3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
molecule tags Chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
1FD9A 1Q6UA 1Q6HA 1Q6IA 3B09A
chains in the Genus database with same CATH superfamily
2A79B 5FL7G 3G6EV 2ZE5A 3K3WA 4JZGA 2XT9A 2A7WA 5B1BC 3OMIB 4DV6B 1O9GA 3OD4A 1COWG 2DYSC 2F23A 3HPLC 3SJQC 2YUAA 2M6YA 5LBQA 3EXAA 4JTAB 1G6UA 1U97A 1ZAUA 1YIJV 2DQ3A 1XDCA 4MVSA 1IDSA 1OJHA 4J80A 5LXTA 4CBCA 4IIJB 2F4VB 2IJIA 2Y0IA 1OV9A 5IJ9B 4O4IB 5LP6B 1M4UA 3H1JH 1FYJA 1R1BA 1Q90D 4DR5B 4LF8B 1PL4A 3AK1A 1IURA 3DSQA 3C3SA 5J2TA 4RAIA 2ZQMA 1SKVA 3LSQA 1M1KW 3L74H 1IVSA 1FXKB 1RSOB 2AXTZ 4X89A 4J11A 5LMNO 1SERA 4JAVA 2DE0X 3EHBB 4J9ZB 4PDVA 4O4IA 1EN4A 4RUFA 1KB9F 4MVZA 3SPJA 2MW2B 4X1IB 4DR1O 4EB6B 1N4CA 3H1LH 4DV6O 2PYLA 4AILC 3ASOC 4IHJB 1FXKA 1RSOA 2E75B 3N2GB 2Q9LA 2DQ0A 1AP5A 2X6CA 4JF3A 2OTJV 1VQ9V 2RN9A 3JCUZ 5LA6B 3WFVA 2CE4A 4G27B 1XL4A 4YHHB 5KAIZ 4P30A 1N33B 3SYCA 4UV9A 2LP7A 3APQA 3TETA 1W59A 1ZTEA 4GX1A 1THZA 5FPRA 5LP6A 2LFRA 4TWKA 4BR6A 4ZOLB 1YXBA 3TXSA 4JI5B 5ITZB 2EIKC 5LHIA 2HHHO 4X1YA 2OIGA 1EZVH 4OPHA 1JFFB 1A32A 2PY5A 3SJBC 4DR1B 1Q43A 2IM9A 4WF9V 4NTYA 4NTXA 1SA0A 1WAZA 2CGNA 2VQFO 4H0LB 1WPXA 1W0KG 3L73H 2V4DA 3JAWB 1MZEA 2LGWA 1NTZH 1DGSA 1B06A 4ZIBA 4UFZA 1SQVH 4DW0A 4JI4B 2UUBB 3SJCC 5KLVH 5IYCO 1Q81W 1YJ9V 3K08A 1R3IC 4JYBA 2UXCB 1WB7A 2CTQA 1M56B 3OTOB 3OEHG 5B1NA 3HKCA 2RQ6A 1HNXB 3G4SV 2L6LA 3K0GA 1D5AA 1TAEA 2UXNA 2LGQA 2E74B 2EIJB 3RFRA 4YHHO 4UCVA 4WFEA 4LF9B 2R9IA 3AG7A 4H44B 1BHBA 4UCTA 3CCUV 4JYAB 1XHZA 2P7TC 5GW7A 2RJZA 3JSLA 4JASA 4F4LA 1MZFA 4LF6B 1ORQC 1OCZB 2VQFB 3AG2C 3I55V 4R6ZA 1KP3A 1IBMO 4LFBO 4TUYA 1Y76B 1EM1A 1VEWA 3ZRXA 3OMAB 4A5UB 4DV2O 2QEXV 1V54B 1B3QA 5CA0B 3BCCH 2EILB 1JPXA 3BVOA 3T4ZA 3OEEG 4I50A 5LGTA 2XAHA 2XUMA 1JCHA 4U7OA 1Q6IA 1Z2GA 4PHZA 2F93B 1KP2A 3E89A 4JGSA 5CBHA 1R3KC 4KHPO 2O57A 1K92A 3H1KH 2QKCA 3K03A 4I0XA 1H8EG 1SZXA 2W0XA 3IC9A 1S72V 1FFXA 2ZDIA 3IFXA 4MT8A 2WPDG 1K34A 1O9HA 3F5TA 4DV5O 3OMNB 2Z3YA 3ETQA 1TA8A 1L0LH 4TQFA 3RYHB 4PA6A 1VQNV 2ZM6B 1M9NA 2PI5A 2E5LB 2PZSA 3AG3C 4LF9O 2OCHA 3CCRV 4LFBB 4JTDB 1NVPD 4YY3B 1AJNA 2HR3A 5IE9A 1N33O 4B7KA 5JQGA 4NXNO 5JCOC 2UXDB 5LYJA 3Q4HB 2EBOA 4FFBA 1IBLB 1GK9A 1URFA 1SF9A 1GKFA 2ZR2A 3W7TA 3ZCCA 3LDEA 5JWPA 2JS5A 1BZKA 2Y0PA 3CWBH 3FD9A 1P49A 3P3PA 5LP6C 2HVKC 3ZRWB 1V55C 2BOBC 4ZI7B 2WLNA 1I7FA 2Y69C 4DV0O 4K8ZA 2GSMB 3TJTA 4NYKA 5GONB 1JJOA 4FLYA 3A0BZ 1VF6C 5DN6G 3OTFA 3K9AA 1H2MA 3ZJZA 1I08A 4JYCA 4MTFA 2A3QA 5LL6Y 5IJ0A 2OWOA 5AG2A 1BHAA 4FM2A 4NXMO 3HKEB 4UCUA 4DRXB 1NH2B 4X8AA 3RYCB 3JD4A 3B4SA 2K9PA 3VQVA 1K8AW 2LJ2A 2M7WA 1L0NH 4R7CA 2Y4TA 3QNEA 2IBZH 4FLTA 3H1HH 4H33A 3RYFA 2ZE7A 1IBLO 4NXMB 1FFTB 3ABKC 2PF4E 4LFAB 3HKEA 4CS2A 1HNZO 1JR9A 1ENVA 1I5YA 3NR7A 2NNUA 3DXRB 1NS1A 2V7QG 3O65A 5FNVB 1PKXA 3SYPA 1YTFB 3CCEV 1MSDA 2Y4UA 4CH5A 3CJHA 1L1FA 1VP7A 5EYPA 5BY1A 4LP8A 4JI3B 1AR4A 4DR4O 5LGNA 2B1GA 4U7NA 4DR7O 4B3TB 1Y76A 1YTFD 5B1AB 4X64B 1SS3A 4FLXA 1PNLA 3S3XA 2ZIOA 1B6QA 3ETGA 3G6BA 2Y48A 4PELA 1OCOB 1OCCC 1XI1A 3K06A 3CCJV 4FMTA 2JDIG 4JI7O 2LO1A 4WFBV 4O4HB 1VQMV 1M90W 5H9CA 3B40A 1NTMH 3F5WC 1AI7A 2CAZC 4PA7A 4NVPA 1H2NA 4L8JA 4UVAA 3ZMUA 3JATB 1BQZA 2X0LA 1LNQA 1VQ8V 2ZIMA 1YJNV 4B3SB 1XILA 1HNZB 4Z1MG 5D5QA 5BXZA 5IDJA 1AP6A 2DOSA 1LUWA 1OCOC 2KSDA 3AG3B 4IHJA 3BY6A 3N2KA 5F2VO 1EZJA 4ZOLA 5FLXN 2QWRB 3ASNB 3K57A 2ADQB 4ZBMA 1F4NA 1BMFG 1EN6A 2UUCO 1X59A 4LH6A 4PJ0Z 3CRAA 1XNQO 1YITV 4X64O 3N27A 4YXWG 1Q86W 4TV8A 3K59A 2OCCB 1PV0A 2EIJC 4ASUG 1SQPH 1NBMG 5LYJB 3E86A 3RYCA 3N2KB 4DV4O 3UT5B 1OZ0A 2NN4A 4DV3O 3JARB 2QTOA 4DUZO 5KX5A 4QPKA 2UUAO 3ZMSA 1AVMA 2IH1C 1YEWA 3L70H 2UXBB 1FKAO 1WNSA 1RPRA 4B3TO 2CH7B 