3FB5C

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb5C00
4HYOA 2WLHA 3RBZA 4LP8A 3SPIA 2WLNA 1BL8A 3SPHA 2DYRC 3ASOC 4MTOA 4DXWA 3SPJA 1K4DC 1M57C 1J95A 1OCCC 2ZD9A 2WLKA 2EINC 3KG2A 2IH1C 4JTDB 3SYOA 2HJFC 4HZ3A 2BOCC 4OXSA 2NLJC 1M56C 4H33A 3SJQC 2IH3C 2W0FC 3LDEA 3R65A 3T2MA 3T4ZA 5BZBA 2KB1A 4P30A 2JK5C 4PDMA 4QE7A 4P9PA 1LNQA 3FB7C 4R8CA 3T1CA 3RVZA 3K04A 5B1AC 1R3KC 3E83A 3OGCC 3PJSK 4JTCB 3AG1C 4PA6A 3E8GA 4WFGA 3UKMA 2K1EA 3AG4C 4R6ZA 4XDJA 3ZJZA 2WLLA 2Q68A 3ABMC 4TWKA 2BOBC 1ORQC 1XL4A 5EBLC 2Q6AA 2HFEC 4MSWC 5CBGA 2Q69A 4GX0A 1R3LC 4RO2A 4CBCA 5CBFA 2AHYA 4R7CA 2X6AA 3E8HA 3GB7C 4I9WA 4P9OA 1G4YB 2QKSA 3AG2C 4KFMA 3X2QC 5EC2C 3LDCA 4MS2A 4WFEA 1OCRC 2ZXWC 3OUFA 4H37A 4MW3A 3ZRSA 3STLC 3STZC 3K0GA 2EIKC 5EBWC 4F4LA 4GX2A 4PA9A 2R9RB 2HG5C 1K4CC 3LDDA 5B3SC 2DYSC 1R3IC 3FB5C 4MVZA 3EFFK 2X6CA 4PA4A 5KUKA 3LUTB 3K03A 2Q67A 3ASNC 4MVMA 4WFFA 2WLIA 4R50A 4LBEC 4RAIA 1OCZC 2ITCC 4MVSA 4MW8A 4JTAB 3TCUA 3T4DA 2A9HA 4XDKA 4X88A 4QNHB 5EBMC 1QLEC 4LCUC 3IGAC 4GX1A 4X89A 2WLJA 2YEVA 2P7TC 3OUSA 3F7VC 3K0DA 2A0LA 3ABKC 2HVJC 4G27B 3SYAA 1P7BA 5EC1C 4RUEA 4EKWA 5E1AC 3RVYA 5IY5C 4G28B 2X6BA 3SYQA 3OR7C 2EIJC 4WFHA 3SPCA 5EK0A 4MTGA 3FB8C 3E8BA 4MVQA 3RW0A 2ATKC 3E89A 1R3JC 3IFXA 3VOUA 5J9PC 4J9YB 3SPGA 4ZBMA 4MTFA 4UUJC 3UM7A 2WLLB 4J9ZB 3SYPA 3BEHA 4RUFA 2HVKC 3TETA 1V55C 4XDLA 2DWEC 3E86A 3F5WC 2ITDC 1OCOC 4MVUA 4MVRA 3ABLC 4PDLA 4BW5A 2DWDC 2EIMC 1V54C 2A79B 3F7YC 4PA7A 4PDVA 4X8AA 3WG7C 3HPLC 1JVMA 3E8FA 3AG3C 4GX5A 4MVOA 2QTOA 1KKDA 4P2ZA 4PA3A 2OCCC 2H8PC 5KUMA 2EILC 4PDRA 1S5HC 2Y69C 3K08A 5B1BC 1XL6A 3SYCA 2AHZA 2WLMA 5CBHA 3OR6C 3K06A 3LNMB 2WLIB 3JYCA 1ZWIC 4QE9A 3FB6C
chains in the Genus database with same CATH superfamily
4LF5O 1CP9A 5LL6Y 4GYCB 4DXWA 5JVDA 2UXBB 1PNLA 1WP8A 1MZFA 1GTOA 3BRCA 1Q6IA 5LHGA 4LF7B 2H3OA 4O2BA 3T1CA 3JAWA 4AQYO 2AZ0A 3I56V 1VF7A 4JV5B 4N21A 1Q3EA 2D2CB 3MHHC 3S3WA 3BAAA 2Y4TA 3TXSA 1Q43A 2RN9A 5JH7B 4DUYO 3ZHVA 4PJ0Z 4QPJA 4X64O 4O2AB 3CCLV 3H1JH 3STLC 2DW4A 4LF8B 1ZL8B 3TJTA 3CCVV 1EFRG 2QEXV 2E76B 4KHPB 4FFKA 4MVZA 1B04A 2UUBB 1VP7A 1YEWA 2WLIA 4D6TH 1N8RW 3T4DA 2E74B 2A9HA 4LF9B 1SQGA 4X88A 1SETA 2UXNA 5EZYB 5TISZ 2F95B 4CC5A 3EXAA 1NTMH 2B1GA 3T1YB 5E1AC 1I5XA 1XOUA 1S3JA 2EIJC 3UO2A 3JD2A 4TV9B 2F4VO 3HKBA 3AG4B 2HKOA 3BEHA 4RUFA 1S77D 4PDLA 1VQNV 3A0BZ 4XBFA 1TVKA 4TT3G 2B5UA 4GKJO 1AP6A 1Q5OA 1FJGO 1Q6UA 4FJCC 5KUMA 2WAMA 4GT1A 1SQPH 1XEQA 2Q9LA 1IURA 5JJNB 1M57C 2PI4A 3SYOA 3ZMSA 1UJWB 4JI5B 3T2MA 4K0KB 5F2VO 2E5LB 4DR4B 2HJDA 4PELA 2QM7A 3ZRXA 3HKEA 1GM7A 3VQVA 3KKYA 4XDJA 5FPOA 2ODMA 3WB1A 2ZE7A 5EYPB 1RM1B 2XT9A 1D5AA 4J10A 1MA1A 4DV6B 3ETQA 1WJZA 3MDSA 4DV1O 2PYJA 4DRXA 3OEEG 4DYLA 2NN4A 1QLNA 2ZINA 1DF4A 4NXMO 5DN6G 1R3IC 4PA4A 4X65B 1COWG 1L1FA 2GTAA 1XMOB 4O4LB 3B77A 2ZT9B 3LSSA 1NVPD 2GTSA 1NVPB 3PN1A 1FD9A 1GMGA 4FIPC 3FYIB 4K8XA 1H8HG 1SA0A 5H5NA 1SZXA 5CA1A 3GWOA 3TETA 2Y0IA 2JRIA 1U96A 3HKCA 3JD1A 3CCMV 4UCOA 2ZNIA 2HHHO 3U0ZA 4DR2B 4JI1O 1XBLA 3MHSC 4X20A 3JSNA 4O4JA 3UT5B 4FMTA 2Q7HA 1NTZH 3K3WA 2AGAA 1XHXA 2EIKB 1Y67A 3SYCA 2LO1A 1FFXB 2DMXA 1TUBB 3A2FA 4QE9A 2Q4PA 3RBZA 3OMNB 2YEVB 5B1OA 4WFAV 1XNRB 1Q90D 2CH7A 2EBOA 3ZS8C 3HB3B 1JFFA 1JA8A 4P30A 1VQKV 4P9PA 1ROPA 1R3KC 4PA6A 3VQXA 1H2SB 3QO8A 3K79A 1YTFD 2WSSG 4JF3A 1YTFB 1R3LC 1SC5B 4FLWA 3JD3A 4P9OA 1G4YB 2LQTA 2P06A 1W2BU 5LA6B 1OCRC 4JPRA 4H37A 2ZCEA 3ZRSA 1Y66A 4HNAA 4WFBV 3O65A 2ADQB 3D3QA 1FYJA 5CA0B 5KUKA 3ZX6A 4RAIA 2UXDO 1NT2B 1WA8A 2Y69B 3DC6A 1OJHA 2DJVA 3RYHA 4XDKA 2GV9A 2IBZH 3G80A 3OUSA 3MD0A 2A0LA 3ZMTA 3RYFB 2L6LA 4RUEA 3RVYA 1JQ0A 2LP7A 4O4HA 1J5EO 3ETDA 2N04A 1BCCH 3SJBC 3CS5A 2E3CA 1M9NA 1WLEA 4LWSA 4F6RA 5LYJB 4DR7O 2R72A 3LSUA 5B1NA 3ZHRA 1Y76A 1XILA 2QJ1A 4NB5A 5IJ9B 1AROP 2EINB 4JYAO 5GONA 4GX5A 1HW7A 5LBQA 3NXSA 4DV3B 3G67A 1VQMV 1XMQO 3H1KH 2HEPA 3KZIZ 2WLHA 3K5OA 3CMAV 1OCZB 1BL8A 2WLNA 4MTOA 4F4LA 4IHJA 3CRCA 1M56C 1IXMA 4WF9V 2GBOA 4EB6B 1HR0O 2XUMA 1LNQA 3JD4A 5J2UB 2DOSA 2JVDA 3K04A 5JCOC 3TK1A 2XAJA 2BOBC 1D2DA 3JASB 1KC8W 1H8EG 3OTOO 4LF6B 4DR6O 3AK3A 5L3EA 3ABLB 4MS2A 5KHJA 4B3TB 5K1PA 5IWAB 5LXTA 4CS3A 4B3MB 1JMKC 2R9RB 5B3SC 1VARA 5HFMA 4EFEA 4OGQB 4BR6A 2JGDA 2DQ3A 4X89A 2BTQA 4IIJA 3FAVA 3F7VC 1NKDA 2D3OW 1H2LA 3JD0A 4X62O 3CJHA 3CMEV 4DW1A 3OR7C 3SPCA 4B3RO 4YXWG 3RYIB 1R3JC 3JATA 4X66O 4L8JA 2ZIOA 4J9ZB 1Q86W 3JCZA 1EZJA 4X1IB 1K5QA 5KHIA 3E2EA 2Y0PA 5BR8O 1V54C 3DTUB 3AG3C 1MG1A 3H1HH 2L35A 5ITZA 2VQEO 3M7MX 2Z3YA 1HDJA 1XL6A 3CE2A 4DV4B 1AVMA 3E35A 2CTWA 3O9OA 1MSDA 3FB6C 1YVWA 1N34O 1IX9A 1AJPA 4BIOA 4DV5B 2NLJC 4OX9O 5KAFZ 1IBMB 5KMGA 4R8CA 2RNBA 3Q4HB 3CCQV 2KG7B 2ILMA 3OGCC 4UXNA 3FX7A 5JCOA 2CGNA 3QO7A 1AI4A 5J2TB 2EJ7A 5LP6B 5C93A 2ZM6O 2AHYA 4LH7A 3MAQA 2ARHA 4Q6GA 4DV7O 2RQ6A 1Z5WA 1BMFG 1RSOB 1Y4MA 4ZOLB 3UQ8A 4FLTA 4LF4O 2GUZA 3STZC 4LNUA 1VQPV 3DGEA 3L9DA 4UV9A 1BSMA 2OIGA 3ABTA 1H2MA 2EILB 3CXHF 1FXKC 2A7WA 4WFFA 4IYIA 5B1BB 3ZHQA 2UU9O 4JTAB 1VMGA 2MW2B 5EBMC 1QLEC 2P4VA 3IGAC 5JJJB 4DR1O 2BSKA 2WLJA 3D8CA 1NR7A 4G27B 4EKWA 2OCHA 4KL1A 4G28B 4JYYA 3ETEA 5FNVA 4JI2B 4I0XB 1MABG 5IE9A 2UXXA 4E4EA 4ZBMA 1W59A 2HP8A 4X1YA 2QWOB 2WLLB 1N33B 1HNZO 2DWEC 3E86A 1I08A 3FKSG 1K33A 2UUCB 3WG7C 4X8AA 1XNQB 4U7OA 1KUQA 4ABMA 5AG2A 4YIPA 5LOVB 4ZI7B 4PI2A 1RFYA 2R9AA 3K08A 3B8NA 1JR9A 1N36O 1K97A 2XOKG 1SKVA 4N23A 2DYRC 4CZZA 2IJJA 3SPJA 1KQSU 1OCCC 4FZ0A 3HKDB 2ADPA 1FPOA 3R65A 3T4ZA 4FM0A 5JWPA 5BMVA 2WA3A 3RVZA 2Y4UA 3JARA 4I55B 1QU7A 3OW2U 1MZEA 3SGIA 5LMNO 3DC5A 4L87A 2Q69A 1VF5B 3K9SA 4DV0B 2P90A 5EC2C 3SJAC 5CB4B 2YXLA 2EJRA 3OD4A 4FM2A 4WBNB 3QVNA 4ZHQA 3N2KA 1GM9A 1SERA 1Q8IA 2DYSC 3W7UA 1NBMG 