3L71H

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l71H00
1KYOF 5KLVH 2FYUH 3H1KH 1BCCH 1P84F 2A06H 3L75H 4D6TH 3H1LH 1NTMH 3L73H 1BE3H 1NTKH 3L70H 1SQBH 1KB9F 1PPJH 3H1HH 1EZVH 3L74H 4PD4F 3CX5F 1L0NH 1BGYH 3H1JH 1SQVH 1PP9H 4U3FH 3CWBH 1SQXH 1SQPH 3BCCH 1NU1H 3L72H 3H1IH 3TGUH 1L0LH 2IBZH 1SQQH 2BCCH 3CXHF 1NTZH 3L71H
chains in the Genus database with same CATH superfamily
4EEQA 4ZIBA 2ZM6B 2VRZA 1FXHA 2W6JG 4OPHA 2UUBB 5LYJA 5IT9N 3BY6A 4RUFA 2HVJC 3MHHC 1GM8A 4JI4O 1BSMA 2C2AA 5L3FA 2D2CB 4LF7O 4JYAB 3H1IH 2JEUA 3OTFA 4X65O 1IBMO 4O4JA 2PTMA 2M6YA 2X6CA 4MVMA 5CN0A 3K5MA 2QR4A 4LF8O 4MTXA 1R3IC 4AQYO 3L73H 4CS3A 1FJGB 4PDRA 2AHYA 5KUKA 1NJIW 3CHXA 1SQGA 3CRCA 1WJZA 3APOA 5KHGA 2FB5A 3SR2C 3ABKB 4RWUA 3CXHF 3D36A 3WFVA 5KLVH 3DC5A 4TSFG 2QTOA 3RVYA 3S3WA 1SZTA 4HZ3A 3CS5A 5JVDB 1Q6HA 2NN4A 3JALB 2DWDC 1XHZA 5IYBO 3ABUA 2H3OA 3CYOA 4Z1MG 2IU3A 1VF5B 5CA3A 5KAFZ 2YEVA 5BR8O 4JI8B 2XTAA 2W0FC 1QQCA 4H13B 4B3MB 1WNSA 5GONB 4BR6A 1FXKA 5KHHA 4NXMB 4O4LB 2P22C 4D6TH 1BHAA 3CCLV 1VQ9V 1AVMA 3CEIA 3TK1A 3BEHA 1Q6IA 4WFHA 2Q73A 2KKWA 1FFXA 4I9WA 1QCEA 3HKEB 1IXMA 3W7WA 3FYEB 3MDSA 2CH7A 5FLXN 2H94A 5LHIA 4OXSA 4O2AB 2X0LA 4HAMA 3AG1C 3N2GB 3SDLA 3CPWU 3KG2A 4X88A 4B3TB 3LNMB 5LMNB 2Y69C 1OCZC 1Z2GA 2QM4A 3LDDA 4JYCA 5H5NA 4N21A 4LF7B 2Q68A 3WG7C 4X62O 2WWWA 2AXTZ 4WFAV 3UCSC 2D3OW 3L71H 5HFLA 5EBWC 5JQGA 4DUZO 3ZHTA 2CDYA 1NTKH 2IH1C 3FFQA 1DF4A 2EIMC 4TWKA 4B3RO 2QKAA 2WLNA 5GTHZ 1XL6A 1YJNV 1OCRC 3JD4A 3Q4HB 5JWPA 5LOVA 3VQYA 5LMUO 4YIOA 4DR5B 4XBFA 1MSDA 2ZM6O 1BHBA 1S5LZ 4O4LA 4JAAA 3U0ZA 5IJ0B 1PNKA 3OEHG 2BTQA 1IBKO 3CJHA 3G80A 2P4KA 1GH6A 1IBLO 3TXSA 3EHBB 1WB8A 2PUSA 3CCSV 4BW5A 4WFFA 5DM6V 1LUVA 1P4RA 2QWNB 1EN5A 4DK1A 4GCZA 2K1EA 4PDLA 2YIBA 3ZRSA 1NT2B 1X4TA 1PV0A 2CTRA 5B3SC 3OTOO 3GWOA 1JJOA 4Q6GA 5KA6A 2R9IA 3LDCA 2E74B 3CCVV 3OGIB 3JCUZ 4G28B 3ZIAG 4O2AA 2FMLA 5B1AC 2IBZH 2Y69B 2Z3YA 1W59A 5EK0A 1I94B 5LP6A 5CBGA 5EC2C 2P90A 4O4HA 4FZ1A 1QR8A 1QHTA 1D2DA 1MSWD 1ZTEA 2UXCO 1K4DC 1TVKA 2B9ZA 3ZEDA 1H8HG 5LHGA 3QNEA 3ZMTA 1Y76A 1H38A 3CWBH 1PL4A 2GV9A 2DYSB 3WB2A 1N34B 1AI6A 3T1YB 1ENVA 4DRXA 2ZKOA 3CC2V 4B08A 3FAVB 2B1IA 3K0DA 4DR6B 2EIJC 5L3GA 2EULA 4PJ0Z 2HP8A 4RQEA 4Q20A 3U11A 1CPYA 1DGSA 1OV9A 3CCRV 3H1JH 4DV7O 1YXBA 5B1OA 5CA0A 4LC1A 3T1HB 2QM8A 1Y66A 2JS3A 1H2SB 4DXWA 2R9AA 1JVMA 3A8TA 3JAKB 2GUZB 1WP7A 1IBLB 4NXNB 1R3JC 4JI0O 3CCJV 3ABKC 2HVKC 2ZNJA 4UB6Z 2CTWA 3DTUB 4G27B 4UUJC 3CC7V 3RVZA 3SJAC 4QPJA 2XAFA 3RN4A 2DN9A 1HNWO 2QKCA 4DV5B 1PNLA 1G8MA 3S3XA 2UXXA 4U3JB 4CH3A 3I5DA 3JAMN 3ZRWA 1EFRG 1B04A 3K04A 4PI2A 4B3SB 1Q8IA 4K0KB 2A7WA 4YY3B 3HKCA 3ICXA 5H9CA 2LP7A 1YSCA 1I08A 2R9RB 1D5AA 2ODMA 5B1AB 1SA0B 2IJKA 1YDXA 3RW0A 4MTFA 1FKAO 1XMOB 3CSXA 3EFFK 1F7YA 1N34O 4X20B 2RDCA 2LO1A 4PHZA 4I55A 5C93A 2GDSA 3OM3B 3VOUA 3WU2Z 3C90A 3CP1A 3QO7A 4UVBA 4AI8A 1E79G 5L3DA 1WP8A 3UT5B 2ZNIA 2GBOA 2PY5A 4DW1A 2ZCEA 1FXKB 1BL8A 1I94O 4RAIA 3NXSA 4JTCB 2JJ2G 3GWKC 5JJEB 5TISZ 2WLHA 3ZMSA 5CA0B 3RT3C 2EIMB 3ZMVA 3K5NA 4CS4A 1P49A 3AK2A 2ZE7A 4FLZA 2K9PA 2OYQA 2A0LA 4YJ2B 1W0KG 1N8RW 3FAVA 1XOUA 2JJ1G 4P2ZA 5A2QN 4LF9O 5BMVA 1K97A 5LL6Y 4JYYA 4PA3A 3ZHQA 1VQ4V 4K3AA 4ZBMA 2LJ2A 4KP4A 2WPDG 3RGBA 1YF2A 4X1IB 5B1NA 4GKKB 1TVKB 4AQYB 4JI7O 3CMAV 3E86A 1KBHA 3UT5A 3RWRD 2WLJA 4B7EA 1V54B 2F95B 3E8FA 4DR1O 1NR1A 3WG7B 4KFMA 2DJVA 3ASOC 3JATB 1YJWV 2G38A 1K92A 2WA3A 5CMUA 2CTQA 1PPJH 3H1HH 1I5YA 4FMTA 4JZ2A 4MTGA 1GM9A 4EFBA 1OHHG 2VQEO 4QNHB 3UKMA 3ZBHA 4DV4B 3M7MX 5LYJB 1UPGA 1S5HC 1VQMV 1MA1A 4J7ZA 4MW3A 5IYZA 4NTYA 3AG4B 3TCUA 1Q5OA 3BHPA 1AJPA 2Y4UA 5E1AC 5CA1B 5IY5C 2ZINA 4LF6B 4DV5O 4UVAA 5B1BC 2BTQB 3SPIA 3ZN0A 4X8AA 4JGSA 3B2EE 1B6QA 2MW2B 2V1DA 3QTCA 1IVSA 5BZBA 2EZPA 4K0KO 1NQTA 3ABMB 4DR7B 1GN6A 1Y4MA 1F51A 2IJHA 1KB9F 3G71V 3Q4HA 2XNDG 1I0HA 1RSOA 4JF3A 1XNRO 1N36O 4JAUA 