1KYOF

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
b'DTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 26
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kyoF00
1BCCH 1NTZH 1EZVH 1SQBH 1PPJH 1P84F 3BCCH 3CXHF 1L0NH 1KYOF 3H1KH 3L70H 1SQXH 4PD4F 1SQVH 3TGUH 1L0LH 3L71H 1SQPH 4U3FH 3H1HH 3L74H 1NU1H 1BE3H 3CX5F 1PP9H 1KB9F 3L75H 2FYUH 2IBZH 3L73H 1SQQH 2A06H 3CWBH 1BGYH 3L72H 1NTMH 3H1JH 3H1LH 4D6TH 2BCCH 5KLVH 1NTKH 3H1IH
chains in the Genus database with same CATH superfamily
4J80A 3OTOO 2ZXWB 1SQXH 4PELA 3SJCC 2DN9A 2ZD9A 2M7WA 2RMKB 1HR0O 4NTYA 4I55A 5FNVB 2VQFB 4WFEA 3MAQA 2UUBO 2AHYA 3FFQA 3RVZA 3FD9A 1N0NA 3SPHA 4TSFG 1DK1A 3JAKA 1I5XA 1P4RA 4H44B 4DV0B 1D2DA 2H94A 5K1XA 3KZIZ 3CRQA 4JV5B 3L71H 3ABMB 4ZI7B 4B08A 2P5OA 3WB1A 2Q67A 3AK2A 5BMVA 4NXNB 2CAZC 1RFYA 3NR7A 1WA8B 4BIZA 4JI0O 3IGAC 1H2MA 4ZIBA 4NYKA 3RYCB 4FLWA 3JAMN 2HLDG 3ML0A 1R3LC 2ZNJA 1Q6HA 1KECA 4X1YA 4JI1B 2DYSC 1RSOA 1YDXA 5KX5A 2BCCH 4LC1A 1M1KW 4N23A 1JFFA 3JYCA 1I7FA 4DR2B 1OCRB 3JATB 2DWDC 3RFRA 4DR4O 4TV8B 2QDOA 2Y4UA 4I5SA 4N21A 1BQ0A 2KG7A 1X4TA 2ILMA 1K3EA 3QO5A 2BTOA 1S72V 3AEIA 1NJIW 1PP9H 3KCYA 1VQ6V 2HR3A 3LDDA 4IYHA 4HNAB 2LW1A 2GV9A 4FLVA 3CHXA 1NTZH 1K4CC 1F23A 4O2BA 4X8AA 3A0HZ 3BCCH 3ZMTA 1EN4A 1SESA 1QQCA 1ZX3A 5D5QA 1Y66A 1F51A 4L87A 5BZBA 1BHBA 3Q4HB 3THOA 1FXKC 3JARB 2EINC 5CA3A 3AG1C 1U97A 2P6JA 1FPOA 1P7BA 1WJZA 2VQEO 1CXZB 2OT5A 4P30A 2KB1A 5H5NA 3T4ZA 5LOVB 4GUNA 3W7TA 1IX9A 4K0KB 1SRYA 2B9ZA 1SKVA 5EBLC 4CBCA 4KL1A 5LMNO 5LP6B 3SR2C 1YVWA 2WLKA 1BS3A 1B04A 4Z1MG 3SYQA 1MZFA 2CGOA 1R6TA 1BL8A 2YIBA 1VQ5V 4OX9B 4MVRA 3SJAC 1Z2GA 2JGDB 1XNRO 1WPXA 1Y4MA 3I56V 3K08A 5KLVH 2B1IA 2QTOA 5IWAO 1PL4A 1EN6A 3O65A 1QBZA 2D2CB 1YZBA 2KSDA 1YJWV 2XAJA 1Z5WA 3CMEV 2IM9A 3SYCA 3ABKB 1KQSU 4JYAO 3J7AU 5IYDO 1K34A 2DOSA 2Q4PA 4GLXA 5LYJA 4NXMB 1G4YB 1V55C 4H33A 3WFVA 1FFXA 4JPRA 1L8DA 2ZIOA 1I94O 3CD6V 4NB5A 1GM7A 1WPBA 1IURA 3T1HO 1FS0G 2FMLA 4FMTA 4DV1B 4W4LA 3QO8A 4JAVA 3X2QC 5LMUB 1Q43A 2F95B 1Y74A 1TA8A 3QG5A 1YI2V 3OEEG 1NTKH 1PNLA 4BWAA 1B6QA 4DV2B 4UVCA 2Z0AA 5KMGB 3SYPA 3JAWB 4DK0A 2IH1C 3OMAB 4LF4B 1FJGO 3PN1A 4OXSA 3AG2B 3W7SA 1V54B 2P4KA 4TUYB 1ENVA 3E83A 2ZXWC 4X89A 5L3FA 1VF6A 3UO2A 2F4VO 2Y0PA 5JCOA 2GDSA 1P49A 3EFFK 2V1DA 5HFLA 2QA4V 4DR7B 2UXDO 1S77D 1HNZB 2JS3A 1CP9A 4LF5O 3L70H 1MNGA 4WFBV 3IC9A 4CC6A 1KP3A 3H1HH 1HP8A 2WA3A 1TUBB 1AJNA 3RYFA 3ABMC 3L73H 3TETA 3RYIA 4X1KB 2CK3G 5B66Z 3RYHB 4DR3B 4DR6O 2QE7G 3ZEDA 2AXTZ 2Q73A 2BSKB 3B77A 3E22B 3LUTB 2K9PA 3TCUA 3DXRB 2UXCB 4WCEV 1P84F 1KYOF 5FL7G 3JD3A 1QNMA 2JK5C 4AQYB 3MHHC 1DTOA 3P32A 1H8EG 3OGCC 4IIJB 2QR4A 2IBZH 3BABA 1XDCA 3E89A 2NLJC 4HAMA 4D7TA 3OD4A 2QM4A 4DR1O 3WG7B 3UKMA 2XAFA 2ITDC 1IZ3A 1H2LA 4D7SA 4OPHA 4Q20A 1OCRC 3F5TA 4DUZB 3KCXA 1PV0A 4I50B 3CSXA 3HKEA 5ITZA 4J7ZA 1JQ0A 4GCZA 4DV5O 1VMGA 3QF7A 2X7RB 4Q6GA 4DO2A 1YHQV 4LF9B 2AHZA 4FFBB 2DW4A 1TVKB 1SERA 4U3JB 4WBNB 3H1KH 1B3QA 4JYCA 1SQVH 4PDRA 5JJJB 4FLTA 4TT3G 2LQTA 1N36O 2CDYA 3K04A 1QLEB 2LGWA 1GH6A 2X0LA 4TV9A 5LXTB 3ASOB 1W2BU 5JVDB 3IJ4A 3EXAA 3FYEB 1ZL8A 3N2GA 4P9OA 2QSAA 3LSUA 2P4VA 5C93A 2ZM6B 2ZR2A 3RN4A 1FXVA 1VQ7V 1H2NA 1HNXB 2YXLA 2BE3A 4I55B 3OAAG 4EKWA 4WFHA 1YTFD 1XMOB 1WB8A 4MS2A 4JI5B 3CCVV 4QIWF 3E86A 2ZQMA 3OT7A 2E75B 2Q0AA 4ASUG 1XOUA 2RQ6A 2DE0X 2DQ0A 3JD4A 5LP6C 1MMMA 1SC5B 1Q7YW 5BMVB 2W0XA 4JI7B 1QR9A 3FB5C 5H2FZ 3K79A 3N2KA 3HKCA 4KHPO 4DV4B 4NVPA 3LSSA 3FB8C 4J9YB 1DF4A 3CRAA 3CS5A 1OHHG 1TGOA 2XNDG 1GRJA 3TK1A 3I55V 4JI6B 1NZ6A 4MTFA 3B8NA 3HKDA 1SQQH 1WNSA 2R72A 2O57A 2WLLA 3ABKC 2EZOA 5EZYA 1S5LZ 1GN6A 1US6A 2RJZA 3A2FA 3OW2U 4H13B 4QNHB 2UU9O 4X62B 5IDJA 4LFCO 2ZNIA 1AR4A 1ZWIC 1JR9A 2KG7B 2Q68A 3F7VC 4YHHO 2OYQA 2F1MA 4O2AB 1GN3A 4MTGA 2HHHB 1AILA 1QLNA 1WP8A 3GWKC 4DV6O 3BA8A 1L0NH 4MVZA 3VQVA 4JI8B 2RN9A 4E2LA 1EBOA 1J95A 2WAMA 4FZ0A 4OPAA 