1HNZO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnzO00
1XMQO 4LF6O 4OX9O 2UU9O 1X59A 2AGAA 5A2QN 2E5LO 2UUCO 3R66A 4X66O 1N34O 5LL6Y 1XNQO 2JRIA 1AB3A 2DJVA 1HNXO 4DR6O 1HNZO 2UXDO 4B3TO 4DR2O 1FJGO 4DV1O 4JI4O 4JI5O 4LFAO 1IBKO 4K0KO 1HNWO 1AILA 4LF9O 5H5NA 1HR0O 1A32A 2VQEO 5LMUO 3OTOO 4DUYO 4KHPO 4DV3O 4JI6O 4X64O 4LF4O 4DR7O 2HHHO 4DR4O 1FKAO 4JI0O 4X65O 4YHHO 4JI8O 4GKKO 4B3RO 5BR8O 3F5TA 4X62O 4LF7O 1XNRO 4NXMO 4JI2O 1J5EO 4JV5O 4LFCO 2UXCO 2ZM6O 2UXBO 1DK1A 2Z0AA 2ZKOA 1N36O 4YY3O 1G1XB 5BXZA 3J7AU 3RT3C 4DV6O 1XEQA 4JI1O 4A5UB 2N74A 4LF8O 4DR1O 1IBLO 4GKJO 2UUAO 4LFBO 1N33O 4DUZO 4AQYO 1R1BA 4DR3O 2VQFO 4JI7O 1XMOO 4LF5O 2UUBO 1I94O 1KUQA 3M8AA 4NXNO 1F7YA 3JAMN 3O65A 4OPAA 2FKXA 5IWAO 5LMNO 1YZBA 4JYAO 4DV0O 1D2DA 3T1YO 2LW7A 3J81N 3T1HO 4DR5O 1NS1A 4B3MO 4DV2O 1FYJA 2F4VO 1N32O 4DV7O 4DV4O 3J80N 5IT9N 4DV5O 4OPHA 4B3SO 5FLXN 4JI3O 1R6TA 5BY1A 1IBMO 2DOSA 3SDLA
chains in the Genus database with same CATH superfamily
1ZWIC 4Z2WA 2B1GA 4LF6O 3FB5C 1SESA 1XILA 1Q6UA 4LNUA 5AG2A 2UUCO 2IH3C 3LUTB 2EZPA 2C2AA 4F6EA 4G27B 4DR6O 4PA9A 4IIJA 1D5AA 2Y48A 3B4SA 2XAJA 5FPRA 4J41A 5DN6G 1Y67A 4LP8A 2P6JA 4CS3A 1HDJA 1VQ7V 4NR1A 1JCHA 4LBEC 4LF4O 1FKAO 4NXNB 3CCUV 4YHHO 4L87A 4PA3A 3E2EA 1KBHA 1XNRO 1GM9A 3ZRXA 5EBWC 3QG5A 1YI2V 4PHZA 2LFSA 3N2GA 3IFXA 3K08A 1E1QG 3BRCA 5H6QA 5H6RA 2Q7HA 4X1KB 2ZR2A 1CPYA 3JATA 1RFYA 1OCRC 4LF6B 5J2TB 3UKMA 5GONA 4PA7A 2ITCC 4ICGA 4YJ2B 5BMVA 1IBLO 4F4LA 4DV0B 4PA4A 4JAVA 2AZ2A 2HP8A 1SQQH 4BIOA 4LCUC 2VQFO 1P84F 4EKWA 1R3JC 4K3AA 3CB2A 1HP8A 1B04A 4GZRB 4F6RA 1IX9A 1S72V 3JCZA 2E76B 2ZD9A 4WFFA 1FYJA 1WB7A 3RW0A 4O4HA 2QTSA 1R3KC 4B3SO 3CWBH 3GWKC 1SQGA 2XAGA 5BY1A 1IBMO 3JD0A 1YTFD 2HR3A 2LW1A 3VQVA 4WBNB 4O4LB 2ZCEA 4K0KB 2NNUA 3THOA 4K35A 3VQYA 1Z2GA 4JAUA 3ZMVA 1NVPB 2HJFC 5KHKA 2BOCC 2VS0A 3K57A 4HNAA 5H9CA 2XTAA 4LH7A 4YJ3A 4ZOLB 5JVDB 2EIJC 1HNWO 3CC7V 4JF3A 4O4JA 4O2BA 3FKSG 2E75B 2X6AA 3C3TA 2YXYA 4X1IA 5FL7G 1D5NA 2LJ2A 3JASA 4GKKO 2HVJC 4QE7A 1S0VA 1B6QA 4WFGA 3HKCA 2JS3A 1FD9A 3APQA 1SQVH 1VQ6V 1N8RW 4UVBA 1JR9A 3SPHA 2VRZA 4DRXA 2ATKC 3CMEV 3AG7A 3DXRB 1W59A 4I7ZB 4GKJO 1F51A 3T1YB 3CHXA 3D3IA 2OT5A 4AQYO 3CPWU 3K9AA 3CCQV 1N32B 1OCRB 3JSNA 3CCMV 3SPGA 3HKEA 3CRAA 2WLLB 2RCVA 2JJ1G 1OJHA 3Q4HB 5LYJA 1KYOF 3CJHA 3JAWB 2F1MA 3U11A 3FD9A 2B1IA 3BAAA 1NH2D 4DV4O 1DF4A 1H2MA 2BE3A 5CA0A 2AHZA 3K79A 4PI2A 3IJ4A 2CDYA 3SDLA 2XAFA 3SGIA 1EN5A 2HG5C 3AG4C 4W4KA 1PD3A 1VARA 4H13B 5LL6Y 2BTQB 3CCLV 5C8YA 4P9PA 4TV9A 3OD4A 3ETEA 5BR8B 3L75H 3WU2Z 3FAVB 1VMGA 4J10A 1SQXH 4B7KA 2X0LA 1WP7A 2IH1C 4DUYO 3UQ8A 4UV9A 1GN3A 4X64O 2A0LA 4DR4O 3BEHA 1PL4A 4KXRA 4B7EA 2EIJB 4ZBMA 3X2QC 1LUVA 2WAMA 3ZIAG 4GYCB 2N04A 3L73H 4X88A 3B8MA 4LFCO 3W7SA 4UXNA 4XDKA 4U3JA 2RN9A 2YXLA 1F4NA 1BCCH 1G4YB 5ITZB 5LP6A 3JSLA 3W7WA 3SYCA 4JGSA 4LF8O 4X89A 1UPGA 3ZHVA 3K5OA 1F4MA 3JALB 4JAAA 4DV5B 5GTIZ 1K97A 1I0HA 3JAMN 5FPOA 4H44B 4JYAO 4I9WA 1H8EG 3CD6V 3D36A 4I50A 3LSQA 2UU9B 3RYCA 4PI0A 5GW7A 5B1OA 4DV7O 2VWKA 4QNHB 2Q67A 1JOYA 5LGUA 3LDEA 3ICXA 4IHJA 4MTFA 4JTCB 3RN4A 3ZRWA 2AW9A 3B09A 1YIJV 3SYQA 1OHHG 2PY5A 4PDLA 4TWKA 3E35A 4B3TO 3CXCU 3HKBB 5EK0A 4LF8B 4JI4O 1Y76B 3AG4B 4QE9A 5LOVB 4DV3O 3TXQA 4UB6Z 2ILMA 2AHYA 5IE9A 4WF9V 4C7UA 3A0BZ 3BA9A 4UCTA 4DV6B 4I5SA 3CRMA 3H1KH 2ZT9B 2PF4E 3AK3A 1DK1A 4FLTA 1G8MA 2ZNIA 3OM3B 5FNVA 3X2QB 2R9RB 1Y74B 1WPXA 2DYRC 1XMOB 1IXMA 2YICA 1K7DA 3ASNC 1YVWA 2FL4A 4I55B 2FYUH 5IWAB 4UCSA 2UUAO 2HKOA 2V7QG 4RAIA 2XNDG 1YJ9V 1GM7A 1WA8B 4MS2A 4UFZA 2LQTA 1GH6A 5LBQA 4UVCA 3L74H 2HJDA 1RPOA 1BSMA 2XASA 3CC4V 1GAXA 3M8AA 2IU3A 1KKDA 3SYAA 3SPCA 5L3GA 3TK1A 5KUKA 2ZE8A 2ZE7A 2PTMA 3A2FA 4JASA 4FZ0A 1S3JA 2EJRA 5TISZ 5LXTA 2PZSA 3OT7A 2M7WA 4U7NA 1XNQB 2YEVA 2CH7A 3AG2C 4JI3O 3G67A 1K92A 2ODMA 1HNXB 2ZIOA 1HNZB 3GVMA 1VF6A 4JYBA 3OR6C 5LGNA 1L0LH 1PKXA 2Q5ZA 4UCOA 2OTLV 1GN2A 1VQ5V 2W0FC 4EEQA 2HVKC 3ASOC 2Q9LA 1RSOA 1KB9F 3RYHB 2HHHB 2VWJA 4JI0B 1OV9A 4BAYA 4H37A 2UUAB 5LHHA 5KHIA 2YXHA 5IJ9A 4J42A 3JD4A 3RYIB 2V4DA 4X1YA 4R7CA 5CB4A 1J5EB 3F7VC 3RBZA 3OEEG 2UXBB 1P4RA 3CX5F 1U96A 4FJCC 4Q6GA 2ZE5A 5CBGA 3IAYA 1W2BU 4UUJC 4I9QA 4DO2A 3P30A 2IU0A 1TUEB 2JEUA 2QGNA 1PL0A 4O2AB 2OWOA 1Q82W 