3FB5C

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody Fab fragment heavy chain
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb5C00
2WLIA 4J9YB 1M56C 4R7CA 1JVMA 1OCCC 2X6AA 4MW8A 4JTDB 3UM7A 3T4DA 4PDMA 4EKWA 4RUFA 3STLC 3X2QC 2DYRC 4WFFA 5EC1C 4XDJA 1R3JC 3SYQA 3ABMC 2WLHA 4RUEA 5KUKA 5EK0A 1J95A 4H33A 4PA4A 1OCOC 2DWEC 3RBZA 3SPHA 4MS2A 4MVSA 2A79B 5EC2C 5CBHA 2Q67A 4G28B 4MVMA 4P9PA 1XL4A 2IH1C 4P9OA 5CBFA 1OCZC 2A9HA 3ASOC 3JYCA 3K03A 4KFMA 3SJQC 2ZXWC 4JTCB 4MSWC 4R50A 3HPLC 2HVJC 4MTGA 3OR6C 4HYOA 4MVRA 4TWKA 2IH3C 3RVYA 4R6ZA 4CBCA 3FB6C 3LDCA 3WG7C 3IFXA 4X88A 4GX2A 5B3SC 1ZWIC 2K1EA 3EFFK 1LNQA 2HG5C 3ABKC 3LDDA 2EINC 2ATKC 4PA7A 3SPCA 4R8CA 3E8BA 3SYOA 2OCCC 2DYSC 4RO2A 5B1AC 3FB7C 1BL8A 3TETA 2HFEC 2Q69A 3BEHA 1K4CC 2WLJA 3SPJA 3IGAC 4PA3A 4F4LA 3K0GA 3SYCA 2AHYA 4LBEC 5EBMC 4MVUA 2WLKA 4PDVA 4X8AA 3STZC 5EBLC 2X6CA 3FB8C 4RAIA 5EBWC 2A0LA 2R9RB 3F7VC 4J9ZB 3RW0A 2Q6AA 3T4ZA 3E83A 2EIMC 4GX5A 2AHZA 3GB7C 3PJSK 4UUJC 5E1AC 3ABLC 2JK5C 4HZ3A 1KKDA 3OGCC 1M57C 3R65A 4GX0A 4MVQA 4MTFA 4XDLA 1K4DC 3UKMA 1ORQC 3E8GA 3K04A 3LNMB 5KUMA 3FB5C 4MTOA 5IY5C 3E8FA 1V55C 3AG4C 3OUSA 2BOBC 4P30A 2EIKC 4H37A 3F7YC 4QE9A 2EILC 2HVKC 3AG1C 4OXSA 3K08A 1S5HC 3LDEA 3RVZA 4I9WA 3OUFA 4X89A 2ITDC 3F5WC 2KB1A 2HJFC 3SPIA 3SYAA 1R3IC 2WLNA 3VOUA 3K06A 2WLLB 4ZBMA 3TCUA 4BW5A 4PDLA 2ITCC 1R3LC 1OCRC 3SPGA 1G4YB 4GX1A 2H8PC 3ZJZA 2P7TC 3T2MA 4LP8A 2Y69C 3AG2C 2YEVA 3K0DA 3KG2A 4PA9A 2X6BA 4WFGA 3T1CA 2BOCC 5BZBA 2W0FC 2WLIB 3ASNC 3E8HA 1XL6A 4MVOA 4MVZA 5B1BC 4QNHB 4WFHA 1R3KC 4PDRA 4WFEA 1P7BA 3AG3C 4P2ZA 4MW3A 4G27B 1QLEC 4DXWA 2EIJC 2NLJC 2WLLA 2QTOA 2Q68A 4XDKA 2WLMA 4JTAB 1V54C 4LCUC 3E86A 4QE7A 3E89A 5CBGA 3SYPA 3ZRSA 5J9PC 2DWDC 3LUTB 2QKSA 2ZD9A 4PA6A 3OR7C
chains in the Genus database with same CATH superfamily
1RM1B 4DV6O 1IBKB 3J7AU 1B04A 1NBMG 5DN6G 3QO7A 1JJ2U 4K0KO 1K33A 3FX7A 1QR8A 2UXBB 3CD6V 1L1FA 3N2GB 1HNXO 3VQYA 1LR1A 2BSKB 1VEWA 4YIPA 1YI2V 4JI4B 1IX9A 3RGBA 1SERA 4H13B 4EFEA 4NXNB 3WG7C 1FKAO 4DYLA 3E8BA 2DYSC 2HR3A 5GW7A 5JH7A 2WLJA 3CB2A 2LO1A 3L74H 4ZI7B 3CPWU 3RYFB 2NNUA 4CS3A 3JATA 4LNUA 4OPAA 3K59A 5EIBD 2O57A 3UKMA 3A0BZ 4J41A 2Y4UA 4P30A 2QR4A 2ZR3A 1FXKC 4BIUA 3U0ZA 4GYCB 3F5WC 4GUNA 3JD2A 1RM1C 3SJBC 1HW7A 1R3IC 2QWOB 3VOUA 2WLLB 3CC2V 4FVMA 4JI0O 4UCVA 4WFAV 4DR5B 1UFIA 2YIBA 3K0DA 4TQDA 4LFCB 5KHGA 1JFFB 2KQXA 3VBBA 1YITV 4QNHB 1XL6A 1OHHG 4N23A 3BAAA 1M57B 2AGAA 2QTOA 4O2AA 1Q90D 1NTKH 4QE7A 2GUZB 1Q5OA 1VQNV 5LP6A 2KG7B 4KP4A 4DR2B 2E5LB 1WP8A 5FNVA 4MW8A 4B3SB 4ABMA 2IW5A 4GKJO 5EC1C 2DJVA 3R66A 3W7XA 3OGIB 4LF6O 4P9PA 4KHPO 4MT8A 2ZIMA 3JYCA 5LXTA 1H8EG 1SQGA 2R9IA 2N04A 4HYOA 2CH7A 1BGYH 3G6EV 1VF6C 1MNGA 3RVYA 2XHBA 2ZR2A 1GN3A 3IFXA 4DR4O 4H0LB 4FZ0A 3H1HH 4RO2A 3ZHRA 1BL8A 1SQQH 1H2NA 2WLKA 1WA8B 4X8AA 3STZC 2P06A 5KLVH 3FB8C 5CA1B 2ZE7A 1AB3A 3CRQA 2ZE5A 1IZ3A 3L71H 2JJ2G 4DV0B 4FMTA 2IU0A 1M57C 2VQFB 3TXSA 3LNMB 4LWSA 5IYBO 2CTRA 2LW7A 2PYLA 2CE4A 1MA1A 1BS3A 2BTQB 5HFLA 2IBZH 4DR7O 3APOA 3OW2U 2XTAA 4QGPA 3D8CA 1S0VA 1LUVA 1CPYA 1IBLB 3JSNA 4I4TB 1YEWA 4JPRA 2E76B 1DLBA 1XDCA 3THOA 1QNMA 1BQ0A 2XUMA 4QIWF 1IBMO 4PDRA 1H8HG 3ABLB 4P2ZA 1KBHA 4G27B 4DV5O 2D3OW 2ILMA 2XNDG 1V55B 1YHQV 1WNSA 1B6QA 5CBGA 1YCIA 5J9PC 4OPHA 3BVOA 2JGUA 4DR3O 1L0NH 3GWOA 3T4DA 1FPOA 4N21A 4EB6A 4WFFA 1YTFD 5J2UA 2QTSA 1NR7A 4PA4A 3AK3A 4MS2A 4MVSA 5DEDA 1IXBA 4CC5A 4WFBV 1NTMH 3SJQC 1QLEB 3JCZA 4I55B 1WPBA 4FM2A 4IIJB 4Z1VA 3DTUB 4FLTA 4JI6O 2F4VB 3QVNA 3UQ8A 5GONA 2XAJA 3ZHQA 1OCCB 4Q6GA 5D5PA 5FPOA 2H94A 1TUBB 3DXRB 3WU2Z 3JASB 4B7KA 1IBKO 3BEHA 3BRCA 3OMNB 1JR9A 4GT1A 1D5AA 2DW4A 2RJZA 1T5EA 4IGGA 2X6CA 1US6A 4YIOA 5LGTA 2UXBO 1QVGU 3ABLC 3E22B 4DV1B 1FFXB 1SQVH 1V55C 1P4RA 3FD9A 2W6IG 2HVKC 4CH4A 1FYJA 2EINB 2GHYA 5EZYA 3I5DA 4U7NA 1KMIZ 2AZ2A 1R3LC 1NQTA 1P49A 3TGUH 4HNAB 2VS0A 1AR4A 3N2KB 5HFMA 1R3KC 2PTMA 3RFRA 4FJCC 1QLEC 1Y67A 3ZCCA 1M5IA 4JAVA 1QBZA 3Q4HA 2YIAA 5C8YB 4X1KA 3PJSK 5L3EA 1Q3EA 4R7CA 2GBOA 1OCCC 4JTDB 3CC4V 5EYPB 2OTJV 3G71V 1Q6IA 1ZAUA 4IL6Z 5LL6Y 2Q4PA 2ZNJA 5JWPA 4B08A 4H33A 4LF8B 3OTFA 3ASNB 2Z0AA 2IH1C 4DR5O 3B77A 2HHHB 2PF4E 4I50A 4O4JA 4JF3A 4YJ3B 4QPJA 4MTGA 5LA6A 4A5UB 2V4DA 2GV9A 4W4LA 2ZM6B 4UCOA 2EINC 4X9QA 2HP8A 3CCLV 4AI8A 1H2GA 4DR2O 2E5LO 4QJFB 2MK3A 3ABMB 5IJ0A 4J11A 4B3SO 2BCCH 1Y66A 4TQFA 3CRMA 4U3JB 2Q8VA 1XREA 1YXBA 1JMKC 4EFBA 1RPOA 3WB0A 3HKCB 4WCEV 4O4HA 1BCCH 1K4DC 3H01A 4RQFA 1OV9A 1I0HA 4UB6Z 5BY1A 2LQTA 1S77D 2HLDG 3HKDB 3OD4A 2DE0X 3JALA 4KL1A 1CEZA 3CCRV 1KC8W 2E75B 4WF9V 3JSLA 4UV8A 3D36A 2DQ3A 5LOVB 2A3QA 3M8AA 4Z2WA 3JAWB 4I0XA 1XUQA 4NXMB 2Q5ZA 2W0FC 2Q0OC 2WLIB 3ASNC 1RSOA 3OE7G 4WFEA 5CMUA 2DOSA 2HEPA 1N33B 2NLJC 2IJJA 4DUYB 4DV0O 5BMVA 3AG1B 2VQFO 4J9YB 3RYIB 1JVMA 1AILA 4PDMA 4OGQB 1H2SB 1F4NA 3KCYA 3ABMC 1PNMA 5KUKA 3CRAA 2UXXA 4GKKB 2NN4A 3CCQV 1R6KA 3L70H 5CA3A 5H5NA 2A9HA 2E74B 4MSWC 2XASA 4X62B 5IYZA 1QVFU 5LBQA 1K8AW 2ZINA 1KU9A 3FAVB 2PI5A 3W7UA 3AG7A 4TV8A 4RWUA 1XNQB 2W6JG 2G38A 1N0JA 1Y74A 2WPDG 3SJAC 2JEUA 1OZ0A 3OT7A 1I7FA 3CRRA 3JAKA 1SQPH 1Q8IA 3IJ4A 2R9RB 2ZXWB 2JK5C 4HZ3A 2EZPA 3ETGA 4ZHQA 1VQKV 4EEQA 1EN4A 2X0LA 3F7YC 3ZMVA 4JI8B 4B3TB 3AG1C 2YSUB 3ABKB 1SZTA 3K5LA 1H38A 4X64B 2F4VO 1MSWD 2VWJA 1TGOA 1Q82W 3DSQA 4NB5A 1FJGB 2FL4A 4DW0A 2BOCC 3B8NA 2JRIA 5FPRA 3ABTA 1JQ0A 4FM0A 5KHKA 2OWOA 1KUQA 3G4SV 4DK1A 3I56V 4O4LA 3ZS8C 2EIKB 2PI4A 2JS3A 2DWDC 4MVQA 1G8MA 1GN2A 1A32A 1EM1A 2CGOA 3B2EE 3UM7A 2C2AA 4EKWA 3STLC 3K5OA 4LF9B 2X7RB 1ZUQA 3LNNA 1MABG 4YHHB 3AG2B 3QO8A 5IT9N 1CXZB 3JATB 3RBZA 1DK1A 4LNUB 2IJKA 4PV1B 2JS5A 5CBHA 5KAFZ 5KHIA 1S76D 1SETA 2Q9LA 1KD1W 2ZXWC 4JI2B 1V54B 