4JTDB 1T5EA 3OFNG 2W0XA 1J5EB 1XEQA 4H33A 1PD3A 5EC1C 3ASNB 2GHYA 5B5EZ 2ZQMA 4IIJA 4CH6A 3N2KA 2UU9O 2HEPA 1XI1A 4AHCA 2PZSA 3JSLA 3OE7G 3RYFA 2OCHA 3H1LH 5LA6A 3QO8A 2Q6AA 3CCQV 4MW8A 4DR2O 2UXDB 4PV1B 4F4LA 4PDMA 4HYOA 3SYCA 4ZKIA 3CB2A 1DTOA 5IWAB 5IDJA 3A2FA 1HW7A 4DV2B 1HDJA 1V9PA 2E76B 1NTMH 1FS0G 2QEXV 1HP8A 5L3CA 4I9QA 1EN6A 1GRJA 4UVCA 3FX7A 5D5PA 4XDKA 1FFXB 5KAIZ 1FYJA 4I4TA 3E8BA 2AW9A 4L8JA 2Q8VA 2YXYA 4O4HB 1GK9A 2QWPB 4WFGA 2WLIA 1IBKB 1THZA 3MHSC 4P30A 1S5JA 1VQ7V 4NVPA 4DW0A 1BT8A 1FJGO 1DF5A 3J7AU 1EZJA 1EZVH 4LF6O 4DR5O 4DV1B 5KA5A 3ZHVA 3SPJA 1H2LA 4YJ2A 2YC0A 2IJJA 4TQFA 2UXNA 1MZFA 2FKXA 1RPOA 2AHZA 4JI3O 1NI8A 3ASNC 3RYFB 4DV6O 4X64O 4J11A 3OMAB 2ETNA 4XDLA 4GUNA 2PYJA 4IIJB 3T4DA 2RCVA 2PGGA 3LSUA 3HKDB 5IJ0A 2AZ2A 3CJHB 1F23A 2NNUA 1RSOB 1FXVA 3KCYA 3RYHA 4JAVA 5KHKA 3ZRXA 1OCOB 2WLIB 3E2EA 1TUBA 1S77D 1NH2B 3ML0A 4RO2A 1IDSA 3X2QC 1Y67A 1JPXA 2X6BA 3J81N 2VWJA 1VMGA 1CXZB 3JYCA 4UCTA 4UV9A 4JI2O 3LSSA 4WBNB 1R3LC 4DV3B 5IYZB 2DQ3A 3MAQA 3JD2A 3OR7C 2WLLB 3AG2C 1AI7A 1WA8A 1TAEA 2YICA 4FPPA 1Y74A 3UQ8A 3C3SA 4U3JA 3AG3C 4DR3O 5FNVA 3STLC 3KKYA 1VF6C 3JARA 4X1KB 3CC4V 1Q86W 4J80A 2GTAA 4DUZB 4QPKA 4JI0B 4FLVA 3T1CA 3K3WA 4TV8B 2QE7G 4X65B 4JTAB 2QA4V 2ADQB 3G4SV 1QVGU 3E8GA 1S3JA 4R6ZA 1YVWA 5JH7B 4U7NA 3ZX6A 1YCIA 3BA9A 5JCOA 2VWKA 4GX2A 3PN1A 1DLBA 2OTLV 1KD1W 4ZHQA 3RYHB 4JI4B 5J2TA 1WPXA 1XQ8A 2YEVB 4NXNO 1NS1A 5GONA 1KUQA 3ZN1A 2ZE8A 5DN6G 2O57A 1WLEA 1JX9A 2HFEC 3MD0A 3K59A 1FD9A 2UXBB 1TGOA 4LP8A 1XDCA 2Y0PA 3ZJZA 4RQFA 2FYUH 3T4ZA 1VQOV 1HNWB 4OGQB 1M56C 3K9SA 4B3MO 3K79A 2Y4TA 2WLMA 3HKBA 3ZMZA 2QWRB 1P7BA 4QIWF 1VF7A 1SQPH 3JATA 3HB3B 5KX5A 4FLUA 2XUMA 4O2BA 4KUMA 4QGPA 2LGWA 3STZC 4X64B 3ABTA 4FIPC 4GKJB 1VF6A 1M1KW 4FLTA 4I4TB 2XAGA 1IXBA 3AEIA 5IYDO 2RN9A 3HKBB 4GX1A 4FJCC 1PNMA 2ZDIC 4FZ0A 2P5OA 3DSQA 4OX9O 4JI6B 4MVUA 2WAMA 3SGIA 3R65A 4UCOA 4JV5B 4IL6Z 4BAYA 5ITZA 1W2BU 4LF5B 4ZOLA 4UFZA 4H0LB 1RFYA 1SESA 1VQ6V 3K03A 4U7OA 3JASA 2F66C 3ABMC 1SF9A 2V7QG 3RFRA 2LW7A 1A32A 2HJFC 1SS3A 3I55V 5J2UA 1SQQH 4I0XB 3HR0A 1XREA 3JAWB 2W6IG 4GLXA 1QLEB 4FM2A 4YIPA 2EINC 1GO3F 1GTOA 4ZHQB 4KL1A 2P4VA 3D8CA 3LSQA 1JFFB 5LOVB 4FFKA 1I5XA 4LCUC 2CAZC 2Q5ZA 2ILMA 4OPAA 2NR5A 5IYCO 4YHHB 4CH5A 3QVNA 3ZHUA 2QDOA 3BFRA 4I0XA 5FNVB 5LMUB 2F93B 3EXAA 1MMMA 5J2UB 2KQXA 2YIBD 3JASB 1VQ8V 3JARB 2BE3A 1ZAUA 1NZ6A 3D3IA 2WLLA 1HR0O 1JOYA 4RUEA 2KG7B 4BIZA 4X9QA 1N33O 1OCCC 1QR9A 3R66A 5EIBD 2YDEA 1NVPB 5CB4B 4JI1B 2PI4A 2DMXA 4IT5A 2UXCB 3G6BA 1VQLV 4H37A 1Q82W 1ZL8A 4EB6A 2NLJC 1L0LH 2DQ0A 1BQZA 1KU9A 2CUGA 3SPGA 2A9HA 4DR4O 4K35A 1OCZB 1TA8A 3T1YO 4HNAA 4CC5A 4MS2A 5IJ9B 1AROP 5EZYA 2OT5A 4WFEA 3AK1A 2LGQA 1L0NH 2HR3A 3E35A 4GT1A 1Q43A 2BSKA 1Q90D 2IW5A 2Q0AA 5HFMA 2R70A 3B09A 2UUAO 4DR7O 1GN4A 3O65A 2JDIG 4E4EA 1NVPD 4KHPB 4I7ZB 3L75H 4ICGA 3SJCC 1J5EO 5D5QA 1RP3B 2UUBO 2DWEC 4DK0A 1MNGA 2JGDB 1US6A 4DV2O 3FD9A 3TETA 4G2KA 4J9ZB 1WN7A 3BCCH 3OD4A 5CBFA 3QF7A 1JMKC 2AGAA 4X66O 1V55B 3RBZA 1MZEA 3ZS8C 3F5TA 4YHHO 4LR3A 4R8CA 4LF5O 1LUWA 2B5UA 1AJNA 1R6TA 2OIEA 2YSUB 3BABA 4X89A 5IWAO 1G1XB 1QNMA 3ETDA 2IH3C 2LFSA 1AB3A 2ZR3A 3I56V 2ZR2A 2V4DA 3N27A 2QKSA 2F4VO 3THOA 2Q9LA 3T2MA 2RMKB 2HHHB 4UCRA 4TT3G 2P7TC 3DXRA 4GX5A 1ZWIC 3K9AA 1VEWA 5J9PC 2DYSC 1I7FA 1K7DA 1VP7A 1JJ2U 3SYAA 1KMIZ 4WFBV 1Y74B 1KKCA 4MTOA 1WA8B 1Z5VA 2E5LO 4WBNA 4LBEC 4LFCO 4QE7A 3N2GA 3CXCU 1XMOO 3FYIB 2KB1A 2ZXWB 1X59A 1HNZB 2ZDIA 3W7TA 4DV1O 1URFA 3JD3A 1AILA 1GAXA 2EILC 4B3SO 4TQDA 3M8AA 2AZ0A 4CBCA 3FKSG 2WA4A 1B06A 2LW1A 4FK5C 2PYLA 4E2LA 3K5LA 4DV0B 1M90W 3ZMUA 1F4NA 1UJWB 2B1GA 2CGNA 3TXQA 4LFAO 3L74H 4DO2A 4QE9A 3X2QB 2Q67A 2XAHA 5LMNO 3D3QA 4UV8A 2CGOA 2LFRA 5L3EA 4WCEV 5C8YB 2UU9B 3JSNA 1K9MW 1N0NA 2JEXA 3F7VC 2QM7A 4PA6A 4JPRA 4DUYB 3AG7A 4JYAO 1MG1A 1BZKA 1M4UA 1JQ0A 4DR2B 1IBMB 4EKWA 5F2VO 4LF8B 