3L71H

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l71H00
1SQPH 3H1KH 4U3FH 5KLVH 4D6TH 1P84F 1L0LH 3L72H 2A06H 1PP9H 1KB9F 1PPJH 1NU1H 3CXHF 3L71H 3CWBH 1NTKH 1L0NH 3H1IH 1SQXH 3BCCH 3L70H 3H1HH 3H1JH 1SQQH 1BGYH 3L73H 1BCCH 1SQVH 1NTZH 2BCCH 1BE3H 3H1LH 3TGUH 3L75H 2FYUH 1KYOF 3CX5F 1EZVH 1SQBH 3L74H 4PD4F 1NTMH 2IBZH
chains in the Genus database with same CATH superfamily
5EBWC 4YY3O 4LWSB 5CB4B 5CMUA 1JVMA 2PTMA 4NYKA 3ETQA 1PNLA 1YJWV 3UT5B 4JI6B 1GM8A 2WLJA 2WLIA 4GKJB 3CWBH 3CCEV 4GKKO 4JI4O 5DEDA 5IWAO 5H2FZ 3ZMVA 3ZS8C 1HNWB 2ZR2A 3D36A 2ZKOA 1BHAA 3EHBB 3IC9A 5CBGA 1I5XA 1Q6UA 2DE0X 3P3NA 1N4CA 1XILA 2VWKA 2NN4A 3RT3C 1MA1A 4TT3G 3HKBB 1H2LA 3K5NA 2BE3A 1QVFU 2ARHA 1AI5A 3OT7A 3K04A 3I56V 5L3BA 1I94O 5L3EA 3ZMTA 1FFXB 5C8YA 3CCLV 1V54B 2YUAA 2CAZC 2XASA 4KHPB 4FLVA 2Y0PA 4OPHA 4X62B 2BOCC 2UXCO 3QO5A 1N36O 2ADPA 1XI1A 3U10A 4DV0O 1X59A 4ABMA 4LF6O 1DGSA 2KG7B 4RO2A 1VF7A 2V1DA 2XNDG 1A32A 1ZX3A 1N32B 4DV5B 3AG7A 1UJWB 5KLVH 3BEHA 4O4HA 1YIJV 4FFKA 2Q68A 1QLNA 3CCMV 3AG3B 4MTXA 4ZHQA 3HB3B 1SKVA 1YSCA 2QGNA 3W7WA 2WA3A 5KHJA 2DYRB 1WA8A 3WU2Z 1IBLO 2EINB 1Y74A 2PY5A 3G6BA 5EIBD 4JI2B 4DR2O 5ITZB 2UXBO 1HR0B 5CA0A 3ETGA 1QLEB 2PF4E 5B1AC 1I0HA 3S3XA 1GAXA 3ASNB 2YXLA 2WLHA 2E5LO 1G8MA 4JI1O 2ZCEA 4DV2O 3OTOB 3SR2C 1GN4A 2XUMA 3ZHTA 3JD4A 5LGNA 3CC2V 2QWNB 5CN0A 1F7YA 2X0LA 3ABUA 2UUBB 3VQYA 3WB1A 2Y69C 4UCOA 1JFFB 1K33A 2OYQA 1ORQC 2EINC 4LF7B 4QIWF 1IZ3A 3JAWA 1AJPA 3K5OA 4AQYO 5B3SC 3K9AA 3SYCA 1GN6A 2HEPA 4EB6B 3DXRA 5CA3A 3RVYA 4G28B 2Q7EA 2YICA 2LGWA 1XNRO 4PELA 1AR1B 3RN4A 1E1QG 3OFNG 3AK2A 1WJZA 2JGDB 1VQPV 2ZNIA 4W4KA 1F51A 1FXKC 2F4VB 2BTQB 4WFFA 2OTLV 1WP8A 4DUZB 2JDIG 2EIMB 3SDLA 1ROPA 4JGSA 4JI3B 2VQFO 5IYZA 3DC6A 2YIDA 1RPRA 4JI0O 4JYAB 3JSLA 1QQCA 3SGIA 3ZRWB 5CA1A 2UXDO 1O9HA 1Y4MA 2ADQB 2H8PC 4GCZA 1MSDA 3TCUA 3CJHA 3ABMB 3H1JH 4NXMO 1SA0B 2OT5A 4K35A 5JVDB 2IH1C 1EM1A 1TUEB 4RUEA 4Q20A 1N34B 3JYCA 1IXMA 1IBMO 2DQ3A 1P84F 1GN3A 1OJHA 4BIOA 2NLJC 3X2QC 1PD3A 2UU9O 2Q4PA 4JI8O 1K7DA 4LF9O 2CTPA 2YIBD 4QPJA 1US6A 1NTZH 2EIJC 1FKAO 5CBHA 4X65O 4BIUA 1GM9A 5BMVB 2GUZB 4WFBV 2Z3YA 3RYCA 1RM1C 4E2LA 4IHJA 1K34A 2D2CB 4LFAB 3M7MX 3MHSC 1JA8A 2GBOA 3OMNB 4LNUB 4PA4A 2X6AA 3P32A 3GVMA 4U3JB 2FKXA 2W0XA 3A0BZ 3RFRA 2EILC 3FKSG 5LGTA 1IVSA 3RYIB 5BZBA 3RWRD 5B1BC 5EBMC 5CB4A 4XDLA 4PA7A 4RQEA 1GH6A 5LHIA 1XHZA 2OTJV 1HNXO 1FYJA 3UT5A 4X20B 4FM1A 5A2QN 3ICXA 3R65A 1H8HG 4O2AB 1VMGA 5BR8B 1BQ0A 2Z5UA 3JATB 3WG7B 3TGUH 2Y4UA 3OMIB 5IJ0A 4LCUC 2ZQMA 5E79Z 5GONB 3FB5C 3SJQC 2JEUA 5GW7A 2UUAB 4W4LA 4JTCB 2WWWA 3BPZA 2GTSA 5FL7G 2GSMB 3HKBA 3S3WA 5LMNB 1URFA 2GHYA 2WLIB 4D7SA 1V55B 4TV8A 2WLMA 1FFXA 3CCQV 4FK5C 1W2BU 2JRIA 4X89A 3CRAA 4H37A 4DYLA 3JASA 4U7NA 4UB6Z 2P4KA 1YTFB 1FXHA 5E1AC 5HFMA 1AR4A 2ITDC 3CMEV 2DN9A 2BTOA 1NU1H 4RUFA 1S5JA 3JSNA 3TK1A 1VQ5V 3ZN0A 5IY5B 3MHHC 1DF4A 1VQ7V 1XREA 4LF4O 5FPOA 5FLXN 3ETDA 4DV1B 4KFMA 2RNBA 4CC6A 4YJ2A 3IJ4A 4ZI7A 1NR1A 5B66Z 1NH2D 1CEZA 1Q82W 2QM4A 4JZGA 4BWAA 4MVUA 4LR3A 4DK1A 3CRRA 4YXWG 2YXHA 3KKYA 2V7QG 1M1KW 1AI7A 2RMKB 4YJ3B 4ZKIA 4DV4O 1JJOA 2XT9A 2RQ6A 4D6TH 1Q43A 2KSDA 1M57C 3DC5A 3A0RA 4FLZA 3CHXA 5KUMA 1OCOC 4TV9A 4O4HB 2LQTA 4HBNA 1GO3F 1KBHA 1RSOB 2LFSA 4R7CA 1N0NA 3STLC 3CX5F 1YTFD 1FXKA 4R8CA 1MG1A 1OCRB 4MW3A 1Y74B 3AG2C 4I55A 3FX7A 4X1KA 5CA0B 1DLBA 1OV9A 3CC4V 1KUQA 1D2DA 1HNZO 1M90W 2EZOA 4B3RO 3Q4HA 3CD6V 2HVKC 2A0LA 1VQNV 4OXSA 3G4SV 3CCJV 4J7ZA 2BTQA 1XMQO 1EZJA 4DV7B 5KUKA 1BQZA 1HWYA 1B6QA 3BA8A 3APQA 3DXRB 1WPXA 1AP5A 1YJ9V 2DJVA 2ZR3A 4K0KB 3IC7A 2XAQA 2NR5A 3CEIA 2CUGA 1Y6XA 2AZ2A 2E75B 1YCIA 2PYLA 3OGCC 3E83A 4X1IA 2B1GA 1K9MW 2F43G 2E74B 3B2EE 4PI2A 3SYPA 3BABA 1BSMA 2ZXWC 1NI8A 4UFZA 1MABG 1D5AA 2CGOA 2CTQA 3G67A 4H0LB 4R6ZA 3ZHSA 4DR5B 3W7XA 5IYDO 3RBZA 3M8AA 2V4DA 2RJZA 2EX3A 3K57A 5KHIA 4XDJA 2Q0AA 