3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
molecule tags Chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
1Q6HA 1Q6IA 1Q6UA 1FD9A 3B09A
chains in the Genus database with same CATH superfamily
1AILA 3SDLA 1FYJA 5FNVA 3LSSA 4R7CA 1XL4A 2YEVA 2ZM6B 3CC7V 1IBLB 2V1DA 4MSWC 4TV8B 2IW5A 4X64B 4MVUA 5EBWC 5IDJA 3E8GA 1K92A 1FAFA 4PA9A 3H1LH 1Y74B 3BA9A 2Q69A 1VEWA 4LF8B 4JZ2A 2Q7EA 3GVMA 3WFVA 4OX9B 5CA0B 1YIJV 4FIPC 3CCQV 3I5DA 4O4IB 1Y6XA 3DC5A 1IBKO 1QLNA 2YDEA 4LFAB 3FAVA 3K0GA 4IGGA 4DV3B 1B04A 3FAVB 5KAIZ 1JMKC 3W7SA 1W2BU 3H1KH 4UVBA 3QF7A 4DUYO 3UKMA 1ZL8A 4UUJC 2FTKA 1JX9A 4DV7O 4MW8A 1N33O 4KL1A 5LGUA 2XAJA 1EZVH 1LNQA 4FLTA 1KP3A 1Q3EA 4EB6B 1M4UA 1IURA 1YJNV 3E86A 4UCTA 2WLIB 1XILA 3ASNB 5J2UA 4K35A 2ZDIA 2BTOA 1ZAUA 2DN9A 1ZSPA 1XHXA 3Q4HB 3ZRWB 5LP6B 5H2FZ 1VP7A 2ZR3A 2KSDA 1NTZH 3CC4V 3ZRSA 4CS4A 4JI0O 2JJ1G 3CYOA 4K8ZA 2AZ2A 4DRXB 1I5XA 3RGBA 3N27A 4H0LB 1QVGU 4YHHO 4WF9V 5L3GA 2DYRB 5B1AC 1ZLZA 1N0NA 2DMXA 5LMNO 4RUEA 5B1AB 4LF4O 2R9AA 1EBOA 1YI2V 2XNDG 1E1QG 4MTGA 1F51A 3JSLA 2RDCA 4JI5B 1YXBA 4JI8O 1M1KW 2JS5A 1SESA 5IWAO 4I5SA 1RM1C 1K33A 1OHHG 1WB7A 4JYBA 3U0ZA 1AB3A 4NXNB 2VRZA 2R9IA 1BZKA 4G2KA 1AR1B 3JALA 2B9ZA 3SJBC 1HNZB 1MNGA 3CC2V 2XAHA 3JSNA 1NTMH 2NN4A 2LP7A 4JI1O 4DV0B 5B3SC 4DV7B 1VQKV 4FFKA 2QDOA 2CH7A 4LWSB 4H44B 1ZUQA 2AW9A 2EJ7A 2OIGA 5IE9A 1K5SA 3OT7A 3BPZA 2Z0AA 2ODMA 5L3CA 1VQ7V 4JI3O 3N2GB 4MVZA 1X4TA 2P6JA 1XNRB 1IXBA 3B4SA 2EIJC 1GK9A 4WFEA 1PL0A 5IJ0B 4F6RB 1VQMV 3KCXA 2OWOA 3TGUH 1XHZA 2A9HA 5GONB 4P9OA 1NVPB 1SQPH 1R6KA 4O4HA 3CCVV 1LUWA 1JCHA 1MSDA 5EC1C 4DYLA 5LBQA 1FJGO 2WPDG 1R6TA 2BE3A 1JJOA 4W4KA 4I0XA 4GX2A 1XDCA 1EM1A 4LC1A 4X20B 1EN5A 1P84F 1H8HG 1TUBA 4YJ2B 2V7QG 1BS3A 4GKKB 5E1AC 2GTAA 1K9MW 3APQA 3ZMVA 3AG4C 5LYJB 5JCOA 2GDSA 2UUCO 1NKDA 4NXMB 3SYOA 2QM4A 4X65O 3UT5B 1Q81W 1N8RW 2RMKB 1DLBA 2ADPA 1Q90D 1VMGA 5JH7B 2EBOA 1F7YA 4JAUA 1Z2GA 2QKAA 3MHSC 2RCVA 4UCSA 1XI1A 4BW9A 3F5TA 4BIZA 4JYCA 5FLXN 4DR6O 4KHPB 3JD1A 2ITDC 3JAWB 4PI0A 4PJ0Z 3ZEDA 3BRCA 4PA3A 5CBFA 2JGUA 1RM1B 1TUBB 2ZT9B 1YF2A 4YIOA 4X20A 5IWAB 1UPGA 5LA6B 5CN0A 2KQXA 2YIBD 4I0XB 3AG2B 4JTCB 4EFEA 3OW2U 4J80A 1W0JG 3SYCA 4LH7A 2L35A 4LF6B 1AVMA 1HWYA 3D3QA 1VIBA 1H2KA 1U97A 2YXLA 4ZOLA 3EHBB 3BA8A 1IX9A 3M8AA 3OUSA 1VARA 3THOA 2EZOA 3H1HH 2GUZA 1O9HA 3OD4A 2YXYA 4JF3A 4F6RA 2B5UA 2HFEC 1NR1A 3SR2C 2OIEA 2JJ2G 4WFBV 4NB5A 2CE4A 3IGAC 1RP3B 4IIJA 3A0HZ 5JVDA 2UXNA 3CCUV 3WG7B 4P2ZA 1KYOF 3OR6C 1KMIZ 1JFFA 2D3OW 5L3DA 1SF9A 3A8TA 3FFQA 2ZE6A 1J95A 3K5OA 4LNUB 3A0BZ 4Z1VA 3RYIA 4UV9A 4D7SA 4HYOA 3KG2A 4XDKA 1FXVA 1NS1A 3JARB 1BQZA 4DR4B 4FLXA 1FKAO 4AILC 3D36A 5LMUB 2JEXA 4ZKIA 4LF7O 4WFFA 4LFAO 2ZQMA 4PI2A 2UUBB 4O4JB 4I50B 3FB8C 5J2TA 2EULA 1D5NA 1FXHA 5FPRA 1TGOA 1XL6A 2UU9O 2CAZC 4LP8A 2ZXWC 1S3JA 1URFA 4J41A 1S5LZ 5GTIZ 3CD6V 4OPAA 3HKEB 3UO3A 3D3IA 4DV6B 1Y67A 3VBBA 5ITZB 3AK2A 3K58A 2UXBO 1XMQO 1NI8A 3RBZA 2JRIA 1OCZC 4UB6Z 2Q8VA 4O2AA 1L0LH 5IY5B 4J42A 4OXSA 2WLNA 5IY5C 2YI8A 3OGIB 2H3OA 5KUMA 3OE7G 2LGQA 1SERA 4DV1O 3ETDA 4FLZA 4KHPO 4HAMA 2WLIA 4MVMA 2Q9LA 5LOVA 1JVMA 4AHCA 2W6IG 5LOVB 1Y76A 3F7YC 3T1YB 1HR0O 2KKWA 1AI6A 3OMIB 1M57C 4JASA 5CB4A 3CCLV 1TA8A 3IJ4A 1GN3A 3K5NA 4Q6GA 2HEPA 3AG4B 3QVNA 4CH6A 4LF5B 3ZCCA 2Q6AA 3SPJA 1R3IC 2HVKC 2EZPA 4K8XA 4DUZB 4DR3B 3F7VC 3JYCA 4GT1A 1S5HC 2A7WA 3ABMC 2MK3A 5BZBA 4DV2B 3ZMTA 5K1XA 3N2GA 3O9OA 4MVOA 3BAAA 3OTFA 1H2GA 5F2VO 2WLLB 2H94A 4I50A 5J2TB 5LXTA 1VQLV 2P22C 3RVYA 4WBNA 3VQYA 3S3XA 4X88A 4HNAA 4PA4A 3FD9A 2DQ0A 1EZJA 1VQNV 4B3TO 1KD1W 3HKCB 4GUNA 4Z2WA 4F6EA 3OEHG 1TUEB 2DWEC 5H6QA 1VF5B 4B3RB 3NXSA 4UXNA 4FLWA 1QR8A 2YC0A 1RSOB 1Y4MA 4PDMA 1BSMA 1PP9H 4GX0A 1DF4A 