1KYOF

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
DTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kyoF00
3L74H 3L70H 1SQBH 2IBZH 3TGUH 4U3FH 2FYUH 1BE3H 1PPJH 3H1HH 3L75H 3H1IH 1EZVH 3H1KH 1KB9F 1NTMH 1SQVH 3L72H 1L0NH 1BGYH 3L73H 1SQPH 2A06H 1KYOF 1NTZH 3CXHF 1SQQH 1L0LH 1NU1H 3H1JH 3CWBH 1P84F 3CX5F 2BCCH 4D6TH 1NTKH 4PD4F 1SQXH 5KLVH 3H1LH 3L71H 3BCCH 1BCCH 1PP9H
chains in the Genus database with same CATH superfamily
1K9MW 2LQTA 4DV6B 2QJ1A 2F4VB 1E1QG 4I0XA 4X62O 3ZBHA 3BA9A 2Q0AA 3QG5A 1WB7A 2YICA 4DV2B 1X4TA 4D6TH 3GWOA 1NKDA 5J2UA 1YXBA 2HG5C 1Q3EA 2F43G 3K9SA 1R73A 3C90A 1TUBB 3G67A 2LP7A 4NTXA 1N4CA 3FB7C 1M93A 4MT8A 2HFEC 1I7FA 1RM1B 4LFBB 4DV4O 1F4NA 2AW9A 5K1XA 3BPZA 3M8AA 4UV8A 1Y6XA 5ITZA 3BRCA 2L35A 4EKWA 3JD0A 2P22C 1QQCA 1XILA 3K58A 1QHTA 4DR7B 1ZSPA 4JYAB 1S76D 2JJ1G 4Q6GA 2CE4A 3H01A 4JV5O 1WLEA 1FYJA 1OCCC 1NI8A 3J80N 3ZHTA 1ZL8B 4CS3A 1OZ0A 1SQPH 4QGPA 3CXCU 4FVMA 2D3OW 3CRMA 3E22A 1I5XA 2OYQA 2OTLV 1V9PA 5JH7A 3E8BA 5BR8O 1XMOO 3E8GA 1HP8A 4JASA 5B1BC 2UUCB 3CCVV 2JS5A 1YCIA 2JS3A 4UVCA 4DK1A 3P3NA 4MSWC 1JOYA 4LP8A 4AI8A 3JARB 4PJ0Z 4LR3A 5KMGB 3OAAG 1LUWA 1B3QA 4YIPA 5IJ0A 1VQNV 4LF5B 4B3RB 2XUMA 2ZE6A 1H2LA 3UT5A 4W4LA 2Y69B 4LFAO 4DW1A 4FM0A 1IXBA 2AXTZ 3ZCCA 3STLC 4LC1A 2H3OA 1THZA 4HYOA 1M4UA 4KP4A 2QWOB 1P49A 1VQ6V 1K4DC 3CX5F 5IWAB 1G6UA 4LNUA 1RSOA 3SPCA 3KKYA 4DR3B 3RGBA 4JI1B 1YTFB 1OCOB 5GONB 2YXYA 3TK1A 2WLIB 1AI7A 5B1NA 4DR2O 1HNZO 5CA0B 1DGSA 1XREA 3ETDA 1N0JA 3DSQA 3F7VC 1IBKB 2P90A 4K35A 4UB8Z 5KHIA 3G71V 4FM2A 5LMUB 3A0BZ 4HNAA 1PD3A 5L3GA 1M9NA 5KX5B 2EILB 4DRXB 3NR7A 4KUMA 4O4IB 3HR0A 5J9PC 2YI9A 4LF6O 3N2GB 2WLKA 3JCZA 3A0HZ 3J7AU 4GKJB 3AEIA 4JI8B 2WA4A 3OW2U 3N2KA 3WB1A 3IC9A 4J9YB 3JAMN 2KB1A 1MSWD 1N32O 1M56C 2GSMB 3OUFA 4PI0A 2OT5A 2IH1C 2EINB 4JAAA 1K4CC 1BMFG 2P4VA 3HB3B 5KA6A 2N04A 3CC4V 1Y74A 3HKEA 3BY6A 4MVRA 4O2AA 2EIKB 3SJCC 3U0ZA 4DV3B 4QPKA 1MMMA 2R9IA 4FLUA 4GCZA 4DXWA 2O57A 2OIGA 4TOIA 4EFEA 3K9AA 1VQ4V 4X9QA 3GB7C 2QWPB 3JAKA 5LA6A 4H37A 2YIAA 2CH7B 1P4RA 4YJ3A 4J7KA 1DF4A 1PV0A 2YIBA 4KHPB 2R70A 5B1AB 5LYJA 4LFCB 4WBNA 2EULA 5KHKA 3TCUA 3SJQC 4B08A 4TUYB 1HR0B 2HEPA 2BTOA 1GKFA 4X65B 3JALB 3UM7A 2EBOA 1WAZA 1K5QA 2Q6AA 3SYPA 5KLVH 4NTYA 1FXKA 3T4DA 3FD9A 3TETA 3NXSA 1K5SA 1SA0B 3Q4HB 1EFRG 4YJ2A 1GAXA 2EIMC 3IJ4A 2LW7A 3ZN1A 1ZLZA 1JFFB 5JVDB 2HKOA 1H2KA 5LP6B 2WA3A 1XOUA 5BZBA 1BQZA 3W7SA 2XAQA 3SPHA 1RM1C 3JAWA 4I9WA 3W7UA 2Q8VA 2C2AA 2JVDA 4ZKIA 3CXHF 5CMUA 4A5UB 5IYZB 1MA1A 1JCHA 1VF6C 4JGSA 2ZKOA 1SQFA 2UUBO 4HZ3A 2ZDIC 2WWWA 4L8JA 4O4HA 2Z3YA 1GH6A 2ZNJA 3CJHB 5CB4A 3CSXA 3IAYA 3LSSA 2Q67A 3SPGA 4X62B 1S72V 1WA8A 4PA4A 2CAZC 4PA9A 2GTSA 1BHBA 4DUZO 2DYRB 2Q68A 4E2LA 1YEWA 4TQFA 2OCCB 1SRYA 2EZPA 1WP8A 1XMQO 5LMNO 3ASNB 4DR4B 4FZ1A 5LHGA 5J2UB 4K0KO 5EBLC 3ZHRA 1RP3B 4DV7O 2FYUH 1Q5OA 1HW7A 2RNBA 1QVGU 5H6RA 1UFIA 3DC5A 4X8AA 3ZRVA 2A0LA 4MVOA 3THOA 5ITZB 1HNWO 3ZMUA 4FM1A 1Q6IA 2XT9A 4B3MO 4JV5B 1K33A 2P4KA 4Z1VA 4UFZA 1AP5A 2N74A 1N34O 1S5JA 4NVPA 4IL6Z 4JZGA 5FLXN 1QVFU 5C8YA 3HKBA 4FPPA 5EIBD 2ADPA 2Y0IA 1Y67A 4LWSA 1EZJA 2UUAO 2ADQB 3E22B 5IY5B 3OUSA 4IIJB 5B66Z 2HVJC 2JGDA 3E35A 4WFGA 5JH7B 2W0XA 1BE3H 1IZ3A 1VQ7V 4LF9O 1V54B 3WG7C 1NQTA 3LDCA 3CS5A 1P7BA 2X6AA 1LUVA 4FLVA 4FFBA 2EILC 4W4KA 4X89A 3G80A 3AK2A 4I4TA 1M1KW 1W0KG 1ORQC 3CCUV 5IJ0B 1W59A 4FLYA 2ZD9A 3MHSC 3RT3C 3C3SA 5H6QA 2ZE8A 2R72A 4NKGB 2ZQMA 1AJPA 4LNUB 1RSOB 5H5NA 4RWUA 4DR2B 1HNZB 4DR5O 1B6QA 2WLNA 5IYBO 3VQYA 1K73W 1AI5A 2DJVA 3BEHA 1YTFD 2FTKA 1GM8A 1K34A 4I50A 3SYAA 1VQMV 4NXMO 4FLWA 4J10A 4HNAB 1GO3F 4JI0O 1JA8A 2RDCA 3ICXA 1IXMA 4JI7O 2HR3A 4WFHA 4DV0O 3L71H 2XHBA 4JI5O 4RQEA 3DTUB 4CS4A 4LF6B 4PDVA 1GM9A 3A8TA 2ZNIA 4F6RA 2WLMA 3CCLV 3VBBA 4U3JA 3M7MX 1R1BA 1DF5A 1JPXA 4K8XA 1N32B 1KQSU 3E86A 1DLBA 3N2KB 5LHIA 1NS1A 3AG2B 2B9ZA 3IGAC 