3AG2C 5K1PA 4QJFB 2IJJA 2OCHA 1V54C 1EFRG 5D5PA 3OMNB 1VEWA 4JTDB 4FM2A 2UUCO 1QVGU 4LFAO 2N04A 1DF5A 2UUAO 4X65O 3G6EV 4ICGA 1OCCB 1XEQA 2QWRB 4B3RO 1PNMA 4JI4O 4LF7B 1GM9A 2H8PC 3JSLA 4U7NA 3CYOA 2WLMA 3EHBB 4FLUA 3T1YB 5L3CA 1T5EA 1XILA 1JJOA 3SYOA 2LFSA 3U11A 2HG5C 4FLXA 1VQMV 2CE4A 2DWEC 3K3WA 4DUYO 1R1BA 4XBFA 4GKKO 4PJ0Z 4LBEC 1RPOA 4FPPA 2HJDA 1G8MA 3ABLB 1Q82W 1L1FA 3G71V 4Z1VA 3FB6C 4OGQB 2QKSA 4PDLA 1H2GA 1HNWB 4UVBA 1KMIZ 4PI2A 5IYCO 5A2QN 5LHGA 5IT9N 3CPWU 3WG7C 3LDEA 1N32B 2XAGA 2QWQB 4CC5A 2OIGA 4MW8A 1YTFB 4JI3B 5B1BB 2LW7A 1GK9A 4TQDA 2OTJV 2W6JG 5HFMA 2OWOA 3SPIA 4RUFA 4IHJA 4C7UA 3OTOB 2F66C 1JVMA 5J2TA 3RWRD 3JALA 3A0BZ 1HR0B 4MW3A 5LYJB 5BR8B 2RDCA 1FFXB 1OCOB 4BR6A 1J5EB 4I4TA 4A5UB 4CH3A 2K1EA 5JH7A 3ZMSA 4I0XA 4QE7A 2IU0A 3ZCCA 2Q69A 1NU1H 1IBKB 2YDEA 4DV0O 4JYBA 3SJBC 1Y67A 4JV5O 4JZ2A 1S0VA 1Y74B 1QLEC 3HKBB 2QM8A 2VWKA 2UXXA 5CA0A 3ETQA 4LH7A 3ASOC 3CJHB 1KU9A 3F7YC 4J10A 4UUJC 1YIJV 4JI0B 4KUMA 4PHZA 2IJIA 2Q5ZA 1V9PA 2Z5UA 2QTSA 2JGUA 1KP2A 4YJ2B 1XMQO 1CEZA 5C8YA 1VQPV 4PA3A 1XHXA 1M56B 1Q8IA 2GSMB 2QWOB 4JI1O 2W6IG 5KAFZ 1LUWA 4PA7A 3QTCA 2YSUB 3TXQA 1FXKA 1BQZA 3ZIAG 2ADQB 3J81N 2GUZA 5IYBO 4X1IA 4DR2O 4R50A 3RYFB 2OTLV 2UXBO 1AR5A 4ZOLB 3BY6A 3HPLC 4MT8A 1RM1B 2PI5A 3DSQA 5TISZ 2ZE7A 3APQA 2E3CA 5E1AC 3CCRV 4GX0A 2ARHA 3R65A 1O9HA 5JQGB 1JOYA 4J42A 1NR7A 4B3MB 4DV7B 1VARA 2HEPA 4LFBB 1KB9F 3K5NA 4LP8A 3ZS8C 4PI0A 2DQ3A 1F7YA 2Q8VA 1VQOV 4O4IB 2P06A 4O4JB 2YI9A 4X88A 1AI4A 1HWYA 3WU2Z 3KKYA 1EM1A 4CH5A 1EZJA 3OUFA 4PA9A 4GYCB 1K73W 2P90A 2CH7A 3K59A 1PKXA 2VQEB 1BSMA 4PDVA 4MSWC 1MZEA 3QNEA 1KUQA 3L9DA 2C2AA 3UCSC 3HKEB 3O9OA 2JS5A 4KXRA 5ITZB 2EIJB 2PYJA 1PM9A 5J9PC 1E1QG 1MOFA 2RCVA 2E5LB 2LP7A 2PF4E 3WB2A 4K0KO 4BW9A 3QO7A 4B7KA 1FYJA 1AB3A 1NR1A 5GONA 3A0RA 3M99B 5IJ9B 2GTAA 1R3KC 3SPGA 1BMFG 3TJTA 2QM7A 1SA0A 4H0LB 1VIBA 4EB6A 2ATKC 4GKJB 3PJSK 1YCIA 4YY3B 5IJ0B 3N2GB 4B3SO 1OCCC 3AG3B 3AK3A 5CBHA 4IYIA 2CTRA 1YF2A 4GX5A 2CGNA 5EC1C 2QWPB 2V4DA 2E74B 1MA1A 2GTSA 2GBOA 2PY5A 1BCCH 1K7DA 1RP3B 1CPYA 1U96A 1F4MA 5EIBD 5FNVA 1MSWD 4UFZA 2YIDA 5A9GA 1R3JC 1NI8A 2Y69B 4FM1A 3ZHSA 4JAAA 3BAAA 2X6CA 1XREA 1JA8A 3ABLC 1QHTA 5EYPB 2IW5A 1YEWA 3K5OA 4DV1O 3CCJV 5B5EZ 4F6EA 5LMUO 3ETGA 4ZI7A 4RQEA 1PNKA 3OE7G 4QE9A 4DV2O 3OM3B 1WA8A 2A7WA 5B1BC 4LF4O 2FB5A 1FJGB 3HKDB 2QKCA 1XNQB 2WLLB 2KQXA 1JPXA 2WA4A 2ZT9B 3CRCA 4QPJA 1R73A 2ETNA 3WB0A 3D3IA 1SQFA 1AI6A 1S3JA 5H9CA 1OCOC 1IBLB 4DR7O 1MSDA 4DRXB 1IXMA 3JASB 1NKDA 2UXDB 5IYZA 3UT5B 4DK1A 2WLIA 3RGBA 2N74A 1LUVA 3JATA 4TV8A 1IBMB 2ZCEA 5L3DA 1Q81W 3G80A 2DMXA 3OTFA 1E1RG 3ICXA 3M7MX 2JDIG 4X20B 3ZHRA 4CS3A 4HNAA 2AZ0A 2UXCO 4RWUA 5GW7A 4FLYA 4AQYO 4CZZA 4I7ZB 1UJWB 1X59A 1M56C 4YXWG 1N8RW 5KHGA 1NVPD 3B09A 2Y0IA 1VQ4V 4AILC 3Q4HA 1GM8A 3CC7V 1SQGA 1S5JA 3JARA 4F6RB 2YEVB 5KA5A 1M5IA 5KUMA 4BW5A 4DR5O 1ORQC 4DUZO 3S3WA 3QVNA 2HJFC 2N05A 1AVMA 5LOVA 1Y76B 4LWSA 1RM1C 2A0LA 3P30A 3DC5A 1N0JA 3ZN1A 3LSQA 5CN0A 3GWOA 4MVUA 4LF9O 1GAXA 2W0FC 4BIOA 3C3TA 3VQWA 3G6BA 2XASA 1YITV 3K03A 4EEQA 3ZMVA 5LP6A 4UV8A 2YIBD 4K3AA 1N33O 1PD3A 4DW1A 1QR8A 3JCZA 2V7QG 5IY5B 4LF6B 2ZIMA 3SYAA 2XTAA 5CMUA 1NH2D 2A79B 2B1GA 1I5YA 4K8XA 3K0DA 4GX1A 3E8GA 1A32A 1QCEA 4LF8O 2ZM6O 2XUMA 3JALB 5CB4A 1KKDA 3ZRXA 1HNXO 2EIJC 3JAKB 3SGIA 4K8ZA 1XMOO 3ASNB 4I4TB 3CEIA 1G1XB 3OEHG 1BHAA 1NTMH 3CCQV 4NKGB 4XDLA 4G28B 4UV9A 5KHJA 5LGTA 3KG2A 4DW0A 1AR1B 5CA0B 5H6QA 3GVMA 1YXBA 3CE2A 4MVMA 5L3GA 3EVKA 3ZHVA 2YICA 4KHPB 2UXNA 4XDJA 5LA6A 4ZHQA 3J80N 4X1YB 5LL6Y 2R9AA 3HR0A 3SJQC 1NQTA 3AG3C 2HP8A 3ZRWA 2IJKA 1RSOB 2F23A 3K5LA 2VWJA 2YXHA 5KX5B 4JI6O 5KMGA 3JAWA 3D36A 4LNUA 4JI2B 4L8JA 1JFFB 3D3QA 1WB7A 2AZ2A 3K06A 1Q6UA 2XOKG 3ZHQA 2G38A 1WP7A 4X1IB 4X62O 2UU9B 3B4SA 1YJNV 4LFCB 1OJHA 2Y69C 5J2UA 3ZRSA 1D5NA 1AP5A 3K9AA 2RNBA 2ZDIA 1AJQA 4FK5C 3GB7C 4YHHB 3B8MA 4RQFA 