3FB5C

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
molecule keywords antibody Fab fragment heavy chain
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb5C00
2WLLB 3T1CA 1M57C 1R3JC 2EILC 5EC2C 3AG1C 3EFFK 1OCOC 2A79B 2BOCC 2WLNA 4MVRA 4F4LA 2Q68A 4ZBMA 3K04A 1JVMA 2A0LA 4R50A 1KKDA 3K08A 3E83A 4GX1A 4MW3A 2WLJA 5BZBA 3SYPA 4OXSA 2Q6AA 3E8HA 2BOBC 2DWDC 3ABKC 3ASOC 2WLMA 3RW0A 3LDDA 3T4ZA 2W0FC 3E8FA 4PDRA 5CBHA 4X88A 3SJQC 3K06A 5EBLC 1S5HC 3LNMB 3OUFA 3UM7A 1M56C 2ATKC 3IGAC 4MTFA 3SPIA 3STZC 2Q69A 3FB8C 4BW5A 2OCCC 2X6BA 4RUEA 1OCZC 2QKSA 3K0GA 2EIJC 4KFMA 2A9HA 1V54C 2HJFC 4PA6A 3ABLC 3LUTB 2WLHA 3ABMC 3GB7C 3IFXA 3PJSK 4GX2A 5CBFA 3BEHA 2WLKA 4MVOA 3KG2A 3TETA 4QE9A 2HG5C 4WFFA 2R9RB 2NLJC 4MTOA 1G4YB 1R3LC 4PA7A 3ZJZA 4GX5A 1XL6A 2EIMC 2IH3C 5EC1C 3SPGA 2DYSC 1K4DC 2EINC 3OR7C 4J9ZB 4JTAB 2QTOA 3WG7C 5KUKA 3RVZA 4P9PA 2EIKC 4TWKA 2Y69C 2KB1A 3ASNC 1QLEC 4H33A 3AG2C 4PA3A 5EK0A 4HZ3A 5KUMA 3SYQA 1LNQA 5B1BC 2JK5C 2YEVA 3LDCA 2ITCC 4P2ZA 5EBMC 2ZXWC 5J9PC 3AG3C 5EBWC 4JTDB 3LDEA 4MVUA 4RO2A 4R7CA 4XDKA 3FB6C 4G27B 4LP8A 3TCUA 4GX0A 3SPCA 4EKWA 2P7TC 4PA9A 2H8PC 4MVZA 3STLC 4RUFA 4XDLA 4QE7A 3ZRSA 4QNHB 4PA4A 2K1EA 3FB5C 3E86A 1ORQC 2HVKC 3R65A 2HVJC 4DXWA 4H37A 1BL8A 3FB7C 1OCRC 4UUJC 4I9WA 1V55C 3VOUA 3F7YC 4PDLA 2AHYA 4MVSA 1XL4A 4R6ZA 4R8CA 3UKMA 2WLIA 2ITDC 4PDVA 3E89A 4LBEC 4LCUC 4MS2A 4PDMA 3X2QC 5E1AC 3SYCA 1K4CC 3K0DA 3SYAA 3SYOA 4MTGA 3E8GA 4WFHA 4X8AA 4RAIA 4G28B 3RVYA 1R3IC 5IY5C 4MVMA 4WFGA 2HFEC 3OR6C 4J9YB 1OCCC 3T2MA 3E8BA 2WLIB 2WLLA 3JYCA 3F5WC 4JTCB 3K03A 4MSWC 4X89A 4CBCA 1P7BA 2DWEC 4WFEA 3RBZA 4HYOA 5B1AC 2X6AA 2ZD9A 1J95A 4P30A 5CBGA 2X6CA 1ZWIC 1R3KC 2Q67A 4MVQA 4XDJA 2IH1C 3OUSA 4P9OA 3AG4C 3SPHA 3HPLC 5B3SC 3OGCC 3T4DA 2DYRC 3F7VC 4MW8A 3SPJA 2AHZA
chains in the Genus database with same CATH superfamily
3IAYA 4D7SA 1VQLV 2B1IA 1RM1C 1FAFA 3CC4V 3UT5A 4JAUA 3ZX6A 3RW0A 1Z5VA 5BMVB 2UUAO 1VQ8V 4FLTA 2ZQMA 3K06A 2D3OW 1QLEB 2HKOA 5IWAO 4IT5A 2F4VB 3OMIB 5L3CA 1N32O 2OCCC 2EBOA 5LYJB 1HNXO 3ZIAG 3CCQV 2JGDB 4NXMB 2FYUH 1FXVA 4GX2A 4FM0A 4NB5A 1M93A 4UVBA 2IBZH 3P3PA 4LFCO 3CCRV 3CHXA 4LF4O 4LWSA 2NLJC 2QM8A 2EIMC 3GWOA 4N23A 5EC1C 2CTRA 1NJIW 3KCYA 5IYBO 4DV4O 1FXKC 1YVWA 2DN9A 2Y69C 5CB4A 2OCHA 3CJHA 2Q4PA 3H9VA 4UVAA 4IHJB 2KSDA 3OM3B 1ZLZA 2V7QG 1THZA 3LDEA 1G8MA 1E1RG 4FMTA 2BTOA 4JTDB 4W4KA 2N74A 4FJCC 3AK1A 4TUYA 2GBOA 4JI8B 2ZXWB 2HVKC 1IDSA 4B3TB 1UPGA 4LFCB 2B1GA 1IURA 3UKMA 4QJFB 1Q8IA 2VRZA 2QDOA 2E5LO 2ZR3A 3D3QA 4FFKA 2HP8A 3SYAA 1S5LZ 1N0JA 2P67A 3OEEG 1NH2B 3RFRA 1SS3A 3ZEDA 3T2MA 1S5JA 4I55B 2QWOB 1AI5A 4DK1A 2Q0OC 1K5SA 3CYOA 2DQ3A 3CXCU 1J95A 1QNMA 4MVQA 3CCVV 4P9OA 2EJ7A 1KC8W 1H2NA 5FNVB 5B3SC 4YJ2B 1XNRB 5BXZA 1M57C 4KUMA 1K3EA 2FKXA 3RGBA 2DOSA 2Y69B 3CCSV 1HDJA 2FL4A 3JSLA 2E75B 3EXAA 2XAHA 5IT9N 5LP6C 3UM7A 4NYKA 4F6RA 5IYDO 1Q82W 4X64B 2XUMA 2EIJC 3D8CA 1FJGO 5DN6G 3CD6V 2JS3A 3DSQA 4X65B 3KCXA 4L87A 3JATB 1ZL8A 1KECA 4NTYA 3N27A 1MZFA 2AZ0A 1NQTA 2GV9A 1QHTA 4GLXA 1Y76A 2XAFA 3JASB 4NXNB 1NTKH 4LFBO 2BE3A 5EBWC 1R6KA 3L70H 1NH2D 4QNHB 2JVDA 1PNLA 2HLDG 4FVMA 4I9QA 3SJAC 2DMXA 4DUZO 3JD3A 2HHHO 2VQEB 2R9AA 1VQKV 1SQBH 1EN6A 3SYCA 2V1DA 2WA4A 5IY5C 2N05A 4IL6Z 4O4HB 4DV6O 3OW2U 5KHHA 3JYCA 2PI4A 3BFRA 1P7BA 4BWAA 3RBZA 2OT5A 3X2QB 3UCSC 5K1XA 1VARA 2DW4A 1CEZA 1VQOV 4MW8A 3ETEA 2PTMA 4B3SO 4LF8O 4CH3A 4ZKIA 2MW2B 3AG1C 1AJQA 3EFFK 2VQFB 3HKEB 2HR3A 2BTQA 1V55B 2YIBA 4FLWA 3ASNB 1XMOB 3G6BA 4IGGA 1I94O 5HFMA 2AGAA 3TGUH 3RWRD 2DWDC 1U97A 3U0ZA 3FD9A 1OJHA 1GMGA 4LWSB 1HP8A 1S5HC 4RWUA 4B08A 3N2KA 2L6LA 1S3JA 1OCZC 1FFTB 1U96A 3K0GA 2ADQB 2PYJA 3ZHVA 3JD2A 3ABUA 1B04A 1QVGU 3LSUA 2Q73A 4IIJB 3L75H 2N04A 2Y0PA 3RYHB 3QF7A 4DUYB 2B5UA 4CZZA 1W0KG 3ZJZA 2DYSC 2Q0AA 3PN1A 3DC5A 2E5LB 4X62B 2QE7G 2BSKB 4PA3A 1EZVH 1K73W 1LNQA 2ZXWC 2ZINA 2NNUA 3FB6C 3JD4A 3BA8A 3APOA 2JEUA 5BR8O 1FYJA 4JI1B 3AG1B 3QTCA 5LXTB 3E86A 4DR3O 1V55C 4HNAB 1MMMA 1F23A 1FXKB 4FK5C 1PM9A 2YS8A 1HWYA 4LCUC 4ZIBA 3WG7B 1EN5A 5LXTA 1R3IC 2IJHA 1MSWD 4DV3B 3OR6C 3ZRWB 1OCCC 1VF6C 4U3FH 2EIMB 4GUNA 2YIBD 3K03A 1J5EB 1Y6XA 2KG7A 1XI1A 3OAAG 1WA8A 1ZWIC 4LF9B 3G4SV 2R9IA 3WFVA 4I0XB 2YIAA 1GM8A 1XNRO 1H2LA 1PP9H 3JCZA 1EN4A 3O65A 4TOIA 1WA8B 3W7WA 2PY5A 5EYPA 2WLMA 1OZ0A 3B2EE 3S3XA 2RQ6A 3K9SA 1FFXB 1YHQV 1NI8A 4KXRA 4E2LA 1FS0G 1M90W 3ICXA 1K92A 4JV5O 3JASA 1COWG 3E22B 2ZDIC 1TA8A 3T1HO 3KZIZ 3CJHB 1K4DC 4IHJA 4J9ZB 1Y66A 3WG7C 5KUKA 4WFBV 1VQ5V 2AW9A 4DR5O 2EIKC 5A2QN 3E35A 2YC0A 4AILC 4QGPA 1S0VA 1XREA 4TUYB 3AG3C 1M56B 1MZEA 4DR7B 1SQFA 4LP8A 3JAWA 1SESA 1EBOA 3Q4HB 2P7TC 4QE7A 3CRRA 5J2UA 4JZGA 4QIWF 2RJZA 4DUZB 3FB7C 2P06A 2JJ1G 4J7ZA 3H1LH 1QCEA 4I9WA 1L1FA 1OCRB 4BIZA 3VOUA 4H0LB 3MHSC 1BZKA 4TQDA 4JI3O 4C7UA 3OFNG 3ZMTA 1K9MW 1I5XA 3S3WA 4PELA 1NKDA 2X7RB 1S77D 1N33B 3E8BA 3ZMSA 4ZHQA 4IYIA 3N2GB 4DR6O 4JGSA 2OTLV 1HNWO 3D3IA 4X1YB 4DV3O 4RQFA 2QR4A 3ZMZA 2ETNA 5D5PA 3LNNA 1M1KW 4TT3G 3ZS8C 4GZRB 1JJ2U 4X1KB 5IJ9B 1NR7A 1RP3B 1TGOA 3CB2A 3K04A 1XMOO 2QM7A 2LFRA 3ABKC 3ASOC 1YEWA 3SJQC 2EZPA 4OX9O 4I55A 1M56C 2O57A 4BW5A 3ZHTA 4U7OA 4DV7O 3K57A 3L71H 1DLBA 2G38A 5KMGB 1XDCA 4KP4A 5KHJA 1WB8A 1WPXA 4I5SA 3TETA 3CC7V 1P49A 5IYZB 2R9RB 1ZAUA 4I50A 4OPHA 1G4YB 1XL6A 2IM9A 3DC6A 3OR7C 4OPAA 1KYOF 1XQ8A 3THOA 3CRAA 4JV5B 2ZIMA 1EFRG 1WPBA 1QLEC 2WSSG 1WJZA 3LSSA 2OIEA 5LYJA 4B3MB 4RUFA 4JI6O 2UUCB 3FB5C 2HVJC 1PD3A 1Z5WA 5HFLA 1ZTEA 4O4HA 1UJWB 3ML0A 4LF7O 4J42A 4PV1B 2P5OA 1AR1B 1FKAO 1BGYH 4FLXA 4CC5A 3ZHSA 2ZM6B 1D5NA 3AEIA 3A8TA 3HKBB 2DQ0A 2LO1A 1JX9A 1WLEA 4O4LB 2ODMA 1VMGA 1K33A 2VWJA 2ZD9A 3Q4HA 2FTKA 1QBZA 1Q43A 4UB6Z 2H94A 5D5QA 5JJJB 4F6EA 