3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
molecule tags Chaperone
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
1Q6HA 1FD9A 1Q6IA 1Q6UA 3B09A
chains in the Genus database with same CATH superfamily
2P22C 4JTCB 4P9OA 1LUVA 2JDIG 1EBOA 4YIOA 4YY3O 4PI2A 2V1DA 3ABLB 4JV5O 4PDVA 2OCHA 4JI6B 1WA8B 2XAJA 5LGTA 3SR2C 4GX1A 3HKDB 1NTZH 1VF5B 4YJ3B 3JAMN 5LA6A 4TV9B 5FPOA 1I5YA 2ATKC 4X66O 4LF5O 2ZM6O 5IYDO 4YHHO 3ASNB 1Q81W 2CH7B 1TGOA 4MTXA 3ABMB 1IZ3A 4QPJA 2CUGA 4J7ZA 4X62B 1WB7A 1XILA 4LFCB 3ASOC 3T2MA 1BT8A 5E79Z 3RYFA 2IBZH 2EJRA 3HKBB 2DJVA 4C7UA 3SPIA 3K9AA 3WB1A 4KHPO 4KFMA 3D3IA 3Q4HB 4I7ZB 4J11A 2QE7G 1WN7A 4HNAA 2PI5A 2PYLA 5CA0B 4QPKA 3CCJV 2WSSG 1JQ0A 1R3IC 3FB8C 3SPJA 2W6IG 1YI2V 2VRZA 5KLVH 4QE7A 2A7WA 2PF4E 1S76D 5BMVA 3UT5B 4FZ1A 4LF9B 3L73H 4Q20A 1J5EO 1OJHA 3ZMTA 1N36O 1MSWD 1PKXA 2YIAA 3H1HH 4DV2O 1VQLV 4LF7B 4D7SA 1YSCA 4IGGA 3M8AA 4DV3O 2EINC 3ASOB 4JI4O 2VWJA 4UCUA 3EVKA 1OCRC 4B3TB 3FD9A 1FJGB 1PM9A 3AG7A 5C8YA 2YIBD 3SJBC 2R9RB 1FXVA 1VQ6V 1XMQO 1WP7A 1N4CA 2EIJC 4R7CA 4I50A 3JSNA 1QU7A 3BA9A 4JI3B 4ZI7A 3BRCA 4MS2A 4TQDA 4MVSA 4PDMA 4CH6A 4L8JA 3K5NA 3SPGA 2F43G 3QO5A 3OT7A 5A2QN 3ZBHA 4NR1A 1ZWIC 2UXBO 2LO1A 3A8TA 1W59A 4FM0A 3B8NA 2UUBB 5IJ9B 3AG3C 4K3AA 4X1IB 3WG7C 1H38A 1M90W 4MVQA 4RUFA 2EINB 4IL6Z 4H13B 4U3JB 3RVZA 1F7YA 4DV1B 4CBCA 2Y69B 3SDLA 3APOA 3AG1C 5IWAB 4WFAV 4NTWA 5KX5B 3ZCCA 1VQ4V 1EN4A 1FXKA 4JYCA 5JCOC 1QR8A 4UXNA 3A0BZ 5H5NA 1SKVA 3TJTA 4LNUA 4JI2O 4LFBB 1HDJA 3E8BA 2EIJB 3QF7A 1NTMH 2B1IA 3ZN0A 1RPOA 4TT3G 5H6QA 3STZC 4LBEC 3ZX6A 5JH7A 1IBMB 2HHHB 4JAVA 2Y0IA 4HZ3A 2YI8A 4JI5O 1YCIA 5EYPB 4JI1O 2IM9A 3CXHF 3P30A 2OIGA 5EC2C 3AG3B 3RYHA 1NT2B 3D3QA 3CRRA 1VQ5V 4DR3B 3THOA 1Y4MA 4CC6A 3G4SV 3RYIB 1N34O 3AG1B 5KHGA 2ZIMA 4DUYO 2WWWA 4JAAA 2OT5A 1LNQA 2UXDB 4LWSB 4LF6B 1HNWO 5IJ0A 5IT9N 4CH5A 5LGUA 3HKEA 3JASB 1FS0G 1CEZA 1YJNV 3SYCA 2VQEB 1TUBB 3OW2U 1H8EG 3OGIB 3E22B 4DV0O 2IW5A 2QKCA 3KKYA 4JYAO 2CTRA 1GN6A 4MVZA 2IU0A 1UPGA 1AR4A 3E2EA 2LGWA 2P7TC 1PD3A 4HBNA 4UVAA 1N0JA 4UCTA 3ZMZA 1K34A 4JI8B 2V7QG 1RSOA 2P4KA 5B66Z 4OX9O 1MSDA 2X6CA 4TV8A 1KYOF 3RYCA 4F6EA 4K8ZA 3JSLA 1ZAUA 4X88A 1NQTA 1K73W 5FNVA 1WPXA 1S5JA 4PA9A 1DGSA 1S5HC 1PL0A 1BL8A 4UB8Z 1ZTEA 1JPXA 3N2KA 2ZE5A 4DR1B 2WLHA 3CRCA 3AG4C 3W7XA 4OGQB 4MVRA 3CD6V 1Y76A 4WFEA 2UUAO 1MOFA 3ZS8C 5GW7A 4I55A 3FB5C 5FLXN 4O2BB 5IYZA 3CJHB 2A0LA 4FLYA 4X8AA 2GUZB 1SETA 1VF6C 4FLXA 1HR0B 1QVFU 3E35A 1N33O 5IY5C 3DGEA 2E5LB 1GH6A 1FYJA 5K1XA 2QWOB 1NR7A 4B7KA 4UFZA 1M9NA 3SYQA 1KB9F 1NJIW 3BEHA 3RGBA 4OXSA 2B1GA 2CDYA 1BCCH 1KMIZ 5L3CA 1URFA 1Y74A 3ETGA 4UV9A 2HEPA 1NI8A 2EULA 2MK3A 4E4EA 4O4HA 4G2KA 5E1AC 1VP7A 5LYJB 2BCCH 3J80N 3LUTB 3AG4B 1S0VA 1PL4A 4DR6B 1R3JC 3OR7C 1F4MA 3JALB 2GDSA 3JD3A 4WFHA 1VQMV 5CN0A 3BABA 2X6BA 4DV4B 4FLTA 5L3BA 5CA3A 1HP8A 1XL4A 1SQBH 2W6JG 2QTOA 2DQ3A 4UB6Z 3M7MX 5IY5B 4YIPA 1XOUA 1AVMA 4FK5C 2E74B 2R72A 4G27B 1TVKB 4UVCA 3VQVA 1QLNA 2LW1A 3AK1A 5CBGA 3IC7A 1XMOO 1FFXA 4CS3A 2ODMA 3ZRXA 2E76B 3R65A 1YF2A 1K97A 1XNRO 1XNQO 4DO2A 4NXNB 1M57C 3K59A 3JD4A 1BMFG 3W7UA 3I5DA 1W0KG 3CCLV 4FM2A 1IBKB 1P4RA 5CB4A 1GN2A 4J41A 1Y66A 4TWKA 2QEXV 1WNSA 4IIJA 3MAQA 1AB3A 3ETEA 1JX9A 4PA3A 1JFFB 3TETA 3IC9A 5JVDB 3ZJZA 3WB0A 1QHTA 1PNKA 3CEIA 2F95B 2ZE6A 5H6RA 1G6UA 2Q7GA 2N05A 3ZHUA 4H0LB 2EIKC 2F23A 5LMUB 1IBLO 1OV9A 4I4TB 1JOYA 2PZSA 2Y4UA 4JI0O 3CXCU 4TQFA 5C8YB 4LF4O 3SYPA 3BAAA 4AILC 1U97A 2DN9A 3OR6C 4A5UB 4I0XB 3CC4V 3OMIB 3A2FA 1JJOA 4CC5A 5B1AB 3CCQV 4AQYB 1AP6A 3T1YB 1B04A 1YEWA 5KMGA 2F4VO 3OFNG 2XASA 1I94B 2AGAA 2Q68A 1QBZA 3D36A 3TCUA 3CSXA 3IJ4A 4X20A 1FXHA 3OE7G 5EIBC 3O9OA 2ETNA 5BR8B 1D5NA 2LFSA 2M7WA 3SYAA 4WCEV 