1KUQA

Crystal structure of t3c mutant s15 ribosomal protein in complex with 16s rrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
CKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
publication title Role of N-terminal helix in interaction of ribosomal protein S15 with 16S rRNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1kuqA00
1I94O 4JI5O 1IBMO 1N36O 5IWAO 4YHHO 1G1XB 4JI8O 4DR5O 5LMUO 2E5LO 5A2QN 1YZBA 1XMOO 1HNZO 4DR4O 4KHPO 4LFBO 3R66A 1FJGO 4DR6O 4JI0O 4DV4O 3J81N 4JI6O 2FKXA 1AB3A 4X64O 5BY1A 4JI2O 4DR3O 1KUQA 4GKJO 1IBKO 2UU9O 4DV3O 3JAMN 5BXZA 4LF5O 1XNQO 4YY3O 1FKAO 3M8AA 4DUZO 4DV0O 4JI1O 4AQYO 4NXMO 3RT3C 1XNRO 4DR1O 1F7YA 2UUCO 1N33O 4LF8O 4LF6O 4B3MO 4JYAO 4DV7O 3SDLA 3OTOO 2DJVA 4B3TO 3O65A 5LL6Y 2UUBO 2UXBO 4X62O 1N34O 2Z0AA 1XEQA 4A5UB 2VQFO 1J5EO 1FYJA 2JRIA 1N32O 2VQEO 1IBLO 1HNWO 1XMQO 1D2DA 2UXDO 2ZKOA 1NS1A 2ZM6O 4LF7O 2F4VO 4OPHA 4DR2O 4JI3O 3T1HO 4OPAA 2AGAA 4LFAO 1AILA 4DV1O 3T1YO 2N74A 1X59A 1DK1A 1HNXO 4LFCO 3J7AU 4DV5O 4DV2O 4GKKO 3J80N 4DV6O 4DR7O 4K0KO 5IT9N 1HR0O 4JV5O 5FLXN 4OX9O 2LW7A 2UXCO 4LF4O 1R1BA 5H5NA 5LMNO 2HHHO 4B3SO 4JI7O 4LF9O 4B3RO 5BR8O 1R6TA 1A32A 3F5TA 4JI4O 2UUAO 4X66O 4NXNO 2DOSA 4DUYO 4X65O
chains in the Genus database with same CATH superfamily
2ADPA 2AHYA 1JJOA 2JJ1G 1JFFB 2RDCA 3HKBA 3JCZA 1DF5A 5L3EA 4QPJA 2BSKB 4NKGB 1OCCB 4DO2A 5A2QN 4Q6GA 2Q69A 1PNLA 3L73H 2YICA 3J81N 3HPLC 4GZRB 5CBGA 1CP9A 4GX2A 4LNUB 1JPXA 3LNNA 4MVUA 2OYQA 2N04A 2WLJA 3LSQA 4NXMO 1N36B 2JS3A 5IWAB 1M56C 3A0BZ 5B1BB 4B3MO 2ZXWC 4NTYA 1FJGB 1IXBA 3OTOO 1BQ0A 4PA7A 1KP2A 2IJIA 4DV4B 3CRQA 1BSMA 3HKCB 4BW9A 4F6RB 2Z5UA 4RWUA 3ZCCA 5IYZA 4CS3A 3NXSA 3CYOA 3QF7A 1O9GA 4IHJB 2ARHA 2IU3A 4X89A 1XL6A 4J42A 3STLC 4LR3A 1VF7A 3RVYA 2HEPA 4R8CA 4HBNA 2FMLA 3CMEV 3SYQA 1AROP 4DR7O 3BAAA 1XREA 2EIMC 4CH3A 1BMFG 1AP6A 2UXCO 3H01A 4LF7B 5KLVH 1CPYA 4J80A 1YITV 4B3RO 1RP3B 5BR8O 1MSDA 2QSAA 1NTZH 2YEVB 2ZDIA 2UXXA 3A2FA 3JAKB 5K1PA 1TUEB 2HG5C 2JGDA 1OJHA 4ABMA 1ENVA 2YC0A 2QJ1A 2QWRB 3EFFK 3U10A 4BIZA 3OFNG 3CJHA 3VQVA 3VBBA 1P84F 4I55A 4WFHA 4KHPO 4LFBO 4LH6A 4DR6O 4JI0O 5ITZB 1IDSA 3ZHVA 4YJ3B 1AB3A 5BY1A 1EFRG 3OT7A 5FNVB 1SETA 5LA6A 2ZINA 4XDLA 4YIOA 3CRAA 4CH6A 1BCCH 4LBEC 1VARA 1S5HC 4DV0O 1MMMA 4DUYB 2BTQA 5J2TA 2F23A 3QO7A 1VQKV 1MABG 4WFGA 3VQYA 2Y69C 1I7FA 1VQ7V 3AG4C 2CH7B 3G6BA 3RYHA 2OTJV 4ICGA 2JS5A 4FFBA 1JX9A 3CXHF 3K5OA 2P7TC 3LSUA 1M5IA 5JJNB 1XMQO 5JWPA 4X1YA 2MW2B 1XHXA 2F4VO 5B1NA 5LYJB 5IJ0B 4JASA 1V54B 2DN9A 1OCZB 1QLEB 5K1XA 2N74A 1SERA 3JASB 3ASNC 2ETNA 4DV5O 4GKKO 4FM0A 4UVCA 2WLLA 2WLNA 2KB1A 1N34B 4UCSA 3DC6A 1IBLB 5LHGA 5C8YB 4MW3A 3TCUA 1A32A 1NR7A 3TETA 4X66O 2P5OA 3L71H 5EBMC 3RYCB 3G80A 1TA8A 4MVMA 5LXTB 3K3WA 4U3JB 1HR0B 2DWEC 1FD9A 1HNZO 2W6IG 4LP8A 1QLNA 4R6ZA 2NN4A 1XUQA 1G8MA 3SR2C 4C7UA 2RNBA 1KKDA 1TUBB 1XQ8A 2Y0IA 3ABLB 4YY3O 2IW5A 1Q7YW 4TUYB 4FIPC 1I94B 4GCZA 2V7QG 5B3SC 5KAIZ 3KCXA 3GWOA 4XDKA 1YSCA 1M90W 3JARA 2DJVA 3JD3A 4WFAV 5LHIA 5LL6Y 2Q7GA 4U7NA 1KC8W 5CA1B 1WP8A 3AG1C 1SQQH 2PYLA 3N2GA 2YI8A 2UU9B 2VQEO 4O4LB 4I5SA 4B7EA 2DQ3A 4FK5C 4AILC 4U3FH 4XDJA 5H6RA 1GH6A 5IDJA 2R72A 3RYFB 4PI2A 1M93A 3K59A 4LFAO 2ITCC 2P6JA 3H1HH 1F23A 3DGEA 2JVDA 1S5LZ 2YIAA 1KB9F 5KX5A 3TXSA 2OTLV 4UB6Z 1YIJV 1J5EB 3P3NA 3UT5A 3IC7A 1S76D 1XDCA 1MZEA 5FLXN 1HNWB 4I0XA 2XNDG 1MG1A 4FM2A 4D7TA 2G38A 3PJSK 2Q0AA 2ILMA 1VQLV 3RWRD 1SC5B 5IY5B 3CCSV 2EULA 5JVDA 1K8AW 1MSWD 3OMNB 2A3QA 3HKEB 2LGQA 2Q67A 1R3LC 1EM1A 2IH1C 2QEXV 4UCTA 3K9SA 4DV2B 1KP3A 3LDDA 3ETQA 5KHHA 1N36O 5IWAO 3ZRWA 1NJIW 3SYPA 4I4TB 3BPZA 5GONB 3ABKB 3SYAA 1FJGO 2P4VA 5L3BA 4LF4B 1S3JA 5EZYA 4DV4O 2EIKC 3ABTA 3OMAB 1SQPH 1AR5A 1GMGA 4H0LB 1RM1B 4PA9A 3ZHUA 4HNAA 3RT3C 3RVZA 3A0HZ 3L9DA 5FL7G 2YIBA 1B3QA 2Y4TA 5L3FA 3DXRB 4X1IB 4OGQB 3WB1A 5BZBA 3TXQA 4JYYA 1JOYA 4TT3G 1JFFA 1AJQA 3H1LH 3SPIA 2BSKA 1CEZA 1XNQB 1BZKA 1D2DA 4WBNB 1HWYA 2LW1A 1KMIZ 4LF7O 4JI1B 4JAVA 1QNMA 4DR1B 1NBMG 4G28B 3HB3B 4MTFA 3G71V 4LNUA 3JD0A 2Q7EA 4JYAB 1G6UA 3AG2C 1W59A 1XBLA 2OIEA 1L0LH 4PD4F 1FS0G 2VQFB 3LNMB 3D8CA 3TK1A 4O2BB 1M57C 3K57A 1D5NA 3K5LA 2QM4A 3ASOB 4UVAA 4ZKIA 3D36C 3SGIA 4L8JA 1NH2D 4F6RA 3CRCA 4FZ0A 1Z5WA 4NXNB 1HNXB 3X2QC 4PDMA 4PA4A 4DUYO 4IHJA 3LDEA 3E86A 