1F4MA 1YJNV 1M4UA 2Y0PA 4LFBB 1VQ4V 4AQYB 1V9PA 1JCHA 1PV0A 4R6ZA 1UJWB 3ABKC 4NYKA 2ZIOA 1N8RW 3SDLA 1WAZA 1XHZA 5IJ9A 3ML0A 4DV7B 2HFEC 1ZTEA 1ZSPA 1HWYA 1XNRB 4MVUA 1RPRA 1FD9A 4O2AB 5K1XA 2RN9A 3A8TA 4LF8O 5LP6B 2Y4TA 2Q0AA 2ZDIA 2AHZA 1U96A 2JVDA 2P6JA 4GX0A 4JI1B 1NVPB 3MDSA 2EIKC 3BHPA 3KZIZ 1WJZA 5CB4B 2YICA 3H1IH 4I9WA 1XEQA 3JD3A 5B1AB 2ZM6O 4O4IA 4CS4A 4BW9A 4K35A 3D3IA 3UCSC 2ODMA 1BSMA 3AG2C 3BCCH 4NR1A 2EJRA 3D3QA 4L87A 1XILA 2CAZC 1JX9A 2W0XA 3CCSV 1V54C 1W0JG 4LR3A 2QKSA 2ZD9A 5LYJA 4LF7B 1VF7A 4IT5A 4IYIA 2ZE6A 3BPZA 3WB2A 2WLHA 5ITZA 3N27A 1K97A 2UUAB 3SPHA 3ZMTA 4K8ZA 5B1BB 1XL4A 4LWSB 5CBFA 1F51A 3ZEDA 1NZ6A 2VWKA 1MMMA 5L3DA 5LP6C 4NXMO 1SS3A 2ARHA 4DR1B 2HVJC 3CCVV 2EULA 3OR6C 3CE2A 1N33O 1M56B 1EN6A 2FYUH 5KX5B 2OT5A 1R1BA 3G6BA 4TV9A 4DV3B 5B1AC 2XAHA 3TETA 1NKDA 1PKXA 3SPJA 2QEXV 3KKYA 4UCUA 1ROPA 3QG5A 3ZHUA 4J42A 1GO3F 5GTHZ 4GKKO 2Q6AA 4W4KA 2P67A 4XDLA 1ORQC 2UU9B 3ZHVA 3E8FA 4X62O 4X20A 1K9MW 4EB6B 4D7SA 3K9SA 1PNKA 3HKBA 3LDEA 5B1NA 2ITDC 3OMIB 2HJFC 5B1OA 1XNQO 1P84F 1PM9A 2RCVA 2H8PC 1IDSA 2GDSA 4LC1A 3RT3C 2X6BA 2UXNA 4JV5B 5B1BC 2LGWA 2E3CA 1XBLA 1S5LZ 3ZMZA 3VQVA 3IAYA 5K1PA 3P32A 4X65B 3SGIA 2WLLA 5GONB 1PL0A 2EBOA 1O9GA 3LUTB 1M56C 2RMKB 3CSXA 3OTOB 3K3WA 5DECA 1G6UA 1SF9A 4JI8O 3I55V 4B3TO 3B8MA 1NT2B 2QM8A 1OCRB 1W0KG 4X64O 2GUZA 3L73H 2Y0IA 5FL7G 2KG7A 1WPXA 1FXVA 1NJIW 1FJGO 1TVKB 2F95B 2M7WA 1IXMA 2P4KA 1SESA 1OJHA 1KECA 1KQSU 2CTQA 1Z5VA 2CK3G 1HNWB 2AW9A 1CP9A 5EZYB 1I08A 4TOIA 4I7ZB 3CCJV 4I9QA 1AR5A 4UXNA 2OIGA 2Q7EA 2MW2B 1SA0A 4PA7A 4R8CA 2WAMA 2DYRB 1VQPV 5CN0A 2LFRA 2Q69A 2QWPB 2YXLA 1S3JA 1BQZA 5JJNB 1VF5B 4LF9O 1IURA 3H1LH 4YHHO 1OCZB 4J9ZB 1M90W 1HR0B 4GX5A 3Q4HB 2R72A 4X1KB 5F2VO 2DN9A 3HR0A 1TAEA 4ASUG 1BZKA 4H44B 4JI2O 4WBNB 5B3SB 4LFBO 3OM3B 4AQYO 4DV2B 4FFBB 5J2TA 1QQCA 2QM7A 5L3CA 5LMNB 1O9HA 3K06A 4BWAA 3TCUA 2ITCC 2NR5A 1EBOA 1Y4MA 1OCRC 3ZBHA 1N0NA 4I50B 4O4JB 2YEVA 3VQWA 3KG2A 1MZFA 4DV7O 4LH6A 5L3BA 2CTPA 1KB9F 1XNRO 3L75H 4PELA 4MW3A 4JI4O 4NKGB 2UXCB 2Q68A 4NXNO 2F43G 3RVZA 5IJ0B 3M7MX 3O65A 1N4CA 1NTZH 4DW1A 1ENVA 3GWKC 2DYRC 2Q7GA 3ZRWA 3F5TA 4O4HB 2YIDA 4ICGA 3ZN0A 2LJ2A 1SC5B 4FLZA 1KP2A 3QF7A 1OCZC 4YJ2B 2Y48A 2P5OA 4TUYA 4BAYA 4R50A 1AI6A 4B3MB 1H2LA 3JALB 1K5SA 2PUSA 4JYCA 4KXRA 3EXAA 4CBCA 2ZNIA 4GX2A 5B3SC 3EFFK 3CS5A 5CA0A 5A9GA 1EFRG 2IM9A 2FB5A 4I0XB 2B5UA 4JYBA 3JD0A 4LF7O 4I55A 4PI2A 1Z5WA 2WSSG 1RSOB 4DO2A 4ZKIA 4JAAA 1K4CC 1K73W 3H1KH 5LHHA 1Y76A 4LFCO 4IHJB 3NXSA 1ZL8A 1N32B 2UUAO 2LGQA 5BMVB 2IJIA 4L8JA 1TUBA 2YIBD 4TT3G 1AP6A 2QM4A 4UVBA 3JASA 1KKDA 3DC6A 4C7UA 1BHAA 3E8GA 5JJJB 1DGSA 4MTXA 5IE9A 4DR1O 1N36B 1XQ8A 1ZLZA 4OXSA 4FLWA 1GAXA 4DR6B 2OCCB 3SPIA 3ZX6A 4X66B 3B09A 3K5NA 1NVPD 1XI1A 4FFKA 1PP9H 3B40A 4DV3O 3GVMA 4JI5B 5IYZB 1Q43A 1L8DA 3BY6A 5AG2A 1LUWA 3E35A 4WFHA 1AR1B 4PD4F 4TV8B 4XDKA 5B66Z 2FKXA 4IYHA 3CCMV 1P7GA 2YI8A 2UUCB 1Y74B 2UU9O 2X6AA 3D36C 1SRYA 3JAKB 1AJPA 3CRCA 3UO3A 3SYQA 1L0LH 4NTYA 4RUEA 4FZ1A 5H6QA 1HNZB 5C8YA 1YJ9V 3DC5A 1XHXA 4O2BA 4ZHQB 5FLXN 3IC7A 3MD0A 5H9CA 1M9NA 2QDOA 2RNBA 3K9AA 3JCUZ 4JV5O 1MOFA 4F6RA 4X65O 4TWKA 3FB6C 4ZOLB 4X88A 1WB7A 2K1EA 5C93A 1X4TA 3UT5A 4ZIBA 3AEIA 1AP5A 3CJHA 2OCCC 3C3SA 3OTOO 4G2KA 1FAFA 3CX5F 1K3EA 1IBLO 2L6LA 4PDVA 2DMXA 1JPXA 4O4LB 3HKEB 4GZRB 1QHTA 5JVDA 3GB7C 5JQGA 3OGCC 3R65A 1J5EB 3OUSA 1HNWO 3CWBH 2QKCA 4U3JA 3EVKA 1NH2B 1M93A 1AJQA 2JGDA 2V1DA 3UO2A 3J81N 2H3OA 5JCOA 1D2DA 2FTKA 4UV9A 5GTIZ 1S5JA 3SPGA 3K57A 5B5EZ 3ZRXA 2UXDB 3S3WA 3HKDA 4Q20A 1VQMV 1EN5A 3AG3C 5LMUB 4LF5B 1H2MA 4YXWG 3JD4A 1HR0O 3E86A 1K92A 1K34A 3RYCA 3JAWA 5IJ9B 1H2KA 2F93B 2WLIA 4CZZA 1VQ8V 3FYIB 1X59A 4DV2O 2HJDA 1FFTB 1IVSA 3ETQA 2PY5A 1WP7A 4HBNA 2JJ1G 5LMNO 4GCZA 2DWEC 5EC2C 1F23A 2CDYA 1SQBH 3A2FA 4K3AA 4HAMA 3K03A 2LW1A 3KCXA 2RQ6A 4U7OA 5JH7B 4DV1O 1JOYA 3TK1A 3A0HZ 4O4IB 3H1JH 2UXCO 2YDEA 1LNQA 3BFRA 4CH5A 2B9ZA 2YXHA 3SYOA 3H9VA 2QKAA 3ZHTA 3ZIAG 3K0GA 2AHYA 1I94B 1NR1A 3WFVA 1FS0G 5KHHA 1VQOV 3F7VC 1FXHA 3E83A 1XMQB 1XOUA 1GKFA 5BXZA 1QLNA 1TUEB 5LGUA 3RN4A 4B3MO 4X1IA 3QNEA 3CHXA 4JI6B 4PHZA 2ZT9B 2OYQA 5ITZB 3G80A 1RP3B 4BR6A 2QJ1A 1G4YB 4GX1A 1BMFG 3RYHA 2XAGA 2ZDIC 4PA9A 4LFAB 2QGNA 4F6EA 3NR7A 4MVOA 5FNVB 5L3FA 2HHHO 4DXWA 1YZBA 1N32O 2EJ7A 4JTAB 5IY5B 3AG4B 4LF4B 1HDJA 4TV9B 2ADPA 3FYEB 4X1YA 5E79Z 3OR7C 2V7QG 5H6RA 1Q7YW 1TA8A 1N36O 2F23A 5LXTB 4UB8Z 1R6TA 4DR6O 3W7TA 4JZGA 2GTSA 2CH7B 3JARA 4X66O 5KAIZ 1VIBA 3ZHSA 5IYCO 1BHBA 3OMAB 4JI5O 4X20B 2ZE8A 3ZMSA 3ZN1A 3HKBB 1AVMA 4DRXA 3J80N 1SQXH 5KMGA 1GN6A 2A06H 1ZWIC 2HG5C 4CH6A 1WLEA 2ATKC 4JZ2A 4KUMA 1NU1H 4TSFG 2UUCO 1FXKA 3T1HB 2AZ0A 1VQLV 3MHSC 3HB3B 5EBMC 2Z5UA 1Z2GA 5EBLC 2F66C 3ETDA 3CXCU 3K58A 1HNZO 3FFQA 2QWQB 4CC6A 4B7EA 1E79G 1M1KW 4DUYO 3N2GA 1Y6XA 5IY5C 2BSKA 3AG4C 2BOBC 1GMGA 1S72V 4J7KA 5IWAB 2OTLV 3OUFA 5KA6A 3K79A 3U10A 4DV4B 1KP3A 4UVAA 3P30A 1U97A 1QCEA 1BT8A 3JD1A 1WN7A 2P7TC 5CB4A 2RDCA 3T1CA 1VARA 2EIMB 2XT9A 1NI8A 1GTOA 3K5MA 4ZI7A 1SA0B 4J10A 3RYFA 5J2UB 2EILB 3CYOA 1VQ7V 4PA6A 2ETNA 2PZSA 4JGSA 4FPPA 1J5EO 2PYJA 3CXHF 1W59A 2R70A 1VF6A 3AK2A 3AK1A 4XDJA 1N34B 5KA5A 1GN4A 1URFA 4B3RB 1PNLA 4MVMA 3LSUA 5KHJA 4P9OA 1SZXA 2UXDO 2P4VA 3U11A 1BE3H 1E1QG 1JFFA 2BTOA 5J2TB 3CC7V 5LMUO 4LF5O 2CUGA 3OEHG 3LDCA 3JAMN 1EZVH 4J80A 4LH7A 3LDDA 2IU3A 2ZQMA 2YEVB 3P3NA 2B1GA 1UPGA 1VQ6V 4PA3A 3SYCA 3BA9A 1OCOB 2YI9A 5KX5A 2EIMC 2N05A 4RQEA 2UUBB 5E1AC 4DK0A 3ETEA 5LHGA 1GM8A 3ZMUA 4MTOA 4OX9B 1SKVA 2EILC 3K08A 1S5HC 4DUZB 2QWRB 3ZRWB 5DM6V 4X89A 2A7WA 4TUYB 4LP8A 3W7SA 1NH2D 3LSSA 4JYAB 3E8HA 2YC0A 1I94O 2QA4V 5JJEB 1WA8A 5CA0B 3VQXA 2WLMA 5CA1A 4LCUC 1XMQO 2CGNA 3T1YB 1MSDA 