1KUQA

Crystal structure of t3c mutant s15 ribosomal protein in complex with 16s rrna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
CKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
publication title Role of N-terminal helix in interaction of ribosomal protein S15 with 16S rRNA.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1kuqA00
2UU9O 4DR7O 2FKXA 3T1YO 4JI7O 4AQYO 1X59A 2ZM6O 1DK1A 1KUQA 4DUYO 4LFBO 4OPAA 3M8AA 4X65O 2UUCO 4X66O 1N32O 1D2DA 1F7YA 1AB3A 1I94O 3F5TA 3OTOO 4KHPO 4JI6O 1HNXO 2VQFO 4YHHO 2AGAA 4OPHA 4DR3O 5FLXN 4JI1O 1N33O 1R6TA 1AILA 1HNWO 4LFAO 2N74A 3SDLA 4DUZO 1N34O 2ZKOA 2DJVA 4B3TO 1FYJA 4JI0O 3JAMN 3O65A 5LMUO 4LFCO 1FJGO 1HNZO 4DR2O 1R1BA 2JRIA 4GKKO 4LF9O 4JV5O 1IBLO 1IBKO 4LF7O 5IT9N 4X64O 4JI8O 1XMQO 3J7AU 4JYAO 5BR8O 1FKAO 1XNQO 2LW7A 5BXZA 1IBMO 4B3RO 1A32A 2UXDO 2UXCO 1HR0O 3R66A 3J80N 4B3MO 2DOSA 3RT3C 4K0KO 2HHHO 5LL6Y 4X62O 5IWAO 4JI5O 4OX9O 4DV5O 1XMOO 4YY3O 4NXNO 4DV4O 1XNRO 4DV6O 2UUAO 5LMNO 1N36O 2F4VO 1G1XB 2UXBO 4DR5O 4DV3O 4DV7O 1J5EO 2VQEO 3T1HO 4DR4O 2Z0AA 4JI3O 5A2QN 4NXMO 4JI2O 2UUBO 4B3SO 1YZBA 4LF4O 3J81N 5H5NA 4DR6O 4JI4O 1XEQA 4A5UB 4LF5O 2E5LO 4GKJO 5BY1A 4DV1O 4DV2O 1NS1A 4DR1O 4DV0O 4LF6O 4LF8O
chains in the Genus database with same CATH superfamily
1RPRA 1SQQH 3CYOA 2PYJA 3CMEV 3CCMV 1R3IC 2NN4A 2W0XA 4PV1B 4B3MB 3AK1A 4MVSA 4U7NA 1K73W 4UB6Z 2Q7HA 3SJBC 4KFMA 4UXNA 4MVZA 4YHHO 2ILMA 2KG7A 4JYAB 4GZRB 3WFVA 1UJWB 5JCOC 1N33O 3IJ4A 1NR1A 5L3FA 5L3EA 1HNWO 1O9HA 1OCCB 2DWEC 4U3JB 4JI3B 5EZYB 2ZKOA 2DJVA 4WFEA 5H2FZ 4P30A 1GMGA 3IGAC 1AR5A 2CAZC 4PA4A 4GCZA 2WLHA 1OJHA 4DV0B 5B3SC 3OR6C 1N8RW 3H1IH 3T1YB 2HR3A 3JD3A 2AW9A 1WJZA 3L71H 2HVJC 2Y48A 1DLBA 2UXDO 1VQKV 3EFFK 2LP7A 4HZ3A 1L1FA 1Y76A 1I7FA 3J80N 1EN6A 3SGIA 2DOSA 1F4MA 1WPBA 1S5HC 4RO2A 5CA1B 1AJPA 1QVFU 4FLWA 3TGUH 4DV4O 4X88A 2UUAO 3TCUA 3ZMZA 3K5LA 3SPHA 2DYRB 2GV9A 1WN7A 4TUYB 4DR4O 2AHZA 4J11A 1W2BU 2P67A 4U3JA 4O4JB 5EZYA 4JI4O 1M4UA 2DYSB 4AI8A 4NYKA 1KD1W 2Y69C 3SPGA 1IBMB 2DW4A 2HG5C 3K3WA 4RUFA 4MSWC 2AZ2A 4OPAA 4X65O 3BHPA 4QNHB 2IJKA 1XL4A 3W7WA 2FMLA 3AG4B 2G38A 3OTOO 5CBGA 4NXNB 1OCRB 4F6EA 5KX5B 3EHBB 3X2QB 4DV3B 1NTZH 3ABTA 1XL6A 4LBEC 3JSNA 5CA1A 3K06A 1XUQA 2LGWA 3CXCU 4HAMA 3ETDA 3TXSA 5IJ9B 1JA8A 4Z1VA 2ZCEA 5KHGA 4FFKA 5GTIZ 3BFRA 2E74B 4TUYA 3HPLC 3H1JH 1GN3A 3E35A 1R6NA 1XMQO 5LA6B 4O4JA 2C2AA 3B2EE 1I94B 4MTFA 5KHJA 2BOCC 3BPZA 1YDXA 1AROP 2Z3YA 4J9YB 2ZXWB 3FB8C 2EBOA 3A8TA 2F93B 4UCUA 2ZE7A 3OUSA 3ZX6A 1EZJA 2LW1A 4TSFG 2WLKA 5KX5A 1I0HA 2LQTA 1HWYA 5IY5C 1VF6A 3CB2A 3VQVA 1TGOA 2W0FC 3OGCC 2GSMB 2WLNA 5IJ9A 1VF5B 5BR8B 4DV1O 3UO3A 5IYZB 1RFYA 5L3BA 4X1YB 1Y6XA 2X6AA 3K04A 4C7UA 3HKCB 1ZLZA 3JASB 2IU0A 2XUMA 1D2DA 5LA6A 1M57C 1HDJA 3OEHG 3BABA 5ITZB 3K08A 2AGAA 1XNQB 1OCOB 1EBOA 5HFMA 3T1HB 2MW2B 2VWKA 3E8BA 1ENVA 2EILC 4JI2B 1TUEB 3GVMA 1JMKC 1S0VA 1MG1A 4R8CA 1FFXB 1Z2GA 2R9IA 3VQWA 2GTSA 3K03A 3FX7A 1F51A 2UU9B 5CBHA 2YIBA 4JV5O 1V55C 1PM9A 4LFBB 1XBLA 4YIPA 3NXSA 1QLNA 4X66B 5KMGB 3ZS8C 3CEIA 4FM1A 1ZWIC 2ZINA 1FXKC 2NR5A 5IYZA 4QE9A 4H44B 2HJFC 3CHXA 4X1YA 1G4YB 2YSUB 1JJ2U 2A79B 2EIJB 3HKCA 1YIJV 3JASA 3SYAA 2CTRA 1PKXA 2EZPA 2RMKB 1OCZC 1LUWA 1S5JA 4O4IB 2JGUA 4WFHA 3ETGA 4X1IA 5ITZA 1Q6HA 3WB2A 2AZ0A 2XAQA 2EINC 4Q6GA 5H6RA 1FAFA 3MHSC 2QJ1A 2QKAA 1P84F 3ZEDA 3FYEB 1IBLB 1CEZA 4F4LA 3SPIA 4DR1O 3ZN1A 1FFXA 3ZMSA 4FZ1A 3RWRD 2CTQA 3APOA 2X6BA 3TK1A 3JYCA 5EBMC 2YXYA 1RM1C 2WLMA 3BRCA 4GX2A 4DO2A 2YEVB 4GUNA 3K59A 4YJ3B 2QKSA 5BMVB 5KMGA 4YY3B 2PF4E 2UXNA 1WP8A 2ZR3A 4UCSA 1PD3A 3OD4A 4HYOA 4WFFA 1RP3B 3ABLC 4PHZA 1XHZA 2ITDC 3CX5F 3M99B 4O4IA 2X6CA 3QF7A 5B1AC 1L8DA 1OHHG 3JAKB 3UO2A 1PNLA 3AG7A 4X64O 4QJFB 3K57A 2KSDA 3P3NA 1Q86W 2UUCB 3K0GA 2ZE5A 2UXXA 5CA3A 4J9ZB 3CRRA 1GM9A 1TA8A 1VQPV 4UB8Z 1SRYA 3ABMC 5LBQA 4XDLA 2IH1C 2YEVA 4PDMA 2Q5ZA 4J7KA 4YJ3A 2M6YA 1KB9F 4AQYB 1L0NH 4DUZB 3A0BZ 5BMVA 3BCCH 1ZX3A 4PDRA 2F43G 3L74H 3CMAV 1PPJH 1E79G 4NXMO 4N23A 3ZMTA 2CTPA 4CH5A 1M1KW 4BIZA 1SF9A 1HP8A 4DR3B 2Q4PA 1R3KC 2QTOA 3AG1C 2N05A 4K8XA 4JASA 4AILC 4TQDA 4JZGA 5JCOA 3JAKA 2ODMA 1KC8W 4UCOA 4K0KB 5LYJB 4OX9B 4XDKA 2Y69B 1Q6IA 2Y0IA 1H2MA 1K92A 5FLXN 2Q68A 3M7MX 4PA9A 1Y66A 3CC7V 2QM7A 3MDSA 2DN9A 1VARA 2UUBB 1MMMA 