3JAMN

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3jamN02
2AGAA 4DR6O 4LFCO 4AQYO 4DR2O 1FKAO 3T1HO 4JI5O 4X65O 4DV1O 4JI8O 2UXDO 1FYJA 4JI0O 5FLXN 5BR8O 4LF9O 1N33O 2DOSA 2UUAO 4JV5O 1F7YA 2VQFO 2UUCO 3J7AU 1R6TA 4X62O 4LF7O 4LF6O 1NS1A 5IT9N 1I94O 4LFAO 2UUBO 5LL6Y 4JYAO 2UXBO 3R66A 4OX9O 4DV2O 2JRIA 4LF8O 1IBLO 2N74A 4GKJO 1A32A 2VQEO 4DUZO 1XEQA 1IBMO 4JI3O 4JI6O 3T1YO 3J81N 1YZBA 4B3SO 1X59A 4NXNO 4DV5O 2E5LO 4JI4O 4X64O 4GKKO 4DV0O 4OPHA 5LMNO 2Z0AA 4B3MO 3M8AA 2FKXA 4X66O 4DR3O 1XNRO 4DR1O 1IBKO 4DR7O 4DV4O 2HHHO 1N32O 4B3TO 3JAMN 4K0KO 1N36O 1G1XB 4DUYO 5IWAO 5BXZA 2DJVA 4LF5O 4NXMO 3SDLA 1AB3A 4DR4O 4DR5O 3O65A 3OTOO 5A2QN 3RT3C 4JI2O 1HR0O 4JI1O 3F5TA 2F4VO 5BY1A 1KUQA 5H5NA 4YY3O 1HNWO 2UXCO 2UU9O 4LFBO 4DV3O 1FJGO 1HNXO 4OPAA 1XMQO 1XMOO 4LF4O 1HNZO 1R1BA 5LMUO 4B3RO 4A5UB 4YHHO 1N34O 1DK1A 1AILA 2LW7A 4DV6O 2ZKOA 2ZM6O 3J80N 1J5EO 4KHPO 1D2DA 4DV7O 1XNQO 4JI7O
chains in the Genus database with same CATH superfamily
2JDIG 2RMKB 2C2AA 2IBZH 1P49A 4ASUG 3ZCCA 2YI8A 4CS2A 1Y66A 4JV5O 3ZJZA 4WF9V 2OT5A 3ZRVA 4G2KA 1KB9F 1I94O 2CAZC 5B5EZ 4JYAO 1YCIA 3D3QA 2IH3C 3ZX6A 2ZE8A 2KKWA 3E22B 2JEXA 2M7WA 3OMNB 5LA6A 1YVWA 1AVMA 5J2TA 2W6JG 1O9HA 3SPCA 5L3EA 5KHGA 4LWSA 4B7KA 1XQ8A 5B1AC 2IW5A 2P22C 2BCCH 4JI4O 4JYCA 4LNUA 3RW0A 1Q8IA 5EBLC 1SQBH 3VQXA 3ABMB 1TAEA 2FKXA 5KUMA 2KG7A 4MT8A 2K9PA 1XL4A 4X9QA 5KUKA 5IJ9B 4K0KO 4GKJB 4DUYO 2YXYA 5B3SC 4FIPC 1XNRB 3JASB 1Y67A 2DYSB 4ZBMA 2RJZA 1AI5A 5CBGA 1H2MA 4GKKB 5JVDB 2DN9A 4JI1B 3K5NA 2F1MA 1OCRB 1Q5OA 3K79A 3W7TA 4U3FH 1HNWO 4PA3A 1UJWB 2IJIA 5ITZA 1JFFB 4YXWG 2XAFA 1PPJH 2ADPA 1YTFD 2HVKC 3G80A 4J11A 4UCSA 1OJHA 2R9AA 2E3CA 4AHCA 4DR2O 1ZSPA 1Q82W 4DV1O 1XDCA 1D5NA 1XOUA 3P3NA 1AP5A 1YJWV 2NNUA 4JTDB 3U10A 1P7GA 1FXKC 4X62O 4RUEA 1PM9A 3CC4V 2MK3A 1R3IC 1RPRA 4RQFA 1PKXA 4H44B 2WWWA 4JYAB 1A32A 4QE9A 1WB7A 3J81N 1Y6XA 3SPHA 2P4VA 1IURA 2QWOB 1I5YA 1NH2B 3G6EV 1SERA 5DM6V 3GB7C 1WA8B 2WLIA 1NVPB 4DR6B 1H2KA 1XL6A 3CCLV 5GONA 4HZ3A 2DWEC 3IAYA 1W0JG 3L70H 3D8CA 3NR7A 3CD6V 1FFXA 3LNNA 1S5HC 1SZXA 2QTOA 3CP1A 4H37A 1MOFA 3DGEA 4I50A 5EC2C 2OTJV 2ZNIA 3K3WA 2X7RB 2ZT9B 5J2TB 1M93A 3K0GA 5A9GA 4TV8B 5D5QA 2Q5ZA 1K9MW 5BR8B 3UO3A 3OM3B 5H5NA 4PV1B 4TWKA 4NKGB 4JTAB 1DTOA 2WAMA 2Y4TA 5CA0B 1IBLB 1SKVA 4P2ZA 4X1IB 4G28B 2EIMC 4JYBA 4O2BB 3OMAB 4FZ1A 3BVOA 1YXBA 4BWAA 1J5EO 2V1DA 3WG7C 2QA4V 5C8YA 3B40A 4Q20A 3CHXA 2AGAA 3OMIB 3HKEA 4LFAB 4MW3A 2YUAA 2P6JA 1OZ0A 1OCCB 3HB3B 4YIOA 1Q6IA 1P84F 2X6AA 2F66C 3J7AU 2X6CA 1NS1A 1MABG 4F4LA 5LL6Y 4OX9O 1ZLZA 3ABTA 4J7KA 3F5WC 1VARA 1YZBA 1OCOB 2Q67A 4B3SO 3N27A 2ETNA 3ZHVA 3EXAA 2QM7A 5FNVA 1GAXA 1TVKB 5IJ0A 4DR5B 4DR4B 1Z2GA 3ZN0A 3AG7A 1EN6A 4K8XA 3D36A 4IHJA 1BS3A 3K03A 3BHPA 4DR1O 2HHHO 2XUMA 2KG7B 3SJCC 1X4TA 5L3CA 1VF6C 3KZIZ 2E75B 1YEWA 2ITDC 3SGIA 5KHIA 2ZD9A 2WA3A 3KCXA 3UO2A 2OTLV 1V55B 2E74B 2RDCA 1XI1A 2HJDA 2YIAA 2B1GA 4FLZA 4U3JA 4GX0A 5LYJB 4F6EA 4FFBB 2LO1A 3T1CA 4EB6A 4PJ0Z 1OCRC 3ICXA 4DV3O 1F51A 1XMOO 4NXNB 5KA6A 1N34O 2AZ2A 5DN6G 2NR5A 5L3BA 2A79B 2CH7A 3CRAA 1OCCC 1TA8A 2D2CB 4UXNA 3I55V 2QTSA 4X88A 1TUBB 2Q7GA 4O2AB 1WP7A 3CEIA 3JD0A 4GYCB 1U96A 1W59A 3M99B 1JR9A 3TCUA 4LBEC 3OE7G 4MTGA 2M6YA 5EC1C 1B04A 2ZDIC 2A9HA 1RFYA 2EILC 4NR1A 4BIZA 1AR5A 3R65A 1N8RW 2W0FC 4JI7B 2QKCA 4DV2O 1IVSA 5B66Z 1NR1A 1NT2B 4X1KA 2XAGA 1YF2A 1IBLO 4GKJO 2UUBB 2ARHA 3OW2U 3PJSK 4JI3O 1M57C 2Z5UA 1S0VA 4LC1A 4X1YB 3LDEA 2CTQA 2EIJC 3WB2A 1Y76A 1CXZB 2BSKB 2XASA 5JH7A 4DRXA 4MVUA 1JOYA 1H8EG 4PA6A 2OWOA 2XAJA 3AEIA 1SESA 2VWKA 4X66O 2QWQB 3CE2A 3IFXA 1VF7A 3CC2V 2EIKC 4MVZA 1G1XB 2CE4A 3BCCH 3K57A 1ENVA 5EBMC 3AG2C 1I94B 1SQFA 4R8CA 3STLC 3E8BA 4DV4B 1JMKC 1VEWA 1IDSA 1R3LC 2HKOA 3F5TA 4O2AA 1WN7A 3AG4B 2WLHA 3VQWA 3B2EE 4FM0A 3APQA 3E83A 3TGUH 1R1BA 3OGIB 5E79Z 3AG1C 4L87A 4PI0A 2FYUH 5LGNA 5K1PA 1K97A 2DE0X 5JVDA 1Q86W 1GK9A 1N4CA 3FD9A 1Z5VA 4LH6A 1BHBA 4K35A 2YIBD 4DV1B 4CH6A 2DMXA 1IZ3A 1MMMA 1Q6HA 3D3IA 1MA1A 5GONB 2D3OW 2WLIB 3O9OA 4GT1A 4LF9B 3E22A 4EEQA 1YJ9V 5KX5B 1VQKV 2R70A 2Y0PA 4JI5B 1ZAUA 1HW7A 4R6ZA 1AI7A 1THZA 2EZPA 1R6NA 2OIEA 4OXSA 4OGQB 4LNUB 3RYHA 4WFHA 5IYZB 1FJGB 4DUZO 1XEQA 1JVMA 2WLLB 2XOKG 4JGSA 1KECA 1BT8A 3RWRD 2JEUA 