1KYOF

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
DTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 26
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kyoF00
3L72H 3H1LH 1L0LH 3CWBH 3L74H 1SQVH 4PD4F 3CX5F 1EZVH 1KYOF 1NU1H 3H1KH 3L71H 2A06H 1BCCH 1SQXH 3BCCH 1SQBH 1NTZH 2BCCH 2IBZH 3H1HH 3L75H 5KLVH 1PPJH 4U3FH 1BGYH 3CXHF 1KB9F 3H1JH 1NTKH 1BE3H 3TGUH 3L70H 1PP9H 2FYUH 3H1IH 3L73H 1NTMH 1L0NH 1SQPH 1P84F 4D6TH 1SQQH
chains in the Genus database with same CATH superfamily
2XT9A 3CJHB 1TUEB 3I55V 3D36A 4WFHA 1PV0A 3HKBB 4PI2A 2MK3A 4NYKA 1H2GA 2KG7B 4IIJA 3CCMV 1TGOA 2V7QG 5JH7B 4CC6A 2BOBC 3STLC 4JAUA 4X89A 1M56C 3WB1A 5KMGA 1M4UA 5DECA 3PN1A 3ZRVA 1NT2B 1HDJA 4LH7A 4PA6A 4QIWF 5LP6B 4FLYA 1P4RA 2DWEC 4O2BB 3S3WA 4ASUG 3HKBA 3RVYA 4IIJB 1FAFA 3SYPA 1YTFD 4CH3A 2RNBA 1DLBA 2ZDIA 3ABKC 1GN3A 2GDSA 1TAEA 4B7KA 5LL6Y 4HBNA 4QNHB 2ZDIC 3RYHA 3ZHVA 1QR8A 2B1IA 5B1BC 3G4SV 1K33A 2ADPA 4WBNA 4G28B 3WG7C 1FFXA 1Y67A 2UXDO 3Q4HB 2E74B 4CH5A 1WA8B 2XTAA 1YXBA 3CC7V 3QVNA 4YJ3B 5CBHA 1G6UA 4DRXA 1DK1A 4D6TH 3RYHB 2F43G 5BZBA 1Z5WA 4P9PA 3JARA 2Y0PA 2QR4A 1FFXB 1AP5A 3QO5A 4H37A 1FXVA 4R6ZA 1P7GA 2VRZA 3EFFK 4YJ3A 2ZCEA 5GONB 2UXDB 3GB7C 4DV0O 4LWSB 4NTYA 5LGTA 5L3BA 2X6CA 4JAVA 1M90W 1IBLO 4LNUA 2YI8A 4NXMB 4TWKA 5KUKA 4AI8A 1I94O 4UV8A 3W7WA 3LUTB 1PD3A 2GSMB 3MHHC 3L75H 4B3SO 1DGSA 2X0LA 4Q20A 3ZHTA 5IJ9A 3ZBHA 5GONA 4GCZA 1H2LA 3P3NA 3QF7A 1X59A 2WLLA 2JJ1G 1KP2A 5KUMA 1V54B 2CGNA 1EZVH 3AG2C 2Q68A 5H6QA 3AK1A 2UXBO 3EXAA 4W4KA 4EB6A 2DOSA 2QM8A 3DXRA 4DUYB 4JYAO 4LF8B 4U3JB 4JYCA 3K5MA 4ZIBA 3AG3B 3CCJV 3CRQA 1K3EA 4R50A 1RSOB 3KKYA 2E76B 3K06A 5E1AC 4ZHQA 5K1XA 4J7JA 4FJCC 2IW5A 5KLVH 2EJRA 1NVPB 3ZHUA 3ETGA 4JI8B 4HZ3A 5CBGA 1R3LC 5E79Z 5CBFA 5CMUA 2QE7G 3E35A 1AILA 1B06A 1US6A 3K3WA 2UUAO 2QWPB 4AQYO 1TUBB 2BTQA 3RVZA 4UCRA 2YIBA 2FMLA 1M56B 4WF9V 1P7BA 3SYQA 1H2MA 3VQWA 5KHKA 1M57C 2VQFB 2PI5A 5A9GA 2VQFO 3RBZA 2IJHA 2CGOA 1VQ8V 1AI5A 2CUGA 1GAXA 2HR3A 3B8NA 1S5HC 1RPOA 4JI1O 3SPJA 1SQVH 3UO2A 1IXMA 1ENVA 1SQXH 3SJAC 1Q6IA 3JD2A 3K0DA 4K0KO 4LP8A 1YF2A 3P3PA 1ZL8A 3L70H 4P2ZA 1IBKB 1GN2A 2Q7HA 3B09A 4RWUA 3K08A 5L3GA 1K34A 2YS8A 4P9OA 2V4DA 5DN6G 2EILC 5B5EZ 5JJEB 4PA3A 5BR8B 2ETNA 2AXTZ 5JVDA 4J7KA 4EEQA 1WPXA 3OEEG 2LFRA 4IYHA 1KB9F 4DR6B 3BAAA 5C8YB 5BY1A 4IHJB 1RP3B 3APQA 1W0KG 2DJVA 4FM1A 1F51A 2WA4A 4YHHO 1YJWV 2PI4A 1ZWIC 3CSXA 5B1AB 3KZIZ 4JTDB 2Q67A 5D5PA 1N36B 4B3RO 4LF8O 2R70A 1I0HA 3SYOA 1FKAO 3UO3A 4JI6B 4X64B 1NI8A 1KC8W 4MVMA 2CK3G 4G2KA 4B3MO 3ASNB 1N32O 4B3SB 3ABTA 1SC5B 4BIUA 4J80A 2ZE6A 1MA1A 2IH1C 3JALA 2YICA 3E89A 1JQ0A 4UV9A 3CJHA 1SQFA 4DW1A 2OWOA 3CEIA 2NN4A 5JH7A 4K3AA 4TQFA 1XOUA 5J9PC 1MZEA 2ZR3A 2X6BA 4DW0A 5CA1B 1Q43A 4FPPA 2DYSC 1IBLB 5IWAO 3F7YC 3IC7A 5LA6B 4O2BA 4DV0B 1NH2D 2WLIB 1QVGU 5LMUB 1WB8A 5IY5B 4DR4O 2M6YA 1VF6A 1YI2V 2W0XA 2JEXA 2LJ2A 5HFMA 3OD4A 4GKKB 1EM1A 4GZRB 2DYRB 5LA6A 1Q5OA 2EZOA 2ATKC 4I9WA 4DR5O 4ZBMA 4FFBA 2JGDB 2OTJV 3VQYA 2GUZA 2EINB 2QEXV 2LO1A 4Z1MG 1IDSA 1VQ5V 2P5OA 3TXSA 3J7AU 3IGAC 1FXKA 2YXLA 4J41A 3QO8A 4MT8A 4H0LB 1FXHA 4DK1A 4GLXA 2YUAA 2JVDA 4N21A 4J42A 4AILC 1OCCB 1NU1H 1AP6A 1EN5A 3ZRWB 4JI5O 4LFAO 5KMGB 4FLUA 4FLZA 5J2TB 3OUSA 2CDYA 3RYFB 3H1JH 3DC5A 3RN4A 1M5IA 4QGPA 4DUZO 2ZNIA 4KHPO 3BVOA 3K58A 2OYQA 4LWSA 2Y69B 4DK0A 5BMVA 4DV4O 1YZBA 1BT8A 4UB8Z 1GKFA 3AG4B 1QHTA 4LNUB 5CB4B 5C93A 1OCCC 3EVKA 3EHBB 1URFA 2RDCA 1A32A 4FM2A 3CS5A 3ZEDA 1SZXA 2L6LA 3HR0A 4JI4B 3H9VA 2LFSA 1WAZA 2EIJB 1ZX3A 4LF7O 3LDEA 4P30A 2RMKB 2PGGA 3CCLV 1R6NA 3SYAA 2KB1A 2E5LO 3BHPA 5FPOA 1OV9A 1JFFB 5LMNO 3Q4HA 1Y66A 4PDRA 1HNXO 4MVOA 2P4KA 4OXSA 3ZHQA 4YY3O 1AI7A 4ZKIA 1GMGA 4DRXB 1XQ8A 2R9IA 2P22C 1NH2B 1Q8IA 1P84F 2PY5A 1RFYA 4JI0B 2AHYA 2QKCA 3ZIAG 4IT5A 2IU0A 2IM9A 2P7TC 2N04A 1Q86W 2DYSB 3AK3A 1RM1C 4FVMA 5IYZB 1L0NH 1R6KA 3U0ZA 1E79G 1R73A 