3JAMN

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3jamN02
5A2QN 2DOSA 2LW7A 1AILA 4DV4O 1A32A 4GKKO 4DR5O 2UUBO 4DR4O 4DR2O 1KUQA 4JI0O 3RT3C 2UXDO 2JRIA 4B3RO 4DUZO 1IBMO 4B3MO 4B3TO 1XNQO 2F4VO 3T1YO 1X59A 4JI5O 1N33O 3J80N 3T1HO 4DV7O 4A5UB 5H5NA 3F5TA 1DK1A 1HNWO 4DR7O 4X66O 4DV3O 5LMNO 4DUYO 1FYJA 4JI7O 4LF6O 2DJVA 1HR0O 1G1XB 2FKXA 4X64O 4LF4O 4NXNO 4JI1O 4JI2O 1XEQA 4JV5O 3O65A 5LL6Y 4DV2O 4NXMO 2UU9O 1IBLO 4DV6O 1AB3A 2ZM6O 4AQYO 4LF8O 2UUCO 1IBKO 2N74A 2Z0AA 1HNZO 1NS1A 5LMUO 4DV1O 2AGAA 4DR3O 5BY1A 1F7YA 1R1BA 2E5LO 3M8AA 4LF5O 4X65O 4X62O 1N36O 2UXBO 1YZBA 4K0KO 3R66A 1N32O 2VQEO 4DR1O 1J5EO 1XNRO 2UXCO 4KHPO 1FJGO 4LFBO 3J81N 4LFCO 4OPAA 5IT9N 2HHHO 1HNXO 4JI8O 4OX9O 4JYAO 2UUAO 5BXZA 4OPHA 4LFAO 1FKAO 1I94O 4GKJO 4YHHO 3OTOO 2ZKOA 4JI6O 4JI3O 1XMQO 5FLXN 1N34O 4YY3O 4JI4O 4LF7O 4DV0O 4DV5O 1XMOO 4DR6O 5IWAO 1R6TA 5BR8O 3JAMN 3J7AU 3SDLA 2VQFO 1D2DA 4LF9O 4B3SO
chains in the Genus database with same CATH superfamily
4PA6A 4FFBB 2LW7A 3D3QA 5KHGA 1ZTEA 1GAXA 1S5JA 3CCEV 1XL4A 1GN6A 1Y6XA 3ABTA 2ADQB 3HR0A 4ZHQB 1XNQO 1XI1A 2NR5A 4XBFA 3B09A 2LFSA 1QBZA 1Z5WA 3SYCA 1YITV 2B9ZA 4A5UB 2W0XA 2YEVB 1AJQA 1AR4A 1B3QA 1W0KG 1KB9F 2WLHA 2W6JG 1XHZA 3OGIB 2WLLA 1XEQA 4JV5O 2P67A 4QPJA 2Y69C 3OM3B 1ROPA 2ILMA 1SC5B 1GM9A 1OCZB 1AB3A 3KCYA 3QG5A 4I7ZB 1M9NA 5JCOC 2WLKA 1IBKO 4JZ2A 2QGNA 3JSNA 2AGAA 1AR1B 1T5EA 4EKWA 3CB2A 3M8AA 5E1AC 4LF5O 3SJQC 1XNQB 1ZLZA 5IJ9A 4X1YA 3UM7A 4JAAA 1BT8A 3SPCA 1J5EO 2Q9LA 3ZN1A 5IJ0A 4KHPO 3ABKB 4ZBMA 2QWQB 3J81N 4O2AB 4O4LB 2QKCA 4JV5B 4J80A 1WAZA 3K3WA 4OXSA 2LJ2A 2IU0A 3ZRXA 4O2BB 4GKJO 2FMLA 3SPJA 2YI8A 1JJ2U 1NZ6A 3K03A 3VOUA 1IBKB 2HP8A 4AILC 5CMUA 3TGUH 5IWAO 3JATA 1NQTA 4LF5B 4PELA 4F6RA 4R6ZA 3N27A 2D3OW 3H1IH 4IL6Z 1KKCA 1J5EB 3GWOA 1S76D 2ADPA 3ABUA 1SQVH 4KHPB 2QR4A 1GKFA 1OCZC 4D7SA 5CA3A 2QM4A 2LP7A 4X1IB 5CA1B 5KLVH 4WFAV 5FNVB 5CB4A 4DR5B 1H2NA 1QHTA 4U3FH 4TT3G 2Q5ZA 1RM1B 4HAMA 4GKJB 3BAAA 1PD3A 2G38A 2Q7HA 1WNSA 4LR3A 2XNDG 1S3JA 5IWAB 3WU2Z 2Q73A 1TUBA 4GUNA 2AZ0A 4TUYA 5EBWC 1VQOV 2Y0PA 4X20B 2PF4E 2N05A 1HP8A 3ABLB 4XDKA 5BY1A 1IVSA 2M6YA 5EZYA 3DXRA 1VF6A 3JD2A 1YZBA 4DR1O 2UXXA 1OHHG 2YS8A 1EBOA 1QR8A 1XNRO 4HBNA 3IFXA 1PNMA 5DN6G 3K06A 4PA3A 1H2KA 4OPAA 2JK5C 4H33A 4KL1A 2ZQMA 3W7XA 1R3JC 5D5PA 5LHHA 3E35A 3JASA 4PA4A 2LGQA 5EBLC 4TWKA 5LP6A 2JGUA 4YY3O 2RNBA 1P84F 1R6NA 4UB8Z 1R6TA 3ZBHA 1BHBA 1RM1C 4FLYA 3D36C 3K08A 4LFAB 2JDIG 2DOSA 5B66Z 2WLIB 3IC9A 3K9AA 5JH7B 2XTAA 3UCSC 2XOKG 2QM7A 1JCHA 1QR9A 4NKGB 2ETNA 4UXNA 4MTOA 2PI5A 3K5NA 3SJAC 3K04A 4P9OA 2QWOB 1YI2V 4J11A 1HDJA 3ABLC 1EM1A 3JAWA 5EIBC 5B1OA 4DR7O 2GUZA 3OUSA 4BAYA 3AG7A 1RP3B 5C8YA 1G1XB 5L3BA 4YY3B 5H9CA 4NXNO 4JTDB 2IH1C 3CCLV 5JQGB 4N23A 2R9RB 1WB7A 4IIJA 1NH2B 3BFRA 4PA9A 2GTAA 3SPGA 1K5SA 1Z2GA 2ZNJA 3CJHA 4P30A 2PGGA 3A0RA 3Q4HB 1K33A 2ZM6B 1TGOA 2E75B 2PYJA 1NJIW 2ITCC 4DR7B 2HEPA 4GX0A 4EFEA 1ZSPA 1M93A 1UFIA 4UUJC 3ASOC 2HFEC 2ZD9A 3K58A 1N8RW 1HNXO 5J9PC 1HW7A 1I7FA 2XAHA 4C7UA 3JSLA 3HKBA 2QTOA 1OCCB 4GCZA 3OR7C 1AROP 4NTXA 2CAZC 2DQ3A 2NLJC 4LF9O 2RQ6A 3CC2V 2FL4A 1YEWA 4DK0A 3AG2B 3P3PA 1NTZH 4LNUB 5EK0A 3DC6A 4MS2A 3D3IA 4JI0O 3KZIZ 1VMGA 4CH3A 1COWG 2YIBD 3K0DA 3RW0A 4NTYA 1HNXB 3S3WA 1N0JA 3E8HA 3JAKB 4DR2B 4WFGA 1H2SB 3SJCC 2H94A 2Q67A 4FLWA 5J2TA 3LNMB 2QE7G 2ZE5A 3EVKA 2W0FC 2YXHA 5KMGA 3CCQV 1SRYA 3RYCA 5H6QA 3CRCA 5L3DA 2JJ2G 4LF9B 1BQ0A 3LDCA 2Q6AA 4WBNA 3W7WA 5KHKA 4O4HA 4AQYO 1J95A 3G67A 4L87A 3G6BA 2WLNA 1K97A 1VQPV 4JI0B 3AG1B 1LUVA 1RFYA 4DV2B 1PNLA 1MABG 2Y48A 5ITZA 1WA8B 2XAFA 5B1AC 1OCCC 4WFEA 4DV6B 4TV8A 2GDSA 5LXTB 1BGYH 3FAVB 1LUWA 5B3SB 3SPHA 1N4CA 3C3TA 3AG2C 3ZMUA 1WPBA 1XREA 2E3CA 1FKAO 3OTOO 1M56B 1SF9A 4AQYB 2JVDA 5BZBA 3ZIAG 1XMOO 2ODMA 4DYLA 3JAMN 1UJWB 4GKKO 4B3SO 3AG3B 2QWNB 2WWWA 1K92A 2DE0X 2B1IA 2DYSB 4R50A 1L8DA 3QNEA 5KUKA 2UXDO 3RYIA 1WLEA 4FM2A 5CA0A 4FFKA 4GX1A 1IDSA 4B3TO 5LA6B 3T4DA 5LOVA 4G2KA 2DN9A 4CS2A 1B6QA 4DK1A 1N33O 4DV7O 2R9AA 5H5NA 5BMVB 2UXNA 1FD9A 3AG1C 3AK3A 2E74B 2FTKA 3RYFA 1CEZA 4ZOLB 4DUYO 3OTOB 1FYJA 3G71V 1MA1A 4WFHA 2YIAA 1IX9A 2GSMB 1E1RG 1UPGA 2WLLB 4LC1A 3CCVV 5K1PA 3JALA 1FXKB 5IYBO 4GKKB 4AI8A 4B3SB 4TQDA 2PUSA 2N74A 3ZMVA 2YICA 