4QNHB

Calcium-calmodulin (t79d) complexed with the calmodulin binding domain from a small conductance potassium channel sk2-a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ion transport/protein binding
molecule keywords Small conductance calcium-activated potassium channel protei
publication title Selective phosphorylation modulates the PIP2 sensitivity of the CaM-SK channel complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qnhB00
2X6BA 1KKDA 1V55C 3FB7C 4R50A 2WLMA 3ABKC 5EK0A 3K06A 3T4ZA 5BZBA 5CBFA 2EILC 2DWDC 1M56C 4TWKA 4MTOA 2NLJC 4I9WA 4MS2A 4PA4A 3E83A 2A9HA 4XDJA 1LNQA 2ITCC 3SPIA 3AG3C 4CBCA 5KUKA 3OR6C 4MW3A 5EC2C 3AG1C 3E89A 3RVZA 2Q69A 2HJFC 3X2QC 5EBLC 3E8GA 3F7VC 2KB1A 3HPLC 4HYOA 4RUFA 3SPGA 5B3SC 2JK5C 2HVKC 2HFEC 4P9PA 4WFHA 2WLIB 4MTFA 3SPHA 4PA7A 1M57C 3LDDA 3K0DA 5CBHA 1BL8A 2K1EA 4X8AA 1R3KC 4MVOA 3T4DA 2EIJC 4PDRA 2BOBC 2IH3C 4QE9A 2HG5C 2WLIA 1JVMA 3LNMB 4HZ3A 1OCCC 1OCRC 4MVRA 4GX1A 4GX5A 4PA6A 4PA9A 2WLNA 4PA3A 2AHYA 3STZC 3T2MA 3TCUA 3LDCA 4MW8A 3ASOC 1K4CC 4R7CA 4XDKA 2EIMC 4LCUC 3SPCA 4MTGA 3SYCA 3R65A 4RUEA 2Q67A 4X89A 2DWEC 1R3IC 2EINC 3BEHA 2DYSC 1ORQC 2A79B 4BW5A 4XDLA 2HVJC 1XL4A 3OUFA 5J9PC 3ASNC 3SYOA 3F7YC 3UM7A 3FB8C 1J95A 4PDLA 3VOUA 4KFMA 1V54C 3FB5C 4LBEC 4MVSA 2OCCC 4DXWA 4WFEA 5B1AC 3ABLC 3KG2A 3STLC 4MSWC 2AHZA 5KUMA 5E1AC 2W0FC 4J9YB 4R8CA 3SPJA 3SYAA 5IY5C 4JTCB 3E8BA 3WG7C 2H8PC 1ZWIC 4MVZA 2Y69C 4PDVA 3RBZA 3SYPA 4R6ZA 4RO2A 4GX2A 2ZXWC 4P30A 1R3LC 5EBWC 5CBGA 3OR7C 4RAIA 3E8FA 4EKWA 2WLJA 1S5HC 3K04A 3PJSK 1K4DC 4QE7A 1OCZC 2R9RB 2X6AA 1R3JC 4P2ZA 4G27B 4G28B 3K08A 1P7BA 2Q68A 3AG4C 4J9ZB 3TETA 3IGAC 4MVUA 4P9OA 3LUTB 1QLEC 2EIKC 1XL6A 4ZBMA 4H37A 4WFFA 3ABMC 3UKMA 3LDEA 4GX0A 2WLLB 4MVMA 2ZD9A 4UUJC 2A0LA 2Q6AA 5EC1C 3SJQC 3ZJZA 3F5WC 2X6CA 4H33A 3K03A 3GB7C 3IFXA 3OUSA 4MVQA 2QKSA 3E86A 2BOCC 4JTAB 4PDMA 1G4YB 2WLKA 3ZRSA 2YEVA 3K0GA 2WLLA 2WLHA 3SYQA 2P7TC 3OGCC 4JTDB 2ATKC 3E8HA 4WFGA 2IH1C 4LP8A 4QNHB 3AG2C 4X88A 2QTOA 3JYCA 5EBMC 3RVYA 3EFFK 3RW0A 4F4LA 2ITDC 5B1BC 2DYRC 4OXSA 3T1CA 1OCOC 3FB6C
chains in the Genus database with same CATH superfamily
1YJNV 5JH7A 5GTIZ 2ZINA 1SF9A 1SA0B 3RGBA 1H2SB 5LA6A 1KECA 2UUCB 1UPGA 1NT2B 2KKWA 4UCRA 1N0JA 4JV5O 1D5AA 4DV1B 1SQFA 4KP4A 5EC2C 1IZ3A 2MW2B 4LFCB 4FK5C 4A5UB 1NI8A 4WFHA 4GKJB 4H13B 2QM8A 4PA7A 4B3SO 1YITV 2RNBA 4FIPC 5CBHA 2GV9A 3CCRV 4YJ2A 3OMIB 3ZMSA 3L75H 4WFBV 4PA6A 4BR6A 2FMLA 4JI5O 3CCVV 2EIMC 1N36O 3AK1A 2LP7A 3EVKA 3SYCA 4ZKIA 1WB8A 3W7XA 2IJHA 3AG2B 4NXNB 3ZHQA 3OTFA 3OFNG 4CH3A 1J5EO 1P49A 4X1YB 2P6JA 4NYKA 1M57B 3FB8C 4QPKA 1XMOO 3JATA 1FXKB 3ZX6A 5LP6C 2P22C 4LR3A 4O2AB 5LOVA 3SPJA 2JGUA 4B3RO 2EZPA 2LJ2A 4B08A 4CS2A 5IYZB 5IJ0B 2HHHB 2R9RB 4P2ZA 4EB6A 4FLWA 3AG4C 1I5XA 1SS3A 4ZBMA 3H1IH 2F4VO 5A9GA 2Q6AA 1QLNA 3OE7G 3C3SA 1TUBB 2QKSA 3ICXA 1EM1A 5LL6Y 2BOCC 4ZI7A 5DM6V 4W4KA 2DYSB 4KUMA 5EBMC 4U7NA 1YCIA 4J80A 5JQGA 4K0KB 4RWUA 2VWJA 2DN9A 1R1BA 3B77A 1S77D 3T4ZA 1YVWA 2PYLA 3HKBA 3JAMN 4I9WA 4YIPA 3CSXA 3SJBC 3B8NA 4DV3O 4DR3B 1H2MA 2KB1A 4JI8B 3B8MA 1OCZB 4LWSA 2JS5A 3SPGA 4MTFA 1TAEA 1M57C 3K0DA 1XNQB 3T4DA 1PL0A 1FXKC 2WLIA 1JVMA 2UXBO 2AHYA 3CEIA 1AJNA 1K4CC 1WP7A 4LCUC 4RQEA 1IXBA 1VQMV 3RYFA 4YHHB 5K1XA 2CAZC 3CCEV 1JFFA 1K5SA 2YI9A 4PDLA 4DV2O 4NTXA 4MVSA 5BY1A 2FL4A 2GBOA 3M8AA 4J9YB 4U3JB 1BHBA 1UFIA 2JVDA 1BE3H 3HKCB 4PELA 1IBMO 4D7TA 3QTCA 4DR2B 1NS1A 1K4DC 2YIDA 3H01A 2BCCH 1MZFA 1DGSA 1NR7A 1YHQV 4P9OA 1I7FA 2D2CB 1GK9A 4TV8B 3LDEA 5EC1C 1KUQA 1IBKB 1BCCH 4GLXA 2YIAA 3OM3B 4ZHQA 3W7TA 1PL4A 2QM4A 2ZR2A 3D3QA 2YEVA 3CC7V 2WLLA 3JD2A 3B40A 2ARHA 3E2EA 2QWRB 4L8JA 4LF4B 5ITZA 2ITDC 1SC5B 3H1LH 1GO3F 2YXLA 3CMAV 1BS3A 1QLEB 4I0XB 2A06H 2B9ZA 3RT3C 1VF6A 3IC7A 4TWKA 5EIBC 1NQTA 1NU1H 2CTQA 5GTHZ 1E79G 2RN9A 2YIBD 2XUMA 3SPIA 1K8AW 1H8HG 1MNGA 3A8TA 4X65O 1FXHA 2ILMA 1M9NA 4TUYB 1IDSA 2GDSA 5BMVB 5GONB 4LFBB 1R3KC 3JD1A 3OEEG 1EN4A 3P3NA 2IH3C 3ZN0A 4GX1A 5FNVA 1XNRO 3AG7A 2Q8VA 3Q4HB 2M6YA 3HKEB 4X20A 3RYHB 1M1KW 4NB5A 4LF6B 1TA8A 4XDLA 3OW2U 3JALA 3AK3A 3FB5C 1B06A 1S3JA 4JAAA 2QSAA 3UT5B 2FKXA 1OCCB 4MSWC 5KUMA 3N2KB 3SGIA 4LNUA 3M7MX 5KMGB 1MOFA 1RPOA 1M4UA 3TK1A 1PNKA 5EBWC 1NVPB 1SQGA 2B1IA 5B3SB 3BPZA 2P5OA 2N05A 1H38A 3LUTB 1QLEC 4OX9O 4H37A 4WFFA 3QF7A 1MA1A 3DXRB 4DV4B 3K03A 3GB7C 5LYJB 5DEDA 5E79Z 1XMQO 1VQLV 2JEUA 4JTDB 4RQFA 2EINB 4CC5A 3JAWB 3APOA 2VQEB 1L8DA 3JAKB 1F4NA 3OMAB 3EHBB 1IVSA 3BVOA 4LF8O 3K9AA 3T1YO 3K5MA 3ABLB 4NVPA 1Y6XA 1K97A 2WSSG 4DV6O 3TXSA 4C7UA 4LFAB 2F1MA 5EZYA 3AG3C 1RFYA 3F7VC 1R6TA 5HFMA 4CH6A 4DR5B 1FYJA 3FX7A 2HFEC 1AVMA 3G67A 1GM7A 1VEWA 3D8CA 2Q7HA 1BL8A 2UUBB 1KP2A 5H2FZ 1OCCC 2BSKA 1F7YA 3LDCA 2Y4UA 1KD1W 1HW7A 4FLXA 1KMIZ 2QE7G 3ZHRA 1AP6A 1GKFA 2UXNA 1R3IC 4FFBB 1ORQC 1HP8A 3CC4V 1HWYA 5LHHA 1HNWB 3CXCU 2UUCO 4DV7O 5GW7A 4O4LB 1VQ7V 2XAGA 2IW5A 2QKCA 1Q6UA 1KP3A 5KA5A 2OTJV 5JWPA 4WCEV 4UVBA 4YJ3B 4QPJA 4EKWA 1S5HC 3K04A 2UU9O 1N34B 4GKJO 2DOSA 2EX3A 2OCHA 4G28B 4E4EA 5LMUO 4J9ZB 5LMNB 4X62O 4JZ2A 2Y4TA 2KQXA 5B1AB 2YICA 2VWKA 5F2VO 1BSMA 4I5SA 1JMKC 1BQ0A 5L3EA 2A0LA 4JI6B 1N33B 4NTWA 5L3FA 3BABA 3JARA 2GTAA 3B09A 1VQ5V 5IT9N 3ABTA 4FM1A 5HFLA 1OJHA 1H2LA 1AI4A 5KX5B 2YXYA 4IHJB 2ZDIA 1Q81W 3BA8A 1YDXA 2QGNA 1XQ8A 1S5LZ 2CH7B 4I55A 1N32B 3CJHA 2X7RB 4E2LA 5K1PA 4X1IB 4DW1A 2ZM6B 1G6UA 3E83A 2A9HA 3CXHF 1SA0A 4O2BB 3BA9A 2Q69A 2H94A 3ZS8C 2OIEA 2JK5C 5LBQA 4ABMA 4JI4B 4IYHA 2D3OW 4W4LA 1GTOA 4U3FH 4TSFG 3MHSC 3A0HZ 4ASUG 2ZE8A 4DUYB 1WB7A 3ZRWB 4N23A 1HR0B 1JJOA 4I9QA 3DC5A 4JI3B 4ZIBA 3RYCB 3SYOA 4OPAA 3L71H 4X1KB 1AB3A 4WFEA 5B1AC 4X1YA 1EN5A 2K9PA 3ZMVA 1W0JG 4JI2B 4GUNA 4LF7O 2EZOA 1Q3EA 4MVZA 5C8YB 2LQTA 1FXKA 1RSOB 4DO2A 