5JJJB 1KP3A 4DR6B 2RJZA 2GUZB 3WG7C 2XOKG 2BE3A 1KKCA 1FJGO 4R7CA 4GKJB 5JQGB 4DR2O 5CN0A 3STLC 2JRIA 4X9QA 1MZFA 1CXZB 1KU9A 3J7AU 3CC2V 1P7GA 2LJ2A 5KLVH 1RPOA 5IDJA 1COWG 3LUTB 4B3RO 4FLUA 1VQLV 1FXVA 1QHTA 1NH2D 3AK3A 5HFLA 2NLJC 1HR0O 1MSWD 3CP1A 4LP8A 4YHHB 3K9AA 3SJAC 2HFEC 5IWAO 1N33B 4HNAB 3HKBB 1QLEC 1AP6A 1SA0B 2FB5A 4E4EA 1HNWB 1XHXA 1M90W 3ZIAG 5LYJA 4B08A 4ZI7B 4DV6O 1OV9A 1ROPA 4DV7O 1WP7A 1NBMG 4LH7A 4MT8A 3JD4A 4LCUC 5J2TB 1H2KA 1WB7A 3L70H 1YJWV 1BQ0A 1Y67A 2WLIB 2E5LO 4NTXA 1YCIA 2GUZA 1SZXA 4LF8O 1VMGA 4EFBA 5IY5B 2WSSG 4XBFA 2Q67A 5JQGA 2UXDB 4RUEA 5KA6A 1KUQA 2JVDA 2L35A 3OMIB 3ZRXA 1FXHA 1BMFG 2ADPA 2HKOA 2FL4A 3CWBH 4X20B 3CD6V 2Q9LA 3WB0A 5KUKA 1BE3H 1ZAUA 3ASOC 4ZIBA 2VQFO 4DV4B 3DC5A 3LSSA 2HJDA 2WLJA 4TWKA 2IW5A 3SJCC 4LFAO 1BHAA 4W4LA 1M57B 4BAYA 2YDEA 4HNAA 3HKBA 1SA0A 4TT3G 4B3TO 4ZI7A 4JI4B 2YC0A 3JAMN 2ITCC 5E1AC 4LWSB 4GLXA 2Y4TA 2GTAA 1R1BA 2OIEA 2EILB 1N36B 5JH7B 5J2TA 1J5EB 2ETNA 2QSAA 3A0HZ 4X65B 4PELA 1NT2B 2E3CA 2WLIA 1GK9A 4CS2A 1U97A 3G71V 1V55B 4UCRA 2IJJA 4GX1A 3RT3C 1TUBB 4KL1A 2ZIOA 4MW3A 1VQNV 3CCRV 3BAAA 4UCVA 3I5DA 1FXKB 4DRXB 1H38A 4I9WA 3LDCA 4X20A 5B1BC 3GWKC 4WF9V 3NR7A 1QR9A 2F1MA 2YS8A 3ETEA 3SR2C 4U3FH 4DK0A 3U0ZA 1OCZB 1IZ3A 2GHYA 3QTCA 2JEUA 2PZSA 1SQVH 3WB1A 1K3EA 3ZJZA 1XMQB 4IT5A 2EINB 1NS1A 3R65A 2JK5C 3LDEA 4DR7O 2FKXA 2H8PC 4LWSA 2B1IA 4DUYO 1QVGU 4Z2WA 1Q90D 1N0JA 2OCCC 5LGNA 1SC5B 4OGQB 2HEPA 4FLVA 1N32O 5JH7A 1XQ8A 3UCSC 4WFBV 4KHPO 5DN6G 4OXSA 1RM1B 2WPDG 1SQGA 1FS0G 3E86A 2ARHA 3MD0A 4OPHA 2QTSA 4FM0A 1TUBA 2N74A 3SDLA 3ABKC 4MVRA 4ASUG 1FXKA 4JZ2A 4DRXA 5IYDO 3CRMA 4MTXA 4PI2A 4DV1B 3ABUA 1YITV 3ZMUA 3E8FA 3ABLB 3CCQV 2DWDC 4JYAO 2LGQA 4K35A 5B1AB 1IXBA 1SS3A 2LFSA 2EJRA 4G2KA 2R70A 2H3OA 4J80A 1VQ9V 1VEWA 1GN2A 4G28B 2F95B 2V4DA 3P30A 4CZZA 4DV2B 1YXBA 4P2ZA 1G8MA 3BA9A 4D7TA 1QCEA 1SETA 1JJOA 1NI8A 1G1XB 4PDLA 2QE7G 1GM7A 4ZHQB 1Y74B 3ABMB 1GAXA 3RBZA 4I4TB 2YI9A 3SYOA 2PI5A 2R9AA 3T1CA 1K9MW 4B3SO 3JD2A 1VQ7V 4LF4O 3CCUV 3J81N 5H5NA 3UKMA 4EB6B 1KMIZ 1AR4A 4JV5B 4GT1A 1S5LZ 2XAJA 2QA4V 2BSKB 2MK3A 1R3JC 1I08A 1K4DC 3M8AA 5C93A 5K1PA 3ZHVA 4JYBA 4GX0A 3AG1B 1D5NA 4FLTA 1AB3A 2WWWA 3ML0A 3TXQA 1NTMH 2FYUH 2HVKC 3DTUB 3EVKA 4P9PA 3QO7A 2M7WA 3VOUA 3HB3B 1JVMA 4N21A 4NTYA 4FK5C 1N34O 3HKDB 3GWOA 3UT5B 1KKDA 1X4TA 2ZE8A 2A0LA 3RN4A 4CBCA 3CSXA 4QGPA 2EIMC 2KQXA 3H9VA 2HLDG 2VRZA 1Y74A 4ZHQA 4DR1B 3RW0A 3I55V 4I4TA 4O2AB 1JOYA 2P4KA 4JI8O 1Q5OA 2RNBA 4EB6A 2CH7B 2R72A 3WG7B 4DW0A 1EZVH 5IYBO 2V7QG 1BGYH 4IIJB 3RVZA 2BSKA 3JD1A 3PJSK 2CTWA 5LGUA 3F7YC 1V9PA 1ZSPA 3ETQA 5F2VO 1MABG 3K5NA 5EYPB 4NB5A 3SPJA 2XAHA 1SQFA 5LMNO 2Q6AA 1LUVA 1W0JG 1N4CA 3B09A 2F4VO 2P22C 4RAIA 4DR5O 2RN9A 1WA8B 2Q0OC 2V1DA 4KP4A 2VQEO 2YXLA 2DQ0A 3U10A 1QLEB 4PD4F 1OCCC 2P6JA 4I0XB 2JIZG 3HKDA 3UT5A 1Q3EA 1EN5A 2B1GA 2EX3A 4X64B 2OYQA 2ZNIA 3N27A 5TISZ 4GYCB 3RYHB 1QNMA 4TOIA 3KCYA 3RYIB 1M56C 5EBWC 3ZCCA 2ZM6O 2ZDIC 2D2CB 3K58A 4O2AA 4BW9A 2OTLV 3W7SA 1THZA 2QR4A 2W6JG 2CH7A 1FPOA 2D3OW 2VWJA 3B77A 2EIKC 4IIJA 1F4NA 3SPCA 4KUMA 3AG3C 1AJNA 1AILA 3E2EA 1AI7A 3JD0A 3Q4HB 4NXMB 1V54B 5EYPA 2QM4A 3ASOB 2Z5UA 2XAGA 4J42A 4UVBA 4B7KA 2P06A 1WAZA 4LR3A 1WA8A 4PA3A 2Y4UA 3CCLV 2JDIG 1NJIW 3L72H 4LF9O 4FVMA 4I0XA 3FAVB 1YSCA 3L75H 3E8GA 1XNQO 1YJNV 1XOUA 2PY5A 1VQ8V 1A32A 1PNKA 2YIDA 3RYHA 3UQ8A 2UXCO 1SERA 4MW8A 1PP9H 3RYIA 3FKSG 4MTGA 4EEQA 2HHHO 2PYLA 4DV5O 1ZUQA 4UFZA 1XMOO 4CH4A 2N04A 5J2UB 3CS5A 4IL6Z 3S3XA 2XAFA 1BHBA 3IC9A 2UXBO 1KP2A 1Q6UA 1FFTB 4BR6A 5B3SB 4X89A 3D36C 4DR2B 3CCEV 4JF3A 5EC2C 1YZBA 4CH3A 3Q4HA 2Q7EA 2GBOA 5CMUA 5B1BB 2DMXA 2ZIMA 2K9PA 1Q8IA 4LF6O 3P3PA 4I7ZB 4B3RB 4PDVA 3OT7A 4UVCA 5L3GA 4PA7A 1PL4A 1HR0B 2EJ7A 4YJ2B 3OAAG 3FAVA 4H33A 3AG2C 3E22B 3B4SA 4JYCA 1M9NA 3K9SA 4DV6B 2OCCB 3ASNC 1Q7YW 2R9RB 4DV7B 1R6TA 1IXMA 1KQSU 4JGSA 3ZRVA 3RFRA 3OEEG 4CC5A 1G6UA 5J2UA 4IHJB 4JI0O 4BIUA 3CPWU 3TJTA 5JJEB 3CXHF 2YIAA 3O65A 5LXTB 1O9GA 4QE7A 4LF8B 2HP8A 5GONB 5J9PC 1KBHA 1K7DA 3ABKB 2NNUA 2AHYA 3H01A 4YIOA 4FFBB 1FKAO 4NTWA 3ICXA 2BTQB 3LSQA 1UFIA 5LOVB 2PGGA 3OGIB 1S77D 4YJ2A 1GRJA 4LFAB 2PI4A 2QWQB 3VQYA 4U7OA 2P5OA 4G27B 3O9OA 4DW1A 1MA1A 3E22A 4B3TB 3SYCA 2JS5A 4TQFA 3A0RA 3FYIB 5H6QA 2JJ1G 1RSOB 3A2FA 4L87A 5LGTA 4MVQA 