2R9IA 4LBEC 1H2NA 4MVSA 4WCEV 1FXKA 3JAKB 1H38A 1OHHG 2CE4A 1QQCA 4LF5B 2IJKA 3APOA 3NR7A 4NTXA 5JVDB 4UVBA 1XREA 3ZRWA 3K5LA 4O2BB 2EX3A 1SQVH 2A3QA 4WFHA 3CCJV 4AQYB 3GWKC 4MVQA 1QVGU 3CCEV 2QE7G 1KP3A 4MTFA 4LFBO 2BE3A 5LGNA 4XDLA 3ABMB 2ZR3A 1N4CA 3S3XA 1EBOA 4DUYB 3ZMZA 1CEZA 4MVOA 2YDEA 4P2ZA 4X64B 2PZSA 2PF4E 4I5SA 3OM3B 2RCVA 4TV9A 2RDCA 2ZR2A 1IBKO 1TAEA 2NR5A 1S0VA 1B06A 2WLIB 5B66Z 3FFQA 1YITV 2DQ0A 4ASUG 3ASNB 4W4LA 3SPHA 4B7EA 1M93A 4LFAO 3P3NA 2F93B 5C8YB 3N2GA 1YJNV 4HZ3A 4OXSA 4B08A 2P67A 3IC7A 2IH3C 3DXRB 1ZX3A 3JAMN 2Z0AA 5IY5B 2ETNA 3BABA 3PJSK 2QWNB 1N32O 3UO3A 2OIEA 2CTPA 1PL4A 3OE7G 1F4MA 1G1XB 3VQYA 2IJIA 2F4VB 3HKBB 4D7SA 1V55B 2IW5A 1OCOB 3X2QC 2PTMA 2QSAA 3DSQA 3J80N 4WFEA 4DUZO 4NXNO 2N74A 3EHBB 2HG5C 4GKJB 3LDDA 3WB0A 1FJGB 3FB5C 2PI5A 3LUTB 1P4RA 5L3BA 2IM9A 2JIZG 3CWBH 1EN5A 4E2LA 1Z5VA 5CMUA 1GN6A 4LCUC 2NNUA 2Q8VA 1Q82W 1ZTEA 5IJ0A 3ML0A 2YXHA 2LFSA 1VQOV 3OGIB 1NH2D 1G8MA 5EK0A 1KYOF 3HKEB 1XDCA 2DE0X 5J9PC 3SPGA 4JASA 3SYPA 4H0LB 2WPDG 3CRQA 3F5WC 2ITDC 4YHHO 2ZE5A 1WB7A 2A79B 4PA7A 4DRXB 4K8ZA 4DV1B 2YS8A 3T1HO 2OCCC 1PNKA 3LSQA 4HBNA 2AW9A 2YIDA 4NXMB 1Q81W 1BE3H 1KD1W 3LNMB 1B6QA 4TQDA 3E22A 3D3IA 1U97A 2VWKA 1M4UA 3ASOC 2XNDG 2VQFO 2EINC 4BWAA 2Q7EA 3I55V 2W0FC 5JJEB 4AI8A 1RPRA 4LH6A 2UXCO 3IC9A 3E83A 1CXZB 4WFGA 4X1KA 1Q7YW 2EIJB 3ZJZA 1DTOA 2H94A 2YI9A 2HR3A 1SA0B 4JI3O 5CA1B 2KKWA 3HKCB 4Z1VA 4H13B 2X6AA 1AI6A 4JYBA 2HHHB 2ZXWC 4JI1B 4O4JB 3A0RA 2VRZA 2Q67A 4CH3A 2EULA 1CPYA 3TCUA 4YJ2A 3C3TA 1SF9A 1YIJV 5KA6A 1H2GA 3RFRA 3K0DA 1M57B 4CH6A 1K8AW 4FPPA 5EC1C 1H2KA 2XAQA 2CH7B 2CUGA 1JFFB 2E75B 4GZRB 5EIBC 3BCCH 5L3CA 1Y74A 1E79G 2F43G 2EIMC 2LGWA 4PDVA 1QVFU 1JVMA 4JI7O 1SQQH 5IYZA 4HNAB 4QJFB 2UUAB 5LYJA 1XI1A 4FLYA 1WA8B 4J7ZA 5LGTA 1I5YA 2UXDB 3RYHB 1K7DA 2XAGA 1VQ4V 2JJ2G 2WLKA 1SQFA 3A0HZ 4JI4O 4JI8O 3L70H 4H33A 4DV3O 3LDEA 1GAXA 4O4HB 5B1AC 1J5EB 3AG1C 3JALA 2XAFA 4DR3O 2PYLA 1WNSA 3FD9A 3K58A 4F6RB 4LWSB 4YY3O 1B3QA 3APQA 1ZSPA 4DR7B 3BA8A 1AJNA 4YJ3A 1Y76B 2EZOA 1KU9A 2ZDIC 2QKAA 1L0LH 5GONB 4DO2A 1P7GA 4J7JA 4JYAB 1US6A 5L3FA 1PD3A 1L8DA 3EFFK 1UPGA 3F5TA 1XMQB 4TUYA 5H6QA 4TSFG 1AILA 1NU1H 1R73A 3ABKC 4I50A 3I5DA 4IHJB 1QR9A 1P7BA 5FPRA 3CXCU 1AP5A 3G6EV 1EM1A 5LMUO 1HR0B 4DV2O 1PNMA 3BPZA 1DK1A 2O57A 2W6JG 1EN4A 2B1IA 4JGSA 3OTOB 2IU0A 4DR6B 3JSLA 3KCYA 1Y6XA 2JS3A 3LNNA 2ZQMA 1BHAA 2QKCA 1OCRB 5LXTB 1YF2A 2B9ZA 2YICA 1WB8A 4Z1MG 1M1KW 4LFCO 3OAAG 4GCZA 3CCUV 4HYOA 4J7KA 4DR5O 2JGDB 4J41A 4GKKO 3RYCA 1EN6A 2BTQB 4FVMA 3FAVB 3HR0A 3AG2B 4EEQA 3K5MA 2ZE8A 3CJHB 2FMLA 4X62B 5KX5B 3UKMA 1BS3A 4PI0A 4B3SO 3L73H 2LGQA 4B3RB 1ORQC 2FKXA 3JATB 3OT7A 2IU3A 3ZHSA 4X66B 4UVCA 5L3DA 3ZMVA 4CBCA 3CCRV 1AB3A 2ZE6A 3GB7C 1ZAUA 5BR8B 1PKXA 2HLDG 2ZDIA 1L0NH 1SQBH 4GX2A 5ITZB 4NVPA 2LFRA 2G38A 2VQEB 4I7ZB 4MW8A 1HNXO 2CDYA 1IBLO 3WU2Z 5H6RA 5E79Z 2MK3A 2YC0A 4O4IA 3BHPA 1N34B 4NTYA 5JQGA 5KLVH 4EFBA 1I94O 3ZCCA 4ZOLA 4X9QA 4U3JA 1O9GA 4JZGA 1M56B 4OX9B 4UCSA 1HNWO 5KMGB 1K73W 3SYQA 2YUAA 2X7RB 1BQ0A 4I4TB 1JCHA 5A9GA 3IFXA 4JI6O 1IVSA 2Y48A 1VQ8V 1F23A 1QCEA 2VS0A 1VQ6V 4UB8Z 2ZM6B 1D5NA 4ICGA 1WP7A 4DK0A 4DV7B 1S72V 2GUZB 4PV1B 4LF4B 1K34A 2LW7A 2M6YA 2A06H 2BCCH 4QPKA 1AR5A 1BT8A 5B3SB 2AXTZ 4LP8A 2UU9B 3OFNG 1PPJH 3CCSV 2BSKB 5IYCO 4FLZA 2OWOA 1GO3F 4DR1B 1I7FA 3CRMA 3TGUH 1F7YA 1R6TA 5D5PA 2P5OA 1VQ7V 3FB7C 3CC7V 3RN4A 4UCUA 5FNVB 4FFBA 3ZHTA 2BTOA 1YJWV 3THOA 4BW9A 3AG4C 2Q68A 4JI0O 4MTXA 5EBLC 4NKGB 4X1YB 3FYEB 3C90A 4KXRA 1HP8A 4GX0A 4RO2A 1HNZB 1F51A 4TQFA 2ZIMA 4KFMA 1P49A 2YIBA 1V54B 4TV8A 2QWQB 1QHTA 2X6CA 2WA4A 1JJOA 3K03A 2QR4A 4QIWF 3CP1A 4LC1A 1N36B 2UXBO 1E1QG 1WPXA 2RMKB 4LF7O 2OTLV 3SJCC 1BQZA 5BMVB 1ZLZA 4JV5O 2R70A 3BVOA 5K1XA 3CSXA 3JARB 1Q6HA 1O9HA 1RM1C 2N05A 1NR1A 4MVRA 1VEWA 5LMNB 5JH7A 1QNMA 1WPBA 4O2AA 1HWYA 4LF8O 4KHPO 1ZL8A 2RJZA 3BY6A 2UUBO 4ZHQB 3AK2A 1S5HC 3N2KB 3JAWB 1NI8A 1DGSA 4LF9O 3K06A 5L3GA 2V1DA 5H9CA 1ZWIC 1FXKB 5EZYA 3T1YO 1QLEB 2BOCC 1PV0A 3N27A 1SQXH 2XAHA 5BZBA 2FTKA 2JK5C 1VQLV 3U11A 4JAUA 3D36C 3ZBHA 3ZRWB 1G6UA 1XUQA 4CH4A 3QF7A 3W7SA 1S5LZ 4TWKA 2Q6AA 5C8YA 4MSWC 4G2KA 3OEHG 4JAVA 4LFBB 2QA4V 3ZEDA 3KCXA 5GTIZ 3DXRA 4MT8A 3LDCA 4D7TA 3OUFA 4MW3A 3WG7B 2QM8A 1R1BA 2EIKC 3L72H 1RPOA 1K4CC 3TXQA 4UCTA 3J81N 4FM1A 1ZUQA 4MVMA 5IDJA 4UVAA 1IBKB 1QR8A 4Z2WA 4QNHB 3IAYA 4RQEA 4JI5O 2DYRB 4C7UA 4LFAB 3N2GB 2E5LO 4DR4O 4K0KO 3QG5A 2WWWA 2HVJC 3H1IH 1OCCB 1TVKB 1TUEB 1GK9A 2GSMB 2JEUA 3FB8C 1JPXA 2Q0OC 4NYKA 3P32A 2QWPB 1N32B 1MNGA 3ZHUA 5EYPA 4DV6O 2HVKC 3M8AA 1T5EA 4RQFA 4UB6Z 3L71H 4LR3A 3HPLC 2OTJV 3GVMA 1YJ9V 1LR1A 2YSUB 3AG7A 4DUZB 4NXNB 5B5EZ 5IYBO 4X65O 2V7QG 4ZIBA 2Y69C 3CPWU 4I9QA 4NTWA 1NS1A 1XQ8A 1NH2B 5KHGA 2DYSB 4K35A 1XMOO 3JYCA 1K9MW 4O4LA 4BIZA 1J95A 4J11A 3W7WA 3SJQC 1R6KA 3CYOA 1SESA 5IJ0B 2JJ1G 5DEDA 1NJIW 3ABUA 1F4NA 2X0LA 3D36A 5LHIA 2K1EA 1DF5A 1URFA 2Z5UA 1NQTA 2QTSA 2FB5A 4DR2O 1MMMA 2QDOA 5DECA 4YHHB 3UT5A 2F66C 2PGGA 3QNEA 2KSDA 3R66A 4PA9A 1JOYA 3T1HB 4J42A 1FFXA 1TUBA 1K92A 4UFZA 1OCZC 3CD6V 4A5UB 4F6EA 3E22B 4GX1A 1PP9H 2YEVA 1XNRO 1GN3A 1X59A 3QO5A 2JEXA 2VQFB 3OMIB 4X20B 4W4KA 4JAAA 3L74H 4JYCA 4CC6A 2UXCB 4FZ1A 5GTHZ 2LJ2A 4X1KB 3H9VA 4FLXA 3UM7A 4B7KA 1IDSA 1LUVA 1YZBA 1KP2A 3ABLC 3RT3C 4FLVA 4JI3B 1X4TA 4CS4A 5LA6A 1GRJA 1FFTB 1FXVA 5DM6V 1FAFA 3X2QB 1WN7A 3ICXA 1KKDA 2ZNJA 3QTCA 5CA0A 1KMIZ 1W0JG 5HFLA 2VWJA 3OR6C 3VBBA 2DN9A 1NZ6A 2EZPA 4K3AA 1MSWD 5BY1A 4YJ2B 1OZ0A 1Z2GA 3KG2A 3U10A 3RYFA 2Q7GA 3OMAB 5KA5A 2PY5A 1NTKH 2KB1A 2UUAO 5IYDO 3RWRD 1P84F 2OYQA 3E8GA 1KECA 2W0XA 1XL4A 2LW1A 2ZKOA 4U7NA 2HFEC 4H44B 1VF6C 1Y74B 2F1MA 5CBGA 4OPAA 3VQWA 3B4SA 5CBFA 2M7WA 5IJ9A 1JJ2U 2YI8A 3AG2C 3EVKA 1ENVA 5EBWC 4JI7B 5IYZB 3W7XA 3K5NA 1W0KG 2OCCB 1GM8A 2ITCC 4IL6Z 4AHCA 4IGGA 3ZIAG 5FL7G 3ASOB 3WB2A 4EB6A 2IJHA 1XHZA 4JI4B 4JI8B 1S76D 5J2UA 1I0HA 4CH5A 2YXYA 1PL0A 2QGNA 1FKAO 3J7AU 4MTGA 3W7TA 1WAZA 3JALB 3RW0A 3E89A 3B40A 4J9YB 3JASA 5LP6C 4LF6O 4UUJC 4DR3B 5H2FZ 1IZ3A 4BW5A 1THZA 2DWDC 4YY3B 4B3TO 4YJ3B 4ZKIA 3F7YC 5IWAO 4B3MO 4BIUA 1LUWA 2ZXWB 3B8MA 1V9PA 2EILC 5B1BC 2AHZA 3G71V 1AR4A 1VIBA 3CB2A 3JCUZ 3SPIA 4J80A 2P4KA 4TUYB 5LGUA 4FK5C 2ZD9A 4JTDB 3ZN1A 2HJFC 4CS2A 2GHYA 3SR2C 4I50B 4HAMA 4UV8A 1PM9A 4QE7A 1KKCA 4YIOA 3B2EE 1YSCA 2XASA 2YIAA 4JTCB 3RYIA 5EIBD 2GDSA 3AEIA 1BHBA 4QGPA 5LMUB 3G6BA 4DV2B 1KB9F 4X1IA 5KHKA 2CTRA 2JGUA 4GLXA 1VF6A 3RGBA 1M90W 1RP3B 4I9WA 2V4DA 4IIJB 2EIMB 5GW7A 3AK1A 2QM4A 3K0GA 2Q5ZA 3BFRA 5KX5A 1SS3A 3UCSC 1SRYA 2W6IG 5KAIZ 4DV4O 1AR1B 2F23A 4R50A 3OTFA 1DLBA 2FYUH 4LFCB 2P22C 1M5IA 3C3SA 4DV5O 4DR5B 2P7TC 3RYCB 1IBMO 4GKKB 4DW0A 3ZRVA 1A32A 3SDLA 3Q4HA 2CTQA 4IYHA 4UCRA 3ZMUA 2KG7A 3P3PA 1VQ5V 3ETGA 1N0NA 1IXBA 4GUNA 5J2TA 4OPHA 2ATKC 5B1AB 3VOUA 3AG1B 1UFIA 4BAYA 1VQ9V 4JZ2A 4B3SB 5LP6A 1YXBA 1SZTA 5IT9N 1RSOA 1GH6A 4KP4A 1YDXA 4FLUA 2Q73A 2PUSA 2QTOA 1AJQA 5LHHA 3CC2V 4I4TA 4IT5A 4PDRA 3K9AA 3G4SV 4PHZA 3CRAA 2WLMA 5CBHA 3CEIA 3K57A 1GN4A 5CN0A 1HNXB 1K4DC 1IBLB 2OT5A 4O4IB 2IH1C 3CX5F 3H1LH 3CC4V 5JQGB 1YCIA 2AZ2A 1I94B 2C2AA 3ABKB 4U3JB 4JI2O 3B09A 4PDMA 2XTAA 4U3FH 4TOIA 1R6NA 5CA3A 4I0XA 4LNUB 1HNWB 1FXHA 4R6ZA 1N33O 2WLLA 3ABMC 1JX9A 1TGOA 4JI6B 2UUCO 1XNQO 4R7CA 3E8HA 2QKSA 3CHXA 5LOVA 4Q20A 2KQXA 2FL4A 4ZI7A 1GN2A 2K9PA 3CRRA 2CGOA 2CK3G 3A8TA 4NR1A 3ASNC 5A2QN 3ZN0A 3BA9A 3H01A 1K5SA 1N0JA 4DK1A 1MOFA 1FS0G 1OV9A 3HKDA 2P6JA 2CAZC 1TA8A 3SYAA 2XHBA 5IY5C 1E1RG 1AI5A 1YHQV 2X6BA 5FLXN 1BGYH 3AG3B 1K3EA 2QWRB 2JDIG 4I55A 3L75H 3E8BA 4FFBB 4KUMA 4UCVA 5BXZA 1GKFA 4PD4F 1KBHA 2Q0AA 2JS5A 1YI2V 1AI7A 1V55C 4JI0B 4MVUA 1OCOC 4DV0O 4AILC 3K59A 1QBZA 1EZVH 1BZKA 5CB4A 2YIBD 3E8FA 5D5QA 4WBNA 3IJ4A 4PA3A 2H8PC 1S5JA 4TV8B 3WFVA 3M99B 5KHHA 3P30A 4RWUA 3JAKA
chains in the Genus database with same CATH topology
5LGTA 1I5YA 1CP9A 1K7DA 2XAGA 4DXWA 1VQ4V 2JJ2G 4BIZA 1J95A 2WLKA 1AJPA 1PNLA 2NLJC 1GTOA 3W7WA 4H33A 3SJQC 1R6KA 5LHGA 3CYOA 3LDEA 1SESA 2JJ1G 1NJIW 3ABUA 1F4NA 4R8CA 3T1CA 3CCQV 3I56V 2X0LA 3D36A 5B1AC 3OGCC 5LHIA 3AG1C 4UXNA 2XAFA 2K1EA 1DF5A 4N21A 3QO7A 1AI4A 2Z5UA 1NQTA 3MHHC 5C93A 1AJNA 2AHYA 2EZOA 4QPJA 2ZDIC 1BMFG 1Y4MA 3CCLV 3QNEA 3STLC 3STZC 2DW4A 4DO2A 1VQPV 3DGEA 4PA9A 5L3FA 4UV9A 3CCVV 1EFRG 2QEXV 1JOYA 3ABTA 1PD3A 4MVZA 3EFFK 2EILB 1FXKC 4WFFA 2WLIA 1K92A 1OCZC 3CD6V 5B1BB 4JTAB 3T4DA 1N8RW 2A9HA 5H6QA 4TSFG 4X88A 1SETA 1QLEC 5EBMC 2UXNA 3IGAC 4GX1A 2WLJA 2YEVA 3QO5A 1R73A 2JEXA 3ABKC 1NR7A 2B1GA 4G27B 1QR9A 1P7BA 3OMIB 5E1AC 4EKWA 3CXCU 1I5XA 3G6EV 4G28B 3ETEA 1S3JA 2EIJC 1PNMA 1MABG 3JD2A 2UXXA 4JYCA 2W6JG 4ZBMA 3UM7A 2WLLB 3AG4B 2HKOA 3BEHA 4RUFA 1KP2A 1S77D 2B1IA 2DWEC 3E86A 4PDLA 1VQNV 3ABLC 4JGSA 3FKSG 4XBFA 1K33A 2IU0A 3WG7C 4X8AA 4U7OA 4TT3G 1FFTB 1FXVA 5DM6V 2B5UA 3X2QB 1BHAA 2ZQMA 1KKDA 1OCRB 4FJCC 5KUMA 2WAMA 1M1KW 4Z1MG 3K08A 1W0JG 3B8NA 5HFLA 3OAAG 4GT1A 3OR6C 4GCZA 3VBBA 1K97A 3CCUV 2XOKG 4HYOA 2EZPA 4N23A 1MSWD 2DYRC 4CZZA 2IJJA 3SPJA 1KQSU 1M57C 1OZ0A 1OCCC 2PI4A 3KG2A 3SYOA 3ZMSA 1UJWB 3OMAB 3R65A 3T2MA 5KA5A 3T4ZA 2KB1A 4PELA 3AG2B 2QM7A 5IYDO 3RVZA 3ZRXA 1GM7A 3E8GA 3OW2U 3UKMA 1KECA 4XDJA 1ORQC 1XL4A 2IU3A 2HFEC 4U7NA 5CBGA 4L87A 2Q69A 1RM1B 4UVCA 5L3DA 2M7WA 3ZMVA 4CBCA 5CBFA 3CCRV 1JJ2U 3GB7C 2P90A 3AG2C 5EC2C 3OEEG 1PKXA 2EJRA 2HLDG 2ZDIA 1QLNA 1DF4A 1ENVA 5EBWC 4GX2A 1GM9A 1SERA 3W7XA 5DN6G 3W7UA 2DYSC 1R3IC 1W0KG 2OCCB 2LFRA 1GM8A 4PA4A 1NBMG 2R9IA 4LBEC 2ITCC 4MVSA 4WCEV 1FXKA 1COWG 4MW8A 1L1FA 1H38A 1OHHG 5H6RA 2MK3A 2IJKA 3ZIAG 5FL7G 3B77A 3ZCCA 3ASOB 2IJHA 4UVBA 3LSSA 1S76D 1M56B 1NVPD 3ZRWA 1K73W 3SYQA 1NVPB 1PL0A 2X7RB 4WFHA 4MTGA 3CCJV 4MVQA 1JCHA 1GMGA 3W7TA 4FIPC 1QVGU 3CCEV 2QE7G 3FYIB 1KP3A 3E89A 3IFXA 3RW0A 2Y48A 4J9YB 1VQ8V 4MTFA 4UUJC 1H8HG 1F23A 1QCEA 3GWOA 5LGNA 3TETA 4XDLA 3ABMB 1VQ6V 2ZR3A 4BW5A 3JD1A 1THZA 3CCMV 2DWDC 4ZKIA 3F7YC 3MHSC 1EBOA 4BIUA 3ZMZA 1CEZA 4FMTA 4MVOA 1S72V 4P2ZA 3K3WA 2ZXWB 1K34A 3B8MA 4I5SA 4QPKA 2EILC 3OM3B 2EIKB 2ZR2A 5B1BC 3SYCA 5B3SB 1S0VA 2AHZA 3G71V 2WLIB 1YITV 2DQ0A 4QE9A 4ASUG 3ASNB 3SPIA 3RBZA 4LP8A 3SPHA 3OFNG 3OMNB 5LGUA 4FK5C 2ZD9A 4JTDB 3ZN1A 3CCSV 2HJFC 2YEVB 4HZ3A 4OXSA 5B1OA 5IYCO 2P67A 1YJNV 1GO3F 2GHYA 3IC7A 4WFAV 2IH3C 4HAMA 4UV8A 2EBOA 3HB3B 4P30A 4QE7A 1VQKV 1VQ7V 4P9PA 3FB7C 5IY5B 3CC7V 1ROPA 1R3KC 1YSCA 2XASA 3PJSK 4JTCB 4PA6A 1YJWV 3AEIA 3AG4C 1BHBA 3QO8A 3K79A 3OE7G 1F4MA 2Q68A 1YTFD 2WSSG 4MTXA 5EBLC 4JF3A 2IJIA 3FYEB 1YTFB 4GX0A 1R3LC 4RO2A 1M90W 1V55B 1F51A 2IW5A 3JD3A 1OCOB 4I9WA 4P9OA 1G4YB 4KFMA 3X2QC 1W2BU 2EIMB 5GW7A 4WFEA 1OCRC 1V54B 4JPRA 4H37A 3ZRSA 1Y66A 3EHBB 3K0GA 4WFBV 2HG5C 3LDDA 1SRYA 2W6IG 3FB5C 2X6CA 5KUKA 2PI5A 3LUTB 3K03A 1AR1B 1P4RA 4QIWF 4R50A 4RAIA 5L3BA 2JIZG 2Y69B 1DLBA 4E2LA 5CMUA 3CP1A 4LC1A 4XDKA 1E1QG 4LCUC 2NNUA 1WPXA 2P7TC 3MD0A 3OUSA 2A0LA 3ZMTA 1Q82W 2OTLV 3ZRVA 3ML0A 4RUEA 3RVYA 2LFSA 1JQ0A 2LP7A 1VQOV 3ZMUA 3ETDA 1NH2D 1VQ5V 3ETGA 1G8MA 5EK0A 5B1AB 2ATKC 3VOUA 1M9NA 5J9PC 3AG1B 3SPGA 1RM1C 1WLEA 4JASA 4BAYA 1VQ9V 3SYPA 1NR1A 2WPDG 3F5WC 2ITDC 4MVRA 5B1NA 1SZTA 2A79B 4PA7A 1AROP 1HWYA 4KP4A 2EINB 4GX5A 2QTOA 5LBQA 3NXSA 1AJQA 2OCCC 5LHHA 1PNKA 3CC2V 3BY6A 3LSQA 4PDRA 3K9AA 1S5HC 3G4SV 1VQMV 2WLMA 1Q81W 5CBHA 3K06A 5L3GA 1KD1W 3LNMB 2V1DA 5H9CA 1ZWIC 1B6QA 1FXKB 2WLHA 3CMAV 5CN0A 1OCZB 1BL8A 2WLNA 3D3IA 4MTOA 3ASOC 2XNDG 1K4DC 2OT5A 2EINC 4F4LA 2IH1C 