1HNZO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnzO00
4GKKO 4X64O 4LF5O 5FLXN 5BXZA 4YY3O 4JI4O 3SDLA 3J7AU 4DV7O 3O65A 4DV4O 2UXDO 5H5NA 1IBKO 1N36O 4JI7O 4B3RO 4LF7O 4JI1O 1NS1A 4DV3O 4X65O 2Z0AA 1I94O 4DV0O 4JI5O 2N74A 2DJVA 1N32O 1HNXO 2LW7A 4B3TO 4LFCO 3J80N 1R1BA 2VQEO 4JI6O 2DOSA 4JYAO 2AGAA 5BY1A 4YHHO 1A32A 2VQFO 4B3SO 4B3MO 2UXBO 1F7YA 2UUBO 1KUQA 2UUCO 4NXMO 3JAMN 3RT3C 4OX9O 1YZBA 2FKXA 1XNRO 4X62O 4JI3O 1N33O 2UUAO 4LFBO 3OTOO 4DUZO 1XEQA 3T1YO 5IWAO 4JI8O 3T1HO 5LL6Y 5A2QN 4OPAA 1R6TA 1DK1A 1XMQO 1HNZO 4NXNO 1FKAO 4K0KO 5BR8O 2E5LO 4AQYO 4GKJO 4KHPO 4DR5O 4DR3O 4DV6O 4LF4O 4DV2O 4X66O 5IT9N 4JV5O 1HR0O 4OPHA 3M8AA 4DUYO 3J81N 4DR4O 1HNWO 4DR2O 4A5UB 1D2DA 3R66A 1XMOO 2ZKOA 2UXCO 1N34O 4JI2O 1G1XB 2HHHO 4DR1O 1FJGO 5LMNO 1XNQO 2JRIA 2ZM6O 5LMUO 4LFAO 1FYJA 2F4VO 1J5EO 1X59A 4LF6O 1AB3A 1IBLO 4LF9O 2UU9O 4DR6O 1IBMO 4LF8O 4DV5O 4JI0O 3F5TA 4DR7O 1AILA 4DV1O
chains in the Genus database with same CATH superfamily
5EIBD 3JAWA 4I50B 4UVAA 1XMQB 4TQDA 2WLIB 4JASA 2JJ2G 1XNRB 3ABKB 2EIKC 1YF2A 5HFMA 4RWUA 3HKBA 2B1IA 2QM7A 1K5SA 1ZUQA 3BAAA 1P49A 4NVPA 1N32O 5JH7B 4X20A 1ZWIC 1BHBA 1NKDA 1R6KA 2OTLV 3ZMVA 2Q67A 2VQEO 4TUYB 2KG7B 4L87A 3ZRVA 1SQBH 1QLEC 2JS3A 1SQGA 3QO8A 4EB6A 1YEWA 2E5LB 3CB2A 5LGNA 1N0JA 4MTXA 3C90A 1H8EG 3ZMSA 4ZOLB 1S72V 2NLJC 3SJCC 3RW0A 4PA9A 2QWQB 1W0JG 4UUJC 4WF9V 1N34B 3ZRWB 4PDMA 5IWAO 2ZD9A 3OTFA 1N4CA 1N36B 4ZHQA 1OZ0A 2OCHA 4QPJA 3AK1A 3ZHUA 4FIPC 2ZQMA 4PV1B 4LC1A 2R9AA 4I0XA 4TWKA 2FMLA 2UXXA 1O9HA 3AK3A 3HKCA 3IJ4A 4LNUA 1IZ3A 2QWNB 5L3CA 5KX5B 4P2ZA 4HYOA 3VQYA 4A5UB 1D5AA 2ZKOA 4L8JA 4D7TA 2HHHO 4DO2A 1KD1W 1VF6C 3TGUH 5KHGA 2P6JA 5IJ9A 1WA8A 2YEVB 3DSQA 3CCLV 3DGEA 2ETNA 2WLNA 2KSDA 4J42A 4O2AB 4H44B 1KP2A 3LNNA 4MW8A 2OTJV 4U3JA 1O9GA 2M7WA 2JS5A 5IDJA 1S0VA 4MTOA 5H5NA 1SZXA 1QVGU 4JI7O 4FZ0A 4O2BA 5IYBO 4DV3O 1YITV 2CUGA 2FYUH 4U3FH 4I55A 4F6RA 1RSOB 3SYCA 4LBEC 3UKMA 4KFMA 1AP5A 4F4LA 2DYRC 1FXKB 2XAGA 3RYIA 2X0LA 4RQEA 3ZMTA 2P67A 5IY5B 1VP7A 1WPBA 1WP8A 3OAAG 3X2QB 1XNRO 3K08A 3ABMB 4WFHA 3AG4C 3M99B 2LGWA 1M57B 1EN5A 2GV9A 4Z2WA 4GCZA 2P5OA 2VWKA 4D7SA 2WLMA 1GO3F 3K9SA 5A2QN 2A3QA 3LDDA 1K33A 1EN6A 5B1NA 1XDCA 2JJ1G 3VQWA 2DN9A 4J9YB 2IU3A 2P7TC 2E5LO 4HNAB 2M6YA 1IBMB 1PPJH 1GN3A 3D36C 4X8AA 2XOKG 4Q6GA 4QIWF 5J2TA 2EULA 3D36A 5EIBC 4NTWA 3G67A 1N34O 1K5QA 3CXHF 3BPZA 2BSKA 4MVZA 5EYPB 1SRYA 1EZJA 3JATA 3P30A 1N33B 3B40A 2GBOA 4JI5B 1EZVH 2DYSB 4UCTA 2IH3C 2Q7EA 5LGTA 4TT3G 4XBFA 2FB5A 3K3WA 3K5NA 3HKDB 3ETGA 1JJ2U 3F7YC 4NTXA 2H8PC 2G38A 5CA3A 5E79Z 3MD0A 3BABA 4GX0A 1MZFA 4UVBA 5GTIZ 1I94O 1HR0B 3SYQA 2HR3A 3N2KB 4X1KB 2H94A 1IXMA 3TXSA 2QE7G 4FM2A 2P22C 2Y0PA 2EJ7A 3VOUA 2LJ2A 2PI5A 1PL4A 4YIPA 5BR8B 4NXMO 2F43G 3CCVV 2ZR2A 3FYIB 2XT9A 4DR3B 1MA1A 4DW0A 1OV9A 3RN4A 2Q7HA 4K3AA 1GAXA 1ENVA 5JCOC 3HKEA 3CRCA 4JI1B 4ASUG 4WBNB 1QU7A 1FKAO 2EIJC 2BOCC 5IYZA 3K0DA 1UPGA 4QE9A 4DV5B 1MABG 5CA0A 5KHHA 4X64B 1GM8A 3UQ8A 4PI0A 4ZBMA 3FB8C 3OD4A 2V1DA 2R9IA 1SS3A 1N0NA 4ZIBA 1OCZC 1H2SB 4JTDB 4G2KA 2NR5A 2NN4A 3OR6C 4LF9O 1COWG 1W59A 3AG2C 3E22B 1IBMO 1Y6XA 4B3MB 4MTGA 1GTOA 1H2NA 1OCRC 1TVKA 2QKAA 4MVMA 1ZLZA 3U0ZA 4O4IA 2KB1A 1FFTB 2UXDO 1DTOA 4G28B 4U7OA 3KKYA 4O4HB 1NU1H 4JI5O 3WU2Z 1PL0A 1XMOB 3T1HB 1K3EA 4JF3A 1Z2GA 2IBZH 4GT1A 3QF7A 4HAMA 1ZL8A 1NI8A 2AGAA 3O9OA 2ARHA 1JR9A 1JVMA 4LFAB 5KUMA 2Q73A 1JFFA 4X89A 5LGUA 3UT5A 3CRAA 3JD1A 4FZ1A 1OHHG 1K92A 1WAZA 3B4SA 3SPHA 1SA0B 2XTAA 2V4DA 4DRXB 5K1PA 2L35A 2RCVA 4J7ZA 3JAWB 3RGBA 3CS5A 4B08A 1S76D 3CCMV 2QWRB 4OPAA 5LMUB 5IYCO 1Q7YW 5KA5A 1VQ6V 4LF6B 1WB8A 3HKBB 5BR8O 4FM1A 3CRQA 4TQFA 1B6QA 1LNQA 2EIKB 3RBZA 4JI0B 4X20B 2R70A 4DR3O 4GX5A 2YI9A 2HLDG 1BE3H 2EX3A 1YCIA 1S5LZ 4FLUA 1BSMA 4MVOA 1VF7A 1BHAA 1MSDA 4EB6B 2E75B 1IX9A 1LR1A 3P32A 1QLEB 5GTHZ 1RP3B 2CE4A 3S3XA 1X59A 1US6A 4DR6O 4B7EA 4R7CA 5KAIZ 1JMKC 4DV5O 1H2LA 1VQ7V 4X64O 4JZ2A 2XAHA 3SDLA 2YSUB 5DN6G 3SGIA 2LFRA 4J7JA 4DW1A 4ZHQB 1I5XA 1KU9A 4J7KA 3ZHTA 3VBBA 5KHIA 1I7FA 3CP1A 5B3SC 1NZ6A 2WPDG 2E3CA 2WA4A 2Q8VA 4I0XB 2N74A 1VQ8V 1RPOA 3HKCB 4LNUB 5CBGA 4LH6A 3BCCH 4B3MO 1SQVH 1KUQA 1MG1A 5EK0A 3H01A 5LYJA 3E35A 3ABUA 3CPWU 3BEHA 2IJHA 5IJ9B 1WA8B 1WPXA 4PD4F 1CEZA 3ZS8C 