3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
3B09A 1FD9A 1Q6UA 1Q6HA 1Q6IA
chains in the Genus database with same CATH superfamily
3JD1A 2ZM6O 5FNVB 1SQVH 3DSQA 1CP9A 1AILA 2QR4A 3PJSK 2Y48A 1OCRC 2CH7B 4DW0A 2JEUA 3CRMA 3GVMA 4O4IA 5BZBA 3K9SA 2OIGA 4RUFA 4MTOA 1H2GA 4BR6A 1HNXB 2ZKOA 3QF7A 2P06A 3B77A 2WA3A 2RDCA 3JAMN 3I55V 2KSDA 1IBLB 1KP3A 4OPAA 5GONA 2UU9O 4Z1MG 1BSMA 2CAZC 2CTRA 2Q7HA 4PV1B 3CC7V 2DN9A 4JTCB 4J11A 2E74B 4I50A 3N2GA 1QU7A 2L35A 1CXZB 3A8TA 4DV2B 1BGYH 2WLIB 1AROP 4U7NA 5IWAO 2E75B 3KCYA 4WFBV 4LF7O 3H1IH 4FZ1A 4UV8A 4CH3A 2KQXA 2Y69C 3ETQA 4R7CA 2EJRA 3JCUZ 1FXKC 3AG2C 1VQMV 2KG7A 1BE3H 4QE7A 2PTMA 4B3TB 5JWPA 4B7EA 3FYEB 1SS3A 3FFQA 4IHJA 4X64B 4WFFA 4EFEA 1K92A 2GUZB 5GTHZ 3K5LA 3J80N 1P7BA 3SYAA 1JCHA 2ZNJA 3ZMUA 5LHIA 1BQ0A 3CHXA 4LF5O 1PPJH 2YIDA 4LFBB 2QM8A 5IYZA 1WJZA 1YDXA 3OD4A 5CA0A 3G80A 2QWOB 3HKDA 4JAVA 4PHZA 3ZHRA 1L1FA 1FFXB 4JI2B 2PUSA 4JYBA 1YXBA 1NH2D 1XNRB 2JK5C 2UUBO 2RQ6A 5IJ0B 3IFXA 1XEQA 4AHCA 3ZHTA 1PKXA 1YZBA 1WPXA 1BHBA 3ZRXA 2PY5A 2ZDIC 1XL4A 3VQWA 5KUMA 1M5IA 2W0XA 2W6IG 1GH6A 1K33A 3K5NA 5KHKA 3ZN0A 4R50A 4FLYA 1MG1A 1QQCA 4I4TA 4O4JA 1OCRB 1MZFA 3SPCA 3PN1A 1VF5B 4X1IA 5L3GA 2DW4A 1I08A 1F4NA 3RYFA 4DV0B 2P4VA 4DV3B 2Y4TA 3APOA 4UVBA 1K73W 3OT7A 2WLLB 4GKKO 1NKDA 1N33B 5H6RA 4AI8A 1PL4A 5LA6B 4O4HB 2UUCB 1IXMA 3CCSV 3BABA 1BQZA 3CC2V 1JOYA 3FAVB 3RT3C 2ZT9B 4UVAA 1N8RW 3QO5A 2L6LA 1OHHG 2XNDG 4GKJB 4TV8A 3IC9A 2XUMA 3OR6C 5KAFZ 4DR1O 5KX5A 4PDRA 3H1LH 5EZYB 5E1AC 4DUZO 5BY1A 1DLBA 2EULA 5EC1C 3ABTA 1MABG 4UFZA 4BIUA 1IBMO 2Y69B 4FZ0A 2N05A 1TUEB 1FXKB 4OX9O 4IYIA 2HVKC 2IJIA 1Y74B 4MVOA 4X65B 1H8EG 3AG2B 4LFCB 2F43G 4UUJC 1XHXA 4Q6GA 2YC0A 3JYCA 3LSUA 3ZMSA 3GB7C 4I0XB 2HHHO 1PL0A 3CXCU 2EIKC 5CA1B 4FMTA 4DV5B 4LFAO 1U97A 2JGDA 2ILMA 3FB8C 3WG7C 3HR0A 5B1OA 3S3WA 4TQFA 5KHGA 1K8AW 1AR4A 1S5HC 1GM7A 4UXNA 5LBQA 3MAQA 1NJIW 3L70H 1ZX3A 2HFEC 4JI6O 4IT5A 3ML0A 4JTDB 5BR8O 1RP3B 2JEXA 1HWYA 1Q82W 1YF2A 4FM0A 5ITZB 2HKOA 3EVKA 4TV9B 2ZM6B 4C7UA 1KYOF 5EK0A 1KMIZ 1I0HA 4YIPA 3T4DA 4R8CA 3HKCB 3RBZA 2AHYA 2O57A 4FFBB 2GTSA 3ZX6A 1NBMG 2W6JG 3O65A 1K3EA 3OUSA 1NR1A 3GWOA 4WBNA 5CB4A 4RQFA 1N32B 2YICA 2YEVA 4IYHA 3OEEG 3TGUH 4LCUC 2UU9B 1KKCA 1YITV 2CE4A 5CBGA 1Y66A 4AQYO 1QCEA 2QKAA 4JTAB 5AG2A 3SJCC 3UM7A 1WP8A 4LH7A 3AG1C 3ABLC 4L8JA 3E86A 1NVPB 1FFTB 3B40A 3DXRB 3ZHSA 4DW1A 1F7YA 4ZI7A 2ARHA 3N2KA 4LH6A 3D36A 3ABMC 3E22B 3W7UA 4DR4B 4LBEC 5DN6G 2F95B 1HNXO 3MHSC 1AP6A 1M4UA 2Q67A 3G6BA 3OGIB 2RCVA 4CC5A 3A0RA 5LXTA 2GV9A 1IBLO 3R66A 4DV7B 1VF6A 2YI8A 1VIBA 1OCOC 5IYCO 3JARB 3JAWA 4O2AA 4YJ3B 5J2UB 3ZHUA 1VQ9V 2IJJA 4F6RB 3HKBB 4I9WA 3O9OA 1Z5WA 2B1GA 2E3CA 2OCHA 4IIJA 4X1YA 3CWBH 1AI4A 2DWDC 3LDCA 4GX2A 1NQTA 4JI1O 1K4DC 2AZ2A 4LF8O 3RYHB 4FM1A 2Q7GA 5EBLC 3CJHB 5KLVH 1TUBB 2EIKB 3UO2A 2PYLA 2JRIA 2UUBB 2BTQA 3WG7B 3C3TA 3D8CA 3A0BZ 1A32A 3L75H 2A7WA 2WLJA 4B3TO 3JASA 3BVOA 1NU1H 4X20A 4J10A 5IJ9A 2QM7A 2R9IA 2XAJA 4UV9A 1H8HG 3HKEA 3RYCA 3VOUA 3ASNC 3ZRSA 2Q0OC 2YDEA 4JI3O 1M57C 3AG4C 1JPXA 3ZRWA 3FX7A 1WAZA 4HBNA 4DV4O 3K0DA 2IJKA 5F2VO 3K79A 5L3BA 1XNRO 1S3JA 4LF4O 1XMOB 2A79B 1AVMA 2HLDG 4XDKA 1Q6HA 4RQEA 1I94O 2YUAA 2ZR3A 3K04A 1YTFD 3CRAA 4CH4A 3SYCA 2WA4A 3AG1B 4WCEV 1G1XB 3U11A 2V7QG 4DR1B 3OTFA 1H38A 3CB2A 2KB1A 5LMNB 5LMUO 4TUYA 4CH5A 2CTWA 3ABMB 4DUZB 1N34B 3T1HO 5LOVB 1IBMB 4LR3A 4QPKA 1ROPA 4OX9B 1S76D 3CMAV 3SJBC 4B3RB 1RSOA 2R9RB 1QLEC 4MVUA 4ZHQA 1WNSA 3BFRA 1OCOB 3UT5A 1NT2B 3F7YC 3OMIB 3CCLV 4I55B 4WF9V 2AXTZ 4X8AA 1R6TA 2B1IA 1Q5OA 2P22C 2HHHB 5KUKA 4K35A 4GKJO 1LUVA 4H33A 3SPJA 4LFAB 2GHYA 4HNAB 4K8XA 5IYBO 1GTOA 2VQEO 2RN9A 3BA8A 1RFYA 3LUTB 1NH2B 3C3SA 2WWWA 2JIZG 