3X2QB 4X1YB 4D7SA 2XAJA 4G27B 4X62O 4LF5O 4UVBA 5IWAB 3ZN0A 3ML0A 4QE9A 2AW9A 2JS5A 3SPHA 2M7WA 4TSFG 4OX9B 2HVJC 1VQ4V 4RQFA 4DR1O 5IYZA 2HHHO 5IJ0B 4LC1A 1BQ0A 1LUVA 1H2KA 5L3EA 2QKSA 1GRJA 2V1DA 3CCUV 1SKVA 4Q6GA 3OE7G 2Z0AA 3DXRB 3VQXA 1D2DA 4DV7B 1AI4A 1ORQC 5KA6A 2D2CB 2GV9A 2VWKA 5IJ0A 3W7TA 1HWYA 2RQ6A 3OUFA 1YTFB 4U7OA 2MW2B 3A2FA 5LGNA 4KP4A 1N4CA 2EILB 4PD4F 3NXSA 3NR7A 1K5QA 1L8DA 4UUJC 1KMIZ 1SRYA 1VF5B 2BSKA 1H2NA 4UCOA 4DV6B 4NXNO 2A9HA 2QWQB 4I9QA 3CC2V 1VQMV 4KL1A 1W0JG 2BTQB 3ZMTA 1PP9H 4O4IB 1Q82W 5BXZA 5LOVB 4TQDA 4LF4B 5KHJA 2ZIOA 2GBOA 4IGGA 2ZD9A 3T1HO 2LP7A 3CRAA 3DC6A 3K03A 2CTWA 4RAIA 1M93A 1OCRC 4YXWG 4MVSA 3B4SA 3CXHF 1CPYA 2UXCO 4UVAA 3BRCA 3T1YO 5LYJA 4J10A 1SESA 3B77A 3E22A 4O4HB 1S76D 3L9DA 1H8EG 4EFEA 1D5AA 2IH3C 2KQXA 1XNRO 1G1XB 2ZE8A 1RM1B 1ZL8B 3CRMA 1E1RG 2FB5A 1NR1A 3ETEA 4C7UA 4YIPA 3BY6A 3A0RA 3E22B 1XDCA 2H94A 3L73H 1FPOA 3ZX6A 2W6IG 5CA1A 3IJ4A 3L72H 5LP6C 3LDCA 3RYCA 2ZXWC 1PL0A 3ABUA 3OMAB 3QTCA 5LHIA 1VARA 2OIEA 1B6QA 1YVWA 3AK2A 4DV1O 3CD6V 4ZOLA 5EC2C 5KAFZ 3BABA 4TUYB 1WLEA 3T1YB 2KKWA 5B3SB 5LMNB 2Q0AA 3OMNB 4DYLA 4YJ2B 3UT5A 4EKWA 3TK1A 5CA3A 3K9AA 2EIJC 1MSWD 4ZOLB 1NQTA 3X2QC 4FFBB 2XNDG 3WG7B 2X7RB 4J9YB 1Z5VA 1NTKH 1VEWA 3DTUB 4DV4B 3SGIA 2K9PA 3HKCB 2DN9A 4K35A 4KHPB 3SPIA 2QJ1A 2Y48A 3WB2A 1S5LZ 3J80N 4U7NA 3TJTA 2HFEC 1QLEB 2ITDC 2ITCC 1XHXA 4PHZA 4DV5B 3OGIB 5KX5B 3OAAG 2XUMA 3K04A 4X9QA 2XAFA 1KP3A 3E8GA 3M7MX 4FFKA 1I94B 2QM7A 1IX9A 1Q81W 4DR7O 5CB4A 1TA8A 5FLXN 1JJOA 4DR3O 1VMGA 4X1IB 5LP6A 1VP7A 1HW7A 5KX5A 3RYIB 1WJZA 1AR4A 3ZHSA 1GN4A 3H01A 3JAKB 1XHZA 2JGDA 3CPWU 2OCHA 4MTFA 2GUZB 3CB2A 2X6AA 4FM0A 2BTOA 1HNWB 4CH6A 1JFFA 2OCCB 1XNQO 4LBEC 4MVRA 2W6JG 3RFRA 1YCIA 1SQBH 3JATA 4H44B 1GM8A 4JPRA 3W7UA 4CS4A 2DQ0A 4JZGA 5IY5C 3D36C 4J7ZA 3ABLC 2ADQB 5HFLA 3ZRSA 3H1IH 3AG1B 3D3IA 5H2FZ 1FJGO 2BOCC 2Y69C 2DMXA 1XNQB 3T4DA 2CTPA 1FYJA 3AG7A 5J2TA 5B66Z 1H38A 3ABLB 1F7YA 2H3OA 3JSLA 1BHAA 2Q9LA 2QGNA 1FFTB 2XAQA 3WFVA 1JA8A 1XMQO 2ZE5A 2XHBA 5IT9N 3FAVB 4MS2A 2QWRB 5BMVB 4CH4A 3KCYA 1AJNA 2XAHA 3A0HZ 2ZM6O 1QLNA 1SS3A 4KUMA 5GTIZ 3O65A 4CBCA 1MABG 3CCEV 3HKEB 4XBFA 4RUFA 3ZMSA 2R9AA 1HP8A 4UVCA 4B3TO 1VQKV 4X1KA 2F1MA 3CE2A 4R7CA 3BFRA 4JI4O 1HNZO 1NS1A 1V55B 3RT3C 1XL6A 4YHHB 1XUQA 3P30A 4O4LB 1IBMO 1IXBA 2QTOA 4LCUC 4ZI7B 2WAMA 4BAYA 1JMKC 4IYIA 1PPJH 1VIBA 3OMIB 3K5LA 4X88A 4DUZB 1SQPH 2CH7A 3SPGA 4GKJO 1J5EB 4I55B 3TXQA 4O4LA 1BQZA 4EB6B 1GH6A 1M9NA 2RCVA 3FX7A 2F23A 4O2AA 1I7FA 1L1FA 1OHHG 3TGUH 1OCZC 3WB0A 2Z5UA 3TCUA 1ZLZA 4UB6Z 1VF6C 4O4IA 1NR7A 3CP1A 4BW5A 1BS3A 2R9RB 3U10A 2A79B 5DEDA 5B1AC 2EIMB 5H9CA 1QQCA 2QWNB 1QCEA 4JV5B 4JI2B 1SA0B 2ZXWB 1S0VA 4AQYB 3T4ZA 4KFMA 3LNNA 2R72A 3QO7A 5GTHZ 4DR4B 4Z2WA 5A2QN 1GTOA 3FB6C 3ABMC 2QWOB 2JDIG 2P67A 4BIZA 1XILA 4WCEV 3OEHG 1R1BA 2EBOA 4CZZA 3PJSK 3UCSC 5JQGA 4MTXA 3I5DA 3DGEA 3ZN1A 3FKSG 1K97A 5EK0A 4FIPC 2ODMA 2Y4TA 2ZINA 4B7EA 3FD9A 5L3CA 2OCCC 4TV9A 4WFBV 2VS0A 2DE0X 3THOA 5JQGB 2Q5ZA 2UUCO 3A8TA 2B9ZA 4DV6O 4NXNB 5EYPA 1PM9A 3AG2B 2AHZA 2OIGA 4QPJA 2YEVB 3K0GA 3SPCA 1R3JC 4PA9A 4YJ2A 4B3RB 4UXNA 4JI3B 3KG2A 3FFQA 2HKOA 1O9HA 4UCTA 1VQLV 5JCOA 2EIKC 3APOA 1GM9A 1Y76B 2Q0OC 3D8CA 4DR6O 3OR6C 2QTSA 1EN6A 4MVUA 4XDKA 2P90A 5BR8O 2UUBO 2UXNA 2B5UA 1AR5A 2EJ7A 2WPDG 1VF7A 1B3QA 2NR5A 3VBBA 3JCUZ 3G71V 2HHHB 2YC0A 5EBWC 1Y76A 3JALB 3CRCA 4JV5O 4JI7O 4MTOA 4X65B 2ZR2A 3N2KB 2K1EA 2Y4UA 3SJQC 4UCUA 4TOIA 1NBMG 2CTRA 4JTAB 4OPAA 3UT5B 1N0NA 3WU2Z 2WLIA 2ZQMA 2Q69A 3H1LH 4GYCB 3CWBH 5IYBO 4GX1A 3CX5F 3ABKB 4BWAA 1RPRA 3BCCH 2ARHA 3MD0A 2Q7EA 1J5EO 3H1HH 4J9ZB 3JATB 3HPLC 1BGYH 3HKCA 1K9MW 4DO2A 2OT5A 5TISZ 1VQ9V 4L87A 2W0FC 5J2UB 4YY3B 1K8AW 1YITV 3FYIB 3E86A 1VQOV 4W4LA 1R3KC 4AHCA 3B40A 3G80A 4R8CA 1N34O 4MSWC 3OM3B 3CCQV 5KHGA 1WB7A 3ZJZA 1V9PA 1IBMB 2GHYA 4FLVA 1DF5A 4X1IA 4MW8A 1VQPV 3H1KH 3K5NA 