2P6JA 4G27B 3I55V 3HPLC 3CJHB 2GUZA 4LF8O 3N2GB 2M6YA 2Q8VA 4GYCB 1W0KG 5IJ9A 2ZNJA 4LBEC 4LNUA 5BY1A 2DQ0A 3E2EA 1GTOA 4J11A 3K59A 4U3JA 3CPWU 3FB7C 4B3TB 1BGYH 3LSQA 1EFRG 4IYIA 1R6TA 4TQFA 2Q9LA 2QWPB 1FAFA 2NNUA 1S77D 4JYYA 4X20A 1JCHA 4GLXA 1ZTEA 3RYCB 3ABKC 1DTOA 1S5HC 1P49A 3ZMUA 2IJJA 3M99B 5GTIZ 5H6QA 3RGBA 2CE4A 5GONA 1PNKA 3CC7V 2Q6AA 1N0JA 2PI5A 3UCSC 3QTCA 1LR1A 3ML0A 4FM2A 3FFQA 2IW5A 1H2SB 2EULA 4FFBA 4B3MB 1Q90D 1JOYA 4DR3O 1I08A 4HNAA 4DV6B 3SPCA 4I7ZB 2IU3A 4DR6B 4LH7A 1ZLZA 5LMUO 1F23A 5IJ0B 1KKCA 3BAAA 4TWKA 4CH4A 2HJDA 2QWOB 1WPBA 3K0DA 5H6RA 1WAZA 4ASUG 4JV5O 4FIPC 4DV3B 4B7KA 4DR7O 1VQOV 3GWKC 4TV8B 4B3SB 2JVDA 4J80A 4NR1A 4WF9V 3T1HB 4UV8A 2LO1A 3G6EV 4JYCA 4N23A 3JASB 5H9CA 2R9AA 1VQ9V 3H1IH 3JCZA 1I5YA 4MVRA 1IDSA 3ETEA 4JAVA 2R9RB 2GV9A 4FVMA 4YJ3A 1XHXA 5B1AB 3VOUA 1GN2A 2ZT9B 5B1NA 3P30A 2ZIMA 3CXHF 4NB5A 4YJ2B 1RSOA 4ZI7B 3QG5A 4GT1A 5KHGA 5JH7A 3OE7G 3JAMN 1Q6IA 2Y69B 2LW7A 3ABLC 2VQEB 1BL8A 1I7FA 2GDSA 4F4LA 3LSUA 3UO3A 2YI9A 3AG1C 3KCXA 2PZSA 3ZRSA 4QNHB 2ZIOA 5B3SB 4H33A 4F6RA 1VQ4V 4PDVA 2F1MA 1TGOA 2ZDIC 3WFVA 4GZRB 2XTAA 3NR7A 1M56C 1PNMA 4TV9B 1SETA 4X1YA 1CPYA 3JARA 1AI6A 3JD0A 2ZE5A 3OAAG 2JIZG 2QSAA 1FXKB 3FAVA 4JI5B 2LFRA 4LFBB 2P06A 4CS3A 4JI6O 1N33B 2CK3G 4GKJO 2L35A 2QWQB 3ZHRA 1AROP 4I55B 1EN4A 4X1KB 4YHHB 4QE9A 1HNWO 3I5DA 5IYBO 1OCCC 5KA5A 3L74H 5LOVA 2ILMA 3Q4HB 4CH6A 3QO7A 3W7TA 3K06A 4IL6Z 5J2TA 1M4UA 2QJ1A 1Q7YW 5EBLC 1CXZB 1XQ8A 2R72A 3MD0A 2Q7GA 1Z2GA 4O2BB 1TAEA 4RAIA 5B1OA 4GX0A 4ZBMA 3PJSK 4X64B 4PA3A 3DTUB 2ZM6B 1VF6C 5KA6A 1SZXA 2GTAA 3E86A 1D5NA 4X62O 2UUCB 1U96A 4MTOA 1MNGA 4KXRA 1AILA 3X2QB 4CS2A 2A06H 2FB5A 4BIZA 4X1IB 2ZD9A 2HP8A 1XBLA 4JTAB 2EIJB 4IYHA 3L73H 3N2GA 1Q8IA 3QO8A 1N32O 3A0HZ 1RM1B 4DV5O 1IX9A 4OX9B 1WB7A 2JEXA 1EN5A 1QR9A 3B4SA 5LYJA 1K3EA 2JJ1G 1IBKB 2LP7A 1NKDA 3OR7C 4I50B 1L0LH 3LNNA 4MTGA 3ABTA 2KB1A 1Q3EA 2EILB 2WLKA 4KL1A 4GX5A 1BE3H 4CC5A 2AW9A 3H1LH 5B1BB 4BAYA 3JD3A 1K5QA 3ZCCA 1J95A 2RN9A 4FZ0A 3K58A 2PGGA 3B77A 1HR0O 3IAYA 4IGGA 1SS3A 4CS4A 1P7GA 2EBOA 1K92A 3TETA 1OHHG 4UUJC 5IJ9B 3OTOO 2QM7A 2FMLA 1AB3A 2UUBO 1XOUA 3E22A 2A9HA 4LF7O 2DMXA 4J41A 3HKEB 4RQFA 2JJ2G 1YF2A 2QKSA 3BRCA 5LP6C 1AJNA 3SJCC 1H8EG 4X88A 1R3JC 2ZE7A 5J9PC 5JJEB 4DR4B 4CH3A 2IJKA 4DO2A 4JYBA 2DWDC 3K5LA 5EZYB 2ZE8A 4GX2A 4J7JA 2P67A 4MTFA 1KMIZ 3ZHVA 3UQ8A 4U7OA 4NXNB 1BHBA 4NTYA 2F4VO 3CRMA 1XUQA 4DK0A 4JF3A 4DUZO 4AHCA 3ASOC 1THZA 4JI3O 4FFBB 1SZTA 3KZIZ 2P22C 1QU7A 3UKMA 1EZVH 4I4TA 4HNAB 3D3QA 4JYAO 2YC0A 3ZIAG 2YSUB 4E4EA 3TXQA 3AK3A 1XNQB 5LGUA 3N2KA 3AG4C 2Q5ZA 1F4NA 1F4MA 3VQWA 1K73W 1KKDA 2VRZA 3OGIB 1HW7A 5EC2C 2VS0A 4GX1A 3CE2A 2HKOA 2Q7HA 3HKCA 3ZX6A 3CP1A 1E79G 2JS3A 4DR1B 2ZDIA 5KHKA 5KX5A 1N34O 2OWOA 4BR6A 4UCTA 4O4JB 2AHZA 1Z5VA 1DF5A 1M57B 1XDCA 4NVPA 2RDCA 5DM6V 1OCOB 4JASA 3P3PA 4H44B 4FLXA 1Z5WA 4H13B 3F7VC 4PI0A 1UPGA 4KUMA 3E8HA 4FM0A 2OCHA 1S0VA 2H94A 2XAHA 3HKDA 4LFCB 2W0FC 3AG2B 4O4IA 1T5EA 2K1EA 4LF5B 4LFAO 4X66B 3CRQA 3PN1A 2A3QA 4MW8A 3ZMSA 2Q73A 1PP9H 5B5EZ 1H2KA 2CH7A 1PL4A 1XMOB 4PHZA 4UCRA 4N21A 4JI7B 4P9PA 3APOA 5JH7B 2OCCC 1HDJA 2KKWA 3T1YB 2Y0IA 1ZSPA 1JPXA 5EYPA 1R3KC 5L3FA 2ATKC 1TUBB 4F6RB 3MDSA 3CXCU 1PV0A 5BR8O 3OMAB 3L70H 4FLWA 4I0XA 4DUYB 3CCRV 2VWJA 2N04A 4X1YB 3JARB 3OEHG 1NZ6A 1FJGB 3D3IA 3OM3B 4PDMA 5H5NA 3LDEA 3SPIA 3H1KH 2UUAO 2P5OA 3AEIA 2X7RB 3K0GA 3EVKA 5LMNO 1R3LC 3FAVB 4O2BA 2WPDG 1PPJH 5DN6G 3W7SA 4PJ0Z 4EFBA 3H1HH 3GWOA 1JQ0A 2ZXWB 3K79A 2OIGA 1B04A 1PKXA 1J5EB 1EN6A 1YITV 3KCYA 1ZL8B 1K97A 1H2MA 1R3IC 2HHHB 1FD9A 1K5SA 2WAMA 5LOVB 1COWG 4YY3B 4L87A 3K03A 5C93A 3SJBC 5J2TB 4L8JA 4J42A 1YZBA 2LGQA 3MAQA 1IURA 4C7UA 5K1PA 4GKKB 4JI4B 2QDOA 5IWAB 1IXBA 2YI8A 3ZN1A 3T4ZA 4TOIA 2XAJA 3VQXA 4DV1O 4I50A 2AZ0A 5JJNB 2QA4V 4EFEA 3DGEA 3T1CA 4JAUA 3BVOA 2MW2B 1NT2B 2EIKC 2FTKA 1BMFG 