3FB5C

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
molecule keywords antibody Fab fragment heavy chain
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb5C00
2ATKC 4MTOA 4MW3A 3E83A 5EC2C 3OUSA 5B1BC 5J9PC 3SPIA 2DWEC 3KG2A 3FB8C 2A0LA 3OUFA 2ZXWC 3SPHA 3T1CA 3IGAC 2DYSC 3OGCC 2YEVA 2OCCC 3SPGA 3K03A 1R3IC 4XDLA 3GB7C 2ZD9A 3LDEA 2R9RB 4KFMA 2WLHA 3UM7A 2IH1C 2X6AA 3SYOA 3ASOC 3RW0A 4EKWA 4MVQA 3AG2C 4H33A 3TCUA 1OCZC 3RBZA 4GX2A 2AHZA 3X2QC 4HYOA 5EC1C 4RAIA 2X6BA 2BOBC 4MVRA 2A9HA 4JTCB 2Q6AA 4XDJA 2Q68A 4PDLA 4G28B 4WFFA 1V55C 3SYCA 3UKMA 1R3JC 4X88A 1OCRC 3FB6C 3VOUA 1K4DC 1R3KC 4MVSA 3E89A 5BZBA 2A79B 4JTAB 1QLEC 3FB5C 4P30A 3K0DA 3AG3C 4GX0A 2DWDC 2QKSA 4QE7A 3STZC 1J95A 2WLLB 3F7YC 4PDMA 2HG5C 3ABLC 3E8GA 3E8BA 3T4DA 4PA3A 2KB1A 2EIKC 3SYPA 4DXWA 3K08A 5EBLC 4XDKA 3EFFK 5KUKA 3IFXA 3RVZA 1P7BA 3BEHA 2WLIB 3E86A 4PDRA 2EILC 1OCOC 3AG4C 2WLIA 3JYCA 3ZJZA 4QE9A 1V54C 4PA7A 4TWKA 1ZWIC 2WLMA 4J9YB 2BOCC 3ABMC 4LP8A 2EINC 2ITCC 1K4CC 3K06A 4I9WA 4G27B 1M56C 2WLJA 4R8CA 3SJQC 4MVOA 1XL4A 3SYAA 4H37A 5EK0A 3E8HA 3HPLC 4BW5A 2WLNA 4MW8A 2K1EA 2DYRC 4MSWC 4P9PA 3RVYA 2JK5C 2NLJC 5E1AC 3T4ZA 3SPCA 3PJSK 5CBFA 4GX1A 4CBCA 1BL8A 4X89A 3LDCA 2HJFC 4WFGA 3LNMB 3LUTB 4X8AA 4F4LA 1G4YB 1R3LC 3TETA 2HVKC 2P7TC 4MVZA 4RUFA 2QTOA 3LDDA 1M57C 3SPJA 3T2MA 4WFEA 2EIMC 1LNQA 2Q67A 3WG7C 4MVUA 1KKDA 4MTFA 4HZ3A 2ITDC 1XL6A 4GX5A 5CBHA 3K04A 5CBGA 3F7VC 3OR6C 2HVJC 3STLC 5EBMC 2IH3C 4MS2A 5B1AC 4J9ZB 2WLLA 2HFEC 4P2ZA 4P9OA 4PA6A 4ZBMA 5KUMA 4MTGA 5IY5C 3OR7C 4OXSA 4R6ZA 4UUJC 1ORQC 3FB7C 4R7CA 4RUEA 1OCCC 4PA4A 2WLKA 4PA9A 4WFHA 3ZRSA 1JVMA 3R65A 4PDVA 5B3SC 2Y69C 4LCUC 2AHYA 2X6CA 4MVMA 4QNHB 1S5HC 2Q69A 2W0FC 4RO2A 2H8PC 3AG1C 3SYQA 3ABKC 3E8FA 4R50A 3K0GA 2EIJC 4JTDB 5EBWC 3ASNC 4LBEC 3F5WC
chains in the Genus database with same CATH superfamily
5B1BC 2ZM6O 1U96A 3QO5A 4X65B 3ZN0A 1N8RW 2QWNB 1NTZH 3AG7A 4XDLA 3A0HZ 1N32B 5D5QA 2P22C 2X6AA 2KSDA 1WJZA 5J2UB 1XHXA 1R1BA 4JI8O 2P06A 5GONB 3K57A 3M8AA 3M7MX 4GX2A 2QWRB 2R70A 3G4SV 3K59A 1VQ5V 3RYHB 2BSKB 1FPOA 4D6TH 2D3OW 1K4DC 1L0LH 5LXTA 5BZBA 1VQNV 2PF4E 4JI1B 3VQXA 2UU9O 5CA1B 1VP7A 1N0JA 4LF8O 3K5LA 3TJTA 1M5IA 1SQQH 3SJCC 2Q0AA 1YSCA 1OV9A 4LF7B 4UCRA 3RVZA 1AP6A 5A2QN 3E86A 2F95B 4YHHO 4PA7A 2YIBA 3ABLB 2WLMA 3K06A 1XMQO 1M56C 4H13B 3RYIB 1NKDA 1AJPA 3IAYA 3ZMZA 1B04A 1FFXA 2ZE8A 4LH7A 2M6YA 1AJQA 4B08A 1BS3A 1F23A 4FLVA 1M9NA 4K0KB 1NBMG 3G71V 5JWPA 1IBMO 1H8EG 4X62O 4B3TO 2ZIOA 1XILA 3WG7C 1KKDA 1US6A 1G1XB 4I5SA 2FL4A 4I9QA 1JA8A 1M1KW 4JAVA 2QKAA 3JCZA 1HDJA 2CTRA 4P2ZA 2RQ6A 4R7CA 1TVKA 4YIPA 2HHHB 1BMFG 1JMKC 1Q7YW 1QVGU 1NI8A 3JAKB 4LFBB 2EIJC 3N2GB 4A5UB 2AZ2A 1Q86W 4UCUA 2F66C 4ZI7A 5ITZB 1PD3A 5LHIA 3BVOA 3SPHA 5B1OA 2YEVA 2Z5UA 1R3IC 4DV0B 4UB6Z 3LDEA 2XHBA 3E22A 3KKYA 4ZOLA 3QNEA 4DW0A 1UJWB 2E5LB 2IU3A 1XNQB 2X6BA 3K58A 4UV8A 2UXXA 1Y74B 4LC1A 3HR0A 4JGSA 4GX0A 5B1AB 3B8NA 4GZRB 2QTSA 3CCUV 4WFAV 1DGSA 2A3QA 2QKCA 3NR7A 4PA3A 4U3JA 4JI3B 2GHYA 3H1JH 3NXSA 3AG4C 3T1YB 1V55B 5KHJA 1D5AA 1W59A 2H94A 4LP8A 2P5OA 3LNNA 4LFAO 1ZSPA 3SJQC 1ZX3A 4WF9V 1SETA 2JK5C 2ZQMA 5LOVB 4FLZA 1Q90D 4FPPA 4TV8B 3LSUA 2EZPA 1H8HG 1F4MA 2BTQA 3FAVA 3UO3A 2DYRB 3L9DA 4DR6B 3CHXA 1M90W 1E79G 3W7SA 1NH2B 4ZBMA 4OX9B 4OXSA 1SESA 1OCCC 4Z2WA 3CXCU 4I55A 4PV1B 2FB5A 4DR2O 4OGQB 1JVMA 1TUEB 1NVPD 4DR7B 2AHYA 2UXBO 1K7DA 4RO2A 1XHZA 3E8FA 1VARA 2EULA 5EBWC 3G67A 2WA3A 2KG7A 1VIBA 1IBKO 1YDXA 2PUSA 1EZVH 1K92A 2WLHA 3P30A 2AW9A 2YXHA 1ZUQA 1YI2V 3OEHG 2Q6AA 2VWKA 5IYDO 4G28B 4JAAA 3OEEG 1XNRB 2EIKB 1XOUA 3CRQA 1PNLA 3JATA 1VQ8V 1RP3B 1R6TA 4FZ1A 3CCMV 1P7GA 4AI8A 4CC5A 3STZC 4J42A 4EB6A 1LR1A 2WLLB 5HFMA 3SYPA 3WU2Z 3K08A 5KLVH 2Y4TA 2CTPA 4DV1O 3IFXA 3CCEV 4DR5B 2Q0OC 1S77D 1KUQA 4G27B 2KKWA 2JS5A 3RYIA 1P84F 4EFBA 2PI5A 4JI3O 4FVMA 1FFXB 4B3MO 1E1QG 3ABMB 1GO3F 5C8YB 1XEQA 1G6UA 1MG1A 3TETA 2Y69B 4C7UA 2HVKC 2WWWA 2QTOA 1AI4A 4YJ2B 1N33O 1YITV 2OIEA 1AR4A 2WA4A 4YY3B 4DRXB 2ZKOA 3STLC 3JARA 5F2VO 2UXDB 3FD9A 1OJHA 4UUJC 4WFHA 2WLKA 5JH7A 1BHAA 4UCOA 1BQ0A 3FYEB 1TVKB 3APQA 3B40A 1SQXH 2H8PC 2Q5ZA 3K79A 5JQGA 4E4EA 3K9SA 4GLXA 1HR0B 2QSAA 4FMTA 3TK1A 3JD2A 3CSXA 1YVWA 3OUFA 2CDYA 3IGAC 3RWRD 4DR1O 3OD4A 2LGQA 2OCCC 4W4LA 1IBMB 3TGUH 1FXVA 4LWSA 1H2NA 5E79Z 3DC5A 4X88A 4O4LA 1HNZO 4DR1B 4TT3G 1YF2A 5LHHA 1YCIA 4YHHB 4EFEA 4JV5B 2LGWA 3ABLC 5H9CA 4CH6A 2ZIMA 2HJDA 2NN4A 4CS3A 2WAMA 2WSSG 5FNVB 1YEWA 2R9IA 3RT3C 4QJFB 1N33B 5LGTA 1M4UA 2YI8A 3OAAG 4KXRA 2NLJC 1SQFA 4D7TA 1S0VA 3R66A 4X65O 2YC0A 1QR8A 1KP2A 1ROPA 3CS5A 4L87A 3D3QA 2IM9A 4GCZA 3P32A 3CP1A 3BABA 3JAMN 1H2KA 2R72A 4WBNA 4DV2O 4NXNB 1JCHA 2RDCA 2H3OA 2JGUA 4DV1B 5CA1A 2QJ1A 1KD1W 5IY5C 5KX5B 5IE9A 1ZTEA 1KB9F 3U10A 1GRJA 1FKAO 2QGNA 4FZ0A 2OWOA 2W0FC 4BIOA 1FXKB 1QLNA 1CP9A 5D5PA 4LF5B 3F5WC 5EC2C 1AB3A 3SPIA 3JD0A 2NR5A 4YXWG 2CK3G 2KG7B 4FIPC 2KQXA 3ZCCA 1M57B 2JIZG 4HAMA 1XMOB 2UUAO 2B1IA 1J5EO 3ZMSA 4O2AB 3AG2C 4HYOA 3B4SA 4MVRA 1FS0G 3HKDB 4LNUA 4DV3O 1R3JC 3FB6C 3BA8A 4J80A 5LHGA 1IBKB 1QLEC 2DQ3A 2HKOA 4JI0O 4FFBB 1OZ0A 3AG3C 1GTOA 1Q5OA 5DM6V 3L70H 5JVDB 5KAFZ 2M7WA 3SJBC 3T4DA 3RN4A 1Z5VA 1GN3A 4JF3A 3ZMVA 2LFRA 1MMMA 1LUVA 1TAEA 4AQYB 1OCOC 1LUWA 2P90A 2QA4V 2B1GA 1R73A 1BHBA 2UXBB 5CMUA 2WLJA 4FFKA 4MW8A 1SQVH 4DUYB 3MD0A 3RYCA 5CBFA 5KAIZ 3CMEV 1Y4MA 4WFGA 2YXLA 1WAZA 4NXMB 3B77A 3UO2A 2EIMC 4LFAB 2UUBB 3CWBH 3L72H 2CGNA 1SQBH 1HW7A 2UUCB 2XAQA 3LSQA 2A7WA 3JD1A 3PN1A 4CH5A 1B3QA 3D8CA 3E2EA 4I7ZB 3ZRSA 3FB7C 2ZNIA 5JH7B 2Y69C 4JASA 4U3JB 2Z3YA 1R6KA 3WB0A 2Q69A 5LMUB 1BCCH 5EYPA 1JQ0A 1DF5A 4MTOA 2QWQB 3E83A 1P49A 5KHGA 4AILC 1QVFU 1N34B 3BA9A 3KG2A 2Z0AA 5DECA 1UFIA 