1FS0G 1K34A 3RGBA 2WWWA 2QJ1A 4JI1O 1FAFA 3FYIB 1W0KG 3ZRSA 3VBBA 2WLKA 1EM1A 3ETQA 2DYRB 3N2KB 5KA6A 2QEXV 1NTMH 4LC1A 3F7YC 4FMTA 1I94O 3ZX6A 4DK1A 2P4KA 1WLEA 5D5QA 3C3SA 2YS8A 4Q20A 1S5HC 1I5XA 1XMQB 2BCCH 4DR5O 1JPXA 1EBOA 1GTOA 3A0HZ 4FVMA 2Q0AA 2QM7A 2P22C 4WFHA 1NR1A 3CE2A 2CTPA 3H1HH 3ABLB 5HFMA 4OX9O 4MVZA 2F43G 1X59A 3M7MX 3JARA 2E5LO 2YIAA 3AG2B 2WLNA 2DJVA 4LNUB 5K1PA 2ZDIA 4DR7B 1FJGO 3ZMSA 4DV1O 3G4SV 3UT5A 4LFAO 3FFQA 3K03A 2RQ6A 5HFLA 4IIJB 2P67A 2JGDA 4LF9O 3ASOB 5JCOA 4JV5B 3RWRD 5IYBO 1H2NA 2AXTZ 1NI8A 1SQPH 3LSUA 2H3OA 4RUEA 5J2UB 4ZHQA 1GO3F 2IJIA 2W6IG 4MW3A 3GWOA 1ORQC 2UXCO 2GSMB 3B40A 4IL6Z 2ZM6O 2GUZA 3H1LH 1TA8A 1RM1B 2Q0OC 3QO7A 4RQEA 3ETDA 1AJPA 3JATB 2E5LB 3FB7C 3T4DA 2JIZG 4TQFA 2CTWA 5GONB 3L72H 4J11A 1QVGU 5B1NA 5BMVB 3BPZA 1JJ2U 5A9GA 3E8HA 3SYOA 2QKSA 2IM9A 3CCEV 3CCVV 2LW7A 5IYDO 4F6RB 3LDCA 4FM1A 2F4VO 4OXSA 1YJNV 2UUCB 3K0GA 3IC9A 1T5EA 4OPHA 4DR6B 3DTUB 4O4HB 1WNSA 2Q73A 2ZM6B 4BIZA 1ZL8B 4K8XA 2AGAA 1BL8A 4FLYA 1THZA 4MSWC 2XHBA 4L8JA 4HBNA 4LF4B 1FXKC 3ZS8C 1YF2A 3LSSA 4YHHB 4X20B 3MDSA 3K9SA 4HNAB 1XNRB 2EINC 1ZAUA 3BVOA 4YJ3B 1CP9A 4J7KA 1DGSA 3R65A 5LA6A 4O4JB 4O2BB 5KHHA 4JI8O 3B8NA 4O4IA 4LH6A 4X1IB 4NXMO 1FPOA 3JASB 1Q81W 1LR1A 1IBLB 1H2LA 3PJSK 2YIBA 5B66Z 1E1RG 4Z1MG 2XAHA 2VQFB 2MW2B 1NTZH 3QO8A 3K5LA 1X4TA 2MK3A 4NTYA 1BMFG 4CH5A 3OMIB 1BS3A 4TSFG 4JTDB 5CBFA 2OIEA 4DRXB 3BY6A 4QGPA 4WBNA 4O4LA 4DUZO 4FM2A 4JZGA 1AVMA 2QWPB 3G6BA 4B3SB 3SPIA 1IBMB 2NN4A 2FKXA 5LHIA 3HKEB 3KCYA 4TQDA 1YJWV 4BIUA 1P7BA 1NS1A 5IYZA 5H2FZ 5LYJB 1EN6A 2EIKC 5JVDA 3ABKC 1OCZC 1AI4A 3CCSV 4JI8B 1K3EA 1VEWA 3OE7G 1Q43A 5JQGB 5CA0B 1JJOA 4TUYA 2Q6AA 2JK5C 1PPJH 5KX5A 1HNWB 3R66A 4TV8A 1K73W 4EFBA 5EZYB 1AB3A 4H33A 1ZX3A 1TAEA 4MW8A 2DYSC 1QU7A 3O9OA 4GKKB 1IBKO 4CC5A 5C8YB 2D2CB 4TV9B 1FFXA 5H5NA 3T2MA 1VQ4V 1GMGA 3KCXA 4TOIA 4G28B 4PD4F 1M90W 1FXKB 1VQNV 1U97A 5CA3A 2W0XA 3HR0A 2EULA 3M99B 1YHQV 1YDXA 2EINB 3AK2A 4LF7O 1M57C 4RWUA 3QO5A 3RFRA 1CXZB 1YTFB 4GKJB 5B5EZ 4AQYB 4YY3O 3OMNB 4I0XA 4U3JB 5BXZA 1NQTA 1M5IA 4CS4A 2E3CA 1L0NH 4QIWF 2XAQA 2Q7EA 3SPJA 1NJIW 3HKDA 1N33O 2PUSA 4DR3O 5JH7A 1W0JG 3JCUZ 4DV4B 2Y4UA 1SA0A 2OCCC 2BTQA 1WPBA 3F5WC 2DQ0A 2K1EA 3JAKA 1QR8A 5LMNO 1YZBA 2XOKG 2QTOA 5KMGA 2CE4A 4EB6B 4GLXA 1Q90D 2BOBC 4J7ZA 1WJZA 1JFFB 2KB1A 1VF6C 2QA4V 3TXSA 3OR7C 2JVDA 2QWOB 1H2SB 3ZN1A 4NTXA 3LDDA 3ZRVA 2EIKB 4NKGB 3ABKB 1OCZB 4IHJB 3MHSC 4DW0A 4FM0A 1XI1A 1URFA 3A0RA 3ETGA 4DUYB 4FLXA 4X64B 1BGYH 4DR4B 4DR2O 3K06A 1VQKV 5CN0A 3CCJV 2EJ7A 5KHGA 1S5JA 5CMUA 4DR3B 1HR0O 4LFCB 5LMUO 1H2GA 2DYSB 3OGIB 5E1AC 1QLNA 1NBMG 1K5QA 1TGOA 4FFBA 3A8TA 3K5MA 4ASUG 2WA4A 3JALA 3D3QA 1NH2B 1FXVA 4UCVA 4JI2O 4RO2A 4Z1VA 5JJJB 3KZIZ 5LHGA 3FB8C 2GDSA 1H2KA 2H94A 4G2KA 4R50A 1JQ0A 3S3WA 3K58A 1BE3H 1M57B 1RPRA 1G1XB 1ENVA 4ZKIA 1OZ0A 1Q8IA 3W7XA 3ABMC 4WCEV 1AJQA 4JYAB 2A9HA 4LFBO 2KG7B 3EVKA 2PGGA 4TT3G 4JI7O 3K04A 2WLIA 4ZIBA 4X9QA 3RVYA 2ZE6A 4DV7B 2WLHA 2A3QA 1K5SA 2LGQA 1Q5OA 3E8FA 2BSKA 5KHJA 3TETA 1HR0B 1HWYA 3JYCA 3T1HO 4DV2O 1YXBA 4FLWA 4IGGA 5LOVA 1EN4A 1VQ9V 2OCCB 4ZI7A 1G6UA 1OCOC 3APOA 5EIBD 3AK1A 1R6KA 2A79B 3BCCH 4B3TB 2P7TC 4JI4B 2CH7B 1V54C 2EX3A 5CA1A 1IURA 2GBOA 1AR5A 2ZDIC 3P3NA 3E22B 4NVPA 3CC2V 1Y6XA 4H0LB 4DV3B 2ZNJA 3IC7A 2QSAA 1QVFU 4JYCA 3U10A 1FXHA 4W4LA 2K9PA 4I4TA 5IY5C 4JI7B 2ZXWC 2QWRB 5IJ9B 2O57A 4JI6O 3H1JH 4X1YB 5DEDA 2NR5A 1Q6HA 4X65O 3RYFA 3ZHQA 2WSSG 2QKAA 4JZ2A 1QNMA 3F5TA 4X62O 1QLEC 1R73A 1QHTA 1E79G 1KKCA 2AZ0A 2YIDA 1TUBA 4CS2A 1O9HA 5L3FA 1N36O 3RVZA 1MNGA 3ZJZA 2GTAA 4DR1O 4MVSA 3T4ZA 2GTSA 4WFEA 1B3QA 3CP1A 4KUMA 3VOUA 3K3WA 1NR7A 4LF5O 3ABMB 1Q6IA 4OGQB 5KA5A 4JI3B 1XHZA 5EYPB 1SQFA 1D2DA 4B3MO 1IVSA 2CAZC 1ZLZA 3P3PA 1NZ6A 2R72A 4IYHA 1KC8W 4HYOA 2LGWA 1SETA 3ASNB 5IJ0A 4YIPA 2WA3A 4DYLA 5K1XA 1BQ0A 1BZKA 2PYJA 4JTAB 3MD0A 2JJ2G 1OCOB 3L70H 2ITDC 1SERA 1N34O 3JARB 3ZN0A 2UXDO 4QPJA 1V54B 2NLJC 2Y69C 1Q3EA 3JD2A 2DE0X 3MHHC 5GTHZ 2PI5A 1K4DC 3CRCA 2RMKB 2ARHA 3UT5B 4J80A 3ZHTA 1PV0A 2JGDB 2JDIG 2YIBD 1JMKC 5L3BA 3UM7A 3HPLC 5IY5B 2FMLA 4B3MB 2ZXWB 3L71H 4JI1B 1KECA 5BZBA 1XBLA 5EBLC 1S5LZ 1V9PA 2ZKOA 2RNBA 1QLEB 2EILC 2QR4A 1M93A 1I94B 1QCEA 4FFKA 3TGUH 2GV9A 4LWSA 1NVPD 3OW2U 