1HNZO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnzO00
2JRIA 2ZM6O 1XEQA 1R6TA 4YHHO 4JI1O 4DUYO 1IBKO 1IBLO 2UXCO 4JI7O 4JV5O 2LW7A 4JYAO 5LMNO 4DV2O 2UXDO 2UXBO 1YZBA 4X64O 4JI2O 4GKJO 3J80N 4JI5O 1N34O 2Z0AA 4DV5O 5IWAO 5IT9N 3J81N 4JI3O 1HNXO 4JI6O 1AB3A 4DR6O 1DK1A 4NXNO 2UUCO 4X66O 5BY1A 4JI4O 1HR0O 4NXMO 1FJGO 1HNZO 3F5TA 5A2QN 4OX9O 1R1BA 1NS1A 1N33O 4LFBO 4DR1O 1FYJA 4DV7O 4LFAO 4DR5O 1G1XB 4DV6O 3JAMN 4OPAA 5BR8O 1N36O 4B3TO 4B3RO 1A32A 4DR3O 3M8AA 3SDLA 4DUZO 1AILA 2AGAA 4B3MO 4DV4O 4LFCO 4LF8O 4DR7O 1KUQA 4X65O 4X62O 3J7AU 1XMOO 1N32O 4A5UB 2DOSA 2UUAO 2FKXA 4K0KO 4KHPO 2UU9O 5H5NA 1HNWO 4DV3O 3OTOO 1X59A 4DV1O 2ZKOA 3T1YO 3R66A 4DR2O 5FLXN 2UUBO 4GKKO 4LF5O 2DJVA 4YY3O 4JI0O 4LF9O 4DR4O 1IBMO 2E5LO 4DV0O 3O65A 4B3SO 1XMQO 4LF4O 2VQEO 4OPHA 4LF7O 5LL6Y 5LMUO 1FKAO 1D2DA 4JI8O 2F4VO 3RT3C 2HHHO 1XNRO 1I94O 1F7YA 4LF6O 4AQYO 3T1HO 2VQFO 2N74A 5BXZA 1J5EO 1XNQO
chains in the Genus database with same CATH superfamily
3KG2A 3UO3A 2AHYA 1N34B 3ABLB 3DTUB 3BHPA 4O4JA 2FTKA 4DUYO 1IBKO 2BOBC 5KHKA 3QNEA 1GM8A 3EFFK 1YXBA 4I4TB 2HVJC 5KA5A 5KAIZ 3HKEA 1FPOA 2HR3A 3E35A 3J81N 1QLEC 4X9QA 4LR3A 1PNLA 4JI5B 4LFAB 3CS5A 4WFAV 2W0FC 4UFZA 3A0RA 2HP8A 2NR5A 2JIZG 5BY1A 3G80A 1SZTA 1THZA 3CC2V 1D5NA 2AZ2A 4LFCB 4OX9O 2H94A 4TV8A 3APOA 2KB1A 1OJHA 2ADPA 4X1YA 2ZE5A 4O4LB 3CCEV 1KKCA 1PL0A 4PA9A 3VQXA 3HKBB 2P6JA 2IU0A 3OEEG 4X65O 1EN5A 3EVKA 3TGUH 1URFA 4YY3B 2P5OA 4Q20A 4O2AA 3T4ZA 2IM9A 2R9IA 1CPYA 3TJTA 1M5IA 4YJ2A 3EXAA 1R3LC 3ZIAG 2F4VB 2A06H 2FL4A 4GX2A 2XAHA 4HZ3A 2DWEC 2EULA 3ZRXA 2DE0X 1EFRG 1WP7A 3HKCB 3ZMUA 4MTOA 2WLLA 3LDDA 4MT8A 1I94O 3DC5A 1OHHG 2HJDA 4JTAB 3T4DA 3B09A 1AR5A 3BA9A 3ZN1A 2XUMA 4JI1O 1L1FA 2EJ7A 1LUVA 4JI5O 2EILB 3STZC 2QM4A 1OCRC 5J2UB 4MTFA 4O4IA 3WG7B 1NTZH 1VF6A 3TETA 1R3KC 1RP3B 4PDLA 1Y76A 1TGOA 5B66Z 2ZIMA 2ITDC 2P06A 3UQ8A 3JCUZ 1HP8A 1ZTEA 1IZ3A 1NH2D 3H1IH 4B7EA 1NU1H 1FS0G 2YS8A 3D8CA 1S5JA 3B2EE 4J9ZB 3P32A 1GN6A 5KUMA 1V55C 2DMXA 1EZVH 3C3SA 3OTOB 4DR2B 1P7BA 1MMMA 2Q9LA 4P9OA 4A5UB 4JI0B 1COWG 3AG3B 1V9PA 4BWAA 4PELA 3RGBA 4F6RA 5IE9A 2Y4UA 3H1KH 3B4SA 5CA0B 4K35A 4NKGB 1MNGA 2JGDA 1WA8B 2F95B 1UJWB 1BHBA 1KYOF 1EM1A 1NTKH 1FXHA 1IXBA 5LL6Y 2PGGA 3IFXA 2YEVB 1VQMV 2WLJA 2FB5A 5DECA 2VQFO 4O4HB 2UXDB 2R9RB 1J5EO 1SQVH 1P7GA 1KC8W 1VQ6V 2F43G 2EIMC 2JK5C 1Q43A 2P4VA 2CTRA 4DV2O 4I50A 3NR7A 4MVOA 4X64O 3ZHVA 5IDJA 2GHYA 1HR0B 4JI7B 3AG2B 4FM1A 2ZXWB 4LFBB 2PYLA 2R72A 1B3QA 3OUFA 1KMIZ 1SQGA 2XHBA 2UUCO 1AP5A 2ZINA 4FFKA 3VQWA 1BQZA 4EB6B 4R50A 5KUKA 5JH7B 3CRCA 1YF2A 2CDYA 1N33O 1N0NA 2IJKA 4UCVA 5GTHZ 3L72H 5L3CA 3ABMB 4CS2A 1G1XB 1GO3F 1QBZA 4OPAA 2EX3A 2DQ0A 1SC5B 1WB8A 4U3JB 1ZWIC 1K73W 4WFGA 3E8FA 4UB8Z 5EZYA 2HJFC 3G6BA 4G27B 4B3TB 3ZMVA 2DOSA 3BVOA 2FKXA 2ZR2A 1AROP 2NN4A 2JVDA 3TXQA 1FFXA 3W7TA 2ZKOA 3MHSC 3U11A 3JASB 1WPXA 2X0LA 3LDEA 2DJVA 5DM6V 1X4TA 2JJ2G 2UUBB 1BGYH 5KAFZ 1GK9A 1F23A 2AXTZ 3E8GA 4TOIA 4EFEA 4DR4B 4OGQB 2EIKC 4TSFG 4JV5B 2ARHA 5LYJB 1K4CC 1XNQO 1M90W 5EC1C 3STLC 4ZKIA 1BS3A 4FFBB 4J41A 4JI7O 1GRJA 1OZ0A 1Y74A 1GM9A 4QIWF 4WBNB 4MVZA 1S76D 3H1LH 3HPLC 5EBLC 1NR1A 2LQTA 3CD6V 1R6NA 1DGSA 5LGNA 2Y0IA 1SESA 1YEWA 3QVNA 1FJGO 5ITZA 5J9PC 1R1BA 2P90A 3C90A 3SR2C 1I7FA 5JVDB 2GDSA 1ZL8A 1LUWA 3JARB 1ZSPA 1H8EG 4HNAA 2UUAB 4B3TO 1JVMA 3JAKB 2K9PA 4N21A 4DV7B 4J11A 4UVCA 2JS5A 4PV1B 3O9OA 3L74H 3JD4A 2ZDIC 4NTXA 2EIJC 1QHTA 2LFSA 1EZJA 1US6A 3HKDA 3QO5A 1XMQB 4KHPO 3FX7A 3ASNC 1K3EA 3ASOC 5C8YA 4JF3A 2A79B 3ZHUA 5FLXN 2UUBO 3P3PA 1IDSA 2V4DA 4YIPA 4DR4O 1RFYA 4FLYA 3O65A 1BSMA 3K5MA 4GT1A 1NJIW 2GBOA 1XNRO 3JAWA 1QLEB 1ZX3A 3K5OA 4L8JA 4LF6O 4JYAB 5EC2C 1M9NA 3DXRB 1VQ9V 4YJ3A 2VS0A 4K8ZA 3RVZA 3UT5B 5BMVA 1M4UA 1K5QA 1K4DC 3ZCCA 1GTOA 4MTXA 2LFRA 1AI6A 4GKJO 4O2BA 4X1KA 1Q8IA 1K9MW 3OMAB 5J2TB 1E1QG 5KX5A 4JI3O 1AP6A 1GAXA 4WCEV 3BCCH 5IWAB 3RYCB 1VQKV 4DR3B 4JI6B 3CRMA 3U10A 5JH7A 4K8XA 4J80A 3OT7A 1PNMA 1VF7A 2WAMA 4DV7O 1XMOB 1K8AW 1H2NA 3CMEV 2ATKC 1W0KG 3SJQC 2Q69A 2PY5A 2LJ2A 2UU9B 4U3JA 4PHZA 1WPBA 5E1AC 1ENVA 1YSCA 3ZS8C 2GUZA 4N23A 3JATA 3ZMTA 1KUQA 4NB5A 5LGUA 3QTCA 2HVKC 1AI5A 4FM0A 3CHXA 4PA6A 5H5NA 5FNVB 4LF4B 1YVWA 4AILC 5F2VO 2Q7EA 4DV3O 1KD1W 3A8TA 1N8RW 