4X66B 2YICA 2Y4UA 2R9RB 2IH1C 2LJ2A 3SYOA 2UUBO 4UB8Z 4YIOA 4O2BB 5LYJB 5IYZB 2XASA 2MK3A 4NKGB 5IYBO 1VF6C 4KP4A 2FTKA 1V54B 4B3RB 2P4VA 1NR7A 2RN9A 4ABMA 3KZIZ 3K0DA 4GKJO 2DWDC 2JJ1G 1J95A 2ADPA 4PD4F 4TUYB 3E35A 2E5LO 4FM0A 4LF4B 1N4CA 5B1BB 1KC8W 1S5LZ 2QDOA 1YZBA 1RFYA 1O9GA 4JV5O 1AVMA 1K4CC 1Y66A 3BHPA 4CH4A 2UUCO 5IWAB 2DN9A 1V9PA 3LSSA 1MSWD 3QG5A 5GTHZ 1YHQV 1I94O 3AK3A 2WPDG 5KHHA 3WB1A 4F4LA 2PI4A 2JRIA 4RUFA 4I4TA 2XNDG 1F51A 4QIWF 3W7UA 4ZHQA 1JX9A 3AK2A 3CCLV 3H9VA 1HR0O 1AI7A 4NTXA 4X20B 3T1HO 2OCHA 4DYLA 4EB6B 1GM7A 3HKCB 4PDVA 2CTWA 4FLWA 4QGPA 2HLDG 1SQGA 3JSNA 1Q43A 4HBNA 1DK1A 3AK1A 3ZRVA 4OPAA 1NS1A 2LP7A 3OT7A 2DYSC 5LOVA 2XAGA 1KKCA 1S72V 4OPHA 3RW0A 5GONA 4MVQA 1AP5A 3OTOB 4O2AA 5IJ9B 3X2QC 4NVPA 1N34O 4WFFA 2Q7HA 3THOA 3WG7B 3T1YO 1YJWV 3FB5C 4DRXA 2Y48A 1OCZB 2B5UA 1P4RA 1GN2A 5JJNB 5JJJB 1FAFA 3F7YC 4PDMA 1URFA 3OTOO 3E8GA 3CE2A 5B66Z 2KB1A 4DV2B 2QM7A 5KUKA 2RJZA 1Y76B 4B7KA 1NU1H 3ZIAG 1WPXA 5CN0A 3ABKB 1DLBA 4DV4O 5B3SB 3D36C 4DV0O 3ZEDA 5EK0A 4BW5A 5CB4B 1M93A 1FFTB 4MSWC 3RVYA 1MZEA 1K5SA 3KCYA 2IJIA 3C90A 4GX1A 4PI0A 4ZKIA 3RYCB 2P7TC 3T2MA 1VQ6V 4HZ3A 3RFRA 1AR5A 3K04A 5AG2A 2GV9A 3F7VC 3OR6C 4LFBO 2LFSA 3BCCH 3CRAA 4YJ3B 4MTXA 1AR1B 4K0KO 3RYFA 1VQPV 3ZHRA 4JYAB 4UV9A 4I0XB 3ZHVA 2ZR3A 3OMAB 4MVMA 4JZ2A 4E2LA 4JTDB 4IYHA 4DR3B 4BAYA 1B6QA 1DTOA 3OW2U 3OM3B 4KL1A 5B1NA 2OIGA 3W7TA 3GB7C 4N21A 1TA8A 3UM7A 3ASOC 3CCRV 2Q8VA 2ZCEA 4LF8B 1VF7A 1I0HA 4YJ2A 3K5NA 3OGIB 2RCVA 2ZDIA 4RAIA 3UQ8A 2LQTA 4X64O 4FLXA 4PDLA 4NXNO 4DUZO 3GWKC 1PL4A 1Y67A 5LGNA 4DV4B 4WBNB 1XMQB 4JPRA 5L3DA 1FXKC 1F4NA 1EFRG 3J81N 1BZKA 3EFFK 4LH6A 2YUAA 3HB3B 5IY5B 2EILC 2DMXA 4NYKA 4FM1A 1W0JG 3CCSV 4BR6A 4R8CA 4MVOA 1W0KG 1VQOV 2Q9LA 4FK5C 3S3WA 4D7SA 3H1LH 4JI4O 5LL6Y 3WFVA 2Y0IA 4I50B 3T1HB 4UXNA 3SDLA 1W2BU 3QO8A 1RPRA 1R3LC 1PP9H 4EEQA 4O4LB 5K1PA 5K1XA 2YDEA 2HEPA 5BXZA 4X9QA 1A32A 2A06H 2Q4PA 5EBMC 1JR9A 5B1AC 2E76B 1HNXO 4G2KA 4UVCA 1IVSA 1VEWA 3R65A 3FX7A 1VQ7V 2F4VO 2N04A 4QNHB 4FLYA 2GBOA 4PHZA 3ASNC 2ATKC 3OUSA 1QU7A 4X1KB 3FB8C 4O4JB 1E1RG 3W7XA 4U3FH 4NTWA 4X62B 3CCJV 3HKBA 4EKWA 4J7JA 4DUYO 2DW4A 1EN4A 4DK0A 2BOBC 4JTCB 4J7KA 2PTMA 3L75H 3I56V 2ETNA 3CJHB 4DR2B 2UXNA 1XMOO 1OCOB 1RM1C 2F4VB 4X1YB 1NTMH 2FMLA 3C3SA 5IWAO 4GT1A 1HP8A 2EIKC 2YIBD 4FLUA 4BIUA 4GUNA 1L0NH 2IJHA 4JI4B 1VQ4V 3DTUB 1Y6XA 4PDRA 1MOFA 2ZXWB 1B06A 2XAJA 2JGDA 3B09A 1V54C 3U0ZA 1ZWIC 4J9YB 2FYUH 1QLEB 5HFLA 1THZA 5LA6B 1NZ6A 1EN5A 3AG1B 2K1EA 4P9PA 4DV7B 1IBLO 3SPCA 3OFNG 2LW1A 1BL8A 3LNMB 3QO7A 1K34A 5BR8O 1GN6A 1N32O 1M57C 3HKDA 4LNUB 4PJ0Z 4WFEA 1KU9A 2JDIG 2PYJA 1XL6A 2V4DA 2EX3A 2HVJC 3B2EE 1G8MA 3CC4V 3DXRB 4YJ3A 4R6ZA 1JOYA 1GKFA 3BY6A 4TV9A 3RYFB 1K97A 4B3SB 4LCUC 2P4KA 3TXQA 4RQFA 1ZAUA 4J7ZA 3CC2V 4LR3A 3ICXA 5IT9N 3K0GA 1RSOA 3CYOA 4IHJB 4LF9B 1KECA 1SQPH 2Q7EA 1Z2GA 4FM2A 4DR4B 2P6JA 1Q82W 4JYAO 3OGCC 5L3FA 1JJOA 4KFMA 2GDSA 3ETQA 1WLEA 4DR3O 2RMKB 3H01A 2HP8A 4H0LB 4U7OA 4IIJB 1V55C 3EVKA 5B5EZ 4ASUG 1R3KC 5L3BA 2G38A 1NJIW 4ZHQB 5J2TB 5CA0B 2ZE7A 4XBFA 1FXHA 3K3WA 1BSMA 1H2LA 4B7EA 1K73W 5KHIA 4F6RB 3F5TA 2OT5A 1SERA 1AI5A 3JASA 1HNXB 2VQEB 3HKEA 5FNVA 1O9HA 1D5NA 2ZINA 2NNUA 4DR4O 3K9AA 3A0BZ 4JAUA 4TWKA 3J7AU 4KHPB 3OE7G 1KBHA 1IXBA 2BTOA 4Z1VA 4H37A 1N36B 3E8HA 4UCVA 1KYOF 2DYRC 1VF5B 3JD3A 5FLXN 2CUGA 5EIBD 4LF4O 1SC5B 4DV6O 4LFCB 4W4KA 3UT5B 4OX9O 3ZRXA 2Q73A 1G4YB 2GUZB 2LW7A 5KMGB 3GWOA 5IJ9A 1LNQA 2Q67A 3N2KB 2CGOA 2EIJB 4GKKB 1K9MW 4CC6A 4TSFG 4O4HA 4FJCC 3MDSA 1GK9A 1ZL8B 4PA6A 4TUYA 1TUBB 3SYAA 1ORQC 4RUEA 3QTCA 2V7QG 1KMIZ 2UU9B 4GKJB 1VMGA 1FXKA 1CEZA 1IXMA 2JJ2G 1CXZB 3IJ4A 3IC9A 4MW3A 4X64B 1PV0A 5LMNO 2YSUB 4O4JA 1KP3A 5BMVA 1L1FA 4DV6B 4JI5B 3L73H 2ARHA 3SYCA 3RYHA 4O4IA 5LXTB 5DEDA 1F7YA 3VQVA 4X20A 3P3NA 3C3TA 5JVDA 2HHHO 1OCCB 4DK1A 5EIBC 3ASNB 3E8BA 3N27A 2C2AA 4I0XA 5H6QA 5EZYB 4DUZB 1I94B 4KUMA 4DV5B 2WLIB 5JCOA 1I7FA 3FFQA 1HNZB 1CPYA 2UXCO 2RNBA 1YJ9V 3ABMC 2GSMB 2EINC 2ITCC 1FYJA 2R9AA 1QQCA 4HNAB 2CE4A 1WB7A 5LP6C 5IJ0A 3L71H 4Q6GA 3VQYA 2AXTZ 4CBCA 1EZJA 4NR1A 4B3RO 4MVZA 3LDDA 5KHKA 2N05A 2ITDC 4L8JA 2ZE6A 1M56B 4TQDA 3EXAA 5H2FZ 2EJ7A 4J9ZB 2IW5A 4P9OA 1R6NA 5KUMA 5LP6B 4MTGA 3CCQV 3W7WA 3AEIA 2QM4A 4IT5A 1J5EB 4R50A 2HR3A 3O65A 3JAKA 3MAQA 4JI5O 4UFZA 1I5YA 1RSOB 1QBZA 3K5OA 4ZI7B 2A0LA 3ZRWA 3A0RA 3K03A 1H2GA 2E74B 1WP7A 5IYZA 4K8XA 3E22B 1MZFA 4H33A 2X0LA 3TCUA 1OCZC 4BW9A 1VQKV 4DV7O 2AHZA 2BCCH 2CH7B 2A9HA 3ZS8C 1KQSU 4U7NA 5BR8B 2W6JG 4IIJA 2CTQA 4H44B 4P30A 3JALA 5J2TA 3BPZA 3AG4B 4JI6B 4CS4A 1IZ3A 2YIDA 4RQEA 2BE3A 4XDKA 1SRYA 1FJGO 1P7BA 3ZMTA 2ZM6B 5FPOA 5CA3A 3DSQA 4QE9A 1SA0A 5BY1A 5L3CA 2V1DA 4JYYA 4BWAA 3HPLC 4Z1MG 2OCCB 3CC7V 4TOIA 1JFFB 2YXYA 3PJSK 4IGGA 3UT5A 5GTIZ 5J2UA 4TV8A 1OHHG 4WCEV 4JYCA 1SKVA 5KMGA 4QPKA 3ZHQA 1K8AW 2VRZA 2IH3C 5TISZ 1VQLV 3BAAA 3QF7A 2B9ZA 2PGGA 3JD4A 1PNKA 2JVDA 3SYQA 4DR6O 3AG1C 2QM8A 4LBEC 2ODMA 2VQEO 1FJGB 2ADQB 3QVNA 1YXBA 4DV5O 2ZXWC 4QPJA 2W0XA 2P67A 4JI0B 1IDSA 3CCVV 2LO1A 1XI1A 1WB8A 2IBZH 2F1MA 1D2DA 2VS0A 4LF5O 2E3CA 1RM1B 3JSLA 2MW2B 4N23A 4LF7O 5KA6A 3ZX6A 3ZBHA 1OCRC 2ILMA 4MVSA 1DF4A 2PYLA 3I55V 4JTAB 1QR9A 4O4IB 2CAZC 4GYCB 4IYIA 1NH2D 4J41A 1NR1A 1GAXA 3WB2A 5LMUO 4TV9B 3A8TA 1S3JA 1AILA 4IL6Z 2L35A 1Y76A 1K33A 2AGAA 4B3MB 2PY5A 2WLIA 3JYCA 4JI1O 4B3SO 1EN6A 2BOCC 4X1KA 3N2GA 4JI6O 3CXHF 5CB4A 2DE0X 3SR2C 1S76D 2QE7G 1UPGA 4JI8B 1SF9A 5E1AC 3T4ZA 3L74H 3HKBB 1XNQO 3Q4HA 2XUMA 3ETDA 4X89A 3LDCA 3ZHTA 1X4TA 3LUTB 1YTFB 3BFRA 1VQ9V 2BSKA 1COWG 4CH3A 5L3GA 4UVAA 3D3IA 3CJHA 4DO2A 3DGEA 5CA0A 1SZTA 5LBQA 1Q81W 5H6RA 5LP6A 3J80N 2ZDIC 4NXMO 4MT8A 2XAHA 3VBBA 4B3TB 3MHHC 4KHPO 2K9PA 3HKEB 2JGDB 