1HNZO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnzO00
1KUQA 4LF5O 2VQEO 2UXCO 5IWAO 4AQYO 4JYAO 1FJGO 4B3TO 3SDLA 2N74A 4DUYO 4OX9O 2UXDO 1HNZO 5LMNO 2UU9O 4NXMO 2JRIA 1XMOO 5BY1A 4JV5O 4YY3O 4DV3O 2HHHO 4KHPO 4LFBO 1HNWO 3J7AU 2Z0AA 4DV1O 4DUZO 1IBLO 1FYJA 3J81N 4DV5O 1N34O 1AILA 2UUAO 4LF8O 1G1XB 5IT9N 4B3MO 3RT3C 2ZM6O 4GKKO 4JI1O 4X62O 4JI8O 2DOSA 4A5UB 4DR2O 4JI7O 4DR7O 4LF4O 3M8AA 2ZKOA 1D2DA 4DR5O 2VQFO 3R66A 4DR3O 4DV0O 5LMUO 4JI0O 2UUBO 4JI3O 1HR0O 4YHHO 4OPAA 1R6TA 2LW7A 4JI2O 4JI5O 4DR6O 5H5NA 2UUCO 1XNRO 5A2QN 5BXZA 4DV2O 3J80N 4X66O 1HNXO 2FKXA 1XNQO 1I94O 1FKAO 4DV4O 1XMQO 1YZBA 4LFAO 1N36O 4LF9O 2F4VO 4NXNO 4DR4O 3T1YO 2AGAA 4OPHA 1J5EO 1N32O 4B3SO 2DJVA 5LL6Y 4X64O 4X65O 4B3RO 1N33O 1NS1A 1F7YA 4DR1O 3JAMN 2UXBO 4GKJO 4LF7O 3OTOO 4JI6O 1IBMO 4LF6O 1DK1A 4K0KO 4LFCO 4DV6O 1IBKO 5BR8O 5FLXN 3T1HO 1X59A 1R1BA 2E5LO 3O65A 4DV7O 1AB3A 1A32A 1XEQA 3F5TA 4JI4O
chains in the Genus database with same CATH superfamily
2JGUA 4GKJB 2R9RB 3UCSC 1IBMB 1COWG 2BCCH 3TXSA 4DRXB 5LMNO 2ITDC 1XMQB 1QU7A 3AK2A 4PA3A 2JGDB 5B3SC 4H37A 3MD0A 4FLZA 3J7AU 5C93A 4IIJB 1XBLA 3RWRD 1TA8A 4UV8A 5LBQA 2VQEB 4H33A 4KUMA 3T2MA 4JYAB 1RFYA 3E8GA 4UVCA 3K0DA 4X89A 5CN0A 4ZHQB 2EZPA 3L75H 1B6QA 2RQ6A 4I55B 3FB5C 1EBOA 1D2DA 2Q6AA 3I56V 5IJ0A 2JIZG 2Y4TA 1OCRB 2FB5A 1TUBA 2Q7GA 2E75B 3KZIZ 4R50A 3BA8A 3HKBA 5KX5A 1OHHG 1BSMA 4JI3B 4KP4A 1S5HC 1XMQO 1P7GA 2P4KA 3ZRWA 3OR7C 1V54B 3CPWU 1SA0B 3ML0A 2AZ2A 4JI7B 2LFSA 2QA4V 4CBCA 1ORQC 1Y67A 3DTUB 2WPDG 3DC6A 4DR4B 1WPBA 4IHJB 5EC2C 1GH6A 3GWKC 1WA8A 1HR0B 3ABLC 2EJRA 3A0HZ 1AB3A 2GUZA 4DV7O 2Q67A 2NN4A 5FL7G 3CJHA 4ZIBA 4DV2B 1N8RW 1NKDA 5IWAO 4UCVA 1BHAA 3ZCCA 3CRCA 5FPOA 2CK3G 3ASNC 4AHCA 3BHPA 1KP2A 2WLIA 4QPKA 1AR5A 5EBMC 1GRJA 3EFFK 1VQ5V 3RN4A 3JATA 3DXRB 2M7WA 1V55B 1K3EA 2CAZC 3SYQA 1DF5A 2HKOA 4JI7O 3AG1C 4DV1B 1IVSA 3M8AA 4LP8A 3JAKA 3CWBH 3AK1A 4RUFA 1N34B 2EILC 4F4LA 1BT8A 4RUEA 3LSUA 1JCHA 3EHBB 1HR0O 4P9OA 1I08A 1VQ4V 3S3WA 3E22B 1H2KA 2B9ZA 2OCHA 3VQYA 1NVPB 4TQDA 5BXZA 4DV2O 2A3QA 2PY5A 3WB2A 2ZR3A 5KHKA 1EN5A 4DV0B 4U7NA 1OZ0A 3L9DA 2X0LA 2P7TC 3H1HH 4DV5B 3QO8A 4L87A 2YEVB 3LNNA 2F4VO 5B1AB 1NVPD 2GSMB 3GWOA 1S5JA 4I0XB 2DYRC 2L6LA 1HW7A 1N32O 3D36A 2QWPB 1F7YA 4TV8A 1SS3A 3QF7A 5H9CA 1HDJA 1K5SA 3SGIA 5L3GA 1MSDA 5CBHA 2QE7G 1XQ8A 3E83A 3CX5F 1Q43A 1H2GA 1A32A 4ZOLB 1O9HA 2Y69B 3RYHA 4DXWA 3L74H 4J7KA 5LXTB 3ETGA 3D8CA 3SYPA 4EB6B 4DV4B 1PP9H 2WA4A 3ZBHA 5IDJA 5B1BC 2WLNA 4MVZA 1FYJA 4FM0A 2R72A 3TGUH 2AXTZ 4DV5O 5IYZA 4Q6GA 4BW9A 4JI6B 1D5NA 1T5EA 1K34A 4RQEA 2MK3A 1S76D 2QR4A 2HHHB 3JD1A 1VIBA 3WB0A 1TAEA 2LJ2A 2EINC 3AG3C 3D36C 1L1FA 1IDSA 2VQFO 5J2TA 5KAFZ 3CXCU 1XOUA 5DEDA 4LF5B 5CBFA 1WNSA 1BE3H 4OXSA 1Q90D 2ETNA 4TQFA 1VQNV 1GN6A 4K3AA 4O2BB 3ZHUA 1I5YA 4O4JB 2Y48A 2YUAA 1G4YB 1QR9A 2QWOB 3U0ZA 4LFBB 1HNWB 3WU2Z 4DV4O 1TVKA 2BOCC 1SQGA 2ZDIC 2PF4E 1JOYA 2ZE8A 3FYIB 1KU9A 2CGNA 4NB5A 1W2BU 1HNXB 5FNVB 4I50B 3TETA 3CC7V 4DR7B 3JAMN 4E2LA 2QTOA 2PZSA 2CTWA 3BCCH 2D3OW 1M56B 4JI6O 3MAQA 1RPRA 2Q7HA 1AR1B 2BSKA 3G80A 4QPJA 2P6JA 2DQ0A 4F6RB 1N4CA 3HKEA 1NH2D 3FYEB 1E1RG 5C8YB 4O4HA 5TISZ 4LF5O 3CCQV 4UCOA 5EK0A 4LFCB 1Y74A 4BIUA 3L70H 2CTRA 3MDSA 3BVOA 3ZHRA 1YXBA 1H38A 1QVGU 1K92A 1R3LC 5LA6B 1H8EG 4LFBO 4FZ0A 1HNWO 3LSQA 5LHGA 5D5QA 4MTGA 3SPGA 5F2VO 3A2FA 1IXBA 3ABMC 4JTCB 1IZ3A 2JEXA 3ZS8C 3OEHG 3CCSV 5BR8B 5JVDA 4DR7O 2Y69C 3VQVA 1R3IC 1SKVA 2BOBC 3RYIB 4DR5O 5GTIZ 2LGQA 4X20B 2AZ0A 4FLXA 3H1IH 1VF7A 1Z5WA 1GN4A 4Q20A 3OD4A 3JARA 4JI2O 3Q4HB 1Y4MA 2QTSA 4CH5A 3WG7C 3QG5A 1BS3A 1S72V 4WBNB 4O2AA 1K7DA 2UUBB 2IJHA 5CA1B 4NTXA 2HP8A 2FTKA 5LOVB 5E1AC 2YXHA 4LWSB 5CA0B 4PDMA 4X62B 5IJ9B 2Q0OC 2DE0X 2LGWA 1L0NH 2JS3A 2OT5A 4J10A 4P9PA 3P30A 2WAMA 1PM9A 3BPZA 3VQWA 3OE7G 5BR8O 5FLXN 1J5EB 3T1HO 1X59A 3RBZA 3B8MA 3K08A 1KC8W 2IU0A 1VF6A 4PA7A 5B3SB 3SJCC 1XNQB 5B66Z 1K9MW 1IBKB 4XDJA 3FKSG 1KECA 1MABG 3LUTB 2IBZH 1KD1W 4DW0A 1QLEC 5JCOA 4GT1A 2YIDA 2Z0AA 1YITV 2EZOA 1M56C 2ZXWB 4PDVA 2XHBA 4ZBMA 4AQYB 4B3TB 4JAUA 5LGTA 4LR3A 4UV9A 2UU9B 1JVMA 1Y76B 4JI1O 4X62O 4YY3B 1OCCC 1F23A 3X2QC 5LYJB 4D7TA 3H1LH 1YTFB 2WSSG 4DR3O 3CP1A 1AP6A 4I5SA 1DGSA 1PL4A 3FB8C 1VEWA 4J41A 1EN6A 1WJZA 2JVDA 