3L71H

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l71H00
1NTZH 1NU1H 3L75H 1NTMH 3L70H 1SQXH 1PPJH 1SQBH 1BGYH 1L0NH 3H1KH 4PD4F 2IBZH 3CX5F 3CWBH 1EZVH 1SQVH 1L0LH 3BCCH 2FYUH 3L71H 3H1LH 1KB9F 3H1IH 3CXHF 3H1HH 2BCCH 1P84F 3L72H 3L74H 1PP9H 4U3FH 3TGUH 1SQPH 1NTKH 2A06H 5KLVH 3H1JH 4D6TH 1KYOF 3L73H 1BCCH 1BE3H 1SQQH
chains in the Genus database with same CATH superfamily
4ZKIA 1KC8W 1QR8A 4UB8Z 1SQXH 3CD6V 2F93B 4U3JB 3JD2A 2M6YA 1QNMA 2ZIOA 3N2GB 4TV8A 1JVMA 4TWKA 4GKJB 4GCZA 5IWAB 1WP7A 5E1AC 2P7TC 1BE3H 4JI1O 1FXKB 4DRXB 4IIJA 4JI6B 3J81N 2PTMA 4GX1A 3LSSA 3DC6A 3SJAC 4L87A 5IY5C 2ATKC 5EIBC 3VQVA 4ZOLB 1Z5WA 3PJSK 4EB6A 1Q7YW 3CP1A 2WPDG 4P9OA 3OMIB 4R8CA 2CTWA 3OAAG 1MABG 2CE4A 1QVFU 3NR7A 3RFRA 1AILA 3O9OA 4J10A 4P2ZA 5CN0A 3SR2C 5B1OA 2QR4A 3QO7A 4IYIA 5BMVB 1RM1C 1U97A 1Q6HA 4TQDA 2EIJC 3KG2A 1JJ2U 1VEWA 1CXZB 3VQWA 3HKBB 3BA9A 1BCCH 4MVQA 5IJ9A 1WPBA 3W7SA 2CGOA 2QWQB 4OGQB 4F6EA 1VQ6V 2QE7G 1OCOC 5LYJB 3OEHG 2Y4TA 4MW8A 1IBLO 5GW7A 4MT8A 2QKSA 3E86A 4NXMO 1ZX3A 1VQ5V 4WBNB 1QR9A 1AI5A 3DXRA 3OE7G 2IBZH 4DUZO 1VIBA 4NTWA 3T1HB 1H8EG 1RPOA 3JSNA 4X20A 4MSWC 4X88A 1QLEC 2JJ1G 1P7GA 2X6CA 4BIUA 4JAVA 4B3TO 3CCJV 3FKSG 3ZS8C 4B7KA 3VBBA 3KZIZ 3SYQA 4FLYA 5LOVB 2PI5A 1NTMH 3JALB 5H9CA 4H44B 3CB2A 2IU0A 3CPWU 2BOCC 3LUTB 1Q5OA 3UQ8A 2NLJC 4TV9B 5LGTA 4LF8B 1VARA 2IH1C 1M57B 2DYSC 1YXBA 4DV3O 1PNMA 1SZTA 2OCHA 4QJFB 4JI8B 3TETA 4E4EA 1VF6C 1ZWIC 5KA6A 2UUAO 2LW1A 1THZA 1BGYH 1W2BU 2QWRB 2E5LO 4F6RB 3HKCB 4JYBA 1YCIA 1JFFB 3T1YB 4J9ZB 3Q4HB 4X66B 2CTRA 1AR1B 5JQGA 1L8DA 2QTSA 4I4TA 4MTGA 2GTAA 5L3CA 5EBLC 1OHHG 5FLXN 1DGSA 2CAZC 2MW2B 4JI0O 3WU2Z 3ASNC 4LFCB 3T4ZA 4JI5B 1K33A 4J41A 2UUBB 1ENVA 1K5SA 3LNNA 2LW7A 4I0XA 3B8NA 1NVPD 2B5UA 3B8MA 3W7XA 3L75H 1W0KG 2UXXA 1M56C 1WA8B 4GKJO 5KHIA 3BRCA 4DV0B 1VQLV 2Y0PA 4PV1B 2JVDA 1E79G 4FLTA 5FPOA 1WNSA 2CK3G 1MOFA 5FNVA 1GM7A 1EFRG 1GM9A 1Y74B 4AILC 4JI6O 2Q0OC 4JTDB 3E22A 3B2EE 1XBLA 2NN4A 5EC2C 4CS4A 1N8RW 4YY3B 3ZRVA 1SQBH 4B3SB 3P32A 3HKDB 4DXWA 3CRCA 4JYCA 3M7MX 4FFBB 4NKGB 1XREA 3QO8A 4YJ3B 4DW1A 1SZXA 5J2TB 1NJIW 3FB7C 2RDCA 5BMVA 2Z3YA 2QWNB 2QM4A 4JI3B 1H2LA 1S5LZ 3QVNA 4NVPA 3D36C 2WA4A 3K9AA 4P9PA 2XNDG 5B1BB 4X1IB 4FIPC 4QIWF 1HDJA 1HR0B 2WA3A 1RP3B 3OGIB 1B04A 4WF9V 3ABTA 1YSCA 3ABMC 4MVSA 2BSKA 4RO2A 5GONA 4ZI7B 3E89A 1OCCB 1XI1A 1GN4A 2GSMB 1KP3A 3UT5B 4JGSA 1K34A 5EZYB 2WLKA 5CA1A 5LMUO 2R9IA 5BZBA 4RWUA 4LF7O 4O4JB 4GT1A 2ZXWB 4GX0A 1YI2V 3F7YC 1MG1A 2OWOA 3T1HO 4XDLA 3SPHA 4KXRA 2FB5A 4LF6O 4O4LA 5LOVA 4GX2A 4BAYA 5EIBD 3W7TA 2EINB 2AXTZ 2LJ2A 5KX5B 4J11A 3K5MA 2YIAA 3JAWB 4MVRA 3FB6C 3G6BA 2UUCB 4D6TH 1QU7A 2Z0AA 2XOKG 3RYHA 4I55B 4E2LA 1VF5B 5CA0A 2EIMB 2NNUA 4I50B 5J2UB 4LF8O 4X62B 1H2NA 1FYJA 3BA8A 4AHCA 2CGNA 2H3OA 3DGEA 3AG1B 3CCQV 4JI8O 4F6RA 3E8BA 2B1GA 4OPHA 3STZC 1V55B 5L3BA 5LXTA 1D2DA 1D5AA 3AG3B 1FJGO 4DR4O 1FFXA 4JYAO 1HW7A 1L0NH 3SPCA 2PYJA 3JSLA 1Y6XA 4JI1B 3SDLA 3ZJZA 3T1YO 4QPJA 5JH7B 4UCRA 2G38A 3JCZA 3BPZA 1BHBA 2HG5C 1XL4A 1HNXB 1WB8A 1P49A 5KUKA 4ZHQA 4QNHB 4X1YB 5F2VO 5LHIA 3ABLC 1E1RG 1OCZC 4CH6A 1GO3F 3FAVA 4DR2O 4LF5O 4K35A 4BIZA 3CJHB 1Q3EA 4DR6B 1F51A 3CRMA 4R50A 3E83A 3DC5A 3MHSC 5EK0A 5IY5B 3CC7V 5JCOA 2IM9A 2EILC 2V1DA 2JRIA 4DV0O 2B1IA 2DOSA 3G80A 3SYAA 2UXBB 3RW0A 5L3DA 2VS0A 1GH6A 1Y76A 3ZRSA 2EX3A 4KL1A 4TUYB 1FXHA 5IJ0B 4UVBA 1QBZA 1WLEA 3F5WC 3ICXA 4FFBA 2R9RB 1J95A 4PI0A 1SERA 4B3SO 1Q8IA 1QVGU 1Q90D 4IHJB 1IBLB 1RM1B 1S3JA 5B1AC 3K06A 1OCRC 5ITZA 3CEIA 1DK1A 5A9GA 4B3MB 4N23A 1XNRO 3OD4A 3N27A 4JI3O 4PI2A 2A7WA 4W4LA 4RUFA 2QKAA 3WB2A 4MVZA 2L35A 2VQEO 4DK0A 1HR0O 4TT3G 3ZRWB 2F66C 4TOIA 4B3TB 2WSSG 4F4LA 1K92A 3CWBH 3UKMA 1EZVH 5L3GA 1CPYA 5LP6C 4NXNO 2KSDA 4LNUA 2VWKA 4BW5A 2YEVB 3K04A 2Q8VA 4DV3B 1XUQA 5C8YA 4J7KA 2A79B 3MDSA 4D7TA 3U11A 2F4VO 1SESA 3K0GA 4HNAA 4Z2WA 2Q0AA 