2H3OA 4MVMA 5IJ0B 4D7SA 2CK3G 5IJ9A 4FK5C 1KQSU 3ZMUA 1XHXA 2ZXWC 1NBMG 3JATB 3OR6C 1FFTB 4DW0A 4CC6A 1AR1B 1XNRO 4PDLA 2HLDG 2W0XA 5KAFZ 4RUFA 1E1QG 1VP7A 1H8HG 3JAMN 4UCOA 2Y69C 2A3QA 3B8NA 3L75H 1N34B 3JAKA 2HVJC 5B1OA 2CTWA 3PN1A 3HKEB 3BAAA 1WA8A 2P5OA 2QE7G 3ZRXA 1OV9A 4DV0B 3H1KH 1XBLA 4MVQA 4J10A 5FPOA 4UUJC 1BGYH 3CC7V 2QR4A 3HKCB 1HNZO 4LF8B 5J2UB 1M57B 4A5UB 5JJEB 4PA4A 5BMVA 3CMEV 3MD0A 2QKAA 4D7TA 2ZXWB 1R73A 1H2SB 1JFFA 5GTIZ 3FX7A 2CDYA 4TV9B 4JI0O 5FLXN 4KUMA 2B5UA 2IU3A 2A7WA 4MTXA 3IGAC 1BE3H 1M9NA 4LF5B 4J41A 3JATA 3JSLA 3LSUA 2Q7HA 1RM1C 1ORQC 4OX9B 2MW2B 4H33A 5LXTB 1QNMA 4LF4B 3OFNG 3RN4A 1PV0A 1VQ5V 3T1YO 4B3TB 4JTCB 1HR0B 1V55C 2WA4A 2HFEC 1FXKB 3L74H 2UU9B 2BTQA 1OCOC 2P67A 4FZ0A 3ASNC 2EINB 1KP3A 2YS8A 1J5EB 3AK2A 2ZDIA 2GHYA 1FXKA 1FAFA 4O4HB 2X6BA 3HKCA 2JJ2G 3CCMV 1V9PA 2BTQB 1B3QA 4FLYA 1K34A 2JS3A 4I4TB 1V54C 1S3JA 4QPKA 4LH7A 4JI2O 5CA1A 2F4VO 1O9GA 1AR4A 3DXRA 3JCZA 4UV9A 3ZRWB 1QQCA 5LMUO 2F23A 1EZJA 3ZHSA 1I08A 2W6IG 3FKSG 5HFMA 2DYRB 3DXRB 4DUZB 1WP8A 3H1LH 3SPIA 2PTMA 3H1IH 5JQGA 3RYCB 4FM2A 2ZE6A 4B7EA 4DR6O 3HKDB 1JX9A 3UKMA 4XDLA 1XMQB 4LFCO 1SQPH 5GTHZ 4LF6B 2DQ0A 2Y0IA 3Q4HA 4QJFB 2LJ2A 2YI9A 1PD3A 2ZE7A 4LF9O 1Y4MA 1FXVA 3K0DA 1F4NA 2YICA 4Z2WA 4J9ZB 1MG1A 3AG1B 2PI4A 3ASOB 4MVSA 5B1BC 3SYQA 3HPLC 2JK5C 1HNZB 4LF8O 2AHZA 3K5OA 4KP4A 4PI2A 2IJJA 4I7ZB 4LWSB 1KMIZ 4I50B 4ZI7B 2N05A 2EIMB 3C3SA 4I5SA 1ROPA 4DV0O 1HP8A 4JZ2A 2EX3A 2FTKA 5B1BB 3ASOC 5CA1B 1M56C 2WLKA 3ETDA 4NB5A 3T4ZA 1CPYA 5KHHA 3KG2A 4DR7O 5DECA 3ZMVA 2FMLA 3ABKC 3H01A 3ZN1A 1G6UA 1GN4A 2ZINA 3CJHA 4CH4A 2QWRB 4NYKA 4LR3A 4TQDA 3SR2C 4X1IA 4NXMO 4O4HA 2PI5A 5LP6C 1HNWB 2VQFB 3UT5A 4JI1O 4JASA 2GTSA 3N2GB 2DYRC 2YSUB 2YXHA 5C93A 4FLXA 5J2UA 4E2LA 1FJGO 1EFRG 2HJFC 3JSNA 4HNAA 3I56V 3CX5F 4MS2A 4DUYB 4MTFA 4W4KA 1NR7A 3K08A 1IBMB 3KCYA 2F95B 4FJCC 4WFEA 2BSKA 1L0LH 1XNQO 2JGDB 3JAWA 2ZIOA 2WPDG 3JD3A 3T2MA 2WSSG 3DC5A 3OR7C 1NQTA 4YY3B 1Z5WA 4CBCA 3CXCU 4JI4B 2DYSC 1KD1W 4X1KB 4DV5B 1DLBA 1VF5B 2YIDA 4HBNA 2VQFO 1B6QA 1GO3F 1F23A 2LGQA 4J9YB 4IIJB 5IT9N 3RGBA 1IXMA 3LSQA 1VQOV 3WU2Z 3G4SV 1CP9A 1AJNA 4B3RB 2HG5C 1VQ6V 2Y4UA 1S5LZ 5KHKA 1QLNA 2V4DA 1PNKA 4KHPB 5B3SB 2VQEO 2GDSA 5E1AC 3GWOA 5JJJB 4NXNO 4JV5B 1AJPA 3ZBHA 1MZFA 3OUSA 4B3MB 3FFQA 4MSWC 3K58A 2P4KA 5IYBO 1GN3A 1OCZB 3QF7A 4K3AA 2B9ZA 4HAMA 4DK0A 4PELA 3M8AA 4UVCA 5LBQA 1QVFU 4JYYA 2N04A 4KFMA 1ZL8B 2JGUA 3DTUB 1N32O 1SQQH 1JJ2U 3IC9A 1JCHA 2QDOA 5JH7B 4NTXA 4X66B 1UFIA 2Q8VA 1S77D 3X2QC 3O65A 5EYPA 5A2QN 3N2KB 2DW4A 3DC6A 3TK1A 2VRZA 3IC7A 5ITZB 1Q43A 4IGGA 3RFRA 3CCQV 2LFRA 4O2BA 1WPXA 3L73H 3B09A 1E79G 2QEXV 1GN6A 1VF6A 1XUQA 5FL7G 2ZKOA 4JZGA 5EK0A 4E4EA 4O4IB 2BTOA 3NXSA 3QG5A 2AXTZ 3BPZA 4ZHQB 3VQYA 1FKAO 1HNXB 4J80A 5H9CA 1M56B 2UUCB 4FPPA 4DW1A 2DOSA 2UUAO 1FFXB 4FMTA 4X20A 2OCHA 1WPBA 1YDXA 2UUCO 5LYJA 3H1HH 1AJQA 4PDMA 1KC8W 5JCOA 3H9VA 3I5DA 1VQ7V 3SJAC 1ZX3A 1XMOB 4L8JA 4TV9A 3E2EA 3E8HA 3MHSC 2UXCB 2Q0AA 1RM1B 4TOIA 2AHYA 2CGNA 5J9PC 1QCEA 2CTRA 4FFKA 5IYCO 4FLWA 1SQVH 2OYQA 1QR9A 3GWKC 1JPXA 3T4DA 3CCEV 5L3GA 1BSMA 3W7WA 2DQ3A 4GZRB 4D6TH 3CB2A 2Q0OC 4DR3O 1NJIW 3ZMSA 4UCUA 1L0NH 2ZQMA 4B3TO 2H8PC 5EIBC 2P7TC 3HKBA 3TXQA 4WFFA 4TQFA 1D5AA 1NZ6A 4AI8A 4DR4O 4DR5O 2RCVA 3DSQA 1PL0A 2R9IA 5IDJA 1GRJA 2EJ7A 4WCEV 2UXXA 4CH3A 3KKYA 4ZOLA 3QVNA 2HR3A 1GTOA 4JI6B 4U7OA 3E35A 3BRCA 2RQ6A 2OCCC 4DV7B 3CPWU 3U0ZA 4X20B 1VQNV 4I4TA 2LGWA 3K06A 4YJ2B 5LP6A 4BIUA 4KHPO 5IY5C 5CB4A 2Q6AA 3A0HZ 2PUSA 1QLEB 5HFLA 1XREA 3K04A 1AP6A 3MAQA 2GUZB 2GSMB 1VQMV 1MSWD 4RO2A 2QJ1A 4GX1A 2IM9A 1F7YA 1COWG 3UM7A 1DGSA 3QO7A 4IYIA 3E8GA 2UXNA 3ABKB 3OTFA 1XNQB 3ABUA 3BA8A 2N74A 3P30A 3HKDA 4I0XA 3LUTB 5LOVA 1IBMO 1T5EA 2Q4PA 4F6RA 3G6BA 2IH1C 4XDJA 1N33B 2IJHA 2O57A 4EB6B 5LGTA 5LHIA 2ILMA 1N0NA 2JS5A 1XILA 1ZL8A 2EILB 4IYHA 4UV8A 4JAAA 4ZOLB 3IJ4A 1N36O 4EFBA 5KMGA 1K7DA 1DF4A 2JIZG 1OHHG 2OIGA 2EIKB 1GMGA 4BW5A 3L9DA 3BA9A 5DEDA 3OEEG 1K8AW 1GH6A 4UCRA 2CTPA 4GCZA 5D5PA 3ZS8C 1TGOA 4IHJB 2PYLA 3THOA 3SPGA 1G8MA 4ABMA 5LOVB 1N0JA 3FAVA 2GUZA 3B8MA 2P90A 4HNAB 4N23A 1LUWA 1SQGA 3E8FA 4P30A 5H6QA 4I9WA 4YHHO 5IE9A 3ZMTA 3HKBB 5KAIZ 3J80N 1NI8A 4DO2A 2VS0A 4P9OA 4QNHB 4YHHB 1D2DA 1URFA 