2XAGA 4PDRA 1GMGA 4UVAA 3JD1A 4P9OA 1N8RW 3E8FA 2C2AA 4FMTA 2ETNA 1V9PA 4LH6A 1I94B 3N27A 3SYQA 3DSQA 5L3CA 1YI2V 4LP8A 5LP6A 3ABKB 1QNMA 5LYJB 4WFAV 4AI8A 2UXCB 1B06A 3OUFA 1N36B 4DV0B 2UXNA 3CB2A 4LF6B 4EKWA 1MSWD 2Y4TA 5KAIZ 1PM9A 1WN7A 2JGUA 1SESA 1VEWA 2IJIA 4IIJB 5K1XA 2K9PA 4UCVA 1SQPH 1W0JG 4OGQB 2Y48A 3HKEA 2YIAA 4PV1B 4CBCA 1TVKA 5DECA 1ENVA 3F5WC 3LSSA 1L8DA 3FD9A 4WBNA 1E1RG 3BCCH 1WP7A 1SQQH 4CZZA 1OCZB 3H9VA 4TQDA 4MVSA 1P4RA 5EZYA 4UCSA 2WSSG 2FYUH 3C3TA 3FB6C 1YHQV 3B09A 3HR0A 5LHGA 1IBLB 2CTRA 3E22B 4DR2B 1MZEA 2UXBB 2DYSC 4MVMA 2CGNA 3CCUV 2E5LB 2W6IG 2AGAA 3O9OA 4JI1B 2YXYA 5EK0A 2QR4A 4KP4A 4DV2B 1FXVA 4FLTA 1LNQA 3LDDA 4K0KO 1OCZC 1GKFA 4Q6GA 1S5LZ 4UCUA 1Y76A 3B8MA 2DOSA 4AQYB 2EJ7A 1GM7A 1BT8A 2IH3C 4WFEA 3J7AU 1O9GA 4MVZA 2IM9A 4NTWA 4O4JA 2HR3A 2PI4A 1HP8A 1H2GA 4MSWC 4F6EA 4NTXA 1SQFA 1Q86W 4I4TB 1XNRB 4DW0A 4DR5O 3IGAC 4OPAA 4HYOA 2HG5C 3N2KB 4YIPA 3ZRXA 2N05A 3JALA 3JCUZ 2QE7G 5IDJA 1H2NA 1Q6HA 3ABLB 1M93A 3EFFK 1G1XB 4P2ZA 2F66C 2WLLA 1ZUQA 2VQFB 2AHYA 3AG1B 3HKCB 1NTMH 3CRCA 1PL0A 4U3FH 3RYHA 5KX5B 4JI0B 3THOA 2UXDB 1AR5A 5EIBC 4G2KA 1M56B 4B3TO 1K4DC 2F23A 2B1IA 4UVCA 3W7UA 4EEQA 4NXMB 2UXXA 4J7KA 4X9QA 3JAKB 3ZEDA 5L3DA 3ZMZA 2E76B 1VQ8V 3HKDB 2HLDG 1V54C 1TUBA 3CS5A 5FNVA 4O4IB 1JR9A 1IBMB 1GRJA 4O4LA 4D7TA 2UU9B 3U11A 2A7WA 4JI8B 1UFIA 4UV9A 4LF9B 2ODMA 1OCCB 4MVOA 2CH7B 4X65B 3FYIB 2QM8A 5KHHA 4FLYA 3RW0A 3VQVA 2YEVA 5IE9A 1VQLV 5EYPB 3KG2A 4WFHA 3RYFB 4UB8Z 2L6LA 3SPHA 4TUYA 4B3MO 4P30A 1QR8A 3IFXA 1QHTA 2Q0OC 3AG3C 4DV6O 2F93B 2AXTZ 5JCOC 1ZL8A 2DYRC 4DR6O 4I0XB 4JTDB 3CCSV 5J2UA 4X8AA 4AILC 1Q81W 2QKAA 3H01A 1HNXB 1Q5OA 3WB2A 1QLEC 1KQSU 2DWEC 2X6CA 2M7WA 3ASNC 4DV3O 1YDXA 4Z1VA 3C90A 4I5SA 1S3JA 1FFTB 4B3SO 3LDCA 1AI4A 2P7TC 3T1HO 1B3QA 2G38A 4DRXA 1KC8W 2D3OW 1QBZA 4KHPO 2BSKA 5LHHA 1OZ0A 3CCVV 1RPOA 1LUVA 3G80A 3OUSA 4IT5A 4PA9A 5JQGA 2PUSA 3A2FA 4QE7A 3E89A 1Y67A 1BCCH 3CYOA 1XL6A 4ZOLA 4MT8A 5IYCO 3K5MA 2QWRB 2HFEC 4B08A 4WCEV 1WB8A 2R9IA 1VP7A 4R50A 1QCEA 4J10A 1KU9A 1L1FA 3ZJZA 2VQEO 1SQVH 4IIJA 5LXTA 2EIMC 1DK1A 4JI2O 5TISZ 1K8AW 5L3GA 5JWPA 4LF4B 1ZAUA 3STZC 4Z1MG 5LP6B 3ZBHA 5LA6A 1S76D 1XEQA 1X4TA 2R70A 2XOKG 3ABMC 2YS8A 2Z0AA 4DXWA 1R6NA 4PD4F 1BZKA 5KMGA 3JD2A 4JI5O 4LFBO 1N33O 2CDYA 3ZRVA 4DV4B 1AJQA 3L72H 1RP3B 3A8TA 3ASOB 3CSXA 1VARA 2ZE6A 3D8CA 4YHHO 4FLUA 1TVKB 1ZWIC 2E3CA 3J80N 1R6KA 2BCCH 4WBNB 4B7EA 5D5QA 3EXAA 3NXSA 1SERA 4LWSA 2Q69A 1SQGA 1NS1A 2B5UA 3AG4B 1S72V 4HZ3A 1YJNV 5FPRA 1GK9A 3OR6C 3FYEB 5AG2A 4YIOA 3SPJA 1YVWA 2OIEA 5CBFA 2XAFA 1NH2B 4X64O 1HNZB 2ZM6O 1VIBA 4B3RB 1VF5B 4K8XA 3SJAC 2UUCO 5F2VO 4BW9A 3TJTA 4PDLA 1QVGU 1Y76B 5LL6Y 1SC5B 2HJFC 4QJFB 1XMQB 4FPPA 5D5PA 5GTHZ 2A79B 3QNEA 2JS5A 2PYJA 4FZ1A 4OX9O 4QPKA 4MS2A 4MVQA 3WG7C 1KP3A 3SPGA 4HAMA 1IBKO 1U97A 4XBFA 1M9NA 1MZFA 2XHBA 2KG7A 3J81N 2ITCC 1L0NH 3U0ZA 3K08A 2CTWA 4ICGA 1P7BA 3L9DA 3UO2A 3JALB 2OCCB 3JAKA 1V55C 2EZPA 3L75H 5A9GA 3LNMB 2WLLB 4TSFG 3WB0A 5C8YB 3O65A 1LUWA 4ZIBA 2HVJC 3D36C 5BXZA 1K4CC 3RYHB 3T2MA 2P4VA 5JCOA 3B8NA 3TXSA 5KAFZ 1NBMG 3E8GA 5ITZA 3F7YC 4LF8B 5IY5C 2QKCA 2H3OA 3QF7A 2KQXA 1VQ6V 2FL4A 3OD4A 3RYFA 2RCVA 5FNVB 3F5TA 1VF6A 3C3SA 1VQKV 4O4LB 4DR4O 2QTSA 4ZHQB 1JFFA 2EJRA 1NQTA 1WA8B 4JPRA 4LC1A 3OW2U 1VQMV 3VBBA 4NXNO 1WNSA 4WFGA 1M5IA 2YEVB 4BW5A 4EB6A 5EC1C 1XL4A 1YEWA 1NVPB 4J9YB 4PA6A 3R66A 2YIBA 4TUYB 2B9ZA 1JMKC 5JJJB 2ZINA 2Q67A 2BOBC 1XNQO 2JGDA 1OCRC 2WA4A 5J2UB 2EIKB 1R1BA 3JAWB 1KB9F 3ZHUA 1W59A 3LUTB 1KECA 4DR1O 1FS0G 1KP2A 4DR3B 1KYOF 3ZRWA 4A5UB 4J9ZB 2IBZH 3AK1A 4DRXB 5LMUB 4UXNA 2QTOA 2BSKB 3FB8C 1KD1W 4JZ2A 4K3AA 1SA0A 4Z2WA 2DW4A 1AVMA 5JQGB 3QVNA 3GB7C 3G71V 5JVDA 4K8ZA 4I9QA 4JV5B 1SRYA 3E8BA 4XDKA 4LFCO 4UVBA 3OTFA 2MK3A 4LF5O 4DR7B 2LW1A 5IYZB 3SYOA 4CH5A 4X66O 4ZOLB 2IU0A 1NVPD 5CA1B 1G6UA 4GUNA 2JK5C 3K9SA 1FPOA 4JAAA 4FJCC 1AP6A 5LBQA 1XMOO 1Y66A 2W6JG 4NKGB 4DW1A 4JI7O 3UM7A 1EBOA 5BMVA 3BY6A 5IT9N 3T1YO 3B40A 3SYAA 2DYSB 2YDEA 5LXTB 2P90A 4I9WA 1R73A 1JJ2U 4RWUA 3RVZA 1WLEA 2X6BA 1YXBA 1BS3A 3RYIA 1SF9A 4DUYO 3E35A 5HFLA 3OEEG 5LA6B 3BFRA 1FJGO 2QEXV 1NR7A 1G4YB 2LJ2A 1NJIW 2N74A 4IHJB 5KMGB 3BHPA 1RFYA 4DV7O 4O2AA 2F95B 1CP9A 3L71H 1NTKH 3JATA 3CMAV 1MOFA 1SQXH 2O57A 3T4DA 1MMMA 2WLNA 1J5EO 1JX9A 3BA9A 3K3WA 2IJHA 1H38A 3ZHQA 1SQBH 2HHHO 1TA8A 4QGPA
