3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
molecule tags Chaperone
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
3B09A 1Q6UA 1FD9A 1Q6IA 1Q6HA
chains in the Genus database with same CATH superfamily
1BE3H 2CDYA 1NT2B 3X2QB 1K33A 4WF9V 1IDSA 2E76B 2JVDA 1SF9A 2RNBA 4C7UA 3CCMV 1BGYH 1WA8A 3RYIB 3E22A 4TUYA 3ZRXA 3K57A 1VF6C 1US6A 3SPGA 2QWQB 4DR4O 4DV4O 3CRQA 2R72A 2DYRB 5ITZB 5B5EZ 3UCSC 5KHIA 3ABUA 3ETDA 5JJEB 1FPOA 4HNAA 2QKSA 1SQVH 4FLVA 3G80A 2EIKB 3FYEB 5EBWC 1N32B 1S5LZ 4QNHB 1AJQA 3OGIB 4UCUA 1PV0A 2LFRA 1W59A 2LW7A 3LDCA 3JCUZ 4XDKA 1S5HC 1T5EA 5JQGB 1Q7YW 5AG2A 2AHZA 2CUGA 1JA8A 3JAKB 4YY3O 1I94B 2UUAO 4TV9A 2UUBO 4DV0B 3LDEA 4JYAO 4LP8A 5LOVA 2IU3A 1ROPA 4GX5A 2B1IA 1XQ8A 3NR7A 4GZRB 4ZKIA 3STZC 4EKWA 4KL1A 4O4JA 4LFBB 3QNEA 1VQ6V 3TK1A 1XNRB 2YC0A 3AG7A 4LWSB 3WU2Z 3JALB 2OIEA 2HFEC 1N8RW 4OXSA 1ZWIC 5IY5B 4I0XA 4LWSA 1EM1A 4KHPO 3G6EV 3JALA 4BW9A 2ZDIA 4GT1A 5J2TA 4DR1B 1BS3A 1QLEC 3CCQV 4FLXA 4PI0A 1Y74A 4OGQB 4D7TA 3RYHA 4LFCO 1E79G 2X7RB 5LHIA 1BQ0A 4NXMO 1O9GA 4X66B 1K4CC 4JI7O 2CAZC 2ZR2A 5KHKA 1NTZH 2F4VO 2HLDG 3ICXA 4EB6A 4WFBV 1GN3A 3B40A 1FAFA 2XAGA 4I55B 3AK3A 3VQVA 1NI8A 3ZRSA 3ZBHA 2UXCO 4B3MO 2HHHO 4D7SA 2AZ0A 2EILC 2VS0A 4J80A 2UU9B 1VF7A 2OTLV 1ZL8B 2ZE6A 3IJ4A 5EC2C 1ZL8A 4JTCB 2JJ1G 1MZFA 5KA5A 3CCUV 1NR1A 4X1KB 3OTFA 5LP6B 3W7TA 1Q3EA 4X65O 2AZ2A 3BCCH 4WFHA 4Z1VA 4WFEA 4JGSA 2H3OA 3I5DA 1VMGA 2PI5A 4FMTA 3CRRA 5DECA 2EJ7A 1XL6A 4NTXA 2FTKA 4IYIA 1N36B 3MHHC 4ZOLA 3MD0A 1UJWB 1IVSA 4JYYA 3BA9A 1HNXB 4B7KA 2LJ2A 2P06A 4DV6O 5J2UA 2V7QG 4NKGB 4AQYO 4PI2A 4X1YB 4DV7O 5JH7A 3L71H 2QWNB 3M99B 1NS1A 1URFA 2CH7B 3A0BZ 5FNVA 3OMIB 4CS4A 1A32A 4O4HA 4I9QA 1KKCA 3R66A 1YXBA 1JJ2U 2UUCB 3OR6C 1VQPV 4JAVA 3EXAA 1FJGO 3ZMVA 5LP6C 4B7EA 1AR1B 2ATKC 5H6QA 2UXBO 1K5SA 4PDRA 1R1BA 2PUSA 1IBKO 3LDDA 5CB4A 1H2GA 1IBLB 2DWDC 1SQPH 3H1LH 1AR4A 3ETEA 3OFNG 4X20A 4TWKA 4FFBA 2DMXA 5L3CA 3WB1A 3W7SA 4DUZO 2ZE8A 5LHGA 4NTWA 4Q20A 1OZ0A 2ZCEA 1MA1A 3RYCB 4MT8A 1RPOA 4DR5O 4JZ2A 4NXNO 4UCVA 1N33O 4DV1O 1PNLA 5D5QA 1AJNA 1VF5B 1E1QG 2WLJA 1UPGA 1MSDA 1QQCA 2F43G 1H2KA 1PD3A 3KZIZ 1HR0O 4DK0A 5LGTA 1M1KW 4HBNA 1GKFA 3CC7V 1R3IC 2Q7HA 5B3SB 1K34A 3BVOA 3E2EA 3KG2A 1RSOB 3DC5A 3CD6V 5CA3A 4LF7B 3ZN1A 5B1NA 3ZCCA 4MVSA 2EINB 1M93A 4U3JB 4IIJA 1OCRB 3ZMZA 5D5PA 2EBOA 1D5AA 5HFMA 3HKBB 1OCOC 2GUZB 4ZHQB 1QBZA 3ABLB 2QE7G 5IYBO 2OT5A 4LF8B 2BSKB 2XOKG 4MTFA 1YJWV 1XL4A 3H1JH 3ABMC 2BSKA 1DTOA 4DR3B 5LL6Y 2QJ1A 3OUFA 2WLMA 2WLIB 1R73A 4FK5C 5H9CA 1AP5A 2WSSG 4LH6A 3SPIA 2GTAA 5LGUA 4B3TB 4H44B 3K9AA 3B8MA 3SJQC 5KLVH 3APQA 5B3SC 5H5NA 4F6RB 1H2NA 4LF5B 1KMIZ 3ZJZA 1M57B 2A06H 2ODMA 5L3BA 1Z5WA 3CB2A 3I56V 3ETQA 4F6RA 5EZYB 1OCRC 4BR6A 1IXMA 1TUBB 4LC1A 4I4TA 3UT5A 2WLLA 4IT5A 4DV2B 2B5UA 2XUMA 3O9OA 1IX9A 2QDOA 3SR2C 3UKMA 5L3GA 4F6EA 4GKKB 5DN6G 3OW2U 3JD1A 1Y6XA 4LF4B 3HKEB 1FXKB 2N04A 4O4IB 2F23A 1J5EB 4JI5B 4XDJA 5FPOA 4O4IA 1KU9A 1PL4A 4JTAB 2P22C 4ICGA 1LUVA 3T1YB 1FYJA 2Q7GA 4UUJC 2DW4A 1PM9A 3WFVA 4HZ3A 1N32O 1N34O 2PI4A 4LCUC 3KCYA 3ZMUA 3JASB 4UCTA 4LBEC 4H33A 1Q6IA 3BFRA 1MMMA 2HEPA 3JAWB 4FPPA 1M57C 1LNQA 3D36C 3S3WA 3AG3B 5KHJA 2ITCC 1MNGA 3JATA 4U7NA 1Y67A 3QTCA 1BZKA 1H38A 1PKXA 4EFEA 1HW7A 3SPCA 2JGDA 4DV5B 2YXHA 1Q6UA 3SDLA 4B08A 4MVMA 5EC1C 3IC9A 5CA0A 1NTMH 1S72V 4H0LB 3WG7C 4RUEA 1FXKC 4DR6O 3K03A 2QM7A 2OWOA 4LFAO 4YJ3B 4CS2A 4DR1O 2JS3A 3LUTB 1B6QA 4DXWA 2BCCH 2IW5A 2EIMB 3HKCA 4L87A 1N4CA 2OCCB 2AW9A 2EULA 4BIZA 2EX3A 4FIPC 2DN9A 1BHAA 3K5MA 1P4RA 3DC6A 4Q6GA 3CXCU 1XOUA 2JS5A 2QWOB 3AG3C 2C2AA 1WN7A 2WAMA 2PYLA 1QHTA 4P9OA 1TVKB 2HJDA 3R65A 5C8YB 2VWJA 4FLYA 1K9MW 1TVKA 1W0KG 5IYZB 1M5IA 3TXQA 1AJPA 1HWYA 2E75B 5C8YA 