1SZXA 1TVKA 2R9AA 4J9ZB 4DR5B 5DM6V 2IW5A 2EBOA 3PN1A 2QKCA 1YITV 2YSUB 1M4UA 3GB7C 5KAFZ 1KP3A 1K4CC 2FTKA 2V1DA 3O65A 3N2GB 1AR4A 3ZEDA 3W7TA 2F93B 4DV0O 1P49A 3N27A 3STLC 4OX9B 1IXBA 3AG3C 3TCUA 5L3EA 4BW5A 4AI8A 5IT9N 4HAMA 3H9VA 3ZHUA 4N21A 1SS3A 4FLVA 1FJGB 4U3FH 1OCCC 4DV1B 5J2UA 4LFAB 2DN9A 1GK9A 1KMIZ 4LF9B 1GN4A 3NXSA 1EZVH 2RJZA 2Q68A 4J9YB 1MOFA 3E89A 3CYOA 2XT9A 3WG7C 2Q69A 4BWAA 1BT8A 4JI5O 3UO2A 4QJFB 4MVUA 4K0KO 4QPKA 3DGEA 3JD3A 2CTRA 2UXCB 2OTJV 1R6NA 2WLMA 1VQ8V 2Y69B 1R3IC 1M56C 1QQCA 1UFIA 3I5DA 3ABTA 1DLBA 5LA6B 2P5OA 2QWNB 4MT8A 3OUSA 3D8CA 2Q7GA 4O4IB 2R70A 4X1KA 2OYQA 4HZ3A 1AP6A 2YC0A 5J2TA 3G71V 4PJ0Z 1SC5B 4YJ2A 4J7JA 4CC6A 3J7AU 2CTQA 2UXXA 3W7UA 3UO3A 4A5UB 4P2ZA 1S77D 1I7FA 3OFNG 5CBHA 1PNMA 2RDCA 5E79Z 2EILB 2F4VB 1ZL8A 1NKDA 4YIOA 2UUBO 1PP9H 1SZTA 4JI5B 1LNQA 3HKCB 1Q86W 5LP6C 3CRRA 2A06H 1MABG 1SRYA 5KLVH 4OPAA 4DK0A 3QVNA 3T1YO 1AI7A 1P7GA 2A7WA 2P90A 4X20A 1H38A 1N32O 1R3LC 2Y4TA 5F2VO 4JPRA 3J80N 3EXAA 5IYZB 1QBZA 5FLXN 4LR3A 2QWQB 1UJWB 1KQSU 1ZUQA 4R6ZA 3G80A 4GCZA 1AI5A 3AG3B 2KQXA 2JS5A 1Q7YW 3D36C 2QM4A 5A2QN 1FFTB 4NTWA 1DF5A 1I08A 4TUYB 4X66O 4UCUA 1J95A 4AHCA 4IT5A 5KX5B 4ZOLA 1JVMA 1OCCB 5J9PC 4D7SA 4CZZA 4TV8B 3CJHB 5B3SC 1US6A 2ADPA 4NXMB 1SQBH 2LP7A 2KKWA 1L1FA 4XDLA 4CH3A 3E8BA 4GT1A 3WG7B 1GM8A 2UUBB 4KHPO 3OEHG 1FFXB 4PV1B 2WLJA 4PDRA 2Q4PA 4R8CA 3BABA 5BR8O 4XBFA 3E8GA 3B77A 2L6LA 2ZQMA 1MA1A 5B1AC 1N0JA 1K33A 1M56B 2X6CA 4DUZB 4GX0A 3DXRA 4D7TA 4EFEA 2PI4A 4MVRA 2ZIMA 4E2LA 3RT3C 1AP5A 3LNNA 3SJCC 4I0XB 5JQGA 1JA8A 2DWDC 4X66B 3SJAC 3WB1A 1O9GA 2WLLA 1VIBA 4MVQA 1MMMA 2EIMC 4UB8Z 2N05A 3ZHRA 3B2EE 3HKDB 3Q4HA 1V55C 1COWG 1WN7A 3AEIA 3ZCCA 2E74B 3JAWA 2R9IA 5EZYA 5JH7B 1MZFA 4RUFA 3LNMB 1SA0B 3FX7A 3OMAB 3JAKB 4KFMA 4KHPB 3FYEB 5KMGB 5LP6B 1EFRG 5EC2C 1NU1H 1HW7A 2F66C 2H8PC 4DV5O 2UXNA 1Z5VA 1R6TA 1BQZA 1FXKA 2DOSA 3SYPA 1WP8A 2Z5UA 2UU9O 2CGNA 1IBKB 2PYLA 4FPPA 1KP2A 2XUMA 3VQXA 3IGAC 3FAVA 4X8AA 4RQFA 3SJBC 4I50B 2Y0IA 3RYCB 3G6EV 4LF7B 2P06A 5IYCO 1AILA 1YCIA 1GRJA 2IJKA 2LFRA 1AR1B 2YI9A 2HEPA 5B3SB 2YUAA 2LO1A 1DTOA 4YY3B 1ZSPA 4B3RO 1MSDA 3HB3B 2CK3G 4FK5C 1Y4MA 1VQPV 3ZRWB 3UCSC 1XOUA 4FFBB 1YSCA 2FB5A 5EBMC 3E86A 5ITZA 4GX5A 2DQ3A 2Y0PA 1N33B 1VQMV 2JGUA 3ZMZA 4EB6A 2Z3YA 1XREA 1PNKA 1JFFA 3CEIA 4NB5A 1XHXA 3I56V 5B1AB 4DV6O 2N74A 1GKFA 2QM8A 5LMNB 4U7OA 1VQOV 4DW1A 2D3OW 2DWEC 4K8ZA 1XMOO 1S76D 1N4CA 2HFEC 2ZR3A 4P9OA 5JWPA 3T1CA 1KUQA 1PM9A 3VQWA 2WLIB 3QTCA 5IWAO 3KKYA 4XDJA 2BTOA 2QDOA 2EIMB 5FNVB 4PELA 3CRQA 2BSKB 4FIPC 2QE7G 1V55B 3K59A 4FLUA 4B3RB 4NYKA 1VF5B 1MSWD 1ROPA 3CS5A 3H01A 2IBZH 4ZI7B 4DR2B 2B5UA 4MTGA 1VQLV 2ZINA 3OGCC 1JX9A 2JEXA 5KAIZ 3HKBA 1XNQO 2JRIA 5LMUB 5CA1B 1EZJA 1Y76A 5B1BC 1HNXO 1HNZO 4CH6A 1ZTEA 4IYIA 4MVMA 1F23A 5LXTB 1BHBA 4JI2B 1PNLA 4GX1A 4P30A 4N23A 2CUGA 1A32A 2YEVB 3OTOO 2ETNA 3STZC 5EIBC 4I4TB 3CXHF 3DC6A 2HHHO 4YXWG 4JI0O 3OTFA 1KD1W 2KG7A 3ZBHA 2KSDA 3C90A 1M1KW 3L9DA 1NT2B 4KP4A 1GN6A 1N0NA 3RYFB 1J5EO 3DC5A 1B06A 3JD1A 5JCOC 1Y66A 1Y74A 1RSOB 2UXBO 1WB8A 1IZ3A 2Z0AA 1I5YA 1AJNA 1WAZA 4LFBB 3EHBB 1QR9A 1K8AW 4GUNA 4I55A 1XL4A 3ABLC 3ML0A 1TUBB 3AG1C 5CB4B 1YEWA 1IDSA 3BA8A 1WA8A 2EZOA 2CGOA 2IJJA 2IJHA 3DSQA 3T1HB 4MTOA 4DV2B 1R1BA 4ABMA 3K0DA 3E22A 4D6TH 1F7YA 1BHAA 3SR2C 5D5PA 5DECA 3SJQC 1SF9A 3WB2A 4MTXA 3U0ZA 3WFVA 3OTOB 3ZMUA 3P32A 2M6YA 3NR7A 3MAQA 3E83A 1Z5WA 2OCHA 2W6JG 3OUFA 2Q8VA 3BFRA 1XMQO 3S3XA 5C93A 2L35A 5IDJA 5IJ0B 2F95B 4CH4A 3RYHA 3WB0A 2OIGA 4DXWA 3EFFK 1RM1C 4JI6B 3KG2A 4BR6A 1K9MW 3RYIA 5EC1C 4X65B 3CCRV 4KL1A 2YDEA 4GX2A 3ZHSA 4BW9A 4JYYA 4X62B 2G38A 1XQ8A 5B1BB 5L3CA 2VQEO 2P4VA 3H1IH 4DR7O 2ADQB 3ZMTA 3K5NA 4E4EA 1N36B 4UV8A 5JJEB 5JJNB 1AI6A 3QF7A 4UVAA 4B08A 4JV5O 4FZ1A 2GHYA 1NTKH 1H8HG 5EYPA 4DR1B 1XL6A 4O2AA 1RP3B 4WFBV 3CMAV 1MG1A 1XUQA 1LUWA 2DMXA 2X6BA 4PDMA 4LF5B 2YI8A 5KUMA 1XEQA 4UCRA 5L3DA 4FLZA 3N2KA 2F23A 3BHPA 1SKVA 3CSXA 1AROP 1XDCA 3ABUA 2DW4A 4MVOA 4LWSB 2WPDG 3TJTA 3FB6C 4ZHQB 1TVKB 3AG1B 5LGTA 2B9ZA 2X7RB 1M9NA 4NXNO 1MZEA 2GUZB 1VP7A 2HLDG 1CEZA 4WFAV 2VQEB 3J81N 1KU9A 4PA6A 4CBCA 3I55V 3QNEA 1N34B 1L8DA 3OAAG 1VF7A 2UXDB 4AILC 4PDVA
chains in the Genus database with same CATH topology
