3JAMN

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 41
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
N PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3jamN02
4JI5O 4OPHA 5LMNO 4JI4O 2E5LO 4K0KO 4DV6O 5FLXN 1AILA 1J5EO 4B3TO 3R66A 5IT9N 4YY3O 1A32A 1XMOO 1G1XB 4DV3O 4DR1O 5LMUO 4NXMO 4LF5O 5A2QN 3T1YO 4X66O 2UUBO 3JAMN 4JI0O 4AQYO 2UXCO 3RT3C 5BR8O 1KUQA 3J80N 2JRIA 4DV0O 4JYAO 4LFCO 2UXBO 4LF6O 2AGAA 4DR3O 4GKKO 5BXZA 3J81N 2VQEO 4DR7O 1N34O 4X65O 2ZM6O 2F4VO 1HNZO 4B3MO 4B3RO 1AB3A 1FKAO 1XNRO 4A5UB 4DV2O 3OTOO 2UUAO 1I94O 1X59A 2Z0AA 5H5NA 4DR6O 4X62O 4DUYO 4LF4O 1HNXO 4JI8O 1D2DA 5IWAO 2UU9O 4NXNO 1YZBA 4DV4O 1FYJA 4GKJO 4LFBO 4DR2O 1XEQA 4JI3O 4B3SO 1R6TA 3T1HO 1FJGO 4OX9O 4LF7O 2HHHO 5BY1A 2UXDO 3F5TA 1N33O 4JI6O 1IBLO 4LFAO 1R1BA 1DK1A 1N32O 4LF8O 1IBMO 1XNQO 4LF9O 1N36O 4YHHO 4DR4O 2LW7A 4DV1O 2DOSA 4DV5O 1HNWO 4DUZO 1XMQO 1HR0O 2UUCO 4DV7O 4KHPO 2N74A 1NS1A 4JV5O 1IBKO 2FKXA 3SDLA 3J7AU 3M8AA 2DJVA 1F7YA 5LL6Y 4JI7O 4JI1O 4JI2O 2VQFO 3O65A 4OPAA 2ZKOA 4DR5O 4X64O
chains in the Genus database with same CATH superfamily
3CEIA 3W7TA 1QVGU 2H8PC 2YIBD 1VQ8V 2QWOB 4JTCB 2E76B 5IT9N 2X0LA 4X9QA 5GONB 1S72V 4DV0B 1PD3A 2AZ0A 3AG2C 4DRXB 2YI8A 4LF6B 3RT3C 3H1HH 1KUQA 5IYDO 1NJIW 4UCVA 4DV0O 1ZL8B 3JYCA 4HBNA 4LF6O 2ITDC 3K06A 1NT2B 4DK0A 1TA8A 1XUQA 1IZ3A 1HNXB 4R7CA 3OAAG 1Q90D 2K1EA 2MW2B 4KHPB 2ZXWB 1HNXO 5GONA 3AG1B 5B5EZ 2BSKB 4D6TH 4DRXA 1UPGA 3FAVA 4HNAB 3VQVA 4QGPA 2A7WA 2XAHA 2XOKG 2XAGA 4UUJC 4JI6B 4ZI7B 2QKAA 1R6TA 3IGAC 4LFAB 1XL4A 1ZL8A 4FZ1A 1Q6HA 3A2FA 1RPRA 4JI6O 4TWKA 3ICXA 4LFAO 1Y6XA 1Y67A 1JJOA 4GUNA 4FLVA 3BY6A 1K5SA 2JDIG 1IBKB 3K0GA 3VQXA 2ADQB 4X8AA 1O9HA 1PV0A 4LH7A 3Q4HB 3K59A 3WB0A 1IBKO 1V55B 5EYPB 2FKXA 4K8ZA 4HNAA 3CHXA 1VQ9V 2ZDIC 3ZN0A 3AK1A 4GT1A 3K03A 4ZI7A 1XHZA 3E2EA 3C3SA 5LHIA 5LHGA 1VQNV 3JALB 5IYCO 1NZ6A 3LNNA 1FAFA 4OPHA 1EBOA 3QG5A 1M93A 1PL0A 5JJJB 3OE7G 3E8GA 4XDLA 1M90W 2BTQB 1SKVA 3OM3B 3SJAC 4I0XB 1D5AA 1VF6C 3Q4HA 2ZE8A 5EYPA 2GUZB 3J80N 4O4JB 2VQEB 4CS2A 3CRCA 4I5SA 3CXHF 4X1KA 2F95B 2VQEO 1I94B 2VWKA 4DR6B 5EBLC 1GN3A 1YSCA 1AJQA 1FKAO 4Z1VA 5CA0B 1F23A 1I94O 3KCXA 4GX1A 4DR6O 1WPXA 2CTPA 5GTHZ 2FB5A 3UQ8A 2BTQA 1SERA 4FM0A 1JQ0A 4I0XA 1OHHG 4K3AA 4MVOA 1ENVA 1DLBA 1PKXA 2GUZA 4Z1MG 1FYJA 2XASA 2PF4E 3LSUA 3TETA 2WLHA 4PDLA 1KKDA 3I56V 5IYBO 4H33A 4F4LA 3RYFB 3AG4C 1SC5B 4DV7B 3G80A 5CA0A 4IIJB 2PI4A 4DV7O 2KKWA 4FFKA 1RM1B 2Z3YA 1GM9A 2EIKB 2JGDB 3UO3A 2ZNJA 3FX7A 3CB2A 3DC6A 1ZTEA 4OPAA 1KC8W 1IVSA 1RFYA 4J7JA 2YXYA 2WA4A 3RYHB 1KD1W 4ZOLB 1K5QA 3SGIA 1WP8A 3AG4B 4J7ZA 2Q68A 3MAQA 2QR4A 1ZWIC 2OT5A 3CCEV 2GTAA 2OTLV 4WFGA 4KL1A 4RWUA 2HP8A 1N34B 3JD3A 2XUMA 3AK3A 5DECA 1Y4MA 4MVUA 1SZXA 3ABUA 5BXZA 1N34O 2QM8A 1RSOB 4LF4B 1QLNA 3CMEV 3RYHA 4JTDB 1WPBA 3D3QA 3W7WA 1K92A 4LF4O 2Q9LA 4UCUA 1VQPV 2QWQB 3PJSK 4G28B 3OGCC 1S5HC 4FVMA 3BCCH 4MTXA 4PD4F 1UJWB 2YEVA 2CH7A 1BL8A 1F51A 4JASA 1NQTA 1R6NA 3A0HZ 1IBMB 4YJ2B 4LF9B 3F5TA 1M1KW 4DR4B 3QO7A 1MSDA 2W0FC 4ICGA 1AP5A 1YDXA 1RSOA 2XAQA 2Y69C 3SPCA 3ZRXA 3W7XA 3CXCU 5EBWC 1IBMO 4LF9O 3WU2Z 5BMVB 4DR4O 4E2LA 3L71H 3IC9A 1NKDA 1VQ6V 3STLC 4JPRA 2HLDG 5K1XA 3K3WA 3JARB 4LH6A 4ZKIA 3SJCC 2FYUH 4WBNA 5LL6Y 4LWSB 3CRAA 4YJ3A 3OEHG 4XDJA 4J9YB 2CK3G 3CX5F 2Y0IA 4YJ2A 3LUTB 1BQZA 3AEIA 2Q7GA 2JS5A 3JCZA 1JX9A 5B1OA 5BMVA 2CGNA 3ABKB 3TK1A 1SQPH 2EILC 1S5LZ 3FB7C 2Y69B 1BMFG 1K3EA 3A8TA 4JYAB 1SQQH 1QR8A 3ABLC 5LGUA 3BHPA 3QTCA 3TCUA 1OCOB 2KSDA 1BCCH 3ZS8C 3FD9A 3EFFK 4TV9B 1QCEA 4JYAO 4LWSA 1XL6A 2JVDA 3JATB 1XDCA 4J11A 2AGAA 5KHHA 4DV2B 4I55A 1LUWA 4DYLA 1VQ5V 1VARA 2M6YA 3J81N 3K5NA 2CGOA 2BOBC 3SJQC 4FIPC 2MK3A 4EKWA 4DV2O 2IJKA 5KLVH 5FNVA 2YUAA 3BPZA 3C3TA 1Q3EA 2NR5A 1S3JA 3CPWU 4JI3B 1GO3F 1VQLV 1GN6A 2XTAA 1B06A 1I5XA 2EILB 1TVKB 5J2TB 4JI3O 1AR1B 2H94A 5KA5A 2ZE6A 4QIWF 1G6UA 3JATA 5L3BA 1KQSU 1JFFB 4RAIA 1H2KA 5KHKA 4NTWA 4P9PA 1SF9A 3VQYA 4JV5B 5LOVB 3ZHSA 1IURA 5D5QA 1OCRC 4YIOA 4UV8A 1JA8A 4JV5O 1VF7A 4JI1B 3CC4V 1W0JG 1K8AW 3ZHTA 2JGUA 1Z2GA 5J2TA 4TQFA 4UB6Z 4JI1O 2EZPA 2VQFO 4FFBA 2CUGA 4JAUA 2ETNA 1H2MA 2QM7A 3OTFA 5CMUA 1M57C 2EINC 4PJ0Z 5E1AC 5LOVA 4J9ZB 4BIUA 1FD9A 1WB8A 2JK5C 1M5IA 2CAZC 3BVOA 2AZ2A 3SPHA 1EZVH 1QBZA 