3SJQC 1AR1B 1R3IC 4JI6B 4K3AA 1HW7A 5BR8B 1QNMA 4YY3O 1Q8IA 4MTGA 5IDJA 2LGQA 3I5DA 4Z1VA 2X7RB 2V4DA 4G2KA 3TCUA 3AEIA 1THZA 4ZOLA 1H2NA 1KKDA 2N04A 5JVDB 4BW9A 1JVMA 4UB6Z 1IX9A 4X9QA 3K58A 2BOBC 2VS0A 1GM8A 4ABMA 3FB7C 4FLXA 4UCSA 3JD4A 1KP2A 4D6TH 3ASNB 1GRJA 1M57B 3AG4B 1JA8A 2RJZA 3L72H 5EYPB 4AQYB 3VQYA 5FL7G 2P5OA 2LFRA 1SQBH 3KKYA 1ENVA 2BOCC 3WU2Z 3B8NA 2YI9A 2ZXWC 2ZE8A 4UB8Z 3LNNA 3IGAC 3OGCC 1K5QA 1ZL8B 4JASA 5LHHA 2F93B 1WA8A 1S77D 4H44B 3RN4A 1VQOV 4FM2A 1SRYA 1SERA 1K5SA 1W59A 1AI6A 1OJHA 4EB6A 3CCMV 2JS3A 4BWAA 1N32O 1SZXA 1JFFA 2ZE5A 3RWRD 4HAMA 4JYYA 1GKFA 3ZHVA 4J7KA 4X88A 2BCCH 4DK0A 2QTSA 4DV6O 5KMGA 3SYQA 4RO2A 3Q4HA 2IU3A 5LYJA 1QLEB 4IL6Z 3S3XA 3ETDA 2IU0A 1JR9A 3ZBHA 4X1IB 1J95A 1ORQC 2A9HA 3K5MA 3ZCCA 4JI1B 4DR4O 1PP9H 1QR8A 3JD0A 3A0HZ 3CRRA 1VQLV 4LF8B 1G6UA 3JD2A 1WB7A 2OYQA 1W0KG 2HJFC 2CUGA 4P9PA 4TQDA 1RPRA 3IJ4A 1ZLZA 5JH7B 1E79G 3K06A 2F66C 1V55C 5EIBC 3THOA 5CBFA 1AR5A 5LL6Y 2XHBA 1Q6IA 4DV7O 2BSKA 3VBBA 5C8YB 1Q86W 1F23A 4QNHB 1S5LZ 3C90A 2IJHA 2F23A 4PI2A 2HG5C 2P6JA 2PZSA 4LNUB 1KC8W 1Q7YW 2LJ2A 3AK3A 1KB9F 2QTOA 4JAUA 4G27B 1SA0A 4J9YB 4LF9B 3BRCA 1BHAA 1GN6A 4JI3B 1HP8A 1PD3A 4RWUA 1BT8A 3U0ZA 1GN2A 3JATA 1YIJV 4DV4B 2UXNA 1GAXA 3AG3B 4MVQA 1XMQO 1XOUA 1XUQA 2QA4V 3OAAG 1SQFA 4LF4B 5FNVA 4NR1A 2XAFA 1N36O 5JJJB 2CH7A 2QKCA 5KA5A 1I94B 2E5LO 1FXHA 1IZ3A 4NXMO 2XOKG 1K97A 2X0LA 2R9AA 2NR5A 2ZXWB 3P32A 4JYCA 5LMUB 4O2BB 3T1HB 2LW1A 3MHHC 4W4LA 4QE9A 3FD9A 4JAAA 1XMOO 2DYRC 5HFMA 4Q20A 2WLIA 4B3MO 1H2LA 4EKWA 3CRQA 3I56V 1BL8A 1G4YB 1LR1A 2HVJC 3ICXA 4N21A 4ZKIA 2P4KA 2DJVA 5LP6C 5LMNO 2VQEB 1MZEA 4E4EA 2JDIG 1N34O 3H9VA 1MOFA 1P84F 2VWKA 1E1QG 1RPOA 1UJWB 2Q8VA 1XL6A 4YY3B 2GUZA 4IGGA 1WPBA 3QG5A 4B3RO 1V55B 2X6AA 2FYUH 4JZ2A 1NS1A 2K9PA 4MW3A 2DQ3A 4MT8A 1MMMA 4FVMA 2WLMA 2WSSG 3SR2C 2LGWA 1FFXA 5K1PA 4O4LB 3CCVV 5IJ0A 2FTKA 3MDSA 2JGUA 2EX3A 4PELA 3CMEV 4DR3O 3JAKB 3L74H 2PYJA 3CD6V 3W7SA 2QKSA 4OGQB 2Y0PA 1YTFB 3X2QC 1TGOA 3WB0A 1FPOA 2H8PC 1YCIA 3OTOO 1H2SB 2Y0IA 4LWSB 2FL4A 2AHZA 2ADPA 3P3NA 4DUYB 1FS0G 4U3FH 3B2EE 4W4KA 4DK1A 3RGBA 1KUQA 2WLLA 2DMXA 5JCOC 5B1BC 4TSFG 4FPPA 4A5UB 5LA6A 4O4HA 4ICGA 5J2TB 3ZS8C 4DR6O 2JJ2G 2XTAA 2IH3C 2EZPA 3FAVA 3K0GA 4DV6B 1MA1A 2ZD9A 5FPOA 4DRXB 1SETA 2EILC 5K1XA 4QPJA 2IM9A 3H1KH 3UQ8A 2DYRB 1YSCA 3WB1A 2ZCEA 5EZYA 2QWPB 1M93A 4MVZA 4X62B 3T1CA 2EINC 4J41A 4QJFB 2E76B 1K34A 1M56C 3SYOA 5DEDA 1IXBA 1YJNV 4ASUG 2ZR2A 1FXKA 1BCCH 1O9GA 1V54C 3H01A 1Y74A 3ABUA 1XNQO 1IDSA 5LP6B 5IYDO 1R1BA 2ITCC 1ZAUA 1QVFU 2AZ0A 2LFSA 2P67A 4UCRA 4FLTA 2WLHA 4GT1A 1VQKV 3IAYA 1VP7A 1YJWV 3BAAA 4I0XA 3D3QA 2JS5A 4FLUA 5JQGB 2KKWA 5CA1A 3P3PA 2OCCC 5BXZA 4K8ZA 2Z3YA 4U3JB 2Q0AA 3EHBB 2GSMB 1OV9A 3DGEA 1JJOA 2A06H 1I5XA 1R3LC 4TWKA 1XMQB 3B4SA 4NXNO 5ITZA 1K9MW 4TV9A 2K1EA 4NTWA 3FKSG 3HPLC 1TVKB 2WPDG 1N36B 3HKCA 4CC6A 1FD9A 4FFBA 4P9OA 2E5LB 1Y76B 4JYAO 4JI0B 4NXMB 2ZDIA 3SJAC 2CDYA 2YIBA 3ABKC 3RYIB 1W0JG 2EZOA 4MTFA 4YJ2B 3H1JH 3SYPA 1NTKH 3X2QB 3STZC 1NR7A 4LF9O 4BIZA 3QO7A 4OXSA 4CS2A 4DO2A 2IW5A 1R3JC 2NLJC 2MK3A 4QIWF 1SQQH 3A2FA 1FYJA 4KHPO 3E8FA 3M99B 4WFHA 3ZN1A 1OCCC 3JALB 3LDEA 2OWOA 3E2EA 1AI7A 3OE7G 3CCEV 4JGSA 3DXRA 1OCZC 3D3IA 2OTJV 5B1BB 3SGIA 2HR3A 1S0VA 1KD1W 4B3MB 3JSNA 4KFMA 5H5NA 2ODMA 4LF6O 4MTXA 3E22A 4X89A 1GN3A 1N0JA 1HDJA 5B3SC 4H37A 4BAYA 4WFGA 2EILB 4GZRB 4DXWA 3SPIA 3J81N 1JMKC 1SESA 2Q68A 1M1KW 2RMKB 3HB3B 1GK9A 4B7KA 1Y67A 1AJNA 4DR2O 3TXSA 3JARA 1Z5VA 2EINB 2CTQA 4MSWC 4YJ3A 5J2UA 4F6RA 3BEHA 2ZIMA 3HKBA 1M56B 5B1NA 3E8HA 2Q6AA 4DV1B 1PNMA 3TETA 3K3WA 2Q73A 1V54B 2B9ZA 2H3OA 4O4IB 5DECA 3G6EV 4DYLA 4YHHO 1PM9A 3ZMTA 2ADQB 4JI7O 1PV0A 1M9NA 2R72A 2N74A 1F51A 