1A 5KAIZ 2EIMC 2JK5C 1WP8A 4I7ZB 2DYRB 3STZC 4OPHA 1M5IA 4FLYA 3OMAB 2Y0PA 4IT5A 1GRJA 5FNVA 4O4JA 2Q69A 3ETQA 1V9PA 3ABTA 1YIJV 4LNUA 4KUMA 2WLLB 5FLXN 1TUEB 1XL4A 3ZN0A 2ADQB 4I4TB 2P7TC 4X9QA 2AHZA 1IVSA 2AGAA 4NTXA 5IYBO 1VF6C 4AQYO 1MSDA 4CH4A 3AK3A 3UO3A 2FYUH 1KKDA 4ZIBA 4DK0A 3L70H 2PTMA 5GTIZ 1ROPA 2EX3A 4JAVA 2DOSA 3RGBA 3FKSG 1N36O 4JI8O 4NTYA 1IURA 1XL6A 4HAMA 4JYAO 2JDIG 4ZOLA 4HNAB 2OTJV 4GKKO 3ZMTA 4CS2A 4QNHB 1BS3A 1E1QG 3M99B 4O2BA 3CB2A 3FB7C 4Z1VA 3TXQA 4DV6B 1I7FA 4LWSA 2WLNA 3C3SA 1XREA 1NKDA 3CP1A 1VP7A 2W6JG 1Y6XA 4B3TO 2GBOA 4JTDB 2IU0A 1SRYA 5LHGA 5L3EA 3ABMC 4W4LA 2N05A 3FFQA 1WP7A 3JALA 3BFRA 2O57A 4KL1A 3ZIAG 4F6RA 2Q4PA 3SPIA 5H5NA 5L3GA 4DR5B 3BA9A 4MVUA 1WJZA 2GUZA 4YY3B 4KHPO 2XAQA 4JYAB 1V54C 1NTZH 1Y74A 2AZ0A 1N33B 2OCCC 1NR7A 2RDCA 1V55C 1HNZB 4JV5B 4BW5A 1SC5B 2UUBB 2PZSA 4FLXA 2M6YA 2Q7HA 2HG5C 5BZBA 1FFTB 3OAAG 4CS3A 3W7WA 1PNLA 5A9GA 1AI4A 4MVSA 1AR5A 3OMIB 1F4MA 2A06H 1PV0A 1TUBA 2ZKOA 1VQ4V 3JSLA 3HKDB 3RVYA 4L87A 1FFXB 1GM9A 2CTWA 2P5OA 2PYJA 1KBHA 3D36A 3IFXA 3WB1A 5DM6V 5LMNB 2QKAA 2A0LA 3D36C 3CCEV 5EIBD 2ZDIC 3FAVB 2W6IG 5B5EZ 4UVCA 2UUAB 3K5MA 3HKCA 3CCRV 2BOBC 5IWAO 2EILB 1XHZA 2XNDG 3GVMA 1K73W 3ZRSA 2UUCB 4MVRA 4DV4B 2EJRA 1YJWV 3KZIZ 4R7CA 4HYOA 4U7NA 5A2QN 4P9PA 3ZHSA 3LNMB 1YJ9V 1R6TA 4PA6A 4ZBMA 2B1IA 3ASOB 3K03A 3TXSA 2HLDG 1TGOA 1VQ6V 4DV2B 4GKJB 4UVBA 2XASA 5EIBC 1M9NA 1F23A 1SA0A 3KKYA 4OGQB 3VQYA 2Z5UA 3AK1A 5B1AC 1K92A 2QE7G 3IC9A 1FFXA 1XI1A 3D8CA 4PA7A 1GN3A 3N2GA 2F1MA 4FFBB 3AG7A 1BGYH 1P4RA 3ZHQA 2IJHA 4MVQA 1E79G 5LXTA 1VQ9V 5L3DA 4LC1A 5CA0B 1YSCA 1PKXA 2YDEA 4K35A 5FPOA 5BMVA 1GMGA 1EN5A 3SJQC 2A9HA 4NVPA 2BOCC 1PM9A 2YC0A 2CH7A 1Y74B 5GONB 1RM1C 1IBKB 4BIZA 1YVWA 4JI4O 3JARB 5B1AB 4P2ZA 4DUYB 2JGDB 4F6RB 4B3TB 2Y69C 1N4CA 5EBWC 1H38A 4X1YB 2EINB 1HR0B 4DR7O 4X88A 1AB3A 5FL7G 3VBBA 2E3CA 1K97A 4J80A 4I9QA 2CAZC 4FJCC 3CRMA 1Q90D 3CRAA 3QNEA 2LGWA 4O2BB 1N34B 5HFMA 3Q4HB 1O9HA 5BR8O 2JEXA 4WBNA 1AVMA 3K5OA 4JPRA 4UB8Z 1Q81W 4LFAO 2XUMA 3OD4A 1DLBA 3E8FA 1F4NA 4TSFG 1H2NA 4RAIA 1I08A 1L8DA 2H3OA 2XOKG 1S72V 3DSQA 2PF4E 1KECA 2ZM6B 1NH2B 2E5LB 2DMXA 1AR1B 1FXKC 3AG1B 1N36B 4FM1A 1JA8A 4FM0A 4FLUA 5LL6Y 1JFFB 3OFNG 4TT3G 1KMIZ 4LF5B 2YI8A 3E8BA 1I5XA 4X20B 5CA3A 1EZVH 2QWNB 5BY1A 2CK3G 3CEIA 1XMQB 3E8GA 2ZXWB 3B40A 4LF4O 3K79A 5J2TB 4JI4B 1NZ6A 3LSSA 3H01A 4H33A 4LNUB 1AI7A 2DYSB 2QM8A 4RUFA 3DTUB 3OTFA 1SKVA 2QKCA 1S0VA 2QM4A 3HKBB 1VQ7V 3IJ4A 3G6BA 3OUSA 1NJIW 3KCYA 4J7JA 2UU9B 1PL4A 2BCCH 5EYPB 3H1IH 2Z0AA 1WNSA 1K33A 1P84F 4XDKA 5EK0A 1Z5VA 5BMVB 1R3LC 4DV7B 4B08A 1G1XB 1XMOO 1K4DC 2ITDC 3X2QC 3H1JH 1SQGA 4B3RO 3I56V 3BCCH 2P06A 3OE7G 1ORQC 4JAAA 5J2UA 2PYLA 2ZNIA 2ZCEA 3W7TA 4Z1MG 4AILC 4DV0O 4DV6O 1NVPD 5KHJA 1FAFA 4LF7O 4MTFA 4GYCB 4EFEA 2UXDO 5IYZB 2N74A 2OYQA 4J7KA 4O4HB 3JAKA 2KQXA 3CRRA 4YJ2B 4DV7O 4DV4O 4RO2A 4UCRA 1KC8W 3CMEV 3G4SV 5GW7A 3SPJA 2LW7A 2FL4A 4B7EA 1F7YA 4NXMO 1IXBA 3HKEB 1YEWA 1ZLZA 3ZHUA 4XBFA 3UO2A 4NR1A 1XDCA 3MHSC 1EFRG 1Z5WA 4IYHA 4YY3O 1NI8A 3HKCB 3ASNB 2DQ0A 2JIZG 4P30A 4PV1B 2CTPA 3W7UA 4CZZA 3L9DA 4E4EA 2LW1A 3FB5C 1QR9A 3RYFB 1FXKA 5KX5B 3ABMB 4JI6B 5KHIA 1ZAUA 2ODMA 2OIGA 2JEUA 4FLZA 4NKGB 4JI5B 2XHBA 1NT2B 4H13B 3SYPA 3D3IA 4OPAA 1WB7A 4DK1A 3ZMUA 1IX9A 2KG7A 1MNGA 4JI3B 2HHHB 3ZHVA 1R6NA 1HNZO 2E74B 2PGGA 3J81N 4N23A 4DR6B 4WFBV 1YJNV 1N32B 3SDLA 1GN6A 3SYCA 5B1OA 4CBCA 5LA6B 2DN9A 4B3RB 3K04A 3ABKC 1SETA 4O4IA 2X6CA 2JS3A 1B3QA 2UU9O 3CS5A 2YXHA 3BHPA 4JASA 1VF5B 5EC2C 2FKXA 1EM1A 3J80N 2YICA 4UVAA 1ENVA 4TUYA 1Y76A 3JAMN 3UCSC 2EULA 3B09A 1JOYA 3BRCA 3MD0A 4JI5O 3JALB 3OT7A 2R9IA 4IGGA 5H9CA 2VS0A 1URFA 1FJGO 5JJJB 3I5DA 5LMNO 3AG3C 4FZ0A 5B1BC 4DRXA 5E79Z 1WPBA 2KKWA 5L3BA 1QNMA 4GKKB 1H2LA 4NTWA 4NXNB 1ZSPA 2VQEB 3R65A 2Q8VA 2YXYA 4ZOLB 3PN1A 5KA5A 4DV5B 4MT8A 5LHHA 4YIOA 1SQBH 2P6JA 3K3WA 1HP8A 3MAQA 2BTOA 5CN0A 1YTFD 2RCVA 4AQYB 2HEPA 4J41A 5CMUA 4JI7O 4DR3B 1YZBA 2GTAA 1VMGA 4JYCA 3F7YC 5B1BB 2ATKC 2QWQB 4QPKA 2CUGA 4MSWC 4JI0O 4DR6O 4H0LB 1MSWD 2AW9A 4DO2A 4WF9V 3RT3C 3L74H 