3L9DA 4DR1B 4JI8O 3G6BA 3T1HO 1PKXA 1XI1A 4U3JB 1K34A 1NR1A 4P30A 2D3OW 4X65B 1PV0A 3VQXA 4O2BB 1S3JA 1R73A 3QTCA 2QEXV 2CTRA 4LF8B 2EZOA 4I55B 4F6RB 1Z5VA 2QSAA 3K5MA 1L0NH 1SESA 4UCOA 4JTCB 2UXBB 3NXSA 3RYIB 3BHPA 2DYRB 2YI8A 4MTFA 4H33A 1H2GA 4Z1MG 5LMUO 1AROP 3ZRXA 2ILMA 4CS4A 3CEIA 1NH2D 4LF6O 1WNSA 1T5EA 1VQKV 2CTPA 1F4MA 3SYPA 4UV9A 2ZDIA 4JI0O 4YHHB 4BR6A 5BXZA 2YIAA 2DWDC 1VQOV 4RQFA 3I55V 1XREA 2P4VA 3CCUV 1SZTA 2EBOA 4WFAV 2YIBD 2Z0AA 4DV0O 2V7QG 1DGSA 4I9WA 5B1BB 4PDVA 5J2TB 2DOSA 1Q82W 3ABLC 5K1XA 4Q20A 1AP6A 2BSKB 5EBWC 3JATB 3H1HH 4RO2A 2CH7A 4ABMA 4GKJB 2X7RB 4I5SA 2FKXA 1M90W 1HW7A 4KP4A 3FX7A 2F93B 2EILC 1SQXH 5LHHA 1H8HG 1Q5OA 5D5PA 3G4SV 4UXNA 5JJJB 3JSLA 1OCCB 1XNQB 4OGQB 4DV4B 5TISZ 1NTKH 1K8AW 3K04A 1IVSA 2GTAA 5F2VO 4BW5A 3JD3A 1E1RG 4H13B 3CSXA 4YIOA 4BIZA 1HDJA 3OUFA 1Q6HA 1KQSU 1HP8A 1XHXA 5BMVA 1PNMA 2ZE8A 3C3TA 2UXCO 4NTYA 2ODMA 1FXVA 2Q7GA 3AG3C 4DR1O 4LF7B 1YJNV 3B8MA 1M56B 5B1AC 2WLLA 5DM6V 4CS2A 4B3TB 2AXTZ 1QR8A 3JD2A 4JI6B 2LFSA 4CC5A 1B3QA 4O4JB 4LF8O 4JYBA 3JALA 2RQ6A 4QJFB 3TXQA 3HKEB 3B09A 2QA4V 1GN4A 1WP7A 1YJ9V 4UB6Z 4DR5B 5C8YA 1V9PA 5IYZB 4FFBA 3NR7A 4LFBB 1VF6A 4X66B 3MAQA 5CA0B 4GX2A 1GN2A 3ETEA 4WFGA 1F4NA 2BTQB 3WFVA 1L1FA 2P90A 2CTWA 1M9NA 4YHHO 1WN7A 3CRMA 2Y69B 5J9PC 4ZI7A 4B7KA 2D2CB 2X6AA 3ZHVA 4IT5A 1YZBA 4MVRA 3OFNG 4DV2B 4X62B 1UJWB 4GKKB 4LF5B 2OCCB 4YY3B 3H1IH 3T1YO 2ZNIA 3EVKA 1YVWA 4EEQA 1FJGB 4MSWC 2ZR3A 2HJFC 1TVKB 1GN6A 1Q43A 5FL7G 1XMQO 4O4IB 1KECA 3W7UA 2AW9A 2PGGA 3CCEV 4I9QA 4HBNA 4XDKA 4GKJO 1KKDA 2JVDA 3SJAC 4JYAB 4CH6A 2QKSA 4H37A 1NVPB 1ZL8B 1VQNV 1BQZA 1AR1B 2Y48A 1ORQC 2XASA 3M7MX 5GONA 2CK3G 1XNQO 4UCVA 2IU0A 1JFFB 2MK3A 5B66Z 3UT5B 5CB4A 1BGYH 3D3QA 3CCJV 2FL4A 3E8GA 3JD0A 3KCYA 3STZC 4XDLA 2P4KA 3K79A 1Y67A 2YIBA 3T2MA 2Q9LA 4WCEV 4BIUA 3K0GA 2UUBB 4PA6A 4GUNA 2HVJC 3AG1B 2PYJA 1YI2V 3L73H 3A0HZ 5B1OA 5JJEB 4JTAB 1N36O 4LF7O 4DUZB 3WG7C 2WLHA 3B8NA 4X88A 1FPOA 4FLYA 3OEHG 4B3TO 3U11A 1R1BA 4JI6O 1XILA 5FPRA 3E83A 1E79G 3E86A 3Q4HA 2ZE6A 3STLC 1YJWV 1Y74A 2WA3A 1IBLB 1Y4MA 3G71V 2XAFA 2PY5A 2GTSA 4DR7B 4LFBO 1BMFG 2X6CA 1XUQA 3FFQA 4CH4A 3D3IA 2EIMB 3RYCA 1H2MA 3W7SA 3MHHC 2QGNA 5H2FZ 3RWRD 3ZX6A 4B3RB 1QVFU 1KBHA 2Z3YA 3E89A 4QGPA 2UXNA 1P84F 2Y0IA 4YXWG 5B3SB 3CCSV 3LSUA 1QBZA 4DV2O 4LWSA 1SQFA 4O4JA 1SC5B 5LP6C 3J81N 4PHZA 2UUCB 3KZIZ 4IHJA 3CMEV 5LP6A 1FJGO 1IBKB 1K4DC 4FJCC 5LYJB 4LH7A 5JCOA 5GW7A 4YJ2A 3LSSA 2BTOA 3EFFK 4OXSA 2KKWA 1NTZH 3CD6V 1LUWA 3F5TA 3OMIB 2BTQA 1YTFD 3H1JH 3CC7V 2ITCC 5FLXN 3W7WA 2QDOA 2H3OA 5JVDA 3ZEDA 2HP8A 4AQYB 1K7DA 4JYCA 1KC8W 1BT8A 1FFXA 4LF4B 4EFBA 2YUAA 2EJRA 4P9PA 1VQ4V 3P3NA 4GYCB 3OE7G 2VRZA 3A0RA 2BOBC 5ITZA 3J80N 4I4TA 2YXLA 3ASNB 3IFXA 2Z5UA 1V54C 1Y76A 2MW2B 1SKVA 3VQVA 3OM3B 1OJHA 3FYEB 2GSMB 1JPXA 2UUBO 1QR9A 1WJZA 1PNLA 1E1QG 4DV6B 1N33O 2IM9A 1ROPA 4QPKA 5CA1A 2QKCA 4DUZO 4DR4B 1FXKC 1BZKA 4J10A 3WB0A 2W6IG 3E8BA 1U97A 4WFFA 3X2QC 2QJ1A 3DXRA 2DQ0A 2A7WA 1WB7A 4RUEA 1J5EB 2QWPB 2B5UA 2RNBA 1PP9H 4MW3A 3R65A 1B06A 1HR0O 4OPHA 3CX5F 1JJOA 1K4CC 4DV7B 3SR2C 4P9OA 3BA8A 1G1XB 1BCCH 5LA6B 2W6JG 3ZHSA 3L70H 3E2EA 3ABLB 2CH7B 4FLXA 1I08A 4IIJA 1V55C 2JGUA 3CCRV 5L3GA 5IYDO 4BIOA 1AJPA 4JPRA 1EFRG 3QVNA 3ZHQA 4EFEA 2IJKA 5CN0A 1XBLA 1ZAUA 3L71H 2DYSC 3FAVA 5EC2C 4ICGA 2ZNJA 1ZTEA 1IBKO 2K1EA 3L72H 1D5NA 2EZPA 4JI1O 4N21A 3H1KH 2GUZA 2DJVA 3HPLC 2OT5A 3ASOC 1EM1A 5BMVB 3TCUA 2Y4UA 4CH3A 1P7GA 1HNZB 1P7BA 3F7VC 3KCXA 3WB2A 4D6TH 2ITDC 2WLLB 1NQTA 2XUMA 4PDLA 1FAFA 5KUKA 1GM7A 1QQCA 1H2KA 2ZT9B 2Q4PA 4DR2B 2YXHA 3JALB 3CYOA 1VQ5V 4JI2B 4GZRB 2PUSA 1U96A 3UO2A 3GWOA 1RPRA 5LHIA 2ZE5A 3B77A 3IGAC 1XOUA 4N23A 2F4VB 4MVSA 3SPGA 5IE9A 5C8YB 4FFBB 4YJ3A 1Y66A 1QNMA 4JAUA 2VQEB 5EBMC 4DV6O 2CGOA 3E8FA 2PYLA 1CPYA 4KXRA 3LUTB 3APOA 5BZBA 2HKOA 2PTMA 4DR4O 3SPJA 1D2DA 1XMOO 1AI7A 1AI4A 4ZI7B 4AILC 3CE2A 2B1GA 3HR0A 4LFAO 4K8XA 1J5EO 4MT8A 2QR4A 2P06A 4X1IA 3LSQA 1KKCA 1Q6UA 4FM0A 4UFZA 5FNVA 1NT2B 1XL6A 2CAZC 1CXZB 5JWPA 2YDEA 3A8TA 4DV7O 1BQ0A 1IDSA 3FD9A 3RVZA 5AG2A 3JCUZ 3QO7A 2OYQA 4I7ZB 2EINC 3CJHA 3ETQA 2RDCA 1J95A 3K06A 4FLWA 3ZCCA 1K73W 3CXCU 1NH2B 3JAKA 1KMIZ 3AG4B 3ML0A 1OCOC 4J9ZB 5KAFZ 2E74B 2QTOA 5LXTB 5HFLA 5GONB 1VIBA 