chains in the Genus database with same CATH topology
1SQPH 3H1KH 4U3FH 5KLVH 4D6TH 1P84F 1L0LH 3L72H 2A06H 1PP9H 1KB9F 1PPJH 1NU1H 3CXHF 3L71H 3CWBH 1NTKH 1L0NH 3H1IH 1SQXH 3BCCH 3L70H 3H1HH 3H1JH 1SQQH 1BGYH 3L73H 1BCCH 1SQVH 1NTZH 2BCCH 1BE3H 3H1LH 3TGUH 3L75H 2FYUH 1KYOF 3CX5F 1EZVH 1SQBH 3L74H 4PD4F 1NTMH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP H;  3H1K H;  4U3F H;  5KLV H;  4D6T H;  1P84 F;  1L0L H;  3L72 H;  2A06 H;  1PP9 H;  1KB9 F;  1PPJ H;  1NU1 H;  3CXH F;  3L71 H;  3CWB H;  1NTK H;  1L0N H;  3H1I H;  1SQX H;  3BCC H;  3L70 H;  3H1H H;  3H1J H;  1SQQ H;  1BGY H;  3L73 H;  1BCC H;  1SQV H;  1NTZ H;  2BCC H;  1BE3 H;  3H1L H;  3TGU H;  3L75 H;  2FYU H;  1KYO F;  3CX5 F;  1EZV H;  1SQB H;  3L74 H;  4PD4 F;  1NTM H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 5EBW C;  4YY3 O;  4LWS B;  5CB4 B;  5CMU A;  1JVM A;  2PTM A;  4NYK A;  3ETQ A;  1PNL A;  1YJW V;  3UT5 B;  4JI6 B;  1GM8 A;  2WLJ A;  2WLI A;  4GKJ B;  3CWB H;  3CCE V;  4GKK O;  4JI4 O;  5DED A;  5IWA O;  5H2F Z;  3ZMV A;  3ZS8 C;  1HNW B;  2ZR2 A;  3D36 A;  2ZKO A;  1BHA A;  3EHB B;  3IC9 A;  5CBG A;  1I5X A;  1Q6U A;  2DE0 X;  3P3N A;  1N4C A;  1XIL A;  2VWK A;  2NN4 A;  3RT3 C;  1MA1 A;  4TT3 G;  3HKB B;  1H2L A;  3K5N A;  2BE3 A;  1QVF U;  2ARH A;  1AI5 A;  3OT7 A;  3K04 A;  3I56 V;  5L3B A;  1I94 O;  5L3E A;  3ZMT A;  1FFX B;  5C8Y A;  3CCL V;  1V54 B;  2YUA A;  2CAZ C;  2XAS A;  4KHP B;  4FLV A;  2Y0P A;  4OPH A;  4X62 B;  2BOC C;  2UXC O;  3QO5 A;  1N36 O;  2ADP A;  1XI1 A;  3U10 A;  4DV0 O;  1X59 A;  4ABM A;  4LF6 O;  1DGS A;  2KG7 B;  4RO2 A;  1VF7 A;  2V1D A;  2XND G;  1A32 A;  1ZX3 A;  1N32 B;  4DV5 B;  3AG7 A;  1UJW B;  5KLV H;  3BEH A;  4O4H A;  1YIJ V;  4FFK A;  2Q68 A;  1QLN A;  3CCM V;  3AG3 B;  4MTX A;  4ZHQ A;  3HB3 B;  1SKV A;  1YSC A;  2QGN A;  3W7W A;  2WA3 A;  5KHJ A;  2DYR B;  1WA8 A;  3WU2 Z;  1IBL O;  2EIN B;  1Y74 A;  2PY5 A;  3G6B A;  5EIB D;  4JI2 B;  4DR2 O;  5ITZ B;  2UXB O;  1HR0 B;  5CA0 A;  3ETG A;  1QLE B;  2PF4 E;  5B1A C;  1I0H A;  3S3X A;  1GAX A;  3ASN B;  2YXL A;  2WLH A;  2E5L O;  1G8M A;  4JI1 O;  2ZCE A;  4DV2 O;  3OTO B;  3SR2 C;  1GN4 A;  2XUM A;  3ZHT A;  3JD4 A;  5LGN A;  3CC2 V;  2QWN B;  5CN0 A;  1F7Y A;  2X0L A;  3ABU A;  2UUB B;  3VQY A;  3WB1 A;  2Y69 C;  4UCO A;  1JFF B;  1K33 A;  2OYQ A;  1ORQ C;  2EIN C;  4LF7 B;  4QIW F;  1IZ3 A;  3JAW A;  1AJP A;  3K5O A;  4AQY O;  5B3S C;  3K9A A;  3SYC A;  1GN6 A;  2HEP A;  4EB6 B;  3DXR A;  5CA3 A;  3RVY A;  4G28 B;  2Q7E A;  2YIC A;  2LGW A;  1XNR O;  4PEL A;  1AR1 B;  3RN4 A;  1E1Q G;  3OFN G;  3AK2 A;  1WJZ A;  2JGD B;  1VQP V;  2ZNI A;  4W4K A;  1F51 A;  1FXK C;  2F4V B;  2BTQ B;  4WFF A;  2OTL V;  1WP8 A;  4DUZ B;  2JDI G;  2EIM B;  3SDL A;  1ROP A;  4JGS A;  4JI3 B;  2VQF O;  5IYZ A;  3DC6 A;  2YID A;  1RPR A;  4JI0 O;  4JYA B;  3JSL A;  1QQC A;  3SGI A;  3ZRW B;  5CA1 A;  2UXD O;  1O9H A;  1Y4M A;  2ADQ B;  2H8P C;  4GCZ A;  1MSD A;  3TCU A;  3CJH A;  3ABM B;  3H1J H;  4NXM O;  1SA0 B;  2OT5 A;  4K35 A;  5JVD B;  2IH1 C;  1EM1 A;  1TUE B;  4RUE A;  4Q20 A;  1N34 B;  3JYC A;  1IXM A;  1IBM O;  2DQ3 A;  1P84 F;  1GN3 A;  1OJH A;  4BIO A;  2NLJ C;  3X2Q C;  1PD3 A;  2UU9 O;  2Q4P A;  4JI8 O;  1K7D A;  4LF9 O;  2CTP A;  2YIB D;  4QPJ A;  1US6 A;  1NTZ H;  2EIJ C;  1FKA O;  