3ZHRA 2XASA 1VQ5V 2UUAB 2IM9A 1QU7A 4ZI7B 5LXTA 3P32A 4KHPO 4O4IA 1M57B 3RYCB 1P84F 1E1RG 2EIJB 4YJ3A 1Y76B 4PELA 3G67A 1GMGA 3K57A 1GN2A 3ETGA 3SPCA 5B66Z 4U3FH 3A0HZ 2YXLA 3SYPA 4X66B 1NU1H 3L72H 5LP6B 2Q7HA 1SZXA 3AG1B 5KUMA 2VQEB 2E5LB 2EILB 4DV4O 4JASA 3K06A 3E83A 4GKKO 2R72A 4ABMA 3UO3A 3ETQA 4J10A 4NYKA 1ZX3A 3OAAG 3VBBA 2QJ1A 1SRYA 1VQPV 4JZGA 3BVOA 2OTJV 3OTOB 5LA6B 4C7UA 5LP6C 5GTIZ 5EBMC 3B40A 3IAYA 4TV9B 4IHJA 4YXWG 2N05A 1KKDA 3IJ4A 2VS0A 2OCCC 4P9OA 5JJNB 4LH7A 1K73W 3KCXA 3HPLC 5J2TB 4JI8O 3CRQA 1COWG 1KC8W 1QLNA 1Q3EA 4MT8A 4GKJO 1JFFA 2EJ7A 3ZHSA 2OWOA 3M99B 2XAQA 3CMEV 5JH7A 4O4JB 2WLKA 1HNZO 1K3EA 2XOKG 1YI2V 1KP2A 3WB0A 1SERA 1AR5A 4TV8A 1U96A 1VQKV 3OUFA 1MOFA 3CCMV 3C3TA 1XMQO 4BIOA 3LUTB 4X20A 1VQNV 3OT7A 3HKCB 3O9OA 2FL4A 1BMFG 4DV7B 5JQGB 1K33A 3IC7A 2DE0X 1XNRB 1LR1A 3DC6A 3ZRWB 2DYRB 3IGAC 1XHXA 1SQFA 2KG7A 3BAAA 4FLYA 4FVMA 1XNQB 5H2FZ 1RM1B 4PI0A 4OX9B 1U97A 3B8MA 2A79B 3GVMA 3AG4C 4DYLA 4MSWC 3JCZA 4DR3B 1EM1A 2M7WA 3AG2B 1PL0A 2A3QA 4NR1A 2XHBA 1Q81W 3L9DA 4UB8Z 1TUBB 1YITV 2XAJA 2IU0A 4PD4F 4FLWA 1N4CA 4FM1A 3F7YC 4BW9A 3QG5A 2GUZA 2BOCC 2RNBA 5EYPB 1R6NA 2QGNA 1UFIA 3CRRA 3HKDA 1SQXH 4F6RB 5KHJA 4LF4O 3E22A 3H9VA 1AP5A 1OCOC 3P3NA 5DEDA 1BE3H 3W7XA 2YIDA 1HR0B 1AI4A 1Y6XA 2JGDA 1GKFA 1XILA 1EBOA 4GYCB 1PM9A 5K1PA 2UXBO 5BR8B 3LNNA 5ITZB 1ZLZA 3W7UA 1DK1A 3VQXA 3OUSA 3UM7A 1KYOF 2P67A 3B77A 2JIZG 3ETEA 5H6RA 3SJQC 5EIBC 2Q7GA 4CH4A 4FFBA 2OIGA 1AR4A 1R6KA 1V55C 3A0BZ 4BWAA 3AG3B 2YXHA 3SJBC 2ITDC 3K5OA 5L3BA 2QWQB 4MVRA 4O4IB 2X7RB 1XNQO 1H2NA 2P06A 5IE9A 4GZRB 3K58A 1K5QA 5CB4A 2HLDG 2DYRC 4W4LA 4UCVA 1SA0A 3U10A 4QJFB 1Q6UA 2Q7EA 1M57C 1RM1C 2XT9A 1YEWA 4P9PA 1OCCB 4LF9B 1JA8A 3CRMA 4LWSA 3CE2A 4B7KA 2ITCC 5LGUA 1ZSPA 3OMNB 3N2KB 3SPHA 4NB5A 5LGTA 2EIKB 2ZXWC 1NH2D 2QWOB 1ROPA 1P7GA 1H2MA 3BRCA 1WAZA 3K0GA 4NTXA 4IYHA 4X1YB 4I5SA 4DR1B 5BXZA 1VARA 3F5WC 2ZT9B 1M9NA 4J9YB 3H01A 2WSSG 2EX3A 5IY5B 1BQ0A 4J7JA 1L8DA 5B1BB 5FL7G 3ZRVA 3JAWA 3JAKA 2EINB 3A0RA 1K5SA 4TOIA 1LNQA 1L1FA 1KP3A 4IHJB 2YUAA 4JI5O 1M93A 3AK3A 4KXRA 2EBOA 2QTSA 5AG2A 1AJQA 1Z5WA 3P3PA 4ZOLB 4AILC 2HJDA 3LDEA 2VQFO 1YIJV 1SQBH 2JS5A 2YI8A 4YY3O 2CH7B 1SKVA 4J42A 3VQVA 5E79Z 5B3SB 1N33B 4PA9A 2L35A 1CP9A 3B8NA 3IC9A 4JI1O 1H2KA 1R3KC 4R7CA 1N36B 1GN3A 1JR9A 4J41A 1OCRB 4YJ3B 3BA8A 3RYCA 3WB1A 4O2BB 1N32B 5EBLC 4JYBA 1BCCH 4ZI7A 2YIAA 1NR7A 4PDVA 4JI6O 5DECA 2PI5A 1AI5A 4JV5O 4K8ZA 1GM7A 3W7SA 2JRIA 4I50A 1G6UA 4D7SA 1H2GA 3KZIZ 4DV3O 1YHQV 1VIBA 3JALA 2E75B 2UUCO 3L70H 5LGNA 4I50B 2YI9A 5GW7A 4X62B 4UCUA 3E8HA 4UXNA 5KHIA 5JCOC 2BSKB 4HNAB 2IJIA 4LFBO 3TJTA 4Z1VA 1YJ9V 3H1KH 4LH6A 5IJ9A 4IGGA 1M5IA 2Y0IA 2ZD9A 2JVDA 1ZUQA 4LNUB 1ZL8B 2CK3G 3ABLC 4F6EA 2E3CA 2Q0OC 2BTOA 2ZE6A 2CE4A 3OMIB 4CS2A 5A9GA 4Z2WA 1E1QG 1SC5B 2VQFB 2CTPA 2HHHO 4LWSB 3SYOA 1KECA 3OW2U 4JI3B 1Q7YW 4MVOA 4DV6B 1FAFA 2Z0AA 2QSAA 4BIUA 1R73A 3CCEV 3VQWA 3DXRB 4FM0A 1HNXO 4J7KA 1AP6A 3IFXA 1NKDA 1K4CC 3HKEA 4HBNA 1K8AW 2RQ6A 2F1MA 1YTFD 4JI5B 2DW4A 4FLXA 4NTWA 4DR4B 3JD1A 1OZ0A 2Y48A 1BGYH 1J95A 2F23A 4MVQA 1H8EG 1PP9H 2F43G 4LNUA 1CEZA 2H8PC 4X1IA 4X1YA 4FFBB 3CD6V 1XMQB 1QVFU 2PF4E 3K08A 3CRAA 2GSMB 2ARHA 2N04A 1SETA 2UUCB 5K1XA 3T1HO 3DGEA 5H6QA 1WPBA 4TV9A 4LFAB 1FPOA 2GTSA 4PA4A 2Q4PA 5LBQA 4DR6O 5JVDA 4LFBB 3CCUV 4PA7A 1RPRA 1N32O 1QLEC 3OEEG 1K34A 1YTFB 3G6EV 4A5UB 2YS8A 2ZIOA 1XL4A 1ORQC 3ZCCA 3EVKA 1HWYA 1AR1B 1NBMG 2ZE5A 2X6AA 4MVZA 4DRXB 4EFEA 2ATKC 2BOBC 5EZYB 2LQTA 5BY1A 4JI7B 5EYPA 3P30A 1G4YB 2Z5UA 2JGUA 3QO5A 3TGUH 1JCHA 1IX9A 2F4VB 1PKXA 2A06H 4I55B 2EJRA 2EZOA 3CX5F 2ADPA 4EB6B 5LHHA 5LXTB 5KX5B 4R50A 1V54C 1QBZA 1WB7A 4N23A 3OGCC 3ASOB 1HNXB 2P6JA 3JD0A 1NTZH 3FB5C 1D5NA 5BMVB 4K8XA 1O9GA 1S0VA 2MK3A 2HG5C 3OR6C 1YZBA 4TUYA 4LFCB 5C8YA 5CBHA 4LF4B 1MABG 2Q69A 5KMGB 2KSDA 3RYIB 2BCCH 1EN4A 4UCSA 3E22B 1B3QA 1KQSU 2RJZA 1W0JG 1O9HA 2EIKC 4MVSA 4F6RA 4GX0A 3ABLB 1N0JA 4XDJA 2ZIMA 4IYIA 2L6LA 3GB7C 5FPRA 4DV0O 4B3TO 3FB7C 5FPOA 4NKGB 3FB6C 1FFTB 2OCCB 2JK5C 3E89A 1FXKC 4CZZA 1OJHA 3APQA 1R1BA 3BPZA 3FB8C 3NR7A 5JJJB 3D36C 3J80N 4X1KA 1XBLA 4L87A 4NXMO 4WF9V 2HKOA 1BS3A 4D7TA 3B4SA 2UXDO 2N74A 2DOSA 1F4MA 1IZ3A 4CC6A 3RYIA 4W4KA 1S76D 5CA1A 1S72V 3PJSK 3SYQA 1XUQA 4DUYO 4TUYB 4JI2B 4B3RB 1SQVH 5KMGA 2FTKA 3UO2A 4H44B 1M56B 1TUEB 1IURA 4ASUG