1E1QG 1XHXA 1F51A 2WLNA 4QPKA 2YSUB 1K7DA 2A06H 3AG2B 1GTOA 4LNUB 5LHGA 1GN6A 3T1YB 3SYPA 1ENVA 1KP2A 2ZM6O 2IJJA 1IBLO 2L35A 5B3SB 4J7KA 1WAZA 1M57B 1V9PA 4U3JA 1QR9A 1SZXA 2W6IG 4GKKO 1XMQO 1N36B 4TV8B 3JATA 1ROPA 4EB6A 3IC7A 1Y67A 1XHZA 3KG2A 4DV1O 1IBKO 3UO2A 1P7GA 2CE4A 1XNQO 3CPWU 2XASA 3L73H 3LSQA 4JI5B 3FKSG 3QG5A 5LP6A 1Y4MA 1SA0A 4HAMA 4JI7B 3SYQA 4ZOLA 5EIBC 2JRIA 1JFFB 4EFEA 1VQMV 2RDCA 3BY6A 4MVUA 4YIOA 2GSMB 5JH7B 3FAVA 3SPCA 4EKWA 1YTFD 1QQCA 4LF4B 1ZX3A 5KMGA 1DK1A 1GH6A 3R65A 2JGDA 1WN7A 2Q5ZA 3K9AA 2PZSA 2CTPA 1XL4A 4NVPA 5L3FA 3EVKA 2HHHB 4LH6A 4LBEC 5CA3A 4RQEA 3K58A 4GKJB 1TAEA 2CH7B 1B3QA 3OE7G 3P32A 3SYOA 1SQGA 3I56V 3BA9A 5GW7A 4WFGA 3E2EA 5JVDA 1IZ3A 5BR8B 1W0JG 4X89A 1YXBA 3DXRB 2X6AA 5KA6A 5KHKA 3OUSA 4NTXA 3OGCC 5BY1A 4LR3A 2WLLB 4L8JA 1FFXA 1VQ4V 1GN4A 1YZBA 1H2GA 3ZHRA 1KKDA 4MW3A 4Z1MG 2Q6AA 2QJ1A 4FZ0A 1QLNA 1PL4A 1KD1W 3IGAC 1KMIZ 2X6BA 2QKSA 2H3OA 4FFBA 1G6UA 4PA6A 1H2MA 3ABMC 3RYIA 2WLKA 4GCZA 1AI6A 1TUBB 4O4JA 1IXBA 1R6TA 3RYFB 1VP7A 2XAJA 3ZHQA 2F93B 1R73A 2WPDG 3ABKB 1HR0B 2XAGA 5LHIA 3L74H 2QM4A 1N34B 4LF5O 5JQGA 2CTWA 2XHBA 3P3NA 1Z2GA 3K5MA 2W0XA 5J2UB 2PI5A 1LR1A 4DV0B 4DV6B 1N32B 2RMKB 3HB3B 2ZIOA 1YSCA 1JPXA 3U10A 2QWQB 3CRQA 4YHHB 3T1HB 2AZ2A 4H37A 3K5OA 2IU0A 5KHGA 4AQYB 2LW7A 1RPRA 2LGWA 3RYCB 4JYAO 1LUWA 4X1IA 4DV5B 2PUSA 4TV9A 2KQXA 5C8YB 3H1KH 1YITV 2Z5UA 1ZL8B 4NKGB 4WFHA 3CCEV 1HW7A 1YJWV 3M99B 3HKCB 4G28B 1W59A 1EM1A 3O9OA 1VEWA 4CC6A 5E79Z 3W7SA 1JMKC 1O9HA 2XAQA 4P30A 1R3KC 5B1NA 2IH1C 4LF9O 1KKCA 2D2CB 5K1PA 3T4DA 1Q90D 1H38A 2AHZA 2EILC 5L3GA 3N2KB 3OD4A 2YI8A 1XUQA 4JI2B 2WLJA 2CGOA 4B3RO 2CH7A 2R70A 4PDRA 3VQWA 3RYHA 3QNEA 4ZI7B 3LNMB 2IW5A 2UU9O 4MTFA 3WB0A 5B1BB 2HJFC 4B3SB 1PKXA 4BR6A 3CX5F 5EIBD 2B9ZA 4UB8Z 4YIPA 4ZI7A 4MTOA 1D2DA 2IJIA 4JTAB 4UCOA 4DR5B 2ZDIA 3HKEA 4UV9A 4LNUA 1D5AA 2F1MA 2GTAA 4I4TA 4CH5A 2HEPA 4R7CA 1JA8A 3HKDB 1Q5OA 2GTSA 1J5EO 4PA4A 2ZE5A 4J11A 1AI7A 2OIGA 4DXWA 1CP9A 1TUBA 3ZRWA 1AR5A 3G67A 5JVDB 3H1JH 3TXSA 3E22A 4MVSA 1N4CA 4UCTA 4JI8O 4A5UB 4B3TO 3BABA 1FXHA 2UXXA 1YJNV 4JYAB 1WB7A 4LF6O 1AROP 1KUQA 2WLIB 4JI1O 4K0KO 2V4DA 1AJNA 2JGUA 3JAWB 4X66B 3ABTA 4I7ZB 4B3RB 3ZRVA 2A7WA 1NT2B 2PGGA 1AP6A 3CSXA 3JCUZ 2A3QA 5JCOA 1Y74B 5GONA 4DR2B 1URFA 3OGIB 1UFIA 4OXSA 2OWOA 3TXQA 4X9QA 1K34A 1L0NH 3BVOA 3OUFA 4EB6B 4OX9B 2RCVA 4YXWG 3ZCCA 4NTWA 2QWNB 3CWBH 5LGTA 4ZHQB 2UXBO 3GB7C 3L72H 2VWKA 3QO7A 4QPJA 4QE9A 4DR1B 3K79A 3H1IH 2UXDO 2F43G 5IE9A 4JYBA 3SPGA 2Y4UA 1ZSPA 2P6JA 4LFBB 4X62O 1IBLB 1I94B 1PV0A 3P30A 4N21A 4TSFG 4PHZA 4K8ZA 4MT8A 3WU2Z 2WAMA 4B7KA 4X1IB 1RPOA 2E74B 4GT1A 4Q6GA 3ZRSA 5JJEB 4IIJA 4J10A 1OCRC 3ETDA 5A9GA 3CCUV 1AVMA 4U7NA 4PDLA 4O4JB 1AP5A 2QWPB 3E89A 4WCEV 1G1XB 2UXNA 1K8AW 2ZE6A 3OTOB 1BHBA 2BSKA 3BRCA 3ZRXA 2CUGA 3A2FA 5KX5B 1TVKB 1Q3EA 3JALB 3CS5A 5GTHZ 2WLLA 1Y76B 4CBCA 3G6EV 5LMNO 1NR1A 3FAVB 2X6CA 5B1AB 5H6RA 5GTIZ 2DYRC 3F7VC 3SJBC 3SPJA 5EZYB 2NN4A 3BHPA 2QGNA 4O2BB 3F5TA 2BOCC 4ASUG 1IVSA 4JI2O 2GUZA 4ZBMA 2ZNJA 5LA6A 2F95B 2YEVB 3E83A 1RFYA 4X66O 3MD0A 3T1YO 1P4RA 3MHHC 1HNXB 2QEXV 4FLUA 4U3JB 1YIJV 3T4ZA 3E8FA 5IYZA 4AI8A 4I50B 2Q69A 4BW9A 5LMNB 2ZT9B 5LGUA 4H13B 1KP3A 2YUAA 1MA1A 2HG5C 4JI6B 4FIPC 2FMLA 4DYLA 5LP6B 3WB2A 4YHHO 1Q86W 1P84F 3OEHG 2LJ2A 3HKDA 4EEQA 3CCMV 4P9PA 3JAMN 4CH6A 5B1OA 2BTQB 5ITZA 4H33A 4YJ3A 3VQYA 2UUBO 5LL6Y 5J9PC 5KAIZ 2ZCEA 3B77A 2YXHA 3TCUA 4GX0A 2EIKB 1Q6HA 4TV9B 4B7EA 4DO2A 2K1EA 4TV8A 1YI2V 1GAXA 2QSAA 2ITDC 4PDVA 3JARA 1DGSA 2LFSA 1YTFB 2EULA 1I0HA 1NVPD 5E1AC 2AXTZ 4CS3A 3FYIB 4MTGA 1I08A 3W7TA 1SQPH 3NXSA 3FFQA 5BMVA 3A0HZ 2HFEC 1E79G 1SRYA 1H8HG 3F5WC 3FX7A 4MSWC 1VIBA 4KHPO 4I0XA 1GN2A 1NS1A 1JFFA 3G80A 2ILMA 4HYOA 2OTJV 4X1KA 5IJ9A 2Z3YA 5CA1A 1XMQB 1N36O 3HPLC 1V54B 3D36C 3J7AU 2YDEA 3CEIA 3D36A 1SETA 4TQFA 3I55V 4F4LA 4MVRA 1MABG 1BT8A 4D7TA 3ETGA 4R50A 4E4EA 1ZUQA 4GX1A 3K59A 2JS5A 2Q7EA 1PL0A 1XNQB 3C3TA 3AG3B 5CB4B 5CBHA 2W0FC 2BCCH 3J81N 4UCRA 1XILA 2ATKC 3FYEB 4J41A 4DK0A 1R6NA 3GWKC 3JD0A 3B8NA 4JAVA 2EINB 2IH3C 3U11A 4O2BA 3CMEV 4DV4B 1SERA 1NBMG 2YXLA 3ABMB 1GO3F 2JK5C 4UCSA 1KQSU 3LDCA 1TUEB 4RO2A 3K5LA 4XDKA 2DJVA 2LP7A 4UCUA 3CXHF 4NXNO 1NZ6A 3H1HH 5DM6V 4DR7O 3F7YC 4GYCB 3K3WA 4R6ZA 3RYFA 2WLIA 1S76D 5LOVB 2MK3A 2Z0AA 3H01A 5H5NA 2RN9A 1JJOA 1WP8A 1K4CC 2CK3G 3K0DA 1Q6UA 4O2AB 5FLXN 4JI3B 2YXYA 1SA0B 2DWEC 2VQFO 2XNDG 4YY3B 2C2AA 3BPZA 1PPJH 3VBBA 3SGIA 1OCOB 3APQA 2E3CA 2Q9LA 2YI9A 3ZN0A 2M6YA 1NVPB 5C93A 1SQVH 1YCIA 3DGEA 5C8YA 2NR5A 3BCCH 2QTSA 1SQXH 3SPIA 3CRCA 1PNMA 1WNSA 2EILB 5J2TB 5IY5B 4PJ0Z 5KA5A 1QU7A 1FPOA 4MVOA 4WBNB 4DRXB 5LMUB 1NU1H 4WFFA 2VQEO 4DV1B 4GX5A 2XTAA 5J2TA 3JSNA 4DV2O 4JZ2A 2QTOA 3RVZA 5GONB 5F2VO 5LBQA 5EZYA 1Q81W 5KHIA 3AG7A 3SR2C 4JI0B 4DV5O 4HZ3A 4JI7O 2LQTA 2YEVA 5EBMC 4K3AA 4JF3A 3QO8A 3ZMUA 3MDSA 1N0NA 4YJ2A 3ZMVA 4JAAA 1IX9A 3RN4A 1QVFU 4JI4B 4LF8B 1BL8A 1MNGA 1JR9A 3HR0A 4CS4A 3HKBA 2P4VA 4PDMA 3X2QC 5IJ0A 3UT5B 4W4LA 2FB5A 2RNBA 3WB1A 2W6JG 4CH4A 1GKFA 2HJDA 4BIUA 2GUZB 1I7FA 5LGNA 1US6A 2XT9A 3M8AA 4JPRA 2KG7B 4K8XA 1JCHA 3UQ8A 2P22C 1BCCH 3VQXA 1JQ0A 1T5EA 1JVMA 1Q7YW 2ZE7A 4J7JA 5FL7G 5FPOA 3RYCA 4LC1A 1XEQA 3J80N 1BQZA 3CRMA 4O2AA 3G71V 3CCJV 2F4VO 5JWPA 1AB3A 2GHYA 3HKCA 3JAKB 4XBFA 4AHCA 5KLVH 1V54C 1EZJA 3ABLC 3PJSK 2WLHA 3IFXA 1VF5B 3AK2A 2Q7GA 4DR1O 3OMNB 4JI0O 4GKKB 5L3DA 2ZKOA 5CA1B 4ZOLB 2ZR2A 5LMUO 5L3EA 1PNKA 4TWKA 2KB1A 3OTFA 3AG2C 5KUMA 3VQVA 1VQNV 2EJRA 5FPRA 4CS2A 1BMFG 4LH7A 1QR8A 2H8PC 3RYIB 3STLC 1FD9A 1MSDA 5CMUA 4ABMA 4PI0A 3RT3C 1IBMO 4UCVA 1VQ6V 2IU3A 4MS2A 4JI4O 1K97A 3CP1A 3ABLB 4LFAO 5IYCO 1MG1A 4J9YB 2CAZC 4JYCA 4UFZA 3W7XA 1X4TA 4IYHA 2GDSA 5CN0A 3CCLV 