1OCRB 3A0RA 3WFVA 4JYCA 1QQCA 4PDMA 3WG7B 4ZHQB 4B3MB 2ZQMA 3VOUA 1S77D 1YEWA 4CH6A 2X7RB 3JAWB 2RDCA 1FXKA 4B3MO 4PDRA 3FKSG 1VQMV 1YJWV 4ZIBA 1P49A 4TOIA 5CBHA 5AG2A 3SYCA 3CSXA 1V9PA 5FL7G 1D2DA 3ABMC 1R6KA 2DYRC 4I4TB 4LNUB 3ZIAG 5KUMA 1B04A 3OUSA 1Q86W 4X88A 4JAVA 3AG3C 4I50B 4PDVA 4LR3A 1AI5A 2WLJA 3HKEB 5JQGB 4QE7A 4MTOA 4X1IA 3JAWA 4I7ZB 1R1BA 1XHXA 3MHSC 1NH2B 2JEXA 1M9NA 3MHHC 1GAXA 2Q67A 1VP7A 4X66B 4UFZA 1W59A 4PA7A 1Q6UA 1YJ9V 4RUEA 1EZJA 4I4TA 2HG5C 2L6LA 3J7AU 4TV8A 4I50A 2BE3A 4JYBA 2DWDC 3HKEA 1WLEA 3TJTA 5JQGA 2BCCH 3EVKA 4MVZA 4LF5B 3T1YB 1O9GA 3ZX6A 1EN5A 1FXVA 1XMOO 5BR8B 3ZEDA 4LF5O 3T1YO 5LP6C 1QR9A 1WJZA 4X1YA 2JIZG 1JOYA 2IW5A 5BR8O 2JRIA 1GTOA 4RQEA 2ILMA 2EIMC 1ZAUA 1YVWA 2YS8A 4FPPA 1Z5WA 3U0ZA 3QO5A 2OYQA 4N21A 1CEZA 4X62B 4MVMA 4CS3A 4JTAB 1PM9A 1P4RA 3FB6C 1VMGA 2ADPA 5IDJA 2Z0AA 1TUBB 4X62O 1GN4A 2B9ZA 1THZA 4Q6GA 2NNUA 3SPGA 3JSLA 1L0NH 5FPRA 2RCVA 1YZBA 1YI2V 4TUYB 2UXNA 5B1AC 1IBLB 5LP6B 3RYIB 5L3DA 3ZHVA 2NN4A 3ZCCA 4YHHB 1IBLO 5KHIA 1NR1A 1HR0B 4QPKA 3UKMA 2PUSA 3P3PA 4YHHO 2DOSA 1HR0O 3APOA 2RN9A 2PYLA 4KHPO 2DQ3A 4H0LB 3HKDB 3AG2B 2A3QA 4TUYA 4DXWA 4GX0A 1JMKC 3D36A 1OV9A 1YTFB 1YF2A 5HFLA 3RYIA 5B3SC 1GM8A 4G2KA 3ASOC 3CMAV 5B1AB 1AI6A 2Y0PA 2ODMA 1L0LH 5EIBD 2CTWA 4AI8A 5TISZ 1YIJV 3STZC 1W2BU 1PL4A 2HJFC 2BSKA 1G1XB 4PA4A 2OWOA 4KXRA 4FJCC 1KP2A 3ETDA 3JD0A 3HKDA 1HDJA 4MVRA 2QDOA 1KYOF 3OFNG 1IXBA 4R8CA 1I0HA 5JJNB 1KBHA 4XDKA 2XT9A 3NXSA 5CBGA 2D3OW 5B3SB 2A79B 2HVJC 4Q20A 2AHZA 3DGEA 4U7NA 1T5EA 2BTOA 1OCZC 3CS5A 4OX9B 2GDSA 4J42A 1N33B 1EM1A 5E79Z 3JAKB 1Y74B 3JALA 4OX9O 3IAYA 2JJ2G 2WSSG 1NR7A 1N33O 1SZTA 5KX5B 3ZMSA 4FLUA 1AROP 4GYCB 4LBEC 4JAAA 3M99B 5LYJB 1HWYA 2WLKA 1US6A 2DWEC 4TT3G 4O4JA 3CC7V 3JD4A 4JI2B 5ITZB 3AG7A 4RQFA 4G27B 5CA3A 1TGOA 3K9AA 1IXMA 2ZDIA 1Y74A 4D7SA 4H37A 4JI2O 3BFRA 4BWAA 1SQBH 2V1DA 1E1RG 5EZYB 4YY3B 3I55V 4NVPA 5KX5A 1RPOA 2P22C 1K33A 2QKSA 3GWKC 1QLEC 1QVFU 4YY3O 4BW9A 1V54C 5LYJA 5A2QN 5FPOA 1SA0B 2Y48A 4TQDA 3ZBHA 1W0KG 5ITZA 5IYZB 4IT5A 3ETQA 2ZNIA 4O2BB 1H38A 1KB9F 1HNZB 2R70A 4U3FH 2F66C 4X20B 2GSMB 2Q0AA 4UVAA 3RYFA 2WLMA 1JJ2U 4BIZA 4CH3A 2DN9A 4FLZA 3KZIZ 5EC2C 2QEXV 4NTXA 5EZYA 3RWRD 1HNZO 4PI2A 2JS3A 4IIJA 4A5UB 5IWAB 4O2AB 1TUEB 5DM6V 1FFXB 3K5MA 1M56C 4P2ZA 3ZRVA 4O4HB 4C7UA 3ZHUA 5IWAO 4K35A 1VIBA 4B3SB 3B8NA 4MS2A 2P5OA 1GKFA 2JGDA 4B7KA 1PNMA 5IYZA 4B3SO 3SPIA 2DE0X 4WCEV 4EFEA 1I5YA 1K4CC 3KG2A 2PY5A 1NH2D 4ZOLA 4PHZA 3SR2C 5KMGB 3SJBC 2N05A 1FFXA 2V7QG 3T4DA 4O4HA 2YXLA 2YICA 2IU0A 1VQ4V 2X6BA 2DJVA 1G8MA 4FLTA 1VEWA 1ROPA 1FPOA 3UM7A 4H13B 3E22B 3CCUV 4W4KA 3SYPA 4BR6A 4NR1A 4J7KA 2V4DA 5KMGA 4MTGA 1BZKA 1OJHA 4Z2WA 3E8FA 2JJ1G 4OXSA 2QKCA 2OCHA 2IBZH 2F43G 4CC5A 1BHAA 2XAJA 1N8RW 5JCOC 5JJEB 1K73W 2CTQA 3CYOA 5KAIZ 3F7YC 4F6RB 1AJPA 1N4CA 3E22A 2CTRA 4IYIA 3AK2A 4W4LA 3K04A 3N2GB 2QTOA 4GCZA 2DW4A 4DW0A 3B8MA 3UCSC 2ZR3A 2UU9B 3DC5A 1I08A 2PTMA 3CRMA 3JARA 4DR2B 4FM2A 3ZMUA 2RNBA 3CCSV 2UU9O 4KP4A 2Z5UA 4U3JB 3OMAB 3RYCB 3DSQA 5LBQA 4DR2O 1XEQA 5J2UB 1NTZH 1BSMA 1K4DC 4FLXA 2F23A 4L8JA 2PYJA 4F6RA 1ZSPA 4DV5B 3ABTA 4WFHA 1AI4A 3N2GA 4CS4A 1JVMA 4DV5O 1K34A 3OW2U 3OD4A 2XHBA 2UXXA 1NTMH 1P7BA 4JI7B 1MA1A 4TV9A 2GBOA 2N04A 3ABLB 3UO2A 4U3JA 1QNMA 5CB4B 1K9MW 1YTFD 2D2CB 3RYCA 4FLYA 4WFEA 3M8AA 2WPDG 2QWPB 1F7YA 5J2UA 4JI7O 4DR5B 3E83A 1XREA 2Y4TA 2LFRA 3O65A 4DV6B 3WB1A 2QWNB 1ORQC 4DR5O 2VWJA 1FXKC 3HR0A 4DV6O 4JI0B 3H1JH 1Q6IA 5C8YB 2YI9A 2L35A 2QA4V 3LSQA 2W6JG 4D7TA 1TVKA 1JR9A 2EIJC 1S5JA 4JI0O 2IH1C 3G71V 2DYSC 5CB4A 2LO1A 4UB8Z 2LFSA 1WA8B 1JFFA 3FB5C 2OCCC 3IFXA 2GTSA 3ZHQA 4HAMA 3ETEA 2LGWA 1R3IC 2X6CA 1K7DA 1F4MA 4MT8A 4X89A 1OCCC 4MVQA 3QF7A 2WLIB 3R65A 4NXNB 3FB8C 3ASNC 3U11A 4EEQA 3WB2A 5C8YA 1Z5VA 1Q81W 3JD2A 4LFBB 1VQKV 4NXNO 5HFMA 2BOCC 1AI7A 3CWBH 3RN4A 2ZT9B 3FYEB 4QE9A 2KB1A 4AILC 4LFBO 1WA8A 2EIJB 2IM9A 3RVZA 2Q7HA 1N32B 2DYSB 4QPJA 4UCOA 3UT5B 4DV1B 4JI5B 3CRQA 1MG1A 2LJ2A 4JF3A 1PP9H 1N32O 5JWPA 1M57B 5GTIZ 2EBOA 3ZMZA 2EINB 4DV1O 3S3XA 3JD1A 2WLIA 5L3CA 1VQ7V 1BT8A 3P3NA 4R50A 4BAYA 3LDDA 2WLLB 1H2LA 4P9OA 2DMXA 4PELA 4ZHQA 5L3GA 2WWWA 3OR7C 1L8DA 1B6QA 3CCVV 1VF5B 4K0KB 2ZE5A 1COWG 3UT5A 1J5EB 1ZX3A 4B3TB 1LNQA 3X2QC 1DTOA 4K0KO 1H2GA 