4DV6B 4DV5B 1Q6HA 1ZUQA 5IYCO 1GM8A 2DYRC 2YEVB 3ZIAG 4X65O 2ADPA 2RNBA 4NTXA 3K5LA 2YIBA 3E89A 3OMNB 3KG2A 4CH3A 2V4DA 3SJQC 5LP6A 3ABUA 1MZFA 5L3FA 3UCSC 1HW7A 2DMXA 1I7FA 5JH7B 1AI5A 4YY3B 4JV5B 1F4NA 1IXBA 3ETDA 3L70H 1SA0B 3TK1A 1L1FA 1BZKA 5GONA 3K5OA 1P49A 5EK0A 3K08A 4PA4A 1H2NA 5FPRA 4X66B 5JWPA 4LF5B 2ZM6B 4YHHB 4TUYA 3IGAC 1Q82W 2W0XA 5J2UB 3RT3C 1I0HA 5ITZB 2Y0PA 3OTFA 1QLEC 3BA8A 4EB6A 2DYRB 1SQPH 2RCVA 1OHHG 1Z5VA 2HKOA 4CS4A 1XBLA 1K4DC 1DF5A 4XDLA 1L0NH 2WLIB 1TUEB 3OUFA 5J2TA 2XNDG 2JS3A 4FFBA 1H2MA 1DF4A 4KHPB 1YHQV 1GN4A 3F7VC 2HVJC 3ZRWA 1CXZB 4DW1A 1LUWA 2ZKOA 4DUZO 3T1CA 1OCCC 1R73A 4LP8A 2K1EA 2CK3G 3JAKA 1SQVH 5D5QA 3NXSA 4DR2O 2AW9A 1OCOC 4PV1B 2HVKC 1J5EB 1N36B 1KC8W 1VQ9V 5L3DA 4DV2B 2O57A 1QLEB 2PY5A 1Q43A 3CX5F 1V9PA 4ZHQA 3CC2V 4DV3B 1ZL8A 4JI4B 1V55B 2DE0X 5LXTA 3H1JH 4DR5O 5JQGB 3BY6A 4O4LB 1WLEA 4BWAA 1XMQB 2X6AA 2Y69C 2AZ2A 4DR4O 2ITCC 1YTFB 5EZYA 3PN1A 1OCCB 4N23A 4FFKA 5AG2A 4D7TA 3RWRD 2XAFA 2PYJA 2DWDC 3DXRA 1HNZO 4Z1VA 4DXWA 4ZKIA 5LBQA 4B3MO 2WLJA 3OEEG 1BQ0A 3MDSA 4JTAB 1GK9A 3CCUV 5IYZB 1OCOB 2IJHA 1IDSA 3T1HO 4FJCC 4EEQA 1JR9A 3HKCB 2QM4A 3ZMSA 2FTKA 2UXBB 3EFFK 2A3QA 2EX3A 2AHYA 5CA1B 2CTQA 4EKWA 2FB5A 2LJ2A 5KUKA 2AZ0A 4MTFA 4U7OA 1SQGA 1VQOV 3IAYA 4MTOA 1KD1W 5EBWC 3H9VA 2ARHA 2JK5C 2XAQA 3RFRA 2JIZG 3E83A 4JGSA 3M99B 4FLZA 4GKJO 4YJ2A 1W2BU 4O4HB 4R50A 1NU1H 4K0KO 4JI2B 1Y6XA 2ZDIC 1FFTB 1AR1B 2HLDG 2PUSA 2FKXA 5EBMC 5CBFA 5H2FZ 1O9GA 4RAIA 1AP5A 1GO3F 4O4JA 4JI5B 1GMGA 1P7BA 4IYHA 4PJ0Z 2QSAA 4JI1B 1XI1A 4PELA 4QIWF 3B77A 2UUBO 2ZINA 4ZOLA 4X1YA 4PHZA 3JAWA 1M5IA 3ZHQA 5KA5A 1S72V 2W0FC 4IT5A 4QGPA 2HFEC 1SQXH 2NLJC 5KHIA 4DRXB 4Z1MG 4GCZA 4CZZA 3BCCH 3JD0A 2N04A 3F5TA 3CMAV 2ZD9A 5IDJA 1NH2B 2FMLA 1N34B 4DUYB 1I5XA 1FFXB 1WPBA 3B8MA 1NVPB 3FB6C 4F6RA 4I9WA 2OTLV 1S5LZ 1F23A 4K35A 2UXCO 3R66A 1US6A 4O2AB 3DTUB 3FYEB 5LGNA 3UKMA 2L6LA 2D3OW 2C2AA 4DV0B 1KECA 1H8HG 1KKDA 4J7KA 4JYAB 3HKDA 3OTOO 4YJ3A 3ML0A 4TV9A 3K57A 4UVBA 2R9IA 2ADQB 3K0DA 2GTSA 3LSUA 5CB4B 4IHJB 1N8RW 3RVYA 3O65A 1UJWB 1JCHA 2RJZA 3T4ZA 4IIJB 4LCUC 4OX9B 2UXNA 1MZEA 3C3TA 3SPCA 2WLMA 4FLWA 4O4IA 3OUSA 3HKBA 4TOIA 4IYIA 4FVMA 4WBNA 4U7NA 3G71V 4P9PA 2LFRA 2HP8A 3Q4HA 4U3FH 3B2EE 3CPWU 1OCZB 4QE9A 5CA0A 3BVOA 4JPRA 3CE2A 2YDEA 5F2VO 1Q6IA 1XL6A 1GAXA 4JYYA 4GKKO 1IXMA 2UUCO 4AI8A 2WLLB 3CCVV 1GN3A 2UUAB 4X64O 3H1IH 5B3SC 3JYCA 3MD0A 2XOKG 4LF8O 2UU9O 3LDDA 1FPOA 4WFFA 1AJNA 3UO3A 1X59A 1J95A 1M1KW 1N33B 2WPDG 3L72H 1ROPA 1N32O 2VQFO 3ZHVA 2CGNA 3JARA 2VS0A 3BHPA 4W4KA 5KA6A 4BR6A 1WB8A 4R8CA 1O9HA 4BIZA 4BW9A 3FAVB 3APQA 1E1QG 2ZCEA 4F4LA 3FX7A 3RBZA 4J9YB 4Z2WA 4B3RO 2QA4V 1ZSPA 2QJ1A 1RM1B 5B3SB 4KUMA 3RW0A 2BSKB 2FL4A 5EIBD 3JATB 1MABG 3JD1A 1A32A 2E5LO 5IJ9A 2NR5A 5LOVB 4X1IA 5BXZA 1YIJV 2XAGA 4L87A 4J9ZB 1KUQA 2YI9A 3PJSK 3T4DA 4LFAO 4JAUA 2R70A 5KX5A 1T5EA 2YUAA 4KL1A 4GYCB 2QWPB 1FKAO 1EM1A 2H3OA 2ILMA 4DYLA 1HWYA 1XMOB 1MA1A 2H8PC 4QJFB 5LA6B 3KCXA 4H33A 3VOUA 2NNUA 3FFQA 4FMTA 2QKAA 5B1BC 1JJ2U 4LC1A 2OYQA 2N74A 3P32A 2OCCC 1XNQB 2ZXWC 4OPHA 3VQWA 2QKSA 3ZMUA 5EYPA 3K79A 5GTHZ 4J80A 1L0LH 1V54C 3RYFB 2B5UA 2BTOA 2KQXA 1F51A 2NN4A 3VQXA 3W7TA 4B7EA 3G6BA 5LMNO 2AXTZ 2KKWA 1G1XB 3JAKB 3RYIA 4HNAB 2PTMA 3OAAG 5L3EA 4FLVA 4LH6A 1XDCA 3P3PA 3G80A 5JCOA 3ETQA 4PA6A 5JJEB 2XT9A 3GB7C 2P90A 2YIDA 5TISZ 1R6NA 3JASA 5B1AC 2EJ7A 2IJKA 2QM7A 3B09A 1R6TA 5BMVB 3J81N 5L3GA 3FKSG 3IFXA 3K0GA 3E22A 4NYKA 5K1PA 5B1BB 1VARA 2OCCB 3SGIA 2ZXWB 4LH7A 1IBLB 2JJ2G 1YTFD 1VQKV 3CCSV 1JMKC 2Z3YA 4FZ0A 4JI0B 1AI6A 1QQCA 1Z5WA 5B5EZ 2E75B 2AHZA 1YVWA 1V54B 2Z0AA 2GBOA 2A79B 5DN6G 4RWUA 2Q0AA 5EZYB 2JJ1G 2CE4A 1FXKC 2XTAA 4DV7O 1WP8A 3F5WC 2FYUH 5IYBO 3GWKC 1ENVA 