4QNHB

Calcium-calmodulin (t79d) complexed with the calmodulin binding domain from a small conductance potassium channel sk2-a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective phosphorylation modulates the PIP2 sensitivity of the CaM-SK channel complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ion transport/protein binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qnhB00
2A0LA 3SPCA 2EINC 3FB6C 4MVOA 3KG2A 2Q69A 4MVSA 1K4CC 3K06A 1OCZC 5E1AC 2R9RB 1R3JC 2ZD9A 5EBWC 3OUSA 3RVZA 1ZWIC 2H8PC 3T1CA 4P2ZA 4EKWA 1P7BA 4G28B 1XL4A 4MSWC 3RBZA 4MW3A 5EBMC 2WLKA 4QE7A 2Q67A 4KFMA 3SYPA 2HVJC 3RVYA 4I9WA 2QTOA 3E86A 2KB1A 3FB7C 4PA9A 3K0GA 3SPHA 2HVKC 3SPIA 4DXWA 1V55C 3JYCA 3PJSK 2HJFC 5B1AC 1K4DC 4GX5A 4X8AA 3LUTB 3SJQC 2IH3C 2IH1C 4MVUA 3UKMA 3X2QC 3IFXA 2AHZA 4XDJA 1BL8A 1JVMA 1OCOC 3ASNC 3K03A 3OUFA 4WFFA 3AG1C 3TETA 1OCCC 4ZBMA 4PDMA 5B1BC 3SPGA 4R8CA 3SYAA 5J9PC 3SYCA 4MVRA 2WLLA 3STZC 4PA7A 4MVZA 4PA3A 3UM7A 4PDRA 5EC2C 5B3SC 3F7YC 2WLJA 3T4ZA 2DWDC 5EBLC 4JTAB 4MTOA 5EK0A 3LDCA 3OR7C 3GB7C 3E83A 1QLEC 4P30A 4LP8A 3SYQA 2HFEC 4QE9A 5BZBA 4X88A 3RW0A 5KUMA 3FB5C 2BOCC 2WLLB 3AG4C 3E8BA 4X89A 2AHYA 5CBFA 4WFHA 1V54C 2Q6AA 4G27B 3BEHA 4LBEC 4PA6A 2WLMA 5IY5C 3AG3C 2X6BA 4H37A 3K04A 5CBGA 3SPJA 4P9PA 4BW5A 4F4LA 1S5HC 2DWEC 4MS2A 4P9OA 3R65A 4MVQA 3SYOA 3WG7C 2EIMC 3LDEA 3AG2C 2Y69C 1R3KC 2ZXWC 3FB8C 4RO2A 4RUEA 4QNHB 4RAIA 3IGAC 4HZ3A 3ZJZA 1M57C 2NLJC 3E8GA 4WFEA 4J9YB 2A9HA 2P7TC 4UUJC 3K0DA 4R6ZA 2W0FC 4JTDB 3TCUA 3K08A 3LDDA 5CBHA 4MVMA 2WLHA 3LNMB 4MTGA 5KUKA 1ORQC 3VOUA 2EILC 1M56C 3HPLC 4CBCA 1OCRC 1G4YB 2OCCC 3ASOC 3EFFK 1R3IC 2YEVA 4PA4A 4LCUC 4R7CA 3E89A 2Q68A 4JTCB 4TWKA 4WFGA 4MW8A 1KKDA 2K1EA 2EIJC 4MTFA 3OR6C 4PDVA 4XDKA 2WLIB 4J9ZB 4GX2A 1LNQA 2JK5C 2ITCC 3F7VC 1J95A 2DYSC 2BOBC 2QKSA 2DYRC 3T2MA 3E8HA 2HG5C 3ABMC 3T4DA 2X6CA 3E8FA 3OGCC 4GX1A 3STLC 2EIKC 3ZRSA 2WLNA 4XDLA 4OXSA 3F5WC 2WLIA 4RUFA 2ATKC 5EC1C 1XL6A 1R3LC 4HYOA 2A79B 4GX0A 4H33A 3ABKC 3ABLC 2X6AA 4PDLA 2ITDC 4R50A