2LFSA 3BHPA 1KB9F 1SQGA 3GVMA 1N34O 4PJ0Z 2UUAB 1ZTEA 5LA6B 2ARHA 4IGGA 2Q67A 5DN6G 2ZDIA 2DWDC 3L9DA 4FLUA 4D7SA 4NTYA 2UXCO 1TGOA 5LGUA 3G4SV 2BTOA 3OM3B 4I50A 1AROP 5J2UA 2X7RB 2HHHB 2UUCO 2WLJA 3H1HH 3TCUA 1QCEA 4MVMA 4N21A 2YXHA 3RYFA 4JI0B 4GKKB 3WFVA 2ZKOA 1H38A 4XBFA 4FZ1A 3OMAB 1FKAO 2ZD9A 4K8XA 1TUBA 2WLLB 2YSUB 4DV2B 4JZ2A 2P06A 4FM0A 5KA5A 4PA4A 3AK1A 4PA6A 3U0ZA 1VQ8V 2LQTA 4J9YB 4CS2A 4JF3A 1MZEA 4LWSA 3SPJA 4K0KO 4G28B 4RQEA 2R72A 3ASNB 1EM1A 1KUQA 3B40A 1Q81W 2BTQA 1HNXO 1FD9A 4G27B 4X1YA 3SYCA 1YTFD 3GWKC 4FK5C 2ILMA 2AHYA 3SJQC 3K58A 4X9QA 1ORQC 2QDOA 4JI4B 5IYCO 4CS3A 3CJHA 3OT7A 1M56B 4MS2A 4UVCA 3CXCU 3B77A 4NR1A 1XHZA 2Q68A 4DR6O 1SETA 1IX9A 4CH5A 2P6JA 3JATA 5GTIZ 2LGWA 2V4DA 2HKOA 2Q4PA 4DR3O 1R6NA 3JASB 3GWOA 2UXBO 1ZL8B 2DMXA 2JJ2G 4FLVA 3N2KB 2JS3A 4IHJA 2P5OA 1IURA 5B3SC 3ZMTA 5B5EZ 2ZT9B 3A0RA 1S72V 3K3WA 3RYIB 3UO3A 4J42A 4XDJA 2YC0A 4FJCC 5KUMA 2ITDC 2QM7A 4KHPO 5LMUB 3JAKA 4B3MO 4LF7B 3ZIAG 1KQSU 3R66A 2ADPA 4QGPA 3ABMB 1R3LC 4AI8A 2Z5UA 1NKDA 2FYUH 1BSMA 3ZRWA 3T4DA 1WAZA 2GHYA 1XL6A 4LF6B 2QJ1A 5B1NA 3ASOC 3B09A 4LF4B 1YTFB 1F23A 4K3AA 1KD1W 2DN9A 1AVMA 2EJRA 4DV6B 2Y69C 5CB4B 3OR6C 4RUEA 2GUZB 4HZ3A 2CTPA 4OX9B 1QLNA 2QEXV 1JMKC 3OR7C 3BCCH 4JAUA 1YIJV 4GLXA 4MVUA 3QNEA 2AZ0A 2XUMA 3K5OA 1K3EA 1NS1A 4O2AB 4FVMA 1YF2A 1R3IC 5FL7G 1I7FA 5H6RA 2GTSA 1TA8A 5DM6V 1LUVA 1FJGB 1P7BA 2P4VA 4DR4B 4X89A 3P3NA 4P30A 2EJ7A 5IE9A 4JYAB 1SA0B 2HLDG 3P30A 1IZ3A 3AG4C 3L72H 4O2BB 3EXAA 1EN4A 2JGDA 5IT9N 1X59A 2HEPA 3LSUA 4UCSA 2EIKC 1IBKB 2HHHO 4TQFA 1GKFA 3OGCC 2R9AA 2YUAA 3FFQA 5DECA 1I0HA 3AG2C 2IH3C 3DTUB 4U3JA 2OIEA 3ZMVA 1J5EB 4GKKO 2GBOA 1JPXA 4DR2B 4LF5B 3W7WA 1IXBA 1GTOA 4X1KB 3N2GA 4DV2O 4UVAA 1NBMG 1VQ7V 2JK5C 4A5UB 2A9HA 1GAXA 3WG7C 1AI6A 1MZFA 1FXKA 1L0LH 2IJIA 3L71H 4DRXA 4KUMA 2Q5ZA 2R70A 3JD1A 1QHTA 3BY6A 2BCCH 4DUYO 3EHBB 1T5EA 2CH7B 2FMLA 3ABLB 4ZOLA 1VQMV 4BIOA 1OCZB 1QQCA 1U96A 3ZHVA 5IYZB 5EYPB 3H9VA 1WJZA 1OJHA 3QG5A 3J7AU 4JI4O 1KP2A 1YEWA 3CCSV 2AHZA 2F43G 2OCCB 2EILB 5KMGB 1YJ9V 3STLC 2LP7A 1G8MA 3JARB 4UUJC 3J80N 4NB5A 1XNRB 2P90A 2Y4UA 4HBNA 1BT8A 1TUEB 2V7QG 5B66Z 1R6KA 5LHHA 2VQEB 1TVKB 3HKBA 3CX5F 3K0DA 2ZNIA 2QWPB 1GRJA 1NH2D 3APOA 3MD0A 2YIBA 5B1AB 3VQXA 3U10A 3ZN1A 1OCRB 2BOBC 5LYJA 5DEDA 4EEQA 4NXNB 3QTCA 1YDXA 1MMMA 1HNWB 4PA7A 2PI4A 1Q6IA 4EFBA 1I5XA 4UFZA 4WBNA 3G6EV 4LBEC 1YITV 1NVPB 2F4VB 4RAIA 1FXVA 2F23A 2ZNJA 1N34B 4WFGA 1KMIZ 5LP6B 1UFIA 5JVDB 4PDRA 4DV4B 1PNLA 1K7DA 2Q6AA 1XEQA 1H2KA 4GX5A 1SQVH 4LF4O 3ZHQA 3JALA 2GUZA 2UXCB 2ZIMA 3ZN0A 3IAYA 3S3WA 4DV6O 3TGUH 4TV9A 2H8PC 4UXNA 3ZHRA 1A32A 3BVOA 4OX9O 2DJVA 3VOUA 1MSWD 3ETGA 1K73W 3G71V 2Q7EA 3AK2A 2DWEC 4O2AA 3X2QC 1Y67A 2Q73A 2YI9A 2KG7B 5AG2A 4QPKA 1DLBA 1AP6A 2Q7GA 1VQOV 4X8AA 4LFAB 3IJ4A 2WLHA 2ZM6B 3HKCA 2K1EA 1WPXA 3G67A 4FM2A 3HPLC 2EBOA 2D2CB 4I5SA 1JFFA 1K97A 3Q4HA 2Y48A 2RNBA 4UB6Z 3ZHSA 1HWYA 4K0KB 1KECA 3H1IH 1HP8A 1M5IA 3S3XA 4JYYA 4Z1MG 5LL6Y 1BZKA 3A0BZ 1IBKO 3E8HA 4OPAA 3BAAA 5HFLA 1SQQH 5IYBO 2ODMA 2F1MA 4MTOA 4J7ZA 4JI7O 4JV5O 4PD4F 4PDVA 4TV8B 4DV1O 1J5EO 1AP5A 3CE2A 4CH4A 1B6QA 3KCYA 3ZMSA 2KQXA 4FLZA 3O65A 3CRAA 1FPOA 5JJNB 1WA8A 1I08A 3FX7A 3C90A 5K1PA 2D3OW 4IIJB 5KLVH 3CCUV 2OTJV 4I7ZB 1KYOF 1K4DC 4X64B 5JCOC 2RMKB 4EB6B 3OMNB 4DR3B 1Y74A 1NT2B 4H0LB 4UCVA 2B9ZA 3D3QA 1PNKA 3ABKC 4R7CA 3A2FA 5EYPA 1SKVA 2WAMA 3HKDA 3K5NA 3ZCCA 4YJ3A 3ZMZA 5KMGA 3CRRA 3I55V 5J2TA 3ZX6A 1I94O 1IBMO 3JARA 2JGUA 4U7OA 2A0LA 4LFBB 1R1BA 4KHPB 2EIJB 5BXZA 2UXDO 3IFXA 1BQ0A 2RN9A 5EBWC 1YHQV 2XAJA 1B06A 4HYOA 4WFAV 1TVKA 2QWOB 3RVYA 1E1QG 4FFKA 4X1IA 5IJ9B 4JI2O 2W6JG 1N32O 4DR5O 5KAFZ 1PV0A 3SPGA 5B3SB 2UU9B 3OUFA 3ML0A 3K57A 1OCOB 3SJCC 4W4KA 2IW5A 5KHHA 3H1KH 1HNZB 4ZI7A 3LNMB 1SRYA 4GYCB 1PM9A 3RN4A 5FPRA 5LMNO 1F4NA 3UT5A 4AQYB 4LF9O 1GK9A 5EZYA 3OFNG 5JWPA 1LNQA 3OW2U 1HNWO 