3ZHRA 1KBHA 2HJDA 4NXMO 1QVGU 4I50B 4B3SO 1DLBA 3QVNA 4EFBA 2F4VB 4ZI7B 3CYOA 2DWEC 2P67A 4WFBV 3CWBH 2WLKA 2IH3C 3E8HA 3KCYA 5LMUO 2X7RB 4DK0A 1EN5A 1BQZA 1SQQH 1QCEA 2QWRB 1KP3A 2EIMB 4X65B 2YXHA 2P06A 5BY1A 3D8CA 1ZX3A 4D6TH 3ZMVA 3CJHA 1D5AA 3ICXA 4DR7O 5J9PC 1FXKB 4NVPA 1G4YB 3DC5A 1VQ8V 2ZIOA 2QTSA 1HNXO 1K92A 2YS8A 4PD4F 2D2CB 3HR0A 4LNUB 1S3JA 2KG7A 4E2LA 1YDXA 1PNLA 4YXWG 2LQTA 4B08A 5DM6V 3ABTA 4RUEA 5BZBA 1NH2D 2Q8VA 3JAWB 4ABMA 4GX2A 1NVPD 4JI7O 1B6QA 2YXLA 1GM9A 4XDJA 3K06A 3UQ8A 3NR7A 1SRYA 4ZIBA 4ASUG 2JGUA 2IH1C 2WAMA 3GWOA 2P5OA 1K8AW 3RYHB 2KB1A 3A0RA 3UM7A 1XUQA 4HAMA 4KXRA 2P4VA 3TXQA 5JJJB 4WF9V 1AROP 2BTQA 3CB2A 3ZHTA 2IJJA 4UCRA 4TSFG 3U10A 1VF6A 5JJNB 5KHKA 4CH4A 1V55C 1ORQC 5IJ0B 3HKEB 4XBFA 4DUZB 4UCVA 2DQ0A 1K33A 1NZ6A 3LDCA 3H1LH 3WFVA 1TVKA 2Q4PA 3ZHSA 4JI6O 4FIPC 1KP2A 1X4TA 4J42A 1BHAA 4DR2B 3B40A 1AILA 2JS5A 3JD2A 1YJ9V 1CPYA 4UUJC 3MHSC 3CC7V 1YJWV 1M93A 2A06H 4RO2A 1GTOA 4MVMA 2ZNJA 3BPZA 1VEWA 4O4IB 4R6ZA 1RSOB 4MW8A 1FAFA 4WBNB 4X62O 4JZ2A 4TV8B 4LFCO 4J7JA 1MMMA 1VIBA 3RYCB 2EILC 3DC6A 4DR5B 1K5SA 1KQSU 3K04A 5FNVB 3I56V 1Y67A 2LP7A 4DR4B 1R3LC 4WFGA 3I55V 1QR9A 1JFFA 4GUNA 1HNZB 2P6JA 5D5PA 3N2KB 5JVDA 2EZOA 3L9DA 4B3MB 3QO7A 4H37A 4GT1A 3X2QC 1Q86W 2A9HA 3SJCC 3N2GA 4GX0A 3T1HB 1PP9H 4GX5A 1SQFA 2JGDA 1IURA 4LF9O 1Y76B 4JTDB 3KZIZ 4I55B 1CP9A 4FPPA 5KHHA 3CRMA 4MVUA 1IVSA 4I4TA 4LF7O 3ZN1A 4W4LA 1SC5B 1K5QA 2QWNB 5C93A 1W0JG 3G6EV 4FM1A 1YXBA 3JARB 1K4CC 2Q67A 2EILB 4B3TO 4GLXA 4GKJB 1K9MW 1FJGO 4I0XA 2WLNA 1L8DA 4BIOA 4K0KB 1Y74B 1BGYH 1FD9A 4DW0A 2Q7EA 3AK2A 4JI3O 3A0HZ 3X2QB 1JVMA 3SPHA 3LSSA 4EFEA 3W7SA 5GTIZ 4I9QA 3BFRA 4RQFA 3S3WA 2JRIA 4PI0A 2Q7HA 1OCRB 1EFRG 2YEVA 1Z2GA 3CCRV 1K7DA 2ZE8A 3ZEDA 3K58A 4BW5A 4DV1O 2BOBC 5IWAO 3E8GA 1NR1A 2VWKA 1P84F 3CCEV 2Q6AA 4UCOA 2Q73A 2UXCB 4X1KA 4LFBO 1UFIA 4ICGA 1E79G 1HNWB 2QDOA 1SA0A 3OTOB 3P3NA 1IBMO 1EN6A 1OCZC 2HHHO 1RPRA 3AK3A 2L35A 1N0NA 1WA8A 1IX9A 3UO2A 2PGGA 3WG7B 2MW2B 3LDEA 5J2UA 2YICA 5B1NA 3EXAA 5ITZA 4OPAA 5LHIA 2E3CA 2ZR3A 2CH7A 2WLIA 3H1KH 4DR3O 4JASA 2F66C 4QNHB 5EBLC 3U11A 3OD4A 4X89A 5DECA 4KP4A 1BHBA 2UXDO 2K9PA 2Y48A 4LF6O 3G67A 1PPJH 3D36C 1LR1A 4NTYA 1BSMA 2VQEO 3CCMV 3WB2A 1AI7A 2BOCC 4GKKB 3N27A 2OTJV 3E8FA 2UUCB 3AEIA 3CS5A 3C3SA 3CRAA 2UXXA 3L75H 2IU3A 4X64B 1D2DA 3SYOA 1H2SB 4LF8B 5KHJA 2UU9B 2ZT9B 3L71H 4NKGB 5LP6C 3LNNA 3UT5A 1M4UA 3LNMB 4JI8O 3ZRSA 1RM1C 4PDLA 2KSDA 2M6YA 2HG5C 1N32B 5LL6Y 2VQFB 3SJAC 1GRJA 5JQGA 5KMGB 1H2GA 4O4LA 1G8MA 2Q5ZA 2YXYA 1R3KC 4X20B 2GSMB 1M56C 2R9AA 3ABKC 3K3WA 1RP3B 2Y4TA 2ZE7A 3HPLC 4MVOA 4DR1O 2YSUB 1B06A 1VMGA 4B3RB 3OGCC 2LGQA 1SZTA 3S3XA 2GHYA 4I5SA 3HKCA 4JYBA 2JVDA 3TXSA 5KAFZ 1OZ0A 5CA1A 1BE3H 5LP6B 1JA8A 2CTWA 2KG7B 2XHBA 1GM7A 5CBHA 3FYIB 2GTAA 1XEQA 1HR0O 2XUMA 3VQYA 4LFAB 3U0ZA 1Q8IA 1U96A 4N21A 4H44B 4J10A 2QGNA 4U3JA 5GONB 4MW3A 2B9ZA 4FLUA 3QTCA 4GZRB 1M56B 4X9QA 2DOSA 3ABKB 4TUYB 2F1MA 5HFLA 1H2LA 1GKFA 4DK1A 5LHHA 4DR6O 4EB6B 2BTQB 3QG5A 3JCUZ 1R6KA 2RDCA 2YC0A 1EZVH 1TAEA 1H2KA 1XNRB 1NBMG 5H9CA 5J2TB 3E86A 5KAIZ 4FFBB 1DK1A 4DV4O 2Q69A 3CMEV 5A9GA 4G28B 2CGOA 5IE9A 4P2ZA 5LMNB 2EZPA 4DRXA 4JF3A 1SS3A 1AJPA 3ZRWB 1S77D 1KKCA 1THZA 4UV8A 4BAYA 2PI4A 4NB5A 1RFYA 3CP1A 1VQNV 1SF9A 3B4SA 3JCZA 1BS3A 2XAHA 3J7AU 2CAZC 3VBBA 3QNEA 1SZXA 1B3QA 1KU9A 2ZDIA 3FB7C 3CRQA 1YITV 1PNMA 3GVMA 4O2AA 1QNMA 4JZGA 4LWSA 2JEUA 5DEDA 2RQ6A 2OIEA 2IJIA 2ZQMA 1TUBA 4AHCA 5B1OA 2DYSC 5KUMA 2HJFC 4PDRA 2LW7A 4NXNO 1TA8A 2GV9A 4ZHQB 3K9SA 3W7WA 1ZL8B 1Q5OA 4ZBMA 3AG2C 4IHJA 3STLC 4XDKA 4MTGA 1I08A 1P7GA 2EIMC 5LHGA 5LXTB 2Q0OC 1DTOA 3K03A 1IBKO 5FL7G 1NS1A 4DV7B 3F7YC 4LF4B 3EHBB 2RN9A 2Q9LA 1XREA 5EC1C 2RMKB 4NXMB 