3JAMN

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
b'GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3jamN02
2HHHO 1R1BA 4DR2O 4LFCO 1HNXO 1R6TA 4DUZO 4JI0O 4B3MO 4GKKO 4AQYO 1IBKO 4DV7O 4DR1O 4K0KO 4OX9O 1IBMO 1IBLO 4B3RO 4JI1O 1FYJA 4JI4O 4DR7O 2VQEO 2ZM6O 2UU9O 4LF4O 4B3SO 2UXBO 4DV4O 5LMUO 4DV6O 4YY3O 2UUAO 1DK1A 1N34O 4JI2O 4JI7O 1A32A 4LF7O 4JI6O 1YZBA 3SDLA 4LF5O 5LL6Y 5LMNO 2FKXA 5BXZA 3T1HO 3J7AU 1KUQA 4B3TO 2UXDO 3RT3C 4NXMO 4X66O 4A5UB 5IWAO 2DOSA 4JYAO 3J81N 5H5NA 2VQFO 3JAMN 4X62O 4LF8O 4DV2O 2UUCO 5BR8O 1N36O 4DV0O 3M8AA 1HNWO 2E5LO 1G1XB 1HNZO 2LW7A 3O65A 4LF9O 4LFAO 1NS1A 4YHHO 4GKJO 3OTOO 4OPAA 5A2QN 4DV5O 4JI8O 4JI3O 5BY1A 1XEQA 4NXNO 4X65O 4DR4O 1XNRO 4DR6O 1XMQO 2UUBO 4DR5O 1F7YA 4JI5O 1D2DA 4JV5O 1FJGO 4DV3O 4DR3O 3J80N 2AGAA 4OPHA 1XNQO 1HR0O 2DJVA 1I94O 2F4VO 1N32O 1N33O 4LF6O 1XMOO 5FLXN 3R66A 4DUYO 4LFBO 4DV1O 2JRIA 2UXCO 3T1YO 2N74A 1X59A 2Z0AA 2ZKOA 3F5TA 4X64O 1J5EO 1FKAO 5IT9N 1AILA 1AB3A 4KHPO
chains in the Genus database with same CATH superfamily
2N04A 4GCZA 4RAIA 4KUMA 1US6A 1AP5A 1ZLZA 3S3XA 4DV7O 1EZVH 3JATA 1WPXA 3ZHRA 1QR8A 3VQWA 1QHTA 3RWRD 3ZRXA 1HNWB 1HNZB 3SGIA 1OCZB 3E86A 2OCCB 1XILA 5H9CA 1GM8A 3CCRV 1PV0A 4JAAA 4JI3B 2QWQB 2WA4A 2ZT9B 1FFTB 4EFEA 3T1HO 4NXNB 2PY5A 4B3TO 3MD0A 4FM1A 4RUFA 5KMGB 4NXMO 3SYCA 5EYPB 4YIOA 3W7UA 1NKDA 4X62O 2UUCO 3SJAC 1Y4MA 2HFEC 1XI1A 5CBFA 1DF5A 2W0XA 3ABKB 3M8AA 2E5LO 1CEZA 2YDEA 2ZDIA 2AHYA 5B1NA 1YXBA 4RQEA 2UXCB 5TISZ 4QJFB 5BZBA 2EIKC 1B06A 2Y4UA 3ZHUA 1K33A 4DV4B 3RYFA 1HDJA 2OTLV 4R7CA 1VQ6V 4I7ZB 4DR2B 5KA6A 3HKEB 5L3FA 1NH2D 4IL6Z 4I55A 3JCUZ 1W2BU 3OMAB 1ZL8B 4LNUA 5LP6B 3CCJV 4JYAB 2OCHA 2UXNA 3T4DA 3WB0A 3L70H 1EBOA 1SESA 2DE0X 1L0LH 5IYBO 2Y69B 2X6BA 2GUZA 4MVOA 4R50A 4YY3B 3AK3A 2FMLA 1PM9A 2H3OA 3T1YO 3APOA 1SA0B 2JGDB 1V55C 3STLC 2EINC 3JAWB 3AG4C 3CRMA 1S5JA 1V54C 2UXDB 3KKYA 1DLBA 3CJHB 1GAXA 2BOBC 4MTFA 4X66B 4ABMA 4DK1A 2YUAA 5JQGB 4FFKA 1MSDA 1NTMH 1IBKO 2P06A 1VARA 4DV2B 1WA8A 1U96A 1AR1B 4DR3B 3FB5C 2W0FC 2OIGA 3AG3B 1MZFA 4GZRB 3DTUB 4EB6B 1B6QA 3KG2A 3R65A 4O4JA 4DRXA 3H1LH 1XREA 3I56V 1FFXB 3OGCC 5BXZA 3WU2Z 5IJ0A 2V7QG 3FD9A 3SPJA 5IWAO 2ZNJA 4MS2A 5H5NA 2JJ1G 3HR0A 1QR9A 3LNMB 1R3LC 2YIAA 3JARB 2Q7EA 4LFCB 3SPGA 3RW0A 5IE9A 1VF6C 1MOFA 4MVMA 1IBMB 4YHHO 4GKJO 1JJOA 1HP8A 4UCRA 4F4LA 1Q7YW 3C3TA 2XOKG 4U7NA 4JI7B 4J7JA 1W0KG 4TOIA 1PKXA 1J95A 3ZMUA 1TUEB 2Y0PA 3OEEG 1NJIW 4GLXA 1N4CA 4OX9B 4CH4A 3IAYA 1MA1A 4UFZA 4F6RB 3U0ZA 1WB8A 3VOUA 5HFLA 5KHGA 3W7TA 1AVMA 1XHZA 4TV9A 4LFAB 3FKSG 5C8YA 3BCCH 1NTZH 1AILA 5J2TA 1Z2GA 1X4TA 4CC5A 2HLDG 2ZE5A 4X88A 3G4SV 2DMXA 2GTAA 1YVWA 4AI8A 2R9AA 5GONA 4JI0O 1V9PA 3E35A 1JX9A 3E8FA 1ZAUA 4R8CA 4BAYA 1BT8A 5A9GA 4P9OA 4DR7O 4PDVA 2UXBO 1SQXH 4NR1A 1E1RG 4P9PA 2DWEC 4K35A 1D5AA 2Q8VA 2RQ6A 1YSCA 2E76B 5EC2C 2IJIA 4I4TA 5KA5A 2YXHA 2QKAA 3D36A 5IYZB 2WSSG 3ETDA 3FX7A 4O4LB 2LW1A 1SQPH 2YICA 4LF8O 4LBEC 4CH6A 4CS2A 2XUMA 1N36O 3ETEA 3K3WA 3MHSC 3ZN0A 4D6TH 2HKOA 1P7GA 4J7KA 5JWPA 4BWAA 1NVPD 3P32A 3CCMV 1IBLB 3TGUH 2EULA 3S3WA 4LP8A 4B3SB 4LF4B 2VS0A 2CH7A 1QNMA 3BAAA 4I50B 2ARHA 4ZKIA 4DR6O 4YJ3B 1KP3A 4XDJA 2G38A 4DV3O 4E4EA 1BSMA 3ZIAG 2WA3A 4E2LA 3K04A 5B1BC 2R9IA 4FIPC 5LMUB 5EBWC 2P4KA 2F95B 5E79Z 4LF7B 2N74A 4CBCA 2Z0AA 4X64O 1AB3A 5IYDO 3BEHA 2WLHA 2YC0A 3B4SA 4FPPA 4BW5A 2Q7HA 5CA3A 4PI2A 2B5UA 3C3SA 4B3MO 1M56C 3K0DA 4DR1O 3SJCC 4JI1O 1XOUA 4B7KA 1KB9F 4N23A 3JCZA 2FL4A 1SETA 4OGQB 3CCEV 4JAVA 1HR0B 3H9VA 1CXZB 2F4VB 4IYHA 4ZHQA 2O57A 1N32B 4WCEV 1AROP 2WLLA 3CMAV 1R73A 1P84F 3NXSA 2Y0IA 2F93B 3K08A 1GO3F 3SPHA 5CA0B 1S3JA 4JYBA 2A79B 2DOSA 4NTWA 1MMMA 4JZ2A 3JSLA 2Q68A 2JS5A 4I0XB 4JTAB 4TT3G 2LGQA 1G8MA 2HEPA 1AR5A 2OIEA 1XMOB 1GN2A 3UO3A 2QSAA 1H2NA 5FPOA 2A0LA 1K7DA 1RPRA 2DN9A 3DXRB 4NTYA 2HHHB 3OAAG 1E79G 3HKCA 4TSFG 3SJBC 5H2FZ 4HNAB 2PI4A 4MW3A 2H8PC 1FJGO 4R6ZA 1OCRC 3MHHC 3KCYA 4FJCC 2RJZA 4JYCA 2OYQA 2KKWA 4O4IA 1YHQV 4MVZA 2QKCA 3GVMA 2WLJA 4J41A 1OCCB 3OT7A 2HJFC 4TUYB 4JI2B 1WLEA 1S5LZ 1X59A 3K9AA 1M57B 1H8HG 3ETQA 3A0HZ 1FXVA 3ZRWB 2BCCH 3ABLC 4IT5A 1N0JA 4ZOLA 4L87A 1K8AW 4UVCA 1SZXA 5CB4B 4UCTA 1O9HA 2XAFA 1EFRG 1NZ6A 2XAHA 3TK1A 3HKDB 4B3RO 1S76D 3CCUV 5L3CA 1SERA 2VWKA 