1SETA 1EZJA 3RYFA 4XDLA 1AI6A 2PYLA 1TVKA 1V54C 4HYOA 3RYIA 1AR1B 3JAKA 5CA0A 4WBNB 4N23A 1AJQA 1F4MA 2QDOA 3CXCU 2Q6AA 1K4DC 2RN9A 5IYDO 2BE3A 3DSQA 2ZE7A 2WWWA 1QNMA 4DV2B 4DV3O 1BL8A 1TVKB 1FXKC 4ABMA 4NXMO 2ILMA 3IAYA 5CA0B 2CTQA 3SJCC 2PTMA 1R6TA 3JAMN 4MVZA 2IU3A 1WP7A 3ABMB 2FKXA 5JCOC 5EZYB 4DR5B 1VQ7V 1N33B 2LQTA 1UFIA 2QKAA 4K8XA 4JF3A 3JASB 3M99B 4A5UB 4JGSA 4FZ0A 2QM4A 5JWPA 1GO3F 2Q7GA 3BPZA 1YEWA 3ZMUA 1BZKA 3OFNG 1IURA 1VQNV 4QPKA 1BMFG 2NLJC 4X65O 2IJKA 3HKEA 3N2GB 5LMUO 4GX0A 3ZRXA 2UUBB 2LW1A 4K8ZA 2WLLB 4JAAA 1KUQA 1EN4A 1MOFA 2HEPA 3LSQA 3FB7C 2HP8A 3JD0A 5EIBC 1SQGA 4X1YA 2LGQA 3ETQA 5LXTA 3CMEV 3CC4V 2JS3A 1SERA 1F23A 1SZTA 4ZI7A 2XASA 1K92A 4JI3O 2WLMA 2EX3A 1FD9A 2JRIA 3AG1C 4LF6O 3UM7A 1S3JA 1WNSA 1S5JA 1OZ0A 2WSSG 4E4EA 3CMAV 4MVQA 3ZMVA 2HJFC 1MZFA 3OR7C 2VWJA 2F66C 5B1OA 3CRRA 1OJHA 1QVFU 2PF4E 3VOUA 4NVPA 1PNLA 4I50A 1K73W 4O2AB 4DR2O 4MW3A 1ROPA 2JJ2G 2KSDA 2L35A 3JD3A 5AG2A 3ICXA 4FK5C 1TUBA 2DYRC 1GM7A 4H33A 3TETA 3W7SA 2YIBD 3IC9A 1Z2GA 1NZ6A 2PYJA 2JIZG 4DXWA 1I08A 5H5NA 1P49A 5B1NA 1YJNV 4UCSA 2E75B 1D5NA 5L3FA 4BIOA 4LR3A 3R66A 1KBHA 1XMOO 2YXHA 4LH6A 5H6RA 4PV1B 2YXYA 1XEQA 4J11A 3CHXA 1XI1A 1BE3H 4K0KB 5EIBD 3RW0A 2N74A 1BHBA 2DW4A 4NTWA 4QE7A 1AB3A 3SR2C 1AVMA 1QR9A 4H13B 1SF9A 3ETDA 2A06H 4X66B 1XNRB 4JI2O 4WFFA 5LYJB 3A0BZ 1LNQA 4PJ0Z 4PA7A 1GN6A 4U3FH 2UU9B 5F2VO 5D5QA 4JASA 2GTSA 4GX5A 4I0XB 4TV9B 1XMOB 3FB8C 4GT1A 3E8BA 1FS0G 1ZSPA 3CYOA 4F6RB 1PNMA 1G8MA 3JYCA 3BA9A 2UUAB 1BCCH 1DF4A 1MMMA 3S3XA 1N0JA 1JX9A 3N2KA 2UXCB 4X8AA 4JI8O 2Q8VA 4FZ1A 4LF9O 4I4TA 1LUWA 1Q90D 5K1PA 2E3CA 5JJNB 4I5SA 4KXRA 2G38A 1J95A 3F5WC 3FB5C 3OGCC 3E8HA 2WLNA 1WN7A 1M1KW 4TUYA 1I5YA 5LBQA 4HAMA 1HNZB 2Z3YA 3U11A 3K57A 2Q4PA 4I4TB 3M8AA 1JJ2U 5CN0A 5IDJA 4B3TB 1I5XA 4PA4A 2UXBB 1CXZB 2JK5C 2OTLV 3JD1A 5J2UA 2LW7A 3MAQA 1L0LH 2A3QA 4LF6B 3L74H 3F5TA 1YHQV 1K7DA 1AROP 3L71H 3G67A 2LGWA 1GK9A 3K79A 2O57A 1G4YB 1OCRB 1X4TA 4CC5A 2WLJA 1UPGA 2XOKG 1QBZA 1XMQB 4OX9O 4O4JA 3CCVV 4DV7O 1YJ9V 2ZIMA 4F6EA 2ZM6B 4JZ2A 4FLXA 2AGAA 1YDXA 4LFCB 4TT3G 4DR1B 4MTGA 2VQEB 4PDLA 3J81N 1MNGA 1THZA 1R3IC 1Y74B 4UFZA 1KD1W 3UKMA 2H8PC 1KU9A 1QLEC 5KAIZ 2XAGA 4PDVA 3VQVA 3T1CA 2BCCH 1U97A 1FJGB 1FXKB 1ZAUA 2QSAA 2EIKB 2FTKA 2YIAA 1Y74A 3ZRWA 3SDLA 3ZHRA 3GVMA 4ICGA 2F95B 3OTFA 1HNWO 4DV3B 4NR1A 3JCZA 1Y6XA 1EBOA 3LDDA 4NTXA 2PUSA 1S72V 4DV5O 3T2MA 2DQ3A 1U96A 2E5LB 3JARB 4DR3B 4FLTA 3OTOO 1VQ6V 5B3SC 4NB5A 1LR1A 4DR7B 2P4VA 1M57B 4XDJA 1SQQH 3OT7A 4PELA 2QA4V 3F7VC 5FL7G 4F4LA 5EBMC 1JCHA 3FAVA 3MDSA 1CEZA 4JYYA 4LF7B 2EZPA 5JJJB 2AZ0A 1N8RW 2CAZC 1N34B 1K4CC 3SJBC 3LSUA 3O9OA 2WLHA 5IJ9B 2GTAA 2HJDA 1Q7YW 1JVMA 4L8JA 1KKDA 4X20A 4LFAB 1JR9A 5FPRA 1PNKA 2YIDA 4JTCB 2WA3A 2N05A 1DTOA 4X1KB 4LF9B 3LNMB 3E83A 4CS2A 1WA8A 5EZYA 3AG3C 5IE9A 1S77D 3FYEB 3ZS8C 4DV1B 3K9SA 3OTOB 3JASA 1HR0O 5DM6V 4JI5B 4X20B 3E2EA 3E8FA 4U3JA 4YIOA 3UQ8A 1ZUQA 1Q6HA 4RO2A 1T5EA 1PKXA 2IBZH 1RSOA 2JEUA 3N2GA 4GKKO 3BEHA 2CH7B 2B1GA 4I55A 4ZHQB 4X66O 4LFBB 2Y0IA 2DWDC 5B1BB 2JGUA 4UCVA 3AEIA 2YI9A 1Q3EA 4GX2A 4JI7B 4PDMA 5LXTB 3IFXA 2D3OW 2ZT9B 4WFEA 4QJFB 2AZ2A 4Z1VA 3G6EV 4WFAV 3HKDB 4GUNA 3K59A 2VQEO 1YIJV 2RJZA 3JD4A 4LFCO 5EBLC 1MG1A 5FNVA 2F4VB 2FL4A 4LF4O 1EFRG 1W2BU 3STZC 1YSCA 1SA0A 1XREA 1AJPA 5LGUA 2NNUA 3MHSC 4I50B 3HKDA 2Q73A 1Y4MA 2BSKB 3T1HB 4E2LA 4DR2B 4X64O 4I0XA 4HNAA 1O9GA 1WPBA 4RUEA 5FNVB 3B8MA 1OCZB 1NVPD 5LOVA 3SYCA 2A7WA 2YDEA 1Q6UA 4B3MB 1N32B 3K5OA 5L3DA 2IJJA 1H8HG 4JI6O 4RQEA 2YSUB 5ITZB 2UUCB 5GW7A 2ZKOA 5JVDB 4FMTA 4WFGA 4HNAB 5LHGA 3JAWB 5IYCO 1N36O 4JYBA 2A0LA 5C8YA 1KYOF 1KKCA 5LHHA 2P06A 3ASOC 1KQSU 4O4HA 4TV8B 2C2AA 5EYPB 2IJIA 2WLKA 4BR6A 5ITZA 3N27A 4D7TA 2YEVA 3QG5A 3B2EE 3W7XA 3JAWA 1W59A 3D3QA 2F4VO 1E1QG 2EINC 4CS3A 3I56V 2EIMC 3ZMZA 1MSDA 4TV8A 4I7ZB 2HG5C 2ZNJA 1QU7A 1B04A 2UXXA 1XL4A 4JI1B 1OCOB 1IBKO 3RYCB 1JPXA 3RGBA 4PI0A 3HB3B 1OCOC 1PL4A 4F6RA 3P32A 1KECA 1BSMA 3GWOA 4X62B 4LF5B 1N33O 2UU9O 4FLWA 4O4JB 1WP8A 2P6JA 3ZCCA 3C3SA 3AG4C 1ZTEA 4B08A 1K5SA 4JI0O 3OW2U 4BW9A 5KHIA 1H2SB 4LFBO 4IHJA 2CE4A 3LSSA 1UJWB 3ASOB 1F4NA 4DV2O 2HVKC 4OGQB 1IVSA 2PZSA 3GWKC 1IZ3A 1XBLA 4GKJB 5KHHA 4NKGB 1NKDA 3QNEA 1NJIW 3C3TA 1HR0B 1NTZH 3C90A 5KA5A 1V55C 2F93B 2KG7A 3BA8A 5EC1C 3CCRV 4EFBA 3RWRD 3CCSV 2EULA 3R65A 3ASNC 3KCXA 4IL6Z 1COWG 2FYUH 1CP9A 3JSNA 4DUYO 4JYAB 1NTMH 1HNXB 3G6BA 1JOYA 2HLDG 4OPHA
