3L71H

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l71H00
1KYOF 3L73H 5KLVH 1SQBH 1SQVH 1SQXH 1L0LH 1NU1H 3CX5F 3L75H 1PPJH 3H1HH 4U3FH 1SQQH 1P84F 1EZVH 1BGYH 1SQPH 1NTKH 1NTMH 1KB9F 2BCCH 3H1LH 3CXHF 1L0NH 3TGUH 3L70H 3L71H 4D6TH 3L72H 3L74H 1BE3H 3H1JH 2A06H 3H1IH 1PP9H 3CWBH 2FYUH 3H1KH 4PD4F 2IBZH 1NTZH 1BCCH 3BCCH
chains in the Genus database with same CATH superfamily
4TQFA 4YJ3B 2X6BA 3CJHB 2ZR2A 1B06A 3ZMSA 2QWPB 1YXBA 4EFEA 1H2MA 2C2AA 4EKWA 1N36O 3L71H 2G38A 1NVPD 5AG2A 3OE7G 1SESA 2JVDA 2X6CA 4CS2A 4O4LB 3KCYA 4IIJB 3OTFA 1FYJA 4X89A 5EZYB 4LP8A 3QF7A 4MSWC 4JI6B 3FYEB 5EK0A 2KG7B 2AHYA 5L3CA 3WG7B 3SPCA 4DR6B 4OX9B 1P49A 2RCVA 4DK0A 4DR3O 1MOFA 5KHKA 3O65A 4DR3B 2IU0A 1TUEB 4X64O 2V1DA 2FKXA 2PI4A 3SPIA 2JGUA 1BT8A 1V54B 2LQTA 1URFA 3WB2A 4BIOA 2A0LA 3HR0A 1VEWA 5JWPA 3E86A 1NR1A 2DMXA 2FMLA 2ZD9A 2UU9O 4JTAB 4J42A 3UO3A 1JX9A 3I55V 3RWRD 2A3QA 2K9PA 1YTFD 4DR7B 1IBKO 2PI5A 2NN4A 2EIMB 5KHHA 4O4LA 4PELA 3AEIA 2YIAA 5CB4B 4LF5B 1O9GA 2ZNIA 4LF5O 3ZMTA 5B1OA 1GKFA 4GX0A 5HFMA 1XOUA 4DK1A 1L0NH 1BL8A 2R70A 1IBMB 4CH5A 2E5LB 4F6EA 4O4JA 1N32B 4NTXA 2QKCA 1W0KG 2WLIB 4UCVA 5GTHZ 1K4DC 1XHXA 5IWAB 1ROPA 2X6AA 2LW7A 4FM0A 3VOUA 5IYZB 4H13B 4EB6B 2HFEC 1HR0O 4I4TA 5HFLA 3ABMC 5CA0A 1NI8A 2PTMA 2QM7A 2R9IA 1HWYA 2ZDIA 4DUZB 1KECA 2GUZB 3SGIA 5KHJA 1R3LC 1K9MW 1N34B 2PGGA 5JCOC 1SZTA 1ZTEA 1NVPB 2BTQB 1AI6A 4UCOA 3CCRV 3CMAV 3TCUA 3ZMVA 1R6NA 1SS3A 1XL4A 4O2AB 2QR4A 3WFVA 2ZNJA 5IJ9A 1I7FA 4FJCC 1IBLB 2Y69B 3OMNB 1AJQA 4BAYA 2IH3C 3HPLC 3JALB 3BCCH 1GN6A 4X88A 4UCTA 5EBMC 1K92A 1GO3F 2RQ6A 3CRAA 4YY3B 2GV9A 4I50A 3RYIA 2Z5UA 4I9QA 3ZHRA 4DR1B 4B3MB 1GMGA 3QTCA 3C90A 4O2BA 3K03A 4LF4B 2UXCO 4BW9A 4LH7A 4X62O 4OGQB 1W59A 2Q0OC 5IYCO 4RO2A 3WG7C 1K3EA 3OR6C 3HKDA 4X1IB 3BEHA 4CH6A 3OEEG 3OUSA 3K04A 3G6BA 2VQFO 1AR5A 2ZE6A 2ZXWB 4JPRA 5IY5B 3L74H 3CYOA 4FLWA 4GX5A 3RYCA 5B5EZ 3TXSA 3BA9A 1QHTA 2ADPA 1VQ9V 4N21A 1KYOF 5BR8B 1PL0A 1P7GA 2HP8A 2XOKG 4LF6O 4LF4O 2QSAA 4J7KA 4NB5A 1N36B 4KP4A 1VQMV 2LO1A 2Q7EA 4G28B 1N32O 4DV4O 3C3TA 3QVNA 3SPHA 2E75B 3JD3A 1RSOA 1VQ8V 2QA4V 1PP9H 2XAHA 2ZE7A 3FAVB 3UM7A 1H2NA 3CCLV 4QE9A 5LXTA 4ZBMA 4J10A 5B1AB 4MVUA 1HNXB 4PI2A 4L8JA 3AG7A 1SQVH 2CGNA 4TUYA 1F51A 2QWOB 3T1HB 1RM1B 1K34A 1K4CC 4O4HB 3RYFB 2VWKA 4ABMA 1BHAA 2XAJA 4UVAA 3F5WC 2XUMA 2JIZG 2UU9B 2P90A 2HG5C 3N27A 2JEXA 3A2FA 4DV0O 1US6A 1SZXA 1G6UA 4PI0A 2EZOA 3ML0A 3CHXA 1XBLA 3LSSA 2HJDA 3KZIZ 3MHHC 5JVDB 2OT5A 5EC2C 1YJ9V 1S3JA 4LF7O 4UUJC 2WLNA 3C3SA 1JPXA 3K5OA 4GX2A 4J9ZB 2YC0A 4JI7B 3RYHB 4QIWF 5CA1A 2F23A 2Q73A 1SQQH 4HYOA 4AQYO 2YXLA 4IYIA 1OCZB 1VQPV 1TUBB 2CAZC 4X1KA 5JJNB 4GKKB 1I08A 2CGOA 4FM1A 4E4EA 3H9VA 3GVMA 3K59A 4JASA 4F6RA 4ZI7A 4YXWG 3ETGA 4LFAO 3F5TA 4CS3A 1BS3A 1OCCB 1QVGU 2OCCB 4O4JB 2JK5C 1OZ0A 3HB3B 3CCMV 1K97A 1M57C 2Y48A 3QO5A 3ICXA 2ARHA 4BIZA 1VQOV 1WN7A 3W7SA 1NBMG 3K9SA 3ETEA 4FLZA 2B9ZA 1Y74B 2EILB 4LFAB 1SERA 5D5QA 1B04A 4JYBA 1N34O 4TOIA 2BE3A 5KMGA 1U96A 1BE3H 1FJGB 1O9HA 1BHBA 1SQFA 1PL4A 1Q43A 1HR0B 4X9QA 1Y66A 1NQTA 3ZN0A 2DYSC 4H44B 3RYCB 2WLKA 2EINC 2UXNA 4FFBB 3T4ZA 3ZEDA 5KAIZ 1S5HC 1AJPA 1KP3A 5LGTA 1MSWD 4K35A 3VQVA 3AG4B 4O4IB 4TV9B 3GB7C 2VWJA 3M7MX 3ZCCA 3OD4A 4UCSA 1SETA 4Q6GA 2A9HA 4QGPA 3TGUH 1IBKB 4J7ZA 2ZIOA 1J5EO 4IHJB 4DV4B 4UB8Z 2DJVA 3MDSA 1JQ0A 4TUYB 1TVKB 4DR2B 1PV0A 1VP7A 3M8AA 4Q20A 1COWG 2XTAA 4JTCB 1ZLZA 2F43G 1KKDA 3RVZA 5L3BA 1M56C 2UUBB 1NS1A 2HJFC 4PA9A 1GTOA 3J80N 2QTOA 2DQ0A 3OR7C 4OXSA 4O2BB 2W6JG 1QLEC 4DRXB 3G4SV 3CRCA 3U11A 4PD4F 1MABG 5DECA 2OYQA 2BOBC 4DR5B 4J11A 1VMGA 1WA8B 1Z2GA 4ZOLB 1P84F 1SQPH 2ADQB 5IJ9B 3JSLA 1YZBA 2EIKC 3HKDB 4NVPA 1EN5A 5LGNA 2Z3YA 4K3AA 1Q6HA 5LHHA 4DV7O 1CXZB 1H8HG 2XT9A 3BA8A 3N2GB 4IYHA 1FXVA 3K57A 3OM3B 4U3FH 1H2KA 5B1BB 2YDEA 1IBLO 4MW3A 1N33B 2BOCC 1V55C 4MTXA 3IGAC 4B7KA 5LHGA 1XNRO 