3IC7A 4JYYA 3ZHTA 4IHJA 2LO1A 1BZKA 5LXTA 4AQYO 1X59A 2B5UA 4H37A 5GONA 5CB4B 3DC6A 1SZTA 1SQPH 1YHQV 5EC1C 3E89A 1EN4A 3F5TA 4KXRA 4MVOA 1CP9A 4D7SA 1HNXO 4JAUA 2BTQA 4DR3O 1TVKB 4IYHA 4JI1O 3B8NA 4FLYA 1VQMV 2EIJC 5JWPA 1H2LA 1SKVA 3QG5A 2XT9A 4DK1A 5LOVA 3MAQA 1Q82W 1K8AW 4BW5A 5LP6C 5KUMA 2YIBD 2OT5A 1VP7A 4FPPA 1B3QA 2X7RB 4CC6A 5LMUO 4XDJA 1P7BA 1IDSA 4LC1A 1R73A 4FM2A 3DSQA 2UUAB 4PI0A 1IBKO 1NTKH 4DUYB 1RSOA 3JATB 2EIMB 3H1LH 4QIWF 5CA0B 1N32B 4DR4B 2LW7A 4GX5A 1NZ6A 1H2GA 4KHPB 3STZC 1JR9A 4RQEA 3W7UA 3ZBHA 2IJIA 5CB4A 5EBLC 4X62O 1D5AA 1VQ6V 4JI5O 4UV9A 1LNQA 4UCTA 1XNRO 2IH3C 1Y76B 1I5XA 1QQCA 3IAYA 1S3JA 4JTDB 3SYPA 1TVKA 1ZL8B 5A2QN 3WU2Z 3OTOB 4MTOA 2QKCA 2CGOA 3RYCB 4LF5O 4NR1A 1QBZA 3TETA 4BIOA 4JI7O 1IX9A 5KAIZ 3K5OA 3B40A 2IBZH 3KCXA 1CPYA 2O57A 3JATA 5DEDA 2XTAA 4TV9B 1NU1H 2RQ6A 1WNSA 5CA0A 1AI4A 1M56B 1GTOA 4JI6O 3THOA 3E8HA 3HKEB 3RYFB 3JCZA 5KAFZ 5FPRA 1DTOA 2A06H 4NVPA 3ZMVA 3CCSV 1K33A 1YTFD 3L73H 4B3SB 4UUJC 4I55B 4LF4B 2EIKB 4EFEA 2QM8A 2OIGA 4LFCO 2Q69A 3AG3B 1HNZO 2P4VA 4UV8A 1AI6A 1ZL8A 1JCHA 4GKKO 4W4KA 5KHHA 4LF7O 1WPXA 1P49A 3OMAB 4IYIA 3CJHB 2BCCH 3RYCA 1XI1A 3K0DA 2JS3A 1TAEA 2F23A 5IJ0B 2WLLB 3LNNA 4B3MO 4MVMA 4HBNA 3GB7C 1T5EA 4CS4A 4MVUA 1JQ0A 4D6TH 1M5IA 4TV9A 4ICGA 4O4LB 4PJ0Z 1GN6A 3JSLA 1N34B 3BY6A 1N36O 1QU7A 3JCUZ 3D3QA 2OTJV 2ZDIA 1J5EO 1W59A 1B06A 3HKEA 4JI3O 4K3AA 3RYFA 1AI5A 1AJQA 1H2SB 3RGBA 2VS0A 2ZD9A 4LH6A 1W0KG 2DE0X 4JI8B 4I55A 4DV0O 1R3LC 5LHIA 1I5YA 3T1YO 2Q8VA 4L8JA 1EFRG 1PL0A 1NH2B 3CJHA 2QWNB 2L6LA 3BVOA 2ZNJA 1K34A 3DXRB 5LMNB 3HR0A 5IJ0A 2F4VB 1SQBH 1K5QA 2P7TC 2WLLA 4DR5B 5JVDB 2VQEB 4ABMA 3AG2B 3ZHUA 1S72V 4DYLA 4O4LA 1AP5A 4QPJA 3ASNB 3CRAA 2ATKC 3K5MA 3G80A 1BCCH 2YUAA 1HW7A 3K79A 2ZQMA 1AVMA 4FZ0A 1Q43A 5DM6V 1IURA 1BQZA 1P4RA 1VQOV 2ZM6B 2KKWA 2X0LA 1M93A 3C3SA 2QWOB 1BS3A 3VBBA 3RVYA 1IBMO 2K1EA 1KYOF 3T4DA 3FB5C 2JEXA 2YICA 1IVSA 1YF2A 2WAMA 3D36A 1S76D 3FB7C 5FL7G 2A3QA 3OW2U 1XREA 1H2NA 2WA3A 4NXNO 4JTAB 4H13B 4CH6A 3H1KH 1GO3F 5KA5A 3VQXA 4DV3O 3APQA 5AG2A 3DXRA 4X1KB 3FB6C 3ZRWB 1EM1A 1F23A 5JVDA 4UVAA 2CGNA 4LF9B 4X1IB 4J7ZA 3E83A 4A5UB 1LR1A 3QNEA 2F66C 1B6QA 2W6IG 3C3TA 1N0NA 4DV2O 1Z5VA 4JAAA 2P90A 3KZIZ 1YEWA 3SYQA 2UXCB 1NKDA 3ZN0A 2DQ3A 3N2KB 3CRCA 1MOFA 3OR7C 2IU3A 4Z1MG 1NVPD 4TV8B 2HHHB 1I94O 3QO5A 4DV5B 1XMOB 4RWUA 4FLZA 3QO8A 1R6KA 4P9OA 2UXBB 2Y0PA 1NQTA 2YI8A 4DXWA 1VQ4V 2IM9A 3W7TA 2GDSA 2YXHA 2A7WA 2Q7GA 2RDCA 3DGEA 1FYJA 5KHIA 1US6A 4JPRA 3EXAA 4X8AA 4LF6B 4X1KA 4O2BB 5LP6B 3ZRWA 1ORQC 5BR8O 3ZHRA 5CBFA 1FD9A 4I9QA 3T2MA 4WBNB 4BWAA 3IFXA 1YTFB 2ZR2A 4FJCC 1E1QG 1JFFB 1GM8A 2DYRC 5B66Z 4JAVA 4FIPC 5H9CA 5LL6Y 2JGDB 3N2KA 3T4ZA 3BEHA 1K5SA 4TV8A 3PN1A 3ZRSA 1XDCA 2ZT9B 2QWRB 3CRQA 5L3CA 2DYSC 4JI0B 2PTMA 3H1HH 3T1HO 4ZBMA 1JX9A 3F5WC 4FLXA 4JI2O 4AHCA 5D5QA 3KG2A 4F6RB 3L9DA 4CS3A 5GW7A 2LFRA 5BZBA 4H0LB 2UU9O 3AG4C 3G6EV 3I56V 1XILA 5LHHA 4LFBO 4O2BA 1WB8A 5LP6A 1OCRC 3G4SV 4IGGA 5EK0A 1MNGA 1K4CC 3X2QC 4X66O 1VF6C 3JARB 1F7YA 1URFA 1FJGB 4WBNA 2A9HA 1H8HG 1Y4MA 2QWPB 1VF7A 3QVNA 4PA6A 2B9ZA 5A9GA 3P32A 2QEXV 1JFFA 2KB1A 2CE4A 1J95A 1U96A 1AR1B 4K8ZA 1WLEA 2E76B 5GTHZ 2JGDA 3CE2A 2QDOA 1VIBA 1MSDA 4I50B 1BSMA 5IWAB 3LSUA 4WFAV 5B1OA 5IT9N 1IBLO 3OE7G 1ZTEA 4F6RA 4LNUB 4ZKIA 2ZXWC 1L0LH 3OFNG 3JAWB 5C8YB 3KKYA 4J41A 1HNXB 1E1RG 2E5LB 1NR7A 3FFQA 4JI1B 5D5PA 2CDYA 5DECA 1H8EG 3JARA 4YY3O 4E2LA 3LDDA 4R6ZA 3D3IA 5KHKA 3F7VC 2E75B 2EULA 3S3WA 1YJ9V 3UM7A 4WCEV 1GN4A 3OMNB 5LMUB 2CUGA 1SQXH 3ZHQA 1B04A 5IE9A 5JJNB 5B1NA 1YI2V 5K1XA 4NKGB 5EIBC 2VQFB 1KECA 1IBKB 2XHBA 4I50A 3MHHC 1DK1A 3G6BA 3CCVV 1PNMA 1PV0A 1MZEA 1BT8A 2UUCO 1DGSA 4YXWG 4ZOLB 1OCOC 2EZOA 4LNUA 3U11A 4EKWA 4X62B 5FNVB 4JI5B 3JAWA 4I5SA 5B5EZ 2FTKA 3AK2A 2OCHA 4RQFA 5C8YA 2PUSA 1XNRB 1QR8A 1Q81W 2RCVA 3SJQC 1JPXA 4Q20A 1GH6A 4FMTA 4O4HB 4DUZO 1DF4A 2ADQB 5L3DA 1DF5A 3N2GB 5FPOA 4J7JA 2WA4A 3JALB 2OWOA 4J10A 3W7XA 1NVPB 4LF5B 1BL8A 3OM3B 4FFBA 2QGNA 1VQ5V 1GKFA 2Q0AA 3LNMB 3ZHSA 2ZE6A 3AEIA 4JI7B 2XNDG 1YVWA 3BA8A 5IYCO 5BXZA 2XASA 1Z5WA 4B7EA 2KG7B 4JI6B 4QPKA 3R66A 1OZ0A 3B8MA 2BTOA 3CCJV 4R50A 4JTCB 4K0KO 3D8CA 3CC4V 4WFGA 1UPGA 4DR7B 4OX9O 4ZOLA 1SESA 2IJHA 5FNVA 4MS2A 5EIBD 2JJ2G 2BOBC 2Q73A 3OTFA 2Z0AA 4LFCB 5E79Z 1HNZB 1K97A 2AXTZ 3C90A 2UUBO 4O4HA 3OUFA 1V54C 3FD9A 4DR6O 4GKKB 1XEQA 3G67A 4LF7B 2CK3G 5LHGA 3N2GA 2H94A 3JALA 4GKJO 5BY1A