4FLYA 3EHBB 3ZRSA 3O9OA 3C90A 4NVPA 2JDIG 1Y76B 2GSMB 1XMOB 1WB8A 3L72H 1ZL8B 1KYOF 5LA6B 2BTQA 2Y69B 1OCOC 2VQEB 2HKOA 4JASA 4KFMA 4LFAO 2EIJB 4JTCB 4JI1O 2CTWA 4I4TA 1JJOA 3WB1A 5BR8B 2YXYA 2N74A 1D5NA 4JI7B 4LF4O 1AI5A 1Q6HA 1TVKA 3QO5A 3FB7C 4F4LA 3BABA 2AXTZ 4J7JA 3APQA 5A2QN 1PPJH 4JI3B 2WWWA 4UVCA 3BA8A 4RAIA 5EBWC 1F7YA 2A0LA 3T4ZA 2IJHA 2L35A 4UUJC 1G1XB 4UCSA 3SR2C 4YY3B 5KUMA 4I5SA 1YSCA 4UCTA 4H37A 4DV6B 1KKCA 1AI7A 1THZA 1MG1A 1VMGA 5IDJA 2BE3A 4IIJA 2XAFA 4K0KB 1DTOA 1K7DA 4E2LA 4FIPC 4O2BB 2GTAA 4PDLA 1HNXB 3T1HO 4WBNA 2Y69C 3DXRA 4JYYA 4F6RB 2DQ0A 4FFBA 4AILC 4JAUA 3W7WA 2EIJC 2WA3A 4UCRA 3UT5B 3CJHB 3E89A 1AI4A 1K5QA 3MAQA 4FM1A 3E22A 2YUAA 4CH3A 1QR9A 1EZJA 3LSQA 4D6TH 1FFXA 3CEIA 3PN1A 5IWAO 4PI0A 1R3JC 2R9AA 4DV4O 5EIBC 5EK0A 1E1RG 5JVDB 1J95A 2EX3A 3G67A 5JQGB 1YJWV 1GM7A 2A79B 1I5YA 1MZEA 3CCUV 2B1IA 2KKWA 2KSDA 4HNAA 4FK5C 2JGDB 1DF5A 3N2KA 5IYDO 2IH3C 4XBFA 1NS1A 4FLVA 3ABUA 4D7TA 3SPCA 4JI0B 4J7ZA 4YJ2A 4UFZA 2K9PA 3CP1A 1B06A 5LGNA 3X2QB 1W2BU 1R73A 3IC9A 1GM9A 4LBEC 2QSAA 3AG3B 2YS8A 5EYPA 1N34O 3TXQA 3SJCC 3FKSG 2Q73A 3ASOB 1Q86W 3RW0A 4B3RO 3DGEA 2OCHA 3RYCB 4NTXA 4GLXA 2JIZG 2FMLA 4MTFA 2M6YA 5LHIA 1GRJA 4IHJA 2Q7HA 1R6NA 4YJ3A 4GKJB 1QU7A 3OFNG 2KB1A 4U3FH 2P22C 1DF4A 4LF6B 2VRZA 4BW5A 1GK9A 4KHPB 1I5XA 3ZJZA 3C3TA 3ZRVA 1JA8A 2ZCEA 5BZBA 1Q6UA 4MVZA 1AROP 1P7BA 4DR4B 1YTFB 3RWRD 3CMAV 2UUBO 5JCOC 1YIJV 3SYPA 4AHCA 3HKCA 3CMEV 4OX9O 1COWG 3OAAG 2Z3YA 3ICXA 2D2CB 3B4SA 4RUFA 3X2QC 4DUZO 1AJNA 2F1MA 3M99B 2Q67A 4G28B 1PL4A 5D5QA 2LP7A 3ASOC 4X1IB 2QE7G 5LOVA 3HPLC 4JYAO 3OEEG 3A0RA 4MVRA 1B3QA 3MHHC 4DR7B 5TISZ 2XOKG 4NTWA 2P90A 3T1YO 3RYHB 4BIZA 3P3PA 1XMOO 3RYIA 3IGAC 2WA4A 4Z1MG 1IBMB 2QWNB 4ZOLA 4QPKA 1PD3A 4DV5B 4FLXA 3L9DA 4BIOA 1VQ9V 5H2FZ 1RFYA 2VQEO 4X1YB 1YF2A 1Q81W 4DR3B 3K04A 1VP7A 3FB5C 3WG7B 5L3GA 1SQFA 2LFSA 1HP8A 4QE9A 4FLUA 1VQ5V 2ZKOA 2EZOA 5BR8O 3E2EA 3FAVA 3HKEA 3JARB 2DYSB 3CCEV 3SYAA 4JI7O 2WLNA 1YDXA 4ZBMA 1GH6A 4K8XA 4E4EA 3T2MA 1ZX3A 2OIEA 4WFGA 5LYJB 3S3XA 4DRXB 2ADQB 5KMGB 3QTCA 4JI3O 2PGGA 1YVWA 3TJTA 4PJ0Z 2XAQA 1FXKB 2JEXA 4CS2A 4YY3O
chains in the Genus database with same CATH topology
4JGSA 4J9YB 4FPPA 1JVMA 1RM1B 4PDMA 1ENVA 1F4NA 1NBMG 2DYRC 4XDJA 5DN6G 3ABMC 1PNMA 3QO7A 5KUKA 1JJ2U 5KA5A 1K33A 3ZRWA 2UXXA 1QR8A 3CD6V 3ZN0A 1L1FA 1PNLA 3CCQV 4MVMA 1R6KA 5CA3A 4P9OA 1KP2A 1OCZC 2A9HA 2Y48A 4BAYA 4R50A 4MSWC 1E1QG 2XASA 1AI6A 1YI2V 1QVFU 5LBQA 1K8AW 1SERA 1K5SA 3CC7V 4JYCA 2PI5A 4CBCA 3OEHG 3W7UA 3LDCA 3WG7C 4GX2A 5B3SC 3EFFK 3LDDA 2IU3A 2ZQMA 1EFRG 3E8BA 2W6JG 2YEVB 2DYSC 2B1GA 2B5UA 4JYBA 3JD0A 2HR3A 5GW7A 2WSSG 4DO2A 4ZKIA 1K4CC 2WLJA 2WPDG 1VQ6V 4PA3A 1K73W 3SYCA 1OCOB 5LHHA 2JEUA 1OZ0A 3NXSA 3CPWU 2R9RB 2IJIA 4TT3G 2EIMC 2ZXWB 4RQEA 2NNUA 5E1AC 2JK5C 3ETEA 4HZ3A 4UVBA 1KKDA 2EZPA 3ETGA 5LHGA 1GM8A 3UKMA 3E8GA 1BHAA 3ZMUA 4MTOA 1VQKV 4MTXA 4P30A 2X0LA 3F7YC 2ZR3A 1FXKC 3ZMVA 2EILC 3AG1C 4OXSA 4BIUA 2YSUB 3K08A 1S5HC 3ABKB 1SZTA 3ZRWB 1H38A 5DM6V 4X89A 3F5WC 2OCCB 3JD2A 1RM1C 3SPIA 1R3IC 1MSWD 3VOUA 2WLLB 3CC2V 1NVPD 1Q82W 4WFAV 4LP8A 3K0DA 3W7SA 2BOCC 3B8NA 3VBBA 3BY6A 1NH2D 3LSSA 1YITV 3E8HA 1XL6A 3ABTA 4QNHB 3E35A 4WFHA 2QA4V 1OHHG 4N23A 1JQ0A 1AR1B 1M57B 3G4SV 2QTOA 4XDKA 2WLMA 3I56V 4LCUC 4QE7A 2EIKB 1VQNV 3CCMV 2PI4A 3EHBB 3ZRSA 2DWDC 4MVQA 4KP4A 1G8MA 2X6AA 4MW8A 3UM7A 2JDIG 1SRYA 2C2AA 2GSMB 2IW5A 4EKWA 1AJPA 3STLC 5EC1C 3SYQA 2X7RB 4RUEA 5H6QA 1MABG 3W7XA 2Y69B 3AG2B 3QO8A 3RBZA 1OCOC 1YJ9V 2IJKA 5CBHA 2HKOA 4P9PA 3IC7A 3MD0A 4MT8A 5H9CA 1SETA 1M9NA 1S76D 4JASA 3JYCA 4KFMA 3K9AA 1KD1W 1H8EG 2EIJB 2ZXWC 4JTCB 1MOFA 1V54B 1F4MA 2R9IA 1YJNV 1VQ4V 4HYOA 3G6EV 4TWKA 1JCHA 3RVYA 2ZR2A 4R6ZA 3FB6C 3IFXA 4X88A 2K1EA 1UJWB 5C93A 1AI5A 3ABKC 3AEIA 3QO5A 2OCCC 1N8RW 4RO2A 3FB7C 3ML0A 1BL8A 4G2KA 2HFEC 1K3EA 4F4LA 1HWYA 4MVUA 1RPRA 2WLKA 2WWWA 4PDVA 4X8AA 3STZC 4UVCA 3FB8C 1JPXA 4RAIA 5EBWC 2A0LA 3T4ZA 2IJHA 2JJ2G 2ZDIA 2AHZA 3GB7C 4UUJC 4FMTA 2IU0A 3OGCC 1M57C 2P6JA 3R65A 4GX0A 1NVPB 3LNMB 5KUMA 4I5SA 1YSCA 5IYBO 3OUSA 2EIKC 4H37A 1AI7A 1THZA 1MG1A 5IDJA 1NH2B 1AJQA 2V1DA 4I9WA 5HFLA 3JD3A 2XAFA 1DTOA 5B1AB 1K7DA 2FTKA 4UV9A 4E2LA 3OW2U 4FIPC 4PDLA 3SPGA 3D3IA 1S0VA 3ZRXA 1CPYA 2Y69C 3AG2C 2EJRA 4JPRA 4Q20A 1DLBA 1VQMV 2DQ0A 4L87A 4QIWF 4JAUA 4PDRA 3W7WA 3AG3C 1H8HG 3ABLB 4P2ZA 4G27B 2EIJC 1JX9A 4YXWG 2D3OW 3CCSV 3JD4A 1V54C 2XNDG 1V55B 3E86A 1YHQV 1K92A 1B6QA 3E89A 5CBGA 1AI4A 1W0JG 1K5QA 1K34A 5J9PC 2QKSA 2ZD9A 3GWOA 2WLIA 4CZZA 1VQ8V 1QR9A 1EZJA 3LSQA 3T4DA 3FYIB 4N21A 4WFFA 1FFTB 1R3JC 1YTFD 2WLHA 2JJ1G 1E1RG 5EK0A 1J95A 1K97A 1NR7A 4PA4A 4GCZA 2DWEC 3SPHA 3ZMTA 1YJWV 4MS2A 4MVSA 1GM7A 2A79B 1I5YA 1F23A 5EC2C 5B1BB 1XL4A 5CBFA 1F51A 4WFBV 3CCUV 2B1IA 4HAMA 3K03A 5L3DA 1QLEB 3JCZA 3SJQC 2HVJC 4FK5C 3CCVV 4U7OA 3OR6C 3DTUB 1DF5A 5IYDO 2IH3C 3TK1A 1JOYA 4XBFA 1M56B 3ABUA 2XAJA 1LNQA 1OCCB 3SPCA 2H94A 3SYOA 3CP1A 2OT5A 5LGNA 3X2QB 5B1AC 1W2BU 1R73A 2XAHA 3TETA 1NKDA 3BEHA 1PKXA 3ZIAG 3SPJA 3OMNB 2QEXV 3K0GA 1GM9A 1ROPA 2AHYA 4GT1A 4LBEC 3AG3B 2DW4A 1NR1A 3WFVA 2X6CA 1FS0G 1GO3F 3FKSG 3ASOB 1VQOV 3RW0A 5LGTA 3F7VC 1Q86W 2Q6AA 3DGEA 1FXHA 3E83A 1QVGU 2JIZG 1GKFA 3ABLC 1QLNA 1TUEB 4MTFA 2P67A 4XDLA 1ORQC 5LHIA 5LGUA 3E8FA 1V55C 1P4RA 1K9MW 3QNEA 2W6IG 2HVKC 1R6NA 1PNKA 2EINB 2GHYA 3LDEA 5B1NA 2ITDC 3OFNG 2KB1A 3OMIB 2HJFC 1DF4A 4U7NA 5B1OA 4BW5A 1GK9A 1R3LC 1NQTA 1G4YB 4GX1A 1I5XA 1BMFG 2H8PC 3ZJZA 2XAGA 2ZDIC 4LC1A 4PA9A 3ZRVA 2X6BA 2UXNA 5BZBA 5B1BC 4MVOA 4MVZA 3ZMZA 5HFMA 5L3FA 1R3KC 1AROP 1P7BA 3P32A 4DXWA 4FJCC 1QLEC 2WLLA 3ZCCA 1PL0A 1YTFB 4JTAB 5IY5B 3CMAV 3AG4B 1YIJV 2EBOA 3SYPA 4JAVA 1QBZA 3LUTB 3FYEB 3OR7C 