1KYOF

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
DTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 26
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1kyoF00
3L70H 1BE3H 1NU1H 3H1KH 2BCCH 3H1IH 3H1LH 5KLVH 1EZVH 3CX5F 2FYUH 1KYOF 3H1JH 1PPJH 1SQPH 1PP9H 4PD4F 1L0NH 1NTMH 1SQXH 1BCCH 1P84F 3CXHF 3BCCH 3TGUH 1KB9F 1NTZH 1NTKH 4D6TH 4U3FH 1BGYH 3L74H 3L71H 1L0LH 1SQQH 1SQBH 3H1HH 1SQVH 2A06H 2IBZH 3CWBH 3L73H 3L72H 3L75H
chains in the Genus database with same CATH superfamily
4DUYO 5DECA 1R3LC 4UB8Z 1N36O 3RYIA 2YS8A 2PYLA 5B66Z 3CXHF 3BCCH 4NR1A 4MW8A 1U97A 4FFBA 4UXNA 4DR4B 5HFLA 4I4TA 1KUQA 1AR5A 2R9AA 3K06A 1XI1A 4FLZA 3VQWA 4QNHB 4TV8B 3L75H 4YY3O 4DV3B 2QA4V 4JV5B 1FXVA 3H1JH 3OMIB 2N74A 1KB9F 3N2KA 3ABTA 2HVKC 4QGPA 2CH7B 5KUMA 2RDCA 5LA6B 1VIBA 4KHPB 4ZIBA 1F4NA 4JTCB 4JI4B 1Q90D 4DV7B 1DLBA 4R7CA 5DM6V 3QNEA 2ILMA 3IC9A 3SPCA 4EEQA 3THOA 2QSAA 3CCRV 1AI4A 4K35A 4A5UB 3UCSC 2UUBB 4JI1O 5CB4A 5E1AC 2QM4A 1XNQB 1KKCA 1PP9H 1Q6IA 4CH5A 5HFMA 1PL4A 2Q0AA 1JVMA 4JAUA 1N34O 2CTQA 2WLKA 1Z2GA 4MVSA 4DR7B 1AP5A 3HKDA 4JI0B 1SRYA 4I50A 2ZM6O 3K58A 4JI8O 1SQBH 2E3CA 3LSUA 3JASB 4LF4O 2UXBB 3JARA 2QKCA 3N27A 1HP8A 2F23A 1KP3A 2C2AA 1IBLB 4UV9A 5IJ0B 4TV8A 1BQZA 3KCXA 1GN3A 1H2MA 2EX3A 2ZIOA 2VWJA 2HVJC 2F93B 5CA1B 2F95B 3SJAC 2LJ2A 2W6JG 5KAFZ 1OV9A 4LFCB 1I7FA 3W7TA 1IBMB 2CH7A 4DW1A 2NN4A 2HR3A 3G80A 5B1BB 2AGAA 3EXAA 1SQGA 1VQ9V 5EIBC 1AILA 4NXMB 3ABMB 4P9PA 2Q4PA 5C93A 1TVKA 2VQFO 2A7WA 5L3BA 1QQCA 4LF5O 2OT5A 4KUMA 3T1CA 5DEDA 1IBKB 4D7TA 1QLNA 2BTOA 4L87A 1VMGA 4WFEA 3ZRVA 1VQ6V 4DR6O 1I94B 1Q5OA 4HBNA 2KSDA 3HKBB 4DV2O 2Z3YA 4J7ZA 2HHHB 4E2LA 2OCCB 1IVSA 1AR1B 3ASOB 1IXMA 3ABKC 3STZC 1KECA 2XAGA 4O4LB 1JR9A 4JI6O 2WLMA 4J9ZB 4DXWA 4LWSA 1YI2V 3DGEA 3B8MA 4GKKO 5K1XA 5EZYA 5CBGA 1I08A 5JH7A 5GW7A 3ZHRA 5IJ0A 5H2FZ 4XDJA 1GO3F 1L0LH 1XBLA 5KHHA 2X6CA 3LDDA 5LMNO 2YI8A 2DW4A 3CMAV 5LBQA 2HP8A 1VQ8V 2JJ2G 2JEXA 4RO2A 2WA3A 1N32B 2OCHA 1RM1C 3M99B 2CTWA 4LNUB 1ORQC 1AI7A 1LUVA 1N0NA 1YEWA 3FYIB 2OTJV 3VOUA 2KQXA 1FJGO 1K73W 3HB3B 4FLUA 1VF7A 1UPGA 2Q9LA 2H3OA 3X2QC 5L3EA 4IYIA 4N23A 4Z2WA 2QWRB 1OCZC 2M7WA 3BPZA 3OD4A 2GDSA 3K57A 3DSQA 3ICXA 1HNXB 3ZMTA 2M6YA 4YJ3A 4JTDB 3HKBA 4LF7O 3GWKC 4U3JB 2XAQA 1ENVA 3H1LH 3VBBA 1SZXA 3DXRA 3K3WA 1BSMA 1BQ0A 4FLWA 3LUTB 4DRXB 3WB0A 5B1OA 3E2EA 5JJJB 4AQYB 2EILC 3AG2C 4O4LA 3FB8C 1A32A 4LR3A 4DK0A 4K0KO 4JZGA 4EB6A 1ZLZA 2AXTZ 4EFEA 1SF9A 4UCSA 3AG4C 2HJFC 3I5DA 2FL4A 4DR2O 1WPXA 3ML0A 4TV9B 1VQ4V 4ZOLA 3K0GA 3ZHTA 4JI5O 1MA1A 3HPLC 4J11A 3MHSC 5BMVB 4LF6O 2W0XA 2DYSB 4DR5O 2QWOB 5A9GA 4X9QA 3AG1B 1MZEA 3OMAB 5LYJB 3T1HO 4PI2A 3CRRA 1R6NA 3ZRWB 1PD3A 4B7EA 5J9PC 5L3CA 4ZI7A 2F4VO 3S3WA 3IFXA 1YIJV 2GSMB 1R3IC 3BRCA 1HDJA 1TAEA 3CYOA 4YIPA 4F6RB 5GTIZ 2ARHA 1SS3A 4HZ3A 4TWKA 5D5PA 2H94A 3G67A 4UCTA 1PPJH 1WPBA 2WLLA 4PD4F 3T4ZA 4JYAB 1PNKA 3OW2U 1ZAUA 4NXNO 3OMNB 4U3JA 1MG1A 2UXCO 1RSOB 4DRXA 3H9VA 1KMIZ 1S5LZ 4MTFA 1JQ0A 1YSCA 1GN6A 4B3RO 5B1NA 2XAJA 1RP3B 2UUCO 5LGUA 2IJJA 2NNUA 2BTQB 3FFQA 1AJPA 3JAKB 4KXRA 1AI6A 3M7MX 3WB1A 4YIOA 4CS4A 1N33B 1GN2A 5H9CA 3J80N 3JALA 1M57C 1WP8A 4AI8A 1O9HA 3RBZA 2XOKG 1XMQB 4TOIA 5LL6Y 1L8DA 3LSSA 5B3SC 1TGOA 2PTMA 3FAVA 5LYJA 3HKCA 2YEVB 3OEHG 3P3NA 2WLIB 5EBWC 4Q20A 3OAAG 5BZBA 3T1YB 4K3AA 2LGQA 2AZ0A 4J7JA 5BR8B 2A0LA 2QJ1A 1PKXA 3I55V 1HR0O 4H44B 4DR1O 1M56C 1BT8A 4F6RA 2E5LO 3BA9A 2P90A 1Z5VA 2BOCC 2XTAA 5IYCO 1COWG 2CAZC 5IJ9B 4MVOA 1KBHA 3F7YC 1VF5B 3EHBB 3UM7A 4TUYA 4RAIA 4DO2A 1Y74A 2ZT9B 5KX5A 2PGGA 3K08A 3CE2A 2B1IA 4FM1A 4DV1B 5AG2A 3ZMSA 1GH6A 3CCUV 1H2SB 1ZL8A 1WA8B 1RM1B 4UV8A 3CC7V 4I55B 4CS2A 4Z1MG 4JYBA 1N4CA 3CSXA 2BTQA 1US6A 4PA7A 4TQDA 1QU7A 2IJKA 3CC2V 3JAKA 1G4YB 1K3EA 3LNMB 1Q81W 1SETA 4FM0A 3X2QB 4DYLA 4PA3A 1F51A 1YCIA 2WA4A 4I4TB 1OCZB 3BY6A 4W4LA 4F6EA 2YI9A 3ZHVA 4UVAA 3BEHA 2B5UA 3NXSA 