1KUQA 1IXMA 2QDOA 4X65B 1AJQA 3JAWA 2CGOA 2WLIB 3RYHA 2D3OW 1CEZA 1SQFA 3VQWA 2DQ3A 4I55A 1U96A 1Q7YW 4JI6O 1K3EA 3LDDA 4PDLA 2ZINA 2RQ6A 1BCCH 3LDEA 1PNKA 5IY5B 4JF3A 4JI8B 2BSKA 3ICXA 4DUYO 2B1GA 2JS5A 4BW9A 4GUNA 4JYYA 1ZL8A 1SQQH 2V4DA 2Q6AA 2QA4V 1KD1W 1K5SA 1QVGU 4IHJA 3STLC 3K58A 4UCVA 4UB6Z 5CBHA 3F7VC 4MTOA 1I0HA 1XNQB 1VQLV 4PA3A 1I94B 4QPJA 5L3FA 1IBMO 4B3MO 4JGSA 5JVDB 1YI2V 1BL8A 4O2AA 1K8AW 4MS2A 5LGNA 5K1PA 3OTOO 4MW3A 4LP8A 4WCEV 4LFCB 3B2EE 2HP8A 4BR6A 5KHHA 4U7OA 3BABA 2DYSC 2WAMA 5CBGA 2EZOA 3FX7A 5AG2A 2ADPA 1YCIA 3H1KH 3RYCB 3OEEG 1YXBA 1EN6A 4I50B 2Q0AA 5JQGA 4PI2A 4JV5O 3JATB 4IYIA 4JYBA 3AG4C 4J9YB 1LR1A 4UFZA 2DJVA 2PUSA 4LBEC 3RBZA 5C93A 1GM7A 3N2KA 3QO5A 2W0XA 3K59A 2DW4A 1K5QA 4DV1B 1WLEA 3G71V 1XNRO 1VQNV 4UV8A 1NTKH 1XILA 3GWKC 2IW5A 4ZHQA 3RYCA 3CXCU 1QLEB 3DXRA 4I5SA 1B6QA 3K5LA 1J5EO 4X1KA 2WLKA 5LMUO 5IJ0B 4DR2B 5CA1B 1OV9A 1FD9A 4LF6B 4J7ZA 3J7AU 1K7DA 3OEHG 2B5UA 1DK1A 3P30A 4DUZO 2EIJB 1YDXA 3T1HO 2CTQA 3FB6C 3BY6A 3ZMSA 2L6LA 5EC1C 3K06A 5CBFA 5JVDA 2HJDA 5HFLA 2X0LA 5EZYA 1FS0G 1FXVA 1PD3A 2P67A 1JVMA 4I0XB 1IBKO 1XBLA 2XT9A 2EIKC 4OX9B 2ZD9A 1HNWB 3MDSA 3E22B 2QWPB 3E2EA 3WU2Z 1R1BA 1TVKB 4TV9A 3HB3B 4TV8A 2UXBB 1AP6A 1OCCB 3L75H 4UCSA 4MVMA 3APOA 2FB5A 4G28B 2QTSA 3CSXA 3LUTB 4DYLA 4DW0A 4I55B 2QSAA 3K08A 4R6ZA 3RYHB 5LYJB 2Y0IA 3SYQA 1K34A 3JD2A 4YJ3B 3THOA 1RPRA 2E75B 2Q0OC 4C7UA 1GM8A 3L71H 4BWAA 2FTKA 3ASOC 1HDJA 1HNXB 2RNBA 1AI6A 5GTHZ 3ML0A 1WPXA 2VWKA 1R3JC 3CCUV 2EILC 3VQXA 1GN4A 4FZ1A 2IBZH 3OGCC 3ABLB 1W2BU 4CS4A 1XNRB 5D5PA 1NU1H 2NLJC 3OMNB 4DV3O 2XAHA 3OW2U 1GK9A 1BE3H 2V1DA 4MTXA 4F6EA 5KUKA 4JI3O 4H44B 5KUMA 1WN7A 2GHYA 5DN6G 1ZWIC 5DECA 5LP6C 4MW8A 1AP5A 2ZR3A 1DTOA 4WFEA 2YXLA 5KAFZ 5IJ9B 4DR7B 1MA1A 1RP3B 3F5WC 4PA9A 2KSDA 1BHAA 3BAAA 4LFBO 3ZCCA 2ZNJA 1H8HG 1M4UA 1Z2GA 3U0ZA 1RSOB 1J95A 3B8NA 2K1EA 1X59A 1OCOC 4LCUC 1COWG 2WA3A 4LH6A 4YJ3A 1XMQO 1VEWA 3RFRA 1HR0O 3NXSA 1W0JG 1JJOA 1Y76B 1XUQA 1VF7A 4X62B 1SZXA 1OCCC 3QF7A 3WG7C 5LGTA 4JI7B 5LP6A 1RPOA 1AILA 1TVKA 4D7TA 2YI9A 4DV2O 4QIWF 4GKJO 3A0RA 2F66C 5LA6A 1GAXA 2E5LO 2ZE5A 1KYOF 3E22A 2OCHA 4PD4F 4KHPB 3ZHTA 4X66B 1IBLO 5EBLC 4DR5O 4X1IA 4IIJA 4PJ0Z 4D7SA 1YTFB 3W7SA 2R9AA 3E35A 3CCVV 4B3SB 5EZYB 4EB6A 4GX0A 1R3KC 3JD4A 2H94A 2X6AA 1HW7A 1BSMA 4TOIA 4QGPA 4KFMA 3SYOA 1Q86W 5H6QA 4PDMA 1NVPB 2Y4UA 4HZ3A 3X2QB 4PHZA 4YHHO 1SQPH 2CDYA 4RQFA 1VARA 4JI2B 4DXWA 1T5EA 4JI0B 4X1KB 2QEXV 3ZHRA 1D5NA 4OXSA 2WLMA 2HFEC 1VQOV 1W59A 2UUCO 3TETA 2QWRB 3SJBC 4ZHQB 3ZX6A 4E2LA 4KP4A 1NQTA 4UCOA 4LFCO 4RUEA 2HVKC 3AG4B 3CC7V 2ILMA 5LOVB 3M8AA 3OR7C 4U3FH 3N2KB 4K0KB 3HKEA 4FFKA 2CTRA 1XNQO 1CPYA 3QG5A 3EVKA 1MZEA 4G2KA 1XOUA 1QCEA 5JQGB 2AZ2A 4OX9O 4YJ2A 3JAKB 5C8YB 2W0FC 4U3JA 3TGUH 1WAZA 2OCCB 1SF9A 1KQSU 3JD0A 3CJHB 3T1YB 2V7QG 1NR1A 2GDSA 4X64O 3ZJZA 2VQEO 4LF9O 3UKMA 4MTGA 1EN4A 1AROP 1UJWB 4LH7A 5L3CA 3LSUA 3SJAC 2UXDB 3DC5A 1EZJA 3U10A 4LF9B 3EXAA 4JI1B 3RVZA 4BIUA 1ZUQA 3CCSV 2R70A 4FMTA 3K57A 5ITZA 1XEQA 2ZM6O 3EFFK 1MOFA 3ZRWB 4XDJA 3UT5B 4WFHA 3OR6C 1ZL8B 4Q20A 4R8CA 2JJ1G 5IY5C 1R3IC 4EEQA 1MZFA 3CC2V 3B8MA 4J42A 4B7KA 5K1XA 4PDVA 4X89A 4K8XA 4LF8O 5EYPA 4LFAB 1JCHA 2IH3C 4NB5A 1E1RG 1VQ5V 5KLVH 2FMLA 3FB8C 2YIAA 3PJSK 2WLIA 3JAWB 4DUZB 4JI2O 2N04A 2OWOA 3A0BZ 1GN2A 3ASNC 2F4VO 3WFVA 5J2TA 1VQ8V 1QLNA 5D5QA 2IJKA 1BZKA 1SQXH 1J5EB 3FYIB 4X20A 4GT1A 3ZRXA 1R73A 2WA4A 2ZIMA 3CRQA 2PI4A 4FK5C 5J9PC 5B1NA 1WA8A 4FIPC 3SPGA 1S77D 5H6RA 1K9MW 5C8YA 1BQZA 1THZA 4YXWG 2NNUA 3WB0A 2M7WA 3JCUZ 5KHGA 3AEIA 2YS8A 4QE7A 4X64B 5BXZA 3A8TA 1P7GA 2G38A 2A3QA 2Q7EA 4A5UB 2CGNA 1TA8A 2XAFA 5LOVA 1NTMH 2BTQB 4ICGA 3W7XA 1M57C 3BVOA 3DC6A 3B4SA 4FVMA 2LJ2A 3Q4HA 3LNNA 3S3WA 2LFRA 2F93B 1FYJA 3U11A 3F5TA 3IAYA 3TJTA 1BHBA 1N8RW 4XDLA 1GO3F 2VWJA 5JJEB 4DRXB 2BE3A 5JH7B 5B3SB 4LF5O 1SESA 1BMFG 2R72A 2IH1C 2EINC 3JARA 2D2CB 5TISZ 3O9OA 4EB6B 4QE9A 3QTCA 4BIOA 1PP9H 5KMGB 4YHHB 5IT9N 4IIJB 4X1IB 3MHHC 2CH7B 3G80A 1AI5A 1M57B 2EBOA 3CXHF 1VQKV 1FKAO 2Z3YA 1Q82W 3SPCA 4EKWA 5CA0A 1Y4MA 1X4TA 4TQDA 5LXTB 2UXNA 5KMGA 2HR3A 2MW2B 2Q73A 2KG7B 5IYDO 4D6TH 4JZGA 2HKOA 3VQVA 1Y66A 5B3SC 4NXMB 1Q8IA 3CYOA 3FYEB 1XHXA 4MVOA 1TAEA 4I9WA 2B9ZA 5JCOA 1VF6A 4B3SO 5JH7A 3HR0A 5KX5A 1FXKB 1PPJH 2Y48A 2AHYA 2OIEA 4K3AA 4F4LA 1S3JA 1I94O 3JD1A 1OCOB 2GTSA 2F4VB 4CH5A 3ZBHA 1KKCA 1V54B 2UXCO 2F43G 3E8HA 1Q3EA 2DWEC 2WSSG 1US6A 3DGEA 2Q68A 5H2FZ 2ZXWC 4AHCA 2GSMB 2BTQA 3CMAV 2NN4A 3E86A 1SS3A 2Q9LA 2QKSA 2YSUB 4J9ZB 1HNWO 3IGAC 3A0HZ 2LQTA 2DYRC 3BEHA 1P7BA 1N32O 4MVZA 4J10A 4TWKA 1H2SB 4O4HA 2K9PA 4P9OA 3BPZA 3FAVA 4ABMA 2PI5A 1UFIA 4X65O 1WA8B 4N21A 1KP2A 3KCXA 1ZTEA 3T1HB 2WLHA 1I5YA 1OZ0A 4CH3A 5JJNB 3ETGA 5FPRA 1B04A 1LUWA 1FPOA 5J2UB 3ABLC 3HKDA 3RN4A 3KG2A 4DR2O 3JCZA 5LMUB 1TUBB 4PI0A 1L1FA 1S5LZ 4JAUA 1KU9A 3R66A 4L8JA 3ABUA 1VIBA 2QGNA 3ZMVA 2IJIA 1G8MA 4X8AA 3APQA 2ZDIA 1NS1A 3K9AA 3H1LH 4DR4O 3A2FA 4TV9B 2Q7GA 1SZTA 5IWAB 2JVDA 4G27B 1GKFA 2GUZB 2A7WA 3UT5A 3ZRWA 4TQFA 5JCOC 2P22C 2YIBA 3CWBH 1LUVA 4DV5O 4I0XA 1NH2D 3HKBA 1P49A 5ITZB 4NXNO 2OTLV 3LSQA 1B06A 3OGIB 3AG2B 3ZRVA 1QLEC 3CRCA 3LDCA 2MK3A 4GX1A 4LWSB 5BR8B 2A79B 4UUJC 2IU3A 5KA6A 1Q5OA 2HVJC 2EIJC 1IBMB 4B3MB 1JFFA 2R9RB 1KB9F 5CA1A 4GZRB 1PNMA 3K5NA 1QQCA 1QBZA 1FJGB 3CJHA 5E1AC 2ETNA 3ABKB 4DR4B 2WLJA 2EZPA 3DXRB 4UV9A 3G6EV 4U3JB 3CPWU 2RMKB 1OCZC 1A32A 1R6KA 3S3XA 2XTAA 2YIBD 1H2MA 3OM3B 1D2DA 4CC5A 3SPHA 5B66Z 1QVFU 2F95B 2LFSA 1DF4A 3L72H 2DWDC 4UXNA 5IYCO 3RWRD 4WBNB 3T4DA 3K0GA 1IDSA 4LF7B 4I50A 4PDRA 1H8EG 2LP7A 1VQPV 4LF6O 3WG7B 3GWOA 3CCLV 2ZT9B 1U97A 3N27A 2E76B 1S5HC 4JZ2A 1BT8A 3CE2A 1BQ0A 4JI1O 3TCUA 3M7MX 2UXCB 2LGQA 4X1YA 4FM2A 2GV9A 1L0LH 4IL6Z 2WPDG 3JSNA 3HPLC 4RQEA 1F51A 4O2AB 1M56B 2JGDA 1N0NA 1YHQV 2IM9A 3AG3B 4AI8A 3K9SA 4UCTA 5GONA 3ZMZA 4IHJB 3CCMV 2P4VA 2UXBO 2QTOA 4WFAV 3GB7C 1D5AA 1UPGA 3AG1C 1AJPA 4X62O 1N33O 2JGUA 3P3PA 2EJ7A 1OHHG 2ZE8A 5LP6B 3EHBB 4K0KO 1DF5A 1V55B 2X7RB 5JWPA 3UQ8A 3OTOB 1S5JA 1Q6HA 4FFBA 3N2GB 4LF4B 1GTOA 2L35A 5CB4A 3O65A 2WWWA 1OCZB 2JRIA 1N34O 5DEDA 1AJNA 1AR4A 1IZ3A 2XAJA 5LBQA 1RSOA 3E89A 4WFGA 2VQFO 4H37A 1SA0B 3TK1A 1JPXA 2EIMB 2VRZA 4R50A 3NR7A 2QR4A 2OT5A 5IJ9A 4LF8B 1FXHA 4DR3O 3FD9A 2Y4TA 1CP9A 1O9GA 3I55V 1S76D 3QVNA 4FLTA 1JQ0A 1JR9A 4GX2A 1WB8A 1RM1B 3JYCA 1K4CC 2RJZA 3SGIA 4BAYA 2RN9A 4JTCB 3C90A 2YEVB 4ASUG 2UUBO 1HNXO 1OCRB 1Q6IA 3B77A 3G67A 4QJFB 1RFYA 2EIKB 4GLXA 1H2KA 1Q43A 4PELA 4DR1O 3QO7A 4KXRA 2ZR2A 3H1HH 4O4LB 1Y67A 3IC7A 2X6BA 4Z2WA 1G6UA 3CCJV 3RW0A 1QHTA 3OUFA 4W4KA 3SJCC 3JASB 1M56C 1JJ2U 2Q5ZA 5LGUA 1NBMG 4JTAB 4LFBB 5LYJA 3RYIB 1VQMV 4K8ZA 1M93A 4TUYB 4FLVA 2CE4A 3WB2A 2P4KA 2YIDA 4ZI7A 4DV1O 1JX9A 3D3QA 2P90A 4LR3A 3ETEA 4TV8B 4O4IB 1OCRC 1W0KG 2KB1A 1HWYA 4WFFA 4ZI7B 1YITV 2QJ1A 3H9VA 3ZEDA 4DV3B 3JD3A 2H8PC 3K0DA 1LNQA 4NYKA 1DGSA 2ZE7A 3RYIA 2QWOB 3T1CA 1SQVH 2ITCC 3AG2C 3JASA 1L0NH 2Y69B 4RWUA 1YF2A 2AXTZ 4CC6A 1MG1A 4ZKIA 2Q67A 4PA4A 5EBMC 1QR8A 2LO1A 1GH6A 4UCUA 2ARHA 2JJ2G 4O4LA 5LHIA 3CD6V 3CHXA 3AK2A 3RYFA 1M90W 2QM7A 4CH6A 5IJ0A 3T2MA 3T4ZA 3QO8A 2HJFC 4HNAA 1G4YB 2YEVA 4X66O 4Q6GA 1XMOB 4EFBA 2PY5A 2NR5A 1SERA 2ZQMA 2HHHO 3SYAA 3T1YO 2C2AA 2UUAO 1ZX3A 2DE0X 1QU7A 4FPPA 3JATA 3CC4V 3P32A 4FLWA 1H2GA 3VOUA 2YUAA 2XAGA 4J11A
chains in the Genus database with same CATH topology
1N33O 4DV2O 4JI7O 4GKJO 4JI4O 1YZBA 2E5LO 2Z0AA 2DOSA 1N36O 4K0KO 4JV5O 1FYJA 3F5TA 1IBLO 4DR5O 1XEQA 4JI8O 1HNWO 2ZM6O 4OPAA 4DV1O 2DJVA 4DR7O 4JYAO 1AB3A 3O65A 1G1XB 1XMOO 4GKKO 1N34O 2JRIA 5IWAO 4JI0O 1HNZO 1N32O 4LF5O 3J81N 4DR6O 1A32A 3SDLA 1XNRO 4B3RO 2VQFO 4X65O 3RT3C 4LF8O 1KUQA 4YHHO 5A2QN 1D2DA 5BR8O 1R6TA 4DV3O 4LFAO 1J5EO 5LMUO 4B3TO 5IT9N 2UU9O 2FKXA 4JI3O 3J80N 3J7AU 4DR2O 4DV0O 4DV6O 4DR3O 2UUCO 4JI6O 4JI2O 4LF7O 1DK1A 1FKAO 4LFCO 3JAMN 2F4VO 5H5NA 4LF6O 4DUZO 3R66A 2UXDO 4JI5O 4OPHA 2N74A 3T1HO 4DUYO 3M8AA 4KHPO 4DV7O 1FJGO 4DV4O 4JI1O 5LMNO 1NS1A 4X66O 2LW7A 1XNQO 5FLXN 4DR4O 1IBKO 5LL6Y 1F7YA 4NXMO 4LFBO 2UUBO 1HNXO 2HHHO 1X59A 4OX9O 3T1YO 1IBMO 5BY1A 4B3MO 4DR1O 4B3SO 1R1BA 1XMQO 2AGAA 1HR0O 4YY3O 2UUAO 4LF4O 1I94O 3OTOO 4X64O 5BXZA 4DV5O 2VQEO 4LF9O 