1GM9A 5J2UB 3CPWU 1WNSA 4KP4A 2ATKC 3O9OA 3AG1B 3IGAC 4LCUC 1Q43A 4LF5O 2NNUA 3RYHA 4PA3A 1K73W 1PL4A 2RMKB 4ZIBA 2EZPA 3SYOA 4QIWF 4EKWA 4A5UB 2UUBB 5LOVA 2KB1A 4XDKA 4X89A 1K5QA 1TUBB 2BSKB 1K97A 4FM2A 1JVMA 2HVJC 2ZXWB 1NU1H 2Q4PA 1N0NA 1XL6A 1AI4A 3IC7A 5CBGA 3WG7C 1K5SA 2EJRA 1XBLA 2VQEB 2QTSA 2ZM6B 4FK5C 3H1HH 3ML0A 4YXWG 5IY5C 3SYAA 4IHJB 4X1YB 1XNRO 1NBMG 2DYRC 3VQXA 1IXMA 2ETNA 2HVKC 3OW2U 3BPZA 4O4HA 2LFRA 1F7YA 1YF2A 2LJ2A 3J80N 3AK2A 3G6EV 2Q6AA 4FLTA 4UB8Z 3A0RA 1TGOA 4JI4B 1BHAA 1LUWA 1K34A 4LFBO 3PJSK 5LP6C 4WBNA 3MAQA 4FLZA 3HKBA 5KHHA 3I55V 3OTOB 1KKCA 2Y69C 1H2MA 3Q4HA 1MABG 2ILMA 1SQQH 3F5WC 2YEVA 4YIPA 5IJ9B 2QJ1A 1LUVA 3A2FA 3OR6C 4IIJB 1XL4A 4D7TA 4FLYA 1YJNV 1OZ0A 5KX5B 4UCOA 5BR8B 3ZX6A 5LA6A 4TV8A 2UU9O 3JALA 2ITCC 1EN4A 1AI7A 3L9DA 3U10A 4Z2WA 5JVDA 1RSOB 2XNDG 4ZBMA 4JI6O 3M99B 4DUYB 2ZR3A 1JFFB 1VQMV 1VQOV 5CN0A 2KQXA 5LHGA 2BOCC 4BIUA 1YEWA 2BTOA 1M93A 2PGGA 1J5EB 1VQKV 4KHPB 1Y66A 4ZI7A 4RQFA 4KXRA 5AG2A 5FL7G 1HNWO 4DV7B 4WF9V 1OJHA 1HNZO 3O65A 2F1MA 1VQ9V 4PDMA 2CGNA 5B66Z 4MVRA 2NN4A 4JI3O 3ZBHA 2LQTA 2JIZG 2CUGA 4NXNO 1UJWB 4UCUA 2MW2B 2CTPA 1I5YA 2QWOB 3T1HB 4B3TB 1VF7A 3BABA 4DUZB 1D2DA 2QTOA 2EIJB 5LGNA 1M1KW 1PP9H 3CHXA 1VQLV 2DW4A 4X62B 1E1QG 2GDSA 2UUAB 2UXCO 2E5LB 5LYJB 3CCSV 4LR3A 3IJ4A 2ODMA 1FKAO 3PN1A 2B1GA 2WLKA 1R1BA 3SYPA 4DR2O 1HW7A 3ABMB 4UCVA 4DK0A 5KUKA 2F66C 4UUJC 3CS5A 4WFEA 2PI5A 3E83A 5EC1C 1NT2B 2QEXV 3X2QC 1Y6XA 1GN6A 5E1AC 5KHIA 2QWRB 1PNKA 3APQA 3ZS8C 4DV5B 4YY3O 4BW9A 3ASNC 1Y67A 4MSWC 3SDLA 1EZJA 2CK3G 5B3SC 5F2VO 3OEHG 3RFRA 3JASB 3T1YB 5KHKA 5GONB 3N2KB 2UXDO 1JJ2U 4X66O 3RBZA 4YJ2A 3ABUA 5B5EZ 5CA1B 4GX1A 2IH3C 2BTQB 3DGEA 1CPYA 4X1IA 3VBBA 4NB5A 1IXBA 3E22A 2EIMB 4DV2O 2B1IA 3BA9A 1I7FA 2FTKA 2HG5C 4XBFA 1KKDA 1IBKB 2OWOA 3K59A 1AP6A 2LW7A 1AJNA 4LF9O 1K92A 1K4DC 1PD3A 1H2SB 4H0LB 3L71H 5GW7A 4RUEA 3THOA 1FS0G 3MDSA 4GUNA 2YIBD 3UT5B 3OE7G 2D3OW 2X6AA 4PA4A 2PYLA 4W4LA 2CDYA 4H13B 3I5DA 1VP7A 3CWBH 5IWAB 2M6YA 2IW5A 5KMGA 4IGGA 3RYCA 1W59A 2MK3A 5EBLC 4EFBA 3AG2C 1EN5A 2K9PA 1ROPA 2XASA 5EYPA 5L3BA 4YHHB 2JS3A 5LMNB 3UO2A 1PNLA 1TVKB 3RYIB 1RM1C 3ZHTA 5EIBD 1M5IA 3E8BA 4K0KO 4G28B 4OX9O 1QLEC 5BMVB 4PDRA 1FYJA 3QTCA 3HKEA 4WFAV 3E2EA 1XDCA 4X20B 2EIKB 4PA9A 1ZL8A 5LP6A 4U3JB 4RO2A 2V1DA 5B1AC 3CMEV 4I9WA 3J7AU 1L1FA 2QWNB 1JOYA 4K8ZA 1FXKB 1BQZA 3J81N 1QVFU 4O2BB 1SA0A 2JGDA 1L8DA 2YIBA 3L73H 3JAWA 1Z5VA 4DV0O 4XDLA 4JI0B 3CX5F 4ICGA 3CJHA 3GWKC 2JJ2G 3H1KH 5EZYB 5D5PA 5JQGA 2EINB 2UXBB 3JD2A 2QM8A 3AG4B 2H94A 5BY1A 1V54B 1SZTA 1H2GA 3CRRA 4EB6A 4X1KB 1BS3A 1QLNA 2PZSA 1FFXA 3RVZA 3N27A 5FPRA 1XNQO 4LF8B 1LNQA 4LF6O 2P90A 1N36B 3K57A 4DV1O 2ZIOA 4J7ZA 5LHIA 4H44B 4MTXA 3GB7C 5FNVB 3LSSA 4DXWA 3JARA 1DTOA 2EILC 3OM3B 2LFSA 2QR4A 2Q67A 4C7UA 2CGOA 4GX5A 1KMIZ 3B2EE 5B1OA 5DECA 2XTAA 4DR6B 1G6UA 4J42A 3G6BA 3ASOB 1GN3A 4MTGA 5JJJB 2E3CA 3KCXA 5LMUO 4NYKA 4DV6O 4CH5A 1THZA 4LF7O 1QVGU 2YIDA 2M7WA 4KL1A 3B8MA 4U3FH 4HBNA 3FAVB 3CXHF 4DR4B 4TWKA 1I08A 2XAQA 1XMQB 3B77A 2ZCEA 2BE3A 2JVDA 4DR5B 1YTFB 1ZX3A 1NTKH 2ZIMA 2VQFO 2DYSB 3EVKA 4JGSA 1FXHA 3LUTB 4FLWA 4B3MB 2F23A 1ZTEA 1I94B 4DR1B 3T2MA 3HPLC 5A2QN 2ZXWC 1Y76B 4L8JA 4JI8O 3ZEDA 4CZZA 2RNBA 5KAIZ 5JH7B 2ZE7A 5KUMA 4FLXA 3A0BZ 4UVAA 1HNXB 2YI8A 1AI6A 4FFBA 1Q3EA 2AGAA 4OPHA 3H1IH 3CRCA 4U7OA 2DJVA 3P30A 2HP8A 1Q82W 4MVUA 4LWSB 4DYLA 1N33O 4X8AA 1XMOO 1YTFD 5IYZA 1GN4A 3ZRVA 4O4LA 3K5OA 1RFYA 1VEWA 3L75H 2Q7GA 2XHBA 1YJ9V 5LXTB 2HHHO 4BIZA 4UVBA 2YXLA 3EFFK 1OCOB 1WAZA 2QM4A 4PI0A 4GT1A 4I50A 3ZHVA 4P30A 1B04A 1FJGB 1R3IC 5ITZB 4JYYA 1K3EA 2EJ7A 4YJ3A 4W4KA 3FYEB 4MT8A 1L0NH 3FB6C 4JI2O 1A32A 1NQTA 4LH6A 2FKXA 2A3QA 2N05A 3K79A 3QO7A 1Q6IA 1DGSA 3JAKB 2JDIG 3FB8C 1RPOA 2KG7B 5JCOC 2VWJA 4PA6A 2WLIB 3F7VC 1R3KC 3E89A 2GV9A 3W7WA 1IZ3A 1Y74B 4PV1B 1OCZC 4B3RB 4AILC 2OCCC 1JCHA 5LGUA 1RP3B 2YXYA 3JATB 3L74H 2F43G 4X65O 2Q0AA 3N2GA 3K9SA 2PF4E 4AHCA 2EZOA 2ADQB 1WP8A 2UUBO 3ZMZA 4JV5O 4J9YB 5KHJA 3CXCU 4FMTA 4UV9A 1JA8A 1UFIA 2DQ0A 2D2CB 5CA0A 3D8CA 3ABKC 3CRAA 1ZUQA 2EIJC 5FLXN 2C2AA 1JMKC 1GK9A 4I0XA 3QNEA 3T4ZA 2WLMA 2OTJV 3G67A 4NVPA 4CS3A 4GKKO 4AQYO 4H37A 5KAFZ 3SPIA 2GSMB 3CC7V 3DXRA 3JD0A 4QE7A 3RYFB 1VQ5V 4JI4O 4MVQA 4D7SA 4FVMA 