1MZEA 4ZI7A 2EX3A 3ZX6A 2WWWA 1QNMA 1CP9A 2CK3G 2F23A 2JGDB 3KKYA 3WB0A 1XMOO 5CA3A 2GSMB 4NKGB 3E8FA 5B1OA 3FYIB 4AQYO 1S0VA 2F4VO 2HKOA 2OTJV 1NH2D 1V55B 1K5QA 4TV9A 2GUZB 3X2QB 3G80A 1BL8A 2OT5A 3X2QC 2WA4A 2QKCA 4IYIA 4JI3B 1QU7A 4B3MB 5A2QN 1Q8IA 4JI8B 3IAYA 2IBZH 3G67A 2Y4UA 2XAFA 2ZDIC 4X9QA 1EN4A 1DK1A 1BHBA 2UXDO 3ABLC 1FXKB 4FFBB 4YHHB 4I4TB 1WP8A 1I08A 4DUYB 3SGIA 3WU2Z 3FKSG 4NTYA 2VQEB 1N32B 2P67A 1N0JA 2K1EA 4KP4A 3JAWA 4YIPA 2LFSA 3WB1A 2XOKG 1AP6A 5ITZA 1D5AA 4IYHA 4DV5O 2BOBC 1S76D 5B1BC 3CWBH 2Q73A 4WFGA 4FK5C 4JTDB 1TVKB 4U3JB 4GCZA 2PI4A 4H13B 3T1YO 1SZTA 5KHJA 2QWNB 4QJFB 1K4CC 4FLVA 3ZHTA 1NQTA 1WA8B 1RPRA 1HR0B 1VQ5V 4LFBO 2EILC 4L87A 4JV5B 1BT8A 4LFCB 3L75H 3RWRD 4W4LA 3ASNC 3H01A 3MAQA 1M57B 4B3SB 3LSUA 5DN6G 1B3QA 4TSFG 1BCCH 2ZCEA 4U7OA 2GTSA 2E75B 2ETNA 4DR7O 4X1KA 1K34A 1S5JA 2F93B 4QE9A 2XT9A 2R72A 4DXWA 3SYPA 4FM2A 3TJTA 1YHQV 5GTHZ 3CRRA 1GAXA 1M5IA 2IJIA 4O2BB 5IJ0A 1PM9A 1P4RA 5DEDA 2BOCC 3B40A 3UM7A 1X59A 4BIUA 3LDCA 4JYAO 3E8BA 3H1JH 1VQ6V 2ZKOA 3S3WA 1H2LA 4X1YB 5C8YB 3K79A 1VQ9V 3AK3A 4DR1O 3RYHB 2X0LA 5IT9N 3B8NA 3SYQA 1OCOC 3OUFA 2P90A 2ZIOA 4FVMA 3RYFA 4Q20A 4E4EA 3RYFB 3VQVA 4CS2A 2R9RB 5JJNB 1NTKH 2X6CA 4MTXA 2PTMA 3ABKC 3MDSA 1R6NA 3CB2A 2X6BA 1CPYA 2FB5A 4MVQA 1VQPV 3SPCA 3BCCH 4JI0B 3OTOB 3K3WA 4CS3A 5L3EA 2LFRA 1CXZB 2VQEO 3VQWA 2BCCH 5JJJB 4YXWG 1H2NA 3L9DA 4MTFA 1IBMO 2EIJB 4GKJO 2ATKC 2AHYA 4O2BA 1O9GA 5KX5B 4DRXA 1M56C 4IHJB 2CTQA 4LF6O 1BQ0A 4J11A 3CP1A 3CRCA 4GZRB 3K03A 3UCSC 1KQSU 2IU0A 2WAMA 3GWOA 3R66A 4XBFA 1I7FA 3HPLC 5KMGB 2OCCB 5LL6Y 4LR3A 3OM3B 1UJWB 3N2KA 3HKDB 1SA0A 1J5EO 2B1GA 3DGEA 5J2UB 4BIOA 2JVDA 5BXZA 3HKDA 3G4SV 2Z3YA 1WP7A 1CEZA 4JI5O 2AHZA 1NVPD 4J7ZA 3OAAG 4PDVA 4O4LA 3CCRV 1K7DA 3KCYA 5LP6C 5GONA 1I5YA 1M90W 4H37A 5BY1A 1Q6IA 1DTOA 3OMAB 3UO2A 5JJEB 4N23A 3UQ8A 1H2MA 4UFZA 1FFXA 5KUKA 3SJQC 3TETA 4LH6A 5B1BB 1SRYA 3IFXA 2ARHA 1PV0A 1UFIA 2QGNA 1ZX3A 2DYRC 1FD9A 1QVFU 3K06A 3P3NA 4OGQB 3TXSA 4OX9O 4QPKA 2QTOA 2CTWA 1I0HA 3JD4A 4TQFA 1VF6A 4X1IA 1T5EA 1R3JC 4TV8A 1L0NH 1SS3A 4UCVA 1XNQB 5KA5A 1HNXB 2VWKA 1WLEA 1K8AW 1OCCC 4ASUG 2ADQB 1OCCB 4H33A 3PN1A 3ABKB 2CTPA 3ICXA 4JI4B 4GX5A 4X62B 3J80N 2PF4E 4CC6A 1QHTA 1QQCA 5JQGA 2VS0A 4UCOA 5DECA 4I9WA 5KHGA 2A79B 3CCMV 1NU1H 5EIBC 4DR5O 2FKXA 3IC7A 4GX1A 4BAYA 3LNMB 2IU3A 2QTSA 1AR4A 2Y0IA 4DV0O 3B77A 3H1IH 2NNUA 2LO1A 3DC6A 2VQFO 5LMUO 3ZRVA 2N04A 1W0KG 3LDEA 1OZ0A 1IBMB 3P32A 3ZRWA 3ABUA 2QM7A 5KA6A 5EIBD 2EIKB 1RSOA 2QWRB 1HNWB 1SZXA 1YCIA 1SQXH 1WPXA 2FL4A 2QWOB 3LNNA 4DUZO 2EJRA 1XNRO 2HJDA 2ILMA 2KB1A 4C7UA 2UXBB 3DXRB 3J81N 4JAAA 1FFTB 3L74H 1GN6A 1Q6HA 1YEWA 3SYAA 3CMEV 1R1BA 1YTFD 2EINB 2KG7B 1GM7A 4U3JA 2IM9A 1KKCA 1TVKA 2QWPB 5TISZ 4J9ZB 1OV9A 1IDSA 2JS3A 1S72V 1M56B 4K0KB 1PNMA 4GLXA 1FFXB 4G28B 1PNKA 3MHHC 5CA0A 1N34O 3QO8A 1BGYH 1L1FA 4FJCC 3GWKC 1F4NA 4MT8A 3C3SA 2IJHA 1FXKA 4FFBA 2A06H 1SC5B 1Y76B 1OCRC 2P5OA 1KECA 3ZN1A 4LF7B 3ASOC 4R50A 3JASA 5KMGA 4LF9O 3HKBB 4LF9B 5H9CA 2HHHB 4TV9B 3QO7A 2WLJA 4JI7O 3L73H 3CXCU 4IHJA 1JA8A 1IBKB 4UCUA 1Z5WA 2LGWA 1GKFA 1XQ8A 2UU9B 2X6AA 2IH3C 5EZYB 2JDIG 4I55A 3E8HA 3JAMN 5JQGB 3ETQA 2YIAA 3C90A 4QNHB 4JI4O 1GH6A 1XUQA 2Q7HA 3FB6C 4MW3A 1EN6A 3JARA 4NR1A 1OCOB 5IYZA 1F4MA 4JI6O 1HNWO 1ZTEA 3ZJZA 1QCEA 2B1IA 2XAGA 5BR8B 3TXQA 1GTOA 2LJ2A 3OGCC 4FPPA 4LBEC 4LNUA 4X1IB 2ZNIA 2GV9A 3JATA 4WBNB 3ZMZA 1B6QA 3QG5A 4YJ3B 4BW5A 1NBMG 4HZ3A 2D2CB 3CPWU 4NXMO 4B3SO 5FL7G 4GKJB 3BVOA 1GN2A 3M99B 4CBCA 5CA1B 1Q86W 4X66B 4IIJB 3OTOO 2ZM6O 1BE3H 1COWG 3J7AU 3CRQA 3VQXA 1NJIW 3FX7A 2W0FC 3ZHQA 3K5MA 1B06A 1G8MA 4EEQA 5EYPA 3G6BA 4MTOA 3K0DA 1RFYA 4QPJA 4LF4B 4JI2B 4RWUA 3P30A 1XMQB 4DV4B 3ZS8C 1JOYA 3LSQA 