3PJSK 2V7QG 5L3EA 3CMEV 4R7CA 1M56C 5H6RA 1COWG 3OAAG 1OCCC 1Q7YW 3K3WA 4JTDB 2Z3YA 3I55V 3CC4V 2OTJV 3G71V 4RUFA 3X2QC 3B8MA 1AJNA 2QM8A 1OCRB 1W0KG 3W7TA 3M99B 4H33A 5FL7G 1WPXA 5IYCO 1FXVA 2Q67A 4G28B 3ASNB 1BHBA 2IH1C 1NJIW 3B77A 3OMAB 2M7WA 1IXMA 2LP7A 3ASOC 1SESA 1KECA 3ZMSA 2QE7G 3HPLC 3ZN1A 1KQSU 4JF3A 2CK3G 4QPJA 4MTGA 3OEEG 1CP9A 3A0RA 4MVRA 3MHHC 3CCJV 1ZWIC 2XOKG 4UXNA 2HG5C 2P90A 2EINC 1WLEA 2ATKC 4PA7A 4R8CA 3CCLV 4KUMA 4TSFG 2WAMA 1H2GA 1FXKA 2DYRB 4QJFB 4BIZA 1VQPV 2MK3A 2LFRA 3ABMB 5CN0A 1VQLV 2Q69A 3MHSC 3IGAC 3HB3B 1S3JA 1Y66A 5EBMC 4Z1MG 2Z5UA 5EBLC 4QPKA 1PD3A 1OCZB 3ETDA 3CXCU 1VQ9V 4J9ZB 1RPOA 1M90W 4GX5A 4WCEV 1E79G 1M1KW 1Q81W 1K4DC 3H01A 4RQFA 3K04A 4ASUG 3FB5C 5IY5C 3AG4C 1S72V 2BOBC 1GMGA 1S77D 3WG7B 5L3GA 2HLDG 2LFSA 4QE9A 5B3SB 1VQ5V 2EZOA 3OM3B 2OTLV 3E2EA 3OUFA 5KA6A 3K79A 1CEZA 2DYSB 3CCRV 1KP3A 2QM7A 3P30A 4UVAA 3SYAA 3CCEV 1KC8W 2WLNA 5L3CA 1QCEA 3K06A 4ZBMA 3TCUA 4WF9V 2ITCC 1EBOA 1Y4MA 1OCRC 4UV8A 3D36A 3JD1A 2DQ3A 2P7TC 3T2MA 2YEVA 3KG2A 4WFGA 3T1CA 2W0FC 2WLIB 5L3BA 3ASNC 2EIMB 3OE7G 4WFEA 1GTOA 5CMUA 4PELA 4MW3A 2NLJC 2IJJA 2Q68A 2XAQA 1FXKB 2F43G 2JEXA 2EILB 3AG1B 3CYOA 1VQ7V 3RVZA 4PA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI A;  4J9Y B;  1M56 C;  4R7C A;  1JVM A;  1OCC C;  2X6A A;  4MW8 A;  4JTD B;  3UM7 A;  3T4D A;  4PDM A;  4EKW A;  4RUF A;  3STL C;  3X2Q C;  2DYR C;  4WFF A;  5EC1 C;  4XDJ A;  1R3J C;  3SYQ A;  3ABM C;  2WLH A;  4RUE A;  5KUK A;  5EK0 A;  1J95 A;  4H33 A;  4PA4 A;  1OCO C;  2DWE C;  3RBZ A;  3SPH A;  4MS2 A;  4MVS A;  2A79 B;  5EC2 C;  5CBH A;  2Q67 A;  4G28 B;  4MVM A;  4P9P A;  1XL4 A;  2IH1 C;  4P9O A;  5CBF A;  1OCZ C;  2A9H A;  3ASO C;  3JYC A;  3K03 A;  4KFM A;  3SJQ C;  2ZXW C;  4JTC B;  4MSW C;  4R50 A;  3HPL C;  2HVJ C;  4MTG A;  3OR6 C;  4HYO A;  4MVR A;  4TWK A;  2IH3 C;  3RVY A;  4R6Z A;  4CBC A;  3FB6 C;  3LDC A;  3WG7 C;  3IFX A;  4X88 A;  4GX2 A;  5B3S C;  1ZWI C;  2K1E A;  3EFF K;  1LNQ A;  2HG5 C;  3ABK C;  3LDD A;  2EIN C;  2ATK C;  4PA7 A;  3SPC A;  4R8C A;  3E8B A;  3SYO A;  2OCC C;  2DYS C;  4RO2 A;  5B1A C;  3FB7 C;  1BL8 A;  3TET A;  2HFE C;  2Q69 A;  3BEH A;  1K4C C;  2WLJ A;  3SPJ A;  3IGA C;  4PA3 A;  4F4L A;  3K0G A;  3SYC A;  2AHY A;  4LBE C;  5EBM C;  4MVU A;  2WLK A;  4PDV A;  4X8A A;  3STZ C;  5EBL C;  2X6C A;  3FB8 C;  4RAI A;  5EBW C;  2A0L A;  2R9R B;  3F7V C;  4J9Z B;  3RW0 A;  2Q6A A;  3T4Z A;  3E83 A;  2EIM C;  4GX5 A;  2AHZ A;  3GB7 C;  3PJS K;  4UUJ C;  5E1A C;  3ABL C;  2JK5 C;  4HZ3 A;  1KKD A;  3OGC C;  1M57 C;  3R65 A;  4GX0 A;  4MVQ A;  4MTF A;  4XDL A;  1K4D C;  3UKM A;  1ORQ C;  3E8G A;  3K04 A;  3LNM B;  5KUM A;  3FB5 C;  4MTO A;  5IY5 C;  3E8F A;  1V55 C;  3AG4 C;  3OUS A;  2BOB C;  4P30 A;  2EIK C;  4H37 A;  3F7Y C;  4QE9 A;  2EIL C;  2HVK C;  3AG1 C;  4OXS A;  3K08 A;  1S5H C;  3LDE A;  3RVZ A;  4I9W A;  3OUF A;  4X89 A;  2ITD C;  3F5W C;  2KB1 A;  2HJF C;  3SPI A;  3SYA A;  1R3I C;  2WLN A;  3VOU A;  3K06 A;  2WLL B;  4ZBM A;  3TCU A;  4BW5 A;  4PDL A;  2ITC C;  1R3L C;  1OCR C;  3SPG A;  1G4Y B;  4GX1 A;  2H8P C;  3ZJZ A;  2P7T C;  3T2M A;  4LP8 A;  2Y69 C;  3AG2 C;  2YEV A;  3K0D A;  3KG2 A;  4PA9 A;  2X6B A;  4WFG A;  3T1C A;  2BOC C;  5BZB A;  2W0F C;  2WLI B;  3ASN C;  3E8H A;  1XL6 A;  4MVO A;  4MVZ A;  5B1B C;  4QNH B;  4WFH A;  1R3K C;  4PDR A;  4WFE A;  1P7B A;  3AG3 C;  4P2Z A;  4MW3 A;  4G27 B;  1QLE C;  4DXW A;  2EIJ C;  2NLJ C;  2WLL A;  2QTO A;  2Q68 A;  4XDK A;  2WLM A;  4JTA B;  1V54 C;  4LCU C;  3E86 A;  4QE7 A;  3E89 A;  5CBG A;  3SYP A;  3ZRS A;  5J9P C;  2DWD C;  3LUT B;  2QKS A;  2ZD9 A;  4PA6 A;  3OR7 C; 
#chains in the Genus database with same CATH topology
 1RM1 B;  4DV6 O;  1IBK B;  3J7A U;  1B04 A;  1NBM G;  5DN6 G;  3QO7 A;  1JJ2 U;  4K0K O;  1K33 A;  3FX7 A;  1QR8 A;  2UXB B;  3CD6 V;  1L1F A;  3N2G B;  1HNX O;  3VQY A;  1LR1 A;  2BSK B;  1VEW A;  4YIP A;  1YI2 V;  4JI4 B;  1IX9 A;  3RGB A;  1SER A;  4H13 B;  4EFE A;  4NXN B;  3WG7 C;  1FKA O;  4DYL A;  3E8B A;  2DYS C;  2HR3 A;  5GW7 A;  5JH7 A;  2WLJ A;  3CB2 A;  2LO1 A;  3L74 H;  4ZI7 B;  3CPW U;  3RYF B;  2NNU A;  4CS3 A;  3JAT A;  4LNU A;  4OPA A;  3K59 A;  5EIB D;  2O57 A;  3UKM A;  3A0B Z;  4J41 A;  2Y4U A;  4P30 A;  2QR4 A;  2ZR3 A;  1FXK C;  4BIU A;  3U0Z A;  4GYC B;  3F5W C;  4GUN A;  3JD2 A;  1RM1 C;  3SJB C;  1HW7 A;  1R3I C;  2QWO B;  3VOU A;  2WLL B;  3CC2 V;  4FVM A;  4JI0 O;  4UCV A;  4WFA V;  4DR5 B;  1UFI A;  2YIB A;  3K0D A;  4TQD A;  4LFC B;  5KHG A;  1JFF B;  2KQX A;  3VBB A;  1YIT V;  4QNH B;  1XL6 A;  1OHH G;  4N23 A;  3BAA A;  1M57 B;  2AGA A;  2QTO A;  4O2A A;  1Q90 D;  1NTK H;  4QE7 A;  2GUZ B;  1Q5O A;  1VQN V;  5LP6 A;  2KG7 B;  4KP4 A;  4DR2 B;  2E5L B;  1WP8 A;  5FNV A;  4MW8 A;  4B3S B;  4ABM A;  2IW5 A;  4GKJ O;  5EC1 C;  2DJV A;  3R66 A;  3W7X A;  3OGI B;  4LF6 O;  4P9P A;  4KHP O;  4MT8 A;  2ZIM A;  3JYC A;  5LXT A;  1H8E G;  1SQG A;  2R9I A;  2N04 A;  4HYO A;  2CH7 A;  1BGY H;  3G6E V;  1VF6 C;  1MNG A;  3RVY A;  2XHB A;  2ZR2 A;  1GN3 A;  3IFX A;  4DR4 O;  4H0L B;  4FZ0 A;  3H1H H;  4RO2 A;  3ZHR A;  1BL8 A;  1SQQ H;  1H2N A;  2WLK A;  1WA8 B;  4X8A A;  3STZ C;  2P06 A;  5KLV H;  3FB8 C;  5CA1 B;  2ZE7 A;  1AB3 A;  3CRQ A;  2ZE5 A;  1IZ3 A;  3L71 H;  2JJ2 G;  4DV0 B;  4FMT A;  2IU0 A;  1M57 C;  2VQF B;  3TXS A;  3LNM B;  4LWS A;  5IYB O;  2CTR A;  2LW7 A;  2PYL A;  2CE4 A;  1MA1 A;  1BS3 A;  2BTQ B;  5HFL A;  2IBZ H;  4DR7 O;  3APO A;  3OW2 U;  2XTA A;  4QGP A;  3D8C A;  1S0V A;  1LUV A;  1CPY A;  1IBL B;  3JSN A;  4I4T B;  1YEW A;  4JPR