3B09A

Crystal structure of the n-domain of fkbp22 from shewanella sp. sib1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
b'DLFSTMEQHASYGVGRQMGEQLAANSFEGIDIPAVQAGLADAFAGKESAVSMEELQVAFTEISRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of N-domain of FKBP22 from Shewanella sp. SIB1: dimer dissociation by disruption of Val-Leu knot
pubmed doi rcsb
source organism Shewanella
molecule tags Chaperone
total genus 17
structure length 65
sequence length 65
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.460 Mainly Alpha Orthogonal Bundle Helix Hairpins Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain 3b09A00
1Q6HA 1Q6UA 1FD9A 1Q6IA 3B09A
chains in the Genus database with same CATH superfamily
2YIBD 4UV8A 3STLC 2F95B 1YJ9V 1KP3A 4LF5B 3UM7A 2O57A 3K9AA 1K9MW 5IE9A 1XMQB 2JJ1G 5CB4A 2B1GA 1V54C 2AHYA 4D6TH 1M4UA 1FXVA 1RFYA 2XAHA 3N2GA 4YIPA 4B3RO 2JIZG 2VQEO 5ITZB 1I5XA 3E8FA 1XNRO 1AJNA 4QE7A 4PV1B 1L0NH 1H2LA 4MVSA 3LDCA 3PN1A 5DM6V 1AR1B 1QR8A 2Q69A 1X4TA 2Q9LA 4X62B 3B4SA 3UO3A 2V1DA 1EN6A 3N2KA 1IBMB 5IYZA 5CA3A 5E79Z 2EIKC 1BSMA 2CTWA 4YJ2A 1M9NA 4HBNA 3CCUV 5D5QA 2NNUA 5CA0A 1JOYA 4MTFA 2LO1A 2H94A 4X65B 4U3JB 2RMKB 5FPOA 2M7WA 3F5TA 1FJGO 1D5NA 3K5LA 3J7AU 3WU2Z 3K57A 3GB7C 2LFRA 1OCCB 1URFA 4DRXB 4W4KA 4TT3G 1YIJV 3FD9A 2XAJA 3W7SA 4WFBV 3ASOC 2X0LA 1IVSA 1FD9A 4LF5O 5LGUA 5CBFA 3BABA 4LH6A 3RYFB 2PY5A 1HWYA 3MHSC 1M5IA 4UUJC 3QO5A 4RQFA 3E8GA 4O2AB 1DTOA 2DYRB 3OTFA 2ZQMA 2EIMB 2ZXWB 4JI6B 3SYAA 5GTIZ 1I5YA 1NTKH 1K92A 3U0ZA 3OFNG 4PDVA 4OGQB 4JYYA 4DXWA 4UCRA 1YF2A 2RQ6A 2IBZH 1N0NA 3FYIB 3Q4HB 4X62O 3ABMC 3TXQA 5BXZA 3L70H 1HR0B 1IBMO 4FZ1A 4J11A 2DYRC 3ZMUA 5KX5A 2ZXWC 1UJWB 2A79B 1D5AA 3OR7C 3ZMTA 1QQCA 3ZN0A 2XHBA 4X9QA 5LYJA 1O9GA 4GYCB 3MDSA 2BSKB 2KKWA 4O4HA 2JVDA 5KUKA 1KU9A 2F93B 2X6BA 3QG5A 4WF9V 1H2MA 4HNAA 2Q68A 4U7NA 5C93A 1K3EA 4JZ2A 5BMVB 3QNEA 2QSAA 4QE9A 5CA1B 5JCOA 1V55C 3HR0A 2QKAA 4I50B 2OIGA 2MK3A 3T2MA 3DC6A 4LBEC 3ZHUA 1RSOA 4JAAA 1XI1A 1FFXB 1NZ6A 3ML0A 4NB5A 3RN4A 3ZRXA 4XDKA 1K97A 2JEXA 1R6NA 4DW0A 3K79A 2L6LA 1NH2B 3CJHB 1US6A 1K5SA 5IJ9A 4JI1O 4JI6O 4CS2A 3QVNA 3ASNB 1R1BA 3AG4C 4PD4F 4Q6GA 1XUQA 2L35A 2ILMA 3FB6C 3JAWB 1I7FA 2JS5A 1HR0O 4FLTA 4Z2WA 5L3GA 3CC7V 4JI8O 2XASA 5BR8B 1YVWA 3JASA 3OD4A 1FXKB 2FMLA 3OMAB 1BT8A 4UB8Z 5FPRA 2Q73A 1YEWA 1Z5VA 3RWRD 5LMNB 2QTSA 2CTRA 4FLYA 4JTAB 1MZEA 3OMIB 4KXRA 3D8CA 2JJ2G 5GW7A 4Z1VA 4BR6A 3JSLA 2E74B 2WLLB 1AI7A 5JJNB 1P7BA 2LP7A 1VF7A 3JAKB 3JD3A 5L3EA 4B7KA 4AILC 1XOUA 3B77A 3H1JH 3TJTA 3CMAV 3KG2A 1BS3A 2A0LA 1NTMH 3IAYA 1W2BU 3SJAC 1KQSU 4DR1B 3CC4V 4UCOA 4TV8A 1IBLO 3ZRWB 1AI4A 4WBNA 2EIJB 4O2BB 3SPIA 3OEHG 1S5HC 5CN0A 1KBHA 3CCSV 5FLXN 4DW1A 1TVKA 2ZNIA 3WG7C 2HVKC 4AQYB 3VQVA 1M56B 4QPJA 2EZPA 5B1AB 5L3FA 3IC9A 4ZBMA 2E75B 3RVZA 2KB1A 1BMFG 1NTZH 5BR8O 2A9HA 4JI0B 3CRCA 1K5QA 4JASA 2P4VA 1EN4A 3QO8A 4K3AA 5LMNO 4PELA 4FZ0A 5DEDA 1YZBA 4XBFA 2WLIB 4F6RA 1H2GA 1ZWIC 4UVCA 2QKCA 1H2SB 1M56C 1LUWA 3KCXA 4C7UA 4IT5A 3F5WC 3K0GA 5EZYA 1XNQO 1JCHA 2CUGA 1P84F 1BHBA 5LGNA 3E22A 4TV9B 1WB8A 3I56V 4DV6B 4PI0A 2N05A 1PP9H 2Q0OC 2OWOA 1M90W 4ABMA 4B08A 2GHYA 2GUZB 2E76B 3T4ZA 1OCRB 3CB2A 5JJJB 4O4IB 1VQ5V 3RYIB 4DR1O 2Z3YA 3IFXA 1JFFB 2YIBA 2JDIG 1L8DA 2DMXA 1MA1A 1NR7A 5H6RA 1VQLV 5EBMC 2PTMA 4DV3B 3HKCB 5CBGA 4AQYO 2BTQA 4X1KA 4K0KB 3UKMA 1E1QG 1XMOB 4JI7B 1OCRC 4ZI7B 2DQ0A 2UXBO 1VIBA 2QM4A 5EIBC 1PKXA 1XBLA 1Q6UA 5EIBD 3QO7A 4JI0O 3BPZA 1GM9A 3L71H 2Q7GA 5LOVA 4LC1A 4DR3B 1OCOC 5A9GA 2IJHA 3H1IH 4JYAB 1K7DA 4LWSB 1UFIA 3OW2U 4I9WA 4ZKIA 2BOCC 1QLEB 1N8RW 3FB5C 5IT9N 4PJ0Z 1QHTA 1O9HA 3B40A 4X64O 2ZIMA 3T1CA 5LHHA 2KG7B 4I9QA 4DV6O 1GN4A 5IDJA 2BCCH 5H5NA 4FVMA 1EM1A 2YDEA 3ABLB 1ZLZA 3B09A 2UU9B 3S3XA 4LF4B 2GTAA 4LFBB 