5JJJB 1PPJH 3NXSA 3H1HH 4ZKIA 5EBWC 3K5MA 4U7OA 3RGBA 2Q4PA 2ZKOA 2HLDG 1IVSA 3Q4HA 4TWKA 4RUFA 3HKEA 4ZHQB 1AJNA 3D36C 2A79B 4I9WA 1G1XB 3E22A 2BTQA 3F7VC 2V7QG 3B8NA 3CP1A 1YTFB 3HKEB 2X0LA 1B6QA 2WLMA 2F1MA 3Q4HB 4U3JA 2HHHB 4IT5A 2R9RB 1YJWV 4I7ZB 3J81N 2Y4UA 3JARA 2KG7A 1KP2A 3EVKA 2P22C 3IJ4A 1S76D 1L0LH 3OFNG 3SR2C 3L75H 2OTJV 1YVWA 1Z5WA 1MA1A 3L70H 5B3SB 5ITZA 5GTIZ 1ZL8A 2B1IA 3IFXA 3U0ZA 3CWBH 4KUMA 2YUAA 4LFCO 2XASA 4JI0B 3RBZA 4YHHO 2JS5A 1K5SA 1V9PA 1WAZA 3E8FA 4MTGA 4FPPA 1NZ6A 5CBGA 1LUWA 4UB6Z 3ABMB 1Q3EA 5J2TA 1PNKA 3UCSC 4LFBO 2N05A 3JARB 4DO2A 4LF9B 4P30A 1K73W 1NTZH 3ZJZA 1V54C 1QQCA 4DV6O 4PA6A 1AVMA 1YDXA 2CTPA 5BMVB 5E1AC 4X1YB 1Q6IA 3E22B 3N2GA 2JS3A 2OIEA 1SKVA 4X66B 3OW2U 4X66O 2PUSA 4DV3B 3H1KH 5L3EA 3FFQA 3K5NA 2IJJA 3OAAG 4WF9V 4FLYA 3STZC 2R9AA 1KD1W 2JEUA 2NNUA 1AB3A 4IIJA 3A0BZ 4IL6Z 2Q9LA 4AHCA 5EBLC 1MSDA 2JRIA 4LWSA 2Y69C 2DYRC 4NXMO 4CZZA 4AI8A 2Z0AA 4GLXA 4D7SA 4IHJA 1GAXA 1XILA 2IU3A 2ITDC 1XNRB 4NYKA 5LOVA 1E1RG 2QWQB 3SPGA 5F2VO 3CB2A 2YICA 3MD0A 4TV9A 2GBOA 3APOA 2KQXA 4JI1O 4QE7A 2GDSA 3AG3C 3CD6V 1KB9F 5GONA 1BQ0A 4YY3O 3B4SA 5FPRA 2Q7HA 5IY5C 1FAFA 4D7TA 3LNMB 1N4CA 4JZGA 2RN9A 4OPAA 4CH3A 2P7TC 1PD3A 4BR6A 4TSFG 1SQBH 3ASOB 5EYPA 1XMQO 3CCJV 2PF4E 2ZE5A 4N23A 1YIJV 2YIBD 3FB8C 3APQA 5LMUB 2E76B 3CPWU 4Z2WA 5LMUO 4JAVA 2YXHA 4LF8B 1NR7A 1I0HA 4EEQA 4BIUA 4LF7B 1H2GA 2Q69A 1ZSPA 1KKCA 2GSMB 3CEIA 4TV8B 3D3IA 4LNUB 3UQ8A 2CTWA 3PN1A 1SF9A 3X2QC 2X7RB 2ETNA 1Q6UA 3PJSK 2JDIG 2F66C 3T4DA 2IJKA 2QTSA 4DUYB 1XEQA 4I55A 4X65O 1SQXH 3S3WA 4R7CA 1OV9A 1WNSA 1ENVA 4A5UB 3ZRXA 1AI5A 1M4UA 3JATB 3D8CA 1WP7A 1P7BA 4KFMA 1FXKB 4KL1A 1YF2A 4FFBA 2Y4TA 5KHGA 4JI4O 2ITCC 4XDJA 1AROP 2EULA 1W0JG 4DR7O 3RYHA 1YI2V 2FL4A 2F93B 5C93A 1NTKH 2F4VO 3EXAA 3CC2V 5JQGA 1LUVA 2EBOA 3ZBHA 2YI8A 4LF6B 3CRQA 2LJ2A 1VQ4V 3ABUA 3JAWA 4RQFA 1HW7A 2OWOA 1B3QA 4DV2O 4MTOA 3GWOA 1TUBA 5KUKA 4JI3O 5LA6B 4I5SA 3ABLB 2AZ2A 2YEVB 1H2SB 5IJ0A 4B3RB 2PY5A 1MNGA 2UUAO 4FLXA 4LFBB 1CEZA 1XNQO 1QR8A 4FZ1A 1TA8A 3WU2Z 5KX5B 2LW1A 2MW2B 4DV0B 2JGDB 5KLVH 4MW8A 5L3DA 4OPHA 4DUYO 1FXKA 1GK9A 4CC5A 3AG3B 5CBFA 3I56V 3AK1A 2D2CB 4XBFA 1ZUQA 1Q90D 5JJEB 4JZ2A 1H2LA 2L35A 1F4MA 4ZIBA 5LHIA 3OGIB 4DV1B 3KCXA 4I55B 3MAQA 2UXBO 3RYFA 1CPYA 1GH6A 1FKAO 1HNXO 5CMUA 5LMNO 1Q7YW 3THOA 5JH7B 1D5NA 2DYSB 1OCRB 1AI4A 4AILC 2QDOA 4JAUA 3E35A 4GUNA 3DXRB 2HHHO 1HP8A 2XAFA 3FD9A 4FFKA 4LBEC 1MZEA 3JASB 4JAAA 1U97A 2UUCO 3AG4C 4QPKA 2IJIA 1JCHA 1Q86W 3P3NA 3ZX6A 2DN9A 4DUZO 2PYJA 3BABA 1R6KA 1R3JC 1BZKA 4GKJO 4RAIA 3X2QB 1VQ7V 4P2ZA 2LGQA 4BWAA 5LYJB 3R65A 4IGGA 2UXDO 4J9YB 1K7DA 5LP6C 4PDVA 4Z1VA 4O4IA 5EYPB 3SJCC 1G4YB 5LP6A 1PM9A 3OGCC 3SYOA 1IX9A 3LSQA 2E5LO 1M56B 3ZMZA 4X1IA 3T1HO 3UO2A 1IDSA 4H0LB 2DWEC 3WB1A 1M9NA 2WLLA 2EIJB 4WFAV 3E89A 3S3XA 3RVYA 5FNVB 2QGNA 3DXRA 5IYDO 3P30A 4O4HA 4BW5A 5EZYA 2WSSG 1AR1B 2HR3A 5EC1C 1G8MA 2QKAA 1XHZA 1BGYH 1DK1A 4JI8O 2P06A 2XAQA 3ABKB 1QU7A 4NXNB 1Y74A 1M1KW 5H5NA 3EHBB 3H1IH 5CN0A 5J9PC 1RPOA 4TT3G 1QLNA 2EJ7A 4GYCB 2YIBA 3T2MA 4PDRA 3STLC 5CBHA 3RFRA 2XAGA 3RN4A 4LR3A 3DC6A 1OHHG 4D6TH 3JAKA 2WLIA 3ZIAG 1JOYA 4GKJB 5FLXN 3W7UA 4G27B 4Z1MG 1QNMA 5IYBO 3E8BA 4R8CA 4DV5B 4K0KB 1F4NA 2YEVA 3B8MA 5IJ0B 3RYIB 5LOVB 1FS0G 4NXNO 3QO8A 4H33A 5B1BC 5IYZA 3ZMUA 4DR2O 4U7NA 5CA1B 1QLEB 4JI4B 5JQGB 4FLTA 4LF9O 2PYLA 4DW0A 4XDKA 4FVMA 4O2AA 1GM8A 1K5QA 1GRJA 3LDDA 1VF6A 4KHPO 2UXBB 5H2FZ 3W7XA 3ZRSA 4X1YA 3G6EV 2DW4A 2EJRA 1X59A 3E8HA 5DM6V 2CTQA 4H37A 4PHZA 3K06A 2EIKB 1YITV 1EN4A 1SA0A 1Y6XA 1THZA 4UVCA 1ZWIC 4K8ZA 4ICGA 3WB0A 1MG1A 1S5JA 2B5UA 3FYIB 1F23A 2UUCB 2NLJC 3M99B 5BY1A 1V55B 3W7WA 4CC6A 3VQWA 2Q5ZA 4XDLA 1OJHA 2GUZA 5LXTB 3T1YO 4WFGA 2ATKC 4F4LA 4JI6O 2N74A 3FAVA 3T1CA 4DV2B 1M90W 4GCZA 2H94A 4KHPB 1JR9A 3IC9A 4W4LA 1KUQA 1D5AA 1D2DA 2F4VB 4RQEA 1HNWB 3OT7A 3JSNA 1BCCH 