chains in the Genus database with same CATH topology
2UU9O 4DR7O 2FKXA 3T1YO 4JI7O 4AQYO 1X59A 2ZM6O 1DK1A 1KUQA 4DUYO 4LFBO 4OPAA 3M8AA 4X65O 2UUCO 4X66O 1N32O 1D2DA 1F7YA 1AB3A 1I94O 3F5TA 3OTOO 4KHPO 4JI6O 1HNXO 2VQFO 4YHHO 2AGAA 4OPHA 4DR3O 5FLXN 4JI1O 1N33O 1R6TA 1AILA 1HNWO 4LFAO 2N74A 3SDLA 4DUZO 1N34O 2ZKOA 2DJVA 4B3TO 1FYJA 4JI0O 3JAMN 3O65A 5LMUO 4LFCO 1FJGO 1HNZO 4DR2O 1R1BA 2JRIA 4GKKO 4LF9O 4JV5O 1IBLO 1IBKO 4LF7O 5IT9N 4X64O 4JI8O 1XMQO 3J7AU 4JYAO 5BR8O 1FKAO 1XNQO 2LW7A 5BXZA 1IBMO 4B3RO 1A32A 2UXDO 2UXCO 1HR0O 3R66A 3J80N 4B3MO 2DOSA 3RT3C 4K0KO 2HHHO 5LL6Y 4X62O 5IWAO 4JI5O 4OX9O 4DV5O 1XMOO 4YY3O 4NXNO 4DV4O 1XNRO 4DV6O 2UUAO 5LMNO 1N36O 2F4VO 1G1XB 2UXBO 4DR5O 4DV3O 4DV7O 1J5EO 2VQEO 3T1HO 4DR4O 2Z0AA 4JI3O 5A2QN 4NXMO 4JI2O 2UUBO 4B3SO 1YZBA 4LF4O 3J81N 5H5NA 4DR6O 4JI4O 1XEQA 4A5UB 4LF5O 2E5LO 4GKJO 5BY1A 4DV1O 4DV2O 1NS1A 4DR1O 4DV0O 4LF6O 4LF8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 O;  4DR7 O;  2FKX A;  3T1Y O;  4JI7 O;  4AQY O;  1X59 A;  2ZM6 O;  1DK1 A;  1KUQ A;  4DUY O;  4LFB O;  4OPA A;  3M8A A;  4X65 O;  2UUC O;  4X66 O;  1N32 O;  1D2D A;  1F7Y A;  1AB3 A;  1I94 O;  3F5T A;  3OTO O;  4KHP O;  4JI6 O;  1HNX O;  2VQF O;  4YHH O;  2AGA A;  4OPH A;  4DR3 O;  5FLX N;  4JI1 O;  1N33 O;  1R6T A;  1AIL A;  1HNW O;  4LFA O;  2N74 A;  3SDL A;  4DUZ O;  1N34 O;  2ZKO A;  2DJV A;  4B3T O;  1FYJ A;  4JI0 O;  3JAM N;  3O65 A;  5LMU O;  4LFC O;  1FJG O;  1HNZ O;  4DR2 O;  1R1B A;  2JRI A;  4GKK O;  4LF9 O;  4JV5 O;  1IBL O;  1IBK O;  4LF7 O;  5IT9 N;  4X64 O;  4JI8 O;  1XMQ O;  3J7A U;  4JYA O;  5BR8 O;  1FKA O;  1XNQ O;  2LW7 A;  5BXZ A;  1IBM O;  4B3R O;  1A32 A;  2UXD O;  2UXC O;  1HR0 O;  3R66 A;  3J80 N;  4B3M O;  2DOS A;  3RT3 C;  4K0K O;  2HHH O;  5LL6 Y;  4X62 O;  5IWA O;  4JI5 O;  4OX9 O;  4DV5 O;  1XMO O;  4YY3 O;  4NXN O;  4DV4 O;  1XNR O;  4DV6 O;  2UUA O;  5LMN O;  1N36 O;  2F4V O;  1G1X B;  2UXB O;  4DR5 O;  4DV3 O;  4DV7 O;  1J5E O;  2VQE O;  3T1H O;  4DR4 O;  2Z0A A;  4JI3 O;  5A2Q N;  4NXM O;  4JI2 O;  2UUB O;  4B3S O;  1YZB A;  4LF4 O;  3J81 N;  5H5N A;  4DR6 O;  4JI4 O;  1XEQ A;  4A5U B;  4LF5 O;  2E5L O;  4GKJ O;  5BY1 A;  4DV1 O;  4DV2 O;  1NS1 A;  4DR1 O;  4DV0 O;  4LF6 O;  4LF8 O; 
#chains in the Genus database with same CATH topology
 1RPR A;  1SQQ H;  3CYO A;  2PYJ A;  3CME V;  3CCM V;  1R3I C;  2NN4 A;  2W0X A;  4PV1 B;  4B3M B;  3AK1 A;  4MVS A;  4U7N A;  1K73 W;  4UB6 Z;  2Q7H A;  3SJB C;  4KFM A;  4UXN A;  4MVZ A;  4YHH O;  2ILM A;  2KG7 A;  4JYA B;  4GZR B;  3WFV A;  1UJW B;  5JCO C;  1N33 O;  3IJ4 A;  1NR1 A;  5L3F A;  5L3E A;  1HNW O;  1O9H A;  1OCC B;  2DWE C;  4U3J B;  4JI3 B;  5EZY B;  2ZKO A;  2DJV A;  4WFE A;  5H2F Z;  4P30 A;  1GMG A;  3IGA C;  1AR5 A;  2CAZ C;  4PA4 A;  4GCZ A;  2WLH A;  1OJH A;  4DV0 B;  5B3S C;  3OR6 C;  1N8R W;  3H1I H;  3T1Y B;  2HR3 A;  3JD3 A;  2AW9 A;  1WJZ A;  3L71 H;  2HVJ C;  2Y48 A;  1DLB A;  2UXD O;  1VQK V;  3EFF K;  2LP7 A;  4HZ3 A;  1L1F A;  1Y76 A;  1I7F A;  3J80 N;  1EN6 A;  3SGI A;  2DOS A;  1F4M A;  1WPB A;  1S5H C;  4RO2 A;  5CA1 B;  1AJP A;  1QVF U;  4FLW A;  3TGU H;  4DV4 O;  4X88 A;  2UUA O;  3TCU A;  3ZMZ A;  3K5L A;  3SPH A;  2DYR B;  2GV9 A;  1WN7 A;  4TUY B;  4DR4 O;  2AHZ A;  4J11 A;  1W2B U;  2P67 A;  4U3J A;  4O4J B;  5EZY A;  4JI4 O;  1M4U A;  2DYS B;  4AI8 A;  4NYK A;  1KD1 W;  2Y69 C;  3SPG A;  1IBM B;  2DW4 A;  2HG5 C;  3K3W A;  4RUF A;  4MSW C;  2AZ2 A;  4OPA A;  4X65 O;  3BHP A;  4QNH B;  2IJK A;  1XL4 A;  3W7W A;  2FML A;  3AG4 B;  2G38 A;  3OTO O;  5CBG A;  4NXN B;  1OCR B;  4F6E A;  5KX5 B;  3EHB B;  3X2Q B;  4DV3 B;  1NTZ H;  3ABT A;  1XL6 A;  4LBE C;  3JSN A;  5CA1 A;  3K06 A;  1XUQ A;  2LGW A;  3CXC U;  4HAM A;  3ETD A;  3TXS A;  5IJ9 B;  1JA8 A;  4Z1V A;  2ZCE A;  5KHG A;  4FFK A;  5GTI Z;  3BFR A;  2E74 B;  4TUY A;  3HPL C;  3H1J H;  1GN3 A;  3E35 A;  1R6N A;  1XMQ O;  5LA6 B;  4O4J A;  2C2A A;  3B2E E;  1I94 B;  4MTF A;  5KHJ A;  2BOC C;  3BPZ A;  1YDX A;  1ARO P;  2Z3Y A;  4J9Y B;  2ZXW B;  3FB8 C;  2EBO A;  3A8T A;  2F93 B;  