1QLEC 4LFAB 1WNSA 1BL8A 1B06A 4JI7O 1M93A 3OEEG 3P30A 5LXTA 1XMOO 4UFZA 2HG5C 2R70A 4K8XA 4KL1A 4ZBMA 1URFA 5H6QA 5LMUB 2ZR3A 4RQEA 3AG2B 3OGIB 4TSFG 3MHHC 4G27B 3NR7A 1XEQA 1VQLV 1Q86W 3K5MA 3AG4B 1SC5B 2HKOA 1NH2B 3DC5A 3I56V 1X4TA 3E86A 3E8HA 3FX7A 4DV6B 1HW7A 1IZ3A 1M9NA 1ZTEA 2GTSA 1N8RW 3CJHA 1VQMV 4X65O 2YXHA 5CB4B 4DUZB 4QE7A 5FNVA 3EFFK 4WCEV 3SJBC 2EIKB 1P4RA 4X62B 3HKDB 5IE9A 4I50B 3O9OA 4EKWA 4DUYB 4YHHO 3ZN1A 5IDJA 1N36B 4FZ0A 2EZOA 3JARB 1TUBB 5JJEB 1EN4A 2EIMC 2QTSA 1XQ8A 1QHTA 3E8GA 3SGIA 1DF4A 1JA8A 4LF9O 2IH1C 1AI5A 5CBHA 2ZNIA 1XUQA 4ABMA 1NR1A 2N04A 4YY3B 1GMGA 3JD4A 3UT5A 1AROP 2EBOA 2X6AA 3WU2Z 2Q68A 4BWAA 1UJWB 1K4DC 2B1GA 1VP7A 2XT9A 2FYUH 3C90A 1VARA 3A0HZ 3IJ4A 1G8MA 1TVKB 2E75B 1XREA 1YITV 5EIBD 3F7VC 2ZE7A 1V54C 2VQEO 2N05A 1GM8A 2ZXWC 3A2FA 2A06H 1K5QA 5L3DA 4D7SA 4QPKA 5B3SB 4GUNA 3SPHA 1BHBA 1GM9A 1THZA 3SPGA 3QO5A 1FXKC 4MVRA 5E79Z 2JS5A 4JI1B 4B08A 1DF5A 1ZWIC 4O2BB 3CXCU 3K5NA 4IL6Z 2JGDB 5IYBO 1OCRC 3L73H 1N34B 1X59A 2ZD9A 4LWSB 1Q82W 2L6LA 3H1KH 3HR0A 5EZYB 1NQTA 3UQ8A 1ZUQA 1RFYA 1TUBA 4ASUG 5FL7G 1M56B 4JI8B 2ZM6B 2K1EA 5JH7B 4QIWF 4YJ2B 4BIZA 1H2GA 4LF4B 3HKEA 1M90W 3JD3A 5JVDB 4PJ0Z 4ZHQA 1BGYH 5D5QA 1HNZO 1K4CC 3CEIA 4N21A 1BMFG 2Y48A 4UCOA 3ASNB 2UXNA 3Q4HB 3CCQV 2WLHA 4MVQA 1EZVH 3RYCB 3H01A 5JQGA 1H2NA 1R3KC 4OXSA 4UVBA 4FFKA 2EIJC 4I7ZB 5KAIZ 1H2KA 3ABLC 2HEPA 1NVPB 4U7OA 3E83A 5H6RA 5B5EZ 2Q8VA 2G38A 3JCUZ 2W0FC 1Q43A 1L1FA 3WG7C 2CGNA 5CBFA 1I5YA 2VQFB 3CHXA 1SQFA 3F5TA 4LF5B 3U0ZA 5GONB 1VF6C 4YJ3B 4E4EA 4LFBO 2EINC 3DXRB 5LOVA 2QE7G 5JCOC 3A8TA 1YXBA 4PA6A 2PZSA 4DR6B 2Y0IA 5ITZB 1QLEB 1VQOV 3FB7C 1K7DA 4O2BA 4DV2B 4WBNB 3R65A 3SJQC 2JGDA 4DV0O 3CRQA 3P3PA 1P84F 1GK9A 3L9DA 4EB6B 1NTZH 4X66O 2ETNA 4B3MO 2ODMA 1H8HG 4JI6B 1YJ9V 4YJ2A 3K03A 4GKKB 4ZOLB 4KFMA 5JVDA 3A0BZ 3OM3B 1NH2D 1FKAO 2GUZB 1MOFA 4PI0A 3B09A 5LMNB 2A79B 3Q4HA 3C3SA 4IYHA 3RYCA 1DGSA 4CBCA 4J80A 3E89A 3L71H 2PI4A 3KCYA 3APQA 3W7XA 2LP7A 1J5EB 2LW1A 1NU1H 3K04A 4B3TO 2AHYA 1QNMA 1HNWO 1M1KW 3ETGA 4ZI7B 1R3JC 5IY5C 1QVFU 1S72V 2D2CB 1FJGB 2YXLA 3S3XA 4XBFA 4I5SA 4PA4A 4CH6A 2Q67A 2Q6AA 5GONA 2EIMB 1V55C 2WLLB 2CGOA 1CP9A 4UB6Z 2P5OA 2WSSG 5ITZA 2Z0AA 2LW7A 1WB7A 4LF7B 2A3QA 4WBNA 2DJVA 3BABA 3UO3A 1FS0G 4J41A 1JMKC 1Q6HA 3H1HH 4MSWC 1I5XA 3RYHA 3CWBH 4RQFA 4BIUA 2JRIA 3ZRSA 3SR2C 2JS3A 3UKMA 4K0KB 5EC1C 2PUSA 2UXXA 3GWOA 4DR2B 1K34A 1JFFA 3JALB 1TUEB 4D6TH 4FJCC 2FKXA 4W4KA 2GUZA 4JI5B 1LNQA 1KQSU 2GTAA 2ZIMA 1SQVH 4X8AA 2ZXWB 3BFRA 4FLTA 3FAVB 4LF6B 1Q6UA 3HKCB 1JJ2U 2V7QG 4DR5B 2ZE8A 4F4LA 2YICA 1K5SA 1Y67A 3T1HB 2FB5A 1VEWA 3ETQA 5GTHZ 1AJNA 1FXKB 2P06A 2AHZA 1XILA 1YTFB 1FD9A 3GVMA 2F4VB 3QO8A 3GB7C 4FLXA 4QE9A 1KYOF 3E22B 3VQVA 2DQ3A 4NTWA 4TUYB 2JDIG 3ZIAG 1Y74B 4BR6A 5KX5B 4OX9O 3JAWB 2OTLV 2Y69C 3FYEB 3ZMZA 1XL6A 1XNRO 2Y0PA 4NXNB 2XAHA 1ZL8B 2UXCB 2YXYA 5JJNB 1PNLA 2B9ZA 3W7SA 3A0RA 4HYOA 3BAAA 5KA6A 4DW0A 1WB8A 1KC8W 2PI5A 1GAXA 4O4IB 1IDSA 1YF2A 3LDEA 2ZNJA 3E8BA 4MVMA 4BIOA 4B3RB 4GX5A 3K5LA 1OCCC 2IJIA 4FIPC 2UUCB 2EIJB 5CA0B 1ZX3A 3ABLB 1GRJA 4U7NA 4G28B 5IYDO 1D5AA 1UFIA 4X20A 5LHIA 4I9WA 1NVPD 3RW0A 2DWDC 1YDXA 4JI2O 4JTAB 1OJHA 1DK1A 1M4UA 1S76D 2LGWA 2X7RB 4PDRA 1CXZB 2YC0A 1SESA 4CH3A 4X1YA 1PM9A 2YUAA 3ZEDA 2ZE6A 4KP4A 2BOBC 2EINB 3ZMVA 5LXTB 3WB2A 2GHYA 1FXKA 2QEXV 3ABKB 3AG7A 4DR3O 2V1DA 3TJTA 2CTPA 4X64O 1P7GA 2H8PC 1HR0B 1R6TA 3E35A 2JGUA 3STLC 1KP2A 3ZBHA 2E5LB 3E22A 1K92A 2ZINA 3JD2A 2DE0X 3SYQA 3JAWA 4LC1A 2UXDO 3ZHUA 2V4DA 1WLEA 5C8YA 3OTOB 4JYYA 3ZRXA 2WPDG 1BCCH 1K97A 2KG7B 3CJHB 2UUAO 4B3SO 3JSNA 1F23A 4O4IA 5FNVB 1S77D 1XL4A 2DYRC 3R66A 3RYFA 1KKDA 1EFRG 4XDLA 4DV5O 1T5EA 1WP7A 5CA0A 3F5WC 2IU0A 2ZE5A 5IY5B 2ATKC 3CCVV 1Y76A 3PJSK 4WFGA 4DV4O 1LUWA 2DOSA 4FLVA 2XASA 4GKJO 3PN1A 3SYCA 4XDKA 4JASA 1K33A 5FPOA 4LF8O 3ETEA 1VF6A 4FVMA 4P30A 4UUJC 1FXHA 4WFFA 4FLYA 