2MW2B 5EC2C 5IJ9A 4X64O 5CB4B 1M9NA 4TT3G 3U10A 4DV2O 1AJPA 1MOFA 3CHXA 2PUSA 2YICA 2DYSB 3ABLB 1JQ0A 2UXXA 4Z1MG 2YIDA 4PDLA 3CE2A 3ZHVA 2QJ1A 4PELA 4X62O 3U11A 1WA8A 2K9PA 2PZSA 3ETEA 1YJ9V 4O2AB 2LW7A 3GB7C 1SQFA 4RQEA 2JEUA 4DR5B 1Q5OA 1XREA 2F1MA 1IVSA 1I94B 1N33B 4PV1B 3AG1C 2PY5A 3AG1B 1OCZB 1NT2B 4DR7B 4MS2A 4CH5A 2FYUH 1YTFB 4O4JA 2YI9A 3JCZA 2PYJA 4RUFA 1AR5A 2BSKB 3CS5A 3E22A 3T4ZA 3I55V 4DK0A 5JWPA 2HHHO 1YZBA 3STZC 2CGOA 3W7WA 2ZR2A 2P06A 3STLC 4YY3B 2Q5ZA 2H8PC 2DW4A 3BABA 5H5NA 1WN7A 2QR4A 3ASOB 3JAKB 3RYHA 1YDXA 4I9QA 1MA1A 1SETA 4CH3A 1DGSA 3IC9A 3BY6A 4TOIA 4WFHA 4FLUA 1FS0G 5JVDB 5EYPB 4CZZA 2RNBA 3M7MX 3TK1A 4AI8A 4J9YB 5CBHA 2IJKA 3OMNB 1MG1A 1N36B 3KZIZ 1PL4A 3RW0A 3W7XA 5CBGA 1AP5A 5K1PA 2QKSA 4A5UB 3SPIA 1XNQO 1YJWV 3ABTA 3DTUB 5D5QA 1GMGA 2UXCB 4X1KB 4CH4A 1GRJA 2EIKC 1PNLA 3WB2A 4MVSA 3OFNG 3K9AA 3NR7A 2LW1A 2R70A 1XEQA 3ZMUA 1G4YB 3FB7C 4JAVA 1US6A 3HKCA 2Q67A 5LA6A 5IYZB 1HW7A 2DOSA 2YXHA 5B66Z 4HNAB 3ZHUA 3CSXA 2CUGA 1G6UA 4JGSA 2BSKA 1LUVA 3RN4A 3JD0A 5LXTB 2EINC 4XDJA 4QGPA 2WLLA 3HB3B 4KUMA 4N21A 4UVAA 3QNEA 4JYYA 3E35A 5JH7A 4TUYA 3ZRXA 2W6JG 4RQFA 3K04A 1MSWD 1AI4A 4B3RO 2N74A 4P30A 2C2AA 1OJHA 4GKKO 5HFMA 4YY3O 2RN9A 5FPOA 4EFBA 4B3TB 2Q68A 5LYJA 4PA7A 4K0KO 2HLDG 3E2EA 2XTAA 4NTXA 3JASB 5LHGA 1VF7A 1YVWA 1KB9F 2HVJC 2PI5A 2Q0AA 3APOA 4ZHQB 4XDLA 4JPRA 3D8CA 2ZE8A 1S77D 2OCHA 3OR7C 4JV5O 1V54C 3DSQA 1R3KC 4B08A 5DM6V 3RT3C 2A0LA 4EB6A 3EVKA 4ZHQA 4DV1B 2Q7GA 5AG2A 4TWKA 5IYCO 1Q6UA 4K3AA 5IJ9B 3EXAA 3BHPA 2VWJA 4O4HB 3L70H 4UB8Z 4NVPA 1QLEC 5A9GA 2YS8A 1Q43A 4FZ1A 2OYQA 1NZ6A 1H8EG 2WLHA 3JD3A 2G38A 4LFCO 2ZIMA 2ZINA 3LUTB 4PA6A 1ORQC 4WFAV 3K59A 4UVCA 4O4IA 1A32A 4JTAB 5EK0A 2YIBA 3WG7C 1YSCA 2BTQB 3ZIAG 1AROP 4RO2A 2JGDA 2E5LO 4LF8O 4I7ZB 4ZI7B 2P7TC 1PD3A 3D36C 4YJ3A 4LWSA 1KKDA 3ML0A 1N34B 5IYDO 3JATB 3QO5A 2WA3A 3K08A 1ZWIC 4DV5B 5KLVH 4TQDA 3DXRA 2N05A 1IXMA 1HDJA 3QTCA 1IBLO 4HBNA 1BHAA 1KBHA 4NYKA 2YEVB 2HJFC 2CTRA 4DR3O 4GYCB 3RYIB 1BMFG 4D7TA 1MABG 5C93A 1N32O 4DW1A 2Q4PA 1WB8A 2HR3A 1TAEA 4X8AA 4LFBB 2BTQA 1K3EA 3JD2A 3CCJV 4I55B 2F4VB 3BEHA 2Y48A 4DR1B 3FB5C 3RVZA 2ZXWB 2UUCB 5BR8O 3W7TA 2QSAA 3SJCC 1V55C 5H6RA 4FM0A 1WJZA 2E74B 4G27B 4JZGA 3Q4HA 1P49A 2F43G 2UXDB 3JAKA 1JJ2U 3P3PA 1IZ3A 2IH1C 2AXTZ 1XMOB 3RFRA 4D6TH 1WAZA 4KXRA 1V54B 3E83A 3A0RA 1XBLA 2DJVA 4MVRA 2JK5C 3H9VA 4OPHA 3PJSK 1FXKC 2AZ0A 3FYEB 2LQTA 3CCEV 1HNZO 1E79G 5B1NA 1P7BA 2YSUB 4NXNO 1NR7A 2PYLA 2F66C 1AI5A 1MMMA 2RJZA 2WSSG 1FJGB 2VQFB 2F95B 3C3TA 3HKEA 4TUYB 2ITCC 1KC8W 2E76B 2E5LB 3E89A 2KG7A 1GM9A 3CXHF 3ETGA 5JCOC 2CDYA 1I94O 5KHHA 3T1CA 1AJNA 2OCCC 2JIZG 3SJAC 2EILB 4B7EA 4JI7B 4QIWF 4YJ2A 4B3MO 2WLKA 2P4KA 3AG2C 2PGGA 1U96A 4X66O 3LDDA 5CMUA 1SA0B 3T2MA 3B09A 1QBZA 1LR1A 4U3FH 1KUQA 1HNXO 4E2LA 3G6EV 2L6LA 1JR9A 1SQBH 5J9PC 4P9PA 3T1HO 2Y69C 2W0XA 1SKVA 3CJHA 1W59A 1JFFB 4NTWA 1MZFA 4JI1B 2DQ3A 3K57A 1KU9A 1Q7YW 4CC5A 5KX5A 1RPOA 3ABMB 4BWAA 4B7KA 5GW7A 3ZBHA 1SQVH 3BFRA 2GHYA 3HR0A 4LF5O 2HG5C 4LCUC 3SPGA 4RAIA 1D2DA 1R3LC 1AI7A 4J10A 4R6ZA 4PHZA 2X7RB 2DE0X 1F23A 2CH7B 2QA4V 4ZOLB 4X89A 4IT5A 2E3CA 4ZBMA 3JALB 5KHIA 3B2EE 2UUAO 5C8YA 5B3SB 1VF6C 3G71V 4JI2O 2EIMB 3AG7A 1M93A 1VQ8V 3CRMA 3E22B 1EFRG 3ZMSA 1GM8A 5BMVA 2QE7G 4DO2A 4DW0A 4F4LA 3T4DA 3CRAA 3TCUA 1GO3F 5L3FA 2UXCO 4PDRA 2QWQB 4DR2B 1L8DA 4UV8A 2IJJA 2GBOA 3UT5A 3VOUA 2V4DA 4WCEV 2ZD9A 3JCUZ 4FLYA 2P4VA 2DWDC 1SQGA 4U7NA 2M7WA 3AEIA 4FM1A 5LP6A 4O4LB 1H2SB 4BR6A 5E79Z 4ABMA 3A2FA 2O57A 5LGNA 2OTLV 2QEXV 2ZE5A 1GN4A 3RYCB 4UCRA 1VQOV 2NLJC 4KFMA 2M6YA 5HFLA 1OCRB 1QR9A 5L3BA 3SPHA 3L71H 2DYSC 1Z5VA 2WLMA 3RYCA 3F5WC 3N2KB 5IYBO 2HP8A 5LHHA 2RQ6A 4J7JA 3ZHSA 4FMTA 4X65B 