A;  2E76 B;  1DLB A;  1XDC A;  3THO A;  1QNM A;  1BQ0 A;  2XUM A;  4QIW F;  1IBM O;  4PDR A;  1H8H G;  3ABL B;  4P2Z A;  1KBH A;  4G27 B;  4DV5 O;  2D3O W;  2ILM A;  2XND G;  1V55 B;  1YHQ V;  1WNS A;  1B6Q A;  5CBG A;  1YCI A;  5J9P C;  4OPH A;  3BVO A;  2JGU A;  4DR3 O;  1L0N H;  3GWO A;  3T4D A;  1FPO A;  4N21 A;  4EB6 A;  4WFF A;  1YTF D;  5J2U A;  2QTS A;  1NR7 A;  4PA4 A;  3AK3 A;  4MS2 A;  4MVS A;  5DED A;  1IXB A;  4CC5 A;  4WFB V;  1NTM H;  3SJQ C;  1QLE B;  3JCZ A;  4I55 B;  1WPB A;  4FM2 A;  4IIJ B;  4Z1V A;  3DTU B;  4FLT A;  4JI6 O;  2F4V B;  3QVN A;  3UQ8 A;  5GON A;  2XAJ A;  3ZHQ A;  1OCC B;  4Q6G A;  5D5P A;  5FPO A;  2H94 A;  1TUB B;  3DXR B;  3WU2 Z;  3JAS B;  4B7K A;  1IBK O;  3BEH A;  3BRC A;  3OMN B;  1JR9 A;  4GT1 A;  1D5A A;  2DW4 A;  2RJZ A;  1T5E A;  4IGG A;  2X6C A;  1US6 A;  4YIO A;  5LGT A;  2UXB O;  1QVG U;  3ABL C;  3E22 B;  4DV1 B;  1FFX B;  1SQV H;  1V55 C;  1P4R A;  3FD9 A;  2W6I G;  2HVK C;  4CH4 A;  1FYJ A;  2EIN B;  2GHY A;  5EZY A;  3I5D A;  4U7N A;  1KMI Z;  2AZ2 A;  1R3L C;  1NQT A;  1P49 A;  3TGU H;  4HNA B;  2VS0 A;  1AR4 A;  3N2K B;  5HFM A;  1R3K C;  2PTM A;  3RFR A;  4FJC C;  1QLE C;  1Y67 A;  3ZCC A;  1M5I A;  4JAV A;  1QBZ A;  3Q4H A;  2YIA A;  5C8Y B;  4X1K A;  3PJS K;  5L3E A;  1Q3E A;  4R7C A;  2GBO A;  1OCC C;  4JTD B;  3CC4 V;  5EYP B;  2OTJ V;  3G71 V;  1Q6I A;  1ZAU A;  4IL6 Z;  5LL6 Y;  2Q4P A;  2ZNJ A;  5JWP A;  4B08 A;  4H33 A;  4LF8 B;  3OTF A;  3ASN B;  2Z0A A;  2IH1 C;  4DR5 O;  3B77 A;  2HHH B;  2PF4 E;  4I50 A;  4O4J A;  4JF3 A;  4YJ3 B;  4QPJ A;  4MTG A;  5LA6 A;  4A5U B;  2V4D A;  2GV9 A;  4W4L A;  2ZM6 B;  4UCO A;  2EIN C;  4X9Q A;  2HP8 A;  3CCL V;  4AI8 A;  1H2G A;  4DR2 O;  2E5L O;  4QJF B;  2MK3 A;  3ABM B;  5IJ0 A;  4J11 A;  4B3S O;  2BCC H;  1Y66 A;  4TQF A;  3CRM A;  4U3J B;  2Q8V A;  1XRE A;  1YXB A;  1JMK C;  4EFB A;  1RPO A;  3WB0 A;  3HKC B;  4WCE V;  4O4H A;  1BCC H;  1K4D C;  3H01 A;  4RQF A;  1OV9 A;  1I0H A;  4UB6 Z;  5BY1 A;  2LQT A;  1S77 D;  2HLD G;  3HKD B;  3OD4 A;  2DE0 X;  3JAL A;  4KL1 A;  1CEZ A;  3CCR V;  1KC8 W;  2E75 B;  4WF9 V;  3JSL A;  4UV8 A;  3D36 A;  2DQ3 A;  5LOV B;  2A3Q A;  3M8A A;  4Z2W A;  3JAW B;  4I0X A;  1XUQ A;  4NXM B;  2Q5Z A;  2W0F C;  2Q0O C;  2WLI B;  3ASN C;  1RSO A;  3OE7 G;  4WFE A;  5CMU A;  2DOS A;  2HEP A;  1N33 B;  2NLJ C;  2IJJ A;  4DUY B;  4DV0 O;  5BMV A;  3AG1 B;  2VQF O;  4J9Y B;  3RYI B;  1JVM A;  1AIL A;  4PDM A;  4OGQ B;  1H2S B;  1F4N A;  3KCY A;  3ABM C;  1PNM A;  5KUK A;  3CRA A;  2UXX A;  4GKK B;  2NN4 A;  3CCQ V;  1R6K A;  3L70 H;  5CA3 A;  5H5N A;  2A9H A;  2E74 B;  4MSW C;  2XAS A;  4X62 B;  5IYZ A;  1QVF U;  5LBQ A;  1K8A W;  2ZIN A;  1KU9 A;  3FAV B;  2PI5 A;  3W7U A;  3AG7 A;  4TV8 A;  4RWU A;  1XNQ B;  2W6J G;  2G38 A;  1N0J A;  1Y74 A;  2WPD G;  3SJA C;  2JEU A;  1OZ0 A;  3OT7 A;  1I7F A;  3CRR A;  3JAK A;  1SQP H;  1Q8I A;  3IJ4 A;  2R9R B;  2ZXW B;  2JK5 C;  4HZ3 A;  2EZP A;  3ETG A;  4ZHQ A;  1VQK V;  4EEQ A;  1EN4 A;  2X0L A;  3F7Y C;  3ZMV A;  4JI8 B;  4B3T B;  3AG1 C;  2YSU B;  3ABK B;  1SZT A;  3K5L A;  1H38 A;  4X64 B;  2F4V O;  1MSW D;  2VWJ A;  1TGO A;  1Q82 W;  3DSQ A;  4NB5 A;  1FJG B;  2FL4 A;  4DW0 A;  2BOC C;  3B8N A;  2JRI A;  5FPR A;  3ABT A;  1JQ0 A;  4FM0 A;  5KHK A;  2OWO A;  1KUQ A;  3G4S V;  4DK1 A;  3I56 V;  4O4L A;  3ZS8 C;  2EIK B;  2PI4 A;  2JS3 A;  2DWD C;  4MVQ A;  1G8M A;  1GN2 A;  1A32 A;  1EM1 A;  2CGO A;  3B2E E;  3UM7 A;  2C2A A;  4EKW A;  3STL C;  3K5O A;  4LF9 B;  2X7R B;  1ZUQ A;  3LNN A;  1MAB G;  4YHH B;  3AG2 B;  3QO8 A;  5IT9 N;  1CXZ B;  3JAT B;  3RBZ A;  1DK1 A;  4LNU B;  2IJK A;  4PV1 B;  2JS5 A;  5CBH A;  5KAF Z;  5KHI A;  1S76 D;  1SET A;  2Q9L A;  1KD1 W;  2ZXW C;  4JI2 B;  1V54 B;  1F4M A;  1YJN V;  1M4U A;  2Y0P A;  4LFB B;  1VQ4 V;  4AQY B;  1V9P A;  1JCH A;  1PV0 A;  4R6Z A;  1UJW B;  3ABK C;  4NYK A;  2ZIO A;  1N8R W;  3SDL A;  1WAZ A;  1XHZ A;  5IJ9 A;  3ML0 A;  4DV7 B;  2HFE C;  1ZTE A;  1ZSP A;  1HWY A;  1XNR B;  4MVU A;  1RPR A;  1FD9 A;  4O2A B;  5K1X A;  2RN9 A;  3A8T A;  4LF8 O;  5LP6 B;  2Y4T A;  2Q0A A;  2ZDI A;  2AHZ A;  1U96 A;  2JVD A;  2P6J A;  4GX0 A;  4JI1 B;  1NVP B;  3MDS A;  2EIK C;  3BHP A;  3KZI Z;  1WJZ A;  5CB4 B;  2YIC A;  3H1I H;  4I9W A;  1XEQ A;  3JD3 A;  5B1A B;  2ZM6 O;  4O4I A;  4CS4 A;  4BW9 A;  4K35 A;  3D3I A;  3UCS C;  2ODM A;  1BSM A;  3AG2 C;  3BCC H;  4NR1 A;  2EJR A;  3D3Q A;  4L87 A;  1XIL A;  2CAZ C;  1JX9 A;  2W0X A;  3CCS V;  1V54 C;  1W0J G;  4LR3 A;  2QKS A;  2ZD9 A;  5LYJ A;  4LF7 B;  1VF7 A;  4IT5 A;  4IYI A;  2ZE6 A;  3BPZ A;  3WB2 A;  2WLH A;  5ITZ A;  3N27 A;  1K97 A;  2UUA B;  3SPH A;  3ZMT A;  4K8Z A;  5B1B B;  1XL4 A;  4LWS B;  5CBF A;  1F51 A;  3ZED A;  1NZ6 A;  2VWK A;  1MMM A;  5L3D A;  5LP6 C;  4NXM O;  1SS3 A;  2ARH A;  4DR1 B;  2HVJ C;  3CCV V;  2EUL A;  3OR6 C;  3CE2 A;  1N33 O;  1M56 B;  1EN6 A;  2FYU H;  5KX5 B;  2OT5 A;  1R1B A;  3G6B A;  4TV9 A;  4DV3 B;  5B1A C;  2XAH A;  3TET A;  1NKD A;  1PKX A;  3SPJ A;  2QEX V;  3KKY A;  4UCU A;  1ROP A;  3QG5 A;  3ZHU A;  4J42 A;  1GO3 F;  5GTH Z;  4GKK O;  2Q6A A;  4W4K A;  2P67 A;  4XDL A;  1ORQ C;  2UU9 B;  3ZHV A;  3E8F A;  4X62 O;  4X20 A;  1K9M W;  4EB6 B;  4D7S A;  3K9S A;  1PNK A;  3HKB A;  3LDE A;  5B1N A;  2ITD C;  3OMI B;  2HJF C;  5B1O A;  1XNQ O;  1P84 F;  1PM9 A;  2RCV A;  2H8P C;  1IDS A;  2GDS A;  4LC1 A;  3RT3 C;  2X6B A;  2UXN A;  4JV5 B;  5B1B C;  2LGW A;  2E3C A;  1XBL A;  1S5L Z;  3ZMZ A;  3VQV A;  3IAY A;  5K1P A;  3P32 A;  4X65 B;  3SGI A;  2WLL A;  5GON B;  1PL0 A;  