4MS2A 2UU9O 5JCOA 2LFSA 3UT5B 3TXQA 4LFAO 2DQ0A 3TCUA 2BSKB 1WAZA 3D3IA 3M8AA 4JI3O 1F4MA 2EILB 4JI7B 1OCOC 1XMOB 4Q6GA 1RPOA 3AK3A 4ZKIA 5LGNA 3ASOC 2CE4A 3L72H 5LP6C 4NB5A 3OT7A 1EN6A 2ADQB 2YIAA 5L3FA 4MT8A 2QWPB 3CRMA 1GKFA 3BHPA 5IWAO 3D36C 2Q7EA 2IJHA 4LBEC 4PA9A 3KKYA 2KG7A 4O2AA 4P9OA 5F2VO 3OGCC 5IYZA 3VQXA 2HLDG 2E74B 2IU3A 4X65B 1NR7A 3B40A 3JATA 1BZKA 1SQXH 1PNMA 1JPXA 3SYAA 3MAQA 3ZCCA 1RPRA 4YXWG 2OYQA 4LH6A 1YZBA 3WFVA 3IAYA 1Y6XA 4H33A 1S5HC 3CCMV 4RUFA 1S5JA 4YHHB 4FMTA 2BCCH 4GZRB 3B8NA 3HKEB 4NTYA 1YTFD 2BE3A 1OHHG 4DR4O 4JGSA 3ABUA 4ZHQB 2VS0A 5FPRA 5LGTA 4NVPA 4I0XA 4GYCB 4LF9B 5TISZ 3QG5A 1EN5A 4OPHA 4DV3O 2Y69B 1NS1A 1N0JA 4LP8A 4JV5O 5KMGB 3G71V 4WFHA 1MMMA 2Y4UA 1IXBA 1EM1A 2BSKA 2JIZG 1B3QA 5JQGB 4PDMA 2K9PA 2OIGA 2X6BA 3W7WA 4TQFA 5DN6G 4L8JA 3CCEV 1MSWD 4IIJA 3EVKA 4KHPO 2ZR2A 2WAMA 1Q7YW 4O4HA 2LO1A 1OCCB 4GX0A 2Q73A 4JI4O 4DV7O 1FFXB 5JWPA 1M57B 5EBMC 3AK1A 1BE3H 2JVDA 2JJ1G 3H1IH 4X88A 2YIDA 2KB1A 4PV1B 1FPOA 2CDYA 3AK2A 4X89A 2VQEB 5J2UA 5CN0A 2QWNB 2O57A 4UCRA 5K1PA 5LHGA 5LOVB 2DYSC 2UUBO 1MZFA 1KD1W 3AG1C 1XNQO 4CS3A 4GX2A 5CMUA 1CEZA 4DR7O 4UVCA 1SA0A 2EULA 4H0LB 5LHHA 3OE7G 1U96A 4JI0O 2FTKA 2UXBO 4BW5A 1IBLO 1AJQA 1NI8A 1K9MW 4K8ZA 1EBOA 2P67A 3TETA 1H2LA 4MVZA 3L70H 2HJDA 2RQ6A 3N2GB 5KMGA 1HNZB 3RGBA 4JPRA 2HFEC 3AEIA 4JF3A 3CCLV 1PV0A 2P4VA 4LFCO 2ITDC 1QCEA 1IBMO 2QM8A 2DYRB 1NT2B 1V9PA 1H38A 1Z5WA 3SPJA 3JD0A 5KHJA 4NXMO 3T4DA 3SYOA 4NYKA 5LA6A 4NTXA 1FFXA 5EC2C 1CPYA 2XNDG 4MTGA 2QWQB 3FD9A 3VQYA 3JD1A 3K59A 2X0LA 4U3FH 3K9SA 2D3OW 4JAVA 2Q7GA 2RNBA 5A2QN 2ITCC 4CC5A 2KKWA 1IBKO 1S0VA 4QJFB 5KHGA 2XHBA 2AW9A 1PL0A 1I94O 4LFBB 1E1QG 2HHHO 4AHCA 3AG3C 4UCUA 4RUEA 2WLJA 1W59A 2W6IG 3FKSG 3ZHSA 2VWKA 3RYHB 2ZDIA 1AB3A 5CA3A 4DV0B 2F1MA 1OCOB 4H37A 1YHQV 2R9RB 4J9YB 4Z1VA 4X66B 2IBZH 4B3MB 3CP1A 3OUSA 5LP6B 3JASA 1JFFB 1HWYA 3CX5F 4GCZA 2MW2B 1QR8A 3O65A 4CH4A 1P49A 3KZIZ 3N2GA 2F66C 2LQTA 1SERA 2ZQMA 4GLXA 1AR4A 1NZ6A 2YDEA 4R50A 1N32O 5EBLC 1YJNV 4GT1A 2QKSA 1AVMA 3B4SA 1W0KG 3B2EE 4R6ZA 5CA1A 3U10A 3CCJV 4LCUC 1P7BA 3OR6C 3TGUH 1J5EO 4B3TB 1YJWV 1HNWB 4IT5A 4X1IB 2NR5A 3TK1A 3G6EV 4R8CA 3CRAA 3L74H 5J2TB 4OGQB 4H13B 3LSQA 4BAYA 2ZCEA 1FAFA 1LR1A 1SZTA 2QDOA 2EZPA 3CS5A 1OZ0A 1HNXO 3QF7A 1NTMH 2Z5UA 2YIBA 1MNGA 1NTKH 5B1AC 3LDCA 4OPAA 4X1KB 2CUGA 1SQQH 5BY1A 4RWUA 1E1RG 4AQYO 2YSUB 2WLNA 3UO2A 3ZMUA 4AILC 3D3QA 4TT3G 4FK5C 2LFRA 5LP6A 1JX9A 2P6JA 4C7UA 3SPIA 1XOUA 4X20B 1MSDA 1VQ5V 2F43G 4EFBA 3FB6C 2A9HA 3B77A 2IM9A 1Q8IA 1V54B 2PYJA 3D36A 4WF9V 5EK0A 1JJOA 4X1YB 4QPJA 3CMEV 1F7YA 3OFNG 2EJ7A 3W7UA 4BW9A 4HAMA 2RN9A 2IH3C 4IHJB 3CCSV 2Q7HA 3IGAC 2WWWA 2P4KA 2RMKB 4LNUA 3SYPA 1GN4A 2E76B 4X1IA 3QVNA 1OCRB 4FPPA 5KLVH 3RWRD 5J2TA 2EIKC 3RVZA 4MTXA 2QGNA 3RT3C 3T2MA 3JYCA 1R6KA 2AZ2A 3J7AU 4MTOA 4J7KA 3OR7C 3APOA 2P22C 4HNAB 1R73A 1XDCA 1B04A 3RFRA 5C8YB 4JYAO 2GBOA 3CD6V 4P2ZA 3CPWU 4OX9B 5KHIA 4PHZA 1D5NA 4X1KA 1GTOA 1KU9A 1BS3A 3CRCA 1XNRB 3ETDA 3ZHQA 4WFAV 4MVUA 4FZ1A 1NBMG 4GX1A 3RYFB 3QO7A 1YVWA 2MK3A 2RCVA 1J95A 3DC6A 3K5OA 1QR9A 1BHAA 3J81N 4UCVA 4J10A 1Y76B 3MDSA 5L3GA 1VQ7V 3WG7B 3JSLA 2CTRA 1EZJA 1VQNV 5FLXN 1SQPH 1L0NH 2CK3G 3SJCC 1N33O 4TV9A 1ROPA 3D8CA 4FM2A 4JI2B 2ZKOA 1AP6A 2R72A 3RVYA 1FYJA 1W2BU 1XMQO 3BVOA 1IURA 2R9IA 1H8EG 1VQPV 5IT9N 5BMVA 1I0HA 4IHJA 2IW5A 3OUFA 5KHKA 4CC6A 3T1YO 2PF4E 2ZDIC 3CB2A 2YIBD 3AG3B 5BR8O 1Y4MA 4NKGB 1SKVA 2NLJC 4DR3B 4DR1B 2EJRA 3ZRWA 4LH7A 5EYPB 3SDLA 2P7TC 4X64B 1D2DA 3TXSA 1NJIW 4HNAA 2DWEC 3ZX6A 1G1XB 2QKAA 2L35A 2QR4A 4PDVA 4JAAA 3RN4A 4O2AB 2UXDB 4DV1O 2OWOA 5IYZB 1XHXA 3P32A 3OTOO 4I9QA 1G6UA 3CC4V 3ASNC 2UUAB 1TA8A 1Y66A 3K0DA 1RSOA 4B3SB 3JATB 4PELA 1WJZA 1Q3EA 3JCZA 1QBZA 1B6QA 4J42A 3C3TA 5B1BC 3KG2A 5H5NA 4O4JB 4DV5B 3ABMC 3K9AA 4ICGA 4IGGA 1WN7A 3DTUB 2Q69A 2PY5A 1XHZA 1GM7A 3FB5C 2JEUA 3ZN0A 1NKDA 3RYIB 4DV4B 2Q5ZA 2RJZA 2OIEA 4WFBV 1V55B 4I0XB 1QVGU 3MD0A 2Q0OC 4GKJB 1R1BA 4MW3A 1S3JA 3BA8A 2GV9A 1FFTB 4FFBB 3U11A 4LF8B 4PDLA 5KA5A 1JOYA 4DK1A 1JCHA 3QTCA 1MABG 5B1AB 2XAFA 2YEVA 2UU9B 2OCCC 2WLIA 1E79G 2QTOA 2XUMA 5LMUO 2FMLA 5EYPA 4JI3B 4B7KA 3N2KB 4G2KA 4IIJB 1W0JG 4CZZA 4O4HB 5KUKA 3LNNA 3ZJZA 1O9GA 2QM7A 5BXZA 1VQKV 1IX9A 2Y4TA 3OTFA 3G6BA 2JK5C 1ZSPA 1K8AW 2DN9A 5IJ9A 3G4SV 4DV6O 3E8FA 2VRZA 5IWAB 3IC7A 5J2UB 3JAMN 2DMXA 2ADPA 4JYCA 4JZ2A 4DUZO 3ZS8C 1WA8A 4I55A 4X62O 3K79A 1M5IA 4O4JA 1SA0B 1DTOA