4TSFG 1EBOA 1SRYA 3O9OA 4DR3O 4J10A 1BQ0A 2BCCH 4Q6GA 2PI4A 2YXYA 3RYIB 3VQWA 5EC1C 5K1PA 3IJ4A 4JI7B 5GONA 3ZRSA 2QWOB 2HG5C 1KKDA 4TV9A 1YF2A 3B2EE 4DXWA 2LQTA 2AZ0A 1SQGA 3AG4C 4X20A 2UUAB 1XL6A 1Q7YW 1DK1A 4PDRA 3KG2A 2KG7A 1PNMA 3FB7C 4O2AB 4JAUA 2YSUB 3UKMA 3U0ZA 1SQXH 3FX7A 3M8AA 4F6RB 2ZD9A 2RDCA 1NZ6A 3K5LA 3OFNG 2R9AA 2R70A 2UUCB 5E79Z 5KHJA 3JD3A 4OXSA 4UV8A 3FB6C 2YEVB 5KA6A 3M7MX 4CH4A 5A2QN 4JYAO 5HFMA 3JD2A 2HJFC 2FMLA 5KA5A 4YJ3A 2IW5A 3CPWU 1QHTA 4IYHA 4I55B 1IX9A 3JATA 1IBKO 1D2DA 4DR3B 1FD9A 4WFHA 1PM9A 2AW9A 1DF4A 1OHHG 4ABMA 3WG7C 4J7JA 1WP8A 4XBFA 1K7DA 3BA8A 4LH7A 4UVBA 5K1XA 1QVFU 2YIAA 3CSXA 1QCEA 5CB4A 3PN1A 1Y4MA 4KUMA 4CC6A 4HBNA 4K0KB 4NTWA 1H38A 3B09A 1MA1A 3CP1A 4PI2A 3BA9A 4L87A 4F6EA 4HAMA 1KKCA 4IIJA 4KP4A 2EIKB 4GKKO 4FM1A 3BAAA 4HYOA 1P84F 1OCRB 1N0NA 4BIZA 4RQFA 3SR2C 5L3CA 1QLEC 2RMKB 3PJSK 1KBHA 5B5EZ 3CCMV 4B3RO 5HFLA 2JJ1G 4W4LA 3JALA 3K5OA 1FFXB 4RWUA 2QR4A 1NT2B 4OX9B 4GKJO 2BTOA 3X2QB 1S0VA 3L9DA 4TUYB 1PPJH 4GYCB 1JMKC 1VQLV 1ZX3A 2G38A 3M99B 2P06A 5IYBO 2P4KA 3LSUA 4FLWA 1X4TA 4JI0B 2C2AA 4OPAA 2GTAA 3CB2A 3R65A 1IBMB 3OTOO 3CD6V 2P5OA 1SESA 2FKXA 1GN3A 1I0HA 4WFGA 1VARA 2QM8A 3RGBA 1GN6A 4DV4B 1VQ5V 4DV7O 3FB5C 3ABKB 3TXQA 2H8PC 1AILA 4JI8O 4UXNA 2YIDA 3ZRVA 1SQFA 4FLUA 4JI0O 3SDLA 3JAKA 3T1YO 5D5PA 3E35A 2XAQA 2F1MA 4LFCO 4B7EA 4FFBB 1VF5B 1RP3B 3APOA 5GTHZ 4B3RB 2IJJA 4LC1A 5IWAB 2KQXA 2DN9A 1FJGB 1HNWO 3SYQA 3L71H 3ZMVA 2P90A 1YHQV 3ZEDA 2Q6AA 2AHZA 3D36A 4PI0A 3WU2Z 4PV1B 1JA8A 4FK5C 4KL1A 5A9GA 4ZHQB 4JZ2A 3RW0A 2Z5UA 2YI8A 1YJWV 3CC7V 4CZZA 3KKYA 1KQSU 4B3MB 3I5DA 3MDSA 5IJ0B 2ZM6O 3E8FA 3CE2A 4LNUB 4U3JA 2HVJC 3SYAA 1P7GA 2Q4PA 3HB3B 1AI4A 1UPGA 4LBEC 2WLKA 3C3TA 3MD0A 1ZSPA 3OW2U 4KHPB 4MVRA 4FZ0A 4AHCA 4DYLA 3JSNA 1M56C 4YJ2B 1QVGU 1I94B 5DM6V 5H5NA 3EFFK 4TV9B 4O2BB 2YI9A 4I4TB 2H94A 1QBZA 3HKBB 5JCOA 2EJ7A 3LNNA 3ZIAG 2CTPA 1HDJA 3T1YB 2W0FC 5LGUA 4X1KA 2DYRC 3RYFB 5LXTB 1XNQB 2LW7A 5LMNB 3IGAC 3CCLV 2E3CA 1N32B 1KC8W 1WN7A 1E79G 2A06H 2GDSA 3FFQA 2QKAA 5FNVA 1U96A 2EJRA 4O2BA 5CA1B 2WLJA 3CRCA 1Z5VA 3AK3A 4CS3A 4MSWC 5J2UA 3JD1A 5B1AC 3CMEV 2EX3A 1SZTA 2HKOA 2N74A 4UCRA 1Y66A 5KHGA 1FJGO 2P67A 3K9SA 4GX5A 3CMAV 1G4YB 2NLJC 4DR6B 2WA3A 4FM0A 1BL8A 3A8TA 5JH7A 4B08A 4JI6O 5B3SB 1T5EA 3QO5A 1LUVA 2UXBO 3E22B 3W7XA 2EINC 4LFAO 2VWKA 1YZBA 3OT7A 5IYDO 1UJWB 5CBFA 3THOA 1GM9A 4O4JB 4H13B 3ZHVA 5L3EA 4XDJA 1BE3H 4X1KB 3AG2B 1R6KA 1P7BA 3A0RA 3STLC 4GLXA 3UO2A 1GM7A 1S76D 4GX0A 1M93A 3QVNA 1CEZA 3B8NA 2JGDA 4DR7B 4MVQA 1NR1A 2ZE6A 2B9ZA 3G71V 1KMIZ 4FJCC 1E1QG 3AG4B 4E2LA 3GB7C 4IL6Z 3QG5A 1JOYA 1F23A 3ZMZA 1NJIW 4WBNA 3BABA 1TUBA 3RVYA 4TV8B 1N36O 3JAMN 3JAKB 3P30A 3X2QC 2DMXA 3MAQA 2QTSA 4FZ1A 2MK3A 1QLNA 1F7YA 4JI1O 1SQBH 1NH2D 1XHXA 3A0HZ 5H6RA 5EIBC 5C8YA 4QE7A 3RYIA 1L8DA 5B1OA 4J9YB 3FYEB 4IGGA 4UB6Z 4X1IA 2DYSB 1MNGA 2EIMB 5B1BB 1KYOF 2L35A 5EZYA 3SGIA 4OX9O 5BMVB 1R6TA 3FYIB 2B5UA 1QNMA 5IY5C 3J80N 3K58A 4YJ2A 1AR5A 4R8CA 2CUGA 4GZRB 1VQ7V 4C7UA 4DV3B 3KZIZ 4UCSA 5BR8O 2ADPA 1BCCH 2DYRB 3H1IH 1XMOB 1HW7A 4Z2WA 2Q0OC 5KHHA 4O2AA 1H2SB 4LF5O 4I55A 4F6RA 1NTKH 3P3NA 4UUJC 4DV1B 1GO3F 5E1AC 4CS4A 3CRRA 3CEIA 1IZ3A 5IYZA 5CA1A 2Z0AA 3KCYA 2BE3A 2F43G 2W6JG 5BR8B 1OCCB 3HKCB 3D3QA 2W6IG 4H37A 2WLLB 2WWWA 3QTCA 3SPHA 2P4VA 1I94O 3MHSC 2YXHA 4MTXA 3OUSA 1K4DC 1VQ4V 1LR1A 2QDOA 5CB4B 4RQEA 4DR2B 4N21A 3CXCU 4K3AA 2DWEC 3GWOA 1EFRG 3E8BA 2XNDG 1MABG 5J2TB 4MTGA 3WB2A 4TQDA 3JAWA 4D6TH 3T1HO 1FXKC 2A0LA 1QR9A 1Q3EA 1SQQH 4BAYA 3K04A 4K35A 1QR8A 4FFKA 1AJQA 3ZBHA 1RPOA 4JI3O 2ODMA 1JVMA 1FS0G 1SC5B 1JQ0A 1RM1C 2UU9B 3JASB 5L3FA 4DR2O 4B3MO 1VQPV 5EK0A 4LF5B 4O4JA 4X66B 1ZLZA 2NR5A 4D7SA 3VOUA 3F7YC 2F66C 5FPOA 