1WA8A 3I5DA 2VQFO 1EM1A 1WPBA 5LA6A 1PM9A 5J9PC 3DC6A 4K35A 4CS2A 2X7RB 3T1CA 1XQ8A 2YI9A 5DN6G 3SPGA 1SZXA 3H1KH 1NTKH 1JPXA 3KCXA 1YIJV 2FKXA 4LWSB 3RBZA 5LGUA 2DQ0A 4XDJA 2Q68A 3BRCA 5FL7G 1WP8A 1Z5WA 2UXDO 2UXCB 5JJEB 3JAWB 4O4HB 3APOA 4NB5A 4QE7A 1VQMV 1ZL8A 4JI2O 5L3EA 1XDCA 3ASOB 4I55B 1GMGA 2Y0PA 3ZJZA 5ITZA 4IHJA 3ZN1A 4CZZA 1HNWB 2PZSA 2UUAB 1XL4A 2EJRA 1Q6UA 2YEVB 4J10A 4TQFA 4X1IB 1HWYA 1BQZA 1JFFA 3FYIB 4I50A 1QCEA 4ZOLB 1PKXA 4X66O 4UVBA 2JEXA 3CEIA 1RPOA 3SPJA 3P3PA 1Y74A 1HNWO 1PNMA 5CBGA 1FD9A 1BT8A 2EBOA 3UCSC 1XNRO 3FKSG 1Q6IA 3VQWA 3OTFA 3MHSC 3OR7C 3CRMA 1MSDA 3CB2A 1GM9A 1NVPB 2N74A 4JI2B 2L6LA 2XT9A 1S5HC 4PI2A 3G80A 3U11A 3JCUZ 3M99B 3B8MA 3EHBB 2YIAA 3SJAC 2EINB 2DWEC 4AQYO 1X59A 2GTAA 2XAFA 4HNAA 3SGIA 2JEUA 2XOKG 3K5MA 2Q7GA 5IJ0B 1MNGA 2GUZA 3FAVB 1SS3A 1AI6A 5A9GA 1MABG 3N2KA 1I5XA 3UKMA 3VOUA 2QWPB 2QR4A 1YJNV 1QHTA 1QNMA 2E75B 1TUBA 2QKSA 3JARB 3X2QB 4X1YA 4DR7O 4Q20A 1ZLZA 4ICGA 2HG5C 3G6EV 4DXWA 2O57A 1OCRB 4DW1A 2DOSA 5EBLC 1Q8IA 1JJ2U 1H2SB 1PL0A 3BEHA 5JQGB 3ZMUA 3OMNB 2WLNA 3ZRWB 1AJNA 4LF9O 3ZHUA 5BMVB 2QWOB 1IX9A 1Q6HA 2HJFC 2W6IG 3Q4HB 3CPWU 2YS8A 4JZGA 3CD6V 4K8ZA 1PPJH 3JATB 4MVUA 4MTFA 4GX5A 1BE3H 5CBHA 1MA1A 1K3EA 1N0NA 2EZOA 3DXRA 5JCOC 2WLLA 2HFEC 1GM8A 2AZ0A 3JALB 3CMAV 4JYBA 5GW7A 1T5EA 1XREA 4NTYA 3A2FA 2GTSA 4JI7O 5C93A 2JS3A 3ABTA 3O9OA 1NQTA 5EZYA 5B3SC 1L8DA 4GKKO 1NT2B 3ABKC 1WA8B 3ABUA 3IC7A 5EYPB 2F93B 4DR5O 1SA0B 1Q3EA 1IBLB 2VWJA 2IJKA 2QEXV 4JI7B 4ZIBA 3CX5F 3ZHSA 2ZD9A 3S3XA 4RWUA 5C8YA 1BGYH 4LF6O 2DJVA 2OTLV 3GVMA 5LYJA 4O2BA 4BIZA 5EC1C 2EILB 2EIMB 4AHCA 1K5QA 2F43G 1XBLA 3E89A 2A79B 1H38A 2D2CB 3RGBA 3JAWA 3H1HH 1WNSA 3D36A 4F6RA 1N36O 2IU0A 3ETGA 5KX5A 3JASB 4FLTA 2ZNJA 4LFCO 4UCTA 1AROP 2XTAA 1YTFD 1VF6A 4F6EA 3H1IH 4I9WA 1XUQA 2ZE5A 3AG3B 1IURA 2VQFB 1I08A 4J11A 3CRRA 1GN4A 1GH6A 4X1IA 3OMIB 3CRCA 1S5JA 4DV3B 4X8AA 2BTQB 2CH7A 5H5NA 2OTJV 2OYQA 5FPRA 4I4TB 5KA5A 3TXSA 5IYCO 1U97A 1WN7A 3AG2B 1EBOA 3ETEA 4WFBV 1H2MA 4MS2A 1ENVA 4FFBA 5LMNB 4PELA 5IDJA 4PA4A 4PA9A 1TGOA 4UCSA 2IJJA 2ZT9B 3HKCA 3ML0A 4K3AA 2X6CA 2DYSB 4LF6B 4YY3O 2ZR2A 3G6BA 2F23A
chains in the Genus database with same CATH topology
2ATKC 5EC2C 3OUSA 5B1BC 3SPIA 3JD0A 4YXWG 2CK3G 3FB8C 3QO5A 4FIPC 3ZN0A 2ZXWC 4QPJA 3ZCCA 1N8RW 2P67A 1E1RG 3W7XA 1M57B 4XDLA 2JIZG 4HAMA 3CCJV 3CCVV 2X6AA 2B1IA 3ZMSA 4EKWA 3AG2C 2DW4A 4GX2A 1RM1B 4HYOA 3G4SV 4MVRA 1FS0G 2BOBC 4N23A 4JTCB 1VQ5V 5KA6A 1R3JC 1OCRC 3FB6C 2D3OW 1K4DC 4MVSA 1DF4A 3I55V 5BZBA 5LHGA 1VQNV 4JTAB 1QR9A 1QLEC 2DQ3A 2HKOA 3I56V 2QM8A 2UXNA 1OZ0A 3AG3C 1GTOA 1OCOB 1RM1C 1NH2D 5DM6V 2M7WA 1NR1A 4GT1A 3T4DA 2EIKC 4BIUA 1S3JA 1YSCA 2IJHA 4JF3A 3RVZA 2LFRA 3ZMVA 1K33A 3DTUB 1VQ4V 3E86A 1MOFA 2ZXWB 4PDRA 2XAJA 1OCOC 2WLIA 3JYCA 1V54C 2P90A 4PA7A 3ABLB 1ZWIC 2WLMA 2B1GA 2BOCC 4J9YB 2QA4V 1QLEB 1R73A 1BHBA 3K06A 5CMUA 5HFLA 1M56C 2WLJA 1THZA 1S76D 3AG1B 1NKDA 1AJPA 2QE7G 2K1EA 4MW8A 4P9PA 3MD0A 5E1AC 3T4ZA 3ZMZA 3SPCA 3OFNG 5CBFA 3ETDA 1BL8A 4X89A 1AJQA 3LDCA 3CMEV 1Y4MA 1F23A 4WFGA 3LNMB 3QO7A 1K34A 1M9NA 3LUTB 1YTFB 1NBMG 3G71V 1VQ9V 3B77A 1H8EG 1M57C 4WFEA 2EIMC 2JDIG 3WG7C 1KKDA 1COWG 1XL6A 4I5SA 5L3GA 4UVAA 2XAQA 3D3IA 3LSQA 3JD1A 4DO2A 1M1KW 2HVJC 3JCZA 4JAVA 3DGEA 1G8MA 4P2ZA 1SZTA 3CC4V 3E2EA 5LBQA 1Q81W 4R6ZA 3ZRSA 3FB7C 4R7CA 5H6RA 1JOYA 1GKFA 2ZDIC 3BY6A 4MT8A 2XAHA 3VBBA 1K97A 2Y69C 4LCUC 3MHHC 1BMFG 4JASA 1Q7YW 2Z3YA 1R6KA 4RQFA 1QVGU 2Q69A 3CC2V 3K0GA 2EIJC 1DF5A 1JQ0A 3CYOA 1Q86W 4MTOA 3E83A 5J9PC 1QVFU 1KECA 1PD3A 3KG2A 5LHIA 2X7RB 2P6JA 3SPHA 3T1CA 5DN6G 1Q82W 5B1OA 3OGCC 2YEVA 3SPGA 5L3FA 2Z5UA 1R3IC 3LDEA 1JPXA 2R9RB 4KFMA 2IH1C 3SYOA 1YIJV 3QNEA 1UJWB 1WLEA 3RBZA 2XASA 5LGUA 2IU3A 2DQ0A 2MK3A 2X6BA 3H01A 5IYBO 4KP4A 4XDJA 4U7OA 2Q68A 4UV8A 5FL7G 2FTKA 1V55C 2UXXA 4ASUG 1R3KC 1V54B 5L3BA 4LC1A 1NJIW 1NR7A 4JGSA 3K0DA 4GX0A 4XBFA 2DWDC 4QE7A 5B1AB 1FXHA 2JJ1G 3B8NA 1VQMV 3K3WA 1J95A 5L3EA 3CCUV 4WFAV 1K73W 3E35A 3ASOB 4PA3A 1GMGA 2OT5A 1SERA 1AI5A 5B1BB 2GHYA 1KC8W 2NNUA 3NXSA 3AG4C 3K9AA 1V55B 3ZJZA 4JAUA 2H94A 4LP8A 4TWKA 3ZN1A 1K4CC 1Y66A 3OE7G 4CZZA 3SJQC 1XL4A 4WF9V 2EJRA 4H37A 3E8HA 2YEVB 1SETA 2DYRC 3JD3A 3LSSA 1MSWD 2JK5C 2ZQMA 1HWYA 1YHQV 3FYIB 2WPDG 1QCEA 1PKXA 3ZRXA 4FPPA 4UVBA 4F4LA 2JEXA 1G4YB 2EZPA 2PI4A 1H8HG 1F4MA 1RPOA 4RUFA 3SPJA 3GWOA 2XNDG 1F51A 2DYRB 4QIWF 1LNQA 2Q67A 1PNMA 3W7UA 2EIJB 5CBGA 1K9MW 4TSFG 1JX9A 2EBOA 3CCLV 4FJCC 1GK9A 1M90W 1AI7A 1E79G 3FKSG 3W7SA 4PA6A 4ZBMA 1NH2B 3MHSC 3OR7C 4OXSA 3SYAA 1ORQC 1SESA 4RUEA 1OCCC 3CXCU 2V7QG 1GM7A 1GM9A 1JVMA 1TUEB 4PDVA 1NVPD 1NVPB 1FXKA 2AHYA 1CEZA 1K7DA 1S5HC 4RO2A 2HLDG 3E8FA 1IXMA 2JJ2G 5EBWC 3M99B 3B8MA 3ZRVA 3EHBB 4MW3A 2EINB 2YSUB 2DWEC 2LP7A 2DYSC 2XAFA 2XAGA 2JEUA 2XOKG 1KP3A 1K92A 2WLHA 3P30A 1S72V 3RW0A 4MVQA 1L1FA 1YI2V 1AI6A 3X2QC 1MABG 3OEHG 2Q6AA 5IYDO 4WFFA 4G28B 3OEEG 1I5XA 3SYCA 3UKMA 3WG7B 2EIKB 3VOUA 1PNLA 1VQ8V 1YJWV 1YJNV 3FB5C 3CCMV 2Y48A 1OCZB 2B5UA 1P4RA 2QKSA 3STZC 3X2QB 1OCCB 2WLLB 4Q20A 3F7YC 4PDMA 2HG5C 3E8GA 3ASNB 3E8BA 3G6EV 4DXWA 2KB1A 1OCRB 3SYPA 5HFMA 3K08A 5EBLC 2QM7A 1JJ2U 2C2AA 5H6QA 5KUKA 3IFXA 3CCEV 1PL0A 3BEHA 4KUMA 2WLIB 3ZIAG 1CPYA 1WPXA 5CN0A 3ABKB 1DLBA 1YJ9V 1S77D 3ABMC 2GSMB 2EINC 2ITCC 5B3SB 4G27B 3ZMUA 3OMNB 5EK0A 4BW5A 2WLNA 1FFTB 4MSWC 3RVYA 3ZRWB 2PI5A 1K5SA 1AJNA 2IJIA 4GX1A 4CBCA 4ZKIA 1EZJA 3CPWU 2HJFC 2W6IG 1E1QG 3ABMB 1GO3F 1MG1A 3TETA 2Y69B 2HVKC 2P7TC 4MVZA 2WWWA 3CD6V 2QTOA 3LDDA 3T2MA 1AI4A 1YITV 4MVUA 4MTFA 4HZ3A 1VQ6V 2ITDC 4GX5A 5CBHA 3K04A 1M56B 1K3EA 3F7VC 3OR6C 2LFSA 2EZOA 3STLC 4J9ZB 2IW5A 2HFEC 1GM8A 2WLLA 4MTXA 4P9OA 1R6NA 5KUMA 1AR1B 4JYBA 4MTGA 