1T5EA 4G28B 3RYHA 2WLKA 1Q90D 4P2ZA 3CJHA 4EB6B 2DQ0A 1TUBA 4PA4A 2OCCB 4J42A 1PNKA 5GONB 2UXXA 3FYIB 3OM3B 1EN6A 5IT9N 1GN4A 1DGSA 2ITDC 4DR3B 1KU9A 3T2MA 4RUEA 5KHJA 4TOIA 4I50B 3N2GB 4X1KA 1KQSU 3CCUV 3G4SV 2XASA 1Q6UA 5H2FZ 3R65A 2ETNA 1B06A 1PNLA 3OTOB 5LGUA 1F4MA 5HFLA 3UKMA 1EFRG 3WFVA 5L3EA 2Q7EA 1GM9A 4D7TA 2Y4UA 1B04A 1SKVA 1X4TA 3AG3C 1IURA 1EBOA 4BIOA 4GYCB 2D2CB 3ABKB 1SZTA 2KG7B 4NKGB 1UPGA 5A9GA 1GO3F 1I5YA 3LSSA 5KA6A 4PD4F 4UCVA 4IHJB 4DR6B 2ZE7A 2BE3A 3T1YB 4PA9A 2UXBB 2OT5A 4JI4O 1XQ8A 1H2MA 2ZE6A 1OCCB 2EBOA 3AK1A 4F4LA 1OCZB 2M6YA 5BMVA 3ETGA 2LO1A 3CYOA 2W0FC 2CTPA 3SDLA 5IYZB 5J9PC 1DF4A 2QWNB 3ZMVA 5CA0B 3HKDB 3W7XA 1AJPA 3GWKC 4MVMA 5LOVA 1EM1A 3BY6A 5B3SB 4DUYO 2OIEA 3DTUB 1URFA 5EBMC 4LC1A 2B5UA 3L71H 3OEHG 5GW7A 2FMLA 3LSQA 4X66O 1L0NH 3E8GA 3NR7A 1XNQB 4D7SA 2ZINA 2VRZA 2GTAA 3BPZA 2WAMA 4K0KO 4NVPA 5B1AC 4EFBA 4I55A 4DR5O 4JV5B 2PI5A 1P7GA 1IBKB 4NB5A 4I4TB 2XT9A 4O4JB 4HNAA 3W7WA 2QEXV 5C93A 1RM1C 5EC2C 3RYFB 4X62O 4F6EA 4XDLA 2EIMC 1XBLA 4CS3A 2A0LA 3M7MX 1W2BU 1HNZO 2ZNIA 3CXHF 4NXNB 1ZSPA 1BS3A 3CS5A 4GUNA 3D36C 5GTIZ 1ZWIC 1XILA 1R6NA 1SF9A 1D5AA 4FLWA 3RVZA 2AGAA 1R3KC 4U7OA 4JYAB 1NTZH 3E8BA 4FLZA 1K7DA 1WB8A 5JVDA 3LNMB 2YSUB 3J7AU 3VQVA 4TV8B 5JJNB 5L3FA 5L3DA 5KX5B 4KP4A 4R6ZA 1WN7A 4GX0A 1VF6C 1SQPH 1HNWB 3K08A 1VQ8V 4FIPC 4N23A 5EYPA 1VQ7V 1DF5A 4PA7A 4KHPB 1DTOA 2GDSA 4PA3A 1E1RG 3L73H 1VARA 2P90A 2P7TC 4LP8A 1Q3EA 4JZGA 4GX1A 5CBHA 4JI8O 4XBFA 4FFKA 3KZIZ 4LF6B 1ZL8A 2PF4E 4JI0O 5KHHA 4MVRA 1G8MA 3QVNA 2JGDB 4UCTA 3AG7A 3APQA 3OMNB 4KXRA 3E35A 1X59A 4DR2B 2Q5ZA 2XAQA 3CE2A 3FB6C 2DYSC 4MS2A 3ZJZA 2JVDA 3OUFA 2WLNA 2X6CA 3ASOC 4PJ0Z 3ZMZA 1FJGB 2JJ1G 3UCSC 5B1AB 3JD3A 1L0LH 1AP5A 4YHHB 4HYOA 1JJ2U 1NI8A 2QGNA 4JI7B 4YXWG 1WLEA 5DM6V 5EBWC 4AILC 3B09A 1XREA 2YXLA 4WBNB 4OPHA 1WP7A 2Q9LA 5CB4B 2UXDO 1HR0O 2EIJC 2ATKC 5FPRA 2YEVB 2C2AA 5JH7A 4J9ZB 2CGOA 2GBOA 5L3CA 4E2LA 5H6QA 5C8YA 1RM1B 1CEZA 1R73A 1AB3A 2YXHA 5FLXN 1S72V 2EIMB 5KHIA 4DV1O 4LNUA 4ZI7B 4DR7O 3LDDA 3N2KB 4PDMA 2V1DA 4H13B 4UVCA 1ZUQA 1VQ4V 4NYKA 1EN4A 1VQ6V 3M8AA 1DK1A 3K59A 5LXTB 1VQNV 2A3QA 1TA8A 2HEPA 4XDJA 4QGPA 3BA9A 4J7ZA 2Z5UA 3JAWB 4O2AB 4MVSA 1J5EB 2F4VO 3MD0A 4JI4B 2UXCO 4J80A 4IIJB 5CMUA 1SQXH 1YJ9V 3JSLA 5B5EZ 4X1YB 3L9DA 4B3SO 4CBCA 4JI5O 3E83A 4O2BA 5JJEB 3CCRV 3G71V 1LNQA 1QLNA 5H9CA 4PDLA 1KECA 4WFEA 3ZRVA 4X66B 2LP7A 2BTQB 3P30A 1OZ0A 4GX5A 4CS4A 2M7WA 3CC4V 1COWG 1MSDA 2DWEC 3JASB 1NTMH 4K0KB 2QWRB 3EXAA 4X20B 5IJ9B 1EZJA 3T1YO 3CPWU 2UXBO 2UUAO 3F5WC 4DR5B 2DYSB 2VQFO 1YHQV 3HKEB 4CZZA 3RYCB 2NNUA 2QE7G 3ASOB 1QR9A 1QHTA 4J7JA 1SQGA 3F7VC 4GCZA 3ZRWB 4FK5C 2AW9A 2H94A 3ETEA 1NZ6A 1XI1A 1HNZB 5CN0A 1P49A 1XDCA 5IY5C 2EIJB 1XHZA 1MSWD 3SPHA 1YI2V 4P30A 5IWAB 1SC5B 3WB2A 4H0LB 3SPGA 3DC6A 2D3OW 4LF7B 2HJDA 5E79Z 4I7ZB 3CX5F 4JV5O 3EFFK 3QNEA 1BMFG 1FKAO 3RFRA 2G38A 4O4LA 1IBKO 1EN5A 2MW2B 1IVSA 3G67A 4MW8A 4TUYB 4FLVA 3FB5C 1Q81W 1H2KA 3CEIA 2PI4A 3K9AA 2Z0AA 3JAKA 2DOSA 2CK3G 3TK1A 3QO8A 2RNBA 2QJ1A 2Q4PA 4B08A 1B3QA 2QSAA 1RSOB 3OMAB 2ZQMA 4NTYA 1K4CC 3CSXA 2EJ7A 4DV2O 4ZHQB 4JI8B 1FXVA 4LF5B 1I7FA 1D5NA 1L8DA 3UT5B 3STLC 1YEWA 4LWSA 1LUWA 2IH1C 2FKXA 2IBZH 1HNWO 4ZIBA 2YS8A 3T4ZA 2XAGA 1JQ0A 1MNGA 4CH6A 5J2TA 4X64O 4I9QA 1D2DA 5EIBD 3N27A 1S5JA 1Y6XA 3CCJV 4X1KB 2LQTA 3CCQV 4DRXA 3RW0A 3AK2A 4NTXA 1US6A 4BW5A 3ZHQA 4JPRA 1M90W 4PI0A 4UCOA 4LFBO 4ZBMA 2QM4A 1QBZA 4ZOLB 2CGNA 3DC5A 2XAHA 1CPYA 4YIOA 4JI2O 2FB5A 2PGGA 1Y4MA 3B8MA 2ZIOA 4GLXA 4GKKB 2UXDB 1HR0B 3QTCA 1O9HA 1YVWA 2OTLV 2X6BA 5LP6A 1VF7A 5CA3A 1ZTEA 1Q43A 1KBHA 2QDOA 5D5PA 3ABLB 3CP1A 3UO3A 1TAEA 1VEWA 5LHGA 5JQGA 5BMVB 5IY5B 4TT3G 4DR7B 1FJGO 2Q69A 2NN4A 4U3JA 