1CXZB 4YIOA 2ZXWC 1H2LA 1GAXA 2FL4A 3ZHTA 3N2GA 1AR1B 1N0JA 1SA0B 3JD0A 1Z5WA 4WCEV 1SETA 2OIEA 1S77D 1K9MW 1FAFA 1S3JA 3ZRWA 2FB5A 3W7WA 4GKKB 4W4KA 1ZWIC 1VF7A 1H8HG 1TVKA 1AI5A 1D5NA 4EFBA 3T1HB 1AB3A 4ZHQA 2KB1A 4FIPC 3OR7C 1V55B 1Y67A 3ZHRA 2BSKB 4HNAA 2EZOA 1TGOA 2ITCC 3FKSG 5L3BA 3E83A 3LDDA 4R50A 4IYIA 4P9OA 4QJFB 4J41A 4GKJB 2ZT9B 1NVPB 4JI1B 1TVKB 4JPRA 3Q4HA 1ZUQA 2XAJA 4LF4O 1V54C 3GWKC 4I0XB 1M5IA 3TK1A 3HKDB 2VS0A 2AHYA 2PUSA 5DEDA 5IY5B 4DW1A 1BSMA 1V9PA 3ASNC 1KD1W 1OCZC 4K8XA 3RYHA 4X62B 2A9HA 5KMGA 2EIMC 2Q7EA 1F4MA 1BS3A 4X1YB 3T2MA 1S5JA 4PA3A 2QWQB 4DV7B 1QU7A 3UO3A 4CC5A 1Q6HA 4J7ZA 2AZ2A 1XMOO 4U3FH 4RO2A 4DV5B 1PD3A 5JVDB 1G1XB 2ARHA 1M57B 4BIOA 2ATKC 1QLEB 1S5HC 3AG1B 4X65B 2OT5A 1XOUA 5IWAO 1W0JG 2FYUH 3AEIA 5H2FZ 4WFFA 4O4HA 2YXLA 1IXMA 2IJKA 3OR6C 4BW9A 1GRJA 3RVZA 2QSAA 4PDMA 4JI6B 4J7KA 1ROPA 2YDEA 4P2ZA 4MS2A 3E8HA 2JRIA 3WB0A 3IC7A 5C93A 1XMQO 1PL0A 3CCQV 3H9VA 2CTRA 2WLHA 3BHPA 3B8MA 1HWYA 1XQ8A 1K97A 1HNWB 2ZNJA 3CCSV 2Q69A 4OGQB 2Q7GA 3RWRD 1US6A 2JGDB 4DUZB 3C90A 3CC4V 2HHHB 4KXRA 3LNMB 1GN4A 5BZBA 4BIUA 2IU3A 4LF7O 3OAAG 2B1IA 1KUQA 1RM1B 3LSSA 3K0DA 4DR4B 1YDXA 3DC6A 2WSSG 4FPPA 4LR3A 5KUMA 3NXSA 2D3OW 2WLMA 2WAMA 1KECA 2CTWA 1EN5A 3L75H 2VQEO 2RCVA 4JI2B 1GMGA 2Q73A 1YSCA 4MW8A 2XAFA 4MVUA 4DUYO 4D7TA 4DR5O 3QO7A 2XAGA 1CP9A 5C8YB 2Q7HA 2YICA 5H6QA 1R6NA 4MVOA 3HR0A 4DV1O 2GUZA 5EBWC 5LA6A 2HEPA 3RT3C 5KAFZ 2F95B 5KMGB 2YC0A 4XDLA 3ETDA 2VQEB 3BEHA 5J9PC 1YI2V 5LOVA 4QE9A 4JV5O 2JS3A 4UB8Z 4Q20A 1TUBB 4MW3A 2R9RB 5EBMC 2IU0A 3CX5F 2AGAA 3GVMA 3UQ8A 4GUNA 1YCIA 1BGYH 3F7VC 4LF8O 3T4DA 1OCRC 1NU1H 5EBLC 4BW5A 2XTAA 3ZHQA 3IAYA 2JGUA 2OCCC 4I9QA 2JIZG 5KHIA 4LWSA 1JJ2U 5JJNB 3DTUB 1HR0B 2PYJA 5BMVA 4DR6O 1K33A 1WA8A 1TUEB 1DLBA 4FLZA 1DTOA 1XBLA 2UU9O 1VMGA 4LFCB 2UXXA 3CRMA 3ABTA 3JCZA 2ILMA 1J95A 2OYQA 3BRCA 5CMUA 2JVDA 4GT1A 3ZMTA 4X20B 1KU9A 3UCSC 2E76B 3VBBA 1UFIA 5GTIZ 3LDCA 1S5LZ 2ZR3A 4JI5O 2X6AA 4LF4B 4O4LB 4JV5B 5JVDA 4WFAV 1MSWD 3TCUA 4DUYB 3UT5A 2GHYA 3QO8A 3HKBA 3TGUH 2PGGA 4MTOA 1BT8A 1FPOA 2Q67A 3BFRA 4CH6A 2R72A 3A2FA 2EINB 5KUKA 2YEVA 2CH7A 4NR1A 4NKGB 5EYPB 5L3DA 1N8RW 2ZNIA 2ZKOA 1VQKV 2JJ2G 3OM3B 4FVMA 2QM7A 1K5QA 2XHBA 1I5XA 2H3OA 2E5LO 4QNHB 4EEQA 1H2GA 4G28B 1P4RA 3OGIB 4NB5A 5L3GA 2ZCEA 4EFEA 2EULA 4JYYA 2BTQA 2P6JA 4X66O 4X65O 1E1RG 1ZL8B 3G67A 3OE7G 4DK0A 5KX5B 4PDLA 2QA4V 3WB1A 3CC2V 5CA0A 5IYZB 4EB6A 2ZXWB 1NQTA 1W2BU 4EKWA 2GBOA 2QE7G 3ZN0A 4JI8B 2WLLA 3RBZA 2N04A 5LHGA 3QF7A 4DV0B 2ZINA 1YVWA 1Y74B 2ITDC 2ZDIC 1M57C 2DW4A 3D3IA 2WLIA 4IT5A 3VQXA 1WP7A 5LMUB 1FXVA 2P22C 5LHHA 5B3SC 1Q8IA 3ABLC 2K1EA 2QM4A 2QJ1A 2Q8VA 3ICXA 3ABMC 1VQOV 4E4EA 3JALB 3STZC 4LWSB 4G2KA 5CBGA 1JFFA 3SPCA 3CCVV 2Q5ZA 1XNRO 1K3EA 1GH6A 1N34O 4X9QA 2WA4A 1AI6A 2JEUA 3W7SA 2OTLV 1FXHA 2FTKA 1XEQA 4LF6O 5ITZA 2LFSA 4I4TA 3B77A 2Y69B 2VRZA 5B66Z 3J81N 2HP8A 4XDKA 1J5EO 4X62O 4WBNB 3D36C 3JYCA 4TOIA 4YJ3B 2XOKG 5KHKA 4AQYO 1R73A 2YIBD 1ZL8A 3OUFA 3E8GA 1F51A 2X6BA 3R66A 2IH3C 3D8CA 3ABLB 4LNUA 4U3JB 4UCOA 2HLDG 2N05A 2X7RB 2LW1A 2ZE8A 3U10A 2HFEC 1K5SA 5LMUO 3K5NA 4KFMA 1XUQA 2KG7B 1Q5OA 3EVKA 4FLVA 1HR0O 4CH3A 4DRXA 1N36B 1CPYA 3AK2A 3DXRA 2RNBA 2YS8A 3BPZA 2HJDA 2ETNA 3ZS8C 1NKDA 4ZKIA 1MG1A 1N34B 3U11A 3ASOB 1XNRB 5EZYB 2QWPB 4BWAA 1WJZA 1MMMA 4HZ3A 2UXCO 2KKWA 3I56V 3CXHF 2PTMA 3UM7A 2IJHA 3MHHC 3SPGA 3H01A 4QPJA 1J5EB 2DWDC 4AI8A 1PNKA 4JI4O 3CYOA 4LCUC 2F4VO 1GN2A 2EZPA 1H2KA 2Q0AA 4DO2A 1K4CC 4I9WA 3ZHSA 1Y74A 4MVMA 4NXNB 1JX9A 2VWJA 1HNXO 3ETEA 4YIPA 3KCXA 3JASA 1WB8A 1AJPA 1G8MA 2BOCC 2QKSA 3CJHB 4GCZA 3K79A 3FAVB 4I50B 2GTSA 4P9PA 3SPIA 3P32A 1VF6A 3VQYA 4I5SA 1MOFA 4GX2A 5TISZ 1IXBA 4N23A 4O4LA 2JK5C 2UUBO 3ABUA 