3E8GA 2EZPA 1Z2GA 3UO2A 2GV9A 2DW4A 1G6UA 1G4YB 4O4JA 1URFA 1SF9A 4X20B 1QLEB 2HP8A 3I56V 3ASOB 3HB3B 5LP6A 5JVDA 3ZEDA 1JOYA 1FS0G 2DYRC 1KKCA 1XDCA 2Y69B 4TSFG 1MA1A 2ZCEA 4DV4O 3HR0A 1WP8A 1M9NA 2ZDIC 5EBMC 3K59A 5KX5A 3WB0A 4JASA 4DO2A 1NTZH 4UCUA 4O4HB 1OZ0A 3JAWA 5H2FZ 1AB3A 1JQ0A 5BY1A 2QGNA 2DYSB 1M90W 4I55A 1BQZA 1IXMA 1N0JA 4YHHB 4JTCB 3SYPA 3ETQA 4CBCA 4I9QA 1ZLZA 4YXWG 1BMFG 2XAFA 3OEEG 2IJHA 1SQFA 2YIDA 3AG4B 2YXYA 1GN6A 1R3KC 4LFAO 3HKEB 4FM1A 2ZM6O 4NYKA 3K03A 1OV9A 2DE0X 1PP9H 3TXSA 4PELA 4MVOA 3T1CA 4U7NA 3W7UA 5JH7A 4C7UA 1AI7A 4I4TB 3CYOA 1S0VA 4DV5B 2YIBD 4I9WA 4DUYB 1Q6UA 4WFHA 2PY5A 2RQ6A 2KKWA 1N4CA 1K5QA 4PDLA 3AG2B 2OYQA 3CMEV 2VQFO 4ZBMA 4I0XB 3FB5C 1W0JG 3ZBHA 2XTAA 3H1JH 3WG7B 4UV8A 1F4MA 1M93A 2PGGA 3L70H 4KFMA 1NQTA 5H6QA 3T2MA 4DR7B 1GM8A 1Q82W 3RYCB 5FNVB 2N05A 3ZHTA 1EZJA 4JPRA 3UCSC 3E22B 2E74B 1MNGA 2YDEA 4X64O 1NR7A 1XMQB 4B08A 2E76B 4TUYA 4JZGA 5IJ0A 1VQ4V 1ZSPA 3TJTA 4PDMA 1YJNV 4X65B 2ZE7A 2JDIG 1PPJH 1VF7A 1UJWB 1K4CC 1YJWV 2W0FC 3A0HZ 2HVKC 1XILA 3SJBC 5LBQA 1NZ6A 2Q69A 4LFBO 5JJEB 3CS5A 5CBGA 1V9PA 4DW0A 2E3CA 2AZ2A 3M8AA 3OTOO 2OTLV 4LC1A 2Y0IA 3CC4V 2PZSA 4YJ2B 2BSKB 5GONB 1LUWA 1ZAUA 2UU9O 2WLIB 5H5NA 1H2SB 2CUGA 5A2QN 3CCEV 2IJKA 3CSXA 3L73H 1HNZO 4BW9A 3F7VC 3BEHA 1FAFA 3ZRXA 5CA1B 5BR8B 2YEVA 4AQYO 1V54C 4DV7O 4FLXA 1IVSA 1XMOB 2N04A 1VQ9V 3RBZA 3I5DA 4ZIBA 4BWAA 4ASUG 3OUSA 1VMGA 4IL6Z 5LA6A 5TISZ 4LR3A 5LHGA 4O4LB 1JR9A 3F5TA 1XNQB 3UM7A 3BABA 3JAMN 2YXLA 4O4HA 1N0NA 2OT5A 3R65A 3QF7A 3RYHB 3OTFA 4K8ZA 1P84F 5CA0B 1SQPH 3BFRA 2VWJA 1XQ8A 3MAQA 3E8FA 2XASA 3X2QB 5L3FA 1VF6A 1GN2A 4YIPA 4YHHO 1F7YA 1N33B 3CRQA 2QKCA 2L6LA 4JI7B 1G1XB 4JV5B 2IU3A 2Q9LA 3AK3A 3K79A 5LXTB 2WLLA 2JEXA 3HKEA 4DV1B 1FFXB 2CDYA 4UV9A 1Y66A 1CEZA 1NU1H 1NR1A 4B3RB 5L3EA 1EN6A 1BL8A 1IDSA 1S76D 1S5HC 4QE7A 3CHXA 4CH3A 1FXKC 1N36O 1JX9A 4ZHQB 3CXHF 1WN7A 4CC6A 4DV5O 1NI8A 3PN1A 3GB7C 3FAVB 4DYLA 1ROPA 2ADQB 1EN5A 3D3IA 3TXQA 3CCRV 4MW3A 1S77D 1I94B 1IBMB 1PL0A 1LR1A 5IWAO 5IDJA 3CCLV 3ZMUA 4CC5A 3K5LA 2PUSA 1MSDA 2X6AA 2ZE5A 3RYCA 3WB1A 3FD9A 2UXDB 4Q6GA 2X6BA 3FB8C 4PA3A 4DR7O 3ABKB 2ITCC 1KBHA 1VP7A 4JI2B 5KHKA 1Y76B 3CCMV 1N32B 2UXNA 4DR5B 2P22C 1YZBA 2AW9A 1AI4A 1K9MW 4O4IB 1M1KW 3JASA 2FKXA 5GTHZ 4EKWA 1ZL8A 3C3TA 1BS3A 1XMQO 2QSAA 4FZ0A 3VQYA 3N2KA 4ICGA 4CZZA 1JCHA 4X65O 2FTKA 5ITZB 5LMNB 3JYCA 2BE3A 2QA4V 1S5JA 3RVZA 3RYIA 3D36A 4UCTA 4LF9B 4MTFA 2P67A 3E2EA 3SYOA 3SPIA 2ZR2A 2HR3A 5EC1C 2Q7HA 3JCUZ 2PF4E 4YJ2A 4IT5A 1KU9A 4L8JA 3K9SA 1RSOB 3APQA 2AGAA 2WLIA 4FMTA 4FLWA 1O9HA 4Q20A 4PHZA 4XDKA 3ABUA 3LDEA 3IC7A 2A3QA 3CMAV 5JJJB 4LNUB 2K9PA 4OXSA 2X0LA 5CB4A 3K08A 2YS8A 1DF5A 5C8YB 2WLNA 1KKDA 1JJOA 5BR8O 3JD4A 1M57C 1Y4MA 4HNAB 2DQ3A 1PL4A 2DYRB 3RGBA 3THOA 4R6ZA 1XMOO 4NTXA 5K1XA 1X4TA 2WLMA 2LGQA 2P4KA 2XAGA 4DR1B 1R6TA 1WB7A 2XHBA 2ZQMA 1COWG 3EVKA 1XNQO 2ETNA 3IGAC 2IJJA 1SA0A 3FYIB 2M7WA 1NH2B 2JS5A 4O2BA 1P4RA 1VQKV 5J9PC 5HFMA 4WFFA 3AEIA 1H8HG 1YVWA 2O57A 4J80A 3H01A 1I5YA 3RYFB 3ETDA 4WCEV 4LH7A 1R73A 1TAEA 2MK3A 1D5NA 1N33O 1TUBB 2VQFB 3KCXA 2HJFC 4HAMA 4LP8A 4MTXA 4JAAA 5KHGA 4X1KA 4ABMA 4GUNA 3CC2V 2VRZA 4WFEA 1AJQA 2JEUA 2OIGA 4H37A 4X66O 4LWSB 1AJPA 1GMGA 2H94A 2DQ0A 3FYEB 2CTQA 5C93A 2JIZG 3C3SA 3E35A 4B3RO 4DK1A 1GN3A 2LFRA 2BTQB 4PA9A 1W59A 2CH7A 4JTAB 4B7EA 2RJZA 4Z1VA 2QTOA 4LFCO 1UPGA 2PYLA 5D5PA 4JI5O 3LSQA 2EULA 3H1LH 2UUBO 2XAHA 5IYZA 2ZE6A 3QO5A 1DTOA 4EFEA 3A8TA 1H2MA 3B4SA 2ZE8A 2OCCC 4LCUC 1H2GA 3KKYA 5KHJA 3JD0A 3JATB 2F95B 1Q43A 4LH6A 1ZUQA 1RFYA 2FL4A 5CMUA 1Z5VA 1SS3A 3OTOB 3LDDA 4O4IA 1BHAA 3L74H 5B1BC 1B3QA 2WWWA 3DSQA 2HJDA 2A06H 4YY3O 1AR5A 3IC9A 1VQPV 2GDSA 3ETEA 3ZHUA 1PD3A 4NXMB 1OCCC 5IYDO 2W0XA 1VQNV 3NXSA 1US6A 2QM8A 4GZRB 2NR5A 3RWRD 1K8AW 3JAKB 3JD3A 4DUZB 2KB1A 1EBOA 4DV7B 2YI8A 4J7JA 5CBFA 3DXRB 3LDCA 4H33A 4BR6A 4KP4A 1CP9A 1RSOA 5D5QA 3EFFK 2ZXWC 1M4UA 4G2KA 1AJNA 3TK1A 1O9GA 4QE9A 2ZINA 2XT9A 1SC5B 1L1FA 1V54B 2EINC 2XAQA 1XHXA 5KAIZ 5CBHA 2W6IG 2HFEC 3D8CA 1FFTB 2EIMC 2N74A 2RCVA 4UCOA 2E5LB 4U3FH 1RPRA 3RT3C 2LO1A 1PKXA 2KG7A 3MHHC 4IYHA 5CA3A 4RQFA 1R3JC 3AG1C 1Q86W 1NTKH 5E79Z 4DR1O 3CCVV 1DF4A 1XOUA 2EZOA 3SGIA 1V55C 2JGDB 1AR4A 5LGNA 3M99B 3AG3C 3AG7A 2ZR3A 2C2AA 5JQGB 2YICA 2EIKB 4X62O 3P3PA 4WFBV 1N36B 4H13B 1JA8A 2HVJC 4FPPA 2E75B 4YIOA