5LMUO 2ATKC 4UCTA 2UXDB 1F7YA 2E5LO 4B3TB 1M56C 3OTFA 3CMAV 4DV7B 1JR9A 4I55B 4FPPA 1K9MW 1PV0A 2IU3A 3ZMSA 1JJOA 4FLUA 2Q69A 4ZI7A 1PNKA 5IJ0B 1K34A 3IGAC 4DR3B 3TJTA 4MTXA 3UT5B 3H01A 3D8CA 1YJWV 1KMIZ 5JJJB 1D5NA 2DYSC 1YF2A 3RVZA 2KKWA 1IZ3A 2EULA 1KP2A 1VEWA 3K5MA 4GT1A 3TCUA 2M7WA 5EBMC 4MSWC 5FPOA 1KU9A 1LR1A 4I0XA 2KG7A 1XMQO 1TUEB 2V7QG 3HPLC 4LP8A 1QCEA 3RYHB 4R8CA 3FB5C 5LMUB 3RN4A 4DV5O 2Y69B 3UO2A 2QA4V 3CC7V 3HKCA 4J9ZB 1VQ8V 3ZRWA 1K3EA 4GX2A 3WB1A 4PDRA 4LF7B 1HWYA 1H2LA 2BSKA 4Z1VA 4MVQA 1Y74B 5KHHA 4B7KA 3ZEDA 5KX5A 1SERA 2JGDA 2HJDA 3MDSA 3T2MA 2EINC 5CBHA 3F7VC 2L6LA 4DV4B 2C2AA 1M90W 1HNWO 4PDLA 3K5LA 3RFRA 3G80A 2V1DA 2B1GA 2RJZA 2DJVA 2XAQA 4FIPC 1XMQB 4RUFA 4K8XA 3HKDA 3G4SV 4DV5B 5JVDB 5EC1C 5L3CA 2N04A 4NXMO 1TUBB 1H8HG 4MVMA 2Q7GA 4TUYB 4LBEC 1V9PA 4LWSA 4MVRA 2OYQA 4FVMA 3K79A 1PKXA 3ASNC 2EX3A 1Q43A 1BL8A 1GRJA 5KAIZ 2NN4A 3ZJZA 5IY5B 4LH7A 5B1NA 4PJ0Z 1HNWB 3VQWA 1OV9A 4UV8A 4FLVA 1AI4A 2KQXA 1Q6IA 4X89A 3X2QC 3JD0A 4DRXA 2GHYA 3CP1A 4ASUG 4NVPA 1YDXA 1KECA 4NXMB 2X6BA 1VF7A 2CK3G 4YIOA 3LSQA 3R65A 1YIJV 4W4LA 1AI5A 1V54B 2A79B 1EN5A 5BR8O 1VQNV 1YXBA 5FPRA 2IW5A 4JGSA 3C90A 4H0LB 4IHJA 2PYLA 1YVWA 4O4JB 3LSUA 4CZZA 1A32A 1RPRA 4DR5O 4DR4O 1W0JG 4NYKA 4DR6B 3APOA 4G27B 4ZIBA 1AJNA 3JD1A 3BA9A 1IXBA 1MSDA 2RN9A 3ZHTA 2UUBB 3JAWB 3VQXA 5LMNO 3LDDA 2OIEA 2GUZB 1VF6C 2FKXA 2ZINA 3N2KA 1JPXA 3SR2C 5IY5C 1QVGU 2OIGA 3W7TA 3SJBC 2A9HA 5BR8B 1ZL8A 1XUQA 1KD1W 3ETQA 2VWKA 4MVZA 4X64B 3H1KH 4IIJB 2CH7B 4DR4B 5GTIZ 3E2EA 5JCOA 5H6RA 3BA8A 3BRCA 3WB0A 1Y76A 3CJHB 5IYZA 3FB8C 5LP6C 4X62O 3CWBH 3R66A 2EJ7A 3ETDA 1V54C 4QE9A 2QTSA 1QU7A 4JF3A 4PV1B 2JEXA 4YJ2A 1KP3A 5LMNB 3I55V 1FJGO 1K8AW 5KA5A 4JYYA 2QEXV 4LFAO 1NVPD 4H44B 2RCVA 2LW1A 2DYRB 3ZCCA 3OR6C 1OJHA 3OMNB 1SESA 2O57A 1NBMG 2OCHA 3MHSC 3STZC 3H1HH 3CRQA 5KHIA 3E8FA 2ZT9B 4I50B 2JJ1G 2IJJA 3GVMA 1AI7A 4X62B 2WA3A 2CTRA 3W7SA 1XL6A 5B5EZ 3RT3C 3ZHRA 3E22A 1X4TA 4KXRA 1FJGB 4IT5A 1OZ0A 3J80N 4JYBA 4CH6A 1QLNA 1WB8A 5IDJA 1VQKV 3T1CA 4E4EA 1ZAUA 3ASOB 5J2TB 4GZRB 4JI2O 1Q82W 2CGNA 4F4LA 2P90A 3CRAA 1ZUQA 1G6UA 3RYCB 4BIUA 4WBNB 1TVKB 2JIZG 4CH4A 2IJHA 2ZM6O 1I5XA 1XOUA 3I56V 4O4LA 2YI9A 1R3LC 1VARA 4PI0A 4Q20A 2DYRC 1N36O 2UU9B 3OGCC 4NR1A 4PDVA 4KP4A 2VQEO 2QJ1A 1YHQV 5GW7A 4J7JA 3JYCA 3H1LH 1ZWIC 4FMTA 2CGOA 4JI2B 4KUMA 3VQVA 3JCUZ 3P32A 1KQSU 1VQ4V 5C93A 2UUAO 1NKDA 4EB6B 2DW4A 4LFBB 3CCSV 3RVYA 1L1FA 4LFCB 4X1IA 3CMEV 1AP6A 3OFNG 1MNGA 1WJZA 2OTLV 2JS3A 3CCJV 4XDJA 1N36B 5IYDO 3U0ZA 4U3JA 2VQEB 3TK1A 4MVUA 3CCMV 4DR2O 1VF5B 4B3RO 1K7DA 3TETA 2EIKC 5CA0B 1E79G 1KKDA 5B1AB 4X8AA 5EYPA 4K8ZA 1GN3A 1H2MA 1NI8A 2UUAB 4HZ3A 1YTFD 2YSUB 4DW1A 1R3IC 2YXLA 4FK5C 5D5QA 4X1KB 4K35A 3CCUV 2LFRA 5DEDA 2X6CA 1JA8A 5LL6Y 1MMMA 4DV2O 2DWEC 3QO5A 4JTAB 1QNMA 2ZNIA 4CC5A 2CTPA 2EIJC 3N2GB 4DV6O 3G6EV 4QJFB 4N21A 2ZIMA 4JI1B 1HNZO 1B04A 1WP8A 1CPYA 5J2UB 4B3RB 1FFXA 1F51A 4RQFA 4O4IA 4X65O 1Z5VA 3QO8A 1IBLB 1IXMA 3ZRSA 5JJEB 3L74H 4P2ZA 4TV9B 1JFFB 4J7ZA 2B5UA 4LCUC 1FPOA 4FLZA 2R70A 1DGSA 3OEHG 2QWRB 5BXZA 4JASA 3TXSA 2RDCA 2NNUA 3CCRV 2ITDC 4Q6GA 2EZPA 5FLXN 5AG2A 3CRRA 1SQPH 1HNZB 2YXYA 4MW8A 4X9QA 3CS5A 2XT9A 4X65B 1SQGA 1MZFA 1XHXA 2CTWA 3QO7A 1KYOF 3ZRWB 1WN7A 3A2FA 4HNAB 5JQGA 1H38A 1YJ9V 1P7BA 2AZ2A 4JI5O 4FZ1A 1YJNV 5LGTA 5E79Z 4I4TA 4EEQA 4JI7O 2PTMA 4P9PA 1IBMB 4LF4O 1BCCH 3OAAG 2Y4UA 1M57B 3HKDB 2PI4A 3T1HB 1K5QA 4I9WA 3B2EE 4CC6A 2IM9A 3CHXA 4BIOA 1Y66A 3HKEA 4LWSB 3OT7A 2LQTA 3LSSA 4YJ3A 4BW9A 1GTOA 2FB5A 5L3GA 1VQ5V 1FAFA 4DR3O 1Y67A 3IC7A 3UQ8A 3L9DA 2VRZA 3DSQA 4JI5B 4K0KO 1OCRB 1XBLA 1I08A 1VIBA 1XDCA 4J41A 2QWPB 2EJRA 5FL7G 4WCEV 1U96A 1MZEA 4G28B 3M99B 3UO3A 4JI7B 1D5AA 1P49A 2HR3A 4LF4B 2EINB 3W7UA 4DRXB 2XAGA 1M5IA 1EFRG 4YIPA 2MW2B 2X6AA 3E86A 5GONA 3L72H 4YHHO 2H3OA 2P7TC 5CBGA 5IJ9B 3OD4A 3FYEB 4X1YB 1N34O 4LF7O 2GBOA 1L0LH 4IYHA 3ML0A 5EC2C 3BABA 4MTGA 3JAKA 2WLJA 4I9QA 1D2DA 5F2VO 4F6EA 5A9GA 3B4SA 4FZ0A 4UVCA 4K0KB 2DQ0A 1M57C 3AK1A 1CXZB 3CE2A 4DV4O 4JI4B 3EXAA 2ZXWB 3ABMC 2A0LA 4D7TA 3ASNB 1SKVA 1MOFA 2WSSG 3ZHVA 4FM1A 1EZJA 3APQA 3QVNA 3E83A 3JATB 4GX5A 4H13B 1BHAA 4BR6A 3ZMTA 4F6RB 4YHHB 3BEHA 1SA0A 4FLXA 2WA4A 3CX5F 3X2QB 4TOIA 1OCRC 4DXWA 1N34B 1WA8A 