4HNAA 4DO2A 1AR4A 2IJKA 4MW8A 1N34O 4I55B 1GRJA 4LC1A 1GKFA 4LNUB 3K5LA 1H38A 1KUQA 1YI2V 5DEDA 1U97A 1VQ7V 1K9MW 4TUYA 4JI5B 2GUZB 1OCRB 2QA4V 4O2AA 1AI5A 1SQGA 5BR8O 4WFFA 3ZRWA 2QDOA 1G1XB 2RDCA 3CB2A 3AG7A 4JTCB 2EIMC 3UCSC 4FZ1A 3RN4A 3AG3C 5CB4A 1SQBH 1XQ8A 1QCEA 4K3AA 5J9PC 4JTDB 4BR6A 2ZR2A 2ADPA 3HKDA 1WA8B 2L6LA 3ABLB 5EIBC 3B8NA 4JI6B 1N8RW 3E22B 4DW0A 1WJZA 4G2KA 4O4JB 4DRXB 2Y48A 1BGYH 1SQVH 3DC6A 4Q20A 3UKMA 1GH6A 2DQ3A 1PNMA 1Q6HA 2AHZA 5IJ0B 3ETGA 2GTSA 3IC9A 1TUBA 1SS3A 2BSKA 3CCQV 3QVNA 5K1XA 4JZGA 1NH2B 2LO1A 1XHXA 4FLVA 3OUFA 3CC4V 2PUSA 1FD9A 4NXMB 2FB5A 5DM6V 4QGPA 1PPJH 3HB3B 2Y4TA 3TETA 4DUZO 5L3EA 2UUCB 3RYCB 3A8TA 4IHJA 2YSUB 3EHBB 4X1YA 1HWYA 2Q5ZA 4JAUA 3WG7B 4IYIA 1COWG 4DV4O 2UUAO 1VQPV 1PL0A 5IY5B 3ZHSA 5LL6Y 3AEIA 1YIJV 1F51A 4B08A 2DYRB 1BE3H 1KC8W 3H01A 4BIOA 3RT3C 1EN6A 4UB6Z 1AJQA 2CAZC 4DW1A 4JYAO 3SR2C 1KECA 1LR1A 4UXNA 4TV9B 3CEIA 3QG5A 1IURA 1I0HA 1F4NA 1FXKC 1H2KA 5C8YB 5J2TB 3BVOA 2YI9A 3BHPA 5IJ9A 5KLVH 2AW9A 3OUSA 4IIJA 3CP1A 4DV5O 4WFBV 2ZE8A 4QE9A 5KX5A 4UCSA 4PD4F 1Q86W 1Q81W 3K06A 3U11A 4QNHB 1RSOA 4J10A 3K03A 4Z1MG 1M90W 2WLNA 1SC5B 4DR3O 5JCOA 1JFFA 3LDCA 1IDSA 2R9RB 1Q5OA 1ZWIC 4G27B 1S72V 3OTFA 4I4TB 2KSDA 3JD1A 1MZEA 5JJNB 2QM7A 4F6EA 1G4YB 4LF9B 3T1CA 3CC2V 4LFCO 4GYCB 3ABTA 1KU9A 1WPBA 3QO5A 2CH7B 1IBMO 5JJEB 1YITV 2AZ2A 2ZINA 2CTWA 4HAMA 4NKGB 1MG1A 4JPRA 1I5XA 1WP7A 3ZN1A 2Q9LA 4GKJB 2ZNIA 1WN7A 3ASOC 1S0VA 2EX3A 1R6KA 4JI7O 3RGBA 2R72A 1GTOA 3E8HA 3P3PA 1BHBA 5LMNO 4QPKA 3AK1A 2Q73A 4CH3A 2DWDC 3LDDA 2FYUH 2CE4A 4J80A 5LYJA 4WFHA 2ZQMA 3BFRA 5K1PA 1R3JC 1K4CC 1JR9A 3CE2A 4K0KB 2DYSC 3W7XA 2WPDG 4LFAO 1BCCH 3TXSA 2ZD9A 2L35A 2JEUA 2LGWA 2P4VA 3WB1A 1CP9A 2QGNA 2YS8A 3OGIB 3W7SA 3G80A 1Q90D 2R70A 3GWOA 3SJQC 3H1JH 1DF4A 4UV8A 3WB2A 1Q6UA 1P49A 4ZHQB 2GBOA 4KFMA 2CTRA 1NVPB 2WLLB 3X2QB 3JASA 3N2KA 4DR7B 3K5MA 1V55B 4DV0B 5CA1A 3ASNB 1OHHG 2BTQA 5CMUA 2QKSA 3DC5A 1BL8A 1SRYA 3G71V 4PA7A 5B3SB 3STZC 2ZKOA 1F23A 5IT9N 2X7RB 3LNNA 1YDXA 4MVSA 1M9NA 3P3NA 4FFBB 4I9QA 4J11A 3JSNA 5IDJA 1MNGA 1YJWV 1OV9A 1VQ8V 1QQCA 5EBMC 1IBLO 2X6CA 1OCOC 1TA8A 3UT5A 2E75B 4B3SO 4LF4O 5LGTA 3HKCB 4EEQA 1XNQB 1OCCC 1KBHA 4LF6B 2XT9A 1YZBA 2IJJA 4DV1B 1Z5WA 1M57C 3NR7A 4O4IB 3LSUA 4K8XA 3B09A 4RWUA 2E74B 3ZMVA 1FAFA 4DV3B 1QU7A 1TVKA 1NI8A 2Z5UA 3RYIA 1F4MA 2A9HA 4TQDA 3SPCA 2K1EA 5IYCO 3AG2B 2RN9A 4ZOLB 4FM0A 4F6RA 3KZIZ 3FB7C 2XAJA 3AG1C 1Q8IA 2QE7G 4LH7A 3CRQA 4JASA 5BMVA 4DV6B 1NR1A 1RM1B 4X64B 1WB7A 3TXQA 1SQFA 4DR4O 3B40A 4I5SA 1EM1A 5LBQA 1XMQO 4X20A 2IU0A 2X0LA 4DR5O 2IBZH 3FYIB 1QLEB 2Q69A 4U3JA 2GHYA 1KQSU 4PELA 4JI1B 2VQFB 3RYHB 1GMGA 1HR0O 1I94O 2F4VO 4PDLA 5LHHA 1N32O 3BA8A 1FXKA 3D3IA 3BY6A 1JPXA 2JRIA 1QBZA 5LOVB 4OXSA 4O2BA 1TAEA 3N2GB 5B1AB 3EXAA 4GX2A 4JI8B 3K5NA 5EZYA 1R6NA 1YCIA 2Z3YA 4J9ZB 4TQFA 3CCVV 3UQ8A 1HNXO 1O9GA 1SKVA 5EK0A 1R6TA 3WFVA 3ZCCA 3LDEA 2IH1C 4HYOA 5D5QA 3OMIB 2ITDC 5CBHA 3JD4A 2ZDIC 1BMFG 3K58A 2QWPB 4X1KA 2IU3A 3ZMTA 4O4HB 4FZ0A 1N33B 1VMGA 1MSWD 2WWWA 2NLJC 1S77D 2V4DA 3OFNG 3ZMSA 4WBNB 2IJHA 3HKBB 5FNVA 3JAMN 3LSQA 2OT5A 4MTOA 2WAMA 5C93A 3Q4HB 3QF7A 4HZ3A 2YEVB 4OPAA 3BRCA 3QO8A 2EILB 3C90A 1KD1W 1IX9A 2A06H 2AXTZ 1VF6A 4PJ0Z 2AZ0A 4B7EA 2HJDA 5LA6B 4TV8B 4NTXA 4O2AB 1T5EA 2EBOA 3JALB 4CS4A 5B1BB 5JVDB 4GX0A 3FFQA 1D5NA 3UM7A 2CTQA 4QPJA 3FAVA 1URFA 2P6JA 3R66A 4X9QA 4Q6GA 4ZI7B 2PYJA 1P4RA 3SYQA 1M4UA 4LF5B 5DN6G 2JEXA 3ICXA 3L72H 1KYOF 3DSQA 1M56B 1VF5B 3OMNB 4X65B 1Y76A 1P7BA 1H2LA 4JF3A 1W0JG 2W6JG 5JH7A 2P7TC 5L3GA 3OR7C 4N21A 4FLUA 4JV5B 1SF9A 2B9ZA 2LP7A 2VQEO 2ZM6O 2ZE6A 2P67A 1DK1A 3CCLV 3E8GA 2HR3A 4ASUG 5GTIZ 1ORQC 5GTHZ 2RCVA 4WFGA 4PHZA 4LWSA 3CYOA 1XNRB 3JYCA 1VIBA 1UPGA 3CSXA 2VRZA 3ABMC 2PTMA 3F7YC 1VQ4V 1ZSPA 3JD3A 3ZRSA 1KP2A 1GM7A 3TJTA 4P2ZA 2A7WA 1FPOA 4GKKB 5LXTA 4AQYB 4LFBB 1NS1A 3K0GA 3OTOO 2Q0OC 3M7MX 3OD4A 1XUQA 2XAGA 3ZHQA 1IVSA 4CC6A 2JK5C 1XEQA 5ITZA 1N34B 2IM9A 4H33A 4Z1VA 5L3DA 5H6RA 1NR7A 1B3QA 3IFXA 4JI5O 1BQ0A 1AJPA 1JQ0A 1ENVA 3VQVA 5H6QA 2UXXA 3VQYA 3CD6V 3JAKA 2UU9B 3TCUA 2KG7A 2JGUA 2P22C 4DUYO 2WLIA 1S5HC 3RVYA 4YJ2B 2W6IG 5HFMA 1BZKA 1VQNV 4X1IB 3ZJZA 2P5OA 3F5TA 5J2UA 3D3QA 1J5EO 1H8EG 3D36C 4KHPO 2NR5A 1Y74A