3VBBA 1VQ8V 3IGAC 4XDJA 3SJCC 1SQFA 1YIJV 1OCOC 1K92A 1XL4A 2OIEA 4DV0O 2E3CA 2QGNA 4JTCB 2LGQA 3IC7A 2ZT9B 1D2DA 4JASA 4EFBA 4ZI7B 4LF7B 2UXBB 1HW7A 3ZRWA 4CH5A 3JCZA 2LW1A 3ZMSA 2RMKB 4ZOLA 4KP4A 4WFBV 1VIBA 3RYFA 5B1BC 1M56C 2V1DA 3CX5F 4NTWA 5HFLA 1H2GA 2QEXV 5CA1A 1RM1C 4JI2O 4NXNB 5LP6C 2EZOA 2A9HA 1YJ9V 1L0LH 1Z5VA 2UXCB 1S77D 5IWAO 3ETQA 1TUBA 3MAQA 1VQLV 1HWYA 4D7SA 1YTFB 4JI6O 4QPJA 3Q4HA 3WB1A 2QKAA 4UV8A 3F5WC 3N2GB 4JYYA 2DYRB 2PUSA 2N04A 3I56V 2RDCA 5LP6A 2WA3A 4DK0A 4NXMO 1J95A 3BABA 4B3MB 4GUNA 4IHJA 2QM7A 2QJ1A 2JEUA 4MTGA 1YJNV 1WB7A 4X62B 2BCCH 1M57C 2YIBA 3HB3B 4MVMA 3JAKA 1QR9A 1A32A 5JJEB 4AHCA 4QNHB 3W7SA 1JFFB 2AGAA 5LA6B 1PP9H 4FLXA 4TWKA 1I5XA 4LBEC 3SPHA 4UCUA 1IX9A 1VP7A 2OCCB 1VQOV 3CPWU 2JJ1G 4ZHQA 2KQXA 3FKSG 4FLVA 4BIOA 1NBMG 1I5YA 3FAVA 4B3SB 5LOVA 1SA0A 3AG4C 4UCOA 3JALA 2VWJA 4P30A 4LF9O 3CJHB 5LXTA 4X1IB 1AJQA 4L87A 4LF7O 2DWDC 3FB7C 3P3NA 1IBLB 3OM3B 2QDOA 1F7YA 3CC4V 3T1HO 4EEQA 2LP7A 4BW9A 2BTQA 3DXRA 3KKYA 4PI2A 2RNBA 2Y69B 3B40A 2YC0A 2UXCO 3L9DA 2LW7A 4X20A 4OXSA 3KCYA 3L71H 5HFMA 4MVQA 1XREA 1YDXA 3BEHA 2JEXA 3QF7A 3APQA 4GLXA 1N34O 4CC5A 1Y4MA 3E22B 2KSDA 4G28B 1V54C 1ZUQA 3BFRA 3CCLV 3MHHC 4FK5C 2A7WA 4CH3A 5BR8B 2P22C 1VF6C 1IVSA 2XAFA 3AK2A 1FXKB 4UXNA 1CEZA 3UCSC 2RN9A 2OCHA 4U3FH 4LFAO 4NTYA 3K04A 2PTMA 4R6ZA 2CH7A 2CAZC 1QCEA 5GONB 5L3BA 2WLHA 3DC6A 5EIBD 5B1AB 4LFCO 3T1CA 1NTMH 4F4LA 2R9AA 2IH3C 1B06A 4TV9A 3CRRA 1S72V 3ZMZA 4RQEA 3UO2A 5B5EZ 2CGNA 1P84F 3ZHQA 2HFEC 4DRXB 1PKXA 1S0VA 1BQ0A 1Q82W 2WLIB 4FVMA 4YY3O 1SKVA 2V7QG 3ZRVA 4JAVA 5CB4A 1BE3H 2QKSA 2F4VO 5L3GA 2CGOA 4CS3A 3AG1C 4CH6A 2ZD9A 2D2CB 4IGGA 2Q0OC 5IYZA 2L6LA 3K08A 1R3IC 2XTAA 2YXYA 4KL1A 4DV5B 2P7TC 5IJ0A 5CBHA 1SZXA 3CC7V 4I0XB 1F51A 3ABLC 4DXWA 3OR6C 2ZM6B 4IIJB 3QG5A 1RSOA 3E83A 3OW2U 2QWNB 2ITCC 2E74B 2QKCA 4UVBA 5L3DA 2QWQB 4QE9A 2NLJC 3L75H 1DK1A 5B3SB 2YDEA 5KHJA 1N36B 2G38A 1XUQA 1MABG 5A2QN 3G4SV 1GKFA 3FYEB 2YIBD 2AW9A 5B1NA 1Q90D 2Y48A 4I4TA 4IYIA 2QA4V 4GX0A 3X2QB 5LHGA 5KMGB 2EINB 4WF9V 3B8MA 4ASUG 4RUFA 2WA4A 5DEDA 1MOFA 2DYSB 2YXLA 4GKKB 3NXSA 4LWSB 3ABKB 4E2LA 1QLNA 2XT9A 2E5LB 5K1PA 1R3JC 2B9ZA 1H2KA 3CXCU 1OCZB 4DO2A 1PL4A 3OTOO 3AG7A 1OCCB 5IYBO 4X89A 3R66A 4DR2O 1IXMA 4DK1A 4O4LA 5IJ9B 1BHAA 4AQYB 1S3JA 3HKBA 4JI0O 4JAUA 1K5SA 1WLEA 3RT3C 1GN2A 4FLWA 4LNUB 2QTOA 3ABTA 1PNKA 1G8MA 2WLKA 3F7YC 5JCOC 2BE3A 2RJZA 2ZM6O 4RUEA 1YCIA 3G6EV 1DF5A 1R6TA 3CE2A 3CSXA 2IU3A 3ZHRA 4WFEA 2A0LA 3OMNB 4XDKA 2Q67A 1XL6A 3HKCA 3QO7A 2UXDO 2KG7B 1YZBA 4DR6B 1MA1A 2YIAA 5JCOA 2WWWA 5CBGA 2BSKB 3JD3A 3BAAA 2EILC 3CRAA 1Q81W 1SQQH 1OV9A 2B1GA 5A9GA 3SPGA 4DR5B 2ZE7A 3WG7C 1UFIA 4WFHA 3CCJV 1L0NH 4FJCC 1HR0O 1HNXB 1BMFG 1VQ4V 2Q8VA 1VQNV 4LFBO 1AI7A 3K59A 1N32B 3FFQA 5J2UA 1SS3A 3JAMN 5KLVH 4QPKA 3GWOA 2BOCC 2CTPA 4RQFA 3G71V 3K5LA 3HR0A 3T1YB 5BZBA 1Q7YW 1GMGA 5KA6A 4I55B 4FM2A 3VQVA 2R70A 5EYPB 2OWOA 4LF5B 1VF5B 2Q7GA 1PD3A 1XQ8A 5FL7G 1R6KA 3DGEA 2W6IG 4IT5A 3CCSV 3AG3C 3M99B 1B6QA 3G67A 1M56B 1KP3A 3LNNA 3ETDA 3S3XA 4O4JB 4QE7A 3N2KB 1PM9A 3B77A 1WNSA 2IBZH 2GTAA 3E8HA 1FKAO 4JZGA 3K58A 1IBMB 4PA4A 1SRYA 4DW1A 3K9SA 2E75B 1O9GA 3HKEB 5LMNB 1P4RA 5BXZA 4PD4F 5CA0A 1QQCA 1EN4A 5IY5C 2WLMA 1WA8A 2Y0PA 4TT3G 3F7VC 4J10A 1AVMA 3JD2A 1MG1A 4JV5O 3FB6C 3ZEDA 2LGWA 4X66B 2YEVA 4TV8B 1PV0A 2YI9A 1YTFD 2XAQA 1JJOA 1HNZB 4O4HA 4X1YB 1S5LZ 3AG2C 1HNXO 3H1JH 3CWBH 2ZXWC 5DN6G 4I5SA 1W2BU 4HYOA 1VEWA 1NVPB 4B3RB 2QM8A 3EHBB 4KUMA 2EJRA 5D5PA 4O2AB 2GSMB 1HDJA 4LF8B 1VMGA 3K3WA 4DR7B 3OTFA 4YJ2B 4QJFB 1CP9A 2JS3A 4K0KB 3ABMC 4Q6GA 4U7NA 4DV1B 2RQ6A 2XNDG 3ZN0A 4EB6A 2CE4A 1M1KW 2HEPA 3CCVV 4DUZB 1Z2GA 3FD9A 2WLLB 2UUAO 3I5DA 5GW7A 1WJZA 1TA8A 5EIBC 1BL8A 4FZ0A 4BW5A 4JI8B 1X59A 3WFVA 3CYOA 2M7WA 3TXSA 4Z1VA 4K3AA 1W0JG 3VOUA 1QVGU 1IBMO 3R65A 2QWRB 4ABMA 4H13B 1XMQO 2Z3YA 4G2KA 2RCVA 1ZAUA 4DUYB 1IBKB 1AR4A 1XDCA 2QTSA 5H2FZ 2VQEB 3VQYA 5LMUB 1KU9A 4O4IB 2HHHB 2JRIA 3AK3A 3UKMA 1KQSU 3JASA 1XEQA 4NR1A 1KBHA 4FLTA 1Y76B 5CA3A 5LBQA 4JYAO 3LDCA 3SYCA 1OCRB 2ZR3A 3BY6A 2ZNJA 2PI4A 1Y67A 5LYJA 4OX9B 5IYCO 4J7ZA 4EKWA 2Y4TA 1F4NA 4MS2A 1ROPA 1NZ6A 2OTLV 4FFBA 2Q0AA 2YUAA 1TVKB 1D5AA 2VWKA 3F5TA 1H2SB 2A3QA 2QWOB 3K0DA 5EBMC 3QO8A 4WBNA 1SERA 