2YIBD 1WA8B 1V9PA 5LGTA 5KAIZ 1AI5A 4DV0O 2R70A 5LGNA 4DV3O 4L87A 4PA6A 3BCCH 3KG2A 3E89A 1QVGU 1N33O 5IE9A 4JF3A 2YXYA 2UUCO 1JFFB 3U10A 1TVKA 1EZVH 4I5SA 1NVPD 4KUMA 2F4VB 2YIAA 1Y76A 2VWJA 5KMGB 1R6KA 2UXCB 3Q4HB 3OR7C 5TISZ 3ZIAG 2BTOA 5LYJB 3RYIA 4YJ2A 3CRCA 4B3SB 1VQ5V 3KCXA 3JCZA 4JI5B 4WFAV 3W7TA 1N0NA 2F1MA 2LW7A 1VQPV 3H1HH 4EEQA 1JX9A 3K5OA 3ZEDA 3JALA 2QWQB 4X65O 4KL1A 4LFCO 4UCUA 4HZ3A 2BSKB 3K57A 1B6QA 2HP8A 4RAIA 5JCOA 2DE0X 3BHPA 1VMGA 1J5EO 4PDVA 3VQXA 1GMGA 1P4RA 1Z2GA 3TJTA 3OW2U 2UUAB 4Z2WA 3F5TA 3TXQA 1BZKA 2VQFB 1UFIA 5D5QA 1SA0B 4DV5O 1AJQA 3OFNG 3IC7A 1U96A 1FAFA 4FJCC 5A2QN 1N4CA 3RVYA 5B66Z 3JATB 3K03A 3NXSA
chains in the Genus database with same CATH topology
3B09A 1FD9A 1Q6UA 1Q6HA 1Q6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B09 A;  1FD9 A;  1Q6U A;  1Q6H A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 3JD1 A;  2ZM6 O;  5FNV B;  1SQV H;  3DSQ A;  1CP9 A;  1AIL A;  2QR4 A;  3PJS K;  2Y48 A;  1OCR C;  2CH7 B;  4DW0 A;  2JEU A;  3CRM A;  3GVM A;  4O4I A;  5BZB A;  3K9S A;  2OIG A;  4RUF A;  4MTO A;  1H2G A;  4BR6 A;  1HNX B;  2ZKO A;  3QF7 A;  2P06 A;  3B77 A;  2WA3 A;  2RDC A;  3JAM N;  3I55 V;  2KSD A;  1IBL B;  1KP3 A;  4OPA A;  5GON A;  2UU9 O;  4Z1M G;  1BSM A;  2CAZ C;  2CTR A;  2Q7H A;  4PV1 B;  3CC7 V;  2DN9 A;  4JTC B;  4J11 A;  2E74 B;  4I50 A;  3N2G A;  1QU7 A;  2L35 A;  1CXZ B;  3A8T A;  4DV2 B;  1BGY H;  2WLI B;  1ARO P;  4U7N A;  5IWA O;  2E75 B;  3KCY A;  4WFB V;  4LF7 O;  3H1I H;  4FZ1 A;  4UV8 A;  4CH3 A;  2KQX A;  2Y69 C;  3ETQ A;  4R7C A;  2EJR A;  3JCU Z;  1FXK C;  3AG2 C;  1VQM V;  2KG7 A;  1BE3 H;  4QE7 A;  2PTM A;  4B3T B;  5JWP A;  4B7E A;  3FYE B;  1SS3 A;  3FFQ A;  4IHJ A;  4X64 B;  4WFF A;  4EFE A;  1K92 A;  2GUZ B;  5GTH Z;  3K5L A;  3J80 N;  1P7B A;  3SYA A;  1JCH A;  2ZNJ A;  3ZMU A;  5LHI A;  1BQ0 A;  3CHX A;  4LF5 O;  1PPJ H;  2YID A;  4LFB B;  2QM8 A;  5IYZ A;  1WJZ A;  1YDX A;  3OD4 A;  5CA0 A;  3G80 A;  2QWO B;  3HKD A;  4JAV A;  4PHZ A;  3ZHR A;  1L1F A;  1FFX B;  4JI2 B;  2PUS A;  4JYB A;  1YXB A;  1NH2 D;  1XNR B;  2JK5 C;  2UUB O;  2RQ6 A;  5IJ0 B;  3IFX A;  1XEQ A;  4AHC A;  3ZHT A;  1PKX A;  1YZB A;  1WPX A;  1BHB A;  3ZRX A;  2PY5 A;  2ZDI C;  1XL4 A;  3VQW A;  5KUM A;  1M5I A;  2W0X A;  2W6I G;  1GH6 A;  1K33 A;  3K5N A;  5KHK A;  3ZN0 A;  4R50 A;  4FLY A;  1MG1 A;  1QQC A;  4I4T A;  4O4J A;  1OCR B;  1MZF A;  3SPC A;  3PN1 A;  1VF5 B;  4X1I A;  5L3G A;  2DW4 A;  1I08 A;  1F4N A;  3RYF A;  4DV0 B;  2P4V A;  4DV3 B;  2Y4T A;  3APO A;  4UVB A;  1K73 W;  3OT7 A;  2WLL B;  4GKK O;  1NKD A;  1N33 B;  5H6R A;  4AI8 A;  1PL4 A;  5LA6 B;  4O4H B;  2UUC B;  1IXM A;  3CCS V;  3BAB A;  1BQZ A;  3CC2 V;  1JOY A;  3FAV B;  3RT3 C;  2ZT9 B;  4UVA A;  1N8R W;  3QO5 A;  2L6L A;  1OHH G;  2XND G;  4GKJ B;  4TV8 A;  3IC9 A;  2XUM A;  3OR6 C;  5KAF Z;  4DR1 O;  5KX5 A;  4PDR A;  3H1L H;  5EZY B;  5E1A C;  4DUZ O;  5BY1 A;  1DLB A;  2EUL A;  5EC1 C;  3ABT A;  1MAB G;  4UFZ A;  4BIU A;  1IBM O;  2Y69 B;  4FZ0 A;  2N05 A;  1TUE B;  1FXK B;  4OX9 O;  4IYI A;  2HVK C;  2IJI A;  1Y74 B;  4MVO A;  4X65 B;  1H8E G;  3AG2 B;  4LFC B;  2F43 G;  4UUJ C;  1XHX A;  4Q6G A;  2YC0 A;  3JYC A;  3LSU A;  3ZMS A;  3GB7 C;  4I0X B;  2HHH O;  1PL0 A;  3CXC U;  2EIK C;  5CA1 B;  4FMT A;  4DV5 B;  4LFA O;  1U97 A;  2JGD A;  2ILM A;  3FB8 C;  3WG7 C;  3HR0 A;  5B1O A;  3S3W A;  4TQF A;  5KHG A;  1K8A W;  1AR4 A;  1S5H C;  1GM7 A;  4UXN A;  5LBQ A;  3MAQ A;  1NJI W;  3L70 H;  1ZX3 A;  2HFE C;  4JI6 O;  4IT5 A;  3ML0 A;  4JTD B;  5BR8 O;  1RP3 B;  2JEX A;  1HWY A;  1Q82 W;  1YF2 A;  4FM0 A;  5ITZ B;  2HKO