3JCUZ 1BL8A 5B1AB 3QO8A 3ETEA 3B8MA 3BFRA 2M6YA 1GN3A 1IVSA 3CHXA 4FLUA 4DR4O 1VF5B 1SA0B 3R66A 3CCVV 1S5JA 3PN1A 1BQZA 4F4LA 3RN4A 2FKXA 5IYCO 1OCCC 1H2SB 1U97A 1GRJA 2LFRA 3D3QA 3JD4A 3B40A 2A9HA 3D3IA 2FL4A 4P30A 3RFRA 4BAYA 2DYSB 4RUFA 1W2BU 4OXSA 4KL1A 1V55B 1L8DA 2E5LB 3JAKA 4P2ZA 2RN9A 1M1KW 1US6A 4DXWA 2IBZH 4G27B 1N34O 2Z0AA 2GUZB 3OEEG 4CH5A 5KUMA 1TVKB 3OR7C 3WG7B 1IBLO 2CTQA 4QIWF 2OWOA 4HYOA 1H38A 5LP6B 5ITZA 1SZTA 2EIJB 4YJ3A 3A0RA 5FNVA 1S72V 1SF9A 4I50B 4LF8B 2CGOA 4KXRA 1K34A 1P7GA 3C3SA 1PM9A 2WLIB 1JMKC 1QBZA 1U96A 3JALB 1FFXB 3T4ZA 2XOKG 4PA6A 3UCSC 1HR0O 2R9IA 2HVJC 1AI7A 1VQPV 3BVOA 2CH7A 1GAXA 4LWSB 5A9GA 4JI3B 1FXVA 2X6BA 3ZMUA 2D3OW 4FLWA 5KHIA 3CC4V 3FKSG 1HW7A 1AJNA 5EIBC 2EINB 4J10A 2K9PA 4WFEA 1I94O 1YHQV 1N4CA 5LYJA 2PYJA 4I7ZB 1Y67A 1ZL8B 5LOVB 1BS3A 3VQWA 1GM8A 3JASA 1K9MW 3CEIA 1JR9A 1UFIA 2H8PC 4H33A 2QE7G 3H1JH 1AJPA 5J9PC 2UU9O 2DYRC 3L74H 3IJ4A 3JAMN 5KA6A 1FKAO 2Q0OC 5C8YA 1XOUA 1GM7A 2ZD9A 1FXKB 1WNSA 2B1GA 2OCCC 1OCRB 4JPRA 4UV8A 1OZ0A 4B08A 1PNKA 1D5AA 2B5UA 4FVMA 3O65A 3RYCA 3BA8A 3C3TA 5LXTA 2HJDA 1WPBA 1AI6A 4U3JA 4DR3B 1J5EO 2IJJA 1E79G 3BA9A 2XAGA 2QTSA 3G6EV 3SJCC 1HNWO 2F93B 3FYEB 2YXYA 4E2LA 1Q5OA 4OPAA 2UUCB 2XTAA 5JQGB 1F4NA 1AILA 1TUBA 4IGGA 3DSQA 4K35A 2JDIG 3CCUV 4O4IA 4TUYA 4CH4A 3C90A 4DV2O 1OCZC 1OHHG 4RQEA 3H1IH 4P9OA 3E8HA 4W4LA 4WFBV 1EZVH 1Y74B 1K4CC 4JZGA 3G4SV 4LF4O 5IE9A 1H2NA 4TV8B 4DW1A 5CBHA 1EN6A 5CA1A 1LNQA 3H9VA 3GWKC 2Q5ZA 5KMGB 3GVMA 4DV1B 4O4LA 2PZSA 4LFCB 2FYUH 3APQA 1WAZA 5GW7A 2W0XA 4QE9A 3B09A 4DV6B 4K0KB 4LCUC 3WB2A 5EBWC 4NTWA 2ZE8A 5IYDO 1YTFD 1K5SA 3OGCC 1GM9A 1JVMA 4TOIA 4FM1A 3VOUA 3TGUH 3MHSC 3QVNA 5EYPA 4IYIA 1YJNV 1XNQO 4JI1O 3RGBA 1AI4A 1UPGA 1Q90D 1VQMV 4YHHB 4DR1O 3ABLC 3JAWB 3ICXA 5DN6G 3HKEA 3W7WA 5LMUB 4JYAO 4QPKA 1Q86W 2AZ2A 3FYIB 3CS5A 1ZWIC 3UQ8A 4H13B 3BABA 4X64B 2R9AA 4I4TA 4UCRA 2KSDA 2VQFO 4EB6B 2ZIMA 5H2FZ 3LSSA 5GONA 3T2MA 3ZMVA 3ABMB 4FLXA 3HR0A 5B1OA 3CCQV 3VQXA 3KG2A 2IH3C 3HKDB 5LBQA 3WU2Z 3S3XA 3QNEA 4YJ2A 1L0NH 3S3WA 2GDSA 4QGPA 4X9QA 1I5XA 2BTOA 1NTMH 4LF6B 1FXHA 1URFA 1HNXO 4CBCA 2GHYA 3FB8C 3SJQC 4BR6A 3SJAC 3B8NA 1GTOA 1Q6UA 3GB7C 4CC5A 3DXRA 4X1IA 2YI9A 1QVGU 2KKWA 2RCVA 2ZDIC 5LGNA 2ZM6B 2JJ2G 1YVWA 1R6TA 4MTXA 5FPOA 3K5MA 3AK3A 1NVPD 3I56V 2QDOA 1M56B 4WBNA 2X7RB 3K03A 2X6AA 2XHBA 3U0ZA 2ITDC 2L35A 3AG7A 3OAAG 4TQDA 1IX9A 2W0FC 2GTSA 2E5LO 2WWWA 2OIGA 1BHBA 1F4MA 3ZMZA 1I0HA 3B77A 4JI4B 2A79B 4O2BA 5L3DA 3E8GA 4RUEA 4GKJB 2CGNA 5C93A 4JI5B 1IBMB 3CB2A 4E4EA 4LF8O 2QKCA 2IM9A 1BHAA 1YI2V 1K92A 3AK2A 3OW2U 3OGIB 2EIMB 5D5PA 5JH7B 1XEQA 1BT8A 2BOCC 1SA0A 3W7UA 1JQ0A 4J9ZB 2ZKOA 4JI3O 2Q6AA 3K0GA 3CXCU 1VQ8V 3I55V 1R3KC 1JCHA 1VEWA 1DK1A 2N05A 1NH2B 4X62B 3MHHC 5IT9N 5EIBD 3OEHG 1OCOC 2WLKA 2VWKA 4DRXB 4RAIA 2WPDG 2AXTZ 4DR2B 4BWAA 4HAMA 4Z1MG 2GUZA 4FJCC 3OR6C 3OMIB 1TVKA 2WAMA 2BOBC 3AEIA 4K8ZA 3F7VC 1AR4A 2PGGA 4MTGA 3JATB 2O57A 2Y69B 1RSOB 1YF2A 2CUGA 1G1XB 3AG4B 3UO2A 3E83A 1Y6XA 2B9ZA 2WLIA 2X0LA 3KKYA 1GKFA 4LF9B 3JALA 1K7DA 1FFXA 3RYIB 4DR3O 2XAFA 2BCCH 1P4RA 2MK3A 4MVQA 2XASA 3ZEDA 3N2KB 4HZ3A 2P06A 1VQ4V 3P30A 4NVPA 3L72H 1KKCA 3JYCA 1PL0A 1ZAUA 2ATKC 3ASNB 2UUCO 4R50A 4PV1B 2LJ2A 1XMOB 2KG7B 4TQFA 3SDLA 3CP1A 2F43G 3APOA 1ROPA 4JI2B 5B5EZ 4PI0A 3FB6C 5LOVA 2YXLA 5H6QA 1IBKB 4J7KA 4DV3B 4ZOLB 4P9PA 3EXAA 5LGTA 1NS1A 2KQXA 2P90A 3WG7C 2AHZA 2VWJA 4DV1O 1TGOA 4DV7B 4LFCO 4JYCA 2QM8A 5J2UB 5CA3A 1Q81W 1FXKA 2QWQB 4DV6O 4K0KO 2L6LA 3ZRVA 1PPJH 4U7OA 3P32A 2UXDB 2GBOA 1WB7A 4J11A 1WB8A 3F5TA 1AR1B 3SYCA 4CC6A 3CX5F 5B3SB 3CCLV 3ETGA 4KUMA 4YHHO 1BGYH 5JQGA 2EINC 5LMUO 4G2KA 2F66C 1K3EA 5HFMA 4UB8Z 4X20B 3AG1B 3UM7A 1QVFU 3HKCA 4X64O 1E1QG 3CC2V 1GN2A 1Y74A 3STZC 3M8AA 3ZRSA 2RMKB 4O2AB 4TV8A 4MTOA 1XILA 1R3JC 2A06H 4D6TH 2V1DA 4JI8B 5KMGA 4LF6O 1K5QA 1I5YA 4O4HB 1FXKC 5IJ9B 3K5NA 1YJWV 4DW0A 1OCRC 2RJZA 3ZX6A 4A5UB 1IXMA 1M4UA 5CMUA 2P67A 3K04A 4MW8A 4UCVA 1VP7A 2ZM6O 2YEVA 3R65A 4GX0A 4K8XA 1N33B 2WLHA 2ZE6A 2RQ6A 2CK3G 1LUVA 1AVMA 4TWKA 3FD9A 5B1BC 2CAZC 4R7CA 3JAWA 1Q6HA 1KQSU 5D5QA 2EIKB 1GO3F 2XAJA 2ZQMA 2AW9A 5H5NA 2XAHA 3EHBB 4JI4O 1VIBA 4EB6A 1PNMA 2V4DA 5BMVB 2HR3A 1CXZB 3ETDA 2BE3A 5EC1C 4UV9A 4X66B 1Z2GA 1WPXA 1YTFB 3HKDA 4JI5O 1IBMO 3U11A 1ZLZA 3NR7A 