1YJ9V 3K58A 1GN2A 4LH6A 2HFEC 4O2BB 2HHHO 2Q7GA 3LNNA 4U3FH 4O4HA 1AROP 2YC0A 4X1KA 3N27A 3RYHA 1F4NA 3CWBH 4JI8O 5B3SB 1PL0A 2BSKA 1NVPB 1H2SB 5AG2A 4DV3O 2VS0A 1HDJA 3CRMA 3DXRA 3ETEA 1E79G 3DGEA 3IFXA 2Z3YA 4JYYA 1VQ8V 1FD9A 4ABMA 1SZTA 3VOUA 2R9IA 3BPZA 2JIZG 3E8HA 2UUCB 4R6ZA 1SQPH 3ZX6A 4IIJA 4X65B 1N34O 1BE3H 3STLC 4LF7O 4JI4B 3UO3A 3FAVA 2LJ2A 1R6KA 5DEDA 4J41A 3RVYA 2ZINA 3T1YO 1VF5B 3ZMUA 1NS1A 4FM0A 4X64B 4X66B 3T4DA 2PZSA 3JD2A 1BZKA 1GKFA 5JWPA 4YIPA 3E35A 4CH6A 2A06H 4DUYB 2EIMB 5EBWC 3CB2A 3U10A 1MABG 3MD0A 2HVJC 1TVKA 3ZMZA 1SA0B 1WAZA 4RUEA 1SQBH 4WBNA 3W7UA 1N4CA 2H3OA 4MVQA 1NH2B 3IAYA 2XAHA 3BFRA 3OR6C 2ODMA 1XI1A 2AW9A 4KP4A 4ZBMA 2P22C 4B3TB 1OCZB 1N32O 5LXTA 2XT9A 1KC8W 5JVDA 2P67A 3SPCA 4HBNA 2WSSG 2VQFO 2UUBB 2QEXV 1AI7A 1RPRA 2D3OW 4LR3A 3C90A 2ITCC 2LGQA 5IE9A 1JJ2U 1XL4A 5BR8O 3CXCU 4IT5A 1S5HC 2JRIA 4CS4A 2Q0OC 4UB8Z 1ZUQA 1K5QA 1J5EO 3U0ZA 2HVKC 1XQ8A 1HW7A 3F5WC 1K9MW 1IBKO 2EIKB 4BIUA 5LHHA 4WFGA 4NXNO 4CH4A 2Q7EA 4O4LA 5IY5C 4NTWA 2QKAA 1IDSA 2QWNB 4NTXA 2IU3A 3ABTA 1P7GA 1B06A 3E8FA 2WLNA 1Z5VA 3E2EA 1EZVH 1XMQB 4X9QA 4NR1A 5EIBC 5BY1A 3DTUB 4UCTA 4CS2A 3W7WA 2LO1A 1OZ0A 2L6LA 3ASNC 2BTQA 3OUSA 4WF9V 1ZSPA 5IYZB 4DR4B 1WN7A 5B1OA 5H6RA 3RYIB 3R66A 5DECA 2NR5A 2WLIB 4W4KA 1QVFU 2JJ1G 3MHSC 1GTOA 2PUSA 1SZXA 2UXBB 4RAIA 4WFFA 2OCCB 2CTPA 1SETA 2Q9LA 4O2AA 4PA6A 5L3EA 4AI8A 3OR7C 1D5AA 3H1JH 4JZGA 1TAEA 4B3MO 4DV7O 2YIAA 3ZRVA 4LFBO 2JEXA 2FL4A 3CCSV 1Y6XA 1I0HA 1KKCA 2EJRA 2ZKOA 3BVOA 1AJPA 3IC7A 4PD4F 5LBQA 1JMKC 2F93B 5DM6V 3CMAV 4JGSA 1EN5A 4JAUA 3CX5F 3ZN0A 3L75H 2FKXA 1FAFA 5FPOA 1W0KG 1Q6IA 1GMGA 5KAIZ 3BEHA 4G27B 1ZTEA 3CCUV 2A3QA 4LWSB 4AHCA 2E5LO 1M4UA 5LHIA 2FYUH 1UFIA 5CA1A 1XBLA 5LMNB 3AG4B 3T1CA 3LDCA 4P9PA 4MTOA 4TV9B 1MG1A 3APOA 5B3SC 3STZC 2X6AA 2YI8A 1K5SA 2NNUA 3K0GA 4OX9O 1XNRB 2R70A 1ZL8B 3CCEV 1H8HG 4P2ZA 3E8BA 1M90W 2DJVA 3OMIB 3UQ8A 5EBMC 3ZJZA 2VRZA 3JSNA 3DC6A 4GKJO 5IWAB 1FKAO 1AI5A 4YY3O 3ZHTA 1BGYH 3L72H 3CCMV 4YJ3A 4B3SB 4TWKA 4MVOA 5KUKA 1K8AW 2EILB 5CB4B 5GTHZ 4JYAB 1K97A 1NT2B 3CXHF 3M8AA 4KFMA 2ZE5A 4NXMO 4UCOA 1K33A 4DYLA 1S76D 1AP6A 3H01A 4LCUC 1VQLV 1I94B 3CRRA 3T1HB 2EIMC 4Z2WA 2IJHA 3OGIB 1M57B 2GHYA 3N2KB 4TQFA 1JX9A 3HKCB 4DXWA 3FKSG 1DGSA 2JEUA 4E4EA 2JJ2G 4FIPC 4RO2A 2AGAA 2CTQA 3L74H 5JJNB 3RW0A 4IGGA 5LA6B 2EULA 4ZHQB 3VBBA 1OCZC 3HKBA 5LGUA 3CCLV 3ZRWB 1VF7A 4J11A 4U7OA 3H1IH 3RYCA 3CJHA 5EZYB 5KHIA 2F4VB 4LNUB 1ROPA 1COWG 5B1NA 1XNQO 1L0LH 2BOBC 5JJEB 2WWWA 4YJ2A 2QJ1A 4HZ3A 5LGNA 3RBZA 3HB3B 4QPKA 1HNZO 4BAYA 4GT1A 4LF5B 2BOCC 5B1AB 5J2UB 1G6UA 1IBLO 3ETDA 2WLJA 3JCUZ 3S3XA 1M93A 4UB6Z 2A9HA 1THZA 2EIKC 1UPGA 4DR3O 4DR6B 4UCSA 4GX2A 1IBMO 3ZHUA 3AG7A 4O4HB 3G67A 1FFTB 2JVDA 4ZOLA 4H37A 3C3SA 1DLBA 2ADPA 4JTAB 1VF6C 2DYRB 4EFBA 5JCOC 2FTKA 5JQGA 1IVSA 4DR1B 4QGPA 2QGNA 2CUGA 3FB7C 3RT3C 2XHBA 2WPDG 1VQKV 4O4IA 1KBHA 1SF9A 4O4JA 1OV9A 1VQNV 3FAVB 3BHPA 2EBOA 3B2EE 2MK3A 3NXSA 3FX7A 1SS3A 4B7EA 2MW2B 3CC2V 4WFAV 3TGUH 4DV5B 3P3PA 4DR5B 1YSCA 5EC2C 3UM7A 3JD1A 3T2MA 4UCVA 4UCRA 1Q5OA 1TUEB 2LFRA 2OCCC 3LNMB 4I9QA 1XUQA 1KD1W 3OFNG 4MTXA 1N36B 3A8TA 2ZE8A 4FZ1A 2Q7HA 2Q6AA 5IJ9A 1K4DC 4HYOA 2JGDA 1N33B 4FFKA 4LF6O 4UXNA 4IHJB 1VQ9V 5J2TB 4JTCB 1R3IC 4FJCC 5EK0A 5IJ0A 4JASA 2DYSB 4PDMA 4LF8B 2X6BA 2M6YA 4JI5O 3BA9A 1XHZA 5JH7B 4J9ZB 4I0XB 4PV1B 1GN4A 3AG4C 1NBMG 3K5MA 2PI4A 4PA4A 4UVAA 2E76B 4JI7O 2IH3C 1ZAUA 4UCUA 3MDSA 2YUAA 1O9GA 2PTMA 2Y4TA 4O4LB 5CBFA 5GTIZ 4DV4O 5EYPA 5L3BA 1IXBA 1URFA 1H38A 3G4SV 3K57A 5C8YB 2PGGA 1I08A 3VQYA 4G2KA 1FXHA 2EILC 4TUYA 1FXKB 5KHKA 2EINB 3VQXA 3AG1B 4K35A 3W7XA 5FPRA 5DN6G 4R7CA 2ZR3A 4JI2O 2BTQB 2GUZB 2OIEA 5KA6A 1W0JG 1Q90D 2P7TC 2ZE6A 5CBGA 1PPJH 4IL6Z 2WLHA 1M57C 1Q3EA 5E79Z 4DRXA 1LR1A 3I5DA 1LNQA 3JASA 3ZBHA 1TUBA 3K9SA 3UT5A 4DV6B 1XL6A 4EFEA 3TXSA 4ZKIA 3CC4V 3E22A 4FVMA 2EJ7A 2EX3A 2NN4A 4X20A 1ZLZA 4DV3B 3FYIB 3D36C 1K92A 4I9WA 4LFAB 2CH7B 2UUAB 2CTWA 2Y48A 4JF3A 1R6NA 2XAQA 2YXYA 4R8CA 2L35A 4B3RB 3H1LH 5BXZA 2YS8A 4GZRB 5FLXN 4J7JA 1N34B 5F2VO 2EZPA 5B1AC 1QU7A 3JD0A 2ZDIC 4XDKA 4F6RA 4I50A 2YEVA 1Q86W 3H9VA 2PYLA 3ABUA 4X64O 5GONB 3P3NA 4X66O 1V55B 5CA1B 2R9RB 4GKKB 4FFBA 1Y76A 3AK1A 4U3JA 2B5UA 1M9NA 3SDLA 1JCHA 4EB6B 3SPJA 4F4LA 1WLEA 2DYRC 2HKOA 1HNWO 4J7KA 3X2QB 1GO3F 4MVSA 3B40A 3CP1A 1H2KA 5KHHA 4YIOA 1VP7A 2KKWA 2F43G 4D6TH 4TOIA 1BT8A 4FLZA 4YJ3B 4JI3O 4B3TO 1W59A 3BRCA 3D8CA