1QLEB 2BOCC 3CC4V 1M56C 1IXMA 4WF9V 3I55V 2W0FC 2C2AA 3ABKB 2XAHA 5BZBA 2FTKA 4PDMA 2JK5C 1VQLV 1LNQA 1RPRA 3JD4A 4JAUA 3ZRWB 1R6NA 5CA3A 3K04A 3E83A 3W7SA 4WFGA 3TK1A 1FXHA 4R6ZA 1Q7YW 2EIJB 3ZJZA 2WLLA 2XAJA 3ABMC 1DTOA 2BOBC 4TWKA 1JX9A 2Q6AA 2H94A 1KC8W 1H8EG 4MSWC 2HR3A 4G2KA 3OEHG 4JAVA 2QA4V 4R7CA 2X6AA 3E8HA 5L3EA 3ABLB 4MT8A 2QKSA 1AI6A 3LDCA 4JYBA 4MS2A 2ZXWC 3OUFA 4MW3A 3WG7B 4Q20A 2QM8A 3A0RA 2EIKC 1RPOA 2R9RB 1K4CC 5B3SC 5HFMA 2CK3G 2Q67A 3ASNC 4MVMA 3ZN0A 5IDJA 4UVAA 1CPYA 1QR8A 3H01A 3TCUA 4QNHB 1K5SA 2DQ3A 1YIJV 4X89A 5KA6A 1H2GA 1FS0G 1MOFA 4RQEA 2DYRB 2P6JA 3F7VC 1NKDA 1M57B 3K0DA 2WWWA 1K8AW 2HVJC 1OCCB 4FPPA 5EC1C 3SYAA 2D3OW 5IY5C 2XAQA 1TUEB 3JD0A 1E1RG 1AI5A 1GK9A 1YHQV 2X6BA 3CMEV 3OR7C 3AG3B 1K3EA 2GSMB 2JDIG 2JEUA 3SPCA 3FB8C 3E8BA 4YXWG 4KUMA 1JPXA 1GKFA 1R3JC 3P32A 4J9ZB 5L3CA 1Q86W 3JCZA 1YI2V 2HVKC 1AI7A 1V55C 1EZJA 4MVUA 1OCOC 1E79G 1K5QA 3E2EA 2F43G 4RQFA 2EIMC 1QBZA 1V54C 4PDVA 3DTUB 1QVFU 3HPLC 1JVMA 3E8FA 2OTJV 3AG3C 1MG1A 1YJ9V 4PA3A 2YSUB 2H8PC 3WFVA 5IYBO 3M99B 2V7QG 2Y69C 3P30A 2Z3YA 3CPWU 1XL6A 4QJFB 1NH2B 2DYSB 3E35A 3JYCA 1K9MW 3FB6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYO A;  2WLH A;  3RBZ A;  4LP8 A;  3SPI A;  2WLN A;  1BL8 A;  3SPH A;  2DYR C;  3ASO C;  4MTO A;  4DXW A;  3SPJ A;  1K4D C;  1M57 C;  1J95 A;  1OCC C;  2ZD9 A;  2WLK A;  2EIN C;  3KG2 A;  2IH1 C;  4JTD B;  3SYO A;  2HJF C;  4HZ3 A;  2BOC C;  4OXS A;  2NLJ C;  1M56 C;  4H33 A;  3SJQ C;  2IH3 C;  2W0F C;  3LDE A;  3R65 A;  3T2M A;  3T4Z A;  5BZB A;  2KB1 A;  4P30 A;  2JK5 C;  4PDM A;  4QE7 A;  4P9P A;  1LNQ A;  3FB7 C;  4R8C A;  3T1C A;  3RVZ A;  3K04 A;  5B1A C;  1R3K C;  3E83 A;  3OGC C;  3PJS K;  4JTC B;  3AG1 C;  4PA6 A;  3E8G A;  4WFG A;  3UKM A;  2K1E A;  3AG4 C;  4R6Z A;  4XDJ A;  3ZJZ A;  2WLL A;  2Q68 A;  3ABM C;  4TWK A;  2BOB C;  1ORQ C;  1XL4 A;  5EBL C;  2Q6A A;  2HFE C;  4MSW C;  5CBG A;  2Q69 A;  4GX0 A;  1R3L C;  4RO2 A;  4CBC A;  5CBF A;  2AHY A;  4R7C A;  2X6A A;  3E8H A;  3GB7 C;  4I9W A;  4P9O A;  1G4Y B;  2QKS A;  3AG2 C;  4KFM A;  3X2Q C;  5EC2 C;  3LDC A;  4MS2 A;  4WFE A;  1OCR C;  2ZXW C;  3OUF A;  4H37 A;  4MW3 A;  3ZRS A;  3STL C;  3STZ C;  3K0G A;  2EIK C;  5EBW C;  4F4L A;  4GX2 A;  4PA9 A;  2R9R B;  2HG5 C;  1K4C C;  3LDD A;  5B3S C;  2DYS C;  1R3I C;  3FB5 C;  4MVZ A;  3EFF K;  2X6C A;  4PA4 A;  5KUK A;  3LUT B;  3K03 A;  2Q67 A;  3ASN C;  4MVM A;  4WFF A;  2WLI A;  4R50 A;  4LBE C;  4RAI A;  1OCZ C;  2ITC C;  4MVS A;  4MW8 A;  4JTA B;  3TCU A;  3T4D A;  2A9H A;  4XDK A;  4X88 A;  4QNH B;  5EBM C;  1QLE C;  4LCU C;  3IGA C;  4GX1 A;  4X89 A;  2WLJ A;  2YEV A;  2P7T C;  3OUS A;  3F7V C;  3K0D A;  2A0L A;  3ABK C;  2HVJ C;  4G27 B;  3SYA A;  1P7B A;  5EC1 C;  4RUE A;  4EKW A;  5E1A C;  3RVY A;  5IY5 C;  4G28 B;  2X6B A;  3SYQ A;  3OR7 C;  2EIJ C;  4WFH A;  3SPC A;  5EK0 A;  4MTG A;  3FB8 C;  3E8B A;  4MVQ A;  3RW0 A;  2ATK C;  3E89 A;  1R3J C;  3IFX A;  3VOU A;  5J9P C;  4J9Y B;  3SPG A;  4ZBM A;  4MTF A;  4UUJ C;  3UM7 A;  2WLL B;  4J9Z B;  3SYP A;  3BEH A;  4RUF A;  2HVK C;  3TET A;  1V55 C;  4XDL A;  2DWE C;  3E86 A;  3F5W C;  2ITD C;  1OCO C;  4MVU A;  4MVR A;  3ABL C;  4PDL A;  4BW5 A;  2DWD C;  2EIM C;  1V54 C;  2A79 B;  3F7Y C;  4PA7 A;  4PDV A;  4X8A A;  3WG7 C;  3HPL C;  1JVM A;  3E8F A;  3AG3 C;  4GX5 A;  4MVO A;  2QTO A;  1KKD A;  4P2Z A;  4PA3 A;  2OCC C;  2H8P C;  5KUM A;  2EIL C;  4PDR A;  1S5H C;  2Y69 C;  3K08 A;  5B1B C;  1XL6 A;  3SYC A;  2AHZ A;  2WLM A;  5CBH A;  3OR6 C;  3K06 A;  3LNM B;  2WLI B;  3JYC A;  1ZWI C;  4QE9 A;  3FB6 C; 
#chains in the Genus database with same CATH topology
 4LF5 O;  1CP9 A;  5LL6 Y;  4GYC B;  4DXW A;  5JVD A;  2UXB B;  1PNL A;  1WP8 A;  1MZF A;  1GTO A;  3BRC A;  1Q6I A;  5LHG A;  4LF7 B;  2H3O A;  4O2B A;  3T1C A;  3JAW A;  4AQY O;  2AZ0 A;  3I56 V;  1VF7 A;  4JV5 B;  4N21 A;  1Q3E A;  2D2C B;  3MHH C;  3S3W A;  3BAA A;  2Y4T A;  3TXS A;  1Q43 A;  2RN9 A;  5JH7 B;  4DUY O;  3ZHV A;  4PJ0 Z;  4QPJ A;  4X64 O;  4O2A B;  3CCL V;  3H1J H;  3STL C;  2DW4 A;  4LF8 B;  1ZL8 B;  3TJT A;  3CCV V;  1EFR G;  2QEX V;  2E76 B;  4KHP B;  4FFK A;  4MVZ A;  1B04 A;  2UUB B;  1VP7 A;  1YEW A;  2WLI A;  4D6T H;  1N8R W;  3T4D A;  2E74 B;  2A9H A;  4LF9 B;  1SQG A;  4X88 A;  1SET A;  2UXN A;  5EZY B;  5TIS Z;  2F95 B;  4CC5 A;  3EXA A;  1NTM H;  2B1G A;  3T1Y B;  5E1A C;  1I5X A;  1XOU A;  1S3J A;  2EIJ C;  3UO2 A;  3JD2 A;  4TV9 B;  2F4V O;  3HKB A;  3AG4 B;  2HKO A;  3BEH A;  4RUF A;  1S77 D;  4PDL A;  1VQN V;  3A0B Z;  4XBF A;  1TVK A;  4TT3 G;  2B5U A;  4GKJ O;  1AP6 A;  1Q5O A;  1FJG O;  1Q6U A;  4FJC C;  5KUM A;  2WAM A;  4GT1 A;  1SQP H;  1XEQ A;  2Q9L A;  1IUR A;  5JJN B;  1M57 C;  2PI4 A;  3SYO A;  3ZMS A;  1UJW B;  4JI5 B;  3T2M A;  4K0K B;  5F2V O;  2E5L B;  4DR4 B;  2HJD A;  4PEL A;  2QM7 A;  3ZRX A;  3HKE A;  1GM7 A;  3VQV A;  3KKY A;  4XDJ A;  5FPO A;  2ODM A;  3WB1 A;  2ZE7 A;  5EYP B;  1RM1 B;  2XT9 A;  1D5A A;  4J10 A;  1MA1 A;  4DV6 B;  3ETQ A;  1WJZ A;  3MDS A;  4DV1 O;  2PYJ A;  4DRX A;  3OEE G;  4DYL A;  2NN4 A;  1QLN A;  2ZIN A;  1DF4 A;  4NXM O;  5DN6 G;  1R3I C;  4PA4 A;  4X65 B;  1COW G;  1L1F A;  2GTA A;  1XMO B;  4O4L B;  3B77 A;  2ZT9 B;  3LSS A;  1NVP D;  2GTS A;  1NVP B;  3PN1 A;  1FD9 A;  1GMG A;  4FIP C;  3FYI B;  4K8X A;  1H8H G;  1SA0 A;  5H5N A;  1SZX A;  5CA1 A;  3GWO A;  3TET A;  2Y0I A;  2JRI A;  1U96 A;  3HKC A;  3JD1 A;  3CCM V;  4UCO A;  2ZNI A;  2HHH O;  3U0Z A;  4DR2 B;  4JI1 O;  1XBL A;  3MHS C;  4X20 A;  3JSN A;  4O4J A;  3UT5 B;  4FMT A;  