5CB4B 3K03A 1L0LH 5EBLC 1NBMG 3GVMA 1QCEA 2ZIMA 1B04A 3T4ZA 3FB6C 5EC1C 4DUYB 1RM1C 5KMGA 2RJZA 3N27A 1HWYA 4J41A 2F66C 1Q81W 5LMNB 4PI2A 3ZBHA 1HNZO 5LA6A 4TV9A 5LHGA 3RYFA 1M5IA 3D8CA 2UU9B 3ETDA 3MDSA 4CS3A 3SYAA 1PNKA 4DV1B 5LOVA 4RUFA 2CTQA 1NR7A 4K8ZA 4CZZA 3M8AA 3ICXA 4DR2O 1M93A 1BL8A 5J2UA 4JI2O 1SQQH 4C7UA 3Q4HB 3QO5A 4FVMA 1Y74B 2ATKC 2HJDA 2F4VO 1K97A 1GK9A 3JSNA 5H9CA 3F5WC 2E76B 2Q0OC 3N2GA 1MMMA 3RYCB 1Q6IA 2R9RB 3IC9A 1N8RW 1JX9A 3OGCC 5EZYA 2VS0A 2ADQB 1W2BU 5E1AC 3JASA 4JI3B 3BVOA 5A9GA 3OTOB 3CC2V 4X65O 1AI5A 1L8DA 3K5OA 3ZMZA 4F6EA 2PI4A 2YS8A 4HZ3A 4LWSB 1VF5B 2DW4A 2WLJA 2Q5ZA 1ZX3A 1A32A 4IHJB 2IH1C 5LP6B 2UXBO 1UFIA 1I0HA 2JIZG 3W7XA 4K0KB 3JAMN 1GKFA 1JCHA 1PM9A 4YJ2B 3UM7A 2Q69A 3OT7A 4PA7A 3K57A 4AI8A 1MZEA 1GRJA 3L75H 2EIJB 3BFRA 1R3KC 3HB3B 4X1YA 2QM8A 4DYLA 3ZRSA 5JVDB 2ZM6B 3UO3A 1TUBA 1JQ0A 5KLVH 1I94B 2DWEC 1AR5A 1VARA 1SQPH 4MS2A 5L3FA 1FFXB 1S5JA 3JARA 1SF9A 4J80A 1F23A 1KB9F 1VQPV 1OCZB 1G8MA 5ITZB 3K59A 2QM4A 5IT9N 5IJ0A 4I4TB 4FFKA 3I56V 3K58A 1Y76B 4DUYO 1GH6A 3AG2B 4NXMB 2ZINA 1V54B 5LMNO 4R8CA 1VEWA 4X9QA 1G4YB 1OCRB 5KA6A 2CDYA 1KYOF 3FKSG 4CH5A 2ZCEA 5CA1B 1AB3A 2UU9O 1MOFA 4RAIA 4U7NA 4W4LA 2XHBA 2OWOA 1AILA 3RVYA 4DV1O 2VQFB 2ZXWC 3G80A 3AEIA 5LXTA 3DXRB 4DK0A 4PA3A 2ZIOA 4DV4O 3OW2U 2LQTA 3RYHA 2XAJA 1NS1A 1TUEB 1NVPD 1M1KW 2LW7A 4UV8A 3THOA 4FLTA 3CMAV 3TJTA 2JGDA 5JQGA 5L3BA 4TV8A 2HG5C 4O4LA 1YIJV 1TA8A 3KG2A 5D5QA 4KHPB 4IIJB 4JYYA 3TK1A 4LF9B 3AK2A 4JI3O 2QTSA 5B1BC 4JV5B 3G6EV 4E4EA 1V55B 3OTOO 4BWAA 3B2EE 4ZKIA 1GM9A 3IC7A 4I50A 3TETA 1FS0G 4LCUC 1QLNA 3ABKC 3OGIB 2AZ2A 2WLIA 3ZMUA 2UXDB 1R6TA 3BA9A 1AR4A 2W0XA 1VQLV 3FAVB 4KUMA 1R3JC 4K0KO 2C2AA 2HVKC 1BS3A 2GUZB 1R6NA 4DR5O 2K9PA 3P3PA 4E2LA 5KHJA 5JH7A 1OCCC 3IAYA 4CBCA 4X66O 4JI4B 3GWKC 1THZA 4TUYA 2KG7A 3SJQC 2Q0AA 3R66A 3JCZA 5H6QA 3ASOB 2ADPA 2N05A 2A79B 4PELA 2ZM6O 3OMAB 4TSFG 2A0LA 1FYJA 3EXAA 5LBQA 1S77D 4LFCB 3UCSC 5CBFA 4ZOLA 4LR3A 1YDXA 5L3DA 1MNGA 1FD9A 3S3WA 2HFEC 2KQXA 4X62O 3ZRWA 4GKKO 4LF5O 2IJJA 1VQMV 4YY3O 3L74H 2OIEA 4NB5A 1M56C 1TGOA 2RN9A 3O65A 4WFBV 2A9HA 1JA8A 3OR7C 4Z1VA 2F1MA 4XDJA 4YJ3B 4JAAA 1GMGA 4FLZA 2DE0X 3W7TA 2FTKA 2RMKB 4H0LB 1ZSPA 5KX5A 3DC6A 1NTMH 4JYAO 3CRRA 3SYOA 5BY1A 2JK5C 2VQFO 4NXNB 3CCQV 4MVUA 1YTFB 1SETA 2F95B 2YIDA 3E8HA 4DR6B 4NKGB 2YEVA 4FPPA 4BAYA 1VMGA 3JYCA 4X1IB 3OUSA 1XHZA 3RFRA 1HNWB 1VQ9V 2Y69C 4UB8Z 2LW1A 3A2FA 2JDIG 5C93A 4O2AA 5FNVB 2Q6AA 4DK1A 2JEXA 4PA4A 2PZSA 1DK1A 2WLKA 3GB7C 4R50A 2YC0A 2IJIA 4CC6A 2OCCC 3CJHB 3ZHRA 4UCUA 4NYKA 1IURA 4KHPO 5KHKA 4JZGA 4G27B 4GLXA 1EN4A 2EINB 4JGSA 1XQ8A 2ZE7A 1RSOA 4JV5O 3JAKB 3JD4A 5IY5C 3ABTA 1FXKA 1AJNA 2A06H 1URFA 1OCOB 4UCSA 2JRIA 2XAQA 3ABMC 2AZ0A 1HNXB 1PD3A 3T4DA 4FMTA 1M57C 3PN1A 1IBLO 3SPIA 4J11A 4JI8B 5KMGB 1TAEA 4DR7O 4KL1A 4B3SB 1RM1B 4JI4O 4JAVA 4OX9B 1AI6A 4TV9B 1CP9A 5B5EZ 3RYFB 3AG7A 3K9AA 4B3RO 4BW9A 2UUAB 4TOIA 4HNAA 1RFYA 5LOVB 2DQ3A 4WFEA 4LFCO 5DEDA 2Y4TA 3AG1C 1K9MW 2OIGA 1SERA 3OEEG 5J2UB 2EILB 2LP7A 1IXBA 3U10A 5EYPA 4GX1A 2UUCO 2YXYA 3K5LA 2AHYA 1DF5A 2R72A 3LDCA 4IGGA 2O57A 2BCCH 1R3IC 1W0KG 4IYIA 5JJNB 2BE3A 3N2GB 1AJQA 1YXBA 2W0FC 3HKDA 3CWBH 4AHCA 3SJBC 5L3EA 5EZYB 4NXNO 3JASB 3I5DA 3LNMB 4DV0B 1DF4A 4PJ0Z 3AG3B 1X4TA 2PF4E 4AQYO 2YICA 2VWJA 2Q68A 5B1AB 2EIMC 2B9ZA 4LF4O 3DC5A 2QWOB 3N2KA 1DLBA 1Q3EA 4LP8A 4X1KA 1HNWO 3CC4V 1M4UA 1R3LC 1Q90D 2AHZA 2JEUA 1N32B 3H9VA 3SPCA 3H1LH 4MVQA 4X1YB 3APQA 3BY6A 1EBOA 2F23A 3T1CA 1XEQA 1Q86W 2LGQA 5H6RA 3ZN0A 1Z5WA 1MSWD 2CGNA 3J7AU 3LDEA 1TUBB 5DECA 4WBNA 3BRCA 4FLVA 3EHBB 1NJIW 3JARB 1AVMA 4K35A 3FB5C 2WAMA 3CHXA 1YHQV 1LUVA 4W4KA 1HNXO 4UVCA 5IWAB 2UXCB 5IJ0B 1I5YA 2WWWA 4UCRA 3WB1A 1G6UA 4QE7A 4DXWA 4B3SO 1S5HC 3DTUB 1H38A 1F7YA 4IL6Z 4QNHB 3RT3C 4OX9O 3OMNB 3A0BZ 1P4RA 2XNDG 3ASNC 3QG5A 1KP3A 2UUAO 1YSCA 1WLEA 2GDSA 1XL4A 3E22A 3ZIAG 3ZN1A 2NNUA 1QHTA 5FPOA 2HHHB 2IW5A 2X6BA 5LL6Y 3ZJZA 4FK5C 2ZXWB 1F51A 2LO1A 2HEPA 2GHYA 3RYHB 2ZDIC 1JOYA 4NR1A 4PDRA 4O4HA 4R6ZA 1FXHA 3MHSC 3FB7C 3PJSK 3C3SA 3QNEA 2JGDB 5JQGB 4TV8B 2DMXA 2WSSG 4EKWA 4O4LB 4JI7B 4DV3B 2L6LA 5CMUA 1SA0A 3T1YB 5CBHA 4DRXA 2N04A 4IYHA 1Q8IA 3WG7B
chains in the Genus database with same CATH topology