4MVRA 4MTOA 4U3JB 1KYOF 1JJOA 4XBFA 4DR2B 1B06A 2XAHA 1RSOA 2NN4A 1M1KW 1Q90D 1EN4A 1M5IA 2ZM6B 4LF6O 3STZC 2VQEB 3S3WA 2EBOA 3E86A 1SRYA 3S3XA 1F4MA 1Y74A 4WBNA 4P9PA 3ZEDA 3CMAV 1L8DA 2FB5A 1JQ0A 4JF3A 3JD4A 1K33A 3M7MX 3ASNB 5KLVH 4DV5O 3F7YC 1JA8A 4PDVA 2A0LA 4GKKO 3WB0A 3EFFK 5CB4B 1U97A 3HR0A 5LMNO 4LP8A 3SYCA 4TV8A 1M90W 2A06H 1E1RG 1PP9H 1PL4A 2CH7B 3FB8C 1UPGA 3FAVB 2FL4A 4EKWA 4J7JA 4JI3B 5CA3A 4UCVA 3CCUV 3CS5A 4GX2A 4R7CA 5LXTA 3TXSA 1SQXH 4CS4A 3RYFB 3ZHUA 1BL8A 4WFAV 4TUYB 4GX5A 5JQGB 4WBNB 2G38A 4U7NA 3C3TA 1NTKH 1US6A 2BE3A 2UU9O 5B1AB 2XTAA 5KA5A 4CH5A 1GM8A 3LDDA 3L72H 3BABA 1LNQA 1EN5A 2XAQA 3K9SA 2WLLA 2JJ1G 3SPJA 3BFRA 3T1YB 5IYZA 4MVOA 2ZM6O 3RYIA 4YJ3A 1IX9A 4DV7O 4DR7B 3LNMB 3VOUA 1W0KG 4AQYO 3T1HO 3MDSA 5KX5A 4JI8O 1FYJA 4FM1A 2JVDA 4KXRA 4Q6GA 4Z1VA 4JI0B 4GLXA 5H6RA 2AZ0A 2QKSA 4DV6B 3JYCA 1HDJA 1RSOB 3B4SA 2UXBO 2HP8A 3JAKB 1YI2V 3APOA 2WLMA 3G67A 3ZMZA 2XHBA 1Q81W 1R6KA 1SZTA 1FPOA 2HHHB 3CCJV 3A0RA 4DR3B 1AI6A 4UB6Z 3CXHF 2IJKA 3RYFA 4X64O 4G27B 1SF9A 1GM7A 2YC0A 2F93B 3F7VC 3CRRA 4RQEA 5BMVB 3TJTA 1XHZA 5IWAB 3RYHB 4ZIBA 1PNLA 1K5SA 3N2GA 1N36B 3OEHG 1NVPD 3SJQC 1BHAA 1H2LA 4CC5A 1KKCA 4H0LB 3CYOA 4NVPA 2XT9A 1AB3A 4W4LA 4LFBB 4HYOA 3WFVA 1BZKA 2F4VB 4JI2B 4X89A 5LHHA 3UT5B 1EZVH 4LFBO 2ATKC 4QGPA 4PD4F 1HNXO 2DWDC 2YXLA 2PYJA 4O4LA 4UFZA 1Q7YW 3FYIB 2E5LB 2QSAA 1BQZA 4PA7A 1WJZA 4IIJA 3L71H 1M4UA 3ZIAG 2LW1A 1QR8A 2IU0A 3A8TA 2PZSA 4JI5O 1ZWIC 3FB5C 2UXDO 3ZHTA 2WLNA 4X64B 3VQVA 1PNMA 5BR8O 3Q4HB 4JAUA 5EIBD 3SYAA 3AG2B 5L3DA 1NTMH 1VQ8V 2LP7A 2YDEA 2PF4E 4WFGA 3WB1A 3UQ8A 2JRIA 3A2FA 4ZKIA 5EBWC 1KU9A 4J7ZA 4QIWF 3SYPA 4JI6O 5JWPA 1N32B 4AILC 1GN2A 3ML0A 5BZBA 2JGDA 3BEHA 4JI8B 4KL1A 3ABLC 4O4IA 4AQYB 3H1JH 4UB8Z 3ZHQA 4FVMA 4N21A 4B3MO 3K59A 2ZCEA 1IBKO 3SYOA 4DV4O 3JD2A 1HWYA 5JCOC 3JD1A 1G4YB 2L35A 4X62B 1GM9A 3OTOO 2Y69B 5K1XA 2X0LA 4FFBA 5BY1A 3JASA 4YY3O 3W7UA 2UXCO 4C7UA 3GVMA 2LW7A 2EIJB 2RNBA 1NH2D 2ZE5A 5CBHA 2CGOA 3U11A 1H2NA 4O4JB 4CZZA 3ABMC 4DV2B 4JI7O 1YIJV 4ZI7A 2YIBA 5LA6B 3ZRWA 1BMFG 3QNEA 4X65B 1K3EA 5LMNB 1P7BA 2F43G 1KP2A 3FB6C 1VIBA 1Y74B 2KSDA 4I9QA 2KQXA 1WLEA 3SJBC 1YTFB 4NXMB 5C8YB 4IL6Z 2B1IA 4PHZA 1ZUQA 3OUFA 3RVZA 4K0KB 4FLUA 5CMUA 1QBZA 3CCVV 3ETEA 4TSFG 3X2QB 1R3KC 4BR6A 1K73W 2E76B 2LQTA 2V7QG 4PA9A 4OPHA 4O4JA 3AK1A 1Q3EA 1BQ0A 3W7XA 4DRXB 4DYLA 2ZNJA 4QPJA 3ETQA 4NTYA 3OTOB 1VQPV 2P06A 3AK3A 2EZOA 1YITV 5F2VO 4TUYA 1LUVA 2DJVA 1I5XA 2BOBC 3W7SA 4K8ZA 1TVKA 3SDLA 2HEPA 3BY6A 2Q69A 2EINC 3ZHRA 3JALA 1SA0B 3CCSV 4UCTA 3EVKA 4RWUA 3QO5A 3CJHB 3WG7B 1XMQO 3P32A 2CUGA 2KB1A 3JALB 4B3RO 2Q73A 1DK1A 1AILA 3A0BZ 1TUBA 1K4CC 3JAWB 1YSCA 4WFBV 3JARA 5CA0A 5IYDO 3K5LA 5LMUB 1GKFA 2Q9LA 2RN9A 2XNDG 2Y48A 4X65O 3OAAG 4J42A 4F6RB 3D36C 3G71V 1N33O 5AG2A 2QWPB 1VQ4V 3JARB 3OGCC 5CBFA 2ITCC 2QM4A 4IT5A 5EZYB 2UXDB 1R6TA 2BOCC 3RYIB 3AG4C 4LFAO 2UUBO 1LR1A 1FXHA 4X8AA 1R3JC 2ODMA 5TISZ 1K92A 3LDCA 4TT3G 2K1EA 1I0HA 1WNSA 3B77A 1WB8A 2QGNA 2GV9A 2EULA 4GUNA 2Q7EA 2ZR3A 1YHQV 2E5LO 1S5JA 1RP3B 3P3PA 4JAVA 1EBOA 4DK1A 3RYCA 3E89A 3ETGA 1FS0G 3AG3C 2WLJA 4QE7A 1SA0A 1RPOA 1I7FA 1S72V 5FNVB 2GTAA 2L6LA 3ZRSA 1IBKB 1Y76B 3FB7C 1L1FA 5BXZA 1VQLV 4LF5O 4DV3B 3EHBB 4CS3A 4LF7B 1EM1A 1KBHA 3UCSC 4LCUC 2PGGA 1MZEA 5CN0A 3CCRV 3ABLB 1DF5A 4JPRA 5LHGA 1H2GA 5B1NA 2QM8A 1QVGU 4XDKA 3TETA 3K5MA 1SC5B 4OPAA 3JCUZ 1H38A 2LFSA 5IY5B 3CRCA 4NTWA 1WAZA 3VBBA 1MNGA 3N2KA 4H13B 5EYPB 4DR1B 3AG3B 2Q68A 5LGUA 1VQ9V 3FYEB 5KMGB 2H94A 4BW9A 2UXBB 1K5QA 4LFCB 4DXWA 1NKDA 4O4LB 2R9RB 4B3SB 4BAYA 1OCZC 1SETA 4LF7O 4UVBA 3T1HB 2OCCB 5L3FA 1K4DC 2GBOA 1Q6UA 2YEVB 4RAIA 3R66A 1TUEB 4I55B 5EZYA 1BCCH 2QWNB 3RBZA 4ZHQA 1QLEC 1VMGA 2Z3YA 1X59A 1NTZH 3OT7A 5FPRA 2UUAB 2YEVA 3MHHC 1V54B 4FLVA 1AROP 4R50A 1KKDA 1YJNV 4YJ3B 1SS3A 2Z0AA 3RVYA 1QU7A 3CRMA 5GW7A 1ZTEA 4UVAA 5JJNB 4PDRA 1QHTA 5LP6B 4YJ2A 3K9AA 1P4RA 5IWAO 1CEZA 2NLJC 4YIPA 2ZR2A 1NU1H 4EFEA 3CSXA 5KHJA 3LSSA 1W2BU 3RT3C 3QTCA 2ADQB 2R72A 3OD4A 4MW8A 3C90A 1HR0O 2VWJA 2ZIMA 1KUQA 2AW9A 1MSDA 4Z1MG 4X1YA 2EJRA 3CWBH 4FLTA 1AI4A 4LF4O 4I0XB 2PY5A 4B08A 1S76D 4ICGA 3CRQA 1J95A 4BIOA 1FD9A 4DV6O 5H2FZ 3QO8A 1IXBA 4I55A
chains in the Genus database with same CATH topology