2Y69B 4DR6B 1QLEB 3CX5F 5D5PA 1PPJH 5KHKA 3K5LA 1N36O 1ZL8B 1Q82W 5KAFZ 1PKXA 1G1XB 5EBLC 1DF5A 5LGTA 3ZHRA 2FMLA 2XHBA 1Y66A 1K4DC 3EFFK 2QM8A 1N4CA 3OEEG 4EKWA 4DR4O 3I56V 5CA1A 1J5EB 4AQYB 5BMVB 4DV3O 1K73W 1P7GA 1Y74A 2Q0OC 2YUAA 3CEIA 5B5EZ 2NR5A 2AGAA 1E1RG 1JPXA 4I4TA 1R73A 4DR2O 4IL6Z 4DV4O 4DK1A 3T1HB 4FZ0A 1VQ4V 5EBMC 4R8CA 1HP8A 2Z5UA 2UUBO 3ZN0A 1FPOA 1V9PA 2Y4TA 4JI6B 2A3QA 3CMAV 1KP2A 5LHIA 5FNVB 4ICGA 4JYAB 2XASA 2ZE7A 1THZA 1SQQH 4X1YA 2XAQA 4L8JA 3CCSV 1ENVA 1XOUA 2CGNA 3AG3C 1NH2B 3AK1A 2EIMC 3AG3B 2UUAB 4J7KA 4PD4F 3B8MA 1WPBA 4QE7A 5EZYA 2XUMA 3L72H 4DV6O 3K9SA 2ZNJA 3R65A 5LMNB 4ZIBA 3W7UA 1K97A 1H38A 1ROPA 2Y0PA 1YITV 3O65A 3MD0A 3CJHB 1AJQA 3HKBA 1WNSA
chains in the Genus database with same CATH topology
1Q6HA 1Q6IA 1Q6UA 1FD9A 3B09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  1Q6I A;  1Q6U A;  1FD9 A;  3B09 A; 
#chains in the Genus database with same CATH topology
 1AIL A;  3SDL A;  1FYJ A;  5FNV A;  3LSS A;  4R7C A;  1XL4 A;  2YEV A;  2ZM6 B;  3CC7 V;  1IBL B;  2V1D A;  4MSW C;  4TV8 B;  2IW5 A;  4X64 B;  4MVU A;  5EBW C;  5IDJ A;  3E8G A;  1K92 A;  1FAF A;  4PA9 A;  3H1L H;  1Y74 B;  3BA9 A;  2Q69 A;  1VEW A;  4LF8 B;  4JZ2 A;  2Q7E A;  3GVM A;  3WFV A;  4OX9 B;  5CA0 B;  1YIJ V;  4FIP C;  3CCQ V;  3I5D A;  4O4I B;  1Y6X A;  3DC5 A;  1IBK O;  1QLN A;  2YDE A;  4LFA B;  3FAV A;  3K0G A;  4IGG A;  4DV3 B;  1B04 A;  3FAV B;  5KAI Z;  1JMK C;  3W7S A;  1W2B U;  3H1K H;  4UVB A;  3QF7 A;  4DUY O;  3UKM A;  1ZL8 A;  4UUJ C;  2FTK A;  1JX9 A;  4DV7 O;  4MW8 A;  1N33 O;  4KL1 A;  5LGU A;  2XAJ A;  1EZV H;  1LNQ A;  4FLT A;  1KP3 A;  1Q3E A;  4EB6 B;  1M4U A;  1IUR A;  1YJN V;  3E86 A;  4UCT A;  2WLI B;  1XIL A;  3ASN B;  5J2U A;  4K35 A;  2ZDI A;  2BTO A;  1ZAU A;  2DN9 A;  1ZSP A;  1XHX A;  3Q4H B;  3ZRW B;  5LP6 B;  5H2F Z;  1VP7 A;  2ZR3 A;  2KSD A;  1NTZ H;  3CC4 V;  3ZRS A;  4CS4 A;  4JI0 O;  2JJ1 G;  3CYO A;  4K8Z A;  2AZ2 A;  4DRX B;  1I5X A;  3RGB A;  3N27 A;  4H0L B;  1QVG U;  4YHH O;  4WF9 V;  5L3G A;  2DYR B;  5B1A C;  1ZLZ A;  1N0N A;  2DMX A;  5LMN O;  4RUE A;  5B1A B;  4LF4 O;  2R9A A;  1EBO A;  1YI2 V;  2XND G;  1E1Q G;  4MTG A;  1F51 A;  3JSL A;  2RDC A;  4JI5 B;  1YXB A;  4JI8 O;  1M1K W;  2JS5 A;  1SES A;  5IWA O;  4I5S A;  1RM1 C;  1K33 A;  1OHH G;  1WB7 A;  4JYB A;  3U0Z A;  1AB3 A;  4NXN B;  2VRZ A;  2R9I A;  1BZK A;  4G2K A;  1AR1 B;  3JAL A;  2B9Z A;  3SJB C;  1HNZ B;  1MNG A;  3CC2 V;  2XAH A;  3JSN A;  1NTM H;  2NN4 A;  2LP7 A;  4JI1 O;  4DV0 B;  5B3S C;  4DV7 B;  1VQK V;  4FFK A;  2QDO A;  2CH7 A;  4LWS B;  4H44 B;  1ZUQ A;  2AW9 A;  2EJ7 A;  2OIG A;  5IE9 A;  1K5S A;  3OT7 A;  3BPZ A;  2Z0A A;  2ODM A;  5L3C A;  1VQ7 V;  4JI3 O;  3N2G B;  4MVZ A;  1X4T A;  2P6J A;  1XNR B;  1IXB A;  3B4S A;  2EIJ C;  1GK9 A;  4WFE A;  1PL0 A;  5IJ0 B;  4F6R B;  1VQM V;  3KCX A;  2OWO A;  3TGU H;  1XHZ A;  2A9H A;  5GON B;  4P9O A;  1NVP B;  1SQP H;  1R6K A;  4O4H A;  3CCV V;  1LUW A;  1JCH A;  1MSD A;  5EC1 C;  4DYL A;  5LBQ A;  1FJG O;  2WPD G;  1R6T A;  2BE3 A;  1JJO A;  4W4K A;  4I0X A;  4GX2 A;  1XDC A;  1EM1 A;  4LC1 A;  4X20 B;  1EN5 A;  1P84 F;  1H8H G;  1TUB A;  4YJ2 B;  2V7Q G;  1BS3 A;  4GKK B;  5E1A C;  2GTA A;  1K9M W;  3APQ A;  3ZMV A;  3AG4 C;  5LYJ B;  5JCO A;  2GDS A;  2UUC O;  1NKD A;  4NXM B;  3SYO A;  2QM4 A;  4X65 O;  3UT5 B;  1Q81 W;  1N8R W;  2RMK B;  1DLB A;  2ADP A;  1Q90 D;  1VMG A;  5JH7 B;  2EBO A;  1F7Y A;  4JAU A;  1Z2G A;  2QKA A;  3MHS C;  2RCV A;  4UCS A;  1XI1 A;  4BW9 A;  3F5T A;  4BIZ A;  4JYC A;  5FLX N;  4DR6 O;  4KHP B;  3JD1 A;  2ITD C;  3JAW B;  4PI0 A;  4PJ0 Z;  3ZED A;  3BRC