3M7MX 2RMKB 4BW5A 1EN6A 1N0NA 1NQTA 4CH6A 1FFXB 3K0GA 3RVYA 1F4MA 4GUNA 3QVNA 2ZE7A 3SJAC 2ARHA 2Y4TA 4GX1A 1CEZA 1AI4A 4DR7B 1AROP 5LHHA 1WPXA 4X64O 3OR7C 3K9SA 3T2MA 4WBNA 2ZR3A 3K5NA 2EIMC 4JV5O 5BMVB 4KXRA 5LYJB 4CZZA 1VQ7V 1Z2GA 5BMVA 4DRXB 4EEQA 1GM9A 2JGUA 1R3LC 2GV9A 5GW7A 3GB7C 2ZM6O 4JAUA 3CRCA 4LNUA 4RUFA 1XUQA 4F4LA 4P30A 1Y76B 2KKWA 2Q6AA 3VQWA 1HNXO 2QEXV 3DTUB 2AGAA 3U0ZA 4MW8A 1EFRG 5L3FA 1NBMG 1U96A 2R9RB 3RFRA 3RYIA 2YS8A 4UVAA 1WB7A 2W0XA 4OPHA 1IBMO 2P5OA 3CSXA 2DOSA 3CCRV 1DF5A 2IH3C 4K35A 2L35A 4DUYB 2OYQA 3QF7A 5ITZA 1QLEB 1SZXA 4J11A 1V9PA 1WNSA 5LBQA 3SPJA 4RQEA 2CTWA 4JI2O 3G67A 5FL7G 5KX5B 3QG5A 3HR0A 3OM3B 1W0JG 4G28B 2A3QA 1N0JA 1QU7A 5KX5A 2R70A 2NN4A 2YI9A 1ENVA 1K73W 4K3AA 1IBLO 3L75H 1OCZC 1R3KC 3OTOB 4UVBA 3ZHUA 5JQGA 4LF9B 3JD4A 2ZT9B 3JAKA 1BCCH 4L8JA 1VEWA 1DGSA 1F7YA 3F7YC 1QLNA 4K0KO 2BOBC 5LMUB 4JI3B 4ZBMA 1YSCA 2EILB 3ZRVA 3T1CA 1IXBA 3P3PA 2RJZA 2LFSA 2BOCC 4FM1A 1JPXA 1K4DC 4X88A 2Q4PA 4FFKA 4GX2A 1JFFB 2YICA 3CCSV 3FB8C 5FPRA 5LMNB 1HP8A 2YEVB 4DW1A 3MAQA 4IGGA 2Q69A 1JMKC 4PJ0Z 4JYBA 1NTKH 4UCOA 3N2KB 3B09A 4DR2B 4LF7O 5IYDO 3ZEDA 3LSQA 1SQGA 1NR7A 4B3RB 3CMAV 1YTFB 3W7WA 2FKXA 3B2EE 4CH4A 4BAYA 1KP3A 2XNDG 2QTOA 1COWG 4IHJB 4CC6A 1G6UA 2ETNA 2MK3A 4P2ZA 4JI0B 3CCLV 1SQQH 2XT9A 3ZHTA 1AVMA 4ZI7B 2Q8VA 2CGNA 1MG1A 4I55A 3K3WA 3JARB 1K5QA 1K92A 2M7WA 2RQ6A 5KAIZ 2VRZA 3JARA 3T4DA 4B3TO 3QO7A 1KUQA 1G1XB 4YHHB 4MVRA 4B3SO 5KMGB 1YHQV 4X1KA 4LF5O 5LP6A 3CRAA 4UFZA 4CH3A 5KUMA 4PA9A 2ZNIA 1YTFD 3QO8A 5BXZA 2W0FC 1VQKV 2WLKA 5KA6A 3E89A 3G6BA 2A7WA 2YUAA 4DV2O 4W4KA 1DLBA 4TT3G 2VQFB 1GK9A 1YI2V 4DV3B 1VARA 1YEWA 3AG4C 4MTXA 5LXTB 4PA7A 1OJHA 2GSMB 1BHBA 2PY5A 3E86A 4GKKO 3ZMTA 1Y4MA 3K04A 4X9QA 4X1YA 3PJSK 2F66C 2Q67A 1Q6HA 4XDLA 1K3EA 2H94A 4YIOA 2W6JG 5EBLC 2CH7A 3EHBB 3JD3A 1XHXA 2JRIA 2YSUB 3CJHB 3OE7G 4UB8Z 4I7ZB 3H1IH 4DR4B 2Y0PA 4J9ZB 1GH6A 4DV4B 4AILC 2BTQB 3K06A 4ASUG 1I5XA 2WA4A 2LGWA 2BTQA 4KUMA 3LSSA 4PHZA 3CCVV 2HJFC 3SPHA 2JEUA 1XMOO 1OCOB 3CYOA 4JI6O 3THOA 1KECA 4WFGA 1H2SB 4PDVA 1KBHA 3G4SV 3E8GA 2W6IG 3FAVB 4YY3B 5IDJA 3ZHVA 3ABMB 2UUAB 1XDCA 3D3IA 2UUBB 2QM8A 1HNZO 2IM9A 4JYAB 3TCUA 3L72H 3RYCA 2ZNJA 1YIJV 1I0HA 3UQ8A 4JI8B 4PA3A 3C3TA 2G38A 4N21A 1BMFG 3C3SA 4OX9O 1Q90D 5B66Z 2LQTA 3L73H 3BABA 1SC5B 3APOA 3ZHQA 5IWAB 4KHPB 3DSQA 3P3NA 1DK1A 5E1AC 1G4YB 2LO1A 3CPWU 1RSOA 2HR3A 2Q9LA 5A9GA 4U3JA 1B04A 1ZLZA 4JAAA 4X62O 2B9ZA 2Y48A 1M90W 3H01A 1TAEA 3T1HO 3E8BA 1RP3B 3HKBA 4QIWF 3CMEV 1YDXA 4QPJA 2GUZA 4JI7B 4ZHQA 1TGOA 2F4VB 3J80N 5GONB 3CCJV 1R6NA 3Q4HB 1L1FA 1W2BU 2YDEA 1B06A 3RGBA 4YJ2B 5GONA 1R6TA 2WLIA 3WB0A 1XMQO 2F95B 4IL6Z 1XNQO 2DWEC 2UXCB 4J42A 2VWKA 1ZAUA 4JI1B 1XILA 1H8EG 5JCOA 1XI1A 4U3FH 1K7DA 2YXYA 3N27A 5EYPB 4YXWG 4PA4A 2IJJA 2KSDA 2ZIMA 3E8HA 4NR1A 4K8XA 1HNWB 3D36A 4X1IB 5EYPA 1IURA 5EZYA 4GKJB 5BY1A 1V54B 3SYCA 4X65B 5CBGA 3RWRD 1M56C 3HPLC 1D5NA 1M9NA 1TUBA 5GTHZ 2E5LB 1WP8A 4KFMA 1AI5A 3PN1A 2CK3G 4OPAA 3WG7B 3CWBH 3EFFK 5CBFA 1SZTA 5EK0A 5K1PA 3RYFB 4LF6B 3HKEA 1FXKA 2IJIA 1KC8W 4W4LA 4AQYB 1WAZA 4H13B 2Q7EA 2Y69C 3QO5A 4J10A 2GBOA 4DV7B 1GRJA 3ZRWB 2ZD9A 2ZQMA 5A2QN 4FLUA 2XTAA 3OAAG 5EIBD 3FB6C 3H9VA 5EIBC 3JASA 2B1GA 4FLWA 5JWPA 1JOYA 3JAWA 1SA0B 1I94O 3OTOO 1RM1B 1FJGB 4DV0O 4DK1A 1V54C 3AG1B 1DF4A 2GHYA 2FB5A 2AHYA 2KG7B 3ZN0A 1IBKB 1QNMA 3AG2B 4UXNA 3FFQA 5H6RA 3D3QA 3SYAA 1QVFU 3F5TA 4RQFA 2DJVA 3K58A 4LFBO 1QR9A 2XHBA 1P84F 2X6CA 3ZHSA 2EZPA 4JI3O 1XNRO 4DUZB 4R50A 1H8HG 4TOIA 1PPJH 2WWWA 2YXLA 4FM2A 4O2BB 3CCEV 1Q81W 1KQSU 2X6BA 2PF4E 3CEIA 1I08A 2Y0IA 4DR5B 4NXNB 4UCSA 4YJ3A 1Q86W 1ZX3A 3BEHA 4MVUA 3RN4A 5BZBA 3M8AA 4R8CA 1GAXA 2VQEB 4DYLA 4UVCA 2Q5ZA 3CE2A 4WFAV 