2Q7H A;  1NTZ H;  3K3W A;  2AGA A;  1XHX A;  2EIK B;  1Y67 A;  3SYC A;  2LO1 A;  1FFX B;  2DMX A;  1TUB B;  3A2F A;  4QE9 A;  2Q4P A;  3RBZ A;  3OMN B;  2YEV B;  5B1O A;  4WFA V;  1XNR B;  1Q90 D;  2CH7 A;  2EBO A;  3ZS8 C;  3HB3 B;  1JFF A;  1JA8 A;  4P30 A;  1VQK V;  4P9P A;  1ROP A;  1R3K C;  4PA6 A;  3VQX A;  1H2S B;  3QO8 A;  3K79 A;  1YTF D;  2WSS G;  4JF3 A;  1YTF B;  1R3L C;  1SC5 B;  4FLW A;  3JD3 A;  4P9O A;  1G4Y B;  2LQT A;  2P06 A;  1W2B U;  5LA6 B;  1OCR C;  4JPR A;  4H37 A;  2ZCE A;  3ZRS A;  1Y66 A;  4HNA A;  4WFB V;  3O65 A;  2ADQ B;  3D3Q A;  1FYJ A;  5CA0 B;  5KUK A;  3ZX6 A;  4RAI A;  2UXD O;  1NT2 B;  1WA8 A;  2Y69 B;  3DC6 A;  1OJH A;  2DJV A;  3RYH A;  4XDK A;  2GV9 A;  2IBZ H;  3G80 A;  3OUS A;  3MD0 A;  2A0L A;  3ZMT A;  3RYF B;  2L6L A;  4RUE A;  3RVY A;  1JQ0 A;  2LP7 A;  4O4H A;  1J5E O;  3ETD A;  2N04 A;  1BCC H;  3SJB C;  3CS5 A;  2E3C A;  1M9N A;  1WLE A;  4LWS A;  4F6R A;  5LYJ B;  4DR7 O;  2R72 A;  3LSU A;  5B1N A;  3ZHR A;  1Y76 A;  1XIL A;  2QJ1 A;  4NB5 A;  5IJ9 B;  1ARO P;  2EIN B;  4JYA O;  5GON A;  4GX5 A;  1HW7 A;  5LBQ A;  3NXS A;  4DV3 B;  3G67 A;  1VQM V;  1XMQ O;  3H1K H;  2HEP A;  3KZI Z;  2WLH A;  3K5O A;  3CMA V;  1OCZ B;  1BL8 A;  2WLN A;  4MTO A;  4F4L A;  4IHJ A;  3CRC A;  1M56 C;  1IXM A;  4WF9 V;  2GBO A;  4EB6 B;  1HR0 O;  2XUM A;  1LNQ A;  3JD4 A;  5J2U B;  2DOS A;  2JVD A;  3K04 A;  5JCO C;  3TK1 A;  2XAJ A;  2BOB C;  1D2D A;  3JAS B;  1KC8 W;  1H8E G;  3OTO O;  4LF6 B;  4DR6 O;  3AK3 A;  5L3E A;  3ABL B;  4MS2 A;  5KHJ A;  4B3T B;  5K1P A;  5IWA B;  5LXT A;  4CS3 A;  4B3M B;  1JMK C;  2R9R B;  5B3S C;  1VAR A;  5HFM A;  4EFE A;  4OGQ B;  4BR6 A;  2JGD A;  2DQ3 A;  4X89 A;  2BTQ A;  4IIJ A;  3FAV A;  3F7V C;  1NKD A;  2D3O W;  1H2L A;  3JD0 A;  4X62 O;  3CJH A;  3CME V;  4DW1 A;  3OR7 C;  3SPC A;  4B3R O;  4YXW G;  3RYI B;  1R3J C;  3JAT A;  4X66 O;  4L8J A;  2ZIO A;  4J9Z B;  1Q86 W;  3JCZ A;  1EZJ A;  4X1I B;  1K5Q A;  5KHI A;  3E2E A;  2Y0P A;  5BR8 O;  1V54 C;  3DTU B;  3AG3 C;  1MG1 A;  3H1H H;  2L35 A;  5ITZ A;  2VQE O;  3M7M X;  2Z3Y A;  1HDJ A;  1XL6 A;  3CE2 A;  4DV4 B;  1AVM A;  3E35 A;  2CTW A;  3O9O A;  1MSD A;  3FB6 C;  1YVW A;  1N34 O;  1IX9 A;  1AJP A;  4BIO A;  4DV5 B;  2NLJ C;  4OX9 O;  5KAF Z;  1IBM B;  5KMG A;  4R8C A;  2RNB A;  3Q4H B;  3CCQ V;  2KG7 B;  2ILM A;  3OGC C;  4UXN A;  3FX7 A;  5JCO A;  2CGN A;  3QO7 A;  1AI4 A;  5J2T B;  2EJ7 A;  5LP6 B;  5C93 A;  2ZM6 O;  2AHY A;  4LH7 A;  3MAQ A;  2ARH A;  4Q6G A;  4DV7 O;  2RQ6 A;  1Z5W A;  1BMF G;  1RSO B;  1Y4M A;  4ZOL B;  3UQ8 A;  4FLT A;  4LF4 O;  2GUZ A;  3STZ C;  4LNU A;  1VQP V;  3DGE A;  3L9D A;  4UV9 A;  1BSM A;  2OIG A;  3ABT A;  1H2M A;  2EIL B;  3CXH F;  1FXK C;  2A7W A;  4WFF A;  4IYI A;  5B1B B;  3ZHQ A;  2UU9 O;  4JTA B;  1VMG A;  2MW2 B;  5EBM C;  1QLE C;  2P4V A;  3IGA C;  5JJJ B;  4DR1 O;  2BSK A;  2WLJ A;  3D8C A;  1NR7 A;  4G27 B;  4EKW A;  2OCH A;  4KL1 A;  4G28 B;  4JYY A;  3ETE A;  5FNV A;  4JI2 B;  4I0X B;  1MAB G;  5IE9 A;  2UXX A;  4E4E A;  4ZBM A;  1W59 A;  2HP8 A;  4X1Y A;  2QWO B;  2WLL B;  1N33 B;  1HNZ O;  2DWE C;  3E86 A;  1I08 A;  3FKS G;  1K33 A;  2UUC B;  3WG7 C;  4X8A A;  1XNQ B;  4U7O A;  1KUQ A;  4ABM A;  5AG2 A;  4YIP A;  5LOV B;  4ZI7 B;  4PI2 A;  1RFY A;  2R9A A;  3K08 A;  3B8N A;  1JR9 A;  1N36 O;  1K97 A;  2XOK G;  1SKV A;  4N23 A;  2DYR C;  4CZZ A;  2IJJ A;  3SPJ A;  1KQS U;  1OCC C;  4FZ0 A;  3HKD B;  2ADP A;  1FPO A;  3R65 A;  3T4Z A;  4FM0 A;  5JWP A;  5BMV A;  2WA3 A;  3RVZ A;  2Y4U A;  3JAR A;  4I55 B;  1QU7 A;  3OW2 U;  1MZE A;  3SGI A;  5LMN O;  3DC5 A;  4L87 A;  2Q69 A;  1VF5 B;  3K9S A;  4DV0 B;  2P90 A;  5EC2 C;  3SJA C;  5CB4 B;  2YXL A;  2EJR A;  3OD4 A;  4FM2 A;  4WBN B;  3QVN A;  4ZHQ A;  3N2K A;  1GM9 A;  1SER A;  1Q8I A;  2DYS C;  3W7U A;  1NBM G;  2R9I A;  4LBE C;  1H2N A;  4MVS A;  4WCE V;  1FXK A;  3JAK B;  1H38 A;  1OHH G;  2CE4 A;  1QQC A;  4LF5 B;  2IJK A;  3APO A;  3NR7 A;  4NTX A;  5JVD B;  4UVB A;  1XRE A;  3ZRW A;  3K5L A;  4O2B B;  2EX3 A;  1SQV H;  2A3Q A;  4WFH A;  3CCJ V;  4AQY B;  3GWK C;  4MVQ A;  1QVG U;  3CCE V;  2QE7 G;  1KP3 A;  4MTF A;  4LFB O;  2BE3 A;  5LGN A;  4XDL A;  3ABM B;  2ZR3 A;  1N4C A;  3S3X A;  1EBO A;  4DUY B;  3ZMZ A;  1CEZ A;  4MVO A;  2YDE A;  4P2Z A;  4X64 B;  2PZS A;  2PF4 E;  4I5S A;  3OM3 B;  2RCV A;  4TV9 A;  2RDC A;  2ZR2 A;  1IBK O;  1TAE A;  2NR5 A;  1S0V A;  1B06 A;  2WLI B;  5B66 Z;  3FFQ A;  1YIT V;  2DQ0 A;  4ASU G;  3ASN B;  4W4L A;  3SPH A;  4B7E A;  1M93 A;  4LFA O;  3P3N A;  2F93 B;  5C8Y B;  3N2G A;  1YJN V;  4HZ3 A;  4OXS A;  4B08 A;  2P67 A;  3IC7 A;  2IH3 C;  3DXR B;  1ZX3 A;  3JAM N;  2Z0A A;  5IY5 B;  2ETN A;  3BAB A;  3PJS K;  2QWN B;  1N32 O;  3UO3 A;  2OIE A;  2CTP A;  1PL4 A;  3OE7 G;  1F4M A;  1G1X B;  3VQY A;  2IJI A;  2F4V B;  3HKB B;  4D7S A;  1V55 B;  2IW5 A;  1OCO B;  3X2Q C;  2PTM A;  2QSA A;  3DSQ A;  3J80 N;  4WFE A;  4DUZ O;  4NXN O;  2N74 A;  3EHB B;  2HG5 C;  4GKJ B;  3LDD A;  3WB0 A;  1FJG B;  3FB5 C;  2PI5 A;  3LUT B;  1P4R A;  5L3B A;  2IM9 A;  2JIZ G;  3CWB H;  1EN5 A;  4E2L A;  1Z5V A;  5CMU A;  1GN6 A;  4LCU C;  2NNU A;  2Q8V A;  1Q82 W;  1ZTE A;  5IJ0 A;  3ML0 A;  2YXH A;  2LFS A;  1VQO V;  3OGI B;  1NH2 D;  1G8M A;  5EK0 A;  1KYO F;  3HKE B;  1XDC A;  2DE0 X;  5J9P C;  3SPG A;  4JAS A;  3SYP A;  4H0L B;  2WPD G;  3CRQ A;  3F5W C;  2ITD C;  4YHH O;  2ZE5 A;  1WB7 A;  2A79 B;  4PA7 A;  4DRX B;  4K8Z A;  4DV1 B;  2YS8 A;  3T1H O;  2OCC C;  1PNK A;  3LSQ A;  4HBN A;  2AW9 A;  2YID A;  4NXM B;  1Q81 W;  