A;  4PA3 A;  5CBF A;  2JGU A;  1RM1 B;  1TUB B;  2ZT9 B;  1YF2 A;  4YIO A;  4X20 A;  5IWA B;  1UPG A;  5LA6 B;  5CN0 A;  2KQX A;  2YIB D;  4I0X B;  3AG2 B;  4JTC B;  4EFE A;  3OW2 U;  4J80 A;  1W0J G;  3SYC A;  4LH7 A;  2L35 A;  4LF6 B;  1AVM A;  1HWY A;  3D3Q A;  1VIB A;  1H2K A;  1U97 A;  2YXL A;  4ZOL A;  3EHB B;  3BA8 A;  1IX9 A;  3M8A A;  3OUS A;  1VAR A;  3THO A;  2EZO A;  3H1H H;  2GUZ A;  1O9H A;  3OD4 A;  2YXY A;  4JF3 A;  4F6R A;  2B5U A;  2HFE C;  1NR1 A;  3SR2 C;  2OIE A;  2JJ2 G;  4WFB V;  4NB5 A;  2CE4 A;  3IGA C;  1RP3 B;  4IIJ A;  3A0H Z;  5JVD A;  2UXN A;  3CCU V;  3WG7 B;  4P2Z A;  1KYO F;  3OR6 C;  1KMI Z;  1JFF A;  2D3O W;  5L3D A;  1SF9 A;  3A8T A;  3FFQ A;  2ZE6 A;  1J95 A;  3K5O A;  4LNU B;  3A0B Z;  4Z1V A;  3RYI A;  4UV9 A;  4D7S A;  4HYO A;  3KG2 A;  4XDK A;  1FXV A;  1NS1 A;  3JAR B;  1BQZ A;  4DR4 B;  4FLX A;  1FKA O;  4AIL C;  3D36 A;  5LMU B;  2JEX A;  4ZKI A;  4LF7 O;  4WFF A;  4LFA O;  2ZQM A;  4PI2 A;  2UUB B;  4O4J B;  4I50 B;  3FB8 C;  5J2T A;  2EUL A;  1D5N A;  1FXH A;  5FPR A;  1TGO A;  1XL6 A;  2UU9 O;  2CAZ C;  4LP8 A;  2ZXW C;  1S3J A;  1URF A;  4J41 A;  1S5L Z;  5GTI Z;  3CD6 V;  4OPA A;  3HKE B;  3UO3 A;  3D3I A;  4DV6 B;  1Y67 A;  3VBB A;  5ITZ B;  3AK2 A;  3K58 A;  2UXB O;  1XMQ O;  1NI8 A;  3RBZ A;  2JRI A;  1OCZ C;  4UB6 Z;  2Q8V A;  4O2A A;  1L0L H;  5IY5 B;  4J42 A;  4OXS A;  2WLN A;  5IY5 C;  2YI8 A;  3OGI B;  2H3O A;  5KUM A;  3OE7 G;  2LGQ A;  1SER A;  4DV1 O;  3ETD A;  4FLZ A;  4KHP O;  4HAM A;  2WLI A;  4MVM A;  2Q9L A;  5LOV A;  1JVM A;  4AHC A;  2W6I G;  5LOV B;  1Y76 A;  3F7Y C;  3T1Y B;  1HR0 O;  2KKW A;  1AI6 A;  3OMI B;  1M57 C;  4JAS A;  5CB4 A;  3CCL V;  1TA8 A;  3IJ4 A;  1GN3 A;  3K5N A;  4Q6G A;  2HEP A;  3AG4 B;  3QVN A;  4CH6 A;  4LF5 B;  3ZCC A;  2Q6A A;  3SPJ A;  1R3I C;  2HVK C;  2EZP A;  4K8X A;  4DUZ B;  4DR3 B;  3F7V C;  3JYC A;  4GT1 A;  1S5H C;  2A7W A;  3ABM C;  2MK3 A;  5BZB A;  4DV2 B;  3ZMT A;  5K1X A;  3N2G A;  3O9O A;  4MVO A;  3BAA A;  3OTF A;  1H2G A;  5F2V O;  2WLL B;  2H94 A;  4I50 A;  5J2T B;  5LXT A;  1VQL V;  2P22 C;  3RVY A;  4WBN A;  3VQY A;  3S3X A;  4X88 A;  4HNA A;  4PA4 A;  3FD9 A;  2DQ0 A;  1EZJ A;  1VQN V;  4B3T O;  1KD1 W;  3HKC B;  4GUN A;  4Z2W A;  4F6E A;  3OEH G;  1TUE B;  2DWE C;  5H6Q A;  1VF5 B;  4B3R B;  3NXS A;  4UXN A;  4FLW A;  1QR8 A;  2YC0 A;  1RSO B;  1Y4M A;  4PDM A;  1BSM A;  1PP9 H;  4GX0 A;  1DF4 A;  1MZE A;  4ZI7 A;  2EX3 A;  3ZX6 A;  2WWW A;  1QNM A;  1CP9 A;  2CK3 G;  2F23 A;  2JGD B;  3KKY A;  3WB0 A;  1XMO O;  5CA3 A;  2GSM B;  4NKG B;  3E8F A;  5B1O A;  3FYI B;  4AQY O;  1S0V A;  2F4V O;  2HKO A;  2OTJ V;  1NH2 D;  1V55 B;  1K5Q A;  4TV9 A;  2GUZ B;  3X2Q B;  3G80 A;  1BL8 A;  2OT5 A;  3X2Q C;  2WA4 A;  2QKC A;  4IYI A;  4JI3 B;  1QU7 A;  4B3M B;  5A2Q N;  1Q8I A;  4JI8 B;  3IAY A;  2IBZ H;  3G67 A;  2Y4U A;  2XAF A;  2ZDI C;  4X9Q A;  1EN4 A;  1DK1 A;  1BHB A;  2UXD O;  3ABL C;  1FXK B;  4FFB B;  4YHH B;  4I4T B;  1WP8 A;  1I08 A;  4DUY B;  3SGI A;  3WU2 Z;  3FKS G;  4NTY A;  2VQE B;  1N32 B;  2P67 A;  1N0J A;  2K1E A;  4KP4 A;  3JAW A;  4YIP A;  2LFS A;  3WB1 A;  2XOK G;  1AP6 A;  5ITZ A;  1D5A A;  4IYH A;  4DV5 O;  2BOB C;  1S76 D;  5B1B C;  3CWB H;  2Q73 A;  4WFG A;  4FK5 C;  4JTD B;  1TVK B;  4U3J B;  4GCZ A;  2PI4 A;  4H13 B;  3T1Y O;  1SZT A;  5KHJ A;  2QWN B;  4QJF B;  1K4C C;  4FLV A;  3ZHT A;  1NQT A;  1WA8 B;  1RPR A;  1HR0 B;  1VQ5 V;  4LFB O;  2EIL C;  4L87 A;  4JV5 B;  1BT8 A;  4LFC B;  3L75 H;  3RWR D;  4W4L A;  3ASN C;  3H01 A;  3MAQ A;  1M57 B;  4B3S B;  3LSU A;  5DN6 G;  1B3Q A;  4TSF G;  1BCC H;  2ZCE A;  4U7O A;  2GTS