chains in the Genus database with same CATH topology
3L72H 3H1LH 1L0LH 3CWBH 3L74H 1SQVH 4PD4F 3CX5F 1EZVH 1KYOF 1NU1H 3H1KH 3L71H 2A06H 1BCCH 1SQXH 3BCCH 1SQBH 1NTZH 2BCCH 2IBZH 3H1HH 3L75H 5KLVH 1PPJH 4U3FH 1BGYH 3CXHF 1KB9F 3H1JH 1NTKH 1BE3H 3TGUH 3L70H 1PP9H 2FYUH 3H1IH 3L73H 1NTMH 1L0NH 1SQPH 1P84F 4D6TH 1SQQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 H;  3H1L H;  1L0L H;  3CWB H;  3L74 H;  1SQV H;  4PD4 F;  3CX5 F;  1EZV H;  1KYO F;  1NU1 H;  3H1K H;  3L71 H;  2A06 H;  1BCC H;  1SQX H;  3BCC H;  1SQB H;  1NTZ H;  2BCC H;  2IBZ H;  3H1H H;  3L75 H;  5KLV H;  1PPJ H;  4U3F H;  1BGY H;  3CXH F;  1KB9 F;  3H1J H;  1NTK H;  1BE3 H;  3TGU H;  3L70 H;  1PP9 H;  2FYU H;  3H1I H;  3L73 H;  1NTM H;  1L0N H;  1SQP H;  1P84 F;  4D6T H;  1SQQ H; 
#chains in the Genus database with same CATH topology
 2XT9 A;  3CJH B;  1TUE B;  3I55 V;  3D36 A;  4WFH A;  1PV0 A;  3HKB B;  4PI2 A;  2MK3 A;  4NYK A;  1H2G A;  2KG7 B;  4IIJ A;  3CCM V;  1TGO A;  2V7Q G;  5JH7 B;  4CC6 A;  2BOB C;  3STL C;  4JAU A;  4X89 A;  1M56 C;  3WB1 A;  5KMG A;  1M4U A;  5DEC A;  3PN1 A;  3ZRV A;  1NT2 B;  1HDJ A;  4LH7 A;  4PA6 A;  4QIW F;  5LP6 B;  4FLY A;  1P4R A;  2DWE C;  4O2B B;  3S3W A;  4ASU G;  3HKB A;  3RVY A;  4IIJ B;  1FAF A;  3SYP A;  1YTF D;  4CH3 A;  2RNB A;  1DLB A;  2ZDI A;  3ABK C;  1GN3 A;  2GDS A;  1TAE A;  4B7K A;  5LL6 Y;  4HBN A;  4QNH B;  2ZDI C;  3RYH A;  3ZHV A;  1QR8 A;  2B1I A;  5B1B C;  3G4S V;  1K33 A;  2ADP A;  4WBN A;  4G28 B;  3WG7 C;  1FFX A;  1Y67 A;  2UXD O;  3Q4H B;  2E74 B;  4CH5 A;  1WA8 B;  2XTA A;  1YXB A;  3CC7 V;  3QVN A;  4YJ3 B;  5CBH A;  1G6U A;  4DRX A;  1DK1 A;  4D6T H;  3RYH B;  2F43 G;  5BZB A;  1Z5W A;  4P9P A;  3JAR A;  2Y0P A;  2QR4 A;  1FFX B;  1AP5 A;  3QO5 A;  4H37 A;  1FXV A;  4R6Z A;  1P7G A;  2VRZ A;  3EFF K;  4YJ3 A;  2ZCE A;  5GON B;  2UXD B;  3GB7 C;  4DV0 O;  4LWS B;  4NTY A;  5LGT A;  5L3B A;  2X6C A;  4JAV A;  1M90 W;  1IBL O;  4LNU A;  2YI8 A;  4NXM B;  4TWK A;  5KUK A;  4AI8 A;  1I94 O;  4UV8 A;  3W7W A;  3LUT B;  1PD3 A;  2GSM B;  3MHH C;  3L75 H;  4B3S O;  1DGS A;  2X0L A;  4Q20 A;  3ZHT A;  5IJ9 A;  3ZBH A;  5GON A;  4GCZ A;  1H2L A;  3P3N A;  3QF7 A;  1X59 A;  2WLL A;  2JJ1 G;  1KP2 A;  5KUM A;  1V54 B;  2CGN A;  1EZV H;  3AG2 C;  2Q68 A;  5H6Q A;  3AK1 A;  2UXB O;  3EXA A;  4W4K A;  4EB6 A;  2DOS A;  2QM8 A;  3DXR A;  4DUY B;  4JYA O;  4LF8 B;  4U3J B;  4JYC A;  3K5M A;  4ZIB A;  3AG3 B;  3CCJ V;  3CRQ A;  1K3E A;  4R50 A;  1RSO B;  3KKY A;  2E76 B;  3K06 A;  5E1A C;  4ZHQ A;  5K1X A;  4J7J A;  4FJC C;  2IW5 A;  5KLV H;  2EJR A;  1NVP B;  3ZHU A;  3ETG A;  4JI8 B;  4HZ3 A;  5CBG A;  1R3L C;  5E79 Z;  5CBF A;  5CMU A;  2QE7 G;  3E35 A;  1AIL A;  1B06 A;  1US6 A;  3K3W A;  2UUA O;  2QWP B;  4AQY O;  1TUB B;  2BTQ A;  3RVZ A;  4UCR A;  2YIB A;  2FML A;  1M56 B;  4WF9 V;  1P7B A;  3SYQ A;  1H2M A;  3VQW A;  5KHK A;  1M57 C;  2VQF B;  2PI5 A;  5A9G A;  2VQF O;  3RBZ A;  2IJH A;  2CGO A;  1VQ8 V;  1AI5 A;  2CUG A;  1GAX A;  2HR3 A;  3B8N A;  1S5H C;  1RPO A;  4JI1 O;  3SPJ A;  1SQV H;  3UO2 A;  1IXM A;  1ENV A;  1SQX H;  3SJA C;  1Q6I A;  3JD2 A;  3K0D A;  4K0K O;  4LP8 A;  1YF2 A;  3P3P A;  1ZL8 A;  3L70 H;  4P2Z A;  1IBK B;  1GN2 A;  2Q7H A;  3B09 A;  4RWU A;  3K08 A;  