2LFRA 2IJJA 2ZIMA 4O2AA 4NKGB 3RYIA 4EFBA 4DR3O 2QWPB 2UXDB 3ASNB 4TQDA 5IYZA 1K73W 1XNQO 5CMUA 5TISZ 2R70A 4GZRB 4MVMA 5IWAB 2ZD9A 1SQVH 4DR4O 1V9PA 2Z5UA 4J41A 1VMGA 3SYQA 2OWOA 1TUBA 4YHHO 1O9HA 1VQ8V 4X88A 4O4IB 1WA8A 2BTQB 4PI0A 4YXWG 1VQ6V 1OV9A 2F95B 2FTKA 3T1HB 1LR1A 3OAAG 1EBOA 1Y66A 3FYEB 2ADPA 2EJ7A 5L3DA 5CB4B 3CE2A 3F5TA 1K34A 4X64O 1YI2V 1NTMH 4N21A 2HJFC 3E8GA 4J11A 3IJ4A 5IDJA 4P9PA 4FLZA 2XT9A 3AG4B 2B5UA 3I5DA 2Z3YA 1M93A 4UXNA 1KQSU 3FD9A 4DV0B 1GN4A 2QJ1A 3P3PA 4R7CA 3SPCA 5BR8B 2Q67A 1MSDA 2WA4A 3MAQA 1YJ9V 3ZBHA 5JJNB 5KHIA 5DN6G 3ASNC 3ABUA 4JF3A 1L1FA 1J95A 1NH2D 4DW0A 1P7GA 4H0LB 5J2UA 3EXAA 1YTFB 2CK3G 4GKKO 1N4CA 5IY5C 3ASOB 3JD4A 2P90A 1JA8A 3JASB 3C90A 5FPOA 3RN4A 3VQYA 3G80A 4U3JA 4X66B 3K5OA 3W7UA 4LFBO 2O57A 1G8MA 1U96A 2PYJA 5L3BA 4KHPB 1FJGB 3APQA 5CA3A 2IBZH 4PDMA 1G4YB 4TV8A 3K0GA 2WLHA 3DC6A 4LF6O 2KG7B 3K59A 3ZRXA 3QO5A 4FLUA 1SZTA 1XREA 4JYYA 5JCOC 4B3TB 4NTYA 2UUAO 4XDJA 4JI7B 2ZCEA 4JGSA 4UCVA 3E89A 3OEHG 5EBLC 3GVMA 2YSUB 2RDCA 2G38A 4I4TB 1Z2GA 3ML0A 5IYCO 4DR6O 2EIJC 2HG5C 3STZC 3CCJV 3FYIB 5BMVA 4MW8A 1EFRG 3ASOC 5GONA 4MTGA 3JD3A 2UXCO 3R65A 4X89A 2VQEO 2Q7EA 1XOUA 4FM0A 1XHZA 2HLDG 1AR1B 3VOUA 4LBEC 3CCQV 4LF5O 4DXWA 1ROPA 5LXTB 5H5NA 1CPYA 4LF9O 1ZWIC 4AHCA 4ZOLA 2W6IG 1HNZO 2ZXWC 3UT5A 4JZGA 1S72V 2QM7A 3N2KA 4DR5O 1Z5VA 1GM9A 3GWOA 5KMGA 2X6AA 2ETNA 2QKAA 2FB5A 3J80N 3CRMA 3N2GB 2F43G 1XILA 3OUSA 3B4SA 1XBLA 2P7TC 3OGCC 3E8HA 4J7ZA 3DXRA 5B66Z 4YJ2B 5LYJA 2DE0X 2JGDB 3JCZA 4B3MB 1QNMA 3NXSA 3U11A 1AI5A 3FB6C 4Z2WA 1I5YA 3JAWA 3CCLV 3BRCA 4AQYO 1YIJV 2E5LB 1DF5A 2XAJA 1LNQA 4CBCA 2OIGA 4MW3A 1CEZA 1N34O 4I50B 3GWKC 1FS0G 3PN1A 5LMNO 1EN6A 3CC2V 1Y74B 3CHXA 5CA1B 3OMNB 3H9VA 1ENVA 4F6RB 2BE3A 2EILB 3M99B 4QE9A 1F4MA 2WLNA 2LO1A 4GCZA 3D36A 2PGGA 1K92A 2A7WA 4HNAB 2ZNIA 1MZEA 4JV5B 3P30A 1KC8W 2JRIA 2FYUH 2R9IA 5J9PC 1BGYH 1N32O 4KFMA 1K7DA 4B3SB 4L87A 3BCCH 4FFBA 4YIOA 3CB2A 3KZIZ 3FFQA 3QVNA 3O65A 2AGAA 1SQPH 3CRRA 4NXMB 1X4TA 4JI5B 1QVFU 1QU7A 1R3LC 1N36B 3AG3B 3CCSV 2WLJA 4QIWF 2NNUA 4QE7A 3ZMUA 2XAHA 4DUZO 5H6QA 2GUZA 1PNLA 4WBNB 1I94B 4YJ3A 3IGAC 1XMOB 4D7SA 2W6JG 5LHIA 1ZUQA 4JI0B 4H33A 3SJAC 1N0NA 1JX9A 4B7EA 2IM9A 3ZIAG 3DTUB 2AW9A 4LWSB 3B2EE 3ZRSA 1T5EA 5IJ9B 3OD4A 1Q86W 1YF2A 1VF7A 1ZLZA 2CDYA 2ZIOA 1X59A 3OTOB 2IJKA 2DJVA 3FB7C 3QNEA 3IC9A 3ABMB 4JI2O 5CBFA 2F4VB 2EILC 3QO7A 1K5QA 3RYFB 1Q6IA 2NLJC 4X1IA 3MDSA 1JQ0A 1NTKH 5JJJB 3L9DA 1JJ2U 4DRXB 4IIJA 2LFSA 4O2BA 4GYCB 3H1HH 1HDJA 2N74A 2BOBC 1OCRC 1GN2A 4PA3A 2F66C 5B1OA 1PNMA 2UXXA 4DV3B 2BTOA 1WLEA 3CWBH 5LGTA 1QQCA 1M5IA 3ZRWA 1WJZA 2XASA 3U10A 4O4JA 3T1HO 4ZHQB 1AP5A 1IBLO 2ADQB 3RYCA 4IL6Z 3TJTA 3ZMZA 3MHHC 3WB0A 4FLVA 3I56V 4X1KA 1Y76B 5ITZB 2UXBB 2Y69C 1F23A 4RAIA 2QDOA 4O4HB 1IX9A 1FFXB 4PI2A 3L73H 5C8YA 1RSOA 2CE4A 3G71V 1I08A 1Q8IA 3K08A 4DV2B 1TVKB 3ABMC 3J7AU 1BQZA 3ZHSA 4DV1O 3AEIA 4DR1B 2WLKA 5BR8O 1SQXH 4QNHB 2V7QG 4LFCO 5B1BC 1KYOF 3WFVA 2OYQA 2EIKB 1TGOA 4R50A 1LUVA 4O4IA 2BTQA 1O9GA 2PZSA 1M56C 4H44B 1NZ6A 4GT1A 5LP6A 2PTMA 3OT7A 1RPRA 4NXNO 3AG1C 3H1KH 3UO2A 4TV9B 2JJ1G 5CB4A 1WNSA 3RWRD 2HVKC 4LNUB 2IJIA 2XAQA 4KHPO 2MK3A 3CP1A 2VQFB 2VRZA 1KKCA 4XBFA 3S3XA 2HHHO 3X2QB 2GSMB 4BWAA 4CZZA 3F7YC 5B1NA 4B3TO 1I0HA 1DLBA 4JTCB 3L70H 1XNRB 4GX2A 2YUAA 4JI7O 4P30A 3CRAA 4FPPA 3C3TA 5AG2A 5D5QA 1Q43A 3JASA 4K0KO 1AJQA 1H8EG 2KSDA 2EIKC 1MG1A 5L3GA 1G1XB 5EZYB 1S76D 1QVGU 1PM9A 4UUJC 4WFAV 4JI1B 3ZJZA 5CA0B 4JYAB 1Z5WA 4FFKA 3SR2C 1ZL8B 1WPXA 2CUGA 1NTZH 2HJDA 4WF9V 1S0VA 4LP8A 5KHHA 1K9MW 4JI8O 4DV5B 5KAIZ 4IGGA 4OXSA 2Y48A 2QWNB 5IJ0A 1DK1A 2KG7A 1FKAO 1YXBA 2LGWA 5DECA 2WA3A 2DWDC 3A0RA 5IY5B 4UCOA 2ZE7A 2CGOA 2B1GA 2VS0A 5KHKA 3CRCA 2OTLV 1XMQB 4DK1A 1W2BU 1AI6A 3X2QC 1MSWD 3KCXA 1YSCA 1NVPD 1K33A 1VARA 2Q7GA 3K5LA 4LF8B 3T1YB 5FLXN 1B3QA 3LSQA 2QTSA 3FAVB 1NR1A 3W7SA 4I4TA 4DV6B 3TCUA 3ETQA 2HR3A 3DSQA 4BW9A 5LGNA 1RM1B 3BY6A 1PP9H 4DR2O 2QEXV 1QHTA 3R66A 2RCVA 2ZE5A 3SJCC 3UCSC 4Q6GA 2YI8A 3HB3B 1Q82W 1IBKO 3HKDB 2E5LO 4R8CA 1JCHA 4CH4A 3K5NA 5LXTA 1FD9A 3K79A 1BZKA 1FPOA 2LW7A 3LNNA 1BT8A 4I55B 3E8FA 4LF4O 2YXHA 3LSUA 1YJWV 3KKYA 4JYBA 1P7BA 2Q68A 4FVMA 3TETA 4MVUA 3L74H 1XL6A 2OT5A 2EIJB 4UFZA 5EYPB 4K3AA 3CRQA 3F5WC 4DV7B 4MTXA 5KA6A 4MVQA 2Z0AA 4JASA 2WAMA 5J2TB 5BXZA 1HNXB 2Q0OC 1PD3A 3N2GA 2JJ2G 3RVYA 3RW0A 3JD0A 2UU9B 3HKCA 4AI8A 4UCUA 2CGNA 1V55C 4FZ0A 5LMUB 2WLMA 4X62B 2JGDA 5KHJA 2NN4A 4UB8Z 1B04A 4UB6Z 2LW1A 3VBBA 4NXMO 1DF4A 4MS2A 1LUWA 2Q9LA 4D6TH 2ZXWB 1SRYA 1RP3B 3OR6C 4CH5A 2ZE6A 2L35A 1VIBA 1YEWA 1RM1C 1JR9A 1YZBA 1I94O 1KB9F 1THZA 4I50A 3E22B 4UV8A 3ETEA 4Z1VA 1R6NA 4JI0O 2CTPA 2Y0IA 3RYIB 2PI5A 4BAYA 1Y74A 3LNMB 3T2MA 2ZDIC 2XTAA 5CA1A 3G6EV 4I0XA 4F6RA 4XDKA 1MABG 1IURA 5H9CA 3ZHVA 4I7ZB 1WP8A 1XEQA 1W0KG 4HNAA 3OTOO 3OUFA 1BMFG 4DR7B 5IYDO 1SQBH 1E1QG 4K35A 2EULA 3A2FA 1NKDA 4G2KA 1NJIW 2PY5A 3QO8A 5E1AC 4DV4O 1BHAA 4TUYA 1WA8B 4F6EA 3OGIB 5JVDB 4JYCA 3THOA 5FL7G 2RJZA 1PKXA 4TOIA 2V4DA 3RFRA 3Q4HA 1V54B 2Q73A 3HKEA 2QR4A 1GN6A 4UVAA 1U97A 3RYHA 2RQ6A 3WB1A 3P32A 4UCTA 3UKMA 2JS3A 2PUSA 4LFAO 4WBNA 2X6CA 4LF7B 5LGUA 4Q20A 4K8ZA 4MT8A 2CTRA 3AG2C 2QTOA 3JYCA 5JH7B 4J7JA 3EFFK 5CN0A 1B6QA 2R9AA 5IJ9A 5LA6B 2PI4A 1EZJA 5BZBA 2UUBO 2ZQMA 5D5PA 4J7KA 4MTOA 4PA4A 4DR4B 5J2UB 1OCOB 1M90W 4AILC 2L6LA 2QA4V 5KAFZ 4LH7A 4TT3G 4YY3B 1HNWO 1D5NA 4IYIA 4HBNA 4DRXA 3JAKA 4GX5A 3WB2A 1XHXA 4DR1O 2DQ3A 3AK2A 4OPHA 1SERA 2DW4A 1ZX3A 4X64B 2HEPA 2DYSC 3JATB 2ZNJA 3U0ZA 1N8RW 1SQQH 2HP8A 1H2KA 2HVJC 4EEQA 5L3CA 5LOVB 2P4VA 1V54C 3STLC 4JI6O 2AHZA 1N33O 3CD6V 2H8PC 2Y0PA 3CCUV 2AXTZ 4PDVA 1Q5OA 3ETGA 1GH6A 1ZSPA 4EB6B 2C2AA 1Y76A 2DQ0A 4QGPA 3NR7A 3PJSK 1OCZC 1AROP 3G4SV 1Y67A 2ZT9B 