A;  3EVK A;  4TV9 B;  2ZM6 B;  4C7U A;  1KYO F;  5EK0 A;  1KMI Z;  1I0H A;  4YIP A;  3T4D A;  4R8C A;  3HKC B;  3RBZ A;  2AHY A;  2O57 A;  4FFB B;  2GTS A;  3ZX6 A;  1NBM G;  2W6J G;  3O65 A;  1K3E A;  3OUS A;  1NR1 A;  3GWO A;  4WBN A;  5CB4 A;  4RQF A;  1N32 B;  2YIC A;  2YEV A;  4IYH A;  3OEE G;  3TGU H;  4LCU C;  2UU9 B;  1KKC A;  1YIT V;  2CE4 A;  5CBG A;  1Y66 A;  4AQY O;  1QCE A;  2QKA A;  4JTA B;  5AG2 A;  3SJC C;  3UM7 A;  1WP8 A;  4LH7 A;  3AG1 C;  3ABL C;  4L8J A;  3E86 A;  1NVP B;  1FFT B;  3B40 A;  3DXR B;  3ZHS A;  4DW1 A;  1F7Y A;  4ZI7 A;  2ARH A;  3N2K A;  4LH6 A;  3D36 A;  3ABM C;  3E22 B;  3W7U A;  4DR4 B;  4LBE C;  5DN6 G;  2F95 B;  1HNX O;  3MHS C;  1AP6 A;  1M4U A;  2Q67 A;  3G6B A;  3OGI B;  2RCV A;  4CC5 A;  3A0R A;  5LXT A;  2GV9 A;  1IBL O;  3R66 A;  4DV7 B;  1VF6 A;  2YI8 A;  1VIB A;  1OCO C;  5IYC O;  3JAR B;  3JAW A;  4O2A A;  4YJ3 B;  5J2U B;  3ZHU A;  1VQ9 V;  2IJJ A;  4F6R B;  3HKB B;  4I9W A;  3O9O A;  1Z5W A;  2B1G A;  2E3C A;  2OCH A;  4IIJ A;  4X1Y A;  3CWB H;  1AI4 A;  2DWD C;  3LDC A;  4GX2 A;  1NQT A;  4JI1 O;  1K4D C;  2AZ2 A;  4LF8 O;  3RYH B;  4FM1 A;  2Q7G A;  5EBL C;  3CJH B;  5KLV H;  1TUB B;  2EIK B;  3UO2 A;  2PYL A;  2JRI A;  2UUB B;  2BTQ A;  3WG7 B;  3C3T A;  3D8C A;  3A0B Z;  1A32 A;  3L75 H;  2A7W A;  2WLJ A;  4B3T O;  3JAS A;  3BVO A;  1NU1 H;  4X20 A;  4J10 A;  5IJ9 A;  2QM7 A;  2R9I A;  2XAJ A;  4UV9 A;  1H8H G;  3HKE A;  3RYC A;  3VOU A;  3ASN C;  3ZRS A;  2Q0O C;  2YDE A;  4JI3 O;  1M57 C;  3AG4 C;  1JPX A;  3ZRW A;  3FX7 A;  1WAZ A;  4HBN A;  4DV4 O;  3K0D A;  2IJK A;  5F2V O;  3K79 A;  5L3B A;  1XNR O;  1S3J A;  4LF4 O;  1XMO B;  2A79 B;  1AVM A;  2HLD G;  4XDK A;  1Q6H A;  4RQE A;  1I94 O;  2YUA A;  2ZR3 A;  3K04 A;  1YTF D;  3CRA A;  4CH4 A;  3SYC A;  2WA4 A;  3AG1 B;  4WCE V;  1G1X B;  3U11 A;  2V7Q G;  4DR1 B;  3OTF A;  1H38 A;  3CB2 A;  2KB1 A;  5LMN B;  5LMU O;  4TUY A;  4CH5 A;  2CTW A;  3ABM B;  4DUZ B;  1N34 B;  3T1H O;  5LOV B;  1IBM B;  4LR3 A;  4QPK A;  1ROP A;  4OX9 B;  1S76 D;  3CMA V;  3SJB C;  4B3R B;  1RSO A;  2R9R B;  1QLE C;  4MVU A;  4ZHQ A;  1WNS A;  3BFR A;  1OCO B;  3UT5 A;  1NT2 B;  3F7Y C;  3OMI B;  3CCL V;  4I55 B;  4WF9 V;  2AXT Z;  4X8A A;  1R6T A;  2B1I A;  1Q5O A;  2P22 C;  2HHH B;  5KUK A;  4K35 A;  4GKJ O;  1LUV A;  4H33 A;  3SPJ A;  4LFA B;  2GHY A;  4HNA B;  4K8X A;  5IYB O;  1GTO A;  2VQE O;  2RN9 A;  3BA8 A;  1RFY A;  3LUT B;  1NH2 B;  3C3S A;  2WWW A;  2JIZ G;  3SJQ C;  1AR1 B;  1R3I C;  4JI6 B;  4K3A A;  1HW7 A;  5BR8 B;  1QNM A;  4YY3 O;  1Q8I A;  4MTG A;  5IDJ A;  2LGQ A;  3I5D A;  4Z1V A;  2X7R B;  2V4D A;  4G2K A;  3TCU A;  3AEI A;  1THZ A;  4ZOL A;  1H2N A;  1KKD A;  2N04 A;  5JVD B;  4BW9 A;  1JVM A;  4UB6 Z;  1IX9 A;  4X9Q A;  3K58 A;  2BOB C;  2VS0 A;  1GM8 A;  4ABM A;  3FB7 C;  4FLX A;  4UCS A;  3JD4 A;  1KP2 A;  4D6T H;  3ASN B;  1GRJ A;  1M57 B;  3AG4 B;  1JA8 A;  2RJZ A;  3L72 H;  5EYP B;  4AQY B;  3VQY A;  5FL7 G;  2P5O A;  2LFR A;  1SQB H;  3KKY A;  1ENV A;  2BOC C;  3WU2 Z;  3B8N A;  2YI9 A;  2ZXW C;  2ZE8 A;  4UB8 Z;  3LNN A;  3IGA C;  3OGC C;  1K5Q A;  1ZL8 B;  4JAS A;  5LHH A;  2F93 B;  1WA8 A;  1S77 D;  4H44 B;  3RN4 A;  1VQO V;  4FM2 A;  1SRY A;  1SER A;  1K5S A;  1W59 A;  1AI6 A;  1OJH A;  4EB6 A;  3CCM V;  2JS3 A;  4BWA A;  1N32 O;  1SZX A;  1JFF A;  2ZE5 A;  3RWR D;  4HAM A;  4JYY A;  1GKF A;  3ZHV A;  4J7K A;  4X88 A;  2BCC H;  4DK0 A;  2QTS A;  4DV6 O;  5KMG A;  3SYQ A;  4RO2 A;  3Q4H A;  2IU3 A;  5LYJ A;  1QLE B;  4IL6 Z;  3S3X A;  3ETD A;  2IU0 A;  1JR9 A;  3ZBH A;  4X1I B;  1J95 A;  1ORQ C;  2A9H A;  3K5M A;  3ZCC A;  4JI1 