4JI2B 5E1AC 1Q86W 1SESA 2BTQA 2RN9A 3A2FA 1QU7A 2P06A 5GTHZ 1XNRO 2AHYA 4J9ZB 3SGIA 3HKEB 2R9AA 5KA5A 4O2AB 3WB0A 2PGGA 4MW8A 5LHHA 4DV5O 3ASOC 1KKDA 3SJAC 2YSUB 1JX9A 4PI2A 3JAKB 1SS3A 3L70H 5LA6B 4YHHO 4YJ3B 4I9QA 2YEVB 2E74B 3E8HA 4WBNB 5LYJB 4JI4O 1EN4A 5HFMA 4JYYA 3KG2A 4HBNA 5FPOA 2IJIA 4DW0A 2QDOA 5CBHA 1QCEA 4X64O 1NVPB 4C7UA 1FXKB 4CH4A 2E3CA 3BCCH 2GV9A 2Y48A 2JDIG 3JASA 4RO2A 2Q7GA 3B4SA 1NTMH 2OCCC 3BABA 5KAFZ 5KUKA 3ASNC 4JYBA 1RPRA 4ZI7A 1W0JG 5CBGA 4KXRA 4AHCA 5E79Z 3QO5A 1K97A 4R7CA 3QTCA 4RAIA 1PM9A 4GX2A 2QM8A 3CYOA 2X6CA 3JAWB 1PKXA 1J95A 2UUBB 2QM4A 1BZKA 2Y0PA 2IJJA 2L6LA 3OFNG 1Q6HA 2EIJC 4K8ZA 4O4HB 5CB4B 1L1FA 3I56V 3CP1A 5LGUA 3JCUZ 1BSMA 4DUZB 3D36A 1WA8B 4FIPC 1YITV 4MTGA 4NTWA 1M5IA 2VRZA 5EK0A 2ETNA 4EFBA 5LMNB 1XMQB 3LSQA 1VQKV 2BOCC 3CRRA 3AG4B 1IBMO 4P30A 4K0KB 4DV7B 3APOA 5J2TA 3FFQA 2HP8A 2Q0OC 2CDYA 1V54C 2DWEC 1FPOA 5FNVA 2JGUA 4P9PA 2W6IG 4LF8O 2XNDG 2QWRB 3JD3A 4N23A 3JATA 2DYSC 2A79B 3ABLB 1HNWB 3B8NA 1L0LH 3ZS8C 4P2ZA 2Q7HA 1KKCA 3K5MA 4NR1A 4B3MB 2A3QA 1BQ0A 2ARHA 2F23A 3MD0A 1N34B 2CK3G 4P9OA 2VQEO 3S3WA 2OTJV 4B3SO 2HJFC 3K06A 4MVZA 5C8YB 3HKBB 3RYIA 4NXNB 1FS0G 1TAEA 4AILC 5KHHA 5DN6G 1H2MA 4LH7A 1N33O 4LWSB 1M57B 4JTCB 2R9RB 3B77A 1SERA 1JVMA 3OTOO 2JGDB 3L73H 4LF9B 1S5LZ 4X1YA 1H8HG 3G6BA 4GZRB 1FXVA 5EBWC 4DYLA 3K79A 2QKCA 5B3SC 4FMTA 1SQVH 1SC5B 1MABG 4FFBB 1SQQH 3BFRA 2ITDC 1MNGA 4I4TB 2LGWA 2QTSA 2QA4V 1I5YA 3UCSC 1KBHA 1FXHA 4G2KA 3BA8A 2AZ0A 5EC1C 3QNEA 2IU3A 3CCRV 1GRJA 3T2MA 1PNLA 2K1EA 2JK5C 2XAGA 3G4SV 5JJNB 2YIDA 3MHHC 2PF4E 5L3BA 3H1JH 3P30A 5L3EA 4DR5B 1U97A 4U7NA 4UCRA 1WPBA 3WFVA 5LXTB 1D5AA 1FFXA 1KU9A 4ZBMA 1I0HA 1VF7A 1VP7A 2JEUA 1FJGO 5EBMC 3C3TA 2XASA 4NXMB 1W2BU 4UCVA 4DUYO 2DW4A 3K0DA 4GUNA 1R3JC 2WLLA 1R3LC 4JI7B 1VQOV 4XDLA 4DV0B 5LOVA 4JI5B 2W6JG 1GN4A 3I55V 4MTXA 2DWDC 3JD1A 3MAQA 4F6RB 2UU9O 4WFFA 4X20A 4U3JB 5JWPA 4YY3O 5H9CA 4IGGA 5D5QA 4CBCA 2Y4TA 2ZIMA 2AHZA 4LCUC 4JI3O 1FXKC 2QM7A 1ROPA 4ICGA 5BY1A 4ZOLA 1Y4MA 2BTQB 2QR4A 4DR1O 2XOKG 2D2CB 2B1IA 4ZIBA 5CA3A 1XNRB 2E5LO 4JAUA 4QE7A 4I7ZB 3ZIAG 4DV5B 3T1YO 3OE7G 2QTOA 4TV9A 4MVSA 3LUTB 2KG7A 4YHHB 1AP6A 2E76B 3ABUA 1SKVA 1AR5A 5CA1A 1SQBH 1YSCA 3F7YC 4MTOA 4PA3A 4JI4B 1VEWA 3VQVA 3OMNB 4H0LB 1H2GA 1OCRB 1XUQA 3RFRA 2YIBD 4JTAB 4X64B 2QEXV 4R50A 2WSSG 1GTOA 1YVWA 1EBOA 2Z0AA 2AZ2A 3AG1B 4UCOA 1JJ2U 1T5EA 3JASB 1NVPD 1NZ6A 5EC2C 2NNUA 3AG4C 1FFTB 1AI4A 2ZR2A 3T1HO 4AQYB 2YS8A 2GTAA 4J41A 1NR7A 3KCXA 4FK5C 4WFAV 2B1GA 2W0FC 4XDKA 5EIBC 3ZHQA 4MW3A 4L87A 2F95B 5KHGA 3ZJZA 1KUQA 4WCEV 3CC2V 5LGTA 4I0XB 1WB8A 3ZHVA 1CP9A 2KKWA 1JQ0A 2IH3C 1QLEB 4CZZA 3QO8A 4R8CA 3F5WC 1XEQA 2JIZG 3W7WA 1E79G 4FLXA 3K57A 1ENVA 1EN6A 1HNXO 1K92A 2EJRA 4H33A 1CXZB 4PDLA 3VOUA 4LH6A 1NJIW 2UXCO 3OEEG 3N27A 1IBMB 1Q8IA 1KMIZ 4DV4B 3FX7A 3ZRXA 1PNKA 1I08A 1I94O 1M57C 3ZMZA 1GK9A 2ODMA 2Q73A 4MTFA 1KP2A 4B3TO 4YIOA 5JJEB 5J2TB 1VMGA 1J5EO 5JCOC 4LF8B 1KC8W 2ZDIA 2QKSA 2Y69C 1WN7A 2BOBC 3JATB 4DR7O 3L72H 4EB6A 1SETA 4LF4O 1AR4A 4UVBA 4JI6O 1VQ9V 2PYLA 2GDSA 2RMKB 3HKDA 2GHYA 1RFYA 3FAVA 1GMGA 4JAVA 1D5NA 2VQFO 4ASUG 1OCOC 5BR8B 1LNQA 1HWYA 2VQEB 1XMOB 4UUJC 1YIJV 5L3FA 3ABMB 5DEDA 1Z2GA 3JD4A 3B09A 3AG7A 3AG3B 3RYIB 1N33B 1OV9A 1IX9A 5KHJA 1D2DA 1AI6A 4OX9O 3OTOB 3OGCC 4PDRA 4UCSA 2Y4UA 4PD4F 1K8AW 4BAYA 4MVMA 4X1YB 4LFAB 4U3FH 1FD9A 3UT5B 4LF5O 1WJZA 3O9OA 3JYCA 2MK3A 2DN9A 1SZTA 1AROP 1XHZA 3EHBB 2EINC 4G27B 2Q7EA 2YI8A 4DK0A 3ZX6A 4ABMA 4IHJA 2A7WA 3CB2A 4FJCC 3AK3A 2EIKC 4CH5A 5B5EZ 2V4DA 5EYPA 4D7SA 3DC6A 2QGNA 5K1PA 2CUGA 3I5DA 1Y76A 2PTMA 5LMUO 4B7KA 1S5HC 3UO2A 4DRXA 1FFXB 2ITCC 1FJGB 3OEHG 4KL1A 4DUYB 2ZE5A 5B1AC 4J11A 2YC0A 4G28B 4K3AA 5LOVB 2ZXWB 2UU9B 3EFFK 1R3IC 3JSLA 3S3XA 3CCQV 4OPHA 1G4YB 4YY3B 4R6ZA 1FAFA 4X20B 1Q43A 2CTWA 1L0NH 1R6TA 1Y74B 4BIUA 5LP6C 4DR1B 4ZOLB 3JD2A 3CE2A 1U96A 