chains in the Genus database with same CATH topology
3L70H 1BE3H 1NU1H 3H1KH 2BCCH 3H1IH 3H1LH 5KLVH 1EZVH 3CX5F 2FYUH 1KYOF 3H1JH 1PPJH 1SQPH 1PP9H 4PD4F 1L0NH 1NTMH 1SQXH 1BCCH 1P84F 3CXHF 3BCCH 3TGUH 1KB9F 1NTZH 1NTKH 4D6TH 4U3FH 1BGYH 3L74H 3L71H 1L0LH 1SQQH 1SQBH 3H1HH 1SQVH 2A06H 2IBZH 3CWBH 3L73H 3L72H 3L75H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  1BE3 H;  1NU1 H;  3H1K H;  2BCC H;  3H1I H;  3H1L H;  5KLV H;  1EZV H;  3CX5 F;  2FYU H;  1KYO F;  3H1J H;  1PPJ H;  1SQP H;  1PP9 H;  4PD4 F;  1L0N H;  1NTM H;  1SQX H;  1BCC H;  1P84 F;  3CXH F;  3BCC H;  3TGU H;  1KB9 F;  1NTZ H;  1NTK H;  4D6T H;  4U3F H;  1BGY H;  3L74 H;  3L71 H;  1L0L H;  1SQQ H;  1SQB H;  3H1H H;  1SQV H;  2A06 H;  2IBZ H;  3CWB H;  3L73 H;  3L72 H;  3L75 H; 
#chains in the Genus database with same CATH topology
 4DUY O;  5DEC A;  1R3L C;  4UB8 Z;  1N36 O;  3RYI A;  2YS8 A;  2PYL A;  5B66 Z;  3CXH F;  3BCC H;  4NR1 A;  4MW8 A;  1U97 A;  4FFB A;  4UXN A;  4DR4 B;  5HFL A;  4I4T A;  1KUQ A;  1AR5 A;  2R9A A;  3K06 A;  1XI1 A;  4FLZ A;  3VQW A;  4QNH B;  4TV8 B;  3L75 H;  4YY3 O;  4DV3 B;  2QA4 V;  4JV5 B;  1FXV A;  3H1J H;  3OMI B;  2N74 A;  1KB9 F;  3N2K A;  3ABT A;  2HVK C;  4QGP A;  2CH7 B;  5KUM A;  2RDC A;  5LA6 B;  1VIB A;  4KHP B;  4ZIB A;  1F4N A;  4JTC B;  4JI4 B;  1Q90 D;  4DV7 B;  1DLB A;  4R7C A;  5DM6 V;  3QNE A;  2ILM A;  3IC9 A;  3SPC A;  4EEQ A;  3THO A;  2QSA A;  3CCR V;  1AI4 A;  4K35 A;  4A5U B;  3UCS C;  2UUB B;  4JI1 O;  5CB4 A;  5E1A C;  2QM4 A;  1XNQ B;  1KKC A;  1PP9 H;  1Q6I A;  4CH5 A;  5HFM A;  1PL4 A;  2Q0A A;  1JVM A;  4JAU A;  1N34 O;  2CTQ A;  2WLK A;  1Z2G A;  4MVS A;  4DR7 B;  1AP5 A;  3HKD A;  4JI0 B;  1SRY A;  4I50 A;  2ZM6 O;  3K58 A;  4JI8 O;  1SQB H;  2E3C A;  3LSU A;  3JAS B;  4LF4 O;  2UXB B;  3JAR A;  2QKC A;  3N27 A;  1HP8 A;  2F23 A;  1KP3 A;  2C2A A;  1IBL B;  4UV9 A;  5IJ0 B;  4TV8 A;  1BQZ A;  3KCX A;  1GN3 A;  1H2M A;  2EX3 A;  2ZIO A;  2VWJ A;  2HVJ C;  2F93 B;  5CA1 B;  2F95 B;  3SJA C;  2LJ2 A;  2W6J G;  5KAF Z;  1OV9 A;  4LFC B;  1I7F A;  3W7T A;  1IBM B;  2CH7 A;  4DW1 A;  2NN4 A;  2HR3 A;  3G80 A;  5B1B B;  2AGA A;  3EXA A;  1SQG A;  1VQ9 V;  5EIB C;  1AIL A;  4NXM B;  3ABM B;  4P9P A;  2Q4P A;  5C93 A;  1TVK A;  2VQF O;  2A7W A;  5L3B A;  1QQC A;  4LF5 O;  2OT5 A;  4KUM A;  3T1C A;  5DED A;  1IBK B;  4D7T A;  1QLN A;  2BTO A;  4L87 A;  1VMG A;  4WFE A;  3ZRV A;  1VQ6 V;  4DR6 O;  1I94 B;  1Q5O A;  4HBN A;  2KSD A;  3HKB B;  4DV2 O;  2Z3Y A;  4J7Z A;  2HHH B;  4E2L A;  2OCC B;  1IVS A;  1AR1 B;  3ASO B;  1IXM A;  3ABK C;  3STZ C;  1KEC A;  2XAG A;  4O4L B;  1JR9 A;  4JI6 O;  2WLM A;  4J9Z B;  4DXW A;  4LWS A;  1YI2 V;  3DGE A;  3B8M A;  4GKK O;  5K1X A;  5EZY A;  5CBG A;  1I08 A;  5JH7 A;  5GW7 A;  3ZHR A;  5IJ0 A;  5H2F Z;  4XDJ A;  1GO3 F;  1L0L H;  1XBL A;  5KHH A;  2X6C A;  3LDD A;  5LMN O;  2YI8 A;  2DW4 A;  3CMA V;  5LBQ A;  2HP8 A;  1VQ8 V;  2JJ2 G;  2JEX A;  4RO2 A;  2WA3 A;  1N32 B;  2OCH A;  1RM1 C;  3M99 B;  2CTW A;  4LNU B;  1ORQ C;  1AI7 A;  1LUV A;  1N0N A;  1YEW A;  3FYI B;  2OTJ V;  3VOU A;  2KQX A;  1FJG O;  1K73 W;  3HB3 B;  4FLU A;  1VF7 A;  1UPG A;  2Q9L A;  2H3O A;  3X2Q C;  5L3E A;  4IYI A;  4N23 A;  4Z2W A;  2QWR B;  1OCZ C;  2M7W A;  3BPZ A;  