5CBH A;  4X65 O;  4BIU A;  1GM9 A;  5BMV B;  2GUZ B;  4WFB V;  2Z3Y A;  3RYC A;  1RM1 C;  4E2L A;  4IHJ A;  1K34 A;  2D2C B;  4LFA B;  3M7M X;  3MHS C;  1JA8 A;  2GBO A;  3OMN B;  4LNU B;  4PA4 A;  2X6A A;  3P32 A;  3GVM A;  4U3J B;  2FKX A;  2W0X A;  3A0B Z;  3RFR A;  2EIL C;  3FKS G;  5LGT A;  1IVS A;  3RYI B;  5BZB A;  3RWR D;  5B1B C;  5EBM C;  5CB4 A;  4XDL A;  4PA7 A;  4RQE A;  1GH6 A;  5LHI A;  1XHZ A;  2OTJ V;  1HNX O;  1FYJ A;  3UT5 A;  4X20 B;  4FM1 A;  5A2Q N;  3ICX A;  3R65 A;  1H8H G;  4O2A B;  1VMG A;  5BR8 B;  1BQ0 A;  2Z5U A;  3JAT B;  3WG7 B;  3TGU H;  2Y4U A;  3OMI B;  5IJ0 A;  4LCU C;  2ZQM A;  5E79 Z;  5GON B;  3FB5 C;  3SJQ C;  2JEU A;  5GW7 A;  2UUA B;  4W4L A;  4JTC B;  2WWW A;  3BPZ A;  2GTS A;  5FL7 G;  2GSM B;  3HKB A;  3S3W A;  5LMN B;  1URF A;  2GHY A;  2WLI B;  4D7S A;  1V55 B;  4TV8 A;  2WLM A;  1FFX A;  3CCQ V;  4FK5 C;  1W2B U;  2JRI A;  4X89 A;  3CRA A;  4H37 A;  4DYL A;  3JAS A;  4U7N A;  4UB6 Z;  2P4K A;  1YTF B;  1FXH A;  5E1A C;  5HFM A;  1AR4 A;  2ITD C;  3CME V;  2DN9 A;  2BTO A;  1NU1 H;  4RUF A;  1S5J A;  3JSN A;  3TK1 A;  1VQ5 V;  3ZN0 A;  5IY5 B;  3MHH C;  1DF4 A;  1VQ7 V;  1XRE A;  4LF4 O;  5FPO A;  5FLX N;  3ETD A;  4DV1 B;  4KFM A;  2RNB A;  4CC6 A;  4YJ2 A;  3IJ4 A;  4ZI7 A;  1NR1 A;  5B66 Z;  1NH2 D;  1CEZ A;  1Q82 W;  2QM4 A;  4JZG A;  4BWA A;  4MVU A;  4LR3 A;  4DK1 A;  3CRR A;  4YXW G;  2YXH A;  3KKY A;  2V7Q G;  1M1K W;  1AI7 A;  2RMK B;  4YJ3 B;  4ZKI A;  4DV4 O;  1JJO A;  2XT9 A;  2RQ6 A;  4D6T H;  1Q43 A;  2KSD A;  1M57 C;  3DC5 A;  3A0R A;  4FLZ A;  3CHX A;  5KUM A;  1OCO C;  4TV9 A;  4O4H B;  2LQT A;  4HBN A;  1GO3 F;  1KBH A;  1RSO B;  2LFS A;  4R7C A;  1N0N A;  3STL C;  3CX5 F;  1YTF D;  1FXK A;  4R8C A;  1MG1 A;  1OCR B;  4MW3 A;  1Y74 B;  3AG2 C;  4I55 A;  3FX7 A;  4X1K A;  5CA0 B;  1DLB A;  1OV9 A;  3CC4 V;  1KUQ A;  1D2D A;  1HNZ O;  1M90 W;  2EZO A;  4B3R O;  3Q4H A;  3CD6 V;  2HVK C;  2A0L A;  1VQN V;  4OXS A;  3G4S V;  3CCJ V;  4J7Z A;  2BTQ A;  1XMQ O;  1EZJ A;  4DV7 B;  5KUK A;  1BQZ A;  1HWY A;  1B6Q A;  3BA8 A;  3APQ A;  3DXR B;  1WPX A;  1AP5 A;  1YJ9 V;  2DJV A;  2ZR3 A;  4K0K B;  3IC7 A;  2XAQ A;  2NR5 A;  3CEI A;  2CUG A;  1Y6X A;  2AZ2 A;  2E75 B;  1YCI A;  2PYL A;  3OGC C;  3E83 A;  4X1I A;  2B1G A;  1K9M W;  2F43 G;  2E74 B;  3B2E E;  4PI2 A;  3SYP A;  3BAB A;  1BSM A;  2ZXW C;  1NI8 A;  4UFZ A;  1MAB G;  1D5A A;  2CGO A;  2CTQ A;  3G67 A;  4H0L B;  4R6Z A;  3ZHS A;  4DR5 B;  3W7X A;  5IYD O;  3RBZ A;  3M8A A;  2V4D A;  2RJZ A;  2EX3 A;  3K57 A;  5KHI A;  4XDJ A;  2Q0A A;  2P6J A;  4G27 B;  3I55 V;  3HPL C;  3CJH B;  2GUZ A;  4LF8 O;  3N2G B;  2M6Y A;  2Q8V A;  4GYC B;  1W0K G;  5IJ9 A;  2ZNJ A;  4LBE C;  4LNU A;  5BY1 A;  2DQ0 A;  3E2E A;  1GTO A;  4J11 A;  3K59 A;  4U3J A;  3CPW U;  3FB7 C;  4B3T B;  1BGY H;  3LSQ A;  1EFR G;  4IYI A;  1R6T A;  4TQF A;  2Q9L A;  2QWP B;  1FAF A;  2NNU A;  1S77 D;  4JYY A;  4X20 A;  1JCH A;  4GLX A;  1ZTE A;  3RYC B;  3ABK C;  1DTO A;  1S5H C;  1P49 A;  3ZMU A;  2IJJ A;  3M99 B;  5GTI Z;  5H6Q A;  3RGB A;  2CE4 A;  5GON A;  1PNK A;  3CC7 V;  2Q6A A;  1N0J A;  2PI5 A;  3UCS C;  3QTC A;  1LR1 A;  3ML0 A;  4FM2 A;  3FFQ A;  2IW5 A;  1H2S B;  2EUL A;  4FFB A;  4B3M B;  1Q90 D;  1JOY A;  4DR3 O;  1I08 A;  4HNA A;  4DV6 B;  3SPC A;  4I7Z B;  2IU3 A;  4DR6 B;  4LH7 A;  1ZLZ A;  5LMU O;  1F23 A;  5IJ0 B;  1KKC A;  3BAA A;  4TWK A;  4CH4 A;  2HJD A;  2QWO B;  1WPB A;  3K0D A;  5H6R A;  1WAZ A;  4ASU G;  4JV5 O;  4FIP C;  4DV3 B;  4B7K A;  4DR7 O;  1VQO V;  3GWK C;  4TV8 B;  4B3S B;  2JVD A;  4J80 A;  4NR1 A;  4WF9 V;  3T1H B;  4UV8 A;  2LO1 A;  3G6E V;  4JYC A;  4N23 A;  3JAS B;  5H9C A;  2R9A A;  1VQ9 V;  3H1I H;  3JCZ A;  1I5Y A;  4MVR A;  1IDS A;  3ETE A;  4JAV A;  2R9R B;  2GV9 A;  