5GW7A 3W7WA 4UUJC 3CMAV 4WFHA 3AEIA 1VQPV 2WLKA 4UV9A 5C93A 3ABTA 1BHAA 1NQTA 3FYEB 5B3SC 2ZR3A 3OMAB 4MVMA 2H8PC 3ABKC 3K79A 4R50A 2HR3A 4E2LA 4JTDB 4BAYA 3ABUA 1I5YA 3IC7A 1B6QA 1QBZA 3CCQV 4FMTA 2IJKA 1DTOA 3TK1A 3JD2A 3OW2U 2QEXV 2A0LA 3OUFA 3OM3B 3ZRWA 3IGAC 5B1NA 3A0RA 2OCCC 3W7TA 3K03A 3GB7C 2ZD9A 4N21A 1H2GA 3UM7A 3ASOC 3CCRV 1FXVA 4H33A 2X0LA 3TCUA 1OCZC 2OTLV 1VQKV 4BIZA 2AHZA 5EC1C 2ZDIA 4RAIA 2A9HA 2EILB 2EIMB 4PDLA 1KQSU 1K5QA 4U7NA 2W6JG 4X88A 2F43G 3E89A 2A79B 1H38A 4TT3G 4P30A 5LHHA 5LGNA 3AG4B 4RQEA 4JPRA 5L3DA 1FXKC 1F4NA 3ABLC 3D36A 2IU0A 3ETGA 1EFRG 5H9CA 4XDKA 1SRYA 3EFFK 1AROP 1P7BA 3ZMTA 1YTFD 3HB3B 2WAMA 2WSSG 5IY5B 2EILC 5CA3A 4QE9A 1W0JG 2R9IA 4QJFB 2V1DA 5L3CA 3CCSV 4I9WA 5LGTA 4R8CA 4MVOA 1W0KG 3AG3B 1VQOV 3HPLC 4Z1MG 2OCCB 3OAAG 4FK5C 3CC7V 2NLJC 1S0VA 3PJSK 3OMIB 3WFVA 1QR8A 1KP2A 4UXNA 4X8AA 1ROPA 3QO8A 1RPRA 1W2BU 1R3LC 4L87A 2OTJV 1OHHG 4WCEV 4GCZA 4JYCA 3P32A 3CP1A 5KA5A 5IYCO 4QPKA 3AG2B 1EBOA 3ETEA 1K8AW 4WFBV 5EBMC 2IH3C 4MS2A 5B1AC 1JCHA 1ENVA 1KD1W 4G2KA 1VQLV 5IY5C 4UVCA 4PELA 5IDJA 4PA4A 4PA9A 2IJJA 3JD4A 3R65A 3ML0A 1PNKA 1VQ7V 2X6CA 4QNHB 2DYSB 2W0FC 1FXKB 3SYQA 3AG1C 1QLNA 1CP9A 2ZR2A 3ASNC 4LBEC 3F5WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  4MTO A;  4MW3 A;  3E83 A;  5EC2 C;  3OUS A;  5B1B C;  5J9P C;  3SPI A;  2DWE C;  3KG2 A;  3FB8 C;  2A0L A;  3OUF A;  2ZXW C;  3SPH A;  3T1C A;  3IGA C;  2DYS C;  3OGC C;  2YEV A;  2OCC C;  3SPG A;  3K03 A;  1R3I C;  4XDL A;  3GB7 C;  2ZD9 A;  3LDE A;  2R9R B;  4KFM A;  2WLH A;  3UM7 A;  2IH1 C;  2X6A A;  3SYO A;  3ASO C;  3RW0 A;  4EKW A;  4MVQ A;  3AG2 C;  4H33 A;  3TCU A;  1OCZ C;  3RBZ A;  4GX2 A;  2AHZ A;  3X2Q C;  4HYO A;  5EC1 C;  4RAI A;  2X6B A;  2BOB C;  4MVR A;  2A9H A;  4JTC B;  2Q6A A;  4XDJ A;  2Q68 A;  4PDL A;  4G28 B;  4WFF A;  1V55 C;  3SYC A;  3UKM A;  1R3J C;  4X88 A;  1OCR C;  3FB6 C;  3VOU A;  1K4D C;  1R3K C;  4MVS A;  3E89 A;  5BZB A;  2A79 B;  4JTA B;  1QLE C;  3FB5 C;  4P30 A;  3K0D A;  3AG3 C;  4GX0 A;  2DWD C;  2QKS A;  4QE7 A;  3STZ C;  1J95 A;  2WLL B;  3F7Y C;  4PDM A;  2HG5 C;  3ABL C;  3E8G A;  3E8B A;  3T4D A;  4PA3 A;  2KB1 A;  2EIK C;  3SYP A;  4DXW A;  3K08 A;  5EBL C;  4XDK A;  3EFF K;  5KUK A;  3IFX A;  3RVZ A;  1P7B A;  3BEH A;  2WLI B;  3E86 A;  4PDR A;  2EIL C;  1OCO C;  3AG4 C;  2WLI A;  3JYC A;  3ZJZ A;  4QE9 A;  1V54 C;  4PA7 A;  4TWK A;  1ZWI C;  2WLM A;  4J9Y B;  2BOC C;  3ABM C;  4LP8 A;  2EIN C;  2ITC C;  1K4C C;  3K06 A;  4I9W A;  4G27 B;  1M56 C;  2WLJ A;  4R8C A;  3SJQ C;  4MVO A;  1XL4 A;  3SYA A;  4H37 A;  5EK0 A;  3E8H A;  3HPL C;  4BW5 A;  2WLN A;  4MW8 A;  2K1E A;  2DYR C;  4MSW C;  4P9P A;  3RVY A;  2JK5 C;  2NLJ C;  5E1A C;  3T4Z A;  3SPC A;  3PJS K;  5CBF A;  4GX1 A;  4CBC A;  1BL8 A;  4X89 A;  3LDC A;  2HJF C;  4WFG A;  3LNM B;  3LUT B;  4X8A A;  4F4L A;  1G4Y B;  1R3L C;  3TET A;  2HVK C;  2P7T C;  4MVZ A;  4RUF A;  2QTO A;  3LDD A;  1M57 C;  3SPJ A;  3T2M A;  4WFE A;  2EIM C;  1LNQ A;  2Q67 A;  3WG7 C;  4MVU A;  1KKD A;  4MTF A;  4HZ3 A;  2ITD C;  1XL6 A;  4GX5 A;  5CBH A;  3K04 A;  5CBG A;  3F7V C;  3OR6 C;  2HVJ C;  3STL C;  5EBM C;  2IH3 C;  4MS2 A;  5B1A C;  4J9Z B;  2WLL A;  2HFE C;  4P2Z A;  4P9O A;  4PA6 A;  4ZBM A;  5KUM A;  4MTG A;  5IY5 C;  3OR7 C;  4OXS A;  4R6Z A;  4UUJ C;  1ORQ C;  3FB7 C;  4R7C A;  4RUE A;  1OCC C;  4PA4 A;  2WLK A;  4PA9 A;  4WFH A;  3ZRS A;  1JVM A;  3R65 A;  4PDV A;  5B3S C;  2Y69 C;  4LCU C;  2AHY A;  2X6C A;  4MVM A;  4QNH B;  1S5H C;  2Q69 A;  2W0F C;  4RO2 A;  2H8P C;  3AG1 C;  3SYQ A;  3ABK C;  3E8F A;  4R50 A;  3K0G A;  2EIJ C;  4JTD B;  5EBW C;  3ASN C;  4LBE C;  3F5W C; 
#chains in the Genus database with same CATH topology
 5B1B C;  2ZM6 O;  1U96 A;  3QO5 A;  4X65 B;  3ZN0 A;  1N8R W;  2QWN B;  1NTZ H;  3AG7 A;  4XDL A;  3A0H Z;  1N32 B;  5D5Q A;  2P22 C;  2X6A A;  2KSD A;  1WJZ A;  5J2U B;  1XHX A;  1R1B A;  4JI8 O;  2P06 A;  5GON B;  3K57 A;  3M8A A;  3M7M X;  4GX2 A;  2QWR B;  2R70 A;  3G4S V;  3K59 A;  1VQ5 V;  3RYH B;  2BSK B;  1FPO A;  4D6T H;  2D3O W;  1K4D C;  1L0L H;  5LXT A;  5BZB A;  1VQN V;  2PF4 E;  4JI1 B;  3VQX A;  2UU9 O;  5CA1 B;  1VP7 A;  1N0J A;  4LF8 O;  3K5L A;  3TJT A;  1M5I A;  1SQQ H;  3SJC C;  2Q0A A;  1YSC A;  1OV9 A;  4LF7 B;  4UCR A;  3RVZ A;  1AP6 A;  5A2Q N;  3E86 A;  2F95 B;  4YHH O;  4PA7 A;  2YIB A;  3ABL B;  2WLM A;  3K06 A;  1XMQ O;  1M56 C;  4H13 B;  3RYI B;  1NKD A;  1AJP A;  3IAY A;  3ZMZ A;  1B04 A;  1FFX A;  2ZE8 A;  4LH7 A;  2M6Y A;  1AJQ A;  4B08 A;  1BS3 A;  1F23 A;  4FLV A;  1M9N A;  4K0K B;  1NBM G;  3G71 V;  5JWP A;  1IBM O;  1H8E G;  4X62 O;  4B3T O;  2ZIO A;  1XIL A;  3WG7 C;  1KKD A;  1US6 A;  1G1X B;  4I5S A;  2FL4 A;  4I9Q A;  1JA8 A;  1M1K W;  4JAV A;  2QKA A;  3JCZ A;  1HDJ A;  2CTR A;  4P2Z A;  2RQ6 A;  4R7C A;  1TVK A;  4YIP A;  2HHH B;  1BMF G;  1JMK C;  1Q7Y W;  1QVG U;  1NI8 A;  3JAK B;  4LFB B;  2EIJ C;  3N2G B;  4A5U B;  2AZ2 A;  1Q86 W;  4UCU A;  2F66 C;  4ZI7 A;  5ITZ B;  1PD3 A;  5LHI A;  3BVO A;  3SPH A;  5B1O A;  2YEV A;  2Z5U A;  1R3I C;  4DV0 B;  4UB6 Z;  3LDE A;  2XHB A;  3E22 A;  3KKY A;  4ZOL A;  3QNE A;  4DW0 A;  1UJW B;  2E5L B;  2IU3 A;  1XNQ B;  2X6B A;  3K58 A;  4UV8 A;  2UXX A;  1Y74 B;  4LC1 A;  3HR0 A;  4JGS A;  4GX0 A;  5B1A B;  3B8N A;  4GZR B;  2QTS A;  3CCU V;  4WFA V;  1DGS A;  2A3Q A;  2QKC A;  3NR7 A;  4PA3 A;  4U3J A;  4JI3 B;  2GHY A;  3H1J H;  3NXS A;  3AG4 C;  3T1Y B;  1V55 B;  5KHJ A;  1D5A A;  1W59 A;  2H94 A;  4LP8 A;  2P5O A;  3LNN A;  4LFA O;  1ZSP A;  3SJQ C;  1ZX3 A;  4WF9 V;  1SET A;  2JK5 