chains in the Genus database with same CATH superfamily
3CCQV 3UQ8A 2QJ1A 2ZINA 2YICA 1DF5A 1OHHG 1ZWIC 5KA5A 2JEXA 4P2ZA 2ZIMA 2QGNA 3DXRB 2EULA 1OCCB 2Q67A 1ENVA 1ZAUA 4W4LA 4TV9A 1NU1H 3ASNB 3EHBB 1IDSA 3M99B 4MVUA 1YJWV 4DW1A 3IFXA 4WFFA 1VQ7V 1HNWO 1QNMA 4MTXA 1SESA 2LW1A 5E79Z 4PDMA 2IJKA 4ZHQA 3VBBA 4X64O 2ODMA 1QQCA 4PA3A 3UM7A 2E76B 3F7YC 5C8YB 4KP4A 3SJAC 3SYQA 5IWAB 3JAWB 3G6BA 4JI0B 2AW9A 2EIMB 4DV0O 2WLMA 2HLDG 5IY5C 3CRCA 2ZM6O 3K9AA 1MMMA 4WBNB 2Y48A 1THZA 2Y69C 3A2FA 4TQDA 1K8AW 1Y74B 3AG4B 2A9HA 3CSXA 3CCUV 5BR8O 4MVMA 4KHPO 1N0NA 4JI5O 1EM1A 1AI5A 4DV3B 3G67A 1K73W 3U11A 2OCCC 3EFFK 4D6TH 4TV8B 1N34O 5LMNB 1PL0A 3RYCA 3G80A 3BAAA 1WLEA 4Q20A 1XEQA 1IZ3A 1Q6IA 2Q73A 3W7SA 1Z5WA 4I0XB 1Y4MA 2AZ0A 3OT7A 3N27A 1QHTA 2F93B 4DV2B 2R9AA 4O2BB 3T2MA 1XI1A 2JEUA 4I7ZB 3VQYA 3SR2C 2EIKC 2PGGA 5EC1C 3B2EE 2A79B 4GX0A 2VWJA 4QGPA 1WN7A 1IVSA 2H8PC 1URFA 3X2QB 1BGYH 1GK9A 1Y6XA 3B8MA 4QJFB 1XUQA 4B3RO 1XMQO 3BA8A 5JCOA 1N36B 4ABMA 2QTOA 1SZTA 4ZHQB 3FKSG 5IYBO 5LOVB 4LFBO 1QLEB 1PPJH 2XHBA 3ASNC 2YXLA 1XNRO 2L35A 1VIBA 1DF4A 2EBOA 3STZC 1Z2GA 1MABG 1Q6HA 5DECA 5B3SC 1OJHA 2UXBO 1SQPH 1KD1W 4LH6A 3E83A 4O4IA 3JAKA 2Q0AA 1RSOB 1G8MA 2AHYA 5CBFA 4WFHA 3H1LH 1VQ9V 1CPYA 2W0XA 4F4LA 3VQVA 2EIMC 3AG2C 2VQEO 4YY3B 3ZHVA 4TV8A 1QVGU 5LGTA 2P7TC 3WG7B 2FMLA 3AK1A 4K35A 4YHHB 2QWQB 3TK1A 1SQVH 4JV5B 2XOKG 1AI4A 4JASA 5IJ9B 5L3CA 4DR5B 4GKKB 1E1QG 5LXTA 5TISZ 5KA6A 5LGUA 3E89A 2QM7A 4YJ2A 1JA8A 4U3JB 2Q8VA 3P30A 1ZSPA 5LHHA 2UXNA 1AB3A 2EJ7A 3IC7A 3B8NA 5LP6B 5FL7G 3JSLA 4FM2A 1MSWD 2HR3A 1XBLA 4RUFA 1NR1A 1S5LZ 3O9OA 4H33A 4DUZO 3ZN0A 3KG2A 2DN9A 1XNQB 