2GHYA 4O4HA 2XOKG 1FFXA 1SZXA 4U7OA 4ZI7B 4FMTA 2VQFO 2ZM6O 3JSNA 3W7WA 1OCRB 4GKKB 1TVKA 3CS5A 3ZMTA 5JQGB 5LHGA 2ATKC 4WFGA 2IH1C 3A0BZ 4O4LA 3D3IA 1AI7A 1OCOC 4Z1MG 1J5EB 4JI4O 3ZRVA 3HKBB 3UO3A 4BIUA 3QG5A 3N27A 2YDEA 1YTFD 2Y69B 4DUYO 2RMKB 1XDCA 1WAZA 4B3RB 1VQKV 1UJWB 1HR0O 5KUKA 4KXRA 3RVZA 4JI3O 2DYRB 4HYOA 2F23A 2WLIB 5KX5A 4IHJA 4ZOLB 3K58A 4TV9A 4X8AA 4JI1O 4CS4A 4LH6A 4PDRA 4JYAO 4HZ3A 2F93B 2CH7A 1FAFA 1WPBA 1WN7A 1L0NH 2UUAB 1JFFB 1Q7YW 4RUEA 2Q4PA 4DV5O 4PD4F 4UV9A 4DK0A 5B1BB 1VQ9V 2UXDO 4BW5A 1DTOA 2XNDG 2E3CA 2IU3A 2H3OA 4JPRA 5IWAO 4DR6B 3WG7B 4FM2A 1JPXA 1M56B 4CC6A 1R6KA 1P4RA 2UXCB 3AG1B 1K3EA 1QR9A 1COWG 1VQOV 2IU0A 1GMGA 4G27B 1AJPA 1US6A 3CYOA 4LF5B 3ZHTA 4NR1A 2YEVB 2WLLB 1JOYA 2CTWA 3WU2Z 3K3WA 1EZVH 4LF9B 3E86A 2Q0AA 1OHHG 2QWOB 1HNZB 3JSLA 5CA0A 2HKOA 5H6RA 3CPWU 1ZL8A 4LC1A 2DYRC 1NH2B 1SKVA 5IYBO 4BIOA 5EK0A 3K06A 3DGEA 3ZN1A 3ZEDA 1PPJH 2E76B 1GAXA 4DV0O 1FXVA 3LSSA 2JIZG 1QCEA 1PV0A 4IT5A 2E75B 5EIBD 2ITCC 1ZAUA 1IBMB 1SETA 4RUFA 1TUEB 5B3SC 4CS3A 2ODMA 3SPHA 3ABKB 1VP7A 5FNVB 3K57A 2ZKOA 4J42A 5IE9A 1CP9A 2AZ0A 4PV1B 3FKSG 3WG7C 1Q6HA 4X20B 1URFA 4PA9A 4KL1A 4AQYB 1GN3A 4UVCA 1HNXO 3FAVA 2GUZB 3JALB 2EBOA 3VQXA 2EINC 3BEHA 3VQWA 2A79B 4HAMA 1KBHA 1F51A 3KCYA 4X66O 2V1DA 1L0LH 2P06A 5C93A 4JAUA 1QBZA 3ABLC 1FJGO 2W0FC 1AR5A 3E8BA 5A2QN 3RBZA 4FLYA 4R6ZA 4RO2A 3UQ8A 1Y4MA 5JCOA 5CBGA 4X9QA 3HKDA 5FPRA 3TXQA 5B5EZ 1OZ0A 2YIBA 2LGQA 2QWQB 4OGQB 4X65B 1VF6C 1S5JA 2OCCB 3D36C 3L72H 1R73A 4GX0A 3BAAA 1W59A 1A32A 3IFXA 5EYPA 1SESA 3K9SA 4IIJB 5J2TA 3BFRA 3CMEV 3T1CA 3BHPA 3VQVA 4DR7O 1XI1A 2X6BA 4DUZB 1KKDA 2NR5A 1NBMG 3ABKC 1ZTEA 3G6BA 3IAYA 4FZ1A 1H2GA 1MMMA 1D2DA 1FFTB 5JJEB 1VQNV 4FJCC 4O4JB 3JCUZ 2Q5ZA 3HPLC 4B7KA 1CXZB 3H1JH 3I55V 3ZCCA 2BSKB 2N04A 3LDDA 1VF5B 3SDLA 3CX5F 1VQ4V 2K1EA 4MVOA 4UCSA 4OX9B 4MVRA 5KHGA 3TGUH 1GRJA 4DYLA 1QR8A 1KU9A 3E22A 1GM8A 2JDIG 4PJ0Z 1P84F 2EJRA 2JEXA 3ETDA 1IXMA 2DWEC 1H2NA 5KLVH 1E1RG 1XL4A 3UM7A 2P4KA 4JAVA 1V55B 3HR0A 2WPDG 2OCCC 4FLTA 3KG2A 2DMXA 3O9OA 2E74B 3SYAA 3J81N 4K8XA 2EIMB 2ZR3A 3SYPA 1Q90D 2W0XA 1AR4A 1AILA 3OR7C 3ZHUA 4EFEA 4ICGA 2WWWA 4B3MO 3S3WA 2YS8A 2A3QA 2GTSA 2M7WA 5JVDA 4J10A 1R3JC 3E35A 4YY3O 2PF4E 3JARB 5LP6B 3CCMV 3MD0A 2XAFA 4BIZA 1IBLB 3SJQC 2R72A 1VQPV 4TQFA 4JTAB 2X0LA 2P67A 4PHZA 4QJFB 2YC0A 3CJHB 1XUQA 2XHBA 4F4LA 2AZ2A
chains in the Genus database with same CATH topology
1YJNV 3FB7C 1EZJA 3QNEA 3ABMB 5BZBA 2X7RB 4E2LA 5CBFA 2EILC 2ZQMA 3QO7A 1K5QA 1KECA 4MTOA 2NLJC 4PA4A 3E83A 2A9HA 1JQ0A 4KP4A 5EC2C 2Q69A 2H94A 1JJ2U 1OCOB 1M90W 4FK5C 2JK5C 4WFHA 2QA4V 2QM8A 4PA7A 5LBQA 1YITV 2LFSA 4TT3G 4FIPC 2D3OW 5CBHA 3CCRV 1GTOA 3OMIB 2BOBC 3ZMSA 4WFBV 1OCRC 4PA6A 4GX5A 4TSFG 4PA3A 3MHSC 2DQ3A 4ASUG 3CCVV 2EIMC 5B1OA 2LP7A 1PNMA 2UXXA 3SYCA 3ZRWB 1SERA 4ZKIA 2DW4A 4N23A 3W7XA 2IJHA 3AG2B 2DYSC 1N8RW 3OFNG 1WLEA 5LGTA 2HVJC 2P6JA 5L3CA 3ZRWA 3SYOA 1M57B 2XASA 3FB8C 4QPKA 1V54C 1FXKB 4WFEA 5B1AC 3ZMVA 1W0JG 3STLC 2AHZA 3CD6V 3SPJA 3ZMZA 2EZOA 3MHHC 2H8PC 3CCUV 3I56V 2EZPA 4MVZA 2Y69C 4PDVA 1FXKA 4DO2A 1F23A 3ETGA 2LFRA 2IJJA 4RAIA 2C2AA 2DQ0A 3PJSK 3ASNB 1OCZC 2R9RB 1AROP 3G71V 4P2ZA 3G4SV 1K73W 3K08A 2GHYA 3AG4C 5CMUA 2XOKG 1I5XA 4U7OA 4ZBMA 3ABMC 4FMTA 4MVMA 2ZD9A 1QLNA 2Q6AA 3OE7G 3W7WA 1OCRB 2QKSA 2BOCC 3AEIA 2Z5UA 2WLKA 3ZMTA 5DM6V 5LHGA 3SYQA 2ATKC 4WFGA 2IH1C 4QNHB 2V7QG 1VQ8V 2DYSB 4KUMA 4X88A 5EBMC 4U7NA 5B1BC 3D3IA 4YXWG 1VQ6V 1AI7A 1OCOC 3WFVA 4Z1MG 3ZRVA 2EIKB 4R50A 3B77A 1S77D 3T4ZA 2FTKA 4BIUA 3OAAG 1M56C 1EBOA 1Y66A 1YTFD 2Y69B 3FYEB 4I9WA 4GT1A 5L3DA 1VQKV 3B8NA 1UJWB 1K34A 5KUKA 1RPRA 3AG1C 1YI2V 4N21A 3RVZA 2HJFC 2DYRB 2JJ1G 3E8GA 2KB1A 4HYOA 3B8MA 1OCZB 3SPGA 2HVKC 5IDJA 4P9PA 2WLIB 4MTFA 3AG4B 2IJIA 1M57C 2B5UA 3K0DA 2XAQA 4X8AA 3T4DA 2Z3YA 1PL0A 2MK3A 1FXKC 4PDRA 3CP1A 1KQSU 2WLIA 4UXNA 1JVMA 4HZ3A 2AHYA 1AJNA 1K4CC 4R7CA 4LCUC 3SPCA 4XBFA 4RQEA 1Q7YW 4RUEA 2Q67A 3X2QB 1YJ9V 1VQMV 4UV9A 2GSMB 5B1BB 1VQ9V 4BW5A 1DTOA 4CZZA 2XNDG 5DN6G 3CCEV 1K5SA 3ASNC 3F7YC 3ABUA 4JF3A 4PDLA 1J95A 1L1FA 4MVSA 5B1NA 1NH2D 2IU3A 4JPRA 1DLBA 3WG7B 1YTFB 1JPXA 2CK3G 4J9YB 1M56B 5IY5C 1BHBA 4JTCB 1R6KA 3ASOB 3JD4A 4GX2A 2P90A 4P30A 1P4RA 4PELA 4FPPA 3AG1B 1K3EA 1QR9A 1COWG 1VQOV 2IU0A 1K4DC 3H01A 1GMGA 4G27B 1AJPA 1AJQA 1H8EG 1NR7A 3W7UA 1YHQV 4P9OA 2EIKC 1MG1A 1G8MA 1GK9A 5L3GA 3CYOA 5L3BA 1S76D 1QVGU 3LDEA 2YEVB 5EC1C 2WLLB 4UUJC 1JOYA 4WFAV 3ZJZA 3K3WA 3OM3B 3W7TA 1WPXA 2ZR2A 3E86A 1OHHG 5CA3A 4PDMA 1G4YB 2YEVA 3K0GA 2WLLA 3JD2A 2WLHA 3CC7V 4WF9V 1S0VA 4LP8A 3E2EA 2HKOA 5H6RA 3CPWU 1K9MW 4LC1A 2ITDC 3ZRXA 3QO5A 2DYRC 4OXSA 1GO3F 1NH2B 2Y48A 3CMAV 5IYBO 1QLEB 5EK0A 1SZTA 3K06A 3DGEA 3ZN1A 2DWDC 3A0RA 5IY5B 3IC7A 4TWKA 1FXVA 1NQTA 3LSSA 2JIZG 1QCEA 1E79G 2B1GA 4XDJA 2OTLV 2ITCC 3SPIA 1K8AW 1H8HG 4JGSA 1W2BU 3E89A 1AI6A 3OEHG 3X2QC 5EBLC 1MSWD 1SETA 2YSUB 4RUFA 1TUEB 1FXHA 1YSCA 5B3SC 1NVPD 1M9NA 1K33A 3SPHA 3ABKB 3ML0A 5IYCO 1CP9A 1R3KC 3JD1A 3OEEG 2EIJC 3LSQA 1NR1A 2IH3C 3ZN0A 2HG5C 3W7SA 3FKSG 3WG7C 4GX1A 3STZC 4PA9A 3CCJV 3TCUA 3FYIB 4MW8A 1EFRG 3ASOC 4UVCA 2HR3A 4MTGA 3JD3A 5LGNA 3R65A 4X89A 2EBOA 1RM1B 2EINC 3BEHA 3BY6A 1M1KW 2A79B 2QEXV 4HAMA 1F51A 4XDLA 3OW2U 2HLDG 1AR1B 2V1DA 5C93A 3VOUA 3FB5C 4LBEC 1S3JA 4JAUA 3CCQV 4DXWA 3HB3B 1QBZA 1ROPA 3ABLC 1Q82W 1OCCB 4MSWC 5KUMA 2W0FC 1CPYA 4R8CA 3E8BA 1ZWIC 1JCHA 3RBZA 2W6IG 4R6ZA 4RO2A 1MOFA 1RPOA 1Y4MA 2ZXWC 3TK1A 3K79A 1PNKA 5EBWC 5CBGA 1S72V 2QM7A 3E8FA 1OZ0A 1NVPB 1YJWV 1GM9A 3GWOA 2B1IA 5B3SB 2X6AA 4JYBA 1P7BA 2Q68A 3TETA 2OCCB 4MVUA 1H38A 3LUTB 1QLEC 1XL6A 4H37A 4WFFA 2OT5A 2EIJB 1R73A 4GX0A 3F5WC 4MTXA 3K03A 2F43G 3GB7C 3IFXA 5KA6A 3OUSA 4MVQA 4JASA 2WAMA 1SESA 1VQLV 2JEUA 