4LF7B 1GM8A 3SYOA 1WLEA 4JTCB 1AROP 1VQ6V 3SJAC 1QQCA 2CDYA 1Q6UA 4K0KO 3DC5A 1RFYA 2YIBA 5CA3A 3FAVA 4JI2O 4QGPA 2GV9A 4DV2B 1NI8A 3OGCC 4ZI7A 5JQGB 1N32O 3AG1C 3WG7B 5DECA 4I7ZB 5IJ9A 3DGEA 2XASA 3JARA 1NR7A 5JJEB 2QGNA 4TT3G 4PA4A 1R3LC 2JEXA 2BTQB 2D2CB 3CS5A 2GUZB 3ZX6A 5EIBD 3ML0A 4YY3O 3T1CA 4PD4F 3ZN1A 1K73W 4Z1VA 4JAAA 3E2EA 2Q68A 1Q82W 2QWNB 2CGOA 5J2UB 3ZHUA 4J42A 4ICGA 3L72H 4UVCA 2DJVA 3CHXA 3FB8C 1WA8B 4B3SO 3CRQA 1IBKB 4X88A 3S3WA 4AQYB 2WLIB 2BSKA 4HNAB 1R3JC 1B04A 2CK3G 3ABMB 5JH7B 2UXDO 1WPBA 5CN0A 4RUEA 1VIBA 3G80A 1XMQB 1PP9H 4DK1A 5IT9N 1DF5A 2EILC 3E22A 3W7UA 5EC2C 1GTOA 1HP8A 3J7AU 1Y6XA 3LUTB 4PA9A 5LOVB 4QIWF 1XREA 3HKDA 2V1DA 3K5MA 5JJJB 3RN4A
chains in the Genus database with same CATH topology
1FD9A 1Q6UA 1Q6HA 1Q6IA 3B09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  1Q6U A;  1Q6H A;  1Q6I A;  3B09 A; 
#chains in the Genus database with same CATH topology
 2A79 B;  5FL7 G;  3G6E V;  2ZE5 A;  3K3W A;  4JZG A;  2XT9 A;  2A7W A;  5B1B C;  3OMI B;  4DV6 B;  1O9G A;  3OD4 A;  1COW G;  2DYS C;  2F23 A;  3HPL C;  3SJQ C;  2YUA A;  2M6Y A;  5LBQ A;  3EXA A;  4JTA B;  1G6U A;  1U97 A;  1ZAU A;  1YIJ V;  2DQ3 A;  1XDC A;  4MVS A;  1IDS A;  1OJH A;  4J80 A;  5LXT A;  4CBC A;  4IIJ B;  2F4V B;  2IJI A;  2Y0I A;  1OV9 A;  5IJ9 B;  4O4I B;  5LP6 B;  1M4U A;  3H1J H;  1FYJ A;  1R1B A;  1Q90 D;  4DR5 B;  4LF8 B;  1PL4 A;  3AK1 A;  1IUR A;  3DSQ A;  3C3S A;  5J2T A;  4RAI A;  2ZQM A;  1SKV A;  3LSQ A;  1M1K W;  3L74 H;  1IVS A;  1FXK B;  1RSO B;  2AXT Z;  4X89 A;  4J11 A;  5LMN O;  1SER A;  4JAV A;  2DE0 X;  3EHB B;  4J9Z B;  4PDV A;  4O4I A;  1EN4 A;  4RUF A;  1KB9 F;  4MVZ A;  3SPJ A;  2MW2 B;  4X1I B;  4DR1 O;  4EB6 B;  1N4C A;  3H1L H;  4DV6 O;  2PYL A;  4AIL C;  3ASO C;  4IHJ B;  1FXK A;  1RSO A;  2E75 B;  3N2G B;  2Q9L A;  2DQ0 A;  1AP5 A;  2X6C A;  4JF3 A;  2OTJ V;  1VQ9 V;  2RN9 A;  3JCU Z;  5LA6 B;  3WFV A;  2CE4 A;  4G27 B;  1XL4 A;  4YHH B;  5KAI Z;  4P30 A;  1N33 B;  3SYC A;  4UV9 A;  2LP7 A;  3APQ A;  3TET A;  1W59 A;  1ZTE A;  4GX1 A;  1THZ A;  5FPR A;  5LP6 A;  2LFR A;  4TWK A;  4BR6 A;  4ZOL B;  1YXB A;  3TXS A;  4JI5 B;  5ITZ B;  2EIK C;  5LHI A;  2HHH O;  4X1Y A;  2OIG A;  1EZV H;  4OPH A;  1JFF B;  1A32 A;  2PY5 A;  3SJB C;  4DR1 B;  1Q43 A;  2IM9 A;  4WF9 V;  4NTY A;  4NTX A;  1SA0 A;  1WAZ A;  2CGN A;  2VQF O;  4H0L B;  1WPX A;  1W0K G;  3L73 H;  2V4D A;  3JAW B;  1MZE A;  2LGW A;  1NTZ H;  1DGS A;  1B06 A;  4ZIB A;  4UFZ A;  1SQV H;  4DW0 A;  4JI4 B;  2UUB B;  3SJC C;  5KLV H;  5IYC O;  1Q81 W;  1YJ9 V;  3K08 A;  1R3I C;  4JYB A;  2UXC B;  1WB7 A;  2CTQ A;  1M56 B;  3OTO B;  3OEH G;  5B1N A;  3HKC A;  2RQ6 A;  1HNX B;  3G4S V;  2L6L A;  3K0G A;  1D5A A;  1TAE A;  2UXN A;  2LGQ A;  2E74 B;  2EIJ B;  3RFR A;  4YHH O;  4UCV A;  4WFE A;  4LF9 B;  2R9I A;  3AG7 A;  4H44 B;  1BHB A;  4UCT A;  3CCU V;  4JYA B;  1XHZ A;  2P7T C;  5GW7 A;  2RJZ A;  3JSL A;  4JAS A;  4F4L A;  1MZF A;  4LF6 B;  1ORQ C;  1OCZ B;  2VQF B;  3AG2 C;  3I55 V;  4R6Z A;  1KP3 A;  1IBM O;  4LFB O;  4TUY A;  1Y76 B;  1EM1 A;  1VEW A;  3ZRX A;  3OMA B;  4A5U B;  4DV2 O;  2QEX V;  1V54 B;  1B3Q A;  5CA0 B;  3BCC H;  2EIL B;  1JPX A;  3BVO A;  3T4Z A;  3OEE G;  4I50 A;  5LGT A;  2XAH A;  2XUM A;  1JCH A;  4U7O A;  1Q6I A;  1Z2G A;  4PHZ A;  2F93 B;  1KP2 A;  3E89 A;  4JGS A;  5CBH A;  1R3K C;  4KHP O;  2O57 A;  1K92 A;  3H1K H;  2QKC A;  3K03 A;  4I0X A;  1H8E G;  1SZX A;  2W0X A;  3IC9 A;  1S72 V;  1FFX A;  2ZDI A;  3IFX A;  4MT8 A;  2WPD G;  1K34 A;  1O9H A;  3F5T A;  4DV5 O;  3OMN B;  2Z3Y A;  3ETQ A;  1TA8 A;  1L0L H;  4TQF A;  3RYH B;  4PA6 A;  1VQN