chains in the Genus database with same CATH topology
2HHHO 1R1BA 4DR2O 4LFCO 1HNXO 1R6TA 4DUZO 4JI0O 4B3MO 4GKKO 4AQYO 1IBKO 4DV7O 4DR1O 4K0KO 4OX9O 1IBMO 1IBLO 4B3RO 4JI1O 1FYJA 4JI4O 4DR7O 2VQEO 2ZM6O 2UU9O 4LF4O 4B3SO 2UXBO 4DV4O 5LMUO 4DV6O 4YY3O 2UUAO 1DK1A 1N34O 4JI2O 4JI7O 1A32A 4LF7O 4JI6O 1YZBA 3SDLA 4LF5O 5LL6Y 5LMNO 2FKXA 5BXZA 3T1HO 3J7AU 1KUQA 4B3TO 2UXDO 3RT3C 4NXMO 4X66O 4A5UB 5IWAO 2DOSA 4JYAO 3J81N 5H5NA 2VQFO 3JAMN 4X62O 4LF8O 4DV2O 2UUCO 5BR8O 1N36O 4DV0O 3M8AA 1HNWO 2E5LO 1G1XB 1HNZO 2LW7A 3O65A 4LF9O 4LFAO 1NS1A 4YHHO 4GKJO 3OTOO 4OPAA 5A2QN 4DV5O 4JI8O 4JI3O 5BY1A 1XEQA 4NXNO 4X65O 4DR4O 1XNRO 4DR6O 1XMQO 2UUBO 4DR5O 1F7YA 4JI5O 1D2DA 4JV5O 1FJGO 4DV3O 4DR3O 3J80N 2AGAA 4OPHA 1XNQO 1HR0O 2DJVA 1I94O 2F4VO 1N32O 1N33O 4LF6O 1XMOO 5FLXN 3R66A 4DUYO 4LFBO 4DV1O 2JRIA 2UXCO 3T1YO 2N74A 1X59A 2Z0AA 2ZKOA 3F5TA 4X64O 1J5EO 1FKAO 5IT9N 1AILA 1AB3A 4KHPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH O;  1R1B A;  4DR2 O;  4LFC O;  1HNX O;  1R6T A;  4DUZ O;  4JI0 O;  4B3M O;  4GKK O;  4AQY O;  1IBK O;  4DV7 O;  4DR1 O;  4K0K O;  4OX9 O;  1IBM O;  1IBL O;  4B3R O;  4JI1 O;  1FYJ A;  4JI4 O;  4DR7 O;  2VQE O;  2ZM6 O;  2UU9 O;  4LF4 O;  4B3S O;  2UXB O;  4DV4 O;  5LMU O;  4DV6 O;  4YY3 O;  2UUA O;  1DK1 A;  1N34 O;  4JI2 O;  4JI7 O;  1A32 A;  4LF7 O;  4JI6 O;  1YZB A;  3SDL A;  4LF5 O;  5LL6 Y;  5LMN O;  2FKX A;  5BXZ A;  3T1H O;  3J7A U;  1KUQ A;  4B3T O;  2UXD O;  3RT3 C;  4NXM O;  4X66 O;  4A5U B;  5IWA O;  2DOS A;  4JYA O;  3J81 N;  5H5N A;  2VQF O;  3JAM N;  4X62 O;  4LF8 O;  4DV2 O;  2UUC O;  5BR8 O;  1N36 O;  4DV0 O;  3M8A A;  1HNW O;  2E5L O;  1G1X B;  1HNZ O;  2LW7 A;  3O65 A;  4LF9 O;  4LFA O;  1NS1 A;  4YHH O;  4GKJ O;  3OTO O;  4OPA A;  5A2Q N;  4DV5 O;  4JI8 O;  4JI3 O;  5BY1 A;  1XEQ A;  4NXN O;  4X65 O;  4DR4 O;  1XNR O;  4DR6 O;  1XMQ O;  2UUB O;  4DR5 O;  1F7Y A;  4JI5 O;  1D2D A;  4JV5 O;  1FJG O;  4DV3 O;  4DR3 O;  3J80 N;  2AGA A;  4OPH A;  1XNQ O;  1HR0 O;  2DJV A;  1I94 O;  2F4V O;  1N32 O;  1N33 O;  4LF6 O;  1XMO O;  5FLX N;  3R66 A;  4DUY O;  4LFB O;  4DV1 O;  2JRI A;  2UXC O;  3T1Y O;  2N74 A;  1X59 A;  2Z0A A;  2ZKO A;  3F5T A;  4X64 O;  1J5E O;  1FKA O;  5IT9 N;  1AIL A;  1AB3 A;  4KHP O; 
#chains in the Genus database with same CATH topology
 2N04 A;  4GCZ A;  4RAI A;  4KUM A;  1US6 A;  1AP5 A;  1ZLZ A;  3S3X A;  4DV7 O;  1EZV H;  3JAT A;  1WPX A;  3ZHR A;  1QR8 A;  3VQW A;  1QHT A;  3RWR D;  3ZRX A;  1HNW B;  1HNZ B;  3SGI A;  1OCZ B;  3E86 A;  2OCC B;  1XIL A;  5H9C A;  1GM8 A;  3CCR V;  1PV0 A;  4JAA A;  4JI3 B;  2QWQ B;  2WA4 A;  2ZT9 B;  1FFT B;  4EFE A;  3T1H O;  4NXN B;  2PY5 A;  4B3T O;  3MD0 A;  4FM1 A;  4RUF A;  5KMG B;  4NXM O;  3SYC A;  5EYP B;  4YIO A;  3W7U A;  1NKD A;  4X62 O;  2UUC O;  3SJA C;  1Y4M A;  2HFE C;  1XI1 A;  5CBF A;  1DF5 A;  2W0X A;  3ABK B;  3M8A A;  2E5L O;  1CEZ A;  2YDE A;  2ZDI A;  2AHY A;  5B1N A;  1YXB A;  4RQE A;  2UXC B;  5TIS Z;  4QJF B;  5BZB A;  2EIK C;  1B06 A;  2Y4U A;  3ZHU A;  1K33 A;  4DV4 B;  3RYF A;  1HDJ A;  2OTL V;  4R7C A;  1VQ6 V;  4I7Z B;  4DR2 B;  5KA6 A;  3HKE B;  5L3F A;  1NH2 D;  4IL6 Z;  4I55 A;  3JCU Z;  1W2B U;  3OMA B;  1ZL8 B;  4LNU A;  5LP6 B;  3CCJ V;  4JYA B;  2OCH A;  2UXN A;  3T4D A;  3WB0 A;  3L70 H;  1EBO A;  1SES A;  2DE0 X;  1L0L H;  5IYB O;  2Y69 B;  2X6B A;  2GUZ A;  4MVO A;  4R50 A;  4YY3 B;  3AK3 A;  2FML A;  1PM9 A;  2H3O A;  3T1Y O;  3APO A;  1SA0 B;  2JGD B;  1V55 C;  3STL C;  2EIN C;  3JAW B;  3AG4 C;  3CRM A;  1S5J A;  1V54 C;  2UXD B;  3KKY A;  1DLB A;  3CJH B;  1GAX A;  2BOB C;  4MTF A;  4X66 B;  4ABM A;  4DK1 A;  2YUA A;  5JQG B;  4FFK A;  1MSD A;  1NTM H;  1IBK O;  2P06 A;  1VAR A;  4DV2 B;  1WA8 A;  1U96 A;  1AR1 B;  4DR3 B;  3FB5 C;  2W0F C;  2OIG A;  3AG3 B;  1MZF A;  4GZR B;  3DTU B;  4EB6 B;  1B6Q A;  3KG2 A;  3R65 A;  4O4J A;  4DRX A;  3H1L H;  1XRE A;  3I56 V;  1FFX B;  3OGC C;  5BXZ A;  3WU2 Z;  5IJ0 A;  2V7Q G;  3FD9 A;  3SPJ A;  5IWA O;  2ZNJ A;  4MS2 A;  5H5N A;  2JJ1 G;  3HR0 A;  1QR9 A;  3LNM B;  1R3L C;  2YIA A;  3JAR B;  2Q7E A;  4LFC B;  3SPG A;  3RW0 A;  5IE9 A;  1VF6 C;  1MOF A;  4MVM A;  1IBM B;  4YHH O;  4GKJ O;  1JJO