3ICXA 5A2QN 3K06A 3B09A 2A0LA 4CS3A 2KSDA 4IGGA 2PYJA 2ADPA 3G67A 3JSNA 1YTFD 4AILC 2FKXA 4PV1B 1XNQO 3H1JH 1I0HA 3M99B 3K58A 4TV9A 4R8CA 1N0JA 2AHYA 5EC1C 3B4SA 1GM9A 2DJVA 2ZIMA 1W59A 1M4UA 4WFGA 3M7MX 2H8PC 1SERA 4HNAA 2ZT9B 4JAAA 5EZYA 2OIEA 1YIJV 3APOA 3K03A 2Z3YA 3HKCA 2K1EA 2RJZA 2QM8A 2Y0IA 5IJ0B 5LHHA 1R3KC 3OM3B 4X66B 2W0FC 5KA6A 1FXVA 3HR0A 3OTOB 4JTDB 4J7ZA 1RPOA 1ZL8A 3IC9A 1TUBB 2HVJC 3RGBA 1QCEA 4OX9O 4I9WA 5IE9A 2RN9A 4TOIA 3HKBB 5IYBO 3OW2U 5KX5B 4RAIA 2IM9A 5KHHA 1OCOB 4CC5A 2HR3A 1K73W 5KAIZ 4X1IB 2JJ2G 4X1KA 3ZJZA 1AILA 3AG1B 3BA9A 1SESA 1M57C 2ZM6O 1EZVH 5KMGA 1AI6A 4L8JA 4ABMA 2EILB 3FB6C 2FMLA 4P2ZA 1FXKA 2NR5A 1R73A 4JZGA 4LC1A 1KKCA 4DUZB 4J11A 1F51A 1SQVH 4J80A 4HAMA 4YJ3A 4ZI7B 5LP6A 1V9PA 2GUZB 4GKKB 2KB1A 3CJHB 2UUCO 4I9QA 5ITZA 1E79G 1TUEB 2VRZA 4X66O 2W6IG 1P84F 1K8AW 2ZXWC 4MW8A 2DYRB 1AJPA 3FD9A 2DMXA 3G6EV 2V1DA 1ZSPA 1B04A 4DR6B 2Q69A 4B08A 2ZR2A 2AGAA 1AROP 4OPHA 4CC6A 3E35A 2YS8A 2QDOA 3JATB 4DO2A 4CH6A 4QGPA 1UPGA 2OIGA 4GKJO 1GAXA 2B1GA 1IBMO 2QEXV 5JH7A 1M9NA 4TSFG 2CTPA 1AVMA 3JALB 4MTXA 3U10A 1VQLV 2OCCC 3JAKB 4HZ3A 4TT3G 5J9PC 1OCZB 1AJNA 2XTAA 4JI5B 4X64B 3QO5A 1XREA 4QIWF 4TUYA 3B77A 5B1BB 2VQEO 1G8MA 2GDSA 4UCUA 5HFMA 4JYAO 3ETDA 3OR6C 2NNUA 3K04A 1ZUQA 3P32A 2A79B 2DW4A 5LP6C 1WP7A 1PKXA 2QSAA 4LCUC 2K9PA 4H44B 3C90A 4MVQA 1ZTEA 3N2GA 4QJFB 3GVMA 2N04A 1W0JG 1FJGB 4J9YB 4PA6A 2EINB 2XAJA 3AG3B 4WCEV 4LF7B 2FYUH 3ETEA 4TV8B 4MVSA 1NR7A 1Z5VA 2A9HA 2MW2B 2A06H 3OGCC 3CYOA 3TXQA 2E5LB 4NVPA 1LNQA 1S0VA 3N27A 3T4DA 3HKDA 5AG2A 4PDLA 4JI3O 1UJWB 3CCJV 3QVNA 3RYFB 4JI5O 3A0RA 4DUYB 3RYHB 2F43G 1D5AA 3W7XA 1OCOC 1ZLZA 1VARA 1Q8IA 5CB4A 4FLWA 3K9SA 2QWRB 2UXNA 3C3TA 2CE4A 4JTAB 2XAQA 4WFHA 4UCRA 1WP8A 5H2FZ 4U3JB 2JK5C 3SPIA 3CS5A 4DR4O 2H94A 5L3CA 3F7YC 2UXXA 5EBWC 4O4IA 1G6UA 2ZQMA 4J7JA 1DTOA 2YXLA 1BQ0A 2P67A 5IYZB 1BCCH 4CS4A 5CBGA 3JD2A 2W0XA 1LR1A 4LF7O 3JD0A 2EIJC 3STLC 5IY5C 5LMUB 1XHXA 4GLXA 2DWDC 2C2AA 1Y6XA 1JX9A 2ZIOA 2GBOA 5EIBC 1SA0A 1U97A 5J2TB 2IU3A 4X65B 2E5LO 2KKWA 1VQ6V 4YIPA 2EIKB 1XL4A 4K0KB 4JYBA 3G71V 3AK3A 4DUYO 1H8HG 1MZFA 1KKDA 3ABMB 4I4TB 3ZRSA 1TVKB 4DV1O 4MTOA 3AG4B 3O9OA 4IYHA 1PPJH 1N34O 1M90W 2P90A 1VQ7V 4AI8A 1OCZC 1YHQV 4GYCB 4KHPB 2X6CA 1RP3B 4C7UA 3S3XA 2M6YA 5CMUA 2BSKB 2ADQB 4DV0O 3WG7B 5LMUO 1RSOA 3E8BA 2UXCB 1FFTB 3HKEB 3JSLA 4FLTA 2GV9A 2ZNJA 2X6AA 4OPAA 3K5OA 4JI8B 3FB7C 1MNGA 2QKAA 2WA3A 4FZ1A 3J80N 4HBNA 3BFRA 1QBZA 1Y74B 4JI0B 2EULA 4R6ZA 3B40A 1VQKV 2KQXA 5B5EZ 2YDEA 4O4LA 3K0GA 1NTZH 2Y4UA 2YSUB 1AP5A 2P06A 2ILMA 4CH4A 4UB6Z 3K5MA 3QTCA 4MTFA 2PTMA 2HG5C 2XT9A 4B3SB 3ZMTA 3PN1A 4NYKA 4B3RB 2JS5A 2EX3A 4DR1B 1CEZA 4YJ2A 1SQXH 1QLEB 4TWKA 3JARB 2UXCO 1WAZA 3OEEG 4WFAV 3GB7C 4GX0A 5KUKA 4LF6B 1VF5B 3SYCA 1XL6A 4FMTA 4DV6B 3SPCA 1MA1A 2AW9A 2JEUA 3LDDA 1N36B 4LF9B 2DWEC 2HHHO 3ZMZA 1GMGA 4ZOLA 4Z1MG 1YDXA 1N33B 1MMMA 1OCCB 3X2QB 2FL4A 2ZE7A 1VQPV 2DYSC 1S77D 4PELA 4IT5A 3E89A 2R9IA 3CCRV 1B06A 1HWYA 2EIKC 2WLLA 3AEIA 3CC4V 1ZX3A 2QKCA 4WFFA 2CH7A 2P4VA 1R6TA 4CZZA 3LDCA 5B1NA 3E86A 1HNZB 3ZX6A 1HNXO 2Q7EA 3AG4C 4JV5B 4GZRB 4WFBV 2XAFA 3HB3B 4J42A 5KUMA 1N36O 4LF9O 4DK1A 3K59A 2E3CA 4B3MB 3I55V 1X4TA 2PUSA 3N2KA 4MVOA 4HYOA 3ZHSA 1N33O 3JD3A 1NS1A 2VS0A 4KL1A 4P30A 5K1XA 3ZMSA 4N23A 4LBEC 4D6TH 3CSXA 2ARHA 1JJ2U 4LFCO 1NT2B 1JFFA 1JR9A 4NTWA 3E8HA 4X1YA 4NTYA 3C3SA 4D7SA 4I50A 4MS2A 2F66C 3CCVV 4BIZA 3F5WC 1M93A 1ZAUA 1TGOA 1LUWA 2Z5UA 3OMNB 1I94B 1LUVA 2E76B 4JF3A 1PV0A 1HNZO 2B5UA 2HJDA 4GX1A 4ZKIA 1Q7YW 5BY1A 4JV5O 3UQ8A 1M57B 2QWQB 3R65A 5JQGA 4JI4B 2YC0A 4TV9B 4DK0A 3J81N 3AG2C 5GTHZ 3QO7A 3MHHC 3P3NA 4B3MO 4NXMB 4QE7A 2IH1C 2YICA 3VOUA 5LA6A 4JGSA 3UT5A 2HEPA 3FAVA 4PI2A 4ASUG 1KMIZ 4HNAB 4ICGA 3KKYA 1AI5A 5EZYB 3OUFA 4CH3A 4UXNA 4B7EA 4LNUA 4K8XA 4FPPA 1DLBA 3TK1A 2UUBO 3ZHQA 3HKCB 3PJSK 1GKFA 1OV9A 5GONB 5J2UA 3JD4A 3OMIB 3TCUA 3LNMB 2WWWA 1ZL8B 3W7UA 4K8ZA 1QLNA 1I94O 2LO1A 3OUSA 1NJIW 1E1QG 3ASOC 3IGAC 4F6EA 3A8TA 3SYOA 4U3FH 4LF8B 3OAAG 1KYOF 3Q4HA 5JWPA 3IAYA 4NR1A 1J5EO 4X1KB 1YVWA 2QM4A 3ABUA 4FVMA 4MVRA 2OCCB 2BTOA 4BAYA 5KMGB 2DN9A 4MW3A 4FLYA 3ZIAG 1IBKO 1YJWV 3K3WA 3H9VA 1VF6C 1M1KW 2BTQA 1S5LZ 3O65A 3STZC 5DN6G 3BAAA 5LP6B 1KUQA 3K5LA 