V;  2ZM6 B;  1M9N A;  2PI5 A;  2E5L B;  2PZS A;  3AG3 C;  4LF9 O;  2OCH A;  3CCR V;  4LFB B;  4JTD B;  1NVP D;  4YY3 B;  1AJN A;  2HR3 A;  5IE9 A;  1N33 O;  4B7K A;  5JQG A;  4NXN O;  5JCO C;  2UXD B;  5LYJ A;  3Q4H B;  2EBO A;  4FFB A;  1IBL B;  1GK9 A;  1URF A;  1SF9 A;  1GKF A;  2ZR2 A;  3W7T A;  3ZCC A;  3LDE A;  5JWP A;  2JS5 A;  1BZK A;  2Y0P A;  3CWB H;  3FD9 A;  1P49 A;  3P3P A;  5LP6 C;  2HVK C;  3ZRW B;  1V55 C;  2BOB C;  4ZI7 B;  2WLN A;  1I7F A;  2Y69 C;  4DV0 O;  4K8Z A;  2GSM B;  3TJT A;  4NYK A;  5GON B;  1JJO A;  4FLY A;  3A0B Z;  1VF6 C;  5DN6 G;  3OTF A;  3K9A A;  1H2M A;  3ZJZ A;  1I08 A;  4JYC A;  4MTF A;  2A3Q A;  5LL6 Y;  5IJ0 A;  2OWO A;  5AG2 A;  1BHA A;  4FM2 A;  4NXM O;  3HKE B;  4UCU A;  4DRX B;  1NH2 B;  4X8A A;  3RYC B;  3JD4 A;  3B4S A;  2K9P A;  3VQV A;  1K8A W;  2LJ2 A;  2M7W A;  1L0N H;  4R7C A;  2Y4T A;  3QNE A;  2IBZ H;  4FLT A;  3H1H H;  4H33 A;  3RYF A;  2ZE7 A;  1IBL O;  4NXM B;  1FFT B;  3ABK C;  2PF4 E;  4LFA B;  3HKE A;  4CS2 A;  1HNZ O;  1JR9 A;  1ENV A;  1I5Y A;  3NR7 A;  2NNU A;  3DXR B;  1NS1 A;  2V7Q G;  3O65 A;  5FNV B;  1PKX A;  3SYP A;  1YTF B;  3CCE V;  1MSD A;  2Y4U A;  4CH5 A;  3CJH A;  1L1F A;  1VP7 A;  5EYP A;  5BY1 A;  4LP8 A;  4JI3 B;  1AR4 A;  4DR4 O;  5LGN A;  2B1G A;  4U7N A;  4DR7 O;  4B3T B;  1Y76 A;  1YTF D;  5B1A B;  4X64 B;  1SS3 A;  4FLX A;  1PNL A;  3S3X A;  2ZIO A;  1B6Q A;  3ETG A;  3G6B A;  2Y48 A;  4PEL A;  1OCO B;  1OCC C;  1XI1 A;  3K06 A;  3CCJ V;  4FMT A;  2JDI G;  4JI7 O;  2LO1 A;  4WFB V;  4O4H B;  1VQM V;  1M90 W;  5H9C A;  3B40 A;  1NTM H;  3F5W C;  1AI7 A;  2CAZ C;  4PA7 A;  4NVP A;  1H2N A;  4L8J A;  4UVA A;  3ZMU A;  3JAT B;  1BQZ A;  2X0L A;  1LNQ A;  1VQ8 V;  2ZIM A;  1YJN V;  4B3S B;  1XIL A;  1HNZ B;  4Z1M G;  5D5Q A;  5BXZ A;  5IDJ A;  1AP6 A;  2DOS A;  1LUW A;  1OCO C;  2KSD A;  3AG3 B;  4IHJ A;  3BY6 A;  3N2K A;  5F2V O;  1EZJ A;  4ZOL A;  5FLX N;  2QWR B;  3ASN B;  3K57 A;  2ADQ B;  4ZBM A;  1F4N A;  1BMF G;  1EN6 A;  2UUC O;  1X59 A;  4LH6 A;  4PJ0 Z;  3CRA A;  1XNQ O;  1YIT V;  4X64 O;  3N27 A;  4YXW G;  1Q86 W;  4TV8 A;  3K59 A;  2OCC B;  1PV0 A;  2EIJ C;  4ASU G;  1SQP H;  1NBM G;  5LYJ B;  3E86 A;  3RYC A;  3N2K B;  4DV4 O;  3UT5 B;  1OZ0 A;  2NN4 A;  4DV3 O;  3JAR B;  2QTO A;  4DUZ O;  5KX5 A;  4QPK A;  2UUA O;  3ZMS A;  1AVM A;  2IH1 C;  1YEW A;  3L70 H;  2UXB B;  1FKA O;  1WNS A;  1RPR A;  4B3T O;  2CH7 B;  4TSF G;  1EBO A;  1SRY A;  3O9O A;  4DR3 O;  4J10 A;  1BQ0 A;  2BCC H;  4Q6G A;  2PI4 A;  2YXY A;  3RYI B;  3VQW A;  5EC1 C;  5K1P A;  3IJ4 A;  4JI7 B;  5GON A;  3ZRS A;  2QWO B;  2HG5 C;  1KKD A;  4TV9 A;  1YF2 A;  3B2E E;  4DXW A;  2LQT A;  2AZ0 A;  1SQG A;  3AG4 C;  4X20 A;  2UUA B;  1XL6 A;  1Q7Y W;  1DK1 A;  4PDR A;  3KG2 A;  2KG7 A;  1PNM A;  3FB7 C;  4O2A B;  4JAU A;  2YSU B;  3UKM A;  3U0Z A;  1SQX H;  3FX7 A;  3M8A A;  4F6R B;  2ZD9 A;  2RDC A;  1NZ6 A;  3K5L A;  3OFN G;  2R9A A;  2R70 A;  2UUC B;  5E79 Z;  5KHJ A;  3JD3 A;  4OXS A;  4UV8 A;  3FB6 C;  2YEV B;  5KA6 A;  3M7M X;  4CH4 A;  5A2Q N;  4JYA O;  5HFM A;  3JD2 A;  2HJF C;  2FML A;  5KA5 A;  4YJ3 A;  2IW5 A;  3CPW U;  1QHT A;  4IYH A;  4I55 B;  1IX9 A;  3JAT A;  1IBK O;  1D2D A;  4DR3 B;  1FD9 A;  4WFH A;  1PM9 A;  2AW9 A;  1DF4 A;  1OHH G;  4ABM A;  3WG7 C;  4J7J A;  1WP8 A;  4XBF A;  1K7D A;  3BA8 A;  4LH7 A;  4UVB A;  5K1X A;  1QVF U;  2YIA A;  3CSX A;  1QCE A;  5CB4 A;  3PN1 A;  1Y4M A;  4KUM A;  4CC6 A;  4HBN A;  4K0K B;  4NTW A;  1H38 A;  3B09 A;  1MA1 A;  3CP1 A;  4PI2 A;  3BA9 A;  4L87 A;  4F6E A;  4HAM A;  1KKC A;  4IIJ A;  4KP4 A;  2EIK B;  4GKK O;  4FM1 A;  3BAA A;  4HYO A;  1P84 