3ABKC 1BHAA 3JSNA 1H8EG 1FFTB 1AB3A 4LFCB 3JAMN 4BAYA 2Q4PA 2QWRB 1WA8B 5E1AC 5EYPB 1JVMA 5B66Z 2LQTA 4DV3O 4WFFA 1VEWA 4GT1A 4K0KO 4CH6A 1IBKB 4UCUA 2Y48A 4DRXA 3M99B 4HZ3A 4MW8A 4OX9B 2EULA 2AHZA 3K5NA 3IJ4A 3O65A 1EBOA 3W7UA 4MS2A 4I0XB 3TCUA 3EVKA 4PA9A 3FYEB 3CD6V 3AG3C 3ETDA 2HJFC 2EINB 3K3WA 4O2AA 1JJOA 2Y69C 1N32B 1NS1A 1DLBA 3C3TA 4JF3A 4CS3A 4QJFB 5JQGA 1HW7A 4IL6Z 2Q67A 4FFBB 1XNRB 1D2DA 4GCZA 1E79G 4KL1A 4O4JA 1QBZA 2GDSA 2UU9O 1T5EA 4LFBO 2Y0IA 3SYPA 4BWAA 3AK2A 5LL6Y 1BZKA 4LFCO 1GM8A 2G38A 1FXHA 5JWPA 3DTUB 1S77D 2QDOA 1GAXA 4QPKA 2RDCA 3CXHF 3RW0A 5JJEB 4JZGA 4TQFA 2BSKA 4R8CA 2DWDC 4GX0A 1SQVH 3OUFA 3A0BZ 4NTWA 4K8XA 3MD0A 2JGDA 3P3PA 4GX5A 1MNGA 4KP4A 3AK1A 1LNQA 1KB9F 2FYUH 1JMKC 3C3SA 4CC5A 4TSFG 3FB8C 1K34A 4OX9O 1G8MA 3BFRA 4I50A 1YTFB 2RNBA 3X2QB 4DR4B 1Q43A 1SF9A 1FFXA 2UUAB 2ZE6A 4PDMA 5JH7A 4HAMA 4FPPA 1N32O 1N0JA 3OUSA 3CJHA 3E2EA 1N4CA 2OCHA 2RCVA 1WN7A 4Z1MG 3B8MA 3CHXA 2HEPA 1YTFD 1J95A 2HG5C 1S76D 1I94B 3CSXA 3HKDA 4D7TA 1Y76A 2OTLV 4JTDB 4AI8A 3SJQC 3E8HA 4X20A 3FAVB 4N23A 1Q6IA 4G2KA 2B1IA 4JYCA 5H6QA 1FXKA 4ICGA 3CPWU 1S5JA 3DGEA 1TA8A 4DV5B 3K59A 3ICXA 3ABTA 4L8JA 4TUYB 3KKYA 3RBZA 4QGPA 3CRMA 2ZE7A 3OR6C 4JAUA 5KHGA 2WLLA 3ZHVA 1QR9A 5EBLC 4RQEA 2P90A 1YITV 5FNVA 5EK0A 2IJKA 1R3KC 3M8AA 2QM7A 3JD1A 4J10A 2DJVA 2ZKOA 3L73H 3OGIB 4J80A 1E1RG 5GTHZ 1NJIW 2WLMA 1DGSA 2JRIA 4KHPO 1N33B 4DR4O 2DOSA 1F51A 1SS3A 1CEZA 1FAFA 5KMGA 3JD4A 2UUAO 3B8NA 2IH3C 1I0HA 1TUBB 4W4LA 4I7ZB 4MTOA 2PF4E 4OPAA 3ZRWA 1AR4A 4O4LA 3JALB 3WB1A 3RVYA 3FB7C 5B1BB 1OCCC 4JI1B 1PV0A 2YSUB 2GBOA 4YXWG 2HVJC 3VBBA 4XDLA 1I94O 2QE7G 1Q90D 4X1YA 3FFQA 1XILA 2DE0X 4NXNB 4NTYA 2DN9A 3TK1A 2PI5A 4DK1A 3I5DA 4UXNA 1HNXB 4JI8B 1SZTA 2W0XA 3JYCA 1IXBA 4DV5O 2EIMC 5LA6B 5GONB 1GN6A 2QKSA 4R50A 4EB6A 4X8AA 4GZRB 2YS8A 5C8YA 1VQ6V 2H3OA 2EJRA 4ZHQB 3HKBA 1AJQA 1JJ2U 2UXDB 4A5UB 4JV5B 2CDYA 3TXSA 2LJ2A 2YEVB 2ADPA 4MTGA 3CRRA 4LF7B 1ZL8A 1N33O 1R73A 3HKEB 4FLVA 3JATB 5BZBA 3RYHB 1GN3A 5A2QN 1VQMV 4LH7A 3RYIA 4ZOLA 1KYOF 1XL6A 2YI8A 3SYCA 2CE4A 4WFHA 1M57B 3K06A 5KLVH 4L87A 3K08A 3OEEG 4CH3A 3E35A 3TGUH 1IBLB 3C90A 3CRQA 5IJ0B 1VARA 1K8AW 4LNUB 1P4RA 4H37A 5B1OA 4J7KA 1K4CC 4X89A 1MSWD 2PZSA 3WB2A 4NXNO 2Q8VA 1HNXO 1Z5WA 1QCEA 1Q8IA 4MT8A 2FKXA 5LMUO 4DO2A 4LWSA 1F23A 1NH2D 3N2GB 4YY3B 4FK5C 3CCRV 4PHZA 5HFLA 3ASNC 2VQFB 4DR7O 2UXDO 3G6BA 4JV5O 4JI2B 1XNQB 1OCZB 2Z5UA 2EILB 4G28B 1RPOA 3CE2A 2ARHA 5IYZB 2P5OA 4LF7O 1FXKC 3ZX6A 2K9PA 2F43G 2F23A 1AJPA 2EBOA 3HB3B 2ZE8A 2DYSB 4CC6A 3DSQA 2PUSA 4H44B 1ZAUA 1Y74B 3J80N 1R3JC 5LXTA 3FKSG 1SQBH 5KUMA 3ZHSA 2LGQA 4LF8B 3N27A 5EYPA 3ETGA 3G6EV 4JTCB 3LSUA 2CK3G 3BA9A 1YHQV 2WSSG 2FL4A 5LP6B 1BCCH 1SETA 1U97A 1SA0B 3CCLV 4WCEV 3QTCA 1YJNV 3THOA 2UXBB 5J2TB 1Q3EA 1GTOA 2A06H 2OYQA 4F6EA 3JCZA 3P3NA 1M93A 2N04A 2EIJC 4GLXA 2MW2B 4I0XA 5IWAO 4YY3O 2UUCB 4K8ZA 5LP6C 3EFFK 4JYBA 3ZMVA 4JI5B 2VQFO 3VQYA 2FTKA 2D2CB 3GVMA 2HR3A 2WLNA 2QTOA 3JD0A 1ROPA 5B1AC 1SQFA 1DK1A 3EXAA 5J2UA 4DR5B 4JI2O 4AHCA 4I55B 4RUEA 2YIDA 2YC0A 4FFBA 4X64B 5HFMA 2XT9A 4DR2B 1VMGA 1SQQH 5KX5B 4UCSA 4LF9B 4H0LB 1DF5A 1GH6A 4O4HB 5J9PC 1EZVH 3KZIZ 3RT3C 4I4TB 1R3IC 4HNAB 4J9ZB 4E4EA 4DUZB 2X6AA 4LF8O 4BIOA 1PNLA 2R9IA 1PNMA 1SESA 3RFRA 3SPCA 4FLXA 3LUTB 1S3JA 1YCIA 5LHIA 4PDLA 5AG2A 1MSDA 1L0LH 2OTJV 4UFZA 3U11A 1VQ9V 1NT2B 4QNHB 1RSOB 4MVUA 4YHHB 1X59A 4YIOA 2CGNA 2NR5A 4EKWA 1A32A 1NR1A 1S5LZ 1WAZA 3VQWA 4PA7A 4BIZA 2UUCO 5KHHA 1G4YB 3P30A 4JI5O 2IU0A 3ZHRA 4FJCC 3ZMZA 2XAFA 4MVQA 1RPRA 3K04A 1EFRG 4IHJB 2XTAA 2Y0PA 4DR5O 3G4SV 2JS3A 5ITZA 3ZHTA 2VWJA 5H2FZ 4DR2O 1J5EB 4PI2A 2WLJA 3SYQA 2Y4TA 4LF9O 3JARB 2R9RB 2P06A 2UXCB 1EZJA 5KAIZ 3E89A 1QLEC 3F7VC 1GMGA 1DF4A 2D3OW 3OAAG 2QEXV 4IYIA 4DUZO 4X1IB 4TUYA 1K4DC 3OMNB 