1XMQO 4LF6O 4OX9O 2UU9O 1X59A 2AGAA 5A2QN 2E5LO 2UUCO 3R66A 4X66O 1N34O 5LL6Y 1XNQO 2JRIA 1AB3A 2DJVA 1HNXO 4DR6O 1HNZO 2UXDO 4B3TO 4DR2O 1FJGO 4DV1O 4JI4O 4JI5O 4LFAO 1IBKO 4K0KO 1HNWO 1AILA 4LF9O 5H5NA 1HR0O 1A32A 2VQEO 5LMUO 3OTOO 4DUYO 4KHPO 4DV3O 4JI6O 4X64O 4LF4O 4DR7O 2HHHO 4DR4O 1FKAO 4JI0O 4X65O 4YHHO 4JI8O 4GKKO 4B3RO 5BR8O 3F5TA 4X62O 4LF7O 1XNRO 4NXMO 4JI2O 1J5EO 4JV5O 4LFCO 2UXCO 2ZM6O 2UXBO 1DK1A 2Z0AA 2ZKOA 1N36O 4YY3O 1G1XB 5BXZA 3J7AU 3RT3C 4DV6O 1XEQA 4JI1O 4A5UB 2N74A 4LF8O 4DR1O 1IBLO 4GKJO 2UUAO 4LFBO 1N33O 4DUZO 4AQYO 1R1BA 4DR3O 2VQFO 4JI7O 1XMOO 4LF5O 2UUBO 1I94O 1KUQA 3M8AA 4NXNO 1F7YA 3JAMN 3O65A 4OPAA 2FKXA 5IWAO 5LMNO 1YZBA 4JYAO 4DV0O 1D2DA 3T1YO 2LW7A 3J81N 3T1HO 4DR5O 1NS1A 4B3MO 4DV2O 1FYJA 2F4VO 1N32O 4DV7O 4DV4O 3J80N 5IT9N 4DV5O 4OPHA 4B3SO 5FLXN 4JI3O 1R6TA 5BY1A 1IBMO 2DOSA 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ O;  4LF6 O;  4OX9 O;  2UU9 O;  1X59 A;  2AGA A;  5A2Q N;  2E5L O;  2UUC O;  3R66 A;  4X66 O;  1N34 O;  5LL6 Y;  1XNQ O;  2JRI A;  1AB3 A;  2DJV A;  1HNX O;  4DR6 O;  1HNZ O;  2UXD O;  4B3T O;  4DR2 O;  1FJG O;  4DV1 O;  4JI4 O;  4JI5 O;  4LFA O;  1IBK O;  4K0K O;  1HNW O;  1AIL A;  4LF9 O;  5H5N A;  1HR0 O;  1A32 A;  2VQE O;  5LMU O;  3OTO O;  4DUY O;  4KHP O;  4DV3 O;  4JI6 O;  4X64 O;  4LF4 O;  4DR7 O;  2HHH O;  4DR4 O;  1FKA O;  4JI0 O;  4X65 O;  4YHH O;  4JI8 O;  4GKK O;  4B3R O;  5BR8 O;  3F5T A;  4X62 O;  4LF7 O;  1XNR O;  4NXM O;  4JI2 O;  1J5E O;  4JV5 O;  4LFC O;  2UXC O;  2ZM6 O;  2UXB O;  1DK1 A;  2Z0A A;  2ZKO A;  1N36 O;  4YY3 O;  1G1X B;  5BXZ A;  3J7A U;  3RT3 C;  4DV6 O;  1XEQ A;  4JI1 O;  4A5U B;  2N74 A;  4LF8 O;  4DR1 O;  1IBL O;  4GKJ O;  2UUA O;  4LFB O;  1N33 O;  4DUZ O;  4AQY O;  1R1B A;  4DR3 O;  2VQF O;  4JI7 O;  1XMO O;  4LF5 O;  2UUB O;  1I94 O;  1KUQ A;  3M8A A;  4NXN O;  1F7Y A;  3JAM N;  3O65 A;  4OPA A;  2FKX A;  5IWA O;  5LMN O;  1YZB A;  4JYA O;  4DV0 O;  1D2D A;  3T1Y O;  2LW7 A;  3J81 N;  3T1H O;  4DR5 O;  1NS1 A;  4B3M O;  4DV2 O;  1FYJ A;  2F4V O;  1N32 O;  4DV7 O;  4DV4 O;  3J80 N;  5IT9 N;  4DV5 O;  4OPH A;  4B3S O;  5FLX N;  4JI3 O;  1R6T A;  5BY1 A;  1IBM O;  2DOS A;  3SDL A; 
#chains in the Genus database with same CATH topology
 1ZWI C;  4Z2W A;  2B1G A;  4LF6 O;  3FB5 C;  1SES A;  1XIL A;  1Q6U A;  4LNU A;  5AG2 A;  2UUC O;  2IH3 C;  3LUT B;  2EZP A;  2C2A A;  4F6E A;  4G27 B;  4DR6 O;  4PA9 A;  4IIJ A;  1D5A A;  2Y48 A;  3B4S A;  2XAJ A;  5FPR A;  4J41 A;  5DN6 G;  1Y67 A;  4LP8 A;  2P6J A;  4CS3 A;  1HDJ A;  1VQ7 V;  4NR1 A;  1JCH A;  4LBE C;  4LF4 O;  1FKA O;  4NXN B;  3CCU V;  4YHH O;  4L87 A;  4PA3 A;  3E2E A;  1KBH A;  1XNR O;  1GM9 A;  3ZRX A;  5EBW C;  3QG5 A;  1YI2 V;  4PHZ A;  2LFS A;  3N2G A;  3IFX A;  3K08 A;  1E1Q G;  3BRC A;  5H6Q A;  5H6R A;  2Q7H A;  4X1K B;  2ZR2 A;  1CPY A;  3JAT A;  1RFY A;  1OCR C;  4LF6 B;  5J2T B;  3UKM A;  5GON A;  4PA7 A;  2ITC C;  4ICG A;  4YJ2 B;  5BMV A;  1IBL O;  4F4L A;  4DV0 B;  4PA4 A;  4JAV A;  2AZ2 A;  2HP8 A;  1SQQ H;  4BIO A;  4LCU C;  2VQF O;  1P84 F;  4EKW A;  1R3J C;  4K3A A;  3CB2 A;  1HP8 A;  1B04 A;  4GZR B;  4F6R A;  1IX9 A;  1S72 V;  3JCZ A;  2E76 B;  2ZD9 A;  4WFF A;  1FYJ A;  1WB7 A;  3RW0 A;  4O4H A;  2QTS A;  1R3K C;  4B3S O;  3CWB H;  3GWK C;  1SQG A;  2XAG A;  5BY1 A;  1IBM O;  3JD0 A;  1YTF D;  2HR3 A;  2LW1 A;  3VQV A;  4WBN B;  4O4L B;  2ZCE A;  4K0K B;  2NNU A;  3THO A;  4K35 A;  3VQY A;  1Z2G A;  4JAU A;  3ZMV A;  1NVP B;  2HJF C;  5KHK A;  2BOC C;  2VS0 A;  3K57 A;  4HNA A;  5H9C A;  2XTA A;  4LH7 A;  4YJ3 A;  4ZOL B;  5JVD B;  2EIJ C;  1HNW O;  3CC7 V;  4JF3 A;  4O4J A;  4O2B A;  3FKS G;  2E75 B;  2X6A A;  3C3T A;  2YXY A;  4X1I A;  5FL7 G;  1D5N A;  2LJ2 A;  3JAS A;  4GKK O;  2HVJ C;  4QE7 A;  1S0V A;  1B6Q A;  4WFG A;  3HKC A;  2JS3 A;  1FD9 A;  3APQ A;  1SQV H;  1VQ6 V;  1N8R W;  4UVB A;  1JR9 A;  3SPH A;  2VRZ A;  4DRX A;  2ATK C;  3CME V;  3AG7 A;  3DXR B;  1W59 A;  4I7Z B;  4GKJ O;  1F51 A;  3T1Y B;  3CHX A;  3D3I A;  2OT5 A;  4AQY O;  3CPW U;  3K9A A;  3CCQ V;  1N32 B;  1OCR B;  3JSN A;  3CCM V;  3SPG A;  3HKE A;  3CRA A;  2WLL B;  2RCV A;  2JJ1 G;  1OJH A;  