4IYHA 3N27A 1DLBA 2PTMA 5EC2C 5KX5B 3E8BA 5KAFZ 4LH7A 4IIJB 1MOFA 2F95B 5LMNB 2HHHB 2GV9A 4BIOA 2K1EA 2HLDG 1Y76B 1VQ6V 3OUSA 2Q7HA 3L75H 4PDLA 4YIPA 4ZI7B 1VQOV 3FB7C 5IJ0A 5E79Z 2F1MA 5E1AC 1F7YA 5H9CA 3AG2B 2WLMA 1SS3A 1S77D 3CD6V 1J95A 1ORQC 4MVZA 3OD4A 3QO5A 3O9OA 1MA1A 1VQ5V 2QKAA 1IURA 4JI6B 4X62O 2IU0A 5HFLA 4MVRA 2XAQA 3FFQA 4LF5B 1M9NA 1NZ6A 3W7SA 2QA4V 4TV9B 4AQYB 4DR2O 1R6KA 2PY5A 2CTWA 3ABUA 3OTFA 1QR8A 3X2QB 4UXNA 2H94A 1DTOA 2EJRA 3P3PA 1SQGA 1VMGA 4JTDB 4O4JB 4EEQA 3K08A 2UXBB 2DE0X 2LFSA 1WN7A 4Q20A 4ZHQB 2Q4PA 4FLYA 1SQFA 1SQVH 1NVPB 5B66Z 3ZN0A 1KYOF 2R9RB 1X4TA 1NI8A 1R73A 5DEDA 5DM6V 4FLVA 3AG3B 1B06A 4LF9O 3T1HB 5JH7A 4LC1A 2ZR2A 1QHTA 3T1YB 5KHJA 1XHZA 5CB4B 1V54C 1YXBA 1QLEC 1Z5VA 3F5WC 1P49A 1ZTEA 1NTKH 2OCHA 4Z2WA 2NLJC 5JCOA 4K3AA 3BCCH 4GX1A 1XMOO 4OX9B 1DGSA 4JI2O 3OE7G 1K73W 2Y48A 1WA8B 4Z1VA 3K06A 2R70A 2HP8A 5EK0A 1IBKO 2LQTA 4DV3O 4JZ2A 3OM3B 4DRXA 4N23A 3RYFA 1Q43A 4UCUA 3E22B 3W7TA 5FPRA 1FPOA 3ML0A 1V9PA 4JF3A 3T1CA 3OUFA 4DR5B 4FMTA 4QE7A 3ZBHA 1EN4A 5KHKA 1O9HA 2NR5A 4F6EA 1THZA 4DV7O 5CA0B 4X88A 5CN0A 1KBHA 3JATA 1UJWB 1LR1A 2P4KA 1RSOA 1Y66A 4H44B 2EILB 1NT2B 4DK0A 3EVKA 2UXDO 3QG5A 4X1KB 3SPCA 2GTAA 1XNRB 3FAVB 3E35A 4EFBA 2D2CB 3BY6A 5KA5A 3RYIA 2YXHA 2E3CA 2QM7A 2LO1A 1QU7A 3N2KA 3J7AU 4B3TB 3CMAV 5JCOC 2DW4A 4RQFA 1N32B 2ZE5A 2KG7A 3ZMSA 1PP9H 1SESA 2DYRB 5GTHZ 3KZIZ 2IJHA 2EBOA 4NXNO 4ZOLA 2OCCB 1RPRA 1KU9A 1AI5A 4JI8O 1JA8A 2GSMB 2YDEA 2PF4E 2YIBD 4JV5B 4L87A 3SJBC 4BW5A 3THOA 4PHZA 4DR4B 1KD1W 5J2UA 3MDSA 4JI7B 2VS0A 3K58A 1S0VA 3SPGA 3Q4HB 2UUAB 1K97A 2HKOA 5BXZA 1W0JG 2CTPA 4ASUG 5IY5C 5AG2A 1VQNV 1KECA 2ZXWB 3IGAC 1ZUQA 4IT5A 1YDXA 1N33O 1SRYA 3QTCA 1Q6IA 2PUSA 1H2GA 3ABKC 4CS2A 3L70H 3ZHRA 2JGUA 3DC5A 1FYJA 4W4KA 1LUWA 3JSNA 4TSFG 1YJ9V 4X20A 2CTRA 3FB5C 4DUZB 1RM1C 1PV0A 1K33A 1WLEA 1AP5A 3E89A 3HKBB 2AGAA 2QWNB 2WSSG 4WF9V 4MVSA 3RBZA 1N0NA 4FPPA 4O2AA 2M7WA 3J80N 1RFYA 2UUBB 1JJ2U 4MVOA 3ZS8C 4O4HA 3JSLA 5IJ9A 2EX3A 1I08A 2LW7A 5LMNO 2HHHO 4UVBA 2QTOA 2ZT9B 5L3GA 4RO2A 2YUAA 3ZHTA 3CSXA 1SQBH 4D7SA 1B6QA 3F7YC 4PJ0Z 4X8AA 3T4DA 1MNGA 1Q82W 4O4IB 1YEWA 1BE3H 1PD3A 5IYZB 5EBLC 4QNHB 3CCRV 2E76B 4JI6O 4B3SB 2QKSA 4QJFB 3ASOC 1OV9A 2FB5A 2WA4A 3UKMA 1FFTB 4LF5O 2YS8A 5LP6A 3CCJV 2OT5A 4CS4A 4MS2A 4X65B 4AQYO 3M7MX 4I50A 3BHPA 4FLTA 1HP8A 2QWOB 1Q3EA 5BMVA 4J41A 4JYBA 5B1AC 2CDYA 5TISZ 2Y4UA 1PL4A 2B1IA 2AZ0A 2UXBO 1FAFA 1GK9A 5CBFA 4EFEA 2ZR3A 2LP7A 1H2MA 2FTKA 4ZBMA 1HDJA 1QR9A 1RPOA 3ZMTA 2JGDB 4IIJA 5EYPB 4LWSA 4NYKA 1N0JA 4NXMB 3T1HO 2NNUA 1Y76A 3CJHB 4FFKA 5JJJB 2YIDA 4NR1A 2DYSC 3T1YO 4I55B 4B3MB 2E75B 1X59A 3OTOB 1V55C 4ZI7A 3UO3A 3JD1A 4GLXA 4GT1A 4AHCA 1ZL8A 1R6NA 5LA6B 4UFZA 1Q8IA 1F51A 4OX9O 1R1BA 2EZPA 2LGWA 5L3CA 2BTQB 5J2TB 1QQCA 3I5DA 3W7XA 4YJ2B 3IFXA 3G67A 5LP6C 2QR4A 4FZ1A 3D36A 2EIJC 5LGUA 2PI5A 5KUKA 2DWDC 2YSUB 4WFFA 4TV9A 4PDRA 3RYHB 2JEXA 2HFEC 1EZJA 3DTUB 2EZOA 5JJEB 3WB0A 4DR7B 2WA3A 4DR5O 4FFBB 1YZBA 2ZE7A 3K79A 5DECA 2HVKC 1NU1H 3CRRA 2UXCB 2CE4A 3H1KH 4X1YB 1XL4A 4O4JA 4B3RB 1NR1A 5BR8B 1Y4MA 1SKVA 4ZHQA 1H2KA 4PDVA 3RW0A 2XUMA 4J7JA 4B7KA 4JAUA 5LHHA 1H8EG 2C2AA 1SQXH 1XNRO 3KCYA 2WLLB 3LUTB 1H2LA 2ADQB 2Z3YA 4NTXA 3IC9A 3CCEV 5CB4A 4PELA 4KHPB 4LFBB 2A7WA 1VQ9V 1PKXA 4YXWG 3CCMV 4DR6B 4B3TO 4JI0B 1OCOB 1WP7A 1MZFA 1H8HG 1B04A 2JRIA 1N32O 3BRCA 4XBFA 4GX5A 4DV0B 1NQTA 1R3IC 2ZCEA 4OPHA 3E8FA 3CC7V 1WA8A 3A8TA 4KP4A 1ZSPA 2QGNA 2H3OA 2Q68A 2E74B 3ZHQA 1IZ3A 3E22A 3K0DA 3ZHSA 1VF6A 4J9YB 1T5EA 4JV5O 2JEUA 3JD2A 1K4DC 5CA0A 3CWBH 1XMQB 1GN4A 1EN5A 4JI7O 2F4VB 2UUAO 1W0KG 1P7BA 3IAYA 3CE2A 2DOSA 3AG3C 3JARB 4BIUA 4DV5B 4UUJC 4GKKB 1E1RG 4X1KA 3FAVA 4I9WA 4PA3A 2Q9LA 4JTAB 3MAQA 3LDCA 3N2GB 4AI8A 2X6CA 4JTCB 3ZN1A 1SZXA 5IYBO 2VRZA 3K9AA 4JAAA 3ZRXA 2QWPB 3ZIAG 2JK5C 3B2EE 1XI1A 4ZIBA 2IJKA 1ZX3A 3BEHA 5F2VO 4NB5A 1KUQA 4GKJO 4GYCB 1GN6A 3AK1A 2PI4A 4DUZO 2ZNJA 4J7ZA 2Q8VA 4UCOA 1L1FA 4KFMA 1YCIA 1DF4A 3UT5B 4I9QA 2JIZG 3ZJZA 2XT9A 1N8RW 3SPJA 1HNZB 4I0XB 1NKDA 4FLZA 3B4SA 3TJTA 1VF6C 2UUBO 2EJ7A 3FX7A 4CZZA 5GTIZ 4DYLA 5KHGA 2ODMA 5JVDB 3E2EA 2P22C 1G4YB 4YY3B 4MSWC 2Y0PA 4WCEV 3CRMA 3M99B 3SPHA 2EILC 3Q4HA 3ZRWB 3MD0A 3WFVA 2ZIOA 2UXNA 3SYOA 2W6JG 1M57B 2HJFC 5EZYB 2ZNIA 1QCEA 4DK1A 2Q73A 2A0LA 1COWG 2DQ0A 2VQEB 3CPWU 1WJZA 4EKWA 4B3SO 4HNAB 3ABMC 4H37A 4JGSA 4IL6Z 4MT8A 2DMXA 4LFAB 4N21A 1EBOA 1TAEA 4GUNA 4X65O