2QWQB 4TV8A 5JQGA 2E5LB 2QE7G 4JZ2A 2FL4A 3H1HH 3T1YB 3PN1A 4KHPO 2DE0X 1KP3A 4TUYA 4UXNA 4DV1O 4TV9B 1GM7A 2KG7B 4JF3A 3TXSA 1YJWV 3OD4A 1LR1A 2Q5ZA 1M56B 2X0LA 5CA1B 1X59A 4GX1A 4F6EA 4X66O 2DYRC 4YJ2B 3LDEA 4CS2A 1QLEC 3L9DA 2PZSA 3K0GA 3K04A 4DR6O 2VS0A 3UQ8A 5JVDA 3G6EV 3ABKB 2LJ2A 1H2NA 1VIBA 3RYCA 3EXAA 2XAFA 3RYHA 3CCSV 1P7GA 1S3JA 3E83A 2LW1A 3T1HB 3ZHSA 2LO1A 1XDCA 4X88A 4UCUA 3OR6C 2ZM6O 1XL4A 3IFXA 2CGOA 2B5UA 4NYKA 4H44B 1XHXA 4QPJA 1S77D 3O65A 1DTOA 2DQ3A 1SZXA 1QR8A 1GN3A 3H1IH 1H2SB 4XBFA 3W7XA 3CC7V 1BL8A 1MSDA 2EIMB 4CH6A 5IY5C 1JR9A 5EZYA 1JMKC 1IBLO 2KSDA 4JPRA 3LDDA 3SYOA 1HNXB 4F4LA 4O4LA 1SQXH 3ABMC 1AJNA 4DR4O 1PP9H 4MVQA 3CHXA 1VQLV 3T4ZA 1HDJA 4X1KA 3ZRWA 3AG3C 2UXCB 2CTPA 5BMVA 1I94B 2WPDG 1WNSA 3ZRSA 1IURA 4BR6A 4X1IA 2M6YA 1AB3A 2JEXA 1B06A 1BS3A 4B3TB 3OMIB 1AJQA 1F4MA 3CRCA 4CC5A 4J7ZA 3K59A 1J5EB 1YZBA 2ZT9B 2CTQA 3HPLC 2QWNB 3K5LA 3RYFA 4LF4B 4LBEC 3U10A 4JI6B 5DM6V 4TQDA 2JJ2G 4EB6B 4LF7O 1CEZA 5L3CA 1ZX3A 2YDEA 4UV9A 1NTZH 3RWRD 5IT9N 1US6A 2VQFB 2UUAB 5A2QN 3HKDB 2UXNA 3FAVB 1NH2D 1GN2A 2BSKA 1EM1A 4IIJA 3ETEA 2Q69A 2WLJA 3SPJA 2WAMA 1YF2A 2X6BA 5FPRA 5CBFA 1VF5B 1YJ9V 4OX9B 2NLJC 1MZEA 4PV1B 4GKKO 4TT3G 1KYOF 1SF9A 3D3QA 4TSFG 2IU0A 1R6KA 3P32A 1E1RG 4O4JA 3E89A 2BCCH 3SYCA 2A9HA 3RVYA 4BIZA 2P6JA 1Q6UA 3U11A 4O2BA 2DQ0A 1RPOA 2FB5A 3OT7A 4UVAA 4BWAA 3K03A 1AR1B 1PPJH 1Z5VA 4PDMA 3D3IA 3SPIA 2UXDO 4UCTA 2X7RB 3K3WA 1UJWB 3ABTA 2ZINA 3EVKA 1V55B 5D5PA 3AG2C 2ZXWC 2K9PA 4YXWG 4RQFA 1R6NA 1O9HA 4FLTA 2F1MA 4QIWF 2CTRA 1N36O 4FZ0A 1YJNV 2LFRA 1ZWIC 3K5NA 4IHJB 3B40A 4GX0A 3FYIB 4E4EA 4OGQB 4D7TA 1A32A 5EYPB 3GVMA 4MS2A 3WG7B 1TUEB 4I50B 2UXBO 4JI0B 4RUFA 4Z1MG 3FYEB 1Y76B 3TJTA 3DXRA 4J7JA 2IW5A 1XNQO 3B2EE 3OGIB 1OHHG 5KAIZ 4Q20A 3TXQA 1URFA 5HFLA 3SJBC 3ETQA 4HAMA 4PA7A 3R65A 3T1CA 5L3DA 4B7EA 2ATKC 4UB6Z 4BIOA 3LNNA 5A9GA 4JI2O 1BCCH 4N21A 2IBZH 4GT1A 3K5OA 1Q7YW 2PI4A 3APQA 4BW5A 1TGOA 3ABKC 2V1DA 3CD6V 2ILMA 1G8MA 4U7OA 2Z5UA 1Q90D 2XAJA 4MVUA 1P84F 4I55A 3R66A 5H2FZ 4TV8B 5JQGB 1XBLA 1BT8A 4J80A 2EX3A 4QJFB 2N05A 2YEVA 1XI1A 2DOSA 4DV1B 1O9GA 3E8FA 5CN0A 1MOFA 2PYJA 4IYIA 3HKCA 3CMEV 2PY5A 3CRAA 4X66B 2GUZA 2YXHA 3BVOA 5IJ9A 2H94A 2HHHO 1ZUQA 2XAHA 4DR6B 2ZR3A 1TVKA 3SYQA 1VQ5V 2EZOA 3DGEA 4RUEA 3ZMVA 2BE3A 4ZI7B 5LBQA 1AVMA 4ZHQA 4FLZA 1XL6A 1NTKH 3RYCB 3X2QB 2VWKA 3ASOB 4WF9V 3RYHB 3CEIA 3TGUH 2WLHA 1KECA 4DV6O 2HLDG 2F4VO 1BGYH 3ABLC 2ZM6B 1S0VA 1NR1A 4IYHA 2ZCEA 2OWOA 5LGNA 2LGQA 5TISZ 3BHPA 4WFEA 3P3PA 3H1LH 4DV2O 1OCZB 1PL4A 2DMXA 2OCHA 3E2EA 1PNMA 3CMAV 1TUBA 1EZVH 3MDSA 3D8CA 2NR5A 4GYCB 1IBLB 5IYCO 1ZAUA 2NN4A 2KQXA 1DK1A 5EZYB 5B1OA 3ZHUA 4I5SA 4LFBO 4O4LB 4FFKA 3VQXA 4CH3A 1QBZA 1VF6A 4X1KB 3ZRWB 5BXZA 3QO7A 5FNVB 5BMVB 5IE9A 1EN5A 2RJZA 2XTAA 2YXLA 3QVNA 4JYAO 4X1IB 1OJHA 5GTIZ 1ZL8A 1NH2B 3J81N 3GWKC 1NT2B 1M90W 3ETGA 4PELA 2YUAA 2F93B 2EIJB 4Z2WA 2JRIA 4B3SB 4LF7B 4OXSA 3RYFB 2AGAA 1K3EA 1QR9A 3A0RA 1V55C 1F7YA 2QSAA 3OR7C 4WFBV 2F66C 4TWKA 4NB5A 3ZEDA 3RBZA 3F5TA 4NXNO 3FKSG 2UUCO 2BSKB 5DECA 3CCEV 3JARA 5KMGA 3RW0A 1H38A 3OTFA 4J42A 2M7WA 5JCOA 4GKKB 4H13B 4GLXA 3H1KH 5GW7A 4B3RO 2H8PC 5FL7G 1CPYA 4BW9A 3WU2Z 4PA6A 2ZE7A 1K7DA 2HJDA 3JSNA 1OCCB 3CPWU 4DO2A 1NBMG 2DYSB 4O4JB 3QF7A 1COWG 2CGNA 2GBOA 4O2BB 2UXDB 1F23A 3L74H 5IWAO 1MZFA 2RCVA 4IT5A 5GONA 2WLIA 1BHAA 4XDJA 4DR3O 2HVKC 4JI1O 1XQ8A 1UPGA 5CA0A 1AILA 1WPXA 2PUSA 3ZMSA 5B1BB 1KD1W 1F51A 1N36B 1IBKO 4KFMA 3M99B 1Q81W 5KX5A 5LXTA 2LFSA 1H8EG 2G38A 3STZC 4O4IA 3WB2A 2RQ6A 3B8MA 2UXBB 1KB9F 3N2GA 1VQPV 3CRQA 2EJ7A 3H9VA 5B3SB 2WLLB 1TA8A 3CCJV 3K08A 3IC7A 5AG2A 2IM9A 1NU1H 1XNQB 4GKJO 2V7QG 2P7TC 3DXRB 2QKAA 4JI8O 2Q4PA 2P67A 1IVSA 1G1XB 2UXXA 1Y66A 1PL0A 3W7TA 2FKXA 1IDSA 3L75H 3UKMA 1SQGA 1OCRC 5F2VO 1Q82W 5LL6Y 4JI3B 2MW2B 2ZIOA 5IDJA 5KUMA 2P5OA 3FB5C 3AG1C 3KCYA 3OM3B 4DV3O 1YHQV 2VWJA 3PJSK 3SR2C 5JJJB 1QLNA 4QNHB 2CH7A 1Z5WA 3UO3A 1R3KC 3FB6C 2E75B 3AK1A 1N8RW 2IJKA 3CCMV 4LFCO 1VARA 3X2QC 4I55B 3OMAB 1B04A 3JALA 3BAAA 1HR0O 2FMLA 4X65O 1YI2V 1FKAO 1VQ8V 1SA0A 4JTDB 3Q4HA 3KZIZ 1YDXA 2OIEA 3LNMB 3VQWA 3RN4A 1GN6A 1N0NA 4EEQA 1WP7A 2A06H 3ZN0A 2PI5A 1JFFA 4OPAA 1OCZC 3HKCB 3FB8C 2IJHA 4PHZA 4CC6A 1MG1A 5LP6A 3LSUA 5IYDO 4GX5A 2HHHB 3D36C 2GUZB 5IJ9B 2Q9LA 3SDLA 3ML0A 1TVKB 1ZTEA 1L8DA 3ZMTA 1QNMA 3RVZA 5IYZA 3CWBH 4ZHQB 4AQYO 1JJOA 5C93A 4QE9A 3CJHA 4JYCA