4UCU A;  2ZE7 A;  3OUS A;  3ZX6 A;  1EZJ A;  2LW1 A;  4TSF G;  2WLK A;  5KX5 A;  1I0H A;  2LQT A;  1HWY A;  5IY5 C;  1VF6 A;  3CB2 A;  3VQV A;  1TGO A;  2W0F C;  3OGC C;  2GSM B;  2WLN A;  5IJ9 A;  1VF5 B;  5BR8 B;  4DV1 O;  3UO3 A;  5IYZ B;  1RFY A;  5L3B A;  4X1Y B;  1Y6X A;  2X6A A;  3K04 A;  4C7U A;  3HKC B;  1ZLZ A;  3JAS B;  2IU0 A;  2XUM A;  1D2D A;  5LA6 A;  1M57 C;  1HDJ A;  3OEH G;  3BAB A;  5ITZ B;  3K08 A;  2AGA A;  1XNQ B;  1OCO B;  1EBO A;  5HFM A;  3T1H B;  2MW2 B;  2VWK A;  3E8B A;  1ENV A;  2EIL C;  4JI2 B;  1TUE B;  3GVM A;  1JMK C;  1S0V A;  1MG1 A;  4R8C A;  1FFX B;  1Z2G A;  2R9I A;  3VQW A;  2GTS A;  3K03 A;  3FX7 A;  1F51 A;  2UU9 B;  5CBH A;  2YIB A;  4JV5 O;  1V55 C;  1PM9 A;  4LFB B;  1XBL A;  4YIP A;  3NXS A;  1QLN A;  4X66 B;  5KMG B;  3ZS8 C;  3CEI A;  4FM1 A;  1ZWI C;  2ZIN A;  1FXK C;  2NR5 A;  5IYZ A;  4QE9 A;  4H44 B;  2HJF C;  3CHX A;  4X1Y A;  1G4Y B;  2YSU B;  1JJ2 U;  2A79 B;  2EIJ B;  3HKC A;  1YIJ V;  3JAS A;  3SYA A;  2CTR A;  1PKX A;  2EZP A;  2RMK B;  1OCZ C;  1LUW A;  1S5J A;  4O4I B;  2JGU A;  4WFH A;  3ETG A;  4X1I A;  5ITZ A;  1Q6H A;  3WB2 A;  2AZ0 A;  2XAQ A;  2EIN C;  4Q6G A;  5H6R A;  1FAF A;  3MHS C;  2QJ1 A;  2QKA A;  1P84 F;  3ZED A;  3FYE B;  1IBL B;  1CEZ A;  4F4L A;  3SPI A;  4DR1 O;  3ZN1 A;  1FFX A;  3ZMS A;  4FZ1 A;  3RWR D;  2CTQ A;  3APO A;  2X6B A;  3TK1 A;  3JYC A;  5EBM C;  2YXY A;  1RM1 C;  2WLM A;  3BRC A;  4GX2 A;  4DO2 A;  2YEV B;  4GUN A;  3K59 A;  4YJ3 B;  2QKS A;  5BMV B;  5KMG A;  4YY3 B;  2PF4 E;  2UXN A;  1WP8 A;  2ZR3 A;  4UCS A;  1PD3 A;  3OD4 A;  4HYO A;  4WFF A;  1RP3 B;  3ABL C;  4PHZ A;  1XHZ A;  2ITD C;  3CX5 F;  3M99 B;  4O4I A;  2X6C A;  3QF7 A;  5B1A C;  1L8D A;  1OHH G;  3JAK B;  3UO2 A;  1PNL A;  3AG7 A;  4X64 O;  4QJF B;  3K57 A;  2KSD A;  3P3N A;  1Q86 W;  2UUC B;  3K0G A;  2ZE5 A;  2UXX A;  5CA3 A;  4J9Z B;  3CRR A;  1GM9 A;  1TA8 A;  1VQP V;  4UB8 Z;  1SRY A;  3ABM C;  5LBQ A;  4XDL A;  2IH1 C;  2YEV A;  4PDM A;  2Q5Z A;  4J7K A;  4YJ3 A;  2M6Y A;  1KB9 F;  4AQY B;  1L0N H;  4DUZ B;  3A0B Z;  5BMV A;  3BCC H;  1ZX3 A;  4PDR A;  2F43 G;  3L74 H;  3CMA V;  1PPJ H;  1E79 G;  4NXM O;  4N23 A;  3ZMT A;  2CTP A;  4CH5 A;  1M1K W;  4BIZ A;  1SF9 A;  1HP8 A;  4DR3 B;  2Q4P A;  1R3K C;  2QTO A;  3AG1 C;  2N05 A;  4K8X A;  4JAS A;  4AIL C;  4TQD A;  4JZG A;  5JCO A;  3JAK A;  2ODM A;  1KC8 W;  4UCO A;  4K0K B;  5LYJ B;  4OX9 B;  4XDK A;  2Y69 B;  1Q6I A;  2Y0I A;  1H2M A;  1K92 A;  5FLX N;  2Q68 A;  3M7M X;  4PA9 A;  1Y66 A;  3CC7 V;  2QM7 A;  3MDS A;  2DN9 A;  1VAR A;  2UUB B;  1MMM A;  5JJJ B;  1KP3 A;  4DR6 B;  2RJZ A;  2GUZ B;  3WG7 C;  2XOK G;  2BE3 A;  1KKC A;  1FJG O;  4R7C A;  4GKJ B;  5JQG B;  4DR2 O;  5CN0 A;  3STL C;  2JRI A;  4X9Q A;  1MZF A;  1CXZ B;  1KU9 A;  3J7A U;  3CC2 V;  1P7G A;  2LJ2 A;  5KLV H;  1RPO A;  5IDJ A;  1COW G;  3LUT B;  4B3R O;  4FLU A;  1VQL V;  1FXV A;  1QHT A;  1NH2 D;  3AK3 A;  5HFL A;  2NLJ C;  1HR0 O;  1MSW D;  3CP1 A;  4LP8 A;  4YHH B;  3K9A A;  3SJA C;  2HFE C;  5IWA O;  1N33 B;  4HNA B;  3HKB B;  1QLE C;  1AP6 A;  1SA0 B;  2FB5 A;  4E4E A;  1HNW B;  1XHX A;  1M90 W;  3ZIA G;  5LYJ A;  4B08 A;  4ZI7 B;  4DV6 O;  1OV9 A;  1ROP A;  4DV7 O;  1WP7 A;  1NBM G;  4LH7 A;  4MT8 A;  3JD4 A;  4LCU C;  5J2T B;  1H2K A;  1WB7 A;  3L70 H;  1YJW V;  1BQ0 A;  1Y67 A;  2WLI B;  2E5L O;  4NTX A;  1YCI A;  2GUZ A;  1SZX A;  4LF8 O;  1VMG A;  4EFB A;  5IY5 B;  2WSS G;  4XBF A;  2Q67 A;  5JQG A;  2UXD B;  4RUE A;  5KA6 A;  1KUQ A;  2JVD A;  2L35 A;  3OMI B;  3ZRX A;  1FXH A;  1BMF G;  2ADP A;  2HKO A;  2FL4 A;  3CWB H;  4X20 B;  3CD6 V;  2Q9L A;  3WB0 A;  5KUK A;  1BE3 H;  1ZAU A;  3ASO C;  4ZIB A;  2VQF O;  4DV4 B;  3DC5 A;  3LSS A;  2HJD A;  2WLJ A;  4TWK A;  2IW5 A;  3SJC C;  4LFA O;  1BHA A;  4W4L A;  1M57 B;  4BAY A;  2YDE A;  4HNA A;  3HKB A;  1SA0 A;  4TT3 G;  4B3T O;  4ZI7 A;  4JI4 B;  2YC0 A;  3JAM N;  2ITC C;  5E1A C;  4LWS B;  4GLX A;  2Y4T A;  2GTA A;  1R1B A;  2OIE A;  2EIL B;  1N36 B;  5JH7 B;  5J2T A;  1J5E B;  2ETN A;  2QSA A;  3A0H Z;  4X65 B;  4PEL A;  1NT2 B;  2E3C A;  2WLI A;  1GK9 A;  4CS2 A;  1U97 A;  3G71 V;  1V55 B;  4UCR A;  2IJJ A;  4GX1 A;  3RT3 