chains in the Genus database with same CATH topology
1I94O 4JI5O 1IBMO 1N36O 5IWAO 4YHHO 1G1XB 4JI8O 4DR5O 5LMUO 2E5LO 5A2QN 1YZBA 1XMOO 1HNZO 4DR4O 4KHPO 4LFBO 3R66A 1FJGO 4DR6O 4JI0O 4DV4O 3J81N 4JI6O 2FKXA 1AB3A 4X64O 5BY1A 4JI2O 4DR3O 1KUQA 4GKJO 1IBKO 2UU9O 4DV3O 3JAMN 5BXZA 4LF5O 1XNQO 4YY3O 1FKAO 3M8AA 4DUZO 4DV0O 4JI1O 4AQYO 4NXMO 3RT3C 1XNRO 4DR1O 1F7YA 2UUCO 1N33O 4LF8O 4LF6O 4B3MO 4JYAO 4DV7O 3SDLA 3OTOO 2DJVA 4B3TO 3O65A 5LL6Y 2UUBO 2UXBO 4X62O 1N34O 2Z0AA 1XEQA 4A5UB 2VQFO 1J5EO 1FYJA 2JRIA 1N32O 2VQEO 1IBLO 1HNWO 1XMQO 1D2DA 2UXDO 2ZKOA 1NS1A 2ZM6O 4LF7O 2F4VO 4OPHA 4DR2O 4JI3O 3T1HO 4OPAA 2AGAA 4LFAO 1AILA 4DV1O 3T1YO 2N74A 1X59A 1DK1A 1HNXO 4LFCO 3J7AU 4DV5O 4DV2O 4GKKO 3J80N 4DV6O 4DR7O 4K0KO 5IT9N 1HR0O 4JV5O 5FLXN 4OX9O 2LW7A 2UXCO 4LF4O 1R1BA 5H5NA 5LMNO 2HHHO 4B3SO 4JI7O 4LF9O 4B3RO 5BR8O 1R6TA 1A32A 3F5TA 4JI4O 2UUAO 4X66O 4NXNO 2DOSA 4DUYO 4X65O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 O;  4JI5 O;  1IBM O;  1N36 O;  5IWA O;  4YHH O;  1G1X B;  4JI8 O;  4DR5 O;  5LMU O;  2E5L O;  5A2Q N;  1YZB A;  1XMO O;  1HNZ O;  4DR4 O;  4KHP O;  4LFB O;  3R66 A;  1FJG O;  4DR6 O;  4JI0 O;  4DV4 O;  3J81 N;  4JI6 O;  2FKX A;  1AB3 A;  4X64 O;  5BY1 A;  4JI2 O;  4DR3 O;  1KUQ A;  4GKJ O;  1IBK O;  2UU9 O;  4DV3 O;  3JAM N;  5BXZ A;  4LF5 O;  1XNQ O;  4YY3 O;  1FKA O;  3M8A A;  4DUZ O;  4DV0 O;  4JI1 O;  4AQY O;  4NXM O;  3RT3 C;  1XNR O;  4DR1 O;  1F7Y A;  2UUC O;  1N33 O;  4LF8 O;  4LF6 O;  4B3M O;  4JYA O;  4DV7 O;  3SDL A;  3OTO O;  2DJV A;  4B3T O;  3O65 A;  5LL6 Y;  2UUB O;  2UXB O;  4X62 O;  1N34 O;  2Z0A A;  1XEQ A;  4A5U B;  2VQF O;  1J5E O;  1FYJ A;  2JRI A;  1N32 O;  2VQE O;  1IBL O;  1HNW O;  1XMQ O;  1D2D A;  2UXD O;  2ZKO A;  1NS1 A;  2ZM6 O;  4LF7 O;  2F4V O;  4OPH A;  4DR2 O;  4JI3 O;  3T1H O;  4OPA A;  2AGA A;  4LFA O;  1AIL A;  4DV1 O;  3T1Y O;  2N74 A;  1X59 A;  1DK1 A;  1HNX O;  4LFC O;  3J7A U;  4DV5 O;  4DV2 O;  4GKK O;  3J80 N;  4DV6 O;  4DR7 O;  4K0K O;  5IT9 N;  1HR0 O;  4JV5 O;  5FLX N;  4OX9 O;  2LW7 A;  2UXC O;  4LF4 O;  1R1B A;  5H5N A;  5LMN O;  2HHH O;  4B3S O;  4JI7 O;  4LF9 O;  4B3R O;  5BR8 O;  1R6T A;  1A32 A;  3F5T A;  4JI4 O;  2UUA O;  4X66 O;  4NXN O;  2DOS A;  4DUY O;  4X65 O; 
#chains in the Genus database with same CATH topology
 2ADP A;  2AHY A;  1JJO A;  2JJ1 G;  1JFF B;  2RDC A;  3HKB A;  3JCZ A;  1DF5 A;  5L3E A;  4QPJ A;  2BSK B;  4NKG B;  1OCC B;  4DO2 A;  5A2Q N;  4Q6G A;  2Q69 A;  1PNL A;  3L73 H;  2YIC A;  3J81 N;  3HPL C;  4GZR B;  5CBG A;  1CP9 A;  4GX2 A;  4LNU B;  1JPX A;  3LNN A;  4MVU A;  2OYQ A;  2N04 A;  2WLJ A;  3LSQ A;  4NXM O;  1N36 B;  2JS3 A;  5IWA B;  1M56 C;  3A0B Z;  5B1B B;  4B3M O;  2ZXW C;  4NTY A;  1FJG B;  1IXB A;  3OTO O;  1BQ0 A;  4PA7 A;  1KP2 A;  2IJI A;  4DV4 B;  3CRQ A;  1BSM A;  3HKC B;  4BW9 A;  4F6R B;  2Z5U A;  4RWU A;  3ZCC A;  5IYZ A;  4CS3 A;  3NXS A;  3CYO A;  3QF7 A;  1O9G A;  4IHJ B;  2ARH A;  2IU3 A;  4X89 A;  1XL6 A;  4J42 A;  3STL C;  4LR3 A;  1VF7 A;  3RVY A;  2HEP A;  4R8C A;  4HBN A;  2FML A;  3CME V;  3SYQ A;  1ARO P;  4DR7 O;  3BAA A;  1XRE A;  2EIM C;  4CH3 A;  1BMF G;  1AP6 A;  2UXC O;  3H01 A;  4LF7 B;  5KLV H;  1CPY A;  4J80 A;  1YIT V;  4B3R O;  1RP3 B;  5BR8 O;  1MSD A;  2QSA A;  1NTZ H;  2YEV B;  2ZDI A;  2UXX A;  3A2F A;  3JAK B;  5K1P A;  1TUE B;  2HG5 C;  2JGD A;  1OJH A;  4ABM A;  1ENV A;  2YC0 A;  2QJ1 A;  2QWR B;  3EFF K;  3U10 A;  4BIZ A;  3OFN G;  3CJH A;  3VQV A;  3VBB A;  1P84 F;  4I55 A;  4WFH A;  4KHP O;  4LFB O;  4LH6 A;  4DR6 O;  4JI0 O;  5ITZ B;  1IDS A;  3ZHV A;  4YJ3 B;  1AB3 A;  5BY1 A;  1EFR G;  3OT7 A;  5FNV B;  1SET A;  5LA6 A;  2ZIN A;  4XDL A;  4YIO A;  3CRA A;  4CH6 A;  1BCC H;  4LBE C;  1VAR A;  1S5H C;  4DV0 O;  1MMM A;  4DUY B;  2BTQ A;  5J2T A;  2F23 A;  3QO7 A;  1VQK V;  1MAB G;  4WFG A;  3VQY A;  2Y69 C;  1I7F A;  1VQ7 V;  3AG4 C;  2CH7 B;  3G6B A;  3RYH A;  2OTJ V;  4ICG A;  2JS5 A;  4FFB A;  1JX9 A;  3CXH F;  3K5O A;  2P7T C;  3LSU A;  1M5I A;  5JJN B;  1XMQ O;  5JWP A;  4X1Y A;  2MW2 B;  1XHX A;  2F4V O;  