1SESA 4IL6Z 1J5EO 2YXHA 4B3TO 1JCHA 4LNUA 5JVDB 1KMIZ 4X66O 3L73H 2WLLA 1FS0G 5IJ9B 2UXBB 3ABMB 3ZN1A 2DYRB 2ARHA 4GKKB 2P7TC 2UXBO 3L72H 1BHBA 1SS3A 2VRZA 3HB3B 3JCUZ 3AG3B 3HPLC 2YIAA 3K57A 3H1IH 1NVPB 3BA8A 4GKKO 5IJ0B 3QVNA 2EJ7A 4UCSA 1S76D 4TSFG 1NBMG 1IDSA 2WLNA 3BEHA 5H5NA 5JVDA 1CP9A 3M7MX 3L9DA 5IJ9A 1U97A 1Y76B 2GV9A 3BRCA 4ASUG 2P4VA 3ML0A 4GZRB 3VQWA 3E35A 5LGTA 1NU1H 1HW7A 2HEPA 5KHJA 3U10A 5IJ0A 5LA6B 1CXZB 5D5PA 3IC7A 4CC6A 3SYOA 2OIEA 2ZXWC 2EULA 2PI5A 3AG1C 4E4EA 2CE4A 1H2SB 3CC2V 3RGBA 1GRJA 2M7WA 2IJJA 1Y76A 3SDLA 3FAVB 5JH7B 2EIMB 3L74H 3GB7C 1WP7A 2WA3A 3GWOA 1KKCA 3EHBB 3E86A 1Q8IA 2QJ1A 1AR4A 1FFTB 4FK5C 3H9VA 4DV3B 4NXMB 1TUBA 1MABG 5LA6A 1Q7YW 3KCYA 1RP3B 4YXWG 4MW3A 2W0XA 5B1NA 2FTKA 3SYQA 4DV3O 4NXMO 3TXSA 4O4IB 4LFCB 1V55C 4MW8A 5LP6A 1EN4A 4JZGA 2KG7B 2VS0A 4LFCO 5JH7A 2R72A 1G4YB 2Q7EA 2UUAB 1BGYH 3JASB 2GHYA 2OIGA 3CD6V 2UUAO 1KU9A 1XOUA 2H3OA 1LUVA 2IJHA 2W6IG 1GK9A 4O4IA 3ZMTA 1AJNA 1FJGB 3B77A 3CE2A 3D8CA 4WFBV 1R3KC 2KG7A 1L1FA 5BZBA 1PNLA 2YIDA 1FJGO 2P06A 3DXRB 4GLXA 3ASOB 2ZE7A 2K9PA 1U96A 3JASA 1JPXA 2HJDA 2E3CA 4X1KB 2AXTZ 5LXTB 4WFFA 2YSUB 1N0NA 1DF4A 1R3JC 1ZLZA 4ABMA 1WNSA 1R3LC 1QHTA 5C93A 3CCMV 2IU3A 3DXRA 2ZKOA 1SQVH 3W7SA 3E8BA 1E1QG 1DGSA 5LMUB 3P32A 1GM7A 2HFEC 3MDSA 1AILA 5LXTA 4FZ0A 2UXCB 2PZSA 5LMUO 3OR6C 4UCRA 4RUFA 1OCZB 3CRRA 4R6ZA 2ZCEA 4JZ2A 3T2MA 1RM1C 2WAMA 3JAKA 2UXCO 4CZZA 4DR3B 2EIKC 1I7FA 1XBLA 5H6RA 4DR7B 4MTFA 1F4NA 1SQFA 4B3RB 4UVCA 1XNRB 1MNGA 4DR3O 1SRYA 4EFBA 4DR7O 5GW7A 4HYOA 4DUYB 5K1PA 1S0VA 3T4ZA 2YC0A 4ZBMA 4B3RO 1XNRO 2RJZA 4JI8B 3HKCB 4DUYO 3LNMB 1VF6A 3K9SA 4LP8A 4JI8O 4NKGB 3P30A 4LC1A 3FFQA 1X4TA 1HP8A 2UXDB 2O57A 3DTUB 4L87A 3LDEA 3K58A 2B5UA 2Y4UA 1IX9A 1AR5A 4UCTA 4N23A 5KHGA 4FLWA 4CH4A 1MOFA 2UXDO 5CN0A 2HR3A 1PNKA 4FMTA 1DF5A 3FYIB 2Q4PA 3G6BA 2A9HA 1YCIA 2Q73A 4QJFB 1SA0A 2OTJV 1QLEB 3HKCA 3K79A 2G38A 1V54B 2N74A 1B3QA 4O2BA 1YXBA 4X20A 3QNEA 1XI1A 4IHJB 2YEVB 2CH7B 5LMNB 2R9IA 4LCUC 4JI4B 2E5LB 2FL4A 4PI0A 3ZRWB 4EB6B 4P30A 3F5WC 4O2AA 1AP6A 4J80A 3T1CA 2ZINA 4DR1B 4MSWC 2B1IA 5LMNO 4JI4O 3K5OA 4NB5A 2E5LO 3ETGA 1SETA 4AQYB 1EFRG 2FMLA 3CCLV 2X6AA 4DR1O 4B7EA 1M56B 2F93B 4XBFA 3GVMA 4H44B 4NYKA 4AQYO 4BW5A 1AVMA 5KUKA 2LGQA 4AHCA 4IHJA 1H8HG 5EC1C 1NVPD 4IYHA 4BIOA 2C2AA 4WBNB 3ZRWA 4EB6A 2AHYA 4YJ3B 1D5NA 4UXNA 4YIPA 5EIBC 3BAAA 3ABKC 3OUFA 4PA6A 3IJ4A 1YITV 2YIBA 4DV4B 4WFAV 5L3EA 1WB7A 4UVBA 3BA9A 4J41A 1XILA 4PV1B 1OCOC 3ZHRA 1P84F 1WN7A 3G67A 4LF7B 4QNHB 4DV4O 3H1LH 4K8XA 2E74B 3C90A 4B08A 2EX3A 1XQ8A 2XNDG 4LF7O 1XNQB 1N36B 3N27A 2QE7G 1HNWB 2R9RB 1XMQB 4I55B 2Q6AA 3H1KH 1XNQO 5LHHA 1N36O 3SYAA 2LW7A 2P90A 1E79G 1NTKH 1HNWO 1XMQO 2YDEA 1BE3H 3CCQV 1M4UA 2HVKC 5FNVB 2IH3C 1NI8A 1GMGA 1OZ0A 3ZJZA 1Q82W 1YJNV 2ZD9A 3K5LA 1WAZA 1KECA 3EXAA 2B1GA 3JSNA 4DO2A 3KKYA 3HKBB 4O4LB 3B09A 3N2KB 1ZUQA 3LSSA 3CCJV 3LDCA 2CDYA 3R66A 3ZMVA 3CCRV 3RW0A 4I9QA 2ZIOA 3BABA 1P7GA 5H6QA 4F6EA 3OGIB 3S3WA 5L3FA 1KP3A 2ZIMA 3H01A 3QO8A 2A0LA 2P67A 3CP1A 3K08A 4X65B 2ZM6B 4KFMA 5JCOA 1R73A 3OTOB 4GX2A 4KUMA 4FM1A 3HKBA 4UV9A 4X65O 2ATKC 4O4LA 2ZM6O 4FFBB 2R9AA 3E89A 3N2KA 3OTOO 2QWRB 4JYYA 3ZRSA 3F7VC 1UFIA 2AW9A 3T1HB 2IJIA 3RVYA 4HZ3A 3WG7C 2ZR2A 2QSAA 3APQA 2VQFB 3T1HO 4LF8B 4OGQB 1BS3A 1MSWD 2F1MA 2Q8VA 3O9OA 2LQTA 1DK1A 4LF8O 1N0JA 5B66Z 1FXKB 5H9CA 4IGGA 3THOA 1TAEA 4J10A 1NS1A 2P6JA 1CPYA 2KQXA 5LGNA 4CH5A 1GN2A 1URFA 3B40A 3D3IA 1YHQV 4X64B 5CA1B 1K97A 2OCCB 5IE9A 3OT7A 2RMKB 2QGNA 4X64O 5CBFA 4JI5O 1QU7A 4I9WA 2Q0OC 1LR1A 2UUBB 2Q5ZA 5FLXN 4X1IB 5DEDA 1OCCB 3VBBA 2HKOA 1A32A 3ASNB 1SQGA 2UUBO 3JAMN 2P4KA 3RFRA 4MVSA 3B2EE 1Q5OA 3CJHB 3I5DA 3OMIB 5F2VO 3L75H 1MZFA 2EZOA 4PA3A 1H8EG 2F4VB 1EN6A 5CA1A 1BQ0A 3NR7A 2RQ6A 1VQOV 1H2NA 4TV8B 5J9PC 2F4VO 5A9GA 5B1BC 1AB3A 1MZEA 2LW1A 2PGGA 2XAFA 1X59A 3W7UA 4NTYA 4GKJB 2LP7A 5KA6A 1FXHA 1GH6A 2QM4A 4WF9V 3CJHA 5IY5C 2HHHB 1Y66A 2ITCC 3G6EV 4GKJO 4JGSA 4X1YB 3TXQA 4PA9A 5EBMC 2HHHO 5BY1A 3PN1A 2JEUA 4DUZB 3L70H 2EJRA 4CBCA 3A0BZ 2A06H 2NLJC 3G4SV 4GX5A 2UUCB 5H2FZ 3X2QB 5KAFZ 1XMOB 4DK1A 2E75B 4DUZO 3B4SA 4RO2A 5EK0A 3SPJA 2Q69A 2UUCO 5B1BB 3RBZA 3MD0A 1Q43A 1MMMA 1PPJH 1J95A 2DQ0A 3TGUH 3D36C 4DW1A 1SQXH 3OMNB 5DN6G 2QTSA 3OEEG 5IY5B 4U7OA 3K0DA 3E8HA