2EBO A;  1O9G A;  3LUT B;  1M56 C;  2RMK B;  3CSX A;  3OTO B;  3K3W A;  5DEC A;  1G6U A;  1SF9 A;  4JI8 O;  3I55 V;  4B3T O;  3B8M A;  1NT2 B;  2QM8 A;  1OCR B;  1W0K G;  4X64 O;  2GUZ A;  3L73 H;  2Y0I A;  5FL7 G;  2KG7 A;  1WPX A;  1FXV A;  1NJI W;  1FJG O;  1TVK B;  2F95 B;  2M7W A;  1IXM A;  2P4K A;  1SES A;  1OJH A;  1KEC A;  1KQS U;  2CTQ A;  1Z5V A;  2CK3 G;  1HNW B;  2AW9 A;  1CP9 A;  5EZY B;  1I08 A;  4TOI A;  4I7Z B;  3CCJ V;  4I9Q A;  1AR5 A;  4UXN A;  2OIG A;  2Q7E A;  2MW2 B;  1SA0 A;  4PA7 A;  4R8C A;  2WAM A;  2DYR B;  1VQP V;  5CN0 A;  2LFR A;  2Q69 A;  2QWP B;  2YXL A;  1S3J A;  1BQZ A;  5JJN B;  1VF5 B;  4LF9 O;  1IUR A;  3H1L H;  4YHH O;  1OCZ B;  4J9Z B;  1M90 W;  1HR0 B;  4GX5 A;  3Q4H B;  2R72 A;  4X1K B;  5F2V O;  2DN9 A;  3HR0 A;  1TAE A;  4ASU G;  1BZK A;  4H44 B;  4JI2 O;  4WBN B;  5B3S B;  4LFB O;  3OM3 B;  4AQY O;  4DV2 B;  4FFB B;  5J2T A;  1QQC A;  2QM7 A;  5L3C A;  5LMN B;  1O9H A;  3K06 A;  4BWA A;  3TCU A;  2ITC C;  2NR5 A;  1EBO A;  1Y4M A;  1OCR C;  3ZBH A;  1N0N A;  4I50 B;  4O4J B;  2YEV A;  3VQW A;  3KG2 A;  1MZF A;  4DV7 O;  4LH6 A;  5L3B A;  2CTP A;  1KB9 F;  1XNR O;  3L75 H;  4PEL A;  4MW3 A;  4JI4 O;  4NKG B;  2UXC B;  2Q68 A;  4NXN O;  2F43 G;  3RVZ A;  5IJ0 B;  3M7M X;  3O65 A;  1N4C A;  1NTZ H;  4DW1 A;  1ENV A;  3GWK C;  2DYR C;  2Q7G A;  3ZRW A;  3F5T A;  4O4H B;  2YID A;  4ICG A;  3ZN0 A;  2LJ2 A;  1SC5 B;  4FLZ A;  1KP2 A;  3QF7 A;  1OCZ C;  4YJ2 B;  2Y48 A;  2P5O A;  4TUY A;  4BAY A;  4R50 A;  1AI6 A;  4B3M B;  1H2L A;  3JAL B;  1K5S A;  2PUS A;  4JYC A;  4KXR A;  3EXA A;  4CBC A;  2ZNI A;  4GX2 A;  5B3S C;  3EFF K;  3CS5 A;  5CA0 A;  5A9G A;  1EFR G;  2IM9 A;  2FB5 A;  4I0X B;  2B5U A;  4JYB A;  3JD0 A;  4LF7 O;  4I55 A;  4PI2 A;  1Z5W A;  2WSS G;  1RSO B;  4DO2 A;  4ZKI A;  4JAA A;  1K4C C;  1K73 W;  3H1K H;  5LHH A;  1Y76 A;  4LFC O;  4IHJ B;  3NXS A;  1ZL8 A;  1N32 B;  2UUA O;  2LGQ A;  5BMV B;  2IJI A;  4L8J A;  1TUB A;  2YIB D;  4TT3 G;  1AP6 A;  2QM4 A;  4UVB A;  3JAS A;  1KKD A;  3DC6 A;  4C7U A;  1BHA A;  3E8G A;  5JJJ B;  1DGS A;  4MTX A;  5IE9 A;  4DR1 O;  1N36 B;  1XQ8 A;  1ZLZ A;  4OXS A;  4FLW A;  1GAX A;  4DR6 B;  2OCC B;  3SPI A;  3ZX6 A;  4X66 B;  3B09 A;  3K5N A;  1NVP D;  1XI1 A;  4FFK A;  1PP9 H;  3B40 A;  4DV3 O;  3GVM A;  4JI5 B;  5IYZ B;  1Q43 A;  1L8D A;  3BY6 A;  5AG2 A;  1LUW A;  3E35 A;  4WFH A;  1AR1 B;  4PD4 F;  4TV8 B;  4XDK A;  5B66 Z;  2FKX A;  4IYH A;  3CCM V;  1P7G A;  2YI8 A;  2UUC B;  1Y74 B;  2UU9 O;  2X6A A;  3D36 C;  1SRY A;  3JAK B;  1AJP A;  3CRC A;  3UO3 A;  3SYQ A;  1L0L H;  4NTY A;  4RUE A;  4FZ1 A;  5H6Q A;  1HNZ B;  5C8Y A;  1YJ9 V;  3DC5 A;  1XHX A;  4O2B A;  4ZHQ B;  5FLX N;  3IC7 A;  3MD0 A;  5H9C A;  1M9N A;  2QDO A;  2RNB A;  3K9A A;  3JCU Z;  4JV5 O;  1MOF A;  4F6R A;  4X65 O;  4TWK A;  3FB6 C;  4ZOL B;  4X88 A;  1WB7 A;  2K1E A;  5C93 A;  1X4T A;  3UT5 A;  4ZIB A;  3AEI A;  1AP5 A;  3CJH A;  2OCC C;  3C3S A;  3OTO O;  4G2K A;  1FAF A;  3CX5 F;  1K3E A;  1IBL O;  2L6L A;  4PDV A;  2DMX A;  1JPX A;  4O4L B;  3HKE B;  4GZR B;  1QHT A;  5JVD A;  3GB7 C;  5JQG A;  3OGC C;  3R65 A;  1J5E B;  3OUS A;  1HNW O;  3CWB H;  2QKC A;  4U3J A;  3EVK A;  1NH2 B;  1M93 A;  1AJQ A;  2JGD A;  2V1D A;  3UO2 A;  3J81 N;  2H3O A;  5JCO A;  1D2D A;  2FTK A;  4UV9 A;  5GTI Z;  1S5J A;  3SPG A;  3K57 A;  5B5E Z;  3ZRX A;  2UXD B;  3S3W A;  3HKD A;  4Q20 A;  1VQM V;  1EN5 A;  3AG3 C;  5LMU B;  4LF5 B;  1H2M A;  4YXW G;  3JD4 A;  1HR0 O;  3E86 A;  1K92 A;  1K34 A;  3RYC A;  3JAW A;  5IJ9 B;  1H2K A;  2F93 B;  2WLI A;  4CZZ A;  1VQ8 V;  3FYI B;  1X59 A;  4DV2 O;  2HJD A;  1FFT B;  1IVS A;  3ETQ A;  2PY5 A;  1WP7 A;  4HBN A;  2JJ1 G;  5LMN O;  4GCZ A;  2DWE C;  5EC2 C;  1F23 A;  2CDY A;  1SQB H;  3A2F A;  4K3A A;  4HAM A;  3K03 A;  2LW1 A;  3KCX A;  2RQ6 A;  4U7O A;  5JH7 B;  4DV1 O;  1JOY A;  3TK1 A;  3A0H Z;  4O4I B;  3H1J H;  2UXC O;  2YDE A;  1LNQ A;  3BFR A;  4CH5 A;  2B9Z A;  2YXH A;  3SYO A;  3H9V A;  2QKA A;  3ZHT A;  3ZIA G;  3K0G A;  2AHY A;  1I94 B;  1NR1 A;  3WFV A;  1FS0 G;  5KHH A;  1VQO V;  3F7V C;  1FXH A;  3E83 A;  1XMQ B;  1XOU A;  1GKF A;  5BXZ A;  1QLN A;  1TUE B;  5LGU A;  3RN4 A;  4B3M O;  4X1I A;  3QNE A;  3CHX A;  4JI6 B;  4PHZ A;  2ZT9 B;  2OYQ A;  5ITZ B;  3G80 A;  1RP3 B;  4BR6 A;  2QJ1 A;  1G4Y B;  4GX1 A;  1BMF G;  3RYH A;  2XAG A;  2ZDI C;  4PA9 A;  4LFA B;  2QGN A;  4F6E A;  3NR7 A;  4MVO A;  5FNV B;  5L3F A;  2HHH O;  4DXW A;  1YZB A;  1N32 O;  2EJ7 A;  4JTA B;  5IY5 B;  3AG4 B;  4LF4 B;  1HDJ A;  4TV9 B;  2ADP A;  3FYE B;  4X1Y A;  5E79 Z;  3OR7 C;  2V7Q G;  5H6R A;  1Q7Y W;  1TA8 A;  1N36 O;  2F23 A;  5LXT B;  4UB8 Z;  1R6T A;  4DR6 O;  3W7T A;  4JZG A;  2GTS A;  2CH7 B;  3JAR A;  4X66 O;  5KAI Z;  1VIB A;  3ZHS A;  5IYC O;  1BHB A;  3OMA B;  4JI5 O;  4X20 B;  2ZE8 A;  3ZMS A;  3ZN1 A;  3HKB B;  1AVM A;  4DRX A;  3J80 N;  1SQX H;  5KMG A;  1GN6 A;  2A06 H;  1ZWI C;  2HG5 C;  4CH6 A;  1WLE A;  2ATK C;  4JZ2 A;  4KUM A;  1NU1 H;  4TSF G;  2UUC O;  1FXK A;  3T1H B;  2AZ0 A;  1VQL V;  3MHS C;  3HB3 B;  5EBM C;  2Z5U A;  1Z2G A;  5EBL C;  2F66 C;  3ETD A;  3CXC U;  3K58 A;  1HNZ O;  3FFQ A;  2QWQ B;  4CC6 A;  4B7E A;  1E79 G;  1M1K W;  4DUY O;  3N2G A;  1Y6X A;  5IY5 C;  2BSK A;  3AG4 C;  2BOB C;  1GMG A;  1S72 V;  4J7K A;  5IWA B;  2OTL V;  3OUF A;  5KA6 A;  3K79 A;  3U10 A;  4DV4 B;  1KP3 A;  4UVA A;  3P30 A;  1U97 A;  1QCE A;  1BT8 A;  3JD1 A;  1WN7 A;  2P7T C;  5CB4 A;  2RDC A;  3T1C A;  1VAR A;  2EIM B;  2XT9 A;  1NI8 A;  1GTO A;  3K5M A;  4ZI7 A;  1SA0 B;  4J10 A;  