chains in the Genus database with same CATH topology
1KYOF 5KLVH 2FYUH 3H1KH 1BCCH 1P84F 2A06H 3L75H 4D6TH 3H1LH 1NTMH 3L73H 1BE3H 1NTKH 3L70H 1SQBH 1KB9F 1PPJH 3H1HH 1EZVH 3L74H 4PD4F 3CX5F 1L0NH 1BGYH 3H1JH 1SQVH 1PP9H 4U3FH 3CWBH 1SQXH 1SQPH 3BCCH 1NU1H 3L72H 3H1IH 3TGUH 1L0LH 2IBZH 1SQQH 2BCCH 3CXHF 1NTZH 3L71H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO F;  5KLV H;  2FYU H;  3H1K H;  1BCC H;  1P84 F;  2A06 H;  3L75 H;  4D6T H;  3H1L H;  1NTM H;  3L73 H;  1BE3 H;  1NTK H;  3L70 H;  1SQB H;  1KB9 F;  1PPJ H;  3H1H H;  1EZV H;  3L74 H;  4PD4 F;  3CX5 F;  1L0N H;  1BGY H;  3H1J H;  1SQV H;  1PP9 H;  4U3F H;  3CWB H;  1SQX H;  1SQP H;  3BCC H;  1NU1 H;  3L72 H;  3H1I H;  3TGU H;  1L0L H;  2IBZ H;  1SQQ H;  2BCC H;  3CXH F;  1NTZ H;  3L71 H; 
#chains in the Genus database with same CATH topology
 4EEQ A;  4ZIB A;  2ZM6 B;  2VRZ A;  1FXH A;  2W6J G;  4OPH A;  2UUB B;  5LYJ A;  5IT9 N;  3BY6 A;  4RUF A;  2HVJ C;  3MHH C;  1GM8 A;  4JI4 O;  1BSM A;  2C2A A;  5L3F A;  2D2C B;  4LF7 O;  4JYA B;  3H1I H;  2JEU A;  3OTF A;  4X65 O;  1IBM O;  4O4J A;  2PTM A;  2M6Y A;  2X6C A;  4MVM A;  5CN0 A;  3K5M A;  2QR4 A;  4LF8 O;  4MTX A;  1R3I C;  4AQY O;  3L73 H;  4CS3 A;  1FJG B;  4PDR A;  2AHY A;  5KUK A;  1NJI W;  3CHX A;  1SQG A;  3CRC A;  1WJZ A;  3APO A;  5KHG A;  2FB5 A;  3SR2 C;  3ABK B;  4RWU A;  3CXH F;  3D36 A;  3WFV A;  5KLV H;  3DC5 A;  4TSF G;  2QTO A;  3RVY A;  3S3W A;  1SZT A;  4HZ3 A;  3CS5 A;  5JVD B;  1Q6H A;  2NN4 A;  3JAL B;  2DWD C;  1XHZ A;  5IYB O;  3ABU A;  2H3O A;  3CYO A;  4Z1M G;  2IU3 A;  1VF5 B;  5CA3 A;  5KAF Z;  2YEV A;  5BR8 O;  4JI8 B;  2XTA A;  2W0F C;  1QQC A;  4H13 B;  4B3M B;  1WNS A;  5GON B;  4BR6 A;  1FXK A;  5KHH A;  4NXM B;  4O4L B;  2P22 C;  4D6T H;  1BHA A;  3CCL V;  1VQ9 V;  1AVM A;  3CEI A;  3TK1 A;  3BEH A;  1Q6I A;  4WFH A;  2Q73 A;  2KKW A;  1FFX A;  4I9W A;  1QCE A;  3HKE B;  1IXM A;  3W7W A;  3FYE B;  3MDS A;  2CH7 A;  5FLX N;  2H94 A;  5LHI A;  4OXS A;  4O2A B;  2X0L A;  4HAM A;  3AG1 C;  3N2G B;  3SDL A;  3CPW U;  3KG2 A;  4X88 A;  4B3T B;  3LNM B;  5LMN B;  2Y69 C;  1OCZ C;  1Z2G A;  2QM4 A;  3LDD A;  4JYC A;  5H5N A;  4N21 A;  4LF7 B;  2Q68 A;  3WG7 C;  4X62 O;  2WWW A;  2AXT Z;  4WFA V;  3UCS C;  2D3O W;  3L71 H;  5HFL A;  5EBW C;  5JQG A;  4DUZ O;  3ZHT A;  2CDY A;  1NTK H;  2IH1 C;  3FFQ A;  1DF4 A;  2EIM C;  4TWK A;  4B3R O;  2QKA A;  2WLN A;  5GTH Z;  1XL6 A;  1YJN V;  1OCR C;  3JD4 A;  3Q4H B;  5JWP A;  5LOV A;  3VQY A;  5LMU O;  4YIO A;  4DR5 B;  4XBF A;  1MSD A;  2ZM6 O;  1BHB A;  1S5L Z;  4O4L A;  4JAA A;  3U0Z A;  5IJ0 B;  1PNK A;  3OEH G;  2BTQ A;  1IBK O;  3CJH A;  3G80 A;  2P4K A;  1GH6 A;  1IBL O;  3TXS A;  3EHB B;  1WB8 A;  2PUS A;  3CCS V;  4BW5 A;  4WFF A;  5DM6 V;  1LUV A;  1P4R A;  2QWN B;  1EN5 A;  4DK1 A;  4GCZ A;  2K1E A;  4PDL A;  2YIB A;  3ZRS A;  1NT2 B;  1X4T A;  1PV0 A;  2CTR A;  5B3S C;  3OTO O;  3GWO A;  1JJO A;  4Q6G A;  5KA6 A;  2R9I A;  3LDC A;  2E74 B;  3CCV V;  3OGI B;  3JCU Z;  4G28 B;  3ZIA G;  4O2A A;  2FML A;  5B1A C;  2IBZ H;  2Y69 B;  2Z3Y A;  1W59 A;  5EK0 A;  1I94 B;  5LP6 A;  5CBG A;  5EC2 C;  2P90 A;  4O4H A;  4FZ1 A;  1QR8 A;  1QHT A;  1D2D A;  1MSW D;  1ZTE A;  2UXC O;  1K4D C;  1TVK A;  2B9Z A;  3ZED A;  1H8H G;  5LHG A;  3QNE A;  3ZMT A;  1Y76 A;  1H38 A;  3CWB H;  1PL4 A;  2GV9 A;  2DYS B;  3WB2 A;  1N34 B;  1AI6 A;  3T1Y B;  1ENV A;  4DRX A;  2ZKO A;  3CC2 V;  4B08 A;  3FAV B;  2B1I A;  3K0D A;  4DR6 B;  2EIJ C;  5L3G A;  2EUL A;  4PJ0 Z;  2HP8 A;  4RQE A;  4Q20 A;  3U11 A;  1CPY A;  1DGS A;  1OV9 A;  3CCR V;  3H1J H;  4DV7 O;  1YXB A;  5B1O A;  5CA0 A;  4LC1 A;  3T1H B;  2QM8 A;  1Y66 A;  2JS3 A;  1H2S B;  4DXW A;  2R9A A;  1JVM A;  3A8T A;  3JAK B;  2GUZ B;  1WP7 A;  1IBL B;  4NXN B;  1R3J C;  4JI0 O;  3CCJ V;  3ABK C;  2HVK C;  2ZNJ A;  4UB6 Z;  2CTW A;  3DTU B;  4G27 B;  4UUJ C;  3CC7 V;  3RVZ A;  3SJA C;  4QPJ A;  2XAF A;  3RN4 A;  2DN9 A;  1HNW O;  2QKC A;  4DV5 B;  1PNL A;  1G8M A;  3S3X A;  2UXX A;  4U3J B;  4CH3 A;  3I5D A;  3JAM N;  3ZRW A;  1EFR G;  1B04 A;  3K04 A;  4PI2 A;  4B3S B;  1Q8I A;  4K0K B;  2A7W A;  4YY3 B;  3HKC A;  3ICX A;  5H9C A;  2LP7 A;  1YSC A;  1I08 A;  2R9R B;  1D5A A;  2ODM A;  5B1A B;  1SA0 B;  2IJK A;  1YDX A;  3RW0 A;  4MTF A;  1FKA O;  1XMO B;  3CSX A;  3EFF K;  1F7Y A;  1N34 O;  4X20 B;  2RDC A;  2LO1 A;  4PHZ A;  4I55 A;  5C93 A;  2GDS A;  3OM3 B;  3VOU A;  3WU2 Z;  3C90 A;  3CP1 A;  3QO7 A;  4UVB A;  4AI8 A;  1E79 G;  5L3D A;  1WP8 A;  3UT5 B;  2ZNI A;  2GBO A;  2PY5 A;  4DW1 A;  2ZCE A;  1FXK B;  1BL8 A;  1I94 O;  4RAI A;  3NXS A;  4JTC B;  2JJ2 G;  3GWK C;  5JJE B;  5TIS Z;  2WLH A;  3ZMS A;  5CA0 B;  3RT3 C;  2EIM B;  3ZMV A;  3K5N A;  4CS4 A;  1P49 A;  3AK2 A;  2ZE7 A;  4FLZ A;  2K9P A;  2OYQ A;  2A0L A;  4YJ2 B;  1W0K G;  1N8R W;  3FAV A;  1XOU A;  2JJ1 G;  4P2Z A;  5A2Q N;  4LF9 O;  5BMV A;  1K97 A;  5LL6 Y;  4JYY A;  4PA3 A;  3ZHQ A;  1VQ4 V;  4K3A A;  4ZBM A;  2LJ2 A;  4KP4 A;  2WPD G;  3RGB A;  1YF2 A;  4X1I B;  5B1N A;  4GKK B;  1TVK B;  4AQY B;  4JI7 O;  3CMA V;  3E86 A;  1KBH A;  3UT5 A;  3RWR D;  2WLJ A;  4B7E A;  1V54 B;  2F95 B;  3E8F A;  4DR1 O;  1NR1 A;  3WG7 B;  4KFM A;  2DJV A;  3ASO C;  3JAT B;  1YJW V;  2G38 A;  1K92 A;  2WA3 A;  5CMU A;  2CTQ A;  1PPJ H;  3H1H H;  1I5Y A;  4FMT A;  4JZ2 A;  4MTG A;  1GM9 A;  4EFB A;  1OHH G;  2VQE O;  4QNH B;  3UKM A;  3ZBH A;  4DV4 B;  3M7M X;  5LYJ B;  1UPG A;  1S5H C;  1VQM V;  1MA1 A;  4J7Z A;  4MW3 A;  5IYZ A;  4NTY A;  3AG4 B;  3TCU A;  1Q5O A;  3BHP A;  1AJP A;  2Y4U A;  5E1A C;  5CA1 B;  5IY5 C;  2ZIN A;  4LF6 B;  4DV5 O;  4UVA A;  5B1B C;  2BTQ B;  3SPI A;  3ZN0 A;  4X8A A;  4JGS A;  3B2E E;  1B6Q A;  2MW2 B;  2V1D A;  3QTC A;  1IVS A;  5BZB A;  2EZP A;  4K0K O;  1NQT A;  3ABM B;  4DR7 B;  1GN6 A;  1Y4M A;  1F51 A;  2IJH A;  1KB9 F;  3G71 V;  3Q4H A;  2XND G;  1I0H A;  1RSO A;  4JF3 A;  1XNR O;  1N36 O;  4JAU A;  4JTD B;  1T5E A;  3OFN G;  2W0X A;  1J5E B;  1XEQ A;  4H33 A;  1PD3 A;  5EC1 C;  3ASN B;  2GHY A;  5B5E Z;  2ZQM A;  4IIJ A;  4CH6 A;  3N2K A;  2UU9 O;  2HEP A;  1XI1 A;  4AHC A;  2PZS A;  3JSL A;  3OE7 G;  3RYF A;  2OCH A;  3H1L H;  5LA6 A;  3QO8 A;  2Q6A A;  3CCQ V;  4MW8 A;  4DR2 O;  2UXD B;  4PV1 B;  4F4L A;  4PDM A;  4HYO A;  3SYC A;  4ZKI A;  3CB2 A;  1DTO A;  5IWA B;  5IDJ A;  3A2F A;  1HW7 A;  4DV2 B;  1HDJ A;  1V9P A;  2E76 B;  1NTM H;  1FS0 G;  2QEX V;  1HP8 A;  5L3C A;  4I9Q A;  1EN6 A;  1GRJ A;  4UVC A;  3FX7 A;  5D5P A;  4XDK A;  1FFX B;  5KAI Z;  1FYJ A;  4I4T A;  3E8B A;  2AW9 A;  4L8J A;  2Q8V A;  2YXY A;  4O4H B;  1GK9 A;  2QWP B;  4WFG A;  2WLI A;  1IBK B;  1THZ A;  3MHS C;  4P30 A;  1S5J A;  1VQ7 V;  4NVP A;  4DW0 A;  1BT8 A;  1FJG O;  1DF5 A;  3J7A U;  1EZJ A;  1EZV H;  4LF6 O;  4DR5 O;  4DV1 B;  5KA5 A;  3ZHV A;  3SPJ A;  1H2L A;  4YJ2 A;  2YC0 A;  2IJJ A;  4TQF A;  2UXN A;  1MZF A;  2FKX A;  1RPO A;  2AHZ A;  4JI3 O;  1NI8 A;  3ASN C;  3RYF B;  4DV6 O;  4X64 O;  4J11 A;  3OMA B;  2ETN A;  4XDL A;  4GUN A;  2PYJ A;  4IIJ B;  3T4D A;  2RCV A;  2PGG A;  3LSU A;  3HKD B;  5IJ0 A;  2AZ2 A;  3CJH B;  1F23 A;  2NNU A;  1RSO B;  