2BTQA 2ZDIA 5LXTA 2Q7EA 3K9SA 4H37A 3FAVA 3K59A 4E2LA 4LF6B 5CB4B 3EFFK 2UUCO 2H8PC 4JZGA 4ICGA 3RBZA 1MG1A 4BWAA 1ZX3A 1JVMA 2AHYA 4CH5A 3GWKC 5L3FA 2KB1A 4QGPA 1M1KW 4MVSA 3AEIA 2QKAA 1R73A 4W4KA 4GLXA 4YJ2B 5HFLA 1NU1H 3FB7C 2AXTZ 1NT2B 3H9VA 4LH6A 2ZR3A 3BCCH 1PPJH 4PD4F 2ZXWC 1S5LZ 1N32B 4JI8O 4JYAO 1SZXA 2A3QA 1BMFG 5EZYB 3DXRB 1S5HC 2Z3YA 1Y4MA 5LA6A 2UUCB 4UCSA 1EN4A 4L8JA 5BMVA 4DR6O 1PL4A 4OGQB 4RQEA 1Q6UA 3SYAA 3CRMA 2Z5UA 3OE7G 1V55C 3VQYA 4ZOLA 3ZHQA 1I94B 1JMKC 1SQXH 2UUBO 2WPDG 5DECA 1KUQA 3PJSK 3JASB 5L3EA 4TQFA 2ARHA 1GN4A 3E22B 1FXKA 1SS3A 5LYJA 1PM9A 5LP6B 2VS0A 4XDLA 3T1YO 1K4DC 4D6TH 3TXQA 4UV9A 3F5TA 4JI8B 4JYAB 4JPRA 1RPOA 4ZKIA 2MK3A 3FX7A 4X64O 3IJ4A 4AHCA 4X88A 2K1EA 2Y0IA 2PY5A 3MHHC 4I55A 4RWUA 3ETEA 3CXHF 1K4CC 3F5WC 3UT5A 3JARA 3NR7A 3WFVA 2BOBC 4FJCC 2ZE8A 1VP7A 2CDYA 5C8YB 4CBCA 1Q90D 4UB6Z 3T1YB 1PP9H 3GB7C 2JS5A 3RYHA 4B7EA 3B8NA 3K0GA 1DF5A 2ZCEA 5CN0A 3DC5A 3SYPA 5LBQA 3ICXA 2HG5C 2GV9A 4NB5A 1QVFU 2PZSA 2A06H 2FYUH 5KAFZ 1FFTB 2WLMA 1Q5OA 5K1XA 1Y74A 1FXVA 1QLEB 1ORQC 3WB2A 2YIDA 3OEEG 2P4KA 4JI3O 1B06A 4JAVA 1R6KA 1FS0G 1I5YA 2KSDA 5HFMA 1RSOA 1Q3EA 2IH3C 2E76B 3SDLA 4Z2WA 1S72V 1WPXA 3SYQA 4FFBA 3QTCA 5EIBD 2OCCB 1W59A 4U3JB 1H8EG 3HKBB 5JVDA 2P22C 3DGEA 4UCRA 3ABKC 4ZHQA 1YSCA 5EYPB 1VQMV 1DK1A 2YEVA 2OWOA 3E8BA 5TISZ 3B8MA 1HR0O 4JI3B 4J10A 1S0VA 2ZE7A 4UCUA 4MVOA 1NVPB 3O65A 1AVMA 3JCZA 3B40A 3RWRD 2UU9O 1SZTA 2Q4PA 4LF8O 4QIWF 1OCOB 3A8TA 3CC4V 2Z0AA 1GM8A 1NS1A 2ZIOA 1G8MA 4UCOA 1QLEC 4GYCB 1AP5A 1FFXB 1R1BA 2D2CB 4O4IB 2F1MA 2RMKB 2QKSA 2JEUA 3QF7A 5KMGB 1AI6A 2BCCH 1Q81W 3SYOA 1WP7A 4KFMA 1JQ0A 2EIKB 4LFBO 4O4HB 1HR0B 2OCCC 4J9YB 3MD0A 4LFCO 4O2AA 4RAIA 4O4JA 4DR1B 3KKYA 2F43G 4O2BA 1XNRB 3CYOA 5ITZB 1EN6A 4TV8B 3CXCU 2CTQA 1O9HA 2YUAA 4LF8B 1BE3H 5JWPA 5LHIA 3C3SA 2ZE6A 3JD4A 4U7NA 3ZX6A 4TSFG 4DV0O 4UCVA 3E8GA 2EZOA 1XQ8A 3K5OA 1EZVH 3A0HZ 2BE3A 5LGNA 1NH2D 2EIJB 3L73H 1Q7YW 3AK2A 3CSXA 5CBFA 4QE7A 1NR1A 1CP9A 2IJIA 2HVKC 2P06A 1ENVA 5CA1A 1OCOC 1X59A 5DM6V 2IBZH 5FNVA 2CH7A 2R9IA 3LNNA 1SQFA 2EIMB 3P3NA 4DV3O 2OT5A 4I4TB 3KG2A 3D36A 3SPIA 4NTWA 4JI1O 4PDMA 4DV0B 3RYIB 3ZHUA 1URFA 4CS4A 5JJNB 5LOVB 1IBLO 3HKEB 2W6IG 4X20A 3OMAB 2EBOA 3BPZA 4NXNB 3FYIB 3U11A 4YJ3B 3RYFB 1IURA 2VWJA 5KHJA 1US6A 1GM7A 1R3KC 4RUEA 3T4ZA 1GMGA 2QM8A 3JALB 4DV3B 2UXCO 4I50A 2L35A 4J42A 2V4DA 3IAYA 3CPWU 3DTUB 3ZMZA 5IT9N 1YTFB 5H2FZ 3BHPA 1K73W 1TA8A 1BSMA 4OX9O 4YXWG 2F93B 1AJPA 5LGUA 5GONB 3LDEA 3WG7B 4K3AA 2GTSA 3L75H 4B08A 2CE4A 1BZKA 4JI6O 1F4MA 4QPKA 2HKOA 2EIMC 4WFBV 4ZI7B 3S3XA 3J7AU 1PL0A 3U10A 2VQFO 5A2QN 1GO3F 2WLIA 1AILA 5JH7A 3FFQA 3KCXA 4UVBA 2P4VA 1NR7A 2UXCB 4IYIA 4PI2A 4I0XB 2AW9A 2F95B 2KG7B 1IBMO 4B3MO 3JD3A 2F4VO 1TVKA 1I0HA 3OW2U 3T1HO 3I5DA 4OX9B 1TAEA 2P5OA 3HKCB 4X66O 1MSWD 2ZR2A 1SA0B 4JI6B 2AHZA 4FM0A 4PHZA 2BTQB 1NTMH 3CEIA 2BSKB 2F66C 3RGBA 5KA6A 5KX5B 3MAQA 2VQFB 2JGDB 3OUFA 2YC0A 1FXHA 3ZHSA 5GTHZ 3ZRVA 2Q8VA 1SQBH 4IGGA 5B1BB 3SGIA 4MT8A 2HJFC 4MTFA 4MW3A 3WG7C 2K9PA 3STLC 3L71H 2Q68A 3O9OA 2Y4TA 4EB6A 4B3MB 4JTCB 2F4VB 2F23A 2UXBO 3Q4HA 1THZA 1VQ9V 1H2GA 1S77D 3ABMB 1JX9A 4X66B 1DLBA 1VQ6V 3CD6V 1QQCA 2YDEA 5LHGA 4JYCA 2Q0OC 4BW5A 4QNHB 1W2BU 2HHHO 2EILB 3ZS8C 4I5SA 3AG4B 4OPHA 4U7OA 2ZKOA 4J7KA 5IE9A 4FLTA 4JI4O 4WFFA 2R72A 2XHBA 2HLDG 3FB6C 2A7WA 3THOA 3L70H 4WF9V 3F7YC 1NTKH 1GK9A 4BIZA 3K57A 2UXBB 1VQLV 2ZDIC 3LUTB 4LNUA 4X1KA 4DW0A 2XASA 1O9GA 4HYOA 4DO2A 1XMOB 1M4UA 2JRIA 4DUZO 2XUMA 1G4YB 3PN1A 5B3SC 5LYJB 3N2GA 5B1BC 2HHHB 3EHBB 4R7CA 2DWDC 3P30A 3OMIB 1P4RA 5J2UA 1KBHA 3VBBA 4LF6O 4IHJB 1YCIA 2QDOA 1N33B 1LNQA 1XILA 4PA7A 1AR5A 2DMXA 1JOYA 4TV9A 1JFFA 1DF4A 2YIBA 2LGWA 1SQQH 3AG3C 4DUYB 1L0NH 4UFZA 2WAMA 3HB3B 3JARB 1F4NA 2EILC 3NXSA 2LO1A 3BVOA 4DV1O 3BY6A 3AG4C 3M7MX 4DUZB 1V55B 1GH6A 3FD9A 4RO2A 3N2KB 2Q0AA 4CS3A 1GN2A 2XAJA 1Q86W 1F23A 1N32O 1ZL8B 3A0BZ 2OTJV 5IYCO 1U97A 1DTOA 2E5LB 2X7RB 1KC8W 2P6JA 3ETGA 4ABMA 3B77A 2HVJC 4EFBA 1SETA 3FKSG 2BOCC 5KUMA 2X0LA 2IJKA 1BQZA 2QSAA 1E1QG 1FXKC 4HNAA 1Y76B 5IYZB 1I94O 2BTOA 2CUGA 3H1JH 4JAUA 1Q8IA 4Z1MG 3E89A 4UVAA 4DV1B 1BS3A 3ZN0A 1RSOB 1Q6HA 1VQ7V 1N0NA 1P7GA 3UKMA
chains in the Genus database with same CATH topology