2UXCB 3ZN1A 3B40A 1VQPV 2PYLA 4D6TH 2VS0A 4PI2A 1F4MA 2KKWA 2XOKG 3B8MA 4FM1A 3T1CA 1R3JC 5EC2C 4Z2WA 1H8EG 3TJTA 2Q68A 2Q7HA 1M5IA 2YIDA 3SJCC 4FM2A 3E8HA 5DEDA 2BOBC 4UVCA 4LFAB 4X88A 5KX5A 1GM9A 2YICA 1Q6IA 2UU9B 1GM7A 4RUEA 2ZNIA 1NTZH 4KFMA 4NR1A 2DYRB 2A9HA 3UO3A 1FJGB 3QVNA 3ZHUA 4JYYA 5CBFA 3CE2A 4O4IA 4X65O 1M4UA 1N34O 4LF5B 1VQ9V 3C3SA 2F23A 1YJ9V 1GRJA 1RSOA 2EINC 1BQ0A 3ASOB 2QWRB 5LA6B 5IWAB 3MAQA 3I5DA 1N33O 5B1BC 3ETQA 1K5QA 2QKAA 5IDJA 5CA0B 1MOFA 1GK9A 4OGQB 4PA9A 2E76B 3TK1A 2Q8VA 5LOVA 4FFBB 2DYSB 4UUJC 4UXNA 2EZOA 3L9DA 5EYPB 2WA3A 1SZTA 4MTXA 4WF9V 4WBNA 4K35A 3E8GA 4JI5O 5DECA 1H2KA 4LF6B 2ARHA 2WWWA 4KHPB 4BAYA 4UV8A 1OCCB 1XBLA 5B1AC 1DTOA 4O4LA 3B09A 4Q20A 1S72V 3AG4C 3SPHA 3CMAV 2P4KA 1WP7A 1SF9A 2UXCO 3N2GA 2Y48A 3OT7A 2Y0IA 5L3BA 2ADPA 1OCOC 2A79B 4X1YA 2CDYA 3OTOO 4FLVA 1OHHG 2A0LA 3AG4B 2JIZG 3K08A 4FPPA 3KKYA 4DR2O 4GKJO 2DE0X 4X20B 2QKCA 1BS3A 5EBLC 3IC9A 2JDIG 3CC2V 3STZC 3FB8C 4DRXA 4Z1VA 3ZBHA 3A0BZ 2JJ2G 4X20A 4DR4O 1OV9A 2EX3A 3M7MX 1FXKA 3R66A 2LGQA 1HNZO 3B4SA 4WFAV 4DUYO 3BAAA 3IJ4A 1X59A 1W2BU 1OCZB 4PD4F 1F7YA 4I4TB 2OYQA 3C90A 5EK0A 4X64O 3SDLA 1AI4A 3A0RA 5AG2A 3DXRA 4DW0A 1GN3A 2ZE8A 5FNVA 1VF6A 2JEXA 4G27B 4B3MO 2K9PA 5JCOC 3K5NA 4FZ1A 5IJ0B 4MVZA 2UUCO 1AR4A 4XDLA 1KU9A 2UXBB 4DR4B 3JAKA 4DR3B 2M7WA 1CPYA 1HNZB 4R8CA 1TVKA 3OMAB 1XOUA 4BIOA 1YF2A 1SQQH 4J80A 1KB9F 4FLYA 4X8AA 2QA4V 3RVYA 5B66Z 4MVMA 1CXZB 4JTCB 5CBGA 4YY3O 1AILA 2OCCB 1BE3H 4DW1A 2X0LA 4DV7B 1YDXA 1H2SB 4K0KB 2CGNA 1JOYA 1L0LH 4AQYO 2UUAB 1RM1B 1AJPA 1KBHA 1NTMH 5BZBA 2LW1A 3W7UA 4O4IB 4NXMO 3LDDA 3JARB 1SKVA 2R72A 1A32A 1I5YA 1RSOB 2Y4TA 1IXMA 3JD1A 5JH7A 4G2KA 3LUTB 3NR7A 4HBNA 1F4NA 3AK3A 3BEHA 1LUVA 5KAFZ 1IBKB 5TISZ 5ITZB 1R3LC 4PA7A 4DV2B 4YJ3B 5CA0A 4ICGA 2EIJB 5H2FZ 4DV0O 1N8RW 1Y74A 3ASNC 1B6QA 1O9GA 1BHAA 1BSMA 2IJKA 2ITCC 4P2ZA 2UUBB 1M9NA 3DTUB 1HR0O 5JQGB 1DF4A 1B06A 2CTQA 5JJNB 2P90A 1R1BA 4EFBA 1ORQC 5H9CA 1DF5A 3GVMA 4KL1A 5LHHA 1VQ7V 2AHYA 4FLZA 1SC5B 3JALA 3QO5A 3EHBB 4H44B 4RAIA 5B5EZ 4HNAA 4F6RB 1VF7A 4WFEA 1HNWB 5H6QA 4JASA 4DR6B 2Q67A 1L8DA 4XDJA 2PF4E 4LF7B 2F66C 1IBMB 2UXDB
chains in the Genus database with same CATH topology
3ZRVA 1JJ2U 1JQ0A 1NR7A 1VQLV 3K04A 2B1IA 1JVMA 1Q7YW 5FL7G 1RM1C 2QM7A 4OXSA 4LC1A 2LFRA 3CC4V 4JAUA 3ABKC 3ASOC 3RW0A 1K34A 1VQ8V 3SJQC 2ZQMA 3G71V 3K06A 3CCJV 2D3OW 2EZPA 3OUFA 1QLEB 1M56C 2HKOA 3OMIB 4BW5A 5L3CA 2OCCC 2EBOA 4U7OA 2GHYA 4YXWG 3ZCCA 3ZIAG 3CCQV 4XBFA 5LGTA 1V54C 1EZJA 1FXVA 1DLBA 3ABLC 3PJSK 2WLHA 3GB7C 3IFXA 4GX2A 4KP4A 3QO7A 4QPJA 4UVBA 1WPXA 4I5SA 3TETA 3CCRV 3OMNB 3CC7V 4QE9A 2R9RB 2NLJC 5L3DA 1G4YB 3K79A 2F43G 2QM8A 1XL6A 2EIMC 3GWOA 4JYBA 4N23A 5EC1C 3SPGA 3OR7C 1NJIW 2P6JA 2ZR2A 5IYBO 5L3EA 1EFRG 1PNKA 1FXKC 4TWKA 3P30A 2KB1A 2Y69C 1QLEC 4N21A 4TSFG 2WSSG 3AG2C 5KUMA 4MT8A 1VQNV 2WAMA 4UVAA 3OM3B 2EJRA 3LSSA 2V7QG 1THZA 3LDEA 1G8MA 1E1RG 4FMTA 4JTDB 1RPOA 1BMFG 4FJCC 1QR8A 2H8PC 3STLC 4GT1A 4RUFA 3ZRSA 3FB5C 2ZXWB 2HVKC 2HVJC 1PD3A 1OCRC 3ETDA 5CMUA 5HFLA 1UJWB 3CCUV 3ML0A 2B1GA 4U7NA 4PDLA 3UKMA 4QJFB 1AR1B 1VQ6V 4WCEV 3E89A 2IU3A 2UXNA 4MS2A 1K97A 1K8AW 2ZR3A 3CP1A 3AEIA 3SYAA 3ABLB 1BHBA 5IYCO 3ZRXA 2DQ0A 1MG1A 2P67A 3OEEG 1NH2B 1JX9A 4J9YB 3T2MA 1WLEA 4JYCA 3W7XA 2WLLA 1AI5A 5CN0A 1K33A 3CCLV 4CBCA 3ZN1A 1VQPV 3G6EV 1K5SA 1NR1A 3CYOA 2DQ3A 3CXCU 2ZD9A 1J95A 2X6CA 5B1AB 1F4MA 4MVQA 2XOKG 3CCVV 4P9OA 2FTKA 5H6RA 1KC8W 3B8MA 1QBZA 5B3SC 2DYRC 3F7VC 2H94A 3SPJA 3T1CA 1M57C 1R3JC 1E1QG 4KUMA 5EC2C 1F51A 2BOCC 1H8EG 1K3EA 2WLNA 4QPKA 4ASUG 2YSUB 2Q68A 4ZBMA 1K7DA 3AG2B 1GTOA 2Y69B 2YEVB 3E83A 3MD0A 5LHGA 3CCSV 3SYPA 1ENVA 1P4RA 3MHHC 2QEXV 1KP2A 3E8HA 2BOBC 1YIJV 4UVCA 3T4ZA 3E8FA 2IJJA 4X88A 2XAHA 1GM9A 5B3SB 3UM7A 2Q69A 5IYDO 1Q82W 1M57B 1GM7A 1QR9A 4RUEA 2W6IG 4KFMA 2EIJC 2DYRB 2A9HA 5DN6G 5LGUA 3CD6V 5CBFA 1ROPA 3IC7A 1KP3A 3KG2A 4L87A 2HG5C 1VQ9V 4FIPC 1KECA 1YJ9V 1Q86W 2EINC 3OEHG 3CCMV 3ASOB 3CPWU 2XASA 4P9PA 3LSQA 5B1OA 3FKSG 1NQTA 1Y4MA 4H33A 4HAMA 3SYQA 2XAFA 5B1BC 1K5QA 1VQMV 5J9PC 5EBWC 3BY6A 4MVUA 1R6KA 2GSMB 3B77A 5IDJA 3TCUA 1MOFA 4GX0A 1GK9A 1NH2D 1YTFD 3SPCA 4EKWA 4PA9A 3TK1A 2EIKB 4QNHB 1PNLA 2HLDG 4DO2A 2K1EA 1YI2V 3R65A 2DYSB 4UUJC 4UXNA 2EZOA 3JD3A 3K9AA 1SZTA 1XL4A 4MTXA 5L3FA 2ITDC 4PDVA 4WF9V 2LFSA 1YTFB 4LBEC 5CA3A 4RQEA 1VQKV 1NVPD 5E1AC 3SYCA 2V1DA 3OE7G 3P32A 3SYOA 3FYIB 4MTGA 3E8GA 3W7TA 3I56V 3NXSA 5IY5C 5GW7A 4WFGA 2HFEC 3OW2U 3E2EA 1E79G 1SRYA 1H8HG 3JYCA 2WWWA 2PI4A 1W0JG 3F5WC 4BAYA 4MSWC 4UV8A 4X89A 1OCCB 1P7BA 3RBZA 4HYOA 5B1AC 2OT5A 2X6AA 3X2QB 1DTOA 2OTJV 4Q20A 2Z3YA 5KA6A 3OUSA 1S72V 3AG4C 3SPHA 3CMAV 3HPLC 1V54B 2DW4A 1CEZA 3OGCC 1VQOV 4MW8A 3ETEA 3D36A 2Y48A 2WLLB 1SETA 5L3BA 4ZKIA 3I55V 3AG1C 1AJQA 3EFFK 1OCOC 2A79B 2HR3A 4F4LA 4MVRA 1MABG 1V55B 1VQ4V 1OHHG 1H2GA 3ETGA 2A0LA 4R50A 1KKDA 3AG4B 2JIZG 3ASNB 3K08A 4GX1A 4MW3A 4FPPA 5HFMA 4Z1MG 1PL0A 2Q6AA 3AG3B 2DWDC 5CBHA 1QLNA 2W0FC 1GMGA 1KD1W 5EBLC 1S5HC 2JDIG 3CC2V 2ATKC 3IGAC 3FYEB 3STZC 3FB8C 2X6BA 1S3JA 1OCZC 2QKSA 1FFTB 3K0GA 4PA6A 1R6NA 3ABMC 3JD2A 3JD0A 2JJ2G 2WLKA 3ABUA 4GCZA 1AI6A 1QVGU 1FXKA 3B8NA 2XAJA 4JAVA 2EINB 2B5UA 4CZZA 1W0KG 4WFAV 3ZJZA 2IH3C 1R73A 2DYSC 2WPDG 3CMEV 3ABKB 2XAGA 5LHIA 1OCZB 1W2BU 1SERA 1NBMG 2QE7G 3ABMB 1GO3F 4PA3A 5EK0A 1K73W 1AI4A 1LNQA 2JK5C 3A0RA 1KQSU 3LDCA 2ZXWC 1TUEB 4RO2A 2PI5A 4XDKA 2NNUA 2JEXA 3FB6C 3JD4A 4G27B 2LP7A 2JEUA 3HB3B 1YSCA 4MVZA 4XDLA 1JPXA 3AG1B 3E86A 5DM6V 4H37A 2IU0A 2M7WA 1RPRA 1V55C 3F7YC 1CPYA 3K3WA 4R6ZA 4R8CA 1F23A 1FXKB 4FK5C 2WLIA 3OMAB 1S76D 2MK3A 1HWYA 4LCUC 3H01A 3WG7B 2CK3G 1K4CC 3K0DA 2Z5UA 1YITV 4WFHA 3CCEV 1YJWV 3M99B 4X8AA 2QA4V 