4FVM A;  4YJ3 A;  1XHX A;  5B1A B;  3VOU A;  1GN2 A;  2ZT9 B;  5B1N A;  3P30 A;  2ZIM A;  3CXH F;  4NB5 A;  4YJ2 B;  1RSO A;  4ZI7 B;  3QG5 A;  4GT1 A;  5KHG A;  5JH7 A;  3OE7 G;  3JAM N;  1Q6I A;  2Y69 B;  2LW7 A;  3ABL C;  2VQE B;  1BL8 A;  1I7F A;  2GDS A;  4F4L A;  3LSU A;  3UO3 A;  2YI9 A;  3AG1 C;  3KCX A;  2PZS A;  3ZRS A;  4QNH B;  2ZIO A;  5B3S B;  4H33 A;  4F6R A;  1VQ4 V;  4PDV A;  2F1M A;  1TGO A;  2ZDI C;  3WFV A;  4GZR B;  2XTA A;  3NR7 A;  1M56 C;  1PNM A;  4TV9 B;  1SET A;  4X1Y A;  1CPY A;  3JAR A;  1AI6 A;  3JD0 A;  2ZE5 A;  3OAA G;  2JIZ G;  2QSA A;  1FXK B;  3FAV A;  4JI5 B;  2LFR A;  4LFB B;  2P06 A;  4CS3 A;  4JI6 O;  1N33 B;  2CK3 G;  4GKJ O;  2L35 A;  2QWQ B;  3ZHR A;  1ARO P;  4I55 B;  1EN4 A;  4X1K B;  4YHH B;  4QE9 A;  1HNW O;  3I5D A;  5IYB O;  1OCC C;  5KA5 A;  3L74 H;  5LOV A;  2ILM A;  3Q4H B;  4CH6 A;  3QO7 A;  3W7T A;  3K06 A;  4IL6 Z;  5J2T A;  1M4U A;  2QJ1 A;  1Q7Y W;  5EBL C;  1CXZ B;  1XQ8 A;  2R72 A;  3MD0 A;  2Q7G A;  1Z2G A;  4O2B B;  1TAE A;  4RAI A;  5B1O A;  4GX0 A;  4ZBM A;  3PJS K;  4X64 B;  4PA3 A;  3DTU B;  2ZM6 B;  1VF6 C;  5KA6 A;  1SZX A;  2GTA A;  3E86 A;  1D5N A;  4X62 O;  2UUC B;  1U96 A;  4MTO A;  1MNG A;  4KXR A;  1AIL A;  3X2Q B;  4CS2 A;  2A06 H;  2FB5 A;  4BIZ A;  4X1I B;  2ZD9 A;  2HP8 A;  1XBL A;  4JTA B;  2EIJ B;  4IYH A;  3L73 H;  3N2G A;  1Q8I A;  3QO8 A;  1N32 O;  3A0H Z;  1RM1 B;  4DV5 O;  1IX9 A;  4OX9 B;  1WB7 A;  2JEX A;  1EN5 A;  1QR9 A;  3B4S A;  5LYJ A;  1K3E A;  2JJ1 G;  1IBK B;  2LP7 A;  1NKD A;  3OR7 C;  4I50 B;  1L0L H;  3LNN A;  4MTG A;  3ABT A;  2KB1 A;  1Q3E A;  2EIL B;  2WLK A;  4KL1 A;  4GX5 A;  1BE3 H;  4CC5 A;  2AW9 A;  3H1L H;  5B1B B;  4BAY A;  3JD3 A;  1K5Q A;  3ZCC A;  1J95 A;  2RN9 A;  4FZ0 A;  3K58 A;  2PGG A;  3B77 A;  1HR0 O;  3IAY A;  4IGG A;  1SS3 A;  4CS4 A;  1P7G A;  2EBO A;  1K92 A;  3TET A;  1OHH G;  4UUJ C;  5IJ9 B;  3OTO O;  2QM7 A;  2FML A;  1AB3 A;  2UUB O;  1XOU A;  3E22 A;  2A9H A;  4LF7 O;  2DMX A;  4J41 A;  3HKE B;  4RQF A;  2JJ2 G;  1YF2 A;  2QKS A;  3BRC A;  5LP6 C;  1AJN A;  3SJC C;  1H8E G;  4X88 A;  1R3J C;  2ZE7 A;  5J9P C;  5JJE B;  4DR4 B;  4CH3 A;  2IJK A;  4DO2 A;  4JYB A;  2DWD C;  3K5L A;  5EZY B;  2ZE8 A;  4GX2 A;  4J7J A;  2P67 A;  4MTF A;  1KMI Z;  3ZHV A;  3UQ8 A;  4U7O A;  4NXN B;  1BHB A;  4NTY A;  2F4V O;  3CRM A;  1XUQ A;  4DK0 A;  4JF3 A;  4DUZ O;  4AHC A;  3ASO C;  1THZ A;  4JI3 O;  4FFB B;  1SZT A;  3KZI Z;  2P22 C;  1QU7 A;  3UKM A;  1EZV H;  4I4T A;  4HNA B;  3D3Q A;  4JYA O;  2YC0 A;  3ZIA G;  2YSU B;  4E4E A;  3TXQ A;  3AK3 A;  1XNQ B;  5LGU A;  3N2K A;  3AG4 C;  2Q5Z A;  1F4N A;  1F4M A;  3VQW A;  1K73 W;  1KKD A;  2VRZ A;  3OGI B;  1HW7 A;  5EC2 C;  2VS0 A;  4GX1 A;  3CE2 A;  2HKO A;  2Q7H A;  3HKC A;  3ZX6 A;  3CP1 A;  1E79 G;  2JS3 A;  4DR1 B;  2ZDI A;  5KHK A;  5KX5 A;  1N34 O;  2OWO A;  4BR6 A;  4UCT A;  4O4J B;  2AHZ A;  1Z5V A;  1DF5 A;  1M57 B;  1XDC A;  4NVP A;  2RDC A;  5DM6 V;  1OCO B;  4JAS A;  3P3P A;  4H44 B;  4FLX A;  1Z5W A;  4H13 B;  3F7V C;  4PI0 A;  1UPG A;  4KUM A;  3E8H A;  4FM0 A;  2OCH A;  1S0V A;  2H94 A;  2XAH A;  3HKD A;  4LFC B;  2W0F C;  3AG2 B;  4O4I A;  1T5E A;  2K1E A;  4LF5 B;  4LFA O;  4X66 B;  3CRQ A;  3PN1 A;  2A3Q A;  4MW8 A;  3ZMS A;  2Q73 A;  1PP9 H;  5B5E Z;  1H2K A;  2CH7 A;  1PL4 A;  1XMO B;  4PHZ A;  4UCR A;  4N21 A;  4JI7 B;  4P9P A;  3APO A;  5JH7 B;  2OCC C;  1HDJ A;  2KKW A;  3T1Y B;  2Y0I A;  1ZSP A;  1JPX A;  5EYP A;  1R3K C;  5L3F A;  2ATK C;  1TUB B;  4F6R B;  3MDS A;  3CXC U;  1PV0 A;  5BR8 O;  3OMA B;  3L70 H;  4FLW A;  4I0X A;  4DUY B;  3CCR V;  2VWJ A;  2N04 A;  4X1Y B;  3JAR B;  3OEH G;  1NZ6 A;  1FJG B;  3D3I A;  3OM3 B;  4PDM A;  5H5N A;  3LDE A;  3SPI A;  3H1K H;  2UUA O;  2P5O A;  3AEI A;  2X7R B;  3K0G