2UXBB 4UFZA 5EYPA 5JCOC 1R6KA 4PD4F 4AQYO 4B3TO 5ITZB 2EBOA 2XUMA 4OGQB 3UO2A 2UU9O 4UCTA 4LFAB 3BRCA 1YJNV 4YY3O 1H2LA 2V7QG 1KP3A 4YXWG 4U7OA 3DSQA 4LF8O 4PA4A 2LP7A 2OYQA 1JPXA 2WLMA 5JJEB 4FFBA 4X9QA 1VP7A 5IYCO 1EFRG 3CMAV 1FFXA 3EXAA 1BMFG 4EKWA 1WLEA 4GCZA 3UO3A 2Q5ZA 2X7RB 5BMVA 4QE9A 5LHIA 3SPHA 1SC5B 3ZRWB 4J9ZB 1MZEA 4TUYB 1Y76A 5IYDO 1F4MA 4UUJC 4FFKA 1PD3A 3K57A 3BEHA 3L73H 1YF2A 1IBLB 1QR8A 4I7ZB 4LFAO 4JZ2A 1WA8B 1S3JA 3RYCA 2W6JG 3N2GB 2EIJB 5IY5B 2P5OA 2DQ3A 4UCSA 1IXMA 4E4EA 1BZKA 4LF4B 4UB8Z 3OTOO 5E79Z 1DK1A 3VQXA 4PI0A 3ABKC 3CE2A 4KFMA 2QKSA 2QM7A 2WLIB 5HFLA 3HKDB 1R1BA 1FS0G 1VMGA 4EFEA 3JASA 1ROPA 3T1CA 2YIBA 5EIBD 2D2CB 3CCEV 2CDYA 2B1IA 5CB4B 3ZHTA 2JRIA 1W0KG 2PI5A 1Q5OA 4DV7B 2R9AA 5KA5A 4RWUA 1IBLO 4JPRA 4BWAA 4DUZO 4JYCA 4GX2A 5IWAB 3K9AA 2XAGA 3CC2V 3OMAB 3T4ZA 1PNLA 1FXKC 1IX9A 2KG7A 3RT3C 4O4IB 2Q8VA 3JAWA 1URFA 4GKKO 2CTQA 2IH3C 1YJ9V 3BY6A 5JJJB 2GTAA 2R70A 1SQBH 4LF4O 3APQA 4H0LB 1R3JC 3IC7A 3R66A 3OTFA 4X1IA 3CD6V 4PA9A 4EFBA 1O9GA 1MSWD 1XUQA 4BIOA 3FX7A 4DR6O 1Q3EA 1SZXA 4EEQA 1FXHA 1VQ8V 4DRXA 1CP9A 1XMOB 2JGDA 1BHBA 4W4LA 2E74B 4YIOA 2PGGA 4ZI7A 4IIJA 4K35A 3UKMA 2EIMC 4FM2A 1Z2GA 1XHZA 2WLHA 1EZJA 5LL6Y 4ZHQA 3CRMA 4X64O 2IW5A 4R7CA 4I55A 2ZE5A 3ZN1A 2ODMA 4IYIA 2A7WA 3CRRA 3CCLV 4XDKA 5D5PA 1VQOV 4QNHB 5L3EA 2F4VB 4X88A 2Q0AA 3AG7A 1N32B 2VWJA 3JYCA 1N0NA 5LGUA 1RSOB 2GHYA 2X6BA 2XNDG 2ATKC 1XEQA 3F5TA 1FPOA 2YI8A 3QNEA 1XILA 1ZWIC 2QGNA 1FJGO 3SDLA 5KLVH 2Y0PA 2OTJV 2RCVA 2HJFC 5EBLC 4XBFA 2YXYA 3JALA 4IL6Z 1XMOO 3ZHVA 2HLDG 1EM1A 2DYSB 1NQTA 3T1YB 3CHXA 4GX5A 4O4LB 3H1KH 1US6A 5K1PA 4JASA 5L3FA 1Q6UA 2ITCC 3LSSA 1QVFU 1YCIA 1QQCA 1SETA 1KBHA 1SQQH 4RO2A 4MVMA 4IHJA 1Q6IA 4UVAA 2RMKB 1KB9F 2G38A 2LW7A 5FPRA 5H5NA 4YJ2B 4N21A 3WB1A 5KHIA 1RM1B 1NTKH 1CXZB 1GK9A 2VQFB 4DV3B 1U96A 3W7WA 1OCRC 2LQTA 2CUGA 2YI9A 1NBMG 2ZE6A 2EJ7A 5DM6V 1M5IA 2UUAB 5JJNB 3RYFA 3NR7A 3ZMUA 3DXRA 1ENVA 2RNBA 3T1YO 5GW7A 4MT8A 4X65O 1L8DA 4O4HB 2XAHA 2ZDIA 2ZCEA 1YI2V 3FFQA 2PI4A 1V54C 1BGYH 1JJOA 4K0KO 3WFVA 1WPXA 4U3JA 3CCMV 2YIAA 2WLLB 4YHHB 5H6RA 2LFRA 1I5XA 1P4RA 3E22A 5DECA 3HPLC 4DW1A 4FLVA 2CH7B 2HFEC 3MHSC 1I7FA 3U11A 3NXSA 1WB8A 3AG2B 1THZA 5JVDB 3W7TA 1YEWA 4DV3O 4NXNB 4KHPO 2YEVA 3KG2A 4I0XA 1GO3F 4MVUA 2JDIG 2UUAO 4W4KA 2RDCA 3N2KB 4Z2WA 4JI8O 4I4TA 5BZBA 2ZKOA 1V55C 1L0LH 3ZRXA 1B3QA 4O2AB 3G4SV 4G2KA 1JFFB 3A0BZ 3B8NA 4JI0O 1XDCA 1GN2A 2N05A 1CPYA 3KCYA 3OT7A 4X1YB 4BW5A 4YHHO 1VQMV 4MSWC 3G6BA 1NH2B 3JCUZ 5LXTA 3ASOB 4UVBA 4EB6A 4PDRA 5CA3A 4DR5B 5B1OA 4JYYA 1WN7A 1NTMH 2XOKG 4B7KA 2F23A 4JI2B 2WLKA 3ZMVA 1NU1H 1NI8A 5JQGB 4NXNO 5L3DA 4FK5C 2OWOA 4NKGB 4B3SO 2IJJA 3I5DA 4B3RO 4DR2B 4DR1O 2P22C 3RVZA 5B1AC 3RFRA 1HP8A 1QHTA 3D3QA 3UT5B 4LF6O 3FAVB 3H01A 4DV6O 2XASA 1RM1C 3CXHF 4LNUB 4KXRA 1XNRB 1YSCA 4FIPC 2BE3A 5KHGA 3CRQA 1GN3A 4O2BA 2F93B 1AR4A 4O4JA 3L72H 5J2UB 1P7BA 3RVYA 3TJTA 1SQFA 1K5QA 3T1HB 1SZTA 4PJ0Z 1NZ6A 3E2EA 1XI1A 3SJQC 2ZINA 2Q4PA 3SR2C 2CGOA 2VWKA 3SJBC 5FNVA 1G1XB 2QWNB 3DGEA 2LW1A 4RQFA 5IT9N 5KHJA 3B2EE 1K4CC 2AHZA 2V4DA 4G27B 3CRAA 3F7VC 4DR2O 2IJKA 1GTOA 3BABA 3K79A 3DC5A 2GTSA 4F6RA 1Q81W 1AI4A 3VBBA 5C8YA 2BTQB 2F1MA 1SQPH 1IURA 2Q73A 1JQ0A 5L3BA 3SPJA 4JAVA 4JI1B 2O57A 4BR6A 5LGNA 1XNRO 2UXDB 1Q6HA 5EYPB 1Y66A 3CCUV 4FLUA 1FKAO 1K4DC 4DR3B 2HVKC 1H2NA 3ZEDA 2Q9LA 3E8FA 2L35A 4FJCC 4CS2A 1P49A 2QJ1A 3JCZA 2NLJC 3ABKB 3IJ4A 1MOFA 4FFBB 1OJHA 3RYIA 1R6NA 2Q68A 1FFXB 4X20A 1KQSU 3ABTA 2OTLV 5BMVB 3SJAC 3KCXA 4FM1A 4JI4O 4H13B 1BQZA 1MG1A 2IJIA 2JJ1G 4GUNA 4Z1VA 1GM8A 5H6QA 4WBNA 2N74A 3CEIA 1SF9A 2UXDO 4X8AA 1SRYA 4NXMO 2ZNIA 3IFXA 4PHZA 1AI7A 1FXKB 1VQ9V 5CA1A 1JA8A 3L71H 5LOVA 1Q82W 2ZD9A 1H2MA 4LH7A 4LWSA 1J95A 4YJ3B 5CA0A 3RYCB 3W7SA 5IJ9A 4OX9B 3EVKA 2DOSA 4A5UB 2F95B 2WLJA 1H2SB 1NR1A 3RW0A 1FAFA 4XDLA 1PL0A 1UFIA 2ZM6B 4DYLA 1EN4A 3OGIB 3OFNG 3ZN0A 3JASB 4LH6A 3ABLB 5LMNB 2EIMB 1GM7A 3SYAA 3UM7A 3LDEA 3ZRVA 1K33A 1WB7A 5JH7B 3K5NA 1FD9A 1YZBA 2UUCB 1Q86W 4WF9V 3ASNB 5GONA 1BL8A 2YIBD 2H3OA 3CMEV 2KG7B 1F4NA 2UXBO 3JAWB 5LYJA 3D3IA 1AJQA 4G28B 2PYLA 1PNMA 3CB2A 3ETQA 3THOA 1PNKA 1DF4A 3P3PA 5A9GA 4WFEA 1QNMA 1JMKC 1K97A
chains in the Genus database with same CATH topology