1BE3 H;  1KD1 W;  3LNM B;  1B6Q A;  4TQD A;  3E22 A;  3D3I A;  1U97 A;  2VWK A;  1M4U A;  3ASO C;  2XND G;  2VQF O;  2EIN C;  4BWA A;  2Q7E A;  3I55 V;  2W0F C;  5JJE B;  4AI8 A;  1RPR A;  4LH6 A;  2UXC O;  3IC9 A;  3E83 A;  1CXZ B;  4WFG A;  4X1K A;  1Q7Y W;  2EIJ B;  3ZJZ A;  1DTO A;  2H94 A;  2YI9 A;  2HR3 A;  1SA0 B;  4JI3 O;  5CA1 B;  2KKW A;  3HKC B;  4Z1V A;  4H13 B;  2X6A A;  1AI6 A;  4JYB A;  2HHH B;  2ZXW C;  4JI1 B;  4O4J B;  3A0R A;  2VRZ A;  2Q67 A;  4CH3 A;  2EUL A;  1CPY A;  3TCU A;  4YJ2 A;  3C3T A;  1SF9 A;  1YIJ V;  5KA6 A;  1H2G A;  3RFR A;  3K0D A;  1M57 B;  4CH6 A;  1K8A W;  4FPP A;  5EC1 C;  1H2K A;  2XAQ A;  2CH7 B;  2CUG A;  1JFF B;  2E75 B;  4GZR B;  5EIB C;  3BCC H;  5L3C A;  1Y74 A;  1E79 G;  2F43 G;  2EIM C;  2LGW A;  4PDV A;  1QVF U;  1JVM A;  4JI7 O;  1SQQ H;  5IYZ A;  4HNA B;  4QJF B;  2UUA B;  5LYJ A;  1XI1 A;  4FLY A;  1WA8 B;  4J7Z A;  5LGT A;  1I5Y A;  2UXD B;  3RYH B;  1K7D A;  2XAG A;  1VQ4 V;  2JJ2 G;  2WLK A;  1SQF A;  3A0H Z;  4JI4 O;  4JI8 O;  3L70 H;  4H33 A;  4DV3 O;  3LDE A;  1GAX A;  4O4H B;  5B1A C;  1J5E B;  3AG1 C;  3JAL A;  2XAF A;  4DR3 O;  2PYL A;  1WNS A;  3FD9 A;  3K58 A;  4F6R B;  4LWS B;  4YY3 O;  1B3Q A;  3APQ A;  1ZSP A;  4DR7 B;  3BA8 A;  1AJN A;  4YJ3 A;  1Y76 B;  2EZO A;  1KU9 A;  2ZDI C;  2QKA A;  1L0L H;  5GON B;  4DO2 A;  1P7G A;  4J7J A;  4JYA B;  1US6 A;  5L3F A;  1PD3 A;  1L8D A;  3EFF K;  1UPG A;  3F5T A;  1XMQ B;  4TUY A;  5H6Q A;  4TSF G;  1AIL A;  1NU1 H;  1R73 A;  3ABK C;  4I50 A;  3I5D A;  4IHJ B;  1QR9 A;  1P7B A;  5FPR A;  3CXC U;  1AP5 A;  3G6E V;  1EM1 A;  5LMU O;  1HR0 B;  4DV2 O;  1PNM A;  3BPZ A;  1DK1 A;  2O57 A;  2W6J G;  1EN4 A;  2B1I A;  4JGS A;  3OTO B;  2IU0 A;  4DR6 B;  3JSL A;  3KCY A;  1Y6X A;  2JS3 A;  3LNN A;  2ZQM A;  1BHA A;  2QKC A;  1OCR B;  5LXT B;  1YF2 A;  2B9Z A;  2YIC A;  1WB8 A;  4Z1M G;  1M1K W;  4LFC O;  3OAA G;  4GCZ A;  3CCU V;  4HYO A;  4J7K A;  4DR5 O;  2JGD B;  4J41 A;  4GKK O;  3RYC A;  1EN6 A;  2BTQ B;  4FVM A;  3FAV B;  3HR0 A;  3AG2 B;  4EEQ A;  3K5M A;  2ZE8 A;  3CJH B;  2FML A;  4X62 B;  5KX5 B;  3UKM A;  1BS3 A;  4PI0 A;  4B3S O;  3L73 H;  2LGQ A;  4B3R B;  1ORQ C;  2FKX A;  3JAT B;  3OT7 A;  2IU3 A;  3ZHS A;  4X66 B;  4UVC A;  5L3D A;  3ZMV A;  4CBC A;  3CCR V;  1AB3 A;  2ZE6 A;  3GB7 C;  1ZAU A;  5BR8 B;  1PKX A;  2HLD G;  2ZDI A;  1L0N H;  1SQB H;  4GX2 A;  5ITZ B;  4NVP A;  2LFR A;  2G38 A;  2VQE B;  4I7Z B;  4MW8 A;  1HNX O;  2CDY A;  1IBL O;  3WU2 Z;  5H6R A;  5E79 Z;  2MK3 A;  2YC0 A;  4O4I A;  3BHP A;  1N34 B;  4NTY A;  5JQG A;  5KLV H;  4EFB A;  1I94 O;  3ZCC A;  4ZOL A;  4X9Q A;  4U3J A;  1O9G A;  4JZG A;  1M56 B;  4OX9 B;  4UCS A;  1HNW O;  5KMG B;  1K73 W;  3SYQ A;  2YUA A;  2X7R B;  1BQ0 A;  4I4T B;  1JCH A;  5A9G A;  3IFX A;  4JI6 O;  1IVS A;  2Y48 A;  1VQ8 V;  1F23 A;  1QCE A;  2VS0 A;  1VQ6 V;  4UB8 Z;  2ZM6 B;  1D5N A;  4ICG A;  1WP7 A;  4DK0 A;  4DV7 B;  1S72 V;  2GUZ B;  4PV1 B;  4LF4 B;  1K34 A;  2LW7 A;  2M6Y A;  2A06 H;  2BCC H;  4QPK A;  1AR5 A;  1BT8 A;  5B3S B;  2AXT Z;  4LP8 A;  2UU9 B;  3OFN G;  1PPJ H;  3CCS V;  2BSK B;  5IYC O;  4FLZ A;  2OWO A;  1GO3 F;  4DR1 B;  1I7F A;  3CRM A;  3TGU H;  1F7Y A;  1R6T A;  5D5P A;  2P5O A;  1VQ7 V;  3FB7 C;  3CC7 V;  3RN4 A;  4UCU A;  5FNV B;  4FFB A;  3ZHT A;  2BTO A;  1YJW V;  3THO A;  4BW9 A;  3AG4 C;  2Q68 A;  4JI0 O;  4MTX A;  5EBL C;  4NKG B;  4X1Y B;  3FYE B;  3C90 A;  4KXR A;  1HP8 A;  4GX0 A;  4RO2 A;  1HNZ B;  1F51 A;  4TQF A;  2ZIM A;  4KFM A;  1P49 A;  2YIB A;  1V54 B;  4TV8 A;  2QWQ B;  1QHT A;  2X6C A;  2WA4 A;  1JJO A;  3K03 A;  2QR4 A;  4QIW F;  3CP1 A;  4LC1 A;  1N36 B;  2UXB O;  1E1Q G;  1WPX A;  2RMK B;  4LF7 O;  2OTL V;  3SJC C;  1BQZ A;  5BMV B;  1ZLZ A;  4JV5 O;  2R70 A;  3BVO A;  5K1X A;  3CSX A;  3JAR B;  1Q6H A;  1O9H A;  1RM1 C;  2N05 A;  1NR1 A;  4MVR A;  1VEW A;  5LMN B;  5JH7 A;  1QNM A;  1WPB A;  4O2A A;  1HWY A;  4LF8 O;  4KHP O;  1ZL8 A;  2RJZ A;  3BY6 A;  2UUB O;  4ZHQ B;  3AK2 A;  1S5H C;  3N2K B;  3JAW B;  1NI8 A;  1DGS A;  4LF9 O;  3K06 A;  5L3G A;  2V1D A;  5H9C A;  1ZWI C;  1FXK B;  5EZY A;  3T1Y O;  1QLE B;  2BOC C;  1PV0 A;  3N27 A;  1SQX H;  2XAH A;  5BZB A;  2FTK A;  2JK5 C;  1VQL V;  3U11 A;  4JAU A;  3D36 C;  3ZBH A;  3ZRW B;  1G6U A;  1XUQ A;  4CH4 A;  3QF7 A;  3W7S A;  1S5L Z;  4TWK A;  2Q6A A;  5C8Y A;  4MSW C;  4G2K A;  3OEH G;  4JAV A;  4LFB B;  2QA4 V;  3ZED A;  3KCX A;  5GTI Z;  3DXR A;  4MT8 A;  3LDC A;  4D7T A;  3OUF A;  4MW3 A;  3WG7 B;  2QM8 A;  1R1B A;  2EIK C;  3L72 H;  1RPO A;  1K4C C;  3TXQ A;  4UCT A;  3J81 N;  4FM1 A;  1ZUQ A;  4MVM A;  5IDJ A;  4UVA A;  1IBK B;  1QR8 A;  4Z2W A;  4QNH B;  3IAY A;  4RQE A;  4JI5 O;  2DYR B;  4C7U A;  4LFA B;  3N2G B;  2E5L O;  4DR4 O;  4K0K O;  3QG5 A;  2WWW A;  2HVJ C;  3H1I H;  1OCC B;  1TVK B;  1TUE B;  1GK9 A;  2GSM B;  2JEU A;  3FB8 C;  1JPX A;  2Q0O C;  4NYK A;  3P32 A;  2QWP B;  1N32 B;  1MNG A;  3ZHU A;  5EYP A;  4DV6 O;  2HVK C;  3M8A A;  1T5E A;  4RQF A;  4UB6 Z;  3L71 H;  4LR3 A;  3HPL C;  2OTJ V;  3GVM A;  1YJ9 V;  1LR1 A;  2YSU B;  3AG7 A;  4DUZ B;  4NXN B;  5B5E Z;  5IYB O;  4X65 O;  2V7Q G;  4ZIB A;  2Y69 C;  3CPW U;  4I9Q A;  4NTW A;  1NS1 A;  1XQ8 A;  1NH2 B;  5KHG A;  2DYS B;  4K35 A;  1XMO O;  3JYC A;  1K9M W;  4O4L A;  4BIZ A;  1J95 A;  4J11 A;  3W7W A;  3SJQ C;  1R6K A;  3CYO A;  1SES A;  5IJ0 B;  2JJ1 G;  5DED A;  1NJI W;  3ABU A;  1F4N A;  2X0L A;  3D36 A;  5LHI A;  2K1E A;  1DF5 A;  1URF A;  2Z5U A;  1NQT A;  2QTS A;  2FB5 A;  4DR2 O;  1MMM A;  2QDO A;  5DEC A;  4YHH B;  3UT5 