chains in the Genus database with same CATH topology
1NTZH 1NU1H 3L75H 1NTMH 3L70H 1SQXH 1PPJH 1SQBH 1BGYH 1L0NH 3H1KH 4PD4F 2IBZH 3CX5F 3CWBH 1EZVH 1SQVH 1L0LH 3BCCH 2FYUH 3L71H 3H1LH 1KB9F 3H1IH 3CXHF 3H1HH 2BCCH 1P84F 3L72H 3L74H 1PP9H 4U3FH 3TGUH 1SQPH 1NTKH 2A06H 5KLVH 3H1JH 4D6TH 1KYOF 3L73H 1BCCH 1BE3H 1SQQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ H;  1NU1 H;  3L75 H;  1NTM H;  3L70 H;  1SQX H;  1PPJ H;  1SQB H;  1BGY H;  1L0N H;  3H1K H;  4PD4 F;  2IBZ H;  3CX5 F;  3CWB H;  1EZV H;  1SQV H;  1L0L H;  3BCC H;  2FYU H;  3L71 H;  3H1L H;  1KB9 F;  3H1I H;  3CXH F;  3H1H H;  2BCC H;  1P84 F;  3L72 H;  3L74 H;  1PP9 H;  4U3F H;  3TGU H;  1SQP H;  1NTK H;  2A06 H;  5KLV H;  3H1J H;  4D6T H;  1KYO F;  3L73 H;  1BCC H;  1BE3 H;  1SQQ H; 
#chains in the Genus database with same CATH topology
 4ZKI A;  1KC8 W;  1QR8 A;  4UB8 Z;  1SQX H;  3CD6 V;  2F93 B;  4U3J B;  3JD2 A;  2M6Y A;  1QNM A;  2ZIO A;  3N2G B;  4TV8 A;  1JVM A;  4TWK A;  4GKJ B;  4GCZ A;  5IWA B;  1WP7 A;  5E1A C;  2P7T C;  1BE3 H;  4JI1 O;  1FXK B;  4DRX B;  4IIJ A;  4JI6 B;  3J81 N;  2PTM A;  4GX1 A;  3LSS A;  3DC6 A;  3SJA C;  4L87 A;  5IY5 C;  2ATK C;  5EIB C;  3VQV A;  4ZOL B;  1Z5W A;  3PJS K;  4EB6 A;  1Q7Y W;  3CP1 A;  2WPD G;  4P9O A;  3OMI B;  4R8C A;  2CTW A;  3OAA G;  1MAB G;  2CE4 A;  1QVF U;  3NR7 A;  3RFR A;  1AIL A;  3O9O A;  4J10 A;  4P2Z A;  5CN0 A;  3SR2 C;  5B1O A;  2QR4 A;  3QO7 A;  4IYI A;  5BMV B;  1RM1 C;  1U97 A;  1Q6H A;  4TQD A;  2EIJ C;  3KG2 A;  1JJ2 U;  1VEW A;  1CXZ B;  3VQW A;  3HKB B;  3BA9 A;  1BCC H;  4MVQ A;  5IJ9 A;  1WPB A;  3W7S A;  2CGO A;  2QWQ B;  4OGQ B;  4F6E A;  1VQ6 V;  2QE7 G;  1OCO C;  5LYJ B;  3OEH G;  2Y4T A;  4MW8 A;  1IBL O;  5GW7 A;  4MT8 A;  2QKS A;  3E86 A;  4NXM O;  1ZX3 A;  1VQ5 V;  4WBN B;  1QR9 A;  1AI5 A;  3DXR A;  3OE7 G;  2IBZ H;  4DUZ O;  1VIB A;  4NTW A;  3T1H B;  1H8E G;  1RPO A;  3JSN A;  4X20 A;  4MSW C;  4X88 A;  1QLE C;  2JJ1 G;  1P7G A;  2X6C A;  4BIU A;  4JAV A;  4B3T O;  3CCJ V;  3FKS G;  3ZS8 C;  4B7K A;  3VBB A;  3KZI Z;  3SYQ A;  4FLY A;  5LOV B;  2PI5 A;  1NTM H;  3JAL B;  5H9C A;  4H44 B;  3CB2 A;  2IU0 A;  3CPW U;  2BOC C;  3LUT B;  1Q5O A;  3UQ8 A;  2NLJ C;  4TV9 B;  5LGT A;  4LF8 B;  1VAR A;  2IH1 C;  1M57 B;  2DYS C;  1YXB A;  4DV3 O;  1PNM A;  1SZT A;  2OCH A;  4QJF B;  4JI8 B;  3TET A;  4E4E A;  1VF6 C;  1ZWI C;  5KA6 A;  2UUA O;  2LW1 A;  1THZ A;  1BGY H;  1W2B U;  2QWR B;  2E5L O;  4F6R B;  3HKC B;  4JYB A;  1YCI A;  1JFF B;  3T1Y B;  4J9Z B;  3Q4H B;  4X66 B;  2CTR A;  1AR1 B;  5JQG A;  1L8D A;  2QTS A;  4I4T A;  4MTG A;  2GTA A;  5L3C A;  5EBL C;  1OHH G;  5FLX N;  1DGS A;  2CAZ C;  2MW2 B;  4JI0 O;  3WU2 Z;  3ASN C;  4LFC B;  3T4Z A;  4JI5 B;  1K33 A;  4J41 A;  2UUB B;  1ENV A;  1K5S A;  3LNN A;  2LW7 A;  4I0X A;  3B8N A;  1NVP D;  2B5U A;  3B8M A;  3W7X A;  3L75 H;  1W0K G;  2UXX A;  1M56 C;  1WA8 B;  4GKJ O;  5KHI A;  3BRC A;  4DV0 B;  1VQL V;  2Y0P A;  4PV1 B;  2JVD A;  1E79 G;  4FLT A;  5FPO A;  1WNS A;  2CK3 G;  1MOF A;  5FNV A;  1GM7 A;  1EFR G;  1GM9 A;  1Y74 B;  4AIL C;  4JI6 O;  2Q0O C;  4JTD B;  3E22 A;  3B2E E;  1XBL A;  2NN4 A;  5EC2 C;  4CS4 A;  1N8R W;  4YY3 B;  3ZRV A;  1SQB H;  4B3S B;  3P32 A;  3HKD B;  4DXW A;  3CRC A;  4JYC A;  3M7M X;  4FFB B;  4NKG B;  1XRE A;  3QO8 A;  4YJ3 B;  4DW1 