chains in the Genus database with same CATH topology
3L74H 3L70H 1SQBH 2IBZH 3TGUH 4U3FH 2FYUH 1BE3H 1PPJH 3H1HH 3L75H 3H1IH 1EZVH 3H1KH 1KB9F 1NTMH 1SQVH 3L72H 1L0NH 1BGYH 3L73H 1SQPH 2A06H 1KYOF 1NTZH 3CXHF 1SQQH 1L0LH 1NU1H 3H1JH 3CWBH 1P84F 3CX5F 2BCCH 4D6TH 1NTKH 4PD4F 1SQXH 5KLVH 3H1LH 3L71H 3BCCH 1BCCH 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 H;  3L70 H;  1SQB H;  2IBZ H;  3TGU H;  4U3F H;  2FYU H;  1BE3 H;  1PPJ H;  3H1H H;  3L75 H;  3H1I H;  1EZV H;  3H1K H;  1KB9 F;  1NTM H;  1SQV H;  3L72 H;  1L0N H;  1BGY H;  3L73 H;  1SQP H;  2A06 H;  1KYO F;  1NTZ H;  3CXH F;  1SQQ H;  1L0L H;  1NU1 H;  3H1J H;  3CWB H;  1P84 F;  3CX5 F;  2BCC H;  4D6T H;  1NTK H;  4PD4 F;  1SQX H;  5KLV H;  3H1L H;  3L71 H;  3BCC H;  1BCC H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 1K9M W;  2LQT A;  4DV6 B;  2QJ1 A;  2F4V B;  1E1Q G;  4I0X A;  4X62 O;  3ZBH A;  3BA9 A;  2Q0A A;  3QG5 A;  1WB7 A;  2YIC A;  4DV2 B;  1X4T A;  4D6T H;  3GWO A;  1NKD A;  5J2U A;  1YXB A;  2HG5 C;  1Q3E A;  2F43 G;  3K9S A;  1R73 A;  3C90 A;  1TUB B;  3G67 A;  2LP7 A;  4NTX A;  1N4C A;  3FB7 C;  1M93 A;  4MT8 A;  2HFE C;  1I7F A;  1RM1 B;  4LFB B;  4DV4 O;  1F4N A;  2AW9 A;  5K1X A;  3BPZ A;  3M8A A;  4UV8 A;  1Y6X A;  5ITZ A;  3BRC A;  2L35 A;  4EKW A;  3JD0 A;  2P22 C;  1QQC A;  1XIL A;  3K58 A;  1QHT A;  4DR7 B;  1ZSP A;  4JYA B;  1S76 D;  2JJ1 G;  4Q6G A;  2CE4 A;  3H01 A;  4JV5 O;  1WLE A;  1FYJ A;  1OCC C;  1NI8 A;  3J80 N;  3ZHT A;  1ZL8 B;  4CS3 A;  1OZ0 A;  1SQP H;  4QGP A;  3CXC U;  4FVM A;  2D3O W;  3CRM A;  3E22 A;  1I5X A;  2OYQ A;  2OTL V;  1V9P A;  5JH7 A;  3E8B A;  5BR8 O;  1XMO O;  3E8G A;  1HP8 A;  4JAS A;  5B1B C;  2UUC B;  3CCV V;  2JS5 A;  1YCI A;  2JS3 A;  4UVC A;  4DK1 A;  3P3N A;  4MSW C;  1JOY A;  4LP8 A;  4AI8 A;  3JAR B;  4PJ0 Z;  4LR3 A;  5KMG B;  3OAA G;  1LUW A;  1B3Q A;  4YIP A;  5IJ0 A;  1VQN V;  4LF5 B;  4B3R B;  2XUM A;  2ZE6 A;  1H2L A;  3UT5 A;  4W4L A;  2Y69 B;  4LFA O;  4DW1 A;  4FM0 A;  1IXB A;  2AXT Z;  3ZCC A;  3STL C;  4LC1 A;  2H3O A;  1THZ A;  4HYO A;  1M4U A;  4KP4 A;  2QWO B;  1P49 A;  1VQ6 V;  1K4D C;  3CX5 F;  5IWA B;  1G6U A;  4LNU A;  1RSO A;  3SPC A;  3KKY A;  4DR3 B;  3RGB A;  4JI1 B;  1YTF B;  1OCO B;  5GON B;  2YXY A;  3TK1 A;  2WLI B;  1AI7 A;  5B1N A;  4DR2 O;  1HNZ O;  5CA0 B;  1DGS A;  1XRE A;  3ETD A;  1N0J A;  3DSQ A;  3F7V C;  1IBK B;  2P90 A;  4K35 A;  4UB8 Z;  5KHI A;  3G71 V;  4FM2 A;  5LMU B;  3A0B Z;  4HNA A;  1PD3 A;  5L3G A;  1M9N A;  5KX5 B;  2EIL B;  4DRX B;  3NR7 A;  4KUM A;  4O4I B;  3HR0 A;  5J9P C;  2YI9 A;  4LF6 O;  3N2G B;  2WLK A;  3JCZ A;  3A0H Z;  3J7A U;  4GKJ B;  3AEI A;  4JI8 B;  2WA4 A;  3OW2 U;  3N2K A;  3WB1 A;  3IC9 A;  4J9Y B;  3JAM N;  2KB1 A;  1MSW D;  1N32 O;  1M56 C;  2GSM B;  3OUF A;  4PI0 A;  2OT5 A;  2IH1 C;  2EIN B;  4JAA A;  1K4C C;  1BMF G;  2P4V A;  3HB3 B;  5KA6 A;  2N04 A;  3CC4 V;  1Y74 A;  3HKE A;  3BY6 A;  4MVR A;  4O2A A;  2EIK B;  3SJC C;  3U0Z A;  4DV3 B;  4QPK A;  1MMM A;  2R9I A;  4FLU A;  4GCZ A;  4DXW A;  2O57 A;  2OIG A;  4TOI A;  4EFE A;  3K9A A;  1VQ4 V;  4X9Q A;  3GB7 C;  2QWP B;  3JAK A;  5LA6 A;  4H37 A;  2YIA A;  2CH7 B;  1P4R A;  4YJ3 A;  4J7K A;  1DF4 A;  1PV0 A;  2YIB A;  4KHP B;  2R70 A;  5B1A B;  5LYJ A;  4LFC B;  4WBN A;  