A;  1HP8 A;  4UCR A;  4F4L A;  1Q7Y W;  3C3T A;  2XOK G;  4U7N A;  4JI7 B;  4J7J A;  1W0K G;  4TOI A;  1PKX A;  1J95 A;  3ZMU A;  1TUE B;  2Y0P A;  3OEE G;  1NJI W;  4GLX A;  1N4C A;  4OX9 B;  4CH4 A;  3IAY A;  1MA1 A;  4UFZ A;  4F6R B;  3U0Z A;  1WB8 A;  3VOU A;  5HFL A;  5KHG A;  3W7T A;  1AVM A;  1XHZ A;  4TV9 A;  4LFA B;  3FKS G;  5C8Y A;  3BCC H;  1NTZ H;  1AIL A;  5J2T A;  1Z2G A;  1X4T A;  4CC5 A;  2HLD G;  2ZE5 A;  4X88 A;  3G4S V;  2DMX A;  2GTA A;  1YVW A;  4AI8 A;  2R9A A;  5GON A;  4JI0 O;  1V9P A;  3E35 A;  1JX9 A;  3E8F A;  1ZAU A;  4R8C A;  4BAY A;  1BT8 A;  5A9G A;  4P9O A;  4DR7 O;  4PDV A;  2UXB O;  1SQX H;  4NR1 A;  1E1R G;  4P9P A;  2DWE C;  4K35 A;  1D5A A;  2Q8V A;  2RQ6 A;  1YSC A;  2E76 B;  5EC2 C;  2IJI A;  4I4T A;  5KA5 A;  2YXH A;  2QKA A;  3D36 A;  5IYZ B;  2WSS G;  3ETD A;  3FX7 A;  4O4L B;  2LW1 A;  1SQP H;  2YIC A;  4LF8 O;  4LBE C;  4CH6 A;  4CS2 A;  2XUM A;  1N36 O;  3ETE A;  3K3W A;  3MHS C;  3ZN0 A;  4D6T H;  2HKO A;  1P7G A;  4J7K A;  5JWP A;  4BWA A;  1NVP D;  3P32 A;  3CCM V;  1IBL B;  3TGU H;  2EUL A;  3S3W A;  4LP8 A;  4B3S B;  4LF4 B;  2VS0 A;  2CH7 A;  1QNM A;  3BAA A;  4I50 B;  2ARH A;  4ZKI A;  4DR6 O;  4YJ3 B;  1KP3 A;  4XDJ A;  2G38 A;  4DV3 O;  4E4E A;  1BSM A;  3ZIA G;  2WA3 A;  4E2L A;  3K04 A;  5B1B C;  2R9I A;  4FIP C;  5LMU B;  5EBW C;  2P4K A;  2F95 B;  5E79 Z;  4LF7 B;  2N74 A;  4CBC A;  2Z0A A;  4X64 O;  1AB3 A;  5IYD O;  3BEH A;  2WLH A;  2YC0 A;  3B4S A;  4FPP A;  4BW5 A;  2Q7H A;  5CA3 A;  4PI2 A;  2B5U A;  3C3S A;  4B3M O;  1M56 C;  3K0D A;  4DR1 O;  3SJC C;  4JI1 O;  1XOU A;  4B7K A;  1KB9 F;  4N23 A;  3JCZ A;  2FL4 A;  1SET A;  4OGQ B;  3CCE V;  4JAV A;  1HR0 B;  3H9V A;  1CXZ B;  2F4V B;  4IYH A;  4ZHQ A;  2O57 A;  1N32 B;  4WCE V;  1ARO P;  2WLL A;  3CMA V;  1R73 A;  1P84 F;  3NXS A;  2Y0I A;  2F93 B;  3K08 A;  1GO3 F;  3SPH A;  5CA0 B;  1S3J A;  4JYB A;  2A79 B;  2DOS A;  4NTW A;  1MMM A;  4JZ2 A;  3JSL A;  2Q68 A;  2JS5 A;  4I0X B;  4JTA B;  4TT3 G;  2LGQ A;  1G8M A;  2HEP A;  1AR5 A;  2OIE A;  1XMO B;  1GN2 A;  3UO3 A;  2QSA A;  1H2N A;  5FPO A;  2A0L A;  1K7D A;  1RPR A;  2DN9 A;  3DXR B;  4NTY A;  2HHH B;  3OAA G;  1E79 G;  3HKC A;  4TSF G;  3SJB C;  5H2F Z;  4HNA B;  2PI4 A;  4MW3 A;  2H8P C;  1FJG O;  4R6Z A;  1OCR C;  3MHH C;  3KCY A;  4FJC C;  2RJZ A;  4JYC A;  2OYQ A;  2KKW A;  4O4I A;  1YHQ V;  4MVZ A;  2QKC A;  3GVM A;  2WLJ A;  4J41 A;  1OCC B;  3OT7 A;  2HJF C;  4TUY B;  4JI2 B;  1WLE A;  1S5L Z;  1X59 A;  3K9A A;  1M57 B;  1H8H G;  3ETQ A;  3A0H Z;  1FXV A;  3ZRW B;  2BCC H;  3ABL C;  4IT5 A;  1N0J A;  4ZOL A;  4L87 A;  1K8A W;  4UVC A;  1SZX A;  5CB4 B;  4UCT A;  1O9H A;  2XAF A;  1EFR G;  1NZ6 A;  2XAH A;  3TK1 A;  3HKD B;  4B3R O;  1S76 D;  3CCU V;  5L3C A;  1SER A;  2VWK A;  1GM9 A;  5J2U B;  3CPW U;  1WNS A;  4KP4 A;  2ATK C;  3O9O A;  3AG1 B;  3IGA C;  4LCU C;  1Q43 A;  4LF5 O;  2NNU A;  3RYH A;  4PA3 A;  1K73 W;  1PL4 A;  2RMK B;  4ZIB A;  2EZP A;  3SYO A;  4QIW F;  4EKW A;  4A5U B;  2UUB B;  5LOV A;  2KB1 A;  4XDK A;  4X89 A;  1K5Q A;  1TUB B;  2BSK B;  1K97 A;  4FM2 A;  1JVM A;  2HVJ C;  2ZXW B;  1NU1 H;  2Q4P A;  1N0N A;  1XL6 A;  1AI4 A;  3IC7 A;  5CBG A;  3WG7 C;  1K5S A;  2EJR A;  1XBL A;  2VQE B;  2QTS A;  2ZM6 B;  4FK5 C;  3H1H H;  3ML0 A;  4YXW G;  5IY5 C;  3SYA A;  4IHJ B;  4X1Y B;  1XNR O;  1NBM G;  2DYR C;  3VQX A;  1IXM A;  2ETN A;  2HVK C;  3OW2 U;  3BPZ A;  4O4H A;  2LFR A;  1F7Y A;  1YF2 A;  2LJ2 A;  3J80 N;  3AK2 A;  3G6E V;  2Q6A A;  4FLT A;  4UB8 Z;  3A0R A;  1TGO A;  4JI4 B;  1BHA A;  1LUW A;  1K34 A;  4LFB O;  3PJS K;  5LP6 C;  4WBN A;  3MAQ A;  4FLZ A;  3HKB A;  5KHH A;  3I55 V;  3OTO B;  1KKC A;  2Y69 C;  1H2M A;  3Q4H A;  1MAB G;  2ILM A;  1SQQ H;  3F5W C;  2YEV A;  4YIP A;  5IJ9 B;  2QJ1 A;  1LUV A;  3A2F A;  3OR6 C;  4IIJ B;  1XL4 A;  4D7T A;  4FLY A;  1YJN V;  1OZ0 A;  5KX5 B;  4UCO A;  5BR8 B;  3ZX6 A;  5LA6 A;  4TV8 A;  2UU9 O;  3JAL A;  2ITC C;  1EN4 A;  1AI7 A;  3L9D A;  3U10 A;  4Z2W A;  5JVD A;  1RSO B;  2XND G;  4ZBM A;  4JI6 O;  3M99 B;  4DUY B;  2ZR3 A;  1JFF B;  1VQM V;  1VQO V;  5CN0 A;  2KQX A;  5LHG A;  2BOC C;  4BIU A;  