A;  1SZX A;  5J2T B;  1NJI W;  3FB7 C;  2RDC A;  5BMV A;  2Z3Y A;  2QWN B;  2QM4 A;  4JI3 B;  1H2L A;  1S5L Z;  3QVN A;  4NVP A;  3D36 C;  2WA4 A;  3K9A A;  4P9P A;  2XND G;  5B1B B;  4X1I B;  4FIP C;  4QIW F;  1HDJ A;  1HR0 B;  2WA3 A;  1RP3 B;  3OGI B;  1B04 A;  4WF9 V;  3ABT A;  1YSC A;  3ABM C;  4MVS A;  2BSK A;  4RO2 A;  5GON A;  4ZI7 B;  3E89 A;  1OCC B;  1XI1 A;  1GN4 A;  2GSM B;  1KP3 A;  3UT5 B;  4JGS A;  1K34 A;  5EZY B;  2WLK A;  5CA1 A;  5LMU O;  2R9I A;  5BZB A;  4RWU A;  4LF7 O;  4O4J B;  4GT1 A;  2ZXW B;  4GX0 A;  1YI2 V;  3F7Y C;  1MG1 A;  2OWO A;  3T1H O;  4XDL A;  3SPH A;  4KXR A;  2FB5 A;  4LF6 O;  4O4L A;  5LOV A;  4GX2 A;  4BAY A;  5EIB D;  3W7T A;  2EIN B;  2AXT Z;  2LJ2 A;  5KX5 B;  4J11 A;  3K5M A;  2YIA A;  3JAW B;  4MVR A;  3FB6 C;  3G6B A;  2UUC B;  4D6T H;  1QU7 A;  2Z0A A;  2XOK G;  3RYH A;  4I55 B;  4E2L A;  1VF5 B;  5CA0 A;  2EIM B;  2NNU A;  4I50 B;  5J2U B;  4LF8 O;  4X62 B;  1H2N A;  1FYJ A;  3BA8 A;  4AHC A;  2CGN A;  2H3O A;  3DGE A;  3AG1 B;  3CCQ V;  4JI8 O;  4F6R A;  3E8B A;  2B1G A;  4OPH A;  3STZ C;  1V55 B;  5L3B A;  5LXT A;  1D2D A;  1D5A A;  3AG3 B;  1FJG O;  4DR4 O;  1FFX A;  4JYA O;  1HW7 A;  1L0N H;  3SPC A;  2PYJ A;  3JSL A;  1Y6X A;  4JI1 B;  3SDL A;  3ZJZ A;  3T1Y O;  4QPJ A;  5JH7 B;  4UCR A;  2G38 A;  3JCZ A;  3BPZ A;  1BHB A;  2HG5 C;  1XL4 A;  1HNX B;  1WB8 A;  1P49 A;  5KUK A;  4ZHQ A;  4QNH B;  4X1Y B;  5F2V O;  5LHI A;  3ABL C;  1E1R G;  1OCZ C;  4CH6 A;  1GO3 F;  3FAV A;  4DR2 O;  4LF5 O;  4K35 A;  4BIZ A;  3CJH B;  1Q3E A;  4DR6 B;  1F51 A;  3CRM A;  4R50 A;  3E83 A;  3DC5 A;  3MHS C;  5EK0 A;  5IY5 B;  3CC7 V;  5JCO A;  2IM9 A;  2EIL C;  2V1D A;  2JRI A;  4DV0 O;  2B1I A;  2DOS A;  3G80 A;  3SYA A;  2UXB B;  3RW0 A;  5L3D A;  2VS0 A;  1GH6 A;  1Y76 A;  3ZRS A;  2EX3 A;  4KL1 A;  4TUY B;  1FXH A;  5IJ0 B;  4UVB A;  1QBZ A;  1WLE A;  3F5W C;  3ICX A;  4FFB A;  2R9R B;  1J95 A;  4PI0 A;  1SER A;  4B3S O;  1Q8I A;  1QVG U;  1Q90 D;  4IHJ B;  1IBL B;  1RM1 B;  1S3J A;  5B1A C;  3K06 A;  1OCR C;  5ITZ A;  3CEI A;  1DK1 A;  5A9G A;  4B3M B;  4N23 A;  1XNR O;  3OD4 A;  3N27 A;  4JI3 O;  4PI2 A;  2A7W A;  4W4L A;  4RUF A;  2QKA A;  3WB2 A;  4MVZ A;  2L35 A;  2VQE O;  4DK0 A;  1HR0 O;  4TT3 G;  3ZRW B;  2F66 C;  4TOI A;  4B3T B;  2WSS G;  4F4L A;  1K92 A;  3CWB H;  3UKM A;  1EZV H;  5L3G A;  1CPY A;  5LP6 C;  4NXN O;  2KSD A;  4LNU A;  2VWK A;  4BW5 A;  2YEV B;  3K04 A;  2Q8V A;  4DV3 B;  1XUQ A;  5C8Y A;  4J7K A;  2A79 B;  3MDS A;  4D7T A;  3U11 A;  2F4V O;  1SES A;  3K0G A;  4HNA A;  4Z2W A;  2Q0A A;  2LFS A;  3BHP A;  1KB9 F;  1SQG A;  3GVM A;  1N34 O;  4PJ0 Z;  2UUA B;  1ZTE A;  5LA6 B;  2ARH A;  4IGG A;  2Q67 A;  5DN6 G;  2ZDI A;  2DWD C;  3L9D A;  4FLU A;  4D7S A;  4NTY A;  2UXC O;  1TGO A;  5LGU A;  3G4S V;  2BTO A;  3OM3 B;  4I50 A;  1ARO P;  5J2U A;  2X7R B;  2HHH B;  2UUC O;  2WLJ A;  3H1H H;  3TCU A;  1QCE A;  4MVM A;  4N21 A;  2YXH A;  3RYF A;  4JI0 B;  4GKK B;  3WFV A;  2ZKO A;  1H38 A;  4XBF A;  4FZ1 A;  3OMA B;  1FKA O;  2ZD9 A;  4K8X A;  1TUB A;  2WLL B;  2YSU B;  4DV2 B;  4JZ2 A;  2P06 A;  4FM0 A;  5KA5 A;  4PA4 A;  3AK1 A;  4PA6 A;  3U0Z A;  1VQ8 V;  2LQT A;  4J9Y B;  4CS2 A;  4JF3 A;  1MZE A;  4LWS A;  3SPJ A;  4K0K O;  4G28 B;  4RQE A;  2R72 A;  3ASN B;  1EM1 A;  1KUQ A;  3B40 A;  1Q81 W;  2BTQ A;  1HNX O;  1FD9 A;  4G27 B;  4X1Y A;  3SYC A;  1YTF D;  3GWK C;  4FK5 C;  2ILM A;  2AHY A;  3SJQ C;  3K58 A;  4X9Q A;  1ORQ C;  2QDO A;  4JI4 B;  5IYC O;  4CS3 A;  3CJH A;  3OT7 A;  1M56 B;  4MS2 A;  4UVC A;  3CXC U;  3B77 A;  4NR1 A;  1XHZ A;  2Q68 A;  4DR6 O;  1SET A;  1IX9 A;  4CH5 A;  2P6J A;  3JAT A;  5GTI Z;  2LGW A;  2V4D A;  2HKO A;  2Q4P A;  4DR3 O;  1R6N A;  3JAS B;  3GWO A;  2UXB O;  1ZL8 B;  2DMX A;  2JJ2 G;  4FLV A;  