3OD4 A;  2GDS A;  3K57 A;  3DSQ A;  3ICX A;  1HNX B;  3ZMT A;  2M6Y A;  4YJ3 A;  4JTD B;  3HKB A;  4LF7 O;  3GWK C;  4U3J B;  2XAQ A;  1ENV A;  3H1L H;  3VBB A;  1SZX A;  3DXR A;  3K3W A;  1BSM A;  1BQ0 A;  4FLW A;  3LUT B;  4DRX B;  3WB0 A;  5B1O A;  3E2E A;  5JJJ B;  4AQY B;  2EIL C;  3AG2 C;  4O4L A;  3FB8 C;  1A32 A;  4LR3 A;  4DK0 A;  4K0K O;  4JZG A;  4EB6 A;  1ZLZ A;  2AXT Z;  4EFE A;  1SF9 A;  4UCS A;  3AG4 C;  2HJF C;  3I5D A;  2FL4 A;  4DR2 O;  1WPX A;  3ML0 A;  4TV9 B;  1VQ4 V;  4ZOL A;  3K0G A;  3ZHT A;  4JI5 O;  1MA1 A;  3HPL C;  4J11 A;  3MHS C;  5BMV B;  4LF6 O;  2W0X A;  2DYS B;  4DR5 O;  2QWO B;  5A9G A;  4X9Q A;  3AG1 B;  1MZE A;  3OMA B;  5LYJ B;  3T1H O;  4PI2 A;  3CRR A;  1R6N A;  3ZRW B;  1PD3 A;  4B7E A;  5J9P C;  5L3C A;  4ZI7 A;  2F4V O;  3S3W A;  3IFX A;  1YIJ V;  2GSM B;  1R3I C;  3BRC A;  1HDJ A;  1TAE A;  3CYO A;  4YIP A;  4F6R B;  5GTI Z;  2ARH A;  1SS3 A;  4HZ3 A;  4TWK A;  5D5P A;  2H94 A;  3G67 A;  4UCT A;  1PPJ H;  1WPB A;  2WLL A;  4PD4 F;  3T4Z A;  4JYA B;  1PNK A;  3OW2 U;  1ZAU A;  4NXN O;  3OMN B;  4U3J A;  1MG1 A;  2UXC O;  1RSO B;  4DRX A;  3H9V A;  1KMI Z;  1S5L Z;  4MTF A;  1JQ0 A;  1YSC A;  1GN6 A;  4B3R O;  5B1N A;  2XAJ A;  1RP3 B;  2UUC O;  5LGU A;  2IJJ A;  2NNU A;  2BTQ B;  3FFQ A;  1AJP A;  3JAK B;  4KXR A;  1AI6 A;  3M7M X;  3WB1 A;  4YIO A;  4CS4 A;  1N33 B;  1GN2 A;  5H9C A;  3J80 N;  3JAL A;  1M57 C;  1WP8 A;  4AI8 A;  1O9H A;  3RBZ A;  2XOK G;  1XMQ B;  4TOI A;  5LL6 Y;  1L8D A;  3LSS A;  5B3S C;  1TGO A;  2PTM A;  3FAV A;  5LYJ A;  3HKC A;  2YEV B;  3OEH G;  3P3N A;  2WLI B;  5EBW C;  4Q20 A;  3OAA G;  5BZB A;  3T1Y B;  4K3A A;  2LGQ A;  2AZ0 A;  4J7J A;  5BR8 B;  2A0L A;  2QJ1 A;  1PKX A;  3I55 V;  1HR0 O;  4H44 B;  4DR1 O;  1M56 C;  1BT8 A;  4F6R A;  2E5L O;  3BA9 A;  2P90 A;  1Z5V A;  2BOC C;  2XTA A;  5IYC O;  1COW G;  2CAZ C;  5IJ9 B;  4MVO A;  1KBH A;  3F7Y C;  1VF5 B;  3EHB B;  3UM7 A;  4TUY A;  4RAI A;  4DO2 A;  1Y74 A;  2ZT9 B;  5KX5 A;  2PGG A;  3K08 A;  3CE2 A;  2B1I A;  4FM1 A;  4DV1 B;  5AG2 A;  3ZMS A;  1GH6 A;  3CCU V;  1H2S B;  1ZL8 A;  1WA8 B;  1RM1 B;  4UV8 A;  3CC7 V;  4I55 B;  4CS2 A;  4Z1M G;  4JYB A;  1N4C A;  3CSX A;  2BTQ A;  1US6 A;  4PA7 A;  4TQD A;  1QU7 A;  2IJK A;  3CC2 V;  3JAK A;  1G4Y B;  1K3E A;  3LNM B;  1Q81 W;  1SET A;  4FM0 A;  3X2Q B;  4DYL A;  4PA3 A;  1F51 A;  1YCI A;  2WA4 A;  4I4T B;  1OCZ B;  3BY6 A;  4W4L A;  4F6E A;  2YI9 A;  3ZHV A;  4UVA A;  3BEH A;  2B5U A;  3NXS A;  1QLE C;  4LFA B;  1WNS A;  1BL8 A;  1B06 A;  4JI7 O;  1M93 A;  3OEE G;  3P30 A;  5LXT A;  1XMO O;  4UFZ A;  2HG5 C;  2R70 A;  4K8X A;  4KL1 A;  4ZBM A;  1URF A;  5H6Q A;  5LMU B;  2ZR3 A;  4RQE A;  3AG2 B;  3OGI B;  4TSF G;  3MHH C;  4G27 B;  3NR7 A;  1XEQ A;  1VQL V;  1Q86 W;  3K5M A;  3AG4 B;  1SC5 B;  2HKO A;  1NH2 B;  3DC5 A;  3I56 V;  1X4T A;  3E86 A;  3E8H A;  3FX7 A;  4DV6 B;  1HW7 A;  1IZ3 A;  1M9N A;  1ZTE A;  2GTS A;  1N8R W;  3CJH A;  1VQM V;  4X65 O;  2YXH A;  5CB4 B;  4DUZ B;  4QE7 A;  5FNV A;  3EFF K;  4WCE V;  3SJB C;  2EIK B;  1P4R A;  4X62 B;  3HKD B;  5IE9 A;  4I50 B;  3O9O A;  4EKW A;  4DUY B;  4YHH O;  3ZN1 A;  5IDJ A;  1N36 B;  4FZ0 A;  2EZO A;  3JAR B;  1TUB B;  5JJE B;  1EN4 A;  2EIM C;  2QTS A;  1XQ8 A;  1QHT A;  3E8G A;  3SGI A;  1DF4 A;  1JA8 A;  4LF9 O;  2IH1 C;  1AI5 A;  5CBH A;  2ZNI A;  1XUQ A;  4ABM A;  1NR1 A;  2N04 A;  4YY3 B;  1GMG A;  3JD4 A;  3UT5 A;  1ARO P;  2EBO A;  2X6A A;  3WU2 Z;  2Q68 A;  4BWA A;  1UJW B;  1K4D C;  2B1G A;  1VP7 A;  2XT9 A;  2FYU H;  3C90 A;  1VAR A;  3A0H Z;  3IJ4 A;  1G8M A;  1TVK B;  2E75 B;  1XRE A;  1YIT V;  5EIB D;  3F7V C;  2ZE7 A;  1V54 C;  2VQE O;  2N05 A;  1GM8 A;  2ZXW C;  3A2F A;  2A06 H;  1K5Q A;  5L3D A;  4D7S A;  4QPK A;  5B3S B;  4GUN A;  3SPH A;  1BHB A;  1GM9 A;  1THZ A;  3SPG A;  3QO5 A;  1FXK C;  4MVR A;  5E79 Z;  2JS5 A;  4JI1 B;  4B08 A;  1DF5 A;  1ZWI C;  4O2B B;  3CXC U;  3K5N A;  4IL6 Z;  2JGD B;  5IYB O;  1OCR C;  3L73 H;  1N34 B;  1X59 A;  2ZD9 A;  4LWS B;  1Q82 W;  2L6L A;  3H1K H;  3HR0 A;  5EZY B;  1NQT A;  3UQ8 A;  1ZUQ A;  1RFY A;  1TUB A;  4ASU G;  5FL7 G;  1M56 B;  4JI8 B;  2ZM6 B;  2K1E A;  5JH7 B;  4QIW F;  4YJ2 B;  4BIZ A;  1H2G A;  4LF4 B;  3HKE A;  1M90 W;  3JD3 A;  5JVD B;  4PJ0 Z;  4ZHQ A;  1BGY H;  5D5Q A;  1HNZ O;  1K4C C;  3CEI A;  4N21 A;  1BMF G;  2Y48 A;  4UCO A;  3ASN B;  2UXN A;  3Q4H B;  3CCQ V;  2WLH A;  4MVQ A;  1EZV H;  3RYC B;  3H01 A;  5JQG A;  1H2N A;  1R3K C;  4OXS A;  4UVB A;  4FFK A;  2EIJ C;  4I7Z B;  5KAI Z;  1H2K A;  3ABL C;  2HEP A;  1NVP B;  4U7O A;  3E83 A;  5H6R A;  5B5E Z;  2Q8V A;  2G38 A;  3JCU Z;  2W0F C;  1Q43 A;  1L1F A;  3WG7 C;  2CGN A;  5CBF A;  1I5Y A;  2VQF B;  3CHX A;  1SQF A;  3F5T A;  4LF5 B;  3U0Z A;  5GON B;  1VF6 C;  4YJ3 B;  4E4E A;  4LFB O;  2EIN C;  3DXR B;  5LOV A;  2QE7 G;  5JCO C;  3A8T A;  1YXB A;  4PA6 A;  2PZS A;  4DR6 B;  2Y0I A;  5ITZ B;  1QLE B;  1VQO V;  3FB7 C;  1K7D A;  4O2B A;  4DV2 B;  4WBN B;  3R65 A;  3SJQ C;  2JGD A;  4DV0 O;  3CRQ A;  3P3P A;  1P84 F;  1GK9 A;  3L9D A;  4EB6 B;  1NTZ H;  4X66 O;  2ETN A;  4B3M O;  2ODM A;  1H8H G;  4JI6 B;  1YJ9 V;  4YJ2 A;  3K03 A;  4GKK B;  4ZOL B;  4KFM A;  5JVD A;  3A0B Z;  3OM3 B;  1NH2 D;  1FKA O;  2GUZ B;  1MOF A;  4PI0 A;  3B09 A;  5LMN B;  2A79 B;  3Q4H A;  3C3S A;  4IYH A;  3RYC A;  1DGS A;  4CBC A;  4J80 A;  3E89 A;  3L71 H;  2PI4 A;  3KCY A;  3APQ A;  3W7X A;  2LP7 A;  1J5E B;  2LW1 A;  1NU1 H;  3K04 A;  4B3T O;  2AHY A;  1QNM A;  1HNW O;  1M1K W;  3ETG A;  4ZI7 B;  1R3J C;  5IY5 C;  1QVF U;  1S72 V;  2D2C B;  1FJG B;  2YXL A;  3S3X A;  4XBF A;  4I5S A;  4PA4 A;  4CH6 A;  2Q67 A;  2Q6A A;  5GON A;  2EIM B;  1V55 C;  2WLL B;  2CGO A;  1CP9 A;  4UB6 Z;  2P5O A;  2WSS G;  5ITZ A;  2Z0A A;  2LW7 A;  1WB7 A;  4LF7 B;  2A3Q A;  4WBN A;  2DJV A;  3BAB A;  3UO3 A;  1FS0 G;  4J41 A;  1JMK C;  1Q6H A;  3H1H H;  4MSW C;  1I5X A;  3RYH A;  3CWB H;  4RQF A;  4BIU A;  2JRI A;  3ZRS A;  3SR2 C;  2JS3 A;  3UKM A;  4K0K B;  5EC1 C;  2PUS A;  2UXX A;  3GWO A;  4DR2 B;  1K34 A;  1JFF A;  3JAL B;  1TUE B;  4D6T H;  4FJC C;  2FKX A;  4W4K A;  2GUZ A;  4JI5 B;  1LNQ A;  1KQS U;  2GTA A;  2ZIM A;  1SQV H;  4X8A A;  2ZXW B;  3BFR A;  4FLT A;  3FAV B;  4LF6 B;  1Q6U A;  3HKC B;  1JJ2 U;  2V7Q G;  4DR5 B;  2ZE8 A;  4F4L A;  2YIC A;  1K5S A;  1Y67 A;  3T1H B;  2FB5 A;  1VEW A;  3ETQ A;  5GTH Z;  1AJN A;  1FXK B;  2P06 A;  2AHZ A;  1XIL A;  1YTF B;  1FD9 A;  3GVM A;  2F4V B;  3QO8 A;  3GB7 C;  4FLX A;  4QE9 A;  1KYO F;  3E22 B;  3VQV A;  2DQ3 A;  4NTW A;  4TUY B;  2JDI G;  3ZIA G;  1Y74 B;  4BR6 A;  5KX5 B;  4OX9 O;  3JAW B;  2OTL V;  2Y69 C;  3FYE B;  3ZMZ A;  1XL6 A;  1XNR O;  2Y0P A;  4NXN B;  2XAH A;  1ZL8 B;  2UXC B;  2YXY A;  5JJN B;  1PNL A;  2B9Z A;  3W7S A;  3A0R A;  4HYO A;  3BAA A;  5KA6 A;  4DW0 A;  1WB8 A;  1KC8 W;  2PI5 A;  1GAX A;  4O4I B;  1IDS A;  1YF2 A;  3LDE A;  2ZNJ A;  3E8B A;  4MVM A;  4BIO A;  4B3R B;  4GX5 A;  3K5L A;  1OCC C;  2IJI A;  4FIP C;  2UUC B;  2EIJ B;  5CA0 B;  1ZX3 A;  3ABL B;  1GRJ A;  4U7N A;  4G28 B;  5IYD O;  1D5A A;  1UFI A;  4X20 A;  5LHI A;  4I9W A;  1NVP D;  3RW0 A;  2DWD C;  1YDX A;  4JI2 O;  4JTA B;  1OJH A;  1DK1 A;  1M4U A;  1S76 D;  2LGW A;  2X7R B;  4PDR A;  1CXZ B;  2YC0 A;  1SES A;  4CH3 A;  4X1Y A;  1PM9 A;  2YUA A;  3ZED A;  2ZE6 A;  4KP4 A;  2BOB C;  2EIN B;  3ZMV A;  5LXT B;  3WB2 A;  2GHY A;  1FXK A;  2QEX V;  3ABK B;  3AG7 A;  4DR3 O;  2V1D A;  3TJT A;  2CTP A;  4X64 O;  1P7G A;  2H8P C;  1HR0 B;  1R6T A;  3E35 A;  2JGU A;  3STL C;  1KP2 A;  3ZBH A;  2E5L B;  3E22 A;  1K92 A;  2ZIN A;  3JD2 A;  2DE0 X;  3SYQ A;  3JAW A;  4LC1 A;  2UXD O;  3ZHU A;  2V4D A;  1WLE A;  5C8Y A;  3OTO B;  4JYY A;  3ZRX A;  2WPD G;  1BCC H;  1K97 A;  2KG7 B;  3CJH B;  2UUA O;  4B3S O;  3JSN A;  1F23 A;  4O4I A;  5FNV B;  1S77 D;  1XL4 A;  2DYR C;  3R66 A;  3RYF A;  1KKD A;  1EFR G;  4XDL A;  4DV5 O;  1T5E A;  1WP7 A;  5CA0 A;  3F5W C;  2IU0 A;  2ZE5 A;  5IY5 B;  2ATK C;  3CCV V;  1Y76 A;  3PJS K;  4WFG A;  4DV4 O;  1LUW A;  2DOS A;  4FLV A;  2XAS A;  4GKJ O;  3PN1 A;  3SYC A;  4XDK A;  4JAS A;  1K33 A;  5FPO A;  4LF8 O;  3ETE A;  1VF6 A;  4FVM A;  4P30 A;  4UUJ C;  1FXH A;  4WFF A;  4FLY A;  4MS2 A;  2UU9 O;  5JCO A;  2LFS A;  3UT5 B;  3TXQ A;  4LFA O;  2DQ0 A;  3TCU A;  2BSK B;  1WAZ A;  3D3I A;  3M8A A;  4JI3 O;  1F4M A;  2EIL B;  4JI7 B;  1OCO C;  1XMO B;  4Q6G A;  1RPO A;  3AK3 A;  4ZKI A;  5LGN A;  3ASO C;  2CE4 A;  3L72 H;  5LP6 C;  4NB5 A;  3OT7 A;  1EN6 A;  2ADQ B;  2YIA A;  5L3F A;  4MT8 A;  2QWP B;  3CRM A;  1GKF A;  3BHP A;  5IWA O;  3D36 C;  2Q7E A;  2IJH A;  4LBE C;  4PA9 A;  3KKY A;  2KG7 A;  4O2A A;  4P9O A;  5F2V O;  3OGC C;  5IYZ A;  3VQX A;  2HLD G;  2E74 B;  2IU3 A;  4X65 B;  1NR7 A;  3B40 A;  3JAT A;  1BZK A;  1SQX H;  1PNM A;  1JPX A;  3SYA A;  3MAQ A;  3ZCC A;  1RPR A;  4YXW G;  2OYQ A;  4LH6 A;  1YZB A;  3WFV A;  3IAY A;  1Y6X A;  4H33 A;  1S5H C;  3CCM V;  4RUF A;  1S5J A;  4YHH B;  4FMT A;  2BCC H;  4GZR B;  3B8N A;  3HKE B;  4NTY A;  1YTF D;  2BE3 A;  1OHH G;  4DR4 O;  4JGS A;  3ABU A;  4ZHQ B;  2VS0 A;  5FPR A;  5LGT A;  4NVP A;  4I0X A;  4GYC B;  4LF9 B;  5TIS Z;  3QG5 A;  1EN5 A;  4OPH A;  4DV3 O;  2Y69 B;  1NS1 A;  1N0J A;  4LP8 A;  4JV5 O;  5KMG B;  3G71 V;  4WFH A;  1MMM A;  2Y4U A;  1IXB A;  1EM1 A;  2BSK A;  2JIZ G;  1B3Q A;  5JQG B;  4PDM A;  2K9P A;  2OIG A;  2X6B A;  3W7W A;  4TQF A;  5DN6 G;  4L8J A;  3CCE V;  1MSW D;  4IIJ A;  3EVK A;  4KHP O;  2ZR2 A;  2WAM A;  1Q7Y W;  4O4H A;  2LO1 A;  1OCC B;  4GX0 A;  2Q73 A;  4JI4 O;  4DV7 O;  1FFX B;  5JWP A;  1M57 B;  5EBM C;  3AK1 A;  1BE3 H;  2JVD A;  2JJ1 G;  3H1I H;  4X88 A;  2YID A;  2KB1 A;  4PV1 B;  1FPO A;  2CDY A;  3AK2 A;  4X89 A;  2VQE B;  5J2U A;  5CN0 A;  2QWN B;  2O57 A;  4UCR A;  5K1P A;  5LHG A;  5LOV B;  2DYS C;  2UUB O;  1MZF A;  1KD1 W;  3AG1 C;  1XNQ O;  4CS3 A;  4GX2 A;  5CMU A;  1CEZ A;  4DR7 O;  4UVC A;  1SA0 A;  2EUL A;  4H0L B;  5LHH A;  3OE7 G;  1U96 A;  4JI0 O;  2FTK A;  2UXB O;  4BW5 A;  1IBL O;  1AJQ A;  1NI8 A;  1K9M W;  4K8Z A;  1EBO A;  2P67 A;  3TET A;  1H2L A;  4MVZ A;  3L70 H;  2HJD A;  2RQ6 A;  3N2G B;  5KMG A;  1HNZ B;  3RGB A;  4JPR A;  2HFE C;  3AEI A;  4JF3 A;  3CCL V;  1PV0 A;  2P4V A;  4LFC O;  2ITD C;  1QCE A;  1IBM O;  2QM8 A;  2DYR B;  1NT2 B;  1V9P A;  1H38 A;  1Z5W A;  3SPJ A;  3JD0 A;  5KHJ A;  4NXM O;  3T4D A;  3SYO A;  4NYK A;  5LA6 A;  4NTX A;  1FFX A;  5EC2 C;  1CPY A;  2XND G;  4MTG A;  2QWQ B;  3FD9 A;  3VQY A;  3JD1 A;  3K59 A;  2X0L A;  4U3F H;  3K9S A;  2D3O W;  4JAV A;  2Q7G A;  2RNB A;  5A2Q N;  2ITC C;  4CC5 A;  2KKW A;  1IBK O;  1S0V A;  4QJF B;  5KHG A;  2XHB A;  2AW9 A;  1PL0 A;  1I94 O;  4LFB B;  1E1Q G;  2HHH O;  4AHC A;  3AG3 C;  4UCU A;  4RUE A;  2WLJ A;  1W59 A;  2W6I G;  3FKS G;  3ZHS A;  2VWK A;  3RYH B;  2ZDI A;  1AB3 A;  5CA3 A;  4DV0 B;  2F1M A;  1OCO B;  4H37 A;  1YHQ V;  2R9R B;  4J9Y B;  4Z1V A;  4X66 B;  2IBZ H;  4B3M B;  3CP1 A;  3OUS A;  5LP6 B;  3JAS A;  1JFF B;  1HWY A;  3CX5 F;  4GCZ A;  2MW2 B;  1QR8 A;  3O65 A;  4CH4 A;  1P49 A;  3KZI Z;  3N2G A;  2F66 C;  2LQT A;  1SER A;  2ZQM A;  4GLX A;  1AR4 A;  1NZ6 A;  2YDE A;  4R50 A;  1N32 O;  5EBL C;  1YJN V;  4GT1 A;  2QKS A;  1AVM A;  3B4S A;  1W0K G;  3B2E E;  4R6Z A;  5CA1 A;  3U10 A;  3CCJ V;  4LCU C;  1P7B A;  3OR6 C;  3TGU H;  1J5E O;  4B3T B;  1YJW V;  1HNW B;  4IT5 A;  4X1I B;  2NR5 A;  3TK1 A;  3G6E V;  4R8C A;  3CRA