C;  1TUB B;  4KL1 A;  2ZIO A;  4MW3 A;  1VQN V;  3CCR V;  3BAA A;  4UCV A;  3I5D A;  1FXK B;  4DRX B;  1H38 A;  4I9W A;  3LDC A;  4X20 A;  5B1B C;  3GWK C;  4WF9 V;  3NR7 A;  1QR9 A;  2F1M A;  2YS8 A;  3ETE A;  3SR2 C;  4U3F H;  4DK0 A;  3U0Z A;  1OCZ B;  1IZ3 A;  2GHY A;  3QTC A;  2JEU A;  2PZS A;  1SQV H;  3WB1 A;  1K3E A;  3ZJZ A;  1XMQ B;  4IT5 A;  2EIN B;  1NS1 A;  3R65 A;  2JK5 C;  3LDE A;  4DR7 O;  2FKX A;  2H8P C;  4LWS A;  2B1I A;  4DUY O;  1QVG U;  4Z2W A;  1Q90 D;  1N0J A;  2OCC C;  5LGN A;  1SC5 B;  4OGQ B;  2HEP A;  4FLV A;  1N32 O;  5JH7 A;  1XQ8 A;  3UCS C;  4WFB V;  4KHP O;  5DN6 G;  4OXS A;  1RM1 B;  2WPD G;  1SQG A;  1FS0 G;  3E86 A;  2ARH A;  3MD0 A;  4OPH A;  2QTS A;  4FM0 A;  1TUB A;  2N74 A;  3SDL A;  3ABK C;  4MVR A;  4ASU G;  1FXK A;  4JZ2 A;  4DRX A;  5IYD O;  3CRM A;  4MTX A;  4PI2 A;  4DV1 B;  3ABU A;  1YIT V;  3ZMU A;  3E8F A;  3ABL B;  3CCQ V;  2DWD C;  4JYA O;  2LGQ A;  4K35 A;  5B1A B;  1IXB A;  1SS3 A;  2LFS A;  2EJR A;  4G2K A;  2R70 A;  2H3O A;  4J80 A;  1VQ9 V;  1VEW A;  1GN2 A;  4G28 B;  2F95 B;  2V4D A;  3P30 A;  4CZZ A;  4DV2 B;  1YXB A;  4P2Z A;  1G8M A;  3BA9 A;  4D7T A;  1QCE A;  1SET A;  1JJO A;  1NI8 A;  1G1X B;  4PDL A;  2QE7 G;  1GM7 A;  4ZHQ B;  1Y74 B;  3ABM B;  1GAX A;  3RBZ A;  4I4T B;  2YI9 A;  3SYO A;  2PI5 A;  2R9A A;  3T1C A;  1K9M W;  4B3S O;  3JD2 A;  1VQ7 V;  4LF4 O;  3CCU V;  3J81 N;  5H5N A;  3UKM A;  4EB6 B;  1KMI Z;  1AR4 A;  4JV5 B;  4GT1 A;  1S5L Z;  2XAJ A;  2QA4 V;  2BSK B;  2MK3 A;  1R3J C;  1I08 A;  1K4D C;  3M8A A;  5C93 A;  5K1P A;  3ZHV A;  4JYB A;  4GX0 A;  3AG1 B;  1D5N A;  4FLT A;  1AB3 A;  2WWW A;  3ML0 A;  3TXQ A;  1NTM H;  2FYU H;  2HVK C;  3DTU B;  3EVK A;  4P9P A;  3QO7 A;  2M7W A;  3VOU A;  3HB3 B;  1JVM A;  4N21 A;  4NTY A;  4FK5 C;  1N34 O;  3HKD B;  3GWO A;  3UT5 B;  1KKD A;  1X4T A;  2ZE8 A;  2A0L A;  3RN4 A;  4CBC A;  3CSX A;  4QGP A;  2EIM C;  2KQX A;  3H9V A;  2HLD G;  2VRZ A;  1Y74 A;  4ZHQ A;  4DR1 B;  3RW0 A;  3I55 V;  4I4T A;  4O2A B;  1JOY A;  2P4K A;  4JI8 O;  1Q5O A;  2RNB A;  4EB6 A;  2CH7 B;  2R72 A;  3WG7 B;  4DW0 A;  1EZV H;  5IYB O;  2V7Q G;  1BGY H;  4IIJ B;  3RVZ A;  2BSK A;  3JD1 A;  3PJS K;  2CTW A;  5LGU A;  3F7Y C;  1V9P A;  1ZSP A;  3ETQ A;  5F2V O;  1MAB G;  3K5N A;  5EYP B;  4NB5 A;  3SPJ A;  2XAH A;  1SQF A;  5LMN O;  2Q6A A;  1LUV A;  1W0J G;  1N4C A;  3B09 A;  2F4V O;  2P22 C;  4RAI A;  4DR5 O;  2RN9 A;  1WA8 B;  2Q0O C;  2V1D A;  4KP4 A;  2VQE O;  2YXL A;  2DQ0 A;  3U10 A;  1QLE B;  4PD4 F;  1OCC C;  2P6J A;  4I0X B;  2JIZ G;  3HKD A;  3UT5 A;  1Q3E A;  1EN5 A;  2B1G A;  2EX3 A;  4X64 B;  2OYQ A;  2ZNI A;  3N27 A;  5TIS Z;  4GYC B;  3RYH B;  1QNM A;  4TOI A;  3KCY A;  3RYI B;  1M56 C;  5EBW C;  3ZCC A;  2ZM6 O;  2ZDI C;  2D2C B;  3K58 A;  4O2A A;  4BW9 A;  2OTL V;  3W7S A;  1THZ A;  2QR4 A;  2W6J G;  2CH7 A;  1FPO A;  2D3O W;  2VWJ A;  3B77 A;  2EIK C;  4IIJ A;  1F4N A;  3SPC A;  4KUM A;  3AG3 C;  1AJN A;  1AIL A;  3E2E A;  1AI7 A;  3JD0 A;  3Q4H B;  4NXM B;  1V54 B;  5EYP A;  2QM4 A;  3ASO B;  2Z5U A;  2XAG A;  4J42 A;  4UVB A;  4B7K A;  2P06 A;  1WAZ A;  4LR3 A;  1WA8 A;  4PA3 A;  2Y4U A;  3CCL V;  2JDI G;  1NJI W;  3L72 H;  4LF9 O;  4FVM A;  4I0X A;  3FAV B;  1YSC A;  3L75 H;  3E8G A;  1XNQ O;  1YJN V;  1XOU A;  2PY5 A;  1VQ8 V;  1A32 A;  1PNK A;  2YID A;  3RYH A;  3UQ8 A;  2UXC O;  1SER A;  4MW8 A;  1PP9 H;  3RYI A;  3FKS G;  4MTG A;  4EEQ A;  2HHH O;  2PYL A;  4DV5 O;  1ZUQ A;  4UFZ A;  1XMO O;  4CH4 A;  2N04 A;  5J2U B;  3CS5 A;  4IL6 Z;  3S3X A;  2XAF A;  1BHB A;  3IC9 A;  2UXB O;  1KP2 A;  1Q6U A;  1FFT B;  4BR6 A;  5B3S B;  4X89 A;  3D36 C;  4DR2 B;  3CCE V;  4JF3 A;  5EC2 C;  1YZB A;  4CH3 A;  3Q4H A;  2Q7E A;  2GBO A;  5CMU A;  5B1B B;  2DMX A;  2ZIM A;  2K9P A;  1Q8I A;  4LF6 O;  3P3P A;  4I7Z B;  4B3R B;  4PDV A;  3OT7 A;  4UVC A;  5L3G A;  4PA7 A;  1PL4 A;  1HR0 B;  2EJ7 A;  4YJ2 B;  3OAA G;  3FAV A;  4H33 A;  3AG2 C;  3E22 B;  3B4S A;  4JYC A;  1M9N A;  3K9S A;  4DV6 B;  2OCC B;  3ASN C;  1Q7Y W;  2R9R B;  4DV7 B;  1R6T A;  1IXM A;  1KQS U;  4JGS A;  3ZRV A;  3RFR A;  3OEE G;  4CC5 A;  1G6U A;  5J2U A;  4IHJ B;  4JI0 O;  4BIU A;  3CPW U;  3TJT A;  5JJE