3RYF A;  5J2U B;  2EIL B;  3CYO A;  1VQ7 V;  4PA6 A;  2ETN A;  2PZS A;  4JGS A;  4FPP A;  1J5E O;  2PYJ A;  3CXH F;  1W59 A;  2R70 A;  1VF6 A;  3AK2 A;  3AK1 A;  4XDJ A;  1N34 B;  5KA5 A;  1GN4 A;  1URF A;  4B3R B;  1PNL A;  4MVM A;  3LSU A;  5KHJ A;  4P9O A;  1SZX A;  2UXD O;  2P4V A;  3U11 A;  1BE3 H;  1E1Q G;  1JFF A;  2BTO A;  5J2T B;  3CC7 V;  5LMU O;  4LF5 O;  2CUG A;  3OEH G;  3LDC A;  3JAM N;  1EZV H;  4J80 A;  4LH7 A;  3LDD A;  2IU3 A;  2ZQM A;  2YEV B;  3P3N A;  2B1G A;  1UPG A;  1VQ6 V;  4PA3 A;  3SYC A;  3BA9 A;  1OCO B;  2YI9 A;  5KX5 A;  2EIM C;  2N05 A;  4RQE A;  2UUB B;  5E1A C;  4DK0 A;  3ETE A;  5LHG A;  1GM8 A;  3ZMU A;  4MTO A;  4OX9 B;  1SKV A;  2EIL C;  3K08 A;  1S5H C;  4DUZ B;  2QWR B;  3ZRW B;  5DM6 V;  4X89 A;  2A7W A;  4TUY B;  4LP8 A;  3W7S A;  1NH2 D;  3LSS A;  4JYA B;  3E8H A;  2YC0 A;  1I94 O;  2QA4 V;  5JJE B;  1WA8 A;  5CA0 B;  3VQX A;  2WLM A;  5CA1 A;  4LCU C;  1XMQ O;  2CGN A;  3T1Y B;  1MSD A;  4FLY A;  3EHB B;  3ZRS A;  3O9O A;  3C90 A;  4NVP A;  2JDI G;  1Y76 B;  2GSM B;  1XMO B;  1WB8 A;  3L72 H;  1ZL8 B;  1KYO F;  5LA6 B;  2BTQ A;  2Y69 B;  1OCO C;  2VQE B;  2HKO A;  4JAS A;  4KFM A;  4LFA O;  2EIJ B;  4JTC B;  4JI1 O;  2CTW A;  4I4T A;  1JJO A;  3WB1 A;  5BR8 B;  2YXY A;  2N74 A;  1D5N A;  4JI7 B;  4LF4 O;  1AI5 A;  1Q6H A;  1TVK A;  3QO5 A;  3FB7 C;  4F4L A;  3BAB A;  2AXT Z;  4J7J A;  3APQ A;  5A2Q N;  1PPJ H;  4JI3 B;  2WWW A;  4UVC A;  3BA8 A;  4RAI A;  5EBW C;  1F7Y A;  2A0L A;  3T4Z A;  2IJH A;  2L35 A;  4UUJ C;  1G1X B;  4UCS A;  3SR2 C;  4YY3 B;  5KUM A;  4I5S A;  1YSC A;  4UCT A;  4H37 A;  4DV6 B;  1KKC A;  1AI7 A;  1THZ A;  1MG1 A;  1VMG A;  5IDJ A;  2BE3 A;  4IIJ A;  2XAF A;  4K0K B;  1DTO A;  1K7D A;  4E2L A;  4FIP C;  4O2B B;  2GTA A;  4PDL A;  1HNX B;  3T1H O;  4WBN A;  2Y69 C;  3DXR A;  4JYY A;  4F6R B;  2DQ0 A;  4FFB A;  4AIL C;  4JAU A;  3W7W A;  2EIJ C;  2WA3 A;  4UCR A;  3UT5 B;  3CJH B;  3E89 A;  1AI4 A;  1K5Q A;  3MAQ A;  4FM1 A;  3E22 A;  2YUA A;  4CH3 A;  1QR9 A;  1EZJ A;  3LSQ A;  4D6T H;  1FFX A;  3CEI A;  3PN1 A;  5IWA O;  4PI0 A;  1R3J C;  2R9A A;  4DV4 O;  5EIB C;  5EK0 A;  1E1R G;  5JVD B;  1J95 A;  2EX3 A;  3G67 A;  5JQG B;  1YJW V;  1GM7 A;  2A79 B;  1I5Y A;  1MZE A;  3CCU V;  2B1I A;  2KKW A;  2KSD A;  4HNA A;  4FK5 C;  2JGD B;  1DF5 A;  3N2K A;  5IYD O;  2IH3 C;  4XBF A;  1NS1 A;  4FLV A;  3ABU A;  4D7T A;  3SPC A;  4JI0 B;  4J7Z A;  4YJ2 A;  4UFZ A;  2K9P A;  3CP1 A;  1B06 A;  5LGN A;  3X2Q B;  1W2B U;  1R73 A;  3IC9 A;  1GM9 A;  4LBE C;  2QSA A;  3AG3 B;  2YS8 A;  5EYP A;  1N34 O;  3TXQ A;  3SJC C;  3FKS G;  2Q73 A;  3ASO B;  1Q86 W;  3RW0 A;  4B3R O;  3DGE A;  2OCH A;  3RYC B;  4NTX A;  4GLX A;  2JIZ G;  2FML A;  4MTF A;  2M6Y A;  5LHI A;  1GRJ A;  4IHJ A;  2Q7H A;  1R6N A;  4YJ3 A;  4GKJ B;  1QU7 A;  3OFN G;  2KB1 A;  4U3F H;  2P22 C;  1DF4 A;  4LF6 B;  2VRZ A;  4BW5 A;  1GK9 A;  4KHP B;  1I5X A;  3ZJZ A;  3C3T A;  3ZRV A;  1JA8 A;  2ZCE A;  5BZB A;  1Q6U A;  4MVZ A;  1ARO P;  1P7B A;  4DR4 B;  1YTF B;  3RWR D;  3CMA V;  2UUB O;  5JCO C;  1YIJ V;  3SYP A;  4AHC A;  3HKC A;  3CME V;  4OX9 O;  1COW G;  3OAA G;  2Z3Y A;  3ICX A;  2D2C B;  3B4S A;  4RUF A;  3X2Q C;  4DUZ O;  1AJN A;  2F1M A;  3M99 B;  2Q67 A;  4G28 B;  1PL4 A;  5D5Q A;  2LP7 A;  3ASO C;  4X1I B;  2QE7 G;  5LOV A;  3HPL C;  4JYA O;  3OEE G;  3A0R A;  4MVR A;  1B3Q A;  3MHH C;  4DR7 B;  5TIS Z;  2XOK G;  4NTW A;  2P90 A;  3T1Y O;  3RYH B;  4BIZ A;  3P3P A;  1XMO O;  3RYI A;  3IGA C;  2WA4 A;  4Z1M G;  1IBM B;  2QWN B;  4ZOL A;  4QPK A;  1PD3 A;  4DV5 B;  4FLX A;  3L9D A;  4BIO A;  1VQ9 V;  5H2F Z;  1RFY A;  2VQE O;  4X1Y B;  1YF2 A;  1Q81 W;  4DR3 B;  3K04 A;  1VP7 A;  3FB5 C;  3WG7 B;  5L3G A;  1SQF A;  2LFS A;  1HP8 A;  4QE9 A;  4FLU A;  1VQ5 V;  2ZKO A;  2EZO A;  5BR8 O;  3E2E A;  3FAV A;  3HKE A;  3JAR B;  2DYS B;  3CCE V;  3SYA A;  4JI7 O;  2WLN A;  1YDX A;  4ZBM A;  1GH6 A;  4K8X A;  4E4E A;  3T2M A;  1ZX3 A;  2OIE A;  4WFG A;  5LYJ B;  3S3X A;  4DRX B;  2ADQ B;  5KMG B;  3QTC A;  4JI3 O;  2PGG A;  1YVW A;  3TJT A;  4PJ0 Z;  2XAQ A;  1FXK B;  2JEX A;  4CS2 A;  4YY3 O; 
#chains in the Genus database with same CATH homology
 4JGS A;  4J9Y B;  4FPP A;  1JVM A;  1RM1 B;  4PDM A;  1ENV A;  1F4N A;  1NBM G;  2DYR C;  4XDJ A;  5DN6 G;  3ABM C;  1PNM A;  3QO7 A;  5KUK A;  1JJ2 U;  5KA5 A;  1K33 A;  3ZRW A;  2UXX A;  1QR8 A;  3CD6 V;  3ZN0 A;  1L1F A;  1PNL A;  3CCQ V;  4MVM A;  1R6K A;  5CA3 A;  4P9O A;  1KP2 A;  1OCZ C;  2A9H A;  2Y48 A;  4BAY A;  4R50 A;  4MSW C;  1E1Q G;  2XAS A;  1AI6 A;  1YI2 V;  1QVF U;  5LBQ A;  1K8A W;  1SER A;  1K5S A;  3CC7 V;  4JYC A;  2PI5 A;  4CBC A;  3OEH G;  3W7U A;  3LDC A;  3WG7 C;  4GX2 A;  5B3S C;  3EFF K;  3LDD A;  2IU3 A;  2ZQM A;  1EFR G;  3E8B A;  2W6J G;  2YEV B;  2DYS C;  2B1G A;  2B5U A;  4JYB A;  3JD0 A;  2HR3 A;  5GW7 A;  2WSS G;  4DO2 A;  4ZKI A;  1K4C C;  2WLJ A;  2WPD G;  1VQ6 V;  4PA3 A;  1K73 W;  3SYC A;  1OCO B;  5LHH A;  2JEU A;  1OZ0 A;  3NXS A;  3CPW U;  2R9R B;  2IJI A;  4TT3 G;  2EIM C;  2ZXW B;  4RQE A;  2NNU A;  5E1A C;  2JK5 C;  3ETE A;  4HZ3 A;  4UVB A;  1KKD A;  2EZP A;  3ETG A;  5LHG A;  1GM8 A;  3UKM A;  3E8G A;  1BHA A;  3ZMU A;  4MTO A;  1VQK V;  4MTX A;  4P30 A;  2X0L A;  3F7Y C;  2ZR3 A;  1FXK C;  3ZMV A;  2EIL C;  3AG1 C;  4OXS A;  4BIU A;  2YSU B;  3K08 A;  1S5H C;  3ABK B;  1SZT A;  3ZRW B;  1H38 A;  5DM6 V;  4X89 A;  3F5W C;  2OCC B;  3JD2 A;  1RM1 C;  3SPI A;  1R3I C;  1MSW D;  3VOU A;  2WLL B;  3CC2 V;  1NVP D;  1Q82 W;  4WFA V;  4LP8 A;  3K0D A;  3W7S A;  2BOC C;  