F;  1OCR B;  1N0N A;  4BIZ A;  4RQF A;  3SR2 C;  5L3C A;  1QLE C;  2RMK B;  3PJS K;  1KBH A;  5B5E Z;  3CCM V;  4B3R O;  5HFL A;  2JJ1 G;  4W4L A;  3JAL A;  3K5O A;  1FFX B;  4RWU A;  2QR4 A;  1NT2 B;  4OX9 B;  4GKJ O;  2BTO A;  3X2Q B;  1S0V A;  3L9D A;  4TUY B;  1PPJ H;  4GYC B;  1JMK C;  1VQL V;  1ZX3 A;  2G38 A;  3M99 B;  2P06 A;  5IYB O;  2P4K A;  3LSU A;  4FLW A;  1X4T A;  4JI0 B;  2C2A A;  4OPA A;  2GTA A;  3CB2 A;  3R65 A;  1IBM B;  3OTO O;  3CD6 V;  2P5O A;  1SES A;  2FKX A;  1GN3 A;  1I0H A;  4WFG A;  1VAR A;  2QM8 A;  3RGB A;  1GN6 A;  4DV4 B;  1VQ5 V;  4DV7 O;  3FB5 C;  3ABK B;  3TXQ A;  2H8P C;  1AIL A;  4JI8 O;  4UXN A;  2YID A;  3ZRV A;  1SQF A;  4FLU A;  4JI0 O;  3SDL A;  3JAK A;  3T1Y O;  5D5P A;  3E35 A;  2XAQ A;  2F1M A;  4LFC O;  4B7E A;  4FFB B;  1VF5 B;  1RP3 B;  3APO A;  5GTH Z;  4B3R B;  2IJJ A;  4LC1 A;  5IWA B;  2KQX A;  2DN9 A;  1FJG B;  1HNW O;  3SYQ A;  3L71 H;  3ZMV A;  2P90 A;  1YHQ V;  3ZED A;  2Q6A A;  2AHZ A;  3D36 A;  4PI0 A;  3WU2 Z;  4PV1 B;  1JA8 A;  4FK5 C;  4KL1 A;  5A9G A;  4ZHQ B;  4JZ2 A;  3RW0 A;  2Z5U A;  2YI8 A;  1YJW V;  3CC7 V;  4CZZ A;  3KKY A;  1KQS U;  4B3M B;  3I5D A;  3MDS A;  5IJ0 B;  2ZM6 O;  3E8F A;  3CE2 A;  4LNU B;  4U3J A;  2HVJ C;  3SYA A;  1P7G A;  2Q4P A;  3HB3 B;  1AI4 A;  1UPG A;  4LBE C;  2WLK A;  3C3T A;  3MD0 A;  1ZSP A;  3OW2 U;  4KHP B;  4MVR A;  4FZ0 A;  4AHC A;  4DYL A;  3JSN A;  1M56 C;  4YJ2 B;  1QVG U;  1I94 B;  5DM6 V;  5H5N A;  3EFF K;  4TV9 B;  4O2B B;  2YI9 A;  4I4T B;  2H94 A;  1QBZ A;  3HKB B;  5JCO A;  2EJ7 A;  3LNN A;  3ZIA G;  2CTP A;  1HDJ A;  3T1Y B;  2W0F C;  5LGU A;  4X1K A;  2DYR C;  3RYF B;  5LXT B;  1XNQ B;  2LW7 A;  5LMN B;  3IGA C;  3CCL V;  2E3C A;  1N32 B;  1KC8 W;  1WN7 A;  1E79 G;  2A06 H;  2GDS A;  3FFQ A;  2QKA A;  5FNV A;  1U96 A;  2EJR A;  4O2B A;  5CA1 B;  2WLJ A;  3CRC A;  1Z5V A;  3AK3 A;  4CS3 A;  4MSW C;  5J2U A;  3JD1 A;  5B1A C;  3CME V;  2EX3 A;  1SZT A;  2HKO A;  2N74 A;  4UCR A;  1Y66 A;  5KHG A;  1FJG O;  2P67 A;  3K9S A;  4GX5 A;  3CMA V;  1G4Y B;  2NLJ C;  4DR6 B;  2WA3 A;  4FM0 A;  1BL8 A;  3A8T A;  5JH7 A;  4B08 A;  4JI6 O;  5B3S B;  1T5E A;  3QO5 A;  1LUV A;  2UXB O;  3E22 B;  3W7X A;  2EIN C;  4LFA O;  2VWK A;  1YZB A;  3OT7 A;  5IYD O;  1UJW B;  5CBF A;  3THO A;  1GM9 A;  4O4J B;  4H13 B;  3ZHV A;  5L3E A;  4XDJ A;  1BE3 H;  4X1K B;  3AG2 B;  1R6K A;  1P7B A;  3A0R A;  3STL C;  4GLX A;  3UO2 A;  1GM7 A;  1S76 D;  4GX0 A;  1M93 A;  3QVN A;  1CEZ A;  3B8N A;  2JGD A;  4DR7 B;  4MVQ A;  1NR1 A;  2ZE6 A;  2B9Z A;  3G71 V;  1KMI Z;  4FJC C;  1E1Q G;  3AG4 B;  4E2L A;  3GB7 C;  4IL6 Z;  3QG5 A;  1JOY A;  1F23 A;  3ZMZ A;  1NJI W;  4WBN A;  3BAB A;  1TUB A;  3RVY A;  4TV8 B;  1N36 O;  3JAM N;  3JAK B;  3P30 A;  3X2Q C;  2DMX A;  3MAQ A;  2QTS A;  4FZ1 A;  2MK3 A;  1QLN A;  1F7Y A;  4JI1 O;  1SQB H;  1NH2 D;  1XHX A;  3A0H Z;  5H6R A;  5EIB C;  5C8Y A;  4QE7 A;  3RYI A;  1L8D A;  5B1O A;  4J9Y B;  3FYE B;  4IGG A;  4UB6 Z;  4X1I A;  2DYS B;  1MNG A;  2EIM B;  5B1B B;  1KYO F;  2L35 A;  5EZY A;  3SGI A;  4OX9 O;  5BMV B;  1R6T A;  3FYI B;  2B5U A;  1QNM A;  5IY5 C;  3J80 N;  3K58 A;  4YJ2 A;  1AR5 A;  4R8C A;  2CUG A;  4GZR B;  1VQ7 V;  4C7U A;  4DV3 B;  3KZI Z;  4UCS A;  5BR8 O;  2ADP A;  1BCC H;  2DYR B;  3H1I H;  1XMO B;  1HW7 A;  4Z2W A;  2Q0O C;  5KHH A;  4O2A A;  1H2S B;  4LF5 O;  4I55 A;  4F6R A;  1NTK H;  3P3N A;  4UUJ C;  4DV1 B;  1GO3 F;  5E1A C;  4CS4 A;  3CRR A;  3CEI A;  1IZ3 A;  5IYZ A;  5CA1 A;  2Z0A A;  3KCY A;  2BE3 A;  2F43 G;  2W6J G;  5BR8 B;  1OCC B;  3HKC B;  3D3Q A;  2W6I G;  4H37 A;  2WLL B;  2WWW A;  3QTC A;  3SPH A;  2P4V