2ZKOA 4AQYO 2UXBO 4NXNO 4A5UB 2UXCO 4X62O 1AILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 O;  4DV2 O;  4JI7 O;  4GKJ O;  4JI4 O;  1YZB A;  2E5L O;  2Z0A A;  2DOS A;  1N36 O;  4K0K O;  4JV5 O;  1FYJ A;  3F5T A;  1IBL O;  4DR5 O;  1XEQ A;  4JI8 O;  1HNW O;  2ZM6 O;  4OPA A;  4DV1 O;  2DJV A;  4DR7 O;  4JYA O;  1AB3 A;  3O65 A;  1G1X B;  1XMO O;  4GKK O;  1N34 O;  2JRI A;  5IWA O;  4JI0 O;  1HNZ O;  1N32 O;  4LF5 O;  3J81 N;  4DR6 O;  1A32 A;  3SDL A;  1XNR O;  4B3R O;  2VQF O;  4X65 O;  3RT3 C;  4LF8 O;  1KUQ A;  4YHH O;  5A2Q N;  1D2D A;  5BR8 O;  1R6T A;  4DV3 O;  4LFA O;  1J5E O;  5LMU O;  4B3T O;  5IT9 N;  2UU9 O;  2FKX A;  4JI3 O;  3J80 N;  3J7A U;  4DR2 O;  4DV0 O;  4DV6 O;  4DR3 O;  2UUC O;  4JI6 O;  4JI2 O;  4LF7 O;  1DK1 A;  1FKA O;  4LFC O;  3JAM N;  2F4V O;  5H5N A;  4LF6 O;  4DUZ O;  3R66 A;  2UXD O;  4JI5 O;  4OPH A;  2N74 A;  3T1H O;  4DUY O;  3M8A A;  4KHP O;  4DV7 O;  1FJG O;  4DV4 O;  4JI1 O;  5LMN O;  1NS1 A;  4X66 O;  2LW7 A;  1XNQ O;  5FLX N;  4DR4 O;  1IBK O;  5LL6 Y;  1F7Y A;  4NXM O;  4LFB O;  2UUB O;  1HNX O;  2HHH O;  1X59 A;  4OX9 O;  3T1Y O;  1IBM O;  5BY1 A;  4B3M O;  4DR1 O;  4B3S O;  1R1B A;  1XMQ O;  2AGA A;  1HR0 O;  4YY3 O;  2UUA O;  4LF4 O;  1I94 O;  3OTO O;  4X64 O;  5BXZ A;  4DV5 O;  2VQE O;  4LF9 O;  2ZKO A;  4AQY O;  2UXB O;  4NXN O;  4A5U B;  2UXC O;  4X62 O;  1AIL A; 
#chains in the Genus database with same CATH topology
 2ZIO A;  3P3N A;  5IYZ A;  1M1K W;  4DV0 B;  4GX5 A;  4I4T A;  3UM7 A;  1XQ8 A;  1Q6U A;  2UXX A;  1CXZ B;  3ETD A;  1MAB G;  2WLL A;  5F2V O;  1N0J A;  1EBO A;  1KP3 A;  4O4J B;  4DR1 B;  3CCQ V;  5FNV B;  5CB4 B;  1MMM A;  2VQF B;  4DW1 A;  3E83 A;  5IE9 A;  1PL0 A;  4GCZ A;  3CX5 F;  3BA8 A;  1IBL B;  2IJJ A;  1JMK C;  3C3T A;  3L73 H;  2ZE6 A;  4YIP A;  3SR2 C;  5IDJ A;  4HBN A;  5KHK A;  3ZS8 C;  1OJH A;  2F23 A;  2BSK B;  3ZN1 A;  5KAI Z;  2EIM C;  2JK5 C;  1WP8 A;  4I7Z B;  2DYR B;  3STZ C;  4OPH A;  1M5I A;  4FLY A;  3OMA B;  2Y0P A;  4IT5 A;  1GRJ A;  5FNV A;  4O4J A;  2Q69 A;  3ETQ A;  1V9P A;  3ABT A;  1YIJ V;  4LNU A;  4KUM A;  2WLL B;  5FLX N;  1TUE B;  1XL4 A;  3ZN0 A;  2ADQ B;  4I4T B;  2P7T C;  4X9Q A;  2AHZ A;  1IVS A;  2AGA A;  4NTX A;  5IYB O;  1VF6 C;  4AQY O;  1MSD A;  4CH4 A;  3AK3 A;  3UO3 A;  2FYU H;  1KKD A;  4ZIB A;  4DK0 A;  3L70 H;  2PTM A;  5GTI Z;  1ROP A;  2EX3 A;  4JAV A;  2DOS A;  3RGB A;  3FKS G;  1N36 O;  4JI8 O;  4NTY A;  1IUR A;  1XL6 A;  4HAM A;  4JYA O;  2JDI G;  4ZOL A;  4HNA B;  2OTJ V;  4GKK O;  3ZMT A;  4CS2 A;  4QNH B;  1BS3 A;  1E1Q G;  3M99 B;  4O2B A;  3CB2 A;  3FB7 C;  4Z1V A;  3TXQ A;  4DV6 B;  1I7F A;  4LWS A;  2WLN A;  3C3S A;  1XRE A;  1NKD A;  3CP1 A;  1VP7 A;  2W6J G;  1Y6X A;  4B3T O;  2GBO A;  4JTD B;  2IU0 A;  1SRY A;  5LHG A;  5L3E A;  3ABM C;  4W4L A;  2N05 A;  3FFQ A;  1WP7 A;  3JAL A;  3BFR A;  2O57 A;  4KL1 A;  3ZIA G;  4F6R A;  2Q4P A;  3SPI A;  5H5N A;  5L3G A;  4DR5 B;  3BA9 A;  4MVU A;  1WJZ A;  2GUZ A;  4YY3 B;  4KHP O;  2XAQ A;  4JYA B;  1V54 C;  1NTZ H;  1Y74 A;  2AZ0 A;  1N33 B;  2OCC C;  1NR7 A;  2RDC A;  1V55 C;  1HNZ B;  4JV5 B;  4BW5 A;  1SC5 B;  2UUB B;  2PZS A;  4FLX A;  2M6Y A;  2Q7H A;  2HG5 C;  5BZB A;  1FFT B;  3OAA G;  4CS3 A;  3W7W A;  1PNL A;  5A9G A;  1AI4 A;  4MVS A;  1AR5 A;  3OMI B;  1F4M A;  2A06 H;  1PV0 A;  1TUB A;  2ZKO A;  1VQ4 V;  3JSL A;  3HKD B;  3RVY A;  4L87 A;  1FFX B;  1GM9 A;  2CTW A;  2P5O A;  2PYJ A;  1KBH A;  3D36 A;  3IFX A;  3WB1 A;  5DM6 V;  5LMN B;  2QKA A;  2A0L A;  3D36 C;  3CCE V;  5EIB D;  2ZDI C;  3FAV B;  2W6I G;  5B5E Z;  4UVC A;  2UUA B;  3K5M A;  3HKC A;  3CCR V;  2BOB C;  5IWA O;  2EIL B;  1XHZ A;  2XND G;  3GVM A;  1K73 W;  3ZRS A;  2UUC B;  4MVR A;  4DV4 B;  2EJR A;  1YJW V;  3KZI Z;  4R7C A;  4HYO A;  4U7N A;  5A2Q N;  4P9P A;  3ZHS A;  3LNM B;  1YJ9 V;  1R6T A;  4PA6 A;  4ZBM A;  2B1I A;  3ASO B;  3K03 A;  3TXS A;  2HLD G;  1TGO A;  1VQ6 V;  4DV2 B;  4GKJ B;  4UVB A;  2XAS A;  5EIB C;  1M9N A;  1F23 