1Q5OA 4P9PA 2QWRB 4MW3A 4YIPA 4X66O 4ABMA 1LR1A 1NKDA 3KCXA 3ZHRA 4LR3A 1RM1C 3BRCA 3K5LA 2DQ3A 4I50B 4I9WA 3AG1C 5F2VO 5JVDB 3NXSA 2WLHA 3VOUA 3AG2C 3A0RA 2PGGA 4RWUA 4I50A 5CN0A 5IYZA 5J9PC 1GO3F 3BHPA 2ITDC 3N2GB 4J7ZA 1VF6A 1BT8A 4IYHA 1FFXA 2UU9O 3TETA 3N2GA 4RAIA 1R6KA 3DGEA 2N05A 4TQDA 2WLNA 1MOFA 1XBLA 4CBCA 1F23A 3IGAC 4JASA 1GM7A 1BL8A 4KP4A 3U10A 4J7KA 3GWOA 1SESA 5LYJA 4GCZA 2UXDB 1J95A 4QJFB 1OCZB 4UCRA 3WB2A 4DRXA 1N36O 3H1HH 3CXHF 1AI6A 3JD2A 3SYPA 2ZKOA 1FXVA 3HKDB 5B1BC 4GLXA 3K59A 1Y76A 1B3QA 1PNMA 3MDSA 2DYSC 2O57A 1WA8B 1S0VA 3E83A 5CBHA 4MTOA 2P4VA 5JJNB 4BIOA 3E22B 4TUYB 2UXXA 5BR8B 1R3JC 5HFLA 1SKVA 3E35A 2NNUA 1E1RG 1XREA 3CP1A 2UUCO 3F7VC 3GVMA 2HG5C 1JVMA 4HNAB 1AB3A 1OV9A 2XAHA 1S3JA 5IJ9B 3JYCA 2QKCA 4JI4B 2RCVA 3CX5F 3A8TA 2P6JA 5IJ9A 1V55B 1S77D 4I5SA 2E74B 2P4KA 3K5OA 5FLXN 1N34B 4CS3A 1UFIA 1YJNV 1Z5VA 4G27B 3RBZA 3P30A 5B1AB 4TV9B 1BSMA 1LUWA 3ZS8C 4CH5A 3EVKA 4X89A 4E2LA 1BQZA 1P7GA 2FMLA 4H37A 3ABTA 5LOVB 3X2QC 4MVZA 1AILA 3JD0A 1H2LA 1XEQA 3O65A 2PZSA 2IJKA 2A79B 4JI8O 4O4JB 4FJCC 1JX9A 4PV1B 1THZA 2V4DA 3ML0A 2L6LA 1EN4A 1L8DA 2RDCA 3W7UA 1JFFA 2ILMA 2FL4A 1VQ4V 4DR6B 5KHHA 4I0XB 5B1OA 1F4NA 3KKYA 4FVMA 5J2TB 3ZMSA 1JJOA 2LW1A 2YEVA 2DYRC 3UO2A 5CA1B 4J41A 4LFAB 4Z1MG 5IWAO 4EFBA 4HAMA 1Y74B 2CGOA 2Z3YA 5CA1A 3N2KA 3RYHB 2RN9A 1V55C 2WA3A 2EIKC 1EZVH 4FZ0A 4Z2WA 3IAYA 1VQOV 3AG4B 1CP9A 1YITV 2NLJC 3SJBC 2QKAA 4RO2A 1SRYA 5B1AC 4IHJA 4LF8O 3IFXA 3LNNA 3A2FA 4PA6A 4EB6B 5IYCO 3JSLA 4PD4F 2QTSA 5KHGA 4CC5A 4MS2A 4DR3O 1I5YA 3HB3B 4ZI7A 1KYOF 2HP8A 2PTMA 3SYQA 4FM0A 1GTOA 3L74H 3B8NA 2DE0X 1RPRA 2HVJC 4JI1O 4NYKA 2Q68A 2M6YA 2ZDIC 3LNMB 1YCIA 5IY5C 4TSFG 4TV8B 1OCCB 5KMGA 4K8ZA 3BA8A 4X64B 4G2KA 1HNWO 1Q43A 1KKDA 2XAFA 3AK1A 4TV8A 4GKJO 4JV5B 5LA6B 1L0LH 2IBZH 2BE3A 2YIBA 1NJIW 3CC2V 5LA6A 3FX7A 4ZOLB 2E5LO 1CXZB 5TISZ 2A9HA 4TQFA 5DM6V 2ZM6B 2X0LA 5LXTA 4LF4O 1VIBA 4LH7A 5J2UB 4QPKA 5KAFZ 1J5EO 4LF6O 4JI5O 4JF3A 5JH7B 3A0HZ 2D3OW 1NH2B 2EJRA 2EZOA 3T1YO 2JEXA 2Q73A 5FNVB 1G8MA 3FB7C 1IBMB 3OEEG 3CS5A 3CJHA 4O4HB 2ADQB 1D2DA 3OEHG 4NVPA 2LP7A 1EBOA 3UO3A 2P90A 1S76D 1OCCC 3J7AU 1FXHA 4FZ1A 4JI2B 2YIBD 4JTDB 1AR5A 3RT3C 1SERA 5CMUA 1MZEA 5CB4B 3G71V 3W7XA 1MABG 3P32A 4DV5O 2NR5A 3L70H 4X20B 2YI8A 4FFBB 2HKOA 5EBMC 3SJCC 3FAVA 1VQ8V 3OT7A 1EZJA 2CTQA 2CTPA 3VBBA 1YZBA 4GX0A 1NH2D 4WCEV 2KB1A 4K0KB 1QVGU 2D2CB 2P7TC 3UM7A 4U7OA 2OCHA 3CC4V 3TGUH 3RW0A 2FYUH 1GN4A 1KP2A 2VQEO 1ZSPA 4BWAA 2BTOA 3MHSC 4X8AA 4WFFA 2XAJA 3JSNA 2CTRA 3K08A 1K97A 1M56B 3OD4A 1L0NH 3ASOB 1NVPB 4LFCB 4DO2A 4IIJB 5IT9N 1WLEA 4NXMB 3CRMA 3H1KH 1YJ9V 1VQ9V 3SGIA 3FKSG 4A5UB 2E3CA 4BIUA 3JAMN 3B77A 4QE9A 1VQNV 3Q4HA 4O2AB 1ZUQA 3K79A 2H8PC 2Y69B 2DQ0A 5E79Z 4DR7O 1I7FA 4YJ2A 4QE7A 4J9YB 4O2AA 4B3MB 2HHHB 3ABKB 1SQFA 5JJJB 3E8FA 1Y66A 4MTGA 2ZINA 4MVQA 1FKAO 2K1EA 4MSWC 1PP9H 3I55V 1TUEB 2UXNA 3U11A 2YIDA 2UXDO 1PNKA 2MW2B 2A0LA 1GMGA 4UB6Z 1FD9A 1GN6A 3ASNB 2GDSA 1NVPD 1SQXH 4X1IA 4B3SB 4AI8A 3ASOC 1HDJA 2QA4V 2IH1C 3ZIAG 4I4TB 3UT5B 2EINC 2WLLB 2JDIG 3OGCC 1KD1W 1H2MA 3GWKC 5C93A 3DXRB 1Q82W 3OUSA 3BY6A 1SS3A 4DV6B 3STLC 1MSWD 1U97A 3DXRA 4AHCA 4DUYO 3ABLC 1OHHG 2Y4UA 5DEDA 3RYFA 5BR8O 1ZTEA 5KUKA 1O9HA 5K1XA 3F5WC 1VQ5V 3FD9A 2YIAA 3ABKC 4R6ZA 3D8CA 1VQLV 2ZE5A 1VP7A 3ZRWA 2K9PA 1FFTB 2R9AA 4UV9A 1F51A 2QWPB 3BPZA 4JI4O 2JIZG 4J7JA 1JQ0A 5JCOC 4LF9O 1GN2A 1SA0A 2UXBB 2XAQA 3TJTA 2Z5UA 3ASNC 2CE4A 3VQXA 1XHZA 2ZXWB 5L3DA 3JCZA 2QM4A 3CHXA 2GTSA 1M4UA 1QR8A 2KG7A 3SYOA 3JATB 5IJ0B 1NU1H 5LMUO 2IJHA 1XMOB 2KQXA 1FS0G 2JGDB 3S3XA 4JI6B 2JK5C 5IJ0A 4UV8A 1JR9A 5GTIZ 5CA0B 1TA8A 1EN5A 3T4ZA 3IC7A 3K0DA 2WPDG 4O2BA 1HNZB 1X4TA 2QR4A 5LMNO 1N33B 3C90A 4XBFA 4DV1B 