2K1EA 2M6YA 1EBOA 1TAEA 1L8DA 1FPOA 4DXWA 2YS8A 1KC8W 3HKCB 1BSMA 3FB6C 3DTUB 3K5LA 3EFFK 1JMKC 1ZL8B 3KG2A 3K3WA 3CXHF 4JI1B 5ITZB 1AR4A 3FKSG 1XREA 5CB4A 4CS4A 4JV5O 3FB7C 4AQYB 3J7AU 4DV5O 4K0KO 1NH2B 3QG5A 5EIBC 1N33O 1XMOB 1LNQA 4PDMA 4X64B 4MS2A 4R6ZA 4B3RO 2A7WA 2UXDB 2FTKA 1LR1A 2WA3A 4EFBA 1YSCA 2OTLV 1VARA 4DR6O 1SC5B 3H1JH 3D36A 5B3SC 1E79G 3RW0A 2NR5A 4HNAA 3ZRVA 3ASNB 1H8EG 5IWAO 3DGEA 2DYRB 1I94O 2RJZA 1KU9A 1P4RA 1Y4MA 1NT2B 3AG1B 1N8RW 4FIPC 1WB8A 1Q5OA 1K33A 5H9CA 2L6LA 1FFTB 4UCUA 3ZHQA 1JFFB 3SDLA 3SPJA 5DEDA 2AW9A 5EIBD 4FZ0A 4WBNB 2RNBA 5LMNB 4YJ2A 3ETQA 5IE9A 2CK3G 4LWSB 1TVKA 5BMVA 1GN4A 2DOSA 2CE4A 1EZVH 3KKYA 1GN2A 2P5OA 1YCIA 1QR9A 2AXTZ 3ZHUA 4FLUA 3JAMN 3CJHA 3HKCA 5H6QA 2A06H 3CC7V 1S0VA 1GM7A 1YHQV 4UV8A 2WLJA 2ZQMA 2VQEB 3CXCU 4YJ2B 1I94B 5J2TB 5A9GA 4LFCB 3JAKB 1I5XA 3UT5B 2ZT9B 1QBZA 3JD4A 4DRXA 1J5EB 1TGOA 1VIBA 2P4KA 1ZX3A 3L9DA 1Q8IA 1QVFU 1EN6A 1VQNV 5FNVA 3K79A 2ODMA 2UUAB 5C8YB 1T5EA 2W0XA 4L87A 3AG2B 4JI2B 2GHYA 1EFRG 1NU1H 3BFRA 5A2QN 2ZM6B 1JJ2U 4HZ3A 1YEWA 3JD0A 1VF7A 2XHBA 3JCZA 5J2UA 3ZHTA 1VF5B 3A0HZ 2H8PC 1FFXA 1SA0B 3JD2A 3BHPA 2Q68A 2WLLB 3AK3A 4DV6B 5D5PA 4YIPA 2KB1A 3ASOC 3TK1A 4YIOA 5TISZ 2DE0X 4B08A 1EZJA 3VQYA 2BTOA 3HKBA 4FLVA 4WFFA 3FB5C 1JVMA 4LCUC 3B09A 4UXNA 4W4KA 2Q0AA 3QNEA 1ORQC 4JF3A 3K0DA 3BVOA 2IM9A 2QWNB 3K08A 3T1YB 4JV5B 1Y76A 2O57A 2FB5A 3TXQA 1I5YA 3N2KB 4JI0O 2Q67A 3LNNA 3CCQV 4GX1A 3ABLC 3H1LH 1PKXA 3JASA 3G71V 1IXBA 5FL7G 4MVQA 1DGSA 3E2EA 2EIMC 5CA3A 2RMKB 4DR4B 4E2LA 4JTDB 4CH4A 2W6IG 2FYUH 3O9OA 2MK3A 1N0NA 4HAMA 1HNWO 2HVJC 2XNDG 3CRRA 5FPOA 1XUQA 1VF6C 1VQ6V 1NJIW 1XL6A 2IH1C 5KX5A 4GZRB 4NR1A 4JI7O 4I0XB 1YJNV 4DR5O 1FXKC 2YIDA 1AP6A 3RT3C 1XMQB 3CCSV 3K9AA 1WA8A 1DF4A 2ZXWC 3G67A 2OIGA 1OCRC 1VQKV 3U10A 4LC1A 4HBNA 3VQXA 4JYAO 2WA4A 2WPDG 3SJBC 4YHHB 4ZI7B 2CUGA 4UCRA 1R3KC 1XQ8A 3SJQC 3SYAA 1PNLA 2RDCA 2VS0A 5BR8O 1BQZA 1W2BU 3CCUV 4ZOLA 3UKMA 4B3SO 4B3TB 4JI5O 3E83A 1L1FA 1XNQB 3BRCA 1AILA 4UV9A 3OUFA 2DQ3A 2CH7B 5DN6G 4J80A 2H3OA 3ZRWB 2QEXV 1GM9A 1F7YA 2QKSA 5KUMA 2LP7A 3AG2C 3L73H 2WLHA 2Q8VA 2Y0PA 2P6JA 3LUTB 2YXYA 4DV7B 1SQGA 1A32A 1UFIA 1CP9A 3G80A 4WFHA 4X62B 3HKBB 2KSDA 2AHZA 2HEPA 1NH2D 2EIJC 2JJ1G 1MZFA 1BMFG 2ZR3A 1ZAUA 4DR1O 4B3MO 5K1PA 2KKWA 3JATA 3CS5A 3CC4V 2QE7G 3E8GA 3ABTA 4JYCA 1IURA 5B1NA 3CX5F 2BSKB 1WP8A 3SJAC 5J2UB 5BXZA 3CSXA 3BPZA 5LYJA 2LGWA 2P4VA 2Y0IA 4QPJA 1XI1A 2LFRA 4MVRA 3ABKC 4KXRA 5L3FA 1S5LZ 4MT8A 1WJZA 5KMGB 3OTOB 4GT1A 1Q81W 3OTOO 2UUBO 3A0RA 2W0FC 2B1GA 4LNUA 5B1AC 1M5IA 3SYPA 3BY6A 1R73A 1R6TA 4B7EA 2EX3A 1RSOB 3SYQA 1VQ5V 1DF5A 4J7JA 4MVMA 1JA8A 4JYAB 3AK2A 2PZSA 4NTYA 5K1XA 5JH7A 4UVBA 5LP6B 4GKKO 1AP5A 4DV3O 4C7UA 2WAMA 1VQLV 1KBHA 2ZINA 5LBQA 4DW1A 1FD9A 3ETDA 1RFYA 2BSKA 1NTMH 1RM1C 1DLBA 1DTOA 2YI9A 1S77D 2DWDC 1IBMO 2GTAA 1WPXA 2CTRA 2Q7GA 1AI7A 1OCOC 4X1KB 2EZPA 5H6RA 1UPGA 4WBNA 2QM4A 3D3QA 3JALA 3CCVV 1HDJA 3VBBA 1JJOA 4F6RB 4PJ0Z 1SRYA 4JI5B 4B3SB 4B3TO 1R1BA 4QNHB 3BAAA 3B40A 1OCZC 2IW5A 5IDJA 2ILMA 2AZ0A 5LA6A 5LGUA 3ZS8C 3LSUA 2CH7A 1KMIZ 1Y67A 3ZN1A 5KHIA 4WCEV 1RPRA 1XDCA 3CCEV 3DSQA 2E74B 4PDLA 4R50A 1IZ3A 1E1QG 2QM8A 3MHSC 5CA0B 2JJ2G 2UXXA 1J95A 1Q82W 3CRMA 1QCEA 2QWRB 4I0XA 1KQSU 3IC7A 3LDEA 3ZHSA 2IBZH 3H01A 4FM2A 5JVDA 2P67A 3P32A 2JGDA 4DV1O 4FMTA 1M57B 2OCHA 2ZDIC 3F7YC 4PV1B 4PA7A 3I5DA 5C8YA 1OCCC 4DYLA 1N0JA 2OCCC 4TV8A 3JCUZ 3LDCA 3QO7A 4RWUA 1M93A 1WPBA 4I4TB 1WLEA 4K8XA 4EB6A 2ZM6O 4MTFA 1X4TA 3IAYA 4PA4A 1FJGO 5B66Z 1NKDA 3GWKC 3N2KA 4X8AA 3JAWB 3DC5A 3TJTA 2EILC 2R72A 2F95B 2N04A 3W7TA 2VQFB 4NKGB 1IXMA 4FK5C 4OX9O 4JI3B 2EINB 1XMOO 1GN3A 4MVSA 2WWWA 2HKOA 3CMEV 5KAFZ 4YJ3A 2QJ1A 3OEHG 2ZIMA 4NTWA 2VQEO 4JI8B 4P9OA 4ZHQA 4QJFB 4RUEA 2AGAA 1JFFA 1Y76B 1K8AW 4WFEA 4MVOA 2VRZA 4P9PA 3NR7A 3B2EE 4JGSA 2D3OW 4U3JB 2ZCEA 5GW7A 1H38A 5L3GA 1HNZO 3FX7A 3ASNC 2LFSA 3ZRWA 3OMAB 3JYCA 4LF8O 3JD1A 4TQDA 4HNAB 4CBCA 3TETA 5E79Z 3R66A 4WFBV 3B77A 3P3PA 3SYCA 2M7WA 3K58A 4MVZA 4X65B 2HVKC 1OCOB 2ZE8A 4JI2O 1FFXB 4X20A 3K0GA 2YSUB 4ASUG 1S72V 1FXHA 2E3CA 1HNZB 5LL6Y 4X20B 1Z5VA 5KA6A 3AG1C 1EM1A 4I50B 2GTSA 4DR4O 1MMMA 3L72H 2Q6AA 2CDYA 1WB7A 1R3IC 3A8TA 4LH6A 3CE2A 1PNMA 1RP3B 4UFZA 5JCOA 4JYYA 2V4DA 5BZBA 4PA3A 5IT9N 2BCCH 5GONB 2UXCB 3UT5A 1UJWB 2IJHA 3ZHVA 4NXMB 4J41A 3OMIB 5KA5A 4G2KA