2EUL A;  5KHK A;  3TCU A;  3SJQ C;  4B08 A;  4TUY B;  1HR0 B;  2HEP A;  2BTO A;  1GKF A;  4X65 B;  3JAL B;  3UM7 A;  2EBO A;  1WAZ A;  1K5Q A;  2Q6A A;  3SYP A;  5KLV H;  4NTY A;  1FXK A;  3T4D A;  3FD9 A;  3TET A;  3NXS A;  1K5S A;  1SA0 B;  3Q4H B;  1EFR G;  4YJ2 A;  1GAX A;  2EIM C;  3IJ4 A;  2LW7 A;  3ZN1 A;  1ZLZ A;  1JFF B;  5JVD B;  2HKO A;  1H2K A;  5LP6 B;  2WA3 A;  1XOU A;  5BZB A;  1BQZ A;  3W7S A;  2XAQ A;  3SPH A;  1RM1 C;  3JAW A;  4I9W A;  3W7U A;  2Q8V A;  2C2A A;  2JVD A;  4ZKI A;  3CXH F;  5CMU A;  4A5U B;  5IYZ B;  1MA1 A;  1JCH A;  1VF6 C;  4JGS A;  2ZKO A;  1SQF A;  2UUB O;  4HZ3 A;  2ZDI C;  2WWW A;  4L8J A;  4O4H A;  2Z3Y A;  1GH6 A;  2ZNJ A;  3CJH B;  5CB4 A;  3CSX A;  3IAY A;  3LSS A;  2Q67 A;  3SPG A;  4X62 B;  1S72 V;  1WA8 A;  4PA4 A;  2CAZ C;  4PA9 A;  2GTS A;  1BHB A;  4DUZ O;  2DYR B;  2Q68 A;  4E2L A;  1YEW A;  4TQF A;  2OCC B;  1SRY A;  2EZP A;  1WP8 A;  1XMQ O;  5LMN O;  3ASN B;  4DR4 B;  4FZ1 A;  5LHG A;  5J2U B;  4K0K O;  5EBL C;  3ZHR A;  1RP3 B;  4DV7 O;  2FYU H;  1Q5O A;  1HW7 A;  2RNB A;  1QVG U;  5H6R A;  1UFI A;  3DC5 A;  4X8A A;  3ZRV A;  2A0L A;  4MVO A;  3THO A;  5ITZ B;  1HNW O;  3ZMU A;  4FM1 A;  1Q6I A;  2XT9 A;  4B3M O;  4JV5 B;  1K33 A;  2P4K A;  4Z1V A;  4UFZ A;  1AP5 A;  2N74 A;  1N34 O;  1S5J A;  4NVP A;  4IL6 Z;  4JZG A;  5FLX N;  1QVF U;  5C8Y A;  3HKB A;  4FPP A;  5EIB D;  2ADP A;  2Y0I A;  1Y67 A;  4LWS A;  1EZJ A;  2UUA O;  2ADQ B;  3E22 B;  5IY5 B;  3OUS A;  4IIJ B;  5B66 Z;  2HVJ C;  2JGD A;  3E35 A;  4WFG A;  5JH7 B;  2W0X A;  1BE3 H;  1IZ3 A;  1VQ7 V;  4LF9 O;  1V54 B;  3WG7 C;  1NQT A;  3LDC A;  3CS5 A;  1P7B A;  2X6A A;  1LUV A;  4FLV A;  4FFB A;  2EIL C;  4W4K A;  4X89 A;  3G80 A;  3AK2 A;  4I4T A;  1M1K W;  1W0K G;  1ORQ C;  3CCU V;  5IJ0 B;  1W59 A;  4FLY A;  2ZD9 A;  3MHS C;  3RT3 C;  3C3S A;  5H6Q A;  2ZE8 A;  2R72 A;  4NKG B;  2ZQM A;  1AJP A;  4LNU B;  1RSO B;  5H5N A;  4RWU A;  4DR2 B;  1HNZ B;  4DR5 O;  1B6Q A;  2WLN A;  5IYB O;  3VQY A;  1K73 W;  1AI5 A;  2DJV A;  3BEH A;  1YTF D;  2FTK A;  1GM8 A;  1K34 A;  4I50 A;  3SYA A;  1VQM V;  4NXM O;  4FLW A;  4J10 A;  4HNA B;  1GO3 F;  4JI0 O;  1JA8 A;  2RDC A;  3ICX A;  1IXM A;  4JI7 O;  2HR3 A;  4WFH A;  4DV0 O;  3L71 H;  2XHB A;  4JI5 O;  4RQE A;  3DTU B;  4CS4 A;  4LF6 B;  4PDV A;  1GM9 A;  3A8T A;  2ZNI A;  4F6R A;  2WLM A;  3CCL V;  3VBB A;  4U3J A;  3M7M X;  1R1B A;  1DF5 A;  1JPX A;  4K8X A;  1N32 B;  1KQS U;  3E86 A;  1DLB A;  3N2K B;  5LHI A;  1NS1 A;  3AG2 B;  2B9Z A;  3IGA C;  4JI2 B;  5E1A C;  1Q86 W;  1SES A;  2BTQ A;  2RN9 A;  3A2F A;  1QU7 A;  2P06 A;  5GTH Z;  1XNR O;  2AHY A;  4J9Z B;  3SGI A;  3HKE B;  2R9A A;  5KA5 A;  4O2A B;  3WB0 A;  2PGG A;  4MW8 A;  5LHH A;  4DV5 O;  3ASO C;  1KKD A;  3SJA C;  2YSU B;  1JX9 A;  4PI2 A;  3JAK B;  1SS3 A;  3L70 H;  5LA6 B;  4YHH O;  4YJ3 B;  4I9Q A;  2YEV B;  2E74 B;  3E8H A;  4WBN B;  5LYJ B;  4JI4 O;  1EN4 A;  5HFM A;  4JYY A;  3KG2 A;  4HBN A;  5FPO A;  2IJI A;  4DW0 A;  2QDO A;  5CBH A;  1QCE A;  4X64 O;  1NVP B;  4C7U A;  1FXK B;  4CH4 A;  2E3C A;  3BCC H;  2GV9 A;  2Y48 A;  2JDI G;  3JAS A;  4RO2 A;  2Q7G A;  3B4S A;  1NTM H;  2OCC C;  3BAB A;  5KAF Z;  5KUK A;  3ASN C;  4JYB A;  1RPR A;  4ZI7 A;  1W0J G;  5CBG A;  4KXR A;  4AHC A;  5E79 Z;  3QO5 A;  1K97 A;  4R7C A;  3QTC A;  4RAI A;  1PM9 A;  4GX2 A;  2QM8 A;  3CYO A;  2X6C A;  3JAW B;  1PKX A;  1J95 A;  2UUB B;  2QM4 A;  1BZK A;  2Y0P A;  2IJJ A;  2L6L A;  3OFN G;  1Q6H A;  2EIJ C;  4K8Z A;  4O4H B;  5CB4 B;  1L1F A;  3I56 V;  3CP1 A;  5LGU A;  3JCU Z;  1BSM A;  4DUZ B;  3D36 A;  1WA8 B;  4FIP C;  1YIT V;  4MTG A;  4NTW A;  1M5I A;  2VRZ A;  5EK0 A;  2ETN A;  4EFB A;  5LMN B;  1XMQ B;  3LSQ A;  1VQK V;  2BOC C;  3CRR A;  3AG4 B;  1IBM O;  4P30 A;  4K0K B;  4DV7 B;  