4GKKO 4X64O 4LF5O 5FLXN 5BXZA 4YY3O 4JI4O 3SDLA 3J7AU 4DV7O 3O65A 4DV4O 2UXDO 5H5NA 1IBKO 1N36O 4JI7O 4B3RO 4LF7O 4JI1O 1NS1A 4DV3O 4X65O 2Z0AA 1I94O 4DV0O 4JI5O 2N74A 2DJVA 1N32O 1HNXO 2LW7A 4B3TO 4LFCO 3J80N 1R1BA 2VQEO 4JI6O 2DOSA 4JYAO 2AGAA 5BY1A 4YHHO 1A32A 2VQFO 4B3SO 4B3MO 2UXBO 1F7YA 2UUBO 1KUQA 2UUCO 4NXMO 3JAMN 3RT3C 4OX9O 1YZBA 2FKXA 1XNRO 4X62O 4JI3O 1N33O 2UUAO 4LFBO 3OTOO 4DUZO 1XEQA 3T1YO 5IWAO 4JI8O 3T1HO 5LL6Y 5A2QN 4OPAA 1R6TA 1DK1A 1XMQO 1HNZO 4NXNO 1FKAO 4K0KO 5BR8O 2E5LO 4AQYO 4GKJO 4KHPO 4DR5O 4DR3O 4DV6O 4LF4O 4DV2O 4X66O 5IT9N 4JV5O 1HR0O 4OPHA 3M8AA 4DUYO 3J81N 4DR4O 1HNWO 4DR2O 4A5UB 1D2DA 3R66A 1XMOO 2ZKOA 2UXCO 1N34O 4JI2O 1G1XB 2HHHO 4DR1O 1FJGO 5LMNO 1XNQO 2JRIA 2ZM6O 5LMUO 4LFAO 1FYJA 2F4VO 1J5EO 1X59A 4LF6O 1AB3A 1IBLO 4LF9O 2UU9O 4DR6O 1IBMO 4LF8O 4DV5O 4JI0O 3F5TA 4DR7O 1AILA 4DV1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK O;  4X64 O;  4LF5 O;  5FLX N;  5BXZ A;  4YY3 O;  4JI4 O;  3SDL A;  3J7A U;  4DV7 O;  3O65 A;  4DV4 O;  2UXD O;  5H5N A;  1IBK O;  1N36 O;  4JI7 O;  4B3R O;  4LF7 O;  4JI1 O;  1NS1 A;  4DV3 O;  4X65 O;  2Z0A A;  1I94 O;  4DV0 O;  4JI5 O;  2N74 A;  2DJV A;  1N32 O;  1HNX O;  2LW7 A;  4B3T O;  4LFC O;  3J80 N;  1R1B A;  2VQE O;  4JI6 O;  2DOS A;  4JYA O;  2AGA A;  5BY1 A;  4YHH O;  1A32 A;  2VQF O;  4B3S O;  4B3M O;  2UXB O;  1F7Y A;  2UUB O;  1KUQ A;  2UUC O;  4NXM O;  3JAM N;  3RT3 C;  4OX9 O;  1YZB A;  2FKX A;  1XNR O;  4X62 O;  4JI3 O;  1N33 O;  2UUA O;  4LFB O;  3OTO O;  4DUZ O;  1XEQ A;  3T1Y O;  5IWA O;  4JI8 O;  3T1H O;  5LL6 Y;  5A2Q N;  4OPA A;  1R6T A;  1DK1 A;  1XMQ O;  1HNZ O;  4NXN O;  1FKA O;  4K0K O;  5BR8 O;  2E5L O;  4AQY O;  4GKJ O;  4KHP O;  4DR5 O;  4DR3 O;  4DV6 O;  4LF4 O;  4DV2 O;  4X66 O;  5IT9 N;  4JV5 O;  1HR0 O;  4OPH A;  3M8A A;  4DUY O;  3J81 N;  4DR4 O;  1HNW O;  4DR2 O;  4A5U B;  1D2D A;  3R66 A;  1XMO O;  2ZKO A;  2UXC O;  1N34 O;  4JI2 O;  1G1X B;  2HHH O;  4DR1 O;  1FJG O;  5LMN O;  1XNQ O;  2JRI A;  2ZM6 O;  5LMU O;  4LFA O;  1FYJ A;  2F4V O;  1J5E O;  1X59 A;  4LF6 O;  1AB3 A;  1IBL O;  4LF9 O;  2UU9 O;  4DR6 O;  1IBM O;  4LF8 O;  4DV5 O;  4JI0 O;  3F5T A;  4DR7 O;  1AIL A;  4DV1 O; 
#chains in the Genus database with same CATH topology
 5EIB D;  3JAW A;  4I50 B;  4UVA A;  1XMQ B;  4TQD A;  2WLI B;  4JAS A;  2JJ2 G;  1XNR B;  3ABK B;  2EIK C;  1YF2 A;  5HFM A;  4RWU A;  3HKB A;  2B1I A;  2QM7 A;  1K5S A;  1ZUQ A;  3BAA A;  1P49 A;  4NVP A;  1N32 O;  5JH7 B;  4X20 A;  1ZWI C;  1BHB A;  1NKD A;  1R6K A;  2OTL V;  3ZMV A;  2Q67 A;  2VQE O;  4TUY B;  2KG7 B;  4L87 A;  3ZRV A;  1SQB H;  1QLE C;  2JS3 A;  1SQG A;  3QO8 A;  4EB6 A;  1YEW A;  2E5L B;  3CB2 A;  5LGN A;  1N0J A;  4MTX A;  3C90 A;  1H8E G;  3ZMS A;  4ZOL B;  1S72 V;  2NLJ C;  3SJC C;  3RW0 A;  4PA9 A;  2QWQ B;  1W0J G;  4UUJ C;  4WF9 V;  1N34 B;  3ZRW B;  4PDM A;  5IWA O;  2ZD9 A;  3OTF A;  1N4C A;  1N36 B;  4ZHQ A;  1OZ0 A;  2OCH A;  4QPJ A;  3AK1 A;  3ZHU A;  4FIP C;  2ZQM A;  4PV1 B;  4LC1 A;  2R9A A;  4I0X A;  4TWK A;  2FML A;  2UXX A;  1O9H A;  3AK3 A;  3HKC A;  3IJ4 A;  4LNU A;  1IZ3 A;  2QWN B;  5L3C A;  5KX5 B;  4P2Z A;  4HYO A;  3VQY A;  4A5U B;  1D5A A;  2ZKO A;  4L8J A;  4D7T A;  2HHH O;  4DO2 A;  1KD1 W;  1VF6 C;  3TGU H;  5KHG A;  2P6J A;  5IJ9 A;  1WA8 A;  2YEV B;  3DSQ A;  3CCL V;  3DGE A;  2ETN A;  2WLN A;  2KSD A;  4J42 A;  4O2A B;  4H44 B;  1KP2 A;  3LNN A;  4MW8 A;  2OTJ V;  4U3J A;  1O9G A;  2M7W A;  2JS5 A;  5IDJ A;  1S0V A;  4MTO A;  5H5N A;  1SZX A;  1QVG U;  4JI7 O;  4FZ0 A;  4O2B A;  5IYB O;  4DV3 O;  1YIT V;  2CUG A;  2FYU H;  4U3F H;  4I55 A;  4F6R A;  1RSO B;  3SYC A;  4LBE C;  3UKM A;  4KFM A;  1AP5 A;  4F4L A;  2DYR C;  1FXK B;  2XAG A;  3RYI A;  2X0L A;  4RQE A;  3ZMT A;  2P67 A;  5IY5 B;  1VP7 A;  1WPB A;  1WP8 A;  3OAA G;  3X2Q B;  1XNR O;  3K08 A;  3ABM B;  4WFH A;  3AG4 C;  3M99 B;  2LGW A;  1M57 B;  1EN5 A;  2GV9 A;  4Z2W A;  4GCZ A;  2P5O A;  2VWK A;  4D7S A;  2WLM A;  1GO3 F;  3K9S A;  5A2Q N;  2A3Q A;  3LDD A;  1K33 A;  1EN6 A;  5B1N A;  1XDC A;  2JJ1 G;  3VQW A;  2DN9 A;  4J9Y B;  2IU3 A;  2P7T C;  2E5L O;  4HNA B;  2M6Y A;  1IBM B;  1PPJ H;  1GN3 A;  