chains in the Genus database with same CATH topology
4JI5O 4OPHA 5LMNO 4JI4O 2E5LO 4K0KO 4DV6O 5FLXN 1AILA 1J5EO 4B3TO 3R66A 5IT9N 4YY3O 1A32A 1XMOO 1G1XB 4DV3O 4DR1O 5LMUO 4NXMO 4LF5O 5A2QN 3T1YO 4X66O 2UUBO 3JAMN 4JI0O 4AQYO 2UXCO 3RT3C 5BR8O 1KUQA 3J80N 2JRIA 4DV0O 4JYAO 4LFCO 2UXBO 4LF6O 2AGAA 4DR3O 4GKKO 5BXZA 3J81N 2VQEO 4DR7O 1N34O 4X65O 2ZM6O 2F4VO 1HNZO 4B3MO 4B3RO 1AB3A 1FKAO 1XNRO 4A5UB 4DV2O 3OTOO 2UUAO 1I94O 1X59A 2Z0AA 5H5NA 4DR6O 4X62O 4DUYO 4LF4O 1HNXO 4JI8O 1D2DA 5IWAO 2UU9O 4NXNO 1YZBA 4DV4O 1FYJA 4GKJO 4LFBO 4DR2O 1XEQA 4JI3O 4B3SO 1R6TA 3T1HO 1FJGO 4OX9O 4LF7O 2HHHO 5BY1A 2UXDO 3F5TA 1N33O 4JI6O 1IBLO 4LFAO 1R1BA 1DK1A 1N32O 4LF8O 1IBMO 1XNQO 4LF9O 1N36O 4YHHO 4DR4O 2LW7A 4DV1O 2DOSA 4DV5O 1HNWO 4DUZO 1XMQO 1HR0O 2UUCO 4DV7O 4KHPO 2N74A 1NS1A 4JV5O 1IBKO 2FKXA 3SDLA 3J7AU 3M8AA 2DJVA 1F7YA 5LL6Y 4JI7O 4JI1O 4JI2O 2VQFO 3O65A 4OPAA 2ZKOA 4DR5O 4X64O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 O;  4OPH A;  5LMN O;  4JI4 O;  2E5L O;  4K0K O;  4DV6 O;  5FLX N;  1AIL A;  1J5E O;  4B3T O;  3R66 A;  5IT9 N;  4YY3 O;  1A32 A;  1XMO O;  1G1X B;  4DV3 O;  4DR1 O;  5LMU O;  4NXM O;  4LF5 O;  5A2Q N;  3T1Y O;  4X66 O;  2UUB O;  3JAM N;  4JI0 O;  4AQY O;  2UXC O;  3RT3 C;  5BR8 O;  1KUQ A;  3J80 N;  2JRI A;  4DV0 O;  4JYA O;  4LFC O;  2UXB O;  4LF6 O;  2AGA A;  4DR3 O;  4GKK O;  5BXZ A;  3J81 N;  2VQE O;  4DR7 O;  1N34 O;  4X65 O;  2ZM6 O;  2F4V O;  1HNZ O;  4B3M O;  4B3R O;  1AB3 A;  1FKA O;  1XNR O;  4A5U B;  4DV2 O;  3OTO O;  2UUA O;  1I94 O;  1X59 A;  2Z0A A;  5H5N A;  4DR6 O;  4X62 O;  4DUY O;  4LF4 O;  1HNX O;  4JI8 O;  1D2D A;  5IWA O;  2UU9 O;  4NXN O;  1YZB A;  4DV4 O;  1FYJ A;  4GKJ O;  4LFB O;  4DR2 O;  1XEQ A;  4JI3 O;  4B3S O;  1R6T A;  3T1H O;  1FJG O;  4OX9 O;  4LF7 O;  2HHH O;  5BY1 A;  2UXD O;  3F5T A;  1N33 O;  4JI6 O;  1IBL O;  4LFA O;  1R1B A;  1DK1 A;  1N32 O;  4LF8 O;  1IBM O;  1XNQ O;  4LF9 O;  1N36 O;  4YHH O;  4DR4 O;  2LW7 A;  4DV1 O;  2DOS A;  4DV5 O;  1HNW O;  4DUZ O;  1XMQ O;  1HR0 O;  2UUC O;  4DV7 O;  4KHP O;  2N74 A;  1NS1 A;  4JV5 O;  1IBK O;  2FKX A;  3SDL A;  3J7A U;  3M8A A;  2DJV A;  1F7Y A;  5LL6 Y;  4JI7 O;  4JI1 O;  4JI2 O;  2VQF O;  3O65 A;  4OPA A;  2ZKO A;  4DR5 O;  4X64 O; 
#chains in the Genus database with same CATH topology
 3CEI A;  3W7T A;  1QVG U;  2H8P C;  2YIB D;  1VQ8 V;  2QWO B;  4JTC B;  2E76 B;  5IT9 N;  2X0L A;  4X9Q A;  5GON B;  1S72 V;  4DV0 B;  1PD3 A;  2AZ0 A;  3AG2 C;  4DRX B;  2YI8 A;  4LF6 B;  3RT3 C;  3H1H H;  1KUQ A;  5IYD O;  1NJI W;  4UCV A;  4DV0 O;  1ZL8 B;  3JYC A;  4HBN A;  4LF6 O;  2ITD C;  3K06 A;  1NT2 B;  4DK0 A;  1TA8 A;  1XUQ A;  1IZ3 A;  1HNX B;  4R7C A;  3OAA G;  1Q90 D;  2K1E A;  2MW2 B;  4KHP B;  2ZXW B;  1HNX O;  5GON A;  3AG1 B;  5B5E Z;  2BSK B;  4D6T H;  4DRX A;  1UPG A;  3FAV A;  4HNA B;  3VQV A;  4QGP A;  2A7W A;  2XAH A;  2XOK G;  2XAG A;  4UUJ C;  4JI6 B;  4ZI7 B;  2QKA A;  1R6T A;  3IGA C;  4LFA B;  1XL4 A;  1ZL8 A;  4FZ1 A;  1Q6H A;  3A2F A;  1RPR A;  4JI6 O;  4TWK A;  3ICX A;  4LFA O;  1Y6X A;  1Y67 A;  1JJO A;  4GUN A;  4FLV A;  3BY6 A;  1K5S A;  2JDI G;  1IBK B;  3K0G A;  3VQX A;  2ADQ B;  4X8A A;  1O9H A;  1PV0 A;  4LH7 A;  3Q4H B;  3K59 A;  3WB0 A;  1IBK O;  1V55 B;  5EYP B;  2FKX A;  4K8Z A;  4HNA A;  3CHX A;  1VQ9 V;  2ZDI C;  3ZN0 A;  3AK1 A;  4GT1 A;  3K03 A;  4ZI7 A;  1XHZ A;  3E2E A;  3C3S A;  5LHI A;  5LHG A;  1VQN V;  3JAL B;  5IYC O;  1NZ6 A;  3LNN A;  1FAF A;  4OPH A;  1EBO A;  3QG5 A;  1M93 A;  1PL0 A;  5JJJ B;  3OE7 G;  3E8G A;  4XDL A;  1M90 W;  2BTQ B;  1SKV A;  3OM3 B;  3SJA C;  4I0X B;  1D5A A;  1VF6 C;  3Q4H A;  2ZE8 A;  5EYP A;  2GUZ B;  3J80 N;  4O4J B;  2VQE B;  4CS2 A;  3CRC A;  4I5S A;  3CXH F;  4X1K A;  2F95 B;  2VQE O;  1I94 B;  2VWK A;  4DR6 B;  5EBL C;  1GN3 A;  1YSC A;  1AJQ A;  1FKA O;  4Z1V A;  5CA0 B;  1F23 A;  1I94 O;  3KCX A;  4GX1 A;  4DR6 O;  1WPX A;  2CTP A;  5GTH Z;  2FB5 A;  3UQ8 A;  2BTQ A;  1SER A;  4FM0 A;  1JQ0 A;  4I0X A;  1OHH G;  4K3A A;  4MVO A;  1ENV A;  1DLB A;  1PKX A;  2GUZ A;  4Z1M G;  1FYJ A;  2XAS A;  2PF4 E;  3LSU A;  3TET A;  2WLH A;  4PDL A;  1KKD A;  3I56 V;  5IYB O;  4H33 