chains in the Genus database with same CATH topology
1BCCH 1NTZH 1EZVH 1SQBH 1PPJH 1P84F 3BCCH 3CXHF 1L0NH 1KYOF 3H1KH 3L70H 1SQXH 4PD4F 1SQVH 3TGUH 1L0LH 3L71H 1SQPH 4U3FH 3H1HH 3L74H 1NU1H 1BE3H 3CX5F 1PP9H 1KB9F 3L75H 2FYUH 2IBZH 3L73H 1SQQH 2A06H 3CWBH 1BGYH 3L72H 1NTMH 3H1JH 3H1LH 4D6TH 2BCCH 5KLVH 1NTKH 3H1IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC H;  1NTZ H;  1EZV H;  1SQB H;  1PPJ H;  1P84 F;  3BCC H;  3CXH F;  1L0N H;  1KYO F;  3H1K H;  3L70 H;  1SQX H;  4PD4 F;  1SQV H;  3TGU H;  1L0L H;  3L71 H;  1SQP H;  4U3F H;  3H1H H;  3L74 H;  1NU1 H;  1BE3 H;  3CX5 F;  1PP9 H;  1KB9 F;  3L75 H;  2FYU H;  2IBZ H;  3L73 H;  1SQQ H;  2A06 H;  3CWB H;  1BGY H;  3L72 H;  1NTM H;  3H1J H;  3H1L H;  4D6T H;  2BCC H;  5KLV H;  1NTK H;  3H1I H; 
#chains in the Genus database with same CATH topology
 4J80 A;  3OTO O;  2ZXW B;  1SQX H;  4PEL A;  3SJC C;  2DN9 A;  2ZD9 A;  2M7W A;  2RMK B;  1HR0 O;  4NTY A;  4I55 A;  5FNV B;  2VQF B;  4WFE A;  3MAQ A;  2UUB O;  2AHY A;  3FFQ A;  3RVZ A;  3FD9 A;  1N0N A;  3SPH A;  4TSF G;  1DK1 A;  3JAK A;  1I5X A;  1P4R A;  4H44 B;  4DV0 B;  1D2D A;  2H94 A;  5K1X A;  3KZI Z;  3CRQ A;  4JV5 B;  3L71 H;  3ABM B;  4ZI7 B;  4B08 A;  2P5O A;  3WB1 A;  2Q67 A;  3AK2 A;  5BMV A;  4NXN B;  2CAZ C;  1RFY A;  3NR7 A;  1WA8 B;  4BIZ A;  4JI0 O;  3IGA C;  1H2M A;  4ZIB A;  4NYK A;  3RYC B;  4FLW A;  3JAM N;  2HLD G;  3ML0 A;  1R3L C;  2ZNJ A;  1Q6H A;  1KEC A;  4X1Y A;  4JI1 B;  2DYS C;  1RSO A;  1YDX A;  5KX5 A;  2BCC H;  4LC1 A;  1M1K W;  4N23 A;  1JFF A;  3JYC A;  1I7F A;  4DR2 B;  1OCR B;  3JAT B;  2DWD C;  3RFR A;  4DR4 O;  4TV8 B;  2QDO A;  2Y4U A;  4I5S A;  4N21 A;  1BQ0 A;  2KG7 A;  1X4T A;  2ILM A;  1K3E A;  3QO5 A;  2BTO A;  1S72 V;  3AEI A;  1NJI W;  1PP9 H;  3KCY A;  1VQ6 V;  2HR3 A;  3LDD A;  4IYH A;  4HNA B;  2LW1 A;  2GV9 A;  4FLV A;  3CHX A;  1NTZ H;  1K4C C;  1F23 A;  4O2B A;  4X8A A;  3A0H Z;  3BCC H;  3ZMT A;  1EN4 A;  1SES A;  1QQC A;  1ZX3 A;  5D5Q A;  1Y66 A;  1F51 A;  4L87 A;  5BZB A;  1BHB A;  3Q4H B;  3THO A;  1FXK C;  3JAR B;  2EIN C;  5CA3 A;  3AG1 C;  1U97 A;  2P6J A;  1FPO A;  1P7B A;  1WJZ A;  2VQE O;  1CXZ B;  2OT5 A;  4P30 A;  2KB1 A;  5H5N A;  3T4Z A;  5LOV B;  4GUN A;  3W7T A;  1IX9 A;  4K0K B;  1SRY A;  2B9Z A;  1SKV A;  5EBL C;  4CBC A;  4KL1 A;  5LMN O;  5LP6 B;  3SR2 C;  1YVW A;  2WLK A;  1BS3 A;  1B04 A;  4Z1M G;  3SYQ A;  1MZF A;  2CGO A;  1R6T A;  1BL8 A;  2YIB A;  1VQ5 V;  4OX9 B;  4MVR A;  3SJA C;  1Z2G A;  2JGD B;  1XNR O;  1WPX A;  1Y4M A;  3I56 V;  3K08 A;  5KLV H;  2B1I A;  2QTO A;  5IWA O;  1PL4 A;  1EN6 A;  3O65 A;  1QBZ A;  2D2C B;  1YZB A;  2KSD A;  1YJW V;  2XAJ A;  1Z5W A;  3CME V;  2IM9 A;  3SYC A;  3ABK B;  1KQS U;  4JYA O;  3J7A U;  5IYD O;  1K34 A;  2DOS A;  2Q4P A;  4GLX A;  5LYJ A;  4NXM B;  1G4Y B;  1V55 C;  4H33 A;  3WFV A;  1FFX A;  4JPR A;  1L8D A;  2ZIO A;  1I94 O;  3CD6 V;  4NB5 A;  1GM7 A;  1WPB A;  1IUR A;  3T1H O;  1FS0 G;  2FML A;  4FMT A;  4DV1 B;  4W4L A;  3QO8 A;  4JAV A;  3X2Q C;  5LMU B;  1Q43 A;  2F95 B;  1Y74 A;  1TA8 A;  3QG5 A;  1YI2 V;  3OEE G;  1NTK H;  1PNL A;  4BWA A;  1B6Q A;  4DV2 B;  4UVC A;  2Z0A A;  5KMG B;  3SYP A;  3JAW B;  4DK0 A;  2IH1 C;  3OMA B;  4LF4 B;  1FJG O;  3PN1 A;  4OXS A;  3AG2 B;  