3D36 C;  4X8A A;  2XOK G;  4Q6G A;  4QIW F;  5J2T A;  2EUL A;  3D36 A;  5EIB C;  4NTW A;  3G67 A;  1N34 O;  1K5Q A;  3CXH F;  3BPZ A;  2BSK A;  4MVZ A;  5EYP B;  1SRY A;  1EZJ A;  3JAT A;  3P30 A;  1N33 B;  3B40 A;  2GBO A;  4JI5 B;  1EZV H;  2DYS B;  4UCT A;  2IH3 C;  2Q7E A;  5LGT A;  4TT3 G;  4XBF A;  2FB5 A;  3K3W A;  3K5N A;  3HKD B;  3ETG A;  1JJ2 U;  3F7Y C;  4NTX A;  2H8P C;  2G38 A;  5CA3 A;  5E79 Z;  3MD0 A;  3BAB A;  4GX0 A;  1MZF A;  4UVB A;  5GTI Z;  1I94 O;  1HR0 B;  3SYQ A;  2HR3 A;  3N2K B;  4X1K B;  2H94 A;  1IXM A;  3TXS A;  2QE7 G;  4FM2 A;  2P22 C;  2Y0P A;  2EJ7 A;  3VOU A;  2LJ2 A;  2PI5 A;  1PL4 A;  4YIP A;  5BR8 B;  4NXM O;  2F43 G;  3CCV V;  2ZR2 A;  3FYI B;  2XT9 A;  4DR3 B;  1MA1 A;  4DW0 A;  1OV9 A;  3RN4 A;  2Q7H A;  4K3A A;  1GAX A;  1ENV A;  5JCO C;  3HKE A;  3CRC A;  4JI1 B;  4ASU G;  4WBN B;  1QU7 A;  1FKA O;  2EIJ C;  2BOC C;  5IYZ A;  3K0D A;  1UPG A;  4QE9 A;  4DV5 B;  1MAB G;  5CA0 A;  5KHH A;  4X64 B;  1GM8 A;  3UQ8 A;  4PI0 A;  4ZBM A;  3FB8 C;  3OD4 A;  2V1D A;  2R9I A;  1SS3 A;  1N0N A;  4ZIB A;  1OCZ C;  1H2S B;  4JTD B;  4G2K A;  2NR5 A;  2NN4 A;  3OR6 C;  4LF9 O;  1COW G;  1W59 A;  3AG2 C;  3E22 B;  1IBM O;  1Y6X A;  4B3M B;  4MTG A;  1GTO A;  1H2N A;  1OCR C;  1TVK A;  2QKA A;  4MVM A;  1ZLZ A;  3U0Z A;  4O4I A;  2KB1 A;  1FFT B;  2UXD O;  1DTO A;  4G28 B;  4U7O A;  3KKY A;  4O4H B;  1NU1 H;  4JI5 O;  3WU2 Z;  1PL0 A;  1XMO B;  3T1H B;  1K3E A;  4JF3 A;  1Z2G A;  2IBZ H;  4GT1 A;  3QF7 A;  4HAM A;  1ZL8 A;  1NI8 A;  2AGA A;  3O9O A;  2ARH A;  1JR9 A;  1JVM A;  4LFA B;  5KUM A;  2Q73 A;  1JFF A;  4X89 A;  5LGU A;  3UT5 A;  3CRA A;  3JD1 A;  4FZ1 A;  1OHH G;  1K92 A;  1WAZ A;  3B4S A;  3SPH A;  1SA0 B;  2XTA A;  2V4D A;  4DRX B;  5K1P A;  2L35 A;  2RCV A;  4J7Z A;  3JAW B;  3RGB A;  3CS5 A;  4B08 A;  1S76 D;  3CCM V;  2QWR B;  4OPA A;  5LMU B;  5IYC O;  1Q7Y W;  5KA5 A;  1VQ6 V;  4LF6 B;  1WB8 A;  3HKB B;  5BR8 O;  4FM1 A;  3CRQ A;  4TQF A;  1B6Q A;  1LNQ A;  2EIK B;  3RBZ A;  4JI0 B;  4X20 B;  2R70 A;  4DR3 O;  4GX5 A;  2YI9 A;  2HLD G;  1BE3 H;  2EX3 A;  1YCI A;  1S5L Z;  4FLU A;  1BSM A;  4MVO A;  1VF7 A;  1BHA A;  1MSD A;  4EB6 B;  2E75 B;  1IX9 A;  1LR1 A;  3P32 A;  1QLE B;  5GTH Z;  1RP3 B;  2CE4 A;  3S3X A;  1X59 A;  1US6 A;  4DR6 O;  4B7E A;  4R7C A;  5KAI Z;  1JMK C;  4DV5 O;  1H2L A;  1VQ7 V;  4X64 O;  4JZ2 A;  2XAH A;  3SDL A;  2YSU B;  5DN6 G;  3SGI A;  2LFR A;  4J7J A;  4DW1 A;  4ZHQ B;  1I5X A;  1KU9 A;  4J7K A;  3ZHT A;  3VBB A;  5KHI A;  1I7F A;  3CP1 A;  5B3S C;  1NZ6 A;  2WPD G;  2E3C A;  2WA4 A;  2Q8V A;  4I0X B;  2N74 A;  1VQ8 V;  1RPO A;  3HKC B;  4LNU B;  5CBG A;  4LH6 A;  3BCC H;  4B3M O;  1SQV H;  1KUQ A;  1MG1 A;  5EK0 A;  3H01 A;  5LYJ A;  3E35 A;  3ABU A;  3CPW U;  3BEH A;  2IJH A;  5IJ9 B;  1WA8 B;  1WPX A;  4PD4 F;  1CEZ A;  3ZS8 C;  3L9D A;  4DR1 B;  4JI8 O;  3G6B A;  3T1H O;  1PKX A;  1XI1 A;  4U3J B;  1K34 A;  1NR1 A;  4P30 A;  2D3O W;  4X65 B;  1PV0 A;  3VQX A;  4O2B B;  1S3J A;  1R73 A;  3QTC A;  2QEX V;  2CTR A;  4LF8 B;  2EZO A;  4I55 B;  4F6R B;  1Z5V A;  2QSA A;  3K5M A;  1L0N H;  1SES A;  4UCO A;  4JTC B;  2UXB B;  3NXS A;  3RYI B;  3BHP A;  2DYR B;  2YI8 A;  4MTF A;  4H33 A;  1H2G A;  4Z1M G;  5LMU O;  1ARO P;  3ZRX A;  2ILM A;  4CS4 A;  3CEI A;  1NH2 D;  4LF6 O;  1WNS A;  1T5E A;  1VQK V;  2CTP A;  1F4M A;  3SYP A;  4UV9 A;  2ZDI A;  4JI0 O;  4YHH B;  4BR6 A;  5BXZ A;  2YIA A;  2DWD C;  1VQO V;  4RQF A;  3I55 V;  1XRE A;  2P4V A;  3CCU V;  1SZT A;  2EBO A;  4WFA V;  2YIB D;  2Z0A A;  4DV0 O;  2V7Q G;  1DGS A;  4I9W A;  5B1B B;  4PDV A;  5J2T B;  2DOS A;  1Q82 W;  3ABL C;  5K1X A;  4Q20 A;  1AP6 A;  2BSK B;  5EBW C;  3JAT B;  3H1H H;  4RO2 A;  2CH7 A;  4ABM A;  4GKJ B;  2X7R B;  4I5S A;  2FKX A;  1M90 W;  1HW7 A;  4KP4 A;  3FX7 A;  2F93 B;  2EIL C;  1SQX H;  5LHH A;  1H8H G;  1Q5O A;  5D5P A;  3G4S V;  4UXN A;  5JJJ B;  3JSL A;  1OCC B;  1XNQ B;  4OGQ B;  4DV4 B;  5TIS Z;  1NTK H;  1K8A W;  3K04 A;  1IVS A;  2GTA A;  5F2V O;  4BW5 A;  3JD3 A;  1E1R G;  4H13 B;  3CSX A;  4YIO A;  4BIZ A;  1HDJ A;  3OUF A;  1Q6H A;  1KQS U;  1HP8 A;  1XHX A;  5BMV A;  1PNM