3L71H

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l71H00
3H1KH 3H1HH 2FYUH 1L0NH 1EZVH 2A06H 3L74H 3BCCH 3TGUH 1KYOF 3L73H 1KB9F 4U3FH 3L75H 3L72H 1SQBH 2BCCH 3CX5F 1PP9H 3H1JH 1NTMH 1PPJH 1SQVH 1BGYH 1SQXH 3L71H 4PD4F 1NTZH 3L70H 3H1IH 1SQPH 3H1LH 5KLVH 1BCCH 1BE3H 1L0LH 2IBZH 3CXHF 4D6TH 1NU1H 1NTKH 1P84F 1SQQH 3CWBH
chains in the Genus database with same CATH superfamily
4LF9O 1NS1A 1MZFA 4DV6O 5FL7G 2EX3A 2RDCA 3BCCH 4O2AA 3K5LA 1URFA 1CEZA 3LNMB 1RP3B 2JS3A 1XOUA 1YF2A 3JARB 3K57A 1KUQA 1TVKB 3HKCB 3OEHG 1TGOA 3BPZA 3HKDB 2FTKA 4CH3A 3R65A 4TQDA 1ZUQA 1OJHA 3PJSK 4B08A 1SQFA 2RNBA 3SPHA 1MZEA 2LJ2A 1NU1H 3RBZA 4RQFA 2BSKB 1S0VA 4O4LA 3CWBH 2R72A 2QA4V 1AROP 1HDJA 2K1EA 3D3IA 2DW4A 1OCZB 1NBMG 2X0LA 5GW7A 3TXQA 4PDMA 1WP8A 4DR4O 1ZX3A 5KA5A 4K0KO 1Q86W 3E89A 1HNZB 2Z3YA 4WFEA 3UO2A 1I94O 4GKKB 3NR7A 1OCOB 2JEXA 4LFBB 2LFRA 3AG7A 3BABA 4I4TA 2P06A 4DRXA 2OCHA 2WLLB 4J10A 4PI0A 3HKBB 1AJNA 1AP6A 1GN6A 1E1RG 4UVBA 3ABMB 2PUSA 4PV1B 3F7YC 4ABMA 1TUBA 3GWKC 2YXHA 1BHBA 1H8HG 2DYSC 3FFQA 4P9PA 3CCUV 1XMQB 3AG2C 4X65B 1WN7A 2PTMA 2KB1A 4MVUA 3K3WA 4JYYA 5KUMA 2KKWA 3DC5A 1R6KA 4GX1A 5CA1A 2NR5A 5B3SC 3JALB 4DK0A 2OT5A 2DN9A 1L0LH 2K9PA 4AILC 4JZGA 2HEPA 1J5EB 3CCLV 4LNUB 1P84F 1DF4A 3OMNB 1VF6C 4EFEA 2QWRB 4FLVA 4JI1O 2EIMC 1RSOA 3ETEA 3B8MA 1SRYA 4MTOA 5EIBC 1D5NA 3ZJZA 1VQMV 4LF7O 4O2AB 2F66C 2R9IA 3ZN0A 5IY5B 4PDVA 5L3DA 4QJFB 3UT5A 3HB3B 3L73H 3H1JH 4FIPC 4FPPA 3WB2A 4F6RB 2WSSG 1AJPA 2F43G 4MTFA 1COWG 4HZ3A 3E35A 3UQ8A 1JX9A 4MSWC 1IZ3A 5KMGA 2XASA 4U7OA 4WFFA 4B7EA 1K73W 1AI6A 3D3QA 1P7GA 4XDKA 1GAXA 1MSDA 1YVWA 4U3FH 3LNNA 1K9MW 2UXXA 5IJ0A 2HFEC 1NTMH 3OGIB 5C93A 5AG2A 4PD4F 4O4LB 3K5NA 2H8PC 3JD3A 4JF3A 4DV3B 1HNZO 2V7QG 1BT8A 4GKKO 3K58A 1SS3A 1YI2V 4LFBO 4PI2A 5LMNB 3T1YO 1JJOA 2IJJA 2RN9A 1CP9A 4FZ1A 2GTAA 4I4TB 4DRXB 3BRCA 4FJCC 4I50A 5JH7A 1U97A 5CBHA 2YC0A 1MA1A 1NH2D 3D36C 3JAMN 1T5EA 4KP4A 1TUBB 1XMQO 4X62B 1FXKC 5LL6Y 2OTLV 3A0RA 1JMKC 1RM1C 1SQPH 1N36B 1H2GA 1P7BA 1Y74A 3ZN1A 4PA6A 3APOA 4H33A 4I0XA 3U0ZA 2Q5ZA 2WA3A 4NXMO 2ITCC 3T2MA 1J5EO 1OCRB 5EBMC 5CA1B 2P7TC 1Q7YW 4LP8A 4ZI7A 1MMMA 2BOBC 2CAZC 2H3OA 3QO5A 3VQXA 4DV4B 2DE0X 3LSQA 3FB5C 2QEXV 4JYBA 2FMLA 5B1OA 1QR9A 3JAWA 4FVMA 3W7UA 1ENVA 3HPLC 1YDXA 4QPJA 4R7CA 1PL4A 2ZR2A 4RWUA 4LF8B 2YEVA 5KHJA 1RSOB 3CC2V 2QWPB 4WF9V 1L0NH 2QKCA 4PA7A 5IDJA 3W7SA 3ABUA 3RVZA 1QLNA 5DM6V 4FK5C 1M56B 1M93A 3UT5B 5IT9N 4QGPA 3ETDA 4H0LB 4TOIA 1K97A 4TQFA 1R3LC 1Y67A 3QTCA 4JI6O 1H2MA 3RW0A 2X6AA 5IYCO 4YJ2A 5LGUA 5KMGB 3RYHA 1N8RW 1SESA 1I5XA 3LDDA 3T4ZA 2EINB 1KKCA 1AVMA 3CB2A 5B1NA 1R1BA 5IJ0B 4CC6A 4FLXA 4DV3O 4B3MB 4LC1A 2FKXA 3M7MX 2CE4A 2LQTA 4R8CA 3WB0A 1PL0A 5LMNO 5DEDA 4YY3B 2ZINA 2YICA 4LF6B 3FYEB 4MT8A 3B4SA 2FL4A 4Z2WA 1KMIZ 1K5QA 3WG7C 2NNUA 1J95A 1X4TA 1R6NA 4I50B 3GVMA 5JH7B 1GN4A 4MS2A 4UCRA 1YTFD 2QGNA 3T1CA 1GK9A 4X1KA 3F5WC 5EZYA 3JSLA 4JI0B 3ZHRA 3X2QB 3ASOB 1N36O 3CC4V 2ZKOA 1TAEA 2JEUA 5EC1C 1MG1A 1Y74B 2EZPA 2JRIA 1MABG 2OIEA 4I0XB 1IXBA 5HFLA 4DV7B 4JTCB 3CC7V 2NLJC 3SPGA 4DV4O 1YJNV 1QU7A 3I5DA 3ABTA 2OYQA 3S3XA 2A0LA 2EJRA 2W6JG 3TJTA 1HNWO 4LF8O 1VMGA 3W7XA 2EIKC 2DJVA 1M1KW 2DYRC 1KP2A 2YEVB 4PA9A 1NZ6A 1GMGA 2W0FC 4G27B 2E75B 4FM0A 2L6LA 4LH7A 3CSXA 4D6TH 5JJNB 3M99B 5F2VO 2ZNIA 2KQXA 3RGBA 4DR1B 3AG4B 4D7TA 2F95B 5CA3A 3F5TA 1S5JA 2CDYA 2Z5UA 2QSAA 3B8NA 3I56V 3CHXA 3ABLB 1CPYA 2L35A 3LSUA 1R3JC 1NQTA 1MSWD 5K1XA 4NTWA 4FMTA 4EFBA 2AZ0A 1TA8A 3K9SA 5KHHA 4DR7B 4YJ2B 1KP3A 3FX7A 1W59A 3OT7A 1OZ0A 2D2CB 4B3MO 3L75H 1AR1B 1Q43A 2B1IA 5EBWC 1OHHG 4CC5A 1IDSA 4DR4B 4K0KB 4IYIA 3ABKB 1QLEC 4YY3O 4L8JA 4LF6O 4NXNB 1VQPV 3ZMZA 3SYOA 2YI8A 2VQEB 4KFMA 3DGEA 3P3NA 3AG1B 2WWWA 1HNXB 5ITZA 3WU2Z 1GM9A 2ZE5A 1BSMA 4JI3B 2DWDC 4P2ZA 2LGWA 4UVAA 4JI0O 3HKEA 3KCXA 3SJQC 3M8AA 4X1KB 4FM2A 2X6CA 1NH2B 4J7KA 5EZYB 