A;  1I94 O;  3MHS C;  2YXH A;  4MTX A;  3OUS A;  1K4D C;  1VQ4 V;  1LR1 A;  2QDO A;  5CB4 B;  4RQE A;  4DR2 B;  4N21 A;  3CXC U;  4K3A A;  2DWE C;  3GWO A;  1EFR G;  3E8B A;  2XND G;  1MAB G;  5J2T B;  4MTG A;  3WB2 A;  4TQD A;  3JAW A;  4D6T H;  3T1H O;  1FXK C;  2A0L A;  1QR9 A;  1Q3E A;  1SQQ H;  4BAY A;  3K04 A;  4K35 A;  1QR8 A;  4FFK A;  1AJQ A;  3ZBH A;  1RPO A;  4JI3 O;  2ODM A;  1JVM A;  1FS0 G;  1SC5 B;  1JQ0 A;  1RM1 C;  2UU9 B;  3JAS B;  5L3F A;  4DR2 O;  4B3M O;  1VQP V;  5EK0 A;  4LF5 B;  4O4J A;  4X66 B;  1ZLZ A;  2NR5 A;  4D7S A;  3VOU A;  3F7Y C;  2F66 C;  5FPO A;  1CXZ B;  4YIO A;  2ZXW C;  1H2L A;  1GAX A;  2FL4 A;  3ZHT A;  3N2G A;  1AR1 B;  1N0J A;  1SA0 B;  3JD0 A;  1Z5W A;  4WCE V;  1SET A;  2OIE A;  1S77 D;  1K9M W;  1FAF A;  1S3J A;  3ZRW A;  2FB5 A;  3W7W A;  4GKK B;  4W4K A;  1ZWI C;  1VF7 A;  1H8H G;  1TVK A;  1AI5 A;  1D5N A;  4EFB A;  3T1H B;  1AB3 A;  4ZHQ A;  2KB1 A;  4FIP C;  3OR7 C;  1V55 B;  1Y67 A;  3ZHR A;  2BSK B;  4HNA A;  2EZO A;  1TGO A;  2ITC C;  3FKS G;  5L3B A;  3E83 A;  3LDD A;  4R50 A;  4IYI A;  4P9O A;  4QJF B;  4J41 A;  4GKJ B;  2ZT9 B;  1NVP B;  4JI1 B;  1TVK B;  4JPR A;  3Q4H A;  1ZUQ A;  2XAJ A;  4LF4 O;  1V54 C;  3GWK C;  4I0X B;  1M5I A;  3TK1 A;  3HKD B;  2VS0 A;  2AHY A;  2PUS A;  5DED A;  5IY5 B;  4DW1 A;  1BSM A;  1V9P A;  3ASN C;  1KD1 W;  1OCZ C;  4K8X A;  3RYH A;  4X62 B;  2A9H A;  5KMG A;  2EIM C;  2Q7E A;  1F4M A;  1BS3 A;  4X1Y B;  3T2M A;  1S5J A;  4PA3 A;  2QWQ B;  4DV7 B;  1QU7 A;  3UO3 A;  4CC5 A;  1Q6H A;  4J7Z A;  2AZ2 A;  1XMO O;  4U3F H;  4RO2 A;  4DV5 B;  1PD3 A;  5JVD B;  1G1X B;  2ARH A;  1M57 B;  4BIO A;  2ATK C;  1QLE B;  1S5H C;  3AG1 B;  4X65 B;  2OT5 A;  1XOU A;  5IWA O;  1W0J G;  2FYU H;  3AEI A;  5H2F Z;  4WFF A;  4O4H A;  2YXL A;  1IXM A;  2IJK A;  3OR6 C;  4BW9 A;  1GRJ A;  3RVZ A;  2QSA A;  4PDM A;  4JI6 B;  4J7K A;  1ROP A;  2YDE A;  4P2Z A;  4MS2 A;  3E8H A;  2JRI A;  3WB0 A;  3IC7 A;  5C93 A;  1XMQ O;  1PL0 A;  3CCQ V;  3H9V A;  2CTR A;  2WLH A;  3BHP A;  3B8M A;  1HWY A;  1XQ8 A;  1K97 A;  1HNW B;  2ZNJ A;  3CCS V;  2Q69 A;  4OGQ B;  2Q7G A;  3RWR D;  1US6 A;  2JGD B;  4DUZ B;  3C90 A;  3CC4 V;  2HHH B;  4KXR A;  3LNM B;  1GN4 A;  5BZB A;  4BIU A;  2IU3 A;  4LF7 O;  3OAA G;  2B1I A;  1KUQ A;  1RM1 B;  3LSS A;  3K0D A;  4DR4 B;  1YDX A;  3DC6 A;  2WSS G;  4FPP A;  4LR3 A;  5KUM A;  3NXS A;  2D3O W;  2WLM A;  2WAM A;  1KEC A;  2CTW A;  1EN5 A;  3L75 H;  2VQE O;  2RCV A;  4JI2 B;  1GMG A;  2Q73 A;  1YSC A;  4MW8 A;  2XAF A;  4MVU A;  4DUY O;  4D7T A;  4DR5 O;  3QO7 A;  2XAG A;  1CP9 A;  5C8Y B;  2Q7H A;  2YIC A;  5H6Q A;  1R6N A;  4MVO A;  3HR0 A;  4DV1 O;  2GUZ A;  5EBW C;  5LA6 A;  2HEP A;  3RT3 C;  5KAF Z;  2F95 B;  5KMG B;  2YC0 A;  4XDL A;  3ETD A;  2VQE B;  3BEH A;  5J9P C;  1YI2 V;  5LOV A;  4QE9 A;  4JV5 O;  2JS3 A;  4UB8 Z;  4Q20 A;  1TUB B;  4MW3 A;  2R9R B;  5EBM C;  2IU0 A;  3CX5 F;  2AGA A;  3GVM A;  3UQ8 A;  4GUN A;  1YCI A;  1BGY H;  3F7V C;  4LF8 O;  3T4D A;  1OCR C;  1NU1 H;  5EBL C;  4BW5 A;  2XTA A;  3ZHQ A;  3IAY A;  2JGU A;  2OCC C;  4I9Q A;  2JIZ G;  5KHI A;  4LWS A;  1JJ2 U;  5JJN B;  3DTU B;  1HR0 B;  2PYJ A;  5BMV A;  4DR6 O;  1K33 A;  1WA8 A;  1TUE B;  1DLB A;  4FLZ A;  1DTO A;  1XBL A;  2UU9 O;  1VMG A;  4LFC B;  2UXX A;  3CRM A;  3ABT A;  3JCZ A;  2ILM A;  1J95 A;  2OYQ A;  3BRC A;  5CMU A;  2JVD A;  4GT1 A;  3ZMT A;  4X20 B;  1KU9 A;  3UCS C;  2E76 B;  3VBB A;  1UFI A;  5GTI Z;  3LDC A;  1S5L Z;  2ZR3 A;  4JI5 O;  2X6A A;  4LF4 B;  4O4L B;  4JV5 B;  5JVD A;  4WFA V;  1MSW D;  3TCU A;  4DUY B;  3UT5 A;  2GHY A;  3QO8 A;  3HKB A;  3TGU H;  2PGG