C;  2ZQM A;  5LOV B;  4FLZ A;  1Q90 D;  4FPP A;  4TV8 B;  3LSU A;  2EZP A;  1H8H G;  1F4M A;  2BTQ A;  3FAV A;  3UO3 A;  2DYR B;  3L9D A;  4DR6 B;  3CHX A;  1M90 W;  1E79 G;  3W7S A;  1NH2 B;  4ZBM A;  4OX9 B;  4OXS A;  1SES A;  1OCC C;  4Z2W A;  3CXC U;  4I55 A;  4PV1 B;  2FB5 A;  4DR2 O;  4OGQ B;  1JVM A;  1TUE B;  1NVP D;  4DR7 B;  2AHY A;  2UXB O;  1K7D A;  4RO2 A;  1XHZ A;  3E8F A;  1VAR A;  2EUL A;  5EBW C;  3G67 A;  2WA3 A;  2KG7 A;  1VIB A;  1IBK O;  1YDX A;  2PUS A;  1EZV H;  1K92 A;  2WLH A;  3P30 A;  2AW9 A;  2YXH A;  1ZUQ A;  1YI2 V;  3OEH G;  2Q6A A;  2VWK A;  5IYD O;  4G28 B;  4JAA A;  3OEE G;  1XNR B;  2EIK B;  1XOU A;  3CRQ A;  1PNL A;  3JAT A;  1VQ8 V;  1RP3 B;  1R6T A;  4FZ1 A;  3CCM V;  1P7G A;  4AI8 A;  4CC5 A;  3STZ C;  4J42 A;  4EB6 A;  1LR1 A;  2WLL B;  5HFM A;  3SYP A;  3WU2 Z;  3K08 A;  5KLV H;  2Y4T A;  2CTP A;  4DV1 O;  3IFX A;  3CCE V;  4DR5 B;  2Q0O C;  1S77 D;  1KUQ A;  4G27 B;  2KKW A;  2JS5 A;  3RYI A;  1P84 F;  4EFB A;  2PI5 A;  4JI3 O;  4FVM A;  1FFX B;  4B3M O;  1E1Q G;  3ABM B;  1GO3 F;  5C8Y B;  1XEQ A;  1G6U A;  1MG1 A;  3TET A;  2Y69 B;  4C7U A;  2HVK C;  2WWW A;  2QTO A;  1AI4 A;  4YJ2 B;  1N33 O;  1YIT V;  2OIE A;  1AR4 A;  2WA4 A;  4YY3 B;  4DRX B;  2ZKO A;  3STL C;  3JAR A;  5F2V O;  2UXD B;  3FD9 A;  1OJH A;  4UUJ C;  4WFH A;  2WLK A;  5JH7 A;  1BHA A;  4UCO A;  1BQ0 A;  3FYE B;  1TVK B;  3APQ A;  3B40 A;  1SQX H;  2H8P C;  2Q5Z A;  3K79 A;  5JQG A;  4E4E A;  3K9S A;  4GLX A;  1HR0 B;  2QSA A;  4FMT A;  3TK1 A;  3JD2 A;  3CSX A;  1YVW A;  3OUF A;  2CDY A;  3IGA C;  3RWR D;  4DR1 O;  3OD4 A;  2LGQ A;  2OCC C;  4W4L A;  1IBM B;  3TGU H;  1FXV A;  4LWS A;  1H2N A;  5E79 Z;  3DC5 A;  4X88 A;  4O4L A;  1HNZ O;  4DR1 B;  4TT3 G;  1YF2 A;  5LHH A;  1YCI A;  4YHH B;  4EFE A;  4JV5 B;  2LGW A;  3ABL C;  5H9C A;  4CH6 A;  2ZIM A;  2HJD A;  2NN4 A;  4CS3 A;  2WAM A;  2WSS G;  5FNV B;  1YEW A;  2R9I A;  3RT3 C;  4QJF B;  1N33 B;  5LGT A;  1M4U A;  2YI8 A;  3OAA G;  4KXR A;  2NLJ C;  1SQF A;  4D7T A;  1S0V A;  3R66 A;  4X65 O;  2YC0 A;  1QR8 A;  1KP2 A;  1ROP A;  3CS5 A;  4L87 A;  3D3Q A;  2IM9 A;  4GCZ A;  3P32 A;  3CP1 A;  3BAB A;  3JAM N;  1H2K A;  2R72 A;  4WBN A;  4DV2 O;  4NXN B;  1JCH A;  2RDC A;  2H3O A;  2JGU A;  4DV1 B;  5CA1 A;  2QJ1 A;  1KD1 W;  5IY5 C;  5KX5 B;  5IE9 A;  1ZTE A;  1KB9 F;  3U10 A;  1GRJ A;  1FKA O;  2QGN A;  4FZ0 A;  2OWO A;  2W0F C;  4BIO A;  1FXK B;  1QLN A;  1CP9 A;  5D5P A;  4LF5 B;  3F5W C;  5EC2 C;  1AB3 A;  3SPI A;  3JD0 A;  2NR5 A;  4YXW G;  2CK3 G;  2KG7 B;  4FIP C;  2KQX A;  3ZCC A;  1M57 B;  2JIZ G;  4HAM A;  1XMO B;  2UUA O;  2B1I A;  1J5E O;  3ZMS A;  4O2A B;  3AG2 C;  4HYO A;  3B4S A;  4MVR A;  1FS0 G;  3HKD B;  4LNU A;  4DV3 O;  1R3J C;  3FB6 C;  3BA8 A;  4J80 A;  5LHG A;  1IBK B;  1QLE C;  2DQ3 A;  2HKO A;  4JI0 O;  4FFB B;  1OZ0 A;  3AG3 C;  1GTO A;  1Q5O A;  5DM6 V;  3L70 H;  5JVD B;  5KAF Z;  2M7W A;  3SJB C;  3T4D A;  3RN4 A;  1Z5V A;  1GN3 A;  4JF3 A;  3ZMV A;  2LFR A;  1MMM A;  1LUV A;  1TAE A;  4AQY B;  1OCO C;  1LUW A;  2P90 A;  2QA4 V;  2B1G A;  1R73 A;  1BHB A;  2UXB B;  5CMU A;  2WLJ A;  4FFK A;  4MW8 A;  1SQV H;  4DUY B;  3MD0 A;  3RYC A;  5CBF A;  5KAI Z;  3CME V;  1Y4M A;  4WFG A;  2YXL A;  1WAZ A;  4NXM B;  3B77 A;  3UO2 A;  2EIM C;  4LFA B;  2UUB B;  3CWB H;  3L72 H;  2CGN A;  1SQB H;  1HW7 A;  2UUC B;  2XAQ A;  3LSQ A;  2A7W A;  3JD1 A;  3PN1 A;  4CH5 A;  1B3Q A;  3D8C A;  3E2E A;  4I7Z B;  3ZRS A;  3FB7 C;  2ZNI A;  5JH7 B;  2Y69 C;  4JAS A;  4U3J B;  2Z3Y A;  1R6K A;  3WB0 A;  2Q69 A;  5LMU B;  1BCC H;  5EYP A;  1JQ0 A;  1DF5 A;  4MTO A;  2QWQ B;  3E83 A;  1P49 A;  5KHG A;  4AIL C;  1QVF U;  1N34 B;  3BA9 A;  3KG2 A;  2Z0A A;  5DEC A;  1UFI A;  4X66 B;  2YIC A;  2Y4U A;  2R9R B;  2IH1 C;  2LJ2 A;  3SYO A;  2UUB O;  4UB8 Z;  4YIO A;  4O2B B;  5LYJ B;  5IYZ B;  2XAS A;  2MK3 A;  4NKG B;  5IYB O;  1VF6 C;  4KP4 A;  2FTK A;  1V54 B;  4B3R B;  2P4V A;  1NR7 A;  2RN9 A;  4ABM A;  3KZI Z;  3K0D A;  4GKJ O;  2DWD C;  2JJ1 G;  1J95 A;  2ADP A;  4PD4 F;  4TUY B;  3E35 A;  2E5L O;  4FM0 A;  4LF4 B;  1N4C A;  5B1B B;  1KC8 W;  1S5L Z;  2QDO A;  1YZB A;  1RFY A;  1O9G A;  4JV5 O;  1AVM A;  1K4C C;  1Y66 A;  3BHP A;  4CH4 A;  2UUC O;  5IWA B;  2DN9 A;  1V9P A;  3LSS A;  1MSW D;  3QG5 A;  5GTH Z;  1YHQ V;  1I94 O;  3AK3 A;  2WPD G;  5KHH A;  3WB1 A;  4F4L A;  2PI4 A;  2JRI A;  4RUF A;  4I4T A;  2XND G;  1F51 A;  4QIW F;  3W7U A;  4ZHQ A;  1JX9 A;  3AK2 A;  3CCL V;  3H9V A;  1HR0 O;  1AI7 A;  4NTX A;  4X20 B;  3T1H O;  2OCH A;  4DYL A;  4EB6 B;  1GM7 A;  3HKC B;  4PDV A;  2CTW A;  4FLW A;  4QGP A;  2HLD G;  1SQG A;  3JSN A;  1Q43 A;  4HBN A;  1DK1 A;  3AK1 A;  3ZRV A;  4OPA A;  1NS1 A;  2LP7 A;  3OT7 A;  2DYS C;  5LOV A;  2XAG A;  1KKC A;  1S72 V;  4OPH A;  3RW0 A;  5GON A;  4MVQ A;  1AP5 A;  3OTO B;  4O2A A;  5IJ9 B;  3X2Q C;  4NVP A;  1N34 O;  4WFF A;  2Q7H A;  3THO A;  3WG7 B;  3T1Y O;  1YJW V;  3FB5 C;  4DRX A;  2Y48 A;  1OCZ B;  2B5U A;  1P4R A;  1GN2 A;  5JJN B;  5JJJ B;  1FAF A;  3F7Y C;  4PDM A;  1URF A;  3OTO O;  3E8G A;  3CE2 A;  5B66 Z;  2KB1 A;  4DV2 B;  2QM7 A;  5KUK A;  2RJZ A;  1Y76 B;  4B7K A;  1NU1 H;  3ZIA G;  1WPX A;  5CN0 A;  3ABK B;  1DLB A;  4DV4 O;  5B3S B;  3D36 C;  4DV0 O;  3ZED A;  5EK0 A;  4BW5 A;  5CB4 B;  1M93 A;  1FFT B;  4MSW C;  3RVY A;  1MZE A;  1K5S A;  3KCY A;  2IJI A;  3C90 A;  4GX1 A;  4PI0 A;  4ZKI A;  3RYC B;  2P7T C;  3T2M A;  1VQ6 V;  4HZ3 A;  3RFR A;  1AR5 A;  3K04 A;  5AG2 A;  2GV9 A;  3F7V C;  3OR6 C;  4LFB O;  2LFS A;  3BCC H;  3CRA A;  4YJ3 B;  4MTX A;  