5A2QN 2DOSA 2LW7A 1AILA 4DV4O 1A32A 4GKKO 4DR5O 2UUBO 4DR4O 4DR2O 1KUQA 4JI0O 3RT3C 2UXDO 2JRIA 4B3RO 4DUZO 1IBMO 4B3MO 4B3TO 1XNQO 2F4VO 3T1YO 1X59A 4JI5O 1N33O 3J80N 3T1HO 4DV7O 4A5UB 5H5NA 3F5TA 1DK1A 1HNWO 4DR7O 4X66O 4DV3O 5LMNO 4DUYO 1FYJA 4JI7O 4LF6O 2DJVA 1HR0O 1G1XB 2FKXA 4X64O 4LF4O 4NXNO 4JI1O 4JI2O 1XEQA 4JV5O 3O65A 5LL6Y 4DV2O 4NXMO 2UU9O 1IBLO 4DV6O 1AB3A 2ZM6O 4AQYO 4LF8O 2UUCO 1IBKO 2N74A 2Z0AA 1HNZO 1NS1A 5LMUO 4DV1O 2AGAA 4DR3O 5BY1A 1F7YA 1R1BA 2E5LO 3M8AA 4LF5O 4X65O 4X62O 1N36O 2UXBO 1YZBA 4K0KO 3R66A 1N32O 2VQEO 4DR1O 1J5EO 1XNRO 2UXCO 4KHPO 1FJGO 4LFBO 3J81N 4LFCO 4OPAA 5IT9N 2HHHO 1HNXO 4JI8O 4OX9O 4JYAO 2UUAO 5BXZA 4OPHA 4LFAO 1FKAO 1I94O 4GKJO 4YHHO 3OTOO 2ZKOA 4JI6O 4JI3O 1XMQO 5FLXN 1N34O 4YY3O 4JI4O 4LF7O 4DV0O 4DV5O 1XMOO 4DR6O 5IWAO 1R6TA 5BR8O 3JAMN 3J7AU 3SDLA 2VQFO 1D2DA 4LF9O 4B3SO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  2DOS A;  2LW7 A;  1AIL A;  4DV4 O;  1A32 A;  4GKK O;  4DR5 O;  2UUB O;  4DR4 O;  4DR2 O;  1KUQ A;  4JI0 O;  3RT3 C;  2UXD O;  2JRI A;  4B3R O;  4DUZ O;  1IBM O;  4B3M O;  4B3T O;  1XNQ O;  2F4V O;  3T1Y O;  1X59 A;  4JI5 O;  1N33 O;  3J80 N;  3T1H O;  4DV7 O;  4A5U B;  5H5N A;  3F5T A;  1DK1 A;  1HNW O;  4DR7 O;  4X66 O;  4DV3 O;  5LMN O;  4DUY O;  1FYJ A;  4JI7 O;  4LF6 O;  2DJV A;  1HR0 O;  1G1X B;  2FKX A;  4X64 O;  4LF4 O;  4NXN O;  4JI1 O;  4JI2 O;  1XEQ A;  4JV5 O;  3O65 A;  5LL6 Y;  4DV2 O;  4NXM O;  2UU9 O;  1IBL O;  4DV6 O;  1AB3 A;  2ZM6 O;  4AQY O;  4LF8 O;  2UUC O;  1IBK O;  2N74 A;  2Z0A A;  1HNZ O;  1NS1 A;  5LMU O;  4DV1 O;  2AGA A;  4DR3 O;  5BY1 A;  1F7Y A;  1R1B A;  2E5L O;  3M8A A;  4LF5 O;  4X65 O;  4X62 O;  1N36 O;  2UXB O;  1YZB A;  4K0K O;  3R66 A;  1N32 O;  2VQE O;  4DR1 O;  1J5E O;  1XNR O;  2UXC O;  4KHP O;  1FJG O;  4LFB O;  3J81 N;  4LFC O;  4OPA A;  5IT9 N;  2HHH O;  1HNX O;  4JI8 O;  4OX9 O;  4JYA O;  2UUA O;  5BXZ A;  4OPH A;  4LFA O;  1FKA O;  1I94 O;  4GKJ O;  4YHH O;  3OTO O;  2ZKO A;  4JI6 O;  4JI3 O;  1XMQ O;  5FLX N;  1N34 O;  4YY3 O;  4JI4 O;  4LF7 O;  4DV0 O;  4DV5 O;  1XMO O;  4DR6 O;  5IWA O;  1R6T A;  5BR8 O;  3JAM N;  3J7A U;  3SDL A;  2VQF O;  1D2D A;  4LF9 O;  4B3S O; 
#chains in the Genus database with same CATH topology
 4PA6 A;  4FFB B;  2LW7 A;  3D3Q A;  5KHG A;  1ZTE A;  1GAX A;  1S5J A;  3CCE V;  1XL4 A;  1GN6 A;  1Y6X A;  3ABT A;  2ADQ B;  3HR0 A;  4ZHQ B;  1XNQ O;  1XI1 A;  2NR5 A;  4XBF A;  3B09 A;  2LFS A;  1QBZ A;  1Z5W A;  3SYC A;  1YIT V;  2B9Z A;  4A5U B;  2W0X A;  2YEV B;  1AJQ A;  1AR4 A;  1B3Q A;  1W0K G;  1KB9 F;  2WLH A;  2W6J G;  1XHZ A;  3OGI B;  2WLL A;  1XEQ A;  4JV5 O;  2P67 A;  4QPJ A;  2Y69 C;  3OM3 B;  1ROP A;  2ILM A;  1SC5 B;  1GM9 A;  1OCZ B;  1AB3 A;  3KCY A;  3QG5 A;  4I7Z B;  1M9N A;  5JCO C;  2WLK A;  1IBK O;  4JZ2 A;  2QGN A;  3JSN A;  2AGA A;  1AR1 B;  1T5E A;  4EKW A;  3CB2 A;  3M8A A;  5E1A C;  4LF5 O;  3SJQ C;  1XNQ B;  1ZLZ A;  5IJ9 A;  4X1Y A;  3UM7 A;  4JAA A;  1BT8 A;  3SPC A;  1J5E O;  2Q9L A;  3ZN1 A;  5IJ0 A;  4KHP O;  3ABK B;  4ZBM A;  2QWQ B;  3J81 N;  4O2A B;  4O4L B;  2QKC A;  4JV5 B;  4J80 A;  1WAZ A;  3K3W A;  4OXS A;  2LJ2 A;  2IU0 A;  3ZRX A;  4O2B B;  4GKJ O;  2FML A;  3SPJ A;  2YI8 A;  1JJ2 U;  1NZ6 A;  3K03 A;  3VOU A;  1IBK B;  2HP8 A;  4AIL C;  5CMU A;  3TGU H;  5IWA O;  3JAT A;  1NQT A;  4LF5 B;  4PEL A;  4F6R A;  4R6Z A;  3N27 A;  2D3O W;  3H1I H;  4IL6 Z;  1KKC A;  1J5E B;  3GWO A;  1S76 D;  2ADP A;  3ABU A;  1SQV H;  4KHP B;  2QR4 A;  1GKF A;  1OCZ C;  4D7S A;  5CA3 A;  2QM4 A;  2LP7 A;  4X1I B;  5CA1 B;  5KLV H;  4WFA V;  5FNV B;  5CB4 A;  4DR5 B;  1H2N A;  1QHT A;  4U3F H;  4TT3 G;  2Q5Z A;  1RM1 B;  4HAM A;  4GKJ B;  3BAA A;  1PD3 A;  2G38 A;  2Q7H A;  1WNS A;  4LR3 A;  2XND G;  1S3J A;  5IWA B;  3WU2 Z;  2Q73 A;  1TUB A;  4GUN A;  2AZ0 A;  4TUY A;  5EBW C;  1VQO V;  2Y0P A;  4X20 B;  2PF4 E;  2N05 A;  1HP8 A;  3ABL B;  4XDK A;  5BY1 A;  1IVS A;  2M6Y A;  5EZY A;  3DXR A;  1VF6 A;  3JD2 A;  1YZB A;  4DR1 O;  2UXX A;  1OHH G;  2YS8 A;  1EBO A;  1QR8 A;  1XNR O;  4HBN A;  3IFX A;  1PNM A;  5DN6 G;  3K06 A;  4PA3 A;  1H2K A;  4OPA A;  2JK5 C;  4H33 A;  4KL1 A;  2ZQM A;  