2P7TC 3OGCC 4JTDB 3E8HA 1PD3A 4RQFA 2JJ2G 2EINB 3RVYA 3RW0A 3JD0A 3JCZA 3NXSA 3CMEV 1AI5A 3T1CA 1F4NA 3OMAB 3FB6C 3EHBB 2X6BA 1KKDA 1V55C 3K9AA 1I5YA 1NBMG 2WLMA 3ABKC 1H2GA 3ABLB 1K97A 3CCLV 2WSSG 3VBBA 1YIJV 1DF4A 1FFTB 4MS2A 1DF5A 2XAJA 2ZXWB 1LNQA 1VQNV 1SRYA 4FJCC 4CBCA 3AG3C 3OR6C 4MW3A 1CEZA 1RM1C 3F7VC 5HFMA 3HPLC 1FS0G 2HFEC 3CC2V 3I55V 3ZCCA 1THZA 3LDDA 3OMNB 1GM7A 4UV8A 1BL8A 1ENVA 2K1EA 3ETEA 1R6NA 4MVOA 2EILB 1VQ4V 1KP2A 3M99B 4QE9A 1F4MA 4BAYA 4MVRA 2PI5A 3LNMB 1OCCC 3T2MA 2ZDIC 1QR8A 2WLNA 3G6EV 3LDCA 4GCZA 3D36A 1GM8A 2JDIG 1KD1W 1K92A 1MABG 4XDKA 2EJRA 5H9CA 2JEXA 2QE7G 3ETDA 3P30A 1IXMA 1KC8W 1GKFA 2UXNA 2DWEC 1W0KG 1R3IC 1ORQC 1E1RG 2R9IA 1XL4A 3OUFA 5J9PC 3UM7A 1BMFG 4JAVA 4KFMA 1K7DA 1V55B 4L87A 5IYDO 3CC4V 1E1QG 2WPDG 1HWYA 2OCCC 5LHHA 3CXCU 1NKDA 3KG2A 4G2KA 1NJIW 3QO8A 5E1AC 1BHAA 3SYAA 5GW7A 2EIMB 2ZR3A 3SYPA 2XAGA 1VQ7V 1QVFU 1R3LC 3AG3B 2IW5A 4JYCA 3OR7C 1KP3A 5FL7G 5KA5A 4WCEV 2OTJV 4UVBA 1PKXA 4QPJA 2WLJA 4EKWA 2WWWA 3CCSV 1S5HC 3K04A 4QIWF 2M7WA 2NNUA 4QE7A 3ZMUA 1R3JC 2XAHA 3E35A 1V54B 4G28B 5H6QA 1PNLA 4J9ZB 3IGAC 5B1AB 4UVAA 3CCMV 3MD0A 4I5SA 2XAFA 2W6JG 3P32A 3UKMA 4BIZA 3SJQC 5L3EA 2A0LA 5LHIA 2X6CA 5L3FA 4H33A 1VQPV 1VQ5V 1JX9A 5LGUA 3ZIAG 3DTUB 3ABTA 5HFLA 4JTAB 3ZRSA 2X0LA 1AI4A 2P67A 4QJFB 4Q20A 2ZDIA 4MT8A 3AG2C 2QTOA 3JYCA 1Q81W 1Q86W 3EFFK 4F4LA 5CN0A 1B6QA 2IJKA 2PI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6B A;  1KKD A;  1V55 C;  3FB7 C;  4R50 A;  2WLM A;  3ABK C;  5EK0 A;  3K06 A;  3T4Z A;  5BZB A;  5CBF A;  2EIL C;  2DWD C;  1M56 C;  4TWK A;  4MTO A;  2NLJ C;  4I9W A;  4MS2 A;  4PA4 A;  3E83 A;  2A9H A;  4XDJ A;  1LNQ A;  2ITC C;  3SPI A;  3AG3 C;  4CBC A;  5KUK A;  3OR6 C;  4MW3 A;  5EC2 C;  3AG1 C;  3E89 A;  3RVZ A;  2Q69 A;  2HJF C;  3X2Q C;  5EBL C;  3E8G A;  3F7V C;  2KB1 A;  3HPL C;  4HYO A;  4RUF A;  3SPG A;  5B3S C;  2JK5 C;  2HVK C;  2HFE C;  4P9P A;  4WFH A;  2WLI B;  4MTF A;  3SPH A;  4PA7 A;  1M57 C;  3LDD A;  3K0D A;  5CBH A;  1BL8 A;  2K1E A;  4X8A A;  1R3K C;  4MVO A;  3T4D A;  2EIJ C;  4PDR A;  2BOB C;  2IH3 C;  4QE9 A;  2HG5 C;  2WLI A;  1JVM A;  3LNM B;  4HZ3 A;  1OCC C;  1OCR C;  4MVR A;  4GX1 A;  4GX5 A;  4PA6 A;  4PA9 A;  2WLN A;  4PA3 A;  2AHY A;  3STZ C;  3T2M A;  3TCU A;  3LDC A;  4MW8 A;  3ASO C;  1K4C C;  4R7C A;  4XDK A;  2EIM C;  4LCU C;  3SPC A;  4MTG A;  3SYC A;  3R65 A;  4RUE A;  2Q67 A;  4X89 A;  2DWE C;  1R3I C;  2EIN C;  3BEH A;  2DYS C;  1ORQ C;  2A79 B;  4BW5 A;  4XDL A;  2HVJ C;  1XL4 A;  3OUF A;  5J9P C;  3ASN C;  3SYO A;  3F7Y C;  3UM7 A;  3FB8 C;  1J95 A;  4PDL A;  3VOU A;  4KFM A;  1V54 C;  3FB5 C;  4LBE C;  4MVS A;  2OCC C;  4DXW A;  4WFE A;  5B1A C;  3ABL C;  3KG2 A;  3STL C;  4MSW C;  2AHZ A;  5KUM A;  5E1A C;  2W0F C;  4J9Y B;  4R8C A;  3SPJ A;  3SYA A;  5IY5 C;  4JTC B;  3E8B A;  3WG7 C;  2H8P C;  1ZWI C;  4MVZ A;  2Y69 C;  4PDV A;  3RBZ A;  3SYP A;  4R6Z A;  4RO2 A;  4GX2 A;  2ZXW C;  4P30 A;  1R3L C;  5EBW C;  5CBG A;  3OR7 C;  4RAI A;  3E8F A;  4EKW A;  2WLJ A;  1S5H C;  3K04 A;  3PJS K;  1K4D C;  4QE7 A;  1OCZ C;  2R9R B;  2X6A A;  1R3J C;  4P2Z A;  4G27 B;  4G28 B;  3K08 A;  1P7B A;  2Q68 A;  3AG4 C;  4J9Z B;  3TET A;  3IGA C;  4MVU A;  4P9O A;  3LUT B;  1QLE C;  2EIK C;  1XL6 A;  4ZBM A;  4H37 A;  4WFF A;  3ABM C;  3UKM A;  3LDE A;  4GX0 A;  2WLL B;  4MVM A;  2ZD9 A;  4UUJ C;  2A0L A;  2Q6A A;  5EC1 C;  3SJQ C;  3ZJZ A;  3F5W C;  2X6C A;  4H33 A;  3K03 A;  3GB7 C;  3IFX A;  3OUS A;  4MVQ A;  2QKS A;  3E86 A;  2BOC C;  4JTA B;  4PDM A;  1G4Y B;  2WLK A;  3ZRS A;  2YEV A;  3K0G A;  2WLL A;  2WLH A;  3SYQ A;  2P7T C;  3OGC C;  4JTD B;  2ATK C;  3E8H A;  4WFG A;  2IH1 C;  4LP8 A;  4QNH B;  3AG2 C;  4X88 A;  2QTO A;  3JYC A;  5EBM C;  3RVY A;  3EFF K;  3RW0 A;  4F4L A;  2ITD C;  5B1B C;  2DYR C;  4OXS A;  3T1C A;  1OCO C;  3FB6 C; 
#chains in the Genus database with same CATH topology
 1YJN V;  5JH7 A;  5GTI Z;  2ZIN A;  1SF9 A;  1SA0 B;  3RGB A;  1H2S B;  5LA6 A;  1KEC A;  2UUC B;  1UPG A;  1NT2 B;  2KKW A;  4UCR A;  1N0J A;  4JV5 O;  1D5A A;  4DV1 B;  1SQF A;  4KP4 A;  5EC2 C;  1IZ3 A;  2MW2 B;  4LFC B;  4FK5 C;  4A5U B;  1NI8 A;  4WFH A;  4GKJ B;  4H13 B;  2QM8 A;  4PA7 A;  4B3S O;  1YIT V;  2RNB A;  4FIP C;  5CBH A;  2GV9 A;  3CCR V;  4YJ2 A;  3OMI B;  3ZMS A;  3L75 H;  4WFB V;  4PA6 A;  4BR6 A;  2FML A;  4JI5 O;  3CCV V;  2EIM C;  1N36 O;  3AK1 A;  2LP7 A;  3EVK A;  3SYC A;  4ZKI A;  1WB8 A;  3W7X A;  2IJH A;  3AG2 B;  4NXN B;  3ZHQ A;  3OTF A;  3OFN G;  4CH3 A;  1J5E O;  1P49 A;  4X1Y B;  2P6J A;  4NYK A;  1M57 B;  3FB8 C;  4QPK A;  1XMO O;  3JAT A;  1FXK B;  3ZX6 A;  5LP6 C;  2P22 C;  4LR3 A;  4O2A B;  5LOV A;  3SPJ A;  2JGU A;  4B3R O;  2EZP A;  2LJ2 A;  4B08 A;  4CS2 A;  5IYZ B;  5IJ0 B;  2HHH B;  2R9R B;  4P2Z A;  4EB6 A;  4FLW A;  3AG4 C;  1I5X A;  1SS3 A;  4ZBM A;  3H1I H;  2F4V O;  5A9G A;  2Q6A A;  1QLN A;  3OE7 G;  3C3S A;  1TUB B;  2QKS A;  3ICX A;  1EM1 A;  5LL6 Y;  2BOC C;  4ZI7 A;  5DM6 V;  4W4K A;  2DYS B;  4KUM A;  5EBM C;  4U7N A;  1YCI A;  4J80 A;  5JQG A;  4K0K B;  4RWU A;  2VWJ A;  2DN9 A;  1R1B A;  3B77 A;  1S77 D;  3T4Z A;  1YVW A;  2PYL A;  3HKB A;  3JAM N;  4I9W A;  4YIP A;  3CSX A;  3SJB C;  3B8N A;  4DV3 O;  4DR3 B;  1H2M A;  2KB1 A;  4JI8 B;  3B8M A;  1OCZ B;  4LWS A;  2JS5 A;  3SPG A;  4MTF A;  1TAE A;  1M57 C;  3K0D A;  1XNQ B;  3T4D A;  1PL0 A;  1FXK C;  2WLI A;  1JVM A;  2UXB O;  2AHY A;  3CEI A;  1AJN A;  1K4C C;  1WP7 A;  4LCU C;  4RQE A;  1IXB A;  1VQM V;  3RYF A;  4YHH B;  5K1X A;  2CAZ C;  3CCE V;  1JFF A;  1K5S A;  2YI9 A;  4PDL A;  4DV2 O;  4NTX A;  4MVS A;  5BY1 