1KUQA 4LF5O 2VQEO 2UXCO 5IWAO 4AQYO 4JYAO 1FJGO 4B3TO 3SDLA 2N74A 4DUYO 4OX9O 2UXDO 1HNZO 5LMNO 2UU9O 4NXMO 2JRIA 1XMOO 5BY1A 4JV5O 4YY3O 4DV3O 2HHHO 4KHPO 4LFBO 1HNWO 3J7AU 2Z0AA 4DV1O 4DUZO 1IBLO 1FYJA 3J81N 4DV5O 1N34O 1AILA 2UUAO 4LF8O 1G1XB 5IT9N 4B3MO 3RT3C 2ZM6O 4GKKO 4JI1O 4X62O 4JI8O 2DOSA 4A5UB 4DR2O 4JI7O 4DR7O 4LF4O 3M8AA 2ZKOA 1D2DA 4DR5O 2VQFO 3R66A 4DR3O 4DV0O 5LMUO 4JI0O 2UUBO 4JI3O 1HR0O 4YHHO 4OPAA 1R6TA 2LW7A 4JI2O 4JI5O 4DR6O 5H5NA 2UUCO 1XNRO 5A2QN 5BXZA 4DV2O 3J80N 4X66O 1HNXO 2FKXA 1XNQO 1I94O 1FKAO 4DV4O 1XMQO 1YZBA 4LFAO 1N36O 4LF9O 2F4VO 4NXNO 4DR4O 3T1YO 2AGAA 4OPHA 1J5EO 1N32O 4B3SO 2DJVA 5LL6Y 4X64O 4X65O 4B3RO 1N33O 1NS1A 1F7YA 4DR1O 3JAMN 2UXBO 4GKJO 4LF7O 3OTOO 4JI6O 1IBMO 4LF6O 1DK1A 4K0KO 4LFCO 4DV6O 1IBKO 5BR8O 5FLXN 3T1HO 1X59A 1R1BA 2E5LO 3O65A 4DV7O 1AB3A 1A32A 1XEQA 3F5TA 4JI4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUQ A;  4LF5 O;  2VQE O;  2UXC O;  5IWA O;  4AQY O;  4JYA O;  1FJG O;  4B3T O;  3SDL A;  2N74 A;  4DUY O;  4OX9 O;  2UXD O;  1HNZ O;  5LMN O;  2UU9 O;  4NXM O;  2JRI A;  1XMO O;  5BY1 A;  4JV5 O;  4YY3 O;  4DV3 O;  2HHH O;  4KHP O;  4LFB O;  1HNW O;  3J7A U;  2Z0A A;  4DV1 O;  4DUZ O;  1IBL O;  1FYJ A;  3J81 N;  4DV5 O;  1N34 O;  1AIL A;  2UUA O;  4LF8 O;  1G1X B;  5IT9 N;  4B3M O;  3RT3 C;  2ZM6 O;  4GKK O;  4JI1 O;  4X62 O;  4JI8 O;  2DOS A;  4A5U B;  4DR2 O;  4JI7 O;  4DR7 O;  4LF4 O;  3M8A A;  2ZKO A;  1D2D A;  4DR5 O;  2VQF O;  3R66 A;  4DR3 O;  4DV0 O;  5LMU O;  4JI0 O;  2UUB O;  4JI3 O;  1HR0 O;  4YHH O;  4OPA A;  1R6T A;  2LW7 A;  4JI2 O;  4JI5 O;  4DR6 O;  5H5N A;  2UUC O;  1XNR O;  5A2Q N;  5BXZ A;  4DV2 O;  3J80 N;  4X66 O;  1HNX O;  2FKX A;  1XNQ O;  1I94 O;  1FKA O;  4DV4 O;  1XMQ O;  1YZB A;  4LFA O;  1N36 O;  4LF9 O;  2F4V O;  4NXN O;  4DR4 O;  3T1Y O;  2AGA A;  4OPH A;  1J5E O;  1N32 O;  4B3S O;  2DJV A;  5LL6 Y;  4X64 O;  4X65 O;  4B3R O;  1N33 O;  1NS1 A;  1F7Y A;  4DR1 O;  3JAM N;  2UXB O;  4GKJ O;  4LF7 O;  3OTO O;  4JI6 O;  1IBM O;  4LF6 O;  1DK1 A;  4K0K O;  4LFC O;  4DV6 O;  1IBK O;  5BR8 O;  5FLX N;  3T1H O;  1X59 A;  1R1B A;  2E5L O;  3O65 A;  4DV7 O;  1AB3 A;  1A32 A;  1XEQ A;  3F5T A;  4JI4 O; 
#chains in the Genus database with same CATH topology
 2JGU A;  4GKJ B;  2R9R B;  3UCS C;  1IBM B;  1COW G;  2BCC H;  3TXS A;  4DRX B;  5LMN O;  2ITD C;  1XMQ B;  1QU7 A;  3AK2 A;  4PA3 A;  2JGD B;  5B3S C;  4H37 A;  3MD0 A;  4FLZ A;  3J7A U;  5C93 A;  4IIJ B;  1XBL A;  3RWR D;  1TA8 A;  4UV8 A;  5LBQ A;  2VQE B;  4H33 A;  4KUM A;  3T2M A;  4JYA B;  1RFY A;  3E8G A;  4UVC A;  3K0D A;  4X89 A;  5CN0 A;  4ZHQ B;  2EZP A;  3L75 H;  1B6Q A;  2RQ6 A;  4I55 B;  3FB5 C;  1EBO A;  1D2D A;  2Q6A A;  3I56 V;  5IJ0 A;  2JIZ G;  2Y4T A;  1OCR B;  2FB5 A;  1TUB A;  2Q7G A;  2E75 B;  3KZI Z;  4R50 A;  3BA8 A;  3HKB A;  5KX5 A;  1OHH G;  1BSM A;  4JI3 B;  4KP4 A;  1S5H C;  1XMQ O;  1P7G A;  2P4K A;  3ZRW A;  3OR7 C;  1V54 B;  3CPW U;  1SA0 B;  3ML0 A;  2AZ2 A;  4JI7 B;  2LFS A;  2QA4 V;  4CBC A;  1ORQ C;  1Y67 A;  3DTU B;  2WPD G;  3DC6 A;  4DR4 B;  1WPB A;  4IHJ B;  5EC2 C;  1GH6 A;  3GWK C;  1WA8 A;  1HR0 B;  3ABL C;  2EJR A;  3A0H Z;  1AB3 A;  2GUZ A;  4DV7 O;  2Q67 A;  2NN4 A;  5FL7 G;  3CJH A;  4ZIB A;  4DV2 B;  1N8R W;  1NKD A;  5IWA O;  4UCV A;  1BHA A;  3ZCC A;  3CRC A;  5FPO A;  2CK3 G;  3ASN C;  4AHC A;  3BHP A;  1KP2 A;  2WLI A;  4QPK A;  1AR5 A;  5EBM C;  1GRJ A;  3EFF K;  1VQ5 V;  3RN4 A;  3JAT A;  3DXR B;  2M7W A;  1V55 B;  1K3E A;  2CAZ C;  3SYQ A;  1DF5 A;  2HKO A;  4JI7 O;  3AG1 C;  4DV1 B;  1IVS A;  3M8A A;  4LP8 A;  3JAK A;  3CWB H;  3AK1 A;  4RUF A;  1N34 B;  2EIL C;  4F4L A;  1BT8 A;  4RUE A;  3LSU A;  1JCH A;  3EHB B;  1HR0 O;  4P9O A;  1I08 A;  1VQ4 V;  3S3W A;  3E22 B;  1H2K A;  2B9Z A;  2OCH A;  3VQY A;  1NVP B;  4TQD A;  5BXZ A;  4DV2 O;  2A3Q A;  2PY5 A;  3WB2 A;  2ZR3 A;  5KHK A;  1EN5 A;  4DV0 B;  4U7N A;  1OZ0 A;  3L9D A;  2X0L A;  2P7T C;  3H1H H;  4DV5 B;  3QO8 A;  4L87 A;  2YEV B;  3LNN A;  2F4V O;  5B1A B;  1NVP D;  2GSM B;  3GWO A;  1S5J A;  4I0X B;  2DYR C;  2L6L A;  1HW7 A;  1N32 O;  3D36 A;  2QWP B;  1F7Y A;  4TV8 A;  1SS3 A;  3QF7 A;  5H9C A;  