1XQ8A 4P30A 3MHHC 4B3SB 2BE3A 3N2GB 1AJQA 1VF7A 2QM8A 1XHZA 1Q3EA 4K8XA 3DXRB 1VQPV 2JGDB 1R1BA 4UCSA 4RQEA 2HR3A 1Q6UA 3WU2Z 2H94A 1M57B 2QR4A 1MG1A 2G38A 3TGUH 1Q90D 1WJZA 1AR5A 5CMUA 2DYSB 2X0LA 1COWG 2WLLA 1K3EA 3AG2B 3CHXA 3OEHG 1ZLZA 3LSQA 4DR7B 2ZNIA 2CTPA 1SERA 4YJ2B 2DW4A 2OWOA 1EZJA 1HNXB 4MSWC 4PA7A 4O2BA 1Q7YW 3K5MA 1SESA 2WA3A 4CS2A 4HYOA 4MT8A 3ABLC 2WA4A 2GUZA 4AQYO 3DSQA 3ZRVA 3L74H 3T1YO 1WAZA 2ZR2A 2ITDC 2Z5UA 4O4JB 1I94O 2F93B 4JI7B 4LR3A 2EIKB 3RN4A 3HB3B 5BR8O 4ZOLB 1YZBA 4X1YB 5HFMA 3FAVA 3OMAB 4BIUA 4DV6O 3ASNC 4DV5O 4Q6GA 1E1RG 1VQ7V 3ABMC 1MNGA 1PV0A 2QWQB 1NTKH 5LYJA 3C90A 1NKDA 1AI4A 3QO8A 1XHXA 2BSKA 3JALA 3H01A 3JATA 3OM3B 2EBOA 4X1KB 5LOVA 4F6RB 2JEXA
chains in the Genus database with same CATH topology
1Q6HA 1FD9A 1Q6IA 1Q6UA 3B09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  1FD9 A;  1Q6I A;  1Q6U A;  3B09 A; 
#chains in the Genus database with same CATH topology
 2P22 C;  4JTC B;  4P9O A;  1LUV A;  2JDI G;  1EBO A;  4YIO A;  4YY3 O;  4PI2 A;  2V1D A;  3ABL B;  4JV5 O;  4PDV A;  2OCH A;  4JI6 B;  1WA8 B;  2XAJ A;  5LGT A;  3SR2 C;  4GX1 A;  3HKD B;  1NTZ H;  1VF5 B;  4YJ3 B;  3JAM N;  5LA6 A;  4TV9 B;  5FPO A;  1I5Y A;  2ATK C;  4X66 O;  4LF5 O;  2ZM6 O;  5IYD O;  4YHH O;  3ASN B;  1Q81 W;  2CH7 B;  1TGO A;  4MTX A;  3ABM B;  1IZ3 A;  4QPJ A;  2CUG A;  4J7Z A;  4X62 B;  1WB7 A;  1XIL A;  4LFC B;  3ASO C;  3T2M A;  1BT8 A;  5E79 Z;  3RYF A;  2IBZ H;  2EJR A;  3HKB B;  2DJV A;  4C7U A;  3SPI A;  3K9A A;  3WB1 A;  4KHP O;  4KFM A;  3D3I A;  3Q4H B;  4I7Z B;  4J11 A;  2QE7 G;  1WN7 A;  4HNA A;  2PI5 A;  2PYL A;  5CA0 B;  4QPK A;  3CCJ V;  2WSS G;  1JQ0 A;  1R3I C;  3FB8 C;  3SPJ A;  2W6I G;  1YI2 V;  2VRZ A;  5KLV H;  4QE7 A;  2A7W A;  2PF4 E;  1S76 D;  5BMV A;  3UT5 B;  4FZ1 A;  4LF9 B;  3L73 H;  4Q20 A;  1J5E O;  1OJH A;  3ZMT A;  1N36 O;  1MSW D;  1PKX A;  2YIA A;  3H1H H;  4DV2 O;  1VQL V;  4LF7 B;  4D7S A;  1YSC A;  4IGG A;  3M8A A;  4DV3 O;  2EIN C;  3ASO B;  4JI4 O;  2VWJ A;  4UCU A;  3EVK A;  1OCR C;  4B3T B;  3FD9 A;  1FJG B;  1PM9 A;  3AG7 A;  5C8Y A;  2YIB D;  3SJB C;  2R9R B;  1FXV A;  1VQ6 V;  1XMQ O;  1WP7 A;  1N4C A;  2EIJ C;  4R7C A;  4I50 A;  3JSN A;  1QU7 A;  3BA9 A;  4JI3 B;  4ZI7 A;  3BRC A;  4MS2 A;  4TQD A;  4MVS A;  4PDM A;  4CH6 A;  4L8J A;  3K5N A;  3SPG A;  2F43 G;  3QO5 A;  3OT7 A;  5A2Q N;  3ZBH A;  4NR1 A;  1ZWI C;  2UXB O;  2LO1 A;  3A8T A;  1W59 A;  4FM0 A;  3B8N A;  2UUB B;  5IJ9 B;  3AG3 C;  4K3A A;  4X1I B;  3WG7 C;  1H38 A;  1M90 W;  4MVQ A;  4RUF A;  2EIN B;  4IL6 Z;  4H13 B;  4U3J B;  3RVZ A;  1F7Y A;  4DV1 B;  4CBC A;  2Y69 B;  3SDL A;  3APO A;  3AG1 C;  5IWA B;  4WFA V;  4NTW A;  5KX5 B;  3ZCC A;  1VQ4 V;  1EN4 A;  1FXK A;  4JYC A;  5JCO C;  1QR8 A;  4UXN A;  3A0B Z;  5H5N A;  1SKV A;  3TJT A;  4LNU A;  4JI2 O;  4LFB B;  1HDJ A;  3E8B A;  2EIJ B;  3QF7 A;  1NTM H;  2B1I A;  3ZN0 A;  1RPO A;  4TT3 G;  5H6Q A;  3STZ C;  4LBE C;  3ZX6 A;  5JH7 A;  1IBM B;  2HHH B;  4JAV A;  2Y0I A;  4HZ3 A;  2YI8 A;  4JI5 O;  1YCI A;  5EYP B;  4JI1 O;  2IM9 A;  3CXH F;  3P30 A;  2OIG A;  5EC2 C;  3AG3 B;  3RYH A;  1NT2 B;  3D3Q A;  3CRR A;  1VQ5 V;  4DR3 B;  3THO A;  1Y4M A;  4CC6 A;  3G4S V;  3RYI B;  1N34 O;  3AG1 B;  5KHG A;  2ZIM A;  4DUY O;  2WWW A;  4JAA A;  2OT5 A;  1LNQ A;  2UXD B;  4LWS B;  4LF6 B;  1HNW O;  5IJ0 A;  5IT9 N;  4CH5 A;  5LGU A;  3HKE A;  3JAS B;  1FS0 G;  1CEZ A;  1YJN V;  3SYC A;  2VQE B;  1TUB B;  3OW2 U;  1H8E G;  3OGI B;  3E22 B;  4DV0 O;  2IW5 A;  2QKC A;  3KKY A;  4JYA O;  2CTR A;  1GN6 A;  4MVZ A;  2IU0 A;  1UPG A;  1AR4 A;  3E2E A;  2LGW A;  2P7T C;  1PD3 A;  4HBN A;  