B;  4DR4 O;  1PP9 H;  1QR8 A;  3JD0 A;  3A0H Z;  3CRR A;  1VQL V;  4LF8 B;  1G6U A;  3JD2 A;  1WB7 A;  2OYQ A;  1W0K G;  2HJF C;  2CUG A;  4P9P A;  4TQD A;  1RPR A;  3IJ4 A;  1ZLZ A;  5JH7 B;  1E79 G;  3K06 A;  2F66 C;  1V55 C;  5EIB C;  3THO A;  5CBF A;  1AR5 A;  5LL6 Y;  2XHB A;  1Q6I A;  4DV7 O;  2BSK A;  3VBB A;  5C8Y B;  1Q86 W;  1F23 A;  4QNH B;  1S5L Z;  3C90 A;  2IJH A;  2F23 A;  4PI2 A;  2HG5 C;  2P6J A;  2PZS A;  4LNU B;  1KC8 W;  1Q7Y W;  2LJ2 A;  3AK3 A;  1KB9 F;  2QTO A;  4JAU A;  4G27 B;  1SA0 A;  4J9Y B;  4LF9 B;  3BRC A;  1BHA A;  1GN6 A;  4JI3 B;  1HP8 A;  1PD3 A;  4RWU A;  1BT8 A;  3U0Z A;  1GN2 A;  3JAT A;  1YIJ V;  4DV4 B;  2UXN A;  1GAX A;  3AG3 B;  4MVQ A;  1XMQ O;  1XOU A;  1XUQ A;  2QA4 V;  3OAA G;  1SQF A;  4LF4 B;  5FNV A;  4NR1 A;  2XAF A;  1N36 O;  5JJJ B;  2CH7 A;  2QKC A;  5KA5 A;  1I94 B;  2E5L O;  1FXH A;  1IZ3 A;  4NXM O;  2XOK G;  1K97 A;  2X0L A;  2R9A A;  2NR5 A;  2ZXW B;  3P32 A;  4JYC A;  5LMU B;  4O2B B;  3T1H B;  2LW1 A;  3MHH C;  4W4L A;  4QE9 A;  3FD9 A;  4JAA A;  1XMO O;  2DYR C;  5HFM A;  4Q20 A;  2WLI A;  4B3M O;  1H2L A;  4EKW A;  3CRQ A;  3I56 V;  1BL8 A;  1G4Y B;  1LR1 A;  2HVJ C;  3ICX A;  4N21 A;  4ZKI A;  2P4K A;  2DJV A;  5LP6 C;  5LMN O;  2VQE B;  1MZE A;  4E4E A;  2JDI G;  1N34 O;  3H9V A;  1MOF A;  1P84 F;  2VWK A;  1E1Q G;  1RPO A;  1UJW B;  2Q8V A;  1XL6 A;  4YY3 B;  2GUZ A;  4IGG A;  1WPB A;  3QG5 A;  4B3R O;  1V55 B;  2X6A A;  2FYU H;  4JZ2 A;  1NS1 A;  2K9P A;  4MW3 A;  2DQ3 A;  4MT8 A;  1MMM A;  4FVM A;  2WLM A;  2WSS G;  3SR2 C;  2LGW A;  1FFX A;  5K1P A;  4O4L B;  3CCV V;  5IJ0 A;  2FTK A;  3MDS A;  2JGU A;  2EX3 A;  4PEL A;  3CME V;  4DR3 O;  3JAK B;  3L74 H;  2PYJ A;  3CD6 V;  3W7S A;  2QKS A;  4OGQ B;  2Y0P A;  1YTF B;  3X2Q C;  1TGO A;  3WB0 A;  1FPO A;  2H8P C;  1YCI A;  3OTO O;  1H2S B;  2Y0I A;  4LWS B;  2FL4 A;  2AHZ A;  2ADP A;  3P3N A;  4DUY B;  1FS0 G;  4U3F H;  3B2E E;  4W4K A;  4DK1 A;  3RGB A;  1KUQ A;  2WLL A;  2DMX A;  5JCO C;  5B1B C;  4TSF G;  4FPP A;  4A5U B;  5LA6 A;  4O4H A;  4ICG A;  5J2T B;  3ZS8 C;  4DR6 O;  2JJ2 G;  2XTA A;  2IH3 C;  2EZP A;  3FAV A;  3K0G A;  4DV6 B;  1MA1 A;  2ZD9 A;  5FPO A;  4DRX B;  1SET A;  2EIL C;  5K1X A;  4QPJ A;  2IM9 A;  3H1K H;  3UQ8 A;  2DYR B;  1YSC A;  3WB1 A;  2ZCE A;  5EZY A;  2QWP B;  1M93 A;  4MVZ A;  4X62 B;  3T1C A;  2EIN C;  4J41 A;  4QJF B;  2E76 B;  1K34 A;  1M56 C;  3SYO A;  5DED A;  1IXB A;  1YJN V;  4ASU G;  2ZR2 A;  1FXK A;  1BCC H;  1O9G A;  1V54 C;  3H01 A;  1Y74 A;  3ABU A;  1XNQ O;  1IDS A;  5LP6 B;  5IYD O;  1R1B A;  2ITC C;  1ZAU A;  1QVF U;  2AZ0 A;  2LFS A;  2P67 A;  4UCR A;  4FLT A;  2WLH A;  4GT1 A;  1VQK V;  3IAY A;  1VP7 A;  1YJW V;  3BAA A;  4I0X A;  3D3Q A;  2JS5 A;  4FLU A;  5JQG B;  2KKW A;  5CA1 A;  3P3P A;  2OCC C;  5BXZ A;  4K8Z A;  2Z3Y A;  4U3J B;  2Q0A A;  3EHB B;  2GSM B;  1OV9 A;  3DGE A;  1JJO A;  2A06 H;  1I5X A;  1R3L C;  4TWK A;  1XMQ B;  3B4S A;  4NXN O;  5ITZ A;  1K9M W;  4TV9 A;  2K1E A;  4NTW A;  3FKS G;  3HPL C;  1TVK B;  2WPD G;  1N36 B;  3HKC A;  4CC6 A;  1FD9 A;  4FFB A;  4P9O A;  2E5L B;  1Y76 B;  4JYA O;  4JI0 B;  4NXM B;  2ZDI A;  3SJA C;  2CDY A;  2YIB A;  3ABK C;  3RYI B;  1W0J G;  2EZO A;  4MTF A;  4YJ2 B;  3H1J H;  3SYP A;  1NTK H;  3X2Q B;  3STZ C;  1NR7 A;  4LF9 O;  4BIZ A;  3QO7 A;  4OXS A;  4CS2 A;  4DO2 A;  2IW5 A;  1R3J C;  2NLJ C;  2MK3 A;  4QIW F;  1SQQ H;  3A2F A;  1FYJ A;  4KHP O;  3E8F A;  3M99 B;  4WFH A;  3ZN1 A;  1OCC C;  3JAL B;  3LDE A;  2OWO A;  3E2E A;  1AI7 A;  3OE7 G;  3CCE V;  4JGS A;  3DXR A;  1OCZ C;  3D3I A;  2OTJ V;  5B1B B;  3SGI A;  2HR3 A;  1S0V