4N23A 3A0HZ 4K8XA 1F7YA 1K34A 2MW2B 4FZ0A 4W4KA 1VQ8V 3STZC 3A2FA 4DV7O 4LCUC 2IW5A 3WFVA 2YXYA 1IBLO 5H6QA 3H9VA 1M57C 2Q0OC 3UM7A 2QWQB 2A06H 4JI1B 1JQ0A 1XNQB 2Y4UA 1VF6A 4JGSA 1XREA 3OUFA 3K9AA 4IT5A 5LYJA 4KHPB 4LF7B 3BEHA 5CBFA 1JFFA 1G6UA 2BTQA 2DOSA 3F7VC 5H2FZ 4DR1O 4X9QA 4NTYA 2Q7HA 3JATA 1KYOF 3IGAC 4NTXA 1SQVH 1WPBA 3ZS8C 1GKFA 2Q9LA 2R70A 5GTHZ 1VIBA 5E79Z 2DQ3A 3A8TA 4MVMA 4NB5A 1IX9A 5CB4A 4FLTA 2ADPA 3K5OA 4DR7O 2NN4A 2XAGA 5L3GA 4LF5O 5A2QN 4NYKA 1EN6A 3G71V 2HHHO 1H2KA 3P30A 5KX5A 1AI7A 2B9ZA 1I0HA 2PI5A 3VQWA 1S3JA 5LP6C 5LGTA 4B3RB 3KZIZ 3KG2A 1Q6IA 5J2UA 3ML0A 1KECA 3IFXA 4NXNO 4D7SA 4PJ0Z 4IYHA 1CXZB 3T1YB 3CRCA 2VQEO 2Q8VA 3BY6A 1H2SB 3CS5A 2P5OA 3OW2U 1FS0G 5LGNA 2Q4PA 1N32B 1HNXO 1G4YB 2XUMA 3CCQV 4H37A 2Y0PA 3U10A 2ILMA 2OIGA 4WFGA 4JI3O 3JCZA 2P4KA 5ITZB 1SQQH 4TSFG 2GTSA 1YITV 5D5QA 1Q6HA 1BL8A 1YTFB 4ZKIA 4K3AA 1V54C 4DR3B 3O9OA 3HKEB 1XEQA 3D36A 1EN4A 1XDCA 1FXKA 4LWSA 1W0JG 4NXMB 4N21A 2DYSB 3ZRWA 5LHHA 1ROPA 2YSUB 1NTKH 1I7FA 3AG2B 1DF5A 1NVPD 2Z0AA 2ZR3A 3SJBC 3AEIA 2UUBB 2WLMA 2AZ2A 3RVYA 1B04A 5B3SB 1SQXH 1IBMB 5FNVA 1XNQO 1HR0B 1MNGA 3LDCA 3AK2A 1AR4A 4YXWG 2B1GA 2N05A 1WPXA 4KHPO 4GYCB 1FD9A 3BAAA 2WLNA 5KA6A 1Z5VA 4UCOA 5H5NA 1VF7A 2CTRA 5LYJB 2XAFA 2EIMB 2BCCH 3B40A 1JFFB 2Q0AA 2ZXWB 2BTQB 5B1AC 3K59A 1LUVA 4ICGA 5LBQA 4CS2A 4O4JA 2ZDIC 3JATB 2RQ6A 4B7KA 4H13B 4JI6B 1MOFA 4GUNA 3C90A 1F51A 2PGGA 4GX5A 4CH6A 1S5LZ 3THOA 5CB4B 1YZBA 5GONA 1PNMA 3IC7A 4H44B 3DXRA 3RT3C 1K33A 4QIWF 4B3RO 2N74A 5KX5B 1X59A 1U96A 5BR8O 1SF9A 2HJFC 4LF4B 2WLKA 4G2KA 3CMAV 4X20A 3FAVA 1JJ2U 5J2UB 1K7DA 3QVNA 4B3SB 1N32O 3T1HB 1LNQA 1H2LA 4IIJA 3ZIAG 2QM4A 3ZRSA 4NKGB 5J9PC 3DC6A 4KL1A 1OV9A 5C8YA 4DUZB 3SPCA 2V4DA 3G80A 3RYCA 4JI8B 4X88A 3GB7C 1WP7A 3CP1A 4DR3O 4MVZA 2EIJC 4IL6Z 4UVCA 5A9GA 1QCEA 1JPXA 2BOCC 1JOYA 1F4MA 2LGQA 1JVMA 2GBOA 3RYFA 2A79B 2A9HA 4UB8Z 2HKOA 2IM9A 4WBNA 1OCRC 3L74H 1FXKB 1KB9F 4LWSB 4J9ZB 1RM1B 1PPJH 2UUBO 2EZOA 4MTXA 1IBMO 1AI4A 1HR0O 3MHHC 1SZTA 1EBOA 2JIZG 1HNWB 5FNVB 1IBKB 5DECA 2YXLA 4WCEV 4U7NA 1EZVH 4HAMA 1K8AW 2EBOA 3CCMV 2CGNA 2W0XA 2JK5C 1YSCA 2ZM6B 4GCZA 1I5YA 4FLWA 1EM1A 1PKXA 1M56C 1H2NA 5L3CA 5EYPA 2MK3A 2WAMA 5KHIA 5KUKA 1SERA 1EFRG 1O9GA 1XHZA 4DV2O 3ZRXA 5FLXN 2DQ0A 4O4JB 2QJ1A 3SYAA 3CRRA 3IAYA 1FYJA 1Z5WA 3OTOB 1BHAA 3P32A 3K06A 3AG3C 5L3FA 4XBFA 3RYIA 5B66Z 3PN1A 3QO8A 2YIAA 2IH3C 2XHBA 4JI5B 2E76B 1QVGU 1VQKV 5GONB 4O4HA 2XNDG 3H1KH 4X1IA 2ARHA 4G28B 3DXRB 4TUYA 4LF4O 3TGUH 2EILC 1Y66A 1GM8A 4JI2B 2ZIMA 2VWKA 1N0NA 5JWPA 4TWKA 3K0DA 4B3SO 3E8BA 4YIOA 2Q68A 4BW9A 2P67A 3T1HO 1N34B 3KKYA 4X20B 5BXZA 2PZSA 3FAVB 2YDEA 2XAHA 1OCCC 4UCSA 4L87A 4UB6Z 1XBLA 2D3OW 2F4VB 2PF4E 4IIJB 4DUZO 3ASNC 1VQ7V 1V55B 5CA0A 4J42A 4JI8O 2CH7A 3EVKA 1GN3A 5C8YB 3CMEV 1QR8A 4JAAA 3QG5A 4ZIBA 2OCCC 3ZHTA 3N2GA 3RYCB 3WG7B 4ZHQA 1Y6XA 4EKWA 2YIBD 5B1BC 1W0KG 4IGGA 3CRAA 4DV0B 1PM9A 1IXMA 3H1HH 3E86A 1GM7A 4KUMA 4R6ZA 3MDSA 2EULA 2IJKA 2QM8A 4FLYA 1AR5A 3RYFB 1NJIW 2PI4A 3K04A 3H1IH 5H6RA 2W6IG 1HW7A 3KCYA 4ZI7B 2JGDA 1UPGA 4PA3A 1IBLB 1R3KC 1NVPB 1BMFG 1D5AA 3IJ4A 4JASA 3BVOA 3JAWB 4X64O 1IBKO 1DLBA 2XTAA 4UCVA 1WLEA 3L72H 3E8HA 5B5EZ 1KBHA 1AILA 2R9AA 3ZBHA 4OGQB 5EIBD 1KC8W 2JVDA 3S3WA 1XNRO 2Y69C 3ICXA 1Q82W 1NI8A 1QBZA 2ZM6O 3E8FA 4TV8A 4JI4B 4LFCB 2DYRB 1L8DA 1G8MA 3OMAB 2AW9A 4PDRA 4Q6GA 5JJJB 3OR6C 1S72V 1SQBH 3CX5F 1Q8IA 1WB8A 2QWOB 3JAKA 1K3EA 3HKCA 3K03A 5EYPB 4JTDB 3OTOO 3EHBB 5JJEB 3ZCCA 1AB3A 3SYQA 1SKVA 3TCUA 1BCCH 3SPJA 3E22A 3OGCC 2M6YA 1B06A 2RJZA 1YJ9V 4GKJB 4LF5B 2JJ1G 3JD2A 4JI5O 3RYHB 1QVFU 4CH5A 5CMUA 3MAQA 3RYIB 4AQYB 2HHHB 1ZLZA 2AGAA 5IYZA 5J2TA 3SPIA 5D5PA 5TISZ 3RN4A 4O4HB 4JI2O 4X1IB 1VQ9V 2Q67A 1N34O 1YEWA 1YXBA 5HFMA 5LP6A 4UFZA 2B5UA 2P6JA 5L3BA 4J7ZA 3FB7C 3Q4HA 1XMOO 2F4VO 1E1QG 2QR4A 2HVKC 1QLEB 4RUEA 2WLLA 1YJWV 4BAYA 4MW8A 