2AGAA 4DR6O 4LFCO 4AQYO 4DR2O 1FKAO 3T1HO 4JI5O 4X65O 4DV1O 4JI8O 2UXDO 1FYJA 4JI0O 5FLXN 5BR8O 4LF9O 1N33O 2DOSA 2UUAO 4JV5O 1F7YA 2VQFO 2UUCO 3J7AU 1R6TA 4X62O 4LF7O 4LF6O 1NS1A 5IT9N 1I94O 4LFAO 2UUBO 5LL6Y 4JYAO 2UXBO 3R66A 4OX9O 4DV2O 2JRIA 4LF8O 1IBLO 2N74A 4GKJO 1A32A 2VQEO 4DUZO 1XEQA 1IBMO 4JI3O 4JI6O 3T1YO 3J81N 1YZBA 4B3SO 1X59A 4NXNO 4DV5O 2E5LO 4JI4O 4X64O 4GKKO 4DV0O 4OPHA 5LMNO 2Z0AA 4B3MO 3M8AA 2FKXA 4X66O 4DR3O 1XNRO 4DR1O 1IBKO 4DR7O 4DV4O 2HHHO 1N32O 4B3TO 3JAMN 4K0KO 1N36O 1G1XB 4DUYO 5IWAO 5BXZA 2DJVA 4LF5O 4NXMO 3SDLA 1AB3A 4DR4O 4DR5O 3O65A 3OTOO 5A2QN 3RT3C 4JI2O 1HR0O 4JI1O 3F5TA 2F4VO 5BY1A 1KUQA 5H5NA 4YY3O 1HNWO 2UXCO 2UU9O 4LFBO 4DV3O 1FJGO 1HNXO 4OPAA 1XMQO 1XMOO 4LF4O 1HNZO 1R1BA 5LMUO 4B3RO 4A5UB 4YHHO 1N34O 1DK1A 1AILA 2LW7A 4DV6O 2ZKOA 2ZM6O 3J80N 1J5EO 4KHPO 1D2DA 4DV7O 1XNQO 4JI7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  4DR6 O;  4LFC O;  4AQY O;  4DR2 O;  1FKA O;  3T1H O;  4JI5 O;  4X65 O;  4DV1 O;  4JI8 O;  2UXD O;  1FYJ A;  4JI0 O;  5FLX N;  5BR8 O;  4LF9 O;  1N33 O;  2DOS A;  2UUA O;  4JV5 O;  1F7Y A;  2VQF O;  2UUC O;  3J7A U;  1R6T A;  4X62 O;  4LF7 O;  4LF6 O;  1NS1 A;  5IT9 N;  1I94 O;  4LFA O;  2UUB O;  5LL6 Y;  4JYA O;  2UXB O;  3R66 A;  4OX9 O;  4DV2 O;  2JRI A;  4LF8 O;  1IBL O;  2N74 A;  4GKJ O;  1A32 A;  2VQE O;  4DUZ O;  1XEQ A;  1IBM O;  4JI3 O;  4JI6 O;  3T1Y O;  3J81 N;  1YZB A;  4B3S O;  1X59 A;  4NXN O;  4DV5 O;  2E5L O;  4JI4 O;  4X64 O;  4GKK O;  4DV0 O;  4OPH A;  5LMN O;  2Z0A A;  4B3M O;  3M8A A;  2FKX A;  4X66 O;  4DR3 O;  1XNR O;  4DR1 O;  1IBK O;  4DR7 O;  4DV4 O;  2HHH O;  1N32 O;  4B3T O;  3JAM N;  4K0K O;  1N36 O;  1G1X B;  4DUY O;  5IWA O;  5BXZ A;  2DJV A;  4LF5 O;  4NXM O;  3SDL A;  1AB3 A;  4DR4 O;  4DR5 O;  3O65 A;  3OTO O;  5A2Q N;  3RT3 C;  4JI2 O;  1HR0 O;  4JI1 O;  3F5T A;  2F4V O;  5BY1 A;  1KUQ A;  5H5N A;  4YY3 O;  1HNW O;  2UXC O;  2UU9 O;  4LFB O;  4DV3 O;  1FJG O;  1HNX O;  4OPA A;  1XMQ O;  1XMO O;  4LF4 O;  1HNZ O;  1R1B A;  5LMU O;  4B3R O;  4A5U B;  4YHH O;  1N34 O;  1DK1 A;  1AIL A;  2LW7 A;  4DV6 O;  2ZKO A;  2ZM6 O;  3J80 N;  1J5E O;  4KHP O;  1D2D A;  4DV7 O;  1XNQ O;  4JI7 O; 
#chains in the Genus database with same CATH topology
 2JDI G;  2RMK B;  2C2A A;  2IBZ H;  1P49 A;  4ASU G;  3ZCC A;  2YI8 A;  4CS2 A;  1Y66 A;  4JV5 O;  3ZJZ A;  4WF9 V;  2OT5 A;  3ZRV A;  4G2K A;  1KB9 F;  1I94 O;  2CAZ C;  5B5E Z;  4JYA O;  1YCI A;  3D3Q A;  2IH3 C;  3ZX6 A;  2ZE8 A;  2KKW A;  3E22 B;  2JEX A;  2M7W A;  3OMN B;  5LA6 A;  1YVW A;  1AVM A;  5J2T A;  2W6J G;  1O9H A;  3SPC A;  5L3E A;  5KHG A;  4LWS A;  4B7K A;  1XQ8 A;  5B1A C;  2IW5 A;  2P22 C;  2BCC H;  4JI4 O;  4JYC A;  4LNU A;  3RW0 A;  1Q8I A;  5EBL C;  1SQB H;  3VQX A;  3ABM B;  1TAE A;  2FKX A;  5KUM A;  2KG7 A;  4MT8 A;  2K9P A;  1XL4 A;  4X9Q A;  5KUK A;  5IJ9 B;  4K0K O;  4GKJ B;  4DUY O;  2YXY A;  5B3S C;  4FIP C;  1XNR B;  3JAS B;  1Y67 A;  2DYS B;  4ZBM A;  2RJZ A;  1AI5 A;  5CBG A;  1H2M A;  4GKK B;  5JVD B;  2DN9 A;  4JI1 B;  3K5N A;  2F1M A;  1OCR B;  1Q5O A;  3K79 A;  3W7T A;  4U3F H;  1HNW O;  4PA3 A;  1UJW B;  2IJI A;  5ITZ A;  1JFF B;  4YXW G;  2XAF A;  1PPJ H;  2ADP A;  1YTF D;  2HVK C;  3G80 A;  4J11 A;  4UCS A;  1OJH A;  2R9A A;  2E3C A;  4AHC A;  4DR2 O;  1ZSP A;  1Q82 W;  4DV1 O;  1XDC A;  1D5N A;  1XOU A;  3P3N A;  1AP5 A;  1YJW V;  2NNU A;  4JTD B;  3U10 A;  1P7G A;  1FXK C;  4X62 O;  4RUE A;  1PM9 A;  3CC4 V;  2MK3 A;  1R3I C;  1RPR A;  4RQF A;  1PKX A;  4H44 B;  2WWW A;  4JYA B;  1A32 A;  4QE9 A;  1WB7 A;  3J81 N;  1Y6X A;  3SPH A;  2P4V A;  1IUR A;  2QWO B;  1I5Y A;  1NH2 B;  3G6E V;  1SER A;  5DM6 V;  3GB7 C;  1WA8 B;  2WLI A;  1NVP B;  4DR6 B;  1H2K A;  1XL6 A;  3CCL V;  5GON A;  4HZ3 A;  2DWE C;  3IAY A;  1W0J G;  3L70 H;  3D8C A;  3NR7 A;  3CD6 V;  1FFX A;  3LNN A;  1S5H C;  1SZX A;  2QTO A;  3CP1 A;  4H37 A;  1MOF A;  3DGE A;  4I50 A;  5EC2 C;  2OTJ V;  2ZNI A;  3K3W A;  2X7R B;  2ZT9 B;  5J2T B;  1M93 A;  3K0G A;  5A9G A;  4TV8 B;  5D5Q A;  2Q5Z A;  1K9M W;  5BR8 B;  3UO3 A;  3OM3 B;  5H5N A;  4PV1 B;  4TWK A;  4NKG B;  4JTA B;  1DTO A;  2WAM A;  2Y4T A;  5CA0 B;  