A;  2F66 C;  2PGG A;  3QNE A;  2KSD A;  3R66 A;  4PA9 A;  1JOY A;  3T1H B;  4J42 A;  1FFX A;  1TUB A;  1K92 A;  4UFZ A;  1OCZ C;  3CD6 V;  4A5U B;  4F6E A;  3E22 B;  4GX1 A;  1PP9 H;  2YEV A;  1XNR O;  1GN3 A;  1X59 A;  3QO5 A;  2JEX A;  2VQF B;  3OMI B;  4X20 B;  4W4K A;  4JAA A;  3L74 H;  4JYC A;  4CC6 A;  2UXC B;  4FZ1 A;  5GTH Z;  2LJ2 A;  4X1K B;  3H9V A;  4FLX A;  3UM7 A;  4B7K A;  1IDS A;  1LUV A;  1YZB A;  1KP2 A;  3ABL C;  3RT3 C;  4FLV A;  4JI3 B;  1X4T A;  4CS4 A;  5LA6 A;  1GRJ A;  1FFT B;  1FXV A;  5DM6 V;  1FAF A;  3X2Q B;  1WN7 A;  3ICX A;  1KKD A;  2ZNJ A;  3QTC A;  5CA0 A;  1KMI Z;  1W0J G;  5HFL A;  2VWJ A;  3OR6 C;  3VBB A;  2DN9 A;  1NZ6 A;  2EZP A;  4K3A A;  1MSW D;  5BY1 A;  4YJ2 B;  1OZ0 A;  1Z2G A;  3KG2 A;  3U10 A;  3RYF A;  2Q7G A;  3OMA B;  5KA5 A;  2PY5 A;  1NTK H;  2KB1 A;  2UUA O;  5IYD O;  3RWR D;  1P84 F;  2OYQ A;  3E8G A;  1KEC A;  2W0X A;  1XL4 A;  2LW1 A;  2ZKO A;  4U7N A;  2HFE C;  4H44 B;  1VF6 C;  1Y74 B;  2F1M A;  5CBG A;  4OPA A;  3VQW A;  3B4S A;  5CBF A;  2M7W A;  5IJ9 A;  1JJ2 U;  2YI8 A;  3AG2 C;  3EVK A;  1ENV A;  5EBW C;  4JI7 B;  5IYZ B;  3W7X A;  3K5N A;  1W0K G;  2OCC B;  1GM8 A;  2ITC C;  4IL6 Z;  4AHC A;  4IGG A;  3ZIA G;  5FL7 G;  3ASO B;  3WB2 A;  4EB6 A;  2IJH A;  1XHZ A;  4JI4 B;  4JI8 B;  1S76 D;  5J2U A;  1I0H A;  4CH5 A;  2YXY A;  1PL0 A;  2QGN A;  1FKA O;  3J7A U;  4MTG A;  3W7T A;  1WAZ A;  3JAL B;  3RW0 A;  3E89 A;  3B40 A;  4J9Y B;  3JAS A;  5LP6 C;  4LF6 O;  4UUJ C;  4DR3 B;  5H2F Z;  1IZ3 A;  4BW5 A;  1THZ A;  2DWD C;  4YY3 B;  4B3T O;  4YJ3 B;  4ZKI A;  3F7Y C;  5IWA O;  4B3M O;  4BIU A;  1LUW A;  2ZXW B;  3B8M A;  1V9P A;  2EIL C;  5B1B C;  2AHZ A;  3G71 V;  1AR4 A;  1VIB A;  3CB2 A;  3JCU Z;  3SPI A;  4J80 A;  2P4K A;  4TUY B;  5LGU A;  4FK5 C;  2ZD9 A;  4JTD B;  3ZN1 A;  2HJF C;  4CS2 A;  2GHY A;  3SR2 C;  4I50 B;  4HAM A;  4UV8 A;  1PM9 A;  4QE7 A;  1KKC A;  4YIO A;  3B2E E;  1YSC A;  2XAS A;  2YIA A;  4JTC B;  3RYI A;  5EIB D;  2GDS A;  3AEI A;  1BHB A;  4QGP A;  5LMU B;  3G6B A;  4DV2 B;  1KB9 F;  4X1I A;  5KHK A;  2CTR A;  2JGU A;  4GLX A;  1VF6 A;  3RGB A;  1M90 W;  1RP3 B;  4I9W A;  2V4D A;  4IIJ B;  2EIM B;  5GW7 A;  3AK1 A;  2QM4 A;  3K0G A;  2Q5Z A;  3BFR A;  5KX5 A;  1SS3 A;  3UCS C;  1SRY A;  2W6I G;  5KAI Z;  4DV4 O;  1AR1 B;  2F23 A;  4R50 A;  3OTF A;  1DLB A;  2FYU H;  4LFC B;  2P22 C;  1M5I A;  3C3S A;  4DV5 O;  4DR5 B;  2P7T C;  3RYC B;  1IBM O;  4GKK B;  4DW0 A;  3ZRV A;  1A32 A;  3SDL A;  3Q4H A;  2CTQ A;  4IYH A;  4UCR A;  3ZMU A;  2KG7 A;  3P3P A;  1VQ5 V;  3ETG A;  1N0N A;  1IXB A;  4GUN A;  5J2T A;  4OPH A;  2ATK C;  5B1A B;  3VOU A;  3AG1 B;  1UFI A;  4BAY A;  1VQ9 V;  4JZ2 A;  4B3S B;  5LP6 A;  1YXB A;  1SZT A;  5IT9 N;  1RSO A;  1GH6 A;  4KP4 A;  1YDX A;  4FLU A;  2Q73 A;  2PUS A;  2QTO A;  1AJQ A;  5LHH A;  3CC2 V;  4I4T A;  4IT5 A;  4PDR A;  3K9A A;  3G4S V;  4PHZ A;  3CRA A;  2WLM A;  5CBH A;  3CEI A;  3K57 A;  1GN4 A;  5CN0 A;  1HNX B;  1K4D C;  1IBL B;  2OT5 A;  4O4I B;  2IH1 C;  3CX5 F;  3H1L H;  3CC4 V;  5JQG B;  1YCI A;  2AZ2 A;  1I94 B;  2C2A A;  3ABK B;  4U3J B;  4JI2 O;  3B09 A;  4PDM A;  2XTA A;  4U3F H;  4TOI A;  1R6N A;  5CA3 A;  4I0X A;  4LNU B;  1HNW B;  1FXH A;  4R6Z A;  1N33 O;  2WLL A;  3ABM C;  1JX9 A;  1TGO A;  4JI6 B;  2UUC O;  1XNQ O;  4R7C A;  3E8H A;  2QKS A;  3CHX A;  5LOV A;  4Q20 A;  2KQX A;  2FL4 A;  4ZI7 A;  1GN2 A;  2K9P A;  3CRR A;  2CGO A;  2CK3 G;  3A8T A;  4NR1 A;  3ASN C;  5A2Q N;  3ZN0 A;  3BA9 A;  3H01 A;  1K5S A;  1N0J A;  4DK1 A;  1MOF A;  1FS0 G;  1OV9 A;  3HKD A;  2P6J A;  2CAZ C;  1TA8 A;  3SYA A;  2XHB A;  5IY5 C;  1E1R G;  1AI5 A;  1YHQ V;  2X6B A;  5FLX N;  1BGY H;  3AG3 B;  1K3E A;  2QWR B;  2JDI G;  4I55 A;  3L75 H;  3E8B A;  4FFB B;  4KUM A;  4UCV A;  5BXZ A;  1GKF A;  4PD4 F;  1KBH A;  2Q0A A;  2JS5 A;  1YI2 V;  1AI7 A;  1V55 C;  4JI0 B;  4MVU A;  1OCO C;  4DV0 O;  4AIL C;  3K59 A;  1QBZ A;  1EZV H;  1BZK A;  5CB4 A;  2YIB D;  3E8F A;  5D5Q A;  4WBN A;  3IJ4 A;  4PA3 A;  2H8P C;  1S5J A;  4TV8 B;  3WFV A;  3M99 B;  5KHH A;  3P30 A;  4RWU A;  3JAK A; 
#chains in the Genus database with same CATH homology
 5LGT A;  1I5Y A;  1CP9 A;  1K7D A;  2XAG A;  4DXW A;  1VQ4 V;  2JJ2 G;  4BIZ A;  1J95 A;  2WLK A;  1AJP A;  1PNL A;  2NLJ C;  1GTO A;  3W7W A;  4H33 A;  3SJQ C;  1R6K A;  5LHG A;  3CYO A;  3LDE A;  1SES A;  2JJ1 G;  1NJI W;  3ABU A;  1F4N A;  4R8C A;  3T1C A;  3CCQ V;  3I56 V;  2X0L A;  3D36 A;  5B1A C;  3OGC C;  5LHI A;  3AG1 C;  4UXN A;  2XAF A;  2K1E A;  1DF5 A;  4N21 A;  3QO7 A;  1AI4 A;  2Z5U A;  1NQT A;  3MHH C;  5C93 A;  1AJN A;  2AHY A;  2EZO A;  4QPJ A;  2ZDI C;  1BMF G;  1Y4M A;  3CCL V;  3QNE A;  3STL C;  3STZ C;  2DW4 A;  4DO2 A;  1VQP V;  3DGE A;  4PA9 A;  5L3F A;  4UV9 A;  3CCV V;  1EFR G;  2QEX V;  1JOY A;  3ABT A;  1PD3 A;  4MVZ A;  3EFF K;  2EIL B;  1FXK C;  4WFF A;  2WLI A;  1K92 A;  1OCZ C;  3CD6 V;  5B1B B;  4JTA B;  3T4D A;  1N8R W;  2A9H A;  5H6Q A;  4TSF G;  4X88 A;  1SET A;  1QLE C;  5EBM C;  2UXN A;  3IGA C;  4GX1 A;  2WLJ A;  2YEV A;  3QO5 A;  1R73 A;  2JEX A;  3ABK C;  1NR7 A;  2B1G A;  4G27 B;  1QR9 A;  1P7B A;  3OMI B;  5E1A C;  4EKW A;  3CXC U;  1I5X A;  3G6E V;  4G28 B;  3ETE A;  1S3J A;  2EIJ C;  1PNM A;  1MAB G;  3JD2 A;  2UXX A;  4JYC A;  2W6J G;  4ZBM A;  3UM7 A;  2WLL B;  3AG4 B;  2HKO A;  3BEH A;  4RUF A;  1KP2 A;  1S77 D;  2B1I A;  2DWE C;  3E86 A;  4PDL A;  1VQN V;  3ABL C;  4JGS A;  3FKS G;  4XBF A;  1K33 A;  2IU0 A;  3WG7 C;  4X8A A;  4U7O A;  4TT3 G;  1FFT B;  1FXV A;  5DM6 V;  2B5U