2PYJA 1VQMV 4JPRA 2EIJB 1QCEA 5H2FZ 1ORQC 1AP6A 2JJ2G 4QGPA 2N74A 2Q0AA 3LSUA 5LGNA 2ZIOA 4DW0A 5IE9A 1HR0B 4DR2O 4JZGA 4ZIBA 3HKCB 1P49A 4OX9B 4PELA 1RFYA 2HVKC 1JCHA 2QGNA 1SETA 4B3RO 2V1DA 2F1MA 3AK2A 4PDMA 3FB5C 1S5JA 2ADPA 1KB9F 4HYOA 3TXSA 5B1BB 2ZXWC 2IU0A 1GM8A 4E4EA 1YVWA 1WPBA 1IZ3A 5JVDA 4JI0O 1PL0A 2DYSB 2Z0AA 2F93B 3ETGA 4NB5A 4X62B 3T1HB 4O4LB 1X59A 1CPYA 4NTYA 4PDLA 2X6AA 2R9IA 3AEIA 2Q0OC 4O4LA 1Q8IA 4R7CA 1WP7A 4N23A 3ZX6A 3OMNB 2LGQA 2OTJV 3VQYA 2EIJC 1SQBH 4YHHO 2P67A 1WJZA 3OMAB 3RVZA 4FLTA 4WBNB 1AI7A 3BAAA 1XMQB 1P7BA 3L9DA 4GYCB 4D6TH 1K8AW 1XNQB 5L3EA 3J81N 2XASA 4FLZA 4JYCA 3B4SA 2AXTZ 2OIGA 4MVOA 2OCCC 1YF2A 1NZ6A 2VQFO 2QSAA 1WB8A 4DV3O 3FYIB 4LNUB 3HKDA
chains in the Genus database with same CATH topology
3B09A 1Q6UA 1FD9A 1Q6IA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B09 A;  1Q6U A;  1FD9 A;  1Q6I A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 1BE3 H;  2CDY A;  1NT2 B;  3X2Q B;  1K33 A;  4WF9 V;  1IDS A;  2E76 B;  2JVD A;  1SF9 A;  2RNB A;  4C7U A;  3CCM V;  1BGY H;  1WA8 A;  3RYI B;  3E22 A;  4TUY A;  3ZRX A;  3K57 A;  1VF6 C;  1US6 A;  3SPG A;  2QWQ B;  4DR4 O;  4DV4 O;  3CRQ A;  2R72 A;  2DYR B;  5ITZ B;  5B5E Z;  3UCS C;  5KHI A;  3ABU A;  3ETD A;  5JJE B;  1FPO A;  4HNA A;  2QKS A;  1SQV H;  4FLV A;  3G80 A;  2EIK B;  3FYE B;  5EBW C;  1N32 B;  1S5L Z;  4QNH B;  1AJQ A;  3OGI B;  4UCU A;  1PV0 A;  2LFR A;  1W59 A;  2LW7 A;  3LDC A;  3JCU Z;  4XDK A;  1S5H C;  1T5E A;  5JQG B;  1Q7Y W;  5AG2 A;  2AHZ A;  2CUG A;  1JA8 A;  3JAK B;  4YY3 O;  1I94 B;  2UUA O;  4TV9 A;  2UUB O;  4DV0 B;  3LDE A;  4JYA O;  4LP8 A;  5LOV A;  2IU3 A;  1ROP A;  4GX5 A;  2B1I A;  1XQ8 A;  3NR7 A;  4GZR B;  4ZKI A;  3STZ C;  4EKW A;  4KL1 A;  4O4J A;  4LFB B;  3QNE A;  1VQ6 V;  3TK1 A;  1XNR B;  2YC0 A;  3AG7 A;  4LWS B;  3WU2 Z;  3JAL B;  2OIE A;  2HFE C;  1N8R W;  4OXS A;  1ZWI C;  5IY5 B;  4I0X A;  4LWS A;  1EM1 A;  4KHP O;  3G6E V;  3JAL A;  4BW9 A;  2ZDI A;  4GT1 A;  5J2T A;  4DR1 B;  1BS3 A;  1QLE C;  3CCQ V;  4FLX A;  4PI0 A;  1Y74 A;  4OGQ B;  4D7T A;  3RYH A;  4LFC O;  1E79 G;  2X7R B;  5LHI A;  1BQ0 A;  4NXM O;  1O9G A;  4X66 B;  1K4C C;  4JI7 O;  2CAZ C;  2ZR2 A;  5KHK A;  1NTZ H;  2F4V O;  2HLD G;  3ICX A;  4EB6 A;  4WFB V;  1GN3 A;  3B40 A;  1FAF A;  2XAG A;  4I55 B;  3AK3 A;  3VQV A;  1NI8 A;  3ZRS A;  3ZBH A;  2UXC O;  4B3M O;  2HHH O;  4D7S A;  2AZ0 A;  2EIL C;  2VS0 A;  4J80 A;  2UU9 B;  1VF7 A;  2OTL V;  1ZL8 B;  2ZE6 A;  3IJ4 A;  5EC2 C;  1ZL8 A;  4JTC B;  2JJ1 G;  1MZF A;  5KA5 A;  3CCU V;  1NR1 A;  4X1K B;  3OTF A;  5LP6 B;  3W7T A;  1Q3E A;  4X65 O;  2AZ2 A;  3BCC H;  4WFH A;  4Z1V A;  4WFE A;  4JGS A;  2H3O A;  3I5D A;  1VMG A;  2PI5 A;  4FMT A;  3CRR A;  5DEC A;  2EJ7 A;  1XL6 A;  4NTX A;  2FTK A;  4IYI A;  1N36 B;  3MHH C;  4ZOL A;  3MD0 A;  1UJW B;  1IVS A;  4JYY A;  3BA9 A;  1HNX B;  4B7K A;  2LJ2 A;  2P06 A;  4DV6 O;  5J2U A;  2V7Q G;  4NKG B;  4AQY O;  4PI2 A;  4X1Y B;  4DV7 O;  5JH7 A;  3L71 H;  2QWN B;  3M99 B;  1NS1 A;  1URF A;  2CH7 B;  3A0B Z;  5FNV A;  3OMI B;  4CS4 A;  1A32 A;  4O4H A;  4I9Q A;  1KKC A;  3R66 A;  1YXB A;  1JJ2 U;  2UUC B;  3OR6 C;  1VQP V;  4JAV A;  3EXA A;  1FJG O;  3ZMV A;  5LP6 C;  4B7E A;  1AR1 B;  2ATK C;  5H6Q A;  2UXB O;  1K5S A;  4PDR A;  1R1B A;  2PUS A;  1IBK O;  3LDD A;  5CB4 A;  1H2G A;  1IBL B;  2DWD C;  1SQP H;  3H1L H;  1AR4 A;  3ETE A;  3OFN G;  4X20 A;  4TWK A;  4FFB A;  2DMX A;  5L3C A;  3WB1 A;  3W7S A;  4DUZ O;  2ZE8 A;  5LHG A;  4NTW A;  4Q20 A;  1OZ0 A;  2ZCE A;  1MA1 A;  3RYC B;  4MT8 A;  1RPO A;  4DR5 O;  4JZ2 A;  4NXN O;  4UCV A;  1N33 O;  4DV1 O;  