1HDJ A;  1K5S A;  3SGI A;  5L3G A;  1MSD A;  5CBH A;  2QE7 G;  1XQ8 A;  3E83 A;  3CX5 F;  1Q43 A;  1H2G A;  1A32 A;  4ZOL B;  1O9H A;  2Y69 B;  3RYH A;  4DXW A;  3L74 H;  4J7K A;  5LXT B;  3ETG A;  3D8C A;  3SYP A;  4EB6 B;  4DV4 B;  1PP9 H;  2WA4 A;  3ZBH A;  5IDJ A;  5B1B C;  2WLN A;  4MVZ A;  1FYJ A;  4FM0 A;  2R72 A;  3TGU H;  2AXT Z;  4DV5 O;  5IYZ A;  4Q6G A;  4BW9 A;  4JI6 B;  1D5N A;  1T5E A;  1K34 A;  4RQE A;  2MK3 A;  1S76 D;  2QR4 A;  2HHH B;  3JD1 A;  1VIB A;  3WB0 A;  1TAE A;  2LJ2 A;  2EIN C;  3AG3 C;  3D36 C;  1L1F A;  1IDS A;  2VQF O;  5J2T A;  5KAF Z;  3CXC U;  1XOU A;  5DED A;  4LF5 B;  5CBF A;  1WNS A;  1BE3 H;  4OXS A;  1Q90 D;  2ETN A;  4TQF A;  1VQN V;  1GN6 A;  4K3A A;  4O2B B;  3ZHU A;  1I5Y A;  4O4J B;  2Y48 A;  2YUA A;  1G4Y B;  1QR9 A;  2QWO B;  3U0Z A;  4LFB B;  1HNW B;  3WU2 Z;  4DV4 O;  1TVK A;  2BOC C;  1SQG A;  2ZDI C;  2PF4 E;  1JOY A;  2ZE8 A;  3FYI B;  1KU9 A;  2CGN A;  4NB5 A;  1W2B U;  1HNX B;  5FNV B;  4I50 B;  3TET A;  3CC7 V;  4DR7 B;  3JAM N;  4E2L A;  2QTO A;  2PZS A;  2CTW A;  3BCC H;  2D3O W;  1M56 B;  4JI6 O;  3MAQ A;  1RPR A;  2Q7H A;  1AR1 B;  2BSK A;  3G80 A;  4QPJ A;  2P6J A;  2DQ0 A;  4F6R B;  1N4C A;  3HKE A;  1NH2 D;  3FYE B;  1E1R G;  5C8Y B;  4O4H A;  5TIS Z;  4LF5 O;  3CCQ V;  4UCO A;  5EK0 A;  4LFC B;  1Y74 A;  4BIU A;  3L70 H;  2CTR A;  3MDS A;  3BVO A;  3ZHR A;  1YXB A;  1H38 A;  1QVG U;  1K92 A;  1R3L C;  5LA6 B;  1H8E G;  4LFB O;  4FZ0 A;  1HNW O;  3LSQ A;  5LHG A;  5D5Q A;  4MTG A;  3SPG A;  5F2V O;  3A2F A;  1IXB A;  3ABM C;  4JTC B;  1IZ3 A;  2JEX A;  3ZS8 C;  3OEH G;  3CCS V;  5BR8 B;  5JVD A;  4DR7 O;  2Y69 C;  3VQV A;  1R3I C;  1SKV A;  2BOB C;  3RYI B;  4DR5 O;  5GTI Z;  2LGQ A;  4X20 B;  2AZ0 A;  4FLX A;  3H1I H;  1VF7 A;  1Z5W A;  1GN4 A;  4Q20 A;  3OD4 A;  3JAR A;  4JI2 O;  3Q4H B;  1Y4M A;  2QTS A;  4CH5 A;  3WG7 C;  3QG5 A;  1BS3 A;  1S72 V;  4WBN B;  4O2A A;  1K7D A;  2UUB B;  2IJH A;  5CA1 B;  4NTX A;  2HP8 A;  2FTK A;  5LOV B;  5E1A C;  2YXH A;  4LWS B;  5CA0 B;  4PDM A;  4X62 B;  5IJ9 B;  2Q0O C;  2DE0 X;  2LGW A;  1L0N H;  2JS3 A;  2OT5 A;  4J10 A;  4P9P A;  3P30 A;  2WAM A;  1PM9 A;  3BPZ A;  3VQW A;  3OE7 G;  5BR8 O;  5FLX N;  1J5E B;  3T1H O;  1X59 A;  3RBZ A;  3B8M A;  3K08 A;  1KC8 W;  2IU0 A;  1VF6 A;  4PA7 A;  5B3S B;  3SJC C;  1XNQ B;  5B66 Z;  1K9M W;  1IBK B;  4XDJ A;  3FKS G;  1KEC A;  1MAB G;  3LUT B;  2IBZ H;  1KD1 W;  4DW0 A;  1QLE C;  5JCO A;  4GT1 A;  2YID A;  2Z0A A;  1YIT V;  2EZO A;  1M56 C;  2ZXW B;  4PDV A;  2XHB A;  4ZBM A;  4AQY B;  4B3T B;  4JAU A;  5LGT A;  4LR3 A;  4UV9 A;  2UU9 B;  1JVM A;  1Y76 B;  4JI1 O;  4X62 O;  4YY3 B;  1OCC C;  1F23 A;  3X2Q C;  5LYJ B;  4D7T A;  3H1L H;  1YTF B;  2WSS G;  4DR3 O;  3CP1 A;  1AP6 A;  4I5S A;  1DGS A;  1PL4 A;  3FB8 C;  1VEW A;  4J41 A;  1EN6 A;  1WJZ A;  2JVD A;  3ICX A;  5A2Q N;  3K06 A;  3B09 A;  2A0L A;  4CS3 A;  2KSD A;  4IGG A;  2PYJ A;  2ADP A;  3G67 A;  3JSN A;  1YTF D;  4AIL C;  2FKX A;  4PV1 B;  1XNQ O;  3H1J H;  1I0H A;  3M99 B;  3K58 A;  4TV9 A;  4R8C A;  1N0J A;  2AHY A;  5EC1 C;  3B4S A;  1GM9 A;  2DJV A;  2ZIM A;  1W59 A;  1M4U A;  4WFG A;  3M7M X;  2H8P C;  1SER A;  4HNA A;  2ZT9 B;  4JAA A;  5EZY A;  2OIE A;  1YIJ V;  3APO A;  3K03 A;  2Z3Y A;  3HKC A;  2K1E A;  2RJZ A;  2QM8 A;  2Y0I A;  5IJ0 B;  5LHH A;  1R3K C;  3OM3 B;  4X66 B;  2W0F C;  5KA6 A;  1FXV A;  3HR0 A;  3OTO B;  4JTD B;  4J7Z A;  1RPO A;  1ZL8 A;  3IC9 A;  1TUB B;  2HVJ C;  3RGB A;  1QCE A;  4OX9 O;  4I9W A;  5IE9 A;  2RN9 A;  4TOI A;  3HKB B;  5IYB O;  3OW2 U;  5KX5 B;  4RAI A;  2IM9 A;  5KHH A;  1OCO B;  4CC5 A;  2HR3 A;  1K73 W;  5KAI Z;  4X1I B;  2JJ2 G;  4X1K A;  3ZJZ A;  1AIL A;  3AG1 B;  3BA9 A;  1SES A;  1M57 C;  2ZM6 O;  1EZV H;  5KMG A;  1AI6 A;  4L8J A;  4ABM A;  2EIL B;  3FB6 C;  2FML A;  4P2Z A;  1FXK A;  2NR5 A;  1R73 A;  4JZG A;  4LC1 A;  1KKC A;  4DUZ B;  4J11 A;  1F51 A;  1SQV H;  4J80 A;  4HAM A;  4YJ3 A;  4ZI7 B;  5LP6 A;  1V9P A;  2GUZ B;  4GKK B;  2KB1 A;  3CJH B;  2UUC O;  4I9Q A;  5ITZ A;  1E79 G;  1TUE B;  2VRZ A;  4X66 O;  2W6I G;  1P84 F;  1K8A W;  2ZXW C;  4MW8 A;  2DYR B;  1AJP A;  3FD9 