4MW3A 4J7ZA 3CCQV 4DK0A 4U3JA 2NN4A 3FX7A 3BVOA 3ABLC 1EN5A 2ZNJA 1XEQA 3W7TA 2ZDIC 4YHHO 4FIPC 5EC1C 1KUQA 3AG1B 1XQ8A 4TV8B 2YIAA 4WBNB 3T1HB 4FLZA 3E86A 2FB5A 2Q7EA 2DWEC 3UT5B 1YI2V 1TUBA 5BY1A 1PPJH 2ZT9B 3RYFA 1R6TA 1Z2GA 2ODMA 2E5LB 3O9OA 3AG2B 3JALA 1TAEA 4JI4B 2A7WA 1Q81W 3ZHQA 3G67A 1AI5A 3LDEA 2HFEC 3S3WA 4CBCA 4OXSA 5KAFZ 1B06A 5LHGA 1COWG 1Q82W 4J42A 4GX2A 4WFEA 2AZ2A 1J5EO 4UCVA 5CMUA 3DXRB 2HHHB 2WLKA 3OTOB 3L74H 4LP8A 1CP9A 3Q4HA 2UXCO 1BGYH 1XDCA 2QR4A 3ZN1A 1RM1B 2R9AA 2EINC 1HNWB 2Y4UA 4H33A 3U10A 2VS0A 3H9VA 5IY5B 5LA6A 3L72H 4JAVA 1NVPB 4RWUA 1WJZA 4RUFA 1VQ4V 2WLHA 3A2FA 2YEVA 4BW9A 2XNDG 5BMVA 1FKAO 3AK3A 5CA1A 4BW5A 2Q6AA 1VQNV 2W0FC 4JGSA 5B5EZ 3G71V 3T1HO 3JD2A 4HYOA 1TGOA 2DQ3A 3RYHA 1JA8A 4KHPB 1Q6HA 3BA8A 3K5MA 1NVPD 2YXYA 2Z0AA 4TOIA 4X66O 3LNNA 2WA4A 2E5LO 1THZA 4JI4O 4EEQA 1V54B 3E8BA 2PYJA 1SQPH 3A8TA 1YJWV 4NYKA 2PGGA 1OV9A 3APOA 2N74A 4JI3B 5B3SB 2R70A 4LNUA 2YUAA 1H38A 1HNZO 3BY6A 1G1XB 1W0JG 5LOVB 4B3TB 1KC8W 2HHHO 3OTOO 4U3FH 2PI4A 4NR1A 3X2QC 2QJ1A 1FYJA 3RYCB 2V4DA 3JAWA 2WPDG 4LR3A 1SRYA 4DV7B 1SQGA 2ITDC 2KSDA 4D7SA 4R7CA 4NXMB 2IH1C 3CWBH 3D36A 1HNWO 2EIKB 1OHHG 4FMTA 4MTXA 4P9OA 5IYCO 3OM3B 2KQXA 5B3SC 1Y6XA 3K9SA 1Y67A 3ABUA 2PYLA 3BCCH 2NLJC 2M6YA 2ETNA 3MAQA 2IW5A 1G6UA 2OIEA 1B3QA 1LUVA 2CH7B 1GK9A 2ZIOA 3JAKA 3SPGA 2HJDA 1TUEB 2OCCB 1W59A 4MVOA 1GN2A 3G80A 1NI8A 1SKVA 5IYBO 3LDDA 4CH4A 3D3QA 3ZRVA 3ASOB 1NBMG 1ZX3A 3SPHA 1VF6C 4P9PA 4FM2A 1P7GA 1UPGA 1Y74A 1GM7A 4UVBA 1VQ7V 2BOBC 2OCCC 4PA4A 3L75H 4O2BA 2R72A 1I08A 3H1KH 1K33A 1VQPV 4JI3O 3CMEV 1VP7A 2IU3A 5LP6A 1ENVA 4B3TO 4UV9A 2QWOB 1SA0A 4NKGB 3ABMB 4DYLA 5J2TA 2ADQB 1BE3H 4DV7O 1XMQO 3K5OA 3GWOA 1MMMA 4DV0B 2XAGA 4NXMO 1OZ0A 4J9YB 3EHBB 1R6KA 1QVGU 2WWWA 5JQGB 5LMUB 5B1BC 3D3IA 1Q7YW 2ZM6B 1FS0G 2WLIA 3DC5A 2AW9A 2K1EA 4YJ3B 4O4JB 2E3CA 4IIJB 4GX1A 1KP2A 1VQ8V 4I55A 4DR7B 5F2VO 3BAAA 4K35A 1HP8A 1PL0A 4FM1A 4Q20A 4TV9A 3VOUA 3BRCA 3OE7G 1V55B 3AEIA 4MVMA 1NQTA 1XHXA 4LF6B 1S0VA 1Y66A 2UUBB 4X65O 1LR1A 4GUNA 2QM8A 5K1PA 2GUZA 4RAIA 2BTOA 1MG1A 1ORQC 4O4IA 2JGDB 4I4TA 1JFFA 1KKDA 3AG7A 3IC7A 1H8HG 3M7MX 2LW7A 1B6QA 2X7RB 1L1FA 1F4MA 1QU7A 3AG4B 1M1KW 3HKCA 5JVDB 2CGOA 2ZINA 2IJJA 1VQKV 4IYHA 2YI9A 4ZI7A 2W6JG 1GRJA 4H13B 4KUMA 4DV0O 5KHJA 1M57C 5JH7B 5KA5A 3SR2C 5L3CA 5CB4B 1N36B 2F66C 5D5PA 4GKKB 2JK5C 1RP3B 1VF5B 3SYOA 5IWAB 4P30A 2HP8A 2ZM6O 1WNSA 1XHZA 4ZIBA 2AZ0A 2Q5ZA 3HKDB 4IHJA 5K1XA 1Y76B 1JX9A 1BL8A 5DN6G 3JCUZ 2XAQA 3CCVV 3CYOA 1F4NA 1AROP 4X20B 2KG7A 4RO2A 3N2KB 1ZTEA 2DW4A 3JARA 3D36C 4LF6O 1BQZA 4YJ2B 5L3DA 1WLEA 2UUBO 3LNMB 5CA0B 4FM0A 2ZDIA 3KCYA 3R65A 3CEIA 3H1LH 1FPOA 2WA3A 4CZZA 1AI6A 1NU1H 1QVFU 3STZC 2C2AA 3L9DA 3ZRSA 4X1IA 5FNVB 1QLNA 1YDXA 3ETEA 1WA8A 3B2EE 1VQOV 1OCZC 2EILC 1MZFA 1H2KA 2CTPA 3WG7B 4MVZA 2H8PC 3H1HH 2P7TC 3GWKC 5KMGB 2DYSC 1PD3A 2CTQA 1CPYA 4WFAV 1PL4A 3ZEDA 2QA4V 2RJZA 4FLWA 4O4LB 3CCJV 5H9CA 1N36O 2Q7HA 3SJBC 4GKKO 2X6CA 3SDLA 3UT5A 4J41A 1F7YA 2W6IG 1JQ0A 4UB6Z 1CXZB 2UXXA 3TETA 4LFAB 4BIUA 3UCSC 3ZMSA 2JEUA 1AVMA 4NTXA 5IYDO 4X1YB 1P49A 4EFBA 3T4DA 3DXRA 1MABG 5LGTA 1K73W 1N34B 3K03A 3ZBHA 5KA6A 3CX5F 4EB6B 2P22C 1OJHA 5LYJB 2UXNA 5C8YB 4PA6A 5FL7G 1IX9A 3HKBB 1SZXA 2F4VB 3QF7A 1WPBA 1XL4A 1WPXA 2P4KA 4CS4A 2BE3A 4J7JA 4U7OA 4TWKA 1IURA 3CCMV 1ZL8B 3UO2A 4MVRA 1Q5OA 1PM9A 1SERA 4TQDA 4DR6B 5EC2C 4ZOLB 4B3MB 4P2ZA 4GKJB 4DV2B 1B04A 1W0KG 3SGIA 2GSMB 1AR5A 1OCOB 1IXMA 4UCTA 2HKOA 1ZUQA 2AXTZ 3H01A 5IJ9B 5KHKA 4R6ZA 5JCOC 4N21A 4LFAO 4FLUA 4JPRA 4QIWF 4FFKA 2B5UA 4B3SB 2ITCC 3SPJA 5CBHA 2P6JA 2JGUA 3BEHA 1YSCA 3JASB 4G27B 4CH5A 1N34O 1Q86W 2WAMA 3RYCA 3WFVA 3ABKB 3CC2V 3J81N 2QWNB 3ZCCA 3FAVA 4E2LA 1MOFA 3OGCC 3W7WA 2XOKG 4KFMA 2F4VO 2RN9A 4XDJA 2Q0AA 4LCUC 1XREA 3UQ8A 2GTSA 1AP5A 1VF6A 3OT7A 3P32A 2HLDG 4I5SA 1GO3F 2QWPB 2CH7A 4IGGA 2EJ7A 4DV4B 2CAZC 2YXHA 3T1YB 2YXLA 3W7XA 4DR6O 1WP8A 2F1MA 2VRZA 4B7EA 3ZJZA 4B3MO 4GKJO 4DV2O 2IM9A 5LXTB 4OPHA 1IDSA 2VWKA 1YXBA 4UVAA 3RGBA 1BQ0A 3A0HZ 4X88A 3K58A 3AG3B 1TVKB 1PNKA 3ZIAG 1XMOO 4JI7O 4ASUG 4X66B 2GV9A 2Y69B 1AILA 4B3SO 2ZE5A 3HPLC 1Y4MA 3IGAC 3NXSA 4DUYB 5B1NA 1QNMA 4DV1B 1AP6A 3A0RA 1H2NA 4F4LA 3AG1C 3SJCC 4DR3O 3PJSK 1WB7A 1HNZB 1U96A 2LGWA 1KMIZ 4JYAO 2QWQB 2XUMA 1HDJA 1ZSPA 2AGAA 2LW1A 4F6RB 3MHHC 3AG2C 3ZS8C 2OT5A 5J2UB 1KD1W 3E83A 5EZYB 5TISZ 1WP7A 3VQXA 4PDRA 4B3RB 4WFGA 5GONA 2VQEB 3E22B 4YJ3A 4NVPA 2ZR2A 5DECA 1GKFA 4IIJA 4LF4O 3CP1A 2A3QA 2ATKC 3BHPA 3CCEV 4DV4O 4ZHQA 1JPXA 2IJIA 2QGNA 3CRAA 3LSQA 3T1YO 4EFEA 2ZD9A 3APQA 2LFSA 3ETQA 3CS5A 3K0DA 4MSWC 1RM1C 5LBQA 2YICA 3R66A 1V9PA 1SC5B 1KKCA 2EZOA 2V7QG 5IY5C 3HKEA 1NKDA 3JATA 2P67A 5KHIA 3WB0A 2ZR3A 1FJGB 3LSSA 1IBKO 3CXCU 4X1KB 2BTQB 2B9ZA 1KECA 4PA3A 1SQXH 3F7YC 3I55V 4DUYO 3NR7A 1IZ3A 1R3LC 2ZCEA 5L3BA 1JR9A 4DV1O 1S72V 5IJ0A 5EBWC 2EX3A 5JVDA
chains in the Genus database with same CATH topology
1Q6HA 1Q6UA 1FD9A 1Q6IA 3B09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  1Q6U A;  1FD9 A;  1Q6I A;  3B09 A; 
#chains in the Genus database with same CATH topology
 2YIB D;  4UV8 A;  3STL C;  2F95 B;  1YJ9 V;  1KP3 A;  4LF5 B;  3UM7 A;  2O57 A;  3K9A A;  1K9M W;  5IE9 A;  1XMQ B;  2JJ1 G;  5CB4 A;  2B1G A;  1V54 C;  2AHY A;  4D6T H;  1M4U A;  1FXV A;  1RFY A;  2XAH A;  3N2G A;  4YIP A;  4B3R O;  2JIZ G;  2VQE O;  5ITZ B;  1I5X A;  3E8F A;  1XNR O;  1AJN A;  4QE7 A;  4PV1 B;  1L0N H;  1H2L A;  4MVS A;  3LDC A;  3PN1 A;  5DM6 V;  1AR1 B;  1QR8 A;  2Q69 A;  1X4T A;  2Q9L A;  4X62 B;  3B4S A;  3UO3 A;  2V1D A;  1EN6 A;  3N2K A;  1IBM B;  5IYZ A;  5CA3 A;  5E79 Z;  2EIK C;  1BSM A;  2CTW A;  4YJ2 A;  1M9N A;  4HBN A;  3CCU V;  5D5Q A;  2NNU A;  5CA0 A;  1JOY A;  4MTF A;  2LO1 A;  2H94 A;  4X65 B;  4U3J B;  2RMK B;  5FPO A;  2M7W A;  3F5T A;  1FJG O;  1D5N A;  3K5L A;  3J7A U;  3WU2 Z;  3K57 A;  3GB7 C;  2LFR A;  1OCC B;  1URF A;  4DRX B;  4W4K A;  4TT3 G;  1YIJ V;  3FD9 A;  2XAJ A;  3W7S A;  4WFB V;  3ASO C;  2X0L A;  1IVS A;  1FD9 A;  4LF5 O;  5LGU A;  5CBF A;  3BAB A;  4LH6 A;  3RYF B;  2PY5 A;  1HWY A;  3MHS C;  1M5I A;  4UUJ C;  3QO5 A;  4RQF A;  3E8G A;  4O2A B;  1DTO A;  2DYR B;  3OTF A;  2ZQM A;  2EIM B;  2ZXW B;  4JI6 B;  3SYA A;  5GTI Z;  1I5Y A;  1NTK H;  1K92 A;  3U0Z A;  3OFN G;  4PDV A;  4OGQ B;  4JYY A;  4DXW A;  4UCR A;  1YF2 A;  2RQ6 A;  2IBZ H;  1N0N A;  3FYI B;  3Q4H B;  4X62 O;  3ABM C;  3TXQ A;  5BXZ A;  3L70 H;  1HR0 B;  1IBM O;  4FZ1 A;  4J11 A;  2DYR C;  3ZMU A;  5KX5 A;  2ZXW C;  1UJW B;  2A79 B;  1D5A A;  3OR7 C;  3ZMT A;  1QQC A;  3ZN0 A;  2XHB A;  4X9Q A;  5LYJ A;  1O9G A;  4GYC B;  3MDS A;  2BSK B;  2KKW A;  4O4H A;  2JVD A;  5KUK A;  1KU9 A;  2F93 B;  2X6B A;  3QG5 A;  4WF9 V;  1H2M A;  4HNA A;  2Q68 A;  4U7N A;  5C93 A;  1K3E A;  4JZ2 A;  5BMV B;  3QNE A;  2QSA A;  4QE9 A;  5CA1 B;  5JCO A;  1V55 C;  3HR0 A;  2QKA A;  4I50 B;  2OIG A;  2MK3 A;  3T2M A;  3DC6 A;  4LBE C;  3ZHU A;  1RSO A;  4JAA A;  1XI1 A;  1FFX B;  1NZ6 A;  3ML0 A;  4NB5 A;  3RN4 A;  3ZRX A;  4XDK A;  1K97 A;  2JEX A;  1R6N A;  4DW0 A;  3K79 A;  2L6L A;  1NH2 B;  3CJH B;  1US6 A;  1K5S A;  5IJ9 A;  4JI1 O;  4JI6 O;  4CS2 A;  3QVN A;  3ASN B;  1R1B A;  3AG4 C;  4PD4 F;  4Q6G A;  1XUQ A;  2L35 A;  2ILM A;  3FB6 C;  3JAW B;  1I7F A;  2JS5 A;  1HR0 O;  4FLT A;  4Z2W A;  5L3G A;  3CC7 V;  4JI8 O;  2XAS A;  5BR8 B;  1YVW A;  3JAS A;  3OD4 A;  1FXK B;  2FML A;  3OMA B;  1BT8 A;  4UB8 Z;  5FPR A;  2Q73 A;  1YEW A;  1Z5V A;  3RWR D;  5LMN B;  2QTS A;  2CTR A;  4FLY A;  4JTA B;  1MZE A;  3OMI