4UVA A;  1N0J A;  4UCT A;  3ZMZ A;  1K34 A;  4JI8 B;  2V7Q G;  1RSO A;  2P4K A;  5B66 Z;  4OX9 O;  1MSD A;  2X6C A;  4TV8 A;  1KYO F;  3RYC A;  4F6E A;  4K8Z A;  3JSL A;  1ZAU A;  4X88 A;  1NQT A;  1K73 W;  5FNV A;  1WPX A;  1S5J A;  4PA9 A;  1DGS A;  1S5H C;  1PL0 A;  1BL8 A;  4UB8 Z;  1ZTE A;  1JPX A;  3N2K A;  2ZE5 A;  4DR1 B;  2WLH A;  3CRC A;  3AG4 C;  3W7X A;  4OGQ B;  4MVR A;  3CD6 V;  1Y76 A;  4WFE A;  2UUA O;  1MOF A;  3ZS8 C;  5GW7 A;  4I55 A;  3FB5 C;  5FLX N;  4O2B B;  5IYZ A;  3CJH B;  2A0L A;  4FLY A;  4X8A A;  2GUZ B;  1SET A;  1VF6 C;  4FLX A;  1HR0 B;  1QVF U;  3E35 A;  1N33 O;  5IY5 C;  3DGE A;  2E5L B;  1GH6 A;  1FYJ A;  5K1X A;  2QWO B;  1NR7 A;  4B7K A;  4UFZ A;  1M9N A;  3SYQ A;  1KB9 F;  1NJI W;  3BEH A;  3RGB A;  4OXS A;  2B1G A;  2CDY A;  1BCC H;  1KMI Z;  5L3C A;  1URF A;  1Y74 A;  3ETG A;  4UV9 A;  2HEP A;  1NI8 A;  2EUL A;  2MK3 A;  4E4E A;  4O4H A;  4G2K A;  5E1A C;  1VP7 A;  5LYJ B;  2BCC H;  3J80 N;  3LUT B;  3AG4 B;  1S0V A;  1PL4 A;  4DR6 B;  1R3J C;  3OR7 C;  1F4M A;  3JAL B;  2GDS A;  3JD3 A;  4WFH A;  1VQM V;  5CN0 A;  3BAB A;  2X6B A;  4DV4 B;  4FLT A;  5L3B A;  5CA3 A;  1HP8 A;  1XL4 A;  1SQB H;  2W6J G;  2QTO A;  2DQ3 A;  4UB6 Z;  3M7M X;  5IY5 B;  4YIP A;  1XOU A;  1AVM A;  4FK5 C;  2E74 B;  2R72 A;  4G27 B;  1TVK B;  4UVC A;  3VQV A;  1QLN A;  2LW1 A;  3AK1 A;  5CBG A;  3IC7 A;  1XMO O;  1FFX A;  4CS3 A;  2ODM A;  3ZRX A;  2E76 B;  3R65 A;  1YF2 A;  1K97 A;  1XNR O;  1XNQ O;  4DO2 A;  4NXN B;  1M57 C;  3K59 A;  3JD4 A;  1BMF G;  3W7U A;  3I5D A;  1W0K G;  3CCL V;  4FM2 A;  1IBK B;  1P4R A;  5CB4 A;  1GN2 A;  4J41 A;  1Y66 A;  4TWK A;  2QEX V;  1WNS A;  4IIJ A;  3MAQ A;  1AB3 A;  3ETE A;  1JX9 A;  4PA3 A;  1JFF B;  3TET A;  3IC9 A;  5JVD B;  3ZJZ A;  3WB0 A;  1QHT A;  1PNK A;  3CEI A;  2F95 B;  2ZE6 A;  5H6R A;  1G6U A;  2Q7G A;  2N05 A;  3ZHU A;  4H0L B;  2EIK C;  2F23 A;  5LMU B;  1IBL O;  1OV9 A;  4I4T B;  1JOY A;  2PZS A;  2Y4U A;  4JI0 O;  3CXC U;  4TQF A;  5C8Y B;  4LF4 O;  3SYP A;  3BAA A;  4AIL C;  1U97 A;  2DN9 A;  3OR6 C;  4A5U B;  4I0X B;  3CC4 V;  3OMI B;  3A2F A;  1JJO A;  4CC5 A;  5B1A B;  3CCQ V;  4AQY B;  1AP6 A;  3T1Y B;  1B04 A;  1YEW A;  5KMG A;  2F4V O;  3OFN G;  2XAS A;  1I94 B;  2AGA A;  2Q68 A;  1QBZ A;  3D36 A;  3TCU A;  3CSX A;  3IJ4 A;  4X20 A;  1FXH A;  3OE7 G;  5EIB C;  3O9O A;  2ETN A;  5BR8 B;  1D5N A;  2LFS A;  2M7W A;  3SYA A;  4WCE V;  4DV6 B;  4DV5 B;  1Q6H A;  1ZUQ A;  5IYC O;  1GM8 A;  2DYR C;  2YEV B;  3ZIA G;  4X65 O;  2ADP A;  2RNB A;  4NTX A;  3K5L A;  2YIB A;  3E89 A;  3OMN B;  3KG2 A;  4CH3 A;  2V4D A;  3SJQ C;  5LP6 A;  3ABU A;  1MZF A;  5L3F A;  3UCS C;  1HW7 A;  2DMX A;  1I7F A;  5JH7 B;  1AI5 A;  4YY3 B;  4JV5 B;  1F4N A;  1IXB A;  3ETD A;  3L70 H;  1SA0 B;  3TK1 A;  1L1F A;  1BZK A;  5GON A;  3K5O A;  1P49 A;  5EK0 A;  3K08 A;  4PA4 A;  1H2N A;  5FPR A;  4X66 B;  5JWP A;  4LF5 B;  2ZM6 B;  4YHH B;  4TUY A;  3IGA C;  1Q82 W;  2W0X A;  5J2U B;  3RT3 C;  1I0H A;  5ITZ B;  2Y0P A;  3OTF A;  1QLE C;  3BA8 A;  4EB6 A;  2DYR B;  1SQP H;  2RCV A;  1OHH G;  1Z5V A;  2HKO A;  4CS4 A;  1XBL A;  1K4D C;  1DF5 A;  4XDL A;  1L0N H;  2WLI B;  1TUE B;  3OUF A;  5J2T A;  2XND G;  2JS3 A;  4FFB A;  1H2M A;  1DF4 A;  4KHP B;  1YHQ V;  1GN4 A;  3F7V C;  2HVJ C;  3ZRW A;  1CXZ B;  4DW1 A;  1LUW A;  2ZKO A;  4DUZ O;  3T1C A;  1OCC C;  1R73 A;  4LP8 A;  2K1E A;  2CK3 G;  3JAK A;  1SQV H;  5D5Q A;  3NXS A;  4DR2 O;  2AW9 A;  1OCO C;  4PV1 B;  2HVK C;  1J5E B;  1N36 B;  1KC8 W;  1VQ9 V;  5L3D A;  4DV2 B;  2O57 A;  1QLE B;  2PY5 A;  1Q43 A;  3CX5 F;  1V9P A;  4ZHQ A;  3CC2 V;  4DV3 B;  1ZL8 A;  4JI4 