1PNL A;  5D5Q A;  1AJN A;  1VF5 B;  1E1Q G;  2WLJ A;  1UPG A;  1MSD A;  1QQC A;  2F43 G;  1H2K A;  1PD3 A;  3KZI Z;  1HR0 O;  4DK0 A;  5LGT A;  1M1K W;  4HBN A;  1GKF A;  3CC7 V;  1R3I C;  2Q7H A;  5B3S B;  1K34 A;  3BVO A;  3E2E A;  3KG2 A;  1RSO B;  3DC5 A;  3CD6 V;  5CA3 A;  4LF7 B;  3ZN1 A;  5B1N A;  3ZCC A;  4MVS A;  2EIN B;  1M93 A;  4U3J B;  4IIJ A;  1OCR B;  3ZMZ A;  5D5P A;  2EBO A;  1D5A A;  5HFM A;  3HKB B;  1OCO C;  2GUZ B;  4ZHQ B;  1QBZ A;  3ABL B;  2QE7 G;  5IYB O;  2OT5 A;  4LF8 B;  2BSK B;  2XOK G;  4MTF A;  1YJW V;  1XL4 A;  3H1J H;  3ABM C;  2BSK A;  1DTO A;  4DR3 B;  5LL6 Y;  2QJ1 A;  3OUF A;  2WLM A;  2WLI B;  1R73 A;  4FK5 C;  5H9C A;  1AP5 A;  2WSS G;  4LH6 A;  3SPI A;  2GTA A;  5LGU A;  4B3T B;  4H44 B;  3K9A A;  3B8M A;  3SJQ C;  5KLV H;  3APQ A;  5B3S C;  5H5N A;  4F6R B;  1H2N A;  4LF5 B;  1KMI Z;  3ZJZ A;  1M57 B;  2A06 H;  2ODM A;  5L3B A;  1Z5W A;  3CB2 A;  3I56 V;  3ETQ A;  4F6R A;  5EZY B;  1OCR C;  4BR6 A;  1IXM A;  1TUB B;  4LC1 A;  4I4T A;  3UT5 A;  2WLL A;  4IT5 A;  4DV2 B;  2B5U A;  2XUM A;  3O9O A;  1IX9 A;  2QDO A;  3SR2 C;  3UKM A;  5L3G A;  4F6E A;  4GKK B;  5DN6 G;  3OW2 U;  3JD1 A;  1Y6X A;  4LF4 B;  3HKE B;  1FXK B;  2N04 A;  4O4I B;  2F23 A;  1J5E B;  4JI5 B;  4XDJ A;  5FPO A;  4O4I A;  1KU9 A;  1PL4 A;  4JTA B;  2P22 C;  4ICG A;  1LUV A;  3T1Y B;  1FYJ A;  2Q7G A;  4UUJ C;  2DW4 A;  1PM9 A;  3WFV A;  4HZ3 A;  1N32 O;  1N34 O;  2PI4 A;  4LCU C;  3KCY A;  3ZMU A;  3JAS B;  4UCT A;  4LBE C;  4H33 A;  1Q6I A;  3BFR A;  1MMM A;  2HEP A;  3JAW B;  4FPP A;  1M57 C;  1LNQ A;  3D36 C;  3S3W A;  3AG3 B;  5KHJ A;  2ITC C;  1MNG A;  3JAT A;  4U7N A;  1Y67 A;  3QTC A;  1BZK A;  1H38 A;  1PKX A;  4EFE A;  1HW7 A;  3SPC A;  2JGD A;  4DV5 B;  2YXH A;  1Q6U A;  3SDL A;  4B08 A;  4MVM A;  5EC1 C;  3IC9 A;  5CA0 A;  1NTM H;  1S72 V;  4H0L B;  3WG7 C;  4RUE A;  1FXK C;  4DR6 O;  3K03 A;  2QM7 A;  2OWO A;  4LFA O;  4YJ3 B;  4CS2 A;  4DR1 O;  2JS3 A;  3LUT B;  1B6Q A;  4DXW A;  2BCC H;  2IW5 A;  2EIM B;  3HKC A;  4L87 A;  1N4C A;  2OCC B;  2AW9 A;  2EUL A;  4BIZ A;  2EX3 A;  4FIP C;  2DN9 A;  1BHA A;  3K5M A;  1P4R A;  3DC6 A;  4Q6G A;  3CXC U;  1XOU A;  2JS5 A;  2QWO B;  3AG3 C;  2C2A A;  1WN7 A;  2WAM A;  2PYL A;  1QHT A;  4P9O A;  1TVK B;  2HJD A;  3R65 A;  5C8Y B;  2VWJ A;  4FLY A;  1K9M W;  1TVK A;  1W0K G;  5IYZ B;  1M5I A;  3TXQ A;  1AJP A;  1HWY A;  2E75 B;  5C8Y A;  3M7M X;  2RMK B;  4BW5 A;  1EN6 A;  1N0N A;  1NQT A;  4CH6 A;  1FFX B;  3K0G A;  3RVY A;  1F4M A;  4GUN A;  3QVN A;  2ZE7 A;  3SJA C;  2ARH A;  2Y4T A;  4GX1 A;  1CEZ A;  1AI4 A;  4DR7 B;  1ARO P;  5LHH A;  1WPX A;  4X64 O;  3OR7 C;  3K9S A;  3T2M A;  4WBN A;  2ZR3 A;  3K5N A;  2EIM C;  4JV5 O;  5BMV B;  4KXR A;  5LYJ B;  4CZZ A;  1VQ7 V;  1Z2G A;  5BMV A;  4DRX B;  4EEQ A;  1GM9 A;  2JGU A;  1R3L C;  2GV9 A;  5GW7 A;  3GB7 C;  2ZM6 O;  4JAU A;  3CRC A;  4LNU A;  4RUF A;  1XUQ A;  4F4L A;  4P30 A;  1Y76 B;  2KKW A;  2Q6A A;  3VQW A;  1HNX O;  2QEX V;  3DTU B;  2AGA A;  3U0Z A;  4MW8 A;  1EFR G;  5L3F A;  1NBM G;  1U96 A;  2R9R B;  3RFR A;  3RYI A;  2YS8 A;  4UVA A;  1WB7 A;  2W0X A;  4OPH A;  1IBM O;  2P5O A;  3CSX A;  2DOS A;  3CCR V;  1DF5 A;  2IH3 C;  4K35 A;  2L35 A;  4DUY B;  2OYQ A;  3QF7 A;  5ITZ A;  1QLE B;  1SZX A;  4J11 A;  1V9P A;  1WNS A;  5LBQ A;  3SPJ A;  4RQE A;  2CTW A;  4JI2 O;  3G67 A;  5FL7 G;  5KX5 B;  3QG5 A;  3HR0 A;  3OM3 B;  1W0J G;  4G28 B;  2A3Q A;  1N0J A;  1QU7 A;  5KX5 A;  2R70 A;  2NN4 A;  2YI9 A;  1ENV A;  1K73 W;  4K3A A;  1IBL O;  3L75 H;  1OCZ C;  1R3K C;  3OTO B;  4UVB A;  3ZHU A;  5JQG A;  4LF9 B;  3JD4 A;  2ZT9 B;  3JAK A;  