B;  4KXR A;  3D8C A;  2JJ2 G;  5GW7 A;  4Z1V A;  4BR6 A;  3JSL A;  2E74 B;  2WLL B;  1AI7 A;  5JJN B;  1P7B A;  2LP7 A;  1VF7 A;  3JAK B;  3JD3 A;  5L3E A;  4B7K A;  4AIL C;  1XOU A;  3B77 A;  3H1J H;  3TJT A;  3CMA V;  3KG2 A;  1BS3 A;  2A0L A;  1NTM H;  3IAY A;  1W2B U;  3SJA C;  1KQS U;  4DR1 B;  3CC4 V;  4UCO A;  4TV8 A;  1IBL O;  3ZRW B;  1AI4 A;  4WBN A;  2EIJ B;  4O2B B;  3SPI A;  3OEH G;  1S5H C;  5CN0 A;  1KBH A;  3CCS V;  5FLX N;  4DW1 A;  1TVK A;  2ZNI A;  3WG7 C;  2HVK C;  4AQY B;  3VQV A;  1M56 B;  4QPJ A;  2EZP A;  5B1A B;  5L3F A;  3IC9 A;  4ZBM A;  2E75 B;  3RVZ A;  2KB1 A;  1BMF G;  1NTZ H;  5BR8 O;  2A9H A;  4JI0 B;  3CRC A;  1K5Q A;  4JAS A;  2P4V A;  1EN4 A;  3QO8 A;  4K3A A;  5LMN O;  4PEL A;  4FZ0 A;  5DED A;  1YZB A;  4XBF A;  2WLI B;  4F6R A;  1H2G A;  1ZWI C;  4UVC A;  2QKC A;  1H2S B;  1M56 C;  1LUW A;  3KCX A;  4C7U A;  4IT5 A;  3F5W C;  3K0G A;  5EZY A;  1XNQ O;  1JCH A;  2CUG A;  1P84 F;  1BHB A;  5LGN A;  3E22 A;  4TV9 B;  1WB8 A;  3I56 V;  4DV6 B;  4PI0 A;  2N05 A;  1PP9 H;  2Q0O C;  2OWO A;  1M90 W;  4ABM A;  4B08 A;  2GHY A;  2GUZ B;  2E76 B;  3T4Z A;  1OCR B;  3CB2 A;  5JJJ B;  4O4I B;  1VQ5 V;  3RYI B;  4DR1 O;  2Z3Y A;  3IFX A;  1JFF B;  2YIB A;  2JDI G;  1L8D A;  2DMX A;  1MA1 A;  1NR7 A;  5H6R A;  1VQL V;  5EBM C;  2PTM A;  4DV3 B;  3HKC B;  5CBG A;  4AQY O;  2BTQ A;  4X1K A;  4K0K B;  3UKM A;  1E1Q G;  1XMO B;  4JI7 B;  1OCR C;  4ZI7 B;  2DQ0 A;  2UXB O;  1VIB A;  2QM4 A;  5EIB C;  1PKX A;  1XBL A;  1Q6U A;  5EIB D;  3QO7 A;  4JI0 O;  3BPZ A;  1GM9 A;  3L71 H;  2Q7G A;  5LOV A;  4LC1 A;  4DR3 B;  1OCO C;  5A9G A;  2IJH A;  3H1I H;  4JYA B;  1K7D A;  4LWS B;  1UFI A;  3OW2 U;  4I9W A;  4ZKI A;  2BOC C;  1QLE B;  1N8R W;  3FB5 C;  5IT9 N;  4PJ0 Z;  1QHT A;  1O9H A;  3B40 A;  4X64 O;  2ZIM A;  3T1C A;  5LHH A;  2KG7 B;  4I9Q A;  4DV6 O;  1GN4 A;  5IDJ A;  2BCC H;  5H5N A;  4FVM A;  1EM1 A;  2YDE A;  3ABL B;  1ZLZ A;  3B09 A;  2UU9 B;  3S3X A;  4LF4 B;  2GTA A;  4LFB B;  3ABK C;  1BHA A;  3JSN A;  1H8E G;  1FFT B;  1AB3 A;  4LFC B;  3JAM N;  4BAY A;  2Q4P A;  2QWR B;  1WA8 B;  5E1A C;  5EYP B;  1JVM A;  5B66 Z;  2LQT A;  4DV3 O;  4WFF A;  1VEW A;  4GT1 A;  4K0K O;  4CH6 A;  1IBK B;  4UCU A;  2Y48 A;  4DRX A;  3M99 B;  4HZ3 A;  4MW8 A;  4OX9 B;  2EUL A;  2AHZ A;  3K5N A;  3IJ4 A;  3O65 A;  1EBO A;  3W7U A;  4MS2 A;  4I0X B;  3TCU A;  3EVK A;  4PA9 A;  3FYE B;  3CD6 V;  3AG3 C;  3ETD A;  2HJF C;  2EIN B;  3K3W A;  4O2A A;  1JJO A;  2Y69 C;  1N32 B;  1NS1 A;  1DLB A;  3C3T A;  4JF3 A;  4CS3 A;  4QJF B;  5JQG A;  1HW7 A;  4IL6 Z;  2Q67 A;  4FFB B;  1XNR B;  1D2D A;  4GCZ A;  1E79 G;  4KL1 A;  4O4J A;  1QBZ A;  2GDS A;  2UU9 O;  1T5E A;  4LFB O;  2Y0I A;  3SYP A;  4BWA A;  3AK2 A;  5LL6 Y;  1BZK A;  4LFC O;  1GM8 A;  2G38 A;  1FXH A;  5JWP A;  3DTU B;  1S77 D;  2QDO A;  1GAX A;  4QPK A;  2RDC A;  3CXH F;  3RW0 A;  5JJE B;  4JZG A;  4TQF A;  2BSK A;  4R8C A;  2DWD C;  4GX0 A;  1SQV H;  3OUF A;  3A0B Z;  4NTW A;  4K8X A;  3MD0 A;  2JGD A;  3P3P A;  4GX5 A;  1MNG A;  4KP4 A;  3AK1 A;  1LNQ A;  1KB9 F;  2FYU H;  1JMK C;  3C3S A;  4CC5 A;  4TSF G;  3FB8 C;  1K34 A;  4OX9 O;  1G8M A;  3BFR A;  4I50 A;  1YTF B;  2RNB A;  3X2Q B;  4DR4 B;  1Q43 A;  1SF9 A;  1FFX A;  2UUA B;  2ZE6 A;  4PDM A;  5JH7 A;  4HAM A;  4FPP A;  1N32 O;  1N0J A;  3OUS A;  3CJH A;  3E2E A;  1N4C A;  2OCH A;  2RCV A;  1WN7 A;  4Z1M G;  3B8M A;  3CHX A;  2HEP A;  1YTF D;  1J95 A;  2HG5 C;  1S76 D;  1I94 B;  3CSX A;  3HKD A;  4D7T A;  1Y76 A;  2OTL V;  4JTD B;  4AI8 A;  3SJQ C;  3E8H A;  4X20 A;  3FAV B;  4N23 A;  1Q6I A;  4G2K A;  2B1I A;  4JYC A;  5H6Q A;  1FXK A;  4ICG A;  3CPW U;  1S5J A;  3DGE A;  1TA8 A;  4DV5 B;  3K59 