5L3G A;  1K34 A;  2YS8 A;  4P9O A;  2V4D A;  5DN6 G;  2EIL C;  5B5E Z;  5JJE B;  4PA3 A;  5BR8 B;  2ETN A;  2AXT Z;  5JVD A;  4J7K A;  4EEQ A;  1WPX A;  3OEE G;  2LFR A;  4IYH A;  1KB9 F;  4DR6 B;  3BAA A;  5C8Y B;  5BY1 A;  4IHJ B;  1RP3 B;  3APQ A;  1W0K G;  2DJV A;  4FM1 A;  1F51 A;  2WA4 A;  4YHH O;  1YJW V;  2PI4 A;  1ZWI C;  3CSX A;  5B1A B;  3KZI Z;  4JTD B;  2Q67 A;  5D5P A;  1N36 B;  4B3R O;  4LF8 O;  2R70 A;  1I0H A;  3SYO A;  1FKA O;  3UO3 A;  4JI6 B;  4X64 B;  1NI8 A;  1KC8 W;  4MVM A;  2CK3 G;  4G2K A;  4B3M O;  3ASN B;  1N32 O;  4B3S B;  3ABT A;  1SC5 B;  4BIU A;  4J80 A;  2ZE6 A;  1MA1 A;  2IH1 C;  3JAL A;  2YIC A;  3E89 A;  1JQ0 A;  4UV9 A;  3CJH A;  1SQF A;  4DW1 A;  2OWO A;  3CEI A;  2NN4 A;  5JH7 A;  4K3A A;  4TQF A;  1XOU A;  5J9P C;  1MZE A;  2ZR3 A;  2X6B A;  4DW0 A;  5CA1 B;  1Q43 A;  4FPP A;  2DYS C;  1IBL B;  5IWA O;  3F7Y C;  3IC7 A;  5LA6 B;  4O2B A;  4DV0 B;  1NH2 D;  2WLI B;  1QVG U;  5LMU B;  1WB8 A;  5IY5 B;  4DR4 O;  2M6Y A;  1VF6 A;  1YI2 V;  2W0X A;  2JEX A;  2LJ2 A;  5HFM A;  3OD4 A;  4GKK B;  1EM1 A;  4GZR B;  2DYR B;  5LA6 A;  1Q5O A;  2EZO A;  2ATK C;  4I9W A;  4DR5 O;  4ZBM A;  4FFB A;  2JGD B;  2OTJ V;  3VQY A;  2GUZ A;  2EIN B;  2QEX V;  2LO1 A;  4Z1M G;  1IDS A;  1VQ5 V;  2P5O A;  3TXS A;  3J7A U;  3IGA C;  1FXK A;  2YXL A;  4J41 A;  3QO8 A;  4MT8 A;  4H0L B;  1FXH A;  4DK1 A;  4GLX A;  2YUA A;  2JVD A;  4N21 A;  4J42 A;  4AIL C;  1OCC B;  1NU1 H;  1AP6 A;  1EN5 A;  3ZRW B;  4JI5 O;  4LFA O;  5KMG B;  4FLU A;  4FLZ A;  5J2T B;  3OUS A;  2CDY A;  3RYF B;  3H1J H;  3DC5 A;  3RN4 A;  1M5I A;  4QGP A;  4DUZ O;  2ZNI A;  4KHP O;  3BVO A;  3K58 A;  2OYQ A;  4LWS A;  2Y69 B;  4DK0 A;  5BMV A;  4DV4 O;  1YZB A;  1BT8 A;  4UB8 Z;  1GKF A;  3AG4 B;  1QHT A;  4LNU B;  5CB4 B;  5C93 A;  1OCC C;  3EVK A;  3EHB B;  1URF A;  2RDC A;  1A32 A;  4FM2 A;  3CS5 A;  3ZED A;  1SZX A;  2L6L A;  3HR0 A;  4JI4 B;  3H9V A;  2LFS A;  1WAZ A;  2EIJ B;  1ZX3 A;  4LF7 O;  3LDE A;  4P30 A;  2RMK B;  2PGG A;  3CCL V;  1R6N A;  3SYA A;  2KB1 A;  2E5L O;  3BHP A;  5FPO A;  1OV9 A;  1JFF B;  5LMN O;  3Q4H A;  1Y66 A;  4PDR A;  1HNX O;  4MVO A;  2P4K A;  4OXS A;  3ZHQ A;  4YY3 O;  1AI7 A;  4ZKI A;  1GMG A;  4DRX B;  1XQ8 A;  2R9I A;  2P22 C;  1NH2 B;  1Q8I A;  1P84 F;  2PY5 A;  1RFY A;  4JI0 B;  2AHY A;  2QKC A;  3ZIA G;  4IT5 A;  2IU0 A;  2IM9 A;  2P7T C;  2N04 A;  1Q86 W;  2DYS B;  3AK3 A;  1RM1 C;  4FVM A;  5IYZ B;  1L0N H;  1R6K A;  3U0Z A;  1E79 G;  1R73 A;  3X2Q B;  4X1Y B;  4D7S A;  2XAJ A;  4G27 B;  4X62 O;  4LF5 O;  4UVB A;  5IWA B;  3ZN0 A;  3ML0 A;  4QE9 A;  2AW9 A;  2JS5 A;  3SPH A;  2M7W A;  4TSF G;  4OX9 B;  2HVJ C;  1VQ4 V;  4RQF A;  4DR1 O;  5IYZ A;  2HHH O;  5IJ0 B;  4LC1 A;  1BQ0 A;  1LUV A;  1H2K A;  5L3E A;  2QKS A;  1GRJ A;  2V1D A;  3CCU V;  1SKV A;  4Q6G A;  3OE7 G;  2Z0A A;  3DXR B;  3VQX A;  1D2D A;  4DV7 B;  1AI4 A;  1ORQ C;  5KA6 A;  2D2C B;  2GV9 A;  2VWK A;  5IJ0 A;  3W7T A;  1HWY A;  2RQ6 A;  3OUF A;  1YTF B;  4U7O A;  2MW2 B;  3A2F A;  5LGN A;  4KP4 A;  1N4C A;  2EIL B;  4PD4 F;  3NXS A;  3NR7 A;  1K5Q A;  1L8D A;  4UUJ C;  1KMI Z;  1SRY A;  1VF5 B;  2BSK A;  1H2N A;  4UCO A;  4DV6 B;  4NXN O;  2A9H A;  2QWQ B;  4I9Q A;  3CC2 V;  1VQM V;  4KL1 A;  1W0J G;  2BTQ B;  3ZMT A;  1PP9 H;  4O4I B;  1Q82 W;  5BXZ A;  5LOV B;  4TQD A;  4LF4 B;  5KHJ A;  2ZIO A;  2GBO A;  4IGG A;  2ZD9 A;  3T1H O;  2LP7 A;  3CRA A;  3DC6 A;  3K03 A;  2CTW A;  4RAI A;  1M93 A;  1OCR C;  4YXW G;  4MVS A;  3B4S A;  3CXH F;  1CPY A;  2UXC O;  4UVA A;  3BRC A;  3T1Y O;  5LYJ A;  4J10 A;  1SES A;  3B77 A;  3E22 A;  4O4H B;  1S76 D;  3L9D A;  1H8E G;  4EFE A;  1D5A A;  2IH3 C;  2KQX A;  1XNR O;  1G1X B;  2ZE8 A;  1RM1 B;  1ZL8 B;  3CRM A;  1E1R G;  2FB5 A;  1NR1 A;  3ETE A;  4C7U A;  4YIP A;  3BY6 A;  3A0R