1AR1 B;  4K0K O;  3RYF A;  1VQP V;  3ZHR A;  4JYA B;  4UV9 A;  4I0X B;  3ZHV A;  2ZR3 A;  3OMA B;  4MVM A;  4JZ2 A;  4E2L A;  4JTD B;  4IYH A;  4DR3 B;  4BAY A;  1B6Q A;  1DTO A;  3OW2 U;  3OM3 B;  4KL1 A;  5B1N A;  2OIG A;  3W7T A;  3GB7 C;  4N21 A;  1TA8 A;  3UM7 A;  3ASO C;  3CCR V;  2Q8V A;  2ZCE A;  4LF8 B;  1VF7 A;  1I0H A;  4YJ2 A;  3K5N A;  3OGI B;  2RCV A;  2ZDI A;  4RAI A;  3UQ8 A;  2LQT A;  4X64 O;  4FLX A;  4PDL A;  4NXN O;  4DUZ O;  3GWK C;  1PL4 A;  1Y67 A;  5LGN A;  4DV4 B;  4WBN B;  1XMQ B;  4JPR A;  5L3D A;  1FXK C;  1F4N A;  1EFR G;  3J81 N;  1BZK A;  3EFF K;  4LH6 A;  2YUA A;  3HB3 B;  5IY5 B;  2EIL C;  2DMX A;  4NYK A;  4FM1 A;  1W0J G;  3CCS V;  4BR6 A;  4R8C A;  4MVO A;  1W0K G;  1VQO V;  2Q9L A;  4FK5 C;  3S3W A;  4D7S A;  3H1L H;  4JI4 O;  5LL6 Y;  3WFV A;  2Y0I A;  4I50 B;  3T1H B;  4UXN A;  3SDL A;  1W2B U;  3QO8 A;  1RPR A;  1R3L C;  1PP9 H;  4EEQ A;  4O4L B;  5K1P A;  5K1X A;  2YDE A;  2HEP A;  5BXZ A;  4X9Q A;  1A32 A;  2A06 H;  2Q4P A;  5EBM C;  1JR9 A;  5B1A C;  2E76 B;  1HNX O;  4G2K A;  4UVC A;  1IVS A;  1VEW A;  3R65 A;  3FX7 A;  1VQ7 V;  2F4V O;  2N04 A;  4QNH B;  4FLY A;  2GBO A;  4PHZ A;  3ASN C;  2ATK C;  3OUS A;  1QU7 A;  4X1K B;  3FB8 C;  4O4J B;  1E1R G;  3W7X A;  4U3F H;  4NTW A;  4X62 B;  3CCJ V;  3HKB A;  4EKW A;  4J7J A;  4DUY O;  2DW4 A;  1EN4 A;  4DK0 A;  2BOB C;  4JTC B;  4J7K A;  2PTM A;  3L75 H;  3I56 V;  2ETN A;  3CJH B;  4DR2 B;  2UXN A;  1XMO O;  1OCO B;  1RM1 C;  2F4V B;  4X1Y B;  1NTM H;  2FML A;  3C3S A;  5IWA O;  4GT1 A;  1HP8 A;  2EIK C;  2YIB D;  4FLU A;  4BIU A;  4GUN A;  1L0N H;  2IJH A;  4JI4 B;  1VQ4 V;  3DTU B;  1Y6X A;  4PDR A;  1MOF A;  2ZXW B;  1B06 A;  2XAJ A;  2JGD A;  3B09 A;  1V54 C;  3U0Z A;  1ZWI C;  4J9Y B;  2FYU H;  1QLE B;  5HFL A;  1THZ A;  5LA6 B;  1NZ6 A;  1EN5 A;  3AG1 B;  2K1E A;  4P9P A;  4DV7 B;  1IBL O;  3SPC A;  3OFN G;  2LW1 A;  1BL8 A;  3LNM B;  3QO7 A;  1K34 A;  5BR8 O;  1GN6 A;  1N32 O;  1M57 C;  3HKD A;  4LNU B;  4PJ0 Z;  4WFE A;  1KU9 A;  2JDI G;  2PYJ A;  1XL6 A;  2V4D A;  2EX3 A;  2HVJ C;  3B2E E;  1G8M A;  3CC4 V;  3DXR B;  4YJ3 A;  4R6Z A;  1JOY A;  1GKF A;  3BY6 A;  4TV9 A;  3RYF B;  1K97 A;  4B3S B;  4LCU C;  2P4K A;  3TXQ A;  4RQF A;  1ZAU A;  4J7Z A;  3CC2 V;  4LR3 A;  3ICX A;  5IT9 N;  3K0G A;  1RSO A;  3CYO A;  4IHJ B;  4LF9 B;  1KEC A;  1SQP H;  2Q7E A;  1Z2G A;  4FM2 A;  4DR4 B;  2P6J A;  1Q82 W;  4JYA O;  3OGC C;  5L3F A;  1JJO A;  4KFM A;  2GDS A;  3ETQ A;  1WLE A;  4DR3 O;  2RMK B;  3H01 A;  2HP8 A;  4H0L B;  4U7O A;  4IIJ B;  1V55 C;  3EVK A;  5B5E Z;  4ASU G;  1R3K C;  5L3B A;  2G38 A;  1NJI W;  4ZHQ B;  5J2T B;  5CA0 B;  2ZE7 A;  4XBF A;  1FXH A;  3K3W A;  1BSM A;  1H2L A;  4B7E A;  1K73 W;  5KHI A;  4F6R B;  3F5T A;  2OT5 A;  1SER A;  1AI5 A;  3JAS A;  1HNX B;  2VQE B;  3HKE A;  5FNV A;  1O9H A;  1D5N A;  2ZIN A;  2NNU A;  4DR4 O;  3K9A A;  3A0B Z;  4JAU A;  4TWK A;  3J7A U;  4KHP B;  3OE7 G;  1KBH A;  1IXB A;  2BTO A;  4Z1V A;  4H37 A;  1N36 B;  3E8H A;  4UCV A;  1KYO F;  2DYR C;  1VF5 B;  3JD3 A;  5FLX N;  2CUG A;  5EIB D;  4LF4 O;  1SC5 B;  4DV6 O;  4LFC B;  4W4K A;  3UT5 B;  4OX9 O;  3ZRX A;  2Q73 A;  1G4Y B;  2GUZ B;  2LW7 A;  5KMG B;  3GWO A;  5IJ9 A;  1LNQ A;  2Q67 A;  3N2K B;  2CGO A;  2EIJ B;  4GKK B;  1K9M W;  4CC6 A;  4TSF G;  4O4H A;  4FJC C;  3MDS A;  1GK9 A;  1ZL8 B;  4PA6 A;  4TUY A;  1TUB B;  3SYA A;  1ORQ C;  4RUE A;  3QTC A;  2V7Q G;  1KMI Z;  2UU9 B;  4GKJ B;  1VMG A;  1FXK A;  1CEZ A;  1IXM A;  2JJ2 G;  1CXZ B;  3IJ4 A;  3IC9 A;  4MW3 A;  4X64 B;  1PV0 A;  5LMN O;  2YSU B;  4O4J A;  1KP3 A;  5BMV A;  1L1F A;  4DV6 B;  4JI5 B;  3L73 H;  2ARH A;  3SYC A;  3RYH A;  4O4I A;  5LXT B;  5DED A;  1F7Y A;  3VQV A;  4X20 A;  3P3N A;  3C3T A;  5JVD A;  2HHH O;  1OCC B;  4DK1 A;  5EIB C;  3ASN B;  3E8B A;  3N27 A;  2C2A A;  4I0X A;  5H6Q A;  5EZY B;  4DUZ B;  1I94 B;  4KUM A;  4DV5 B;  2WLI B;  5JCO A;  1I7F A;  3FFQ A;  1HNZ B;  1CPY A;  2UXC O;  2RNB A;  1YJ9 V;  3ABM C;  2GSM B;  2EIN C;  2ITC C;  1FYJ A;  2R9A A;  1QQC A;  4HNA B;  2CE4 A;  1WB7 A;  5LP6 C;  5IJ0 A;  3L71 H;  4Q6G A;  3VQY A;  2AXT Z;  4CBC A;  1EZJ A;  4NR1 A;  4B3R O;  4MVZ A;  3LDD A;  5KHK A;  2N05 A;  2ITD C;  4L8J A;  2ZE6 A;  1M56 B;  4TQD A;  3EXA A;  5H2F Z;  2EJ7 A;  4J9Z B;  2IW5 A;  4P9O A;  1R6N A;  5KUM A;  5LP6 B;  4MTG A;  3CCQ V;  3W7W A;  3AEI A;  2QM4 A;  4IT5 A;  1J5E B;  4R50 A;  2HR3 A;  3O65 A;  3JAK A;  3MAQ A;  4JI5 O;  4UFZ A;  1I5Y A;  1RSO B;  1QBZ A;  3K5O A;  4ZI7 B;  2A0L A;  3ZRW A;  3A0R A;  3K03 A;  1H2G A;  2E74 B;  1WP7 A;  5IYZ A;  4K8X A;  3E22 B;  1MZF A;  4H33 A;  2X0L A;  3TCU A;  1OCZ C;  4BW9 A;  1VQK V;  4DV7 O;  2AHZ A;  2BCC H;  2CH7 B;  2A9H A;  3ZS8 C;  1KQS U;  4U7N A;  5BR8 B;  2W6J G;  4IIJ A;  2CTQ A;  4H44 B;  4P30 A;  3JAL A;  5J2T A;  3BPZ A;  3AG4 B;  4JI6 B;  4CS4 A;  1IZ3 A;  2YID A;  4RQE A;  2BE3 A;  4XDK A;  1SRY A;  1FJG O;  1P7B A;  3ZMT A;  2ZM6 B;  5FPO A;  5CA3 A;  3DSQ A;  4QE9 A;  1SA0 A;  5BY1 A;  5L3C A;  2V1D A;  4JYY A;  4BWA A;  3HPL C;  4Z1M G;  2OCC B;  3CC7 V;  4TOI A;  1JFF B;  2YXY A;  3PJS K;  4IGG A;  3UT5 A;  5GTI Z;  5J2U A;  4TV8 A;  1OHH G;  4WCE V;  4JYC A;  1SKV A;  5KMG A;  4QPK A;  3ZHQ A;  1K8A W;  2VRZ A;  2IH3 C;  5TIS Z;  1VQL V;  3BAA A;  3QF7 A;  2B9Z A;  2PGG A;  3JD4 A;  1PNK A;  2JVD A;  3SYQ A;  4DR6 O;  3AG1 C;  2QM8 A;  4LBE C;  2ODM A;  2VQE O;  1FJG B;  2ADQ B;  3QVN A;  1YXB A;  4DV5 O;  2ZXW C;  4QPJ A;  2W0X A;  2P67 A;  4JI0 B;  1IDS A;  3CCV V;  2LO1 A;  1XI1 A;  1WB8 A;  2IBZ H;  2F1M