3B8N A;  3VBB A;  3BY6 A;  1NH2 D;  3LSS A;  1YIT V;  3E8H A;  1XL6 A;  3ABT A;  4QNH B;  3E35 A;  4WFH A;  2QA4 V;  1OHH G;  4N23 A;  1JQ0 A;  1AR1 B;  1M57 B;  3G4S V;  2QTO A;  4XDK A;  2WLM A;  3I56 V;  4LCU C;  4QE7 A;  2EIK B;  1VQN V;  3CCM V;  2PI4 A;  3EHB B;  3ZRS A;  2DWD C;  4MVQ A;  4KP4 A;  1G8M A;  2X6A A;  4MW8 A;  3UM7 A;  2JDI G;  1SRY A;  2C2A A;  2GSM B;  2IW5 A;  4EKW A;  1AJP A;  3STL C;  5EC1 C;  3SYQ A;  2X7R B;  4RUE A;  5H6Q A;  1MAB G;  3W7X A;  2Y69 B;  3AG2 B;  3QO8 A;  3RBZ A;  1OCO C;  1YJ9 V;  2IJK A;  5CBH A;  2HKO A;  4P9P A;  3IC7 A;  3MD0 A;  4MT8 A;  5H9C A;  1SET A;  1M9N A;  1S76 D;  4JAS A;  3JYC A;  4KFM A;  3K9A A;  1KD1 W;  1H8E G;  2EIJ B;  2ZXW C;  4JTC B;  1MOF A;  1V54 B;  1F4M A;  2R9I A;  1YJN V;  1VQ4 V;  4HYO A;  3G6E V;  4TWK A;  1JCH A;  3RVY A;  2ZR2 A;  4R6Z A;  3FB6 C;  3IFX A;  4X88 A;  2K1E A;  1UJW B;  5C93 A;  1AI5 A;  3ABK C;  3AEI A;  3QO5 A;  2OCC C;  1N8R W;  4RO2 A;  3FB7 C;  3ML0 A;  1BL8 A;  4G2K A;  2HFE C;  1K3E A;  4F4L A;  1HWY A;  4MVU A;  1RPR A;  2WLK A;  2WWW A;  4PDV A;  4X8A A;  3STZ C;  4UVC A;  3FB8 C;  1JPX A;  4RAI A;  5EBW C;  2A0L A;  3T4Z A;  2IJH A;  2JJ2 G;  2ZDI A;  2AHZ A;  3GB7 C;  4UUJ C;  4FMT A;  2IU0 A;  3OGC C;  1M57 C;  2P6J A;  3R65 A;  4GX0 A;  1NVP B;  3LNM B;  5KUM A;  4I5S A;  1YSC A;  5IYB O;  3OUS A;  2EIK C;  4H37 A;  1AI7 A;  1THZ A;  1MG1 A;  5IDJ A;  1NH2 B;  1AJQ A;  2V1D A;  4I9W A;  5HFL A;  3JD3 A;  2XAF A;  1DTO A;  5B1A B;  1K7D A;  2FTK A;  4UV9 A;  4E2L A;  3OW2 U;  4FIP C;  4PDL A;  3SPG A;  3D3I A;  1S0V A;  3ZRX A;  1CPY A;  2Y69 C;  3AG2 C;  2EJR A;  4JPR A;  4Q20 A;  1DLB A;  1VQM V;  2DQ0 A;  4L87 A;  4QIW F;  4JAU A;  4PDR A;  3W7W A;  3AG3 C;  1H8H G;  3ABL B;  4P2Z A;  4G27 B;  2EIJ C;  1JX9 A;  4YXW G;  2D3O W;  3CCS V;  3JD4 A;  1V54 C;  2XND G;  1V55 B;  3E86 A;  1YHQ V;  1K92 A;  1B6Q A;  3E89 A;  5CBG A;  1AI4 A;  1W0J G;  1K5Q A;  1K34 A;  5J9P C;  2QKS A;  2ZD9 A;  3GWO A;  2WLI A;  4CZZ A;  1VQ8 V;  1QR9 A;  1EZJ A;  3LSQ A;  3T4D A;  3FYI B;  4N21 A;  4WFF A;  1FFT B;  1R3J C;  1YTF D;  2WLH A;  2JJ1 G;  1E1R G;  5EK0 A;  1J95 A;  1K97 A;  1NR7 A;  4PA4 A;  4GCZ A;  2DWE C;  3SPH A;  3ZMT A;  1YJW V;  4MS2 A;  4MVS A;  1GM7 A;  2A79 B;  1I5Y A;  1F23 A;  5EC2 C;  5B1B B;  1XL4 A;  5CBF A;  1F51 A;  4WFB V;  3CCU V;  2B1I A;  4HAM A;  3K03 A;  5L3D A;  1QLE B;  3JCZ A;  3SJQ C;  2HVJ C;  4FK5 C;  3CCV V;  4U7O A;  3OR6 C;  3DTU B;  1DF5 A;  5IYD O;  2IH3 C;  3TK1 A;  1JOY A;  4XBF A;  1M56 B;  3ABU A;  2XAJ A;  1LNQ A;  1OCC B;  3SPC A;  2H94 A;  3SYO A;  3CP1 A;  2OT5 A;  5LGN A;  3X2Q B;  5B1A C;  1W2B U;  1R73 A;  2XAH A;  3TET A;  1NKD A;  3BEH A;  1PKX A;  3ZIA G;  3SPJ A;  3OMN B;  2QEX V;  3K0G A;  1GM9 A;  1ROP A;  2AHY A;  4GT1 A;  4LBE C;  3AG3 B;  2DW4 A;  1NR1 A;  3WFV A;  2X6C A;  1FS0 G;  1GO3 F;  3FKS G;  3ASO B;  1VQO V;  3RW0 A;  5LGT A;  3F7V C;  1Q86 W;  2Q6A A;  3DGE A;  1FXH A;  3E83 A;  1QVG U;  2JIZ G;  1GKF A;  3ABL C;  1QLN A;  1TUE B;  4MTF A;  2P67 A;  4XDL A;  1ORQ C;  5LHI A;  5LGU A;  3E8F A;  1V55 C;  1P4R A;  1K9M W;  3QNE A;  2W6I G;  2HVK C;  1R6N A;  1PNK A;  2EIN B;  2GHY A;  3LDE A;  5B1N A;  2ITD C;  3OFN G;  2KB1 A;  3OMI B;  2HJF C;  1DF4 A;  4U7N A;  5B1O A;  4BW5 A;  1GK9 A;  1R3L C;  1NQT A;  1G4Y B;  4GX1 A;  1I5X A;  1BMF G;  2H8P C;  3ZJZ A;  2XAG A;  2ZDI C;  4LC1 A;  4PA9 A;  3ZRV A;  2X6B A;  2UXN A;  5BZB A;  5B1B C;  4MVO A;  4MVZ A;  3ZMZ A;  5HFM A;  5L3F A;  1R3K C;  1ARO P;  1P7B A;  3P32 A;  4DXW A;  4FJC C;  1QLE C;  2WLL A;  3ZCC A;  1PL0 A;  1YTF B;  4JTA B;  5IY5 B;  3CMA V;  3AG4 B;  1YIJ V;  2EBO A;  3SYP A;  4JAV A;  1QBZ A;  3LUT B;  3FYE B;  3OR7 C;  3PJS K;  2V7Q G;  5L3E A;  3CME V;  4R7C A;  1M56 C;  5H6R A;  1COW G;  3OAA G;  1OCC C;  1Q7Y W;  3K3W A;  4JTD B;  2Z3Y A;  3I55 V;  3CC4 V;  2OTJ V;  3G71 V;  4RUF A;  3X2Q C;  3B8M A;  1AJN A;  2QM8 A;  1OCR B;  1W0K G;  3W7T A;  3M99 B;  4H33 A;  5FL7 G;  1WPX A;  5IYC O;  1FXV A;  2Q67 A;  4G28 B;  3ASN B;  1BHB A;  2IH1 C;  1NJI W;  3B77 A;  3OMA B;  2M7W A;  1IXM A;  2LP7 A;  3ASO C;  1SES A;  1KEC A;  3ZMS A;  2QE7 G;  3HPL C;  3ZN1 A;  1KQS U;  4JF3 A;  2CK3 G;  4QPJ A;  4MTG A;  3OEE G;  1CP9 A;  3A0R A;  4MVR A;  3MHH C;  3CCJ V;  1ZWI C;  2XOK G;  4UXN A;  2HG5 C;  2P90 A;  2EIN C;  1WLE A;  2ATK C;  4PA7 A;  4R8C A;  3CCL V;  4KUM A;  4TSF G;  2WAM A;  1H2G A;  1FXK A;  2DYR B;  4QJF B;  4BIZ A;  1VQP V;  2MK3 A;  2LFR A;  3ABM B;  5CN0 A;  1VQL V;  2Q69 A;  3MHS C;  3IGA C;  3HB3 B;  1S3J A;  1Y66 A;  5EBM C;  4Z1M G;  2Z5U A;  5EBL C;  4QPK A;  1PD3 A;  1OCZ B;  3ETD A;  3CXC U;  1VQ9 V;  4J9Z B;  1RPO A;  1M90 W;  4GX5 A;  4WCE V;  1E79 G;  1M1K W;  1Q81 W;  1K4D C;  3H01 A;  4RQF A;  3K04 A;  4ASU G;  3FB5 C;  5IY5 C;  3AG4 C;  1S72 V;  2BOB C;  1GMG A;  1S77 D;  3WG7 B;  5L3G A;  2HLD G;  2LFS A;  4QE9 A;  5B3S B;  1VQ5 V;  2EZO A;  3OM3 B;  2OTL V;  3E2E A;  3OUF A;  5KA6 A;  3K79 A;  1CEZ A;  2DYS B;  3CCR V;  1KP3 A;  2QM7 A;  3P30 A;  4UVA A;  3SYA A;  3CCE V;  1KC8 W;  2WLN A;  5L3C A;  1QCE A;  3K06 A;  4ZBM A;  3TCU A;  4WF9 V;  2ITC C;  1EBO A;  1Y4M A;  1OCR C;  4UV8 A;  3D36 A;  3JD1 A;  2DQ3 A;  2P7T C;  3T2M A;  2YEV A;  3KG2 A;  4WFG A;  3T1C A;  2W0F C;  2WLI B;  5L3B A;  3ASN C;  2EIM B;  3OE7 G;  4WFE A;  1GTO A;  5CMU A;  4PEL A;  4MW3 A;  2NLJ C;  2IJJ A;  2Q68 A;  2XAQ A;  1FXK B;  2F43 G;  2JEX A;  2EIL B;  3AG1 B;  3CYO A;  1VQ7 V;  3RVZ A;  4PA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...