A;  4F4L A;  3RYF B;  3AG4 C;  1SC5 B;  4DV7 B;  3G80 A;  5CA0 A;  4IIJ B;  2PI4 A;  4DV7 O;  2KKW A;  4FFK A;  1RM1 B;  2Z3Y A;  1GM9 A;  2EIK B;  2JGD B;  3UO3 A;  2ZNJ A;  3FX7 A;  3CB2 A;  3DC6 A;  1ZTE A;  4OPA A;  1KC8 W;  1IVS A;  1RFY A;  4J7J A;  2YXY A;  2WA4 A;  3RYH B;  1KD1 W;  4ZOL B;  1K5Q A;  3SGI A;  1WP8 A;  3AG4 B;  4J7Z A;  2Q68 A;  3MAQ A;  2QR4 A;  1ZWI C;  2OT5 A;  3CCE V;  2GTA A;  2OTL V;  4WFG A;  4KL1 A;  4RWU A;  2HP8 A;  1N34 B;  3JD3 A;  2XUM A;  3AK3 A;  5DEC A;  1Y4M A;  4MVU A;  1SZX A;  3ABU A;  5BXZ A;  1N34 O;  2QM8 A;  1RSO B;  4LF4 B;  1QLN A;  3CME V;  3RYH A;  4JTD B;  1WPB A;  3D3Q A;  3W7W A;  1K92 A;  4LF4 O;  2Q9L A;  4UCU A;  1VQP V;  2QWQ B;  3PJS K;  4G28 B;  3OGC C;  1S5H C;  4FVM A;  3BCC H;  4MTX A;  4PD4 F;  1UJW B;  2YEV A;  2CH7 A;  1BL8 A;  1F51 A;  4JAS A;  1NQT A;  1R6N A;  3A0H Z;  1IBM B;  4YJ2 B;  4LF9 B;  3F5T A;  1M1K W;  4DR4 B;  3QO7 A;  1MSD A;  2W0F C;  4ICG A;  1AP5 A;  1YDX A;  1RSO A;  2XAQ A;  2Y69 C;  3SPC A;  3ZRX A;  3W7X A;  3CXC U;  5EBW C;  1IBM O;  4LF9 O;  3WU2 Z;  5BMV B;  4DR4 O;  4E2L A;  3L71 H;  3IC9 A;  1NKD A;  1VQ6 V;  3STL C;  4JPR A;  2HLD G;  5K1X A;  3K3W A;  3JAR B;  4LH6 A;  4ZKI A;  3SJC C;  2FYU H;  4WBN A;  5LL6 Y;  4LWS B;  3CRA A;  4YJ3 A;  3OEH G;  4XDJ A;  4J9Y B;  2CK3 G;  3CX5 F;  2Y0I A;  4YJ2 A;  3LUT B;  1BQZ A;  3AEI A;  2Q7G A;  2JS5 A;  3JCZ A;  1JX9 A;  5B1O A;  5BMV A;  2CGN A;  3ABK B;  3TK1 A;  1SQP H;  2EIL C;  1S5L Z;  3FB7 C;  2Y69 B;  1BMF G;  1K3E A;  3A8T A;  4JYA B;  1SQQ H;  1QR8 A;  3ABL C;  5LGU A;  3BHP A;  3QTC A;  3TCU A;  1OCO B;  2KSD A;  1BCC H;  3ZS8 C;  3FD9 A;  3EFF K;  4TV9 B;  1QCE A;  4JYA O;  4LWS A;  1XL6 A;  2JVD A;  3JAT B;  1XDC A;  4J11 A;  2AGA A;  5KHH A;  4DV2 B;  4I55 A;  1LUW A;  4DYL A;  1VQ5 V;  1VAR A;  2M6Y A;  3J81 N;  3K5N A;  2CGO A;  2BOB C;  3SJQ C;  4FIP C;  2MK3 A;  4EKW A;  4DV2 O;  2IJK A;  5KLV H;  5FNV A;  2YUA A;  3BPZ A;  3C3T A;  1Q3E A;  2NR5 A;  1S3J A;  3CPW U;  4JI3 B;  1GO3 F;  1VQL V;  1GN6 A;  2XTA A;  1B06 A;  1I5X A;  2EIL B;  1TVK B;  5J2T B;  4JI3 O;  1AR1 B;  2H94 A;  5KA5 A;  2ZE6 A;  4QIW F;  1G6U A;  3JAT A;  5L3B A;  1KQS U;  1JFF B;  4RAI A;  1H2K A;  5KHK A;  4NTW A;  4P9P A;  1SF9 A;  3VQY A;  4JV5 B;  5LOV B;  3ZHS A;  1IUR A;  5D5Q A;  1OCR C;  4YIO A;  4UV8 A;  1JA8 A;  4JV5 O;  1VF7 A;  4JI1 B;  3CC4 V;  1W0J G;  1K8A W;  3ZHT A;  2JGU A;  1Z2G A;  5J2T A;  4TQF A;  4UB6 Z;  4JI1 O;  2EZP A;  2VQF O;  4FFB A;  2CUG A;  4JAU A;  2ETN A;  1H2M A;  2QM7 A;  3OTF A;  5CMU A;  1M57 C;  2EIN C;  4PJ0 Z;  5E1A C;  5LOV A;  4J9Z B;  4BIU A;  1FD9 A;  1WB8 A;  2JK5 C;  1M5I A;  2CAZ C;  3BVO A;  2AZ2 A;  3SPH A;  1EZV H;  1QBZ A;  1OCR B;  3A0R A;  3WFV A;  4JYC A;  1QQC A;  4PDM A;  3WG7 B;  4ZHQ B;  4B3M B;  2ZQM A;  3VOU A;  1S77 D;  1YEW A;  4CH6 A;  2X7R B;  3JAW B;  2RDC A;  1FXK A;  4B3M O;  4PDR A;  3FKS G;  1VQM V;  1YJW V;  4ZIB A;  1P49 A;  4TOI A;  5CBH A;  5AG2 A;  3SYC A;  3CSX A;  1V9P A;  5FL7 G;  1D2D A;  3ABM C;  1R6K A;  2DYR C;  4I4T B;  4LNU B;  3ZIA G;  5KUM A;  1B04 A;  3OUS A;  1Q86 W;  4X88 A;  4JAV A;  3AG3 C;  4I50 B;  4PDV A;  4LR3 A;  1AI5 A;  2WLJ A;  3HKE B;  5JQG B;  4QE7 A;  4MTO A;  4X1I A;  3JAW A;  4I7Z B;  1R1B A;  1XHX A;  3MHS C;  1NH2 B;  2JEX A;  1M9N A;  3MHH C;  1GAX A;  2Q67 A;  1VP7 A;  4X66 B;  4UFZ A;  1W59 A;  4PA7 A;  1Q6U A;  1YJ9 V;  4RUE A;  1EZJ A;  4I4T A;  2HG5 C;  2L6L A;  3J7A U;  4TV8 A;  4I50 A;  2BE3 A;  4JYB A;  2DWD C;  3HKE A;  1WLE A;  3TJT A;  5JQG A;  2BCC H;  3EVK A;  4MVZ A;  4LF5 B;  3T1Y B;  1O9G A;  3ZX6 A;  1EN5 A;  1FXV A;  1XMO O;  5BR8 B;  3ZED A;  4LF5 O;  3T1Y O;  5LP6 C;  1QR9 A;  1WJZ A;  4X1Y A;  2JIZ G;  1JOY A;  2IW5 A;  5BR8 O;  2JRI A;  1GTO A;  4RQE A;  2ILM A;  2EIM C;  1ZAU A;  1YVW A;  2YS8 A;  4FPP A;  1Z5W A;  3U0Z A;  3QO5 A;  2OYQ A;  4N21 A;  1CEZ A;  4X62 B;  4MVM A;  4CS3 A;  4JTA B;  1PM9 A;  1P4R A;  3FB6 C;  1VMG A;  2ADP A;  5IDJ A;  2Z0A A;  1TUB B;  4X62 O;  1GN4 A;  2B9Z A;  1THZ A;  4Q6G A;  2NNU A;  3SPG A;  3JSL A;  1L0N H;  5FPR A;  2RCV A;  1YZB A;  1YI2 V;  4TUY B;  2UXN