A;  3ICX A;  3ABT A;  4L8J A;  4TUY B;  3KKY A;  3RBZ A;  4QGP A;  3CRM A;  2ZE7 A;  3OR6 C;  4JAU A;  5KHG A;  2WLL A;  3ZHV A;  1QR9 A;  5EBL C;  4RQE A;  2P90 A;  1YIT V;  5FNV A;  5EK0 A;  2IJK A;  1R3K C;  3M8A A;  2QM7 A;  3JD1 A;  4J10 A;  2DJV A;  2ZKO A;  3L73 H;  3OGI B;  4J80 A;  1E1R G;  5GTH Z;  1NJI W;  2WLM A;  1DGS A;  2JRI A;  4KHP O;  1N33 B;  4DR4 O;  2DOS A;  1F51 A;  1SS3 A;  1CEZ A;  1FAF A;  5KMG A;  3JD4 A;  2UUA O;  3B8N A;  2IH3 C;  1I0H A;  1TUB B;  4W4L A;  4I7Z B;  4MTO A;  2PF4 E;  4OPA A;  3ZRW A;  1AR4 A;  4O4L A;  3JAL B;  3WB1 A;  3RVY A;  3FB7 C;  5B1B B;  1OCC C;  4JI1 B;  1PV0 A;  2YSU B;  2GBO A;  4YXW G;  2HVJ C;  3VBB A;  4XDL A;  1I94 O;  2QE7 G;  1Q90 D;  4X1Y A;  3FFQ A;  1XIL A;  2DE0 X;  4NXN B;  4NTY A;  2DN9 A;  3TK1 A;  2PI5 A;  4DK1 A;  3I5D A;  4UXN A;  1HNX B;  4JI8 B;  1SZT A;  2W0X A;  3JYC A;  1IXB A;  4DV5 O;  2EIM C;  5LA6 B;  5GON B;  1GN6 A;  2QKS A;  4R50 A;  4EB6 A;  4X8A A;  4GZR B;  2YS8 A;  5C8Y A;  1VQ6 V;  2H3O A;  2EJR A;  4ZHQ B;  3HKB A;  1AJQ A;  1JJ2 U;  2UXD B;  4A5U B;  4JV5 B;  2CDY A;  3TXS A;  2LJ2 A;  2YEV B;  2ADP A;  4MTG A;  3CRR A;  4LF7 B;  1ZL8 A;  1N33 O;  1R73 A;  3HKE B;  4FLV A;  3JAT B;  5BZB A;  3RYH B;  1GN3 A;  5A2Q N;  1VQM V;  4LH7 A;  3RYI A;  4ZOL A;  1KYO F;  1XL6 A;  2YI8 A;  3SYC A;  2CE4 A;  4WFH A;  1M57 B;  3K06 A;  5KLV H;  4L87 A;  3K08 A;  3OEE G;  4CH3 A;  3E35 A;  3TGU H;  1IBL B;  3C90 A;  3CRQ A;  5IJ0 B;  1VAR A;  1K8A W;  4LNU B;  1P4R A;  4H37 A;  5B1O A;  4J7K A;  1K4C C;  4X89 A;  1MSW D;  2PZS A;  3WB2 A;  4NXN O;  2Q8V A;  1HNX O;  1Z5W A;  1QCE A;  1Q8I A;  4MT8 A;  2FKX A;  5LMU O;  4DO2 A;  4LWS A;  1F23 A;  1NH2 D;  3N2G B;  4YY3 B;  4FK5 C;  3CCR V;  4PHZ A;  5HFL A;  3ASN C;  2VQF B;  4DR7 O;  2UXD O;  3G6B A;  4JV5 O;  4JI2 B;  1XNQ B;  1OCZ B;  2Z5U A;  2EIL B;  4G28 B;  1RPO A;  3CE2 A;  2ARH A;  5IYZ B;  2P5O A;  4LF7 O;  1FXK C;  3ZX6 A;  2K9P A;  2F43 G;  2F23 A;  1AJP A;  2EBO A;  3HB3 B;  2ZE8 A;  2DYS B;  4CC6 A;  3DSQ A;  2PUS A;  4H44 B;  1ZAU A;  1Y74 B;  3J80 N;  1R3J C;  5LXT A;  3FKS G;  1SQB H;  5KUM A;  3ZHS A;  2LGQ A;  4LF8 B;  3N27 A;  5EYP A;  3ETG A;  3G6E V;  4JTC B;  3LSU A;  2CK3 G;  3BA9 A;  1YHQ V;  2WSS G;  2FL4 A;  5LP6 B;  1BCC H;  1SET A;  1U97 A;  1SA0 B;  3CCL V;  4WCE V;  3QTC A;  1YJN V;  3THO A;  2UXB B;  5J2T B;  1Q3E A;  1GTO A;  2A06 H;  2OYQ A;  4F6E A;  3JCZ A;  3P3N A;  1M93 A;  2N04 A;  2EIJ C;  4GLX A;  2MW2 B;  4I0X A;  5IWA O;  4YY3 O;  2UUC B;  4K8Z A;  5LP6 C;  3EFF K;  4JYB A;  3ZMV A;  4JI5 B;  2VQF O;  3VQY A;  2FTK A;  2D2C B;  3GVM A;  2HR3 A;  2WLN A;  2QTO A;  3JD0 A;  1ROP A;  5B1A C;  1SQF A;  1DK1 A;  3EXA A;  5J2U A;  4DR5 B;  4JI2 O;  4AHC A;  4I55 B;  4RUE A;  2YID A;  2YC0 A;  4FFB A;  4X64 B;  5HFM A;  2XT9 A;  4DR2 B;  1VMG A;  1SQQ H;  5KX5 B;  4UCS A;  4LF9 B;  4H0L B;  1DF5 A;  1GH6 A;  4O4H B;  5J9P C;  1EZV H;  3KZI Z;  3RT3 C;  4I4T B;  1R3I C;  4HNA B;  4J9Z B;  4E4E A;  4DUZ B;  2X6A A;  4LF8 O;  4BIO A;  1PNL A;  2R9I A;  1PNM A;  1SES A;  3RFR A;  3SPC A;  4FLX A;  3LUT B;  1S3J A;  1YCI A;  5LHI A;  4PDL A;  5AG2 A;  1MSD A;  1L0L H;  2OTJ V;  4UFZ A;  3U11 A;  1VQ9 V;  1NT2 B;  4QNH B;  1RSO B;  4MVU A;  4YHH B;  1X59 A;  4YIO A;  2CGN A;  2NR5 A;  4EKW A;  1A32 A;  1NR1 A;  1S5L Z;  1WAZ A;  3VQW A;  4PA7 A;  4BIZ A;  2UUC O;  5KHH A;  1G4Y B;  3P30 A;  4JI5 O;  2IU0 A;  3ZHR A;  4FJC C;  3ZMZ A;  2XAF A;  4MVQ A;  1RPR A;  3K04 A;  1EFR G;  4IHJ B;  2XTA A;  2Y0P A;  4DR5 O;  3G4S V;  2JS3 A;  5ITZ A;  3ZHT A;  2VWJ A;  5H2F Z;  4DR2 O;  1J5E B;  4PI2 A;  2WLJ A;  3SYQ A;  2Y4T A;  4LF9 O;  3JAR B;  2R9R B;  2P06 A;  2UXC