A;  1KD1 W;  4B3M B;  3JSN A;  4KFM A;  5H5N A;  2ODM A;  4LF6 O;  4MTX A;  3E22 A;  4X89 A;  1GN3 A;  1N0J A;  1HDJ A;  5B3S C;  4H37 A;  4BAY A;  4WFG A;  2EIL B;  4GZR B;  4DXW A;  3SPI A;  3J81 N;  1JMK C;  1SES A;  2Q68 A;  1M1K W;  2RMK B;  3HB3 B;  1GK9 A;  4B7K A;  1Y67 A;  1AJN A;  4DR2 O;  3TXS A;  3JAR A;  1Z5V A;  2EIN B;  2CTQ A;  4MSW C;  4YJ3 A;  5J2U A;  4F6R A;  3BEH A;  2ZIM A;  3HKB A;  1M56 B;  5B1N A;  3E8H A;  2Q6A A;  4DV1 B;  1PNM A;  3TET A;  3K3W A;  2Q73 A;  1V54 B;  2B9Z A;  2H3O A;  4O4I B;  5DEC A;  3G6E V;  4DYL A;  4YHH O;  1PM9 A;  3ZMT A;  2ADQ B;  4JI7 O;  1PV0 A;  1M9N A;  2R72 A;  2N74 A;  1F51 A;  1T5E A;  4G28 B;  3RYH A;  2WLK A;  1Q90 D;  4P2Z A;  3CJH A;  4EB6 B;  2DQ0 A;  1TUB A;  4PA4 A;  2OCC B;  4J42 A;  1PNK A;  5GON B;  2UXX A;  3FYI B;  3OM3 B;  1EN6 A;  5IT9 N;  1GN4 A;  1DGS A;  2ITD C;  4DR3 B;  1KU9 A;  3T2M A;  4RUE A;  5KHJ A;  4TOI A;  4I50 B;  3N2G B;  4X1K A;  1KQS U;  3CCU V;  3G4S V;  2XAS A;  1Q6U A;  5H2F Z;  3R65 A;  2ETN A;  1B06 A;  1PNL A;  3OTO B;  5LGU A;  1F4M A;  5HFL A;  3UKM A;  1EFR G;  3WFV A;  5L3E A;  2Q7E A;  1GM9 A;  4D7T A;  2Y4U A;  1B04 A;  1SKV A;  1X4T A;  3AG3 C;  1IUR A;  1EBO A;  4BIO A;  4GYC B;  2D2C B;  3ABK B;  1SZT A;  2KG7 B;  4NKG B;  1UPG A;  5A9G A;  1GO3 F;  1I5Y A;  3LSS A;  5KA6 A;  4PD4 F;  4UCV A;  4IHJ B;  4DR6 B;  2ZE7 A;  2BE3 A;  3T1Y B;  4PA9 A;  2UXB B;  2OT5 A;  4JI4 O;  1XQ8 A;  1H2M A;  2ZE6 A;  1OCC B;  2EBO A;  3AK1 A;  4F4L A;  1OCZ B;  2M6Y A;  5BMV A;  3ETG A;  2LO1 A;  3CYO A;  2W0F C;  2CTP A;  3SDL A;  5IYZ B;  5J9P C;  1DF4 A;  2QWN B;  3ZMV A;  5CA0 B;  3HKD B;  3W7X A;  1AJP A;  3GWK C;  4MVM A;  5LOV A;  1EM1 A;  3BY6 A;  5B3S B;  4DUY O;  2OIE A;  3DTU B;  1URF A;  5EBM C;  4LC1 A;  2B5U A;  3L71 H;  3OEH G;  5GW7 A;  2FML A;  3LSQ A;  4X66 O;  1L0N H;  3E8G A;  3NR7 A;  1XNQ B;  4D7S A;  2ZIN A;  2VRZ A;  2GTA A;  3BPZ A;  2WAM A;  4K0K O;  4NVP A;  5B1A C;  4EFB A;  4I55 A;  4DR5 O;  4JV5 B;  2PI5 A;  1P7G A;  1IBK B;  4NB5 A;  4I4T B;  2XT9 A;  4O4J B;  4HNA A;  3W7W A;  2QEX V;  5C93 A;  1RM1 C;  5EC2 C;  3RYF B;  4X62 O;  4F6E A;  4XDL A;  2EIM C;  1XBL A;  4CS3 A;  2A0L A;  3M7M X;  1W2B U;  1HNZ O;  2ZNI A;  3CXH F;  4NXN B;  1ZSP A;  1BS3 A;  3CS5 A;  4GUN A;  3D36 C;  5GTI Z;  1ZWI C;  1XIL A;  1R6N A;  1SF9 A;  1D5A A;  4FLW A;  3RVZ A;  2AGA A;  1R3K C;  4U7O A;  4JYA B;  1NTZ H;  3E8B A;  4FLZ A;  1K7D A;  1WB8 A;  5JVD A;  3LNM B;  2YSU B;  3J7A U;  3VQV A;  4TV8 B;  5JJN B;  5L3F A;  5L3D A;  5KX5 B;  4KP4 A;  4R6Z A;  1WN7 A;  4GX0 A;  1VF6 C;  1SQP H;  1HNW B;  3K08 A;  1VQ8 V;  4FIP C;  4N23 A;  5EYP A;  1VQ7 V;  1DF5 A;  4PA7 A;  4KHP B;  1DTO A;  2GDS A;  4PA3 A;  1E1R G;  3L73 H;  1VAR A;  2P90 A;  2P7T C;  4LP8 A;  1Q3E A;  4JZG A;  4GX1 A;  5CBH A;  4JI8 O;  4XBF A;  4FFK A;  3KZI Z;  4LF6 B;  1ZL8 A;  2PF4 E;  4JI0 O;  5KHH A;  4MVR A;  1G8M A;  3QVN A;  2JGD B;  4UCT A;  3AG7 A;  3APQ A;  3OMN B;  4KXR A;  3E35 A;  1X59 A;  4DR2 B;  2Q5Z A;  2XAQ A;  3CE2 A;  3FB6 C;  2DYS C;  4MS2 A;  3ZJZ A;  2JVD A;  3OUF A;  2WLN A;  2X6C A;  3ASO C;  4PJ0 Z;  3ZMZ A;  1FJG B;  2JJ1 G;  3UCS C;  5B1A B;  3JD3 A;  1L0L H;  1AP5 A;  4YHH B;  4HYO A;  1JJ2 U;  1NI8 A;  2QGN A;  4JI7 B;  4YXW G;  1WLE A;  5DM6 V;  5EBW C;  4AIL C;  3B09 A;  1XRE A;  2YXL A;  4WBN B;  4OPH A;  1WP7 A;  2Q9L A;  5CB4 B;  2UXD O;  1HR0 O;  2EIJ C;  2ATK C;  5FPR A;  2YEV B;  2C2A A;  5JH7 A;  4J9Z B;  2CGO A;  2GBO A;  5L3C A;  4E2L A;  5H6Q A;  5C8Y A;  1RM1 B;  1CEZ A;  1R73 A;  1AB3 A;  2YXH A;  5FLX N;  1S72 V;  2EIM B;  5KHI A;  4DV1 