A;  5B1A C;  1IBL B;  5LP6 B;  3RYI B;  5L3D A;  3ZHV A;  2NN4 A;  3ZCC A;  4YHH B;  1IBL O;  5KHI A;  1NR1 A;  1HR0 B;  4QPK A;  3UKM A;  2PUS A;  3P3P A;  4YHH O;  2DOS A;  1HR0 O;  3APO A;  2RN9 A;  2PYL A;  4KHP O;  2DQ3 A;  4H0L B;  3HKD B;  3AG2 B;  2A3Q A;  4TUY A;  4DXW A;  4GX0 A;  1JMK C;  3D36 A;  1OV9 A;  1YTF B;  1YF2 A;  5HFL A;  3RYI A;  5B3S C;  1GM8 A;  4G2K A;  3ASO C;  3CMA V;  5B1A B;  1AI6 A;  2Y0P A;  2ODM A;  1L0L H;  5EIB D;  2CTW A;  4AI8 A;  5TIS Z;  1YIJ V;  3STZ C;  1W2B U;  1PL4 A;  2HJF C;  2BSK A;  1G1X B;  4PA4 A;  2OWO A;  4KXR A;  4FJC C;  1KP2 A;  3ETD A;  3JD0 A;  3HKD A;  1HDJ A;  4MVR A;  2QDO A;  1KYO F;  3OFN G;  1IXB A;  4R8C A;  1I0H A;  5JJN B;  1KBH A;  4XDK A;  2XT9 A;  3NXS A;  5CBG A;  2D3O W;  5B3S B;  2A79 B;  2HVJ C;  4Q20 A;  2AHZ A;  3DGE A;  4U7N A;  1T5E A;  2BTO A;  1OCZ C;  3CS5 A;  4OX9 B;  2GDS A;  4J42 A;  1N33 B;  1EM1 A;  5E79 Z;  3JAK B;  1Y74 B;  3JAL A;  4OX9 O;  3IAY A;  2JJ2 G;  2WSS G;  1NR7 A;  1N33 O;  1SZT A;  5KX5 B;  3ZMS A;  4FLU A;  1ARO P;  4GYC B;  4LBE C;  4JAA A;  3M99 B;  5LYJ B;  1HWY A;  2WLK A;  1US6 A;  2DWE C;  4TT3 G;  4O4J A;  3CC7 V;  3JD4 A;  4JI2 B;  5ITZ B;  3AG7 A;  4RQF A;  4G27 B;  5CA3 A;  1TGO A;  3K9A A;  1IXM A;  2ZDI A;  1Y74 A;  4D7S A;  4H37 A;  4JI2 O;  3BFR A;  4BWA A;  1SQB H;  2V1D A;  1E1R G;  5EZY B;  4YY3 B;  3I55 V;  4NVP A;  5KX5 A;  1RPO A;  2P22 C;  1K33 A;  2QKS A;  3GWK C;  1QLE C;  1QVF U;  4YY3 O;  4BW9 A;  1V54 C;  5LYJ A;  5A2Q N;  5FPO A;  1SA0 B;  2Y48 A;  4TQD A;  3ZBH A;  1W0K G;  5ITZ A;  5IYZ B;  4IT5 A;  3ETQ A;  2ZNI A;  4O2B B;  1H38 A;  1KB9 F;  1HNZ B;  2R70 A;  4U3F H;  2F66 C;  4X20 B;  2GSM B;  2Q0A A;  4UVA A;  3RYF A;  2WLM A;  1JJ2 U;  4BIZ A;  4CH3 A;  2DN9 A;  4FLZ A;  3KZI Z;  5EC2 C;  2QEX V;  4NTX A;  5EZY A;  3RWR D;  1HNZ O;  4PI2 A;  2JS3 A;  4IIJ A;  4A5U B;  5IWA B;  4O2A B;  1TUE B;  5DM6 V;  1FFX B;  3K5M A;  1M56 C;  4P2Z A;  3ZRV A;  4O4H B;  4C7U A;  3ZHU A;  5IWA O;  4K35 A;  1VIB A;  4B3S B;  3B8N A;  4MS2 A;  2P5O A;  1GKF A;  2JGD A;  4B7K A;  1PNM A;  5IYZ A;  4B3S O;  3SPI A;  2DE0 X;  4WCE V;  4EFE A;  1I5Y A;  1K4C C;  3KG2 A;  2PY5 A;  1NH2 D;  4ZOL A;  4PHZ A;  3SR2 C;  5KMG B;  3SJB C;  2N05 A;  1FFX A;  2V7Q G;  3T4D A;  4O4H A;  2YXL A;  2YIC A;  2IU0 A;  1VQ4 V;  2X6B A;  2DJV A;  1G8M A;  4FLT A;  1VEW A;  1ROP A;  1FPO A;  3UM7 A;  4H13 B;  3E22 B;  3CCU V;  4W4K A;  3SYP A;  4BR6 A;  4NR1 A;  4J7K A;  2V4D A;  5KMG A;  4MTG A;  1BZK A;  1OJH A;  4Z2W A;  3E8F A;  2JJ1 G;  4OXS A;  2QKC A;  2OCH A;  2IBZ H;  2F43 G;  4CC5 A;  1BHA A;  2XAJ A;  1N8R W;  5JCO C;  5JJE B;  1K73 W;  2CTQ A;  3CYO A;  5KAI Z;  3F7Y C;  4F6R B;  1AJP A;  1N4C A;  3E22 A;  2CTR A;  4IYI A;  3AK2 A;  4W4L A;  3K04 A;  3N2G B;  2QTO A;  4GCZ A;  2DW4 A;  4DW0 A;  3B8M A;  3UCS C;  2ZR3 A;  2UU9 B;  3DC5 A;  1I08 A;  2PTM A;  3CRM A;  3JAR A;  4DR2 B;  4FM2 A;  3ZMU A;  2RNB A;  3CCS V;  2UU9 O;  4KP4 A;  2Z5U A;  4U3J B;  3OMA B;  3RYC B;  3DSQ A;  5LBQ A;  4DR2 O;  1XEQ A;  5J2U B;  1NTZ H;  1BSM A;  1K4D C;  4FLX A;  2F23 A;  4L8J A;  2PYJ A;  4F6R A;  1ZSP A;  4DV5 B;  3ABT A;  4WFH A;  1AI4 A;  3N2G A;  4CS4 A;  1JVM A;  4DV5 O;  1K34 A;  3OW2 U;  3OD4 A;  2XHB A;  2UXX A;  1NTM H;  1P7B A;  4JI7 B;  1MA1 A;  4TV9 A;  2GBO A;  2N04 A;  3ABL B;  3UO2 A;  4U3J A;  1QNM A;  5CB4 B;  1K9M W;  1YTF D;  2D2C B;  3RYC A;  4FLY A;  4WFE A;  3M8A A;  2WPD G;  2QWP B;  1F7Y A;  5J2U A;  4JI7 O;  4DR5 B;  3E83 A;  1XRE A;  2Y4T A;  2LFR A;  3O65 A;  4DV6 B;  3WB1 A;  2QWN B;  1ORQ C;  4DR5 O;  2VWJ A;  1FXK C;  3HR0 A;  4DV6 O;  4JI0 B;  3H1J H;  1Q6I A;  5C8Y B;  2YI9 A;  2L35 A;  2QA4 V;  3LSQ A;  2W6J G;  4D7T A;  1TVK A;  1JR9 A;  2EIJ C;  1S5J A;  4JI0 O;  2IH1 C;  3G71 V;  2DYS C;  5CB4 A;  2LO1 A;  4UB8 Z;  2LFS A;  1WA8 B;  1JFF A;  3FB5 C;  2OCC C;  3IFX A;  2GTS A;  3ZHQ A;  4HAM A;  3ETE A;  2LGW A;  1R3I C;  2X6C A;  1K7D A;  1F4M A;  4MT8 A;  4X89 A;  1OCC C;  4MVQ A;  3QF7 A;  2WLI B;  3R65 A;  4NXN B;  3FB8 C;  3ASN C;  3U11 A;  4EEQ A;  3WB2 A;  5C8Y A;  1Z5V A;  1Q81 W;  3JD2 A;  4LFB B;  1VQK V;  4NXN O;  