1IBL B;  1SKV A;  4P2Z A;  4X1I B;  4G28 B;  2EIM C;  4JYB A;  4O2B B;  3OMA B;  4FZ1 A;  3BVO A;  1YXB A;  4BWA A;  1J5E O;  2V1D A;  3WG7 C;  2QA4 V;  5C8Y A;  3B40 A;  4Q20 A;  3CHX A;  2AGA A;  3OMI B;  3HKE A;  4LFA B;  4MW3 A;  2YUA A;  2P6J A;  1OZ0 A;  1OCC B;  3HB3 B;  4YIO A;  1Q6I A;  1P84 F;  2X6A A;  2F66 C;  3J7A U;  2X6C A;  1NS1 A;  1MAB G;  4F4L A;  5LL6 Y;  4OX9 O;  1ZLZ A;  3ABT A;  4J7K A;  3F5W C;  1VAR A;  1YZB A;  1OCO B;  2Q67 A;  4B3S O;  3N27 A;  2ETN A;  3ZHV A;  3EXA A;  2QM7 A;  5FNV A;  1GAX A;  1TVK B;  5IJ0 A;  4DR5 B;  4DR4 B;  1Z2G A;  3ZN0 A;  3AG7 A;  1EN6 A;  4K8X A;  3D36 A;  4IHJ A;  1BS3 A;  3K03 A;  3BHP A;  4DR1 O;  2HHH O;  2XUM A;  2KG7 B;  3SJC C;  1X4T A;  5L3C A;  1VF6 C;  3KZI Z;  2E75 B;  1YEW A;  2ITD C;  3SGI A;  5KHI A;  2ZD9 A;  2WA3 A;  3KCX A;  3UO2 A;  2OTL V;  1V55 B;  2E74 B;  2RDC A;  1XI1 A;  2HJD A;  2YIA A;  2B1G A;  4FLZ A;  4U3J A;  4GX0 A;  5LYJ B;  4F6E A;  4FFB B;  2LO1 A;  3T1C A;  4EB6 A;  4PJ0 Z;  1OCR C;  3ICX A;  4DV3 O;  1F51 A;  1XMO O;  4NXN B;  5KA6 A;  1N34 O;  2AZ2 A;  5DN6 G;  2NR5 A;  5L3B A;  2A79 B;  2CH7 A;  3CRA A;  1OCC C;  1TA8 A;  2D2C B;  4UXN A;  3I55 V;  2QTS A;  4X88 A;  1TUB B;  2Q7G A;  4O2A B;  1WP7 A;  3CEI A;  3JD0 A;  4GYC B;  1U96 A;  1W59 A;  3M99 B;  1JR9 A;  3TCU A;  4LBE C;  3OE7 G;  4MTG A;  2M6Y A;  5EC1 C;  1B04 A;  2ZDI C;  2A9H A;  1RFY A;  2EIL C;  4NR1 A;  4BIZ A;  1AR5 A;  3R65 A;  1N8R W;  2W0F C;  4JI7 B;  2QKC A;  4DV2 O;  1IVS A;  5B66 Z;  1NR1 A;  1NT2 B;  4X1K A;  2XAG A;  1YF2 A;  1IBL O;  4GKJ O;  2UUB B;  2ARH A;  3OW2 U;  3PJS K;  4JI3 O;  1M57 C;  2Z5U A;  1S0V A;  4LC1 A;  4X1Y B;  3LDE A;  2CTQ A;  2EIJ C;  3WB2 A;  1Y76 A;  1CXZ B;  2BSK B;  2XAS A;  5JH7 A;  4DRX A;  4MVU A;  1JOY A;  1H8E G;  4PA6 A;  2OWO A;  2XAJ A;  3AEI A;  1SES A;  2VWK A;  4X66 O;  2QWQ B;  3CE2 A;  3IFX A;  1VF7 A;  3CC2 V;  2EIK C;  4MVZ A;  1G1X B;  2CE4 A;  3BCC H;  3K57 A;  1ENV A;  5EBM C;  3AG2 C;  1I94 B;  1SQF A;  4R8C A;  3STL C;  3E8B A;  4DV4 B;  1JMK C;  1VEW A;  1IDS A;  1R3L C;  2HKO A;  3F5T A;  4O2A A;  1WN7 A;  3AG4 B;  2WLH A;  3VQW A;  3B2E E;  4FM0 A;  3APQ A;  3E83 A;  3TGU H;  1R1B A;  3OGI B;  5E79 Z;  3AG1 C;  4L87 A;  4PI0 A;  2FYU H;  5LGN A;  5K1P A;  1K97 A;  2DE0 X;  5JVD A;  1Q86 W;  1GK9 A;  1N4C A;  3FD9 A;  1Z5V A;  4LH6 A;  1BHB A;  4K35 A;  2YIB D;  4DV1 B;  4CH6 A;  2DMX A;  1IZ3 A;  1MMM A;  1Q6H A;  3D3I A;  1MA1 A;  5GON B;  2D3O W;  2WLI B;  3O9O A;  4GT1 A;  4LF9 B;  3E22 A;  4EEQ A;  1YJ9 V;  5KX5 B;  1VQK V;  2R70 A;  2Y0P A;  4JI5 B;  1ZAU A;  1HW7 A;  4R6Z A;  1AI7 A;  1THZ A;  2EZP A;  1R6N A;  2OIE A;  4OXS A;  4OGQ B;  4LNU B;  3RYH A;  4WFH A;  5IYZ B;  1FJG B;  4DUZ O;  1XEQ A;  1JVM A;  2WLL B;  2XOK G;  4JGS A;  1KEC A;  1BT8 A;  3RWR D;  2JEU A;  2H3O A;  4MVM A;  5IJ0 B;  4D7S A;  2CK3 G;  5IJ9 A;  4FK5 C;  1KQS U;  3ZMU A;  1XHX A;  2ZXW C;  1NBM G;  3JAT B;  3OR6 C;  1FFT B;  4DW0 A;  4CC6 A;  1AR1 B;  1XNR O;  4PDL A;  2HLD G;  2W0X A;  5KAF Z;  4RUF A;  1E1Q G;  1VP7 A;  1H8H G;  3JAM N;  4UCO A;  2Y69 C;  2A3Q A;  3B8N A;  3L75 H;  1N34 B;  3JAK A;  2HVJ C;  5B1O A;  2CTW A;  3PN1 A;  3HKE B;  3BAA A;  1WA8 A;  2P5O A;  2QE7 G;  3ZRX A;  1OV9 A;  4DV0 B;  3H1K H;  1XBL A;  4MVQ A;  4J10 A;  5FPO A;  4UUJ C;  1BGY H;  3CC7 V;  2QR4 A;  3HKC B;  1HNZ O;  4LF8 B;  5J2U B;  1M57 B;  4A5U B;  5JJE B;  4PA4 A;  5BMV A;  3CME V;  3MD0 A;  2QKA A;  4D7T A;  2ZXW B;  1R73 A;  1H2S B;  1JFF A;  5GTI Z;  3FX7 A;  2CDY A;  4TV9 B;  4JI0 O;  5FLX N;  4KUM A;  2B5U A;  2IU3 A;  2A7W A;  4MTX A;  3IGA C;  1BE3 H;  1M9N A;  4LF5 B;  4J41 A;  3JAT A;  3JSL A;  3LSU A;  2Q7H A;  1RM1 C;  1ORQ C;  4OX9 B;  2MW2 B;  4H33 A;  5LXT B;  1QNM A;  4LF4 B;  3OFN G;  3RN4 A;  1PV0 A;  1VQ5 V;  3T1Y O;  4B3T B;  4JTC B;  1HR0 B;  1V55 C;  2WA4 A;  2HFE C;  1FXK B;  3L74 H;  2UU9 B;  2BTQ A;  1OCO C;  2P67 A;  4FZ0 A;  3ASN C;  2EIN B;  1KP3 A;  2YS8 A;  1J5E B;  3AK2 A;  2ZDI A;  2GHY A;  1FXK A;  1FAF A;  4O4H B;  2X6B A;  3HKC A;  2JJ2 G;  3CCM V;  1V9P A;  2BTQ B;  1B3Q A;  4FLY A;  1K34 A;  2JS3 A;  4I4T