chains in the Genus database with same CATH topology
1KYOF 3L73H 5KLVH 1SQBH 1SQVH 1SQXH 1L0LH 1NU1H 3CX5F 3L75H 1PPJH 3H1HH 4U3FH 1SQQH 1P84F 1EZVH 1BGYH 1SQPH 1NTKH 1NTMH 1KB9F 2BCCH 3H1LH 3CXHF 1L0NH 3TGUH 3L70H 3L71H 4D6TH 3L72H 3L74H 1BE3H 3H1JH 2A06H 3H1IH 1PP9H 3CWBH 2FYUH 3H1KH 4PD4F 2IBZH 1NTZH 1BCCH 3BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO F;  3L73 H;  5KLV H;  1SQB H;  1SQV H;  1SQX H;  1L0L H;  1NU1 H;  3CX5 F;  3L75 H;  1PPJ H;  3H1H H;  4U3F H;  1SQQ H;  1P84 F;  1EZV H;  1BGY H;  1SQP H;  1NTK H;  1NTM H;  1KB9 F;  2BCC H;  3H1L H;  3CXH F;  1L0N H;  3TGU H;  3L70 H;  3L71 H;  4D6T H;  3L72 H;  3L74 H;  1BE3 H;  3H1J H;  2A06 H;  3H1I H;  1PP9 H;  3CWB H;  2FYU H;  3H1K H;  4PD4 F;  2IBZ H;  1NTZ H;  1BCC H;  3BCC H; 
#chains in the Genus database with same CATH topology
 4TQF A;  4YJ3 B;  2X6B A;  3CJH B;  2ZR2 A;  1B06 A;  3ZMS A;  2QWP B;  1YXB A;  4EFE A;  1H2M A;  2C2A A;  4EKW A;  1N36 O;  3L71 H;  2G38 A;  1NVP D;  5AG2 A;  3OE7 G;  1SES A;  2JVD A;  2X6C A;  4CS2 A;  4O4L B;  3KCY A;  4IIJ B;  3OTF A;  1FYJ A;  4X89 A;  5EZY B;  4LP8 A;  3QF7 A;  4MSW C;  4JI6 B;  3FYE B;  5EK0 A;  2KG7 B;  2AHY A;  5L3C A;  3WG7 B;  3SPC A;  4DR6 B;  4OX9 B;  1P49 A;  2RCV A;  4DK0 A;  4DR3 O;  1MOF A;  5KHK A;  3O65 A;  4DR3 B;  2IU0 A;  1TUE B;  4X64 O;  2V1D A;  2FKX A;  2PI4 A;  3SPI A;  2JGU A;  1BT8 A;  1V54 B;  2LQT A;  1URF A;  3WB2 A;  4BIO A;  2A0L A;  3HR0 A;  1VEW A;  5JWP A;  3E86 A;  1NR1 A;  2DMX A;  2FML A;  2ZD9 A;  2UU9 O;  4JTA B;  4J42 A;  3UO3 A;  1JX9 A;  3I55 V;  3RWR D;  2A3Q A;  2K9P A;  1YTF D;  4DR7 B;  1IBK O;  2PI5 A;  2NN4 A;  2EIM B;  5KHH A;  4O4L A;  4PEL A;  3AEI A;  2YIA A;  5CB4 B;  4LF5 B;  1O9G A;  2ZNI A;  4LF5 O;  3ZMT A;  5B1O A;  1GKF A;  4GX0 A;  5HFM A;  1XOU A;  4DK1 A;  1L0N H;  1BL8 A;  2R70 A;  1IBM B;  4CH5 A;  2E5L B;  4F6E A;  4O4J A;  1N32 B;  4NTX A;  2QKC A;  1W0K G;  2WLI B;  4UCV A;  5GTH Z;  1K4D C;  1XHX A;  5IWA B;  1ROP A;  2X6A A;  2LW7 A;  4FM0 A;  3VOU A;  5IYZ B;  4H13 B;  4EB6 B;  2HFE C;  1HR0 O;  4I4T A;  5HFL A;  3ABM C;  5CA0 A;  1NI8 A;  2PTM A;  2QM7 A;  2R9I A;  1HWY A;  2ZDI A;  4DUZ B;  1KEC A;  2GUZ B;  3SGI A;  5KHJ A;  1R3L C;  1K9M W;  1N34 B;  2PGG A;  5JCO C;  1SZT A;  1ZTE A;  1NVP B;  2BTQ B;  1AI6 A;  4UCO A;  3CCR V;  3CMA V;  3TCU A;  3ZMV A;  1R6N A;  1SS3 A;  1XL4 A;  4O2A B;  2QR4 A;  3WFV A;  2ZNJ A;  5IJ9 A;  1I7F A;  4FJC C;  1IBL B;  2Y69 B;  3OMN B;  1AJQ A;  4BAY A;  2IH3 C;  3HPL C;  3JAL B;  3BCC H;  1GN6 A;  4X88 A;  4UCT A;  5EBM C;  1K92 A;  1GO3 F;  2RQ6 A;  3CRA A;  4YY3 B;  2GV9 A;  4I50 A;  3RYI A;  2Z5U A;  4I9Q A;  3ZHR A;  4DR1 B;  4B3M B;  1GMG A;  3QTC A;  3C90 A;  4O2B A;  3K03 A;  4LF4 B;  2UXC O;  4BW9 A;  4LH7 A;  4X62 O;  4OGQ B;  1W59 A;  2Q0O C;  5IYC O;  4RO2 A;  3WG7 C;  1K3E A;  3OR6 C;  3HKD A;  4X1I B;  3BEH A;  4CH6 A;  3OEE G;  3OUS A;  3K04 A;  3G6B A;  2VQF O;  1AR5 A;  2ZE6 A;  2ZXW B;  4JPR A;  5IY5 B;  3L74 H;  3CYO A;  4FLW A;  4GX5 A;  3RYC A;  5B5E Z;  3TXS A;  3BA9 A;  1QHT A;  2ADP A;  1VQ9 V;  4N21 A;  1KYO F;  5BR8 B;  1PL0 A;  1P7G A;  2HP8 A;  2XOK G;  4LF6 O;  4LF4 O;  2QSA A;  4J7K A;  4NB5 A;  1N36 B;  4KP4 A;  1VQM V;  2LO1 A;  2Q7E A;  4G28 B;  1N32 O;  4DV4 O;  3C3T A;  3QVN A;  3SPH A;  2E75 B;  3JD3 