3Q4H B;  5LYJ A;  1KYO F;  3CJH A;  3JAW B;  2F1M A;  3U11 A;  3FD9 A;  2B1I A;  3BAA A;  1NH2 D;  4DV4 O;  1DF4 A;  1H2M A;  2BE3 A;  5CA0 A;  2AHZ A;  3K79 A;  4PI2 A;  3IJ4 A;  2CDY A;  3SDL A;  2XAF A;  3SGI A;  1EN5 A;  2HG5 C;  3AG4 C;  4W4K A;  1PD3 A;  1VAR A;  4H13 B;  5LL6 Y;  2BTQ B;  3CCL V;  5C8Y A;  4P9P A;  4TV9 A;  3OD4 A;  3ETE A;  5BR8 B;  3L75 H;  3WU2 Z;  3FAV B;  1VMG A;  4J10 A;  1SQX H;  4B7K A;  2X0L A;  1WP7 A;  2IH1 C;  4DUY O;  3UQ8 A;  4UV9 A;  1GN3 A;  4X64 O;  2A0L A;  4DR4 O;  3BEH A;  1PL4 A;  4KXR A;  4B7E A;  2EIJ B;  4ZBM A;  3X2Q C;  1LUV A;  2WAM A;  3ZIA G;  4GYC B;  2N04 A;  3L73 H;  4X88 A;  3B8M A;  4LFC O;  3W7S A;  4UXN A;  4XDK A;  4U3J A;  2RN9 A;  2YXL A;  1F4N A;  1BCC H;  1G4Y B;  5ITZ B;  5LP6 A;  3JSL A;  3W7W A;  3SYC A;  4JGS A;  4LF8 O;  4X89 A;  1UPG A;  3ZHV A;  3K5O A;  1F4M A;  3JAL B;  4JAA A;  4DV5 B;  5GTI Z;  1K97 A;  1I0H A;  3JAM N;  5FPO A;  4H44 B;  4JYA O;  4I9W A;  1H8E G;  3CD6 V;  3D36 A;  4I50 A;  3LSQ A;  2UU9 B;  3RYC A;  4PI0 A;  5GW7 A;  5B1O A;  4DV7 O;  2VWK A;  4QNH B;  2Q67 A;  1JOY A;  5LGU A;  3LDE A;  3ICX A;  4IHJ A;  4MTF A;  4JTC B;  3RN4 A;  3ZRW A;  2AW9 A;  3B09 A;  1YIJ V;  3SYQ A;  1OHH G;  2PY5 A;  4PDL A;  4TWK A;  3E35 A;  4B3T O;  3CXC U;  3HKB B;  5EK0 A;  4LF8 B;  4JI4 O;  1Y76 B;  3AG4 B;  4QE9 A;  5LOV B;  4DV3 O;  3TXQ A;  4UB6 Z;  2ILM A;  2AHY A;  5IE9 A;  4WF9 V;  4C7U A;  3A0B Z;  3BA9 A;  4UCT A;  4DV6 B;  4I5S A;  3CRM A;  3H1K H;  2ZT9 B;  2PF4 E;  3AK3 A;  1DK1 A;  4FLT A;  1G8M A;  2ZNI A;  3OM3 B;  5FNV A;  3X2Q B;  2R9R B;  1Y74 B;  1WPX A;  2DYR C;  1XMO B;  1IXM A;  2YIC A;  1K7D A;  3ASN C;  1YVW A;  2FL4 A;  4I55 B;  2FYU H;  5IWA B;  4UCS A;  2UUA O;  2HKO A;  2V7Q G;  4RAI A;  2XND G;  1YJ9 V;  1GM7 A;  1WA8 B;  4MS2 A;  4UFZ A;  2LQT A;  1GH6 A;  5LBQ A;  4UVC A;  3L74 H;  2HJD A;  1RPO A;  1BSM A;  2XAS A;  3CC4 V;  1GAX A;  3M8A A;  2IU3 A;  1KKD A;  3SYA A;  3SPC A;  5L3G A;  3TK1 A;  5KUK A;  2ZE8 A;  2ZE7 A;  2PTM A;  3A2F A;  4JAS A;  4FZ0 A;  1S3J A;  2EJR A;  5TIS Z;  5LXT A;  2PZS A;  3OT7 A;  2M7W A;  4U7N A;  1XNQ B;  2YEV A;  2CH7 A;  3AG2 C;  4JI3 O;  3G67 A;  1K92 A;  2ODM A;  1HNX B;  2ZIO A;  1HNZ B;  3GVM A;  1VF6 A;  4JYB A;  3OR6 C;  5LGN A;  1L0L H;  1PKX A;  2Q5Z A;  4UCO A;  2OTL V;  1GN2 A;  1VQ5 V;  2W0F C;  4EEQ A;  2HVK C;  3ASO C;  2Q9L A;  1RSO A;  1KB9 F;  3RYH B;  2HHH B;  2VWJ A;  4JI0 B;  1OV9 A;  4BAY A;  4H37 A;  2UUA B;  5LHH A;  5KHI A;  2YXH A;  5IJ9 A;  4J42 A;  3JD4 A;  3RYI B;  2V4D A;  4X1Y A;  4R7C A;  5CB4 A;  1J5E B;  3F7V C;  3RBZ A;  3OEE G;  2UXB B;  1P4R A;  3CX5 F;  1U96 A;  4FJC C;  4Q6G A;  2ZE5 A;  5CBG A;  3IAY A;  1W2B U;  4UUJ C;  4I9Q A;  4DO2 A;  3P30 A;  2IU0 A;  1TUE B;  2JEU A;  2QGN A;  1PL0 A;  4O2A B;  2OWO A;  1Q82 W;  1FS0 G;  1K34 A;  3RGB A;  2WWW A;  2QJ1 A;  4JI1 O;  1FAF A;  3FYI B;  1W0K G;  3ZRS A;  3VBB A;  2WLK A;  1EM1 A;  3ETQ A;  2DYR B;  3N2K B;  5KA6 A;  2QEX V;  1NTM H;  4LC1 A;  3F7Y C;  4FMT A;  1I94 O;  3ZX6 A;  4DK1 A;  2P4K A;  1WLE A;  5D5Q A;  3C3S A;  2YS8 A;  4Q20 A;  1S5H C;  1I5X A;  1XMQ B;  2BCC H;  4DR5 O;  1JPX A;  1EBO A;  1GTO A;  3A0H Z;  4FVM A;  2Q0A A;  2QM7 A;  2P22 C;  4WFH A;  1NR1 A;  3CE2 A;  2CTP A;  3H1H H;  3ABL B;  5HFM A;  4OX9 O;  4MVZ A;  2F43 G;  1X59 A;  3M7M X;  3JAR A;  2E5L O;  2YIA A;  3AG2 B;  2WLN A;  2DJV A;  4LNU B;  5K1P A;  2ZDI A;  4DR7 B;  1FJG O;  3ZMS A;  4DV1 O;  3G4S V;  3UT5 A;  4LFA O;  3FFQ A;  3K03 A;  2RQ6 A;  5HFL A;  4IIJ B;  2P67 A;  2JGD A;  4LF9 O;  3ASO B;  5JCO A;  4JV5 B;  3RWR D;  5IYB O;  1H2N A;  2AXT Z;  1NI8 A;  1SQP H;  3LSU A;  2H3O A;  4RUE A;  5J2U B;  4ZHQ A;  1GO3 F;  2IJI A;  2W6I G;  4MW3 A;  3GWO A;  1ORQ C;  2UXC O;  2GSM B;  3B40 A;  4IL6 Z;  2ZM6 O;  2GUZ A;  3H1L H;  1TA8 A;  1RM1 B;  2Q0O C;  3QO7 A;  4RQE A;  3ETD A;  1AJP A;  3JAT B;  2E5L B;  3FB7 C;  3T4D A;  2JIZ G;  4TQF A;  2CTW A;  5GON B;  3L72 H;  4J11 A;  1QVG U;  5B1N A;  5BMV B;  3BPZ A;  1JJ2 U;  5A9G A;  3E8H A;  3SYO A;  2QKS A;  2IM9 A;  3CCE V;  3CCV V;  2LW7 A;  5IYD O;  4F6R B;  3LDC A;  4FM1 