B;  1V54 C;  1S3J A;  4QPK A;  4LH7 A;  4JI2 O;  5CA1 A;  2F4V O;  1O9G A;  1AR4 A;  3DXR A;  3JCZ A;  4UV9 A;  3ZRW B;  1QQC A;  5LMU O;  2F23 A;  1EZJ A;  3ZHS A;  1I08 A;  2W6I G;  3FKS G;  5HFM A;  2DYR B;  3DXR B;  4DUZ B;  1WP8 A;  3H1L H;  3SPI A;  2PTM A;  3H1I H;  5JQG A;  3RYC B;  4FM2 A;  2ZE6 A;  4B7E A;  4DR6 O;  3HKD B;  1JX9 A;  3UKM A;  4XDL A;  1XMQ B;  4LFC O;  1SQP H;  5GTH Z;  4LF6 B;  2DQ0 A;  2Y0I A;  3Q4H A;  4QJF B;  2LJ2 A;  2YI9 A;  1PD3 A;  2ZE7 A;  4LF9 O;  1Y4M A;  1FXV A;  3K0D A;  1F4N A;  2YIC A;  4Z2W A;  4J9Z B;  1MG1 A;  3AG1 B;  2PI4 A;  3ASO B;  4MVS A;  5B1B C;  3SYQ A;  3HPL C;  2JK5 C;  1HNZ B;  4LF8 O;  2AHZ A;  3K5O A;  4KP4 A;  4PI2 A;  2IJJ A;  4I7Z B;  4LWS B;  1KMI Z;  4I50 B;  4ZI7 B;  2N05 A;  2EIM B;  3C3S A;  4I5S A;  1ROP A;  4DV0 O;  1HP8 A;  4JZ2 A;  2EX3 A;  2FTK A;  5B1B B;  3ASO C;  5CA1 B;  1M56 C;  2WLK A;  3ETD A;  4NB5 A;  3T4Z A;  1CPY A;  5KHH A;  3KG2 A;  4DR7 O;  5DEC A;  3ZMV A;  2FML A;  3ABK C;  3H01 A;  3ZN1 A;  1G6U A;  1GN4 A;  2ZIN A;  3CJH A;  4CH4 A;  2QWR B;  4NYK A;  4LR3 A;  4TQD A;  3SR2 C;  4X1I A;  4NXM O;  4O4H A;  2PI5 A;  5LP6 C;  1HNW B;  2VQF B;  3UT5 A;  4JI1 O;  4JAS A;  2GTS A;  3N2G B;  2DYR C;  2YSU B;  2YXH A;  5C93 A;  4FLX A;  5J2U A;  4E2L A;  1FJG O;  1EFR G;  2HJF C;  3JSN A;  4HNA A;  3I56 V;  3CX5 F;  4MS2 A;  4DUY B;  4MTF A;  4W4K A;  1NR7 A;  3K08 A;  1IBM B;  3KCY A;  2F95 B;  4FJC C;  4WFE A;  2BSK A;  1L0L H;  1XNQ O;  2JGD B;  3JAW A;  2ZIO A;  2WPD G;  3JD3 A;  3T2M A;  2WSS G;  3DC5 A;  3OR7 C;  1NQT A;  4YY3 B;  1Z5W A;  4CBC A;  3CXC U;  4JI4 B;  2DYS C;  1KD1 W;  4X1K B;  4DV5 B;  1DLB A;  1VF5 B;  2YID A;  4HBN A;  2VQF O;  1B6Q A;  1GO3 F;  1F23 A;  2LGQ A;  4J9Y B;  4IIJ B;  5IT9 N;  3RGB A;  1IXM A;  3LSQ A;  1VQO V;  3WU2 Z;  3G4S V;  1CP9 A;  1AJN A;  4B3R B;  2HG5 C;  1VQ6 V;  2Y4U A;  1S5L Z;  5KHK A;  1QLN A;  2V4D A;  1PNK A;  4KHP B;  5B3S B;  2VQE O;  2GDS A;  5E1A C;  3GWO A;  5JJJ B;  4NXN O;  4JV5 B;  1AJP A;  3ZBH A;  1MZF A;  3OUS A;  4B3M B;  3FFQ A;  4MSW C;  3K58 A;  2P4K A;  5IYB O;  1GN3 A;  1OCZ B;  3QF7 A;  4K3A A;  2B9Z A;  4HAM A;  4DK0 A;  4PEL A;  3M8A A;  4UVC A;  5LBQ A;  1QVF U;  4JYY A;  2N04 A;  4KFM A;  1ZL8 B;  2JGU A;  3DTU B;  1N32 O;  1SQQ H;  1JJ2 U;  3IC9 A;  1JCH A;  2QDO A;  5JH7 B;  4NTX A;  4X66 B;  1UFI A;  2Q8V A;  1S77 D;  3X2Q C;  3O65 A;  5EYP A;  5A2Q N;  3N2K B;  2DW4 A;  3DC6 A;  3TK1 A;  2VRZ A;  3IC7 A;  5ITZ B;  1Q43 A;  4IGG A;  3RFR A;  3CCQ V;  2LFR A;  4O2B A;  1WPX A;  3L73 H;  3B09 A;  1E79 G;  2QEX V;  1GN6 A;  1VF6 A;  1XUQ A;  5FL7 G;  2ZKO A;  4JZG A;  5EK0 A;  4E4E A;  4O4I B;  2BTO A;  3NXS A;  3QG5 A;  2AXT Z;  3BPZ A;  4ZHQ B;  3VQY A;  1FKA O;  1HNX B;  4J80 A;  5H9C A;  1M56 B;  2UUC B;  4FPP A;  4DW1 A;  2DOS A;  2UUA O;  1FFX B;  4FMT A;  4X20 A;  2OCH A;  1WPB A;  1YDX A;  2UUC O;  5LYJ A;  3H1H H;  1AJQ A;  4PDM A;  1KC8 W;  5JCO A;  3H9V A;  3I5D A;  1VQ7 V;  3SJA C;  1ZX3 A;  1XMO B;  4L8J A;  4TV9 A;  3E2E A;  3E8H A;  3MHS C;  2UXC B;  2Q0A A;  1RM1 B;  4TOI A;  2AHY A;  2CGN A;  5J9P C;  1QCE A;  2CTR A;  4FFK A;  5IYC O;  4FLW A;  1SQV H;  2OYQ A;  1QR9 A;  3GWK C;  1JPX A;  3T4D A;  3CCE V;  5L3G A;  1BSM A;  3W7W A;  2DQ3 A;  4GZR B;  4D6T H;  3CB2 A;  2Q0O C;  4DR3 O;  1NJI W;  3ZMS A;  4UCU A;  1L0N H;  2ZQM A;  4B3T O;  2H8P C;  5EIB C;  2P7T C;  3HKB A;  3TXQ A;  4WFF A;  4TQF A;  1D5A A;  1NZ6 A;  4AI8 A;  4DR4 O;  4DR5 O;  2RCV A;  3DSQ A;  1PL0 A;  2R9I A;  5IDJ A;  1GRJ A;  2EJ7 A;  4WCE V;  2UXX A;  4CH3 A;  3KKY A;  4ZOL A;  3QVN A;  2HR3 A;  1GTO A;  4JI6 B;  4U7O A;  3E35 A;  3BRC A;  2RQ6 A;  2OCC C;  4DV7 B;  3CPW U;  3U0Z A;  4X20 B;  1VQN V;  4I4T A;  2LGW A;  3K06 A;  4YJ2 B;  5LP6 A;  4BIU A;  4KHP O;  5IY5 C;  5CB4 A;  2Q6A A;  3A0H Z;  2PUS A;  1QLE B;  5HFL A;  1XRE A;  3K04 A;  1AP6 A;  3MAQ A;  2GUZ B;  2GSM B;  1VQM V;  1MSW D;  4RO2 A;  2QJ1 A;  4GX1 A;  2IM9 A;  1F7Y A;  1COW G;  3UM7 A;  1DGS A;  3QO7 A;  4IYI A;  3E8G A;  2UXN A;  3ABK B;  3OTF A;  1XNQ B;  3ABU A;  3BA8 A;  2N74 A;  3P30 A;  3HKD A;  4I0X A;  3LUT B;  5LOV