A;  1RSO A;  1VQ8 V;  2QA4 V;  1PP9 H;  2XAH A;  2ZE7 A;  3FAV B;  3UM7 A;  1H2N A;  3CCL V;  4QE9 A;  5LXT A;  4ZBM A;  4J10 A;  5B1A B;  4MVU A;  1HNX B;  4PI2 A;  4L8J A;  3AG7 A;  1SQV H;  2CGN A;  4TUY A;  1F51 A;  2QWO B;  3T1H B;  1RM1 B;  1K34 A;  1K4C C;  4O4H B;  3RYF B;  2VWK A;  4ABM A;  1BHA A;  2XAJ A;  4UVA A;  3F5W C;  2XUM A;  2JIZ G;  2UU9 B;  2P90 A;  2HG5 C;  3N27 A;  2JEX A;  3A2F A;  4DV0 O;  1US6 A;  1SZX A;  1G6U A;  4PI0 A;  2EZO A;  3ML0 A;  3CHX A;  1XBL A;  3LSS A;  2HJD A;  3KZI Z;  3MHH C;  5JVD B;  2OT5 A;  5EC2 C;  1YJ9 V;  1S3J A;  4LF7 O;  4UUJ C;  2WLN A;  3C3S A;  1JPX A;  3K5O A;  4GX2 A;  4J9Z B;  2YC0 A;  4JI7 B;  3RYH B;  4QIW F;  5CA1 A;  2F23 A;  2Q73 A;  1SQQ H;  4HYO A;  4AQY O;  2YXL A;  4IYI A;  1OCZ B;  1VQP V;  1TUB B;  2CAZ C;  4X1K A;  5JJN B;  4GKK B;  1I08 A;  2CGO A;  4FM1 A;  4E4E A;  3H9V A;  3GVM A;  3K59 A;  4JAS A;  4F6R A;  4ZI7 A;  4YXW G;  3ETG A;  4LFA O;  3F5T A;  4CS3 A;  1BS3 A;  1OCC B;  1QVG U;  2OCC B;  4O4J B;  2JK5 C;  1OZ0 A;  3HB3 B;  3CCM V;  1K97 A;  1M57 C;  2Y48 A;  3QO5 A;  3ICX A;  2ARH A;  4BIZ A;  1VQO V;  1WN7 A;  3W7S A;  1NBM G;  3K9S A;  3ETE A;  4FLZ A;  2B9Z A;  1Y74 B;  2EIL B;  4LFA B;  1SER A;  5D5Q A;  1B04 A;  4JYB A;  1N34 O;  4TOI A;  2BE3 A;  5KMG A;  1U96 A;  1BE3 H;  1FJG B;  1O9H A;  1BHB A;  1SQF A;  1PL4 A;  1Q43 A;  1HR0 B;  4X9Q A;  1Y66 A;  1NQT A;  3ZN0 A;  2DYS C;  4H44 B;  3RYC B;  2WLK A;  2EIN C;  2UXN A;  4FFB B;  3T4Z A;  3ZED A;  5KAI Z;  1S5H C;  1AJP A;  1KP3 A;  5LGT A;  1MSW D;  4K35 A;  3VQV A;  3AG4 B;  4O4I B;  4TV9 B;  3GB7 C;  2VWJ A;  3M7M X;  3ZCC A;  3OD4 A;  4UCS A;  1SET A;  4Q6G A;  2A9H A;  4QGP A;  3TGU H;  1IBK B;  4J7Z A;  2ZIO A;  1J5E O;  4IHJ B;  4DV4 B;  4UB8 Z;  2DJV A;  3MDS A;  1JQ0 A;  4TUY B;  1TVK B;  4DR2 B;  1PV0 A;  1VP7 A;  3M8A A;  4Q20 A;  1COW G;  2XTA A;  4JTC B;  1ZLZ A;  2F43 G;  1KKD A;  3RVZ A;  5L3B A;  1M56 C;  2UUB B;  1NS1 A;  2HJF C;  4PA9 A;  1GTO A;  3J80 N;  2QTO A;  2DQ0 A;  3OR7 C;  4OXS A;  4O2B B;  2W6J G;  1QLE C;  4DRX B;  3G4S V;  3CRC A;  3U11 A;  4PD4 F;  1MAB G;  5DEC A;  2OYQ A;  2BOB C;  4DR5 B;  4J11 A;  1VMG A;  1WA8 B;  1Z2G A;  4ZOL B;  1P84 F;  1SQP H;  2ADQ B;  5IJ9 B;  3JSL A;  1YZB A;  2EIK C;  3HKD B;  4NVP A;  1EN5 A;  5LGN A;  2Z3Y A;  4K3A A;  1Q6H A;  5LHH A;  4DV7 O;  1CXZ B;  1H8H G;  2XT9 A;  3BA8 A;  3N2G B;  4IYH A;  1FXV A;  3K57 A;  3OM3 B;  4U3F H;  1H2K A;  5B1B B;  2YDE A;  1IBL O;  4MW3 A;  1N33 B;  2BOC C;  1V55 C;  4MTX A;  3IGA C;  4B7K A;  5LHG A;  1XNR O;  5JJJ B;  1PPJ H;  3NXS A;  3H1H H;  4ZKI A;  5EBW C;  3K5M A;  4U7O A;  3RGB A;  2Q4P A;  2ZKO A;  2HLD G;  1IVS A;  3Q4H A;  4TWK A;  4RUF A;  3HKE A;  4ZHQ B;  1AJN A;  3D36 C;  2A79 B;  4I9W A;  1G1X B;  3E22 A;  2BTQ A;  3F7V C;  2V7Q G;  3B8N A;  3CP1 A;  1YTF B;  3HKE B;  2X0L A;  1B6Q A;  2WLM A;  2F1M A;  3Q4H B;  4U3J A;  2HHH B;  4IT5 A;  2R9R B;  1YJW V;  4I7Z B;  3J81 N;  2Y4U A;  3JAR A;  2KG7 A;  1KP2 A;  3EVK A;  2P22 C;  3IJ4 A;  1S76 D;  1L0L H;  3OFN G;  3SR2 C;  3L75 H;  2OTJ V;  1YVW A;  1Z5W A;  1MA1 A;  3L70 H;  5B3S B;  5ITZ A;  5GTI Z;  1ZL8 A;  2B1I A;  3IFX A;  3U0Z A;  3CWB H;  4KUM A;  2YUA A;  4LFC O;  2XAS A;  4JI0 B;  3RBZ A;  4YHH O;  2JS5 A;  1K5S A;  1V9P A;  1WAZ A;  3E8F A;  4MTG A;  4FPP A;  1NZ6 A;  5CBG A;  1LUW A;  4UB6 Z;  3ABM B;  1Q3E A;  5J2T A;  1PNK A;  3UCS C;  4LFB O;  2N05 A;  3JAR B;  4DO2 A;  4LF9 B;  4P30 A;  1K73 W;  1NTZ H;  3ZJZ A;  1V54 C;  1QQC A;  4DV6 O;  4PA6 A;  1AVM A;  1YDX A;  2CTP A;  5BMV B;  5E1A C;  4X1Y B;  1Q6I A;  3E22 B;  3N2G A;  2JS3 A;  2OIE A;  1SKV A;  4X66 B;  3OW2 U;  4X66 O;  2PUS A;  4DV3 B;  3H1K H;  5L3E A;  3FFQ A;  3K5N A;  2IJJ A;  3OAA G;  4WF9 V;  4FLY A;  