A;  2E75 B;  2ETN A;  4DR7 O;  4X1K A;  1K34 A;  1S5J A;  2F93 B;  4QE9 A;  2XT9 A;  2R72 A;  4DXW A;  3SYP A;  4FM2 A;  3TJT A;  1YHQ V;  5GTH Z;  3CRR A;  1GAX A;  1M5I A;  2IJI A;  4O2B B;  5IJ0 A;  1PM9 A;  1P4R A;  5DED A;  2BOC C;  3B40 A;  3UM7 A;  1X59 A;  4BIU A;  3LDC A;  4JYA O;  3E8B A;  3H1J H;  1VQ6 V;  2ZKO A;  3S3W A;  1H2L A;  4X1Y B;  5C8Y B;  3K79 A;  1VQ9 V;  3AK3 A;  4DR1 O;  3RYH B;  2X0L A;  5IT9 N;  3B8N A;  3SYQ A;  1OCO C;  3OUF A;  2P90 A;  2ZIO A;  4FVM A;  3RYF A;  4Q20 A;  4E4E A;  3RYF B;  3VQV A;  4CS2 A;  2R9R B;  5JJN B;  1NTK H;  2X6C A;  4MTX A;  2PTM A;  3ABK C;  3MDS A;  1R6N A;  3CB2 A;  2X6B A;  1CPY A;  2FB5 A;  4MVQ A;  1VQP V;  3SPC A;  3BCC H;  4JI0 B;  3OTO B;  3K3W A;  4CS3 A;  5L3E A;  2LFR A;  1CXZ B;  2VQE O;  3VQW A;  2BCC H;  5JJJ B;  4YXW G;  1H2N A;  3L9D A;  4MTF A;  1IBM O;  2EIJ B;  4GKJ O;  2ATK C;  2AHY A;  4O2B A;  1O9G A;  5KX5 B;  4DRX A;  1M56 C;  4IHJ B;  2CTQ A;  4LF6 O;  1BQ0 A;  4J11 A;  3CP1 A;  3CRC A;  4GZR B;  3K03 A;  3UCS C;  1KQS U;  2IU0 A;  2WAM A;  3GWO A;  3R66 A;  4XBF A;  1I7F A;  3HPL C;  5KMG B;  2OCC B;  5LL6 Y;  4LR3 A;  3OM3 B;  1UJW B;  3N2K A;  3HKD B;  1SA0 A;  1J5E O;  2B1G A;  3DGE A;  5J2U B;  4BIO A;  2JVD A;  5BXZ A;  3HKD A;  3G4S V;  2Z3Y A;  1WP7 A;  1CEZ A;  4JI5 O;  2AHZ A;  1NVP D;  4J7Z A;  3OAA G;  4PDV A;  4O4L A;  3CCR V;  1K7D A;  3KCY A;  5LP6 C;  5GON A;  1I5Y A;  1M90 W;  4H37 A;  5BY1 A;  1Q6I A;  1DTO A;  3OMA B;  3UO2 A;  5JJE B;  4N23 A;  3UQ8 A;  1H2M A;  4UFZ A;  1FFX A;  5KUK A;  3SJQ C;  3TET A;  4LH6 A;  5B1B B;  1SRY A;  3IFX A;  2ARH A;  1PV0 A;  1UFI A;  2QGN A;  1ZX3 A;  2DYR C;  1FD9 A;  1QVF U;  3K06 A;  3P3N A;  4OGQ B;  3TXS A;  4OX9 O;  4QPK A;  2QTO A;  2CTW A;  1I0H A;  3JD4 A;  4TQF A;  1VF6 A;  4X1I A;  1T5E A;  1R3J C;  4TV8 A;  1L0N H;  1SS3 A;  4UCV A;  1XNQ B;  5KA5 A;  1HNX B;  2VWK A;  1WLE A;  1K8A W;  1OCC C;  4ASU G;  2ADQ B;  1OCC B;  4H33 A;  3PN1 A;  3ABK B;  2CTP A;  3ICX A;  4JI4 B;  4GX5 A;  4X62 B;  3J80 N;  2PF4 E;  4CC6 A;  1QHT A;  1QQC A;  5JQG A;  2VS0 A;  4UCO A;  5DEC A;  4I9W A;  5KHG A;  2A79 B;  3CCM V;  1NU1 H;  5EIB C;  4DR5 O;  2FKX A;  3IC7 A;  4GX1 A;  4BAY A;  3LNM B;  2IU3 A;  2QTS A;  1AR4 A;  2Y0I A;  4DV0 O;  3B77 A;  3H1I H;  2NNU A;  2LO1 A;  3DC6 A;  2VQF O;  5LMU O;  3ZRV A;  2N04 A;  1W0K G;  3LDE A;  1OZ0 A;  1IBM B;  3P32 A;  3ZRW A;  3ABU A;  2QM7 A;  5KA6 A;  5EIB D;  2EIK B;  1RSO A;  2QWR B;  1HNW B;  1SZX A;  1YCI A;  1SQX H;  1WPX A;  2FL4 A;  2QWO B;  3LNN A;  4DUZ O;  2EJR A;  1XNR O;  2HJD A;  2ILM A;  2KB1 A;  4C7U A;  2UXB B;  3DXR B;  3J81 N;  4JAA A;  1FFT B;  3L74 H;  1GN6 A;  1Q6H A;  1YEW A;  3SYA A;  3CME V;  1R1B A;  1YTF D;  2EIN B;  2KG7 B;  1GM7 A;  4U3J A;  2IM9 A;  1KKC A;  1TVK A;  2QWP B;  5TIS Z;  4J9Z B;  1OV9 A;  1IDS A;  2JS3 A;  1S72 V;  1M56 B;  4K0K B;  1PNM A;  4GLX A;  1FFX B;  4G28 B;  1PNK A;  3MHH C;  5CA0 A;  1N34 O;  3QO8 A;  1BGY H;  1L1F A;  4FJC C;  3GWK C;  1F4N A;  4MT8 A;  3C3S A;  2IJH A;  1FXK A;  4FFB A;  2A06 H;  1SC5 B;  1Y76 B;  1OCR C;  2P5O A;  1KEC A;  3ZN1 A;  4LF7 B;  3ASO C;  4R50 A;  3JAS A;  5KMG A;  4LF9 O;  3HKB B;  4LF9 B;  5H9C A;  2HHH B;  4TV9 B;  3QO7 A;  2WLJ A;  4JI7 O;  3L73 H;  3CXC U;  4IHJ A;  1JA8 A;  1IBK B;  4UCU A;  1Z5W A;  2LGW A;  1GKF A;  1XQ8 A;  2UU9 B;  2X6A A;  2IH3 C;  5EZY B;  2JDI G;  4I55 A;  3E8H A;  3JAM N;  5JQG B;  3ETQ A;  2YIA A;  3C90 A;  4QNH B;  4JI4 O;  1GH6 A;  1XUQ A;  2Q7H A;  3FB6 C;  4MW3 A;  1EN6 A;  3JAR A;  4NR1 A;  1OCO B;  5IYZ A;  1F4M A;  4JI6 O;  1HNW O;  1ZTE A;  3ZJZ A;  1QCE