A;  1D2D A;  2VS0 A;  4LF5 O;  2E3C A;  1RM1 B;  3JSL A;  2MW2 B;  4N23 A;  4LF7 O;  5KA6 A;  3ZX6 A;  3ZBH A;  1OCR C;  2ILM A;  4MVS A;  1DF4 A;  2PYL A;  3I55 V;  4JTA B;  1QR9 A;  4O4I B;  2CAZ C;  4GYC B;  4IYI A;  1NH2 D;  4J41 A;  1NR1 A;  1GAX A;  3WB2 A;  5LMU O;  4TV9 B;  3A8T A;  1S3J A;  1AIL A;  4IL6 Z;  2L35 A;  1Y76 A;  1K33 A;  2AGA A;  4B3M B;  2PY5 A;  2WLI A;  3JYC A;  4JI1 O;  4B3S O;  1EN6 A;  2BOC C;  4X1K A;  3N2G A;  4JI6 O;  3CXH F;  5CB4 A;  2DE0 X;  3SR2 C;  1S76 D;  2QE7 G;  1UPG A;  4JI8 B;  1SF9 A;  5E1A C;  3T4Z A;  3L74 H;  3HKB B;  1XNQ O;  3Q4H A;  2XUM A;  3ETD A;  4X89 A;  3LDC A;  3ZHT A;  1X4T A;  3LUT B;  1YTF B;  3BFR A;  1VQ9 V;  2BSK A;  1COW G;  4CH3 A;  5L3G A;  4UVA A;  3D3I A;  3CJH A;  4DO2 A;  3DGE A;  5CA0 A;  1SZT A;  5LBQ A;  1Q81 W;  5H6R A;  5LP6 A;  3J80 N;  2ZDI C;  4NXM O;  4MT8 A;  2XAH A;  3VBB A;  4B3T B;  3MHH C;  4KHP O;  2K9P A;  3HKE B;  2JGD B;  1WA8 A;  3I5D A;  2VQF O;  1EM1 A;  1WPB A;  5LA6 A;  1PM9 A;  5J9P C;  3DC6 A;  4K35 A;  4CS2 A;  2X7R B;  3T1C A;  1XQ8 A;  2YI9 A;  5DN6 G;  3SPG A;  1SZX A;  3H1K H;  1NTK H;  1JPX A;  3KCX A;  1YIJ V;  2FKX A;  4LWS B;  3RBZ A;  5LGU A;  2DQ0 A;  4XDJ A;  2Q68 A;  3BRC A;  5FL7 G;  1WP8 A;  1Z5W A;  2UXD O;  2UXC B;  5JJE B;  3JAW B;  4O4H B;  3APO A;  4NB5 A;  4QE7 A;  1VQM V;  1ZL8 A;  4JI2 O;  5L3E A;  1XDC A;  3ASO B;  4I55 B;  1GMG A;  2Y0P A;  3ZJZ A;  5ITZ A;  4IHJ A;  3ZN1 A;  4CZZ A;  1HNW B;  2PZS A;  2UUA B;  1XL4 A;  2EJR A;  1Q6U A;  2YEV B;  4J10 A;  4TQF A;  4X1I B;  1HWY A;  1BQZ A;  1JFF A;  3FYI B;  4I50 A;  1QCE A;  4ZOL B;  1PKX A;  4X66 O;  4UVB A;  2JEX A;  3CEI A;  1RPO A;  3SPJ A;  3P3P A;  1Y74 A;  1HNW O;  1PNM A;  5CBG A;  1FD9 A;  1BT8 A;  2EBO A;  3UCS C;  1XNR O;  3FKS G;  1Q6I A;  3VQW A;  3OTF A;  3MHS C;  3OR7 C;  3CRM A;  1MSD A;  3CB2 A;  1GM9 A;  1NVP B;  2N74 A;  4JI2 B;  2L6L A;  2XT9 A;  1S5H C;  4PI2 A;  3G80 A;  3U11 A;  3JCU Z;  3M99 B;  3B8M A;  3EHB B;  2YIA A;  3SJA C;  2EIN B;  2DWE C;  4AQY O;  1X59 A;  2GTA A;  2XAF A;  4HNA A;  3SGI A;  2JEU A;  2XOK G;  3K5M A;  2Q7G A;  5IJ0 B;  1MNG A;  2GUZ A;  3FAV B;  1SS3 A;  1AI6 A;  5A9G A;  1MAB G;  3N2K A;  1I5X A;  3UKM A;  3VOU A;  2QWP B;  2QR4 A;  1YJN V;  1QHT A;  1QNM A;  2E75 B;  1TUB A;  2QKS A;  3JAR B;  3X2Q B;  4X1Y A;  4DR7 O;  4Q20 A;  1ZLZ A;  4ICG A;  2HG5 C;  3G6E V;  4DXW A;  2O57 A;  1OCR B;  4DW1 A;  2DOS A;  5EBL C;  1Q8I A;  1JJ2 U;  1H2S B;  1PL0 A;  3BEH A;  5JQG B;  3ZMU A;  3OMN B;  2WLN A;  3ZRW B;  1AJN A;  4LF9 O;  3ZHU A;  5BMV B;  2QWO B;  1IX9 A;  1Q6H A;  2HJF C;  2W6I G;  3Q4H B;  3CPW U;  2YS8 A;  4JZG A;  3CD6 V;  4K8Z A;  1PPJ H;  3JAT B;  4MVU A;  4MTF A;  4GX5 A;  1BE3 H;  5CBH A;  1MA1 A;  1K3E A;  1N0N A;  2EZO A;  3DXR A;  5JCO C;  2WLL A;  2HFE C;  1GM8 A;  2AZ0 A;  3JAL B;  3CMA V;  4JYB A;  5GW7 A;  1T5E A;  1XRE A;  4NTY A;  3A2F A;  2GTS A;  4JI7 O;  5C93 A;  2JS3 A;  3ABT A;  3O9O A;  1NQT A;  5EZY A;  5B3S C;  1L8D A;  4GKK O;  1NT2 B;  3ABK C;  1WA8 B;  3ABU A;  3IC7 A;  5EYP B;  2F93 B;  4DR5 O;  1SA0 B;  1Q3E A;  1IBL B;  2VWJ A;  2IJK A;  2QEX V;  4JI7 B;  4ZIB A;  3CX5 F;  3ZHS A;  2ZD9 A;  3S3X A;  4RWU A;  5C8Y A;  1BGY H;  4LF6 O;  2DJV A;  2OTL V;  3GVM A;  5LYJ A;  4O2B A;  4BIZ A;  5EC1 C;  2EIL B;  2EIM B;  4AHC A;  1K5Q A;  2F43 G;  1XBL A;  3E89 A;  2A79 B;  1H38 A;  2D2C B;  3RGB A;  3JAW A;  3H1H H;  1WNS A;  3D36 A;  4F6R A;  1N36 O;  2IU0 A;  3ETG A;  5KX5 A;  3JAS B;  4FLT A;  2ZNJ A;  4LFC O;  4UCT A;  1ARO P;  2XTA A;  1YTF D;  1VF6 A;  4F6E A;  3H1I H;  4I9W A;  1XUQ A;  2ZE5 A;  3AG3 B;  1IUR A;  2VQF B;  1I08 A;  4J11 A;  3CRR A;  1GN4 A;  1GH6 A;  4X1I A;  3OMI B;  3CRC A;  1S5J A;  4DV3 B;  4X8A A;  2BTQ B;  2CH7 A;  5H5N A;  2OTJ V;  2OYQ A;  5FPR A;  4I4T B;  5KA5 A;  3TXS A;  5IYC O;  1U97 A;  1WN7 A;  3AG2 B;  1EBO A;  3ETE A;  4WFB V;  1H2M A;  4MS2 A;  1ENV A;  4FFB A;  5LMN B;  4PEL A;  5IDJ A;  4PA4 A;  4PA9 A;  1TGO A;  4UCS A;  2IJJ A;  2ZT9 B;  3HKC A;  3ML0 A;  4K3A A;  2X6C A;  2DYS B;  4LF6 B;  4YY3 O;  2ZR2 A;  3G6B A;  2F23 A; 
#chains in the Genus database with same CATH homology
 2ATK C;  5EC2 C;  3OUS A;  5B1B C;  3SPI A;  3JD0 A;  4YXW G;  2CK3 G;  3FB8 C;  3QO5 A;  4FIP C;  3ZN0 A;  2ZXW C;  4QPJ A;  3ZCC A;  1N8R W;  2P67 A;  1E1R G;  3W7X A;  1M57 B;  4XDL A;  2JIZ G;  4HAM A;  3CCJ V;  3CCV V;  2X6A A;  2B1I A;  3ZMS A;  4EKW A;  3AG2 C;  2DW4 A;  4GX2 A;  1RM1 B;  4HYO A;  3G4S V;  4MVR A;  1FS0 G;  2BOB C;  4N23 A;  4JTC B;  1VQ5 V;  5KA6 A;  1R3J C;  1OCR C;  3FB6 C;  2D3O W;  1K4D C;  4MVS A;  1DF4 A;  3I55 V;  5BZB A;  5LHG A;  1VQN V;  4JTA B;  1QR9 A;  1QLE C;  2DQ3 A;  2HKO A;  3I56 V;  2QM8 A;  2UXN A;  1OZ0 A;  3AG3 C;  1GTO A;  1OCO B;  1RM1 C;  1NH2 D;  5DM6 V;  2M7W A;  1NR1 A;  4GT1 A;  3T4D A;  2EIK C;  4BIU A;  1S3J A;  1YSC A;  2IJH A;  4JF3 A;  3RVZ A;  2LFR A;  3ZMV A;  1K33 A;  3DTU B;  1VQ4 V;  3E86 A;  1MOF A;  2ZXW B;  4PDR A;  2XAJ A;  1OCO C;  2WLI A;  3JYC A;  1V54 C;  2P90 A;  4PA7 A;  3ABL B;  1ZWI C;  2WLM A;  2B1G A;  2BOC C;  4J9Y B;  2QA4 V;  1QLE B;  1R73 A;  1BHB A;  3K06 A;  5CMU A;  5HFL A;  1M56 C;  2WLJ A;  1THZ A;  1S76 D;  3AG1 B;  1NKD A;  1AJP A;  2QE7 G;  2K1E A;  4MW8 A;  4P9P A;  3MD0 A;  5E1A C;  3T4Z A;  3ZMZ A;  3SPC A;  3OFN G;  5CBF A;  3ETD A;  1BL8 A;  4X89 A;  1AJQ A;  3LDC A;  3CME V;  1Y4M A;  1F23 A;  4WFG A;  3LNM B;  3QO7 A;  1K34 A;  1M9N A;  3LUT B;  1YTF B;  1NBM G;  3G71 V;  1VQ9 V;  3B77 A;  1H8E G;  1M57 C;  4WFE A;  