4DUYB 1HP8A 5E1AC 3L71H 3RYIA 5EBWC 4J10A 1DK1A 3E35A 4DR1O 4YXWG 1SA0B 3EXAA 4I9WA 5LBQA 4J41A 1OCOB 2GDSA 3JYCA 3OEHG 1KC8W 1K4DC 3OW2U 1TA8A 4JI4B 2PYLA 1MZEA 3ZRWB 2EINB 4FJCC 3E2EA 2DMXA 5B1BC 3M7MX 1H2LA 3CWBH 3W7XA 4X1IA 3P3PA 1YF2A 1YHQV 3SJCC 3ABUA 1K5QA 1A32A 1FD9A 5GONA 2UXDO 3RW0A 2RNBA 1M9NA 1TAEA 4X89A 2F95B 2YXHA 5IY5B 2Q6AA 1D5AA 3JD2A 1WP7A 1H2KA 3D36A 4MVQA 1JCHA 1R3KC 2QE7G 1EN6A 2HP8A 2JGDA 3LSQA 3WFVA 1NBMG 2WLHA 1AI7A 3DC6A 4TQFA 2EILC 3HPLC 1VQ4V 1VARA 4JAVA 3QO8A 4KUMA 1PNMA 5B5EZ 5F2VO 2JRIA 4XDKA 1QR9A 5BMVB 2DYSC 3JCZA 3CCLV 3M8AA 5JH7B 3JD4A 1ZL8A 3F5WC 1FJGB 1YCIA 3EVKA 1K5SA 4A5UB 2PY5A 2HEPA 1AROP 4AQYO 2ZD9A 4K0KO 1GM9A 1Y76A 4X20A 5H9CA 4LNUB 2H94A 5L3BA 2O57A 3HKDA 2VWKA 2UUBB 4GCZA 4LH7A 3DTUB 4NTWA 3TETA 4GKJB 3SPGA 4IHJA 4JI3O 2YIBD 3F5TA 3HKEA 4EEQA 1V9PA 3RYFA 1F4NA 2Q7HA 4JI6O 5EBLC 4UFZA 5A2QN 4FLZA 1YDXA 3WB0A 3ZEDA 1GAXA 4LF9B 5J2TA 4QPJA 1GH6A 3TXQA 1TGOA 2GUZA 4PA6A 4UCVA 2UUAB 1F7YA 4X1YA 4P9OA 1WA8B 1M93A 2CAZC 4K3AA 3U0ZA 1IBKB 1NVPD 2BTOA 4GKKO 2ZCEA 2OCCB 5CA1A 3J80N 3QVNA 4DR2O 3T1HO 1AJQA 4X9QA 4MT8A 1FXKB 2XT9A 3K59A 1Q86W 4WFGA 1IURA 3CRQA 2MK3A 1PKXA 5FPRA 2E75B 2YEVB 1JX9A 2BOBC 4LF7O 5JVDA 2ZDIC 4TOIA 5LA6A 2XUMA 4LF8O 4JI7B 1XQ8A 1K33A 2ZIOA 4JI8O 2WLIA 2CGOA 1N32B 4ZI7A 1Y76B 4X20B 2OYQA 1QR8A 2YIBA 3ZJZA 1N36O 1QU7A 3CJHA 3FB6C 4MVOA 4N23A 3HKDB 1OCZC 4FPPA 1R3JC 3MHSC 5KLVH 4FZ1A 5D5QA 4UVAA 1P84F 2QM8A 2Q4PA 4IGGA 1PNKA 3H1IH 2YXYA 3OE7G 4FZ0A 3K0GA 5IT9N 4DXWA 3APQA 3MHHC 3ZN1A 1I0HA 2M7WA 1GM7A 2QM4A 2AHZA 4XDJA 2AGAA 1BE3H 1COWG 1Q3EA 2BTQB 4O4HA 4CH4A 1ZTEA 3BA9A 4I55A 3BRCA 4J7JA 3BFRA 1H8HG 4JTAB 3CCJV 4J42A 3ZIAG 4PHZA 1KQSU 5BZBA 4X62B 3CCSV 3QO5A 2E5LO 1W59A 2FTKA 3AG2B 3GWKC 3AG3C 3OD4A 4DV0B 2OIEA 3R65A 2EIJB 3WG7C 1QCEA 3LDEA 3L72H 4OPAA 4FLUA 3ZX6A 2P4VA 