5B1N A;  5LYJ B;  5IJ0 B;  4JAS A;  1V54 B;  2DN9 A;  1OCZ B;  1QLE B;  5K1X A;  2N74 A;  1SER A;  3JAS B;  3ASN C;  2ETN A;  4DV5 O;  4GKK O;  4FM0 A;  4UVC A;  2WLL A;  2WLN A;  2KB1 A;  1N34 B;  4UCS A;  3DC6 A;  1IBL B;  5LHG A;  5C8Y B;  4MW3 A;  3TCU A;  1A32 A;  1NR7 A;  3TET A;  4X66 O;  2P5O A;  3L71 H;  5EBM C;  3RYC B;  3G80 A;  1TA8 A;  4MVM A;  5LXT B;  3K3W A;  4U3J B;  1HR0 B;  2DWE C;  1FD9 A;  1HNZ O;  2W6I G;  4LP8 A;  1QLN A;  4R6Z A;  2NN4 A;  1XUQ A;  1G8M A;  3SR2 C;  4C7U A;  2RNB A;  1KKD A;  1TUB B;  1XQ8 A;  2Y0I A;  3ABL B;  4YY3 O;  2IW5 A;  1Q7Y W;  4TUY B;  4FIP C;  1I94 B;  4GCZ A;  2V7Q G;  5B3S C;  5KAI Z;  3KCX A;  3GWO A;  4XDK A;  1YSC A;  1M90 W;  3JAR A;  2DJV A;  3JD3 A;  4WFA V;  5LHI A;  5LL6 Y;  2Q7G A;  4U7N A;  1KC8 W;  5CA1 B;  1WP8 A;  3AG1 C;  1SQQ H;  2PYL A;  3N2G A;  2YI8 A;  2UU9 B;  2VQE O;  4O4L B;  4I5S A;  4B7E A;  2DQ3 A;  4FK5 C;  4AIL C;  4U3F H;  4XDJ A;  5H6R A;  1GH6 A;  5IDJ A;  2R72 A;  3RYF B;  4PI2 A;  1M93 A;  3K59 A;  4LFA O;  2ITC C;  2P6J A;  3H1H H;  1F23 A;  3DGE A;  2JVD A;  1S5L Z;  2YIA A;  1KB9 F;  5KX5 A;  3TXS A;  2OTL V;  4UB6 Z;  1YIJ V;  1J5E B;  3P3N A;  3UT5 A;  3IC7 A;  1S76 D;  1XDC A;  1MZE A;  5FLX N;  1HNW B;  4I0X A;  2XND G;  1MG1 A;  4FM2 A;  4D7T A;  2G38 A;  3PJS K;  2Q0A A;  2ILM A;  1VQL V;  3RWR D;  1SC5 B;  5IY5 B;  3CCS V;  2EUL A;  5JVD A;  1K8A W;  1MSW D;  3OMN B;  2A3Q A;  3HKE B;  2LGQ A;  2Q67 A;  1R3L C;  1EM1 A;  2IH1 C;  2QEX V;  4UCT A;  3K9S A;  4DV2 B;  1KP3 A;  3LDD A;  3ETQ A;  5KHH A;  1N36 O;  5IWA O;  3ZRW A;  1NJI W;  3SYP A;  4I4T B;  3BPZ A;  5GON B;  3ABK B;  3SYA A;  1FJG O;  2P4V A;  5L3B A;  4LF4 B;  1S3J A;  5EZY A;  4DV4 O;  2EIK C;  3ABT A;  3OMA B;  1SQP H;  1AR5 A;  1GMG A;  4H0L B;  1RM1 B;  4PA9 A;  3ZHU A;  4HNA A;  3RT3 C;  3RVZ A;  3A0H Z;  3L9D A;  5FL7 G;  2YIB A;  1B3Q A;  2Y4T A;  5L3F A;  3DXR B;  4X1I B;  4OGQ B;  3WB1 A;  5BZB A;  3TXQ A;  4JYY A;  1JOY A;  4TT3 G;  1JFF A;  1AJQ A;  3H1L H;  3SPI A;  2BSK A;  1CEZ A;  1XNQ B;  1BZK A;  1D2D A;  4WBN B;  1HWY A;  2LW1 A;  1KMI Z;  4LF7 O;  4JI1 B;  4JAV A;  1QNM A;  4DR1 B;  1NBM G;  4G28 B;  3HB3 B;  4MTF A;  3G71 V;  4LNU A;  3JD0 A;  2Q7E A;  4JYA B;  1G6U A;  3AG2 C;  1W59 A;  1XBL A;  2OIE A;  1L0L H;  4PD4 F;  1FS0 G;  2VQF B;  3LNM B;  3D8C A;  3TK1 A;  4O2B B;  1M57 C;  3K57 A;  1D5N A;  3K5L A;  2QM4 A;  3ASO B;  4UVA A;  4ZKI A;  3D36 C;  3SGI A;  4L8J A;  1NH2 D;  4F6R A;  3CRC A;  4FZ0 A;  1Z5W A;  4NXN B;  1HNX B;  3X2Q C;  4PDM A;  4PA4 A;  4DUY O;  4IHJ A;  3LDE A;  3E86 A;  3JCU Z;  1BL8 A;  5B1A B;  3QO8 A;  3ETE A;  3B8M A;  3BFR A;  2M6Y A;  1GN3 A;  1IVS A;  3CHX A;  4FLU A;  4DR4 O;  1VF5 B;  1SA0 B;  3R66 A;  3CCV V;  1S5J A;  3PN1 A;  1BQZ A;  4F4L A;  3RN4 A;  2FKX A;  5IYC O;  1OCC C;  1H2S B;  1U97 A;  1GRJ A;  2LFR A;  3D3Q A;  3JD4 A;  3B40 A;  2A9H A;  3D3I A;  2FL4 A;  4P30 A;  3RFR A;  4BAY A;  2DYS B;  4RUF A;  1W2B U;  4OXS A;  4KL1 A;  1V55 B;  1L8D A;  2E5L B;  3JAK A;  4P2Z A;  2RN9 A;  1M1K W;  1US6 A;  4DXW A;  2IBZ H;  4G27 B;  1N34 O;  2Z0A A;  2GUZ B;  3OEE G;  4CH5 A;  5KUM A;  1TVK B;  3OR7 C;  3WG7 B;  1IBL O;  2CTQ A;  4QIW F;  2OWO A;  4HYO A;  1H38 A;  5LP6 B;  5ITZ A;  1SZT A;  2EIJ B;  4YJ3 A;  3A0R A;  5FNV A;  1S72 V;  1SF9 A;  4I50 B;  4LF8 B;  2CGO A;  4KXR A;  1K34 A;  1P7G A;  3C3S A;  1PM9 A;  2WLI B;  1JMK C;  1QBZ A;  1U96 A;  3JAL B;  1FFX B;  3T4Z A;  2XOK G;  4PA6 A;  3UCS C;  1HR0 O;  2R9I A;  2HVJ C;  1AI7 A;  1VQP V;  3BVO A;  2CH7 A;  1GAX A;  4LWS B;  5A9G A;  4JI3 B;  1FXV A;  2X6B A;  3ZMU A;  2D3O W;  4FLW A;  5KHI A;  3CC4 V;  3FKS G;  1HW7 A;  1AJN A;  5EIB C;  2EIN B;  4J10 A;  2K9P A;  4WFE A;  1I94 O;  1YHQ V;  1N4C A;  5LYJ A;  2PYJ A;  4I7Z B;  1Y67 A;  1ZL8 B;  5LOV B;  1BS3 A;  3VQW A;  1GM8 A;  3JAS A;  1K9M W;  3CEI A;  1JR9 A;  1UFI A;  2H8P C;  4H33 A;  2QE7 G;  3H1J H;  1AJP A;  5J9P C;  2UU9 O;  2DYR C;  3L74 H;  3IJ4 A;  3JAM N;  5KA6 A;  1FKA O;  2Q0O C;  5C8Y A;  1XOU A;  1GM7 A;  2ZD9 A;  1FXK B;  1WNS A;  2B1G A;  2OCC C;  1OCR B;  4JPR A;  4UV8 A;  1OZ0 A;  4B08 A;  1PNK A;  1D5A A;  2B5U A;  4FVM A;  