3N2K B;  2JS3 A;  4IHJ A;  2P5O A;  1IUR A;  5B3S C;  3ZMT A;  5B5E Z;  2ZT9 B;  3A0R A;  1S72 V;  3K3W A;  3RYI B;  3UO3 A;  4J42 A;  4XDJ A;  2YC0 A;  4FJC C;  5KUM A;  2ITD C;  2QM7 A;  4KHP O;  5LMU B;  3JAK A;  4B3M O;  4LF7 B;  3ZIA G;  1KQS U;  3R66 A;  2ADP A;  4QGP A;  3ABM B;  1R3L C;  4AI8 A;  2Z5U A;  1NKD A;  2FYU H;  1BSM A;  3ZRW A;  3T4D A;  1WAZ A;  2GHY A;  1XL6 A;  4LF6 B;  2QJ1 A;  5B1N A;  3ASO C;  3B09 A;  4LF4 B;  1YTF B;  1F23 A;  4K3A A;  1KD1 W;  2DN9 A;  1AVM A;  2EJR A;  4DV6 B;  2Y69 C;  5CB4 B;  3OR6 C;  4RUE A;  2GUZ B;  4HZ3 A;  2CTP A;  4OX9 B;  1QLN A;  2QEX V;  1JMK C;  3OR7 C;  3BCC H;  4JAU A;  1YIJ V;  4GLX A;  4MVU A;  3QNE A;  2AZ0 A;  2XUM A;  3K5O A;  1K3E A;  1NS1 A;  4O2A B;  4FVM A;  1YF2 A;  1R3I C;  5FL7 G;  1I7F A;  5H6R A;  2GTS A;  1TA8 A;  5DM6 V;  1LUV A;  1FJG B;  1P7B A;  2P4V A;  4DR4 B;  4X89 A;  3P3N A;  4P30 A;  2EJ7 A;  5IE9 A;  4JYA B;  1SA0 B;  2HLD G;  3P30 A;  1IZ3 A;  3AG4 C;  3L72 H;  4O2B B;  3EXA A;  1EN4 A;  2JGD A;  5IT9 N;  1X59 A;  2HEP A;  3LSU A;  4UCS A;  2EIK C;  1IBK B;  2HHH O;  4TQF A;  1GKF A;  3OGC C;  2R9A A;  2YUA A;  3FFQ A;  5DEC A;  1I0H A;  3AG2 C;  2IH3 C;  3DTU B;  4U3J A;  2OIE A;  3ZMV A;  1J5E B;  4GKK O;  2GBO A;  1JPX A;  4DR2 B;  4LF5 B;  3W7W A;  1IXB A;  1GTO A;  4X1K B;  3N2G A;  4DV2 O;  4UVA A;  1NBM G;  1VQ7 V;  2JK5 C;  4A5U B;  2A9H A;  1GAX A;  3WG7 C;  1AI6 A;  1MZF A;  1FXK A;  1L0L H;  2IJI A;  3L71 H;  4DRX A;  4KUM A;  2Q5Z A;  2R70 A;  3JD1 A;  1QHT A;  3BY6 A;  2BCC H;  4DUY O;  3EHB B;  1T5E A;  2CH7 B;  2FML A;  3ABL B;  4ZOL A;  1VQM V;  4BIO A;  1OCZ B;  1QQC A;  1U96 A;  3ZHV A;  5IYZ B;  5EYP B;  3H9V A;  1WJZ A;  1OJH A;  3QG5 A;  3J7A U;  4JI4 O;  1KP2 A;  1YEW A;  3CCS V;  2AHZ A;  2F43 G;  2OCC B;  2EIL B;  5KMG B;  1YJ9 V;  3STL C;  2LP7 A;  1G8M A;  3JAR B;  4UUJ C;  3J80 N;  4NB5 A;  1XNR B;  2P90 A;  2Y4U A;  4HBN A;  1BT8 A;  1TUE B;  2V7Q G;  5B66 Z;  1R6K A;  5LHH A;  2VQE B;  1TVK B;  3HKB A;  3CX5 F;  3K0D A;  2ZNI A;  2QWP B;  1GRJ A;  1NH2 D;  3APO A;  3MD0 A;  2YIB A;  5B1A B;  3VQX A;  3U10 A;  3ZN1 A;  1OCR B;  2BOB C;  5LYJ A;  5DED A;  4EEQ A;  4NXN B;  3QTC A;  1YDX A;  1MMM A;  1HNW B;  4PA7 A;  2PI4 A;  1Q6I A;  4EFB A;  1I5X A;  4UFZ A;  4WBN A;  3G6E V;  4LBE C;  1YIT V;  1NVP B;  2F4V B;  4RAI A;  1FXV A;  2F23 A;  2ZNJ A;  1N34 B;  4WFG A;  1KMI Z;  5LP6 B;  1UFI A;  5JVD B;  4PDR A;  4DV4 B;  1PNL A;  1K7D A;  2Q6A A;  1XEQ A;  1H2K A;  4GX5 A;  1SQV H;  4LF4 O;  3ZHQ A;  3JAL A;  2GUZ A;  2UXC B;  2ZIM A;  3ZN0 A;  3IAY A;  3S3W A;  4DV6 O;  3TGU H;  4TV9 A;  2H8P C;  4UXN A;  3ZHR A;  1A32 A;  3BVO A;  4OX9 O;  2DJV A;  3VOU A;  1MSW D;  3ETG A;  1K73 W;  3G71 V;  2Q7E A;  3AK2 A;  2DWE C;  4O2A A;  3X2Q C;  1Y67 A;  2Q73 A;  2YI9 A;  2KG7 B;  5AG2 A;  4QPK A;  1DLB A;  1AP6 A;  2Q7G A;  1VQO V;  4X8A A;  4LFA B;  3IJ4 A;  2WLH A;  2ZM6 B;  3HKC A;  2K1E A;  1WPX A;  3G67 A;  4FM2 A;  3HPL C;  2EBO A;  2D2C B;  4I5S A;  1JFF A;  1K97 A;  3Q4H A;  2Y48 A;  2RNB A;  4UB6 Z;  3ZHS A;  1HWY A;  4K0K B;  1KEC A;  3H1I H;  1HP8 A;  1M5I A;  3S3X A;  4JYY A;  4Z1M G;  5LL6 Y;  1BZK A;  3A0B Z;  1IBK O;  3E8H A;  4OPA A;  3BAA A;  5HFL A;  1SQQ H;  5IYB O;  2ODM A;  2F1M A;  4MTO A;  4J7Z A;  4JI7 O;  4JV5 O;  4PD4 F;  4PDV A;  4TV8 B;  4DV1 O;  1J5E O;  1AP5 A;  3CE2 A;  4CH4 A;  1B6Q A;  3KCY A;  3ZMS A;  2KQX A;  4FLZ A;  3O65 A;  3CRA A;  1FPO A;  5JJN B;  1WA8 A;  1I08 A;  3FX7 A;  3C90 A;  5K1P A;  2D3O W;  4IIJ B;  5KLV H;  3CCU V;  2OTJ V;  4I7Z B;  1KYO F;  1K4D C;  4X64 B;  5JCO C;  2RMK B;  4EB6 B;  3OMN B;  4DR3 B;  1Y74 A;  1NT2 B;  4H0L B;  4UCV A;  2B9Z A;  3D3Q A;  1PNK A;  3ABK C;  4R7C A;  3A2F A;  5EYP A;  1SKV A;  2WAM A;  3HKD A;  3K5N