1GO3F 3J81N 3K0DA 5IJ0A 4HBNA 4FFBB 3LNMB 4MTGA 5KUKA 4FLWA 3OFNG 2Y0PA 4KHPB 3ETGA 2QWPB 1IX9A 1G4YB 2QTSA 1RFYA 3CX5F 2YEVA 3JATA 4KL1A 5JVDB 4CH5A 2ZR2A 4MW8A 3B77A 2B1GA 1Q7YW 4MTFA 3OR6C 3H01A 1GKFA 2WLIB 1FS0G 4W4KA 3ZMVA 5KHKA 3GWOA 3LSUA 3E8FA 4FM0A 4E4EA 4ZOLA 1KMIZ 4UCUA 1VQPV 3CEIA 1VQKV 2JGUA 1YITV 3ABMB 1XL6A 4K0KB 3D8CA 2Y0IA 4JAUA 4MVSA 1Q43A 1IBMB 5EYPA 1LUVA 2HJDA 2ZR3A 1P7BA 4DR5O 1OCZB 3L70H 4NKGB 4WFAV 3NXSA 4O4HB 3K57A 5HFMA 1SQBH 3O65A 2QKAA 1J5EB 4H13B 2IH1C 3BVOA 3UKMA 2FYUH 3K03A 4BIUA 3T1YB 3UO3A 1XNRB 2V1DA 3KKYA 1VQ8V 2C2AA 2KG7B 3S3XA 4XBFA 4DV5B 4O2BA 1KP3A 2JVDA 1BSMA 4IYHA 1WAZA 5KUMA 1XNQO 3ZMUA 3K5OA 3MAQA 5CBGA 5K1PA 4JI2O 1S72V 5CA0B 1KECA 1YEWA 4QNHB 1Z5VA 1GM8A 4K8XA 4DR6O 4JTDB 4LF6O 5J2UB 3E22A 4NR1A 1RM1C 1NH2D 4LF4B 4TV9B 4YJ3A 1ZUQA 3ZMZA 4B3TB 5EZYA 1LUWA 1EBOA 4I9QA 2RCVA 3CRAA 1IXBA 1MOFA 2Q7GA 2P22C 4GX2A 2JK5C 1TUEB 3K5LA 5FLXN 5JQGA 2KKWA 1RPOA 3JARB 3T4DA 3FD9A 2LGWA 4O4LB 3JAWA 4JI1O 1TVKA 4B7EA 3ASOB 2BCCH 2VQFB 2GHYA 3RN4A 3RWRD 1BMFG 4B3RB 3S3WA 3CXHF 3H9VA 1K92A 4X1KA 2LFRA 2DYSB 2ZNJA 4C7UA 2F4VB 5KX5B 1YIJV 4CS4A 4LFCB 3DGEA 1SZXA 3FAVB 2RN9A 3SPHA 3SPIA 2NN4A 2ZNIA 4X8AA 1P7GA 1NVPB 4PV1B 2CDYA 4FVMA 4CH3A 1WNSA 1BS3A 4DV6O 2YDEA 3SJBC 2HHHB 4UVCA 2H3OA 2GSMB 4MTOA 5KMGB 2HFEC 4DR7O 3C3SA 2W6IG 2WLLB 3C90A 1FFXB 3SPJA 4BW5A 2UXCB 3T1HB 2RQ6A 3U10A 2Q0OC 2LJ2A 1NTMH 1VF6A 3LDDA 1SA0A 1EZJA 4IL6Z 4CBCA 1XOUA 4NVPA 4DK1A 4LF7B 2ZDIA 2Q68A 4TWKA 1IBLB 3FYEB 1VMGA 2K1EA 4X64B 4WFBV 3JCUZ 1YVWA 1NTZH 1KU9A 3JALA 1R73A 4I50A 4QPKA 1I94B 1BT8A 2FKXA 2K9PA 4TUYA 5IYZB 3FX7A 2YC0A 4O4IB 4CC5A 4DO2A 1G1XB 5GONB 4XDLA 1V55B 4X1KB 1S0VA 3MDSA 4JF3A 1N4CA 1YSCA 2MW2B 4LF5O 1TUBB 2R9RB 1JPXA 2JS5A 2Q7EA 4MW3A 4U3FH 4DR1B 5IJ9A 4PA9A 1SKVA 4FMTA 2IH3C 2RMKB 3AG1C 5B1NA 4DV1B 3UT5B 4MVRA 