3STZ C;  2R9A A;  1KD1 W;  2JEU A;  2NNU A;  1AB3 A;  4IIJ A;  3A0B Z;  4IL6 Z;  2Q9L A;  4AHC A;  5EBL C;  1MSD A;  2JRI A;  4LWS A;  2Y69 C;  2DYR C;  4NXM O;  4CZZ A;  4AI8 A;  2Z0A A;  4GLX A;  4D7S A;  4IHJ A;  1GAX A;  1XIL A;  2IU3 A;  2ITD C;  1XNR B;  4NYK A;  5LOV A;  1E1R G;  2QWQ B;  3SPG A;  5F2V O;  3CB2 A;  2YIC A;  3MD0 A;  4TV9 A;  2GBO A;  3APO A;  2KQX A;  4JI1 O;  4QE7 A;  2GDS A;  3AG3 C;  3CD6 V;  1KB9 F;  5GON A;  1BQ0 A;  4YY3 O;  3B4S A;  5FPR A;  2Q7H A;  5IY5 C;  1FAF A;  4D7T A;  3LNM B;  1N4C A;  4JZG A;  2RN9 A;  4OPA A;  4CH3 A;  2P7T C;  1PD3 A;  4BR6 A;  4TSF G;  1SQB H;  3ASO B;  5EYP A;  1XMQ O;  3CCJ V;  2PF4 E;  2ZE5 A;  4N23 A;  1YIJ V;  2YIB D;  3FB8 C;  3APQ A;  5LMU B;  2E76 B;  3CPW U;  4Z2W A;  5LMU O;  4JAV A;  2YXH A;  4LF8 B;  1NR7 A;  1I0H A;  4EEQ A;  4BIU A;  4LF7 B;  1H2G A;  2Q69 A;  1ZSP A;  1KKC A;  2GSM B;  3CEI A;  4TV8 B;  3D3I A;  4LNU B;  3UQ8 A;  2CTW A;  3PN1 A;  1SF9 A;  3X2Q C;  2X7R B;  2ETN A;  1Q6U A;  3PJS K;  2JDI G;  2F66 C;  3T4D A;  2IJK A;  2QTS A;  4DUY B;  1XEQ A;  4I55 A;  4X65 O;  1SQX H;  3S3W A;  4R7C A;  1OV9 A;  1WNS A;  1ENV A;  4A5U B;  3ZRX A;  1AI5 A;  1M4U A;  3JAT B;  3D8C A;  1WP7 A;  1P7B A;  4KFM A;  1FXK B;  4KL1 A;  1YF2 A;  4FFB A;  2Y4T A;  5KHG A;  4JI4 O;  2ITC C;  4XDJ A;  1ARO P;  2EUL A;  1W0J G;  4DR7 O;  3RYH A;  1YI2 V;  2FL4 A;  2F93 B;  5C93 A;  1NTK H;  2F4V O;  3EXA A;  3CC2 V;  5JQG A;  1LUV A;  2EBO A;  3ZBH A;  2YI8 A;  4LF6 B;  3CRQ A;  2LJ2 A;  1VQ4 V;  3ABU A;  3JAW A;  4RQF A;  1HW7 A;  2OWO A;  1B3Q A;  4DV2 O;  4MTO A;  3GWO A;  1TUB A;  5KUK A;  4JI3 O;  5LA6 B;  4I5S A;  3ABL B;  2AZ2 A;  2YEV B;  1H2S B;  5IJ0 A;  4B3R B;  2PY5 A;  1MNG A;  2UUA O;  4FLX A;  4LFB B;  1CEZ A;  1XNQ O;  1QR8 A;  4FZ1 A;  1TA8 A;  3WU2 Z;  5KX5 B;  2LW1 A;  2MW2 B;  4DV0 B;  2JGD B;  5KLV H;  4MW8 A;  5L3D A;  4OPH A;  4DUY O;  1FXK A;  1GK9 A;  4CC5 A;  3AG3 B;  5CBF A;  3I56 V;  3AK1 A;  2D2C B;  4XBF A;  1ZUQ A;  1Q90 D;  5JJE B;  4JZ2 A;  1H2L A;  2L35 A;  1F4M A;  4ZIB A;  5LHI A;  3OGI B;  4DV1 B;  3KCX A;  4I55 B;  3MAQ A;  2UXB O;  3RYF A;  1CPY A;  1GH6 A;  1FKA O;  1HNX O;  5CMU A;  5LMN O;  1Q7Y W;  3THO A;  5JH7 B;  1D5N A;  2DYS B;  1OCR B;  1AI4 A;  4AIL C;  2QDO A;  4JAU A;  3E35 A;  4GUN A;  3DXR B;  2HHH O;  1HP8 A;  2XAF A;  3FD9 A;  4FFK A;  4LBE C;  1MZE A;  3JAS B;  4JAA A;  1U97 A;  2UUC O;  3AG4 C;  4QPK A;  2IJI A;  1JCH A;  1Q86 W;  3P3N A;  3ZX6 A;  2DN9 A;  4DUZ O;  2PYJ A;  3BAB A;  1R6K A;  1R3J C;  1BZK A;  4GKJ O;  4RAI A;  3X2Q B;  1VQ7 V;  4P2Z A;  2LGQ A;  4BWA A;  5LYJ B;  3R65 A;  4IGG A;  2UXD O;  4J9Y B;  1K7D A;  5LP6 C;  4PDV A;  4Z1V A;  4O4I A;  5EYP B;  3SJC C;  1G4Y B;  5LP6 A;  1PM9 A;  3OGC C;  3SYO A;  1IX9 A;  3LSQ A;  2E5L O;  1M56 B;  3ZMZ A;  4X1I A;  3T1H O;  3UO2 A;  1IDS A;  4H0L B;  2DWE C;  3WB1 A;  1M9N A;  2WLL A;  2EIJ B;  4WFA V;  3E89 A;  3S3X A;  3RVY A;  5FNV B;  2QGN A;  3DXR A;  5IYD O;  3P30 A;  4O4H A;  4BW5 A;  5EZY A;  2WSS G;  1AR1 B;  2HR3 A;  5EC1 C;  1G8M A;  2QKA A;  1XHZ A;  1BGY H;  1DK1 A;  4JI8 O;  2P06 A;  2XAQ A;  3ABK B;  1QU7 A;  4NXN B;  1Y74 A;  1M1K W;  5H5N A;  3EHB B;  3H1I H;  5CN0 A;  5J9P C;  1RPO A;  4TT3 G;  1QLN A;  2EJ7 A;  4GYC B;  2YIB A;  3T2M A;  4PDR A;  3STL C;  5CBH A;  3RFR A;  2XAG A;  3RN4 A;  4LR3 A;  3DC6 A;  1OHH G;  4D6T H;  3JAK A;  2WLI A;  3ZIA G;  1JOY A;  4GKJ B;  5FLX N;  3W7U A;  4G27 B;  4Z1M G;  1QNM A;  5IYB O;  3E8B A;  4R8C A;  4DV5 B;  4K0K B;  1F4N A;  2YEV A;  3B8M A;  5IJ0 B;  3RYI B;  5LOV B;  1FS0 G;  4NXN O;  3QO8 A;  4H33 A;  5B1B C;  5IYZ A;  3ZMU A;  4DR2 O;  4U7N A;  5CA1 B;  1QLE B;  4JI4 B;  5JQG B;  4FLT A;  4LF9 O;  2PYL A;  4DW0 A;  4XDK A;  4FVM A;  4O2A A;  1GM8 