A;  2F4V O;  4OXS A;  1YJN V;  2UUC B;  3K0G A;  3IC9 A;  1T5E A;  4OPH A;  4DR6 B;  3DTU B;  4O4H B;  1WNS A;  2Q73 A;  2ZM6 B;  4BIZ A;  1ZL8 B;  4K8X A;  2AGA A;  1BL8 A;  4FLY A;  1THZ A;  4MSW C;  2XHB A;  4L8J A;  4HBN A;  4LF4 B;  1FXK C;  3ZS8 C;  1YF2 A;  3LSS A;  4YHH B;  4X20 B;  3MDS A;  3K9S A;  4HNA B;  1XNR B;  2EIN C;  1ZAU A;  3BVO A;  4YJ3 B;  1CP9 A;  4J7K A;  1DGS A;  3R65 A;  5LA6 A;  4O4J B;  4O2B B;  5KHH A;  4JI8 O;  3B8N A;  4O4I A;  4LH6 A;  4X1I B;  4NXM O;  1FPO A;  3JAS B;  1Q81 W;  1LR1 A;  1IBL B;  1H2L A;  3PJS K;  2YIB A;  5B66 Z;  1E1R G;  4Z1M G;  2XAH A;  2VQF B;  2MW2 B;  1NTZ H;  3QO8 A;  3K5L A;  1X4T A;  2MK3 A;  4NTY A;  1BMF G;  4CH5 A;  3OMI B;  1BS3 A;  4TSF G;  4JTD B;  5CBF A;  2OIE A;  4DRX B;  3BY6 A;  4QGP A;  4WBN A;  4O4L A;  4DUZ O;  4FM2 A;  4JZG A;  1AVM A;  2QWP B;  3G6B A;  4B3S B;  3SPI A;  1IBM B;  2NN4 A;  2FKX A;  5LHI A;  3HKE B;  3KCY A;  4TQD A;  1YJW V;  4BIU A;  1P7B A;  1NS1 A;  5IYZ A;  5H2F Z;  5LYJ B;  1EN6 A;  2EIK C;  5JVD A;  3ABK C;  1OCZ C;  1AI4 A;  3CCS V;  4JI8 B;  1K3E A;  1VEW A;  3OE7 G;  1Q43 A;  5JQG B;  5CA0 B;  1JJO A;  4TUY A;  2Q6A A;  2JK5 C;  1PPJ H;  5KX5 A;  1HNW B;  3R66 A;  4TV8 A;  1K73 W;  4EFB A;  5EZY B;  1AB3 A;  4H33 A;  1ZX3 A;  1TAE A;  4MW8 A;  2DYS C;  1QU7 A;  3O9O A;  4GKK B;  1IBK O;  4CC5 A;  5C8Y B;  2D2C B;  4TV9 B;  1FFX A;  5H5N A;  3T2M A;  1VQ4 V;  1GMG A;  3KCX A;  4TOI A;  4G28 B;  4PD4 F;  1M90 W;  1FXK B;  1VQN V;  1U97 A;  5CA3 A;  2W0X A;  3HR0 A;  2EUL A;  3M99 B;  1YHQ V;  1YDX A;  2EIN B;  3AK2 A;  4LF7 O;  1M57 C;  4RWU A;  3QO5 A;  3RFR A;  1CXZ B;  1YTF B;  4GKJ B;  5B5E Z;  4AQY B;  4YY3 O;  3OMN B;  4I0X A;  4U3J B;  5BXZ A;  1NQT A;  1M5I A;  4CS4 A;  2E3C A;  1L0N H;  4QIW F;  2XAQ A;  2Q7E A;  3SPJ A;  1NJI W;  3HKD A;  1N33 O;  2PUS A;  4DR3 O;  5JH7 A;  1W0J G;  3JCU Z;  4DV4 B;  2Y4U A;  1SA0 A;  2OCC C;  2BTQ A;  1WPB A;  3F5W C;  2DQ0 A;  2K1E A;  3JAK A;  1QR8 A;  5LMN O;  1YZB A;  2XOK G;  2QTO A;  5KMG A;  2CE4 A;  4EB6 B;  4GLX A;  1Q90 D;  2BOB C;  4J7Z A;  1WJZ A;  1JFF B;  2KB1 A;  1VF6 C;  2QA4 V;  3TXS A;  3OR7 C;  2JVD A;  2QWO B;  1H2S B;  3ZN1 A;  4NTX A;  3LDD A;  3ZRV A;  2EIK B;  4NKG B;  3ABK B;  1OCZ B;  4IHJ B;  3MHS C;  4DW0 A;  4FM0 A;  1XI1 A;  1URF A;  3A0R A;  3ETG A;  4DUY B;  4FLX A;  4X64 B;  1BGY H;  4DR4 B;  4DR2 O;  3K06 A;  1VQK V;  5CN0 A;  3CCJ V;  2EJ7 A;  5KHG A;  1S5J A;  5CMU A;  4DR3 B;  1HR0 O;  4LFC B;  5LMU O;  1H2G A;  2DYS B;  3OGI B;  5E1A C;  1QLN A;  1NBM G;  1K5Q A;  1TGO A;  4FFB A;  3A8T A;  3K5M A;  4ASU G;  2WA4 A;  3JAL A;  3D3Q A;  1NH2 B;  1FXV A;  4UCV A;  4JI2 O;  4RO2 A;  4Z1V A;  5JJJ B;  3KZI Z;  5LHG A;  3FB8 C;  2GDS A;  1H2K A;  2H94 A;  4G2K A;  4R50 A;  1JQ0 A;  3S3W A;  3K58 A;  1BE3 H;  1M57 B;  1RPR A;  1G1X B;  1ENV A;  4ZKI A;  1OZ0 A;  1Q8I A;  3W7X A;  3ABM C;  4WCE V;  1AJQ A;  4JYA B;  2A9H A;  4LFB O;  2KG7 B;  3EVK A;  2PGG A;  4TT3 G;  4JI7 O;  3K04 A;  2WLI A;  4ZIB A;  4X9Q A;  3RVY A;  2ZE6 A;  4DV7 B;  2WLH A;  2A3Q A;  1K5S A;  2LGQ A;  1Q5O A;  3E8F A;  2BSK A;  5KHJ A;  3TET A;  1HR0 B;  1HWY A;  3JYC A;  3T1H O;  4DV2 O;  1YXB A;  4FLW A;  4IGG A;  5LOV A;  1EN4 A;  1VQ9 V;  2OCC B;  4ZI7 A;  1G6U A;  1OCO C;  3APO A;  5EIB D;  3AK1 A;  1R6K A;  2A79 B;  3BCC H;  4B3T B;  2P7T C;  4JI4 B;  2CH7 B;  1V54 C;  2EX3 A;  5CA1 A;  1IUR A;  2GBO A;  1AR5 A;  2ZDI C;  3P3N A;  3E22 B;  4NVP A;  3CC2 V;  1Y6X A;  4H0L B;  4DV3 B;  2ZNJ A;  3IC7 A;  2QSA A;  1QVF U;  4JYC A;  3U10 A;  1FXH A;  4W4L A;  2K9P A;  4I4T A;  5IY5 C;  4JI7 B;  2ZXW C;  2QWR B;  5IJ9 B;  2O57 A;  4JI6 O;  3H1J H;  4X1Y B;  5DED A;  2NR5 A;  1Q6H A;  4X65 O;  3RYF A;  3ZHQ A;  2WSS G;  2QKA A;  4JZ2 A;  1QNM A;  3F5T A;  4X62 O;  1QLE C;  1R73 A;  1QHT A;  1E79 G;  1KKC A;  2AZ0 A;  2YID A;  1TUB A;  4CS2 A;  1O9H A;  5L3F A;  1N36 O;  3RVZ A;  1MNG A;  3ZJZ A;  2GTA A;  4DR1 O;  4MVS A;  3T4Z A;  2GTS A;  4WFE A;  1B3Q A;  3CP1 A;  4KUM A;  3VOU A;  3K3W A;  1NR7 A;  4LF5 O;  3ABM B;  1Q6I A;  4OGQ B;  5KA5 A;  4JI3 B;  1XHZ A;  5EYP B;  1SQF A;  1D2D A;  