A;  2B1I A;  2XAG A;  5BR8 B;  3TXQ A;  1GTO A;  2LJ2 A;  3OGC C;  4FPP A;  4LBE C;  4LNU A;  4X1I B;  2ZNI A;  2GV9 A;  3JAT A;  4WBN B;  3ZMZ A;  1B6Q A;  3QG5 A;  4YJ3 B;  4BW5 A;  1NBM G;  4HZ3 A;  2D2C B;  3CPW U;  4NXM O;  4B3S O;  5FL7 G;  4GKJ B;  3BVO A;  1GN2 A;  3M99 B;  4CBC A;  5CA1 B;  1Q86 W;  4X66 B;  4IIJ B;  3OTO O;  2ZM6 O;  1BE3 H;  1COW G;  3J7A U;  3CRQ A;  3VQX A;  1NJI W;  3FX7 A;  2W0F C;  3ZHQ A;  3K5M A;  1B06 A;  1G8M A;  4EEQ A;  5EYP A;  3G6B A;  4MTO A;  3K0D A;  1RFY A;  4QPJ A;  4LF4 B;  4JI2 B;  4RWU A;  3P30 A;  1XMQ B;  4DV4 B;  3ZS8 C;  1JOY A;  3LSQ A;  2MW2 B;  5EC2 C;  5IJ9 A;  4X64 O;  5CB4 B;  1M9N A;  4TT3 G;  3U10 A;  4DV2 O;  1AJP A;  1MOF A;  3CHX A;  2PUS A;  2YIC A;  2DYS B;  3ABL B;  1JQ0 A;  2UXX A;  4Z1M G;  2YID A;  4PDL A;  3CE2 A;  3ZHV A;  2QJ1 A;  4PEL A;  4X62 O;  3U11 A;  1WA8 A;  2K9P A;  2PZS A;  3ETE A;  1YJ9 V;  4O2A B;  2LW7 A;  3GB7 C;  1SQF A;  4RQE A;  2JEU A;  4DR5 B;  1Q5O A;  1XRE A;  2F1M A;  1IVS A;  1I94 B;  1N33 B;  4PV1 B;  3AG1 C;  2PY5 A;  3AG1 B;  1OCZ B;  1NT2 B;  4DR7 B;  4MS2 A;  4CH5 A;  2FYU H;  1YTF B;  4O4J A;  2YI9 A;  3JCZ A;  2PYJ A;  4RUF A;  1AR5 A;  2BSK B;  3CS5 A;  3E22 A;  3T4Z A;  3I55 V;  4DK0 A;  5JWP A;  2HHH O;  1YZB A;  3STZ C;  2CGO A;  3W7W A;  2ZR2 A;  2P06 A;  3STL C;  4YY3 B;  2Q5Z A;  2H8P C;  2DW4 A;  3BAB A;  5H5N A;  1WN7 A;  2QR4 A;  3ASO B;  3JAK B;  3RYH A;  1YDX A;  4I9Q A;  1MA1 A;  1SET A;  4CH3 A;  1DGS A;  3IC9 A;  3BY6 A;  4TOI A;  4WFH A;  4FLU A;  1FS0 G;  5JVD B;  5EYP B;  4CZZ A;  2RNB A;  3M7M X;  3TK1 A;  4AI8 A;  4J9Y B;  5CBH A;  2IJK A;  3OMN B;  1MG1 A;  1N36 B;  3KZI Z;  1PL4 A;  3RW0 A;  3W7X A;  5CBG A;  1AP5 A;  5K1P A;  2QKS A;  4A5U B;  3SPI A;  1XNQ O;  1YJW V;  3ABT A;  3DTU B;  5D5Q A;  1GMG A;  2UXC B;  4X1K B;  4CH4 A;  1GRJ A;  2EIK C;  1PNL A;  3WB2 A;  4MVS A;  3OFN G;  3K9A A;  3NR7 A;  2LW1 A;  2R70 A;  1XEQ A;  3ZMU A;  1G4Y B;  3FB7 C;  4JAV A;  1US6 A;  3HKC A;  2Q67 A;  5LA6 A;  5IYZ B;  1HW7 A;  2DOS A;  2YXH A;  5B66 Z;  4HNA B;  3ZHU A;  3CSX A;  2CUG A;  1G6U A;  4JGS A;  2BSK A;  1LUV A;  3RN4 A;  3JD0 A;  5LXT B;  2EIN C;  4XDJ A;  4QGP A;  2WLL A;  3HB3 B;  4KUM A;  4N21 A;  4UVA A;  3QNE A;  4JYY A;  3E35 A;  5JH7 A;  4TUY A;  3ZRX A;  2W6J G;  4RQF A;  3K04 A;  1MSW D;  1AI4 A;  4B3R O;  2N74 A;  4P30 A;  2C2A A;  1OJH A;  4GKK O;  5HFM A;  4YY3 O;  2RN9 A;  5FPO A;  4EFB A;  4B3T B;  2Q68 A;  5LYJ A;  4PA7 A;  4K0K O;  2HLD G;  3E2E A;  2XTA A;  4NTX A;  3JAS B;  5LHG A;  1VF7 A;  1YVW A;  1KB9 F;  2HVJ C;  2PI5 A;  2Q0A A;  3APO A;  4ZHQ B;  4XDL A;  4JPR A;  3D8C A;  2ZE8 A;  1S77 D;  2OCH A;  3OR7 C;  4JV5 O;  1V54 C;  3DSQ A;  1R3K C;  4B08 A;  5DM6 V;  3RT3 C;  2A0L A;  4EB6 A;  3EVK A;  4ZHQ A;  4DV1 B;  2Q7G A;  5AG2 A;  4TWK A;  5IYC O;  1Q6U A;  4K3A A;  5IJ9 B;  3EXA A;  3BHP A;  2VWJ A;  4O4H B;  3L70 H;  4UB8 Z;  4NVP A;  1QLE C;  5A9G A;  2YS8 A;  1Q43 A;  4FZ1 A;  2OYQ A;  1NZ6 A;  1H8E G;  2WLH A;  3JD3 A;  2G38 A;  4LFC O;  2ZIM A;  2ZIN A;  3LUT B;  4PA6 A;  1ORQ C;  4WFA V;  3K59 A;  4UVC A;  4O4I A;  1A32 A;  4JTA B;  5EK0 A;  2YIB A;  3WG7 C;  1YSC A;  2BTQ B;  3ZIA G;  1ARO P;  4RO2 A;  2JGD A;  2E5L O;  4LF8 O;  4I7Z B;  4ZI7 B;  2P7T C;  1PD3 A;  3D36 C;  4YJ3 A;  4LWS A;  1KKD A;  3ML0 A;  1N34 B;  5IYD O;  3JAT B;  3QO5 A;  2WA3 A;  3K08 A;  1ZWI C;  4DV5 B;  5KLV H;  4TQD A;  3DXR A;  2N05 A;  1IXM A;  1HDJ A;  3QTC A;  1IBL O;  4HBN A;  1BHA A;  1KBH A;  4NYK A;  2YEV B;  2HJF C;  2CTR A;  4DR3 O;  4GYC B;  3RYI B;  1BMF G;  4D7T A;  1MAB G;  5C93 A;  1N32 O;  4DW1 A;  2Q4P