A;  2FL4 A;  2GBO A;  3M8A A;  4J9Y B;  4U3J B;  1BHB A;  1UFI A;  2JVD A;  1BE3 H;  3HKC B;  4PEL A;  1IBM O;  4D7T A;  3QTC A;  4DR2 B;  1NS1 A;  1K4D C;  2YID A;  3H01 A;  2BCC H;  1MZF A;  1DGS A;  1NR7 A;  1YHQ V;  4P9O A;  1I7F A;  2D2C B;  1GK9 A;  4TV8 B;  3LDE A;  5EC1 C;  1KUQ A;  1IBK B;  1BCC H;  4GLX A;  2YIA A;  3OM3 B;  4ZHQ A;  3W7T A;  1PL4 A;  2QM4 A;  2ZR2 A;  3D3Q A;  2YEV A;  3CC7 V;  2WLL A;  3JD2 A;  3B40 A;  2ARH A;  3E2E A;  2QWR B;  4L8J A;  4LF4 B;  5ITZ A;  2ITD C;  1SC5 B;  3H1L H;  1GO3 F;  2YXL A;  3CMA V;  1BS3 A;  1QLE B;  4I0X B;  2A06 H;  2B9Z A;  3RT3 C;  1VF6 A;  3IC7 A;  4TWK A;  5EIB C;  1NQT A;  1NU1 H;  2CTQ A;  5GTH Z;  1E79 G;  2RN9 A;  2YIB D;  2XUM A;  3SPI A;  1K8A W;  1H8H G;  1MNG A;  3A8T A;  4X65 O;  1FXH A;  2ILM A;  1M9N A;  4TUY B;  1IDS A;  2GDS A;  5BMV B;  5GON B;  4LFB B;  1R3K C;  3JD1 A;  3OEE G;  1EN4 A;  3P3N A;  2IH3 C;  3ZN0 A;  4GX1 A;  5FNV A;  1XNR O;  3AG7 A;  2Q8V A;  3Q4H B;  2M6Y A;  3HKE B;  4X20 A;  3RYH B;  1M1K W;  4NB5 A;  4LF6 B;  1TA8 A;  4XDL A;  3OW2 U;  3JAL A;  3AK3 A;  3FB5 C;  1B06 A;  1S3J A;  4JAA A;  2QSA A;  3UT5 B;  2FKX A;  1OCC B;  4MSW C;  5KUM A;  3N2K B;  3SGI A;  4LNU A;  3M7M X;  5KMG B;  1MOF A;  1RPO A;  1M4U A;  3TK1 A;  1PNK A;  5EBW C;  1NVP B;  1SQG A;  2B1I A;  5B3S B;  3BPZ A;  2P5O A;  2N05 A;  1H38 A;  3LUT B;  1QLE C;  4OX9 O;  4H37 A;  4WFF A;  3QF7 A;  1MA1 A;  3DXR B;  4DV4 B;  3K03 A;  3GB7 C;  5LYJ B;  5DED A;  5E79 Z;  1XMQ O;  1VQL V;  2JEU A;  4JTD B;  4RQF A;  2EIN B;  4CC5 A;  3JAW B;  3APO A;  2VQE B;  1L8D A;  3JAK B;  1F4N A;  3OMA B;  3EHB B;  1IVS A;  3BVO A;  4LF8 O;  3K9A A;  3T1Y O;  3K5M A;  3ABL B;  4NVP A;  1Y6X A;  1K97 A;  2WSS G;  4DV6 O;  3TXS A;  4C7U A;  4LFA B;  2F1M A;  5EZY A;  3AG3 C;  1RFY A;  3F7V C;  1R6T A;  5HFM A;  4CH6 A;  4DR5 B;  1FYJ A;  3FX7 A;  2HFE C;  1AVM A;  3G67 A;  1GM7 A;  1VEW A;  3D8C A;  2Q7H A;  1BL8 A;  2UUB B;  1KP2 A;  5H2F Z;  1OCC C;  2BSK A;  1F7Y A;  3LDC A;  2Y4U A;  1KD1 W;  1HW7 A;  4FLX A;  1KMI Z;  2QE7 G;  3ZHR A;  1AP6 A;  1GKF A;  2UXN A;  1R3I C;  4FFB B;  1ORQ C;  1HP8 A;  3CC4 V;  1HWY A;  5LHH A;  1HNW B;  3CXC U;  2UUC O;  4DV7 O;  5GW7 A;  4O4L B;  1VQ7 V;  2XAG A;  2IW5 A;  2QKC A;  1Q6U A;  1KP3 A;  5KA5 A;  2OTJ V;  5JWP A;  4WCE V;  4UVB A;  4YJ3 B;  4QPJ A;  4EKW A;  1S5H C;  3K04 A;  2UU9 O;  1N34 B;  4GKJ O;  2DOS A;  2EX3 A;  2OCH A;  4G28 B;  4E4E A;  5LMU O;  4J9Z B;  5LMN B;  4X62 O;  4JZ2 A;  2Y4T A;  2KQX A;  5B1A B;  2YIC A;  2VWK A;  5F2V O;  1BSM A;  4I5S A;  1JMK C;  1BQ0 A;  5L3E A;  2A0L A;  4JI6 B;  1N33 B;  4NTW A;  5L3F A;  3BAB A;  3JAR A;  2GTA A;  3B09 A;  1VQ5 V;  5IT9 N;  3ABT A;  4FM1 A;  5HFL A;  1OJH A;  1H2L A;  1AI4 A;  5KX5 B;  2YXY A;  4IHJ B;  2ZDI A;  1Q81 W;  3BA8 A;  1YDX A;  2QGN A;  1XQ8 A;  1S5L Z;  2CH7 B;  4I55 A;  1N32 B;  3CJH A;  2X7R B;  4E2L A;  5K1P A;  4X1I B;  4DW1 A;  2ZM6 B;  1G6U A;  3E83 A;  2A9H A;  3CXH F;  1SA0 A;  4O2B B;  3BA9 A;  2Q69 A;  2H94 A;  3ZS8 C;  2OIE A;  2JK5 C;  5LBQ A;  4ABM A;  4JI4 B;  4IYH A;  2D3O W;  4W4L A;  1GTO A;  4U3F H;  4TSF G;  3MHS C;  3A0H Z;  4ASU G;  2ZE8 A;  4DUY B;  1WB7 A;  3ZRW B;  4N23 A;  1HR0 B;  1JJO A;  4I9Q A;  3DC5 A;  4JI3 B;  4ZIB A;  3RYC B;  3SYO A;  4OPA A;  3L71 H;  4X1K B;  1AB3 A;  4WFE A;  5B1A C;  4X1Y A;  1EN5 A;  2K9P A;  3ZMV A;  1W0J G;  4JI2 B;  4GUN A;  4LF7 O;  2EZO A;  1Q3E A;  4MVZ A;  5C8Y B;  2LQT A;  1FXK A;  1RSO B;  4DO2 A;  2LFR A;  2IJJ A;  2ZIM A;  4O2A A;  4NKG B;  3RYI A;  4EFB A;  4DR3 O;  2QWP B;  2UXD B;  3ASN B;  4TQD A;  5IYZ A;  1K73 W;  1XNQ O;  5CMU A;  5TIS Z;  2R70 A;  4GZR B;  4MVM A;  5IWA B;  2ZD9 A;  1SQV H;  4DR4 O;  1V9P A;  2Z5U A;  4J41 A;  1VMG A;  3SYQ A;  2OWO A;  1TUB A;  4YHH O;  1O9H A;  1VQ8 V;  4X88 A;  4O4I B;  1WA8 A;  2BTQ B;  4PI0 A;  4YXW G;  1VQ6 V;  1OV9 A;  2F95 B;  2FTK A;  3T1H B;  1LR1 A;  3OAA G;  1EBO A;  1Y66 A;  3FYE B;  2ADP A;  2EJ7 A;  5L3D A;  5CB4 B;  3CE2 A;  3F5T A;  1K34 A;  4X64 O;  1YI2 V;  1NTM H;  4N21 A;  2HJF C;  3E8G A;  4J11 A;  3IJ4 A;  5IDJ A;  4P9P A;  4FLZ A;  2XT9 A;  3AG4 B;  2B5U A;  3I5D A;  2Z3Y A;  1M93 A;  4UXN A;  1KQS U;  3FD9 A;  4DV0 B;  1GN4 A;  2QJ1 A;  3P3P A;  4R7C A;  3SPC A;  5BR8 B;  2Q67 A;  1MSD A;  2WA4 A;  3MAQ A;  1YJ9 V;  3ZBH A;  5JJN B;  5KHI A;  5DN6 G;  3ASN C;  3ABU A;  4JF3 A;  1L1F A;  1J95 A;  1NH2 D;  4DW0 A;  1P7G A;  4H0L B;  5J2U A;  3EXA A;  1YTF B;  2CK3 G;  4GKK O;  1N4C A;  5IY5 C;  3ASO B;  3JD4 A;  2P90 A;  1JA8 A;  3JAS B;  3C90 A;  5FPO A;  3RN4 A;  3VQY A;  3G80 A;  4U3J A;  4X66 B;  3K5O A;  3W7U A;  4LFB O;  2O57 A;  1G8M A;  1U96 A;  2PYJ A;  5L3B A;  4KHP B;  1FJG B;  3APQ A;  5CA3 A;  2IBZ H;  4PDM A;  1G4Y B;  4TV8 A;  3K0G A;  2WLH A;  3DC6 A;  4LF6 O;  2KG7 B;  3K59 A;  3ZRX A;  3QO5 A;  4FLU A;  1SZT A;  1XRE A;  4JYY A;  5JCO C;  4B3T B;  4NTY A;  2UUA O;  4XDJ A;  4JI7 B;  2ZCE A;  4JGS A;  4UCV A;  3E89 A;  3OEH G;  5EBL C;  3GVM A;  2YSU B;  2RDC A;  2G38 A;  4I4T B;  1Z2G A;  3ML0 A;  5IYC O;  4DR6 O;  2EIJ C;  2HG5 C;  3STZ C;  3CCJ V;  3FYI B;  5BMV A;  4MW8 A;  1EFR G;  3ASO C;  5GON A;  4MTG A;  3JD3 A;  2UXC O;  3R65 A;  4X89 A;  2VQE O;  2Q7E A;  1XOU A;  4FM0 A;  1XHZ A;  2HLD G;  1AR1 B;  3VOU A;  4LBE C;  3CCQ V;  4LF5 O;  4DXW A;  1ROP A;  5LXT B;  5H5N A;  1CPY A;  4LF9 O;  1ZWI C;  4AHC A;  4ZOL A;  2W6I G;  1HNZ O;  2ZXW C;  3UT5 A;  4JZG A;  1S72 V;  2QM7 A;  3N2K A;  4DR5 O;  1Z5V A;  1GM9 A;  3GWO A;  5KMG A;  2X6A A;  2ETN A;  2QKA A;  2FB5 A;  3J80 N;  3CRM A;  3N2G B;  