1YEW A;  2BTO A;  1M93 A;  2PGG A;  1J5E B;  1VQK V;  4KHP B;  1Y66 A;  4ZI7 A;  4RQF A;  4KXR A;  5AG2 A;  5FL7 G;  1HNW O;  4DV7 B;  4WF9 V;  1OJH A;  1HNZ O;  3O65 A;  2F1M A;  1VQ9 V;  4PDM A;  2CGN A;  5B66 Z;  4MVR A;  2NN4 A;  4JI3 O;  3ZBH A;  2LQT A;  2JIZ G;  2CUG A;  4NXN O;  1UJW B;  4UCU A;  2MW2 B;  2CTP A;  1I5Y A;  2QWO B;  3T1H B;  4B3T B;  1VF7 A;  3BAB A;  4DUZ B;  1D2D A;  2QTO A;  2EIJ B;  5LGN A;  1M1K W;  1PP9 H;  3CHX A;  1VQL V;  2DW4 A;  4X62 B;  1E1Q G;  2GDS A;  2UUA B;  2UXC O;  2E5L B;  5LYJ B;  3CCS V;  4LR3 A;  3IJ4 A;  2ODM A;  1FKA O;  3PN1 A;  2B1G A;  2WLK A;  1R1B A;  3SYP A;  4DR2 O;  1HW7 A;  3ABM B;  4UCV A;  4DK0 A;  5KUK A;  2F66 C;  4UUJ C;  3CS5 A;  4WFE A;  2PI5 A;  3E83 A;  5EC1 C;  1NT2 B;  2QEX V;  3X2Q C;  1Y6X A;  1GN6 A;  5E1A C;  5KHI A;  2QWR B;  1PNK A;  3APQ A;  3ZS8 C;  4DV5 B;  4YY3 O;  4BW9 A;  3ASN C;  1Y67 A;  4MSW C;  3SDL A;  1EZJ A;  2CK3 G;  5B3S C;  5F2V O;  3OEH G;  3RFR A;  3JAS B;  3T1Y B;  5KHK A;  5GON B;  3N2K B;  2UXD O;  1JJ2 U;  4X66 O;  3RBZ A;  4YJ2 A;  3ABU A;  5B5E Z;  5CA1 B;  4GX1 A;  2IH3 C;  2BTQ B;  3DGE A;  1CPY A;  4X1I A;  3VBB A;  4NB5 A;  1IXB A;  3E22 A;  2EIM B;  4DV2 O;  2B1I A;  3BA9 A;  1I7F A;  2FTK A;  2HG5 C;  4XBF A;  1KKD A;  1IBK B;  2OWO A;  3K59 A;  1AP6 A;  2LW7 A;  1AJN A;  4LF9 O;  1K92 A;  1K4D C;  1PD3 A;  1H2S B;  4H0L B;  3L71 H;  5GW7 A;  4RUE A;  3THO A;  1FS0 G;  3MDS A;  4GUN A;  2YIB D;  3UT5 B;  3OE7 G;  2D3O W;  2X6A A;  4PA4 A;  2PYL A;  4W4L A;  2CDY A;  4H13 B;  3I5D A;  1VP7 A;  3CWB H;  5IWA B;  2M6Y A;  2IW5 A;  5KMG A;  4IGG A;  3RYC A;  1W59 A;  2MK3 A;  5EBL C;  4EFB A;  3AG2 C;  1EN5 A;  2K9P A;  1ROP A;  2XAS A;  5EYP A;  5L3B A;  4YHH B;  2JS3 A;  5LMN B;  3UO2 A;  1PNL A;  1TVK B;  3RYI B;  1RM1 C;  3ZHT A;  5EIB D;  1M5I A;  3E8B A;  4K0K O;  4G28 B;  4OX9 O;  1QLE C;  5BMV B;  4PDR A;  1FYJ A;  3QTC A;  3HKE A;  4WFA V;  3E2E A;  1XDC A;  4X20 B;  2EIK B;  4PA9 A;  1ZL8 A;  5LP6 A;  4U3J B;  4RO2 A;  2V1D A;  5B1A C;  3CME V;  4I9W A;  3J7A U;  1L1F A;  2QWN B;  1JOY A;  4K8Z A;  1FXK B;  1BQZ A;  3J81 N;  1QVF U;  4O2B B;  1SA0 A;  2JGD A;  1L8D A;  2YIB A;  3L73 H;  3JAW A;  1Z5V A;  4DV0 O;  4XDL A;  4JI0 B;  3CX5 F;  4ICG A;  3CJH A;  3GWK C;  2JJ2 G;  3H1K H;  5EZY B;  5D5P A;  5JQG A;  2EIN B;  2UXB B;  3JD2 A;  2QM8 A;  3AG4 B;  2H94 A;  5BY1 A;  1V54 B;  1SZT A;  1H2G A;  3CRR A;  4EB6 A;  4X1K B;  1BS3 A;  1QLN A;  2PZS A;  1FFX A;  3RVZ A;  3N27 A;  5FPR A;  1XNQ O;  4LF8 B;  1LNQ A;  4LF6 O;  2P90 A;  1N36 B;  3K57 A;  4DV1 O;  2ZIO A;  4J7Z A;  5LHI A;  4H44 B;  4MTX A;  3GB7 C;  5FNV B;  3LSS A;  4DXW A;  3JAR A;  1DTO A;  2EIL C;  3OM3 B;  2LFS A;  2QR4 A;  2Q67 A;  4C7U A;  2CGO A;  4GX5 A;  1KMI Z;  3B2E E;  5B1O A;  5DEC A;  2XTA A;  4DR6 B;  1G6U A;  4J42 A;  3G6B A;  3ASO B;  1GN3 A;  4MTG A;  5JJJ B;  2E3C A;  3KCX A;  5LMU O;  4NYK A;  4DV6 O;  4CH5 A;  1THZ A;  4LF7 O;  1QVG U;  2YID A;  2M7W A;  4KL1 A;  3B8M A;  4U3F H;  4HBN A;  3FAV B;  3CXH F;  4DR4 B;  4TWK A;  1I08 A;  2XAQ A;  1XMQ B;  3B77 A;  2ZCE A;  2BE3 A;  2JVD A;  4DR5 B;  1YTF B;  1ZX3 A;  1NTK H;  2ZIM A;  2VQF O;  2DYS B;  3EVK A;  4JGS A;  1FXH A;  3LUT B;  4FLW A;  4B3M B;  2F23 A;  1ZTE A;  1I94 B;  4DR1 B;  3T2M A;  3HPL C;  5A2Q N;  2ZXW C;  1Y76 B;  4L8J A;  4JI8 O;  3ZED A;  4CZZ A;  2RNB A;  5KAI Z;  5JH7 B;  2ZE7 A;  5KUM A;  4FLX A;  3A0B Z;  4UVA A;  1HNX B;  2YI8 A;  1AI6 A;  4FFB A;  1Q3E A;  2AGA A;  4OPH A;  3H1I H;  3CRC A;  4U7O A;  2DJV A;  3P30 A;  2HP8 A;  1Q82 W;  4MVU A;  4LWS B;  4DYL A;  1N33 O;  4X8A A;  1XMO O;  1YTF D;  5IYZ A;  1GN4 A;  3ZRV A;  4O4L A;  3K5O A;  1RFY A;  1VEW A;  3L75 H;  2Q7G A;  2XHB A;  1YJ9 V;  5LXT B;  2HHH O;  4BIZ A;  4UVB A;  2YXL A;  3EFF K;  1OCO B;  1WAZ A;  2QM4 A;  4PI0 A;  4GT1 A;  4I50 A;  3ZHV A;  4P30 A;  1B04 A;  1FJG B;  1R3I C;  5ITZ B;  4JYY A;  1K3E A;  2EJ7 A;  4YJ3 A;  4W4K A;  3FYE B;  4MT8 A;  1L0N H;  3FB6 C;  4JI2 O;  1A32 A;  1NQT A;  4LH6 A;  2FKX A;  2A3Q A;  2N05 A;  3K79 A;  3QO7 A;  1Q6I A;  1DGS A;  3JAK B;  2JDI G;  3FB8 C;  1RPO A;  2KG7 B;  5JCO