A;  1IBM O;  1T5E A;  2Q4P A;  4F6R A;  3G6B A;  2IH1 C;  4XDJ A;  1N33 B;  2IJH A;  2O57 A;  4EB6 B;  5LGT A;  5LHI A;  2ILM A;  1N0N A;  2JS5 A;  1XIL A;  1ZL8 A;  2EIL B;  4IYH A;  4UV8 A;  4JAA A;  4ZOL B;  3IJ4 A;  1N36 O;  4EFB A;  5KMG A;  1K7D A;  1DF4 A;  2JIZ G;  1OHH G;  2OIG A;  2EIK B;  1GMG A;  4BW5 A;  3L9D A;  3BA9 A;  5DED A;  3OEE G;  1K8A W;  1GH6 A;  4UCR A;  2CTP A;  4GCZ A;  5D5P A;  3ZS8 C;  1TGO A;  4IHJ B;  2PYL A;  3THO A;  3SPG A;  1G8M A;  4ABM A;  5LOV B;  1N0J A;  3FAV A;  2GUZ A;  3B8M A;  2P90 A;  4HNA B;  4N23 A;  1LUW A;  1SQG A;  3E8F A;  4P30 A;  5H6Q A;  4I9W A;  4YHH O;  5IE9 A;  3ZMT A;  3HKB B;  5KAI Z;  3J80 N;  1NI8 A;  4DO2 A;  2VS0 A;  4P9O A;  4QNH B;  4YHH B;  1D2D A;  1URF A;  4MVR A;  4MTO A;  4U3J B;  1KYO F;  1JJO A;  4XBF A;  4DR2 B;  1B06 A;  2XAH A;  1RSO A;  2NN4 A;  1M1K W;  1Q90 D;  1EN4 A;  1M5I A;  2ZM6 B;  4LF6 O;  3STZ C;  2VQE B;  3S3W A;  2EBO A;  3E86 A;  1SRY A;  3S3X A;  1F4M A;  1Y74 A;  4WBN A;  4P9P A;  3ZED A;  3CMA V;  1L8D A;  2FB5 A;  1JQ0 A;  4JF3 A;  3JD4 A;  1K33 A;  3M7M X;  3ASN B;  5KLV H;  4DV5 O;  3F7Y C;  1JA8 A;  4PDV A;  2A0L A;  4GKK O;  3WB0 A;  3EFF K;  5CB4 B;  1U97 A;  3HR0 A;  5LMN O;  4LP8 A;  3SYC A;  4TV8 A;  1M90 W;  2A06 H;  1E1R G;  1PP9 H;  1PL4 A;  2CH7 B;  3FB8 C;  1UPG A;  3FAV B;  2FL4 A;  4EKW A;  4J7J A;  4JI3 B;  5CA3 A;  4UCV A;  3CCU V;  3CS5 A;  4GX2 A;  4R7C A;  5LXT A;  3TXS A;  1SQX H;  4CS4 A;  3RYF B;  3ZHU A;  1BL8 A;  4WFA V;  4TUY B;  4GX5 A;  5JQG B;  4WBN B;  2G38 A;  4U7N A;  3C3T A;  1NTK H;  1US6 A;  2BE3 A;  2UU9 O;  5B1A B;  2XTA A;  5KA5 A;  4CH5 A;  1GM8 A;  3LDD A;  3L72 H;  3BAB A;  1LNQ A;  1EN5 A;  2XAQ A;  3K9S A;  2WLL A;  2JJ1 G;  3SPJ A;  3BFR A;  3T1Y B;  5IYZ A;  4MVO A;  2ZM6 O;  3RYI A;  4YJ3 A;  1IX9 A;  4DV7 O;  4DR7 B;  3LNM B;  3VOU A;  1W0K G;  4AQY O;  3T1H O;  3MDS A;  5KX5 A;  4JI8 O;  1FYJ A;  4FM1 A;  2JVD A;  4KXR A;  4Q6G A;  4Z1V A;  4JI0 B;  4GLX A;  5H6R A;  2AZ0 A;  2QKS A;  4DV6 B;  3JYC A;  1HDJ A;  1RSO B;  3B4S A;  2UXB O;  2HP8 A;  3JAK B;  1YI2 V;  3APO A;  2WLM A;  3G67 A;  3ZMZ A;  2XHB A;  1Q81 W;  1R6K A;  1SZT A;  1FPO A;  2HHH B;  3CCJ V;  3A0R A;  4DR3 B;  1AI6 A;  4UB6 Z;  3CXH F;  2IJK A;  3RYF A;  4X64 O;  4G27 B;  1SF9 A;  1GM7 A;  2YC0 A;  2F93 B;  3F7V C;  3CRR A;  4RQE A;  5BMV B;  3TJT A;  1XHZ A;  5IWA B;  3RYH B;  4ZIB A;  1PNL A;  1K5S A;  3N2G A;  1N36 B;  3OEH G;  1NVP D;  3SJQ C;  1BHA A;  1H2L A;  4CC5 A;  1KKC A;  4H0L B;  3CYO A;  4NVP A;  2XT9 A;  1AB3 A;  4W4L A;  4LFB B;  4HYO A;  3WFV A;  1BZK A;  2F4V B;  4JI2 B;  4X89 A;  5LHH A;  3UT5 B;  1EZV H;  4LFB O;  2ATK C;  4QGP A;  4PD4 F;  1HNX O;  2DWD C;  2YXL A;  2PYJ A;  4O4L A;  4UFZ A;  1Q7Y W;  3FYI B;  2E5L B;  2QSA A;  1BQZ A;  4PA7 A;  1WJZ A;  4IIJ A;  3L71 H;  1M4U A;  3ZIA G;  2LW1 A;  1QR8 A;  2IU0 A;  3A8T A;  2PZS A;  4JI5 O;  1ZWI C;  3FB5 C;  2UXD O;  3ZHT A;  2WLN A;  4X64 B;  3VQV A;  1PNM A;  5BR8 O;  3Q4H B;  4JAU A;  5EIB D;  3SYA A;  3AG2 B;  5L3D A;  1NTM H;  1VQ8 V;  2LP7 A;  2YDE A;  2PF4 E;  4WFG A;  3WB1 A;  3UQ8 A;  2JRI A;  3A2F A;  4ZKI A;  5EBW C;  1KU9 A;  4J7Z A;  4QIW F;  3SYP A;  4JI6 O;  5JWP A;  1N32 B;  4AIL C;  1GN2 A;  3ML0 A;  5BZB A;  2JGD A;  3BEH A;  4JI8 B;  4KL1 A;  3ABL C;  4O4I A;  4AQY B;  3H1J H;  4UB8 Z;  3ZHQ A;  4FVM A;  4N21 A;  4B3M O;  3K59 A;  2ZCE A;  1IBK O;  3SYO A;  4DV4 O;  3JD2 A;  1HWY A;  5JCO C;  3JD1 A;  1G4Y B;  2L35 A;  4X62 B;  1GM9 A;  3OTO O;  2Y69 B;  5K1X A;  2X0L A;  4FFB A;  5BY1 A;  3JAS A;  4YY3 O;  3W7U A;  2UXC O;  4C7U A;  3GVM A;  2LW7 A;  2EIJ B;  2RNB A;  1NH2 D;  2ZE5 A;  5CBH A;  2CGO A;  3U11 A;  1H2N A;  4O4J B;  4CZZ A;  3ABM C;  4DV2 B;  4JI7 O;  1YIJ V;  4ZI7 A;  2YIB A;  5LA6 B;  3ZRW A;  1BMF G;  3QNE A;  4X65 B;  1K3E A;  5LMN B;  1P7B A;  2F43 G;  1KP2 A;  3FB6 C;  1VIB A;  1Y74 B;  2KSD A;  4I9Q A;  2KQX A;  1WLE A;  3SJB C;  1YTF B;  4NXM B;  5C8Y B;  4IL6 Z;  2B1I A;  4PHZ A;  1ZUQ A;  3OUF A;  3RVZ A;  4K0K B;  4FLU A;  5CMU A;  1QBZ A;  3CCV V;  3ETE A;  4TSF G;  3X2Q B;  1R3K C;  4BR6 A;  1K73 W;  2E76 B;  