4XDLA 1S5HC 3B09A 3G6EV 1IURA 3ZEDA 3W7WA 1PD3A 5CA0B 3CYOA 2CH7B 4I5SA 4I9QA 1ZWIC 1Y4MA 3JSNA 4DV0O 3N2GB 2YIBA 1ZSPA 4ZHQB 5DN6G 4DXWA 1BGYH 3CCRV 1KKDA 2BE3A 4UUJC 1TUEB 1GH6A 1YIJV 1BQZA 3EXAA 2OWOA 2CK3G 1RFYA 1AJQA 3OMIB 2Y4TA 4YJ3A 2AXTZ 4J7JA 2X6BA 2JGDB 4UV9A 1S77D 1L1FA 5JCOC 1H8EG 4JV5O 1DTOA 2VQFO 2JS5A 4O4IA 4MW3A 1D2DA 3OAAG 3ZX6A 1BQ0A 4BIZA 1M57B 3SDLA 2UUCO 1DGSA 1DK1A 1PNLA 3FD9A 5KHKA 4CS3A 5LMUB 4JI4O 4LFCO 2DWEC 5EC2C 3CPWU 3CCVV 4TV8B 4OPAA 1XQ8A 1YHQV 3H1LH 1VQ6V 2AHYA 4DR2B 1FXVA 3JAKB 2PY5A 3MD0A 4F6RA 2E74B 2ZDIA 2ATKC 3RFRA 3B2EE 4GKJO 3VQVA 3OR7C 1US6A 3E22B 4P9OA 3UCSC 1WNSA 2GHYA 3GWOA 4AQYO 1OCZC 2YS8A 3CJHA 1UJWB 2P4VA 4QE9A 1THZA 2QTSA 2N04A 4GZRB 2UXCB 4AI8A 5BZBA 5LA6A 1N0JA 4NVPA 2P90A 5IYZB 5J2TB 4EB6A 1B3QA 4CS4A 2ETNA 5BR8B 4UXNA 4K35A 2V1DA 1OCOC 1KQSU 2Q69A 3BA9A 2FYUH 3VQYA 1FKAO 5JQGA 2KSDA 4PELA 1EZJA 4FM1A 3N2KA 5BY1A 5LP6B 3ETGA 4GLXA 4YHHB 3ABMC 1Q90D 4XDJA 3CCSV 2HJDA 1Q81W 3Q4HB 1R6TA 3K5MA 2ODMA 3ZMVA 1FFXA 1Z2GA 1HWYA 1V9PA 2AHZA 2HG5C 4E2LA 1GN2A 4DUYB 4X89A 2RMKB 1H38A 1AP5A 1FAFA 1O9HA 4JAVA 1I08A 4PHZA 2R9RB 3UO3A 2IH1C 3J80N 1K5SA 2ZT9B 4I55A 1V54B 3WB1A 3AK3A 2UU9B 2JGUA 4UCUA 4JYAB 1LUWA 4JI7B 2ZIOA 2Q6AA 4YJ3B 1WJZA 4DV5B 3E83A 4HYOA 2YUAA 1XL4A 3CXHF 5EBLC 4P30A 2X7RB 3JD1A 2PYLA 4Z1MG 3O65A 4O4IB 2EJ7A 2GUZA 3E8GA 5IY5C 2VRZA 5LMUO 3D8CA 1Q6UA 4JPRA 2XAJA 2YIDA 4J11A 1BS3A 4UV8A 3CE2A 2ZXWC 3SYCA 1WB7A 1FFTB 1ZL8A 5IJ9A 4EEQA 4DR5B 2CGOA 4DR2O 4DV2B 2M7WA 3OFNG 3T4DA 3ZMTA 3JASA 1M5IA 1P49A 3U11A 3B77A 2ZE8A 5B1AB 2XOKG 5K1PA 3MHSC 1NR1A 3LDEA 1ORQC 3VBBA 4IHJA 4ASUG 2UXCO 3OE7G 3CJHB 1SA0A 3OEEG 1FPOA 2UXDB 1KD1W 5LOVA 3K08A 2HR3A 3BA8A 2QM7A 2ZQMA 2BTOA 5LA6B 3LSSA 3ZHVA 4EB6B 4HNAA 2CTQA 1Q5OA 2Q7GA 2KG7A 2VS0A 3FYIB 2ZD9A 3JD4A 3VOUA 4X1YA 4JZ2A 5JVDA 4YHHO 5JQGB 1WA8A 4PDLA 1BZKA 4U3JA 3N2KB 4QNHB 1B6QA 2ZNJA 2C2AA 4DO2A 2GDSA 3LUTB 1XHXA 4QE7A 2WLJA 1JR9A 2RCVA 5BMVA 3JD0A 1S76D 1VEWA 2E5LB 3ETQA 4OX9B 1FFXB 1P4RA 3OD4A 4DUYO 3C3SA 4BR6A 1JCHA 3CEIA 2ZE6A 4NR1A 1M90W 4X65O 1PP9H 4HBNA 1QQCA 3QO7A 2UU9O 3ZRWB 2EIJB 3C3TA 4JYAO 1WAZA 4WFBV 4I55B 4CBCA 2HLDG 4JI7O 2IBZH 4JAUA 3QNEA 4DV5O 2UUAB 2CUGA 5KAIZ 3A0BZ 4X64B 4MVQA 2ADQB 2O57A 1VQ4V 3P3PA 1SZXA 2CTPA 3BHPA 3CCEV 4TV9A 3TETA 1NKDA 5IWAB 2A3QA 1XNRB 2IJIA 2A7WA 2WLIA 3L9DA 3ZMUA 4OXSA 2Q7EA 4JTAB 3APQA 3ZHQA 3FB8C 1K4CC 1RPOA 4DYLA 1ZTEA 2GUZB 4FFBA 2UXBB 4X66B 1PNKA 4CH4A 4DR5O 3HR0A 2LP7A 1R3IC 1JA8A 2G38A 4RQEA 3IC9A 4ZOLA 4FLUA 3JYCA 4WFHA 5LXTA 1ZL8B 1Y76A 5IJ9B 2LO1A 2OTJV 2DMXA 4DV1B 4BIOA 3ZHSA 3JASB 2EINC 2E3CA 1Q3EA 1K92A 4MVRA 2UXDO 1QNMA 4IHJB 2WLHA 1W2BU 3AG3B 2QE7G 3SJCC 2UXNA 1SA0B 1SETA 3L70H 5LOVB 3R66A 1N33B 3G4SV 3AK1A 4A5UB 4HNAB 2QWNB 2KG7B 3SYPA 2EILB 4MVSA 4X8AA 1VARA 2H94A 1FJGB 4X1YB 1GRJA 2WPDG 2JDIG 1XMOB 5JVDB 4CZZA 1WA8B 2QTOA 1G1XB 1AI5A 4DR6B 1QHTA 4E4EA 5L3EA 2QDOA 4U3JB 1V55C 3QF7A 3JCUZ 3STLC 4B3TB 2F1MA 1OCCB 2E5LO 4OX9O 5BMVB 3CRMA 2F93B 1N4CA 2LFSA 3X2QC 3ASOC 4JYCA 2JJ2G 4MTGA 1NT2B 3ASNB 4ZBMA 3SJAC 4GX0A 1PV0A 1GO3F 3K0GA 3DSQA 4DK1A 3UKMA 4KXRA 1K4DC 1XI1A 1XILA 4X62O 4O2BA 3L71H 4LR3A 1VQNV 2OCCB 3K79A 1NTZH 5LHIA 4Q20A 5KLVH 3FB6C 1R73A 4WBNB 2LW7A 5B1BB 4W4LA 4J80A 4GX2A 4DW1A 2XAQA 4AHCA 3CRQA 2GSMB 4LH6A 5CN0A 2IU3A 2UUAO 4WFAV 4TT3G 2Y48A 4LFAB 1HP8A 1LR1A 4JV5B 2QKSA 4I7ZB 2VQFB 5H9CA 3G67A 2HP8A 5JCOA 3I55V 5IWAO 3EFFK 3RWRD 4F4LA 2QKAA 4MVOA 5IYDO 2UUCB 2WA4A 2XT9A 4LF9B 1EN5A 4TV9B 1UFIA 4DV6B 2EIKB 2WLIB 2UXBO 4X66O 3JARA 4RUFA 3AG4C 3OTFA 2GV9A 1FXHA 1KU9A 4FFBB 4PA4A 2Y69B 4LBEC 1TVKA 2IU0A 3ABLC 2VWJA 4OPHA 1SC5B 3HKDA 4ZOLB 4DV1O 1VQOV 5IYBO 5LXTB 1Y76B 1SQGA 4FFKA 3OUSA 5EK0A 2ITDC 3TK1A 3BFRA 1ZAUA 3G6BA 4QPKA 2Q73A 1VF5B 4I9WA 4RO2A 2BSKA 2HVJC 4DW0A 3CCJV 3ZHUA 1E79G 4FLZA 3E2EA 3ABKC 4J41A 4TUYB 1N33O 4RAIA 3J81N 1F4NA 2IJHA 3CXCU 3H01A 1NR7A 2ZE7A 4BW5A 1FJGO 1A32A 1GTOA 1M9NA 1F23A 3OM3B 4GT1A 3AG1C 4J9YB 3N27A 4DR6O 1I94B 3HKBA 1VQ5V 4B3TO 1XL6A 2YI9A 2FB5A 2LW1A 1YCIA 3SGIA 4UCTA 4F6EA 4BIUA 5IE9A 1VP7A 3ZRVA 3W7TA 3DTUB 1M4UA 5E1AC 4YIPA 3FKSG 2CTWA 1BE3H 2F23A 2PYJA 4R50A 4O2BB 3NXSA 5KHGA 3JALA 4Z1VA 1XUQA 3SR2C 4LFAO 4LNUA 4C7UA 2Y0IA 3TXSA 5FPOA 5CBGA 1IVSA 5LHGA 4BWAA 5FPRA 2P22C 3ZMSA 3CD6V 1RPRA 1VQLV 2ZCEA 5GTIZ 4K8ZA 3J7AU 5KAFZ