A;  1K5Q A;  1GRJ A;  3LDD A;  1VF6 A;  4KHP O;  2UXB B;  5H2F Z;  3W7X A;  3ZRS A;  4X1Y A;  3G6E V;  2DW4 A;  2EJR A;  1X59 A;  3E8H A;  5DM6 V;  2CTQ A;  4H37 A;  4PHZ A;  3K06 A;  2EIK B;  1YIT V;  1EN4 A;  1SA0 A;  1Y6X A;  1THZ A;  4UVC A;  1ZWI C;  4K8Z A;  4ICG A;  3WB0 A;  1MG1 A;  1S5J A;  2B5U A;  3FYI B;  1F23 A;  2UUC B;  2NLJ C;  3M99 B;  5BY1 A;  1V55 B;  3W7W A;  4CC6 A;  3VQW A;  2Q5Z A;  4XDL A;  1OJH A;  2GUZ A;  5LXT B;  3T1Y O;  4WFG A;  2ATK C;  4F4L A;  4JI6 O;  2N74 A;  3FAV A;  3T1C A;  4DV2 B;  1M90 W;  4GCZ A;  2H94 A;  4KHP B;  1JR9 A;  3IC9 A;  4W4L A;  1KUQ A;  1D5A A;  1D2D A;  2F4V B;  4RQE A;  1HNW B;  3OT7 A;  3JSN A;  1BCC H;  2K1E A;  2M6Y A;  1EBO A;  1TAE A;  1L8D A;  1FPO A;  4DXW A;  2YS8 A;  1KC8 W;  3HKC B;  1BSM A;  3FB6 C;  3DTU B;  3K5L A;  3EFF K;  1JMK C;  1ZL8 B;  3KG2 A;  3K3W A;  3CXH F;  4JI1 B;  5ITZ B;  1AR4 A;  3FKS G;  1XRE A;  5CB4 A;  4CS4 A;  4JV5 O;  3FB7 C;  4AQY B;  3J7A U;  4DV5 O;  4K0K O;  1NH2 B;  3QG5 A;  5EIB C;  1N33 O;  1XMO B;  1LNQ A;  4PDM A;  4X64 B;  4MS2 A;  4R6Z A;  4B3R O;  2A7W A;  2UXD B;  2FTK A;  1LR1 A;  2WA3 A;  4EFB A;  1YSC A;  2OTL V;  1VAR A;  4DR6 O;  1SC5 B;  3H1J H;  3D36 A;  5B3S C;  1E79 G;  3RW0 A;  2NR5 A;  4HNA A;  3ZRV A;  3ASN B;  1H8E G;  5IWA O;  3DGE A;  2DYR B;  1I94 O;  2RJZ A;  1KU9 A;  1P4R A;  1Y4M A;  1NT2 B;  3AG1 B;  1N8R W;  4FIP C;  1WB8 A;  1Q5O A;  1K33 A;  5H9C A;  2L6L A;  1FFT B;  4UCU A;  3ZHQ A;  1JFF B;  3SDL A;  3SPJ A;  5DED A;  2AW9 A;  5EIB D;  4FZ0 A;  4WBN B;  2RNB A;  5LMN B;  4YJ2 A;  3ETQ A;  5IE9 A;  2CK3 G;  4LWS B;  1TVK A;  5BMV A;  1GN4 A;  2DOS A;  2CE4 A;  1EZV H;  3KKY A;  1GN2 A;  2P5O A;  1YCI A;  1QR9 A;  2AXT Z;  3ZHU A;  4FLU A;  3JAM N;  3CJH A;  3HKC A;  5H6Q A;  2A06 H;  3CC7 V;  1S0V A;  1GM7 A;  1YHQ V;  4UV8 A;  2WLJ A;  2ZQM A;  2VQE B;  3CXC U;  4YJ2 B;  1I94 B;  5J2T B;  5A9G A;  4LFC B;  3JAK B;  1I5X A;  3UT5 B;  2ZT9 B;  1QBZ A;  3JD4 A;  4DRX A;  1J5E B;  1TGO A;  1VIB A;  2P4K A;  1ZX3 A;  3L9D A;  1Q8I A;  1QVF U;  1EN6 A;  1VQN V;  5FNV A;  3K79 A;  2ODM A;  2UUA B;  5C8Y B;  1T5E A;  2W0X A;  4L87 A;  3AG2 B;  4JI2 B;  2GHY A;  1EFR G;  1NU1 H;  3BFR A;  5A2Q N;  2ZM6 B;  1JJ2 U;  4HZ3 A;  1YEW A;  3JD0 A;  1VF7 A;  2XHB A;  3JCZ A;  5J2U A;  3ZHT A;  1VF5 B;  3A0H Z;  2H8P C;  1FFX A;  1SA0 B;  3JD2 A;  3BHP A;  2Q68 A;  2WLL B;  3AK3 A;  4DV6 B;  5D5P A;  4YIP A;  2KB1 A;  3ASO C;  3TK1 A;  4YIO A;  5TIS Z;  2DE0 X;  4B08 A;  1EZJ A;  3VQY A;  2BTO A;  3HKB A;  4FLV A;  4WFF A;  3FB5 C;  1JVM A;  4LCU C;  3B09 A;  4UXN A;  4W4K A;  2Q0A A;  3QNE A;  1ORQ C;  4JF3 A;  3K0D A;  3BVO A;  2IM9 A;  2QWN B;  3K08 A;  3T1Y B;  4JV5 B;  1Y76 A;  2O57 A;  2FB5 A;  3TXQ A;  1I5Y A;  3N2K B;  4JI0 O;  2Q67 A;  3LNN A;  3CCQ V;  4GX1 A;  3ABL C;  3H1L H;  1PKX A;  3JAS A;  3G71 V;  1IXB A;  5FL7 G;  4MVQ A;  1DGS A;  3E2E A;  2EIM C;  5CA3 A;  2RMK B;  4DR4 B;  4E2L A;  4JTD B;  4CH4 A;  2W6I G;  2FYU H;  3O9O A;  2MK3 A;  1N0N A;  4HAM A;  1HNW O;  2HVJ C;  2XND G;  3CRR A;  5FPO A;  1XUQ A;  1VF6 C;  1VQ6 V;  1NJI W;  1XL6 A;  2IH1 C;  5KX5 A;  4GZR B;  4NR1 A;  4JI7 O;  4I0X B;  1YJN V;  4DR5 O;  1FXK C;  2YID A;  1AP6 A;  3RT3 C;  1XMQ B;  3CCS V;  3K9A A;  1WA8 A;  1DF4 A;  2ZXW C;  3G67 A;  2OIG A;  1OCR C;  1VQK V;  3U10 A;  4LC1 A;  4HBN A;  3VQX A;  4JYA O;  2WA4 A;  2WPD G;  3SJB C;  4YHH B;  4ZI7 B;  2CUG A;  4UCR A;  1R3K C;  1XQ8 A;  3SJQ C;  3SYA A;  1PNL A;  2RDC A;  2VS0 A;  5BR8 O;  1BQZ A;  1W2B U;  3CCU V;  4ZOL A;  3UKM A;  4B3S O;  4B3T B;  4JI5 O;  3E83 A;  1L1F A;  1XNQ B;  3BRC A;  1AIL A;  4UV9 A;  3OUF A;  2DQ3 A;  2CH7 B;  5DN6 G;  4J80 A;  2H3O A;  3ZRW B;  2QEX V;  1GM9 A;  1F7Y A;  2QKS A;  5KUM A;  2LP7 A;  3AG2 C;  