A;  3ZCC A;  4YJ3 A;  3ZMZ A;  5KMG A;  3CRR A;  3I55 V;  5J2T A;  3ZX6 A;  1I94 O;  1IBM O;  3JAR A;  2JGU A;  4U7O A;  2A0L A;  4LFB B;  1R1B A;  4KHP B;  2EIJ B;  5BXZ A;  2UXD O;  3IFX A;  1BQ0 A;  2RN9 A;  5EBW C;  1YHQ V;  2XAJ A;  1B06 A;  4HYO A;  4WFA V;  1TVK A;  2QWO B;  3RVY A;  1E1Q G;  4FFK A;  4X1I A;  5IJ9 B;  4JI2 O;  2W6J G;  1N32 O;  4DR5 O;  5KAF Z;  1PV0 A;  3SPG A;  5B3S B;  2UU9 B;  3OUF A;  3ML0 A;  3K57 A;  1OCO B;  3SJC C;  4W4K A;  2IW5 A;  5KHH A;  3H1K H;  1HNZ B;  4ZI7 A;  3LNM B;  1SRY A;  4GYC B;  1PM9 A;  3RN4 A;  5FPR A;  5LMN O;  1F4N A;  3UT5 A;  4AQY B;  4LF9 O;  1GK9 A;  5EZY A;  3OFN G;  5JWP A;  1LNQ A;  3OW2 U;  1HNW O;  3E8G A;  2EZP A;  1Z2G A;  3UO2 A;  2GV9 A;  2DW4 A;  1G6U A;  1G4Y B;  4O4J A;  1URF A;  1SF9 A;  4X20 B;  1QLE B;  2HP8 A;  3I56 V;  3ASO B;  3HB3 B;  5LP6 A;  5JVD A;  3ZED A;  1JOY A;  1FS0 G;  2DYR C;  1KKC A;  1XDC A;  2Y69 B;  4TSF G;  1MA1 A;  2ZCE A;  4DV4 O;  3HR0 A;  1WP8 A;  1M9N A;  2ZDI C;  5EBM C;  3K59 A;  5KX5 A;  3WB0 A;  4JAS A;  4DO2 A;  1NTZ H;  4UCU A;  4O4H B;  1OZ0 A;  3JAW A;  5H2F Z;  1AB3 A;  1JQ0 A;  5BY1 A;  2QGN A;  2DYS B;  1M90 W;  4I55 A;  1BQZ A;  1IXM A;  1N0J A;  4YHH B;  4JTC B;  3SYP A;  3ETQ A;  4CBC A;  4I9Q A;  1ZLZ A;  4YXW G;  1BMF G;  2XAF A;  3OEE G;  2IJH A;  1SQF A;  2YID A;  3AG4 B;  2YXY A;  1GN6 A;  1R3K C;  4LFA O;  3HKE B;  4FM1 A;  2ZM6 O;  4NYK A;  3K03 A;  1OV9 A;  2DE0 X;  1PP9 H;  3TXS A;  4PEL A;  4MVO A;  3T1C A;  4U7N A;  3W7U A;  5JH7 A;  4C7U A;  1AI7 A;  4I4T B;  3CYO A;  1S0V A;  4DV5 B;  2YIB D;  4I9W A;  4DUY B;  1Q6U A;  4WFH A;  2PY5 A;  2RQ6 A;  2KKW A;  1N4C A;  1K5Q A;  4PDL A;  3AG2 B;  2OYQ A;  3CME V;  2VQF O;  4ZBM A;  4I0X B;  3FB5 C;  1W0J G;  3ZBH A;  2XTA A;  3H1J H;  3WG7 B;  4UV8 A;  1F4M A;  1M93 A;  2PGG A;  3L70 H;  4KFM A;  1NQT A;  5H6Q A;  3T2M A;  4DR7 B;  1GM8 A;  1Q82 W;  3RYC B;  5FNV B;  2N05 A;  3ZHT A;  1EZJ A;  4JPR A;  3UCS C;  3E22 B;  2E74 B;  1MNG A;  2YDE A;  4X64 O;  1NR7 A;  1XMQ B;  4B08 A;  2E76 B;  4TUY A;  4JZG A;  5IJ0 A;  1VQ4 V;  1ZSP A;  3TJT A;  4PDM A;  1YJN V;  4X65 B;  2ZE7 A;  2JDI G;  1PPJ H;  1VF7 A;  1UJW B;  1K4C C;  1YJW V;  2W0F C;  3A0H Z;  2HVK C;  1XIL A;  3SJB C;  5LBQ A;  1NZ6 A;  2Q69 A;  4LFB O;  5JJE B;  3CS5 A;  5CBG A;  1V9P A;  4DW0 A;  2E3C A;  2AZ2 A;  3M8A A;  3OTO O;  2OTL V;  4LC1 A;  2Y0I A;  3CC4 V;  2PZS A;  4YJ2 B;  2BSK B;  5GON B;  1LUW A;  1ZAU A;  2UU9 O;  2WLI B;  5H5N A;  1H2S B;  2CUG A;  5A2Q N;  3CCE V;  2IJK A;  3CSX A;  3L73 H;  1HNZ O;  4BW9 A;  3F7V C;  3BEH A;  1FAF A;  3ZRX A;  5CA1 B;  5BR8 B;  2YEV A;  4AQY O;  1V54 C;  4DV7 O;  4FLX A;  1IVS A;  1XMO B;  2N04 A;  1VQ9 V;  3RBZ A;  3I5D A;  4ZIB A;  4BWA A;  4ASU G;  3OUS A;  1VMG A;  4IL6 Z;  5LA6 A;  5TIS Z;  4LR3 A;  5LHG A;  4O4L B;  1JR9 A;  3F5T A;  1XNQ B;  3UM7 A;  3BAB A;  3JAM N;  2YXL A;  4O4H A;  1N0N A;  2OT5 A;  3R65 A;  3QF7 A;  3RYH B;  3OTF A;  4K8Z A;  1P84 F;  5CA0 B;  1SQP H;  3BFR A;  2VWJ A;  1XQ8 A;  3MAQ A;  3E8F A;  2XAS A;  3X2Q B;  5L3F A;  1VF6 A;  1GN2 A;  4YIP A;  4YHH O;  1F7Y A;  1N33 B;  3CRQ A;  2QKC A;  2L6L A;  4JI7 B;  1G1X B;  4JV5 B;  2IU3 A;  2Q9L A;  3AK3 A;  3K79 A;  5LXT B;  2WLL A;  2JEX A;  3HKE A;  4DV1 B;  1FFX B;  2CDY A;  4UV9 A;  1Y66 A;  1CEZ A;  1NU1 H;  1NR1 A;  4B3R B;  5L3E A;  1EN6 A;  1BL8 A;  1IDS A;  1S76 D;  1S5H C;  4QE7 A;  3CHX A;  4CH3 A;  1FXK C;  1N36 O;  1JX9 A;  4ZHQ B;  3CXH F;  1WN7 A;  4CC6 A;  4DV5 O;  1NI8 A;  3PN1 A;  3GB7 C;  3FAV B;  4DYL A;  1ROP A;  2ADQ B;  1EN5 A;  3D3I A;  3TXQ A;  3CCR V;  4MW3 A;  1S77 D;  1I94 B;  1IBM B;  1PL0 A;  1LR1 A;  5IWA O;  5IDJ A;  3CCL V;  3ZMU A;  4CC5 A;  3K5L A;  2PUS A;  1MSD A;  2X6A A;  2ZE5 A;  3RYC A;  3WB1 A;  