4PD4F 2WLLA 3OMIB 4NXMB 4IT5A 2R9IA 2LQTA 1N32O 3Q4HA 2WLJA 4X66O 5EK0A 2B9ZA 1N33B 4K8ZA 1V54C 5H2FZ 2PI5A 3HKBA 1WPBA 3CC4V 1SQXH 5L3FA 1B06A 3RYHB 3FB8C 2Z3YA 2QWNB 1AR1B 4PI2A 1D5NA 2NLJC 2W0FC 1MG1A 4JZGA 4B7KA 1ORQC 2QDOA 2F1MA 5H6QA 4JGSA 2F23A 2ZXWB 4LCUC 4ASUG 4JTCB 3ZRWA 4TUYB 5CB4B 2EIJC 3F7VC 2ITCC 3K58A 4X1IB 1Q82W 4QIWF 2IJIA 4JYAB 2ZM6B 3E8HA 3ABMC 1VF6C 5EIBD 2UU9B 1AJPA 1PP9H 1YTFB 4J80A 1BZKA 1BCCH 4HYOA 3CPWU 2Z5UA 3APOA 1K3EA 1K4CC 3P3NA 4O2AA 3CMAV 1H2SB 2EX3A 3WU2Z 4UCSA 2V4DA 1F23A 2JGDB 2OTLV 2QKCA 3KCYA 4MSWC 1XDCA 4QE7A 1SETA 4FFKA 2BSKA 4OX9O 1VP7A 4DV4B 4I5SA 3AK2A 1L0LH 2CGNA 1HW7A 1VEWA 3B40A 1BL8A 4B3MB 2CTRA 2UU9O 4MVZA 5L3DA 4L8JA 4PDRA 5B1AB 5JH7A 5KAFZ 3ETDA 2Y69B 5GTIZ 4P30A 4EFEA 1MA1A 3CCEV 3AG4C 1XHXA 2WA4A 2ZT9B 4HNAA 3BEHA 2NR5A 3JASA 3N2KB 4P9PA 1NS1A 5ITZA 1FAFA 5FNVB 4BIZA 3JAMN 1I5XA 4J11A 1M57C 3SGIA 5LXTB 2VRZA 2D3OW 3ZRXA 4UUJC 4NB5A 4JI5B 1HWYA 2PI4A 4YJ2B 4RQEA 3VOUA 1K7DA 2YIDA 3ZMTA 1P49A 3ABKB 1AILA 3K5MA 2Q9LA 4H0LB 2EIKB 3R66A 5CA3A 1WPXA 5DM6V 3ZHSA 2DYRB 1NI8A 2YI9A 1R6NA 2AXTZ 2UXBB 4TSFG 3KZIZ 5JCOC 2UXDB 4JI7O 2WLNA 3A0RA 5LYJA 4OPHA 1Q8IA 2D2CB 5AG2A 3WB1A 4DV7O 4LFCO 3QG5A 1WP8A 4NYKA 1S3JA 4CZZA 2IU3A 3A8TA 3BPZA 4BW9A 1FYJA 5EBMC 3CB2A 5CA1B 4B3SB 5K1XA 1FXHA 1HNZB 1AJNA 5BXZA 3JATB 3LUTB 1DTOA 1R6TA 3SJQC 4B08A 1B04A 3HR0A 1T5EA 3CP1A 2FL4A 3CE2A 2XAHA 4R8CA 3OR7C 4DR4B 1QLEC 2WSSG 1XMOO 2LW7A 3OTOB 2DQ3A 1YXBA 4UV8A 3CJHB 2VS0A 3D3QA 4L87A 1AVMA 1S5HC 4MS2A 1G6UA 4Q6GA 4N21A 4NXNO 1EN5A 2VQEB 4HZ3A 3CMEV 4Z2WA 1WB7A 3TCUA 4ZKIA 5CBHA 5KHIA 3P32A 4YHHO 2OWOA 5L3EA 1Y74A 2PYJA 3ETQA 5BMVA 1O9GA 1NQTA 4LWSB 3I55V 3BABA 4KXRA 3D3IA 4DW0A 4NTYA 4U7OA 2BTQA 3L74H 3QF7A 1HNWB 5LMUO 1BHAA 3W7TA 1OV9A 4GT1A 4UB6Z 4UB8Z 1I08A 3K5NA 2DYRC 2DJVA 2HKOA 5DN6G 1SQFA 3OGCC 2N05A 