B;  1V55 B;  2DE0 X;  5LXT A;  3H1J H;  4DR5 O;  5JQG B;  3BY6 A;  4O4L B;  1WLE A;  4BWA A;  1XMQ B;  2X6A A;  2Y69 C;  2AZ2 A;  4DR4 O;  2ITC C;  1YTF B;  5EZY A;  3PN1 A;  1OCC B;  4N23 A;  4FFK A;  5AG2 A;  4D7T A;  3RWR D;  2XAF A;  2PYJ A;  2DWD C;  3DXR A;  1HNZ O;  4Z1V A;  4DXW A;  4ZKI A;  5LBQ A;  4B3M O;  2WLJ A;  3OEE G;  1BQ0 A;  3MDS A;  4JTA B;  1GK9 A;  3CCU V;  5IYZ B;  1OCO B;  2IJH A;  1IDS A;  3T1H O;  4FJC C;  4EEQ A;  1JR9 A;  3HKC B;  2QM4 A;  3ZMS A;  2FTK A;  2UXB B;  3EFF K;  2A3Q A;  2EX3 A;  2AHY A;  5CA1 B;  2CTQ A;  4EKW A;  2FB5 A;  2LJ2 A;  5KUK A;  2AZ0 A;  4MTF A;  4U7O A;  1SQG A;  1VQO V;  3IAY A;  4MTO A;  1KD1 W;  5EBW C;  3H9V A;  2ARH A;  2JK5 C;  2XAQ A;  3RFR A;  2JIZ G;  3E83 A;  4JGS A;  3M99 B;  4FLZ A;  4GKJ O;  4YJ2 A;  1W2B U;  4O4H B;  4R50 A;  1NU1 H;  4K0K O;  4JI2 B;  1Y6X A;  2ZDI C;  1FFT B;  1AR1 B;  2HLD G;  2PUS A;  2FKX A;  5EBM C;  5CBF A;  5H2F Z;  1O9G A;  4RAI A;  1AP5 A;  1GO3 F;  4O4J A;  4JI5 B;  1GMG A;  1P7B A;  4IYH A;  4PJ0 Z;  2QSA A;  4JI1 B;  1XI1 A;  4PEL A;  4QIW F;  3B77 A;  2UUB O;  2ZIN A;  4ZOL A;  4X1Y A;  4PHZ A;  3JAW A;  1M5I A;  3ZHQ A;  5KA5 A;  1S72 V;  2W0F C;  4IT5 A;  4QGP A;  2HFE C;  1SQX H;  2NLJ C;  5KHI A;  4DRX B;  4Z1M G;  4GCZ A;  4CZZ A;  3BCC H;  3JD0 A;  2N04 A;  3F5T A;  3CMA V;  2ZD9 A;  5IDJ A;  1NH2 B;  2FML A;  1N34 B;  4DUY B;  1I5X A;  1FFX B;  1WPB A;  3B8M A;  1NVP B;  3FB6 C;  4F6R A;  4I9W A;  2OTL V;  1S5L Z;  1F23 A;  4K35 A;  2UXC O;  3R66 A;  1US6 A;  4O2A B;  3DTU B;  3FYE B;  5LGN A;  3UKM A;  2L6L A;  2D3O W;  2C2A A;  4DV0 B;  1KEC A;  1H8H G;  1KKD A;  4J7K A;  4JYA B;  3HKD A;  3OTO O;  4YJ3 A;  3ML0 A;  4TV9 A;  3K57 A;  4UVB A;  2R9I A;  2ADQ B;  3K0D A;  2GTS A;  3LSU A;  5CB4 B;  4IHJ B;  1N8R W;  3RVY A;  3O65 A;  1UJW B;  1JCH A;  2RJZ A;  3T4Z A;  4IIJ B;  4LCU C;  4OX9 B;  2UXN A;  1MZE A;  3C3T A;  3SPC A;  2WLM A;  4FLW A;  4O4I A;  3OUS A;  3HKB A;  4TOI A;  4IYI A;  4FVM A;  4WBN A;  4U7N A;  3G71 V;  4P9P A;  2LFR A;  2HP8 A;  3Q4H A;  4U3F H;  3B2E E;  3CPW U;  1OCZ B;  4QE9 A;  5CA0 A;  3BVO A;  4JPR A;  3CE2 A;  2YDE A;  5F2V O;  1Q6I A;  1XL6 A;  1GAX A;  4JYY A;  4GKK O;  1IXM A;  2UUC O;  4AI8 A;  2WLL B;  3CCV V;  1GN3 A;  2UUA B;  4X64 O;  3H1I H;  5B3S C;  3JYC A;  3MD0 A;  2XOK G;  4LF8 O;  2UU9 O;  3LDD A;  1FPO A;  4WFF A;  1AJN A;  3UO3 A;  1X59 A;  1J95 A;  1M1K W;  1N33 B;  2WPD G;  3L72 H;  1ROP A;  1N32 O;  2VQF O;  3ZHV A;  2CGN A;  3JAR A;  2VS0 A;  3BHP A;  4W4K A;  5KA6 A;  4BR6 A;  1WB8 A;  4R8C A;  1O9H A;  4BIZ A;  4BW9 A;  3FAV B;  3APQ A;  1E1Q G;  2ZCE A;  4F4L A;  3FX7 A;  3RBZ A;  4J9Y B;  4Z2W A;  4B3R O;  2QA4 V;  1ZSP A;  2QJ1 A;  1RM1 B;  5B3S B;  4KUM A;  3RW0 A;  2BSK B;  2FL4 A;  5EIB D;  3JAT B;  1MAB G;  3JD1 A;  1A32 A;  2E5L O;  5IJ9 A;  2NR5 A;  5LOV B;  4X1I A;  5BXZ A;  1YIJ V;  2XAG A;  4L87 A;  4J9Z B;  1KUQ A;  2YI9 A;  3PJS K;  3T4D A;  4LFA O;  4JAU A;  2R70 A;  5KX5 A;  1T5E A;  2YUA A;  4KL1 A;  4GYC B;  2QWP B;  1FKA O;  1EM1 A;  2H3O A;  2ILM A;  4DYL A;  1HWY A;  1XMO B;  1MA1 A;  2H8P C;  4QJF B;  5LA6 B;  3KCX A;  4H33 A;  3VOU A;  2NNU A;  3FFQ A;  4FMT A;  2QKA A;  5B1B C;  1JJ2 U;  4LC1 A;  2OYQ A;  2N74 A;  3P32 A;  2OCC C;  1XNQ B;  2ZXW C;  4OPH A;  3VQW A;  2QKS A;  3ZMU A;  5EYP A;  3K79 A;  5GTH Z;  4J80 A;  1L0L H;  1V54 C;  3RYF B;  2B5U A;  2BTO A;  2KQX A;  1F51 A;  2NN4 A;  3VQX A;  3W7T A;  4B7E A;  3G6B A;  5LMN O;  2AXT Z;  2KKW A;  1G1X B;  3JAK B;  3RYI A;  4HNA B;  2PTM A;  3OAA G;  5L3E A;  4FLV A;  4LH6 A;  1XDC A;  3P3P A;  3G80 A;  5JCO A;  3ETQ A;  4PA6 A;  5JJE B;  2XT9 A;  3GB7 C;  2P90 A;  2YID A;  5TIS Z;  1R6N A;  3JAS A;  5B1A C;  2EJ7 A;  2IJK A;  2QM7 A;  3B09 A;  1R6T A;  5BMV B;  3J81 N;  5L3G A;  3FKS G;  3IFX A;  3K0G A;  3E22 A;  4NYK A;  5K1P A;  5B1B B;  1VAR A;  2OCC B;  3SGI A;  2ZXW B;  4LH7 A;  1IBL B;  2JJ2 G;  1YTF D;  1VQK V;  3CCS V;  1JMK C;  2Z3Y A;  4FZ0 A;  4JI0 B;  1AI6 A;  1QQC A;  1Z5W A;  5B5E Z;  2E75 B;  2AHZ A;  1YVW A;  1V54 B;  2Z0A A;  2GBO A;  2A79 B;  5DN6 G;  4RWU A;  2Q0A A;  5EZY B;  2JJ1 G;  2CE4 A;  1FXK C;  2XTA A;  4DV7 O;  1WP8 A;  3F5W C;  2FYU H;  5IYB O;  3GWK C;  1ENV A;  3ZHR A;  1KBH A;  2HJD A;  4NXM O;  1QVG U;  4I50 B;  4B3S O;  1DLB A;  3QVN A;  4EFB A;  2F4V B;  4ZI7 B;  3CYO A;  2DWE C;  2P67 A;  4WFB V;  3CWB H;  2WLK A;  2IH3 C;  3E8H A;  3KCY A;  5LMU O;  2X7R B;  4DK0 A;  1EN5 A;  1BQZ A;  1SQQ H;  1QCE A;  2QWR B;  1KP3 A;  2EIM B;  4X65 B;  2YXH A;  2P06 A;  5BY1 A;  3D8C A;  1ZX3 A;  4D6T H;  3ZMV A;  3CJH A;  1D5A A;  3ICX A;  4DR7 O;  5J9P C;  1FXK B;  4NVP A;  1G4Y B;  3DC5 A;  1VQ8 V;  2ZIO A;  2QTS A;  1HNX O;  1K92 A;  2YS8 A;  4PD4 F;  2D2C B;  3HR0 A;  4LNU B;  1S3J A;  2KG7 A;  4E2L A;  1YDX A;  1PNL A;  4YXW G;  2LQT A;  4B08 A;  5DM6 V;  3ABT A;  4RUE A;  5BZB A;  1NH2 D;  2Q8V A;  3JAW B;  4ABM A;  4GX2 A;  1NVP D;  4JI7 O;  1B6Q A;  2YXL A;  1GM9 A;  4XDJ A;  3K06 A;  3UQ8 A;  3NR7 A;  1SRY A;  4ZIB A;  4ASU G;  2JGU A;  2IH1 C;  2WAM A;  3GWO A;  2P5O A;  1K8A W;  3RYH B;  2KB1 A;  3A0R A;  3UM7 A;  1XUQ A;  4HAM A;  4KXR A;  2P4V A;  3TXQ A;  5JJJ B;  4WF9 V;  1ARO P;  2BTQ A;  3CB2 A;  3ZHT A;  2IJJ A;  4UCR A;  4TSF G;  3U10 A;  1VF6 A;  5JJN B;  5KHK A;  4CH4 A;  1V55 C;  1ORQ C;  5IJ0 B;  3HKE B;  4XBF A;  4DUZ B;  4UCV A;  2DQ0 A;  1K33 A;  1NZ6 A;  3LDC A;  3H1L H;  3WFV A;  1TVK A;  2Q4P A;  3ZHS A;  4JI6 O;  4FIP C;  1KP2 A;  1X4T A;  4J42 A;  1BHA A;  4DR2 B;  3B40 A;  1AIL A;  2JS5 A;  3JD2 A;  1YJ9 V;  1CPY A;  4UUJ C;  3MHS C;  3CC7 V;  1YJW V;  1M93 A;  2A06 H;  4RO2 A;  1GTO A;  4MVM A;  2ZNJ A;  3BPZ A;  1VEW A;  4O4I B;  4R6Z A;  1RSO B;  4MW8 A;  1FAF A;  4WBN B;  4X62 O;  4JZ2 A;  4TV8 B;  4LFC O;  4J7J A;  1MMM A;  1VIB A;  3RYC B;  2EIL C;  3DC6 A;  4DR5 B;  1K5S A;  1KQS U;  3K04 A;  5FNV B;  3I56 V;  1Y67 A;  2LP7 A;  4DR4 B;  1R3L C;  4WFG A;  3I55 V;  1QR9 A;  1JFF A;  4GUN A;  1HNZ B;  2P6J A;  5D5P A;  3N2K B;  5JVD A;  2EZO A;  3L9D A;  4B3M B;  3QO7 A;  4H37 A;  4GT1 A;  3X2Q C;  1Q86 W;  2A9H A;  3SJC C;  3N2G A;  4GX0 A;  3T1H B;  1PP9 H;  4GX5 A;  1SQF A;  2JGD A;  1IUR A;  4LF9 O;  1Y76 B;  4JTD B;  3KZI Z;  4I55 B;  1CP9 A;  4FPP A;  5KHH A;  3CRM A;  4MVU A;  1IVS A;  4I4T A;  4LF7 O;  3ZN1 A;  4W4L A;  1SC5 B;  1K5Q A;  2QWN B;  5C93 A;  1W0J G;  3G6E V;  4FM1 A;  1YXB A;  3JAR B;  1K4C C;  2Q67 A;  2EIL B;  4B3T O;  4GLX A;  4GKJ B;  1K9M W;  1FJG O;  4I0X A;  2WLN A;  1L8D A;  4BIO A;  4K0K B;  1Y74 B;  1BGY H;  1FD9 A;  4DW0 A;  2Q7E A;  3AK2 A;  4JI3 O;  3A0H Z;  3X2Q B;  1JVM A;  3SPH A;  3LSS A;  4EFE A;  3W7S A;  5GTI Z;  4I9Q A;  3BFR A;  4RQF A;  3S3W A;  2JRI A;  4PI0 A;  2Q7H A;  1OCR B;  1EFR G;  2YEV A;  1Z2G A;  3CCR V;  1K7D A;  2ZE8 A;  3ZED A;  3K58 A;  4BW5 A;  4DV1 O;  2BOB C;  5IWA O;  3E8G A;  1NR1 A;  2VWK A;  1P84 F;  3CCE V;  2Q6A A;  4UCO A;  2Q73 A;  2UXC B;  4X1K A;  4LFB O;  1UFI A;  4ICG A;  1E79 G;  1HNW B;  2QDO A;  1SA0 A;  3OTO B;  3P3N A;  1IBM O;  1EN6 A;  1OCZ C;  2HHH O;  1RPR A;  3AK3 A;  2L35 A;  1N0N A;  1WA8 A;  1IX9 A;  3UO2 A;  2PGG A;  3WG7 B;  2MW2 B;  3LDE A;  5J2U A;  2YIC A;  5B1N A;  3EXA A;  5ITZ A;  4OPA A;  5LHI A;  2E3C A;  2ZR3 