chains in the Genus database with same CATH topology
3H1KH 3H1HH 2FYUH 1L0NH 1EZVH 2A06H 3L74H 3BCCH 3TGUH 1KYOF 3L73H 1KB9F 4U3FH 3L75H 3L72H 1SQBH 2BCCH 3CX5F 1PP9H 3H1JH 1NTMH 1PPJH 1SQVH 1BGYH 1SQXH 3L71H 4PD4F 1NTZH 3L70H 3H1IH 1SQPH 3H1LH 5KLVH 1BCCH 1BE3H 1L0LH 2IBZH 3CXHF 4D6TH 1NU1H 1NTKH 1P84F 1SQQH 3CWBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K H;  3H1H H;  2FYU H;  1L0N H;  1EZV H;  2A06 H;  3L74 H;  3BCC H;  3TGU H;  1KYO F;  3L73 H;  1KB9 F;  4U3F H;  3L75 H;  3L72 H;  1SQB H;  2BCC H;  3CX5 F;  1PP9 H;  3H1J H;  1NTM H;  1PPJ H;  1SQV H;  1BGY H;  1SQX H;  3L71 H;  4PD4 F;  1NTZ H;  3L70 H;  3H1I H;  1SQP H;  3H1L H;  5KLV H;  1BCC H;  1BE3 H;  1L0L H;  2IBZ H;  3CXH F;  4D6T H;  1NU1 H;  1NTK H;  1P84 F;  1SQQ H;  3CWB H; 
#chains in the Genus database with same CATH topology
 4LF9 O;  1NS1 A;  1MZF A;  4DV6 O;  5FL7 G;  2EX3 A;  2RDC A;  3BCC H;  4O2A A;  3K5L A;  1URF A;  1CEZ A;  3LNM B;  1RP3 B;  2JS3 A;  1XOU A;  1YF2 A;  3JAR B;  3K57 A;  1KUQ A;  1TVK B;  3HKC B;  3OEH G;  1TGO A;  3BPZ A;  3HKD B;  2FTK A;  4CH3 A;  3R65 A;  4TQD A;  1ZUQ A;  1OJH A;  3PJS K;  4B08 A;  1SQF A;  2RNB A;  3SPH A;  1MZE A;  2LJ2 A;  1NU1 H;  3RBZ A;  4RQF A;  2BSK B;  1S0V A;  4O4L A;  3CWB H;  2R72 A;  2QA4 V;  1ARO P;  1HDJ A;  2K1E A;  3D3I A;  2DW4 A;  1OCZ B;  1NBM G;  2X0L A;  5GW7 A;  3TXQ A;  4PDM A;  1WP8 A;  4DR4 O;  1ZX3 A;  5KA5 A;  4K0K O;  1Q86 W;  3E89 A;  1HNZ B;  2Z3Y A;  4WFE A;  3UO2 A;  1I94 O;  4GKK B;  3NR7 A;  1OCO B;  2JEX A;  4LFB B;  2LFR A;  3AG7 A;  3BAB A;  4I4T A;  2P06 A;  4DRX A;  2OCH A;  2WLL B;  4J10 A;  4PI0 A;  3HKB B;  1AJN A;  1AP6 A;  1GN6 A;  1E1R G;  4UVB A;  3ABM B;  2PUS A;  4PV1 B;  3F7Y C;  4ABM A;  1TUB A;  3GWK C;  2YXH A;  1BHB A;  1H8H G;  2DYS C;  3FFQ A;  4P9P A;  3CCU V;  1XMQ B;  3AG2 C;  4X65 B;  1WN7 A;  2PTM A;  2KB1 A;  4MVU A;  3K3W A;  4JYY A;  5KUM A;  2KKW A;  3DC5 A;  1R6K A;  4GX1 A;  5CA1 A;  2NR5 A;  5B3S C;  3JAL B;  4DK0 A;  2OT5 A;  2DN9 A;  1L0L H;  2K9P A;  4AIL C;  4JZG A;  2HEP A;  1J5E B;  3CCL V;  4LNU B;  1P84 F;  1DF4 A;  3OMN B;  1VF6 C;  4EFE A;  2QWR B;  4FLV A;  4JI1 O;  2EIM C;  1RSO A;  3ETE A;  3B8M A;  1SRY A;  4MTO A;  5EIB C;  1D5N A;  3ZJZ A;  1VQM V;  4LF7 O;  4O2A B;  2F66 C;  2R9I A;  3ZN0 A;  5IY5 B;  4PDV A;  5L3D A;  4QJF B;  3UT5 A;  3HB3 B;  3L73 H;  3H1J H;  4FIP C;  4FPP A;  3WB2 A;  4F6R B;  2WSS G;  1AJP A;  2F43 G;  4MTF A;  1COW G;  4HZ3 A;  3E35 A;  3UQ8 A;  1JX9 A;  4MSW C;  1IZ3 A;  5KMG A;  2XAS A;  4U7O A;  4WFF A;  4B7E A;  1K73 W;  1AI6 A;  3D3Q A;  1P7G A;  4XDK A;  1GAX A;  1MSD A;  1YVW A;  4U3F H;  3LNN A;  1K9M W;  2UXX A;  5IJ0 A;  2HFE C;  1NTM H;  3OGI B;  5C93 A;  5AG2 A;  4PD4 F;  4O4L B;  3K5N A;  2H8P C;  3JD3 A;  4JF3 A;  4DV3 B;  1HNZ O;  2V7Q G;  1BT8 A;  4GKK O;  3K58 A;  1SS3 A;  1YI2 V;  4LFB O;  4PI2 A;  5LMN B;  3T1Y O;  1JJO A;  2IJJ A;  2RN9 A;  1CP9 A;  4FZ1 A;  2GTA A;  4I4T B;  4DRX B;  3BRC A;  4FJC C;  4I50 A;  5JH7 A;  1U97 A;  5CBH A;  2YC0 A;  1MA1 A;  1NH2 D;  3D36 C;  3JAM N;  1T5E A;  4KP4 A;  1TUB B;  1XMQ O;  4X62 B;  1FXK C;  5LL6 Y;  2OTL V;  3A0R A;  1JMK C;  1RM1 C;  1SQP H;  1N36 B;  1H2G A;  1P7B A;  1Y74 A;  3ZN1 A;  4PA6 A;  3APO A;  4H33 A;  4I0X A;  3U0Z A;  2Q5Z A;  2WA3 A;  4NXM O;  2ITC C;  3T2M