1Q5OA 1KKCA 3VQWA 2UUAO 2DOSA 2YIAA 2X6AA 1F4MA 3SPCA 3ML0A 2Y4UA 4JYYA 1NJIW 3K06A 1SS3A 4DUYO 1RPRA 3OEEG 4LFAO 1AR4A 4G28B 3KCXA 5B3SB 4X65B 1J5EO 1EN4A 2F4VO 1W2BU 4FFBA 5B1BB 5IYCO 3RVYA 2ILMA 5CN0A 2QWOB 1FPOA 1HR0B 1V55C 4DR2B 1UFIA 3C3TA 1R1BA 4DR3O 3CC7V 2XASA 3AK3A 1VF5B 2RJZA 3OTFA 2YUAA 1M5IA 2KQXA 5LOVA 4ZIBA 3JARA 4ZOLB 2ZQMA 4LP8A 4AQYB 4O4LA 4QE9A 5BY1A 1ZLZA 3IJ4A 5B1OA 2E3CA 4GYCB 1QBZA 4ICGA 2B1IA 5KHGA 4CS3A 4RQFA 5KAIZ 5LGNA 3IAYA 3QNEA 3SYOA 1M57B 4FIPC 1YI2V 1VQLV 2YSUB 3J7AU 4LWSA 4JYCA 2JDIG 1Q90D 3DXRA 3CRRA 1FXKA 1W0JG 2P06A 1IBKO 4DR6B 2EZOA 5L3GA 5FPOA 1M56C 4Z1MG 3RGBA 1VQMV 2JIZG 2CUGA 4R7CA 4NXMO 2EJRA 2YS8A 2CE4A 2JS3A 4JI3B 1KKDA 5A9GA 2DW4A 4J7ZA 1PV0A 3ETEA 4J7KA 1B6QA 1LNQA 2P4KA 2PF4E 4CS2A 2EILB 2XAJA 4JYBA 1JQ0A 1RP3B 5IDJA 5IWAO 4JI4O 1YZBA 4GLXA 2XNDG 3CRMA 4UV9A 2ATKC 2CTQA 2E5LB 2P5OA 2EINC 4JI2B 4LF5B 1JJOA 3TGUH 5LHIA 1XHZA 3UCSC 3ZHUA 1GTOA 2ZE8A 1CXZB 2WLKA 3AG1B 5J2UA 1Y66A 4YJ3B 1WB8A 3E86A 3FB7C 1GN3A 1N34B 2HVKC 1U96A 1HNXO 3RYCB 1PM9A 4PJ0Z 3ZHRA 5B66Z 4BIOA 3D36C 2IBZH 3K9SA 4U7NA 3QTCA 1GN2A 2XAGA 2WPDG 2A06H 1HDJA 4IYIA 2PUSA 3K3WA 2R72A 5LHGA 5IYZA 2CTPA 3VQXA 3WB2A 1K97A 3E8BA 2M6YA 4BAYA 4DUZB 4LBEC 4JAAA 1U97A 2VQFO 1E79G 1IBMO 2ZE6A 2LGQA 2A3QA 4GUNA 2WWWA 1TUBA 1K9MW 2ZXWC 4RAIA 2V7QG 2NNUA 5D5PA 5BR8B 1H38A 2UUCB 3BHPA 4NTXA 1IXMA 2LO1A 4DRXB 4OGQB 1OCRC 3OGIB 1R3IC 4PA4A 2JJ2G 3JD3A 3FFQA 4JV5O 1N8RW 4HAMA 4PDVA 3H1JH 1M90W 5JJJB 2QKSA 3W7UA 1KP2A 2QR4A 2IJJA 4GX1A 1FXKC 1MZFA 2PZSA 3JAKB 2DE0X 4TT3G 2WA3A 4LFAB 2ITDC 3N2GB 2Q69A 4WBNA 1X4TA 1KUQA 2XAFA 4F6RB 3OAAG 3RYHA 1Q81W 2F66C 1F51A 4EKWA 1BQZA 4O4JA 1UPGA 3SYPA 2P67A 3CXCU 3G6EV 4B3TO 1FKAO 1NT2B 3PJSK 5B1AC 4LFBB 4LNUA 2UXXA 3B4SA 4I0XA 1OCCC 5CB4A 2QSAA 4DV3O 3AG3B 5EC2C 2DWDC 2CH7B 5LP6A 4FLTA 1US6A 2P90A 