2LQT A;  2V7Q G;  4PA9 A;  4OPH A;  4O4J A;  3AK1 A;  1Q3E A;  1BQ0 A;  3W7X A;  4DRX B;  4DYL A;  2ZNJ A;  4QPJ A;  3ETQ A;  4NTY A;  3OTO B;  1VQP V;  2P06 A;  3AK3 A;  2EZO A;  1YIT V;  5F2V O;  4TUY A;  1LUV A;  2DJV A;  1I5X A;  2BOB C;  3W7S A;  4K8Z A;  1TVK A;  3SDL A;  2HEP A;  3BY6 A;  2Q69 A;  2EIN C;  3ZHR A;  3JAL A;  1SA0 B;  3CCS V;  4UCT A;  3EVK A;  4RWU A;  3QO5 A;  3CJH B;  3WG7 B;  1XMQ O;  3P32 A;  2CUG A;  2KB1 A;  3JAL B;  4B3R O;  2Q73 A;  1DK1 A;  1AIL A;  3A0B Z;  1TUB A;  1K4C C;  3JAW B;  1YSC A;  4WFB V;  3JAR A;  5CA0 A;  5IYD O;  3K5L A;  5LMU B;  1GKF A;  2Q9L A;  2RN9 A;  2XND G;  2Y48 A;  4X65 O;  3OAA G;  4J42 A;  4F6R B;  3D36 C;  3G71 V;  1N33 O;  5AG2 A;  2QWP B;  1VQ4 V;  3JAR B;  3OGC C;  5CBF A;  2ITC C;  2QM4 A;  4IT5 A;  5EZY B;  2UXD B;  1R6T A;  2BOC C;  3RYI B;  3AG4 C;  4LFA O;  2UUB O;  1LR1 A;  1FXH A;  4X8A A;  1R3J C;  2ODM A;  5TIS Z;  1K92 A;  3LDC A;  4TT3 G;  2K1E A;  1I0H A;  1WNS A;  3B77 A;  1WB8 A;  2QGN A;  2GV9 A;  2EUL A;  4GUN A;  2Q7E A;  2ZR3 A;  1YHQ V;  2E5L O;  1S5J A;  1RP3 B;  3P3P A;  4JAV A;  1EBO A;  4DK1 A;  3RYC A;  3E89 A;  3ETG A;  1FS0 G;  3AG3 C;  2WLJ A;  4QE7 A;  1SA0 A;  1RPO A;  1I7F A;  1S72 V;  5FNV B;  2GTA A;  2L6L A;  3ZRS A;  1IBK B;  1Y76 B;  3FB7 C;  1L1F A;  5BXZ A;  1VQL V;  4LF5 O;  4DV3 B;  3EHB B;  4CS3 A;  4LF7 B;  1EM1 A;  1KBH A;  3UCS C;  4LCU C;  2PGG A;  1MZE A;  5CN0 A;  3CCR V;  3ABL B;  1DF5 A;  4JPR A;  5LHG A;  1H2G A;  5B1N A;  2QM8 A;  1QVG U;  4XDK A;  3TET A;  3K5M A;  1SC5 B;  4OPA A;  3JCU Z;  1H38 A;  2LFS A;  5IY5 B;  3CRC A;  4NTW A;  1WAZ A;  3VBB A;  1MNG A;  3N2K A;  4H13 B;  5EYP B;  4DR1 B;  3AG3 B;  2Q68 A;  5LGU A;  1VQ9 V;  3FYE B;  5KMG B;  2H94 A;  4BW9 A;  2UXB B;  1K5Q A;  4LFC B;  4DXW A;  1NKD A;  4O4L B;  2R9R B;  4B3S B;  4BAY A;  1OCZ C;  1SET A;  4LF7 O;  4UVB A;  3T1H B;  2OCC B;  5L3F A;  1K4D C;  2GBO A;  1Q6U A;  2YEV B;  4RAI A;  3R66 A;  1TUE B;  4I55 B;  5EZY A;  1BCC H;  2QWN B;  3RBZ A;  4ZHQ A;  1QLE C;  1VMG A;  2Z3Y A;  1X59 A;  1NTZ H;  3OT7 A;  5FPR A;  2UUA B;  2YEV A;  3MHH C;  1V54 B;  4FLV A;  1ARO P;  4R50 A;  1KKD A;  1YJN V;  4YJ3 B;  1SS3 A;  2Z0A A;  3RVY A;  1QU7 A;  3CRM A;  5GW7 A;  1ZTE A;  4UVA A;  5JJN B;  4PDR A;  1QHT A;  5LP6 B;  4YJ2 A;  3K9A A;  1P4R A;  5IWA O;  1CEZ A;  2NLJ C;  4YIP A;  2ZR2 A;  1NU1 H;  4EFE A;  3CSX A;  5KHJ A;  3LSS A;  1W2B U;  3RT3 C;  3QTC A;  2ADQ B;  2R72 A;  3OD4 A;  4MW8 A;  3C90 A;  1HR0 O;  2VWJ A;  2ZIM A;  1KUQ A;  2AW9 A;  1MSD A;  4Z1M G;  4X1Y A;  2EJR A;  3CWB H;  4FLT A;  1AI4 A;  4LF4 O;  4I0X B;  2PY5 A;  4B08 A;  1S76 D;  4ICG A;  3CRQ A;  1J95 A;  4BIO A;  1FD9 A;  4DV6 O;  5H2F Z;  3QO8 A;  1IXB A;  4I55 A; 
#chains in the Genus database with same CATH homology
 2AGA A;  4DR6 O;  4LFC O;  4AQY O;  4DR2 O;  1FKA O;  3T1H O;  4JI5 O;  4X65 O;  4DV1 O;  4JI8 O;  2UXD O;  1FYJ A;  4JI0 O;  5FLX N;  5BR8 O;  4LF9 O;  1N33 O;  2DOS A;  2UUA O;  4JV5 O;  1F7Y A;  2VQF O;  2UUC O;  3J7A U;  1R6T A;  4X62 O;  4LF7 O;  4LF6 O;  1NS1 A;  5IT9 N;  1I94 O;  4LFA O;  2UUB O;  5LL6 Y;  4JYA O;  2UXB O;  3R66 A;  4OX9 O;  4DV2 O;  2JRI A;  4LF8 O;  1IBL O;  2N74 A;  4GKJ O;  1A32 A;  2VQE O;  4DUZ O;  1XEQ A;  1IBM O;  4JI3 O;  4JI6 O;  3T1Y O;  3J81 N;  1YZB A;  4B3S O;  1X59 A;  4NXN O;  4DV5 O;  2E5L O;  4JI4 O;  4X64 O;  4GKK O;  4DV0 O;  4OPH A;  5LMN O;  2Z0A A;  4B3M O;  3M8A A;  2FKX A;  4X66 O;  4DR3 O;  1XNR O;  4DR1 O;  1IBK O;  4DR7 O;  4DV4 O;  2HHH O;  1N32 O;  4B3T O;  3JAM N;  4K0K O;  1N36 O;  1G1X B;  4DUY O;  5IWA O;  5BXZ A;  2DJV A;  4LF5 O;  4NXM O;  3SDL A;  1AB3 A;  4DR4 O;  4DR5 O;  3O65 A;  3OTO O;  5A2Q N;  3RT3 C;  4JI2 O;  1HR0 O;  4JI1 O;  3F5T A;  2F4V O;  5BY1 A;  1KUQ A;  5H5N A;  4YY3 O;  1HNW O;  2UXC O;  2UU9 O;  4LFB O;  4DV3 O;  1FJG O;  1HNX O;  4OPA A;  1XMQ O;  1XMO O;  4LF4 O;  1HNZ O;  1R1B A;  5LMU O;  4B3R O;  4A5U B;  4YHH O;  1N34 O;  1DK1 A;  1AIL A;  2LW7 A;  4DV6 O;  2ZKO A;  2ZM6 O;  3J80 N;  1J5E O;  4KHP O;  1D2D A;  4DV7 O;  1XNQ O;  4JI7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...