A;  3E22 B;  1XDC A;  2H94 A;  3L73 H;  1FPO A;  3ZX6 A;  2W6I G;  5CA1 A;  3IJ4 A;  3L72 H;  5LP6 C;  3LDC A;  3RYC A;  2ZXW C;  1PL0 A;  3ABU A;  3OMA B;  3QTC A;  5LHI A;  1VAR A;  2OIE A;  1B6Q A;  1YVW A;  3AK2 A;  4DV1 O;  3CD6 V;  4ZOL A;  5EC2 C;  5KAF Z;  3BAB A;  4TUY B;  1WLE A;  3T1Y B;  2KKW A;  5B3S B;  5LMN B;  2Q0A A;  3OMN B;  4DYL A;  4YJ2 B;  3UT5 A;  4EKW A;  3TK1 A;  5CA3 A;  3K9A A;  2EIJ C;  1MSW D;  4ZOL B;  1NQT A;  3X2Q C;  4FFB B;  2XND G;  3WG7 B;  2X7R B;  4J9Y B;  1Z5V A;  1NTK H;  1VEW A;  3DTU B;  4DV4 B;  3SGI A;  2K9P A;  3HKC B;  2DN9 A;  4K35 A;  4KHP B;  3SPI A;  2QJ1 A;  2Y48 A;  3WB2 A;  1S5L Z;  3J80 N;  4U7N A;  3TJT A;  2HFE C;  1QLE B;  2ITD C;  2ITC C;  1XHX A;  4PHZ A;  4DV5 B;  3OGI B;  5KX5 B;  3OAA G;  2XUM A;  3K04 A;  4X9Q A;  2XAF A;  1KP3 A;  3E8G A;  3M7M X;  4FFK A;  1I94 B;  2QM7 A;  1IX9 A;  1Q81 W;  4DR7 O;  5CB4 A;  1TA8 A;  5FLX N;  1JJO A;  4DR3 O;  1VMG A;  4X1I B;  5LP6 A;  1VP7 A;  1HW7 A;  5KX5 A;  3RYI B;  1WJZ A;  1AR4 A;  3ZHS A;  1GN4 A;  3H01 A;  3JAK B;  1XHZ A;  2JGD A;  3CPW U;  2OCH A;  4MTF A;  2GUZ B;  3CB2 A;  2X6A A;  4FM0 A;  2BTO A;  1HNW B;  4CH6 A;  1JFF A;  2OCC B;  1XNQ O;  4LBE C;  4MVR A;  2W6J G;  3RFR A;  1YCI A;  1SQB H;  3JAT A;  4H44 B;  1GM8 A;  4JPR A;  3W7U A;  4CS4 A;  2DQ0 A;  4JZG A;  5IY5 C;  3D36 C;  4J7Z A;  3ABL C;  2ADQ B;  5HFL A;  3ZRS A;  3H1I H;  3AG1 B;  3D3I A;  5H2F Z;  1FJG O;  2BOC C;  2Y69 C;  2DMX A;  1XNQ B;  3T4D A;  2CTP A;  1FYJ A;  3AG7 A;  5J2T A;  5B66 Z;  1H38 A;  3ABL B;  1F7Y A;  2H3O A;  3JSL A;  1BHA A;  2Q9L A;  2QGN A;  1FFT B;  2XAQ A;  3WFV A;  1JA8 A;  1XMQ O;  2ZE5 A;  2XHB A;  5IT9 N;  3FAV B;  4MS2 A;  2QWR B;  5BMV B;  4CH4 A;  3KCY A;  1AJN A;  2XAH A;  3A0H Z;  2ZM6 O;  1QLN A;  1SS3 A;  4KUM A;  5GTI Z;  3O65 A;  4CBC A;  1MAB G;  3CCE V;  3HKE B;  4XBF A;  4RUF A;  3ZMS A;  2R9A A;  1HP8 A;  4UVC A;  4B3T O;  1VQK V;  4X1K A;  2F1M A;  3CE2 A;  4R7C A;  3BFR A;  4JI4 O;  1HNZ O;  1NS1 A;  1V55 B;  3RT3 C;  1XL6 A;  4YHH B;  1XUQ A;  3P30 A;  4O4L B;  1IBM O;  1IXB A;  2QTO A;  4LCU C;  4ZI7 B;  2WAM A;  4BAY A;  1JMK C;  4IYI A;  1PPJ H;  1VIB A;  3OMI B;  3K5L A;  4X88 A;  4DUZ B;  1SQP H;  2CH7 A;  3SPG A;  4GKJ O;  1J5E B;  4I55 B;  3TXQ A;  4O4L A;  1BQZ A;  4EB6 B;  1GH6 A;  1M9N A;  2RCV A;  3FX7 A;  2F23 A;  4O2A A;  1I7F A;  1L1F A;  1OHH G;  3TGU H;  1OCZ C;  3WB0 A;  2Z5U A;  3TCU A;  1ZLZ A;  4UB6 Z;  1VF6 C;  4O4I A;  1NR7 A;  3CP1 A;  4BW5 A;  1BS3 A;  2R9R B;  3U10 A;  2A79 B;  5DED A;  5B1A C;  2EIM B;  5H9C A;  1QQC A;  2QWN B;  1QCE A;  4JV5 B;  4JI2 B;  1SA0 B;  2ZXW B;  1S0V A;  4AQY B;  3T4Z A;  4KFM A;  3LNN A;  2R72 A;  3QO7 A;  5GTH Z;  4DR4 B;  4Z2W A;  5A2Q N;  1GTO A;  3FB6 C;  3ABM C;  2QWO B;  2JDI G;  2P67 A;  4BIZ A;  1XIL A;  4WCE V;  3OEH G;  1R1B A;  2EBO A;  4CZZ A;  3PJS K;  3UCS C;  5JQG A;  4MTX A;  3I5D A;  3DGE A;  3ZN1 A;  3FKS G;  1K97 A;  5EK0 A;  4FIP C;  2ODM A;  2Y4T A;  2ZIN A;  4B7E A;  3FD9 A;  5L3C A;  2OCC C;  4TV9 A;  4WFB V;  2VS0 A;  2DE0 X;  3THO A;  5JQG B;  2Q5Z A;  2UUC O;  3A8T A;  2B9Z A;  4DV6 O;  4NXN B;  5EYP A;  1PM9 A;  3AG2 B;  2AHZ A;  2OIG A;  4QPJ A;  2YEV B;  3K0G A;  3SPC A;  1R3J C;  4PA9 A;  4YJ2 A;  4B3R B;  4UXN A;  4JI3 B;  3KG2 A;  3FFQ A;  2HKO A;  1O9H A;  4UCT A;  1VQL V;  5JCO A;  2EIK C;  3APO A;  1GM9 A;  1Y76 B;  2Q0O C;  3D8C A;  4DR6 O;  3OR6 C;  2QTS A;  1EN6 A;  4MVU A;  4XDK A;  2P90 A;  5BR8 O;  2UUB O;  2UXN A;  2B5U A;  1AR5 A;  2EJ7 A;  2WPD G;  1VF7 A;  1B3Q A;  2NR5 A;  3VBB A;  3JCU Z;  3G71 V;  2HHH B;  2YC0 A;  5EBW C;  1Y76 A;  3JAL B;  3CRC A;  4JV5 O;  4JI7 O;  4MTO A;  4X65 B;  2ZR2 A;  3N2K B;  2K1E A;  2Y4U A;  3SJQ C;  4UCU A;  4TOI A;  1NBM G;  2CTR A;  4JTA B;  4OPA