B;  3CXH F;  2YIA A;  3O65 A;  5LXT B;  1O9G A;  4QE7 A;  4LF8 B;  2HP8 A;  5GON B;  5J9P C;  1KBH A;  1K7D A;  3ABK B;  2NNU A;  2AHY A;  3H01 A;  4YIO A;  4FFB B;  1FKA O;  4NTW A;  3ICX A;  2BTQ B;  3LSQ A;  1UFI A;  5LOV B;  2PGG A;  3OGI B;  1S77 D;  4YJ2 A;  1GRJ A;  4LFA B;  2PI4 A;  2QWQ B;  3VQY A;  4U7O A;  2P5O A;  4G27 B;  3O9O A;  4DW1 A;  1MA1 A;  3E22 A;  4B3T B;  3SYC A;  2JS5 A;  4TQF A;  3A0R A;  3FYI B;  5H6Q A;  2JJ1 G;  1RSO B;  3A2F A;  4L87 A;  5LGT A;  4MVQ A;  3IC7 A;  4JYY A;  3ZHT A;  4IHJ A;  2LO1 A;  1BZK A;  5LXT A;  4AQY O;  1X59 A;  2B5U A;  4H37 A;  5GON A;  5CB4 B;  3DC6 A;  1SZT A;  1SQP H;  1YHQ V;  5EC1 C;  3E89 A;  1EN4 A;  3F5T A;  4KXR A;  4MVO A;  1CP9 A;  4D7S A;  1HNX O;  4JAU A;  2BTQ A;  4DR3 O;  1TVK B;  4IYH A;  4JI1 O;  3B8N A;  4FLY A;  1VQM V;  2EIJ C;  5JWP A;  1H2L A;  1SKV A;  3QG5 A;  2XT9 A;  4DK1 A;  5LOV A;  3MAQ A;  1Q82 W;  1K8A W;  4BW5 A;  5LP6 C;  5KUM A;  2YIB D;  2OT5 A;  1VP7 A;  4FPP A;  1B3Q A;  2X7R B;  4CC6 A;  5LMU O;  4XDJ A;  1P7B A;  1IDS A;  4LC1 A;  1R73 A;  4FM2 A;  3DSQ A;  2UUA B;  4PI0 A;  1IBK O;  1NTK H;  4DUY B;  1RSO A;  3JAT B;  2EIM B;  3H1L H;  4QIW F;  5CA0 B;  1N32 B;  4DR4 B;  2LW7 A;  4GX5 A;  1NZ6 A;  1H2G A;  4KHP B;  3STZ C;  1JR9 A;  4RQE A;  3W7U A;  3ZBH A;  2IJI A;  5CB4 A;  5EBL C;  4X62 O;  1D5A A;  1VQ6 V;  4JI5 O;  4UV9 A;  1LNQ A;  4UCT A;  1XNR O;  2IH3 C;  1Y76 B;  1I5X A;  1QQC A;  3IAY A;  1S3J A;  4JTD B;  3SYP A;  1TVK A;  1ZL8 B;  5A2Q N;  3WU2 Z;  3OTO B;  4MTO A;  2QKC A;  2CGO A;  3RYC B;  4LF5 O;  4NR1 A;  1QBZ A;  3TET A;  4BIO A;  4JI7 O;  1IX9 A;  5KAI Z;  3K5O A;  3B40 A;  2IBZ H;  3KCX A;  1CPY A;  2O57 A;  3JAT A;  5DED A;  2XTA A;  4TV9 B;  1NU1 H;  2RQ6 A;  1WNS A;  5CA0 A;  1AI4 A;  1M56 B;  1GTO A;  4JI6 O;  3THO A;  3E8H A;  3HKE B;  3RYF B;  3JCZ A;  5KAF Z;  5FPR A;  1DTO A;  2A06 H;  4NVP A;  3ZMV A;  3CCS V;  1K33 A;  1YTF D;  3L73 H;  4B3S B;  4UUJ C;  4I55 B;  4LF4 B;  2EIK B;  4EFE A;  2QM8 A;  2OIG A;  4LFC O;  2Q69 A;  3AG3 B;  1HNZ O;  2P4V A;  4UV8 A;  1AI6 A;  1ZL8 A;  1JCH A;  4GKK O;  4W4K A;  5KHH A;  4LF7 O;  1WPX A;  1P49 A;  3OMA B;  4IYI A;  3CJH B;  2BCC H;  3RYC A;  1XI1 A;  3K0D A;  2JS3 A;  1TAE A;  2F23 A;  5IJ0 B;  2WLL B;  3LNN A;  4B3M O;  4MVM A;  4HBN A;  3GB7 C;  1T5E A;  4CS4 A;  4MVU A;  1JQ0 A;  4D6T H;  1M5I A;  4TV9 A;  4ICG A;  4O4L B;  4PJ0 Z;  1GN6 A;  3JSL A;  1N34 B;  3BY6 A;  1N36 O;  1QU7 A;  3JCU Z;  3D3Q A;  2OTJ V;  2ZDI A;  1J5E O;  1W59 A;  1B06 A;  3HKE A;  4JI3 O;  4K3A A;  3RYF A;  1AI5 A;  1AJQ A;  1H2S B;  3RGB A;  2VS0 A;  2ZD9 A;  4LH6 A;  1W0K G;  2DE0 X;  4JI8 B;  4I55 A;  4DV0 O;  1R3L C;  5LHI A;  1I5Y A;  3T1Y O;  2Q8V A;  4L8J A;  1EFR G;  1PL0 A;  1NH2 B;  3CJH A;  2QWN B;  2L6L A;  3BVO A;  2ZNJ A;  1K34 A;  3DXR B;  5LMN B;  3HR0 A;  5IJ0 A;  2F4V B;  1SQB H;  1K5Q A;  2P7T C;  2WLL A;  4DR5 B;  5JVD B;  2VQE B;  4ABM A;  3AG2 B;  3ZHU A;  1S72 V;  4DYL A;  4O4L A;  1AP5 A;  4QPJ A;  3ASN B;  3CRA A;  2ATK C;  3K5M A;  3G80 A;  1BCC H;  2YUA A;  1HW7 A;  3K79 A;  2ZQM A;  1AVM A;  4FZ0 A;  1Q43 A;  5DM6 V;  1IUR A;  1BQZ A;  1P4R A;  1VQO V;  2ZM6 B;  2KKW A;  2X0L A;  1M93 A;  3C3S A;  2QWO B;  1BS3 A;  3VBB A;  3RVY A;  1IBM O;  2K1E A;  1KYO F;  3T4D A;  3FB5 C;  2JEX A;  2YIC A;  1IVS A;  1YF2 A;  2WAM A;  3D36 A;  1S76 D;  3FB7 C;  5FL7 G;  2A3Q A;  3OW2 U;  1XRE A;  1H2N A;  2WA3 A;  4NXN O;  4JTA B;  4H13 B;  4CH6 A;  3H1K H;  1GO3 F;  5KA5 A;  3VQX A;  4DV3 O;  3APQ A;  5AG2 A;  3DXR A;  4X1K B;  3FB6 C;  3ZRW B;  1EM1 A;  1F23 A;  5JVD A;  4UVA A;  2CGN A;  4LF9 B;  4X1I B;  4J7Z A;  3E83 A;  4A5U B;  1LR1 A;  3QNE A;  2F66 C;  1B6Q A;  2W6I G;  3C3T A;  1N0N A;  4DV2 O;  1Z5V A;  4JAA A;  2P90 A;  3KZI Z;  1YEW A;  3SYQ A;  2UXC B;  1NKD A;  3ZN0 A;  2DQ3 A;  3N2K B;  3CRC A;  1MOF A;  3OR7 C;  2IU3 A;  4Z1M G;  1NVP D;  4TV8 B;  2HHH B;  1I94 O;  3QO5 A;  4DV5 B;  1XMO B;  4RWU A;  4FLZ A;  3QO8 A;  1R6K A;  4P9O A;  2UXB B;  2Y0P A;  1NQT A;  2YI8 A;  4DXW A;  1VQ4 V;  2IM9 A;  3W7T A;  2GDS A;  2YXH A;  2A7W A;  2Q7G A;  2RDC A;  3DGE A;  1FYJ A;  5KHI A;  1US6 A;  4JPR A;  