5HFM A;  2BOC C;  1AI7 A;  3CWB H;  3RN4 A;  2ZT9 B;  3FYE B;  4QE9 A;  2KB1 A;  4AIL C;  4LFB O;  1WA8 A;  2EIJ B;  2IM9 A;  3RVZ A;  2Q7H A;  1N32 B;  2DYS B;  4QPJ A;  4UCO A;  3UT5 B;  4DV1 B;  4JI5 B;  3CRQ A;  1MG1 A;  2LJ2 A;  4JF3 A;  1PP9 H;  1N32 O;  5JWP A;  1M57 B;  5GTI Z;  2EBO A;  3ZMZ A;  2EIN B;  4DV1 O;  3S3X A;  3JD1 A;  2WLI A;  5L3C A;  1VQ7 V;  1BT8 A;  3P3N A;  4R50 A;  4BAY A;  3LDD A;  2WLL B;  1H2L A;  4P9O A;  2DMX A;  4PEL A;  4ZHQ A;  5L3G A;  2WWW A;  3OR7 C;  1L8D A;  1B6Q A;  3CCV V;  1VF5 B;  4K0K B;  2ZE5 A;  1COW G;  3UT5 A;  1J5E B;  1ZX3 A;  4B3T B;  1LNQ A;  3X2Q C;  1DTO A;  4K0K O;  1H2G A;  1SES A;  4IL6 Z;  1J5E O;  2YXH A;  4B3T O;  1JCH A;  4LNU A;  5JVD B;  1KMI Z;  4X66 O;  3L73 H;  2WLL A;  1FS0 G;  5IJ9 B;  2UXB B;  3ABM B;  3ZN1 A;  2DYR B;  2ARH A;  4GKK B;  2P7T C;  2UXB O;  3L72 H;  1BHB A;  1SS3 A;  2VRZ A;  3HB3 B;  3JCU Z;  3AG3 B;  3HPL C;  2YIA A;  3K57 A;  3H1I H;  1NVP B;  3BA8 A;  4GKK O;  5IJ0 B;  3QVN A;  2EJ7 A;  4UCS A;  1S76 D;  4TSF G;  1NBM G;  1IDS A;  2WLN A;  3BEH A;  5H5N A;  5JVD A;  1CP9 A;  3M7M X;  3L9D A;  5IJ9 A;  1U97 A;  1Y76 B;  2GV9 A;  3BRC A;  4ASU G;  2P4V A;  3ML0 A;  4GZR B;  3VQW A;  3E35 A;  5LGT A;  1NU1 H;  1HW7 A;  2HEP A;  5KHJ A;  3U10 A;  5IJ0 A;  5LA6 B;  1CXZ B;  5D5P A;  3IC7 A;  4CC6 A;  3SYO A;  2OIE A;  2ZXW C;  2EUL A;  2PI5 A;  3AG1 C;  4E4E A;  2CE4 A;  1H2S B;  3CC2 V;  3RGB A;  1GRJ A;  2M7W A;  2IJJ A;  1Y76 A;  3SDL A;  3FAV B;  5JH7 B;  2EIM B;  3L74 H;  3GB7 C;  1WP7 A;  2WA3 A;  3GWO A;  1KKC A;  3EHB B;  3E86 A;  1Q8I A;  2QJ1 A;  1AR4 A;  1FFT B;  4FK5 C;  3H9V A;  4DV3 B;  4NXM B;  1TUB A;  1MAB G;  5LA6 A;  1Q7Y W;  3KCY A;  1RP3 B;  4YXW G;  4MW3 A;  2W0X A;  5B1N A;  2FTK A;  3SYQ A;  4DV3 O;  4NXM O;  3TXS A;  4O4I B;  4LFC B;  1V55 C;  4MW8 A;  5LP6 A;  1EN4 A;  4JZG A;  2KG7 B;  2VS0 A;  4LFC O;  5JH7 A;  2R72 A;  1G4Y B;  2Q7E A;  2UUA B;  1BGY H;  3JAS B;  2GHY A;  2OIG A;  3CD6 V;  2UUA O;  1KU9 A;  1XOU A;  2H3O A;  1LUV A;  2IJH A;  2W6I G;  1GK9 A;  4O4I A;  3ZMT A;  1AJN A;  1FJG B;  3B77 A;  3CE2 A;  3D8C A;  4WFB V;  1R3K C;  2KG7 A;  1L1F A;  5BZB A;  1PNL A;  2YID A;  1FJG O;  2P06 A;  3DXR B;  4GLX A;  3ASO B;  2ZE7 A;  2K9P A;  1U96 A;  3JAS A;  1JPX A;  2HJD A;  2E3C A;  4X1K B;  2AXT Z;  5LXT B;  4WFF A;  2YSU B;  1N0N A;  1DF4 A;  1R3J C;  1ZLZ A;  4ABM A;  1WNS A;  1R3L C;  1QHT A;  5C93 A;  3CCM V;  2IU3 A;  3DXR A;  2ZKO A;  1SQV H;  3W7S A;  3E8B A;  1E1Q G;  1DGS A;  5LMU B;  3P32 A;  1GM7 A;  2HFE C;  3MDS A;  1AIL A;  5LXT A;  4FZ0 A;  2UXC B;  2PZS A;  5LMU O;  3OR6 C;  4UCR A;  4RUF A;  1OCZ B;  3CRR A;  4R6Z A;  2ZCE A;  4JZ2 A;  3T2M A;  1RM1 C;  2WAM A;  3JAK A;  2UXC O;  4CZZ A;  4DR3 B;  2EIK C;  1I7F A;  1XBL A;  5H6R A;  4DR7 B;  4MTF A;  1F4N A;  1SQF A;  4B3R B;  4UVC A;  1XNR B;  1MNG A;  4DR3 O;  1SRY A;  4EFB A;  4DR7 O;  5GW7 A;  4HYO A;  4DUY B;  5K1P A;  1S0V A;  3T4Z A;  2YC0 A;  4ZBM A;  4B3R O;  1XNR O;  2RJZ A;  4JI8 B;  3HKC B;  4DUY O;  3LNM B;  1VF6 A;  3K9S A;  4LP8 A;  4JI8 O;  4NKG B;  3P30 A;  4LC1 A;  3FFQ A;  1X4T A;  1HP8 A;  2UXD B;  2O57 A;  3DTU B;  4L87 A;  3LDE A;  3K58 A;  2B5U A;  2Y4U A;  1IX9 A;  1AR5 A;  4UCT A;  4N23 A;  5KHG A;  4FLW A;  4CH4 A;  1MOF A;  2UXD O;  5CN0 A;  2HR3 A;  1PNK A;  4FMT A;  1DF5 A;  3FYI B;  2Q4P A;  3G6B A;  2A9H A;  1YCI A;  2Q73 A;  4QJF B;  1SA0 A;  2OTJ V;  1QLE B;  3HKC A;  3K79 A;  2G38 A;  1V54 B;  2N74 A;  1B3Q A;  4O2B A;  1YXB A;  4X20 A;  3QNE A;  1XI1 A;  4IHJ B;  2YEV B;  2CH7 B;  5LMN B;  2R9I A;  4LCU C;  4JI4 B;  2E5L B;  2FL4 A;  4PI0 A;  3ZRW B;  4EB6 B;  4P30 A;  3F5W C;  4O2A A;  1AP6 A;  4J80 A;  3T1C A;  2ZIN A;  4DR1 B;  4MSW C;  2B1I A;  5LMN O;  4JI4 O;  3K5O A;  4NB5 A;  2E5L O;  3ETG A;  1SET A;  4AQY B;  1EFR G;  2FML A;  3CCL V;  2X6A A;  4DR1 O;  4B7E A;  1M56 B;  2F93 B;  4XBF A;  3GVM A;  4H44 B;  4NYK A;  4AQY O;  4BW5 A;  1AVM A;  5KUK A;  2LGQ A;  4AHC A;  4IHJ A;  1H8H G;  5EC1 C;  1NVP D;  4IYH A;  4BIO A;  2C2A A;  4WBN B;  3ZRW A;  4EB6 A;  2AHY A;  4YJ3 B;  1D5N A;  4UXN A;  4YIP A;  5EIB C;  3BAA A;  3ABK