2EIM C;  2JDI G;  3WG7 C;  1KKD A;  1COW G;  1XL6 A;  4I5S A;  5L3G A;  4UVA A;  2XAQ A;  3D3I A;  3LSQ A;  3JD1 A;  4DO2 A;  1M1K W;  2HVJ C;  3JCZ A;  4JAV A;  3DGE A;  1G8M A;  4P2Z A;  1SZT A;  3CC4 V;  3E2E A;  5LBQ A;  1Q81 W;  4R6Z A;  3ZRS A;  3FB7 C;  4R7C A;  5H6R A;  1JOY A;  1GKF A;  2ZDI C;  3BY6 A;  4MT8 A;  2XAH A;  3VBB A;  1K97 A;  2Y69 C;  4LCU C;  3MHH C;  1BMF G;  4JAS A;  1Q7Y W;  2Z3Y A;  1R6K A;  4RQF A;  1QVG U;  2Q69 A;  3CC2 V;  3K0G A;  2EIJ C;  1DF5 A;  1JQ0 A;  3CYO A;  1Q86 W;  4MTO A;  3E83 A;  5J9P C;  1QVF U;  1KEC A;  1PD3 A;  3KG2 A;  5LHI A;  2X7R B;  2P6J A;  3SPH A;  3T1C A;  5DN6 G;  1Q82 W;  5B1O A;  3OGC C;  2YEV A;  3SPG A;  5L3F A;  2Z5U A;  1R3I C;  3LDE A;  1JPX A;  2R9R B;  4KFM A;  2IH1 C;  3SYO A;  1YIJ V;  3QNE A;  1UJW B;  1WLE A;  3RBZ A;  2XAS A;  5LGU A;  2IU3 A;  2DQ0 A;  2MK3 A;  2X6B A;  3H01 A;  5IYB O;  4KP4 A;  4XDJ A;  4U7O A;  2Q68 A;  4UV8 A;  5FL7 G;  2FTK A;  1V55 C;  2UXX A;  4ASU G;  1R3K C;  1V54 B;  5L3B A;  4LC1 A;  1NJI W;  1NR7 A;  4JGS A;  3K0D A;  4GX0 A;  4XBF A;  2DWD C;  4QE7 A;  5B1A B;  1FXH A;  2JJ1 G;  3B8N A;  1VQM V;  3K3W A;  1J95 A;  5L3E A;  3CCU V;  4WFA V;  1K73 W;  3E35 A;  3ASO B;  4PA3 A;  1GMG A;  2OT5 A;  1SER A;  1AI5 A;  5B1B B;  2GHY A;  1KC8 W;  2NNU A;  3NXS A;  3AG4 C;  3K9A A;  1V55 B;  3ZJZ A;  4JAU A;  2H94 A;  4LP8 A;  4TWK A;  3ZN1 A;  1K4C C;  1Y66 A;  3OE7 G;  4CZZ A;  3SJQ C;  1XL4 A;  4WF9 V;  2EJR A;  4H37 A;  3E8H A;  2YEV B;  1SET A;  2DYR C;  3JD3 A;  3LSS A;  1MSW D;  2JK5 C;  2ZQM A;  1HWY A;  1YHQ V;  3FYI B;  2WPD G;  1QCE A;  1PKX A;  3ZRX A;  4FPP A;  4UVB A;  4F4L A;  2JEX A;  1G4Y B;  2EZP A;  2PI4 A;  1H8H G;  1F4M A;  1RPO A;  4RUF A;  3SPJ A;  3GWO A;  2XND G;  1F51 A;  2DYR B;  4QIW F;  1LNQ A;  2Q67 A;  1PNM A;  3W7U A;  2EIJ B;  5CBG A;  1K9M W;  4TSF G;  1JX9 A;  2EBO A;  3CCL V;  4FJC C;  1GK9 A;  1M90 W;  1AI7 A;  1E79 G;  3FKS G;  3W7S A;  4PA6 A;  4ZBM A;  1NH2 B;  3MHS C;  3OR7 C;  4OXS A;  3SYA A;  1ORQ C;  1SES A;  4RUE A;  1OCC C;  3CXC U;  2V7Q G;  1GM7 A;  1GM9 A;  1JVM A;  1TUE B;  4PDV A;  1NVP D;  1NVP B;  1FXK A;  2AHY A;  1CEZ A;  1K7D A;  1S5H C;  4RO2 A;  2HLD G;  3E8F A;  1IXM A;  2JJ2 G;  5EBW C;  3M99 B;  3B8M A;  3ZRV A;  3EHB B;  4MW3 A;  2EIN B;  2YSU B;  2DWE C;  2LP7 A;  2DYS C;  2XAF A;  2XAG A;  2JEU A;  2XOK G;  1KP3 A;  1K92 A;  2WLH A;  3P30 A;  1S72 V;  3RW0 A;  4MVQ A;  1L1F A;  1YI2 V;  1AI6 A;  3X2Q C;  1MAB G;  3OEH G;  2Q6A A;  5IYD O;  4WFF A;  4G28 B;  3OEE G;  1I5X A;  3SYC A;  3UKM A;  3WG7 B;  2EIK B;  3VOU A;  1PNL A;  1VQ8 V;  1YJW V;  1YJN V;  3FB5 C;  3CCM V;  2Y48 A;  1OCZ B;  2B5U A;  1P4R A;  2QKS A;  3STZ C;  3X2Q B;  1OCC B;  2WLL B;  4Q20 A;  3F7Y C;  4PDM A;  2HG5 C;  3E8G A;  3ASN B;  3E8B A;  3G6E V;  4DXW A;  2KB1 A;  1OCR B;  3SYP A;  5HFM A;  3K08 A;  5EBL C;  2QM7 A;  1JJ2 U;  2C2A A;  5H6Q A;  5KUK A;  3IFX A;  3CCE V;  1PL0 A;  3BEH A;  4KUM A;  2WLI B;  3ZIA G;  1CPY A;  1WPX A;  5CN0 A;  3ABK B;  1DLB A;  1YJ9 V;  1S77 D;  3ABM C;  2GSM B;  2EIN C;  2ITC C;  5B3S B;  4G27 B;  3ZMU A;  3OMN B;  5EK0 A;  4BW5 A;  2WLN A;  1FFT B;  4MSW C;  3RVY A;  3ZRW B;  2PI5 A;  1K5S A;  1AJN A;  2IJI A;  4GX1 A;  4CBC A;  4ZKI A;  1EZJ A;  3CPW U;  2HJF C;  2W6I G;  1E1Q G;  3ABM B;  1GO3 F;  1MG1 A;  3TET A;  2Y69 B;  2HVK C;  2P7T C;  4MVZ A;  2WWW A;  3CD6 V;  2QTO A;  3LDD A;  3T2M A;  1AI4 A;  1YIT V;  4MVU A;  4MTF A;  4HZ3 A;  1VQ6 V;  2ITD C;  4GX5 A;  5CBH A;  3K04 A;  1M56 B;  1K3E A;  3F7V C;  3OR6 C;  2LFS A;  2EZO A;  3STL C;  4J9Z B;  2IW5 A;  2HFE C;  1GM8 A;  2WLL A;  4MTX A;  4P9O A;  1R6N A;  5KUM A;  1AR1 B;  4JYB A;  4MTG A;  5GW7 A;  3W7W A;  4UUJ C;  3CMA V;  4WFH A;  3AEI A;  1VQP V;  2WLK A;  4UV9 A;  5C93 A;  3ABT A;  1BHA A;  1NQT A;  3FYE B;  5B3S C;  2ZR3 A;  3OMA B;  4MVM A;  2H8P C;  3ABK C;  3K79 A;  4R50 A;  2HR3 A;  4E2L A;  4JTD B;  4BAY A;  3ABU A;  1I5Y A;  3IC7 A;  1B6Q A;  1QBZ A;  3CCQ V;  4FMT A;  2IJK A;  1DTO A;  3TK1 A;  3JD2 A;  3OW2 U;  2QEX V;  2A0L A;  3OUF A;  3OM3 B;  3ZRW A;  3IGA C;  5B1N A;  3A0R A;  2OCC C;  3W7T A;  3K03 A;  3GB7 C;  2ZD9 A;  4N21 A;  1H2G A;  3UM7 A;  3ASO C;  3CCR V;  1FXV A;  4H33 A;  2X0L A;  3TCU A;  1OCZ C;  2OTL V;  1VQK V;  4BIZ A;  2AHZ A;  5EC1 C;  2ZDI A;  4RAI A;  2A9H A;  2EIL B;  2EIM B;  4PDL A;  1KQS U;  1K5Q A;  4U7N A;  2W6J G;  4X88 A;  2F43 G;  3E89 A;  2A79 B;  1H38 A;  4TT3 G;  4P30 A;  5LHH A;  5LGN A;  3AG4 B;  4RQE A;  4JPR A;  5L3D A;  1FXK C;  1F4N A;  3ABL C;  3D36 A;  2IU0 A;  3ETG A;  1EFR G;  5H9C A;  4XDK A;  1SRY A;  3EFF K;  1ARO P;  1P7B A;  3ZMT A;  1YTF D;  3HB3 B;  2WAM A;  2WSS G;  5IY5 B;  2EIL C;  5CA3 A;  4QE9 A;  1W0J G;  2R9I A;  4QJF B;  2V1D A;  5L3C A;  3CCS V;  4I9W A;  5LGT A;  4R8C A;  4MVO A;  1W0K G;  3AG3 B;  1VQO V;  3HPL C;  4Z1M G;  2OCC B;  3OAA G;  4FK5 C;  3CC7 V;  2NLJ C;  1S0V A;  3PJS K;  3OMI B;  3WFV A;  1QR8 A;  1KP2 A;  4UXN A;  4X8A A;  1ROP A;  3QO8 A;  1RPR A;  1W2B U;  1R3L C;  4L87 A;  2OTJ V;  1OHH G;  4WCE V;  4GCZ A;  4JYC A;  3P32 A;  3CP1 A;  5KA5 A;  5IYC O;  4QPK A;  3AG2 B;  1EBO A;  3ETE A;  1K8A W;  4WFB V;  5EBM C;  2IH3 C;  4MS2 A;  5B1A C;  1JCH A;  1ENV A;  1KD1 W;  4G2K A;  1VQL V;  5IY5 C;  4UVC A;  4PEL A;  5IDJ A;  4PA4 A;  4PA9 A;  2IJJ A;  3JD4 A;  3R65 A;  3ML0 A;  1PNK A;  1VQ7 V;  2X6C A;  4QNH B;  2DYS B;  2W0F C;  1FXK B;  3SYQ A;  3AG1 C;  1QLN A;  1CP9 A;  2ZR2 A;  3ASN C;  4LBE C;  3F5W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...