A;  3UT5 B;  1N0N A;  3WU2 Z;  2WLI A;  2ZQM A;  2Q69 A;  3H1L H;  4GYC B;  3CWB H;  5IYB O;  4GX1 A;  3CX5 F;  3ABK B;  4BWA A;  1RPR A;  3BCC H;  2ARH A;  3MD0 A;  2Q7E A;  1J5E O;  3H1H H;  4J9Z B;  3JAT B;  3HPL C;  1BGY H;  3HKC A;  1K9M W;  4DO2 A;  2OT5 A;  5TIS Z;  1VQ9 V;  4L87 A;  2W0F C;  5J2U B;  4YY3 B;  1K8A W;  1YIT V;  3FYI B;  3E86 A;  1VQO V;  4W4L A;  1R3K C;  4AHC A;  3B40 A;  3G80 A;  4R8C A;  1N34 O;  4MSW C;  3OM3 B;  3CCQ V;  5KHG A;  1WB7 A;  3ZJZ A;  1V9P A;  1IBM B;  2GHY A;  4FLV A;  1DF5 A;  4X1I A;  4MW8 A;  1VQP V;  3H1K H;  3K5N A;  1SET A;  1EZJ A;  3RYF A;  4XDL A;  1AI6 A;  2PYL A;  1TVK A;  1V54 C;  4HYO A;  3RYI A;  1AR1 B;  3JAK A;  5CA0 A;  4WBN B;  4N23 A;  1AJQ A;  1F4M A;  2QDO A;  3CXC U;  2Q6A A;  1K4D C;  2RN9 A;  5IYD O;  2BE3 A;  3DSQ A;  2ZE7 A;  2WWW A;  1QNM A;  4DV2 B;  4DV3 O;  1BL8 A;  1TVK B;  1FXK C;  4ABM A;  4NXM O;  2ILM A;  3IAY A;  5CA0 B;  2CTQ A;  3SJC C;  2PTM A;  1R6T A;  3JAM N;  4MVZ A;  2IU3 A;  1WP7 A;  3ABM B;  2FKX A;  5JCO C;  5EZY B;  4DR5 B;  1VQ7 V;  1N33 B;  2LQT A;  1UFI A;  2QKA A;  4K8X A;  4JF3 A;  3JAS B;  3M99 B;  4A5U B;  4JGS A;  4FZ0 A;  2QM4 A;  5JWP A;  1GO3 F;  2Q7G A;  3BPZ A;  1YEW A;  3ZMU A;  1BZK A;  3OFN G;  1IUR A;  1VQN V;  4QPK A;  1BMF G;  2NLJ C;  4X65 O;  2IJK A;  3HKE A;  3N2G B;  5LMU O;  4GX0 A;  3ZRX A;  2UUB B;  2LW1 A;  4K8Z A;  2WLL B;  4JAA A;  1KUQ A;  1EN4 A;  1MOF A;  2HEP A;  3LSQ A;  3FB7 C;  2HP8 A;  3JD0 A;  5EIB C;  1SQG A;  4X1Y A;  2LGQ A;  3ETQ A;  5LXT A;  3CME V;  3CC4 V;  2JS3 A;  1SER A;  1F23 A;  1SZT A;  4ZI7 A;  2XAS A;  1K92 A;  4JI3 O;  2WLM A;  2EX3 A;  1FD9 A;  2JRI A;  3AG1 C;  4LF6 O;  3UM7 A;  1S3J A;  1WNS A;  1S5J A;  1OZ0 A;  2WSS G;  4E4E A;  3CMA V;  4MVQ A;  3ZMV A;  2HJF C;  1MZF A;  3OR7 C;  2VWJ A;  2F66 C;  5B1O A;  3CRR A;  1OJH A;  1QVF U;  2PF4 E;  3VOU A;  4NVP A;  1PNL A;  4I50 A;  1K73 W;  4O2A B;  4DR2 O;  4MW3 A;  1ROP A;  2JJ2 G;  2KSD A;  2L35 A;  3JD3 A;  5AG2 A;  3ICX A;  4FK5 C;  1TUB A;  2DYR C;  1GM7 A;  4H33 A;  3TET A;  3W7S A;  2YIB D;  3IC9 A;  1Z2G A;  1NZ6 A;  2PYJ A;  2JIZ G;  4DXW A;  1I08 A;  5H5N A;  1P49 A;  5B1N A;  1YJN V;  4UCS A;  2E75 B;  1D5N A;  5L3F A;  4BIO A;  4LR3 A;  3R66 A;  1KBH A;  1XMO O;  2YXH A;  4LH6 A;  5H6R A;  4PV1 B;  2YXY A;  1XEQ A;  4J11 A;  3CHX A;  1XI1 A;  1BE3 H;  4K0K B;  5EIB D;  3RW0 A;  2N74 A;  1BHB A;  2DW4 A;  4NTW A;  4QE7 A;  1AB3 A;  3SR2 C;  1AVM A;  1QR9 A;  4H13 B;  1SF9 A;  3ETD A;  2A06 H;  4X66 B;  1XNR B;  4JI2 O;  4WFF A;  5LYJ B;  3A0B Z;  1LNQ A;  4PJ0 Z;  4PA7 A;  1GN6 A;  4U3F H;  2UU9 B;  5F2V O;  5D5Q A;  4JAS A;  2GTS A;  4GX5 A;  4I0X B;  4TV9 B;  1XMO B;  3FB8 C;  4GT1 A;  3E8B A;  1FS0 G;  1ZSP A;  3CYO A;  4F6R B;  1PNM A;  1G8M A;  3JYC A;  3BA9 A;  2UUA B;  1BCC H;  1DF4 A;  1MMM A;  3S3X A;  1N0J A;  1JX9 A;  3N2K A;  2UXC B;  4X8A A;  4JI8 O;  2Q8V A;  4FZ1 A;  4LF9 O;  4I4T A;  1LUW A;  1Q90 D;  5K1P A;  2E3C A;  5JJN B;  4I5S A;  4KXR A;  2G38 A;  1J95 A;  3F5W C;  3FB5 C;  3OGC C;  3E8H A;  2WLN A;  1WN7 A;  1M1K W;  4TUY A;  1I5Y A;  5LBQ A;  4HAM A;  1HNZ B;  2Z3Y A;  3U11 A;  3K57 A;  2Q4P A;  4I4T B;  3M8A A;  1JJ2 U;  5CN0 A;  5IDJ A;  4B3T B;  1I5X A;  4PA4 A;  2UXB B;  1CXZ B;  2JK5 C;  2OTL V;  3JD1 A;  5J2U A;  2LW7 A;  3MAQ A;  1L0L H;  2A3Q A;  4LF6 B;  3L74 H;  3F5T A;  1YHQ V;  1K7D A;  1ARO P;  3L71 H;  3G67 A;  2LGW A;  1GK9 A;  3K79 A;  2O57 A;  1G4Y B;  1OCR B;  1X4T A;  4CC5 A;  2WLJ A;  1UPG A;  2XOK G;  1QBZ A;  1XMQ B;  4OX9 O;  4O4J A;  3CCV V;  4DV7 O;  1YJ9 V;  2ZIM A;  4F6E A;  2ZM6 B;  4JZ2 A;  4FLX A;  2AGA A;  1YDX A;  4LFC B;  4TT3 G;  4DR1 B;  4MTG A;  2VQE B;  4PDL A;  3J81 N;  1MNG A;  1THZ A;  1R3I C;  1Y74 B;  4UFZ A;  1KD1 W;  3UKM A;  2H8P