3GB7C 1L8DA 1SQQH 5CA0A 1VQ6V 4X88A 3CCVV 3HKEB 4JI1B 1MSDA 2N74A 1Y67A 2X6BA 2R70A 3E22B 2DQ0A 2OCHA 4DYLA 1AP6A 4O2AB 4RO2A 4DRXA 5KHJA 4J9YB 4R6ZA 4YIPA 4PELA 3ZRVA 1NH2B 2BSKB 4YY3O 2XAQA 2UUBO 3RFRA 4DV5O 1JOYA 2X7RB 1SC5B 1L1FA 5HFLA 1JFFB 4DV6B 1PL4A 1TVKB 3ZCCA 1N0JA 3W7WA 3BCCH 3Q4HB 2QWRB 3UO2A 2HG5C 1RM1B 3CC2V 3N2GA 4DR7B 3RT3C 4UCOA 4F6RA 3G4SV 3ICXA 1RSOA 4FLYA 2GBOA 4LF9O 3OM3B 3JASB 3L9DA 3ZS8C 5KX5A 3MD0A 4O4JB 3HKBB 3TJTA 2CTWA 4DV7B 5ITZB 3ABTA 5FNVA 3OUSA 1DLBA 4ZI7B 4IIJA 1XMQB 1FJGO 1SRYA 1XL4A 1NKDA 4JPRA 1QVFU 2HVJC 1BHBA 1VQNV 1AR5A 2KB1A 5GW7A 5LMUB 1CP9A 4GX5A 3X2QC 2CH7A 4AHCA 4I4TB 2G38A 1IBLO 4U3JA 3TXSA 5J9PC 1YJNV 5LMNO 3LSSA 2BE3A 4EB6A 2GV9A 1FXVA 3QO7A 4WF9V 1I94O 5DEDA 2Q5ZA 4FLVA 1FFXA 2F43G 4JI8B 1ZL8B 2IJHA 2LP7A 5LYJB 2QEXV 1V54B 2A7WA 1EFRG 4G27B 2ADQB 3IC9A 4H37A 1BQ0A 5H5NA 3RYIB 2ZE7A 4RUEA 2QA4V 4NXNB 4JI0O 3E8GA 4F6EA 1KBHA 1AI6A 4H44B 3K08A 3H1KH 1O9HA 1OZ0A 2LFSA 5JJNB 4D7TA 3JD0A 1JFFA 4LF4O 4DV4O 1D2DA 3JALB 1E1RG 3OMNB 3JSNA 2B5UA 1VQOV 4J9ZB 2L6LA 3DC5A 1ROPA 3CS5A 1XILA 1YJ9V 3CYOA 1I7FA 1XREA 3OMAB 1ZX3A 1H8EG 1QLNA 4IIJB 4DV2O 1DGSA 3N2KA 4D7SA 2GUZB 1MNGA 2WAMA 2A0LA 4X1YB 2ZE5A 2UXCO 4BWAA 3CCMV 1M1KW 1WA8A 4E2LA 1NR7A 3RVZA 3T1CA 1HNXB 1HNZO 3CCRV 1H2GA 4I4TA 1K34A 3LNNA 4B3SO 5EYPB 3L73H 1VF7A 2JJ1G 3UT5A 4EB6B 2HJFC 1KB9F 4LR3A 1JVMA 2XTAA 3OUFA 4LF6B 1EZVH 1NZ6A 1S77D 2OT5A 1JJ2U 5GTHZ 4PA7A 4Z1VA 3A0BZ 2RDCA 4LF8B 3HKCB 3G71V 4JYAO 5KHHA 5LA6B 4FK5C 4FLXA 3I5DA 2AZ2A 3AEIA 4UVBA 3FB5C 1S76D 1XMOB 1PD3A 2KG7A 2X0LA 4X65O 2OTJV 1YTFD 4EFBA 2Z0AA 3NR7A 1M56B 2Y4TA 4UXNA 1AP5A 3IGAC 3GVMA 2IW5A 4WFEA 1H2NA 1I5YA 1JR9A 2GTSA 4UCRA 4AI8A 1GN4A 4AILC 1R6KA 3ASOC 4CC6A 3THOA 1SF9A 3T1YO 1WJZA 1P4RA 1N33O 4IHJB 1Q6UA 5IE9A 1H2MA 5EZYB 1GN6A 1UJWB 4I55B 3RYFB 1J95A 2X6CA 4X62O 