C;  2VWJ A;  4PA6 A;  2WLI B;  3F7V C;  1R3K C;  3E89 A;  2GV9 A;  3W7W A;  1IZ3 A;  1Y74 B;  4PV1 B;  1OCZ C;  4B3R B;  4AIL C;  2OCC C;  1JCH A;  5LGU A;  1RP3 B;  2YXY A;  3JAT B;  3L74 H;  2F43 G;  4X65 O;  2Q0A A;  3N2G A;  3K9S A;  2PF4 E;  4AHC A;  2EZO A;  2ADQ B;  1WP8 A;  2UUB O;  3ZMZ A;  4JV5 O;  4J9Y B;  5KHJ A;  3CXC U;  4FMT A;  4UV9 A;  1JA8 A;  1UFI A;  2DQ0 A;  2D2C B;  5CA0 A;  3D8C A;  3ABK C;  3CRA A;  1ZUQ A;  2EIJ C;  5FLX N;  2C2A A;  1JMK C;  1GK9 A;  4I0X A;  3QNE A;  3T4Z A;  2WLM A;  2OTJ V;  3G67 A;  4NVP A;  4CS3 A;  4GKK O;  4AQY O;  4H37 A;  5KAF Z;  3SPI A;  2GSM B;  3CC7 V;  3DXR A;  3JD0 A;  4QE7 A;  3RYF B;  1VQ5 V;  4JI4 O;  4MVQ A;  4D7S A;  4FVM A;  4HNA A;  4DO2 A;  1AR4 A;  2IJK A;  4MW8 A;  1N34 O;  4I55 B;  1GRJ A;  4LC1 A;  1GKF A;  4LNU B;  3K5L A;  1H38 A;  1KUQ A;  1YI2 V;  5DED A;  1U97 A;  1VQ7 V;  1K9M W;  4TUY A;  4JI5 B;  2GUZ B;  1OCR B;  2QA4 V;  4O2A A;  1AI5 A;  1SQG A;  5BR8 O;  4WFF A;  3ZRW A;  2QDO A;  1G1X B;  2RDC A;  3CB2 A;  3AG7 A;  4JTC B;  2EIM C;  3UCS C;  4FZ1 A;  3RN4 A;  3AG3 C;  5CB4 A;  1SQB H;  1XQ8 A;  1QCE A;  4K3A A;  5J9P C;  4JTD B;  4BR6 A;  2ZR2 A;  2ADP A;  3HKD A;  1WA8 B;  2L6L A;  3ABL B;  5EIB C;  3B8N A;  4JI6 B;  1N8R W;  3E22 B;  4DW0 A;  1WJZ A;  4G2K A;  4O4J B;  4DRX B;  2Y48 A;  1BGY H;  1SQV H;  3DC6 A;  4Q20 A;  3UKM A;  1GH6 A;  2DQ3 A;  1PNM A;  1Q6H A;  2AHZ A;  5IJ0 B;  3ETG A;  2GTS A;  3IC9 A;  1TUB A;  1SS3 A;  2BSK A;  3CCQ V;  3QVN A;  5K1X A;  4JZG A;  1NH2 B;  2LO1 A;  1XHX A;  4FLV A;  3OUF A;  3CC4 V;  2PUS A;  1FD9 A;  4NXM B;  2FB5 A;  5DM6 V;  4QGP A;  1PPJ H;  3HB3 B;  2Y4T A;  3TET A;  4DUZ O;  5L3E A;  2UUC B;  3RYC B;  3A8T A;  4IHJ A;  2YSU B;  3EHB B;  4X1Y A;  1HWY A;  2Q5Z A;  4JAU A;  3WG7 B;  4IYI A;  1COW G;  4DV4 O;  2UUA O;  1VQP V;  1PL0 A;  5IY5 B;  3ZHS A;  5LL6 Y;  3AEI A;  1YIJ V;  1F51 A;  4B08 A;  2DYR B;  1BE3 H;  1KC8 W;  3H01 A;  4BIO A;  3RT3 C;  1EN6 A;  4UB6 Z;  1AJQ A;  2CAZ C;  4DW1 A;  4JYA O;  3SR2 C;  1KEC A;  1LR1 A;  4UXN A;  4TV9 B;  3CEI A;  3QG5 A;  1IUR A;  1I0H A;  1F4N A;  1FXK C;  1H2K A;  5C8Y B;  5J2T B;  3BVO A;  2YI9 A;  3BHP A;  5IJ9 A;  5KLV H;  2AW9 A;  3OUS A;  4IIJ A;  3CP1 A;  4DV5 O;  4WFB V;  2ZE8 A;  4QE9 A;  5KX5 A;  4UCS A;  4PD4 F;  1Q86 W;  1Q81 W;  3K06 A;  3U11 A;  4QNH B;  1RSO A;  4J10 A;  3K03 A;  4Z1M G;  1M90 W;  2WLN A;  1SC5 B;  4DR3 O;  5JCO A;  1JFF A;  3LDC A;  1IDS A;  2R9R B;  1Q5O A;  1ZWI C;  4G27 B;  1S72 V;  3OTF A;  4I4T B;  2KSD A;  3JD1 A;  1MZE A;  5JJN B;  2QM7 A;  4F6E A;  1G4Y B;  4LF9 B;  3T1C A;  3CC2 V;  4LFC O;  4GYC B;  3ABT A;  1KU9 A;  1WPB A;  3QO5 A;  2CH7 B;  1IBM O;  5JJE B;  1YIT V;  2AZ2 A;  2ZIN A;  2CTW A;  4HAM A;  4NKG B;  1MG1 A;  4JPR A;  1I5X A;  1WP7 A;  3ZN1 A;  2Q9L A;  4GKJ B;  2ZNI A;  1WN7 A;  3ASO C;  1S0V A;  2EX3 A;  1R6K A;  4JI7 O;  3RGB A;  2R72 A;  1GTO A;  3E8H A;  3P3P A;  1BHB A;  5LMN O;  4QPK A;  3AK1 A;  2Q73 A;  4CH3 A;  2DWD C;  3LDD A;  2FYU H;  2CE4 A;  4J80 A;  5LYJ A;  4WFH A;  2ZQM A;  3BFR A;  5K1P A;  1R3J C;  1K4C C;  1JR9 A;  3CE2 A;  4K0K B;  2DYS C;  3W7X A;  2WPD G;  4LFA O;  1BCC H;  3TXS A;  2ZD9 A;  2L35 A;  2JEU A;  2LGW A;  2P4V A;  3WB1 A;  1CP9 A;  2QGN A;  2YS8 A;  3OGI B;  3W7S A;  3G80 A;  1Q90 D;  2R70 A;  3GWO A;  3SJQ C;  3H1J H;  1DF4 A;  4UV8 A;  3WB2 A;  1Q6U A;  1P49 A;  4ZHQ B;  2GBO A;  4KFM A;  2CTR A;  1NVP B;  2WLL B;  3X2Q B;  3JAS A;  3N2K A;  4DR7 B;  3K5M A;  1V55 B;  4DV0 B;  5CA1 A;  3ASN B;  1OHH G;  2BTQ A;  5CMU A;  2QKS A;  3DC5 A;  1BL8 A;  1SRY A;  3G71 V;  4PA7 A;  5B3S B;  3STZ C;  2ZKO A;  1F23 A;  5IT9 N;  2X7R B;  3LNN A;  1YDX A;  4MVS A;  1M9N A;  3P3N A;  4FFB B;  4I9Q A;  4J11 A;  3JSN A;  5IDJ A;  1MNG A;  1YJW V;  1OV9 A;  1VQ8 V;  1QQC A;  5EBM C;  1IBL O;  2X6C A;  1OCO C;  1TA8 A;  3UT5 A;  2E75 B;  4B3S O;  4LF4 O;  5LGT A;  3HKC B;  4EEQ A;  1XNQ B;  1OCC C;  1KBH A;  4LF6 B;  2XT9 A;  1YZB A;  2IJJ A;  4DV1 B;  1Z5W A;  1M57 C;  3NR7 A;  4O4I B;  3LSU A;  4K8X A;  3B09 A;  4RWU A;  2E74 B;  3ZMV A;  1FAF A;  4DV3 B;  1QU7 A;  1TVK A;  1NI8 A;  2Z5U A;  