A;  1J5E O;  1OCR B;  5EBM C;  5CA1 B;  2P7T C;  1Q7Y W;  4LP8 A;  4ZI7 A;  1MMM A;  2BOB C;  2CAZ C;  2H3O A;  3QO5 A;  3VQX A;  4DV4 B;  2DE0 X;  3LSQ A;  3FB5 C;  2QEX V;  4JYB A;  2FML A;  5B1O A;  1QR9 A;  3JAW A;  4FVM A;  3W7U A;  1ENV A;  3HPL C;  1YDX A;  4QPJ A;  4R7C A;  1PL4 A;  2ZR2 A;  4RWU A;  4LF8 B;  2YEV A;  5KHJ A;  1RSO B;  3CC2 V;  2QWP B;  4WF9 V;  1L0N H;  2QKC A;  4PA7 A;  5IDJ A;  3W7S A;  3ABU A;  3RVZ A;  1QLN A;  5DM6 V;  4FK5 C;  1M56 B;  1M93 A;  3UT5 B;  5IT9 N;  4QGP A;  3ETD A;  4H0L B;  4TOI A;  1K97 A;  4TQF A;  1R3L C;  1Y67 A;  3QTC A;  4JI6 O;  1H2M A;  3RW0 A;  2X6A A;  5IYC O;  4YJ2 A;  5LGU A;  5KMG B;  3RYH A;  1N8R W;  1SES A;  1I5X A;  3LDD A;  3T4Z A;  2EIN B;  1KKC A;  1AVM A;  3CB2 A;  5B1N A;  1R1B A;  5IJ0 B;  4CC6 A;  4FLX A;  4DV3 O;  4B3M B;  4LC1 A;  2FKX A;  3M7M X;  2CE4 A;  2LQT A;  4R8C A;  3WB0 A;  1PL0 A;  5LMN O;  5DED A;  4YY3 B;  2ZIN A;  2YIC A;  4LF6 B;  3FYE B;  4MT8 A;  3B4S A;  2FL4 A;  4Z2W A;  1KMI Z;  1K5Q A;  3WG7 C;  2NNU A;  1J95 A;  1X4T A;  1R6N A;  4I50 B;  3GVM A;  5JH7 B;  1GN4 A;  4MS2 A;  4UCR A;  1YTF D;  2QGN A;  3T1C A;  1GK9 A;  4X1K A;  3F5W C;  5EZY A;  3JSL A;  4JI0 B;  3ZHR A;  3X2Q B;  3ASO B;  1N36 O;  3CC4 V;  2ZKO A;  1TAE A;  2JEU A;  5EC1 C;  1MG1 A;  1Y74 B;  2EZP A;  2JRI A;  1MAB G;  2OIE A;  4I0X B;  1IXB A;  5HFL A;  4DV7 B;  4JTC B;  3CC7 V;  2NLJ C;  3SPG A;  4DV4 O;  1YJN V;  1QU7 A;  3I5D A;  3ABT A;  2OYQ A;  3S3X A;  2A0L A;  2EJR A;  2W6J G;  3TJT A;  1HNW O;  4LF8 O;  1VMG A;  3W7X A;  2EIK C;  2DJV A;  1M1K W;  2DYR C;  1KP2 A;  2YEV B;  4PA9 A;  1NZ6 A;  1GMG A;  2W0F C;  4G27 B;  2E75 B;  4FM0 A;  2L6L A;  4LH7 A;  3CSX A;  4D6T H;  5JJN B;  3M99 B;  5F2V O;  2ZNI A;  2KQX A;  3RGB A;  4DR1 B;  3AG4 B;  4D7T A;  2F95 B;  5CA3 A;  3F5T A;  1S5J A;  2CDY A;  2Z5U A;  2QSA A;  3B8N A;  3I56 V;  3CHX A;  3ABL B;  1CPY A;  2L35 A;  3LSU A;  1R3J C;  1NQT A;  1MSW D;  5K1X A;  4NTW A;  4FMT A;  4EFB A;  2AZ0 A;  1TA8 A;  3K9S A;  5KHH A;  4DR7 B;  4YJ2 B;  1KP3 A;  3FX7 A;  1W59 A;  3OT7 A;  1OZ0 A;  2D2C B;  4B3M O;  3L75 H;  1AR1 B;  1Q43 A;  2B1I A;  5EBW C;  1OHH G;  4CC5 A;  1IDS A;  4DR4 B;  4K0K B;  4IYI A;  3ABK B;  1QLE C;  4YY3 O;  4L8J A;  4LF6 O;  4NXN B;  1VQP V;  3ZMZ A;  3SYO A;  2YI8 A;  2VQE B;  4KFM A;  3DGE A;  3P3N A;  3AG1 B;  2WWW A;  1HNX B;  5ITZ A;  3WU2 Z;  1GM9 A;  2ZE5 A;  1BSM A;  4JI3 B;  2DWD C;  4P2Z A;  2LGW A;  4UVA A;  4JI0 O;  3HKE A;  3KCX A;  3SJQ C;  3M8A A;  4X1K B;  4FM2 A;  2X6C A;  1NH2 B;  4J7K A;  5EZY B;  4N23 A;  3A0H Z;  4K8X A;  1F7Y A;  1K34 A;  2MW2 B;  4FZ0 A;  4W4K A;  1VQ8 V;  3STZ C;  3A2F A;  4DV7 O;  4LCU C;  2IW5 A;  3WFV A;  2YXY A;  1IBL O;  5H6Q A;  3H9V A;  1M57 C;  2Q0O C;  3UM7 A;  2QWQ B;  2A06 H;  4JI1 B;  1JQ0 A;  1XNQ B;  2Y4U A;  1VF6 A;  4JGS A;  1XRE A;  3OUF A;  3K9A A;  4IT5 A;  5LYJ A;  4KHP B;  4LF7 B;  3BEH A;  5CBF A;  1JFF A;  1G6U A;  2BTQ A;  2DOS A;  3F7V C;  5H2F Z;  4DR1 O;  4X9Q A;  4NTY A;  2Q7H A;  3JAT A;  1KYO F;  3IGA C;  4NTX A;  1SQV H;  1WPB A;  3ZS8 C;  1GKF A;  2Q9L A;  2R70 A;  5GTH Z;  1VIB A;  5E79 Z;  2DQ3 A;  3A8T A;  4MVM A;  4NB5 A;  1IX9 A;  5CB4 A;  4FLT A;  2ADP A;  3K5O A;  4DR7 O;  2NN4 A;  2XAG A;  5L3G A;  4LF5 O;  5A2Q N;  4NYK A;  1EN6 A;  3G71 V;  2HHH O;  1H2K A;  3P30 A;  5KX5 A;  1AI7 A;  2B9Z A;  1I0H A;  2PI5 A;  3VQW A;  1S3J A;  5LP6 C;  5LGT A;  4B3R B;  3KZI Z;  3KG2 A;  1Q6I A;  5J2U A;  3ML0 A;  1KEC A;  3IFX A;  4NXN O;  4D7S A;  4PJ0 Z;  4IYH A;  1CXZ B;  3T1Y B;  3CRC A;  2VQE O;  2Q8V A;  3BY6 A;  1H2S B;  3CS5 A;  2P5O A;  3OW2 U;  1FS0 G;  5LGN A;  2Q4P A;  1N32 B;  1HNX O;  1G4Y B;  2XUM A;  3CCQ V;  4H37 A;  2Y0P A;  3U10 A;  2ILM A;  2OIG A;  4WFG A;  4JI3 O;  