A;  2ZE8 A;  3C3T A;  2UXC O;  4NTY A;  2ODM A;  1FXV A;  2Q7G A;  3AG3 C;  4DR1 O;  4LF7 B;  1YJN V;  3B8M A;  1M56 B;  5B1A C;  2WLL A;  5DM6 V;  4CS2 A;  4B3T B;  2AXT Z;  1QR8 A;  3JD2 A;  4JI6 B;  2LFS A;  4CC5 A;  1B3Q A;  4O4J B;  4LF8 O;  4JYB A;  3JAL A;  2RQ6 A;  4QJF B;  3TXQ A;  3HKE B;  3B09 A;  2QA4 V;  1GN4 A;  1WP7 A;  1YJ9 V;  4UB6 Z;  4DR5 B;  5C8Y A;  1V9P A;  5IYZ B;  4FFB A;  3NR7 A;  4LFB B;  1VF6 A;  4X66 B;  3MAQ A;  5CA0 B;  4GX2 A;  1GN2 A;  3ETE A;  4WFG A;  1F4N A;  2BTQ B;  3WFV A;  1L1F A;  2P90 A;  2CTW A;  1M9N A;  4YHH O;  1WN7 A;  3CRM A;  2Y69 B;  5J9P C;  4ZI7 A;  4B7K A;  2D2C B;  2X6A A;  3ZHV A;  4IT5 A;  1YZB A;  4MVR A;  3OFN G;  4DV2 B;  4X62 B;  1UJW B;  4GKK B;  4LF5 B;  2OCC B;  4YY3 B;  3H1I H;  3T1Y O;  2ZNI A;  3EVK A;  1YVW A;  4EEQ A;  1FJG B;  4MSW C;  2ZR3 A;  2HJF C;  1TVK B;  1GN6 A;  1Q43 A;  5FL7 G;  1XMQ O;  4O4I B;  1KEC A;  3W7U A;  2AW9 A;  2PGG A;  3CCE V;  4I9Q A;  4HBN A;  4XDK A;  4GKJ O;  1KKD A;  2JVD A;  3SJA C;  4JYA B;  4CH6 A;  2QKS A;  4H37 A;  1NVP B;  1ZL8 B;  1VQN V;  1BQZ A;  1AR1 B;  2Y48 A;  1ORQ C;  2XAS A;  3M7M X;  5GON A;  2CK3 G;  1XNQ O;  4UCV A;  2IU0 A;  1JFF B;  2MK3 A;  5B66 Z;  3UT5 B;  5CB4 A;  1BGY H;  3D3Q A;  3CCJ V;  2FL4 A;  3E8G A;  3JD0 A;  3KCY A;  3STZ C;  4XDL A;  2P4K A;  3K79 A;  1Y67 A;  2YIB A;  3T2M A;  2Q9L A;  4WCE V;  4BIU A;  3K0G A;  2UUB B;  4PA6 A;  4GUN A;  2HVJ C;  3AG1 B;  2PYJ A;  1YI2 V;  3L73 H;  3A0H Z;  5B1O A;  5JJE B;  4JTA B;  1N36 O;  4LF7 O;  4DUZ B;  3WG7 C;  2WLH A;  3B8N A;  4X88 A;  1FPO A;  4FLY A;  3OEH G;  4B3T O;  3U11 A;  1R1B A;  4JI6 O;  1XIL A;  5FPR A;  3E83 A;  1E79 G;  3E86 A;  3Q4H A;  2ZE6 A;  3STL C;  1YJW V;  1Y74 A;  2WA3 A;  1IBL B;  1Y4M A;  3G71 V;  2XAF A;  2PY5 A;  2GTS A;  4DR7 B;  4LFB O;  1BMF G;  2X6C A;  1XUQ A;  3FFQ A;  4CH4 A;  3D3I A;  2EIM B;  3RYC A;  1H2M A;  3W7S A;  3MHH C;  2QGN A;  5H2F Z;  3RWR D;  3ZX6 A;  4B3R B;  1QVF U;  1KBH A;  2Z3Y A;  3E89 A;  4QGP A;  2UXN A;  1P84 F;  2Y0I A;  4YXW G;  5B3S B;  3CCS V;  3LSU A;  1QBZ A;  4DV2 O;  4LWS A;  1SQF A;  4O4J A;  1SC5 B;  5LP6 C;  3J81 N;  4PHZ A;  2UUC B;  3KZI Z;  4IHJ A;  3CME V;  5LP6 A;  1FJG O;  1IBK B;  1K4D C;  4FJC C;  5LYJ B;  4LH7 A;  5JCO A;  5GW7 A;  4YJ2 A;  3LSS A;  2BTO A;  3EFF K;  4OXS A;  2KKW A;  1NTZ H;  3CD6 V;  1LUW A;  3F5T A;  3OMI B;  2BTQ A;  1YTF D;  3H1J H;  3CC7 V;  2ITC C;  5FLX N;  3W7W A;  2QDO A;  2H3O A;  5JVD A;  3ZED A;  2HP8 A;  4AQY B;  1K7D A;  4JYC A;  1KC8 W;  1BT8 A;  1FFX A;  4LF4 B;  4EFB A;  2YUA A;  2EJR A;  4P9P A;  1VQ4 V;  3P3N A;  4GYC B;  3OE7 G;  2VRZ A;  3A0R A;  2BOB C;  5ITZ A;  3J80 N;  4I4T A;  2YXL A;  3ASN B;  3IFX A;  2Z5U A;  1V54 C;  1Y76 A;  2MW2 B;  1SKV A;  3VQV A;  3OM3 B;  1OJH A;  3FYE B;  2GSM B;  1JPX A;  2UUB O;  1QR9 A;  1WJZ A;  1PNL A;  1E1Q G;  4DV6 B;  1N33 O;  2IM9 A;  1ROP A;  4QPK A;  5CA1 A;  2QKC A;  4DUZ O;  4DR4 B;  1FXK C;  1BZK A;  4J10 A;  3WB0 A;  2W6I G;  3E8B A;  1U97 A;  4WFF A;  3X2Q C;  2QJ1 A;  3DXR A;  2DQ0 A;  2A7W A;  1WB7 A;  4RUE A;  1J5E B;  2QWP B;  2B5U A;  2RNB A;  1PP9 H;  4MW3 A;  3R65 A;  1B06 A;  1HR0 O;  4OPH A;  3CX5 F;  1JJO A;  1K4C C;  4DV7 B;  3SR2 C;  4P9O A;  3BA8 A;  1G1X B;  1BCC H;  5LA6 B;  2W6J G;  3ZHS A;  3L70 H;  3E2E A;  3ABL B;  2CH7 B;  4FLX A;  1I08 A;  4IIJ A;  1V55 C;  2JGU A;  3CCR V;  5L3G A;  5IYD O;  4BIO A;  1AJP A;  4JPR A;  1EFR G;  3QVN A;  3ZHQ A;  4EFE A;  2IJK A;  5CN0 A;  1XBL A;  1ZAU A;  3L71 H;  2DYS C;  3FAV A;  5EC2 C;  4ICG A;  2ZNJ A;  1ZTE A;  1IBK O;  2K1E A;  3L72 H;  1D5N A;  2EZP A;  4JI1 O;  4N21 A;  3H1K H;  2GUZ A;  2DJV A;  3HPL C;  2OT5 A;  3ASO C;  1EM1 A;  5BMV B;  3TCU A;  2Y4U A;  4CH3 A;  1P7G A;  1HNZ B;  1P7B A;  3F7V C;  3KCX A;  3WB2 A;  4D6T H;  2ITD C;  2WLL B;  1NQT A;  2XUM A;  4PDL A;  1FAF A;  5KUK A;  1GM7 A;  1QQC A;  1H2K A;  2ZT9 B;  2Q4P A;  4DR2 B;  2YXH A;  3JAL B;  3CYO A;  1VQ5 V;  4JI2 B;  4GZR B;  2PUS A;  1U96 A;  3UO2 A;  3GWO A;  1RPR A;  5LHI A;  2ZE5 A;  3B77 A;  3IGA C;  1XOU A;  4N23 A;  2F4V B;  4MVS A;  3SPG A;  5IE9 A;  5C8Y B;  4FFB