3W7S A;  1V54 B;  2P4K A;  4TUY B;  1ENV A;  3E83 A;  2ZXW C;  4X89 A;  5L3F A;  1VF6 A;  3UO2 A;  2F4V O;  2Y0P A;  5JCO A;  2GDS A;  1P49 A;  3EFF K;  2V1D A;  5HFL A;  2QA4 V;  4DR7 B;  2UXD O;  1S77 D;  1HNZ B;  2JS3 A;  1CP9 A;  4LF5 O;  3L70 H;  1MNG A;  4WFB V;  3IC9 A;  4CC6 A;  1KP3 A;  3H1H H;  1HP8 A;  2WA3 A;  1TUB B;  1AJN A;  3RYF A;  3ABM C;  3L73 H;  3TET A;  3RYI A;  4X1K B;  2CK3 G;  5B66 Z;  3RYH B;  4DR3 B;  4DR6 O;  2QE7 G;  3ZED A;  2AXT Z;  2Q73 A;  2BSK B;  3B77 A;  3E22 B;  3LUT B;  2K9P A;  3TCU A;  3DXR B;  2UXC B;  4WCE V;  1P84 F;  1KYO F;  5FL7 G;  3JD3 A;  1QNM A;  2JK5 C;  4AQY B;  3MHH C;  1DTO A;  3P32 A;  1H8E G;  3OGC C;  4IIJ B;  2QR4 A;  2IBZ H;  3BAB A;  1XDC A;  3E89 A;  2NLJ C;  4HAM A;  4D7T A;  3OD4 A;  2QM4 A;  4DR1 O;  3WG7 B;  3UKM A;  2XAF A;  2ITD C;  1IZ3 A;  1H2L A;  4D7S A;  4OPH A;  4Q20 A;  1OCR C;  3F5T A;  4DUZ B;  3KCX A;  1PV0 A;  4I50 B;  3CSX A;  3HKE A;  5ITZ A;  4J7Z A;  1JQ0 A;  4GCZ A;  4DV5 O;  1VMG A;  3QF7 A;  2X7R B;  4Q6G A;  4DO2 A;  1YHQ V;  4LF9 B;  2AHZ A;  4FFB B;  2DW4 A;  1TVK B;  1SER A;  4U3J B;  4WBN B;  3H1K H;  1B3Q A;  4JYC A;  1SQV H;  4PDR A;  5JJJ B;  4FLT A;  4TT3 G;  2LQT A;  1N36 O;  2CDY A;  3K04 A;  1QLE B;  2LGW A;  1GH6 A;  2X0L A;  4TV9 A;  5LXT B;  3ASO B;  1W2B U;  5JVD B;  3IJ4 A;  3EXA A;  3FYE B;  1ZL8 A;  3N2G A;  4P9O A;  2QSA A;  3LSU A;  2P4V A;  5C93 A;  2ZM6 B;  2ZR2 A;  3RN4 A;  1FXV A;  1VQ7 V;  1H2N A;  1HNX B;  2YXL A;  2BE3 A;  4I55 B;  3OAA G;  4EKW A;  4WFH A;  1YTF D;  1XMO B;  1WB8 A;  4MS2 A;  4JI5 B;  3CCV V;  4QIW F;  3E86 A;  2ZQM A;  3OT7 A;  2E75 B;  2Q0A A;  4ASU G;  1XOU A;  2RQ6 A;  2DE0 X;  2DQ0 A;  3JD4 A;  5LP6 C;  1MMM A;  1SC5 B;  1Q7Y W;  5BMV B;  2W0X A;  4JI7 B;  1QR9 A;  3FB5 C;  5H2F Z;  3K79 A;  3N2K A;  3HKC A;  4KHP O;  4DV4 B;  4NVP A;  3LSS A;  3FB8 C;  4J9Y B;  1DF4 A;  3CRA A;  3CS5 A;  1OHH G;  1TGO A;  2XND G;  1GRJ A;  3TK1 A;  3I55 V;  4JI6 B;  1NZ6 A;  4MTF A;  3B8N A;  3HKD A;  1SQQ H;  1WNS A;  2R72 A;  2O57 A;  2WLL A;  3ABK C;  2EZO A;  5EZY A;  1S5L Z;  1GN6 A;  1US6 A;  2RJZ A;  3A2F A;  3OW2 U;  4H13 B;  4QNH B;  2UU9 O;  4X62 B;  5IDJ A;  4LFC O;  2ZNI A;  1AR4 A;  1ZWI C;  1JR9 A;  2KG7 B;  2Q68 A;  3F7V C;  4YHH O;  2OYQ A;  2F1M A;  4O2A B;  1GN3 A;  4MTG A;  2HHH B;  1AIL A;  1QLN A;  1WP8 A;  3GWK C;  4DV6 O;  3BA8 A;  1L0N H;  4MVZ A;  3VQV A;  4JI8 B;  2RN9 A;  4E2L A;  1EBO A;  1J95 A;  2WAM A;  4FZ0 A;  4OPA A;  3AG2 C;  5K1P A;  4QJF B;  2IJJ A;  2OCH A;  1V54 C;  1EFR G;  5D5P A;  3OMN B;  1VEW A;  4JTD B;  4FM2 A;  2UUC O;  1QVG U;  4LFA O;  2N04 A;  1DF5 A;  2UUA O;  4X65 O;  3G6E V;  4ICG A;  1OCC B;  1XEQ A;  2QWR B;  4B3R O;  1PNM A;  4JI4 O;  4LF7 B;  1GM9 A;  2H8P C;  3JSL A;  4U7N A;  3CYO A;  2WLM A;  3EHB B;  4FLU A;  3T1Y B;  5L3C A;  1T5E A;  1XIL A;  1JJO A;  3SYO A;  2LFS A;  3U11 A;  2HG5 C;  4FLX A;  1VQM V;  2CE4 A;  2DWE C;  3K3W A;  4DUY O;  1R1B A;  4XBF A;  4GKK O;  4PJ0 Z;  4LBE C;  1RPO A;  4FPP A;  2HJD A;  1G8M A;  3ABL B;  1Q82 W;  1L1F A;  3G71 V;  4Z1V A;  3FB6 C;  4OGQ B;  2QKS A;  4PDL A;  1H2G A;  1HNW B;  4UVB A;  1KMI Z;  4PI2 A;  5IYC O;  5A2Q N;  5LHG A;  5IT9 N;  3CPW U;  3WG7 C;  3LDE A;  1N32 B;  2XAG A;  2QWQ B;  4CC5 A;  2OIG A;  4MW8 A;  1YTF B;  4JI3 B;  5B1B B;  2LW7 A;  1GK9 A;  4TQD A;  2OTJ V;  2W6J G;  5HFM A;  2OWO A;  3SPI A;  4RUF A;  4IHJ A;  4C7U A;  3OTO B;  2F66 C;  1JVM A;  5J2T A;  3RWR D;  3JAL A;  3A0B Z;  1HR0 B;  4MW3 A;  5LYJ B;  5BR8 B;  2RDC A;  1FFX B;  1OCO B;  4BR6 A;  1J5E B;  4I4T A;  4A5U B;  4CH3 A;  2K1E A;  5JH7 A;  3ZMS A;  4I0X A;  4QE7 A;  2IU0 A;  3ZCC A;  2Q69 A;  1NU1 H;  1IBK B;  2YDE A;  4DV0 O;  4JYB A;  3SJB C;  1Y67 A;  4JV5 O;  4JZ2 A;  1S0V A;  1Y74 B;  1QLE C;  