4G28B 3RVYA 1R3IC 2IJHA 1MSWD 4MVMA 3OR6C 3ZRWB 1OCCC 2EIMB 4JTCB 3K03A 2DWEC 3W7SA 3OAAG 2XAQA 4P30A 5CBGA 1ZWIC 1R3KC 2XNDG 2OCCB 3G4SV 2R9IA 2IH1C 5B1NA 3WFVA 2C2AA 2X0LA 3T4DA 1GM8A 1H38A 3VBBA 2AHZA 1OCOB 1JOYA 2EILC 3JCZA 5L3GA 1RM1B 1AJPA 3ZN0A 3W7WA 2WLJA 5BZBA 1NVPB 3W7UA 5C93A 3DGEA 2WLMA 3LDDA 4PDRA 1OZ0A 3QNEA 3LNMB 2IW5A 1I5YA 4MTFA 3SPIA 1PNMA 2EILB 1YHQV 1IXMA 3JD1A 5IY5B 5B1BB 4G2KA 4E2LA 2HJFC 3LUTB 5KA5A 1PKXA 1F4NA 3BEHA 1FS0G 1M90W 1K92A 4MVOA 1COWG 4WFFA 2ZDIC 4MTOA 1R3LC 4PA7A 4GX5A 2IJIA 1K4DC 4JTAB 4J9ZB 1Y66A 2QTOA 3WG7C 5KUKA 3RVZA 4WFBV 2EIJB 2ZDIA 5LBQA 1VQ5V 1Q81W 2EIKC 3E35A 1N8RW 3ASNC 1B6QA 4UV9A 4HZ3A 1BHAA 1S0VA 2IJKA 2YEVA 2ITCC 4P2ZA 5EBMC 1M9NA 3DTUB 4JF3A 3AG3C 1DF4A 3QO8A 3ZMUA 1M56B 4R7CA 4LP8A 2P90A 1SESA 1EBOA 3ZMVA 2P7TC 4QE7A 4PA4A 1QVFU 1ORQC 1AI7A 4QIWF 5H9CA 4DXWA 1DF5A 1BL8A 3FB7C 2JJ1G 1CP9A 1QCEA 3ZRWA 4I9WA 1L1FA 5LHHA 1OCRB 4BIZA 3VOUA 3MHSC 1VQ7V 2AHYA 4MVSA 3OFNG 3ZMTA 4PDMA 3X2QC 1K9MW 3QO5A 3EHBB 1I5XA 1FXHA 2UXXA 1YJNV 4PELA 4RAIA 1NKDA 2X7RB 1S77D 3E8BA 1AROP 3ZMSA 2WLIB 2W6JG 1GKFA 4BIUA 4WFEA 5LGNA 4JGSA 5H6QA 4JASA 2OTLV 3D3IA 2Q67A 4XDJA 4JPRA 1AJNA 3ZMZA 4RQFA 3ABTA 1M1KW 4TT3G 1JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLL B;  3T1C A;  1M57 C;  1R3J C;  2EIL C;  5EC2 C;  3AG1 C;  3EFF K;  1OCO C;  2A79 B;  2BOC C;  2WLN A;  4MVR A;  4F4L A;  2Q68 A;  4ZBM A;  3K04 A;  1JVM A;  2A0L A;  4R50 A;  1KKD A;  3K08 A;  3E83 A;  4GX1 A;  4MW3 A;  2WLJ A;  5BZB A;  3SYP A;  4OXS A;  2Q6A A;  3E8H A;  2BOB C;  2DWD C;  3ABK C;  3ASO C;  2WLM A;  3RW0 A;  3LDD A;  3T4Z A;  2W0F C;  3E8F A;  4PDR A;  5CBH A;  4X88 A;  3SJQ C;  3K06 A;  5EBL C;  1S5H C;  3LNM B;  3OUF A;  3UM7 A;  1M56 C;  2ATK C;  3IGA C;  4MTF A;  3SPI A;  3STZ C;  2Q69 A;  3FB8 C;  4BW5 A;  2OCC C;  2X6B A;  4RUE A;  1OCZ C;  2QKS A;  3K0G A;  2EIJ C;  4KFM A;  2A9H A;  1V54 C;  2HJF C;  4PA6 A;  3ABL C;  3LUT B;  2WLH A;  3ABM C;  3GB7 C;  3IFX A;  3PJS K;  4GX2 A;  5CBF A;  3BEH A;  2WLK A;  4MVO A;  3KG2 A;  3TET A;  4QE9 A;  2HG5 C;  4WFF A;  2R9R B;  2NLJ C;  4MTO A;  1G4Y B;  1R3L C;  4PA7 A;  3ZJZ A;  4GX5 A;  1XL6 A;  2EIM C;  2IH3 C;  5EC1 C;  3SPG A;  2DYS C;  1K4D C;  2EIN C;  3OR7 C;  4J9Z B;  4JTA B;  2QTO A;  3WG7 C;  5KUK A;  3RVZ A;  4P9P A;  2EIK C;  4TWK A;  2Y69 C;  2KB1 A;  3ASN C;  1QLE C;  4H33 A;  3AG2 C;  4PA3 A;  5EK0 A;  4HZ3 A;  5KUM A;  3SYQ A;  1LNQ A;  5B1B C;  2JK5 C;  2YEV A;  3LDC A;  2ITC C;  4P2Z A;  5EBM C;  2ZXW C;  5J9P C;  3AG3 C;  5EBW C;  4JTD B;  3LDE A;  4MVU A;  4RO2 A;  4R7C A;  4XDK A;  3FB6 C;  4G27 B;  4LP8 A;  3TCU A;  4GX0 A;  3SPC A;  4EKW A;  2P7T C;  4PA9 A;  2H8P C;  4MVZ A;  3STL C;  4RUF A;  4XDL A;  4QE7 A;  3ZRS A;  4QNH B;  4PA4 A;  2K1E A;  3FB5 C;  3E86 A;  1ORQ C;  2HVK C;  3R65 A;  2HVJ C;  4DXW A;  4H37 A;  1BL8 A;  3FB7 C;  1OCR C;  4UUJ C;  4I9W A;  1V55 C;  3VOU A;  3F7Y C;  4PDL A;  2AHY A;  4MVS A;  1XL4 A;  4R6Z A;  4R8C A;  3UKM A;  2WLI A;  2ITD C;  4PDV A;  3E89 A;  4LBE C;  4LCU C;  4MS2 A;  4PDM A;  3X2Q C;  5E1A C;  3SYC A;  1K4C C;  3K0D A;  3SYA A;  3SYO A;  4MTG A;  3E8G A;  4WFH A;  4X8A A;  4RAI A;  4G28 B;  3RVY A;  1R3I C;  5IY5 C;  4MVM A;  4WFG A;  2HFE C;  3OR6 C;  4J9Y B;  1OCC C;  3T2M A;  3E8B A;  2WLI B;  2WLL A;  3JYC A;  3F5W C;  4JTC B;  3K03 A;  4MSW C;  4X89 A;  4CBC A;  1P7B A;  2DWE C;  4WFE A;  3RBZ A;  4HYO A;  5B1A C;  2X6A A;  2ZD9 A;  1J95 A;  4P30 A;  5CBG A;  2X6C A;  1ZWI C;  1R3K C;  2Q67 A;  4MVQ A;  4XDJ A;  2IH1 C;  3OUS A;  4P9O A;  3AG4 C;  3SPH A;  3HPL C;  5B3S C;  3OGC C;  3T4D A;  2DYR C;  3F7V C;  4MW8 A;  3SPJ A;  2AHZ A; 
#chains in the Genus database with same CATH topology
 3IAY A;  4D7S A;  1VQL V;  2B1I A;  1RM1 C;  1FAF A;  3CC4 V;  3UT5 A;  4JAU A;  3ZX6 A;  3RW0 A;  1Z5V A;  5BMV B;  2UUA O;  1VQ8 V;  4FLT A;  2ZQM A;  3K06 A;  2D3O W;  1QLE B;  2HKO A;  5IWA O;  4IT5 A;  2F4V B;  3OMI B;  5L3C A;  1N32 O;  2OCC C;  2EBO A;  5LYJ B;  1HNX O;  3ZIA G;  3CCQ V;  2JGD B;  4NXM B;  2FYU H;  1FXV A;  4GX2 A;  4FM0 A;  4NB5 A;  1M93 A;  4UVB A;  2IBZ H;  3P3P A;  4LFC O;  3CCR V;  3CHX A;  4LF4 O;  4LWS A;  2NLJ C;  2QM8 A;  2EIM C;  3GWO A;  4N23 A;  5EC1 C;  2CTR A;  1NJI W;  3KCY A;  5IYB O;  4DV4 O;  1FXK C;  1YVW A;  2DN9 A;  2Y69 C;  5CB4 A;  2OCH A;  3CJH A;  2Q4P A;  3H9V A;  4UVA A;  4IHJ B;  2KSD A;  3OM3 B;  1ZLZ A;  2V7Q G;  1THZ A;  3LDE A;  1G8M A;  1E1R G;  4FMT A;  2BTO A;  4JTD B;  4W4K A;  2N74 A;  4FJC C;  3AK1 A;  4TUY A;  2GBO A;  4JI8 B;  2ZXW B;  2HVK C;  1IDS A;  4B3T B;  1UPG A;  4LFC B;  2B1G A;  1IUR A;  3UKM A;  4QJF B;  1Q8I A;  2VRZ A;  2QDO A;  2E5L O;  2ZR3 A;  3D3Q A;  4FFK A;  2HP8 A;  3SYA A;  1S5L Z;  1N0J A;  2P67 A;  3OEE G;  1NH2 B;  3RFR A;  1SS3 A;  3ZED A;  3T2M A;  1S5J A;  4I55 B;  2QWO B;  1AI5 A;  4DK1 A;  2Q0O C;  1K5S A;  3CYO A;  2DQ3 A;  3CXC U;  1J95 A;  1QNM A;  4MVQ A;  3CCV V;  4P9O A;  2EJ7 A;  1KC8 W;  1H2N A;  5FNV B;  5B3S C;  4YJ2 B;  1XNR B;  5BXZ A;  1M57 C;  4KUM A;  1K3E A;  2FKX A;  3RGB A;  2DOS A;  2Y69 B;  3CCS V;  1HDJ A;  2FL4 A;  3JSL A;  2E75 B;  3EXA A;  2XAH A;  5IT9 N;  5LP6 C;  3UM7 A;  4NYK A;  4F6R A;  5IYD O;  1Q82 W;  4X64 B;  2XUM A;  2EIJ C;  3D8C A;  1FJG O;  5DN6 G;  3CD6 V;  2JS3 A;  3DSQ A;  4X65 B;  3KCX A;  4L87 A;  3JAT B;  1ZL8 A;  1KEC A;  4NTY A;  3N27 A;  1MZF A;  2AZ0 A;  1NQT A;  2GV9 A;  1QHT A;  4GLX A;  1Y76 A;  2XAF A;  3JAS B;  4NXN B;  1NTK H;  4LFB O;  2BE3 A;  5EBW C;  1R6K A;  3L70 H;  1NH2 D;  4QNH B;  2JVD A;  1PNL A;  2HLD G;  