3JCZ A;  2P4K A;  5ITZ B;  1SQQ H;  4TSF G;  2GTS A;  1YIT V;  5D5Q A;  1Q6H A;  1BL8 A;  1YTF B;  4ZKI A;  4K3A A;  1V54 C;  4DR3 B;  3O9O A;  3HKE B;  1XEQ A;  3D36 A;  1EN4 A;  1XDC A;  1FXK A;  4LWS A;  1W0J G;  4NXM B;  4N21 A;  2DYS B;  3ZRW A;  5LHH A;  1ROP A;  2YSU B;  1NTK H;  1I7F A;  3AG2 B;  1DF5 A;  1NVP D;  2Z0A A;  2ZR3 A;  3SJB C;  3AEI A;  2UUB B;  2WLM A;  2AZ2 A;  3RVY A;  1B04 A;  5B3S B;  1SQX H;  1IBM B;  5FNV A;  1XNQ O;  1HR0 B;  1MNG A;  3LDC A;  3AK2 A;  1AR4 A;  4YXW G;  2B1G A;  2N05 A;  1WPX A;  4KHP O;  4GYC B;  1FD9 A;  3BAA A;  2WLN A;  5KA6 A;  1Z5V A;  4UCO A;  5H5N A;  1VF7 A;  2CTR A;  5LYJ B;  2XAF A;  2EIM B;  2BCC H;  3B40 A;  1JFF B;  2Q0A A;  2ZXW B;  2BTQ B;  5B1A C;  3K59 A;  1LUV A;  4ICG A;  5LBQ A;  4CS2 A;  4O4J A;  2ZDI C;  3JAT B;  2RQ6 A;  4B7K A;  4H13 B;  4JI6 B;  1MOF A;  4GUN A;  3C90 A;  1F51 A;  2PGG A;  4GX5 A;  4CH6 A;  1S5L Z;  3THO A;  5CB4 B;  1YZB A;  5GON A;  1PNM A;  3IC7 A;  4H44 B;  3DXR A;  3RT3 C;  1K33 A;  4QIW F;  4B3R O;  2N74 A;  5KX5 B;  1X59 A;  1U96 A;  5BR8 O;  1SF9 A;  2HJF C;  4LF4 B;  2WLK A;  4G2K A;  3CMA V;  4X20 A;  3FAV A;  1JJ2 U;  5J2U B;  1K7D A;  3QVN A;  4B3S B;  1N32 O;  3T1H B;  1LNQ A;  1H2L A;  4IIJ A;  3ZIA G;  2QM4 A;  3ZRS A;  4NKG B;  5J9P C;  3DC6 A;  4KL1 A;  1OV9 A;  5C8Y A;  4DUZ B;  3SPC A;  2V4D A;  3G80 A;  3RYC A;  4JI8 B;  4X88 A;  3GB7 C;  1WP7 A;  3CP1 A;  4DR3 O;  4MVZ A;  2EIJ C;  4IL6 Z;  4UVC A;  5A9G A;  1QCE A;  1JPX A;  2BOC C;  1JOY A;  1F4M A;  2LGQ A;  1JVM A;  2GBO A;  3RYF A;  2A79 B;  2A9H A;  4UB8 Z;  2HKO A;  2IM9 A;  4WBN A;  1OCR C;  3L74 H;  1FXK B;  1KB9 F;  4LWS B;  4J9Z B;  1RM1 B;  1PPJ H;  2UUB O;  2EZO A;  4MTX A;  1IBM O;  1AI4 A;  1HR0 O;  3MHH C;  1SZT A;  1EBO A;  2JIZ G;  1HNW B;  5FNV B;  1IBK B;  5DEC A;  2YXL A;  4WCE V;  4U7N A;  1EZV H;  4HAM A;  1K8A W;  2EBO A;  3CCM V;  2CGN A;  2W0X A;  2JK5 C;  1YSC A;  2ZM6 B;  4GCZ A;  1I5Y A;  4FLW A;  1EM1 A;  1PKX A;  1M56 C;  1H2N A;  5L3C A;  5EYP A;  2MK3 A;  2WAM A;  5KHI A;  5KUK A;  1SER A;  1EFR G;  1O9G A;  1XHZ A;  4DV2 O;  3ZRX A;  5FLX N;  2DQ0 A;  4O4J B;  2QJ1 A;  3SYA A;  3CRR A;  3IAY A;  1FYJ A;  1Z5W A;  3OTO B;  1BHA A;  3P32 A;  3K06 A;  3AG3 C;  5L3F A;  4XBF A;  3RYI A;  5B66 Z;  3PN1 A;  3QO8 A;  2YIA A;  2IH3 C;  2XHB A;  4JI5 B;  2E76 B;  1QVG U;  1VQK V;  5GON B;  4O4H A;  2XND G;  3H1K H;  4X1I A;  2ARH A;  4G28 B;  3DXR B;  4TUY A;  4LF4 O;  3TGU H;  2EIL C;  1Y66 A;  1GM8 A;  4JI2 B;  2ZIM A;  2VWK A;  1N0N A;  5JWP A;  4TWK A;  3K0D A;  4B3S O;  3E8B A;  4YIO A;  2Q68 A;  4BW9 A;  2P67 A;  3T1H O;  1N34 B;  3KKY A;  4X20 B;  5BXZ A;  2PZS A;  3FAV B;  2YDE A;  2XAH A;  1OCC C;  4UCS A;  4L87 A;  4UB6 Z;  1XBL A;  2D3O W;  2F4V B;  2PF4 E;  4IIJ B;  4DUZ O;  3ASN C;  1VQ7 V;  1V55 B;  5CA0 A;  4J42 A;  4JI8 O;  2CH7 A;  3EVK A;  1GN3 A;  5C8Y B;  3CME V;  1QR8 A;  4JAA A;  3QG5 A;  4ZIB A;  2OCC C;  3ZHT A;  3N2G A;  3RYC B;  3WG7 B;  4ZHQ A;  1Y6X A;  4EKW A;  2YIB D;  5B1B C;  1W0K G;  4IGG A;  3CRA A;  4DV0 B;  1PM9 A;  1IXM A;  3H1H H;  3E86 A;  1GM7 A;  4KUM A;  4R6Z A;  3MDS A;  2EUL A;  2IJK A;  2QM8 A;  4FLY A;  1AR5 A;  3RYF B;  1NJI W;  2PI4 A;  3K04 A;  3H1I H;  5H6R A;  2W6I G;  1HW7 A;  3KCY A;  4ZI7 B;  2JGD A;  1UPG A;  4PA3 A;  1IBL B;  1R3K C;  1NVP B;  1BMF G;  1D5A A;  3IJ4 A;  4JAS A;  3BVO A;  3JAW B;  4X64 O;  1IBK O;  1DLB A;  2XTA A;  4UCV A;  1WLE A;  3L72 H;  3E8H A;  5B5E Z;  1KBH A;  1AIL A;  2R9A A;  3ZBH A;  4OGQ B;  5EIB D;  1KC8 W;  2JVD A;  3S3W A;  1XNR O;  2Y69 C;  3ICX A;  1Q82 W;  1NI8 A;  1QBZ A;  2ZM6 O;  3E8F A;  4TV8 A;  4JI4 B;  4LFC B;  2DYR B;  1L8D A;  1G8M A;  3OMA B;  2AW9 A;  4PDR A;  4Q6G A;  5JJJ B;  3OR6 C;  1S72 V;  1SQB H;  3CX5 