A;  3EVK A;  5LMN O;  1R3L C;  3FAV B;  4O2B A;  2WPD G;  1PPJ H;  5DN6 G;  3W7S A;  4PJ0 Z;  4EFB A;  3H1H H;  3GWO A;  1JQ0 A;  2ZXW B;  3K79 A;  2OIG A;  1B04 A;  1PKX A;  1J5E B;  1EN6 A;  1YIT V;  3KCY A;  1ZL8 B;  1K97 A;  1H2M A;  1R3I C;  2HHH B;  1FD9 A;  1K5S A;  2WAM A;  5LOV B;  1COW G;  4YY3 B;  4L87 A;  3K03 A;  5C93 A;  3SJB C;  5J2T B;  4L8J A;  4J42 A;  1YZB A;  2LGQ A;  3MAQ A;  1IUR A;  4C7U A;  5K1P A;  4GKK B;  4JI4 B;  2QDO A;  5IWA B;  1IXB A;  2YI8 A;  3ZN1 A;  3T4Z A;  4TOI A;  2XAJ A;  3VQX A;  4DV1 O;  4I50 A;  2AZ0 A;  5JJN B;  2QA4 V;  4EFE A;  3DGE A;  3T1C A;  4JAU A;  3BVO A;  2MW2 B;  1NT2 B;  2EIK C;  2FTK A;  1BMF G;  2XAG A;  4PDR A;  1GMG A;  4UVA A;  3JD1 A;  4P9O A;  1N8R W;  3E8F A;  2C2A A;  4FMT A;  2ETN A;  1V9P A;  4LH6 A;  1I94 B;  3N27 A;  3SYQ A;  3DSQ A;  5L3C A;  1YI2 V;  4LP8 A;  5LP6 A;  3ABK B;  1QNM A;  5LYJ B;  4WFA V;  4AI8 A;  2UXC B;  1B06 A;  3OUF A;  1N36 B;  4DV0 B;  2UXN A;  3CB2 A;  4LF6 B;  4EKW A;  1MSW D;  2Y4T A;  5KAI Z;  1PM9 A;  1WN7 A;  2JGU A;  1SES A;  1VEW A;  2IJI A;  4IIJ B;  5K1X A;  2K9P A;  4UCV A;  1SQP H;  1W0J G;  4OGQ B;  2Y48 A;  3HKE A;  2YIA A;  4PV1 B;  4CBC A;  1TVK A;  5DEC A;  1ENV A;  3F5W C;  3LSS A;  1L8D A;  3FD9 A;  4WBN A;  1E1R G;  3BCC H;  1WP7 A;  1SQQ H;  4CZZ A;  1OCZ B;  3H9V A;  4TQD A;  4MVS A;  1P4R A;  5EZY A;  4UCS A;  2WSS G;  2FYU H;  3C3T A;  3FB6 C;  1YHQ V;  3B09 A;  3HR0 A;  5LHG A;  1IBL B;  2CTR A;  3E22 B;  4DR2 B;  1MZE A;  2UXB B;  2DYS C;  4MVM A;  2CGN A;  3CCU V;  2E5L B;  2W6I G;  2AGA A;  3O9O A;  4JI1 B;  2YXY A;  5EK0 A;  2QR4 A;  4KP4 A;  4DV2 B;  1FXV A;  4FLT A;  1LNQ A;  3LDD A;  4K0K O;  1OCZ C;  1GKF A;  4Q6G A;  1S5L Z;  4UCU A;  1Y76 A;  3B8M A;  2DOS A;  4AQY B;  2EJ7 A;  1GM7 A;  1BT8 A;  2IH3 C;  4WFE A;  3J7A U;  1O9G A;  4MVZ A;  2IM9 A;  4NTW A;  4O4J A;  2HR3 A;  2PI4 A;  1HP8 A;  1H2G A;  4MSW C;  4F6E A;  4NTX A;  1SQF A;  1Q86 W;  4I4T B;  1XNR B;  4DW0 A;  4DR5 O;  3IGA C;  4OPA A;  4HYO A;  2HG5 C;  3N2K B;  4YIP A;  3ZRX A;  2N05 A;  3JAL A;  3JCU Z;  2QE7 G;  5IDJ A;  1H2N A;  1Q6H A;  3ABL B;  1M93 A;  3EFF K;  1G1X B;  4P2Z A;  2F66 C;  2WLL A;  1ZUQ A;  2VQF B;  2AHY A;  3AG1 B;  3HKC B;  1NTM H;  3CRC A;  1PL0 A;  4U3F H;  3RYH A;  5KX5 B;  4JI0 B;  3THO A;  2UXD B;  1AR5 A;  5EIB C;  4G2K A;  1M56 B;  4B3T O;  1K4D C;  2F23 A;  2B1I A;  4UVC A;  3W7U A;  4EEQ A;  4NXM B;  2UXX A;  4J7K A;  4X9Q A;  3JAK B;  3ZED A;  5L3D A;  3ZMZ A;  2E76 B;  1VQ8 V;  3HKD B;  2HLD G;  1V54 C;  1TUB A;  3CS5 A;  5FNV A;  4O4I B;  1JR9 A;  1IBM B;  1GRJ A;  4O4L A;  4D7T A;  2UU9 B;  3U11 A;  2A7W A;  4JI8 B;  1UFI A;  4UV9 A;  4LF9 B;  2ODM A;  1OCC B;  4MVO A;  2CH7 B;  4X65 B;  3FYI B;  2QM8 A;  5KHH A;  4FLY A;  3RW0 A;  3VQV A;  2YEV A;  5IE9 A;  1VQL V;  5EYP B;  3KG2 A;  4WFH A;  3RYF B;  4UB8 Z;  2L6L A;  3SPH A;  4TUY A;  4B3M O;  4P30 A;  1QR8 A;  3IFX A;  1QHT A;  2Q0O C;  3AG3 C;  4DV6 O;  2F93 B;  2AXT Z;  5JCO C;  1ZL8 A;  2DYR C;  4DR6 O;  4I0X B;  4JTD B;  3CCS V;  5J2U A;  4X8A A;  4AIL C;  1Q81 W;  2QKA A;  3H01 A;  1HNX B;  1Q5O A;  3WB2 A;  1QLE C;  1KQS U;  2DWE C;  2X6C A;  2M7W A;  3ASN C;  4DV3 O;  1YDX A;  4Z1V A;  3C90 A;  4I5S A;  1S3J A;  1FFT B;  4B3S O;  3LDC A;  1AI4 A;  2P7T C;  3T1H O;  1B3Q A;  2G38 A;  4DRX A;  1KC8 W;  2D3O W;  1QBZ A;  4KHP O;  2BSK A;  5LHH A;  1OZ0 A;  3CCV V;  1RPO A;  1LUV A;  3G80 A;  3OUS A;  4IT5 A;  4PA9 A;  5JQG A;  2PUS A;  3A2F A;  4QE7 A;  3E89 A;  1Y67 A;  1BCC H;  3CYO A;  1XL6 A;  4ZOL A;  4MT8 A;  5IYC O;  3K5M A;  2QWR B;  2HFE C;  4B08 A;  4WCE V;  1WB8 A;  2R9I A;  1VP7 A;  4R50 A;  1QCE A;  4J10 A;  1KU9 A;  1L1F A;  3ZJZ A;  2VQE O;  1SQV H;  4IIJ A;  5LXT A;  2EIM C;  1DK1 A;  4JI2 