3W7X A;  1R3J C;  5D5P A;  5LHH A;  3E35 A;  3JAS A;  4PA4 A;  2LGQ A;  5EBL C;  4TWK A;  5LP6 A;  2JGU A;  4YY3 O;  2RNB A;  1P84 F;  1R6N A;  4UB8 Z;  1R6T A;  3ZBH A;  1BHB A;  1RM1 C;  4FLY A;  3D36 C;  3K08 A;  4LFA B;  2JDI G;  2DOS A;  5B66 Z;  2WLI B;  3IC9 A;  3K9A A;  5JH7 B;  2XTA A;  3UCS C;  2XOK G;  2QM7 A;  1JCH A;  1QR9 A;  4NKG B;  2ETN A;  4UXN A;  4MTO A;  2PI5 A;  3K5N A;  3SJA C;  3K04 A;  4P9O A;  2QWO B;  1YI2 V;  4J11 A;  1HDJ A;  3ABL C;  1EM1 A;  3JAW A;  5EIB C;  5B1O A;  4DR7 O;  2GUZ A;  3OUS A;  4BAY A;  3AG7 A;  1RP3 B;  5C8Y A;  1G1X B;  5L3B A;  4YY3 B;  5H9C A;  4NXN O;  4JTD B;  2IH1 C;  3CCL V;  5JQG B;  4N23 A;  2R9R B;  1WB7 A;  4IIJ A;  1NH2 B;  3BFR A;  4PA9 A;  2GTA A;  3SPG A;  1K5S A;  1Z2G A;  2ZNJ A;  3CJH A;  4P30 A;  2PGG A;  3A0R A;  3Q4H B;  1K33 A;  2ZM6 B;  1TGO A;  2E75 B;  2PYJ A;  1NJI W;  2ITC C;  4DR7 B;  2HEP A;  4GX0 A;  4EFE A;  1ZSP A;  1M93 A;  1UFI A;  4UUJ C;  3ASO C;  2HFE C;  2ZD9 A;  3K58 A;  1N8R W;  1HNX O;  5J9P C;  1HW7 A;  1I7F A;  2XAH A;  4C7U A;  3JSL A;  3HKB A;  2QTO A;  1OCC B;  4GCZ A;  3OR7 C;  1ARO P;  4NTX A;  2CAZ C;  2DQ3 A;  2NLJ C;  4LF9 O;  2RQ6 A;  3CC2 V;  2FL4 A;  1YEW A;  4DK0 A;  3AG2 B;  3P3P A;  1NTZ H;  4LNU B;  5EK0 A;  3DC6 A;  4MS2 A;  3D3I A;  4JI0 O;  3KZI Z;  1VMG A;  4CH3 A;  1COW G;  2YIB D;  3K0D A;  3RW0 A;  4NTY A;  1HNX B;  3S3W A;  1N0J A;  3E8H A;  3JAK B;  4DR2 B;  4WFG A;  1H2S B;  3SJC C;  2H94 A;  2Q67 A;  4FLW A;  5J2T A;  3LNM B;  2QE7 G;  2ZE5 A;  3EVK A;  2W0F C;  2YXH A;  5KMG A;  3CCQ V;  1SRY A;  3RYC A;  5H6Q A;  3CRC A;  5L3D A;  2JJ2 G;  4LF9 B;  1BQ0 A;  3LDC A;  2Q6A A;  4WBN A;  3W7W A;  5KHK A;  4O4H A;  4AQY O;  1J95 A;  3G67 A;  4L87 A;  3G6B A;  2WLN A;  1K97 A;  1VQP V;  4JI0 B;  3AG1 B;  1LUV A;  1RFY A;  4DV2 B;  1PNL A;  1MAB G;  2Y48 A;  5ITZ A;  1WA8 B;  2XAF A;  5B1A C;  1OCC C;  4WFE A;  4DV6 B;  4TV8 A;  2GDS A;  5LXT B;  1BGY H;  3FAV B;  1LUW A;  5B3S B;  3SPH A;  1N4C A;  3C3T A;  3AG2 C;  3ZMU A;  1WPB A;  1XRE A;  2E3C A;  1FKA O;  3OTO O;  1M56 B;  1SF9 A;  4AQY B;  2JVD A;  5BZB A;  3ZIA G;  1XMO O;  2ODM A;  4DYL A;  3JAM N;  1UJW B;  4GKK O;  4B3S O;  3AG3 B;  2QWN B;  2WWW A;  1K92 A;  2DE0 X;  2B1I A;  2DYS B;  4R50 A;  1L8D A;  3QNE A;  5KUK A;  2UXD O;  3RYI A;  1WLE A;  4FM2 A;  5CA0 A;  4FFK A;  4GX1 A;  1IDS A;  4B3T O;  5LA6 B;  3T4D A;  5LOV A;  4G2K A;  2DN9 A;  4CS2 A;  1B6Q A;  4DK1 A;  1N33 O;  4DV7 O;  2R9A A;  5H5N A;  5BMV B;  2UXN A;  1FD9 A;  3AG1 C;  3AK3 A;  2E74 B;  2FTK A;  3RYF A;  1CEZ A;  4ZOL B;  4DUY O;  3OTO B;  1FYJ A;  3G71 V;  1MA1 A;  4WFH A;  2YIA A;  1IX9 A;  2GSM B;  1E1R G;  1UPG A;  2WLL B;  4LC1 A;  3CCV V;  5K1P A;  3JAL A;  1FXK B;  5IYB O;  4GKK B;  4AI8 A;  4B3S B;  4TQD A;  2PUS A;  2N74 A;  3ZMV A;  2YIC A;  5LMU O;  2ATK C;  4UCT A;  2UXD B;  1F7Y A;  2E5L O;  4B3T B;  1M56 C;  3OTF A;  3CMA V;  4DV7 B;  1JR9 A;  4I55 B;  4FPP A;  1K9M W;  1PV0 A;  2IU3 A;  3ZMS A;  1JJO A;  4FLU A;  2Q69 A;  4ZI7 A;  1PNK A;  5IJ0 B;  1K34 A;  3IGA C;  4DR3 B;  3TJT A;  4MTX A;  3UT5 B;  3H01 A;  3D8C A;  1YJW V;  1KMI Z;  5JJJ B;  1D5N A;  2DYS C;  1YF2 A;  3RVZ A;  2KKW A;  1IZ3 A;  2EUL A;  1KP2 A;  1VEW A;  3K5M A;  4GT1 A;  3TCU A;  2M7W A;  5EBM C;  4MSW C;  5FPO A;  1KU9 A;  1LR1 A;  4I0X A;  2KG7 A;  1XMQ O;  1TUE B;  2V7Q G;  3HPL C;  4LP8 A;  1QCE A;  3RYH B;  4R8C A;  3FB5 C;  5LMU B;  3RN4 A;  4DV5 O;  2Y69 B;  3UO2 A;  2QA4 V;  3CC7 V;  3HKC A;  4J9Z B;  1VQ8 V;  3ZRW A;  1K3E A;  4GX2 A;  3WB1 A;  4PDR A;  4LF7 B;  1HWY A;  1H2L A;  2BSK A;  4Z1V A;  4MVQ A;  1Y74 B;  5KHH A;  4B7K A;  3ZED A;  5KX5 A;  1SER A;  2JGD A;  2HJD A;  3MDS A;  3T2M A;  2EIN C;  5CBH A;  3F7V C;  2L6L A;  4DV4 B;  2C2A A;  1M90 W;  1HNW O;  4PDL A;  3K5L A;  3RFR A;  3G80 A;  2V1D A;  2B1G A;  2RJZ A;  2DJV A;  2XAQ A;  4FIP C;  1XMQ B;  4RUF A;  4K8X A;  3HKD A;  3G4S V;  4DV5 B;  5JVD B;  5EC1 C;  5L3C A;  2N04 A;  4NXM O;  1TUB B;  1H8H G;  4MVM A;  2Q7G A;  4TUY B;  4LBE C;  1V9P A;  4LWS A;  4MVR A;  2OYQ A;  4FVM A;  3K79 A;  1PKX A;  3ASN C;  2EX3 A;  1Q43 A;  1BL8 