F;  1Q8I A;  1WB8 A;  2QWO B;  3JAK A;  1K3E A;  3HKC A;  3K03 A;  5EYP B;  4JTD B;  3OTO O;  3EHB B;  5JJE B;  3ZCC A;  1AB3 A;  3SYQ A;  1SKV A;  3TCU A;  1BCC H;  3SPJ A;  3E22 A;  3OGC C;  2M6Y A;  1B06 A;  2RJZ A;  1YJ9 V;  4GKJ B;  4LF5 B;  2JJ1 G;  3JD2 A;  4JI5 O;  3RYH B;  1QVF U;  4CH5 A;  5CMU A;  3MAQ A;  3RYI B;  4AQY B;  2HHH B;  1ZLZ A;  2AGA A;  5IYZ A;  5J2T A;  3SPI A;  5D5P A;  5TIS Z;  3RN4 A;  4O4H B;  4JI2 O;  4X1I B;  1VQ9 V;  2Q67 A;  1N34 O;  1YEW A;  1YXB A;  5HFM A;  5LP6 A;  4UFZ A;  2B5U A;  2P6J A;  5L3B A;  4J7Z A;  3FB7 C;  3Q4H A;  1XMO O;  2F4V O;  1E1Q G;  2QR4 A;  2HVK C;  1QLE B;  4RUE A;  2WLL A;  1YJW V;  4BAY A;  4MW8 A;  4XDL A;  1S5H C;  3B09 A;  3G6E V;  1IUR A;  3ZED A;  3W7W A;  1PD3 A;  5CA0 B;  3CYO A;  2CH7 B;  4I5S A;  4I9Q A;  1ZWI C;  1Y4M A;  3JSN A;  4DV0 O;  3N2G B;  2YIB A;  1ZSP A;  4ZHQ B;  5DN6 G;  4DXW A;  1BGY H;  3CCR V;  1KKD A;  2BE3 A;  4UUJ C;  1TUE B;  1GH6 A;  1YIJ V;  1BQZ A;  3EXA A;  2OWO A;  2CK3 G;  1RFY A;  1AJQ A;  3OMI B;  2Y4T A;  4YJ3 A;  2AXT Z;  4J7J A;  2X6B A;  2JGD B;  4UV9 A;  1S77 D;  1L1F A;  5JCO C;  1H8E G;  4JV5 O;  1DTO A;  2VQF O;  2JS5 A;  4O4I A;  4MW3 A;  1D2D A;  3OAA G;  3ZX6 A;  1BQ0 A;  4BIZ A;  1M57 B;  3SDL A;  2UUC O;  1DGS A;  1DK1 A;  1PNL A;  3FD9 A;  5KHK A;  4CS3 A;  5LMU B;  4JI4 O;  4LFC O;  2DWE C;  5EC2 C;  3CPW U;  3CCV V;  4TV8 B;  4OPA A;  1XQ8 A;  1YHQ V;  3H1L H;  1VQ6 V;  2AHY A;  4DR2 B;  1FXV A;  3JAK B;  2PY5 A;  3MD0 A;  4F6R A;  2E74 B;  2ZDI A;  2ATK C;  3RFR A;  3B2E E;  4GKJ O;  3VQV A;  3OR7 C;  1US6 A;  3E22 B;  4P9O A;  3UCS C;  1WNS A;  2GHY A;  3GWO A;  4AQY O;  1OCZ C;  2YS8 A;  3CJH A;  1UJW B;  2P4V A;  4QE9 A;  1THZ A;  2QTS A;  2N04 A;  4GZR B;  2UXC B;  4AI8 A;  5BZB A;  5LA6 A;  1N0J A;  4NVP A;  2P90 A;  5IYZ B;  5J2T B;  4EB6 A;  1B3Q A;  4CS4 A;  2ETN A;  5BR8 B;  4UXN A;  4K35 A;  2V1D A;  1OCO C;  1KQS U;  2Q69 A;  3BA9 A;  2FYU H;  3VQY A;  1FKA O;  5JQG A;  2KSD A;  4PEL A;  1EZJ A;  4FM1 A;  3N2K A;  5BY1 A;  5LP6 B;  3ETG A;  4GLX A;  4YHH B;  3ABM C;  1Q90 D;  4XDJ A;  3CCS V;  2HJD A;  1Q81 W;  3Q4H B;  1R6T A;  3K5M A;  2ODM A;  3ZMV A;  1FFX A;  1Z2G A;  1HWY A;  1V9P A;  2AHZ A;  2HG5 C;  4E2L A;  1GN2 A;  4DUY B;  4X89 A;  2RMK B;  1H38 A;  1AP5 A;  1FAF A;  1O9H A;  4JAV A;  1I08 A;  4PHZ A;  2R9R B;  3UO3 A;  2IH1 C;  3J80 N;  1K5S A;  2ZT9 B;  4I55 A;  1V54 B;  3WB1 A;  3AK3 A;  2UU9 B;  2JGU A;  4UCU A;  4JYA B;  1LUW A;  4JI7 B;  2ZIO A;  2Q6A A;  4YJ3 B;  1WJZ A;  4DV5 B;  3E83 A;  4HYO A;  2YUA A;  1XL4 A;  3CXH F;  5EBL C;  4P30 A;  2X7R B;  3JD1 A;  2PYL A;  4Z1M G;  3O65 A;  4O4I B;  2EJ7 A;  2GUZ A;  3E8G A;  5IY5 C;  2VRZ A;  5LMU O;  3D8C A;  1Q6U A;  4JPR A;  2XAJ A;  2YID A;  4J11 A;  1BS3 A;  4UV8 A;  3CE2 A;  2ZXW C;  3SYC A;  1WB7 A;  1FFT B;  1ZL8 A;  5IJ9 A;  4EEQ A;  4DR5 B;  2CGO A;  4DR2 O;  4DV2 B;  2M7W A;  3OFN G;  3T4D A;  3ZMT A;  3JAS A;  1M5I A;  1P49 A;  3U11 A;  3B77 A;  2ZE8 A;  5B1A B;  2XOK G;  5K1P A;  3MHS C;  1NR1 A;  3LDE A;  1ORQ C;  3VBB A;  4IHJ A;  4ASU G;  2UXC O;  3OE7 G;  3CJH B;  1SA0 A;  3OEE G;  1FPO A;  2UXD B;  1KD1 W;  5LOV A;  3K08 A;  2HR3 A;  3BA8 A;  2QM7 A;  2ZQM A;  2BTO A;  5LA6 B;  3LSS A;  3ZHV A;  4EB6 B;  4HNA A;  2CTQ A;  1Q5O A;  2Q7G A;  2KG7 A;  2VS0 A;  3FYI B;  2ZD9 A;  3JD4 A;  3VOU A;  4X1Y A;  4JZ2 A;  5JVD A;  4YHH O;  5JQG B;  1WA8 A;  4PDL A;  1BZK A;  4U3J A;  3N2K B;  4QNH B;  1B6Q A;  2ZNJ A;  2C2A A;  4DO2 A;  2GDS A;  3LUT B;  1XHX A;  4QE7 A;  2WLJ A;  1JR9 A;  2RCV A;  5BMV A;  3JD0 A;  1S76 D;  1VEW A;  2E5L B;  3ETQ A;  4OX9 B;  1FFX B;  1P4R A;  3OD4 A;  4DUY O;  3C3S A;  4BR6 A;  1JCH A;  3CEI A;  2ZE6 A;  4NR1 A;  1M90 W;  4X65 O;  1PP9 H;  4HBN A;  1QQC A;  