4B3M O;  1IVS A;  2CAZ C;  1ZLZ A;  3P3P A;  1NZ6 A;  2R72 A;  4IYH A;  1KC8 W;  4HYO A;  2LGW A;  1SET A;  3ASN B;  5IJ0 A;  4YIP A;  2WA3 A;  4DYL A;  5K1X A;  1BQ0 A;  1BZK A;  2PYJ A;  4JTA B;  3MD0 A;  2JJ2 G;  1OCO B;  3L70 H;  2ITD C;  1SER A;  1N34 O;  3JAR B;  3ZN0 A;  2UXD O;  4QPJ A;  1V54 B;  2NLJ C;  2Y69 C;  1Q3E A;  3JD2 A;  2DE0 X;  3MHH C;  5GTH Z;  2PI5 A;  1K4D C;  3CRC A;  2RMK B;  2ARH A;  3UT5 B;  4J80 A;  3ZHT A;  1PV0 A;  2JGD B;  2JDI G;  2YIB D;  1JMK C;  5L3B A;  3UM7 A;  3HPL C;  5IY5 B;  2FML A;  4B3M B;  2ZXW B;  3L71 H;  4JI1 B;  1KEC A;  5BZB A;  1XBL A;  5EBL C;  1S5L Z;  1V9P A;  2ZKO A;  2RNB A;  1QLE B;  2EIL C;  2QR4 A;  1M93 A;  1I94 B;  1QCE A;  4FFK A;  3TGU H;  2GV9 A;  4LWS A;  1NVP D;  3OW2 U;  1SZX A;  1TVK A;  2R9A A;  4J9Z B;  4DR5 B;  5DM6 V;  2IW5 A;  2EBO A;  3PN1 A;  2QKC A;  1YIT V;  2YSU B;  1M4U A;  3GB7 C;  5KAF Z;  1KP3 A;  1K4C C;  2FTK A;  2V1D A;  3O65 A;  3N2G B;  1AR4 A;  3ZED A;  3W7T A;  2F93 B;  4DV0 O;  1P49 A;  3N27 A;  3STL C;  4OX9 B;  1IXB A;  3AG3 C;  3TCU A;  5L3E A;  4BW5 A;  4AI8 A;  5IT9 N;  4HAM A;  3H9V A;  3ZHU A;  4N21 A;  1SS3 A;  4FLV A;  1FJG B;  4U3F H;  1OCC C;  4DV1 B;  5J2U A;  4LFA B;  2DN9 A;  1GK9 A;  1KMI Z;  4LF9 B;  1GN4 A;  3NXS A;  1EZV H;  2RJZ A;  2Q68 A;  4J9Y B;  1MOF A;  3E89 A;  3CYO A;  2XT9 A;  3WG7 C;  2Q69 A;  4BWA A;  1BT8 A;  4JI5 O;  3UO2 A;  4QJF B;  4MVU A;  4K0K O;  4QPK A;  3DGE A;  3JD3 A;  2CTR A;  2UXC B;  2OTJ V;  1R6N A;  2WLM A;  1VQ8 V;  2Y69 B;  1R3I C;  1M56 C;  1QQC A;  1UFI A;  3I5D A;  3ABT A;  1DLB A;  5LA6 B;  2P5O A;  2QWN B;  4MT8 A;  3OUS A;  3D8C A;  2Q7G A;  4O4I B;  2R70 A;  4X1K A;  2OYQ A;  4HZ3 A;  1AP6 A;  2YC0 A;  5J2T A;  3G71 V;  4PJ0 Z;  1SC5 B;  4YJ2 A;  4J7J A;  4CC6 A;  3J7A U;  2CTQ A;  2UXX A;  3W7U A;  3UO3 A;  4A5U B;  4P2Z A;  1S77 D;  1I7F A;  3OFN G;  5CBH A;  1PNM A;  2RDC A;  5E79 Z;  2EIL B;  2F4V B;  1ZL8 A;  1NKD A;  4YIO A;  2UUB O;  1PP9 H;  1SZT A;  4JI5 B;  1LNQ A;  3HKC B;  1Q86 W;  5LP6 C;  3CRR A;  2A06 H;  1MAB G;  1SRY A;  5KLV H;  4OPA A;  4DK0 A;  3QVN A;  3T1Y O;  1AI7 A;  1P7G A;  2A7W A;  2P90 A;  4X20 A;  1H38 A;  1N32 O;  1R3L C;  2Y4T A;  5F2V O;  4JPR A;  3J80 N;  3EXA A;  5IYZ B;  1QBZ A;  5FLX N;  4LR3 A;  2QWQ B;  1UJW B;  1KQS U;  1ZUQ A;  4R6Z A;  3G80 A;  4GCZ A;  1AI5 A;  3AG3 B;  2KQX A;  2JS5 A;  1Q7Y W;  3D36 C;  2QM4 A;  5A2Q N;  1FFT B;  4NTW A;  1DF5 A;  1I08 A;  4TUY B;  4X66 O;  4UCU A;  1J95 A;  4AHC A;  4IT5 A;  5KX5 B;  4ZOL A;  1JVM A;  1OCC B;  5J9P C;  4D7S A;  4CZZ A;  4TV8 B;  3CJH B;  5B3S C;  1US6 A;  2ADP A;  4NXM B;  1SQB H;  2LP7 A;  2KKW A;  1L1F A;  4XDL A;  4CH3 A;  3E8B A;  4GT1 A;  3WG7 B;  1GM8 A;  2UUB B;  4KHP O;  3OEH G;  1FFX B;  4PV1 B;  2WLJ A;  4PDR A;  2Q4P A;  4R8C A;  3BAB A;  5BR8 O;  4XBF A;  3E8G A;  3B77 A;  2L6L A;  2ZQM A;  1MA1 A;  5B1A C;  1N0J A;  1K33 A;  1M56 B;  2X6C A;  4DUZ B;  4GX0 A;  3DXR A;  4D7T A;  4EFE A;  2PI4 A;  4MVR A;  2ZIM A;  4E2L A;  3RT3 C;  1AP5 A;  3LNN A;  3SJC C;  4I0X B;  5JQG A;  1JA8 A;  2DWD C;  4X66 B;  3SJA C;  3WB1 A;  1O9G A;  2WLL A;  1VIB A;  4MVQ A;  1MMM A;  2EIM C;  4UB8 Z;  2N05 A;  3ZHR A;  3B2E E;  3HKD B;  3Q4H A;  1V55 C;  1COW G;  1WN7 A;  3AEI A;  3ZCC A;  2E74 B;  3JAW A;  2R9I A;  5EZY A;  5JH7 B;  1MZF A;  4RUF A;  3LNM B;  1SA0 B;  3FX7 A;  3OMA B;  3JAK B;  4KFM A;  4KHP B;  3FYE B;  5KMG B;  5LP6 B;  1EFR G;  5EC2 C;  1NU1 H;  1HW7 A;  2F66 C;  2H8P C;  4DV5 O;  2UXN A;  1Z5V A;  1R6T A;  1BQZ A;  1FXK A;  2DOS A;  3SYP A;  1WP8 A;  2Z5U A;  2UU9 O;  2CGN A;  1IBK B;  2PYL A;  4FPP A;  1KP2 A;  2XUM A;  3VQX A;  3IGA C;  3FAV A;  4X8A A;  4RQF A;  3SJB C;  4I50 B;  2Y0I A;  3RYC B;  3G6E V;  4LF7 B;  2P06 A;  5IYC O;  1AIL A;  1YCI A;  1GRJ A;  2IJK A;  2LFR A;  1AR1 B;  2YI9 A;  2HEP A;  5B3S B;  2YUA A;  2LO1 A;  1DTO A;  4YY3 B;  1ZSP A;  4B3R O;  1MSD A;  3HB3 B;  2CK3 G;  4FK5 C;  1Y4M A;  1VQP V;  3ZRW B;  3UCS C;  1XOU A;  4FFB B;  1YSC A;  2FB5 A;  5EBM C;  3E86 A;  5ITZ A;  4GX5 A;  2DQ3 A;  2Y0P A;  1N33 B;  1VQM V;  2JGU A;  3ZMZ A;  4EB6 A;  2Z3Y A;  1XRE