A;  1GRJ A;  5KAI Z;  2NN4 A;  3ZJZ A;  5IY5 B;  4LH7 A;  5B1N A;  4PJ0 Z;  1HNW B;  3VQW A;  1OV9 A;  4UV8 A;  4FLV A;  1AI4 A;  2KQX A;  1Q6I A;  4X89 A;  3X2Q C;  3JD0 A;  4DRX A;  2GHY A;  3CP1 A;  4ASU G;  4NVP A;  1YDX A;  1KEC A;  4NXM B;  2X6B A;  1VF7 A;  2CK3 G;  4YIO A;  3LSQ A;  3R65 A;  1YIJ V;  4W4L A;  1AI5 A;  1V54 B;  2A79 B;  1EN5 A;  5BR8 O;  1VQN V;  1YXB A;  5FPR A;  2IW5 A;  4JGS A;  3C90 A;  4H0L B;  4IHJ A;  2PYL A;  1YVW A;  4O4J B;  3LSU A;  4CZZ A;  1A32 A;  1RPR A;  4DR5 O;  4DR4 O;  1W0J G;  4NYK A;  4DR6 B;  3APO A;  4G27 B;  4ZIB A;  1AJN A;  3JD1 A;  3BA9 A;  1IXB A;  1MSD A;  2RN9 A;  3ZHT A;  2UUB B;  3JAW B;  3VQX A;  5LMN O;  3LDD A;  2OIE A;  2GUZ B;  1VF6 C;  2FKX A;  2ZIN A;  3N2K A;  1JPX A;  3SR2 C;  5IY5 C;  1QVG U;  2OIG A;  3W7T A;  3SJB C;  2A9H A;  5BR8 B;  1ZL8 A;  1XUQ A;  1KD1 W;  3ETQ A;  2VWK A;  4MVZ A;  4X64 B;  3H1K H;  4IIJ B;  2CH7 B;  4DR4 B;  5GTI Z;  3E2E A;  5JCO A;  5H6R A;  3BA8 A;  3BRC A;  3WB0 A;  1Y76 A;  3CJH B;  5IYZ A;  3FB8 C;  5LP6 C;  4X62 O;  3CWB H;  3R66 A;  2EJ7 A;  3ETD A;  1V54 C;  4QE9 A;  2QTS A;  1QU7 A;  4JF3 A;  4PV1 B;  2JEX A;  4YJ2 A;  1KP3 A;  5LMN B;  3I55 V;  1FJG O;  1K8A W;  5KA5 A;  4JYY A;  2QEX V;  4LFA O;  1NVP D;  4H44 B;  2RCV A;  2LW1 A;  2DYR B;  3ZCC A;  3OR6 C;  1OJH A;  3OMN B;  1SES A;  2O57 A;  1NBM G;  2OCH A;  3MHS C;  3STZ C;  3H1H H;  3CRQ A;  5KHI A;  3E8F A;  2ZT9 B;  4I50 B;  2JJ1 G;  2IJJ A;  3GVM A;  1AI7 A;  4X62 B;  2WA3 A;  2CTR A;  3W7S A;  1XL6 A;  5B5E Z;  3RT3 C;  3ZHR A;  3E22 A;  1X4T A;  4KXR A;  1FJG B;  4IT5 A;  1OZ0 A;  3J80 N;  4JYB A;  4CH6 A;  1QLN A;  1WB8 A;  5IDJ A;  1VQK V;  3T1C A;  4E4E A;  1ZAU A;  3ASO B;  5J2T B;  4GZR B;  4JI2 O;  1Q82 W;  2CGN A;  4F4L A;  2P90 A;  3CRA A;  1ZUQ A;  1G6U A;  3RYC B;  4BIU A;  4WBN B;  1TVK B;  2JIZ G;  4CH4 A;  2IJH A;  2ZM6 O;  1I5X A;  1XOU A;  3I56 V;  4O4L A;  2YI9 A;  1R3L C;  1VAR A;  4PI0 A;  4Q20 A;  2DYR C;  1N36 O;  2UU9 B;  3OGC C;  4NR1 A;  4PDV A;  4KP4 A;  2VQE O;  2QJ1 A;  1YHQ V;  5GW7 A;  4J7J A;  3JYC A;  3H1L H;  1ZWI C;  4FMT A;  2CGO A;  4JI2 B;  4KUM A;  3VQV A;  3JCU Z;  3P32 A;  1KQS U;  1VQ4 V;  5C93 A;  2UUA O;  1NKD A;  4EB6 B;  2DW4 A;  4LFB B;  3CCS V;  3RVY A;  1L1F A;  4LFC B;  4X1I A;  3CME V;  1AP6 A;  3OFN G;  1MNG A;  1WJZ A;  2OTL V;  2JS3 A;  3CCJ V;  4XDJ A;  1N36 B;  5IYD O;  3U0Z A;  4U3J A;  2VQE B;  3TK1 A;  4MVU A;  3CCM V;  4DR2 O;  1VF5 B;  4B3R O;  1K7D A;  3TET A;  2EIK C;  5CA0 B;  1E79 G;  1KKD A;  5B1A B;  4X8A A;  5EYP A;  4K8Z A;  1GN3 A;  1H2M A;  1NI8 A;  2UUA B;  4HZ3 A;  1YTF D;  2YSU B;  4DW1 A;  1R3I C;  2YXL A;  4FK5 C;  5D5Q A;  4X1K B;  4K35 A;  3CCU V;  2LFR A;  5DED A;  2X6C A;  1JA8 A;  5LL6 Y;  1MMM A;  4DV2 O;  2DWE C;  3QO5 A;  4JTA B;  1QNM A;  2ZNI A;  4CC5 A;  2CTP A;  2EIJ C;  3N2G B;  4DV6 O;  3G6E V;  4QJF B;  4N21 A;  2ZIM A;  4JI1 B;  1HNZ O;  1B04 A;  1WP8 A;  1CPY A;  5J2U B;  4B3R B;  1FFX A;  1F51 A;  4RQF A;  4O4I A;  4X65 O;  1Z5V A;  3QO8 A;  1IBL B;  1IXM A;  3ZRS A;  5JJE B;  3L74 H;  4P2Z A;  4TV9 B;  1JFF B;  4J7Z A;  2B5U A;  4LCU C;  1FPO A;  4FLZ A;  2R70 A;  1DGS A;  3OEH G;  2QWR B;  5BXZ A;  4JAS A;  3TXS A;  2RDC A;  2NNU A;  3CCR V;  2ITD C;  4Q6G A;  2EZP A;  5FLX N;  5AG2 A;  3CRR A;  1SQP H;  1HNZ B;  2YXY A;  4MW8 A;  4X9Q A;  3CS5 A;  2XT9 A;  4X65 B;  1SQG A;  1MZF A;  1XHX A;  2CTW A;  3QO7 A;  1KYO F;  3ZRW B;  1WN7 A;  3A2F A;  4HNA B;  5JQG A;  1H38 A;  1YJ9 V;  1P7B A;  2AZ2 A;  4JI5 O;  4FZ1 A;  1YJN V;  5LGT A;  5E79 Z;  4I4T A;  4EEQ A;  4JI7 O;  2PTM A;  4P9P A;  1IBM B;  4LF4 O;  1BCC H;  3OAA G;  2Y4U A;  1M57 B;  3HKD B;  2PI4 A;  3T1H B;  1K5Q A;  4I9W A;  3B2E E;  4CC6 A;  2IM9 A;  3CHX A;  4BIO A;  1Y66 A;  3HKE A;  4LWS B;  3OT7 A;  2LQT A;  3LSS A;  4YJ3 A;  4BW9 A;  1GTO A;  2FB5 A;  5L3G A;  1VQ5 V;  1FAF A;  4DR3 O;  1Y67 A;  3IC7 A;  3UQ8 A;  3L9D A;  2VRZ A;  3DSQ A;  4JI5 B;  4K0K O;  1OCR B;  1XBL A;  1I08 A;  1VIB A;  1XDC A;  4J41 A;  2QWP B;  2EJR A;  5FL7 G;  4WCE V;  1U96 A;  1MZE A;  4G28 B;  3M99 B;  3UO3 A;  4JI7 B;  1D5A A;  1P49 A;  2HR3 