4FVM A;  4I9Q A;  3SJA C;  2DMX A;  4DUZ O;  3JD3 A;  2HHH O;  2VQE B;  2R9A A;  1VQK V;  1SQB H;  1EN6 A;  3SYC A;  2V1D A;  2WA4 A;  5IY5 C;  2N05 A;  4IL6 Z;  4O4H B;  4DV6 O;  3OW2 U;  5KHH A;  3JYC A;  2PI4 A;  3BFR A;  1P7B A;  4BWA A;  3RBZ A;  2OT5 A;  3X2Q B;  3UCS C;  5K1X A;  1VAR A;  2DW4 A;  1CEZ A;  1VQO V;  4MW8 A;  3ETE A;  2PTM A;  4B3S O;  4LF8 O;  4CH3 A;  4ZKI A;  2MW2 B;  3AG1 C;  1AJQ A;  3EFF K;  2VQF B;  3HKE B;  2HR3 A;  2BTQ A;  1V55 B;  2YIB A;  4FLW A;  3ASN B;  1XMO B;  3G6B A;  4IGG A;  1I94 O;  5HFM A;  2AGA A;  3TGU H;  3RWR D;  2DWD C;  1U97 A;  3U0Z A;  3FD9 A;  1OJH A;  1GMG A;  4LWS B;  1HP8 A;  1S5H C;  4RWU A;  4B08 A;  3N2K A;  2L6L A;  1S3J A;  1OCZ C;  1FFT B;  1U96 A;  3K0G A;  2ADQ B;  2PYJ A;  3ZHV A;  3JD2 A;  3ABU A;  1B04 A;  1QVG U;  3LSU A;  2Q73 A;  4IIJ B;  3L75 H;  2N04 A;  2Y0P A;  3RYH B;  3QF7 A;  4DUY B;  2B5U A;  4CZZ A;  1W0K G;  3ZJZ A;  2DYS C;  2Q0A A;  3PN1 A;  3DC5 A;  2E5L B;  4X62 B;  2QE7 G;  2BSK B;  4PA3 A;  1EZV H;  1K73 W;  1LNQ A;  2ZXW C;  2ZIN A;  2NNU A;  3FB6 C;  3JD4 A;  3BA8 A;  3APO A;  2JEU A;  5BR8 O;  1FYJ A;  4JI1 B;  3AG1 B;  3QTC A;  5LXT B;  3E86 A;  4DR3 O;  1V55 C;  4HNA B;  1MMM A;  1F23 A;  1FXK B;  4FK5 C;  1PM9 A;  2YS8 A;  1HWY A;  4LCU C;  4ZIB A;  3WG7 B;  1EN5 A;  5LXT A;  1R3I C;  2IJH A;  1MSW D;  4DV3 B;  3OR6 C;  3ZRW B;  1OCC C;  1VF6 C;  4U3F H;  2EIM B;  4GUN A;  2YIB D;  3K03 A;  1J5E B;  1Y6X A;  2KG7 A;  1XI1 A;  3OAA G;  1WA8 A;  1ZWI C;  4LF9 B;  3G4S V;  2R9I A;  3WFV A;  4I0X B;  2YIA A;  1GM8 A;  1XNR O;  1H2L A;  1PP9 H;  3JCZ A;  1EN4 A;  3O65 A;  4TOI A;  1WA8 B;  3W7W A;  2PY5 A;  5EYP A;  2WLM A;  1OZ0 A;  3B2E E;  3S3X A;  2RQ6 A;  3K9S A;  1FFX B;  1YHQ V;  1NI8 A;  4KXR A;  4E2L A;  1FS0 G;  1M90 W;  3ICX A;  1K92 A;  4JV5 O;  3JAS A;  1COW G;  3E22 B;  2ZDI C;  1TA8 A;  3T1H O;  3KZI Z;  3CJH B;  1K4D C;  4IHJ A;  4J9Z B;  1Y66 A;  3WG7 C;  5KUK A;  4WFB V;  1VQ5 V;  2AW9 A;  4DR5 O;  2EIK C;  5A2Q N;  3E35 A;  2YC0 A;  4AIL C;  4QGP A;  1S0V A;  1XRE A;  4TUY B;  3AG3 C;  1M56 B;  1MZE A;  4DR7 B;  1SQF A;  4LP8 A;  3JAW A;  1SES A;  1EBO A;  3Q4H B;  2P7T C;  4QE7 A;  3CRR A;  5J2U A;  4JZG A;  4QIW F;  2RJZ A;  4DUZ B;  3FB7 C;  2P06 A;  2JJ1 G;  4J7Z A;  3H1L H;  1QCE A;  4I9W A;  1L1F A;  1OCR B;  4BIZ A;  3VOU A;  4H0L B;  3MHS C;  1BZK A;  4TQD A;  4JI3 O;  4C7U A;  3OFN G;  3ZMT A;  1K9M W;  1I5X A;  3S3W A;  4PEL A;  1NKD A;  2X7R B;  1S77 D;  1N33 B;  3E8B A;  3ZMS A;  4ZHQ A;  4IYI A;  3N2G B;  4DR6 O;  4JGS A;  2OTL V;  1HNW O;  3D3I A;  4X1Y B;  4DV3 O;  4RQF A;  2QR4 A;  3ZMZ A;  2ETN A;  5D5P A;  3LNN A;  1M1K W;  4TT3 G;  3ZS8 C;  4GZR B;  1JJ2 U;  4X1K B;  5IJ9 B;  1NR7 A;  1RP3 B;  1TGO A;  3CB2 A;  3K04 A;  1XMO O;  2QM7 A;  2LFR A;  3ABK C;  3ASO C;  1YEW A;  3SJQ C;  2EZP A;  4OX9 O;  4I55 A;  1M56 C;  2O57 A;  4BW5 A;  3ZHT A;  4U7O A;  4DV7 O;  3K57 A;  3L71 H;  1DLB A;  2G38 A;  5KMG B;  1XDC A;  4KP4 A;  5KHJ A;  1WB8 A;  1WPX A;  4I5S A;  3TET A;  3CC7 V;  1P49 A;  5IYZ B;  2R9R B;  1ZAU A;  4I50 A;  4OPH A;  1G4Y B;  1XL6 A;  2IM9 A;  3DC6 A;  3OR7 C;  4OPA A;  1KYO F;  1XQ8 A;  3THO A;  3CRA A;  4JV5 B;  2ZIM A;  1EFR G;  1WPB A;  1QLE C;  2WSS G;  1WJZ A;  3LSS A;  2OIE A;  5LYJ A;  4B3M B;  4RUF A;  4JI6 O;  2UUC B;  3FB5 C;  2HVJ C;  1PD3 A;  1Z5W A;  5HFL A;  1ZTE A;  4O4H A;  1UJW B;  3ML0 A;  4LF7 O;  4J42 A;  4PV1 B;  2P5O A;  1AR1 B;  1FKA O;  1BGY H;  4FLX A;  4CC5 A;  3ZHS A;  2ZM6 B;  1D5N A;  3AEI A;  3A8T A;  3HKB B;  2DQ0 A;  2LO1 A;  1JX9 A;  1WLE A;  4O4L B;  2ODM A;  1VMG A;  1K33 A;  2VWJ A;  2ZD9 A;  3Q4H A;  2FTK A;  1QBZ A;  1Q43 A;  4UB6 Z;  2H94 A;  5D5Q A;  5JJJ B;  4F6E A;  1E1Q G;  1XHX A;  1F51 A;  2WLN A;  4QPK A;  2YSU B;  1K7D A;  2A06 H;  3AG2 B;  1GTO A;  4LNU B;  5LHG A;  1GN6 A;  3T1Y B;  3SYP A;  1ENV A;  1KP2 A;  2ZM6 O;  2IJJ A;  1IBL O;  2L35 A;  5B3S B;  4J7K A;  1WAZ A;  1M57 B;  1V9P A;  4U3J A;  1QR9 A;  1SZX A;  2W6I G;  4GKK O;  1XMQ O;  1N36 B;  4TV8 B;  3JAT A;  1ROP A;  4EB6 A;  3IC7 A;  1Y67 A;  1XHZ A;  3KG2 A;  4DV1 O;  1IBK O;  3UO2 A;  1P7G A;  2CE4 A;  1XNQ O;  3CPW U;  2XAS A;  3L73 H;  3LSQ A;  4JI5 B;  3FKS G;  3QG5 A;  5LP6 A;  1Y4M A;  1SA0 A;  4HAM A;  4JI7 B;  3SYQ A;  4ZOL A;  5EIB C;  2JRI A;  1JFF B;  4EFE A;  1VQM V;  2RDC A;  3BY6 A;  4MVU A;  4YIO A;  2GSM B;  5JH7 B;  3FAV A;  3SPC A;  4EKW A;  1YTF D;  1QQC A;  4LF4 B;  1ZX3 A;  5KMG A;  1DK1 A;  1GH6 A;  3R65 A;  2JGD A;  1WN7 A;  2Q5Z A;  3K9A A;  2PZS A;  2CTP A;  1XL4 A;  4NVP A;  5L3F A;  3EVK A;  2HHH B;  4LH6 A;  4LBE C;  5CA3 A;  4RQE A;  3K58 A;  4GKJ B;  1TAE A;  2CH7 B;  1B3Q A;  3OE7 G;  3P32 A;  3SYO A;  1SQG A;  3I56 V;  3BA9 A;  5GW7 A;  4WFG A;  3E2E A;  5JVD A;  1IZ3 A;  5BR8 B;  1W0J G;  4X89 A;  1YXB A;  3DXR B;  2X6A A;  5KA6 A;  5KHK A;  3OUS A;  4NTX A;  3OGC C;  5BY1 A;  4LR3 A;  2WLL B;  4L8J A;  1FFX A;  1VQ4 V;  1GN4 A;  1YZB A;  1H2G A;  3ZHR A;  1KKD A;  4MW3 A;  4Z1M G;  2Q6A A;  2QJ1 A;  4FZ0 A;  1QLN A;  1PL4 A;  1KD1 W;  3IGA C;  1KMI Z;  2X6B A;  2QKS A;  2H3O A;  4FFB A;  1G6U A;  4PA6 A;  1H2M A;  3ABM C;  3RYI A;  2WLK A;  4GCZ A;  1AI6 A;  1TUB B;  4O4J A;  1IXB A;  1R6T A;  3RYF B;  1VP7 A;  2XAJ A;  3ZHQ A;  2F93 B;  1R73 A;  2WPD G;  3ABK B;  1HR0 B;  2XAG A;  5LHI A;  3L74 H;  2QM4 A;  1N34 B;  4LF5 O;  5JQG A;  2CTW A;  2XHB A;  3P3N A;  1Z2G A;  3K5M A;  2W0X A;  5J2U B;  2PI5 A;  1LR1 A;  4DV0 B;  4DV6 B;  1N32 B;  2RMK B;  3HB3 B;  2ZIO A;  1YSC A;  1JPX A;  3U10 A;  2QWQ B;  3CRQ A;  4YHH B;  3T1H B;  2AZ2 A;  4H37 A;  3K5O A;  2IU0 A;  5KHG A;  4AQY B;  2LW7 A;  1RPR A;  2LGW A;  3RYC B;  4JYA O;  1LUW A;  4X1I A;  4DV5 B;  2PUS A;  4TV9 A;  2KQX A;  5C8Y B;  3H1K H;  1YIT V;  2Z5U A;  1ZL8 B;  4NKG B;  4WFH A;  3CCE V;  1HW7 A;  1YJW V;  3M99 B;  3HKC B;  4G28 B;  1W59 A;  1EM1 A;  3O9O A;  1VEW A;  4CC6 A;  5E79 Z;  3W7S A;  1JMK C;  1O9H A;  2XAQ A;  4P30 A;  1R3K C;  5B1N A;  2IH1 C;  4LF9 O;  1KKC A;  2D2C B;  5K1P A;  3T4D A;  1Q90 D;  1H38 A;  2AHZ A;  2EIL C;  5L3G A;  3N2K B;  3OD4 A;  2YI8 A;  1XUQ A;  4JI2 B;  2WLJ A;  2CGO A;  4B3R O;  2CH7 A;  2R70 A;  4PDR A;  3VQW A;  3RYH A;  3QNE A;  4ZI7 B;  3LNM B;  2IW5 A;  2UU9 O;  4MTF A;  3WB0 A;  5B1B B;  2HJF C;  4B3S B;  1PKX A;  4BR6 A;  3CX5 F;  5EIB D;  2B9Z A;  4UB8 Z;  4YIP A;  4ZI7 A;  4MTO A;  1D2D A;  2IJI A;  4JTA B;  4UCO A;  4DR5 B;  2ZDI A;  3HKE A;  4UV9 A;  4LNU A;  1D5A A;  2F1M A;  2GTA A;  4I4T A;  4CH5 A;  2HEP A;  4R7C A;  1JA8 A;  3HKD B;  1Q5O A;  2GTS A;  1J5E O;  4PA4 A;  2ZE5 A;  4J11 A;  1AI7 A;  2OIG A;  4DXW A;  1CP9 A;  1TUB A;  3ZRW A;  1AR5 A;  3G67 A;  5JVD B;  3H1J H;  3TXS A;  3E22 A;  4MVS A;  1N4C A;  4UCT A;  4JI8 O;  4A5U B;  4B3T O;  3BAB A;  1FXH A;  2UXX A;  1YJN V;  4JYA B;  1WB7 A;  4LF6 O;  1ARO P;  1KUQ A;  2WLI B;  4JI1 O;  4K0K O;  2V4D A;  1AJN A;  2JGU A;  3JAW B;  4X66 B;  3ABT A;  4I7Z B;  4B3R B;  3ZRV A;  2A7W A;  1NT2 B;  2PGG A;  1AP6 A;  3CSX A;  3JCU Z;  2A3Q A;  5JCO A;  1Y74 B;  5GON A;  4DR2 B;  1URF A;  3OGI B;  1UFI A;  4OXS A;  2OWO A;  3TXQ A;  4X9Q A;  1K34 A;  1L0N H;  3BVO A;  3OUF A;  4EB6 B;  4OX9 B;  2RCV A;  4YXW G;  3ZCC A;  4NTW A;  2QWN B;  3CWB H;  5LGT A;  4ZHQ B;  2UXB O;  3GB7 C;  3L72 H;  2VWK A;  3QO7 A;  4QPJ A;  4QE9 A;  4DR1 B;  3K79 A;  3H1I H;  2UXD O;  2F43 G;  5IE9 A;  4JYB A;  3SPG A;  2Y4U A;  1ZSP A;  2P6J A;  4LFB B;  4X62 O;  1IBL B;  1I94 B;  1PV0 A;  3P30 A;  4N21 A;  4TSF G;  4PHZ A;  4K8Z A;  4MT8 A;  3WU2 Z;  2WAM A;  4B7K A;  4X1I B;  1RPO A;  2E74 B;  4GT1 A;  4Q6G A;  3ZRS A;  5JJE B;  4IIJ A;  4J10 A;  1OCR C;  3ETD A;  5A9G A;  3CCU V;  1AVM A;  4U7N A;  4PDL A;  4O4J B;  1AP5 A;  2QWP B;  3E89 A;  4WCE V;  1G1X B;  2UXN A;  1K8A W;  2ZE6 A;  3OTO B;  1BHB A;  2BSK A;  3BRC A;  3ZRX A;  2CUG A;  3A2F A;  5KX5 B;  1TVK B;  1Q3E A;  3JAL B;  3CS5 A;  5GTH Z;  2WLL A;  1Y76 B;  4CBC A;  3G6E V;  5LMN O;  1NR1 A;  3FAV B;  2X6C A;  5B1A B;  5H6R A;  5GTI Z;  2DYR C;  3F7V C;  3SJB C;  3SPJ A;  5EZY B;  2NN4 A;  3BHP A;  2QGN A;  4O2B B;  3F5T A;  2BOC C;  4ASU G;  1IVS A;  4JI2 O;  2GUZ A;  4ZBM A;  2ZNJ A;  5LA6 A;  2F95 B;  2YEV B;  3E83 A;  1RFY A;  4X66 O;  3MD0 A;  3T1Y O;  1P4R A;  3MHH C;  1HNX B;  2QEX V;  4FLU A;  4U3J B;  1YIJ V;  3T4Z A;  3E8F A;  5IYZ A;  4AI8 A;  4I50 B;  2Q69 A;  4BW9 A;  5LMN B;  2ZT9 B;  5LGU A;  4H13 B;  1KP3 A;  2YUA A;  1MA1 A;  2HG5 C;  4JI6 B;  4FIP C;  2FML A;  4DYL A;  5LP6 B;  3WB2 A;  4YHH O;  1Q86 W;  1P84 F;  3OEH G;  2LJ2 A;  3HKD A;  4EEQ A;  3CCM V;  4P9P A;  3JAM N;  4CH6 A;  5B1O A;  2BTQ B;  5ITZ A;  4H33 A;  4YJ3 A;  3VQY A;  2UUB O;  5LL6 Y;  5J9P C;  5KAI Z;  2ZCE A;  3B77 A;  2YXH A;  3TCU A;  4GX0 A;  2EIK B;  1Q6H A;  4TV9 B;  4B7E A;  4DO2 A;  2K1E A;  4TV8 A;  1YI2 V;  1GAX A;  2QSA A;  2ITD C;  4PDV A;  3JAR A;  1DGS A;  2LFS A;  1YTF B;  2EUL A;  1I0H A;  1NVP D;  5E1A C;  2AXT Z;  4CS3 A;  3FYI B;  4MTG A;  1I08 A;  3W7T A;  1SQP H;  3NXS A;  3FFQ A;  5BMV A;  3A0H Z;  2HFE C;  1E79 G;  1SRY A;  1H8H G;  3F5W C;  3FX7 A;  4MSW C;  1VIB A;  4KHP O;  4I0X A;  1GN2 A;  1NS1 A;  1JFF A;  3G80 A;  2ILM A;  4HYO A;  2OTJ V;  4X1K A;  5IJ9 A;  2Z3Y A;  5CA1 A;  1XMQ B;  1N36 O;  3HPL C;  1V54 B;  3D36 C;  3J7A U;  2YDE A;  3CEI A;  3D36 A;  1SET A;  4TQF A;  3I55 V;  4F4L A;  4MVR A;  1MAB G;  1BT8 A;  4D7T A;  3ETG A;  4R50 A;  4E4E A;  1ZUQ A;  4GX1 A;  3K59 A;  2JS5 A;  2Q7E A;  1PL0 A;  1XNQ B;  3C3T A;  3AG3 B;  5CB4 B;  5CBH A;  2W0F C;  2BCC H;  3J81 N;  4UCR A;  1XIL A;  2ATK C;  3FYE B;  4J41 A;  4DK0 A;  1R6N A;  3GWK C;  3JD0 A;  3B8N A;  4JAV A;  2EIN B;  2IH3 C;  3U11 A;  4O2B A;  3CME V;  4DV4 B;  1SER A;  1NBM G;  2YXL A;  3ABM B;  1GO3 F;  2JK5 C;  4UCS A;  1KQS U;  3LDC A;  1TUE B;  4RO2 A;  3K5L A;  4XDK A;  2DJV A;  2LP7 A;  4UCU A;  3CXH F;  4NXN O;  1NZ6 A;  3H1H H;  5DM6 V;  4DR7 O;  3F7Y C;  4GYC B;  3K3W A;  4R6Z A;  3RYF A;  2WLI A;  1S76 D;  5LOV B;  2MK3 A;  2Z0A A;  3H01 A;  5H5N A;  2RN9 A;  1JJO A;  1WP8 A;  1K4C C;  2CK3 G;  3K0D A;  1Q6U A;  4O2A B;  5FLX N;  4JI3 B;  2YXY A;  1SA0 B;  2DWE C;  2VQF O;  2XND G;  4YY3 B;  2C2A A;  3BPZ A;  1PPJ H;  3VBB A;  3SGI A;  1OCO B;  3APQ A;  2E3C A;  2Q9L A;  2YI9 A;  3ZN0 A;  2M6Y A;  1NVP B;  5C93 A;  1SQV H;  1YCI A;  3DGE A;  5C8Y A;  2NR5 A;  3BCC H;  2QTS A;  1SQX H;  3SPI A;  3CRC A;  1PNM A;  1WNS A;  2EIL B;  5J2T B;  5IY5 B;  4PJ0 Z;  5KA5 A;  1QU7 A;  1FPO A;  4MVO A;  4WBN B;  4DRX B;  5LMU B;  1NU1 H;  4WFF A;  2VQE O;  4DV1 B;  4GX5 A;  2XTA A;  5J2T A;  3JSN A;  4DV2 O;  4JZ2 A;  2QTO A;  3RVZ A;  5GON B;  5F2V O;  5LBQ A;  5EZY A;  1Q81 W;  5KHI A;  3AG7 A;  3SR2 C;  4JI0 B;  4DV5 O;  4HZ3 A;  4JI7 O;  2LQT A;  2YEV A;  5EBM C;  4K3A A;  4JF3 A;  3QO8 A;  3ZMU A;  3MDS A;  1N0N A;  4YJ2 A;  3ZMV A;  4JAA A;  1IX9 A;  3RN4 A;  1QVF U;  4JI4 B;  4LF8 B;  1BL8 A;  1MNG A;  1JR9 A;  3HR0 A;  4CS4 A;  3HKB A;  2P4V A;  4PDM A;  3X2Q C;  5IJ0 A;  3UT5 B;  4W4L A;  2FB5 A;  2RNB A;  3WB1 A;  2W6J G;  4CH4 A;  1GKF A;  2HJD A;  4BIU A;  2GUZ B;  1I7F A;  5LGN