3L73 H;  2WLH A;  2Q8V A;  2Y0P A;  2P6J A;  3LUT B;  2YXY A;  4DV7 B;  1SQG A;  1A32 A;  1UFI A;  1CP9 A;  3G80 A;  4WFH A;  4X62 B;  3HKB B;  2KSD A;  2AHZ A;  2HEP A;  1NH2 D;  2EIJ C;  2JJ1 G;  1MZF A;  1BMF G;  2ZR3 A;  1ZAU A;  4DR1 O;  4B3M O;  5K1P A;  2KKW A;  3JAT A;  3CS5 A;  3CC4 V;  2QE7 G;  3E8G A;  3ABT A;  4JYC A;  1IUR A;  5B1N A;  3CX5 F;  2BSK B;  1WP8 A;  3SJA C;  5J2U B;  5BXZ A;  3CSX A;  3BPZ A;  5LYJ A;  2LGW A;  2P4V A;  2Y0I A;  4QPJ A;  1XI1 A;  2LFR A;  4MVR A;  3ABK C;  4KXR A;  5L3F A;  1S5L Z;  4MT8 A;  1WJZ A;  5KMG B;  3OTO B;  4GT1 A;  1Q81 W;  3OTO O;  2UUB O;  3A0R A;  2W0F C;  2B1G A;  4LNU A;  5B1A C;  1M5I A;  3SYP A;  3BY6 A;  1R73 A;  1R6T A;  4B7E A;  2EX3 A;  1RSO B;  3SYQ A;  1VQ5 V;  1DF5 A;  4J7J A;  4MVM A;  1JA8 A;  4JYA B;  3AK2 A;  2PZS A;  4NTY A;  5K1X A;  5JH7 A;  4UVB A;  5LP6 B;  4GKK O;  1AP5 A;  4DV3 O;  4C7U A;  2WAM A;  1VQL V;  1KBH A;  2ZIN A;  5LBQ A;  4DW1 A;  1FD9 A;  3ETD A;  1RFY A;  2BSK A;  1NTM H;  1RM1 C;  1DLB A;  1DTO A;  2YI9 A;  1S77 D;  2DWD C;  1IBM O;  2GTA A;  1WPX A;  2CTR A;  2Q7G A;  1AI7 A;  1OCO C;  4X1K B;  2EZP A;  5H6R A;  1UPG A;  4WBN A;  2QM4 A;  3D3Q A;  3JAL A;  3CCV V;  1HDJ A;  3VBB A;  1JJO A;  4F6R B;  4PJ0 Z;  1SRY A;  4JI5 B;  4B3S B;  4B3T O;  1R1B A;  4QNH B;  3BAA A;  3B40 A;  1OCZ C;  2IW5 A;  5IDJ A;  2ILM A;  2AZ0 A;  5LA6 A;  5LGU A;  3ZS8 C;  3LSU A;  2CH7 A;  1KMI Z;  1Y67 A;  3ZN1 A;  5KHI A;  4WCE V;  1RPR A;  1XDC A;  3CCE V;  3DSQ A;  2E74 B;  4PDL A;  4R50 A;  1IZ3 A;  1E1Q G;  2QM8 A;  3MHS C;  5CA0 B;  2JJ2 G;  2UXX A;  1J95 A;  1Q82 W;  3CRM A;  1QCE A;  2QWR B;  4I0X A;  1KQS U;  3IC7 A;  3LDE A;  3ZHS A;  2IBZ H;  3H01 A;  4FM2 A;  5JVD A;  2P67 A;  3P32 A;  2JGD A;  4DV1 O;  4FMT A;  1M57 B;  2OCH A;  2ZDI C;  3F7Y C;  4PV1 B;  4PA7 A;  3I5D A;  5C8Y A;  1OCC C;  4DYL A;  1N0J A;  2OCC C;  4TV8 A;  3JCU Z;  3LDC A;  3QO7 A;  4RWU A;  1M93 A;  1WPB A;  4I4T B;  1WLE A;  4K8X A;  4EB6 A;  2ZM6 O;  4MTF A;  1X4T A;  3IAY A;  4PA4 A;  1FJG O;  5B66 Z;  1NKD A;  3GWK C;  3N2K A;  4X8A A;  3JAW B;  3DC5 A;  3TJT A;  2EIL C;  2R72 A;  2F95 B;  2N04 A;  3W7T A;  2VQF B;  4NKG B;  1IXM A;  4FK5 C;  4OX9 O;  4JI3 B;  2EIN B;  1XMO O;  1GN3 A;  4MVS A;  2WWW A;  2HKO A;  3CME V;  5KAF Z;  4YJ3 A;  2QJ1 A;  3OEH G;  2ZIM A;  4NTW A;  2VQE O;  4JI8 B;  4P9O A;  4ZHQ A;  4QJF B;  4RUE A;  2AGA A;  1JFF A;  1Y76 B;  1K8A W;  4WFE A;  4MVO A;  2VRZ A;  4P9P A;  3NR7 A;  3B2E E;  4JGS A;  2D3O W;  4U3J B;  2ZCE A;  5GW7 A;  1H38 A;  5L3G A;  1HNZ O;  3FX7 A;  3ASN C;  2LFS A;  3ZRW A;  3OMA B;  3JYC A;  4LF8 O;  3JD1 A;  4TQD A;  4HNA B;  4CBC A;  3TET A;  5E79 Z;  3R66 A;  4WFB V;  3B77 A;  3P3P A;  3SYC A;  2M7W A;  3K58 A;  4MVZ A;  4X65 B;  2HVK C;  1OCO B;  2ZE8 A;  4JI2 O;  1FFX B;  4X20 A;  3K0G A;  2YSU B;  4ASU G;  1S72 V;  1FXH A;  2E3C A;  1HNZ B;  5LL6 Y;  4X20 B;  1Z5V A;  5KA6 A;  3AG1 C;  1EM1 A;  4I50 B;  2GTS A;  4DR4 O;  1MMM A;  3L72 H;  2Q6A A;  2CDY A;  1WB7 A;  1R3I C;  3A8T A;  4LH6 A;  3CE2 A;  1PNM A;  1RP3 B;  4UFZ A;  5JCO A;  4JYY A;  2V4D A;  5BZB A;  4PA3 A;  5IT9 N;  2BCC H;  5GON B;  2UXC B;  3UT5 A;  1UJW B;  2IJH A;  3ZHV A;  4NXM B;  4J41 A;  3OMI B;  5KA5 A;  4G2K A; 
#chains in the Genus database with same CATH homology
 1KYO F;  3L73 H;  5KLV H;  1SQB H;  1SQV H;  1SQX H;  1L0L H;  1NU1 H;  3CX5 F;  3L75 H;  1PPJ H;  3H1H H;  4U3F H;  1SQQ H;  1P84 F;  1EZV H;  1BGY H;  1SQP H;  1NTK H;  1NTM H;  1KB9 F;  2BCC H;  3H1L H;  3CXH F;  1L0N H;  3TGU H;  3L70 H;  3L71 H;  4D6T H;  3L72 H;  3L74 H;  1BE3 H;  3H1J H;  2A06 H;  3H1I H;  1PP9 H;  3CWB H;  2FYU H;  3H1K H;  4PD4 F;  2IBZ H;  1NTZ H;  1BCC H;  3BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...