C;  1KU9 A;  1QLE C;  5KAI Z;  2XAG A;  4PDV A;  3VQV A;  3T1C A;  2BCC H;  1U97 A;  1FJG B;  1FXK B;  1ZAU A;  2QSA A;  2EIK B;  2FTK A;  2YIA A;  1Y74 A;  3ZRW A;  3SDL A;  3ZHR A;  3GVM A;  4ICG A;  2F95 B;  3OTF A;  1HNW O;  4DV3 B;  4NR1 A;  3JCZ A;  1Y6X A;  1EBO A;  3LDD A;  4NTX A;  2PUS A;  1S72 V;  4DV5 O;  3T2M A;  2DQ3 A;  1U96 A;  2E5L B;  3JAR B;  4DR3 B;  4FLT A;  3OTO O;  1VQ6 V;  5B3S C;  4NB5 A;  1LR1 A;  4DR7 B;  2P4V A;  1M57 B;  4XDJ A;  1SQQ H;  3OT7 A;  4PEL A;  2QA4 V;  3F7V C;  5FL7 G;  4F4L A;  5EBM C;  1JCH A;  3FAV A;  3MDS A;  1CEZ A;  4JYY A;  4LF7 B;  2EZP A;  5JJJ B;  2AZ0 A;  1N8R W;  2CAZ C;  1N34 B;  1K4C C;  3SJB C;  3LSU A;  3O9O A;  2WLH A;  5IJ9 B;  2GTA A;  2HJD A;  1Q7Y W;  1JVM A;  4L8J A;  1KKD A;  4X20 A;  4LFA B;  1JR9 A;  5FPR A;  1PNK A;  2YID A;  4JTC B;  2WA3 A;  2N05 A;  1DTO A;  4X1K B;  4LF9 B;  3LNM B;  3E83 A;  4CS2 A;  1WA8 A;  5EZY A;  3AG3 C;  5IE9 A;  1S77 D;  3FYE B;  3ZS8 C;  4DV1 B;  3K9S A;  3OTO B;  3JAS A;  1HR0 O;  5DM6 V;  4JI5 B;  4X20 B;  3E2E A;  3E8F A;  4U3J A;  4YIO A;  3UQ8 A;  1ZUQ A;  1Q6H A;  4RO2 A;  1T5E A;  1PKX A;  2IBZ H;  1RSO A;  2JEU A;  3N2G A;  4GKK O;  3BEH A;  2CH7 B;  2B1G A;  4I55 A;  4ZHQ B;  4X66 O;  4LFB B;  2Y0I A;  2DWD C;  5B1B B;  2JGU A;  4UCV A;  3AEI A;  2YI9 A;  1Q3E A;  4GX2 A;  4JI7 B;  4PDM A;  5LXT B;  3IFX A;  2D3O W;  2ZT9 B;  4WFE A;  4QJF B;  2AZ2 A;  4Z1V A;  3G6E V;  4WFA V;  3HKD B;  4GUN A;  3K59 A;  2VQE O;  1YIJ V;  2RJZ A;  3JD4 A;  4LFC O;  5EBL C;  1MG1 A;  5FNV A;  2F4V B;  2FL4 A;  4LF4 O;  1EFR G;  1W2B U;  3STZ C;  1YSC A;  1SA0 A;  1XRE A;  1AJP A;  5LGU A;  2NNU A;  3MHS C;  4I50 B;  3HKD A;  2Q73 A;  1Y4M A;  2BSK B;  3T1H B;  4E2L A;  4DR2 B;  4X64 O;  4I0X A;  4HNA A;  1O9G A;  1WPB A;  4RUE A;  5FNV B;  3B8M A;  1OCZ B;  1NVP D;  5LOV A;  3SYC A;  2A7W A;  2YDE A;  1Q6U A;  4B3M B;  1N32 B;  3K5O A;  5L3D A;  2IJJ A;  1H8H G;  4JI6 O;  4RQE A;  2YSU B;  5ITZ B;  2UUC B;  5GW7 A;  2ZKO A;  5JVD B;  4FMT A;  4WFG A;  4HNA B;  5LHG A;  3JAW B;  5IYC O;  1N36 O;  4JYB A;  2A0L A;  5C8Y A;  1KYO F;  1KKC A;  5LHH A;  2P06 A;  3ASO C;  1KQS U;  4O4H A;  4TV8 B;  2C2A A;  5EYP B;  2IJI A;  2WLK A;  4BR6 A;  5ITZ A;  3N27 A;  4D7T A;  2YEV A;  3QG5 A;  3B2E E;  3W7X A;  3JAW A;  1W59 A;  3D3Q A;  2F4V O;  1E1Q G;  2EIN C;  4CS3 A;  3I56 V;  2EIM C;  3ZMZ A;  1MSD A;  4TV8 A;  4I7Z B;  2HG5 C;  2ZNJ A;  1QU7 A;  1B04 A;  2UXX A;  1XL4 A;  4JI1 B;  1OCO B;  1IBK O;  3RYC B;  1JPX A;  3RGB A;  4PI0 A;  3HB3 B;  1OCO C;  1PL4 A;  4F6R A;  3P32 A;  1KEC A;  1BSM A;  3GWO A;  4X62 B;  4LF5 B;  1N33 O;  2UU9 O;  4FLW A;  4O4J B;  1WP8 A;  2P6J A;  3ZCC A;  3C3S A;  3AG4 C;  1ZTE A;  4B08 A;  1K5S A;  4JI0 O;  3OW2 U;  4BW9 A;  5KHI A;  1H2S B;  4LFB O;  4IHJ A;  2CE4 A;  3LSS A;  1UJW B;  3ASO B;  1F4N A;  4DV2 O;  2HVK C;  4OGQ B;  1IVS A;  2PZS A;  3GWK C;  1IZ3 A;  1XBL A;  4GKJ B;  5KHH A;  4NKG B;  1NKD A;  3QNE A;  1NJI W;  3C3T A;  1HR0 B;  1NTZ H;  3C90 A;  5KA5 A;  1V55 C;  2F93 B;  2KG7 A;  3BA8 A;  5EC1 C;  3CCR V;  4EFB A;  3RWR D;  3CCS V;  2EUL A;  3R65 A;  3ASN C;  3KCX A;  4IL6 Z;  1COW G;  2FYU H;  1CP9 A;  3JSN A;  4DUY O;  4JYA B;  1NTM H;  1HNX B;  3G6B A;  1JOY A;  2HLD G;  4OPH A; 
#chains in the Genus database with same CATH homology
 3L72 H;  3H1L H;  1L0L H;  3CWB H;  3L74 H;  1SQV H;  4PD4 F;  3CX5 F;  1EZV H;  1KYO F;  1NU1 H;  3H1K H;  3L71 H;  2A06 H;  1BCC H;  1SQX H;  3BCC H;  1SQB H;  1NTZ H;  2BCC H;  2IBZ H;  3H1H H;  3L75 H;  5KLV H;  1PPJ H;  4U3F H;  1BGY H;  3CXH F;  1KB9 F;  3H1J H;  1NTK H;  1BE3 H;  3TGU H;  3L70 H;  1PP9 H;  2FYU H;  3H1I H;  3L73 H;  1NTM H;  1L0N H;  1SQP H;  1P84 F;  4D6T H;  1SQQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...