A;  2DMX A;  3G6E V;  2V1D A;  1ZSP A;  1B04 A;  4DR6 B;  2Q69 A;  4B08 A;  2ZR2 A;  2AGA A;  1ARO P;  4OPH A;  4CC6 A;  3E35 A;  2YS8 A;  2QDO A;  3JAT B;  4DO2 A;  4CH6 A;  4QGP A;  1UPG A;  2OIG A;  4GKJ O;  1GAX A;  2B1G A;  1IBM O;  2QEX V;  5JH7 A;  1M9N A;  4TSF G;  2CTP A;  1AVM A;  3JAL B;  4MTX A;  3U10 A;  1VQL V;  2OCC C;  3JAK B;  4HZ3 A;  4TT3 G;  5J9P C;  1OCZ B;  1AJN A;  2XTA A;  4JI5 B;  4X64 B;  3QO5 A;  1XRE A;  4QIW F;  4TUY A;  3B77 A;  5B1B B;  2VQE O;  1G8M A;  2GDS A;  4UCU A;  5HFM A;  4JYA O;  3ETD A;  3OR6 C;  2NNU A;  3K04 A;  1ZUQ A;  3P32 A;  2A79 B;  2DW4 A;  5LP6 C;  1WP7 A;  1PKX A;  2QSA A;  4LCU C;  2K9P A;  4H44 B;  3C90 A;  4MVQ A;  1ZTE A;  3N2G A;  4QJF B;  3GVM A;  2N04 A;  1W0J G;  1FJG B;  4J9Y B;  4PA6 A;  2EIN B;  2XAJ A;  3AG3 B;  4WCE V;  4LF7 B;  2FYU H;  3ETE A;  4TV8 B;  4MVS A;  1NR7 A;  1Z5V A;  2A9H A;  2MW2 B;  2A06 H;  3OGC C;  3CYO A;  3TXQ A;  2E5L B;  4NVP A;  1LNQ A;  1S0V A;  3N27 A;  3T4D A;  3HKD A;  5AG2 A;  4PDL A;  4JI3 O;  1UJW B;  3CCJ V;  3QVN A;  3RYF B;  4JI5 O;  3A0R A;  4DUY B;  3RYH B;  2F43 G;  1D5A A;  3W7X A;  1OCO C;  1ZLZ A;  1VAR A;  1Q8I A;  5CB4 A;  4FLW A;  3K9S A;  2QWR B;  2UXN A;  3C3T A;  2CE4 A;  4JTA B;  2XAQ A;  4WFH A;  4UCR A;  1WP8 A;  5H2F Z;  4U3J B;  2JK5 C;  3SPI A;  3CS5 A;  4DR4 O;  2H94 A;  5L3C A;  3F7Y C;  2UXX A;  5EBW C;  4O4I A;  1G6U A;  2ZQM A;  4J7J A;  1DTO A;  2YXL A;  1BQ0 A;  2P67 A;  5IYZ B;  1BCC H;  4CS4 A;  5CBG A;  3JD2 A;  2W0X A;  1LR1 A;  4LF7 O;  3JD0 A;  2EIJ C;  3STL C;  5IY5 C;  5LMU B;  1XHX A;  4GLX A;  2DWD C;  2C2A A;  1Y6X A;  1JX9 A;  2ZIO A;  2GBO A;  5EIB C;  1SA0 A;  1U97 A;  5J2T B;  2IU3 A;  4X65 B;  2E5L O;  2KKW A;  1VQ6 V;  4YIP A;  2EIK B;  1XL4 A;  4K0K B;  4JYB A;  3G71 V;  3AK3 A;  4DUY O;  1H8H G;  1MZF A;  1KKD A;  3ABM B;  4I4T B;  3ZRS A;  1TVK B;  4DV1 O;  4MTO A;  3AG4 B;  3O9O A;  4IYH A;  1PPJ H;  1N34 O;  1M90 W;  2P90 A;  1VQ7 V;  4AI8 A;  1OCZ C;  1YHQ V;  4GYC B;  4KHP B;  2X6C A;  1RP3 B;  4C7U A;  3S3X A;  2M6Y A;  5CMU A;  2BSK B;  2ADQ B;  4DV0 O;  3WG7 B;  5LMU O;  1RSO A;  3E8B A;  2UXC B;  1FFT B;  3HKE B;  3JSL A;  4FLT A;  2GV9 A;  2ZNJ A;  2X6A A;  4OPA A;  3K5O A;  4JI8 B;  3FB7 C;  1MNG A;  2QKA A;  2WA3 A;  4FZ1 A;  3J80 N;  4HBN A;  3BFR A;  1QBZ A;  1Y74 B;  4JI0 B;  2EUL A;  4R6Z A;  3B40 A;  1VQK V;  2KQX A;  5B5E Z;  2YDE A;  4O4L A;  3K0G A;  1NTZ H;  2Y4U A;  2YSU B;  1AP5 A;  2P06 A;  2ILM A;  4CH4 A;  4UB6 Z;  3K5M A;  3QTC A;  4MTF A;  2PTM A;  2HG5 C;  2XT9 A;  4B3S B;  3ZMT A;  3PN1 A;  4NYK A;  4B3R B;  2JS5 A;  2EX3 A;  4DR1 B;  1CEZ A;  4YJ2 A;  1SQX H;  1QLE B;  4TWK A;  3JAR B;  2UXC O;  1WAZ A;  3OEE G;  4WFA V;  3GB7 C;  4GX0 A;  5KUK A;  4LF6 B;  1VF5 B;  3SYC A;  1XL6 A;  4FMT A;  4DV6 B;  3SPC A;  1MA1 A;  2AW9 A;  2JEU A;  3LDD A;  1N36 B;  4LF9 B;  2DWE C;  2HHH O;  3ZMZ A;  1GMG A;  4ZOL A;  4Z1M G;  1YDX A;  1N33 B;  1MMM A;  1OCC B;  3X2Q B;  2FL4 A;  2ZE7 A;  1VQP V;  2DYS C;  1S77 D;  4PEL A;  4IT5 A;  3E89 A;  2R9I A;  3CCR V;  1B06 A;  1HWY A;  2EIK C;  2WLL A;  3AEI A;  3CC4 V;  1ZX3 A;  2QKC A;  4WFF A;  2CH7 A;  2P4V A;  1R6T A;  4CZZ A;  3LDC A;  5B1N A;  3E86 A;  1HNZ B;  3ZX6 A;  1HNX O;  2Q7E A;  3AG4 C;  4JV5 B;  4GZR B;  4WFB V;  2XAF A;  3HB3 B;  4J42 A;  5KUM A;  1N36 O;  4LF9 O;  4DK1 A;  3K59 A;  2E3C A;  4B3M B;  3I55 V;  1X4T A;  2PUS A;  3N2K A;  4MVO A;  4HYO A;  3ZHS A;  1N33 O;  3JD3 A;  1NS1 A;  2VS0 A;  4KL1 A;  4P30 A;  5K1X A;  3ZMS A;  4N23 A;  4LBE C;  4D6T H;  3CSX A;  2ARH A;  1JJ2 U;  4LFC O;  1NT2 B;  1JFF A;  1JR9 A;  4NTW A;  3E8H A;  4X1Y A;  4NTY A;  3C3S A;  4D7S A;  4I50 A;  4MS2 A;  2F66 C;  3CCV V;  4BIZ A;  3F5W C;  1M93 A;  1ZAU A;  1TGO A;  1LUW A;  2Z5U A;  3OMN B;  1I94 B;  1LUV A;  2E76 B;  4JF3 A;  1PV0 A;  1HNZ O;  2B5U A;  2HJD A;  4GX1 A;  4ZKI A;  1Q7Y W;  5BY1 A;  4JV5 O;  3UQ8 A;  1M57 B;  2QWQ B;  3R65 A;  5JQG A;  4JI4 B;  2YC0 A;  4TV9 B;  4DK0 A;  3J81 N;  3AG2 C;  5GTH Z;  3QO7 A;  3MHH C;  3P3N A;  4B3M O;  4NXM B;  4QE7 A;  2IH1 C;  2YIC A;  3VOU A;  5LA6 A;  4JGS A;  3UT5 A;  2HEP A;  3FAV