3O65 A;  3RYC A;  3BA8 A;  3C3T A;  5LXT A;  2HJD A;  1WPB A;  1AI6 A;  4U3J A;  4DR3 B;  1J5E O;  2IJJ A;  1E79 G;  3BA9 A;  2XAG A;  2QTS A;  3G6E V;  3SJC C;  1HNW O;  2F93 B;  3FYE B;  2YXY A;  4E2L A;  1Q5O A;  4OPA A;  2UUC B;  2XTA A;  5JQG B;  1F4N A;  1AIL A;  1TUB A;  4IGG A;  3DSQ A;  4K35 A;  2JDI G;  3CCU V;  4O4I A;  4TUY A;  4CH4 A;  3C90 A;  4DV2 O;  1OCZ C;  1OHH G;  4RQE A;  3H1I H;  4P9O A;  3E8H A;  4W4L A;  4WFB V;  1EZV H;  1Y74 B;  1K4C C;  4JZG A;  3G4S V;  4LF4 O;  5IE9 A;  1H2N A;  4TV8 B;  4DW1 A;  5CBH A;  1EN6 A;  5CA1 A;  1LNQ A;  3H9V A;  3GWK C;  2Q5Z A;  5KMG B;  3GVM A;  4DV1 B;  4O4L A;  2PZS A;  4LFC B;  2FYU H;  3APQ A;  1WAZ A;  5GW7 A;  2W0X A;  4QE9 A;  3B09 A;  4DV6 B;  4K0K B;  4LCU C;  3WB2 A;  5EBW C;  4NTW A;  2ZE8 A;  5IYD O;  1YTF D;  1K5S A;  3OGC C;  1GM9 A;  1JVM A;  4TOI A;  4FM1 A;  3VOU A;  3TGU H;  3MHS C;  3QVN A;  5EYP A;  4IYI A;  1YJN V;  1XNQ O;  4JI1 O;  3RGB A;  1AI4 A;  1UPG A;  1Q90 D;  1VQM V;  4YHH B;  4DR1 O;  3ABL C;  3JAW B;  3ICX A;  5DN6 G;  3HKE A;  3W7W A;  5LMU B;  4JYA O;  4QPK A;  1Q86 W;  2AZ2 A;  3FYI B;  3CS5 A;  1ZWI C;  3UQ8 A;  4H13 B;  3BAB A;  4X64 B;  2R9A A;  4I4T A;  4UCR A;  2KSD A;  2VQF O;  4EB6 B;  2ZIM A;  5H2F Z;  3LSS A;  5GON A;  3T2M A;  3ZMV A;  3ABM B;  4FLX A;  3HR0 A;  5B1O A;  3CCQ V;  3VQX A;  3KG2 A;  2IH3 C;  3HKD B;  5LBQ A;  3WU2 Z;  3S3X A;  3QNE A;  4YJ2 A;  1L0N H;  3S3W A;  2GDS A;  4QGP A;  4X9Q A;  1I5X A;  2BTO A;  1NTM H;  4LF6 B;  1FXH A;  1URF A;  1HNX O;  4CBC A;  2GHY A;  3FB8 C;  3SJQ C;  4BR6 A;  3SJA C;  3B8N A;  1GTO A;  1Q6U A;  3GB7 C;  4CC5 A;  3DXR A;  4X1I A;  2YI9 A;  1QVG U;  2KKW A;  2RCV A;  2ZDI C;  5LGN A;  2ZM6 B;  2JJ2 G;  1YVW A;  1R6T A;  4MTX A;  5FPO A;  3K5M A;  3AK3 A;  1NVP D;  3I56 V;  2QDO A;  1M56 B;  4WBN A;  2X7R B;  3K03 A;  2X6A A;  2XHB A;  3U0Z A;  2ITD C;  2L35 A;  3AG7 A;  3OAA G;  4TQD A;  1IX9 A;  2W0F C;  2GTS A;  2E5L O;  2WWW A;  2OIG A;  1BHB A;  1F4M A;  3ZMZ A;  1I0H A;  3B77 A;  4JI4 B;  2A79 B;  4O2B A;  5L3D A;  3E8G A;  4RUE A;  4GKJ B;  2CGN A;  5C93 A;  4JI5 B;  1IBM B;  3CB2 A;  4E4E A;  4LF8 O;  2QKC A;  2IM9 A;  1BHA A;  1YI2 V;  1K92 A;  3AK2 A;  3OW2 U;  3OGI B;  2EIM B;  5D5P A;  5JH7 B;  1XEQ A;  1BT8 A;  2BOC C;  1SA0 A;  3W7U A;  1JQ0 A;  4J9Z B;  2ZKO A;  4JI3 O;  2Q6A A;  3K0G A;  3CXC U;  1VQ8 V;  3I55 V;  1R3K C;  1JCH A;  1VEW A;  1DK1 A;  2N05 A;  1NH2 B;  4X62 B;  3MHH C;  5IT9 N;  5EIB D;  3OEH G;  1OCO C;  2WLK A;  2VWK A;  4DRX B;  4RAI A;  2WPD G;  2AXT Z;  4DR2 B;  4BWA A;  4HAM A;  4Z1M G;  2GUZ A;  4FJC C;  3OR6 C;  3OMI B;  1TVK A;  2WAM A;  2BOB C;  3AEI A;  4K8Z A;  3F7V C;  1AR4 A;  2PGG A;  4MTG A;  3JAT B;  2O57 A;  2Y69 B;  1RSO B;  1YF2 A;  2CUG A;  1G1X B;  3AG4 B;  3UO2 A;  3E83 A;  1Y6X A;  2B9Z A;  2WLI A;  2X0L A;  3KKY A;  1GKF A;  4LF9 B;  3JAL A;  1K7D A;  1FFX A;  3RYI B;  4DR3 O;  2XAF A;  2BCC H;  1P4R A;  2MK3 A;  4MVQ A;  2XAS A;  3ZED A;  3N2K B;  4HZ3 A;  2P06 A;  1VQ4 V;  3P30 A;  4NVP A;  3L72 H;  1KKC A;  3JYC A;  1PL0 A;  1ZAU A;  2ATK C;  3ASN B;  2UUC O;  4R50 A;  4PV1 B;  2LJ2 A;  1XMO B;  2KG7 B;  4TQF A;  3SDL A;  3CP1 A;  2F43 G;  3APO A;  1ROP A;  4JI2 B;  5B5E Z;  4PI0 A;  3FB6 C;  5LOV A;  2YXL A;  5H6Q A;  1IBK B;  4J7K A;  4DV3 B;  4ZOL B;  4P9P A;  3EXA A;  5LGT A;  1NS1 A;  2KQX A;  2P90 A;  3WG7 C;  2AHZ A;  2VWJ A;  4DV1 O;  1TGO A;  4DV7 B;  4LFC O;  4JYC A;  2QM8 A;  5J2U B;  5CA3 A;  1Q81 W;  1FXK A;  2QWQ B;  4DV6 O;  4K0K O;  2L6L A;  3ZRV A;  1PPJ H;  4U7O A;  3P32 A;  2UXD B;  2GBO A;  1WB7 A;  4J11 A;  1WB8 A;  3F5T A;  1AR1 B;  3SYC A;  4CC6 A;  3CX5 F;  5B3S B;  3CCL V;  3ETG A;  4KUM A;  4YHH O;  1BGY H;  5JQG A;  2EIN C;  5LMU O;  4G2K A;  2F66 C;  1K3E A;  5HFM A;  4UB8 Z;  4X20 B;  3AG1 B;  3UM7 A;  1QVF U;  3HKC A;  4X64 O;  1E1Q G;  3CC2 V;  1GN2 A;  1Y74 A;  3STZ C;  3M8A A;  3ZRS A;  2RMK B;  4O2A B;  4TV8 A;  4MTO A;  1XIL A;  1R3J C;  2A06 H;  4D6T H;  2V1D A;  4JI8 B;  5KMG A;  4LF6 O;  1K5Q A;  1I5Y A;  4O4H B;  1FXK C;  5IJ9 B;  3K5N A;  1YJW V;  4DW0 A;  1OCR C;  2RJZ A;  3ZX6 A;  4A5U B;  1IXM A;  1M4U A;  5CMU A;  2P67 