3EXA A;  4X8A A;  4LF6 B;  4X1K A;  4O2B B;  5LP6 B;  3ZRW A;  1ORQ C;  5BR8 O;  3ZHR A;  5CBF A;  1FD9 A;  4I9Q A;  3T2M A;  4WBN B;  4BWA A;  3IFX A;  1YTF B;  2ZR2 A;  4FJC C;  1E1Q G;  1JFF B;  1GM8 A;  2DYR C;  5B66 Z;  4JAV A;  4FIP C;  5H9C A;  5LL6 Y;  2JGD B;  3N2K A;  3T4Z A;  3BEH A;  1K5S A;  4TV8 A;  3PN1 A;  3ZRS A;  1XDC A;  2ZT9 B;  2QWR B;  3CRQ A;  5L3C A;  2DYS C;  4JI0 B;  2PTM A;  3H1H H;  3T1H O;  4ZBM A;  1JX9 A;  3F5W C;  4FLX A;  4JI2 O;  4AHC A;  5D5Q A;  3KG2 A;  4F6R B;  3L9D A;  4CS3 A;  5GW7 A;  2LFR A;  5BZB A;  4H0L B;  2UU9 O;  3AG4 C;  3G6E V;  3I56 V;  1XIL A;  5LHH A;  4LFB O;  4O2B A;  1WB8 A;  5LP6 A;  1OCR C;  3G4S V;  4IGG A;  5EK0 A;  1MNG A;  1K4C C;  3X2Q C;  4X66 O;  1VF6 C;  3JAR B;  1F7Y A;  1URF A;  1FJG B;  4WBN A;  2A9H A;  1H8H G;  1Y4M A;  2QWP B;  1VF7 A;  3QVN A;  4PA6 A;  2B9Z A;  5A9G A;  3P32 A;  2QEX V;  1JFF A;  2KB1 A;  2CE4 A;  1J95 A;  1U96 A;  1AR1 B;  4K8Z A;  1WLE A;  2E76 B;  5GTH Z;  2JGD A;  3CE2 A;  2QDO A;  1VIB A;  1MSD A;  4I50 B;  1BSM A;  5IWA B;  3LSU A;  4WFA V;  5B1O A;  5IT9 N;  1IBL O;  3OE7 G;  1ZTE A;  4F6R A;  4LNU B;  4ZKI A;  2ZXW C;  1L0L H;  3OFN G;  3JAW B;  5C8Y B;  3KKY A;  4J41 A;  1HNX B;  1E1R G;  2E5L B;  1NR7 A;  3FFQ A;  4JI1 B;  5D5P A;  2CDY A;  5DEC A;  1H8E G;  3JAR A;  4YY3 O;  4E2L A;  3LDD A;  4R6Z A;  3D3I A;  5KHK A;  3F7V C;  2E75 B;  2EUL A;  3S3W A;  1YJ9 V;  3UM7 A;  4WCE V;  1GN4 A;  3OMN B;  5LMU B;  2CUG A;  1SQX H;  3ZHQ A;  1B04 A;  5IE9 A;  5JJN B;  5B1N A;  1YI2 V;  5K1X A;  4NKG B;  5EIB C;  2VQF B;  1KEC A;  1IBK B;  2XHB A;  4I50 A;  3MHH C;  1DK1 A;  3G6B A;  3CCV V;  1PNM A;  1PV0 A;  1MZE A;  1BT8 A;  2UUC O;  1DGS A;  4YXW G;  4ZOL B;  1OCO C;  2EZO A;  4LNU A;  3U11 A;  4EKW A;  4X62 B;  5FNV B;  4JI5 B;  3JAW A;  4I5S A;  5B5E Z;  2FTK A;  3AK2 A;  2OCH A;  4RQF A;  5C8Y A;  2PUS A;  1XNR B;  1QR8 A;  1Q81 W;  2RCV A;  3SJQ C;  1JPX A;  4Q20 A;  1GH6 A;  4FMT A;  4O4H B;  4DUZ O;  1DF4 A;  2ADQ B;  5L3D A;  1DF5 A;  3N2G B;  5FPO A;  4J7J A;  2WA4 A;  3JAL B;  2OWO A;  4J10 A;  3W7X A;  1NVP B;  4LF5 B;  1BL8 A;  3OM3 B;  4FFB A;  2QGN A;  1VQ5 V;  1GKF A;  2Q0A A;  3LNM B;  3ZHS A;  2ZE6 A;  3AEI A;  4JI7 B;  2XND G;  1YVW A;  3BA8 A;  5IYC O;  5BXZ A;  2XAS A;  1Z5W A;  4B7E A;  2KG7 B;  4JI6 B;  4QPK A;  3R66 A;  1OZ0 A;  3B8M A;  2BTO A;  3CCJ V;  4R50 A;  4JTC B;  4K0K O;  3D8C A;  3CC4 V;  4WFG A;  1UPG A;  4DR7 B;  4OX9 O;  4ZOL A;  1SES A;  2IJH A;  5FNV A;  4MS2 A;  5EIB D;  2JJ2 G;  2BOB C;  2Q73 A;  3OTF A;  2Z0A A;  4LFC B;  5E79 Z;  1HNZ B;  1K97 A;  2AXT Z;  3C90 A;  2UUB O;  4O4H A;  3OUF A;  1V54 C;  3FD9 A;  4DR6 O;  4GKK B;  1XEQ A;  3G67 A;  4LF7 B;  2CK3 G;  5LHG A;  3N2G A;  2H94 A;  3JAL A;  4GKJ O;  5BY1 A; 
#chains in the Genus database with same CATH homology
 2UU9 O;  4DR7 O;  2FKX A;  3T1Y O;  4JI7 O;  4AQY O;  1X59 A;  2ZM6 O;  1DK1 A;  1KUQ A;  4DUY O;  4LFB O;  4OPA A;  3M8A A;  4X65 O;  2UUC O;  4X66 O;  1N32 O;  1D2D A;  1F7Y A;  1AB3 A;  1I94 O;  3F5T A;  3OTO O;  4KHP O;  4JI6 O;  1HNX O;  2VQF O;  4YHH O;  2AGA A;  4OPH A;  4DR3 O;  5FLX N;  4JI1 O;  1N33 O;  1R6T A;  1AIL A;  1HNW O;  4LFA O;  2N74 A;  3SDL A;  4DUZ O;  1N34 O;  2ZKO A;  2DJV A;  4B3T O;  1FYJ A;  4JI0 O;  3JAM N;  3O65 A;  5LMU O;  4LFC O;  1FJG O;  1HNZ O;  4DR2 O;  1R1B A;  2JRI A;  4GKK O;  4LF9 O;  4JV5 O;  1IBL O;  1IBK O;  4LF7 O;  5IT9 N;  4X64 O;  4JI8 O;  1XMQ O;  3J7A U;  4JYA O;  5BR8 O;  1FKA O;  1XNQ O;  2LW7 A;  5BXZ A;  1IBM O;  4B3R O;  1A32 A;  2UXD O;  2UXC O;  1HR0 O;  3R66 A;  3J80 N;  4B3M O;  2DOS A;  3RT3 C;  4K0K O;  2HHH O;  5LL6 Y;  4X62 O;  5IWA O;  4JI5 O;  4OX9 O;  4DV5 O;  1XMO O;  4YY3 O;  4NXN O;  4DV4 O;  1XNR O;  4DV6 O;  2UUA O;  5LMN O;  1N36 O;  2F4V O;  1G1X B;  2UXB O;  4DR5 O;  4DV3 O;  4DV7 O;  1J5E O;  2VQE O;  3T1H O;  4DR4 O;  2Z0A A;  4JI3 O;  5A2Q N;  4NXM O;  4JI2 O;  2UUB O;  4B3S O;  1YZB A;  4LF4 O;  3J81 N;  5H5N A;  4DR6 O;  4JI4 O;  1XEQ A;  4A5U B;  4LF5 O;  2E5L O;  4GKJ O;  5BY1 A;  4DV1 O;  4DV2 O;  1NS1 A;  4DR1 O;  4DV0 O;  4LF6 O;  4LF8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...