O;  5TIS Z;  1K8A W;  5L3G A;  5JWP A;  4LF4 B;  1ZAU A;  3STZ C;  4Z1M G;  5LP6 B;  3ZBH A;  5LA6 A;  1S76 D;  1XEQ A;  1X4T A;  2R70 A;  2XOK G;  3ABM C;  2YS8 A;  2Z0A A;  4DXW A;  1R6N A;  4PD4 F;  1BZK A;  5KMG A;  3JD2 A;  4JI5 O;  4LFB O;  1N33 O;  2CDY A;  3ZRV A;  4DV4 B;  1AJQ A;  3L72 H;  1RP3 B;  3A8T A;  3ASO B;  3CSX A;  1VAR A;  2ZE6 A;  3D8C A;  4YHH O;  4FLU A;  1TVK B;  1ZWI C;  2E3C A;  3J80 N;  1R6K A;  2BCC H;  4WBN B;  4B7E A;  5D5Q A;  3EXA A;  3NXS A;  1SER A;  4LWS A;  2Q69 A;  1SQG A;  1NS1 A;  2B5U A;  3AG4 B;  1S72 V;  4HZ3 A;  1YJN V;  5FPR A;  1GK9 A;  3OR6 C;  3FYE B;  5AG2 A;  4YIO A;  3SPJ A;  1YVW A;  2OIE A;  5CBF A;  2XAF A;  1NH2 B;  4X64 O;  1HNZ B;  2ZM6 O;  1VIB A;  4B3R B;  1VF5 B;  4K8X A;  3SJA C;  2UUC O;  5F2V O;  4BW9 A;  3TJT A;  4PDL A;  1QVG U;  1Y76 B;  5LL6 Y;  1SC5 B;  2HJF C;  4QJF B;  1XMQ B;  4FPP A;  5D5P A;  5GTH Z;  2A79 B;  3QNE A;  2JS5 A;  2PYJ A;  4FZ1 A;  4OX9 O;  4QPK A;  4MS2 A;  4MVQ A;  3WG7 C;  1KP3 A;  3SPG A;  4HAM A;  1IBK O;  1U97 A;  4XBF A;  1M9N A;  1MZF A;  2XHB A;  2KG7 A;  3J81 N;  2ITC C;  1L0N H;  3U0Z A;  3K08 A;  2CTW A;  4ICG A;  1P7B A;  3L9D A;  3UO2 A;  3JAL B;  2OCC B;  3JAK A;  1V55 C;  2EZP A;  3L75 H;  5A9G A;  3LNM B;  2WLL B;  4TSF G;  3WB0 A;  5C8Y B;  3O65 A;  1LUW A;  4ZIB A;  2HVJ C;  3D36 C;  5BXZ A;  1K4C C;  3RYH B;  3T2M A;  2P4V A;  5JCO A;  3B8N A;  3TXS A;  5KAF Z;  1NBM G;  3E8G A;  5ITZ A;  3F7Y C;  4LF8 B;  5IY5 C;  2QKC A;  2H3O A;  3QF7 A;  2KQX A;  1VQ6 V;  2FL4 A;  3OD4 A;  3RYF A;  2RCV A;  5FNV B;  3F5T A;  1VF6 A;  3C3S A;  1VQK V;  4O4L B;  4DR4 O;  2QTS A;  4ZHQ B;  1JFF A;  2EJR A;  1NQT A;  1WA8 B;  4JPR A;  4LC1 A;  3OW2 U;  1VQM V;  3VBB A;  4NXN O;  1WNS A;  4WFG A;  1M5I A;  2YEV B;  4BW5 A;  4EB6 A;  5EC1 C;  1XL4 A;  1YEW A;  1NVP B;  4J9Y B;  4PA6 A;  3R66 A;  2YIB A;  4TUY B;  2B9Z A;  1JMK C;  5JJJ B;  2ZIN A;  2Q67 A;  2BOB C;  1XNQ O;  2JGD A;  1OCR C;  2WA4 A;  5J2U B;  2EIK B;  1R1B A;  3JAW B;  1KB9 F;  3ZHU A;  1W59 A;  3LUT B;  1KEC A;  4DR1 O;  1FS0 G;  1KP2 A;  4DR3 B;  1KYO F;  3ZRW A;  4A5U B;  4J9Z B;  2IBZ H;  3AK1 A;  4DRX B;  5LMU B;  4UXN A;  2QTO A;  2BSK B;  3FB8 C;  1KD1 W;  4JZ2 A;  4K3A A;  1SA0 A;  4Z2W A;  2DW4 A;  1AVM A;  5JQG B;  3QVN A;  3GB7 C;  3G71 V;  5JVD A;  4K8Z A;  4I9Q A;  4JV5 B;  1SRY A;  3E8B A;  4XDK A;  4LFC O;  4UVB A;  3OTF A;  2MK3 A;  4LF5 O;  4DR7 B;  2LW1 A;  5IYZ B;  3SYO A;  4CH5 A;  4X66 O;  4ZOL B;  2IU0 A;  1NVP D;  5CA1 B;  1G6U A;  4GUN A;  2JK5 C;  3K9S A;  1FPO A;  4JAA A;  4FJC C;  1AP6 A;  5LBQ A;  1XMO O;  1Y66 A;  2W6J G;  4NKG B;  4DW1 A;  4JI7 O;  3UM7 A;  1EBO A;  5BMV A;  3BY6 A;  5IT9 N;  3T1Y O;  3B40 A;  3SYA A;  2DYS B;  2YDE A;  5LXT B;  2P90 A;  4I9W A;  1R73 A;  1JJ2 U;  4RWU A;  3RVZ A;  1WLE A;  2X6B A;  1YXB A;  1BS3 A;  3RYI A;  1SF9 A;  4DUY O;  3E35 A;  5HFL A;  3OEE G;  5LA6 B;  3BFR A;  1FJG O;  2QEX V;  1NR7 A;  1G4Y B;  2LJ2 A;  1NJI W;  2N74 A;  4IHJ B;  5KMG B;  3BHP A;  1RFY A;  4DV7 O;  4O2A A;  2F95 B;  1CP9 A;  3L71 H;  1NTK H;  3JAT A;  3CMA V;  1MOF A;  1SQX H;  2O57 A;  3T4D A;  1MMM A;  2WLN A;  1J5E O;  1JX9 A;  3BA9 A;  3K3W A;  2IJH A;  1H38 A;  3ZHQ A;  1SQB H;  2HHH O;  1TA8 A;  4QGP A; 
#chains in the Genus database with same CATH homology
 1SQP H;  3H1K H;  4U3F H;  5KLV H;  4D6T H;  1P84 F;  1L0L H;  3L72 H;  2A06 H;  1PP9 H;  1KB9 F;  1PPJ H;  1NU1 H;  3CXH F;  3L71 H;  3CWB H;  1NTK H;  1L0N H;  3H1I H;  1SQX H;  3BCC H;  3L70 H;  3H1H H;  3H1J H;  1SQQ H;  1BGY H;  3L73 H;  1BCC H;  1SQV H;  1NTZ H;  2BCC H;  1BE3 H;  3H1L H;  3TGU H;  3L75 H;  2FYU H;  1KYO F;  3CX5 F;  1EZV H;  1SQB H;  3L74 H;  4PD4 F;  1NTM H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...