2F43 G;  1XIL A;  3OUS A;  3B4S A;  1XBL A;  2P7T C;  3OGC C;  3E8H A;  4J7Z A;  3DXR A;  5B66 Z;  4YJ2 B;  5LYJ A;  2DE0 X;  2JGD B;  3JCZ A;  4B3M B;  1QNM A;  3NXS A;  3U11 A;  1AI5 A;  3FB6 C;  4Z2W A;  1I5Y A;  3JAW A;  3CCL V;  3BRC A;  4AQY O;  1YIJ V;  2E5L B;  1DF5 A;  2XAJ A;  1LNQ A;  4CBC A;  2OIG A;  4MW3 A;  1CEZ A;  1N34 O;  4I50 B;  3GWK C;  1FS0 G;  3PN1 A;  5LMN O;  1EN6 A;  3CC2 V;  1Y74 B;  3CHX A;  5CA1 B;  3OMN B;  3H9V A;  1ENV A;  4F6R B;  2BE3 A;  2EIL B;  3M99 B;  4QE9 A;  1F4M A;  2WLN A;  2LO1 A;  4GCZ A;  3D36 A;  2PGG A;  1K92 A;  2A7W A;  4HNA B;  2ZNI A;  1MZE A;  4JV5 B;  3P30 A;  1KC8 W;  2JRI A;  2FYU H;  2R9I A;  5J9P C;  1BGY H;  1N32 O;  4KFM A;  1K7D A;  4B3S B;  4L87 A;  3BCC H;  4FFB A;  4YIO A;  3CB2 A;  3KZI Z;  3FFQ A;  3QVN A;  3O65 A;  2AGA A;  1SQP H;  3CRR A;  4NXM B;  1X4T A;  4JI5 B;  1QVF U;  1QU7 A;  1R3L C;  1N36 B;  3AG3 B;  3CCS V;  2WLJ A;  4QIW F;  2NNU A;  4QE7 A;  3ZMU A;  2XAH A;  4DUZ O;  5H6Q A;  2GUZ A;  1PNL A;  4WBN B;  1I94 B;  4YJ3 A;  3IGA C;  1XMO B;  4D7S A;  2W6J G;  5LHI A;  1ZUQ A;  4JI0 B;  4H33 A;  3SJA C;  1N0N A;  1JX9 A;  4B7E A;  2IM9 A;  3ZIA G;  3DTU B;  2AW9 A;  4LWS B;  3B2E E;  3ZRS A;  1T5E A;  5IJ9 B;  3OD4 A;  1Q86 W;  1YF2 A;  1VF7 A;  1ZLZ A;  2CDY A;  2ZIO A;  1X59 A;  3OTO B;  2IJK A;  2DJV A;  3FB7 C;  3QNE A;  3IC9 A;  3ABM B;  4JI2 O;  5CBF A;  2F4V B;  2EIL C;  3QO7 A;  1K5Q A;  3RYF B;  1Q6I A;  2NLJ C;  4X1I A;  3MDS A;  1JQ0 A;  1NTK H;  5JJJ B;  3L9D A;  1JJ2 U;  4DRX B;  4IIJ A;  2LFS A;  4O2B A;  4GYC B;  3H1H H;  1HDJ A;  2N74 A;  2BOB C;  1OCR C;  1GN2 A;  4PA3 A;  2F66 C;  5B1O A;  1PNM A;  2UXX A;  4DV3 B;  2BTO A;  1WLE A;  3CWB H;  5LGT A;  1QQC A;  1M5I A;  3ZRW A;  1WJZ A;  2XAS A;  3U10 A;  4O4J A;  3T1H O;  4ZHQ B;  1AP5 A;  1IBL O;  2ADQ B;  3RYC A;  4IL6 Z;  3TJT A;  3ZMZ A;  3MHH C;  3WB0 A;  4FLV A;  3I56 V;  4X1K A;  1Y76 B;  5ITZ B;  2UXB B;  2Y69 C;  1F23 A;  4RAI A;  2QDO A;  4O4H B;  1IX9 A;  1FFX B;  4PI2 A;  3L73 H;  5C8Y A;  1RSO A;  2CE4 A;  3G71 V;  1I08 A;  1Q8I A;  3K08 A;  4DV2 B;  1TVK B;  3ABM C;  3J7A U;  1BQZ A;  3ZHS A;  4DV1 O;  3AEI A;  4DR1 B;  2WLK A;  5BR8 O;  1SQX H;  4QNH B;  2V7Q G;  4LFC O;  5B1B C;  1KYO F;  3WFV A;  2OYQ A;  2EIK B;  1TGO A;  4R50 A;  1LUV A;  4O4I A;  2BTQ A;  1O9G A;  2PZS A;  1M56 C;  4H44 B;  1NZ6 A;  4GT1 A;  5LP6 A;  2PTM A;  3OT7 A;  1RPR A;  4NXN O;  3AG1 C;  3H1K H;  3UO2 A;  4TV9 B;  2JJ1 G;  5CB4 A;  1WNS A;  3RWR D;  2HVK C;  4LNU B;  2IJI A;  2XAQ A;  4KHP O;  2MK3 A;  3CP1 A;  2VQF B;  2VRZ A;  1KKC A;  4XBF A;  3S3X A;  2HHH O;  3X2Q B;  2GSM B;  4BWA A;  4CZZ A;  3F7Y C;  5B1N A;  4B3T O;  1I0H A;  1DLB A;  4JTC B;  3L70 H;  1XNR B;  4GX2 A;  2YUA A;  4JI7 O;  4P30 A;  3CRA A;  4FPP A;  3C3T A;  5AG2 A;  5D5Q A;  1Q43 A;  3JAS A;  4K0K O;  1AJQ A;  1H8E G;  2KSD A;  2EIK C;  1MG1 A;  5L3G A;  1G1X B;  5EZY B;  1S76 D;  1QVG U;  1PM9 A;  4UUJ C;  4WFA V;  4JI1 B;  3ZJZ A;  5CA0 B;  4JYA B;  1Z5W A;  4FFK A;  3SR2 C;  1ZL8 B;  1WPX A;  2CUG A;  1NTZ H;  2HJD A;  4WF9 V;  1S0V A;  4LP8 A;  5KHH A;  1K9M W;  4JI8 O;  4DV5 B;  5KAI Z;  4IGG A;  4OXS A;  2Y48 A;  2QWN B;  5IJ0 A;  1DK1 A;  2KG7 A;  1FKA O;  1YXB A;  2LGW A;  5DEC A;  2WA3 A;  2DWD C;  3A0R A;  5IY5 B;  4UCO A;  2ZE7 A;  2CGO A;  2B1G A;  2VS0 A;  5KHK A;  3CRC A;  2OTL V;  1XMQ B;  4DK1 A;  1W2B U;  1AI6 A;  3X2Q C;  1MSW D;  3KCX A;  1YSC A;  1NVP D;  1K33 A;  1VAR A;  2Q7G A;  3K5L A;  4LF8 B;  3T1Y B;  5FLX N;  1B3Q A;  3LSQ A;  2QTS A;  3FAV B;  1NR1 A;  3W7S A;  4I4T A;  4DV6 B;  3TCU A;  3ETQ A;  2HR3 A;  3DSQ A;  4BW9 A;  5LGN A;  1RM1 B;  3BY6 A;  1PP9 H;  4DR2 O;  2QEX V;  1QHT A;  3R66 A;  2RCV A;  2ZE5 A;  3SJC C;  3UCS C;  4Q6G A;  2YI8 A;  3HB3 B;  1Q82 W;  1IBK O;  3HKD B;  2E5L O;  4R8C A;  1JCH A;  4CH4 A;  3K5N A;  5LXT A;  1FD9 A;  3K79 A;  1BZK A;  1FPO A;  2LW7 A;  3LNN A;  1BT8 A;  4I55 B;  3E8F A;  4LF4 O;  2YXH A;  3LSU A;  1YJW V;  3KKY A;  4JYB A;  1P7B A;  2Q68 A;  4FVM A;  3TET A;  4MVU A;  3L74 H;  1XL6 A;  2OT5 A;  2EIJ B;  4UFZ A;  5EYP B;  4K3A A;  3CRQ A;  3F5W C;  4DV7 B;  4MTX A;  5KA6 A;  4MVQ A;  2Z0A A;  4JAS A;  2WAM A;  5J2T B;  5BXZ A;  1HNX B;  2Q0O C;  1PD3 A;  3N2G A;  2JJ2 G;  3RVY A;  3RW0 A;  3JD0 A;  2UU9 B;  3HKC A;  4AI8 A;  4UCU A;  2CGN A;  1V55 C;  4FZ0 A;  5LMU B;  2WLM A;  4X62 B;  2JGD A;  5KHJ A;  2NN4 A;  4UB8 Z;  1B04 A;  4UB6 Z;  2LW1 A;  3VBB A;  4NXM O;  1DF4 A;  4MS2 A;  1LUW A;  2Q9L A;  4D6T H;  2ZXW B;  1SRY A;  1RP3 B;  3OR6 C;  4CH5 A;  2ZE6 A;  2L35 A;  1VIB A;  1YEW A;  1RM1 C;  1JR9 A;  1YZB A;  1I94 O;  1KB9 F;  1THZ A;  4I50 A;  3E22 B;  4UV8 A;  3ETE A;  4Z1V A;  1R6N A;  4JI0 O;  2CTP A;  2Y0I A;  3RYI B;  2PI5 A;  4BAY A;  1Y74 A;  3LNM B;  3T2M A;  2ZDI C;  2XTA A;  5CA1 A;  3G6E V;  4I0X A;  4F6R A;  4XDK A;  1MAB G;  1IUR A;  5H9C A;  3ZHV A;  4I7Z B;  1WP8 A;  1XEQ A;  1W0K G;  4HNA A;  3OTO O;  3OUF A;  1BMF G;  4DR7 B;  5IYD O;  1SQB H;  1E1Q G;  4K35 A;  2EUL A;  3A2F A;  1NKD A;  4G2K A;  1NJI W;  2PY5 A;  3QO8 A;  5E1A C;  4DV4 O;  1BHA A;  4TUY A;  1WA8 B;  4F6E A;  3OGI B;  5JVD B;  4JYC A;  3THO A;  5FL7 G;  2RJZ A;  1PKX A;  4TOI A;  2V4D A;  3RFR A;  3Q4H A;  1V54 B;  2Q73 A;  3HKE A;  2QR4 A;  1GN6 A;  4UVA A;  1U97 A;  3RYH A;  2RQ6 A;  3WB1 A;  3P32 A;  4UCT A;  3UKM A;  2JS3 A;  2PUS A;  4LFA O;  4WBN A;  2X6C A;  4LF7 B;  5LGU A;  4Q20 A;  4K8Z A;  4MT8 A;  2CTR A;  3AG2 C;  2QTO A;  3JYC A;  5JH7 B;  4J7J A;  3EFF K;  5CN0 A;  1B6Q A;  2R9A A;  5IJ9 A;  5LA6 B;  2PI4 A;  1EZJ A;  5BZB