3APO A;  5J2T A;  3FFQ A;  2HP8 A;  2Q0O C;  2CDY A;  1V54 C;  2DWE C;  1FPO A;  5FNV A;  2JGU A;  4P9P A;  2W6I G;  4LF8 O;  2XND G;  2QWR B;  3JD3 A;  4N23 A;  3JAT A;  2DYS C;  2A79 B;  3ABL B;  1HNW B;  3B8N A;  1L0L H;  3ZS8 C;  4P2Z A;  2Q7H A;  1KKC A;  3K5M A;  4NR1 A;  4B3M B;  2A3Q A;  1BQ0 A;  2ARH A;  2F23 A;  3MD0 A;  1N34 B;  2CK3 G;  4P9O A;  2VQE O;  3S3W A;  2OTJ V;  4B3S O;  2HJF C;  3K06 A;  4MVZ A;  5C8Y B;  3HKB B;  3RYI A;  4NXN B;  1FS0 G;  1TAE A;  4AIL C;  5KHH A;  5DN6 G;  1H2M A;  4LH7 A;  1N33 O;  4LWS B;  1M57 B;  4JTC B;  2R9R B;  3B77 A;  1SER A;  1JVM A;  3OTO O;  2JGD B;  3L73 H;  4LF9 B;  1S5L Z;  4X1Y A;  1H8H G;  3G6B A;  4GZR B;  1FXV A;  5EBW C;  4DYL A;  3K79 A;  2QKC A;  5B3S C;  4FMT A;  1SQV H;  1SC5 B;  1MAB G;  4FFB B;  1SQQ H;  3BFR A;  2ITD C;  1MNG A;  4I4T B;  2LGW A;  2QTS A;  2QA4 V;  1I5Y A;  3UCS C;  1KBH A;  1FXH A;  4G2K A;  3BA8 A;  2AZ0 A;  5EC1 C;  3QNE A;  2IU3 A;  3CCR V;  1GRJ A;  3T2M A;  1PNL A;  2K1E A;  2JK5 C;  2XAG A;  3G4S V;  5JJN B;  2YID A;  3MHH C;  2PF4 E;  5L3B A;  3H1J H;  3P30 A;  5L3E A;  4DR5 B;  1U97 A;  4U7N A;  4UCR A;  1WPB A;  3WFV A;  5LXT B;  1D5A A;  1FFX A;  1KU9 A;  4ZBM A;  1I0H A;  1VF7 A;  1VP7 A;  2JEU A;  1FJG O;  5EBM C;  3C3T A;  2XAS A;  4NXM B;  1W2B U;  4UCV A;  4DUY O;  2DW4 A;  3K0D A;  4GUN A;  1R3J C;  2WLL A;  1R3L C;  4JI7 B;  1VQO V;  4XDL A;  4DV0 B;  5LOV A;  4JI5 B;  2W6J G;  1GN4 A;  3I55 V;  4MTX A;  2DWD C;  3JD1 A;  3MAQ A;  4F6R B;  2UU9 O;  4WFF A;  4X20 A;  4U3J B;  5JWP A;  4YY3 O;  5H9C A;  4IGG A;  5D5Q A;  4CBC A;  2Y4T A;  2ZIM A;  2AHZ A;  4LCU C;  4JI3 O;  1FXK C;  2QM7 A;  1ROP A;  4ICG A;  5BY1 A;  4ZOL A;  1Y4M A;  2BTQ B;  2QR4 A;  4DR1 O;  2XOK G;  2D2C B;  2B1I A;  4ZIB A;  5CA3 A;  1XNR B;  2E5L O;  4JAU A;  4QE7 A;  4I7Z B;  3ZIA G;  4DV5 B;  3T1Y O;  3OE7 G;  2QTO A;  4TV9 A;  4MVS A;  3LUT B;  2KG7 A;  4YHH B;  1AP6 A;  2E76 B;  3ABU A;  1SKV A;  1AR5 A;  5CA1 A;  1SQB H;  1YSC A;  3F7Y C;  4MTO A;  4PA3 A;  4JI4 B;  1VEW A;  3VQV A;  3OMN B;  4H0L B;  1H2G A;  1OCR B;  1XUQ A;  3RFR A;  2YIB D;  4JTA B;  4X64 B;  2QEX V;  4R50 A;  2WSS G;  1GTO A;  1YVW A;  1EBO A;  2Z0A A;  2AZ2 A;  3AG1 B;  4UCO A;  1JJ2 U;  1T5E A;  3JAS B;  1NVP D;  1NZ6 A;  5EC2 C;  2NNU A;  3AG4 C;  1FFT B;  1AI4 A;  2ZR2 A;  3T1H O;  4AQY B;  2YS8 A;  2GTA A;  4J41 A;  1NR7 A;  3KCX A;  4FK5 C;  4WFA V;  2B1G A;  2W0F C;  4XDK A;  5EIB C;  3ZHQ A;  4MW3 A;  4L87 A;  2F95 B;  5KHG A;  3ZJZ A;  1KUQ A;  4WCE V;  3CC2 V;  5LGT A;  4I0X B;  1WB8 A;  3ZHV A;  1CP9 A;  2KKW A;  1JQ0 A;  2IH3 C;  1QLE B;  4CZZ A;  3QO8 A;  4R8C A;  3F5W C;  1XEQ A;  2JIZ G;  3W7W A;  1E79 G;  4FLX A;  3K57 A;  1ENV A;  1EN6 A;  1HNX O;  1K92 A;  2EJR A;  4H33 A;  1CXZ B;  4PDL A;  3VOU A;  4LH6 A;  1NJI W;  2UXC O;  3OEE G;  3N27 A;  1IBM B;  1Q8I A;  1KMI Z;  4DV4 B;  3FX7 A;  3ZRX A;  1PNK A;  1I08 A;  1I94 O;  1M57 C;  3ZMZ A;  1GK9 A;  2ODM A;  2Q73 A;  4MTF A;  1KP2 A;  4B3T O;  4YIO A;  5JJE B;  5J2T B;  1VMG A;  1J5E O;  5JCO C;  4LF8 B;  1KC8 W;  2ZDI A;  2QKS A;  2Y69 C;  1WN7 A;  2BOB C;  3JAT B;  4DR7 O;  3L72 H;  4EB6 A;  1SET A;  4LF4 O;  1AR4 A;  4UVB A;  4JI6 O;  1VQ9 V;  2PYL A;  2GDS A;  2RMK B;  3HKD A;  2GHY A;  1RFY A;  3FAV A;  1GMG A;  4JAV A;  1D5N A;  2VQF O;  4ASU G;  1OCO C;  5BR8 B;  1LNQ A;  1HWY A;  2VQE B;  1XMO B;  4UUJ C;  1YIJ V;  5L3F A;  3ABM B;  5DED A;  1Z2G A;  3JD4 A;  3B09 A;  3AG7 A;  3AG3 B;  3RYI B;  1N33 B;  1OV9 A;  1IX9 A;  5KHJ A;  1D2D A;  1AI6 A;  4OX9 O;  3OTO B;  3OGC C;  4PDR A;  4UCS A;  2Y4U A;  4PD4 F;  1K8A W;  4BAY A;  4MVM A;  4X1Y B;  4LFA B;  4U3F H;  1FD9 A;  3UT5 B;  4LF5 O;  1WJZ A;  3O9O A;  3JYC A;  2MK3 A;  2DN9 A;  1SZT A;  1ARO P;  1XHZ A;  3EHB B;  