1BCC H;  4L8J A;  1VEW A;  1DGS A;  1F7Y A;  3F7Y C;  1QLN A;  4K0K O;  2BOB C;  5LMU B;  4JI3 B;  4ZBM A;  1YSC A;  2EIL B;  3ZRV A;  3T1C A;  1IXB A;  3P3P A;  2RJZ A;  2LFS A;  2BOC C;  4FM1 A;  1JPX A;  1K4D C;  4X88 A;  2Q4P A;  4FFK A;  4GX2 A;  1JFF B;  2YIC A;  3CCS V;  3FB8 C;  5FPR A;  5LMN B;  1HP8 A;  2YEV B;  4DW1 A;  3MAQ A;  4IGG A;  2Q69 A;  1JMK C;  4PJ0 Z;  4JYB A;  1NTK H;  4UCO A;  3N2K B;  3B09 A;  4DR2 B;  4LF7 O;  5IYD O;  3ZED A;  3LSQ A;  1SQG A;  1NR7 A;  4B3R B;  3CMA V;  1YTF B;  3W7W A;  2FKX A;  3B2E E;  4CH4 A;  4BAY A;  1KP3 A;  2XND G;  2QTO A;  1COW G;  4IHJ B;  4CC6 A;  1G6U A;  2ETN A;  2MK3 A;  4P2Z A;  4JI0 B;  3CCL V;  1SQQ H;  2XT9 A;  3ZHT A;  1AVM A;  4ZI7 B;  2Q8V A;  2CGN A;  1MG1 A;  4I55 A;  3K3W A;  3JAR B;  1K5Q A;  1K92 A;  2M7W A;  2RQ6 A;  5KAI Z;  2VRZ A;  3JAR A;  3T4D A;  4B3T O;  3QO7 A;  1KUQ A;  1G1X B;  4YHH B;  4MVR A;  4B3S O;  5KMG B;  1YHQ V;  4X1K A;  4LF5 O;  5LP6 A;  3CRA A;  4UFZ A;  4CH3 A;  5KUM A;  4PA9 A;  2ZNI A;  1YTF D;  3QO8 A;  5BXZ A;  2W0F C;  1VQK V;  2WLK A;  5KA6 A;  3E89 A;  3G6B A;  2A7W A;  2YUA A;  4DV2 O;  4W4K A;  1DLB A;  4TT3 G;  2VQF B;  1GK9 A;  1YI2 V;  4DV3 B;  1VAR A;  1YEW A;  3AG4 C;  4MTX A;  5LXT B;  4PA7 A;  1OJH A;  2GSM B;  1BHB A;  2PY5 A;  3E86 A;  4GKK O;  3ZMT A;  1Y4M A;  3K04 A;  4X9Q A;  4X1Y A;  3PJS K;  2F66 C;  2Q67 A;  1Q6H A;  4XDL A;  1K3E A;  2H94 A;  4YIO A;  2W6J G;  5EBL C;  2CH7 A;  3EHB B;  3JD3 A;  1XHX A;  2JRI A;  2YSU B;  3CJH B;  3OE7 G;  4UB8 Z;  4I7Z B;  3H1I H;  4DR4 B;  2Y0P A;  4J9Z B;  1GH6 A;  4DV4 B;  4AIL C;  2BTQ B;  3K06 A;  4ASU G;  1I5X A;  2WA4 A;  2LGW A;  2BTQ A;  4KUM A;  3LSS A;  4PHZ A;  3CCV V;  2HJF C;  3SPH A;  2JEU A;  1XMO O;  1OCO B;  3CYO A;  4JI6 O;  3THO A;  1KEC A;  4WFG A;  1H2S B;  4PDV A;  1KBH A;  3G4S V;  3E8G A;  2W6I G;  3FAV B;  4YY3 B;  5IDJ A;  3ZHV A;  3ABM B;  2UUA B;  1XDC A;  3D3I A;  2UUB B;  2QM8 A;  1HNZ O;  2IM9 A;  4JYA B;  3TCU A;  3L72 H;  3RYC A;  2ZNJ A;  1YIJ V;  1I0H A;  3UQ8 A;  4JI8 B;  4PA3 A;  3C3T A;  2G38 A;  4N21 A;  1BMF G;  3C3S A;  4OX9 O;  1Q90 D;  5B66 Z;  2LQT A;  3L73 H;  3BAB A;  1SC5 B;  3APO A;  3ZHQ A;  5IWA B;  4KHP B;  3DSQ A;  3P3N A;  1DK1 A;  5E1A C;  1G4Y B;  2LO1 A;  3CPW U;  1RSO A;  2HR3 A;  2Q9L A;  5A9G A;  4U3J A;  1B04 A;  1ZLZ A;  4JAA A;  4X62 O;  2B9Z A;  2Y48 A;  1M90 W;  3H01 A;  1TAE A;  3T1H O;  3E8B A;  1RP3 B;  3HKB A;  4QIW F;  3CME V;  1YDX A;  4QPJ A;  2GUZ A;  4JI7 B;  4ZHQ A;  1TGO A;  2F4V B;  3J80 N;  5GON B;  3CCJ V;  1R6N A;  3Q4H B;  1L1F A;  1W2B U;  2YDE A;  1B06 A;  3RGB A;  4YJ2 B;  5GON A;  1R6T A;  2WLI A;  3WB0 A;  1XMQ O;  2F95 B;  4IL6 Z;  1XNQ O;  2DWE C;  2UXC B;  4J42 A;  2VWK A;  1ZAU A;  4JI1 B;  1XIL A;  1H8E G;  5JCO A;  1XI1 A;  4U3F H;  1K7D A;  2YXY A;  3N27 A;  5EYP B;  4YXW G;  4PA4 A;  2IJJ A;  2KSD A;  2ZIM A;  3E8H A;  4NR1 A;  4K8X A;  1HNW B;  3D36 A;  4X1I B;  5EYP A;  1IUR A;  5EZY A;  4GKJ B;  5BY1 A;  1V54 B;  3SYC A;  4X65 B;  5CBG A;  3RWR D;  1M56 C;  3HPL C;  1D5N A;  1M9N A;  1TUB A;  5GTH Z;  2E5L B;  1WP8 A;  4KFM A;  1AI5 A;  3PN1 A;  2CK3 G;  4OPA A;  3WG7 B;  3CWB H;  3EFF K;  5CBF A;  1SZT A;  5EK0 A;  5K1P A;  3RYF B;  4LF6 B;  3HKE A;  1FXK A;  2IJI A;  1KC8 W;  4W4L A;  4AQY B;  1WAZ A;  4H13 B;  2Q7E A;  2Y69 C;  3QO5 A;  4J10 A;  2GBO A;  4DV7 B;  1GRJ A;  3ZRW B;  2ZD9 A;  2ZQM A;  5A2Q N;  4FLU A;  2XTA A;  3OAA G;  5EIB D;  3FB6 C;  3H9V A;  5EIB C;  3JAS A;  2B1G A;  4FLW A;  5JWP A;  1JOY A;  3JAW A;  1SA0 B;  1I94 O;  3OTO O;  1RM1 B;  1FJG B;  4DV0 O;  4DK1 A;  1V54 C;  3AG1 B;  