O;  4LNU A;  4ZI7 B;  4DR7 O;  3LDD A;  3N2K B;  4PDM A;  2V1D A;  4H13 B;  4UVC A;  1ZUQ A;  1VQ4 V;  4NYK A;  1EN4 A;  1VQ6 V;  3M8A A;  1DK1 A;  3K59 A;  5LXT B;  1VQN V;  2A3Q A;  1TA8 A;  2HEP A;  4XDJ A;  4QGP A;  3BA9 A;  4J7Z A;  2Z5U A;  3JAW B;  4O2A B;  4MVS A;  1J5E B;  2F4V O;  3MD0 A;  4JI4 B;  2UXC O;  4J80 A;  4IIJ B;  5CMU A;  1SQX H;  1YJ9 V;  3JSL A;  5B5E Z;  4X1Y B;  3L9D A;  4B3S O;  4CBC A;  4JI5 O;  3E83 A;  4O2B A;  5JJE B;  3CCR V;  3G71 V;  1LNQ A;  1QLN A;  5H9C A;  4PDL A;  1KEC A;  4WFE A;  3ZRV A;  4X66 B;  2LP7 A;  2BTQ B;  3P30 A;  1OZ0 A;  4GX5 A;  4CS4 A;  2M7W A;  3CC4 V;  1COW G;  1MSD A;  2DWE C;  3JAS B;  1NTM H;  4K0K B;  2QWR B;  3EXA A;  4X20 B;  5IJ9 B;  1EZJ A;  3T1Y O;  3CPW U;  2UXB O;  2UUA O;  3F5W C;  4DR5 B;  2DYS B;  2VQF O;  1YHQ V;  3HKE B;  4CZZ A;  3RYC B;  2NNU A;  2QE7 G;  3ASO B;  1QR9 A;  1QHT A;  4J7J A;  1SQG A;  3F7V C;  4GCZ A;  3ZRW B;  4FK5 C;  2AW9 A;  2H94 A;  3ETE A;  1NZ6 A;  1XI1 A;  1HNZ B;  5CN0 A;  1P49 A;  1XDC A;  5IY5 C;  2EIJ B;  1XHZ A;  1MSW D;  3SPH A;  1YI2 V;  4P30 A;  5IWA B;  1SC5 B;  3WB2 A;  4H0L B;  3SPG A;  3DC6 A;  2D3O W;  4LF7 B;  2HJD A;  5E79 Z;  4I7Z B;  3CX5 F;  4JV5 O;  3EFF K;  3QNE A;  1BMF G;  1FKA O;  3RFR A;  2G38 A;  4O4L A;  1IBK O;  1EN5 A;  2MW2 B;  1IVS A;  3G67 A;  4MW8 A;  4TUY B;  4FLV A;  3FB5 C;  1Q81 W;  1H2K A;  3CEI A;  2PI4 A;  3K9A A;  2Z0A A;  3JAK A;  2DOS A;  2CK3 G;  3TK1 A;  3QO8 A;  2RNB A;  2QJ1 A;  2Q4P A;  4B08 A;  1B3Q A;  2QSA A;  1RSO B;  3OMA B;  2ZQM A;  4NTY A;  1K4C C;  3CSX A;  2EJ7 A;  4DV2 O;  4ZHQ B;  4JI8 B;  1FXV A;  4LF5 B;  1I7F A;  1D5N A;  1L8D A;  3UT5 B;  3STL C;  1YEW A;  4LWS A;  1LUW A;  2IH1 C;  2FKX A;  2IBZ H;  1HNW O;  4ZIB A;  2YS8 A;  3T4Z A;  2XAG A;  1JQ0 A;  1MNG A;  4CH6 A;  5J2T A;  4X64 O;  4I9Q A;  1D2D A;  5EIB D;  3N27 A;  1S5J A;  1Y6X A;  3CCJ V;  4X1K B;  2LQT A;  3CCQ V;  4DRX A;  3RW0 A;  3AK2 A;  4NTX A;  1US6 A;  4BW5 A;  3ZHQ A;  4JPR A;  1M90 W;  4PI0 A;  4UCO A;  4LFB O;  4ZBM A;  2QM4 A;  1QBZ A;  4ZOL B;  2CGN A;  3DC5 A;  2XAH A;  1CPY A;  4YIO A;  4JI2 O;  2FB5 A;  2PGG A;  1Y4M A;  3B8M A;  2ZIO A;  4GLX A;  4GKK B;  2UXD B;  1HR0 B;  3QTC A;  1O9H A;  1YVW A;  2OTL V;  2X6B A;  5LP6 A;  1VF7 A;  5CA3 A;  1ZTE A;  1Q43 A;  1KBH A;  2QDO A;  5D5P A;  3ABL B;  3CP1 A;  3UO3 A;  1TAE A;  1VEW A;  5LHG A;  5JQG A;  5BMV B;  5IY5 B;  4TT3 G;  4DR7 B;  1FJG O;  2Q69 A;  2NN4 A;  4U3J A;  2YIB D;  1WA8 B;  1V9P A;  5LGT A;  5KAI Z;  1AI5 A;  4DV0 O;  2R70 A;  5LGN A;  4DV3 O;  4L87 A;  4PA6 A;  3BCC H;  3KG2 A;  3E89 A;  1QVG U;  1N33 O;  5IE9 A;  4JF3 A;  2YXY A;  2UUC O;  1JFF B;  3U10 A;  1TVK A;  1EZV H;  4I5S A;  1NVP D;  4KUM A;  2F4V B;  2YIA A;  1Y76 A;  2VWJ A;  5KMG B;  1R6K A;  2UXC B;  3Q4H B;  3OR7 C;  5TIS Z;  3ZIA G;  2BTO A;  5LYJ B;  3RYI A;  4YJ2 A;  3CRC A;  4B3S B;  1VQ5 V;  3KCX A;  3JCZ A;  4JI5 B;  4WFA V;  3W7T A;  1N0N A;  2F1M A;  2LW7 A;  1VQP V;  3H1H H;  4EEQ A;  1JX9 A;  3K5O A;  3ZED A;  3JAL A;  2QWQ B;  4X65 O;  4KL1 A;  4LFC O;  4UCU A;  4HZ3 A;  2BSK B;  3K57 A;  1B6Q A;  2HP8 A;  4RAI A;  5JCO A;  2DE0 X;  3BHP A;  1VMG A;  1J5E O;  4PDV A;  3VQX A;  1GMG A;  1P4R A;  1Z2G A;  3TJT A;  3OW2 U;  2UUA B;  4Z2W A;  3F5T A;  3TXQ A;  1BZK A;  2VQF B;  1UFI A;  5D5Q A;  1SA0 B;  4DV5 O;  1AJQ A;  3OFN G;  3IC7 A;  1U96 A;  1FAF A;  4FJC C;  5A2Q N;  1N4C A;  3RVY A;  5B66 Z;  3JAT B;  3K03 A;  3NXS A; 
#chains in the Genus database with same CATH homology
 3B09 A;  1FD9 A;  1Q6U A;  1Q6H A;  1Q6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...