A;  3K04 A;  4MW8 A;  4UCV A;  1VP7 A;  2ZM6 O;  2YEV A;  3R65 A;  4GX0 A;  4K8X A;  1N33 B;  2WLH A;  2ZE6 A;  2RQ6 A;  2CK3 G;  1LUV A;  1AVM A;  4TWK A;  3FD9 A;  5B1B C;  2CAZ C;  4R7C A;  3JAW A;  1Q6H A;  1KQS U;  5D5Q A;  2EIK B;  1GO3 F;  2XAJ A;  2ZQM A;  2AW9 A;  5H5N A;  2XAH A;  3EHB B;  4JI4 O;  1VIB A;  4EB6 A;  1PNM A;  2V4D A;  5BMV B;  2HR3 A;  1CXZ B;  3ETD A;  2BE3 A;  5EC1 C;  4UV9 A;  4X66 B;  1Z2G A;  1WPX A;  1YTF B;  3HKD A;  4JI5 O;  1IBM O;  3U11 A;  1ZLZ A;  3NR7 A;  4IYH A;  3N27 A;  1DLB A;  2PTM A;  5EC2 C;  5KX5 B;  3E8B A;  5KAF Z;  4LH7 A;  4IIJ B;  1MOF A;  2F95 B;  5LMN B;  2HHH B;  2GV9 A;  4BIO A;  2K1E A;  2HLD G;  1Y76 B;  1VQ6 V;  3OUS A;  2Q7H A;  3L75 H;  4PDL A;  4YIP A;  4ZI7 B;  1VQO V;  3FB7 C;  5IJ0 A;  5E79 Z;  2F1M A;  5E1A C;  1F7Y A;  5H9C A;  3AG2 B;  2WLM A;  1SS3 A;  1S77 D;  3CD6 V;  1J95 A;  1ORQ C;  4MVZ A;  3OD4 A;  3QO5 A;  3O9O A;  1MA1 A;  1VQ5 V;  2QKA A;  1IUR A;  4JI6 B;  4X62 O;  2IU0 A;  5HFL A;  4MVR A;  2XAQ A;  3FFQ A;  4LF5 B;  1M9N A;  1NZ6 A;  3W7S A;  2QA4 V;  4TV9 B;  4AQY B;  4DR2 O;  1R6K A;  2PY5 A;  2CTW A;  3ABU A;  3OTF A;  1QR8 A;  3X2Q B;  4UXN A;  2H94 A;  1DTO A;  2EJR A;  3P3P A;  1SQG A;  1VMG A;  4JTD B;  4O4J B;  4EEQ A;  3K08 A;  2UXB B;  2DE0 X;  2LFS A;  1WN7 A;  4Q20 A;  4ZHQ B;  2Q4P A;  4FLY A;  1SQF A;  1SQV H;  1NVP B;  5B66 Z;  3ZN0 A;  1KYO F;  2R9R B;  1X4T A;  1NI8 A;  1R73 A;  5DED A;  5DM6 V;  4FLV A;  3AG3 B;  1B06 A;  4LF9 O;  3T1H B;  5JH7 A;  4LC1 A;  2ZR2 A;  1QHT A;  3T1Y B;  5KHJ A;  1XHZ A;  5CB4 B;  1V54 C;  1YXB A;  1QLE C;  1Z5V A;  3F5W C;  1P49 A;  1ZTE A;  1NTK H;  2OCH A;  4Z2W A;  2NLJ C;  5JCO A;  4K3A A;  3BCC H;  4GX1 A;  1XMO O;  4OX9 B;  1DGS A;  4JI2 O;  3OE7 G;  1K73 W;  2Y48 A;  1WA8 B;  4Z1V A;  3K06 A;  2R70 A;  2HP8 A;  5EK0 A;  1IBK O;  2LQT A;  4DV3 O;  4JZ2 A;  3OM3 B;  4DRX A;  4N23 A;  3RYF A;  1Q43 A;  4UCU A;  3E22 B;  3W7T A;  5FPR A;  1FPO A;  3ML0 A;  1V9P A;  4JF3 A;  3T1C A;  3OUF A;  4DR5 B;  4FMT A;  4QE7 A;  3ZBH A;  1EN4 A;  5KHK A;  1O9H A;  2NR5 A;  4F6E A;  1THZ A;  4DV7 O;  5CA0 B;  4X88 A;  5CN0 A;  1KBH A;  3JAT A;  1UJW B;  1LR1 A;  2P4K A;  1RSO A;  1Y66 A;  4H44 B;  2EIL B;  1NT2 B;  4DK0 A;  3EVK A;  2UXD O;  3QG5 A;  4X1K B;  3SPC A;  2GTA A;  1XNR B;  3FAV B;  3E35 A;  4EFB A;  2D2C B;  3BY6 A;  5KA5 A;  3RYI A;  2YXH A;  2E3C A;  2QM7 A;  2LO1 A;  1QU7 A;  3N2K A;  3J7A U;  4B3T B;  3CMA V;  5JCO C;  2DW4 A;  4RQF A;  1N32 B;  2ZE5 A;  2KG7 A;  3ZMS A;  1PP9 H;  1SES A;  2DYR B;  5GTH Z;  3KZI Z;  2IJH A;  2EBO A;  4NXN O;  4ZOL A;  2OCC B;  1RPR A;  1KU9 A;  1AI5 A;  4JI8 O;  1JA8 A;  2GSM B;  2YDE A;  2PF4 E;  2YIB D;  4JV5 B;  4L87 A;  3SJB C;  4BW5 A;  3THO A;  4PHZ A;  4DR4 B;  1KD1 W;  5J2U A;  3MDS A;  4JI7 B;  2VS0 A;  3K58 A;  1S0V A;  3SPG A;  3Q4H B;  2UUA B;  1K97 A;  2HKO A;  5BXZ A;  1W0J G;  2CTP A;  4ASU G;  5IY5 C;  5AG2 A;  1VQN V;  1KEC A;  2ZXW B;  3IGA C;  1ZUQ A;  4IT5 A;  1YDX A;  1N33 O;  1SRY A;  3QTC A;  1Q6I A;  2PUS A;  1H2G A;  3ABK C;  4CS2 A;  3L70 H;  3ZHR A;  2JGU A;  3DC5 A;  1FYJ A;  4W4K A;  1LUW A;  3JSN A;  4TSF G;  1YJ9 V;  4X20 A;  2CTR A;  3FB5 C;  4DUZ B;  1RM1 C;  1PV0 A;  1K33 A;  1WLE A;  1AP5 A;  3E89 A;  3HKB B;  2AGA A;  2QWN B;  2WSS G;  4WF9 V;  4MVS A;  3RBZ A;  1N0N A;  4FPP A;  4O2A A;  2M7W A;  3J80 N;  1RFY A;  2UUB B;  1JJ2 U;  4MVO A;  3ZS8 C;  4O4H A;  3JSL A;  5IJ9 A;  2EX3 A;  1I08 A;  2LW7 A;  5LMN O;  2HHH O;  4UVB A;  2QTO A;  2ZT9 B;  5L3G A;  4RO2 A;  2YUA A;  3ZHT A;  3CSX A;  1SQB H;  4D7S A;  1B6Q A;  3F7Y C;  4PJ0 Z;  4X8A A;  3T4D A;  1MNG A;  1Q82 W;  4O4I B;  1YEW A;  1BE3 H;  1PD3 A;  5IYZ B;  5EBL C;  4QNH B;  3CCR V;  2E76 B;  4JI6 O;  4B3S B;  2QKS A;  4QJF B;  3ASO C;  1OV9 A;  2FB5 A;  2WA4 A;  3UKM A;  1FFT B;  4LF5 O;  2YS8 A;  5LP6 A;  3CCJ V;  2OT5 A;  4CS4 A;  4MS2 A;  4X65 B;  4AQY O;  3M7M X;  4I50 A;  3BHP A;  4FLT A;  1HP8 A;  2QWO B;  1Q3E A;  5BMV A;  4J41 A;  4JYB A;  5B1A C;  2CDY A;  5TIS Z;  2Y4U A;  1PL4 A;  2B1I A;  2AZ0 A;  2UXB O;  1FAF A;  1GK9 A;  5CBF A;  4EFE A;  2ZR3 A;  2LP7 A;  1H2M A;  2FTK A;  4ZBM A;  1HDJ A;  