A;  4LF4 B;  2EIN B;  3W7U A;  4DRX B;  2XAG A;  1M5I A;  1EFR G;  4YIP A;  2MW2 B;  2X6A A;  3E86 A;  5GON A;  3L72 H;  4YHH O;  2H3O A;  2P7T C;  5CBG A;  5IJ9 B;  3OD4 A;  3FYE B;  4X1Y B;  1N34 O;  4LF7 O;  2GBO A;  1L0L H;  4IYH A;  3ML0 A;  5EC2 C;  3BAB A;  4MTG A;  3JAK A;  2WLJ A;  4I9Q A;  1D2D A;  5F2V O;  4F6E A;  5A9G A;  3B4S A;  4FZ0 A;  4UVC A;  4K0K B;  2DQ0 A;  1M57 C;  3AK1 A;  1CXZ B;  3CE2 A;  4DV4 O;  4JI4 B;  3EXA A;  2ZXW B;  3ABM C;  2A0L A;  4D7T A;  3ASN B;  1SKV A;  1MOF A;  2WSS G;  3ZHV A;  4FM1 A;  1EZJ A;  3APQ A;  3QVN A;  3E83 A;  3JAT B;  4GX5 A;  4H13 B;  1BHA A;  4BR6 A;  3ZMT A;  4F6R B;  4YHH B;  3BEH A;  1SA0 A;  4FLX A;  2WA4 A;  3CX5 F;  3X2Q B;  4TOI A;  1OCR C;  4DXW A;  1N34 B;  1WA8 A;  2BTQ A;  2ZDI A;  5LXT A;  2Q7E A;  3K9S A;  4H37 A;  3FAV A;  3K59 A;  4E2L A;  4LF6 B;  5CB4 B;  3EFF K;  2UUC O;  2H8P C;  4JZG A;  4ICG A;  3RBZ A;  1MG1 A;  4BWA A;  1ZX3 A;  1JVM A;  2AHY A;  4CH5 A;  3GWK C;  5L3F A;  2KB1 A;  4QGP A;  1M1K W;  4MVS A;  3AEI A;  2QKA A;  1R73 A;  4W4K A;  4GLX A;  4YJ2 B;  5HFL A;  1NU1 H;  3FB7 C;  2AXT Z;  1NT2 B;  3H9V A;  4LH6 A;  2ZR3 A;  3BCC H;  1PPJ H;  4PD4 F;  2ZXW C;  1S5L Z;  1N32 B;  4JI8 O;  4JYA O;  1SZX A;  2A3Q A;  1BMF G;  5EZY B;  3DXR B;  1S5H C;  2Z3Y A;  1Y4M A;  5LA6 A;  2UUC B;  4UCS A;  1EN4 A;  4L8J A;  5BMV A;  4DR6 O;  1PL4 A;  4OGQ B;  4RQE A;  1Q6U A;  3SYA A;  3CRM A;  2Z5U A;  3OE7 G;  1V55 C;  3VQY A;  4ZOL A;  3ZHQ A;  1I94 B;  1JMK C;  1SQX H;  2UUB O;  2WPD G;  5DEC A;  1KUQ A;  3PJS K;  3JAS B;  5L3E A;  4TQF A;  2ARH A;  1GN4 A;  3E22 B;  1FXK A;  1SS3 A;  5LYJ A;  1PM9 A;  5LP6 B;  2VS0 A;  4XDL A;  3T1Y O;  1K4D C;  4D6T H;  3TXQ A;  4UV9 A;  3F5T A;  4JI8 B;  4JYA B;  4JPR A;  1RPO A;  4ZKI A;  2MK3 A;  3FX7 A;  4X64 O;  3IJ4 A;  4AHC A;  4X88 A;  2K1E A;  2Y0I A;  2PY5 A;  3MHH C;  4I55 A;  4RWU A;  3ETE A;  3CXH F;  1K4C C;  3F5W C;  3UT5 A;  3JAR A;  3NR7 A;  3WFV A;  2BOB C;  4FJC C;  2ZE8 A;  1VP7 A;  2CDY A;  5C8Y B;  4CBC A;  1Q90 D;  4UB6 Z;  3T1Y B;  1PP9 H;  3GB7 C;  2JS5 A;  3RYH A;  4B7E A;  3B8N A;  3K0G A;  1DF5 A;  2ZCE A;  5CN0 A;  3DC5 A;  3SYP A;  5LBQ A;  3ICX A;  2HG5 C;  2GV9 A;  4NB5 A;  1QVF U;  2PZS A;  2A06 H;  2FYU H;  5KAF Z;  1FFT B;  2WLM A;  1Q5O A;  5K1X A;  1Y74 A;  1FXV A;  1QLE B;  1ORQ C;  3WB2 A;  2YID A;  3OEE G;  2P4K A;  4JI3 O;  1B06 A;  4JAV A;  1R6K A;  1FS0 G;  1I5Y A;  2KSD A;  5HFM A;  1RSO A;  1Q3E A;  2IH3 C;  2E76 B;  3SDL A;  4Z2W A;  1S72 V;  1WPX A;  3SYQ A;  4FFB A;  3QTC A;  5EIB D;  2OCC B;  1W59 A;  4U3J B;  1H8E G;  3HKB B;  5JVD A;  2P22 C;  3DGE A;  4UCR A;  3ABK C;  4ZHQ A;  1YSC A;  5EYP B;  1VQM V;  1DK1 A;  2YEV A;  2OWO A;  3E8B A;  5TIS Z;  3B8M A;  1HR0 O;  4JI3 B;  4J10 A;  1S0V A;  2ZE7 A;  4UCU A;  4MVO A;  1NVP B;  3O65 A;  1AVM A;  3JCZ A;  3B40 A;  3RWR D;  2UU9 O;  1SZT A;  2Q4P A;  4LF8 O;  4QIW F;  1OCO B;  3A8T A;  3CC4 V;  2Z0A A;  1GM8 A;  1NS1 A;  2ZIO A;  1G8M A;  4UCO A;  1QLE C;  4GYC B;  1AP5 A;  1FFX B;  1R1B A;  2D2C B;  4O4I B;  2F1M A;  2RMK B;  2QKS A;  2JEU A;  3QF7 A;  5KMG B;  1AI6 A;  2BCC H;  1Q81 W;  3SYO A;  1WP7 A;  4KFM A;  1JQ0 A;  2EIK B;  4LFB O;  4O4H B;  1HR0 B;  2OCC C;  4J9Y B;  3MD0 A;  4LFC O;  4O2A A;  4RAI A;  4O4J A;  4DR1 B;  3KKY A;  2F43 G;  4O2B A;  1XNR B;  3CYO A;  5ITZ B;  1EN6 A;  4TV8 B;  3CXC U;  2CTQ A;  1O9H A;  2YUA A;  4LF8 B;  1BE3 H;  5JWP A;  5LHI A;  3C3S A;  2ZE6 A;  3JD4 A;  4U7N A;  3ZX6 A;  4TSF G;  4DV0 O;  4UCV A;  3E8G A;  2EZO A;  1XQ8 A;  3K5O A;  1EZV H;  3A0H Z;  2BE3 A;  5LGN A;  1NH2 D;  2EIJ B;  3L73 H;  1Q7Y W;  3AK2 A;  3CSX A;  5CBF A;  4QE7 A;  1NR1 A;  1CP9 A;  2IJI A;  2HVK C;  2P06 A;  1ENV A;  5CA1 A;  1OCO C;  1X59 A;  5DM6 V;  2IBZ H;  5FNV A;  2CH7 A;  2R9I A;  3LNN A;  1SQF A;  2EIM B;  3P3N A;  4DV3 O;  2OT5 A;  4I4T B;  3KG2 A;  3D36 A;  3SPI A;  4NTW A;  4JI1 O;  4PDM A;  4DV0 B;  3RYI B;  3ZHU A;  1URF A;  4CS4 A;  5JJN B;  5LOV B;  1IBL O;  3HKE B;  2W6I G;  4X20 A;  3OMA B;  2EBO A;  3BPZ A;  4NXN B;  3FYI B;  3U11 A;  4YJ3 B;  3RYF B;  1IUR A;  2VWJ A;  5KHJ A;  1US6 A;  