A;  3X2Q B;  1BHA A;  2ZQM A;  1KKD A;  1OCR B;  4FJC C;  5KUM A;  2WAM A;  1M1K W;  4Z1M G;  3K08 A;  1W0J G;  3B8N A;  5HFL A;  3OAA G;  4GT1 A;  3OR6 C;  4GCZ A;  3VBB A;  1K97 A;  3CCU V;  2XOK G;  4HYO A;  2EZP A;  4N23 A;  1MSW D;  2DYR C;  4CZZ A;  2IJJ A;  3SPJ A;  1KQS U;  1M57 C;  1OZ0 A;  1OCC C;  2PI4 A;  3KG2 A;  3SYO A;  3ZMS A;  1UJW B;  3OMA B;  3R65 A;  3T2M A;  5KA5 A;  3T4Z A;  2KB1 A;  4PEL A;  3AG2 B;  2QM7 A;  5IYD O;  3RVZ A;  3ZRX A;  1GM7 A;  3E8G A;  3OW2 U;  3UKM A;  1KEC A;  4XDJ A;  1ORQ C;  1XL4 A;  2IU3 A;  2HFE C;  4U7N A;  5CBG A;  4L87 A;  2Q69 A;  1RM1 B;  4UVC A;  5L3D A;  2M7W A;  3ZMV A;  4CBC A;  5CBF A;  3CCR V;  1JJ2 U;  3GB7 C;  2P90 A;  3AG2 C;  5EC2 C;  3OEE G;  1PKX A;  2EJR A;  2HLD G;  2ZDI A;  1QLN A;  1DF4 A;  1ENV A;  5EBW C;  4GX2 A;  1GM9 A;  1SER A;  3W7X A;  5DN6 G;  3W7U A;  2DYS C;  1R3I C;  1W0K G;  2OCC B;  2LFR A;  1GM8 A;  4PA4 A;  1NBM G;  2R9I A;  4LBE C;  2ITC C;  4MVS A;  4WCE V;  1FXK A;  1COW G;  4MW8 A;  1L1F A;  1H38 A;  1OHH G;  5H6R A;  2MK3 A;  2IJK A;  3ZIA G;  5FL7 G;  3B77 A;  3ZCC A;  3ASO B;  2IJH A;  4UVB A;  3LSS A;  1S76 D;  1M56 B;  1NVP D;  3ZRW A;  1K73 W;  3SYQ A;  1NVP B;  1PL0 A;  2X7R B;  4WFH A;  4MTG A;  3CCJ V;  4MVQ A;  1JCH A;  1GMG A;  3W7T A;  4FIP C;  1QVG U;  3CCE V;  2QE7 G;  3FYI B;  1KP3 A;  3E89 A;  3IFX A;  3RW0 A;  2Y48 A;  4J9Y B;  1VQ8 V;  4MTF A;  4UUJ C;  1H8H G;  1F23 A;  1QCE A;  3GWO A;  5LGN A;  3TET A;  4XDL A;  3ABM B;  1VQ6 V;  2ZR3 A;  4BW5 A;  3JD1 A;  1THZ A;  3CCM V;  2DWD C;  4ZKI A;  3F7Y C;  3MHS C;  1EBO A;  4BIU A;  3ZMZ A;  1CEZ A;  4FMT A;  4MVO A;  1S72 V;  4P2Z A;  3K3W A;  2ZXW B;  1K34 A;  3B8M A;  4I5S A;  4QPK A;  2EIL C;  3OM3 B;  2EIK B;  2ZR2 A;  5B1B C;  3SYC A;  5B3S B;  1S0V A;  2AHZ A;  3G71 V;  2WLI B;  1YIT V;  2DQ0 A;  4QE9 A;  4ASU G;  3ASN B;  3SPI A;  3RBZ A;  4LP8 A;  3SPH A;  3OFN G;  3OMN B;  5LGU A;  4FK5 C;  2ZD9 A;  4JTD B;  3ZN1 A;  3CCS V;  2HJF C;  2YEV B;  4HZ3 A;  4OXS A;  5B1O A;  5IYC O;  2P67 A;  1YJN V;  1GO3 F;  2GHY A;  3IC7 A;  4WFA V;  2IH3 C;  4HAM A;  4UV8 A;  2EBO A;  3HB3 B;  4P30 A;  4QE7 A;  1VQK V;  1VQ7 V;  4P9P A;  3FB7 C;  5IY5 B;  3CC7 V;  1ROP A;  1R3K C;  1YSC A;  2XAS A;  3PJS K;  4JTC B;  4PA6 A;  1YJW V;  3AEI A;  3AG4 C;  1BHB A;  3QO8 A;  3K79 A;  3OE7 G;  1F4M A;  2Q68 A;  1YTF D;  2WSS G;  4MTX A;  5EBL C;  4JF3 A;  2IJI A;  3FYE B;  1YTF B;  4GX0 A;  1R3L C;  4RO2 A;  1M90 W;  1V55 B;  1F51 A;  2IW5 A;  3JD3 A;  1OCO B;  4I9W A;  4P9O A;  1G4Y B;  4KFM A;  3X2Q C;  1W2B U;  2EIM B;  5GW7 A;  4WFE A;  1OCR C;  1V54 B;  4JPR A;  4H37 A;  3ZRS A;  1Y66 A;  3EHB B;  3K0G A;  4WFB V;  2HG5 C;  3LDD A;  1SRY A;  2W6I G;  3FB5 C;  2X6C A;  5KUK A;  2PI5 A;  3LUT B;  3K03 A;  1AR1 B;  1P4R A;  4QIW F;  4R50 A;  4RAI A;  5L3B A;  2JIZ G;  2Y69 B;  1DLB A;  4E2L A;  5CMU A;  3CP1 A;  4LC1 A;  4XDK A;  1E1Q G;  4LCU C;  2NNU A;  1WPX A;  2P7T C;  3MD0 A;  3OUS A;  2A0L A;  3ZMT A;  1Q82 W;  2OTL V;  3ZRV A;  3ML0 A;  4RUE A;  3RVY A;  2LFS A;  1JQ0 A;  2LP7 A;  1VQO V;  3ZMU A;  3ETD A;  1NH2 D;  1VQ5 V;  3ETG A;  1G8M A;  5EK0 A;  5B1A B;  2ATK C;  3VOU A;  1M9N A;  5J9P C;  3AG1 B;  3SPG A;  1RM1 C;  1WLE A;  4JAS A;  4BAY A;  1VQ9 V;  3SYP A;  1NR1 A;  2WPD G;  3F5W C;  2ITD C;  4MVR A;  5B1N A;  1SZT A;  2A79 B;  4PA7 A;  1ARO P;  1HWY A;  4KP4 A;  2EIN B;  4GX5 A;  2QTO A;  5LBQ A;  3NXS A;  1AJQ A;  2OCC C;  5LHH A;  1PNK A;  3CC2 V;  3BY6 A;  3LSQ A;  4PDR A;  3K9A A;  1S5H C;  3G4S V;  1VQM V;  2WLM A;  1Q81 W;  5CBH A;  3K06 A;  5L3G A;  1KD1 W;  3LNM B;  2V1D A;  5H9C A;  1ZWI C;  1B6Q A;  1FXK B;  2WLH A;  3CMA V;  5CN0 A;  1OCZ B;  1BL8 A;  2WLN A;  3D3I A;  4MTO A;  3ASO C;  2XND G;  1K4D C;  2OT5 A;  2EIN C;  4F4L A;  2IH1 C;  1QLE B;  2BOC C;  3CC4 V;  1M56 C;  1IXM A;  4WF9 V;  3I55 V;  2W0F C;  2C2A A;  3ABK B;  2XAH A;  5BZB A;  2FTK A;  4PDM A;  2JK5 C;  1VQL V;  1LNQ A;  1RPR A;  3JD4 A;  4JAU A;  3ZRW B;  1R6N A;  5CA3 A;  3K04 A;  3E83 A;  3W7S A;  4WFG A;  3TK1 A;  1FXH A;  4R6Z A;  1Q7Y W;  2EIJ B;  3ZJZ A;  2WLL A;  2XAJ A;  3ABM C;  1DTO A;  2BOB C;  4TWK A;  1JX9 A;  2Q6A A;  2H94 A;  1KC8 W;  1H8E G;  4MSW C;  2HR3 A;  4G2K A;  3OEH G;  4JAV A;  2QA4 V;  4R7C A;  2X6A A;  3E8H A;  5L3E A;  3ABL B;  4MT8 A;  2QKS A;  1AI6 A;  3LDC A;  4JYB A;  4MS2 A;  2ZXW C;  3OUF A;  4MW3 A;  3WG7 B;  4Q20 A;  2QM8 A;  3A0R A;  2EIK C;  1RPO A;  2R9R B;  1K4C C;  5B3S C;  5HFM A;  2CK3 G;  2Q67 A;  3ASN C;  4MVM A;  3ZN0 A;  5IDJ A;  4UVA A;  1CPY A;  1QR8 A;  3H01 A;  3TCU A;  4QNH B;  1K5S A;  2DQ3 A;  1YIJ V;  4X89 A;  5KA6 A;  1H2G A;  1FS0 G;  1MOF A;  4RQE A;  2DYR B;  2P6J A;  3F7V C;  1NKD A;  1M57 B;  3K0D A;  2WWW A;  1K8A W;  2HVJ C;  1OCC B;  4FPP A;  5EC1 C;  3SYA A;  2D3O W;  5IY5 C;  2XAQ A;  1TUE B;  3JD0 A;  1E1R G;  1AI5 A;  1GK9 A;  1YHQ V;  2X6B A;  3CME V;  3OR7 C;  3AG3 B;  1K3E A;  2GSM B;  2JDI G;  2JEU A;  3SPC A;  3FB8 C;  3E8B A;  4YXW G;  4KUM A;  1JPX A;  1GKF A;  1R3J C;  3P32 A;  4J9Z B;  5L3C A;  1Q86 W;  3JCZ A;  1YI2 V;  2HVK C;  1AI7 A;  1V55 C;  1EZJ A;  4MVU A;  1OCO C;  1E79 G;  1K5Q A;  3E2E A;  2F43 G;  4RQF A;  2EIM C;  1QBZ A;  1V54 C;  4PDV A;  3DTU B;  1QVF U;  3HPL C;  1JVM A;  3E8F A;  2OTJ V;  3AG3 C;  1MG1 A;  1YJ9 V;  4PA3 A;  2YSU B;  2H8P C;  3WFV A;  5IYB O;  3M99 B;  2V7Q G;  2Y69 C;  3P30 A;  2Z3Y A;  3CPW U;  1XL6 A;  4QJF B;  1NH2 B;  2DYS B;  3E35 A;  3JYC A;  1K9M W;  3FB6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...