A;  1US6 A;  2XT9 A;  3M8A A;  4JPR A;  2KG7 B;  4K8X A;  1JCH A;  3UQ8 A;  2P22 C;  1BCC H;  3VQX A;  1JQ0 A;  1T5E A;  1JVM A;  1Q7Y W;  2ZE7 A;  4J7J A;  5FL7 G;  5FPO A;  3RYC A;  4LC1 A;  1XEQ A;  3J80 N;  1BQZ A;  3CRM A;  4O2A A;  3G71 V;  3CCJ V;  2F4V O;  5JWP A;  1AB3 A;  2GHY A;  3HKC A;  3JAK B;  4XBF A;  4AHC A;  5KLV H;  1V54 C;  1EZJ A;  3ABL C;  3PJS K;  2WLH A;  3IFX A;  1VF5 B;  3AK2 A;  2Q7G A;  4DR1 O;  3OMN B;  4JI0 O;  4GKK B;  5L3D A;  2ZKO A;  5CA1 B;  4ZOL B;  2ZR2 A;  5LMU O;  5L3E A;  1PNK A;  4TWK A;  2KB1 A;  3OTF A;  3AG2 C;  5KUM A;  3VQV A;  1VQN V;  2EJR A;  5FPR A;  4CS2 A;  1BMF G;  4LH7 A;  1QR8 A;  2H8P C;  3RYI B;  3STL C;  1FD9 A;  1MSD A;  5CMU A;  4ABM A;  4PI0 A;  3RT3 C;  1IBM O;  4UCV A;  1VQ6 V;  2IU3 A;  4MS2 A;  4JI4 O;  1K97 A;  3CP1 A;  3ABL B;  4LFA O;  5IYC O;  1MG1 A;  4J9Y B;  2CAZ C;  4JYC A;  4UFZ A;  3W7X A;  1X4T A;  4IYH A;  2GDS A;  5CN0 A;  3CCL V;  2UXC B;  3ZN1 A;  3B40 A;  1VQP V;  2PYL A;  4D6T H;  2VS0 A;  4PI2 A;  1F4M A;  2KKW A;  2XOK G;  3B8M A;  4FM1 A;  3T1C A;  1R3J C;  5EC2 C;  4Z2W A;  1H8E G;  3TJT A;  2Q68 A;  2Q7H A;  1M5I A;  2YID A;  3SJC C;  4FM2 A;  3E8H A;  5DED A;  2BOB C;  4UVC A;  4LFA B;  4X88 A;  5KX5 A;  1GM9 A;  2YIC A;  1Q6I A;  2UU9 B;  1GM7 A;  4RUE A;  2ZNI A;  1NTZ H;  4KFM A;  4NR1 A;  2DYR B;  2A9H A;  3UO3 A;  1FJG B;  3QVN A;  3ZHU A;  4JYY A;  5CBF A;  3CE2 A;  4O4I A;  4X65 O;  1M4U A;  1N34 O;  4LF5 B;  1VQ9 V;  3C3S A;  2F23 A;  1YJ9 V;  1GRJ A;  1RSO A;  2EIN C;  1BQ0 A;  3ASO B;  2QWR B;  5LA6 B;  5IWA B;  3MAQ A;  3I5D A;  1N33 O;  5B1B C;  3ETQ A;  1K5Q A;  2QKA A;  5IDJ A;  5CA0 B;  1MOF A;  1GK9 A;  4OGQ B;  4PA9 A;  2E76 B;  3TK1 A;  2Q8V A;  5LOV A;  4FFB B;  2DYS B;  4UUJ C;  4UXN A;  2EZO A;  3L9D A;  5EYP B;  2WA3 A;  1SZT A;  4MTX A;  4WF9 V;  4WBN A;  4K35 A;  3E8G A;  4JI5 O;  5DEC A;  1H2K A;  4LF6 B;  2ARH A;  2WWW A;  4KHP B;  4BAY A;  4UV8 A;  1OCC B;  1XBL A;  5B1A C;  1DTO A;  4O4L A;  3B09 A;  4Q20 A;  1S72 V;  3AG4 C;  3SPH A;  3CMA V;  2P4K A;  1WP7 A;  1SF9 A;  2UXC O;  3N2G A;  2Y48 A;  3OT7 A;  2Y0I A;  5L3B A;  2ADP A;  1OCO C;  2A79 B;  4X1Y A;  2CDY A;  3OTO O;  4FLV A;  1OHH G;  2A0L A;  3AG4 B;  2JIZ G;  3K08 A;  4FPP A;  3KKY A;  4DR2 O;  4GKJ O;  2DE0 X;  4X20 B;  2QKC A;  1BS3 A;  5EBL C;  3IC9 A;  2JDI G;  3CC2 V;  3STZ C;  3FB8 C;  4DRX A;  4Z1V A;  3ZBH A;  3A0B Z;  2JJ2 G;  4X20 A;  4DR4 O;  1OV9 A;  2EX3 A;  3M7M X;  1FXK A;  3R66 A;  2LGQ A;  1HNZ O;  3B4S A;  4WFA V;  4DUY O;  3BAA A;  3IJ4 A;  1X59 A;  1W2B U;  1OCZ B;  4PD4 F;  1F7Y A;  4I4T B;  2OYQ A;  3C90 A;  5EK0 A;  4X64 O;  3SDL A;  1AI4 A;  3A0R A;  5AG2 A;  3DXR A;  4DW0 A;  1GN3 A;  2ZE8 A;  5FNV A;  1VF6 A;  2JEX A;  4G27 B;  4B3M O;  2K9P A;  5JCO C;  3K5N A;  4FZ1 A;  5IJ0 B;  4MVZ A;  2UUC O;  1AR4 A;  4XDL A;  1KU9 A;  2UXB B;  4DR4 B;  3JAK A;  4DR3 B;  2M7W A;  1CPY A;  1HNZ B;  4R8C A;  1TVK A;  3OMA B;  1XOU A;  4BIO A;  1YF2 A;  1SQQ H;  4J80 A;  1KB9 F;  4FLY A;  4X8A A;  2QA4 V;  3RVY A;  5B66 Z;  4MVM A;  1CXZ B;  4JTC B;  5CBG A;  4YY3 O;  1AIL A;  2OCC B;  1BE3 H;  4DW1 A;  2X0L A;  4DV7 B;  1YDX A;  1H2S B;  4K0K B;  2CGN A;  1JOY A;  1L0L H;  4AQY O;  2UUA B;  1RM1 B;  1AJP A;  1KBH A;  1NTM H;  5BZB A;  2LW1 A;  3W7U A;  4O4I B;  4NXM O;  3LDD A;  3JAR B;  1SKV A;  2R72 A;  1A32 A;  1I5Y A;  1RSO B;  2Y4T A;  1IXM A;  3JD1 A;  5JH7 A;  4G2K A;  3LUT B;  3NR7 A;  4HBN A;  1F4N A;  3AK3 A;  3BEH A;  1LUV A;  5KAF Z;  1IBK B;  5TIS Z;  5ITZ B;  1R3L C;  4PA7 A;  4DV2 B;  4YJ3 B;  5CA0 A;  4ICG A;  2EIJ B;  5H2F Z;  4DV0 O;  1N8R W;  1Y74 A;  3ASN C;  1B6Q A;  1O9G A;  1BHA A;  1BSM A;  2IJK A;  2ITC C;  4P2Z A;  2UUB B;  1M9N A;  3DTU B;  1HR0 O;  5JQG B;  1DF4 A;  1B06 A;  2CTQ A;  5JJN B;  2P90 A;  1R1B A;  4EFB A;  1ORQ C;  5H9C A;  1DF5 A;  3GVM A;  4KL1 A;  5LHH A;  1VQ7 V;  2AHY A;  4FLZ A;  1SC5 B;  3JAL A;  3QO5 A;  3EHB B;  4H44 B;  4RAI A;  5B5E Z;  4HNA A;  4F6R B;  1VF7 A;  4WFE A;  1HNW B;  5H6Q A;  4JAS A;  4DR6 B;  2Q67 A;  1L8D A;  4XDJ A;  2PF4 E;  4LF7 B;  2F66 C;  1IBM B;  2UXD B; 
#chains in the Genus database with same CATH homology
 3ZRV A;  1JJ2 U;  1JQ0 A;  1NR7 A;  1VQL V;  3K04 A;  2B1I A;  1JVM A;  1Q7Y W;  5FL7 G;  1RM1 C;  2QM7 A;  4OXS A;  4LC1 A;  2LFR A;  3CC4 V;  4JAU A;  3ABK C;  3ASO C;  3RW0 A;  1K34 A;  1VQ8 V;  3SJQ C;  2ZQM A;  3G71 V;  3K06 A;  3CCJ V;  2D3O W;  2EZP A;  3OUF A;  1QLE B;  1M56 C;  2HKO A;  3OMI B;  4BW5 A;  5L3C A;  2OCC C;  2EBO A;  4U7O A;  2GHY A;  4YXW G;  3ZCC A;  3ZIA G;  3CCQ V;  4XBF A;  5LGT A;  1V54 C;  1EZJ A;  1FXV A;  1DLB A;  3ABL C;  3PJS K;  2WLH A;  3GB7 C;  3IFX A;  4GX2 A;  4KP4 A;  3QO7 A;  4QPJ A;  4UVB A;  1WPX A;  4I5S A;  3TET A;  3CCR V;  3OMN B;  3CC7 V;  4QE9 A;  2R9R B;  2NLJ C;  5L3D A;  1G4Y B;  3K79 A;  2F43 G;  2QM8 A;  1XL6 A;  2EIM C;  3GWO A;  4JYB A;  4N23 A;  5EC1 C;  3SPG A;  3OR7 C;  1NJI W;  2P6J A;  2ZR2 A;  5IYB O;  5L3E A;  1EFR G;  1PNK A;  1FXK C;  4TWK A;  3P30 A;  2KB1 A;  2Y69 C;  1QLE C;  4N21 A;  4TSF G;  2WSS G;  3AG2 C;  5KUM A;  4MT8 A;  1VQN V;  2WAM A;  4UVA A;  3OM3 B;  2EJR A;  3LSS A;  2V7Q G;  1THZ A;  3LDE A;  1G8M A;  1E1R G;  4FMT A;  4JTD B;  1RPO A;  1BMF G;  4FJC C;  1QR8 A;  2H8P C;  3STL C;  4GT1 A;  4RUF A;  3ZRS A;  3FB5 C;  2ZXW B;  2HVK C;  2HVJ C;  1PD3 A;  1OCR C;  3ETD A;  5CMU A;  5HFL A;  1UJW B;  3CCU V;  3ML0 A;  2B1G A;  4U7N A;  4PDL A;  3UKM A;  4QJF B;  1AR1 B;  1VQ6 V;  4WCE V;  3E89 A;  2IU3 A;  2UXN A;  4MS2 A;  1K97 A;  