1DF4 A;  2GHY A;  2FB5 A;  2AHY A;  2KG7 B;  3ZN0 A;  1IBK B;  1QNM A;  3AG2 B;  4UXN A;  3FFQ A;  5H6R A;  3D3Q A;  3SYA A;  1QVF U;  3F5T A;  4RQF A;  2DJV A;  3K58 A;  4LFB O;  1QR9 A;  2XHB A;  1P84 F;  2X6C A;  3ZHS A;  2EZP A;  4JI3 O;  1XNR O;  4DUZ B;  4R50 A;  1H8H G;  4TOI A;  1PPJ H;  2WWW A;  2YXL A;  4FM2 A;  4O2B B;  3CCE V;  1Q81 W;  1KQS U;  2X6B A;  2PF4 E;  3CEI A;  1I08 A;  2Y0I A;  4DR5 B;  4NXN B;  4UCS A;  4YJ3 A;  1Q86 W;  1ZX3 A;  3BEH A;  4MVU A;  3RN4 A;  5BZB A;  3M8A A;  4R8C A;  1GAX A;  2VQE B;  4DYL A;  4UVC A;  2Q5Z A;  3CE2 A;  4WFA V;  1Q5O A;  4P9P A;  2QWR B;  4MW3 A;  4YIP A;  4X66 O;  4ABM A;  1LR1 A;  1NKD A;  3KCX A;  3ZHR A;  4LR3 A;  1RM1 C;  3BRC A;  3K5L A;  2DQ3 A;  4I50 B;  4I9W A;  3AG1 C;  5F2V O;  5JVD B;  3NXS A;  2WLH A;  3VOU A;  3AG2 C;  3A0R A;  2PGG A;  4RWU A;  4I50 A;  5CN0 A;  5IYZ A;  5J9P C;  1GO3 F;  3BHP A;  2ITD C;  3N2G B;  4J7Z A;  1VF6 A;  1BT8 A;  4IYH A;  1FFX A;  2UU9 O;  3TET A;  3N2G A;  4RAI A;  1R6K A;  3DGE A;  2N05 A;  4TQD A;  2WLN A;  1MOF A;  1XBL A;  4CBC A;  1F23 A;  3IGA C;  4JAS A;  1GM7 A;  1BL8 A;  4KP4 A;  3U10 A;  4J7K A;  3GWO A;  1SES A;  5LYJ A;  4GCZ A;  2UXD B;  1J95 A;  4QJF B;  1OCZ B;  4UCR A;  3WB2 A;  4DRX A;  1N36 O;  3H1H H;  3CXH F;  1AI6 A;  3JD2 A;  3SYP A;  2ZKO A;  1FXV A;  3HKD B;  5B1B C;  4GLX A;  3K59 A;  1Y76 A;  1B3Q A;  1PNM A;  3MDS A;  2DYS C;  2O57 A;  1WA8 B;  1S0V A;  3E83 A;  5CBH A;  4MTO A;  2P4V A;  5JJN B;  4BIO A;  3E22 B;  4TUY B;  2UXX A;  5BR8 B;  1R3J C;  5HFL A;  1SKV A;  3E35 A;  2NNU A;  1E1R G;  1XRE A;  3CP1 A;  2UUC O;  3F7V C;  3GVM A;  2HG5 C;  1JVM A;  4HNA B;  1AB3 A;  1OV9 A;  2XAH A;  1S3J A;  5IJ9 B;  3JYC A;  2QKC A;  4JI4 B;  2RCV A;  3CX5 F;  3A8T A;  2P6J A;  5IJ9 A;  1V55 B;  1S77 D;  4I5S A;  2E74 B;  2P4K A;  3K5O A;  5FLX N;  1N34 B;  4CS3 A;  1UFI A;  1YJN V;  1Z5V A;  4G27 B;  3RBZ A;  3P30 A;  5B1A B;  4TV9 B;  1BSM A;  1LUW A;  3ZS8 C;  4CH5 A;  3EVK A;  4X89 A;  4E2L A;  1BQZ A;  1P7G A;  2FML A;  4H37 A;  3ABT A;  5LOV B;  3X2Q C;  4MVZ A;  1AIL A;  3JD0 A;  1H2L A;  1XEQ A;  3O65 A;  2PZS A;  2IJK A;  2A79 B;  4JI8 O;  4O4J B;  4FJC C;  1JX9 A;  4PV1 B;  1THZ A;  2V4D A;  3ML0 A;  2L6L A;  1EN4 A;  1L8D A;  2RDC A;  3W7U A;  1JFF A;  2ILM A;  2FL4 A;  1VQ4 V;  4DR6 B;  5KHH A;  4I0X B;  5B1O A;  1F4N A;  3KKY A;  4FVM A;  5J2T B;  3ZMS A;  1JJO A;  2LW1 A;  2YEV A;  2DYR C;  3UO2 A;  5CA1 B;  4J41 A;  4LFA B;  4Z1M G;  5IWA O;  4EFB A;  4HAM A;  1Y74 B;  2CGO A;  2Z3Y A;  5CA1 A;  3N2K A;  3RYH B;  2RN9 A;  1V55 C;  2WA3 A;  2EIK C;  1EZV H;  4FZ0 A;  4Z2W A;  3IAY A;  1VQO V;  3AG4 B;  1CP9 A;  1YIT V;  2NLJ C;  3SJB C;  2QKA A;  4RO2 A;  1SRY A;  5B1A C;  4IHJ A;  4LF8 O;  3IFX A;  3LNN A;  3A2F A;  4PA6 A;  4EB6 B;  5IYC O;  3JSL A;  4PD4 F;  2QTS A;  5KHG A;  4CC5 A;  4MS2 A;  4DR3 O;  1I5Y A;  3HB3 B;  4ZI7 A;  1KYO F;  2HP8 A;  2PTM A;  3SYQ A;  4FM0 A;  1GTO A;  3L74 H;  3B8N A;  2DE0 X;  1RPR A;  2HVJ C;  4JI1 O;  4NYK A;  2Q68 A;  2M6Y A;  2ZDI C;  3LNM B;  1YCI A;  5IY5 C;  4TSF G;  4TV8 B;  1OCC B;  5KMG A;  4K8Z A;  3BA8 A;  4X64 B;  4G2K A;  1HNW O;  1Q43 A;  1KKD A;  2XAF A;  3AK1 A;  4TV8 A;  4GKJ O;  4JV5 B;  5LA6 B;  1L0L H;  2IBZ H;  2BE3 A;  2YIB A;  1NJI W;  3CC2 V;  5LA6 A;  3FX7 A;  4ZOL B;  2E5L O;  1CXZ B;  5TIS Z;  2A9H A;  4TQF A;  5DM6 V;  2ZM6 B;  2X0L A;  5LXT A;  4LF4 O;  1VIB A;  4LH7 A;  5J2U B;  4QPK A;  5KAF Z;  1J5E O;  4LF6 O;  4JI5 O;  4JF3 A;  5JH7 B;  3A0H Z;  2D3O W;  1NH2 B;  2EJR A;  2EZO A;  3T1Y O;  2JEX A;  2Q73 A;  5FNV B;  1G8M A;  3FB7 C;  1IBM B;  3OEE G;  