A;  1PNK A;  1JFF A;  3CEI A;  4NB5 A;  1XHX A;  3I56 V;  5B1A B;  4DV6 O;  2N74 A;  1GKF A;  2QM8 A;  5LMN B;  4U7O A;  1VQO V;  4DW1 A;  2D3O W;  2DWE C;  4K8Z A;  1XMO O;  1S76 D;  1N4C A;  2HFE C;  2ZR3 A;  4P9O A;  5JWP A;  3T1C A;  1KUQ A;  1PM9 A;  3VQW A;  2WLI B;  3QTC A;  5IWA O;  3KKY A;  4XDJ A;  2BTO A;  2QDO A;  2EIM B;  5FNV B;  4PEL A;  3CRQ A;  2BSK B;  4FIP C;  2QE7 G;  1V55 B;  3K59 A;  4FLU A;  4B3R B;  4NYK A;  1VF5 B;  1MSW D;  1ROP A;  3CS5 A;  3H01 A;  2IBZ H;  4ZI7 B;  4DR2 B;  2B5U A;  4MTG A;  1VQL V;  2ZIN A;  3OGC C;  1JX9 A;  2JEX A;  5KAI Z;  3HKB A;  1XNQ O;  2JRI A;  5LMU B;  5CA1 B;  1EZJ A;  1Y76 A;  5B1B C;  1HNX O;  1HNZ O;  4CH6 A;  1ZTE A;  4IYI A;  4MVM A;  1F23 A;  5LXT B;  1BHB A;  4JI2 B;  1PNL A;  4GX1 A;  4P30 A;  4N23 A;  2CUG A;  1A32 A;  2YEV B;  3OTO O;  2ETN A;  3STZ C;  5EIB C;  4I4T B;  3CXH F;  3DC6 A;  2HHH O;  4YXW G;  4JI0 O;  3OTF A;  1KD1 W;  2KG7 A;  3ZBH A;  2KSD A;  3C90 A;  1M1K W;  3L9D A;  1NT2 B;  4KP4 A;  1GN6 A;  1N0N A;  3RYF B;  1J5E O;  3DC5 A;  1B06 A;  3JD1 A;  5JCO C;  1Y66 A;  1Y74 A;  1RSO B;  2UXB O;  1WB8 A;  1IZ3 A;  2Z0A A;  1I5Y A;  1AJN A;  1WAZ A;  4LFB B;  3EHB B;  1QR9 A;  1K8A W;  4GUN A;  4I55 A;  1XL4 A;  3ABL C;  3ML0 A;  1TUB B;  3AG1 C;  5CB4 B;  1YEW A;  1IDS A;  3BA8 A;  1WA8 A;  2EZO A;  2CGO A;  2IJJ A;  2IJH A;  3DSQ A;  3T1H B;  4MTO A;  4DV2 B;  1R1B A;  4ABM A;  3K0D A;  3E22 A;  4D6T H;  1F7Y A;  1BHA A;  3SR2 C;  5D5P A;  5DEC A;  3SJQ C;  1SF9 A;  3WB2 A;  4MTX A;  3U0Z A;  3WFV A;  3OTO B;  3ZMU A;  3P32 A;  2M6Y A;  3NR7 A;  3MAQ A;  3E83 A;  1Z5W A;  2OCH A;  2W6J G;  3OUF A;  2Q8V A;  3BFR A;  1XMQ O;  3S3X A;  5C93 A;  2L35 A;  5IDJ A;  5IJ0 B;  2F95 B;  4CH4 A;  3RYH A;  3WB0 A;  2OIG A;  4DXW A;  3EFF K;  1RM1 C;  4JI6 B;  3KG2 A;  4BR6 A;  1K9M W;  3RYI A;  5EC1 C;  4X65 B;  3CCR V;  4KL1 A;  2YDE A;  4GX2 A;  3ZHS A;  4BW9 A;  4JYY A;  4X62 B;  2G38 A;  1XQ8 A;  5B1B B;  5L3C A;  2VQE O;  2P4V A;  3H1I H;  4DR7 O;  2ADQ B;  3ZMT A;  3K5N A;  4E4E A;  1N36 B;  4UV8 A;  5JJE B;  5JJN B;  1AI6 A;  3QF7 A;  4UVA A;  4B08 A;  4JV5 O;  4FZ1 A;  2GHY A;  1NTK H;  1H8H G;  5EYP A;  4DR1 B;  1XL6 A;  4O2A A;  1RP3 B;  4WFB V;  3CMA V;  1MG1 A;  1XUQ A;  1LUW A;  2DMX A;  2X6B A;  4PDM A;  4LF5 B;  2YI8 A;  5KUM A;  1XEQ A;  4UCR A;  5L3D A;  4FLZ A;  3N2K A;  2F23 A;  3BHP A;  1SKV A;  3CSX A;  1ARO P;  1XDC A;  3ABU A;  2DW4 A;  4MVO A;  4LWS B;  2WPD G;  3TJT A;  3FB6 C;  4ZHQ B;  1TVK B;  3AG1 B;  5LGT A;  2B9Z A;  2X7R B;  1M9N A;  4NXN O;  1MZE A;  2GUZ B;  1VP7 A;  2HLD G;  1CEZ A;  4WFA V;  2VQE B;  3J81 N;  1KU9 A;  4PA6 A;  4CBC A;  3I55 V;  3QNE A;  1N34 B;  1L8D A;  3OAA G;  1VF7 A;  2UXD B;  4AIL C;  4PDV A; 
#chains in the Genus database with same CATH homology
 1XMQ O;  4LF6 O;  4OX9 O;  2UU9 O;  1X59 A;  2AGA A;  5A2Q N;  2E5L O;  2UUC O;  3R66 A;  4X66 O;  1N34 O;  5LL6 Y;  1XNQ O;  2JRI A;  1AB3 A;  2DJV A;  1HNX O;  4DR6 O;  1HNZ O;  2UXD O;  4B3T O;  4DR2 O;  1FJG O;  4DV1 O;  4JI4 O;  4JI5 O;  4LFA O;  1IBK O;  4K0K O;  1HNW O;  1AIL A;  4LF9 O;  5H5N A;  1HR0 O;  1A32 A;  2VQE O;  5LMU O;  3OTO O;  4DUY O;  4KHP O;  4DV3 O;  4JI6 O;  4X64 O;  4LF4 O;  4DR7 O;  2HHH O;  4DR4 O;  1FKA O;  4JI0 O;  4X65 O;  4YHH O;  4JI8 O;  4GKK O;  4B3R O;  5BR8 O;  3F5T A;  4X62 O;  4LF7 O;  1XNR O;  4NXM O;  4JI2 O;  1J5E O;  4JV5 O;  4LFC O;  2UXC O;  2ZM6 O;  2UXB O;  1DK1 A;  2Z0A A;  2ZKO A;  1N36 O;  4YY3 O;  1G1X B;  5BXZ A;  3J7A U;  3RT3 C;  4DV6 O;  1XEQ A;  4JI1 O;  4A5U B;  2N74 A;  4LF8 O;  4DR1 O;  1IBL O;  4GKJ O;  2UUA O;  4LFB O;  1N33 O;  4DUZ O;  4AQY O;  1R1B A;  4DR3 O;  2VQF O;  4JI7 O;  1XMO O;  4LF5 O;  2UUB O;  1I94 O;  1KUQ A;  3M8A A;  4NXN O;  1F7Y A;  3JAM N;  3O65 A;  4OPA A;  2FKX A;  5IWA O;  5LMN O;  1YZB A;  4JYA O;  4DV0 O;  1D2D A;  3T1Y O;  2LW7 A;  3J81 N;  3T1H O;  4DR5 O;  1NS1 A;  4B3M O;  4DV2 O;  1FYJ A;  2F4V O;  1N32 O;  4DV7 O;  4DV4 O;  3J80 N;  5IT9 N;  4DV5 O;  4OPH A;  4B3S O;  5FLX N;  4JI3 O;  1R6T A;  5BY1 A;  1IBM O;  2DOS A;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...