1K8A W;  2ZR3 A;  3CP1 A;  3AEI A;  3SYA A;  3ABL B;  1BHB A;  5IYC O;  3ZRX A;  2DQ0 A;  1MG1 A;  2P67 A;  3OEE G;  1NH2 B;  1JX9 A;  4J9Y B;  3T2M A;  1WLE A;  4JYC A;  3W7X A;  2WLL A;  1AI5 A;  5CN0 A;  1K33 A;  3CCL V;  4CBC A;  3ZN1 A;  1VQP V;  3G6E V;  1K5S A;  1NR1 A;  3CYO A;  2DQ3 A;  3CXC U;  2ZD9 A;  1J95 A;  2X6C A;  5B1A B;  1F4M A;  4MVQ A;  2XOK G;  3CCV V;  4P9O A;  2FTK A;  5H6R A;  1KC8 W;  3B8M A;  1QBZ A;  5B3S C;  2DYR C;  3F7V C;  2H94 A;  3SPJ A;  3T1C A;  1M57 C;  1R3J C;  1E1Q G;  4KUM A;  5EC2 C;  1F51 A;  2BOC C;  1H8E G;  1K3E A;  2WLN A;  4QPK A;  4ASU G;  2YSU B;  2Q68 A;  4ZBM A;  1K7D A;  3AG2 B;  1GTO A;  2Y69 B;  2YEV B;  3E83 A;  3MD0 A;  5LHG A;  3CCS V;  3SYP A;  1ENV A;  1P4R A;  3MHH C;  2QEX V;  1KP2 A;  3E8H A;  2BOB C;  1YIJ V;  4UVC A;  3T4Z A;  3E8F A;  2IJJ A;  4X88 A;  2XAH A;  1GM9 A;  5B3S B;  3UM7 A;  2Q69 A;  5IYD O;  1Q82 W;  1M57 B;  1GM7 A;  1QR9 A;  4RUE A;  2W6I G;  4KFM A;  2EIJ C;  2DYR B;  2A9H A;  5DN6 G;  5LGU A;  3CD6 V;  5CBF A;  1ROP A;  3IC7 A;  1KP3 A;  3KG2 A;  4L87 A;  2HG5 C;  1VQ9 V;  4FIP C;  1KEC A;  1YJ9 V;  1Q86 W;  2EIN C;  3OEH G;  3CCM V;  3ASO B;  3CPW U;  2XAS A;  4P9P A;  3LSQ A;  5B1O A;  3FKS G;  1NQT A;  1Y4M A;  4H33 A;  4HAM A;  3SYQ A;  2XAF A;  5B1B C;  1K5Q A;  1VQM V;  5J9P C;  5EBW C;  3BY6 A;  4MVU A;  1R6K A;  2GSM B;  3B77 A;  5IDJ A;  3TCU A;  1MOF A;  4GX0 A;  1GK9 A;  1NH2 D;  1YTF D;  3SPC A;  4EKW A;  4PA9 A;  3TK1 A;  2EIK B;  4QNH B;  1PNL A;  2HLD G;  4DO2 A;  2K1E A;  1YI2 V;  3R65 A;  2DYS B;  4UUJ C;  4UXN A;  2EZO A;  3JD3 A;  3K9A A;  1SZT A;  1XL4 A;  4MTX A;  5L3F A;  2ITD C;  4PDV A;  4WF9 V;  2LFS A;  1YTF B;  4LBE C;  5CA3 A;  4RQE A;  1VQK V;  1NVP D;  5E1A C;  3SYC A;  2V1D A;  3OE7 G;  3P32 A;  3SYO A;  3FYI B;  4MTG A;  3E8G A;  3W7T A;  3I56 V;  3NXS A;  5IY5 C;  5GW7 A;  4WFG A;  2HFE C;  3OW2 U;  3E2E A;  1E79 G;  1SRY A;  1H8H G;  3JYC A;  2WWW A;  2PI4 A;  1W0J G;  3F5W C;  4BAY A;  4MSW C;  4UV8 A;  4X89 A;  1OCC B;  1P7B A;  3RBZ A;  4HYO A;  5B1A C;  2OT5 A;  2X6A A;  3X2Q B;  1DTO A;  2OTJ V;  4Q20 A;  2Z3Y A;  5KA6 A;  3OUS A;  1S72 V;  3AG4 C;  3SPH A;  3CMA V;  3HPL C;  1V54 B;  2DW4 A;  1CEZ A;  3OGC C;  1VQO V;  4MW8 A;  3ETE A;  3D36 A;  2Y48 A;  2WLL B;  1SET A;  5L3B A;  4ZKI A;  3I55 V;  3AG1 C;  1AJQ A;  3EFF K;  1OCO C;  2A79 B;  2HR3 A;  4F4L A;  4MVR A;  1MAB G;  1V55 B;  1VQ4 V;  1OHH G;  1H2G A;  3ETG A;  2A0L A;  4R50 A;  1KKD A;  3AG4 B;  2JIZ G;  3ASN B;  3K08 A;  4GX1 A;  4MW3 A;  4FPP A;  5HFM A;  4Z1M G;  1PL0 A;  2Q6A A;  3AG3 B;  2DWD C;  5CBH A;  1QLN A;  2W0F C;  1GMG A;  1KD1 W;  5EBL C;  1S5H C;  2JDI G;  3CC2 V;  2ATK C;  3IGA C;  3FYE B;  3STZ C;  3FB8 C;  2X6B A;  1S3J A;  1OCZ C;  2QKS A;  1FFT B;  3K0G A;  4PA6 A;  1R6N A;  3ABM C;  3JD2 A;  3JD0 A;  2JJ2 G;  2WLK A;  3ABU A;  4GCZ A;  1AI6 A;  1QVG U;  1FXK A;  3B8N A;  2XAJ A;  4JAV A;  2EIN B;  2B5U A;  4CZZ A;  1W0K G;  4WFA V;  3ZJZ A;  2IH3 C;  1R73 A;  2DYS C;  2WPD G;  3CME V;  3ABK B;  2XAG A;  5LHI A;  1OCZ B;  1W2B U;  1SER A;  1NBM G;  2QE7 G;  3ABM B;  1GO3 F;  4PA3 A;  5EK0 A;  1K73 W;  1AI4 A;  1LNQ A;  2JK5 C;  3A0R A;  1KQS U;  3LDC A;  2ZXW C;  1TUE B;  4RO2 A;  2PI5 A;  4XDK A;  2NNU A;  2JEX A;  3FB6 C;  3JD4 A;  4G27 B;  2LP7 A;  2JEU A;  3HB3 B;  1YSC A;  4MVZ A;  4XDL A;  1JPX A;  3AG1 B;  3E86 A;  5DM6 V;  4H37 A;  2IU0 A;  2M7W A;  1RPR A;  1V55 C;  3F7Y C;  1CPY A;  3K3W A;  4R6Z A;  4R8C A;  1F23 A;  1FXK B;  4FK5 C;  2WLI A;  3OMA B;  1S76 D;  2MK3 A;  1HWY A;  4LCU C;  3H01 A;  3WG7 B;  2CK3 G;  1K4C C;  3K0D A;  2Z5U A;  1YIT V;  4WFH A;  3CCE V;  1YJW V;  3M99 B;  4X8A A;  2QA4 V;  4G28 B;  3RVY A;  1R3I C;  2IJH A;  1MSW D;  4MVM A;  3OR6 C;  3ZRW B;  1OCC C;  2EIM B;  4JTC B;  3K03 A;  2DWE C;  3W7S A;  3OAA G;  2XAQ A;  4P30 A;  5CBG A;  1ZWI C;  1R3K C;  2XND G;  2OCC B;  3G4S V;  2R9I A;  2IH1 C;  5B1N A;  3WFV A;  2C2A A;  2X0L A;  3T4D A;  1GM8 A;  1H38 A;  3VBB A;  2AHZ A;  1OCO B;  1JOY A;  2EIL C;  3JCZ A;  5L3G A;  1RM1 B;  1AJP A;  3ZN0 A;  3W7W A;  2WLJ A;  5BZB A;  1NVP B;  3W7U A;  5C93 A;  3DGE A;  2WLM A;  3LDD A;  4PDR A;  1OZ0 A;  3QNE A;  3LNM B;  2IW5 A;  1I5Y A;  4MTF A;  3SPI A;  1PNM A;  2EIL B;  1YHQ V;  1IXM A;  3JD1 A;  5IY5 B;  5B1B B;  4G2K A;  4E2L A;  2HJF C;  3LUT B;  5KA5 A;  1PKX A;  1F4N A;  3BEH A;  1FS0 G;  1M90 W;  1K92 A;  4MVO A;  1COW G;  4WFF A;  2ZDI C;  4MTO A;  1R3L C;  4PA7 A;  4GX5 A;  2IJI A;  1K4D C;  4JTA B;  4J9Z B;  1Y66 A;  2QTO A;  3WG7 C;  5KUK A;  3RVZ A;  4WFB V;  2EIJ B;  2ZDI A;  5LBQ A;  1VQ5 V;  1Q81 W;  2EIK C;  3E35 A;  1N8R W;  3ASN C;  1B6Q A;  4UV9 A;  4HZ3 A;  1BHA A;  1S0V A;  2IJK A;  2YEV A;  2ITC C;  4P2Z A;  5EBM C;  1M9N A;  3DTU B;  4JF3 A;  3AG3 C;  1DF4 A;  3QO8 A;  3ZMU A;  1M56 B;  4R7C A;  4LP8 A;  2P90 A;  1SES A;  1EBO A;  3ZMV A;  2P7T C;  4QE7 A;  4PA4 A;  1QVF U;  1ORQ C;  1AI7 A;  4QIW F;  5H9C A;  4DXW A;  1DF5 A;  1BL8 A;  3FB7 C;  2JJ1 G;  1CP9 A;  1QCE A;  3ZRW A;  4I9W A;  1L1F A;  5LHH A;  1OCR B;  4BIZ A;  3VOU A;  3MHS C;  1VQ7 V;  2AHY A;  4MVS A;  3OFN G;  3ZMT A;  4PDM A;  3X2Q C;  1K9M W;  3QO5 A;  3EHB B;  1I5X A;  1FXH A;  2UXX A;  1YJN V;  4PEL A;  4RAI A;  1NKD A;  2X7R B;  1S77 D;  3E8B A;  1ARO P;  3ZMS A;  2WLI B;  2W6J G;  1GKF A;  4BIU A;  4WFE A;  5LGN A;  4JGS A;  5H6Q A;  4JAS A;  2OTL V;  3D3I A;  2Q67 A;  4XDJ A;  4JPR A;  1AJN A;  3ZMZ A;  4RQF A;  3ABT A;  1M1K W;  4TT3 G;  1JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...