4X65B 5CMUA 4JI4B 4F6RB 5LHHA 4HBNA 1V55B 4GZRB 2NNUA 4BR6A 2JGDB 4DR1B 4DR3O 4DUZO 1K97A 1SQBH 3LSUA 3LNMB 1XMOO 2AZ0A 3RW0A 1QU7A 2ETNA 3ZRSA 2H8PC 1JCHA 3RWRD 2QWPB 3GVMA 5JVDA 4W4LA 2UU9O 3JSLA 4LH7A 5JJJB 1JR9A 5LHIA 5FPOA 3JARA 3RYIB 2PI5A 4I9WA 1I94B 1Q6IA 3FB8C 3GWKC 1K7DA 3ZBHA 1QNMA 1VQ7V 1DTOA 3N2KA 4MVUA 3W7WA 2VRZA 1YHQV 4LF4O 2VQEO 1P49A 5LMUO 4I50B 3T2MA 3A0HZ 4C7UA 2HHHO 4JI1B 3E89A 3LUTB 2N74A 1KECA 2EIMB 2ZE8A 2FMLA 2YICA 4P2ZA 3TCUA 1R73A 3CB2A 1S5HC 4HAMA 1SQPH 2GTSA 1Q86W 4CH4A 1H38A 3LSQA 1Y6XA 2UXBO 2ZCEA 2ZIOA 2C2AA 3ETGA 1XHZA 1W59A 3IJ4A 4LC1A 4B08A 4B7KA 4JYBA 3K03A 4ICGA 3H9VA 2MK3A 4FPPA 2KKWA 2PYJA 4XDLA 4NXNO 5EZYB 3UT5A 2W0XA 1M93A 2HG5C 4JI4O 1JQ0A 2YXHA 3RN4A 3OFNG 4F6EA 4TQDA 2IW5A 1Q6UA 2QSAA 3JSNA 1N4CA 4DR1O 4Z2WA 3SPCA 3E2EA 1FFXB 2IJIA 2HKOA 5J2TA 4J7JA 3W7UA 4CS4A 1VARA 3ICXA 3PJSK 1UPGA 2DW4A 1LNQA 3AEIA 3CMAV 4B3MO 1NQTA 2QE7G 1GN4A 4DV6B 3RYCA 3E86A 4X62O 3RYHB 4BAYA 4DW0A 1QR8A 4GCZA 1I08A 4H37A 2BTOA 5GTIZ 4DYLA 3AK1A 2VQFB 2F1MA 3OMIB 2ODMA 1NKDA 2OIGA 2UXXA 1J5EB 4B3SO 4P9PA 3THOA 5C93A 2EIKB 4UCSA 1JMKC 4ZBMA 1Y74B 4R7CA 1FAFA 2CUGA 3FYIB 5FNVA 4DV2B 2LO1A 5KHGA 2PF4E 1E79G 4X64B 2DN9A 2F66C 4FIPC 2XOKG 1FFTB 2F93B 3P30A 1MZEA 5TISZ 2Q73A 1XHXA 4JZ2A 1IBLO 4FLZA 2Q68A 5ITZB 4BIUA 2UUCB 4X88A 1ZL8B 1O9HA 2IJHA 1AJNA 4ZI7A 4HNAB 1K33A 4AI8A 1N33B 4X8AA 1PPJH 4TUYB 1AB3A 3MDSA 3N27A 2K1EA 4W4KA 2B5UA 4YIOA 1TVKA 2DYRC 1BCCH 1XOUA 4TQFA 2EBOA 4MSWC 4MVRA 3HKDB 4I9QA 3B8NA 2MW2B 1TUEB 3RBZA 1AI4A 2YSUB 2IH1C 1MZFA 2XAGA 3MD0A 5C8YB 4DV6O 3PN1A 5H6QA 5BR8O 4LP8A 3C3TA 1YI2V 4CBCA 4H33A 2O57A 1AILA 3N2GA 2EIJB 3SGIA 5EBWC 1WP8A 3CCQV 2CTQA 3ASNB 1Z5WA 1H2MA 3JAWB 3ASOB 4CZZA 3OGCC 3BA8A 2OCCC 3UM7A 3WU2Z 5IY5B 1GM7A 5JQGB 2P67A 4JYCA 3RYIA 4UCTA 3L73H 2OT5A 4YJ3B 3WB0A 1KKDA 4JAAA 5BMVB 1JFFA 4PDRA 4WFFA 5LA6A 1XNQB 2WPDG 3H1HH 2Z5UA 2W6JG 1U97A 3K57A 1RPOA 4O2BB 1G6UA 4X1KB 4PJ0Z 1GN3A 2EZPA 4D7TA 4ZIBA 5KX5B 3IAYA 3JD0A 4UVAA 5L3FA 3L70H 2ADQB 4GX1A 1FD9A 3K06A 3SYAA 3ZHSA 3CCUV 3CJHA 4X1IA 5H6RA 5KHIA 1RPRA 2Y69C 1JJ2U 2UXNA 3OE7G 2H3OA 5H9CA 1WN7A 1Y66A 1FJGB 3JYCA 3ZHTA 1JA8A 1GH6A 4DV5O 4LH6A 3A2FA 1NVPD 2HLDG 4YXWG 2GUZB 3W7XA 3JATB 3IC9A 4PA7A 2ILMA 4PA3A 2YI8A 4J7KA 5FPRA 5K1XA 3K0GA 1XBLA 1FYJA 1FXKC 3SYOA 3E22A 2L35A 1DF4A 1NH2B 2XASA 1N36O 2X7RB 4KHPB 4MW3A 3M8AA 3SDLA 3H01A 1DLBA 3M7MX 2Q5ZA 5EK0A 3RYHA 1EN6A 4PI0A 5B1AC 2E76B 3OEHG 1H2LA 3ABUA 1FXKA 4FZ1A 3D3IA 3D36C 1XNRB 2WSSG 3ZRWB 1N0JA 1OCOB 4ZOLB 4GKKO 4UB6Z 4LF6B 5GONA 4RO2A 3RYFB 1HNWB 2WLNA 2FYUH 5IYDO 2E5LO 4RWUA 1T5EA 3SYQA 3SYPA 1NT2B 5CA1B 3D3QA 3SPIA 3D36A 1MSWD 5D5QA 4R8CA 4CC6A 4AQYO 1QVFU 1JOYA 3WB2A 1TUBB 1AJPA 4GKJB 1H8HG 5KHHA 4GX5A 5B1BB 4DRXA 3Q4HB 4XBFA 2WLIA 2AHZA 1NI8A 5CBFA 1I0HA 2X6BA 4JI3B 1RM1B 5LP6B 3CP1A 4PDVA 4IHJB 4J9YB 4UV9A 1U96A 4YHHB 1Q5OA 4UUJC 2Q6AA 2Z0AA 1CXZB 1SF9A 3ETEA 4TUYA 1K34A 3S3WA 3FB5C 4H0LB 4DR6O 2QR4A 1KP2A 4I0XA 3LSSA 4ZHQB 3OR7C 4E4EA 2X6CA 5B3SC 4IIJA 3FAVB 2CK3G 1M57B 2CTWA 3RVYA 1SQXH 5LOVB 2D3OW 2X6AA 1SA0B 3I55V 1EBOA 1TAEA 4DR5O 3JALB 2N05A 2ZDIA 2OYQA 3X2QC 4DV3B 3OGIB 5LXTB 2EINC 3GB7C 1BZKA 1WAZA 3BPZA 4NVPA 1N32O 5JWPA 4DV4B 3AG4B 2DYSC 1LR1A 4DV0B 3ABKC 5JQGA 1HNWO 2ZQMA 2BTQB 3SPJA 3T1YO 1SETA 5KMGA 1KB9F 1OCZC 4BIZA 5B1OA 4LF5O 1OCCC 1JPXA 3OD4A 2M6YA 3JD1A 3SJBC 4OPHA 5LGTA 1ORQC 4X20B 3ZX6A 4LWSA 3ZJZA 5CN0A 3CCMV 3K9AA 2YIDA 4LCUC 4H44B 1L8DA 2P4KA 1YITV 1G4YB 4JI2B 3SJAC 4PDMA 2OTJV 3RFRA 4IYHA 3CEIA 4FMTA 4QGPA 1XI1A 5IJ9A 2ZE6A 2JDIG 5L3EA 1MSDA 2B1IA 4YHHO 1NR7A 2ZNIA 3K5NA 5LMNO 3E8BA 4LNUA 4UCRA 3J80N 1ZLZA 4JPRA 1V54B 4NXMB 3ML0A 5IT9N 3BRCA 2CH7B 3TK1A 1YJWV 4MVSA 4I7ZB 3KZIZ 4MW8A 4X66O 3KCXA 4RAIA 1HNZO 4TV9B 4NYKA 2KG7A 3CCRV 1NS1A 4FLUA 4KFMA 3K79A 2Q7HA 2PZSA 2JGUA 4D6TH 2BSKA 3CRQA 3A0BZ 1XILA 4B3RO 3DSQA 4U7OA 3U0ZA 5AG2A 1Q3EA 2XAJA 4DV4O 2GV9A 5CB4B 4LF8O 1VQ5V 4DR7O 1FXVA 3OUSA 3J7AU 4KXRA 5E79Z 4LF9B 1AR1B 2F23A 4K0KO 2IJJA 1Q6HA 4GYCB 5IYZB 1IURA 4DV1O 1E1RG 4J42A 1BT8A 3T1HB 4JTDB 4JGSA 4IL6Z 5IJ0B 3CXHF 2DQ3A 3OAAG 4I55A 3AG1B 1B04A 5EYPA 4JI8O 1RSOB 5JJNB 1F4MA 1JX9A 4Z1MG 2Q4PA 1VQPV
chains in the Genus database with same CATH topology