A;  1SA0 A;  3KKY A;  4OGQ B;  3VQY A;  2Z5U A;  3AK1 A;  5B1A C;  1K92 A;  2QE7 G;  3IC9 A;  1FFX A;  1XI1 A;  3D8C A;  4PA7 A;  1GN3 A;  3N2G A;  2F1M A;  4FFB B;  3AG7 A;  1BGY H;  1P4R A;  3ZHQ A;  2IJH A;  4MVQ A;  1E79 G;  5LXT A;  1VQ9 V;  5L3D A;  4LC1 A;  5CA0 B;  1YSC A;  1PKX A;  2YDE A;  4K35 A;  5FPO A;  5BMV A;  1GMG A;  1EN5 A;  3SJQ C;  2A9H A;  4NVP A;  2BOC C;  1PM9 A;  2YC0 A;  2CH7 A;  1Y74 B;  5GON B;  1RM1 C;  1IBK B;  4BIZ A;  1YVW A;  4JI4 O;  3JAR B;  5B1A B;  4P2Z A;  4DUY B;  2JGD B;  4F6R B;  4B3T B;  2Y69 C;  1N4C A;  5EBW C;  1H38 A;  4X1Y B;  2EIN B;  1HR0 B;  4DR7 O;  4X88 A;  1AB3 A;  5FL7 G;  3VBB A;  2E3C A;  1K97 A;  4J80 A;  4I9Q A;  2CAZ C;  4FJC C;  3CRM A;  1Q90 D;  3CRA A;  3QNE A;  2LGW A;  4O2B B;  1N34 B;  5HFM A;  3Q4H B;  1O9H A;  5BR8 O;  2JEX A;  4WBN A;  1AVM A;  3K5O A;  4JPR A;  4UB8 Z;  1Q81 W;  4LFA O;  2XUM A;  3OD4 A;  1DLB A;  3E8F A;  1F4N A;  4TSF G;  1H2N A;  4RAI A;  1I08 A;  1L8D A;  2H3O A;  2XOK G;  1S72 V;  3DSQ A;  2PF4 E;  1KEC A;  2ZM6 B;  1NH2 B;  2E5L B;  2DMX A;  1AR1 B;  1FXK C;  3AG1 B;  1N36 B;  4FM1 A;  1JA8 A;  4FM0 A;  4FLU A;  5LL6 Y;  1JFF B;  3OFN G;  4TT3 G;  1KMI Z;  4LF5 B;  2YI8 A;  3E8B A;  1I5X A;  4X20 B;  5CA3 A;  1EZV H;  2QWN B;  5BY1 A;  2CK3 G;  3CEI A;  1XMQ B;  3E8G A;  2ZXW B;  3B40 A;  4LF4 O;  3K79 A;  5J2T B;  4JI4 B;  1NZ6 A;  3LSS A;  3H01 A;  4H33 A;  4LNU B;  1AI7 A;  2DYS B;  2QM8 A;  4RUF A;  3DTU B;  3OTF A;  1SKV A;  2QKC A;  1S0V A;  2QM4 A;  3HKB B;  1VQ7 V;  3IJ4 A;  3G6B A;  3OUS A;  1NJI W;  3KCY A;  4J7J A;  2UU9 B;  1PL4 A;  2BCC H;  5EYP B;  3H1I H;  2Z0A A;  1WNS A;  1K33 A;  1P84 F;  4XDK A;  5EK0 A;  1Z5V A;  5BMV B;  1R3L C;  4DV7 B;  4B08 A;  1G1X B;  1XMO O;  1K4D C;  2ITD C;  3X2Q C;  3H1J H;  1SQG A;  4B3R O;  3I56 V;  3BCC H;  2P06 A;  3OE7 G;  1ORQ C;  4JAA A;  5J2U A;  2PYL A;  2ZNI A;  2ZCE A;  3W7T A;  4Z1M G;  4AIL C;  4DV0 O;  4DV6 O;  1NVP D;  5KHJ A;  1FAF A;  4LF7 O;  4MTF A;  4GYC B;  4EFE A;  2UXD O;  5IYZ B;  2N74 A;  2OYQ A;  4J7K A;  4O4H B;  3JAK A;  2KQX A;  3CRR A;  4YJ2 B;  4DV7 O;  4DV4 O;  4RO2 A;  4UCR A;  1KC8 W;  3CME V;  3G4S V;  5GW7 A;  3SPJ A;  2LW7 A;  2FL4 A;  4B7E A;  1F7Y A;  4NXM O;  1IXB A;  3HKE B;  1YEW A;  1ZLZ A;  3ZHU A;  4XBF A;  3UO2 A;  4NR1 A;  1XDC A;  3MHS C;  1EFR G;  1Z5W A;  4IYH A;  4YY3 O;  1NI8 A;  3HKC B;  3ASN B;  2DQ0 A;  2JIZ G;  4P30 A;  4PV1 B;  2CTP A;  3W7U A;  4CZZ A;  3L9D A;  4E4E A;  2LW1 A;  3FB5 C;  1QR9 A;  3RYF B;  1FXK A;  5KX5 B;  3ABM B;  4JI6 B;  5KHI A;  1ZAU A;  2ODM A;  2OIG A;  2JEU A;  4FLZ A;  4NKG B;  4JI5 B;  2XHB A;  1NT2 B;  4H13 B;  3SYP A;  3D3I A;  4OPA A;  1WB7 A;  4DK1 A;  3ZMU A;  1IX9 A;  2KG7 A;  1MNG A;  4JI3 B;  2HHH B;  3ZHV A;  1R6N A;  1HNZ O;  2E74 B;  2PGG A;  3J81 N;  4N23 A;  4DR6 B;  4WFB V;  1YJN V;  1N32 B;  3SDL A;  1GN6 A;  3SYC A;  5B1O A;  4CBC A;  5LA6 B;  2DN9 A;  4B3R B;  3K04 A;  3ABK C;  1SET A;  4O4I A;  2X6C A;  2JS3 A;  1B3Q A;  2UU9 O;  3CS5 A;  2YXH A;  3BHP A;  4JAS A;  1VF5 B;  5EC2 C;  2FKX A;  1EM1 A;  3J80 N;  2YIC A;  4UVA A;  1ENV A;  4TUY A;  1Y76 A;  3JAM N;  3UCS C;  2EUL A;  3B09 A;  1JOY A;  3BRC A;  3MD0 A;  4JI5 O;  3JAL B;  3OT7 A;  2R9I A;  4IGG A;  5H9C A;  2VS0 A;  1URF A;  1FJG O;  5JJJ B;  3I5D A;  5LMN O;  3AG3 C;  4FZ0 A;  5B1B C;  4DRX A;  5E79 Z;  1WPB A;  2KKW A;  5L3B A;  1QNM A;  4GKK B;  1H2L A;  4NTW A;  4NXN B;  1ZSP A;  2VQE B;  3R65 A;  2Q8V A;  2YXY A;  4ZOL B;  3PN1 A;  5KA5 A;  4DV5 B;  4MT8 A;  5LHH A;  4YIO A;  1SQB H;  2P6J A;  3K3W A;  1HP8 A;  3MAQ A;  2BTO A;  5CN0 A;  1YTF D;  2RCV A;  4AQY B;  2HEP A;  4J41 A;  5CMU A;  4JI7 O;  4DR3 B;  1YZB A;  2GTA A;  1VMG A;  4JYC A;  3F7Y C;  5B1B B;  2ATK C;  2QWQ B;  4QPK A;  2CUG A;  4MSW C;  4JI0 O;  4DR6 O;  4H0L B;  1MSW D;  2AW9 A;  4DO2 A;  4WF9 V;  3RT3 C;  3L74 H;  1KUQ A;  1IXM A;  2QDO A;  4X65 B;  1AJQ A;  3JAW A;  2CGO A;  2WLI B;  3RYH A;  2D3O W;  1CEZ A;  