3RYI A;  1F4M A;  2A9H A;  4TQD A;  3SPC A;  2K1E A;  5IYC O;  3AG2 B;  2RN9 A;  4ZOL B;  4FM0 A;  4F6R A;  3KZI Z;  3FB7 C;  2XAJ A;  3AG1 C;  1Q8I A;  2QE7 G;  4LH7 A;  3CRQ A;  4JAS A;  5BMV A;  4DV6 B;  1NR1 A;  1RM1 B;  4X64 B;  1WB7 A;  3TXQ A;  1SQF A;  4DR4 O;  3B40 A;  4I5S A;  1EM1 A;  5LBQ A;  1XMQ O;  4X20 A;  2IU0 A;  2X0L A;  4DR5 O;  2IBZ H;  3FYI B;  1QLE B;  2Q69 A;  4U3J A;  2GHY A;  1KQS U;  4PEL A;  4JI1 B;  2VQF B;  3RYH B;  1GMG A;  1HR0 O;  1I94 O;  2F4V O;  4PDL A;  5LHH A;  1N32 O;  3BA8 A;  1FXK A;  3D3I A;  3BY6 A;  1JPX A;  2JRI A;  1QBZ A;  5LOV B;  4OXS A;  4O2B A;  1TAE A;  3N2G B;  5B1A B;  3EXA A;  4GX2 A;  4JI8 B;  3K5N A;  5EZY A;  1R6N A;  1YCI A;  2Z3Y A;  4J9Z B;  4TQF A;  3CCV V;  3UQ8 A;  1HNX O;  1O9G A;  1SKV A;  5EK0 A;  1R6T A;  3WFV A;  3ZCC A;  3LDE A;  2IH1 C;  4HYO A;  5D5Q A;  3OMI B;  2ITD C;  5CBH A;  3JD4 A;  2ZDI C;  1BMF G;  3K58 A;  2QWP B;  4X1K A;  2IU3 A;  3ZMT A;  4O4H B;  4FZ0 A;  1N33 B;  1VMG A;  1MSW D;  2WWW A;  2NLJ C;  1S77 D;  2V4D A;  3OFN G;  3ZMS A;  4WBN B;  2IJH A;  3HKB B;  5FNV A;  3JAM N;  3LSQ A;  2OT5 A;  4MTO A;  2WAM A;  5C93 A;  3Q4H B;  3QF7 A;  4HZ3 A;  2YEV B;  4OPA A;  3BRC A;  3QO8 A;  2EIL B;  3C90 A;  1KD1 W;  1IX9 A;  2A06 H;  2AXT Z;  1VF6 A;  4PJ0 Z;  2AZ0 A;  4B7E A;  2HJD A;  5LA6 B;  4TV8 B;  4NTX A;  4O2A B;  1T5E A;  2EBO A;  3JAL B;  4CS4 A;  5B1B B;  5JVD B;  4GX0 A;  3FFQ A;  1D5N A;  3UM7 A;  2CTQ A;  4QPJ A;  3FAV A;  1URF A;  2P6J A;  3R66 A;  4X9Q A;  4Q6G A;  4ZI7 B;  2PYJ A;  1P4R A;  3SYQ A;  1M4U A;  4LF5 B;  5DN6 G;  2JEX A;  3ICX A;  3L72 H;  1KYO F;  3DSQ A;  1M56 B;  1VF5 B;  3OMN B;  4X65 B;  1Y76 A;  1P7B A;  1H2L A;  4JF3 A;  1W0J G;  2W6J G;  5JH7 A;  2P7T C;  5L3G A;  3OR7 C;  4N21 A;  4FLU A;  4JV5 B;  1SF9 A;  2B9Z A;  2LP7 A;  2VQE O;  2ZM6 O;  2ZE6 A;  2P67 A;  1DK1 A;  3CCL V;  3E8G A;  2HR3 A;  4ASU G;  5GTI Z;  1ORQ C;  5GTH Z;  2RCV A;  4WFG A;  4PHZ A;  4LWS A;  3CYO A;  1XNR B;  3JYC A;  1VIB A;  1UPG A;  3CSX A;  2VRZ A;  3ABM C;  2PTM A;  3F7Y C;  1VQ4 V;  1ZSP A;  3JD3 A;  3ZRS A;  1KP2 A;  1GM7 A;  3TJT A;  4P2Z A;  2A7W A;  1FPO A;  4GKK B;  5LXT A;  4AQY B;  4LFB B;  1NS1 A;  3K0G A;  3OTO O;  2Q0O C;  3M7M X;  3OD4 A;  1XUQ A;  2XAG A;  3ZHQ A;  1IVS A;  4CC6 A;  2JK5 C;  1XEQ A;  5ITZ A;  1N34 B;  2IM9 A;  4H33 A;  4Z1V A;  5L3D A;  5H6R A;  1NR7 A;  1B3Q A;  3IFX A;  4JI5 O;  1BQ0 A;  1AJP A;  1JQ0 A;  1ENV A;  3VQV A;  5H6Q A;  2UXX A;  3VQY A;  3CD6 V;  3JAK A;  2UU9 B;  3TCU A;  2KG7 A;  2JGU A;  2P22 C;  4DUY O;  2WLI A;  1S5H C;  3RVY A;  4YJ2 B;  2W6I G;  5HFM A;  1BZK A;  1VQN V;  4X1I B;  3ZJZ A;  2P5O A;  3F5T A;  5J2U A;  3D3Q A;  1J5E O;  1H8E G;  3D36 C;  4KHP O;  2NR5 A;  1Y74 A; 
#chains in the Genus database with same CATH homology
 2HHH O;  1R1B A;  4DR2 O;  4LFC O;  1HNX O;  1R6T A;  4DUZ O;  4JI0 O;  4B3M O;  4GKK O;  4AQY O;  1IBK O;  4DV7 O;  4DR1 O;  4K0K O;  4OX9 O;  1IBM O;  1IBL O;  4B3R O;  4JI1 O;  1FYJ A;  4JI4 O;  4DR7 O;  2VQE O;  2ZM6 O;  2UU9 O;  4LF4 O;  4B3S O;  2UXB O;  4DV4 O;  5LMU O;  4DV6 O;  4YY3 O;  2UUA O;  1DK1 A;  1N34 O;  4JI2 O;  4JI7 O;  1A32 A;  4LF7 O;  4JI6 O;  1YZB A;  3SDL A;  4LF5 O;  5LL6 Y;  5LMN O;  2FKX A;  5BXZ A;  3T1H O;  3J7A U;  1KUQ A;  4B3T O;  2UXD O;  3RT3 C;  4NXM O;  4X66 O;  4A5U B;  5IWA O;  2DOS A;  4JYA O;  3J81 N;  5H5N A;  2VQF O;  3JAM N;  4X62 O;  4LF8 O;  4DV2 O;  2UUC O;  5BR8 O;  1N36 O;  4DV0 O;  3M8A A;  1HNW O;  2E5L O;  1G1X B;  1HNZ O;  2LW7 A;  3O65 A;  4LF9 O;  4LFA O;  1NS1 A;  4YHH O;  4GKJ O;  3OTO O;  4OPA A;  5A2Q N;  4DV5 O;  4JI8 O;  4JI3 O;  5BY1 A;  1XEQ A;  4NXN O;  4X65 O;  4DR4 O;  1XNR O;  4DR6 O;  1XMQ O;  2UUB O;  4DR5 O;  1F7Y A;  4JI5 O;  1D2D A;  4JV5 O;  1FJG O;  4DV3 O;  4DR3 O;  3J80 N;  2AGA A;  4OPH A;  1XNQ O;  1HR0 O;  2DJV A;  1I94 O;  2F4V O;  1N32 O;  1N33 O;  4LF6 O;  1XMO O;  5FLX N;  3R66 A;  4DUY O;  4LFB O;  4DV1 O;  2JRI A;  2UXC O;  3T1Y O;  2N74 A;  1X59 A;  2Z0A A;  2ZKO A;  3F5T A;  4X64 O;  1J5E O;  1FKA O;  5IT9 N;  1AIL A;  1AB3 A;  4KHP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...