2JRIA 2ZM6O 1XEQA 1R6TA 4YHHO 4JI1O 4DUYO 1IBKO 1IBLO 2UXCO 4JI7O 4JV5O 2LW7A 4JYAO 5LMNO 4DV2O 2UXDO 2UXBO 1YZBA 4X64O 4JI2O 4GKJO 3J80N 4JI5O 1N34O 2Z0AA 4DV5O 5IWAO 5IT9N 3J81N 4JI3O 1HNXO 4JI6O 1AB3A 4DR6O 1DK1A 4NXNO 2UUCO 4X66O 5BY1A 4JI4O 1HR0O 4NXMO 1FJGO 1HNZO 3F5TA 5A2QN 4OX9O 1R1BA 1NS1A 1N33O 4LFBO 4DR1O 1FYJA 4DV7O 4LFAO 4DR5O 1G1XB 4DV6O 3JAMN 4OPAA 5BR8O 1N36O 4B3TO 4B3RO 1A32A 4DR3O 3M8AA 3SDLA 4DUZO 1AILA 2AGAA 4B3MO 4DV4O 4LFCO 4LF8O 4DR7O 1KUQA 4X65O 4X62O 3J7AU 1XMOO 1N32O 4A5UB 2DOSA 2UUAO 2FKXA 4K0KO 4KHPO 2UU9O 5H5NA 1HNWO 4DV3O 3OTOO 1X59A 4DV1O 2ZKOA 3T1YO 3R66A 4DR2O 5FLXN 2UUBO 4GKKO 4LF5O 2DJVA 4YY3O 4JI0O 4LF9O 4DR4O 1IBMO 2E5LO 4DV0O 3O65A 4B3SO 1XMQO 4LF4O 2VQEO 4OPHA 4LF7O 5LL6Y 5LMUO 1FKAO 1D2DA 4JI8O 2F4VO 3RT3C 2HHHO 1XNRO 1I94O 1F7YA 4LF6O 4AQYO 3T1HO 2VQFO 2N74A 5BXZA 1J5EO 1XNQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  2ZM6 O;  1XEQ A;  1R6T A;  4YHH O;  4JI1 O;  4DUY O;  1IBK O;  1IBL O;  2UXC O;  4JI7 O;  4JV5 O;  2LW7 A;  4JYA O;  5LMN O;  4DV2 O;  2UXD O;  2UXB O;  1YZB A;  4X64 O;  4JI2 O;  4GKJ O;  3J80 N;  4JI5 O;  1N34 O;  2Z0A A;  4DV5 O;  5IWA O;  5IT9 N;  3J81 N;  4JI3 O;  1HNX O;  4JI6 O;  1AB3 A;  4DR6 O;  1DK1 A;  4NXN O;  2UUC O;  4X66 O;  5BY1 A;  4JI4 O;  1HR0 O;  4NXM O;  1FJG O;  1HNZ O;  3F5T A;  5A2Q N;  4OX9 O;  1R1B A;  1NS1 A;  1N33 O;  4LFB O;  4DR1 O;  1FYJ A;  4DV7 O;  4LFA O;  4DR5 O;  1G1X B;  4DV6 O;  3JAM N;  4OPA A;  5BR8 O;  1N36 O;  4B3T O;  4B3R O;  1A32 A;  4DR3 O;  3M8A A;  3SDL A;  4DUZ O;  1AIL A;  2AGA A;  4B3M O;  4DV4 O;  4LFC O;  4LF8 O;  4DR7 O;  1KUQ A;  4X65 O;  4X62 O;  3J7A U;  1XMO O;  1N32 O;  4A5U B;  2DOS A;  2UUA O;  2FKX A;  4K0K O;  4KHP O;  2UU9 O;  5H5N A;  1HNW O;  4DV3 O;  3OTO O;  1X59 A;  4DV1 O;  2ZKO A;  3T1Y O;  3R66 A;  4DR2 O;  5FLX N;  2UUB O;  4GKK O;  4LF5 O;  2DJV A;  4YY3 O;  4JI0 O;  4LF9 O;  4DR4 O;  1IBM O;  2E5L O;  4DV0 O;  3O65 A;  4B3S O;  1XMQ O;  4LF4 O;  2VQE O;  4OPH A;  4LF7 O;  5LL6 Y;  5LMU O;  1FKA O;  1D2D A;  4JI8 O;  2F4V O;  3RT3 C;  2HHH O;  1XNR O;  1I94 O;  1F7Y A;  4LF6 O;  4AQY O;  3T1H O;  2VQF O;  2N74 A;  5BXZ A;  1J5E O;  1XNQ O; 
#chains in the Genus database with same CATH topology
 3KG2 A;  3UO3 A;  2AHY A;  1N34 B;  3ABL B;  3DTU B;  3BHP A;  4O4J A;  2FTK A;  4DUY O;  1IBK O;  2BOB C;  5KHK A;  3QNE A;  1GM8 A;  3EFF K;  1YXB A;  4I4T B;  2HVJ C;  5KA5 A;  5KAI Z;  3HKE A;  1FPO A;  2HR3 A;  3E35 A;  3J81 N;  1QLE C;  4X9Q A;  4LR3 A;  1PNL A;  4JI5 B;  4LFA B;  3CS5 A;  4WFA V;  2W0F C;  4UFZ A;  3A0R A;  2HP8 A;  2NR5 A;  2JIZ G;  5BY1 A;  3G80 A;  1SZT A;  1THZ A;  3CC2 V;  1D5N A;  2AZ2 A;  4LFC B;  4OX9 O;  2H94 A;  4TV8 A;  3APO A;  2KB1 A;  1OJH A;  2ADP A;  4X1Y A;  2ZE5 A;  4O4L B;  3CCE V;  1KKC A;  1PL0 A;  4PA9 A;  3VQX A;  3HKB B;  2P6J A;  2IU0 A;  3OEE G;  4X65 O;  1EN5 A;  3EVK A;  3TGU H;  1URF A;  4YY3 B;  2P5O A;  4Q20 A;  4O2A A;  3T4Z A;  2IM9 A;  2R9I A;  1CPY A;  3TJT A;  1M5I A;  4YJ2 A;  3EXA A;  1R3L C;  3ZIA G;  2F4V B;  2A06 H;  2FL4 A;  4GX2 A;  2XAH A;  4HZ3 A;  2DWE C;  2EUL A;  3ZRX A;  2DE0 X;  1EFR G;  1WP7 A;  3HKC B;  3ZMU A;  4MTO A;  2WLL A;  3LDD A;  4MT8 A;  1I94 O;  3DC5 A;  1OHH G;  2HJD A;  4JTA B;  3T4D A;  3B09 A;  1AR5 A;  3BA9 A;  3ZN1 A;  2XUM A;  4JI1 O;  1L1F A;  2EJ7 A;  1LUV A;  4JI5 O;  2EIL B;  3STZ C;  2QM4 A;  1OCR C;  5J2U B;  4MTF A;  4O4I A;  3WG7 B;  1NTZ H;  1VF6 A;  3TET A;  1R3K C;  1RP3 B;  4PDL A;  1Y76 A;  1TGO A;  5B66 Z;  2ZIM A;  2ITD C;  2P06 A;  3UQ8 A;  3JCU Z;  1HP8 A;  1ZTE A;  1IZ3 A;  1NH2 D;  3H1I H;  4B7E A;  1NU1 H;  1FS0 G;  2YS8 A;  3D8C A;  1S5J A;  3B2E E;  4J9Z B;  3P32 A;  1GN6 A;  5KUM A;  1V55 C;  2DMX A;  1EZV H;  3C3S A;  3OTO B;  4DR2 B;  1P7B A;  1MMM A;  2Q9L A;  4P9O A;  4A5U B;  4JI0 B;  1COW G;  3AG3 B;  1V9P A;  4BWA A;  4PEL A;  3RGB A;  4F6R A;  5IE9 A;  2Y4U A;  3H1K H;  3B4S A;  5CA0 B;  4K35 A;  4NKG B;  1MNG A;  2JGD A;  1WA8 B;  2F95 B;  1UJW B;  1BHB A;  1KYO F;  1EM1 A;  1NTK H;  1FXH A;  1IXB A;  5LL6 Y;  2PGG A;  3IFX A;  2YEV B;  1VQM V;  2WLJ A;  2FB5 A;  5DEC A;  2VQF O;  4O4H B;  