A;  1WB8 A;  2HR3 A;  1TAE A;  4X8A A;  4LFB B;  2BTQ A;  1K3E A;  3JD2 A;  3CCJ V;  4I55 B;  2F4V B;  3BEH A;  2Y48 A;  4DR1 B;  3FB5 C;  3RVZ A;  2ZXW B;  2UUC B;  5BR8 O;  3W7T A;  2QSA A;  3SJC C;  1V55 C;  5H6R A;  4FM0 A;  1WJZ A;  2E74 B;  4G27 B;  4JZG A;  3Q4H A;  1P49 A;  2F43 G;  2UXD B;  3JAK A;  1JJ2 U;  3P3P A;  1IZ3 A;  2IH1 C;  2AXT Z;  1XMO B;  3RFR A;  4D6T H;  1WAZ A;  4KXR A;  1V54 B;  3E83 A;  3A0R A;  1XBL A;  2DJV A;  4MVR A;  2JK5 C;  3H9V A;  4OPH A;  3PJS K;  1FXK C;  2AZ0 A;  3FYE B;  2LQT A;  3CCE V;  1HNZ O;  1E79 G;  5B1N A;  1P7B A;  2YSU B;  4NXN O;  1NR7 A;  2PYL A;  2F66 C;  1AI5 A;  1MMM A;  2RJZ A;  2WSS G;  1FJG B;  2VQF B;  2F95 B;  3C3T A;  3HKE A;  4TUY B;  2ITC C;  1KC8 W;  2E76 B;  2E5L B;  3E89 A;  2KG7 A;  1GM9 A;  3CXH F;  3ETG A;  5JCO C;  2CDY A;  1I94 O;  5KHH A;  3T1C A;  1AJN A;  2OCC C;  2JIZ G;  3SJA C;  2EIL B;  4B7E A;  4JI7 B;  4QIW F;  4YJ2 A;  4B3M O;  2WLK A;  2P4K A;  3AG2 C;  2PGG A;  1U96 A;  4X66 O;  3LDD A;  5CMU A;  1SA0 B;  3T2M A;  3B09 A;  1QBZ A;  1LR1 A;  4U3F H;  1KUQ A;  1HNX O;  4E2L A;  3G6E V;  2L6L A;  1JR9 A;  1SQB H;  5J9P C;  4P9P A;  3T1H O;  2Y69 C;  2W0X A;  1SKV A;  3CJH A;  1W59 A;  1JFF B;  4NTW A;  1MZF A;  4JI1 B;  2DQ3 A;  3K57 A;  1KU9 A;  1Q7Y W;  4CC5 A;  5KX5 A;  1RPO A;  3ABM B;  4BWA A;  4B7K A;  5GW7 A;  3ZBH A;  1SQV H;  3BFR A;  2GHY A;  3HR0 A;  4LF5 O;  2HG5 C;  4LCU C;  3SPG A;  4RAI A;  1D2D A;  1R3L C;  1AI7 A;  4J10 A;  4R6Z A;  4PHZ A;  2X7R B;  2DE0 X;  1F23 A;  2CH7 B;  2QA4 V;  4ZOL B;  4X89 A;  4IT5 A;  2E3C A;  4ZBM A;  3JAL B;  5KHI A;  3B2E E;  2UUA O;  5C8Y A;  5B3S B;  1VF6 C;  3G71 V;  4JI2 O;  2EIM B;  3AG7 A;  1M93 A;  1VQ8 V;  3CRM A;  3E22 B;  1EFR G;  3ZMS A;  1GM8 A;  5BMV A;  2QE7 G;  4DO2 A;  4DW0 A;  4F4L A;  3T4D A;  3CRA A;  3TCU A;  1GO3 F;  5L3F A;  2UXC O;  4PDR A;  2QWQ B;  4DR2 B;  1L8D A;  4UV8 A;  2IJJ A;  2GBO A;  3UT5 A;  3VOU A;  2V4D A;  4WCE V;  2ZD9 A;  3JCU Z;  4FLY A;  2P4V A;  2DWD C;  1SQG A;  4U7N A;  2M7W A;  3AEI A;  4FM1 A;  5LP6 A;  4O4L B;  1H2S B;  4BR6 A;  5E79 Z;  4ABM A;  3A2F A;  2O57 A;  5LGN A;  2OTL V;  2QEX V;  2ZE5 A;  1GN4 A;  3RYC B;  4UCR A;  1VQO V;  2NLJ C;  4KFM A;  2M6Y A;  5HFL A;  1OCR B;  1QR9 A;  5L3B A;  3SPH A;  3L71 H;  2DYS C;  1Z5V A;  2WLM A;  3RYC A;  3F5W C;  3N2K B;  5IYB O;  2HP8 A;  5LHH A;  2RQ6 A;  4J7J A;  3ZHS A;  4FMT A;  4X65 B;  2Y69 B;  4DR6 B;  1QLE B;  3CX5 F;  5D5P A;  1PPJ H;  5KHK A;  3K5L A;  1N36 O;  1ZL8 B;  1Q82 W;  5KAF Z;  1PKX A;  1G1X B;  5EBL C;  1DF5 A;  5LGT A;  3ZHR A;  2FML A;  2XHB A;  1Y66 A;  1K4D C;  3EFF K;  2QM8 A;  1N4C A;  3OEE G;  4EKW A;  4DR4 O;  3I56 V;  5CA1 A;  1J5E B;  4AQY B;  5BMV B;  4DV3 O;  1K73 W;  1P7G A;  1Y74 A;  2Q0O C;  2YUA A;  3CEI A;  5B5E Z;  2NR5 A;  2AGA A;  1E1R G;  1JPX A;  4I4T A;  1R73 A;  4DR2 O;  4IL6 Z;  4DV4 O;  4DK1 A;  3T1H B;  4FZ0 A;  1VQ4 V;  5EBM C;  4R8C A;  1HP8 A;  2Z5U A;  2UUB O;  3ZN0 A;  1FPO A;  1V9P A;  2Y4T A;  4JI6 B;  2A3Q A;  3CMA V;  1KP2 A;  5LHI A;  5FNV B;  4ICG A;  4JYA B;  2XAS A;  2ZE7 A;  1THZ A;  1SQQ H;  4X1Y A;  2XAQ A;  4L8J A;  3CCS V;  1ENV A;  1XOU A;  2CGN A;  3AG3 C;  1NH2 B;  3AK1 A;  2EIM C;  3AG3 B;  2UUA B;  4J7K A;  4PD4 F;  3B8M A;  1WPB A;  4QE7 A;  5EZY A;  2XUM A;  3L72 H;  4DV6 O;  3K9S A;  2ZNJ A;  3R65 A;  5LMN B;  4ZIB A;  3W7U A;  1K97 A;  1H38 A;  1ROP A;  2Y0P A;  1YIT V;  3O65 A;  3MD0 A;  3CJH B;  1AJQ A;  3HKB A;  1WNS A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  1Q6I A;  1Q6U A;  1FD9 A;  3B09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...