1QR9 A;  1RPO A;  3ZMT A;  2JGD B;  4IIJ A;  5EYP B;  4LWS A;  4NYK A;  1N0J A;  4NXM B;  3T1H O;  2NNU A;  1Y76 A;  3CJH B;  4FFK A;  5JJJ B;  2YID A;  4NR1 A;  2DYS C;  3T1Y O;  4I55 B;  4B3M B;  2E75 B;  1X59 A;  3OTO B;  1V55 C;  4ZI7 A;  3UO3 A;  3JD1 A;  4GLX A;  4GT1 A;  4AHC A;  1ZL8 A;  1R6N A;  5LA6 B;  4UFZ A;  1Q8I A;  1F51 A;  4OX9 O;  1R1B A;  2EZP A;  2LGW A;  5L3C A;  2BTQ B;  5J2T B;  1QQC A;  3I5D A;  3W7X A;  4YJ2 B;  3IFX A;  3G67 A;  5LP6 C;  2QR4 A;  4FZ1 A;  3D36 A;  2EIJ C;  5LGU A;  2PI5 A;  5KUK A;  2DWD C;  2YSU B;  4WFF A;  4TV9 A;  4PDR A;  3RYH B;  2JEX A;  2HFE C;  1EZJ A;  3DTU B;  2EZO A;  5JJE B;  3WB0 A;  4DR7 B;  2WA3 A;  4DR5 O;  4FFB B;  1YZB A;  2ZE7 A;  3K79 A;  5DEC A;  2HVK C;  1NU1 H;  3CRR A;  2UXC B;  2CE4 A;  3H1K H;  4X1Y B;  1XL4 A;  4O4J A;  4B3R B;  1NR1 A;  5BR8 B;  1Y4M A;  1SKV A;  4ZHQ A;  1H2K A;  4PDV A;  3RW0 A;  2XUM A;  4J7J A;  4B7K A;  4JAU A;  5LHH A;  1H8E G;  2C2A A;  1SQX H;  1XNR O;  3KCY A;  2WLL B;  3LUT B;  1H2L A;  2ADQ B;  2Z3Y A;  4NTX A;  3IC9 A;  3CCE V;  5CB4 A;  4PEL A;  4KHP B;  4LFB B;  2A7W A;  1VQ9 V;  1PKX A;  4YXW G;  3CCM V;  4DR6 B;  4B3T O;  4JI0 B;  1OCO B;  1WP7 A;  1MZF A;  1H8H G;  1B04 A;  2JRI A;  1N32 O;  3BRC A;  4XBF A;  4GX5 A;  4DV0 B;  1NQT A;  1R3I C;  2ZCE A;  4OPH A;  3E8F A;  3CC7 V;  1WA8 A;  3A8T A;  4KP4 A;  1ZSP A;  2QGN A;  2H3O A;  2Q68 A;  2E74 B;  3ZHQ A;  1IZ3 A;  3E22 A;  3K0D A;  3ZHS A;  1VF6 A;  4J9Y B;  1T5E A;  4JV5 O;  2JEU A;  3JD2 A;  1K4D C;  5CA0 A;  3CWB H;  1XMQ B;  1GN4 A;  1EN5 A;  4JI7 O;  2F4V B;  2UUA O;  1W0K G;  1P7B A;  3IAY A;  3CE2 A;  2DOS A;  3AG3 C;  3JAR B;  4BIU A;  4DV5 B;  4UUJ C;  4GKK B;  1E1R G;  4X1K A;  3FAV A;  4I9W A;  4PA3 A;  2Q9L A;  4JTA B;  3MAQ A;  3LDC A;  3N2G B;  4AI8 A;  2X6C A;  4JTC B;  3ZN1 A;  1SZX A;  5IYB O;  2VRZ A;  3K9A A;  4JAA A;  3ZRX A;  2QWP B;  3ZIA G;  2JK5 C;  3B2E E;  1XI1 A;  4ZIB A;  2IJK A;  1ZX3 A;  3BEH A;  5F2V O;  4NB5 A;  1KUQ A;  4GKJ O;  4GYC B;  1GN6 A;  3AK1 A;  2PI4 A;  4DUZ O;  2ZNJ A;  4J7Z A;  2Q8V A;  4UCO A;  1L1F A;  4KFM A;  1YCI A;  1DF4 A;  3UT5 B;  4I9Q A;  2JIZ G;  3ZJZ A;  2XT9 A;  1N8R W;  3SPJ A;  1HNZ B;  4I0X B;  1NKD A;  4FLZ A;  3B4S A;  3TJT A;  1VF6 C;  2UUB O;  2EJ7 A;  3FX7 A;  4CZZ A;  5GTI Z;  4DYL A;  5KHG A;  2ODM A;  5JVD B;  3E2E A;  2P22 C;  1G4Y B;  4YY3 B;  4MSW C;  2Y0P A;  4WCE V;  3CRM A;  3M99 B;  3SPH A;  2EIL C;  3Q4H A;  3ZRW B;  3MD0 A;  3WFV A;  2ZIO A;  2UXN A;  3SYO A;  2W6J G;  1M57 B;  2HJF C;  5EZY B;  2ZNI A;  1QCE A;  4DK1 A;  2Q73 A;  2A0L A;  1COW G;  2DQ0 A;  2VQE B;  3CPW U;  1WJZ A;  4EKW A;  4B3S O;  4HNA B;  3ABM C;  4H37 A;  4JGS A;  4IL6 Z;  4MT8 A;  2DMX A;  4LFA B;  4N21 A;  1EBO A;  1TAE A;  4GUN A;  4X65 O; 
#chains in the Genus database with same CATH homology
 1I94 O;  4JI5 O;  1IBM O;  1N36 O;  5IWA O;  4YHH O;  1G1X B;  4JI8 O;  4DR5 O;  5LMU O;  2E5L O;  5A2Q N;  1YZB A;  1XMO O;  1HNZ O;  4DR4 O;  4KHP O;  4LFB O;  3R66 A;  1FJG O;  4DR6 O;  4JI0 O;  4DV4 O;  3J81 N;  4JI6 O;  2FKX A;  1AB3 A;  4X64 O;  5BY1 A;  4JI2 O;  4DR3 O;  1KUQ A;  4GKJ O;  1IBK O;  2UU9 O;  4DV3 O;  3JAM N;  5BXZ A;  4LF5 O;  1XNQ O;  4YY3 O;  1FKA O;  3M8A A;  4DUZ O;  4DV0 O;  4JI1 O;  4AQY O;  4NXM O;  3RT3 C;  1XNR O;  4DR1 O;  1F7Y A;  2UUC O;  1N33 O;  4LF8 O;  4LF6 O;  4B3M O;  4JYA O;  4DV7 O;  3SDL A;  3OTO O;  2DJV A;  4B3T O;  3O65 A;  5LL6 Y;  2UUB O;  2UXB O;  4X62 O;  1N34 O;  2Z0A A;  1XEQ A;  4A5U B;  2VQF O;  1J5E O;  1FYJ A;  2JRI A;  1N32 O;  2VQE O;  1IBL O;  1HNW O;  1XMQ O;  1D2D A;  2UXD O;  2ZKO A;  1NS1 A;  2ZM6 O;  4LF7 O;  2F4V O;  4OPH A;  4DR2 O;  4JI3 O;  3T1H O;  4OPA A;  2AGA A;  4LFA O;  1AIL A;  4DV1 O;  3T1Y O;  2N74 A;  1X59 A;  1DK1 A;  1HNX O;  4LFC O;  3J7A U;  4DV5 O;  4DV2 O;  4GKK O;  3J80 N;  4DV6 O;  4DR7 O;  4K0K O;  5IT9 N;  1HR0 O;  4JV5 O;  5FLX N;  4OX9 O;  2LW7 A;  2UXC O;  4LF4 O;  1R1B A;  5H5N A;  5LMN O;  2HHH O;  4B3S O;  4JI7 O;  4LF9 O;  4B3R O;  5BR8 O;  1R6T A;  1A32 A;  3F5T A;  4JI4 O;  2UUA O;  4X66 O;  4NXN O;  2DOS A;  4DUY O;  4X65 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...