2UXD B;  2R9R B;  1J5E O;  1SQV H;  1P7G A;  1KC8 W;  1VQ6 V;  2F43 G;  2EIM C;  2JK5 C;  1Q43 A;  2P4V A;  2CTR A;  4DV2 O;  4I50 A;  3NR7 A;  4MVO A;  4X64 O;  3ZHV A;  5IDJ A;  2GHY A;  1HR0 B;  4JI7 B;  3AG2 B;  4FM1 A;  2ZXW B;  4LFB B;  2PYL A;  2R72 A;  1B3Q A;  3OUF A;  1KMI Z;  1SQG A;  2XHB A;  2UUC O;  1AP5 A;  2ZIN A;  4FFK A;  3VQW A;  1BQZ A;  4EB6 B;  4R50 A;  5KUK A;  5JH7 B;  3CRC A;  1YF2 A;  2CDY A;  1N33 O;  1N0N A;  2IJK A;  4UCV A;  5GTH Z;  3L72 H;  5L3C A;  3ABM B;  4CS2 A;  1G1X B;  1GO3 F;  1QBZ A;  4OPA A;  2EX3 A;  2DQ0 A;  1SC5 B;  1WB8 A;  4U3J B;  1ZWI C;  1K73 W;  4WFG A;  3E8F A;  4UB8 Z;  5EZY A;  2HJF C;  3G6B A;  4G27 B;  4B3T B;  3ZMV A;  2DOS A;  3BVO A;  2FKX A;  2ZR2 A;  1ARO P;  2NN4 A;  2JVD A;  3TXQ A;  1FFX A;  3W7T A;  2ZKO A;  3MHS C;  3U11 A;  3JAS B;  1WPX A;  2X0L A;  3LDE A;  2DJV A;  5DM6 V;  1X4T A;  2JJ2 G;  2UUB B;  1BGY H;  5KAF Z;  1GK9 A;  1F23 A;  2AXT Z;  3E8G A;  4TOI A;  4EFE A;  4DR4 B;  4OGQ B;  2EIK C;  4TSF G;  4JV5 B;  2ARH A;  5LYJ B;  1K4C C;  1XNQ O;  1M90 W;  5EC1 C;  3STL C;  4ZKI A;  1BS3 A;  4FFB B;  4J41 A;  4JI7 O;  1GRJ A;  1OZ0 A;  1Y74 A;  1GM9 A;  4QIW F;  4WBN B;  4MVZ A;  1S76 D;  3H1L H;  3HPL C;  5EBL C;  1NR1 A;  2LQT A;  3CD6 V;  1R6N A;  1DGS A;  5LGN A;  2Y0I A;  1SES A;  1YEW A;  3QVN A;  1FJG O;  5ITZ A;  5J9P C;  1R1B A;  2P90 A;  3C90 A;  3SR2 C;  1I7F A;  5JVD B;  2GDS A;  1ZL8 A;  1LUW A;  3JAR B;  1ZSP A;  1H8E G;  4HNA A;  2UUA B;  4B3T O;  1JVM A;  3JAK B;  2K9P A;  4N21 A;  4DV7 B;  4J11 A;  4UVC A;  2JS5 A;  4PV1 B;  3O9O A;  3L74 H;  3JD4 A;  2ZDI C;  4NTX A;  2EIJ C;  1QHT A;  2LFS A;  1EZJ A;  1US6 A;  3HKD A;  3QO5 A;  1XMQ B;  4KHP O;  3FX7 A;  3ASN C;  1K3E A;  3ASO C;  5C8Y A;  4JF3 A;  2A79 B;  3ZHU A;  5FLX N;  2UUB O;  3P3P A;  1IDS A;  2V4D A;  4YIP A;  4DR4 O;  1RFY A;  4FLY A;  3O65 A;  1BSM A;  3K5M A;  4GT1 A;  1NJI W;  2GBO A;  1XNR O;  3JAW A;  1QLE B;  1ZX3 A;  3K5O A;  4L8J A;  4LF6 O;  4JYA B;  5EC2 C;  1M9N A;  3DXR B;  1VQ9 V;  4YJ3 A;  2VS0 A;  4K8Z A;  3RVZ A;  3UT5 B;  5BMV A;  1M4U A;  1K5Q A;  1K4D C;  3ZCC A;  1GTO A;  4MTX A;  2LFR A;  1AI6 A;  4GKJ O;  4O2B A;  4X1K A;  1Q8I A;  1K9M W;  3OMA B;  5J2T B;  1E1Q G;  5KX5 A;  4JI3 O;  1AP6 A;  1GAX A;  4WCE V;  3BCC H;  5IWA B;  3RYC B;  1VQK V;  4DR3 B;  4JI6 B;  3CRM A;  3U10 A;  5JH7 A;  4K8X A;  4J80 A;  3OT7 A;  1PNM A;  1VF7 A;  2WAM A;  4DV7 O;  1XMO B;  1K8A W;  1H2N A;  3CME V;  2ATK C;  1W0K G;  3SJQ C;  2Q69 A;  2PY5 A;  2LJ2 A;  2UU9 B;  4U3J A;  4PHZ A;  1WPB A;  5E1A C;  1ENV A;  1YSC A;  3ZS8 C;  2GUZ A;  4N23 A;  3JAT A;  3ZMT A;  1KUQ A;  4NB5 A;  5LGU A;  3QTC A;  2HVK C;  1AI5 A;  4FM0 A;  3CHX A;  4PA6 A;  5H5N A;  5FNV B;  4LF4 B;  1YVW A;  4AIL C;  5F2V O;  2Q7E A;  4DV3 O;  1KD1 W;  3A8T A;  1N8R W;  3VBB A;  1VQ8 V;  3IGA C;  4XDJ A;  3SJC C;  1SQF A;  1YIJ V;  1OCO C;  1K92 A;  1XL4 A;  2OIE A;  4DV0 O;  2E3C A;  2QGN A;  4JTC B;  2LGQ A;  3IC7 A;  2ZT9 B;  1D2D A;  4JAS A;  4EFB A;  4ZI7 B;  4LF7 B;  2UXB B;  1HW7 A;  3ZRW A;  4CH5 A;  3JCZ A;  2LW1 A;  3ZMS A;  2RMK B;  4ZOL A;  4KP4 A;  4WFB V;  1VIB A;  3RYF A;  5B1B C;  1M56 C;  2V1D A;  3CX5 F;  4NTW A;  5HFL A;  1H2G A;  2QEX V;  5CA1 A;  1RM1 C;  4JI2 O;  4NXN B;  5LP6 C;  2EZO A;  2A9H A;  1YJ9 V;  1L0L H;  1Z5V A;  2UXC B;  1S77 D;  5IWA O;  3ETQ A;  1TUB A;  3MAQ A;  1VQL V;  1HWY A;  4D7S A;  1YTF B;  4JI6 O;  4QPJ A;  3Q4H A;  3WB1 A;  2QKA A;  4UV8 A;  3F5W C;  3N2G B;  4JYY A;  2DYR B;  2PUS A;  2N04 A;  3I56 V;  2RDC A;  5LP6 A;  2WA3 A;  4DK0 A;  4NXM O;  1J95 A;  3BAB A;  4B3M B;  4GUN A;  4IHJ A;  2QM7 A;  2QJ1 A;  2JEU A;  4MTG A;  1YJN V;  1WB7 A;  4X62 B;  2BCC H;  1M57 C;  2YIB A;  3HB3 B;  4MVM A;  3JAK A;  1QR9 A;  1A32 A;  5JJE B;  4AHC A;  4QNH B;  3W7S A;  1JFF B;  2AGA A;  5LA6 B;  1PP9 H;  4FLX A;  4TWK A;  1I5X A;  4LBE C;  3SPH A;  4UCU A;  1IX9 A;  1VP7 A;  2OCC B;  1VQO V;  3CPW U;  2JJ1 G;  4ZHQ A;  2KQX A;  3FKS G;  4FLV A;  4BIO A;  1NBM G;  1I5Y A;  3FAV A;  4B3S B;  5LOV A;  1SA0 A;  3AG4 C;  4UCO A;  3JAL A;  2VWJ A;  4P30 A;  4LF9 O;  3CJH B;  5LXT