A;  4PI2 A;  4ASU G;  1KMI Z;  4HNA B;  4ICG A;  3KKY A;  1AI5 A;  5EZY B;  3OUF A;  4CH3 A;  4UXN A;  4B7E A;  4LNU A;  4K8X A;  4FPP A;  1DLB A;  3TK1 A;  2UUB O;  3ZHQ A;  3HKC B;  3PJS K;  1GKF A;  1OV9 A;  5GON B;  5J2U A;  3JD4 A;  3OMI B;  3TCU A;  3LNM B;  2WWW A;  1ZL8 B;  3W7U A;  4K8Z A;  1QLN A;  1I94 O;  2LO1 A;  3OUS A;  1NJI W;  1E1Q G;  3ASO C;  3IGA C;  4F6E A;  3A8T A;  3SYO A;  4U3F H;  4LF8 B;  3OAA G;  1KYO F;  3Q4H A;  5JWP A;  3IAY A;  4NR1 A;  1J5E O;  4X1K B;  1YVW A;  2QM4 A;  3ABU A;  4FVM A;  4MVR A;  2OCC B;  2BTO A;  4BAY A;  5KMG B;  2DN9 A;  4MW3 A;  4FLY A;  3ZIA G;  1IBK O;  1YJW V;  3K3W A;  3H9V A;  1VF6 C;  1M1K W;  2BTQ A;  1S5L Z;  3O65 A;  3STZ C;  5DN6 G;  3BAA A;  5LP6 B;  1KUQ A;  3K5L A;  2UXB B;  4UFZ A;  5EYP A;  5JCO C;  1R6K A;  4PD4 F;  4AQY O;  4B3T O;  5ITZ B;  2EBO A;  2XUM A;  4OGQ B;  3UO2 A;  2UU9 O;  4UCT A;  4LFA B;  3BRC A;  1YJN V;  4YY3 O;  1H2L A;  2V7Q G;  1KP3 A;  4YXW G;  4U7O A;  3DSQ A;  4LF8 O;  4PA4 A;  2LP7 A;  2OYQ A;  1JPX A;  2WLM A;  5JJE B;  4FFB A;  4X9Q A;  1VP7 A;  5IYC O;  1EFR G;  3CMA V;  1FFX A;  3EXA A;  1BMF G;  4EKW A;  1WLE A;  4GCZ A;  3UO3 A;  2Q5Z A;  2X7R B;  5BMV A;  4QE9 A;  5LHI A;  3SPH A;  1SC5 B;  3ZRW B;  4J9Z B;  1MZE A;  4TUY B;  1Y76 A;  5IYD O;  1F4M A;  4UUJ C;  4FFK A;  1PD3 A;  3K57 A;  3BEH A;  3L73 H;  1YF2 A;  1IBL B;  1QR8 A;  4I7Z B;  4LFA O;  4JZ2 A;  1WA8 B;  1S3J A;  3RYC A;  2W6J G;  3N2G B;  2EIJ B;  5IY5 B;  2P5O A;  2DQ3 A;  4UCS A;  1IXM A;  4E4E A;  1BZK A;  4LF4 B;  4UB8 Z;  3OTO O;  5E79 Z;  1DK1 A;  3VQX A;  4PI0 A;  3ABK C;  3CE2 A;  4KFM A;  2QKS A;  2QM7 A;  2WLI B;  5HFL A;  3HKD B;  1R1B A;  1FS0 G;  1VMG A;  4EFE A;  3JAS A;  1ROP A;  3T1C A;  2YIB A;  5EIB D;  2D2C B;  3CCE V;  2CDY A;  2B1I A;  5CB4 B;  3ZHT A;  2JRI A;  1W0K G;  2PI5 A;  1Q5O A;  4DV7 B;  2R9A A;  5KA5 A;  4RWU A;  1IBL O;  4JPR A;  4BWA A;  4DUZ O;  4JYC A;  4GX2 A;  5IWA B;  3K9A A;  2XAG A;  3CC2 V;  3OMA B;  3T4Z A;  1PNL A;  1FXK C;  1IX9 A;  2KG7 A;  3RT3 C;  4O4I B;  2Q8V A;  3JAW A;  1URF A;  4GKK O;  2CTQ A;  2IH3 C;  1YJ9 V;  3BY6 A;  5JJJ B;  2GTA A;  2R70 A;  1SQB H;  4LF4 O;  3APQ A;  4H0L B;  1R3J C;  3IC7 A;  3R66 A;  3OTF A;  4X1I A;  3CD6 V;  4PA9 A;  4EFB A;  1O9G A;  1MSW D;  1XUQ A;  4BIO A;  3FX7 A;  4DR6 O;  1Q3E A;  1SZX A;  4EEQ A;  1FXH A;  1VQ8 V;  4DRX A;  1CP9 A;  1XMO B;  2JGD A;  1BHB A;  4W4L A;  2E74 B;  4YIO A;  2PGG A;  4ZI7 A;  4IIJ A;  4K35 A;  3UKM A;  2EIM C;  4FM2 A;  1Z2G A;  1XHZ A;  2WLH A;  1EZJ A;  5LL6 Y;  4ZHQ A;  3CRM A;  4X64 O;  2IW5 A;  4R7C A;  4I55 A;  2ZE5 A;  3ZN1 A;  2ODM A;  4IYI A;  2A7W A;  3CRR A;  3CCL V;  4XDK A;  5D5P A;  1VQO V;  4QNH B;  5L3E A;  2F4V B;  4X88 A;  2Q0A A;  3AG7 A;  1N32 B;  2VWJ A;  3JYC A;  1N0N A;  5LGU A;  1RSO B;  2GHY A;  2X6B A;  2XND G;  2ATK C;  1XEQ A;  3F5T A;  1FPO A;  2YI8 A;  3QNE A;  1XIL A;  1ZWI C;  2QGN A;  1FJG O;  3SDL A;  5KLV H;  2Y0P A;  2OTJ V;  2RCV A;  2HJF C;  5EBL C;  4XBF A;  2YXY A;  3JAL A;  4IL6 Z;  1XMO O;  3ZHV A;  2HLD G;  1EM1 A;  2DYS B;  1NQT A;  3T1Y B;  3CHX A;  4GX5 A;  4O4L B;  3H1K H;  1US6 A;  5K1P A;  4JAS A;  5L3F A;  1Q6U A;  2ITC C;  3LSS A;  1QVF U;  1YCI A;  1QQC A;  1SET A;  1KBH A;  1SQQ H;  4RO2 A;  4MVM A;  4IHJ A;  1Q6I A;  4UVA A;  2RMK B;  1KB9 F;  2G38 A;  2LW7 A;  5FPR A;  5H5N A;  4YJ2 B;  4N21 A;  3WB1 A;  5KHI A;  1RM1 B;  1NTK H;  1CXZ B;  1GK9 A;  2VQF B;  4DV3 B;  1U96 A;  3W7W A;  1OCR C;  2LQT A;  2CUG A;  2YI9 A;  1NBM G;  2ZE6 A;  2EJ7 A;  5DM6 V;  1M5I A;  2UUA B;  5JJN B;  3RYF A;  3NR7 A;  3ZMU A;  3DXR A;  1ENV A;  2RNB A;  3T1Y O;  5GW7 A;  4MT8 A;  4X65 O;  1L8D A;  4O4H B;  2XAH A;  2ZDI A;  2ZCE A;  1YI2 V;  3FFQ A;  2PI4 A;  1V54 C;  1BGY H;  1JJO A;  4K0K O;  3WFV A;  1WPX A;  4U3J A;  3CCM V;  2YIA A;  2WLL B;  4YHH B;  5H6R A;  2LFR A;  1I5X A;  1P4R A;  3E22 A;  5DEC A;  3HPL C;  4DW1 A;  4FLV A;  2CH7 B;  2HFE C;  3MHS C;  1I7F A;  3U11 A;  3NXS A;  1WB8 A;  3AG2 B;  1THZ A;  5JVD B;  3W7T A;  1YEW A;  4DV3 O;  4NXN B;  4KHP O;  2YEV A;  3KG2 A;  4I0X A;  1GO3 F;  4MVU A;  2JDI G;  