1SQF A;  3VQW A;  2DQ3 A;  4I55 A;  1U96 A;  1Q7Y W;  4JI6 O;  1K3E A;  3LDD A;  4PDL A;  2ZIN A;  2RQ6 A;  1BCC H;  3LDE A;  1PNK A;  5IY5 B;  4JF3 A;  4JI8 B;  2BSK A;  3ICX A;  4DUY O;  2B1G A;  2JS5 A;  4BW9 A;  4GUN A;  4JYY A;  1ZL8 A;  1SQQ H;  2V4D A;  2Q6A A;  2QA4 V;  1KD1 W;  1K5S A;  1QVG U;  4IHJ A;  3STL C;  3K58 A;  4UCV A;  4UB6 Z;  5CBH A;  3F7V C;  4MTO A;  1I0H A;  1XNQ B;  1VQL V;  4PA3 A;  1I94 B;  4QPJ A;  5L3F A;  1IBM O;  4B3M O;  4JGS A;  5JVD B;  1YI2 V;  1BL8 A;  4O2A A;  1K8A W;  4MS2 A;  5LGN A;  5K1P A;  3OTO O;  4MW3 A;  4LP8 A;  4WCE V;  4LFC B;  3B2E E;  2HP8 A;  4BR6 A;  5KHH A;  4U7O A;  3BAB A;  2DYS C;  2WAM A;  5CBG A;  2EZO A;  3FX7 A;  5AG2 A;  2ADP A;  1YCI A;  3H1K H;  3RYC B;  3OEE G;  1YXB A;  1EN6 A;  4I50 B;  2Q0A A;  5JQG A;  4PI2 A;  4JV5 O;  3JAT B;  4IYI A;  4JYB A;  3AG4 C;  4J9Y B;  1LR1 A;  4UFZ A;  2DJV A;  2PUS A;  4LBE C;  3RBZ A;  5C93 A;  1GM7 A;  3N2K A;  3QO5 A;  2W0X A;  3K59 A;  2DW4 A;  1K5Q A;  4DV1 B;  1WLE A;  3G71 V;  1XNR O;  1VQN V;  4UV8 A;  1NTK H;  1XIL A;  3GWK C;  2IW5 A;  4ZHQ A;  3RYC A;  3CXC U;  1QLE B;  3DXR A;  4I5S A;  1B6Q A;  3K5L A;  1J5E O;  4X1K A;  2WLK A;  5LMU O;  5IJ0 B;  4DR2 B;  5CA1 B;  1OV9 A;  1FD9 A;  4LF6 B;  4J7Z A;  3J7A U;  1K7D A;  3OEH G;  2B5U A;  1DK1 A;  3P30 A;  4DUZ O;  2EIJ B;  1YDX A;  3T1H O;  2CTQ A;  3FB6 C;  3BY6 A;  3ZMS A;  2L6L A;  5EC1 C;  3K06 A;  5CBF A;  5JVD A;  2HJD A;  5HFL A;  2X0L A;  5EZY A;  1FS0 G;  1FXV A;  1PD3 A;  2P67 A;  1JVM A;  4I0X B;  1IBK O;  1XBL A;  2XT9 A;  2EIK C;  4OX9 B;  2ZD9 A;  1HNW B;  3MDS A;  3E22 B;  2QWP B;  3E2E A;  3WU2 Z;  1R1B A;  1TVK B;  4TV9 A;  3HB3 B;  4TV8 A;  2UXB B;  1AP6 A;  1OCC B;  3L75 H;  4UCS A;  4MVM A;  3APO A;  2FB5 A;  4G28 B;  2QTS A;  3CSX A;  3LUT B;  4DYL A;  4DW0 A;  4I55 B;  2QSA A;  3K08 A;  4R6Z A;  3RYH B;  5LYJ B;  2Y0I A;  3SYQ A;  1K34 A;  3JD2 A;  4YJ3 B;  3THO A;  1RPR A;  2E75 B;  2Q0O C;  4C7U A;  1GM8 A;  3L71 H;  4BWA A;  2FTK A;  3ASO C;  1HDJ A;  1HNX B;  2RNB A;  1AI6 A;  5GTH Z;  3ML0 A;  1WPX A;  2VWK A;  1R3J C;  3CCU V;  2EIL C;  3VQX A;  1GN4 A;  4FZ1 A;  2IBZ H;  3OGC C;  3ABL B;  1W2B U;  4CS4 A;  1XNR B;  5D5P A;  1NU1 H;  2NLJ C;  3OMN B;  4DV3 O;  2XAH A;  3OW2 U;  1GK9 A;  1BE3 H;  2V1D A;  4MTX A;  4F6E A;  5KUK A;  4JI3 O;  4H44 B;  5KUM A;  1WN7 A;  2GHY A;  5DN6 G;  1ZWI C;  5DEC A;  5LP6 C;  4MW8 A;  1AP5 A;  2ZR3 A;  1DTO A;  4WFE A;  2YXL A;  5KAF Z;  5IJ9 B;  4DR7 B;  1MA1 A;  1RP3 B;  3F5W C;  4PA9 A;  2KSD A;  1BHA A;  3BAA A;  4LFB O;  3ZCC A;  2ZNJ A;  1H8H G;  1M4U A;  1Z2G A;  3U0Z A;  1RSO B;  1J95 A;  3B8N A;  2K1E A;  1X59 A;  1OCO C;  4LCU C;  1COW G;  2WA3 A;  4LH6 A;  4YJ3 A;  1XMQ O;  1VEW A;  3RFR A;  1HR0 O;  3NXS A;  1W0J G;  1JJO A;  1Y76 B;  1XUQ A;  1VF7 A;  4X62 B;  1SZX A;  1OCC C;  3QF7 A;  3WG7 C;  5LGT A;  4JI7 B;  5LP6 A;  1RPO A;  1AIL A;  1TVK A;  4D7T A;  2YI9 A;  4DV2 O;  4QIW F;  4GKJ O;  3A0R A;  2F66 C;  5LA6 A;  1GAX A;  2E5L O;  2ZE5 A;  1KYO F;  3E22 A;  2OCH A;  4PD4 F;  4KHP B;  3ZHT A;  4X66 B;  1IBL O;  5EBL C;  4DR5 O;  4X1I A;  4IIJ A;  4PJ0 Z;  4D7S A;  1YTF B;  3W7S A;  2R9A A;  3E35 A;  3CCV V;  4B3S B;  5EZY B;  4EB6 A;  4GX0 A;  1R3K C;  3JD4 A;  2H94 A;  2X6A A;  1HW7 A;  1BSM A;  4TOI A;  4QGP A;  4KFM A;  3SYO A;  1Q86 W;  5H6Q A;  4PDM A;  1NVP B;  2Y4U A;  4HZ3 A;  3X2Q B;  4PHZ A;  4YHH O;  1SQP H;  2CDY A;  4RQF A;  1VAR A;  4JI2 B;  4DXW A;  1T5E A;  4JI0 B;  4X1K B;  2QEX V;  3ZHR A;  1D5N A;  4OXS A;  2WLM A;  2HFE C;  1VQO V;  1W59 A;  2UUC O;  3TET A;  2QWR B;  3SJB C;  4ZHQ B;  3ZX6 A;  4E2L A;  4KP4 A;  1NQT A;  4UCO A;  4LFC O;  4RUE A;  2HVK C;  3AG4 B;  3CC7 V;  2ILM A;  5LOV B;  3M8A A;  3OR7 C;  4U3F H;  3N2K B;  4K0K B;  3HKE A;  4FFK A;  2CTR A;  1XNQ O;  1CPY A;  3QG5 A;  3EVK A;  1MZE A;  4G2K A;  1XOU A;  1QCE A;  5JQG B;  2AZ2 A;  4OX9 O;  4YJ2 A;  3JAK B;  5C8Y B;  2W0F C;  4U3J A;  3TGU H;  1WAZ A;  2OCC