A;  4X1I B;  1AJQ A;  4L87 A;  4LF7 O;  2DWD C;  3FB7 C;  3P3N A;  1IBL B;  3OM3 B;  2QDO A;  1F7Y A;  3CC4 V;  3T1H O;  4EEQ A;  2LP7 A;  4BW9 A;  2BTQ A;  3DXR A;  3KKY A;  4PI2 A;  2RNB A;  2Y69 B;  3B40 A;  2YC0 A;  2UXC O;  3L9D A;  2LW7 A;  4X20 A;  4OXS A;  3KCY A;  3L71 H;  5HFM A;  4MVQ A;  1XRE A;  1YDX A;  3BEH A;  2JEX A;  3QF7 A;  3APQ A;  4GLX A;  1N34 O;  4CC5 A;  1Y4M A;  3E22 B;  2KSD A;  4G28 B;  1V54 C;  1ZUQ A;  3BFR A;  3CCL V;  3MHH C;  4FK5 C;  2A7W A;  4CH3 A;  5BR8 B;  2P22 C;  1VF6 C;  1IVS A;  2XAF A;  3AK2 A;  1FXK B;  4UXN A;  1CEZ A;  3UCS C;  2RN9 A;  2OCH A;  4U3F H;  4LFA O;  4NTY A;  3K04 A;  2PTM A;  4R6Z A;  2CH7 A;  2CAZ C;  1QCE A;  5GON B;  5L3B A;  2WLH A;  3DC6 A;  5EIB D;  5B1A B;  4LFC O;  3T1C A;  1NTM H;  4F4L A;  2R9A A;  2IH3 C;  1B06 A;  4TV9 A;  3CRR A;  1S72 V;  3ZMZ A;  4RQE A;  3UO2 A;  5B5E Z;  2CGN A;  1P84 F;  3ZHQ A;  2HFE C;  4DRX B;  1PKX A;  1S0V A;  1BQ0 A;  1Q82 W;  2WLI B;  4FVM A;  4YY3 O;  1SKV A;  2V7Q G;  3ZRV A;  4JAV A;  5CB4 A;  1BE3 H;  2QKS A;  2F4V O;  5L3G A;  2CGO A;  4CS3 A;  3AG1 C;  4CH6 A;  2ZD9 A;  2D2C B;  4IGG A;  2Q0O C;  5IYZ A;  2L6L A;  3K08 A;  1R3I C;  2XTA A;  2YXY A;  4KL1 A;  4DV5 B;  2P7T C;  5IJ0 A;  5CBH A;  1SZX A;  3CC7 V;  4I0X B;  1F51 A;  3ABL C;  4DXW A;  3OR6 C;  2ZM6 B;  4IIJ B;  3QG5 A;  1RSO A;  3E83 A;  3OW2 U;  2QWN B;  2ITC C;  2E74 B;  2QKC A;  4UVB A;  5L3D A;  2QWQ B;  4QE9 A;  2NLJ C;  3L75 H;  1DK1 A;  5B3S B;  2YDE A;  5KHJ A;  1N36 B;  2G38 A;  1XUQ A;  1MAB G;  5A2Q N;  3G4S V;  1GKF A;  3FYE B;  2YIB D;  2AW9 A;  5B1N A;  1Q90 D;  2Y48 A;  4I4T A;  4IYI A;  2QA4 V;  4GX0 A;  3X2Q B;  5LHG A;  5KMG B;  2EIN B;  4WF9 V;  3B8M A;  4ASU G;  4RUF A;  2WA4 A;  5DED A;  1MOF A;  2DYS B;  2YXL A;  4GKK B;  3NXS A;  4LWS B;  3ABK B;  4E2L A;  1QLN A;  2XT9 A;  2E5L B;  5K1P A;  1R3J C;  2B9Z A;  1H2K A;  3CXC U;  1OCZ B;  4DO2 A;  1PL4 A;  3OTO O;  3AG7 A;  1OCC B;  5IYB O;  4X89 A;  3R66 A;  4DR2 O;  1IXM A;  4DK1 A;  4O4L A;  5IJ9 B;  1BHA A;  4AQY B;  1S3J A;  3HKB A;  4JI0 O;  4JAU A;  1K5S A;  1WLE A;  3RT3 C;  1GN2 A;  4FLW A;  4LNU B;  2QTO A;  3ABT A;  1PNK A;  1G8M A;  2WLK A;  3F7Y C;  5JCO C;  2BE3 A;  2RJZ A;  2ZM6 O;  4RUE A;  1YCI A;  3G6E V;  1DF5 A;  1R6T A;  3CE2 A;  3CSX A;  2IU3 A;  3ZHR A;  4WFE A;  2A0L A;  3OMN B;  4XDK A;  2Q67 A;  1XL6 A;  3HKC A;  3QO7 A;  2UXD O;  2KG7 B;  1YZB A;  4DR6 B;  1MA1 A;  2YIA A;  5JCO A;  2WWW A;  5CBG A;  2BSK B;  3JD3 A;  3BAA A;  2EIL C;  3CRA A;  1Q81 W;  1SQQ H;  1OV9 A;  2B1G A;  5A9G A;  3SPG A;  4DR5 B;  2ZE7 A;  3WG7 C;  1UFI A;  4WFH A;  3CCJ V;  1L0N H;  4FJC C;  1HR0 O;  1HNX B;  1BMF G;  1VQ4 V;  2Q8V A;  1VQN V;  4LFB O;  1AI7 A;  3K59 A;  1N32 B;  3FFQ A;  5J2U A;  1SS3 A;  3JAM N;  5KLV H;  4QPK A;  3GWO A;  2BOC C;  2CTP A;  4RQF A;  3G71 V;  3K5L A;  3HR0 A;  3T1Y B;  5BZB A;  1Q7Y W;  1GMG A;  5KA6 A;  4I55 B;  4FM2 A;  3VQV A;  2R70 A;  5EYP B;  2OWO A;  4LF5 B;  1VF5 B;  2Q7G A;  1PD3 A;  1XQ8 A;  5FL7 G;  1R6K A;  3DGE A;  2W6I G;  4IT5 A;  3CCS V;  3AG3 C;  3M99 B;  1B6Q A;  3G67 A;  1M56 B;  1KP3 A;  3LNN A;  3ETD A;  3S3X A;  4O4J B;  4QE7 A;  3N2K B;  1PM9 A;  3B77 A;  1WNS A;  2IBZ H;  2GTA A;  3E8H A;  1FKA O;  4JZG A;  3K58 A;  1IBM B;  4PA4 A;  1SRY A;  4DW1 A;  3K9S A;  2E75 B;  1O9G A;  3HKE B;  5LMN B;  1P4R A;  5BXZ A;  4PD4 F;  5CA0 A;  1QQC A;  1EN4 A;  5IY5 C;  2WLM A;  1WA8 A;  2Y0P A;  4TT3 G;  3F7V C;  4J10 A;  1AVM A;  3JD2 A;  1MG1 A;  4JV5 O;  3FB6 C;  3ZED A;  2LGW A;  4X66 B;  2YEV A;  4TV8 B;  1PV0 A;  2YI9 A;  1YTF D;  2XAQ A;  1JJO A;  1HNZ B;  4O4H A;  4X1Y B;  1S5L Z;  3AG2 C;  1HNX O;  3H1J H;  3CWB H;  2ZXW C;  5DN6 G;  4I5S A;  1W2B U;  4HYO A;  1VEW A;  1NVP B;  4B3R B;  2QM8 A;  3EHB B;  4KUM A;  2EJR A;  5D5P A;  4O2A B;  2GSM B;  1HDJ A;  4LF8 B;  1VMG A;  3K3W A;  4DR7 B;  3OTF A;  4YJ2 B;  4QJF B;  1CP9 A;  2JS3 A;  4K0K B;  3ABM C;  4Q6G A;  4U7N A;  4DV1 B;  2RQ6 A;  2XND G;  3ZN0 A;  4EB6 A;  2CE4 A;  1M1K W;  2HEP A;  3CCV V;  4DUZ B;  1Z2G A;  3FD9 A;  2WLL B;  2UUA O;  3I5D A;  5GW7 A;  1WJZ A;  1TA8 A;  5EIB C;  1BL8 