B;  4YJ3 A;  1Y66 A;  1QNM A;  4JAU A;  2VQE B;  5EBM C;  4DV6 O;  2CGO A;  3E8F A;  2PYL A;  1CPY A;  4KXR A;  3LUT B;  3APO A;  5BZB A;  2HKO A;  2PTM A;  4DR4 O;  3SPJ A;  1D2D A;  1XMO O;  1AI7 A;  1AI4 A;  4ZI7 B;  4AIL C;  3CE2 A;  2B1G A;  3HR0 A;  4LFA O;  4K8X A;  1J5E O;  4MT8 A;  2QR4 A;  2P06 A;  4X1I A;  3LSQ A;  1KKC A;  1Q6U A;  4FM0 A;  4UFZ A;  5FNV A;  1NT2 B;  1XL6 A;  2CAZ C;  1CXZ B;  5JWP A;  2YDE A;  3A8T A;  4DV7 O;  1BQ0 A;  1IDS A;  3FD9 A;  3RVZ A;  5AG2 A;  3JCU Z;  3QO7 A;  2OYQ A;  4I7Z B;  2EIN C;  3CJH A;  3ETQ A;  2RDC A;  1J95 A;  3K06 A;  4FLW A;  3ZCC A;  1K73 W;  3CXC U;  1NH2 B;  3JAK A;  1KMI Z;  3AG4 B;  3ML0 A;  1OCO C;  4J9Z B;  5KAF Z;  2E74 B;  2QTO A;  5LXT B;  5HFL A;  5GON B;  1VIB A;  5CB4 B;  3K03 A;  1L0L H;  5EBL C;  1NBM G;  3GVM A;  1QCE A;  2ZIM A;  1B04 A;  3T4Z A;  3FB6 C;  5EC1 C;  4DUY B;  1RM1 C;  5KMG A;  2RJZ A;  3N27 A;  1HWY A;  4J41 A;  2F66 C;  1Q81 W;  5LMN B;  4PI2 A;  3ZBH A;  1HNZ O;  5LA6 A;  4TV9 A;  5LHG A;  3RYF A;  1M5I A;  3D8C A;  2UU9 B;  3ETD A;  3MDS A;  4CS3 A;  3SYA A;  1PNK A;  4DV1 B;  5LOV A;  4RUF A;  2CTQ A;  1NR7 A;  4K8Z A;  4CZZ A;  3M8A A;  3ICX A;  4DR2 O;  1M93 A;  1BL8 A;  5J2U A;  4JI2 O;  1SQQ H;  4C7U A;  3Q4H B;  3QO5 A;  4FVM A;  1Y74 B;  2ATK C;  2HJD A;  2F4V O;  1K97 A;  1GK9 A;  3JSN A;  5H9C A;  3F5W C;  2E76 B;  2Q0O C;  3N2G A;  1MMM A;  3RYC B;  1Q6I A;  2R9R B;  3IC9 A;  1N8R W;  1JX9 A;  3OGC C;  5EZY A;  2VS0 A;  2ADQ B;  1W2B U;  5E1A C;  3JAS A;  4JI3 B;  3BVO A;  5A9G A;  3OTO B;  3CC2 V;  4X65 O;  1AI5 A;  1L8D A;  3K5O A;  3ZMZ A;  4F6E A;  2PI4 A;  2YS8 A;  4HZ3 A;  4LWS B;  1VF5 B;  2DW4 A;  2WLJ A;  2Q5Z A;  1ZX3 A;  1A32 A;  4IHJ B;  2IH1 C;  5LP6 B;  2UXB O;  1UFI A;  1I0H A;  2JIZ G;  3W7X A;  4K0K B;  3JAM N;  1GKF A;  1JCH A;  1PM9 A;  4YJ2 B;  3UM7 A;  2Q69 A;  3OT7 A;  4PA7 A;  3K57 A;  4AI8 A;  1MZE A;  1GRJ A;  3L75 H;  2EIJ B;  3BFR A;  1R3K C;  3HB3 B;  4X1Y A;  2QM8 A;  4DYL A;  3ZRS A;  5JVD B;  2ZM6 B;  3UO3 A;  1TUB A;  1JQ0 A;  5KLV H;  1I94 B;  2DWE C;  1AR5 A;  1VAR A;  1SQP H;  4MS2 A;  5L3F A;  1FFX B;  1S5J A;  3JAR A;  1SF9 A;  4J80 A;  1F23 A;  1KB9 F;  1VQP V;  1OCZ B;  1G8M A;  5ITZ B;  3K59 A;  2QM4 A;  5IT9 N;  5IJ0 A;  4I4T B;  4FFK A;  3I56 V;  3K58 A;  1Y76 B;  4DUY O;  1GH6 A;  3AG2 B;  4NXM B;  2ZIN A;  1V54 B;  5LMN O;  4R8C A;  1VEW A;  4X9Q A;  1G4Y B;  1OCR B;  5KA6 A;  2CDY A;  1KYO F;  3FKS G;  4CH5 A;  2ZCE A;  5CA1 B;  1AB3 A;  2UU9 O;  1MOF A;  4RAI A;  4U7N A;  4W4L A;  2XHB A;  2OWO A;  1AIL A;  3RVY A;  4DV1 O;  2VQF B;  2ZXW C;  3G80 A;  3AEI A;  5LXT A;  3DXR B;  4DK0 A;  4PA3 A;  2ZIO A;  4DV4 O;  3OW2 U;  2LQT A;  3RYH A;  2XAJ A;  1NS1 A;  1TUE B;  1NVP D;  1M1K W;  2LW7 A;  4UV8 A;  3THO A;  4FLT A;  3CMA V;  3TJT A;  2JGD A;  5JQG A;  5L3B A;  4TV8 A;  2HG5 C;  4O4L A;  1YIJ V;  1TA8 A;  3KG2 A;  5D5Q A;  4KHP B;  4IIJ B;  4JYY A;  3TK1 A;  4LF9 B;  3AK2 A;  4JI3 O;  2QTS A;  5B1B C;  4JV5 B;  3G6E V;  4E4E A;  1V55 B;  3OTO O;  4BWA A;  3B2E E;  4ZKI A;  1GM9 A;  3IC7 A;  4I50 A;  3TET A;  1FS0 G;  4LCU C;  1QLN A;  3ABK C;  3OGI B;  2AZ2 A;  2WLI A;  3ZMU A;  2UXD B;  1R6T A;  3BA9 A;  1AR4 A;  2W0X A;  1VQL V;  3FAV B;  4KUM A;  1R3J C;  4K0K O;  2C2A A;  2HVK C;  1BS3 A;  2GUZ B;  1R6N A;  4DR5 O;  2K9P A;  3P3P A;  4E2L A;  5KHJ A;  5JH7 A;  1OCC C;  3IAY A;  4CBC A;  4X66 O;  4JI4 B;  3GWK C;  1THZ A;  4TUY A;  2KG7 A;  3SJQ C;  2Q0A A;  3R66 A;  3JCZ A;  5H6Q A;  3ASO B;  2ADP A;  2N05 A;  2A79 B;  4PEL A;  2ZM6 O;  3OMA B;  4TSF G;  2A0L A;  1FYJ A;  3EXA A;  5LBQ A;  1S77 D;  4LFC B;  3UCS C;  5CBF A;  4ZOL A;  4LR3 A;  1YDX A;  5L3D A;  1MNG A;  1FD9 A;  3S3W A;  2HFE C;  2KQX A;  4X62 O;  3ZRW A;  4GKK O;  4LF5 O;  2IJJ A;  1VQM V;  4YY3 O;  3L74 H;  2OIE A;  4NB5 A;  1M56 C;  1TGO A;  2RN9 A;  3O65 A;  4WFB V;  2A9H A;  1JA8 A;  3OR7 C;  4Z1V A;  2F1M A;  4XDJ A;  4YJ3 B;  4JAA A;  1GMG A;  4FLZ A;  2DE0 X;  3W7T A;  2FTK A;  2RMK B;  4H0L B;  1ZSP A;  5KX5 A;  3DC6 A;  1NTM H;  4JYA O;  3CRR A;  3SYO A;  5BY1 A;  2JK5 C;  2VQF O;  4NXN B;  3CCQ V;  4MVU A;  