A;  2UUB O;  2ZQM A;  5D5P A;  4J7K A;  4MTO A;  4PA4 A;  4DR4 B;  5J2U B;  1OCO B;  1M90 W;  4AIL C;  2L6L A;  2QA4 V;  5KAF Z;  4LH7 A;  4TT3 G;  4YY3 B;  1HNW O;  1D5N A;  4IYI A;  4HBN A;  4DRX A;  3JAK A;  4GX5 A;  3WB2 A;  1XHX A;  4DR1 O;  2DQ3 A;  3AK2 A;  4OPH A;  1SER A;  2DW4 A;  1ZX3 A;  4X64 B;  2HEP A;  2DYS C;  3JAT B;  2ZNJ A;  3U0Z A;  1N8R W;  1SQQ H;  2HP8 A;  1H2K A;  2HVJ C;  4EEQ A;  5L3C A;  5LOV B;  2P4V A;  1V54 C;  3STL C;  4JI6 O;  2AHZ A;  1N33 O;  3CD6 V;  2H8P C;  2Y0P A;  3CCU V;  2AXT Z;  4PDV A;  1Q5O A;  3ETG A;  1GH6 A;  1ZSP A;  4EB6 B;  2C2A A;  1Y76 A;  2DQ0 A;  4QGP A;  3NR7 A;  3PJS K;  1OCZ C;  1ARO P;  3G4S V;  1Y67 A;  2ZT9 B;  2GHY A;  4O4H A;  2XOK G;  1FFX A;  1SZX A;  4U7O A;  4ZI7 B;  4FMT A;  2VQF O;  2ZM6 O;  3JSN A;  3W7W A;  1OCR B;  4GKK B;  1TVK A;  3CS5 A;  3ZMT A;  5JQG B;  5LHG A;  2ATK C;  4WFG A;  2IH1 C;  3A0B Z;  4O4L A;  3D3I A;  1AI7 A;  1OCO C;  4Z1M G;  1J5E B;  4JI4 O;  3ZRV A;  3HKB B;  3UO3 A;  4BIU A;  3QG5 A;  3N27 A;  2YDE A;  1YTF D;  2Y69 B;  4DUY O;  2RMK B;  1XDC A;  1WAZ A;  4B3R B;  1VQK V;  1UJW B;  1HR0 O;  5KUK A;  4KXR A;  3RVZ A;  4JI3 O;  2DYR B;  4HYO A;  2F23 A;  2WLI B;  5KX5 A;  4IHJ A;  4ZOL B;  3K58 A;  4TV9 A;  4X8A A;  4JI1 O;  4CS4 A;  4LH6 A;  4PDR A;  4JYA O;  4HZ3 A;  2F93 B;  2CH7 A;  1FAF A;  1WPB A;  1WN7 A;  1L0N H;  2UUA B;  1JFF B;  1Q7Y W;  4RUE A;  2Q4P A;  4DV5 O;  4PD4 F;  4UV9 A;  4DK0 A;  5B1B B;  1VQ9 V;  2UXD O;  4BW5 A;  1DTO A;  2XND G;  2E3C A;  2IU3 A;  2H3O A;  4JPR A;  5IWA O;  4DR6 B;  3WG7 B;  4FM2 A;  1JPX A;  1M56 B;  4CC6 A;  1R6K A;  1P4R A;  2UXC B;  3AG1 B;  1K3E A;  1QR9 A;  1COW G;  1VQO V;  2IU0 A;  1GMG A;  4G27 B;  1AJP A;  1US6 A;  3CYO A;  4LF5 B;  3ZHT A;  4NR1 A;  2YEV B;  2WLL B;  1JOY A;  2CTW A;  3WU2 Z;  3K3W A;  1EZV H;  4LF9 B;  3E86 A;  2Q0A A;  1OHH G;  2QWO B;  1HNZ B;  3JSL A;  5CA0 A;  2HKO A;  5H6R A;  3CPW U;  1ZL8 A;  4LC1 A;  2DYR C;  1NH2 B;  1SKV A;  5IYB O;  4BIO A;  5EK0 A;  3K06 A;  3DGE A;  3ZN1 A;  3ZED A;  1PPJ H;  2E76 B;  1GAX A;  4DV0 O;  1FXV A;  3LSS A;  2JIZ G;  1QCE A;  1PV0 A;  4IT5 A;  2E75 B;  5EIB D;  2ITC C;  1ZAU A;  1IBM B;  1SET A;  4RUF A;  1TUE B;  5B3S C;  4CS3 A;  2ODM A;  3SPH A;  3ABK B;  1VP7 A;  5FNV B;  3K57 A;  2ZKO A;  4J42 A;  5IE9 A;  1CP9 A;  2AZ0 A;  4PV1 B;  3FKS G;  3WG7 C;  1Q6H A;  4X20 B;  1URF A;  4PA9 A;  4KL1 A;  4AQY B;  1GN3 A;  4UVC A;  1HNX O;  3FAV A;  2GUZ B;  3JAL B;  2EBO A;  3VQX A;  2EIN C;  3BEH A;  3VQW A;  2A79 B;  4HAM A;  1KBH A;  1F51 A;  3KCY A;  4X66 O;  2V1D A;  1L0L H;  2P06 A;  5C93 A;  4JAU A;  1QBZ A;  3ABL C;  1FJG O;  2W0F C;  1AR5 A;  3E8B A;  5A2Q N;  3RBZ A;  4FLY A;  4R6Z A;  4RO2 A;  3UQ8 A;  1Y4M A;  5JCO A;  5CBG A;  4X9Q A;  3HKD A;  5FPR A;  3TXQ A;  5B5E Z;  1OZ0 A;  2YIB A;  2LGQ A;  2QWQ B;  4OGQ B;  4X65 B;  1VF6 C;  1S5J A;  2OCC B;  3D36 C;  3L72 H;  1R73 A;  4GX0 A;  3BAA A;  1W59 A;  1A32 A;  3IFX A;  5EYP A;  1SES A;  3K9S A;  4IIJ B;  5J2T A;  3BFR A;  3CME V;  3T1C A;  3BHP A;  3VQV A;  4DR7 O;  1XI1 A;  2X6B A;  4DUZ B;  1KKD A;  2NR5 A;  1NBM G;  3ABK C;  1ZTE A;  3G6B A;  3IAY A;  4FZ1 A;  1H2G A;  1MMM A;  1D2D A;  1FFT B;  5JJE B;  1VQN V;  4FJC C;  4O4J B;  3JCU Z;  2Q5Z A;  3HPL C;  4B7K A;  1CXZ B;  3H1J H;  3I55 V;  3ZCC A;  2BSK B;  2N04 A;  3LDD A;  1VF5 B;  3SDL A;  3CX5 F;  1VQ4 V;  2K1E A;  4MVO A;  4UCS A;  4OX9 B;  4MVR A;  5KHG A;  3TGU H;  1GRJ A;  4DYL A;  1QR8 A;  1KU9 A;  3E22 A;  1GM8 A;  2JDI G;  4PJ0 Z;  1P84 F;  2EJR A;  2JEX A;  3ETD A;  1IXM A;  2DWE C;  1H2N A;  5KLV H;  1E1R G;  1XL4 A;  3UM7 A;  2P4K A;  4JAV A;  1V55 B;  3HR0 A;  2WPD G;  2OCC C;  4FLT A;  3KG2 A;  2DMX A;  3O9O A;  2E74 B;  3SYA A;  3J81 N;  4K8X A;  2EIM B;  2ZR3 A;  3SYP A;  1Q90 D;  2W0X A;  1AR4 A;  1AIL A;  3OR7 C;  3ZHU A;  4EFE A;  4ICG A;  2WWW A;  4B3M O;  3S3W A;  2YS8 A;  2A3Q A;  2GTS A;  2M7W A;  5JVD A;  4J10 A;  1R3J C;  3E35 A;  4YY3 O;  2PF4 E;  3JAR B;  5LP6 B;  3CCM V;  3MD0 A;  2XAF A;  4BIZ A;  1IBL B;  3SJQ C;  2R72 A;  1VQP V;  4TQF A;  4JTA B;  2X0L A;  2P67 A;  4PHZ A;  4QJF B;  2YC0 A;  3CJH B;  1XUQ A;  2XHB A;  4F4L A;  2AZ2 A; 
#chains in the Genus database with same CATH homology
 1YJN V;  3FB7 C;  1EZJ A;  3QNE A;  3ABM B;  5BZB A;  2X7R B;  4E2L A;  5CBF A;  2EIL C;  2ZQM A;  3QO7 A;  1K5Q A;  1KEC A;  4MTO A;  2NLJ C;  4PA4 A;  3E83 A;  2A9H A;  1JQ0 A;  4KP4 A;  5EC2 C;  2Q69 A;  2H94 A;  1JJ2 U;  1OCO B;  1M90 W;  4FK5 C;  2JK5 C;  4WFH A;  2QA4 V;  2QM8 A;  4PA7 A;  5LBQ A;  1YIT V;  2LFS A;  4TT3 G;  4FIP C;  2D3O W;  5CBH A;  3CCR V;  1GTO A;  3OMI B;  2BOB C;  3ZMS A;  4WFB V;  1OCR C;  4PA6 A;  4GX5 A;  4TSF G;  4PA3 A;  3MHS C;  2DQ3 A;  4ASU G;  3CCV V;  2EIM C;  5B1O A;  2LP7 A;  1PNM A;  2UXX A;  3SYC A;  3ZRW B;  1SER A;  4ZKI A;  2DW4 A;  4N23 A;  3W7X A;  2IJH A;  3AG2 B;  2DYS C;  1N8R W;  3OFN G;  1WLE A;  5LGT A;  2HVJ C;  2P6J A;  5L3C A;  3ZRW A;  3SYO A;  1M57 B;  2XAS A;  3FB8 C;  4QPK A;  1V54 C;  1FXK B;  4WFE A;  5B1A C;  3ZMV A;  1W0J G;  3STL C;  2AHZ A;  3CD6 V;  3SPJ A;  3ZMZ A;  2EZO A;  3MHH C;  2H8P C;  3CCU V;  3I56 V;  2EZP A;  4MVZ A;  2Y69 C;  4PDV A;  1FXK A;  4DO2 A;  1F23 A;  3ETG A;  2LFR A;  2IJJ A;  4RAI A;  2C2A A;  2DQ0 A;  3PJS K;  3ASN B;  1OCZ C;  2R9R B;  1ARO P;  3G71 V;  4P2Z A;  3G4S V;  1K73 W;  3K08 A;  2GHY A;  3AG4 C;  5CMU A;  2XOK G;  1I5X A;  4U7O A;  4ZBM A;  3ABM C;  4FMT A;  4MVM A;  2ZD9 A;  1QLN A;  2Q6A A;  3OE7 G;  3W7W A;  1OCR B;  2QKS A;  2BOC C;  3AEI A;  2Z5U A;  2WLK A;  3ZMT A;  