3QO7 A;  2UU9 O;  3ZRW B;  2EIJ B;  3C3T A;  4JYA O;  1WAZ A;  4WFB V;  4I55 B;  4CBC A;  2HLD G;  4JI7 O;  2IBZ H;  4JAU A;  3QNE A;  4DV5 O;  2UUA B;  2CUG A;  5KAI Z;  3A0B Z;  4X64 B;  4MVQ A;  2ADQ B;  2O57 A;  1VQ4 V;  3P3P A;  1SZX A;  2CTP A;  3BHP A;  3CCE V;  4TV9 A;  3TET A;  1NKD A;  5IWA B;  2A3Q A;  1XNR B;  2IJI A;  2A7W A;  2WLI A;  3L9D A;  3ZMU A;  4OXS A;  2Q7E A;  4JTA B;  3APQ A;  3ZHQ A;  3FB8 C;  1K4C C;  1RPO A;  4DYL A;  1ZTE A;  2GUZ B;  4FFB A;  2UXB B;  4X66 B;  1PNK A;  4CH4 A;  4DR5 O;  3HR0 A;  2LP7 A;  1R3I C;  1JA8 A;  2G38 A;  4RQE A;  3IC9 A;  4ZOL A;  4FLU A;  3JYC A;  4WFH A;  5LXT A;  1ZL8 B;  1Y76 A;  5IJ9 B;  2LO1 A;  2OTJ V;  2DMX A;  4DV1 B;  4BIO A;  3ZHS A;  3JAS B;  2EIN C;  2E3C A;  1Q3E A;  1K92 A;  4MVR A;  2UXD O;  1QNM A;  4IHJ B;  2WLH A;  1W2B U;  3AG3 B;  2QE7 G;  3SJC C;  2UXN A;  1SA0 B;  1SET A;  3L70 H;  5LOV B;  3R66 A;  1N33 B;  3G4S V;  3AK1 A;  4A5U B;  4HNA B;  2QWN B;  2KG7 B;  3SYP A;  2EIL B;  4MVS A;  4X8A A;  1VAR A;  2H94 A;  1FJG B;  4X1Y B;  1GRJ A;  2WPD G;  2JDI G;  1XMO B;  5JVD B;  4CZZ A;  1WA8 B;  2QTO A;  1G1X B;  1AI5 A;  4DR6 B;  1QHT A;  4E4E A;  5L3E A;  2QDO A;  4U3J B;  1V55 C;  3QF7 A;  3JCU Z;  3STL C;  4B3T B;  2F1M A;  1OCC B;  2E5L O;  4OX9 O;  5BMV B;  3CRM A;  2F93 B;  1N4C A;  2LFS A;  3X2Q C;  3ASO C;  4JYC A;  2JJ2 G;  4MTG A;  1NT2 B;  3ASN B;  4ZBM A;  3SJA C;  4GX0 A;  1PV0 A;  1GO3 F;  3K0G A;  3DSQ A;  4DK1 A;  3UKM A;  4KXR A;  1K4D C;  1XI1 A;  1XIL A;  4X62 O;  4O2B A;  3L71 H;  4LR3 A;  1VQN V;  2OCC B;  3K79 A;  1NTZ H;  5LHI A;  4Q20 A;  5KLV H;  3FB6 C;  1R73 A;  4WBN B;  2LW7 A;  5B1B B;  4W4L A;  4J80 A;  4GX2 A;  4DW1 A;  2XAQ A;  4AHC A;  3CRQ A;  2GSM B;  4LH6 A;  5CN0 A;  2IU3 A;  2UUA O;  4WFA V;  4TT3 G;  2Y48 A;  4LFA B;  1HP8 A;  1LR1 A;  4JV5 B;  2QKS A;  4I7Z B;  2VQF B;  5H9C A;  3G67 A;  2HP8 A;  5JCO A;  3I55 V;  5IWA O;  3EFF K;  3RWR D;  4F4L A;  2QKA A;  4MVO A;  5IYD O;  2UUC B;  2WA4 A;  2XT9 A;  4LF9 B;  1EN5 A;  4TV9 B;  1UFI A;  4DV6 B;  2EIK B;  2WLI B;  2UXB O;  4X66 O;  3JAR A;  4RUF A;  3AG4 C;  3OTF A;  2GV9 A;  1FXH A;  1KU9 A;  4FFB B;  4PA4 A;  2Y69 B;  4LBE C;  1TVK A;  2IU0 A;  3ABL C;  2VWJ A;  4OPH A;  1SC5 B;  3HKD A;  4ZOL B;  4DV1 O;  1VQO V;  5IYB O;  5LXT B;  1Y76 B;  1SQG A;  4FFK A;  3OUS A;  5EK0 A;  2ITD C;  3TK1 A;  3BFR A;  1ZAU A;  3G6B A;  4QPK A;  2Q73 A;  1VF5 B;  4I9W A;  4RO2 A;  2BSK A;  2HVJ C;  4DW0 A;  3CCJ V;  3ZHU A;  1E79 G;  4FLZ A;  3E2E A;  3ABK C;  4J41 A;  4TUY B;  1N33 O;  4RAI A;  3J81 N;  1F4N A;  2IJH A;  3CXC U;  3H01 A;  1NR7 A;  2ZE7 A;  4BW5 A;  1FJG O;  1A32 A;  1GTO A;  1M9N A;  1F23 A;  3OM3 B;  4GT1 A;  3AG1 C;  4J9Y B;  3N27 A;  4DR6 O;  1I94 B;  3HKB A;  1VQ5 V;  4B3T O;  1XL6 A;  2YI9 A;  2FB5 A;  2LW1 A;  1YCI A;  3SGI A;  4UCT A;  4F6E A;  4BIU A;  5IE9 A;  1VP7 A;  3ZRV A;  3W7T A;  3DTU B;  1M4U A;  5E1A C;  4YIP A;  3FKS G;  2CTW A;  1BE3 H;  2F23 A;  2PYJ A;  4R50 A;  4O2B B;  3NXS A;  5KHG A;  3JAL A;  4Z1V A;  1XUQ A;  3SR2 C;  4LFA O;  4LNU A;  4C7U A;  2Y0I A;  3TXS A;  5FPO A;  5CBG A;  1IVS A;  5LHG A;  4BWA A;  5FPR A;  2P22 C;  3ZMS A;  3CD6 V;  1RPR A;  1VQL V;  2ZCE A;  5GTI Z;  4K8Z A;  3J7A U;  5KAF Z; 
#chains in the Genus database with same CATH homology
 3H1K H;  3H1H H;  2FYU H;  1L0N H;  1EZV H;  2A06 H;  3L74 H;  3BCC H;  3TGU H;  1KYO F;  3L73 H;  1KB9 F;  4U3F H;  3L75 H;  3L72 H;  1SQB H;  2BCC H;  3CX5 F;  1PP9 H;  3H1J H;  1NTM H;  1PPJ H;  1SQV H;  1BGY H;  1SQX H;  3L71 H;  4PD4 F;  1NTZ H;  3L70 H;  3H1I H;  1SQP H;  3H1L H;  5KLV H;  1BCC H;  1BE3 H;  1L0L H;  2IBZ H;  3CXH F;  4D6T H;  1NU1 H;  1NTK H;  1P84 F;  1SQQ H;  3CWB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...