B;  1SF9 A;  1KQS U;  3JD0 A;  3CJH B;  3T1Y B;  2V7Q G;  1NR1 A;  2GDS A;  4X64 O;  3ZJZ A;  2VQE O;  4LF9 O;  3UKM A;  4MTG A;  1EN4 A;  1ARO P;  1UJW B;  4LH7 A;  5L3C A;  3LSU A;  3SJA C;  2UXD B;  3DC5 A;  1EZJ A;  3U10 A;  4LF9 B;  3EXA A;  4JI1 B;  3RVZ A;  4BIU A;  1ZUQ A;  3CCS V;  2R70 A;  4FMT A;  3K57 A;  5ITZ A;  1XEQ A;  2ZM6 O;  3EFF K;  1MOF A;  3ZRW B;  4XDJ A;  3UT5 B;  4WFH A;  3OR6 C;  1ZL8 B;  4Q20 A;  4R8C A;  2JJ1 G;  5IY5 C;  1R3I C;  4EEQ A;  1MZF A;  3CC2 V;  3B8M A;  4J42 A;  4B7K A;  5K1X A;  4PDV A;  4X89 A;  4K8X A;  4LF8 O;  5EYP A;  4LFA B;  1JCH A;  2IH3 C;  4NB5 A;  1E1R G;  1VQ5 V;  5KLV H;  2FML A;  3FB8 C;  2YIA A;  3PJS K;  2WLI A;  3JAW B;  4DUZ B;  4JI2 O;  2N04 A;  2OWO A;  3A0B Z;  1GN2 A;  3ASN C;  2F4V O;  3WFV A;  5J2T A;  1VQ8 V;  1QLN A;  5D5Q A;  2IJK A;  1BZK A;  1SQX H;  1J5E B;  3FYI B;  4X20 A;  4GT1 A;  3ZRX A;  1R73 A;  2WA4 A;  2ZIM A;  3CRQ A;  2PI4 A;  4FK5 C;  5J9P C;  5B1N A;  1WA8 A;  4FIP C;  3SPG A;  1S77 D;  5H6R A;  1K9M W;  5C8Y A;  1BQZ A;  1THZ A;  4YXW G;  2NNU A;  3WB0 A;  2M7W A;  3JCU Z;  5KHG A;  3AEI A;  2YS8 A;  4QE7 A;  4X64 B;  5BXZ A;  3A8T A;  1P7G A;  2G38 A;  2A3Q A;  2Q7E A;  4A5U B;  2CGN A;  1TA8 A;  2XAF A;  5LOV A;  1NTM H;  2BTQ B;  4ICG A;  3W7X A;  1M57 C;  3BVO A;  3DC6 A;  3B4S A;  4FVM A;  2LJ2 A;  3Q4H A;  3LNN A;  3S3W A;  2LFR A;  2F93 B;  1FYJ A;  3U11 A;  3F5T A;  3IAY A;  3TJT A;  1BHB A;  1N8R W;  4XDL A;  1GO3 F;  2VWJ A;  5JJE B;  4DRX B;  2BE3 A;  5JH7 B;  5B3S B;  4LF5 O;  1SES A;  1BMF G;  2R72 A;  2IH1 C;  2EIN C;  3JAR A;  2D2C B;  5TIS Z;  3O9O A;  4EB6 B;  4QE9 A;  3QTC A;  4BIO A;  1PP9 H;  5KMG B;  4YHH B;  5IT9 N;  4IIJ B;  4X1I B;  3MHH C;  2CH7 B;  3G80 A;  1AI5 A;  1M57 B;  2EBO A;  3CXH F;  1VQK V;  1FKA O;  2Z3Y A;  1Q82 W;  3SPC A;  4EKW A;  5CA0 A;  1Y4M A;  1X4T A;  4TQD A;  5LXT B;  2UXN A;  5KMG A;  2HR3 A;  2MW2 B;  2Q73 A;  2KG7 B;  5IYD O;  4D6T H;  4JZG A;  2HKO A;  3VQV A;  1Y66 A;  5B3S C;  4NXM B;  1Q8I A;  3CYO A;  3FYE B;  1XHX A;  4MVO A;  1TAE A;  4I9W A;  2B9Z A;  5JCO A;  1VF6 A;  4B3S O;  5JH7 A;  3HR0 A;  5KX5 A;  1FXK B;  1PPJ H;  2Y48 A;  2AHY A;  2OIE A;  4K3A A;  4F4L A;  1S3J A;  1I94 O;  3JD1 A;  1OCO B;  2GTS A;  2F4V B;  4CH5 A;  3ZBH A;  1KKC A;  1V54 B;  2UXC O;  2F43 G;  3E8H A;  1Q3E A;  2DWE C;  2WSS G;  1US6 A;  3DGE A;  2Q68 A;  5H2F Z;  2ZXW C;  4AHC A;  2GSM B;  2BTQ A;  3CMA V;  2NN4 A;  3E86 A;  1SS3 A;  2Q9L A;  2QKS A;  2YSU B;  4J9Z B;  1HNW O;  3IGA C;  3A0H Z;  2LQT A;  2DYR C;  3BEH A;  1P7B A;  1N32 O;  4MVZ A;  4J10 A;  4TWK A;  1H2S B;  4O4H A;  2K9P A;  4P9O A;  3BPZ A;  3FAV A;  4ABM A;  2PI5 A;  1UFI A;  4X65 O;  1WA8 B;  4N21 A;  1KP2 A;  3KCX A;  1ZTE A;  3T1H B;  2WLH A;  1I5Y A;  1OZ0 A;  4CH3 A;  5JJN B;  3ETG A;  5FPR A;  1B04 A;  1LUW A;  1FPO A;  5J2U B;  3ABL C;  3HKD A;  3RN4 A;  3KG2 A;  4DR2 O;  3JCZ A;  5LMU B;  1TUB B;  4PI0 A;  1L1F A;  1S5L Z;  4JAU A;  1KU9 A;  3R66 A;  4L8J A;  3ABU A;  1VIB A;  2QGN A;  3ZMV A;  2IJI A;  1G8M A;  4X8A A;  3APQ A;  2ZDI A;  1NS1 A;  3K9A A;  3H1L H;  4DR4 O;  3A2F A;  4TV9 B;  2Q7G A;  1SZT A;  5IWA B;  2JVD A;  4G27 B;  1GKF A;  2GUZ B;  2A7W A;  3UT5 A;  3ZRW A;  4TQF A;  5JCO C;  2P22 C;  2YIB A;  3CWB H;  1LUV A;  4DV5 O;  4I0X A;  1NH2 D;  3HKB A;  1P49 A;  5ITZ B;  4NXN O;  2OTL V;  3LSQ A;  1B06 A;  3OGI B;  3AG2 B;  3ZRV A;  1QLE C;  3CRC A;  3LDC A;  2MK3 A;  4GX1 A;  4LWS B;  5BR8 B;  2A79 B;  4UUJ C;  2IU3 A;  5KA6 A;  1Q5O A;  2HVJ C;  2EIJ C;  1IBM B;  4B3M B;  1JFF A;  2R9R B;  1KB9 F;  5CA1 A;  4GZR B;  1PNM A;  3K5N A;  1QQC A;  1QBZ A;  1FJG B;  3CJH A;  5E1A C;  2ETN A;  3ABK B;  4DR4 B;  2WLJ A;  2EZP A;  3DXR B;  4UV9 A;  3G6E V;  4U3J B;  3CPW U;  2RMK B;  1OCZ C;  1A32 A;  1R6K A;  3S3X A;  2XTA A;  2YIB D;  1H2M A;  3OM3 B;  1D2D A;  4CC5 A;  3SPH A;  5B66 Z;  1QVF U;  2F95 B;  2LFS A;  1DF4 A;  3L72 H;  2DWD C;  4UXN A;  5IYC O;  3RWR D;  4WBN B;  