3FD9 A;  2UXD B;  4Q6G A;  2X6B A;  3FB8 C;  4PA3 A;  4DR7 O;  3ABK B;  2ITC C;  1KBH A;  1VP7 A;  4JI2 B;  5KHK A;  1Y76 B;  3CCM V;  1N32 B;  2UXN A;  4DR5 B;  2P22 C;  1YZB A;  2AW9 A;  1AI4 A;  1K9M W;  4O4I B;  1M1K W;  3JAS A;  2FKX A;  5GTH Z;  4EKW A;  1ZL8 A;  3C3T A;  1BS3 A;  1XMQ O;  2QSA A;  4FZ0 A;  3VQY A;  3N2K A;  4ICG A;  4CZZ A;  1JCH A;  4X65 O;  2FTK A;  5ITZ B;  5LMN B;  3JYC A;  2BE3 A;  2QA4 V;  1S5J A;  3RVZ A;  3RYI A;  3D36 A;  4UCT A;  4LF9 B;  4MTF A;  2P67 A;  3E2E A;  3SYO A;  3SPI A;  2ZR2 A;  2HR3 A;  5EC1 C;  2Q7H A;  3JCU Z;  2PF4 E;  4YJ2 A;  4IT5 A;  1KU9 A;  4L8J A;  3K9S A;  1RSO B;  3APQ A;  2AGA A;  2WLI A;  4FMT A;  4FLW A;  1O9H A;  4Q20 A;  4PHZ A;  4XDK A;  3ABU A;  3LDE A;  3IC7 A;  2A3Q A;  3CMA V;  5JJJ B;  4LNU B;  2K9P A;  4OXS A;  2X0L A;  5CB4 A;  3K08 A;  2YS8 A;  1DF5 A;  5C8Y B;  2WLN A;  1KKD A;  1JJO A;  5BR8 O;  3JD4 A;  1M57 C;  1Y4M A;  4HNA B;  2DQ3 A;  1PL4 A;  2DYR B;  3RGB A;  3THO A;  4R6Z A;  1XMO O;  4NTX A;  5K1X A;  1X4T A;  2WLM A;  2LGQ A;  2P4K A;  2XAG A;  4DR1 B;  1R6T A;  1WB7 A;  2XHB A;  2ZQM A;  1COW G;  3EVK A;  1XNQ O;  2ETN A;  3IGA C;  2IJJ A;  1SA0 A;  3FYI B;  2M7W A;  1NH2 B;  2JS5 A;  4O2B A;  1P4R A;  1VQK V;  5J9P C;  5HFM A;  4WFF A;  3AEI A;  1H8H G;  1YVW A;  2O57 A;  4J80 A;  3H01 A;  1I5Y A;  3RYF B;  3ETD A;  4WCE V;  4LH7 A;  1R73 A;  1TAE A;  2MK3 A;  1D5N A;  1N33 O;  1TUB B;  2VQF B;  3KCX A;  2HJF C;  4HAM A;  4LP8 A;  4MTX A;  4JAA A;  5KHG A;  4X1K A;  4ABM A;  4GUN A;  3CC2 V;  2VRZ A;  4WFE A;  1AJQ A;  2JEU A;  2OIG A;  4H37 A;  4X66 O;  4LWS B;  1AJP A;  1GMG A;  2H94 A;  2DQ0 A;  3FYE B;  2CTQ A;  5C93 A;  2JIZ G;  3C3S A;  3E35 A;  4B3R O;  4DK1 A;  1GN3 A;  2LFR A;  2BTQ B;  4PA9 A;  1W59 A;  2CH7 A;  4JTA B;  4B7E A;  2RJZ A;  4Z1V A;  2QTO A;  4LFC O;  1UPG A;  2PYL A;  5D5P A;  4JI5 O;  3LSQ A;  2EUL A;  3H1L H;  2UUB O;  2XAH A;  5IYZ A;  2ZE6 A;  3QO5 A;  1DTO A;  4EFE A;  3A8T A;  1H2M A;  3B4S A;  2ZE8 A;  2OCC C;  4LCU C;  1H2G A;  3KKY A;  5KHJ A;  3JD0 A;  3JAT B;  2F95 B;  1Q43 A;  4LH6 A;  1ZUQ A;  1RFY A;  2FL4 A;  5CMU A;  1Z5V A;  1SS3 A;  3OTO B;  3LDD A;  4O4I A;  1BHA A;  3L74 H;  5B1B C;  1B3Q A;  2WWW A;  3DSQ A;  2HJD A;  2A06 H;  4YY3 O;  1AR5 A;  3IC9 A;  1VQP V;  2GDS A;  3ETE A;  3ZHU A;  1PD3 A;  4NXM B;  1OCC C;  5IYD O;  2W0X A;  1VQN V;  3NXS A;  1US6 A;  2QM8 A;  4GZR B;  2NR5 A;  3RWR D;  1K8A W;  3JAK B;  3JD3 A;  4DUZ B;  2KB1 A;  1EBO A;  4DV7 B;  2YI8 A;  4J7J A;  5CBF A;  3DXR B;  3LDC A;  4H33 A;  4BR6 A;  4KP4 A;  1CP9 A;  1RSO A;  5D5Q A;  3EFF K;  2ZXW C;  1M4U A;  4G2K A;  1AJN A;  3TK1 A;  1O9G A;  4QE9 A;  2ZIN A;  2XT9 A;  1SC5 B;  1L1F A;  1V54 B;  2EIN C;  2XAQ A;  1XHX A;  5KAI Z;  5CBH A;  2W6I G;  2HFE C;  3D8C A;  1FFT B;  2EIM C;  2N74 A;  2RCV A;  4UCO A;  2E5L B;  4U3F H;  1RPR A;  3RT3 C;  2LO1 A;  1PKX A;  2KG7 A;  3MHH C;  4IYH A;  5CA3 A;  4RQF A;  1R3J C;  3AG1 C;  1Q86 W;  1NTK H;  5E79 Z;  4DR1 O;  3CCV V;  1DF4 A;  1XOU A;  2EZO A;  3SGI A;  1V55 C;  2JGD B;  1AR4 A;  5LGN A;  3M99 B;  3AG3 C;  3AG7 A;  2ZR3 A;  2C2A A;  5JQG B;  2YIC A;  2EIK B;  4X62 O;  3P3P A;  4WFB V;  1N36 B;  4H13 B;  1JA8 A;  2HVJ C;  4FPP A;  2E75 B;  4YIO A; 
#chains in the Genus database with same CATH homology
 1NTZ H;  1NU1 H;  3L75 H;  1NTM H;  3L70 H;  1SQX H;  1PPJ H;  1SQB H;  1BGY H;  1L0N H;  3H1K H;  4PD4 F;  2IBZ H;  3CX5 F;  3CWB H;  1EZV H;  1SQV H;  1L0L H;  3BCC H;  2FYU H;  3L71 H;  3H1L H;  1KB9 F;  3H1I H;  3CXH F;  3H1H H;  2BCC H;  1P84 F;  3L72 H;  3L74 H;  1PP9 H;  4U3F H;  3TGU H;  1SQP H;  1NTK H;  2A06 H;  5KLV H;  3H1J H;  4D6T H;  1KYO F;  3L73 H;  1BCC H;  1BE3 H;  1SQQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...