1FXV A;  3KCY A;  3RYH A;  4JAV A;  5KHK A;  3ZRX A;  1OCO B;  2WLI B;  3E2E A;  1TUB A;  1S77 D;  1NH2 B;  3ML0 A;  4RO2 A;  1IDS A;  3X2Q C;  1Y67 A;  1JPX A;  2X6B A;  3J81 N;  2VWJ A;  1VMG A;  1CXZ B;  3JYC A;  4UCT A;  4UV9 A;  4JI2 O;  3LSS A;  4WBN B;  1R3L C;  4DV3 B;  5IYZ B;  2DQ3 A;  3MAQ A;  3JD2 A;  3OR7 C;  2WLL B;  3AG2 C;  1AI7 A;  1WA8 A;  1TAE A;  2YIC A;  4FPP A;  1Y74 A;  3UQ8 A;  3C3S A;  4U3J A;  3AG3 C;  4DR3 O;  5FNV A;  3STL C;  3KKY A;  1VF6 C;  3JAR A;  4X1K B;  3CC4 V;  1Q86 W;  4J80 A;  2GTA A;  4DUZ B;  4QPK A;  4JI0 B;  4FLV A;  3T1C A;  3K3W A;  4TV8 B;  2QE7 G;  4X65 B;  4JTA B;  2QA4 V;  2ADQ B;  3G4S V;  1QVG U;  3E8G A;  1S3J A;  4R6Z A;  1YVW A;  5JH7 B;  4U7N A;  3ZX6 A;  1YCI A;  3BA9 A;  5JCO A;  2VWK A;  4GX2 A;  3PN1 A;  1DLB A;  2OTL V;  1KD1 W;  4ZHQ A;  3RYH B;  4JI4 B;  5J2T A;  1WPX A;  1XQ8 A;  2YEV B;  4NXN O;  1NS1 A;  5GON A;  1KUQ A;  3ZN1 A;  2ZE8 A;  5DN6 G;  2O57 A;  1WLE A;  1JX9 A;  2HFE C;  3MD0 A;  3K59 A;  1FD9 A;  2UXB B;  1TGO A;  4LP8 A;  1XDC A;  2Y0P A;  3ZJZ A;  4RQF A;  2FYU H;  3T4Z A;  1VQO V;  1HNW B;  4OGQ B;  1M56 C;  3K9S A;  4B3M O;  3K79 A;  2Y4T A;  2WLM A;  3HKB A;  3ZMZ A;  2QWR B;  1P7B A;  4QIW F;  1VF7 A;  1SQP H;  3JAT A;  3HB3 B;  5KX5 A;  4FLU A;  2XUM A;  4O2B A;  4KUM A;  4QGP A;  2LGW A;  3STZ C;  4X64 B;  3ABT A;  4FIP C;  4GKJ B;  1VF6 A;  1M1K W;  4FLT A;  4I4T B;  2XAG A;  1IXB A;  3AEI A;  5IYD O;  2RN9 A;  3HKB B;  4GX1 A;  4FJC C;  1PNM A;  2ZDI C;  4FZ0 A;  2P5O A;  3DSQ A;  4OX9 O;  4JI6 B;  4MVU A;  2WAM A;  3SGI A;  3R65 A;  4UCO A;  4JV5 B;  4IL6 Z;  4BAY A;  5ITZ A;  1W2B U;  4LF5 B;  4ZOL A;  4UFZ A;  4H0L B;  1RFY A;  1SES A;  1VQ6 V;  3K03 A;  4U7O A;  3JAS A;  2F66 C;  3ABM C;  1SF9 A;  2V7Q G;  3RFR A;  2LW7 A;  1A32 A;  2HJF C;  1SS3 A;  3I55 V;  5J2U A;  1SQQ H;  4I0X B;  3HR0 A;  1XRE A;  3JAW B;  2W6I G;  4GLX A;  1QLE B;  4FM2 A;  4YIP A;  2EIN C;  1GO3 F;  1GTO A;  4ZHQ B;  4KL1 A;  2P4V A;  3D8C A;  3LSQ A;  1JFF B;  5LOV B;  4FFK A;  1I5X A;  4LCU C;  2CAZ C;  2Q5Z A;  2ILM A;  4OPA A;  2NR5 A;  5IYC O;  4YHH B;  4CH5 A;  3QVN A;  3ZHU A;  2QDO A;  3BFR A;  4I0X A;  5FNV B;  5LMU B;  2F93 B;  3EXA A;  1MMM A;  5J2U B;  2KQX A;  2YIB D;  3JAS B;  1VQ8 V;  3JAR B;  2BE3 A;  1ZAU A;  1NZ6 A;  3D3I A;  2WLL A;  1HR0 O;  1JOY A;  4RUE A;  2KG7 B;  4BIZ A;  4X9Q A;  1N33 O;  1OCC C;  1QR9 A;  3R66 A;  5EIB D;  2YDE A;  1NVP B;  5CB4 B;  4JI1 B;  2PI4 A;  2DMX A;  4IT5 A;  2UXC B;  3G6B A;  1VQL V;  4H37 A;  1Q82 W;  1ZL8 A;  4EB6 A;  2NLJ C;  1L0L H;  2DQ0 A;  1BQZ A;  1KU9 A;  2CUG A;  3SPG A;  2A9H A;  4DR4 O;  4K35 A;  1OCZ B;  1TA8 A;  3T1Y O;  4HNA A;  4CC5 A;  4MS2 A;  5IJ9 B;  1ARO P;  5EZY A;  2OT5 A;  4WFE A;  3AK1 A;  2LGQ A;  1L0N H;  2HR3 A;  3E35 A;  4GT1 A;  1Q43 A;  2BSK A;  1Q90 D;  2IW5 A;  2Q0A A;  5HFM A;  2R70 A;  3B09 A;  2UUA O;  4DR7 O;  1GN4 A;  3O65 A;  2JDI G;  4E4E A;  1NVP D;  4KHP B;  4I7Z B;  3L75 H;  4ICG A;  3SJC C;  1J5E O;  5D5Q A;  1RP3 B;  2UUB O;  2DWE C;  4DK0 A;  1MNG A;  2JGD B;  1US6 A;  4DV2 O;  3FD9 A;  3TET A;  4G2K A;  4J9Z B;  1WN7 A;  3BCC H;  3OD4 A;  5CBF A;  3QF7 A;  1JMK C;  2AGA A;  4X66 O;  1V55 B;  3RBZ A;  1MZE A;  3ZS8 C;  3F5T A;  4YHH O;  4LR3 A;  4R8C A;  4LF5 O;  1LUW A;  2B5U A;  1AJN A;  1R6T A;  2OIE A;  2YSU B;  3BAB A;  4X89 A;  5IWA O;  1G1X B;  1QNM A;  3ETD A;  2IH3 C;  2LFS A;  1AB3 A;  2ZR3 A;  3I56 V;  2ZR2 A;  2V4D A;  3N27 A;  2QKS A;  2F4V O;  3THO A;  2Q9L A;  3T2M A;  2RMK B;  2HHH B;  4UCR A;  4TT3 G;  2P7T C;  3DXR A;  4GX5 A;  1ZWI C;  3K9A A;  1VEW A;  5J9P C;  2DYS C;  1I7F A;  1K7D A;  1VP7 A;  1JJ2 U;  3SYA A;  1KMI Z;  4WFB V;  1Y74 B;  1KKC A;  4MTO A;  1WA8 B;  1Z5V A;  2E5L O;  4WBN A;  4LBE C;  4LFC