3HKB B;  2QM8 A;  2VWK A;  2UXX A;  5CA0 A;  3ETQ A;  4LH7 A;  3ASO C;  3CJH B;  1KU9 A;  3F7Y C;  4J10 A;  4UUJ C;  1YIJ V;  4JI0 B;  4KUM A;  4PHZ A;  2IJI A;  2Q5Z A;  1V9P A;  2Z5U A;  2QTS A;  2JGU A;  1KP2 A;  4YJ2 B;  1XMQ O;  1CEZ A;  5C8Y A;  1VQP V;  4PA3 A;  1XHX A;  1M56 B;  1Q8I A;  2GSM B;  2QWO B;  4JI1 O;  2W6I G;  5KAF Z;  1LUW A;  4PA7 A;  3QTC A;  2YSU B;  3TXQ A;  1FXK A;  1BQZ A;  3ZIA G;  2ADQ B;  3J81 N;  2GUZ A;  5IYB O;  4X1I A;  4DR2 O;  4R50 A;  3RYF B;  2OTL V;  2UXB O;  1AR5 A;  4ZOL B;  3BY6 A;  3HPL C;  4MT8 A;  1RM1 B;  2PI5 A;  3DSQ A;  5TIS Z;  2ZE7 A;  3APQ A;  2E3C A;  5E1A C;  3CCR V;  4GX0 A;  2ARH A;  3R65 A;  1O9H A;  5JQG B;  1JOY A;  4J42 A;  1NR7 A;  4B3M B;  4DV7 B;  1VAR A;  2HEP A;  4LFB B;  1KB9 F;  3K5N A;  4LP8 A;  3ZS8 C;  4PI0 A;  2DQ3 A;  1F7Y A;  2Q8V A;  1VQO V;  4O4I B;  2P06 A;  4O4J B;  2YI9 A;  4X88 A;  1AI4 A;  1HWY A;  3WU2 Z;  3KKY A;  1EM1 A;  4CH5 A;  1EZJ A;  3OUF A;  4PA9 A;  4GYC B;  1K73 W;  2P90 A;  2CH7 A;  3K59 A;  1PKX A;  2VQE B;  1BSM A;  4PDV A;  4MSW C;  1MZE A;  3QNE A;  1KUQ A;  3L9D A;  2C2A A;  3UCS C;  3HKE B;  3O9O A;  2JS5 A;  4KXR A;  5ITZ B;  2EIJ B;  2PYJ A;  1PM9 A;  5J9P C;  1E1Q G;  1MOF A;  2RCV A;  2E5L B;  2LP7 A;  2PF4 E;  3WB2 A;  4K0K O;  4BW9 A;  3QO7 A;  4B7K A;  1FYJ A;  1AB3 A;  1NR1 A;  5GON A;  3A0R A;  3M99 B;  5IJ9 B;  2GTA A;  1R3K C;  3SPG A;  1BMF G;  3TJT A;  2QM7 A;  1SA0 A;  4H0L B;  1VIB A;  4EB6 A;  2ATK C;  4GKJ B;  3PJS K;  1YCI A;  4YY3 B;  5IJ0 B;  3N2G B;  4B3S O;  1OCC C;  3AG3 B;  3AK3 A;  5CBH A;  4IYI A;  2CTR A;  1YF2 A;  4GX5 A;  2CGN A;  5EC1 C;  2QWP B;  2V4D A;  2E74 B;  1MA1 A;  2GTS A;  2GBO A;  2PY5 A;  1BCC H;  1K7D A;  1RP3 B;  1CPY A;  1U96 A;  1F4M A;  5EIB D;  5FNV A;  1MSW D;  4UFZ A;  2YID A;  5A9G A;  1R3J C;  1NI8 A;  2Y69 B;  4FM1 A;  3ZHS A;  4JAA A;  3BAA A;  2X6C A;  1XRE A;  1JA8 A;  3ABL C;  1QHT A;  5EYP B;  2IW5 A;  1YEW A;  3K5O A;  4DV1 O;  3CCJ V;  5B5E Z;  4F6E A;  5LMU O;  3ETG A;  4ZI7 A;  4RQE A;  1PNK A;  3OE7 G;  4QE9 A;  4DV2 O;  3OM3 B;  1WA8 A;  2A7W A;  5B1B C;  4LF4 O;  2FB5 A;  1FJG B;  3HKD B;  2QKC A;  1XNQ B;  2WLL B;  2KQX A;  1JPX A;  2WA4 A;  2ZT9 B;  3CRC A;  4QPJ A;  1R73 A;  2ETN A;  3WB0 A;  3D3I A;  1SQF A;  1AI6 A;  1S3J A;  5H9C A;  1OCO C;  1IBL B;  4DR7 O;  1MSD A;  4DRX B;  1IXM A;  3JAS B;  1NKD A;  2UXD B;  5IYZ A;  3UT5 B;  4DK1 A;  2WLI A;  3RGB A;  2N74 A;  1LUV A;  3JAT A;  4TV8 A;  1IBM B;  2ZCE A;  5L3D A;  1Q81 W;  3G80 A;  2DMX A;  3OTF A;  1E1R G;  3ICX A;  3M7M X;  2JDI G;  4X20 B;  3ZHR A;  4CS3 A;  4HNA A;  2AZ0 A;  2UXC O;  4RWU A;  5GW7 A;  4FLY A;  4AQY O;  4CZZ A;  4I7Z B;  1UJW B;  1X59 A;  1M56 C;  4YXW G;  1N8R W;  5KHG A;  1NVP D;  3B09 A;  2Y0I A;  1VQ4 V;  4AIL C;  3Q4H A;  1GM8 A;  3CC7 V;  1SQG A;  1S5J A;  3JAR A;  4F6R B;  2YEV B;  5KA5 A;  1M5I A;  5KUM A;  4BW5 A;  4DR5 O;  1ORQ C;  4DUZ O;  3S3W A;  3QVN A;  2HJF C;  2N05 A;  1AVM A;  5LOV A;  1Y76 B;  4LWS A;  1RM1 C;  2A0L A;  3P30 A;  3DC5 A;  1N0J A;  3ZN1 A;  3LSQ A;  5CN0 A;  3GWO A;  4MVU A;  4LF9 O;  1GAX A;  2W0F C;  4BIO A;  3C3T A;  3VQW A;  3G6B A;  2XAS A;  1YIT V;  3K03 A;  4EEQ A;  3ZMV A;  5LP6 A;  4UV8 A;  2YIB D;  4K3A A;  1N33 O;  1PD3 A;  4DW1 A;  1QR8 A;  3JCZ A;  2V7Q G;  5IY5 B;  4LF6 B;  2ZIM A;  3SYA A;  2XTA A;  5CMU A;  1NH2 D;  2A79 B;  2B1G A;  1I5Y A;  4K8X A;  3K0D A;  4GX1 A;  3E8G A;  1A32 A;  1QCE A;  4LF8 O;  2ZM6 O;  2XUM A;  3JAL B;  5CB4 A;  1KKD A;  3ZRX A;  1HNX O;  2EIJ C;  3JAK B;  3SGI A;  4K8Z A;  1XMO O;  3ASN B;  4I4T B;  3CEI A;  1G1X B;  3OEH G;  1BHA A;  1NTM H;  3CCQ V;  4NKG B;  4XDL A;  4G28 B;  4UV9 A;  5KHJ A;  5LGT A;  3KG2 A;  4DW0 A;  1AR1 B;  5CA0 B;  5H6Q A;  3GVM A;  1YXB A;  3CE2 A;  4MVM A;  5L3G