2EIN C;  4G27 B;  2Q7E A;  2YI8 A;  4DK0 A;  3ZX6 A;  4ABM A;  4IHJ A;  2A7W A;  3CB2 A;  4FJC C;  3AK3 A;  2EIK C;  4CH5 A;  5B5E Z;  2V4D A;  5EYP A;  4D7S A;  3DC6 A;  2QGN A;  5K1P A;  2CUG A;  3I5D A;  1Y76 A;  2PTM A;  5LMU O;  4B7K A;  1S5H C;  3UO2 A;  4DRX A;  1FFX B;  2ITC C;  1FJG B;  3OEH G;  4KL1 A;  4DUY B;  2ZE5 A;  5B1A C;  4J11 A;  2YC0 A;  4G28 B;  4K3A A;  5LOV B;  2ZXW B;  2UU9 B;  3EFF K;  1R3I C;  3JSL A;  3S3X A;  3CCQ V;  4OPH A;  1G4Y B;  4YY3 B;  4R6Z A;  1FAF A;  4X20 B;  1Q43 A;  2CTW A;  1L0N H;  1R6T A;  1Y74 B;  4BIU A;  5LP6 C;  4DR1 B;  4ZOL B;  3JD2 A;  3CE2 A;  1U96 A;  2QWQ B;  4TV8 A;  5JQG A;  2E5L B;  2QE7 G;  4JZ2 A;  2FL4 A;  3H1H H;  3T1Y B;  3PN1 A;  4KHP O;  2DE0 X;  1KP3 A;  4TUY A;  4UXN A;  4DV1 O;  4TV9 B;  1GM7 A;  2KG7 B;  4JF3 A;  3TXS A;  1YJW V;  3OD4 A;  1LR1 A;  2Q5Z A;  1M56 B;  2X0L A;  5CA1 B;  1X59 A;  4GX1 A;  4F6E A;  4X66 O;  2DYR C;  4YJ2 B;  3LDE A;  4CS2 A;  1QLE C;  3L9D A;  2PZS A;  3K0G A;  3K04 A;  4DR6 O;  2VS0 A;  3UQ8 A;  5JVD A;  3G6E V;  3ABK B;  2LJ2 A;  1H2N A;  1VIB A;  3RYC A;  3EXA A;  2XAF A;  3RYH A;  3CCS V;  1P7G A;  1S3J A;  3E83 A;  2LW1 A;  3T1H B;  3ZHS A;  2LO1 A;  1XDC A;  4X88 A;  4UCU A;  3OR6 C;  2ZM6 O;  1XL4 A;  3IFX A;  2CGO A;  2B5U A;  4NYK A;  4H44 B;  1XHX A;  4QPJ A;  1S77 D;  3O65 A;  1DTO A;  2DQ3 A;  1SZX A;  1QR8 A;  1GN3 A;  3H1I H;  1H2S B;  4XBF A;  3W7X A;  3CC7 V;  1BL8 A;  1MSD A;  2EIM B;  4CH6 A;  5IY5 C;  1JR9 A;  5EZY A;  1JMK C;  1IBL O;  2KSD A;  4JPR A;  3LDD A;  3SYO A;  1HNX B;  4F4L A;  4O4L A;  1SQX H;  3ABM C;  1AJN A;  4DR4 O;  1PP9 H;  4MVQ A;  3CHX A;  1VQL V;  3T4Z A;  1HDJ A;  4X1K A;  3ZRW A;  3AG3 C;  2UXC B;  2CTP A;  5BMV A;  1I94 B;  2WPD G;  1WNS A;  3ZRS A;  1IUR A;  4BR6 A;  4X1I A;  2M6Y A;  1AB3 A;  2JEX A;  1B06 A;  1BS3 A;  4B3T B;  3OMI B;  1AJQ A;  1F4M A;  3CRC A;  4CC5 A;  4J7Z A;  3K59 A;  1J5E B;  1YZB A;  2ZT9 B;  2CTQ A;  3HPL C;  2QWN B;  3K5L A;  3RYF A;  4LF4 B;  4LBE C;  3U10 A;  4JI6 B;  5DM6 V;  4TQD A;  2JJ2 G;  4EB6 B;  4LF7 O;  1CEZ A;  5L3C A;  1ZX3 A;  2YDE A;  4UV9 A;  1NTZ H;  3RWR D;  5IT9 N;  1US6 A;  2VQF B;  2UUA B;  5A2Q N;  3HKD B;  2UXN A;  3FAV B;  1NH2 D;  1GN2 A;  2BSK A;  1EM1 A;  4IIJ A;  3ETE A;  2Q69 A;  2WLJ A;  3SPJ A;  2WAM A;  1YF2 A;  2X6B A;  5FPR A;  5CBF A;  1VF5 B;  1YJ9 V;  4OX9 B;  2NLJ C;  1MZE A;  4PV1 B;  4GKK O;  4TT3 G;  1KYO F;  1SF9 A;  3D3Q A;  4TSF G;  2IU0 A;  1R6K A;  3P32 A;  1E1R G;  4O4J A;  3E89 A;  2BCC H;  3SYC A;  2A9H A;  3RVY A;  4BIZ A;  2P6J A;  1Q6U A;  3U11 A;  4O2B A;  2DQ0 A;  1RPO A;  2FB5 A;  3OT7 A;  4UVA A;  4BWA A;  3K03 A;  1AR1 B;  1PPJ H;  1Z5V A;  4PDM A;  3D3I A;  3SPI A;  2UXD O;  4UCT A;  2X7R B;  3K3W A;  1UJW B;  3ABT A;  2ZIN A;  3EVK A;  1V55 B;  5D5P A;  3AG2 C;  2ZXW C;  2K9P A;  4YXW G;  4RQF A;  1R6N A;  1O9H A;  4FLT A;  2F1M A;  4QIW F;  2CTR A;  1N36 O;  4FZ0 A;  1YJN V;  2LFR A;  1ZWI C;  3K5N A;  4IHJ B;  3B40 A;  4GX0 A;  3FYI B;  4E4E A;  4OGQ B;  4D7T A;  1A32 A;  5EYP B;  3GVM A;  4MS2 A;  3WG7 B;  1TUE B;  4I50 B;  2UXB O;  4JI0 B;  4RUF A;  4Z1M G;  3FYE B;  1Y76 B;  3TJT A;  3DXR A;  4J7J A;  2IW5 A;  1XNQ O;  3B2E E;  3OGI B;  1OHH G;  5KAI Z;  4Q20 A;  3TXQ A;  1URF A;  5HFL A;  3SJB C;  3ETQ A;  4HAM A;  4PA7 A;  3R65 A;  3T1C A;  5L3D A;  4B7E A;  2ATK C;  4UB6 Z;  4BIO A;  3LNN A;  5A9G A;  4JI2 O;  1BCC H;  4N21 A;  2IBZ H;  4GT1 A;  3K5O A;  1Q7Y W;  2PI4 A;  3APQ A;  4BW5 A;  1TGO A;  3ABK C;  2V1D A;  3CD6 V;  2ILM A;  1G8M A;  4U7O A;  2Z5U A;  1Q90 D;  2XAJ A;  4MVU A;  1P84 F;  4I55 A;  3R66 A;  5H2F Z;  4TV8 B;  5JQG B;  1XBL A;  1BT8 A;  4J80 A;  2EX3 A;  4QJF B;  2N05 A;  2YEV A;  1XI1 A;  2DOS A;  4DV1 B;  1O9G A;  3E8F A;  5CN0 A;  1MOF A;  