O;  4QE7 A;  3N2G A;  3CXC U;  1XMO O;  3FYI B;  2KB1 A;  2ZXW B;  1X59 A;  1HNZ B;  2ZDI A;  3W7T A;  4DV1 O;  1URF A;  3JD3 A;  1AIL A;  1GAX A;  2EIL C;  4B3S O;  4TQD A;  3M8A A;  2AZ0 A;  4CBC A;  3FKS G;  2WA4 A;  1B06 A;  2LW1 A;  4FK5 C;  2PYL A;  4E2L A;  3K5L A;  4DV0 B;  1M90 W;  3ZMU A;  1F4N A;  1UJW B;  2B1G A;  2CGN A;  3TXQ A;  4LFA O;  3L74 H;  4DO2 A;  4QE9 A;  3X2Q B;  2Q67 A;  2XAH A;  5LMN O;  3D3Q A;  4UV8 A;  2CGO A;  2LFR A;  5L3E A;  4WCE V;  5C8Y B;  2UU9 B;  3JSN A;  1K9M W;  1N0N A;  2JEX A;  3F7V C;  2QM7 A;  4PA6 A;  4JPR A;  4DUY B;  3AG7 A;  4JYA O;  1MG1 A;  1BZK A;  1M4U A;  1JQ0 A;  4DR2 B;  1IBM B;  4EKW A;  5F2V O;  4LF8 B;  3ZHR A;  2XAS A;  1VQ5 V;  2UUA B;  2IM9 A;  1QU7 A;  4ZI7 B;  5LXT A;  3P32 A;  4KHP O;  4O4I A;  1M57 B;  3RYC B;  1P84 F;  1E1R G;  2EIJ B;  4YJ3 A;  1Y76 B;  4PEL A;  3G67 A;  1GMG A;  3K57 A;  1GN2 A;  3ETG A;  3SPC A;  5B66 Z;  4U3F H;  3A0H Z;  2YXL A;  3SYP A;  4X66 B;  1NU1 H;  3L72 H;  5LP6 B;  2Q7H A;  1SZX A;  3AG1 B;  5KUM A;  2VQE B;  2E5L B;  2EIL B;  4DV4 O;  4JAS A;  3K06 A;  3E83 A;  4GKK O;  2R72 A;  4ABM A;  3UO3 A;  3ETQ A;  4J10 A;  4NYK A;  1ZX3 A;  3OAA G;  3VBB A;  2QJ1 A;  1SRY A;  1VQP V;  4JZG A;  3BVO A;  2OTJ V;  3OTO B;  5LA6 B;  4C7U A;  5LP6 C;  5GTI Z;  5EBM C;  3B40 A;  3IAY A;  4TV9 B;  4IHJ A;  4YXW G;  2N05 A;  1KKD A;  3IJ4 A;  2VS0 A;  2OCC C;  4P9O A;  5JJN B;  4LH7 A;  1K73 W;  3KCX A;  3HPL C;  5J2T B;  4JI8 O;  3CRQ A;  1COW G;  1KC8 W;  1QLN A;  1Q3E A;  4MT8 A;  4GKJ O;  1JFF A;  2EJ7 A;  3ZHS A;  2OWO A;  3M99 B;  2XAQ A;  3CME V;  5JH7 A;  4O4J B;  2WLK A;  1HNZ O;  1K3E A;  2XOK G;  1YI2 V;  1KP2 A;  3WB0 A;  1SER A;  1AR5 A;  4TV8 A;  1U96 A;  1VQK V;  3OUF A;  1MOF A;  3CCM V;  3C3T A;  1XMQ O;  4BIO A;  3LUT B;  4X20 A;  1VQN V;  3OT7 A;  3HKC B;  3O9O A;  2FL4 A;  1BMF G;  4DV7 B;  5JQG B;  1K33 A;  3IC7 A;  2DE0 X;  1XNR B;  1LR1 A;  3DC6 A;  3ZRW B;  2DYR B;  3IGA C;  1XHX A;  1SQF A;  2KG7 A;  3BAA A;  4FLY A;  4FVM A;  1XNQ B;  5H2F Z;  1RM1 B;  4PI0 A;  4OX9 B;  1U97 A;  3B8M A;  2A79 B;  3GVM A;  3AG4 C;  4DYL A;  4MSW C;  3JCZ A;  4DR3 B;  1EM1 A;  2M7W A;  3AG2 B;  1PL0 A;  2A3Q A;  4NR1 A;  2XHB A;  1Q81 W;  3L9D A;  4UB8 Z;  1TUB B;  1YIT V;  2XAJ A;  2IU0 A;  4PD4 F;  4FLW A;  1N4C A;  4FM1 A;  3F7Y C;  4BW9 A;  3QG5 A;  2GUZ A;  2BOC C;  2RNB A;  5EYP B;  1R6N A;  2QGN A;  1UFI A;  3CRR A;  3HKD A;  1SQX H;  4F6R B;  5KHJ A;  4LF4 O;  3E22 A;  3H9V A;  1AP5 A;  1OCO C;  3P3N A;  5DED A;  1BE3 H;  3W7X A;  2YID A;  1HR0 B;  1AI4 A;  1Y6X A;  2JGD A;  1GKF A;  1XIL A;  1EBO A;  4GYC B;  1PM9 A;  5K1P A;  2UXB O;  5BR8 B;  3LNN A;  5ITZ B;  1ZLZ A;  3W7U A;  1DK1 A;  3VQX A;  3OUS A;  3UM7 A;  1KYO F;  2P67 A;  3B77 A;  2JIZ G;  3ETE A;  5H6R A;  3SJQ C;  5EIB C;  2Q7G A;  4CH4 A;  4FFB A;  2OIG A;  1AR4 A;  1R6K A;  1V55 C;  3A0B Z;  4BWA A;  3AG3 B;  2YXH A;  3SJB C;  2ITD C;  3K5O A;  5L3B A;  2QWQ B;  4MVR A;  4O4I B;  2X7R B;  1XNQ O;  1H2N A;  2P06 A;  5IE9 A;  4GZR B;  3K58 A;  1K5Q A;  5CB4 A;  2HLD G;  2DYR C;  4W4L A;  4UCV A;  1SA0 A;  3U10 A;  4QJF B;  1Q6U A;  2Q7E A;  1M57 C;  1RM1 C;  2XT9 A;  1YEW A;  4P9P A;  1OCC B;  4LF9 B;  1JA8 A;  3CRM A;  4LWS A;  3CE2 A;  4B7K A;  2ITC C;  5LGU A;  1ZSP A;  3OMN B;  3N2K B;  3SPH A;  4NB5 A;  5LGT A;  2EIK B;  2ZXW C;  1NH2 D;  2QWO B;  1ROP A;  1P7G A;  1H2M A;  3BRC A;  1WAZ A;  3K0G A;  4NTX A;  4IYH A;  4X1Y B;  4I5S A;  4DR1 B;  5BXZ A;  1VAR A;  3F5W C;  2ZT9 B;  1M9N A;  4J9Y B;  3H01 A;  2WSS G;  2EX3 A;  5IY5 B;  1BQ0 A;  4J7J A;  1L8D A;  5B1B B;  5FL7 G;  3ZRV A;  3JAW A;  3JAK A;  2EIN B;  3A0R A;  1K5S A;  4TOI A;  1LNQ A;  1L1F A;  1KP3 A;  4IHJ B;  2YUA A;  4JI5 O;  1M93 A;  3AK3 A;  4KXR A;  2EBO A;  