A;  3L74 H;  5J2T B;  4OGQ B;  4H13 B;  3LSQ A;  4BAY A;  2ZCE A;  1FAF A;  1LR1 A;  1SZT A;  2QDO A;  2EZP A;  3CS5 A;  1OZ0 A;  1HNX O;  3QF7 A;  1NTM H;  2Z5U A;  2YIB A;  1MNG A;  1NTK H;  5B1A C;  3LDC A;  4OPA A;  4X1K B;  2CUG A;  1SQQ H;  5BY1 A;  4RWU A;  1E1R G;  4AQY O;  2YSU B;  2WLN A;  3UO2 A;  3ZMU A;  4AIL C;  3D3Q A;  4TT3 G;  4FK5 C;  2LFR A;  5LP6 A;  1JX9 A;  2P6J A;  4C7U A;  3SPI A;  1XOU A;  4X20 B;  1MSD A;  1VQ5 V;  2F43 G;  4EFB A;  3FB6 C;  2A9H A;  3B77 A;  2IM9 A;  1Q8I A;  1V54 B;  2PYJ A;  3D36 A;  4WF9 V;  5EK0 A;  1JJO A;  4X1Y B;  4QPJ A;  3CME V;  1F7Y A;  3OFN G;  2EJ7 A;  3W7U A;  4BW9 A;  4HAM A;  2RN9 A;  2IH3 C;  4IHJ B;  3CCS V;  2Q7H A;  3IGA C;  2WWW A;  2P4K A;  2RMK B;  4LNU A;  3SYP A;  1GN4 A;  2E76 B;  4X1I A;  3QVN A;  1OCR B;  4FPP A;  5KLV H;  3RWR D;  5J2T A;  2EIK C;  3RVZ A;  4MTX A;  2QGN A;  3RT3 C;  3T2M A;  3JYC A;  1R6K A;  2AZ2 A;  3J7A U;  4MTO A;  4J7K A;  3OR7 C;  3APO A;  2P22 C;  4HNA B;  1R73 A;  1XDC A;  1B04 A;  3RFR A;  5C8Y B;  4JYA O;  2GBO A;  3CD6 V;  4P2Z A;  3CPW U;  4OX9 B;  5KHI A;  4PHZ A;  1D5N A;  4X1K A;  1GTO A;  1KU9 A;  1BS3 A;  3CRC A;  1XNR B;  3ETD A;  3ZHQ A;  4WFA V;  4MVU A;  4FZ1 A;  1NBM G;  4GX1 A;  3RYF B;  3QO7 A;  1YVW A;  2MK3 A;  2RCV A;  1J95 A;  3DC6 A;  3K5O A;  1QR9 A;  1BHA A;  3J81 N;  4UCV A;  4J10 A;  1Y76 B;  3MDS A;  5L3G A;  1VQ7 V;  3WG7 B;  3JSL A;  2CTR A;  1EZJ A;  1VQN V;  5FLX N;  1SQP H;  1L0N H;  2CK3 G;  3SJC C;  1N33 O;  4TV9 A;  1ROP A;  3D8C A;  4FM2 A;  4JI2 B;  2ZKO A;  1AP6 A;  2R72 A;  3RVY A;  1FYJ A;  1W2B U;  1XMQ O;  3BVO A;  1IUR A;  2R9I A;  1H8E G;  1VQP V;  5IT9 N;  5BMV A;  1I0H A;  4IHJ A;  2IW5 A;  3OUF A;  5KHK A;  4CC6 A;  3T1Y O;  2PF4 E;  2ZDI C;  3CB2 A;  2YIB D;  3AG3 B;  5BR8 O;  1Y4M A;  4NKG B;  1SKV A;  2NLJ C;  4DR3 B;  4DR1 B;  2EJR A;  3ZRW A;  4LH7 A;  5EYP B;  3SDL A;  2P7T C;  4X64 B;  1D2D A;  3TXS A;  1NJI W;  4HNA A;  2DWE C;  3ZX6 A;  1G1X B;  2QKA A;  2L35 A;  2QR4 A;  4PDV A;  4JAA A;  3RN4 A;  4O2A B;  2UXD B;  4DV1 O;  2OWO A;  5IYZ B;  1XHX A;  3P32 A;  3OTO O;  4I9Q A;  1G6U A;  3CC4 V;  3ASN C;  2UUA B;  1TA8 A;  1Y66 A;  3K0D A;  1RSO A;  4B3S B;  3JAT B;  4PEL A;  1WJZ A;  1Q3E A;  3JCZ A;  1QBZ A;  1B6Q A;  4J42 A;  3C3T A;  5B1B C;  3KG2 A;  5H5N A;  4O4J B;  4DV5 B;  3ABM C;  3K9A A;  4ICG A;  4IGG A;  1WN7 A;  3DTU B;  2Q69 A;  2PY5 A;  1XHZ A;  1GM7 A;  3FB5 C;  2JEU A;  3ZN0 A;  1NKD A;  3RYI B;  4DV4 B;  2Q5Z A;  2RJZ A;  2OIE A;  4WFB V;  1V55 B;  4I0X B;  1QVG U;  3MD0 A;  2Q0O C;  4GKJ B;  1R1B A;  4MW3 A;  1S3J A;  3BA8 A;  2GV9 A;  1FFT B;  4FFB B;  3U11 A;  4LF8 B;  4PDL A;  5KA5 A;  1JOY A;  4DK1 A;  1JCH A;  3QTC A;  1MAB G;  5B1A B;  2XAF A;  2YEV A;  2UU9 B;  2OCC C;  2WLI A;  1E79 G;  2QTO A;  2XUM A;  5LMU O;  2FML A;  5EYP A;  4JI3 B;  4B7K A;  3N2K B;  4G2K A;  4IIJ B;  1W0J G;  4CZZ A;  4O4H B;  5KUK A;  3LNN A;  3ZJZ A;  1O9G A;  2QM7 A;  5BXZ A;  1VQK V;  1IX9 A;  2Y4T A;  3OTF A;  3G6B A;  2JK5 C;  1ZSP A;  1K8A W;  2DN9 A;  5IJ9 A;  3G4S V;  4DV6 O;  3E8F A;  2VRZ A;  5IWA B;  3IC7 A;  5J2U B;  3JAM N;  2DMX A;  2ADP A;  4JYC A;  4JZ2 A;  4DUZ O;  3ZS8 C;  1WA8 A;  4I55 A;  4X62 O;  3K79 A;  1M5I A;  4O4J A;  1SA0 B;  1DTO A; 
#chains in the Genus database with same CATH homology
 3L70 H;  1BE3 H;  1NU1 H;  3H1K H;  2BCC H;  3H1I H;  3H1L H;  5KLV H;  1EZV H;  3CX5 F;  2FYU H;  1KYO F;  3H1J H;  1PPJ H;  1SQP H;  1PP9 H;  4PD4 F;  1L0N H;  1NTM H;  1SQX H;  1BCC H;  1P84 F;  3CXH F;  3BCC H;  3TGU H;  1KB9 F;  1NTZ H;  1NTK H;  4D6T H;  4U3F H;  1BGY H;  3L74 H;  3L71 H;  1L0L H;  1SQQ H;  1SQB H;  3H1H H;  1SQV H;  2A06 H;  2IBZ H;  3CWB H;  3L73 H;  3L72 H;  3L75 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...