B;  1EZJ A;  5KAI Z;  3E89 A;  1QLE C;  3F7V C;  1GMG A;  1DF4 A;  2D3O W;  3OAA G;  2QEX V;  4IYI A;  4DUZ O;  4X1I B;  4TUY A;  1K4D C;  3OMN B;  4MW3 A;  4J7Z A;  3CCQ V;  4DK0 A;  4U3J A;  2NN4 A;  3FX7 A;  3BVO A;  3ABL C;  1EN5 A;  2ZNJ A;  1XEQ A;  3W7T A;  2ZDI C;  4YHH O;  4FIP C;  5EC1 C;  1KUQ A;  3AG1 B;  1XQ8 A;  4TV8 B;  2YIA A;  4WBN B;  3T1H B;  4FLZ A;  3E86 A;  2FB5 A;  2Q7E A;  2DWE C;  3UT5 B;  1YI2 V;  1TUB A;  5BY1 A;  1PPJ H;  2ZT9 B;  3RYF A;  1R6T A;  1Z2G A;  2ODM A;  2E5L B;  3O9O A;  3AG2 B;  3JAL A;  1TAE A;  4JI4 B;  2A7W A;  1Q81 W;  3ZHQ A;  3G67 A;  1AI5 A;  3LDE A;  2HFE C;  3S3W A;  4CBC A;  4OXS A;  5KAF Z;  1B06 A;  5LHG A;  1COW G;  1Q82 W;  4J42 A;  4GX2 A;  4WFE A;  2AZ2 A;  1J5E O;  4UCV A;  5CMU A;  3DXR B;  2HHH B;  2WLK A;  3OTO B;  3L74 H;  4LP8 A;  1CP9 A;  3Q4H A;  2UXC O;  1BGY H;  1XDC A;  2QR4 A;  3ZN1 A;  1RM1 B;  2R9A A;  2EIN C;  1HNW B;  2Y4U A;  4H33 A;  3U10 A;  2VS0 A;  3H9V A;  5IY5 B;  5LA6 A;  3L72 H;  4JAV A;  1NVP B;  4RWU A;  1WJZ A;  4RUF A;  1VQ4 V;  2WLH A;  3A2F A;  2YEV A;  4BW9 A;  2XND G;  5BMV A;  1FKA O;  3AK3 A;  5CA1 A;  4BW5 A;  2Q6A A;  1VQN V;  2W0F C;  4JGS A;  5B5E Z;  3G71 V;  3T1H O;  3JD2 A;  4HYO A;  1TGO A;  2DQ3 A;  3RYH A;  1JA8 A;  4KHP B;  1Q6H A;  3BA8 A;  3K5M A;  1NVP D;  2YXY A;  2Z0A A;  4TOI A;  4X66 O;  3LNN A;  2WA4 A;  2E5L O;  1THZ A;  4JI4 O;  4EEQ A;  1V54 B;  3E8B A;  2PYJ A;  1SQP H;  3A8T A;  1YJW V;  4NYK A;  2PGG A;  1OV9 A;  3APO A;  2N74 A;  4JI3 B;  5B3S B;  2R70 A;  4LNU A;  2YUA A;  1H38 A;  1HNZ O;  3BY6 A;  1G1X B;  1W0J G;  5LOV B;  4B3T B;  1KC8 W;  2HHH O;  3OTO O;  4U3F H;  2PI4 A;  4NR1 A;  3X2Q C;  2QJ1 A;  1FYJ A;  3RYC B;  2V4D A;  3JAW A;  2WPD G;  4LR3 A;  1SRY A;  4DV7 B;  1SQG A;  2ITD C;  2KSD A;  4D7S A;  4R7C A;  4NXM B;  2IH1 C;  3CWB H;  3D36 A;  1HNW O;  2EIK B;  1OHH G;  4FMT A;  4MTX A;  4P9O A;  5IYC O;  3OM3 B;  2KQX A;  5B3S C;  1Y6X A;  3K9S A;  1Y67 A;  3ABU A;  2PYL A;  3BCC H;  2NLJ C;  2M6Y A;  2ETN A;  3MAQ A;  2IW5 A;  1G6U A;  2OIE A;  1B3Q A;  1LUV A;  2CH7 B;  1GK9 A;  2ZIO A;  3JAK A;  3SPG A;  2HJD A;  1TUE B;  2OCC B;  1W59 A;  4MVO A;  1GN2 A;  3G80 A;  1NI8 A;  1SKV A;  5IYB O;  3LDD A;  4CH4 A;  3D3Q A;  3ZRV A;  3ASO B;  1NBM G;  1ZX3 A;  3SPH A;  1VF6 C;  4P9P A;  4FM2 A;  1P7G A;  1UPG A;  1Y74 A;  1GM7 A;  4UVB A;  1VQ7 V;  2BOB C;  2OCC C;  4PA4 A;  3L75 H;  4O2B A;  2R72 A;  1I08 A;  3H1K H;  1K33 A;  1VQP V;  4JI3 O;  3CME V;  1VP7 A;  2IU3 A;  5LP6 A;  1ENV A;  4B3T O;  4UV9 A;  2QWO B;  1SA0 A;  4NKG B;  3ABM B;  4DYL A;  5J2T A;  2ADQ B;  1BE3 H;  4DV7 O;  1XMQ O;  3K5O A;  3GWO A;  1MMM A;  4DV0 B;  2XAG A;  4NXM O;  1OZ0 A;  4J9Y B;  3EHB B;  1R6K A;  1QVG U;  2WWW A;  5JQG B;  5LMU B;  5B1B C;  3D3I A;  1Q7Y W;  2ZM6 B;  1FS0 G;  2WLI A;  3DC5 A;  2AW9 A;  2K1E A;  4YJ3 B;  4O4J B;  2E3C A;  4IIJ B;  4GX1 A;  1KP2 A;  1VQ8 V;  4I55 A;  4DR7 B;  5F2V O;  3BAA A;  4K35 A;  1HP8 A;  1PL0 A;  4FM1 A;  4Q20 A;  4TV9 A;  3VOU A;  3BRC A;  3OE7 G;  1V55 B;  3AEI A;  4MVM A;  1NQT A;  1XHX A;  4LF6 B;  1S0V A;  1Y66 A;  2UUB B;  4X65 O;  1LR1 A;  4GUN A;  2QM8 A;  5K1P A;  2GUZ A;  4RAI A;  2BTO A;  1MG1 A;  1ORQ C;  4O4I A;  2JGD B;  4I4T A;  1JFF A;  1KKD A;  3AG7 A;  3IC7 A;  1H8H G;  3M7M X;  2LW7 A;  1B6Q A;  2X7R B;  1L1F A;  1F4M A;  1QU7 A;  3AG4 B;  1M1K W;  3HKC A;  5JVD B;  2CGO A;  2ZIN A;  2IJJ A;  1VQK V;  4IYH A;  2YI9 A;  4ZI7 A;  2W6J G;  1GRJ A;  4H13 B;  4KUM A;  4DV0 O;  5KHJ A;  1M57 C;  5JH7 B;  5KA5 A;  3SR2 C;  5L3C A;  5CB4 B;  1N36 B;  2F66 C;  5D5P A;  4GKK B;  2JK5 C;  1RP3 B;  1VF5 B;  3SYO A;  5IWA B;  4P30 A;  2HP8 A;  2ZM6 O;  1WNS