5DM6 V;  5LHG A;  3SYQ A;  2ATK C;  4WFG A;  2IH1 C;  4QNH B;  2V7Q G;  1VQ8 V;  2DYS B;  4KUM A;  4X88 A;  5EBM C;  4U7N A;  5B1B C;  3D3I A;  4YXW G;  1VQ6 V;  1AI7 A;  1OCO C;  3WFV A;  4Z1M G;  3ZRV A;  2EIK B;  4R50 A;  3B77 A;  1S77 D;  3T4Z A;  2FTK A;  4BIU A;  3OAA G;  1M56 C;  1EBO A;  1Y66 A;  1YTF D;  2Y69 B;  3FYE B;  4I9W A;  4GT1 A;  5L3D A;  1VQK V;  3B8N A;  1UJW B;  1K34 A;  5KUK A;  1RPR A;  3AG1 C;  1YI2 V;  4N21 A;  3RVZ A;  2HJF C;  2DYR B;  2JJ1 G;  3E8G A;  2KB1 A;  4HYO A;  3B8M A;  1OCZ B;  3SPG A;  2HVK C;  5IDJ A;  4P9P A;  2WLI B;  4MTF A;  3AG4 B;  2IJI A;  1M57 C;  2B5U A;  3K0D A;  2XAQ A;  4X8A A;  3T4D A;  2Z3Y A;  1PL0 A;  2MK3 A;  1FXK C;  4PDR A;  3CP1 A;  1KQS U;  2WLI A;  4UXN A;  1JVM A;  4HZ3 A;  2AHY A;  1AJN A;  1K4C C;  4R7C A;  4LCU C;  3SPC A;  4XBF A;  4RQE A;  1Q7Y W;  4RUE A;  2Q67 A;  3X2Q B;  1YJ9 V;  1VQM V;  4UV9 A;  2GSM B;  5B1B B;  1VQ9 V;  4BW5 A;  1DTO A;  4CZZ A;  2XND G;  5DN6 G;  3CCE V;  1K5S A;  3ASN C;  3F7Y C;  3ABU A;  4JF3 A;  4PDL A;  1J95 A;  1L1F A;  4MVS A;  5B1N A;  1NH2 D;  2IU3 A;  4JPR A;  1DLB A;  3WG7 B;  1YTF B;  1JPX A;  2CK3 G;  4J9Y B;  1M56 B;  5IY5 C;  1BHB A;  4JTC B;  1R6K A;  3ASO B;  3JD4 A;  4GX2 A;  2P90 A;  4P30 A;  1P4R A;  4PEL A;  4FPP A;  3AG1 B;  1K3E A;  1QR9 A;  1COW G;  1VQO V;  2IU0 A;  1K4D C;  3H01 A;  1GMG A;  4G27 B;  1AJP A;  1AJQ A;  1H8E G;  1NR7 A;  3W7U A;  1YHQ V;  4P9O A;  2EIK C;  1MG1 A;  1G8M A;  1GK9 A;  5L3G A;  3CYO A;  5L3B A;  1S76 D;  1QVG U;  3LDE A;  2YEV B;  5EC1 C;  2WLL B;  4UUJ C;  1JOY A;  4WFA V;  3ZJZ A;  3K3W A;  3OM3 B;  3W7T A;  1WPX A;  2ZR2 A;  3E86 A;  1OHH G;  5CA3 A;  4PDM A;  1G4Y B;  2YEV A;  3K0G A;  2WLL A;  3JD2 A;  2WLH A;  3CC7 V;  4WF9 V;  1S0V A;  4LP8 A;  3E2E A;  2HKO A;  5H6R A;  3CPW U;  1K9M W;  4LC1 A;  2ITD C;  3ZRX A;  3QO5 A;  2DYR C;  4OXS A;  1GO3 F;  1NH2 B;  2Y48 A;  3CMA V;  5IYB O;  1QLE B;  5EK0 A;  1SZT A;  3K06 A;  3DGE A;  3ZN1 A;  2DWD C;  3A0R A;  5IY5 B;  3IC7 A;  4TWK A;  1FXV A;  1NQT A;  3LSS A;  2JIZ G;  1QCE A;  1E79 G;  2B1G A;  4XDJ A;  2OTL V;  2ITC C;  3SPI A;  1K8A W;  1H8H G;  4JGS A;  1W2B U;  3E89 A;  1AI6 A;  3OEH G;  3X2Q C;  5EBL C;  1MSW D;  1SET A;  2YSU B;  4RUF A;  1TUE B;  1FXH A;  1YSC A;  5B3S C;  1NVP D;  1M9N A;  1K33 A;  3SPH A;  3ABK B;  3ML0 A;  5IYC O;  1CP9 A;  1R3K C;  3JD1 A;  3OEE G;  2EIJ C;  3LSQ A;  1NR1 A;  2IH3 C;  3ZN0 A;  2HG5 C;  3W7S A;  3FKS G;  3WG7 C;  4GX1 A;  3STZ C;  4PA9 A;  3CCJ V;  3TCU A;  3FYI B;  4MW8 A;  1EFR G;  3ASO C;  4UVC A;  2HR3 A;  4MTG A;  3JD3 A;  5LGN A;  3R65 A;  4X89 A;  2EBO A;  1RM1 B;  2EIN C;  3BEH A;  3BY6 A;  1M1K W;  2A79 B;  2QEX V;  4HAM A;  1F51 A;  4XDL A;  3OW2 U;  2HLD G;  1AR1 B;  2V1D A;  5C93 A;  3VOU A;  3FB5 C;  4LBE C;  1S3J A;  4JAU A;  3CCQ V;  4DXW A;  3HB3 B;  1QBZ A;  1ROP A;  3ABL C;  1Q82 W;  1OCC B;  4MSW C;  5KUM A;  2W0F C;  1CPY A;  4R8C A;  3E8B A;  1ZWI C;  1JCH A;  3RBZ A;  2W6I G;  4R6Z A;  4RO2 A;  1MOF A;  1RPO A;  1Y4M A;  2ZXW C;  3TK1 A;  3K79 A;  1PNK A;  5EBW C;  5CBG A;  1S72 V;  2QM7 A;  3E8F A;  1OZ0 A;  1NVP B;  1YJW V;  1GM9 A;  3GWO A;  2B1I A;  5B3S B;  2X6A A;  4JYB A;  1P7B A;  2Q68 A;  3TET A;  2OCC B;  4MVU A;  1H38 A;  3LUT B;  1QLE C;  1XL6 A;  4H37 A;  4WFF A;  2OT5 A;  2EIJ B;  1R73 A;  4GX0 A;  3F5W C;  4MTX A;  3K03 A;  2F43 G;  3GB7 C;  3IFX A;  5KA6 A;  3OUS A;  4MVQ A;  4JAS A;  2WAM A;  1SES A;  1VQL V;  2JEU A;  2P7T C;  3OGC C;  4JTD B;  3E8H A;  1PD3 A;  4RQF A;  2JJ2 G;  2EIN B;  3RVY A;  3RW0 A;  3JD0 A;  3JCZ A;  3NXS A;  3CME V;  1AI5 A;  3T1C A;  1F4N A;  3OMA B;  3FB6 C;  3EHB B;  2X6B A;  1KKD A;  1V55 C;  3K9A A;  1I5Y A;  1NBM G;  2WLM A;  3ABK C;  1H2G A;  3ABL B;  1K97 A;  3CCL V;  2WSS G;  3VBB A;  1YIJ V;  1DF4 A;  1FFT B;  4MS2 A;  1DF5 A;  2XAJ A;  2ZXW B;  1LNQ A;  1VQN V;  1SRY A;  4FJC C;  4CBC A;  3AG3 C;  3OR6 C;  4MW3 A;  1CEZ A;  1RM1 C;  3F7V C;  5HFM A;  3HPL C;  1FS0 G;  2HFE C;  3CC2 V;  3I55 V;  3ZCC A;  1THZ A;  3LDD A;  3OMN B;  1GM7 A;  4UV8 A;  1BL8 A;  1ENV A;  2K1E A;  3ETE A;  1R6N A;  4MVO A;  2EIL B;  1VQ4 V;  1KP2 A;  3M99 B;  4QE9 A;  1F4M A;  4BAY A;  4MVR A;  2PI5 A;  3LNM B;  1OCC C;  3T2M A;  2ZDI C;  1QR8 A;  2WLN A;  3G6E V;  3LDC A;  4GCZ A;  3D36 A;  1GM8 A;  2JDI G;  1KD1 W;  1K92 A;  1MAB G;  4XDK A;  2EJR A;  5H9C A;  2JEX A;  2QE7 G;  3ETD A;  3P30 A;  1IXM A;  1KC8 W;  1GKF A;  2UXN A;  2DWE C;  1W0K G;  1R3I C;  1ORQ C;  1E1R G;  2R9I A;  1XL4 A;  3OUF A;  5J9P C;  3UM7 A;  1BMF G;  4JAV A;  4KFM A;  1K7D A;  1V55 B;  4L87 A;  5IYD O;  3CC4 V;  1E1Q G;  2WPD G;  1HWY A;  2OCC C;  5LHH A;  3CXC U;  1NKD A;  3KG2 A;  4G2K A;  1NJI W;  3QO8 A;  5E1A C;  1BHA A;  3SYA A;  5GW7 A;  2EIM B;  2ZR3 A;  3SYP A;  2XAG A;  1VQ7 V;  1QVF U;  1R3L C;  3AG3 B;  2IW5 A;  4JYC A;  3OR7 C;  1KP3 A;  5FL7 G;  5KA5 A;  4WCE V;  2OTJ V;  4UVB A;  1PKX A;  4QPJ A;  2WLJ A;  4EKW A;  2WWW A;  3CCS V;  1S5H C;  3K04 A;  4QIW F;  2M7W A;  2NNU A;  4QE7 A;  3ZMU A;  1R3J C;  2XAH A;  3E35 A;  1V54 B;  4G28 B;  5H6Q A;  1PNL A;  4J9Z B;  3IGA C;  5B1A B;  4UVA A;  3CCM V;  3MD0 A;  4I5S A;  2XAF A;  2W6J G;  3P32 A;  3UKM A;  4BIZ A;  3SJQ C;  5L3E A;  2A0L A;  5LHI A;  2X6C A;  5L3F A;  4H33 A;  1VQP V;  1VQ5 V;  1JX9 A;  5LGU A;  3ZIA G;  3DTU B;  3ABT A;  5HFL A;  4JTA B;  3ZRS A;  2X0L A;  1AI4 A;  2P67 A;  4QJF B;  4Q20 A;  2ZDI A;  4MT8 A;  3AG2 C;  2QTO A;  3JYC A;  1Q81 W;  1Q86 W;  3EFF K;  4F4L A;  5CN0 A;  1B6Q A;  2IJK A;  2PI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...