A;  4MTO A;  1BT8 A;  1FPO A;  2Q67 A;  3BFR A;  4CH6 A;  2R72 A;  3A2F A;  2EIN B;  5KUK A;  2YEV A;  2CH7 A;  4NR1 A;  4NKG B;  5EYP B;  5L3D A;  1N8R W;  2ZNI A;  2ZKO A;  1VQK V;  2JJ2 G;  3OM3 B;  4FVM A;  2QM7 A;  1K5Q A;  2XHB A;  1I5X A;  2H3O A;  2E5L O;  4QNH B;  4EEQ A;  1H2G A;  4G28 B;  1P4R A;  3OGI B;  4NB5 A;  5L3G A;  2ZCE A;  4EFE A;  2EUL A;  4JYY A;  2BTQ A;  2P6J A;  4X66 O;  4X65 O;  1E1R G;  1ZL8 B;  3G67 A;  3OE7 G;  4DK0 A;  5KX5 B;  4PDL A;  2QA4 V;  3WB1 A;  3CC2 V;  5CA0 A;  5IYZ B;  4EB6 A;  2ZXW B;  1NQT A;  1W2B U;  4EKW A;  2GBO A;  2QE7 G;  3ZN0 A;  4JI8 B;  2WLL A;  3RBZ A;  2N04 A;  5LHG A;  3QF7 A;  4DV0 B;  2ZIN A;  1YVW A;  1Y74 B;  2ITD C;  2ZDI C;  1M57 C;  2DW4 A;  3D3I A;  2WLI A;  4IT5 A;  3VQX A;  1WP7 A;  5LMU B;  1FXV A;  2P22 C;  5LHH A;  5B3S C;  1Q8I A;  3ABL C;  2K1E A;  2QM4 A;  2QJ1 A;  2Q8V A;  3ICX A;  3ABM C;  1VQO V;  4E4E A;  3JAL B;  3STZ C;  4LWS B;  4G2K A;  5CBG A;  1JFF A;  3SPC A;  3CCV V;  2Q5Z A;  1XNR O;  1K3E A;  1GH6 A;  1N34 O;  4X9Q A;  2WA4 A;  1AI6 A;  2JEU A;  3W7S A;  2OTL V;  1FXH A;  2FTK A;  1XEQ A;  4LF6 O;  5ITZ A;  2LFS A;  4I4T A;  3B77 A;  2Y69 B;  2VRZ A;  5B66 Z;  3J81 N;  2HP8 A;  4XDK A;  1J5E O;  4X62 O;  4WBN B;  3D36 C;  3JYC A;  4TOI A;  4YJ3 B;  2XOK G;  5KHK A;  4AQY O;  1R73 A;  2YIB D;  1ZL8 A;  3OUF A;  3E8G A;  1F51 A;  2X6B A;  3R66 A;  2IH3 C;  3D8C A;  3ABL B;  4LNU A;  4U3J B;  4UCO A;  2HLD G;  2N05 A;  2X7R B;  2LW1 A;  2ZE8 A;  3U10 A;  2HFE C;  1K5S A;  5LMU O;  3K5N A;  4KFM A;  1XUQ A;  2KG7 B;  1Q5O A;  3EVK A;  4FLV A;  1HR0 O;  4CH3 A;  4DRX A;  1N36 B;  1CPY A;  3AK2 A;  3DXR A;  2RNB A;  2YS8 A;  3BPZ A;  2HJD A;  2ETN A;  3ZS8 C;  1NKD A;  4ZKI A;  1MG1 A;  1N34 B;  3U11 A;  3ASO B;  1XNR B;  5EZY B;  2QWP B;  4BWA A;  1WJZ A;  1MMM A;  4HZ3 A;  2UXC O;  2KKW A;  3I56 V;  3CXH F;  2PTM A;  3UM7 A;  2IJH A;  3MHH C;  3SPG A;  3H01 A;  4QPJ A;  1J5E B;  2DWD C;  4AI8 A;  1PNK A;  4JI4 O;  3CYO A;  4LCU C;  2F4V O;  1GN2 A;  2EZP A;  1H2K A;  2Q0A A;  4DO2 A;  1K4C C;  4I9W A;  3ZHS A;  1Y74 A;  4MVM A;  4NXN B;  1JX9 A;  2VWJ A;  1HNX O;  3ETE A;  4YIP A;  3KCX A;  3JAS A;  1WB8 A;  1AJP A;  1G8M A;  2BOC C;  2QKS A;  3CJH B;  4GCZ A;  3K79 A;  3FAV B;  4I50 B;  2GTS A;  4P9P A;  3SPI A;  3P32 A;  1VF6 A;  3VQY A;  4I5S A;  1MOF A;  4GX2 A;  5TIS Z;  1IXB A;  4N23 A;  4O4L A;  2JK5 C;  2UUB O;  3ABU A;  4LF7 B;  1GM8 A;  3SYO A;  1WLE A;  4JTC B;  1ARO P;  1VQ6 V;  3SJA C;  1QQC A;  2CDY A;  1Q6U A;  4K0K O;  3DC5 A;  1RFY A;  2YIB A;  5CA3 A;  3FAV A;  4JI2 O;  4QGP A;  2GV9 A;  4DV2 B;  1NI8 A;  3OGC C;  4ZI7 A;  5JQG B;  1N32 O;  3AG1 C;  3WG7 B;  5DEC A;  4I7Z B;  5IJ9 A;  3DGE A;  2XAS A;  3JAR A;  1NR7 A;  5JJE B;  2QGN A;  4TT3 G;  4PA4 A;  1R3L C;  2JEX A;  2BTQ B;  2D2C B;  3CS5 A;  2GUZ B;  3ZX6 A;  5EIB D;  3ML0 A;  4YY3 O;  3T1C A;  4PD4 F;  3ZN1 A;  1K73 W;  4Z1V A;  4JAA A;  3E2E A;  2Q68 A;  1Q82 W;  2QWN B;  2CGO A;  5J2U B;  3ZHU A;  4J42 A;  4ICG A;  3L72 H;  4UVC A;  2DJV A;  3CHX A;  3FB8 C;  1WA8 B;  4B3S O;  3CRQ A;  1IBK B;  4X88 A;  3S3W A;  4AQY B;  2WLI B;  2BSK A;  4HNA B;  1R3J C;  1B04 A;  2CK3 G;  3ABM B;  5JH7 B;  2UXD O;  1WPB A;  5CN0 A;  4RUE A;  1VIB A;  3G80 A;  1XMQ B;  1PP9 H;  4DK1 A;  5IT9 N;  1DF5 A;  2EIL C;  3E22 A;  3W7U A;  5EC2 C;  1GTO A;  1HP8 A;  3J7A U;  1Y6X A;  3LUT B;  4PA9 A;  5LOV B;  4QIW F;  1XRE A;  3HKD A;  2V1D A;  3K5M A;  5JJJ B;  3RN4 A; 
#chains in the Genus database with same CATH homology
 1FD9 A;  1Q6U A;  1Q6H A;  1Q6I A;  3B09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...