A;  4FZ0 A;  4BW5 A;  4JI8 B;  1X59 A;  3WFV A;  3CYO A;  2M7W A;  3TXS A;  4Z1V A;  4K3A A;  1W0J G;  3VOU A;  1QVG U;  1IBM O;  3R65 A;  2QWR B;  4ABM A;  4H13 B;  1XMQ O;  2Z3Y A;  4G2K A;  2RCV A;  1ZAU A;  4DUY B;  1IBK B;  1AR4 A;  1XDC A;  2QTS A;  5H2F Z;  2VQE B;  3VQY A;  5LMU B;  1KU9 A;  4O4I B;  2HHH B;  2JRI A;  3AK3 A;  3UKM A;  1KQS U;  3JAS A;  1XEQ A;  4NR1 A;  1KBH A;  4FLT A;  1Y76 B;  5CA3 A;  5LBQ A;  4JYA O;  3LDC A;  3SYC A;  1OCR B;  2ZR3 A;  3BY6 A;  2ZNJ A;  2PI4 A;  1Y67 A;  5LYJ A;  4OX9 B;  5IYC O;  4J7Z A;  4EKW A;  2Y4T A;  1F4N A;  4MS2 A;  1ROP A;  1NZ6 A;  2OTL V;  4FFB A;  2Q0A A;  2YUA A;  1TVK B;  1D5A A;  2VWK A;  3F5T A;  1H2S B;  2A3Q A;  2QWO B;  3K0D A;  5EBM C;  3QO8 A;  4WBN A;  1SER A;  4X65 B;  5CMU A;  4JI4 B;  4F6R B;  5LHH A;  4HBN A;  1V55 B;  4GZR B;  2NNU A;  4BR6 A;  2JGD B;  4DR1 B;  4DR3 O;  4DUZ O;  1K97 A;  1SQB H;  3LSU A;  3LNM B;  1XMO O;  2AZ0 A;  3RW0 A;  1QU7 A;  2ETN A;  3ZRS A;  2H8P C;  1JCH A;  3RWR D;  2QWP B;  3GVM A;  5JVD A;  4W4L A;  2UU9 O;  3JSL A;  4LH7 A;  5JJJ B;  1JR9 A;  5LHI A;  5FPO A;  3JAR A;  3RYI B;  2PI5 A;  4I9W A;  1I94 B;  1Q6I A;  3FB8 C;  3GWK C;  1K7D A;  3ZBH A;  1QNM A;  1VQ7 V;  1DTO A;  3N2K A;  4MVU A;  3W7W A;  2VRZ A;  1YHQ V;  4LF4 O;  2VQE O;  1P49 A;  5LMU O;  4I50 B;  3T2M A;  3A0H Z;  4C7U A;  2HHH O;  4JI1 B;  3E89 A;  3LUT B;  2N74 A;  1KEC A;  2EIM B;  2ZE8 A;  2FML A;  2YIC A;  4P2Z A;  3TCU A;  1R73 A;  3CB2 A;  1S5H C;  4HAM A;  1SQP H;  2GTS A;  1Q86 W;  4CH4 A;  1H38 A;  3LSQ A;  1Y6X A;  2UXB O;  2ZCE A;  2ZIO A;  2C2A A;  3ETG A;  1XHZ A;  1W59 A;  3IJ4 A;  4LC1 A;  4B08 A;  4B7K A;  4JYB A;  3K03 A;  4ICG A;  3H9V A;  2MK3 A;  4FPP A;  2KKW A;  2PYJ A;  4XDL A;  4NXN O;  5EZY B;  3UT5 A;  2W0X A;  1M93 A;  2HG5 C;  4JI4 O;  1JQ0 A;  2YXH A;  3RN4 A;  3OFN G;  4F6E A;  4TQD A;  2IW5 A;  1Q6U A;  2QSA A;  3JSN A;  1N4C A;  4DR1 O;  4Z2W A;  3SPC A;  3E2E A;  1FFX B;  2IJI A;  2HKO A;  5J2T A;  4J7J A;  3W7U A;  4CS4 A;  1VAR A;  3ICX A;  3PJS K;  1UPG A;  2DW4 A;  1LNQ A;  3AEI A;  3CMA V;  4B3M O;  1NQT A;  2QE7 G;  1GN4 A;  4DV6 B;  3RYC A;  3E86 A;  4X62 O;  3RYH B;  4BAY A;  4DW0 A;  1QR8 A;  4GCZ A;  1I08 A;  4H37 A;  2BTO A;  5GTI Z;  4DYL A;  3AK1 A;  2VQF B;  2F1M A;  3OMI B;  2ODM A;  1NKD A;  2OIG A;  2UXX A;  1J5E B;  4B3S O;  4P9P A;  3THO A;  5C93 A;  2EIK B;  4UCS A;  1JMK C;  4ZBM A;  1Y74 B;  4R7C A;  1FAF A;  2CUG A;  3FYI B;  5FNV A;  4DV2 B;  2LO1 A;  5KHG A;  2PF4 E;  1E79 G;  4X64 B;  2DN9 A;  2F66 C;  4FIP C;  2XOK G;  1FFT B;  2F93 B;  3P30 A;  1MZE A;  5TIS Z;  2Q73 A;  1XHX A;  4JZ2 A;  1IBL O;  4FLZ A;  2Q68 A;  5ITZ B;  4BIU A;  2UUC B;  4X88 A;  1ZL8 B;  1O9H A;  2IJH A;  1AJN A;  4ZI7 A;  4HNA B;  1K33 A;  4AI8 A;  1N33 B;  4X8A A;  1PPJ H;  4TUY B;  1AB3 A;  3MDS A;  3N27 A;  2K1E A;  4W4K A;  2B5U A;  4YIO A;  1TVK A;  2DYR C;  1BCC H;  1XOU A;  4TQF A;  2EBO A;  4MSW C;  4MVR A;  3HKD B;  4I9Q A;  3B8N A;  2MW2 B;  1TUE B;  3RBZ A;  1AI4 A;  2YSU B;  2IH1 C;  1MZF A;  2XAG A;  3MD0 A;  5C8Y B;  4DV6 O;  3PN1 A;  5H6Q A;  5BR8 O;  4LP8 A;  3C3T A;  1YI2 V;  4CBC A;  4H33 A;  2O57 A;  1AIL A;  3N2G A;  2EIJ B;  3SGI A;  5EBW C;  1WP8 A;  3CCQ V;  2CTQ A;  3ASN B;  1Z5W A;  1H2M A;  3JAW B;  3ASO B;  4CZZ A;  3OGC C;  3BA8 A;  2OCC C;  3UM7 A;  3WU2 Z;  5IY5 B;  1GM7 A;  5JQG B;  2P67 A;  4JYC A;  3RYI A;  4UCT A;  3L73 H;  2OT5 A;  4YJ3 B;  3WB0 A;  1KKD A;  4JAA A;  5BMV B;  1JFF A;  4PDR A;  4WFF A;  5LA6 A;  1XNQ B;  2WPD G;  3H1H H;  2Z5U A;  2W6J G;  1U97 A;  3K57 A;  1RPO A;  4O2B B;  1G6U A;  4X1K B;  4PJ0 Z;  1GN3 A;  2EZP A;  4D7T A;  4ZIB A;  5KX5 B;  3IAY A;  3JD0 A;  4UVA A;  5L3F A;  3L70 H;  2ADQ B;  4GX1 A;  1FD9 A;  3K06 A;  3SYA A;  3ZHS A;  3CCU V;  3CJH A;  4X1I A;  5H6R A;  5KHI A;  1RPR A;  2Y69 C;  1JJ2 U;  2UXN A;  3OE7 G;  2H3O A;  5H9C A;  1WN7 A;  1Y66 A;  1FJG B;  3JYC A;  3ZHT A;  1JA8 A;  1GH6 A;  4DV5 O;  4LH6 A;  3A2F A;  1NVP D;  2HLD G;  4YXW G;  2GUZ B;  3W7X A;  3JAT B;  3IC9 A;  4PA7 A;  2ILM A;  4PA3 A;  2YI8 A;  4J7K A;  5FPR A;  5K1X A;  3K0G A;  1XBL A;  