2PYJ A;  4IYI A;  3HKC A;  3CME V;  2PY5 A;  3CRA A;  4X66 B;  2GUZ A;  2YXH A;  3BVO A;  5IJ9 A;  2H94 A;  2HHH O;  1ZUQ A;  2XAH A;  4DR6 B;  2ZR3 A;  1TVK A;  3SYQ A;  1VQ5 V;  2EZO A;  3DGE A;  4RUE A;  3ZMV A;  2BE3 A;  4ZI7 B;  5LBQ A;  1AVM A;  4ZHQ A;  4FLZ A;  1XL6 A;  1NTK H;  3RYC B;  3X2Q B;  2VWK A;  3ASO B;  4WF9 V;  3RYH B;  3CEI A;  3TGU H;  2WLH A;  1KEC A;  4DV6 O;  2HLD G;  2F4V O;  1BGY H;  3ABL C;  2ZM6 B;  1S0V A;  1NR1 A;  4IYH A;  2ZCE A;  2OWO A;  5LGN A;  2LGQ A;  5TIS Z;  3BHP A;  4WFE A;  3P3P A;  3H1L H;  4DV2 O;  1OCZ B;  1PL4 A;  2DMX A;  2OCH A;  3E2E A;  1PNM A;  3CMA V;  1TUB A;  1EZV H;  3MDS A;  3D8C A;  2NR5 A;  4GYC B;  1IBL B;  5IYC O;  1ZAU A;  2NN4 A;  2KQX A;  1DK1 A;  5EZY B;  5B1O A;  3ZHU A;  4I5S A;  4LFB O;  4O4L B;  4FFK A;  3VQX A;  4CH3 A;  1QBZ A;  1VF6 A;  4X1K B;  3ZRW B;  5BXZ A;  3QO7 A;  5FNV B;  5BMV B;  5IE9 A;  1EN5 A;  2RJZ A;  2XTA A;  2YXL A;  3QVN A;  4JYA O;  4X1I B;  1OJH A;  5GTI Z;  1ZL8 A;  1NH2 B;  3J81 N;  3GWK C;  1NT2 B;  1M90 W;  3ETG A;  4PEL A;  2YUA A;  2F93 B;  2EIJ B;  4Z2W A;  2JRI A;  4B3S B;  4LF7 B;  4OXS A;  3RYF B;  2AGA A;  1K3E A;  1QR9 A;  3A0R A;  1V55 C;  1F7Y A;  2QSA A;  3OR7 C;  4WFB V;  2F66 C;  4TWK A;  4NB5 A;  3ZED A;  3RBZ A;  3F5T A;  4NXN O;  3FKS G;  2UUC O;  2BSK B;  5DEC A;  3CCE V;  3JAR A;  5KMG A;  3RW0 A;  1H38 A;  3OTF A;  4J42 A;  2M7W A;  5JCO A;  4GKK B;  4H13 B;  4GLX A;  3H1K H;  5GW7 A;  4B3R O;  2H8P C;  5FL7 G;  1CPY A;  4BW9 A;  3WU2 Z;  4PA6 A;  2ZE7 A;  1K7D A;  2HJD A;  3JSN A;  1OCC B;  3CPW U;  4DO2 A;  1NBM G;  2DYS B;  4O4J B;  3QF7 A;  1COW G;  2CGN A;  2GBO A;  4O2B B;  2UXD B;  1F23 A;  3L74 H;  5IWA O;  1MZF A;  2RCV A;  4IT5 A;  5GON A;  2WLI A;  1BHA A;  4XDJ A;  4DR3 O;  2HVK C;  4JI1 O;  1XQ8 A;  1UPG A;  5CA0 A;  1AIL A;  1WPX A;  2PUS A;  3ZMS A;  5B1B B;  1KD1 W;  1F51 A;  1N36 B;  1IBK O;  4KFM A;  3M99 B;  1Q81 W;  5KX5 A;  5LXT A;  2LFS A;  1H8E G;  2G38 A;  3STZ C;  4O4I A;  3WB2 A;  2RQ6 A;  3B8M A;  2UXB B;  1KB9 F;  3N2G A;  1VQP V;  3CRQ A;  2EJ7 A;  3H9V A;  5B3S B;  2WLL B;  1TA8 A;  3CCJ V;  3K08 A;  3IC7 A;  5AG2 A;  2IM9 A;  1NU1 H;  1XNQ B;  4GKJ O;  2V7Q G;  2P7T C;  3DXR B;  2QKA A;  4JI8 O;  2Q4P A;  2P67 A;  1IVS A;  1G1X B;  2UXX A;  1Y66 A;  1PL0 A;  3W7T A;  2FKX A;  1IDS A;  3L75 H;  3UKM A;  1SQG A;  1OCR C;  5F2V O;  1Q82 W;  5LL6 Y;  4JI3 B;  2MW2 B;  2ZIO A;  5IDJ A;  5KUM A;  2P5O A;  3FB5 C;  3AG1 C;  3KCY A;  3OM3 B;  4DV3 O;  1YHQ V;  2VWJ A;  3PJS K;  3SR2 C;  5JJJ B;  1QLN A;  4QNH B;  2CH7 A;  1Z5W A;  3UO3 A;  1R3K C;  3FB6 C;  2E75 B;  3AK1 A;  1N8R W;  2IJK A;  3CCM V;  4LFC O;  1VAR A;  3X2Q C;  4I55 B;  3OMA B;  1B04 A;  3JAL A;  3BAA A;  1HR0 O;  2FML A;  4X65 O;  1YI2 V;  1FKA O;  1VQ8 V;  1SA0 A;  4JTD B;  3Q4H A;  3KZI Z;  1YDX A;  2OIE A;  3LNM B;  3VQW A;  3RN4 A;  1GN6 A;  1N0N A;  4EEQ A;  1WP7 A;  2A06 H;  3ZN0 A;  2PI5 A;  1JFF A;  4OPA A;  1OCZ C;  3HKC B;  3FB8 C;  2IJH A;  4PHZ A;  4CC6 A;  1MG1 A;  5LP6 A;  3LSU A;  5IYD O;  4GX5 A;  2HHH B;  3D36 C;  2GUZ B;  5IJ9 B;  2Q9L A;  3SDL A;  3ML0 A;  1TVK B;  1ZTE A;  1L8D A;  3ZMT A;  1QNM A;  3RVZ A;  5IYZ A;  3CWB H;  4ZHQ B;  4AQY O;  1JJO A;  5C93 A;  4QE9 A;  3CJH A;  4JYC A; 
#chains in the Genus database with same CATH homology
 3L74 H;  3L70 H;  1SQB H;  2IBZ H;  3TGU H;  4U3F H;  2FYU H;  1BE3 H;  1PPJ H;  3H1H H;  3L75 H;  3H1I H;  1EZV H;  3H1K H;  1KB9 F;  1NTM H;  1SQV H;  3L72 H;  1L0N H;  1BGY H;  3L73 H;  1SQP H;  2A06 H;  1KYO F;  1NTZ H;  3CXH F;  1SQQ H;  1L0L H;  1NU1 H;  3H1J H;  3CWB H;  1P84 F;  3CX5 F;  2BCC H;  4D6T H;  1NTK H;  4PD4 F;  1SQX H;  5KLV H;  3H1L H;  3L71 H;  3BCC H;  1BCC H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...