A;  1XHZ A;  4ZIB A;  2AZ0 A;  2Q5Z A;  3HKD B;  4IHJ A;  5K1X A;  1Y76 B;  1JX9 A;  1BL8 A;  5DN6 G;  3JCU Z;  2XAQ A;  3CCV V;  3CYO A;  1F4N A;  1ARO P;  4X20 B;  2KG7 A;  4RO2 A;  3N2K B;  1ZTE A;  2DW4 A;  3JAR A;  3D36 C;  4LF6 O;  1BQZ A;  4YJ2 B;  5L3D A;  1WLE A;  2UUB O;  3LNM B;  5CA0 B;  4FM0 A;  2ZDI A;  3KCY A;  3R65 A;  3CEI A;  3H1L H;  1FPO A;  2WA3 A;  4CZZ A;  1AI6 A;  1NU1 H;  1QVF U;  3STZ C;  2C2A A;  3L9D A;  3ZRS A;  4X1I A;  5FNV B;  1QLN A;  1YDX A;  3ETE A;  1WA8 A;  3B2E E;  1VQO V;  1OCZ C;  2EIL C;  1MZF A;  1H2K A;  2CTP A;  3WG7 B;  4MVZ A;  2H8P C;  3H1H H;  2P7T C;  3GWK C;  5KMG B;  2DYS C;  1PD3 A;  2CTQ A;  1CPY A;  4WFA V;  1PL4 A;  3ZED A;  2QA4 V;  2RJZ A;  4FLW A;  4O4L B;  3CCJ V;  5H9C A;  1N36 O;  2Q7H A;  3SJB C;  4GKK O;  2X6C A;  3SDL A;  3UT5 A;  4J41 A;  1F7Y A;  2W6I G;  1JQ0 A;  4UB6 Z;  1CXZ B;  2UXX A;  3TET A;  4LFA B;  4BIU A;  3UCS C;  3ZMS A;  2JEU A;  1AVM A;  4NTX A;  5IYD O;  4X1Y B;  1P49 A;  4EFB A;  3T4D A;  3DXR A;  1MAB G;  5LGT A;  1K73 W;  1N34 B;  3K03 A;  3ZBH A;  5KA6 A;  3CX5 F;  4EB6 B;  2P22 C;  1OJH A;  5LYJ B;  2UXN A;  5C8Y B;  4PA6 A;  5FL7 G;  1IX9 A;  3HKB B;  1SZX A;  2F4V B;  3QF7 A;  1WPB A;  1XL4 A;  1WPX A;  2P4K A;  4CS4 A;  2BE3 A;  4J7J A;  4U7O A;  4TWK A;  1IUR A;  3CCM V;  1ZL8 B;  3UO2 A;  4MVR A;  1Q5O A;  1PM9 A;  1SER A;  4TQD A;  4DR6 B;  5EC2 C;  4ZOL B;  4B3M B;  4P2Z A;  4GKJ B;  4DV2 B;  1B04 A;  1W0K G;  3SGI A;  2GSM B;  1AR5 A;  1OCO B;  1IXM A;  4UCT A;  2HKO A;  1ZUQ A;  2AXT Z;  3H01 A;  5IJ9 B;  5KHK A;  4R6Z A;  5JCO C;  4N21 A;  4LFA O;  4FLU A;  4JPR A;  4QIW F;  4FFK A;  2B5U A;  4B3S B;  2ITC C;  3SPJ A;  5CBH A;  2P6J A;  2JGU A;  3BEH A;  1YSC A;  3JAS B;  4G27 B;  4CH5 A;  1N34 O;  1Q86 W;  2WAM A;  3RYC A;  3WFV A;  3ABK B;  3CC2 V;  3J81 N;  2QWN B;  3ZCC A;  3FAV A;  4E2L A;  1MOF A;  3OGC C;  3W7W A;  2XOK G;  4KFM A;  2F4V O;  2RN9 A;  4XDJ A;  2Q0A A;  4LCU C;  1XRE A;  3UQ8 A;  2GTS A;  1AP5 A;  1VF6 A;  3OT7 A;  3P32 A;  2HLD G;  4I5S A;  1GO3 F;  2QWP B;  2CH7 A;  4IGG A;  2EJ7 A;  4DV4 B;  2CAZ C;  2YXH A;  3T1Y B;  2YXL A;  3W7X A;  4DR6 O;  1WP8 A;  2F1M A;  2VRZ A;  4B7E A;  3ZJZ A;  4B3M O;  4GKJ O;  4DV2 O;  2IM9 A;  5LXT B;  4OPH A;  1IDS A;  2VWK A;  1YXB A;  4UVA A;  3RGB A;  1BQ0 A;  3A0H Z;  4X88 A;  3K58 A;  3AG3 B;  1TVK B;  1PNK A;  3ZIA G;  1XMO O;  4JI7 O;  4ASU G;  4X66 B;  2GV9 A;  2Y69 B;  1AIL A;  4B3S O;  2ZE5 A;  3HPL C;  1Y4M A;  3IGA C;  3NXS A;  4DUY B;  5B1N A;  1QNM A;  4DV1 B;  1AP6 A;  3A0R A;  1H2N A;  4F4L A;  3AG1 C;  3SJC C;  4DR3 O;  3PJS K;  1WB7 A;  1HNZ B;  1U96 A;  2LGW A;  1KMI Z;  4JYA O;  2QWQ B;  2XUM A;  1HDJ A;  1ZSP A;  2AGA A;  2LW1 A;  4F6R B;  3MHH C;  3AG2 C;  3ZS8 C;  2OT5 A;  5J2U B;  1KD1 W;  3E83 A;  5EZY B;  5TIS Z;  1WP7 A;  3VQX A;  4PDR A;  4B3R B;  4WFG A;  5GON A;  2VQE B;  3E22 B;  4YJ3 A;  4NVP A;  2ZR2 A;  5DEC A;  1GKF A;  4IIJ A;  4LF4 O;  3CP1 A;  2A3Q A;  2ATK C;  3BHP A;  3CCE V;  4DV4 O;  4ZHQ A;  1JPX A;  2IJI A;  2QGN A;  3CRA A;  3LSQ A;  3T1Y O;  4EFE A;  2ZD9 A;  3APQ A;  2LFS A;  3ETQ A;  3CS5 A;  3K0D A;  4MSW C;  1RM1 C;  5LBQ A;  2YIC A;  3R66 A;  1V9P A;  1SC5 B;  1KKC A;  2EZO A;  2V7Q G;  5IY5 C;  3HKE A;  1NKD A;  3JAT A;  2P67 A;  5KHI A;  3WB0 A;  2ZR3 A;  1FJG B;  3LSS A;  1IBK O;  3CXC U;  4X1K B;  2BTQ B;  2B9Z A;  1KEC A;  4PA3 A;  1SQX H;  3F7Y C;  3I55 V;  4DUY O;  3NR7 A;  1IZ3 A;  1R3L C;  2ZCE A;  5L3B A;  1JR9 A;  4DV1 O;  1S72 V;  5IJ0 A;  5EBW C;  2EX3 A;  5JVD A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  1Q6U A;  1FD9 A;  1Q6I A;  3B09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...