2QTS A;  5AG2 A;  1AJQ A;  1Z5W A;  3P3P A;  4ZOL B;  4AIL C;  2HJD A;  3LDE A;  2VQF O;  1YIJ V;  1SQB H;  2JS5 A;  2YI8 A;  4YY3 O;  2CH7 B;  1SKV A;  4J42 A;  3VQV A;  5E79 Z;  5B3S B;  1N33 B;  4PA9 A;  2L35 A;  1CP9 A;  3B8N A;  3IC9 A;  4JI1 O;  1H2K A;  1R3K C;  4R7C A;  1N36 B;  1GN3 A;  1JR9 A;  4J41 A;  1OCR B;  4YJ3 B;  3BA8 A;  3RYC A;  3WB1 A;  4O2B B;  1N32 B;  5EBL C;  4JYB A;  1BCC H;  4ZI7 A;  2YIA A;  1NR7 A;  4PDV A;  4JI6 O;  5DEC A;  2PI5 A;  1AI5 A;  4JV5 O;  4K8Z A;  1GM7 A;  3W7S A;  2JRI A;  4I50 A;  1G6U A;  4D7S A;  1H2G A;  3KZI Z;  4DV3 O;  1YHQ V;  1VIB A;  3JAL A;  2E75 B;  2UUC O;  3L70 H;  5LGN A;  4I50 B;  2YI9 A;  5GW7 A;  4X62 B;  4UCU A;  3E8H A;  4UXN A;  5KHI A;  5JCO C;  2BSK B;  4HNA B;  2IJI A;  4LFB O;  3TJT A;  4Z1V A;  1YJ9 V;  3H1K H;  4LH6 A;  5IJ9 A;  4IGG A;  1M5I A;  2Y0I A;  2ZD9 A;  2JVD A;  1ZUQ A;  4LNU B;  1ZL8 B;  2CK3 G;  3ABL C;  4F6E A;  2E3C A;  2Q0O C;  2BTO A;  2ZE6 A;  2CE4 A;  3OMI B;  4CS2 A;  5A9G A;  4Z2W A;  1E1Q G;  1SC5 B;  2VQF B;  2CTP A;  2HHH O;  4LWS B;  3SYO A;  1KEC A;  3OW2 U;  4JI3 B;  1Q7Y W;  4MVO A;  4DV6 B;  1FAF A;  2Z0A A;  2QSA A;  4BIU A;  1R73 A;  3CCE V;  3VQW A;  3DXR B;  4FM0 A;  1HNX O;  4J7K A;  1AP6 A;  3IFX A;  1NKD A;  1K4C C;  3HKE A;  4HBN A;  1K8A W;  2RQ6 A;  2F1M A;  1YTF D;  4JI5 B;  2DW4 A;  4FLX A;  4NTW A;  4DR4 B;  3JD1 A;  1OZ0 A;  2Y48 A;  1BGY H;  1J95 A;  2F23 A;  4MVQ A;  1H8E G;  1PP9 H;  2F43 G;  4LNU A;  1CEZ A;  2H8P C;  4X1I A;  4X1Y A;  4FFB B;  3CD6 V;  1XMQ B;  1QVF U;  2PF4 E;  3K08 A;  3CRA A;  2GSM B;  2ARH A;  2N04 A;  1SET A;  2UUC B;  5K1X A;  3T1H O;  3DGE A;  5H6Q A;  1WPB A;  4TV9 A;  4LFA B;  1FPO A;  2GTS A;  4PA4 A;  2Q4P A;  5LBQ A;  4DR6 O;  5JVD A;  4LFB B;  3CCU V;  4PA7 A;  1RPR A;  1N32 O;  1QLE C;  3OEE G;  1K34 A;  1YTF B;  3G6E V;  4A5U B;  2YS8 A;  2ZIO A;  1XL4 A;  1ORQ C;  3ZCC A;  3EVK A;  1HWY A;  1AR1 B;  1NBM G;  2ZE5 A;  2X6A A;  4MVZ A;  4DRX B;  4EFE A;  2ATK C;  2BOB C;  5EZY B;  2LQT A;  5BY1 A;  4JI7 B;  5EYP A;  3P30 A;  1G4Y B;  2Z5U A;  2JGU A;  3QO5 A;  3TGU H;  1JCH A;  1IX9 A;  2F4V B;  1PKX A;  2A06 H;  4I55 B;  2EJR A;  2EZO A;  3CX5 F;  2ADP A;  4EB6 B;  5LHH A;  5LXT B;  5KX5 B;  4R50 A;  1V54 C;  1QBZ A;  1WB7 A;  4N23 A;  3OGC C;  3ASO B;  1HNX B;  2P6J A;  3JD0 A;  1NTZ H;  3FB5 C;  1D5N A;  5BMV B;  4K8X A;  1O9G A;  1S0V A;  2MK3 A;  2HG5 C;  3OR6 C;  1YZB A;  4TUY A;  4LFC B;  5C8Y A;  5CBH A;  4LF4 B;  1MAB G;  2Q69 A;  5KMG B;  2KSD A;  3RYI B;  2BCC H;  1EN4 A;  4UCS A;  3E22 B;  1B3Q A;  1KQS U;  2RJZ A;  1W0J G;  1O9H A;  2EIK C;  4MVS A;  4F6R A;  4GX0 A;  3ABL B;  1N0J A;  4XDJ A;  2ZIM A;  4IYI A;  2L6L A;  3GB7 C;  5FPR A;  4DV0 O;  4B3T O;  3FB7 C;  5FPO A;  4NKG B;  3FB6 C;  1FFT B;  2OCC B;  2JK5 C;  3E89 A;  1FXK C;  4CZZ A;  1OJH A;  3APQ A;  1R1B A;  3BPZ A;  3FB8 C;  3NR7 A;  5JJJ B;  3D36 C;  3J80 N;  4X1K A;  1XBL A;  4L87 A;  4NXM O;  4WF9 V;  2HKO A;  1BS3 A;  4D7T A;  3B4S A;  2UXD O;  2N74 A;  2DOS A;  1F4M A;  1IZ3 A;  4CC6 A;  3RYI A;  4W4K A;  1S76 D;  5CA1 A;  1S72 V;  3PJS K;  3SYQ A;  1XUQ A;  4DUY O;  4TUY B;  4JI2 B;  4B3R B;  1SQV H;  5KMG A;  2FTK A;  3UO2 A;  4H44 B;  1M56 B;  1TUE B;  1IUR A;  4ASU G; 
#chains in the Genus database with same CATH homology
 1KYO F;  5KLV H;  2FYU H;  3H1K H;  1BCC H;  1P84 F;  2A06 H;  3L75 H;  4D6T H;  3H1L H;  1NTM H;  3L73 H;  1BE3 H;  1NTK H;  3L70 H;  1SQB H;  1KB9 F;  1PPJ H;  3H1H H;  1EZV H;  3L74 H;  4PD4 F;  3CX5 F;  1L0N H;  1BGY H;  3H1J H;  1SQV H;  1PP9 H;  4U3F H;  3CWB H;  1SQX H;  1SQP H;  3BCC H;  1NU1 H;  3L72 H;  3H1I H;  3TGU H;  1L0L H;  2IBZ H;  1SQQ H;  2BCC H;  3CXH F;  1NTZ H;  3L71 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...