C;  3OUF A;  4PA6 A;  3IJ4 A;  1YIT V;  2YIB A;  4DV4 B;  4WFA V;  5L3E A;  1WB7 A;  4UVB A;  3BA9 A;  4J41 A;  1XIL A;  4PV1 B;  1OCO C;  3ZHR A;  1P84 F;  1WN7 A;  3G67 A;  4LF7 B;  4QNH B;  4DV4 O;  3H1L H;  4K8X A;  2E74 B;  3C90 A;  4B08 A;  2EX3 A;  1XQ8 A;  2XND G;  4LF7 O;  1XNQ B;  1N36 B;  3N27 A;  2QE7 G;  1HNW B;  2R9R B;  1XMQ B;  4I55 B;  2Q6A A;  3H1K H;  1XNQ O;  5LHH A;  1N36 O;  3SYA A;  2LW7 A;  2P90 A;  1E79 G;  1NTK H;  1HNW O;  1XMQ O;  2YDE A;  1BE3 H;  3CCQ V;  1M4U A;  2HVK C;  5FNV B;  2IH3 C;  1NI8 A;  1GMG A;  1OZ0 A;  3ZJZ A;  1Q82 W;  1YJN V;  2ZD9 A;  3K5L A;  1WAZ A;  1KEC A;  3EXA A;  2B1G A;  3JSN A;  4DO2 A;  3KKY A;  3HKB B;  4O4L B;  3B09 A;  3N2K B;  1ZUQ A;  3LSS A;  3CCJ V;  3LDC A;  2CDY A;  3R66 A;  3ZMV A;  3CCR V;  3RW0 A;  4I9Q A;  2ZIO A;  3BAB A;  1P7G A;  5H6Q A;  4F6E A;  3OGI B;  3S3W A;  5L3F A;  1KP3 A;  2ZIM A;  3H01 A;  3QO8 A;  2A0L A;  2P67 A;  3CP1 A;  3K08 A;  4X65 B;  2ZM6 B;  4KFM A;  5JCO A;  1R73 A;  3OTO B;  4GX2 A;  4KUM A;  4FM1 A;  3HKB A;  4UV9 A;  4X65 O;  2ATK C;  4O4L A;  2ZM6 O;  4FFB B;  2R9A A;  3E89 A;  3N2K A;  3OTO O;  2QWR B;  4JYY A;  3ZRS A;  3F7V C;  1UFI A;  2AW9 A;  3T1H B;  2IJI A;  3RVY A;  4HZ3 A;  3WG7 C;  2ZR2 A;  2QSA A;  3APQ A;  2VQF B;  3T1H O;  4LF8 B;  4OGQ B;  1BS3 A;  1MSW D;  2F1M A;  2Q8V A;  3O9O A;  2LQT A;  1DK1 A;  4LF8 O;  1N0J A;  5B66 Z;  1FXK B;  5H9C A;  4IGG A;  3THO A;  1TAE A;  4J10 A;  1NS1 A;  2P6J A;  1CPY A;  2KQX A;  5LGN A;  4CH5 A;  1GN2 A;  1URF A;  3B40 A;  3D3I A;  1YHQ V;  4X64 B;  5CA1 B;  1K97 A;  2OCC B;  5IE9 A;  3OT7 A;  2RMK B;  2QGN A;  4X64 O;  5CBF A;  4JI5 O;  1QU7 A;  4I9W A;  2Q0O C;  1LR1 A;  2UUB B;  2Q5Z A;  5FLX N;  4X1I B;  5DED A;  1OCC B;  3VBB A;  2HKO A;  1A32 A;  3ASN B;  1SQG A;  2UUB O;  3JAM N;  2P4K A;  3RFR A;  4MVS A;  3B2E E;  1Q5O A;  3CJH B;  3I5D A;  3OMI B;  5F2V O;  3L75 H;  1MZF A;  2EZO A;  4PA3 A;  1H8E G;  2F4V B;  1EN6 A;  5CA1 A;  1BQ0 A;  3NR7 A;  2RQ6 A;  1VQO V;  1H2N A;  4TV8 B;  5J9P C;  2F4V O;  5A9G A;  5B1B C;  1AB3 A;  1MZE A;  2LW1 A;  2PGG A;  2XAF A;  1X59 A;  3W7U A;  4NTY A;  4GKJ B;  2LP7 A;  5KA6 A;  1FXH A;  1GH6 A;  2QM4 A;  4WF9 V;  3CJH A;  5IY5 C;  2HHH B;  1Y66 A;  2ITC C;  3G6E V;  4GKJ O;  4JGS A;  4X1Y B;  3TXQ A;  4PA9 A;  5EBM C;  2HHH O;  5BY1 A;  3PN1 A;  2JEU A;  4DUZ B;  3L70 H;  2EJR A;  4CBC A;  3A0B Z;  2A06 H;  2NLJ C;  3G4S V;  4GX5 A;  2UUC B;  5H2F Z;  3X2Q B;  5KAF Z;  1XMO B;  4DK1 A;  2E75 B;  4DUZ O;  3B4S A;  4RO2 A;  5EK0 A;  3SPJ A;  2Q69 A;  2UUC O;  5B1B B;  3RBZ A;  3MD0 A;  1Q43 A;  1MMM A;  1PPJ H;  1J95 A;  2DQ0 A;  3TGU H;  3D36 C;  4DW1 A;  1SQX H;  3OMN B;  5DN6 G;  2QTS A;  3OEE G;  5IY5 B;  4U7O A;  3K0D A;  3E8H A; 
#chains in the Genus database with same CATH homology
 4JI5 O;  4OPH A;  5LMN O;  4JI4 O;  2E5L O;  4K0K O;  4DV6 O;  5FLX N;  1AIL A;  1J5E O;  4B3T O;  3R66 A;  5IT9 N;  4YY3 O;  1A32 A;  1XMO O;  1G1X B;  4DV3 O;  4DR1 O;  5LMU O;  4NXM O;  4LF5 O;  5A2Q N;  3T1Y O;  4X66 O;  2UUB O;  3JAM N;  4JI0 O;  4AQY O;  2UXC O;  3RT3 C;  5BR8 O;  1KUQ A;  3J80 N;  2JRI A;  4DV0 O;  4JYA O;  4LFC O;  2UXB O;  4LF6 O;  2AGA A;  4DR3 O;  4GKK O;  5BXZ A;  3J81 N;  2VQE O;  4DR7 O;  1N34 O;  4X65 O;  2ZM6 O;  2F4V O;  1HNZ O;  4B3M O;  4B3R O;  1AB3 A;  1FKA O;  1XNR O;  4A5U B;  4DV2 O;  3OTO O;  2UUA O;  1I94 O;  1X59 A;  2Z0A A;  5H5N A;  4DR6 O;  4X62 O;  4DUY O;  4LF4 O;  1HNX O;  4JI8 O;  1D2D A;  5IWA O;  2UU9 O;  4NXN O;  1YZB A;  4DV4 O;  1FYJ A;  4GKJ O;  4LFB O;  4DR2 O;  1XEQ A;  4JI3 O;  4B3S O;  1R6T A;  3T1H O;  1FJG O;  4OX9 O;  4LF7 O;  2HHH O;  5BY1 A;  2UXD O;  3F5T A;  1N33 O;  4JI6 O;  1IBL O;  4LFA O;  1R1B A;  1DK1 A;  1N32 O;  4LF8 O;  1IBM O;  1XNQ O;  4LF9 O;  1N36 O;  4YHH O;  4DR4 O;  2LW7 A;  4DV1 O;  2DOS A;  4DV5 O;  1HNW O;  4DUZ O;  1XMQ O;  1HR0 O;  2UUC O;  4DV7 O;  4KHP O;  2N74 A;  1NS1 A;  4JV5 O;  1IBK O;  2FKX A;  3SDL A;  3J7A U;  3M8A A;  2DJV A;  1F7Y A;  5LL6 Y;  4JI7 O;  4JI1 O;  4JI2 O;  2VQF O;  3O65 A;  4OPA A;  2ZKO A;  4DR5 O;  4X64 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...