3CS5 A;  3CJH A;  4O4H B;  2ADQ B;  1D2D A;  3OEH G;  4NVP A;  2LP7 A;  1EBO A;  3UO3 A;  2P90 A;  1S76 D;  1OCC C;  3J7A U;  1FXH A;  4FZ1 A;  4JI2 B;  2YIB D;  4JTD B;  1AR5 A;  3RT3 C;  1SER A;  5CMU A;  1MZE A;  5CB4 B;  3G71 V;  3W7X A;  1MAB G;  3P32 A;  4DV5 O;  2NR5 A;  3L70 H;  4X20 B;  2YI8 A;  4FFB B;  2HKO A;  5EBM C;  3SJC C;  3FAV A;  1VQ8 V;  3OT7 A;  1EZJ A;  2CTQ A;  2CTP A;  3VBB A;  1YZB A;  4GX0 A;  1NH2 D;  4WCE V;  2KB1 A;  4K0K B;  1QVG U;  2D2C B;  2P7T C;  3UM7 A;  4U7O A;  2OCH A;  3CC4 V;  3TGU H;  3RW0 A;  2FYU H;  1GN4 A;  1KP2 A;  2VQE O;  1ZSP A;  4BWA A;  2BTO A;  3MHS C;  4X8A A;  4WFF A;  2XAJ A;  3JSN A;  2CTR A;  3K08 A;  1K97 A;  1M56 B;  3OD4 A;  1L0N H;  3ASO B;  1NVP B;  4LFC B;  4DO2 A;  4IIJ B;  5IT9 N;  1WLE A;  4NXM B;  3CRM A;  3H1K H;  1YJ9 V;  1VQ9 V;  3SGI A;  3FKS G;  4A5U B;  2E3C A;  4BIU A;  3JAM N;  3B77 A;  4QE9 A;  1VQN V;  3Q4H A;  4O2A B;  1ZUQ A;  3K79 A;  2H8P C;  2Y69 B;  2DQ0 A;  5E79 Z;  4DR7 O;  1I7F A;  4YJ2 A;  4QE7 A;  4J9Y B;  4O2A A;  4B3M B;  2HHH B;  3ABK B;  1SQF A;  5JJJ B;  3E8F A;  1Y66 A;  4MTG A;  2ZIN A;  4MVQ A;  1FKA O;  2K1E A;  4MSW C;  1PP9 H;  3I55 V;  1TUE B;  2UXN A;  3U11 A;  2YID A;  2UXD O;  1PNK A;  2MW2 B;  2A0L A;  1GMG A;  4UB6 Z;  1FD9 A;  1GN6 A;  3ASN B;  2GDS A;  1NVP D;  1SQX H;  4X1I A;  4B3S B;  4AI8 A;  3ASO C;  1HDJ A;  2QA4 V;  2IH1 C;  3ZIA G;  4I4T B;  3UT5 B;  2EIN C;  2WLL B;  2JDI G;  3OGC C;  1KD1 W;  1H2M A;  3GWK C;  5C93 A;  3DXR B;  1Q82 W;  3OUS A;  3BY6 A;  1SS3 A;  4DV6 B;  3STL C;  1MSW D;  1U97 A;  3DXR A;  4AHC A;  4DUY O;  3ABL C;  1OHH G;  2Y4U A;  5DED A;  3RYF A;  5BR8 O;  1ZTE A;  5KUK A;  1O9H A;  5K1X A;  3F5W C;  1VQ5 V;  3FD9 A;  2YIA A;  3ABK C;  4R6Z A;  3D8C A;  1VQL V;  2ZE5 A;  1VP7 A;  3ZRW A;  2K9P A;  1FFT B;  2R9A A;  4UV9 A;  1F51 A;  2QWP B;  3BPZ A;  4JI4 O;  2JIZ G;  4J7J A;  1JQ0 A;  5JCO C;  4LF9 O;  1GN2 A;  1SA0 A;  2UXB B;  2XAQ A;  3TJT A;  2Z5U A;  3ASN C;  2CE4 A;  3VQX A;  1XHZ A;  2ZXW B;  5L3D A;  3JCZ A;  2QM4 A;  3CHX A;  2GTS A;  1M4U A;  1QR8 A;  2KG7 A;  3SYO A;  3JAT B;  5IJ0 B;  1NU1 H;  5LMU O;  2IJH A;  1XMO B;  2KQX A;  1FS0 G;  2JGD B;  3S3X A;  4JI6 B;  2JK5 C;  5IJ0 A;  4UV8 A;  1JR9 A;  5GTI Z;  5CA0 B;  1TA8 A;  1EN5 A;  3T4Z A;  3IC7 A;  3K0D A;  2WPD G;  4O2B A;  1HNZ B;  1X4T A;  2QR4 A;  5LMN O;  1N33 B;  3C90 A;  4XBF A;  4DV1 B;  2PYJ A;  1VQM V;  4JPR A;  2EIJ B;  1QCE A;  5H2F Z;  1ORQ C;  1AP6 A;  2JJ2 G;  4QGP A;  2N74 A;  2Q0A A;  3LSU A;  5LGN A;  2ZIO A;  4DW0 A;  5IE9 A;  1HR0 B;  4DR2 O;  4JZG A;  4ZIB A;  3HKC B;  1P49 A;  4OX9 B;  4PEL A;  1RFY A;  2HVK C;  1JCH A;  2QGN A;  1SET A;  4B3R O;  2V1D A;  2F1M A;  3AK2 A;  4PDM A;  3FB5 C;  1S5J A;  2ADP A;  1KB9 F;  4HYO A;  3TXS A;  5B1B B;  2ZXW C;  2IU0 A;  1GM8 A;  4E4E A;  1YVW A;  1WPB A;  1IZ3 A;  5JVD A;  4JI0 O;  1PL0 A;  2DYS B;  2Z0A A;  2F93 B;  3ETG A;  4NB5 A;  4X62 B;  3T1H B;  4O4L B;  1X59 A;  1CPY A;  4NTY A;  4PDL A;  2X6A A;  2R9I A;  3AEI A;  2Q0O C;  4O4L A;  1Q8I A;  4R7C A;  1WP7 A;  4N23 A;  3ZX6 A;  3OMN B;  2LGQ A;  2OTJ V;  3VQY A;  2EIJ C;  1SQB H;  4YHH O;  2P67 A;  1WJZ A;  3OMA B;  3RVZ A;  4FLT A;  4WBN B;  1AI7 A;  3BAA A;  1XMQ B;  1P7B A;  3L9D A;  4GYC B;  4D6T H;  1K8A W;  1XNQ B;  5L3E A;  3J81 N;  2XAS A;  4FLZ A;  4JYC A;  3B4S A;  2AXT Z;  2OIG A;  4MVO A;  2OCC C;  1YF2 A;  1NZ6 A;  2VQF O;  2QSA A;  1WB8 A;  4DV3 O;  3FYI B;  4LNU B;  3HKD A; 
#chains in the Genus database with same CATH homology
 3B09 A;  1Q6U A;  1FD9 A;  1Q6I A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...