3T4D A;  3K0G A;  1IDS A;  4LF7 B;  4I50 A;  4PDR A;  1H8E G;  2LP7 A;  1VQP V;  4LF6 O;  3WG7 B;  3GWO A;  3CCL V;  2ZT9 B;  1U97 A;  3N27 A;  2E76 B;  1S5H C;  4JZ2 A;  1BT8 A;  3CE2 A;  1BQ0 A;  4JI1 O;  3TCU A;  3M7M X;  2UXC B;  2LGQ A;  4X1Y A;  4FM2 A;  2GV9 A;  1L0L H;  4IL6 Z;  2WPD G;  3JSN A;  3HPL C;  4RQE A;  1F51 A;  4O2A B;  1M56 B;  2JGD A;  1N0N A;  1YHQ V;  2IM9 A;  3AG3 B;  4AI8 A;  3K9S A;  4UCT A;  5GON A;  3ZMZ A;  4IHJ B;  3CCM V;  2P4V A;  2UXB O;  2QTO A;  4WFA V;  3GB7 C;  1D5A A;  1UPG A;  3AG1 C;  1AJP A;  4X62 O;  1N33 O;  2JGU A;  3P3P A;  2EJ7 A;  1OHH G;  2ZE8 A;  5LP6 B;  3EHB B;  4K0K O;  1DF5 A;  1V55 B;  2X7R B;  5JWP A;  3UQ8 A;  3OTO B;  1S5J A;  1Q6H A;  4FFB A;  3N2G B;  4LF4 B;  1GTO A;  2L35 A;  5CB4 A;  3O65 A;  2WWW A;  1OCZ B;  2JRI A;  1N34 O;  5DED A;  1AJN A;  1AR4 A;  1IZ3 A;  2XAJ A;  5LBQ A;  1RSO A;  3E89 A;  4WFG A;  2VQF O;  4H37 A;  1SA0 B;  3TK1 A;  1JPX A;  2EIM B;  2VRZ A;  4R50 A;  3NR7 A;  2QR4 A;  2OT5 A;  5IJ9 A;  4LF8 B;  1FXH A;  4DR3 O;  3FD9 A;  2Y4T A;  1CP9 A;  1O9G A;  3I55 V;  1S76 D;  3QVN A;  4FLT A;  1JQ0 A;  1JR9 A;  4GX2 A;  1WB8 A;  1RM1 B;  3JYC A;  1K4C C;  2RJZ A;  3SGI A;  4BAY A;  2RN9 A;  4JTC B;  3C90 A;  2YEV B;  4ASU G;  2UUB O;  1HNX O;  1OCR B;  1Q6I A;  3B77 A;  3G67 A;  4QJF B;  1RFY A;  2EIK B;  4GLX A;  1H2K A;  1Q43 A;  4PEL A;  4DR1 O;  3QO7 A;  4KXR A;  2ZR2 A;  3H1H H;  4O4L B;  1Y67 A;  3IC7 A;  2X6B A;  4Z2W A;  1G6U A;  3CCJ V;  3RW0 A;  1QHT A;  3OUF A;  4W4K A;  3SJC C;  3JAS B;  1M56 C;  1JJ2 U;  2Q5Z A;  5LGU A;  1NBM G;  4JTA B;  4LFB B;  5LYJ A;  3RYI B;  1VQM V;  4K8Z A;  1M93 A;  4TUY B;  4FLV A;  2CE4 A;  3WB2 A;  2P4K A;  2YID A;  4ZI7 A;  4DV1 O;  1JX9 A;  3D3Q A;  2P90 A;  4LR3 A;  3ETE A;  4TV8 B;  4O4I B;  1OCR C;  1W0K G;  2KB1 A;  1HWY A;  4WFF A;  4ZI7 B;  1YIT V;  2QJ1 A;  3H9V A;  3ZED A;  4DV3 B;  3JD3 A;  2H8P C;  3K0D A;  1LNQ A;  4NYK A;  1DGS A;  2ZE7 A;  3RYI A;  2QWO B;  3T1C A;  1SQV H;  2ITC C;  3AG2 C;  3JAS A;  1L0N H;  2Y69 B;  4RWU A;  1YF2 A;  2AXT Z;  4CC6 A;  1MG1 A;  4ZKI A;  2Q67 A;  4PA4 A;  5EBM C;  1QR8 A;  2LO1 A;  1GH6 A;  4UCU A;  2ARH A;  2JJ2 G;  4O4L A;  5LHI A;  3CD6 V;  3CHX A;  3AK2 A;  3RYF A;  1M90 W;  2QM7 A;  4CH6 A;  5IJ0 A;  3T2M A;  3T4Z A;  3QO8 A;  2HJF C;  4HNA A;  1G4Y B;  2YEV A;  4X66 O;  4Q6G A;  1XMO B;  4EFB A;  2PY5 A;  2NR5 A;  1SER A;  2ZQM A;  2HHH O;  3SYA A;  3T1Y O;  2C2A A;  2UUA O;  1ZX3 A;  2DE0 X;  1QU7 A;  4FPP A;  3JAT A;  3CC4 V;  3P32 A;  4FLW A;  1H2G A;  3VOU A;  2YUA A;  2XAG A;  4J11 A; 
#chains in the Genus database with same CATH homology
 1N33 O;  4DV2 O;  4JI7 O;  4GKJ O;  4JI4 O;  1YZB A;  2E5L O;  2Z0A A;  2DOS A;  1N36 O;  4K0K O;  4JV5 O;  1FYJ A;  3F5T A;  1IBL O;  4DR5 O;  1XEQ A;  4JI8 O;  1HNW O;  2ZM6 O;  4OPA A;  4DV1 O;  2DJV A;  4DR7 O;  4JYA O;  1AB3 A;  3O65 A;  1G1X B;  1XMO O;  4GKK O;  1N34 O;  2JRI A;  5IWA O;  4JI0 O;  1HNZ O;  1N32 O;  4LF5 O;  3J81 N;  4DR6 O;  1A32 A;  3SDL A;  1XNR O;  4B3R O;  2VQF O;  4X65 O;  3RT3 C;  4LF8 O;  1KUQ A;  4YHH O;  5A2Q N;  1D2D A;  5BR8 O;  1R6T A;  4DV3 O;  4LFA O;  1J5E O;  5LMU O;  4B3T O;  5IT9 N;  2UU9 O;  2FKX A;  4JI3 O;  3J80 N;  3J7A U;  4DR2 O;  4DV0 O;  4DV6 O;  4DR3 O;  2UUC O;  4JI6 O;  4JI2 O;  4LF7 O;  1DK1 A;  1FKA O;  4LFC O;  3JAM N;  2F4V O;  5H5N A;  4LF6 O;  4DUZ O;  3R66 A;  2UXD O;  4JI5 O;  4OPH A;  2N74 A;  3T1H O;  4DUY O;  3M8A A;  4KHP O;  4DV7 O;  1FJG O;  4DV4 O;  4JI1 O;  5LMN O;  1NS1 A;  4X66 O;  2LW7 A;  1XNQ O;  5FLX N;  4DR4 O;  1IBK O;  5LL6 Y;  1F7Y A;  4NXM O;  4LFB O;  2UUB O;  1HNX O;  2HHH O;  1X59 A;  4OX9 O;  3T1Y O;  1IBM O;  5BY1 A;  4B3M O;  4DR1 O;  4B3S O;  1R1B A;  1XMQ O;  2AGA A;  1HR0 O;  4YY3 O;  2UUA O;  4LF4 O;  1I94 O;  3OTO O;  4X64 O;  5BXZ A;  4DV5 O;  2VQE O;  4LF9 O;  2ZKO A;  4AQY O;  2UXB O;  4NXN O;  4A5U B;  2UXC O;  4X62 O;  1AIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...