1FYJ A;  1FXK C;  3SYO A;  3E22 A;  2L35 A;  1DF4 A;  1NH2 B;  2XAS A;  1N36 O;  2X7R B;  4KHP B;  4MW3 A;  3M8A A;  3SDL A;  3H01 A;  1DLB A;  3M7M X;  2Q5Z A;  5EK0 A;  3RYH A;  1EN6 A;  4PI0 A;  5B1A C;  2E76 B;  3OEH G;  1H2L A;  3ABU A;  1FXK A;  4FZ1 A;  3D3I A;  3D36 C;  1XNR B;  2WSS G;  3ZRW B;  1N0J A;  1OCO B;  4ZOL B;  4GKK O;  4UB6 Z;  4LF6 B;  5GON A;  4RO2 A;  3RYF B;  1HNW B;  2WLN A;  2FYU H;  5IYD O;  2E5L O;  4RWU A;  1T5E A;  3SYQ A;  3SYP A;  1NT2 B;  5CA1 B;  3D3Q A;  3SPI A;  3D36 A;  1MSW D;  5D5Q A;  4R8C A;  4CC6 A;  4AQY O;  1QVF U;  1JOY A;  3WB2 A;  1TUB B;  1AJP A;  4GKJ B;  1H8H G;  5KHH A;  4GX5 A;  5B1B B;  4DRX A;  3Q4H B;  4XBF A;  2WLI A;  2AHZ A;  1NI8 A;  5CBF A;  1I0H A;  2X6B A;  4JI3 B;  1RM1 B;  5LP6 B;  3CP1 A;  4PDV A;  4IHJ B;  4J9Y B;  4UV9 A;  1U96 A;  4YHH B;  1Q5O A;  4UUJ C;  2Q6A A;  2Z0A A;  1CXZ B;  1SF9 A;  3ETE A;  4TUY A;  1K34 A;  3S3W A;  3FB5 C;  4H0L B;  4DR6 O;  2QR4 A;  1KP2 A;  4I0X A;  3LSS A;  4ZHQ B;  3OR7 C;  4E4E A;  2X6C A;  5B3S C;  4IIJ A;  3FAV B;  2CK3 G;  1M57 B;  2CTW A;  3RVY A;  1SQX H;  5LOV B;  2D3O W;  2X6A A;  1SA0 B;  3I55 V;  1EBO A;  1TAE A;  4DR5 O;  3JAL B;  2N05 A;  2ZDI A;  2OYQ A;  3X2Q C;  4DV3 B;  3OGI B;  5LXT B;  2EIN C;  3GB7 C;  1BZK A;  1WAZ A;  3BPZ A;  4NVP A;  1N32 O;  5JWP A;  4DV4 B;  3AG4 B;  2DYS C;  1LR1 A;  4DV0 B;  3ABK C;  5JQG A;  1HNW O;  2ZQM A;  2BTQ B;  3SPJ A;  3T1Y O;  1SET A;  5KMG A;  1KB9 F;  1OCZ C;  4BIZ A;  5B1O A;  4LF5 O;  1OCC C;  1JPX A;  3OD4 A;  2M6Y A;  3JD1 A;  3SJB C;  4OPH A;  5LGT A;  1ORQ C;  4X20 B;  3ZX6 A;  4LWS A;  3ZJZ A;  5CN0 A;  3CCM V;  3K9A A;  2YID A;  4LCU C;  4H44 B;  1L8D A;  2P4K A;  1YIT V;  1G4Y B;  4JI2 B;  3SJA C;  4PDM A;  2OTJ V;  3RFR A;  4IYH A;  3CEI A;  4FMT A;  4QGP A;  1XI1 A;  5IJ9 A;  2ZE6 A;  2JDI G;  5L3E A;  1MSD A;  2B1I A;  4YHH O;  1NR7 A;  2ZNI A;  3K5N A;  5LMN O;  3E8B A;  4LNU A;  4UCR A;  3J80 N;  1ZLZ A;  4JPR A;  1V54 B;  4NXM B;  3ML0 A;  5IT9 N;  3BRC A;  2CH7 B;  3TK1 A;  1YJW V;  4MVS A;  4I7Z B;  3KZI Z;  4MW8 A;  4X66 O;  3KCX A;  4RAI A;  1HNZ O;  4TV9 B;  4NYK A;  2KG7 A;  3CCR V;  1NS1 A;  4FLU A;  4KFM A;  3K79 A;  2Q7H A;  2PZS A;  2JGU A;  4D6T H;  2BSK A;  3CRQ A;  3A0B Z;  1XIL A;  4B3R O;  3DSQ A;  4U7O A;  3U0Z A;  5AG2 A;  1Q3E A;  2XAJ A;  4DV4 O;  2GV9 A;  5CB4 B;  4LF8 O;  1VQ5 V;  4DR7 O;  1FXV A;  3OUS A;  3J7A U;  4KXR A;  5E79 Z;  4LF9 B;  1AR1 B;  2F23 A;  4K0K O;  2IJJ A;  1Q6H A;  4GYC B;  5IYZ B;  1IUR A;  4DV1 O;  1E1R G;  4J42 A;  1BT8 A;  3T1H B;  4JTD B;  4JGS A;  4IL6 Z;  5IJ0 B;  3CXH F;  2DQ3 A;  3OAA G;  4I55 A;  3AG1 B;  1B04 A;  5EYP A;  4JI8 O;  1RSO B;  5JJN B;  1F4M A;  1JX9 A;  4Z1M G;  2Q4P A;  1VQP V; 
#chains in the Genus database with same CATH homology
 2JRI A;  2ZM6 O;  1XEQ A;  1R6T A;  4YHH O;  4JI1 O;  4DUY O;  1IBK O;  1IBL O;  2UXC O;  4JI7 O;  4JV5 O;  2LW7 A;  4JYA O;  5LMN O;  4DV2 O;  2UXD O;  2UXB O;  1YZB A;  4X64 O;  4JI2 O;  4GKJ O;  3J80 N;  4JI5 O;  1N34 O;  2Z0A A;  4DV5 O;  5IWA O;  5IT9 N;  3J81 N;  4JI3 O;  1HNX O;  4JI6 O;  1AB3 A;  4DR6 O;  1DK1 A;  4NXN O;  2UUC O;  4X66 O;  5BY1 A;  4JI4 O;  1HR0 O;  4NXM O;  1FJG O;  1HNZ O;  3F5T A;  5A2Q N;  4OX9 O;  1R1B A;  1NS1 A;  1N33 O;  4LFB O;  4DR1 O;  1FYJ A;  4DV7 O;  4LFA O;  4DR5 O;  1G1X B;  4DV6 O;  3JAM N;  4OPA A;  5BR8 O;  1N36 O;  4B3T O;  4B3R O;  1A32 A;  4DR3 O;  3M8A A;  3SDL A;  4DUZ O;  1AIL A;  2AGA A;  4B3M O;  4DV4 O;  4LFC O;  4LF8 O;  4DR7 O;  1KUQ A;  4X65 O;  4X62 O;  3J7A U;  1XMO O;  1N32 O;  4A5U B;  2DOS A;  2UUA O;  2FKX A;  4K0K O;  4KHP O;  2UU9 O;  5H5N A;  1HNW O;  4DV3 O;  3OTO O;  1X59 A;  4DV1 O;  2ZKO A;  3T1Y O;  3R66 A;  4DR2 O;  5FLX N;  2UUB O;  4GKK O;  4LF5 O;  2DJV A;  4YY3 O;  4JI0 O;  4LF9 O;  4DR4 O;  1IBM O;  2E5L O;  4DV0 O;  3O65 A;  4B3S O;  1XMQ O;  4LF4 O;  2VQE O;  4OPH A;  4LF7 O;  5LL6 Y;  5LMU O;  1FKA O;  1D2D A;  4JI8 O;  2F4V O;  3RT3 C;  2HHH O;  1XNR O;  1I94 O;  1F7Y A;  4LF6 O;  4AQY O;  3T1H O;  2VQF O;  2N74 A;  5BXZ A;  1J5E O;  1XNQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...