1YTF B;  1SET A;  2F95 B;  2YID A;  3E8H A;  4DR6 B;  4NKG B;  2YEV A;  4FPP A;  4BAY A;  1VMG A;  3JYC A;  4X1I B;  3OUS A;  1XHZ A;  3RFR A;  1HNW B;  1VQ9 V;  2Y69 C;  4UB8 Z;  2LW1 A;  3A2F A;  2JDI G;  5C93 A;  4O2A A;  5FNV B;  2Q6A A;  4DK1 A;  2JEX A;  4PA4 A;  2PZS A;  1DK1 A;  2WLK A;  3GB7 C;  4R50 A;  2YC0 A;  2IJI A;  4CC6 A;  2OCC C;  3CJH B;  3ZHR A;  4UCU A;  4NYK A;  1IUR A;  4KHP O;  5KHK A;  4JZG A;  4G27 B;  4GLX A;  1EN4 A;  2EIN B;  4JGS A;  1XQ8 A;  2ZE7 A;  1RSO A;  4JV5 O;  3JAK B;  3JD4 A;  5IY5 C;  3ABT A;  1FXK A;  1AJN A;  2A06 H;  1URF A;  1OCO B;  4UCS A;  2JRI A;  2XAQ A;  3ABM C;  2AZ0 A;  1HNX B;  1PD3 A;  3T4D A;  4FMT A;  1M57 C;  3PN1 A;  1IBL O;  3SPI A;  4J11 A;  4JI8 B;  5KMG B;  1TAE A;  4DR7 O;  4KL1 A;  4B3S B;  1RM1 B;  4JI4 O;  4JAV A;  4OX9 B;  1AI6 A;  4TV9 B;  1CP9 A;  5B5E Z;  3RYF B;  3AG7 A;  3K9A A;  4B3R O;  4BW9 A;  2UUA B;  4TOI A;  4HNA A;  1RFY A;  5LOV B;  2DQ3 A;  4WFE A;  4LFC O;  5DED A;  2Y4T A;  3AG1 C;  1K9M W;  2OIG A;  1SER A;  3OEE G;  5J2U B;  2EIL B;  2LP7 A;  1IXB A;  3U10 A;  5EYP A;  4GX1 A;  2UUC O;  2YXY A;  3K5L A;  2AHY A;  1DF5 A;  2R72 A;  3LDC A;  4IGG A;  2O57 A;  2BCC H;  1R3I C;  1W0K G;  4IYI A;  5JJN B;  2BE3 A;  3N2G B;  1AJQ A;  1YXB A;  2W0F C;  3HKD A;  3CWB H;  4AHC A;  3SJB C;  5L3E A;  5EZY B;  4NXN O;  3JAS B;  3I5D A;  3LNM B;  4DV0 B;  1DF4 A;  4PJ0 Z;  3AG3 B;  1X4T A;  2PF4 E;  4AQY O;  2YIC A;  2VWJ A;  2Q68 A;  5B1A B;  2EIM C;  2B9Z A;  4LF4 O;  3DC5 A;  2QWO B;  3N2K A;  1DLB A;  1Q3E A;  4LP8 A;  4X1K A;  1HNW O;  3CC4 V;  1M4U A;  1R3L C;  1Q90 D;  2AHZ A;  2JEU A;  1N32 B;  3H9V A;  3SPC A;  3H1L H;  4MVQ A;  4X1Y B;  3APQ A;  3BY6 A;  1EBO A;  2F23 A;  3T1C A;  1XEQ A;  1Q86 W;  2LGQ A;  5H6R A;  3ZN0 A;  1Z5W A;  1MSW D;  2CGN A;  3J7A U;  3LDE A;  1TUB B;  5DEC A;  4WBN A;  3BRC A;  4FLV A;  3EHB B;  1NJI W;  3JAR B;  1AVM A;  4K35 A;  3FB5 C;  2WAM A;  3CHX A;  1YHQ V;  1LUV A;  4W4K A;  1HNX O;  4UVC A;  5IWA B;  2UXC B;  5IJ0 B;  1I5Y A;  2WWW A;  4UCR A;  3WB1 A;  1G6U A;  4QE7 A;  4DXW A;  4B3S O;  1S5H C;  3DTU B;  1H38 A;  1F7Y A;  4IL6 Z;  4QNH B;  3RT3 C;  4OX9 O;  3OMN B;  3A0B Z;  1P4R A;  2XND G;  3ASN C;  3QG5 A;  1KP3 A;  2UUA O;  1YSC A;  1WLE A;  2GDS A;  1XL4 A;  3E22 A;  3ZIA G;  3ZN1 A;  2NNU A;  1QHT A;  5FPO A;  2HHH B;  2IW5 A;  2X6B A;  5LL6 Y;  3ZJZ A;  4FK5 C;  2ZXW B;  1F51 A;  2LO1 A;  2HEP A;  2GHY A;  3RYH B;  2ZDI C;  1JOY A;  4NR1 A;  4PDR A;  4O4H A;  4R6Z A;  1FXH A;  3MHS C;  3FB7 C;  3PJS K;  3C3S A;  3QNE A;  2JGD B;  5JQG B;  4TV8 B;  2DMX A;  2WSS G;  4EKW A;  4O4L B;  4JI7 B;  4DV3 B;  2L6L A;  5CMU A;  1SA0 A;  3T1Y B;  5CBH A;  4DRX A;  2N04 A;  4IYH A;  1Q8I A;  3WG7 B; 
#chains in the Genus database with same CATH homology
 4GKK O;  4X64 O;  4LF5 O;  5FLX N;  5BXZ A;  4YY3 O;  4JI4 O;  3SDL A;  3J7A U;  4DV7 O;  3O65 A;  4DV4 O;  2UXD O;  5H5N A;  1IBK O;  1N36 O;  4JI7 O;  4B3R O;  4LF7 O;  4JI1 O;  1NS1 A;  4DV3 O;  4X65 O;  2Z0A A;  1I94 O;  4DV0 O;  4JI5 O;  2N74 A;  2DJV A;  1N32 O;  1HNX O;  2LW7 A;  4B3T O;  4LFC O;  3J80 N;  1R1B A;  2VQE O;  4JI6 O;  2DOS A;  4JYA O;  2AGA A;  5BY1 A;  4YHH O;  1A32 A;  2VQF O;  4B3S O;  4B3M O;  2UXB O;  1F7Y A;  2UUB O;  1KUQ A;  2UUC O;  4NXM O;  3JAM N;  3RT3 C;  4OX9 O;  1YZB A;  2FKX A;  1XNR O;  4X62 O;  4JI3 O;  1N33 O;  2UUA O;  4LFB O;  3OTO O;  4DUZ O;  1XEQ A;  3T1Y O;  5IWA O;  4JI8 O;  3T1H O;  5LL6 Y;  5A2Q N;  4OPA A;  1R6T A;  1DK1 A;  1XMQ O;  1HNZ O;  4NXN O;  1FKA O;  4K0K O;  5BR8 O;  2E5L O;  4AQY O;  4GKJ O;  4KHP O;  4DR5 O;  4DR3 O;  4DV6 O;  4LF4 O;  4DV2 O;  4X66 O;  5IT9 N;  4JV5 O;  1HR0 O;  4OPH A;  3M8A A;  4DUY O;  3J81 N;  4DR4 O;  1HNW O;  4DR2 O;  4A5U B;  1D2D A;  3R66 A;  1XMO O;  2ZKO A;  2UXC O;  1N34 O;  4JI2 O;  1G1X B;  2HHH O;  4DR1 O;  1FJG O;  5LMN O;  1XNQ O;  2JRI A;  2ZM6 O;  5LMU O;  4LFA O;  1FYJ A;  2F4V O;  1J5E O;  1X59 A;  4LF6 O;  1AB3 A;  1IBL O;  4LF9 O;  2UU9 O;  4DR6 O;  1IBM O;  4LF8 O;  4DV5 O;  4JI0 O;  3F5T A;  4DR7 O;  1AIL A;  4DV1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...