A;  2CH7 A;  2WLI A;  3H1K H;  4DR3 O;  4JAS A;  2F66 C;  4QNH B;  5EBL C;  3U11 A;  3OD4 A;  4X89 A;  5DEC A;  4KP4 A;  1BHB A;  2UXD O;  2K9P A;  2Y48 A;  4LF6 O;  3G67 A;  1PPJ H;  3D36 C;  1LR1 A;  4NTY A;  1BSM A;  2VQE O;  3CCM V;  3WB2 A;  1AI7 A;  2BOC C;  4GKK B;  3N27 A;  2OTJ V;  3E8F A;  2UUC B;  3AEI A;  3CS5 A;  3C3S A;  3CRA A;  2UXX A;  3L75 H;  2IU3 A;  4X64 B;  1D2D A;  3SYO A;  1H2S B;  4LF8 B;  5KHJ A;  2UU9 B;  2ZT9 B;  3L71 H;  4NKG B;  5LP6 C;  3LNN A;  3UT5 A;  1M4U A;  3LNM B;  4JI8 O;  3ZRS A;  1RM1 C;  4PDL A;  2KSD A;  2M6Y A;  2HG5 C;  1N32 B;  5LL6 Y;  2VQF B;  3SJA C;  1GRJ A;  5JQG A;  5KMG B;  1H2G A;  4O4L A;  1G8M A;  2Q5Z A;  2YXY A;  1R3K C;  4X20 B;  2GSM B;  1M56 C;  2R9A A;  3ABK C;  3K3W A;  1RP3 B;  2Y4T A;  2ZE7 A;  3HPL C;  4MVO A;  4DR1 O;  2YSU B;  1B06 A;  1VMG A;  4B3R B;  3OGC C;  2LGQ A;  1SZT A;  3S3X A;  2GHY A;  4I5S A;  3HKC A;  4JYB A;  2JVD A;  3TXS A;  5KAF Z;  1OZ0 A;  5CA1 A;  1BE3 H;  5LP6 B;  1JA8 A;  2CTW A;  2KG7 B;  2XHB A;  1GM7 A;  5CBH A;  3FYI B;  2GTA A;  1XEQ A;  1HR0 O;  2XUM A;  3VQY A;  4LFA B;  3U0Z A;  1Q8I A;  1U96 A;  4N21 A;  4H44 B;  4J10 A;  2QGN A;  4U3J A;  5GON B;  4MW3 A;  2B9Z A;  4FLU A;  3QTC A;  4GZR B;  1M56 B;  4X9Q A;  2DOS A;  3ABK B;  4TUY B;  2F1M A;  5HFL A;  1H2L A;  1GKF A;  4DK1 A;  5LHH A;  4DR6 O;  4EB6 B;  2BTQ B;  3QG5 A;  3JCU Z;  1R6K A;  2RDC A;  2YC0 A;  1EZV H;  1TAE A;  1H2K A;  1XNR B;  1NBM G;  5H9C A;  5J2T B;  3E86 A;  5KAI Z;  4FFB B;  1DK1 A;  4DV4 O;  2Q69 A;  3CME V;  5A9G A;  4G28 B;  2CGO A;  5IE9 A;  4P2Z A;  5LMN B;  2EZP A;  4DRX A;  4JF3 A;  1SS3 A;  1AJP A;  3ZRW B;  1S77 D;  1KKC A;  1THZ A;  4UV8 A;  4BAY A;  2PI4 A;  4NB5 A;  1RFY A;  3CP1 A;  1VQN V;  1SF9 A;  3B4S A;  3JCZ A;  1BS3 A;  2XAH A;  3J7A U;  2CAZ C;  3VBB A;  3QNE A;  1SZX A;  1B3Q A;  1KU9 A;  2ZDI A;  3FB7 C;  3CRQ A;  1YIT V;  1PNM A;  3GVM A;  4O2A A;  1QNM A;  4JZG A;  4LWS A;  2JEU A;  5DED A;  2RQ6 A;  2OIE A;  2IJI A;  2ZQM A;  1TUB A;  4AHC A;  5B1O A;  2DYS C;  5KUM A;  2HJF C;  4PDR A;  2LW7 A;  4NXN O;  1TA8 A;  2GV9 A;  4ZHQ B;  3K9S A;  3W7W A;  1ZL8 B;  1Q5O A;  4ZBM A;  3AG2 C;  4IHJ A;  3STL C;  4XDK A;  4MTG A;  1I08 A;  1P7G A;  2EIM C;  5LHG A;  5LXT B;  2Q0O C;  1DTO A;  3K03 A;  1IBK O;  5FL7 G;  1NS1 A;  4DV7 B;  3F7Y C;  4LF4 B;  3EHB B;  2RN9 A;  2Q9L A;  1XRE A;  5EC1 C;  2RMK B;  4NXM B;  1XQ8 A;  4P30 A;  3MHH C;  4B3S B;  2BE3 A;  3N2G B;  1AJQ A;  1VF7 A;  2QM8 A;  1XHZ A;  1Q3E A;  4K8X A;  3DXR B;  1VQP V;  2JGD B;  1R1B A;  4UCS A;  4RQE A;  2HR3 A;  1Q6U A;  3WU2 Z;  2H94 A;  1M57 B;  2QR4 A;  1MG1 A;  2G38 A;  3TGU H;  1Q90 D;  1WJZ A;  1AR5 A;  5CMU A;  2DYS B;  2X0L A;  1COW G;  2WLL A;  1K3E A;  3AG2 B;  3CHX A;  3OEH G;  1ZLZ A;  3LSQ A;  4DR7 B;  2ZNI A;  2CTP A;  1SER A;  4YJ2 B;  2DW4 A;  2OWO A;  1EZJ A;  1HNX B;  4MSW C;  4PA7 A;  4O2B A;  1Q7Y W;  3K5M A;  1SES A;  2WA3 A;  4CS2 A;  4HYO A;  4MT8 A;  3ABL C;  2WA4 A;  2GUZ A;  4AQY O;  3DSQ A;  3ZRV A;  3L74 H;  3T1Y O;  1WAZ A;  2ZR2 A;  2ITD C;  2Z5U A;  4O4J B;  1I94 O;  2F93 B;  4JI7 B;  4LR3 A;  2EIK B;  3RN4 A;  3HB3 B;  5BR8 O;  4ZOL B;  1YZB A;  4X1Y B;  5HFM A;  3FAV A;  3OMA B;  4BIU A;  4DV6 O;  3ASN C;  4DV5 O;  4Q6G A;  1E1R G;  1VQ7 V;  3ABM C;  1MNG A;  1PV0 A;  2QWQ B;  1NTK H;  5LYJ A;  3C90 A;  1NKD A;  1AI4 A;  3QO8 A;  1XHX A;  2BSK A;  3JAL A;  3H01 A;  3JAT A;  3OM3 B;  2EBO A;  4X1K B;  5LOV A;  4F6R B;  2JEX A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  1FD9 A;  1Q6I A;  1Q6U A;  3B09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...