1GM7 A;  1R3K C;  4RUE A;  3T4Z A;  1GMG A;  2QM8 A;  3JAL B;  4DV3 B;  2UXC O;  4I50 A;  2L35 A;  4J42 A;  2V4D A;  3IAY A;  3CPW U;  3DTU B;  3ZMZ A;  5IT9 N;  1YTF B;  5H2F Z;  3BHP A;  1K73 W;  1TA8 A;  1BSM A;  4OX9 O;  4YXW G;  2F93 B;  1AJP A;  5LGU A;  5GON B;  3LDE A;  3WG7 B;  4K3A A;  2GTS A;  3L75 H;  4B08 A;  2CE4 A;  1BZK A;  4JI6 O;  1F4M A;  4QPK A;  2HKO A;  2EIM C;  4WFB V;  4ZI7 B;  3S3X A;  3J7A U;  1PL0 A;  3U10 A;  2VQF O;  5A2Q N;  1GO3 F;  2WLI A;  1AIL A;  5JH7 A;  3FFQ A;  3KCX A;  4UVB A;  2P4V A;  1NR7 A;  2UXC B;  4IYI A;  4PI2 A;  4I0X B;  2AW9 A;  2F95 B;  2KG7 B;  1IBM O;  4B3M O;  3JD3 A;  2F4V O;  1TVK A;  1I0H A;  3OW2 U;  3T1H O;  3I5D A;  4OX9 B;  1TAE A;  2P5O A;  3HKC B;  4X66 O;  1MSW D;  2ZR2 A;  1SA0 B;  4JI6 B;  2AHZ A;  4FM0 A;  4PHZ A;  2BTQ B;  1NTM H;  3CEI A;  2BSK B;  2F66 C;  3RGB A;  5KA6 A;  5KX5 B;  3MAQ A;  2VQF B;  2JGD B;  3OUF A;  2YC0 A;  1FXH A;  3ZHS A;  5GTH Z;  3ZRV A;  2Q8V A;  1SQB H;  4IGG A;  5B1B B;  3SGI A;  4MT8 A;  2HJF C;  4MTF A;  4MW3 A;  3WG7 C;  2K9P A;  3STL C;  3L71 H;  2Q68 A;  3O9O A;  2Y4T A;  4EB6 A;  4B3M B;  4JTC B;  2F4V B;  2F23 A;  2UXB O;  3Q4H A;  1THZ A;  1VQ9 V;  1H2G A;  1S77 D;  3ABM B;  1JX9 A;  4X66 B;  1DLB A;  1VQ6 V;  3CD6 V;  1QQC A;  2YDE A;  5LHG A;  4JYC A;  2Q0O C;  4BW5 A;  4QNH B;  1W2B U;  2HHH O;  2EIL B;  3ZS8 C;  4I5S A;  3AG4 B;  4OPH A;  4U7O A;  2ZKO A;  4J7K A;  5IE9 A;  4FLT A;  4JI4 O;  4WFF A;  2R72 A;  2XHB A;  2HLD G;  3FB6 C;  2A7W A;  3THO A;  3L70 H;  4WF9 V;  3F7Y C;  1NTK H;  1GK9 A;  4BIZ A;  3K57 A;  2UXB B;  1VQL V;  2ZDI C;  3LUT B;  4LNU A;  4X1K A;  4DW0 A;  2XAS A;  1O9G A;  4HYO A;  4DO2 A;  1XMO B;  1M4U A;  2JRI A;  4DUZ O;  2XUM A;  1G4Y B;  3PN1 A;  5B3S C;  5LYJ B;  3N2G A;  5B1B C;  2HHH B;  3EHB B;  4R7C A;  2DWD C;  3P30 A;  3OMI B;  1P4R A;  5J2U A;  1KBH A;  3VBB A;  4LF6 O;  4IHJ B;  1YCI A;  2QDO A;  1N33 B;  1LNQ A;  1XIL A;  4PA7 A;  1AR5 A;  2DMX A;  1JOY A;  4TV9 A;  1JFF A;  1DF4 A;  2YIB A;  2LGW A;  1SQQ H;  3AG3 C;  4DUY B;  1L0N H;  4UFZ A;  2WAM A;  3HB3 B;  3JAR B;  1F4N A;  2EIL C;  3NXS A;  2LO1 A;  3BVO A;  4DV1 O;  3BY6 A;  3AG4 C;  3M7M X;  4DUZ B;  1V55 B;  1GH6 A;  3FD9 A;  4RO2 A;  3N2K B;  2Q0A A;  4CS3 A;  1GN2 A;  2XAJ A;  1Q86 W;  1F23 A;  1N32 O;  1ZL8 B;  3A0B Z;  2OTJ V;  5IYC O;  1U97 A;  1DTO A;  2E5L B;  2X7R B;  1KC8 W;  2P6J A;  3ETG A;  4ABM A;  3B77 A;  2HVJ C;  4EFB A;  1SET A;  3FKS G;  2BOC C;  5KUM A;  2X0L A;  2IJK A;  1BQZ A;  2QSA A;  1E1Q G;  1FXK C;  4HNA A;  1Y76 B;  5IYZ B;  1I94 O;  2BTO A;  2CUG A;  3H1J H;  4JAU A;  1Q8I A;  4Z1M G;  3E89 A;  4UVA A;  4DV1 B;  1BS3 A;  3ZN0 A;  1RSO B;  1Q6H A;  1VQ7 V;  1N0N A;  1P7G A;  3UKM A; 
#chains in the Genus database with same CATH homology
 5A2Q N;  2DOS A;  2LW7 A;  1AIL A;  4DV4 O;  1A32 A;  4GKK O;  4DR5 O;  2UUB O;  4DR4 O;  4DR2 O;  1KUQ A;  4JI0 O;  3RT3 C;  2UXD O;  2JRI A;  4B3R O;  4DUZ O;  1IBM O;  4B3M O;  4B3T O;  1XNQ O;  2F4V O;  3T1Y O;  1X59 A;  4JI5 O;  1N33 O;  3J80 N;  3T1H O;  4DV7 O;  4A5U B;  5H5N A;  3F5T A;  1DK1 A;  1HNW O;  4DR7 O;  4X66 O;  4DV3 O;  5LMN O;  4DUY O;  1FYJ A;  4JI7 O;  4LF6 O;  2DJV A;  1HR0 O;  1G1X B;  2FKX A;  4X64 O;  4LF4 O;  4NXN O;  4JI1 O;  4JI2 O;  1XEQ A;  4JV5 O;  3O65 A;  5LL6 Y;  4DV2 O;  4NXM O;  2UU9 O;  1IBL O;  4DV6 O;  1AB3 A;  2ZM6 O;  4AQY O;  4LF8 O;  2UUC O;  1IBK O;  2N74 A;  2Z0A A;  1HNZ O;  1NS1 A;  5LMU O;  4DV1 O;  2AGA A;  4DR3 O;  5BY1 A;  1F7Y A;  1R1B A;  2E5L O;  3M8A A;  4LF5 O;  4X65 O;  4X62 O;  1N36 O;  2UXB O;  1YZB A;  4K0K O;  3R66 A;  1N32 O;  2VQE O;  4DR1 O;  1J5E O;  1XNR O;  2UXC O;  4KHP O;  1FJG O;  4LFB O;  3J81 N;  4LFC O;  4OPA A;  5IT9 N;  2HHH O;  1HNX O;  4JI8 O;  4OX9 O;  4JYA O;  2UUA O;  5BXZ A;  4OPH A;  4LFA O;  1FKA O;  1I94 O;  4GKJ O;  4YHH O;  3OTO O;  2ZKO A;  4JI6 O;  4JI3 O;  1XMQ O;  5FLX N;  1N34 O;  4YY3 O;  4JI4 O;  4LF7 O;  4DV0 O;  4DV5 O;  1XMO O;  4DR6 O;  5IWA O;  1R6T A;  5BR8 O;  3JAM N;  3J7A U;  3SDL A;  2VQF O;  1D2D A;  4LF9 O;  4B3S O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...