A;  3EVK A;  3ZHV A;  2YIC A;  4KHP B;  2UXN A;  4XDJ A;  5LA6 A;  4ZHQ A;  3J80 N;  4X1Y B;  5LL6 Y;  2R9A A;  3HR0 A;  3SJQ C;  1NQT A;  3AG3 C;  2HP8 A;  3ZRW A;  2IJK A;  1RSO B;  2F23 A;  3K5L A;  2VWJ A;  2YXH A;  5KX5 B;  4JI6 O;  5KMG A;  3JAW A;  3D36 A;  4LNU A;  4JI2 B;  4L8J A;  1JFF B;  3D3Q A;  1WB7 A;  2AZ2 A;  3K06 A;  1Q6U A;  2XOK G;  3ZHQ A;  2G38 A;  1WP7 A;  4X1I B;  4X62 O;  2UU9 B;  3B4S A;  1YJN V;  4LFC B;  1OJH A;  2Y69 C;  5J2U A;  3ZRS A;  1D5N A;  1AP5 A;  3K9A A;  2RNB A;  2ZDI A;  1AJQ A;  4FK5 C;  3GB7 C;  4YHH B;  3B8M A;  4RQF A;  1YJ9 V;  3K58 A;  1GN2 A;  4LH6 A;  2HFE C;  4O2B B;  2HHH O;  2Q7G A;  3LNN A;  4U3F H;  4O4H A;  1ARO P;  2YC0 A;  4X1K A;  3N27 A;  3RYH A;  1F4N A;  3CWB H;  4JI8 O;  5B3S B;  1PL0 A;  2BSK A;  1NVP B;  1H2S B;  5AG2 A;  4DV3 O;  2VS0 A;  1HDJ A;  3CRM A;  3DXR A;  3ETE A;  1E79 G;  3DGE A;  3IFX A;  2Z3Y A;  4JYY A;  1VQ8 V;  1FD9 A;  4ABM A;  1SZT A;  3VOU A;  2R9I A;  3BPZ A;  2JIZ G;  3E8H A;  2UUC B;  4R6Z A;  1SQP H;  3ZX6 A;  4IIJ A;  4X65 B;  1N34 O;  1BE3 H;  3STL C;  4LF7 O;  4JI4 B;  3UO3 A;  3FAV A;  2LJ2 A;  1R6K A;  5DED A;  4J41 A;  3RVY A;  2ZIN A;  3T1Y O;  1VF5 B;  3ZMU A;  1NS1 A;  4FM0 A;  4X64 B;  4X66 B;  3T4D A;  2PZS A;  3JD2 A;  1BZK A;  1GKF A;  5JWP A;  4YIP A;  3E35 A;  4CH6 A;  2A06 H;  4DUY B;  2EIM B;  5EBW C;  3CB2 A;  3U10 A;  1MAB G;  3MD0 A;  2HVJ C;  1TVK A;  3ZMZ A;  1SA0 B;  1WAZ A;  4RUE A;  1SQB H;  4WBN A;  3W7U A;  1N4C A;  2H3O A;  4MVQ A;  1NH2 B;  3IAY A;  2XAH A;  3BFR A;  3OR6 C;  2ODM A;  1XI1 A;  2AW9 A;  4KP4 A;  4ZBM A;  2P22 C;  4B3T B;  1OCZ B;  1N32 O;  5LXT A;  2XT9 A;  1KC8 W;  5JVD A;  2P67 A;  3SPC A;  4HBN A;  2WSS G;  2VQF O;  2UUB B;  2QEX V;  1AI7 A;  1RPR A;  2D3O W;  4LR3 A;  3C90 A;  2ITC C;  2LGQ A;  5IE9 A;  1JJ2 U;  1XL4 A;  5BR8 O;  3CXC U;  4IT5 A;  1S5H C;  2JRI A;  4CS4 A;  2Q0O C;  4UB8 Z;  1ZUQ A;  1K5Q A;  1J5E O;  3U0Z A;  2HVK C;  1XQ8 A;  1HW7 A;  3F5W C;  1K9M W;  1IBK O;  2EIK B;  4BIU A;  5LHH A;  4WFG A;  4NXN O;  4CH4 A;  2Q7E A;  4O4L A;  5IY5 C;  4NTW A;  2QKA A;  1IDS A;  2QWN B;  4NTX A;  2IU3 A;  3ABT A;  1P7G A;  1B06 A;  3E8F A;  2WLN A;  1Z5V A;  3E2E A;  1EZV H;  1XMQ B;  4X9Q A;  4NR1 A;  5EIB C;  5BY1 A;  3DTU B;  4UCT A;  4CS2 A;  3W7W A;  2LO1 A;  1OZ0 A;  2L6L A;  3ASN C;  2BTQ A;  3OUS A;  4WF9 V;  1ZSP A;  5IYZ B;  4DR4 B;  1WN7 A;  5B1O A;  5H6R A;  3RYI B;  3R66 A;  5DEC A;  2NR5 A;  2WLI B;  4W4K A;  1QVF U;  2JJ1 G;  3MHS C;  1GTO A;  2PUS A;  1SZX A;  2UXB B;  4RAI A;  4WFF A;  2OCC B;  2CTP A;  1SET A;  2Q9L A;  4O2A A;  4PA6 A;  5L3E A;  4AI8 A;  3OR7 C;  1D5A A;  3H1J H;  4JZG A;  1TAE A;  4B3M O;  4DV7 O;  2YIA A;  3ZRV A;  4LFB O;  2JEX A;  2FL4 A;  3CCS V;  1Y6X A;  1I0H A;  1KKC A;  2EJR A;  2ZKO A;  3BVO A;  1AJP A;  3IC7 A;  4PD4 F;  5LBQ A;  1JMK C;  2F93 B;  5DM6 V;  3CMA V;  4JGS A;  1EN5 A;  4JAU A;  3CX5 F;  3ZN0 A;  3L75 H;  2FKX A;  1FAF A;  5FPO A;  1W0K G;  1Q6I A;  1GMG A;  5KAI Z;  3BEH A;  4G27 B;  1ZTE A;  3CCU V;  2A3Q A;  4LWS B;  4AHC A;  2E5L O;  1M4U A;  5LHI A;  2FYU H;  1UFI A;  5CA1 A;  1XBL A;  5LMN B;  3AG4 B;  3T1C A;  3LDC A;  4P9P A;  4MTO A;  4TV9 B;  1MG1 A;  3APO A;  5B3S C;  3STZ C;  2X6A A;  2YI8 A;  1K5S A;  2NNU A;  3K0G A;  4OX9 O;  1XNR B;  2R70 A;  1ZL8 B;  3CCE V;  1H8H G;  4P2Z A;  3E8B A;  1M90 W;  2DJV A;  3OMI B;  3UQ8 A;  5EBM C;  3ZJZ A;  2VRZ A;  3JSN A;  3DC6 A;  4GKJ O;  5IWA B;  1FKA O;  1AI5 A;  4YY3 O;  3ZHT A;  1BGY H;  3L72 H;  3CCM V;  4YJ3 A;  4B3S B;  4TWK A;  4MVO A;  5KUK A;  1K8A W;  2EIL B;  5CB4 B;  5GTH Z;  4JYA B;  1K97 A;  1NT2 B;  3CXH F;  3M8A A;  4KFM A;  2ZE5 A;  4NXM O;  4UCO A;  1K33 A;  4DYL A;  1S76 D;  1AP6 A;  3H01 A;  4LCU C;  1VQL V;  1I94 B;  3CRR A;  3T1H