2UUA O;  4W4K A;  2RDC A;  3N2K B;  4Z2W A;  4JI8 O;  4I4T A;  5BZB A;  2ZKO A;  1V55 C;  1L0L H;  3ZRX A;  1B3Q A;  4O2A B;  3G4S V;  4G2K A;  1JFF B;  3A0B Z;  3B8N A;  4JI0 O;  1XDC A;  1GN2 A;  2N05 A;  1CPY A;  3KCY A;  3OT7 A;  4X1Y B;  4BW5 A;  4YHH O;  1VQM V;  4MSW C;  3G6B A;  1NH2 B;  3JCU Z;  5LXT A;  3ASO B;  4UVB A;  4EB6 A;  4PDR A;  5CA3 A;  4DR5 B;  5B1O A;  4JYY A;  1WN7 A;  1NTM H;  2XOK G;  4B7K A;  2F23 A;  4JI2 B;  2WLK A;  3ZMV A;  1NU1 H;  1NI8 A;  5JQG B;  4NXN O;  5L3D A;  4FK5 C;  2OWO A;  4NKG B;  4B3S O;  2IJJ A;  3I5D A;  4B3R O;  4DR2 B;  4DR1 O;  2P22 C;  3RVZ A;  5B1A C;  3RFR A;  1HP8 A;  1QHT A;  3D3Q A;  3UT5 B;  4LF6 O;  3FAV B;  3H01 A;  4DV6 O;  2XAS A;  1RM1 C;  3CXH F;  4LNU B;  4KXR A;  1XNR B;  1YSC A;  4FIP C;  2BE3 A;  5KHG A;  3CRQ A;  1GN3 A;  4O2B A;  2F93 B;  1AR4 A;  4O4J A;  3L72 H;  5J2U B;  1P7B A;  3RVY A;  3TJT A;  1SQF A;  1K5Q A;  3T1H B;  1SZT A;  4PJ0 Z;  1NZ6 A;  3E2E A;  1XI1 A;  3SJQ C;  2ZIN A;  2Q4P A;  3SR2 C;  2CGO A;  2VWK A;  3SJB C;  5FNV A;  1G1X B;  2QWN B;  3DGE A;  2LW1 A;  4RQF A;  5IT9 N;  5KHJ A;  3B2E E;  1K4C C;  2AHZ A;  2V4D A;  4G27 B;  3CRA A;  3F7V C;  4DR2 O;  2IJK A;  1GTO A;  3BAB A;  3K79 A;  3DC5 A;  2GTS A;  4F6R A;  1Q81 W;  1AI4 A;  3VBB A;  5C8Y A;  2BTQ B;  2F1M A;  1SQP H;  1IUR A;  2Q73 A;  1JQ0 A;  5L3B A;  3SPJ A;  4JAV A;  4JI1 B;  2O57 A;  4BR6 A;  5LGN A;  1XNR O;  2UXD B;  1Q6H A;  5EYP B;  1Y66 A;  3CCU V;  4FLU A;  1FKA O;  1K4D C;  4DR3 B;  2HVK C;  1H2N A;  3ZED A;  2Q9L A;  3E8F A;  2L35 A;  4FJC C;  4CS2 A;  1P49 A;  2QJ1 A;  3JCZ A;  2NLJ C;  3ABK B;  3IJ4 A;  1MOF A;  4FFB B;  1OJH A;  3RYI A;  1R6N A;  2Q68 A;  1FFX B;  4X20 A;  1KQS U;  3ABT A;  2OTL V;  5BMV B;  3SJA C;  3KCX A;  4FM1 A;  4JI4 O;  4H13 B;  1BQZ A;  1MG1 A;  2IJI A;  2JJ1 G;  4GUN A;  4Z1V A;  1GM8 A;  5H6Q A;  4WBN A;  2N74 A;  3CEI A;  1SF9 A;  2UXD O;  4X8A A;  1SRY A;  4NXM O;  2ZNI A;  3IFX A;  4PHZ A;  1AI7 A;  1FXK B;  1VQ9 V;  5CA1 A;  1JA8 A;  3L71 H;  5LOV A;  1Q82 W;  2ZD9 A;  1H2M A;  4LH7 A;  4LWS A;  1J95 A;  4YJ3 B;  5CA0 A;  3RYC B;  3W7S A;  5IJ9 A;  4OX9 B;  3EVK A;  2DOS A;  4A5U B;  2F95 B;  2WLJ A;  1H2S B;  1NR1 A;  3RW0 A;  1FAF A;  4XDL A;  1PL0 A;  1UFI A;  2ZM6 B;  4DYL A;  1EN4 A;  3OGI B;  3OFN G;  3ZN0 A;  3JAS B;  4LH6 A;  3ABL B;  5LMN B;  2EIM B;  1GM7 A;  3SYA A;  3UM7 A;  3LDE A;  3ZRV A;  1K33 A;  1WB7 A;  5JH7 B;  3K5N A;  1FD9 A;  1YZB A;  2UUC B;  1Q86 W;  4WF9 V;  3ASN B;  5GON A;  1BL8 A;  2YIB D;  2H3O A;  3CME V;  2KG7 B;  1F4N A;  2UXB O;  3JAW B;  5LYJ A;  3D3I A;  1AJQ A;  4G28 B;  2PYL A;  1PNM A;  3CB2 A;  3ETQ A;  3THO A;  1PNK A;  1DF4 A;  3P3P A;  5A9G A;  4WFE A;  1QNM A;  1JMK C;  1K97 A; 
#chains in the Genus database with same CATH homology
 1KUQ A;  4LF5 O;  2VQE O;  2UXC O;  5IWA O;  4AQY O;  4JYA O;  1FJG O;  4B3T O;  3SDL A;  2N74 A;  4DUY O;  4OX9 O;  2UXD O;  1HNZ O;  5LMN O;  2UU9 O;  4NXM O;  2JRI A;  1XMO O;  5BY1 A;  4JV5 O;  4YY3 O;  4DV3 O;  2HHH O;  4KHP O;  4LFB O;  1HNW O;  3J7A U;  2Z0A A;  4DV1 O;  4DUZ O;  1IBL O;  1FYJ A;  3J81 N;  4DV5 O;  1N34 O;  1AIL A;  2UUA O;  4LF8 O;  1G1X B;  5IT9 N;  4B3M O;  3RT3 C;  2ZM6 O;  4GKK O;  4JI1 O;  4X62 O;  4JI8 O;  2DOS A;  4A5U B;  4DR2 O;  4JI7 O;  4DR7 O;  4LF4 O;  3M8A A;  2ZKO A;  1D2D A;  4DR5 O;  2VQF O;  3R66 A;  4DR3 O;  4DV0 O;  5LMU O;  4JI0 O;  2UUB O;  4JI3 O;  1HR0 O;  4YHH O;  4OPA A;  1R6T A;  2LW7 A;  4JI2 O;  4JI5 O;  4DR6 O;  5H5N A;  2UUC O;  1XNR O;  5A2Q N;  5BXZ A;  4DV2 O;  3J80 N;  4X66 O;  1HNX O;  2FKX A;  1XNQ O;  1I94 O;  1FKA O;  4DV4 O;  1XMQ O;  1YZB A;  4LFA O;  1N36 O;  4LF9 O;  2F4V O;  4NXN O;  4DR4 O;  3T1Y O;  2AGA A;  4OPH A;  1J5E O;  1N32 O;  4B3S O;  2DJV A;  5LL6 Y;  4X64 O;  4X65 O;  4B3R O;  1N33 O;  1NS1 A;  1F7Y A;  4DR1 O;  3JAM N;  2UXB O;  4GKJ O;  4LF7 O;  3OTO O;  4JI6 O;  1IBM O;  4LF6 O;  1DK1 A;  4K0K O;  4LFC O;  4DV6 O;  1IBK O;  5BR8 O;  5FLX N;  3T1H O;  1X59 A;  1R1B A;  2E5L O;  3O65 A;  4DV7 O;  1AB3 A;  1A32 A;  1XEQ A;  3F5T A;  4JI4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...