B;  2EIM C;  4Z2W A;  2IJH A;  3OGI B;  1M57 B;  2GHY A;  3N2K B;  4TQF A;  1JX9 A;  3HKC B;  4DXW A;  3FKS G;  1DGS A;  2JEU A;  4E4E A;  2JJ2 G;  4FIP C;  4RO2 A;  2AGA A;  2CTQ A;  3L74 H;  5JJN B;  3RW0 A;  4IGG A;  5LA6 B;  2EUL A;  4ZHQ B;  3VBB A;  1OCZ C;  3HKB A;  5LGU A;  3CCL V;  3ZRW B;  1VF7 A;  4J11 A;  4U7O A;  3H1I H;  3RYC A;  3CJH A;  5EZY B;  5KHI A;  2F4V B;  4LNU B;  1ROP A;  1COW G;  5B1N A;  1XNQ O;  1L0L H;  2BOB C;  5JJE B;  2WWW A;  4YJ2 A;  2QJ1 A;  4HZ3 A;  5LGN A;  3RBZ A;  3HB3 B;  4QPK A;  1HNZ O;  4BAY A;  4GT1 A;  4LF5 B;  2BOC C;  5B1A B;  5J2U B;  1G6U A;  1IBL O;  3ETD A;  2WLJ A;  3JCU Z;  3S3X A;  1M93 A;  4UB6 Z;  2A9H A;  1THZ A;  2EIK C;  1UPG A;  4DR3 O;  4DR6 B;  4UCS A;  4GX2 A;  1IBM O;  3ZHU A;  3AG7 A;  4O4H B;  3G67 A;  1FFT B;  2JVD A;  4ZOL A;  4H37 A;  3C3S A;  1DLB A;  2ADP A;  4JTA B;  1VF6 C;  2DYR B;  4EFB A;  5JCO C;  2FTK A;  5JQG A;  1IVS A;  4DR1 B;  4QGP A;  2QGN A;  2CUG A;  3FB7 C;  3RT3 C;  2XHB A;  2WPD G;  1VQK V;  4O4I A;  1KBH A;  1SF9 A;  4O4J A;  1OV9 A;  1VQN V;  3FAV B;  3BHP A;  2EBO A;  3B2E E;  2MK3 A;  3NXS A;  3FX7 A;  1SS3 A;  4B7E A;  2MW2 B;  3CC2 V;  4WFA V;  3TGU H;  4DV5 B;  3P3P A;  4DR5 B;  1YSC A;  5EC2 C;  3UM7 A;  3JD1 A;  3T2M A;  4UCV A;  4UCR A;  1Q5O A;  1TUE B;  2LFR A;  2OCC C;  3LNM B;  4I9Q A;  1XUQ A;  1KD1 W;  3OFN G;  4MTX A;  1N36 B;  3A8T A;  2ZE8 A;  4FZ1 A;  2Q7H A;  2Q6A A;  5IJ9 A;  1K4D C;  4HYO A;  2JGD A;  1N33 B;  4FFK A;  4LF6 O;  4UXN A;  4IHJ B;  1VQ9 V;  5J2T B;  4JTC B;  1R3I C;  4FJC C;  5EK0 A;  5IJ0 A;  4JAS A;  2DYS B;  4PDM A;  4LF8 B;  2X6B A;  2M6Y A;  4JI5 O;  3BA9 A;  1XHZ A;  5JH7 B;  4J9Z B;  4I0X B;  4PV1 B;  1GN4 A;  3AG4 C;  1NBM G;  3K5M A;  2PI4 A;  4PA4 A;  4UVA A;  2E76 B;  4JI7 O;  2IH3 C;  1ZAU A;  4UCU A;  3MDS A;  2YUA A;  1O9G A;  2PTM A;  2Y4T A;  4O4L B;  5CBF A;  5GTI Z;  4DV4 O;  5EYP A;  5L3B A;  1IXB A;  1URF A;  1H38 A;  3G4S V;  3K57 A;  5C8Y B;  2PGG A;  1I08 A;  3VQY A;  4G2K A;  1FXH A;  2EIL C;  4TUY A;  1FXK B;  5KHK A;  2EIN B;  3VQX A;  3AG1 B;  4K35 A;  3W7X A;  5FPR A;  5DN6 G;  4R7C A;  2ZR3 A;  4JI2 O;  2BTQ B;  2GUZ B;  2OIE A;  5KA6 A;  1W0J G;  1Q90 D;  2P7T C;  2ZE6 A;  5CBG A;  1PPJ H;  4IL6 Z;  2WLH A;  1M57 C;  1Q3E A;  5E79 Z;  4DRX A;  1LR1 A;  3I5D A;  1LNQ A;  3JAS A;  3ZBH A;  1TUB A;  3K9S A;  3UT5 A;  4DV6 B;  1XL6 A;  4EFE A;  3TXS A;  4ZKI A;  3CC4 V;  3E22 A;  4FVM A;  2EJ7 A;  2EX3 A;  2NN4 A;  4X20 A;  1ZLZ A;  4DV3 B;  3FYI B;  3D36 C;  1K92 A;  4I9W A;  4LFA B;  2CH7 B;  2UUA B;  2CTW A;  2Y48 A;  4JF3 A;  1R6N A;  2XAQ A;  2YXY A;  4R8C A;  2L35 A;  4B3R B;  3H1L H;  5BXZ A;  2YS8 A;  4GZR B;  5FLX N;  4J7J A;  1N34 B;  5F2V O;  2EZP A;  5B1A C;  1QU7 A;  3JD0 A;  2ZDI C;  4XDK A;  4F6R A;  4I50 A;  2YEV A;  1Q86 W;  3H9V A;  2PYL A;  3ABU A;  4X64 O;  5GON B;  3P3N A;  4X66 O;  1V55 B;  5CA1 B;  2R9R B;  4GKK B;  4FFB A;  1Y76 A;  3AK1 A;  4U3J A;  2B5U A;  1M9N A;  3SDL A;  1JCH A;  4EB6 B;  3SPJ A;  4F4L A;  1WLE A;  2DYR C;  2HKO A;  1HNW O;  4J7K A;  3X2Q B;  1GO3 F;  4MVS A;  3B40 A;  3CP1 A;  1H2K A;  5KHH A;  4YIO A;  1VP7 A;  2KKW A;  2F43 G;  4D6T H;  4TOI A;  1BT8 A;  4FLZ A;  4YJ3 B;  4JI3 O;  4B3T O;  1W59 A;  3BRC A;  3D8C A; 
#chains in the Genus database with same CATH homology
 1BCC H;  1NTZ H;  1EZV H;  1SQB H;  1PPJ H;  1P84 F;  3BCC H;  3CXH F;  1L0N H;  1KYO F;  3H1K H;  3L70 H;  1SQX H;  4PD4 F;  1SQV H;  3TGU H;  1L0L H;  3L71 H;  1SQP H;  4U3F H;  3H1H H;  3L74 H;  1NU1 H;  1BE3 H;  3CX5 F;  1PP9 H;  1KB9 F;  3L75 H;  2FYU H;  2IBZ H;  3L73 H;  1SQQ H;  2A06 H;  3CWB H;  1BGY H;  3L72 H;  1NTM H;  3H1J H;  3H1L H;  4D6T H;  2BCC H;  5KLV H;  1NTK H;  3H1I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...