3STLC 3SDLA 3ABLB 2ZKOA 3FYIB 5J2TB 4GKJO 3ZHTA 2FB5A 1OCRB 4RWUA 1R3LC 1CEZA 1PNLA 5JQGB 4UCTA 5EIBC 2HHHO 4LC1A 4R50A 2IU0A 1FFTB 2PTMA 3AG7A 1S5JA 2N04A 3A0HZ 1SQGA 2W6JG 1GRJA 2E74B 5C93A 2OIGA 3RBZA 2YI8A 5IJ0B 4DK0A 4KFMA 3HB3B 4OX9B 3ZMSA 3I56V 3HKCA 3JD1A 1OCOC 1VQ5V 3FAVA 3B09A 4ZBMA 3H1HH 3SYAA 2IM9A 3SYCA 2ETNA 2EZPA 2CK3G 5H6RA 3OTOO 4HNAB 3T4ZA 5LL6Y 1X59A 3LDCA 3ZBHA 2BOCC 5JJEB 4JZ2A 1KYOF 3K04A 3CD6V 5C8YA 2DWEC 5KMGA 5IYDO 4YIOA 1GMGA 4BR6A 5JWPA 4B3MO 4PI0A 3CHXA 2UUCO 3DSQA 4CH6A 4FM1A 3BY6A 1HR0O 5CMUA 1B3QA 1L0NH 2GTAA 2P6JA 4DR3B 4G2KA 1NTKH 1W0KG 4DV1O 3PN1A 1SERA 2ADPA 3ZHQA 5LP6C 4X66B 3ZRSA 4DR4O 3K79A 3L75H 4OXSA 1LR1A 2KSDA 4GZRB 4JI6B 4WCEV 4I50B 1JMKC 3ABKC 2ARHA 3ABLC 4PDLA 1M4UA
chains in the Genus database with same CATH topology
3CCQV 3FB6C 4MVOA 4N23A 1K3EA 2Q69A 1K4CC 2XAFA 1OCZC 1DF5A 3OAAG 4FPPA 3CMAV 1OHHG 1R3JC 1Q81W 1ZWIC 5KA5A 1F51A 2JEXA 1F23A 3MHSC 4P2ZA 2OTLV 4EKWA 4MSWC 1OCCB 4UVAA 4QE7A 2Q67A 1SETA 2QM8A 3SYPA 1PNKA 2P67A 1ENVA 3CXCU 3OE7G 3G6EV 3K0GA 4DXWA 3ASNB 4I5SA 3PJSK 5B1AC 3EHBB 3MHHC 3ZN1A 2M7WA 2UXXA 1GM7A 3M99B 4MVUA 1YJWV 3IFXA 2AHZA 4XDJA 1BL8A 4WFFA 1VQ7V 1COWG 4MTXA 1OCCC 1SESA 4PDMA 2IJKA 3VBBA 3AG3B 4MVZA 5L3DA 4PA3A 3UM7A 4PDRA 5EC2C 3F7YC 5B1AB 2DWDC 1H8HG 4JTAB 3CCJV 3ETDA 2P90A 2Y69B 3GB7C 4KP4A 3ZIAG 4P30A 3SYQA 1KQSU 5BZBA 4X88A 3CCEV 1VQ6V 3CCVV 3CCSV 3AG4C 3QO5A 3BEHA 2EIMB 2FTKA 3AG2B 2WLMA 2HLDG 3AG3C 2X6BA 5IY5C 4P9PA 3K9AA 2DQ0A 2Y48A 1THZA 2EIJB 3R65A 3WG7C 1QCEA 3LDEA 2Y69C 4BIZA 1K8AW 4RO2A 1I5XA 1M57C 3AG4B 4J9YB 1GO3F 2A9HA 3ZRXA 2D3OW 4UUJC 3K0DA 4R6ZA 3CCUV 4MVMA 1HWYA 4PELA 3ZRVA 2PI4A 3LNMB 1NH2B 4MTGA 5KUKA 4RQEA 3OFNG 1AI5A 3ETGA 3VOUA 2XAQA 1K7DA 1K73W 1G4YB 2OCCC 3EFFK 3ZMTA 2YEVA 1JOYA 1PL0A 2X7RB 3ABKB 2EIKB 1WLEA 4Q20A 1L1FA 5CA3A 1WPXA 2ZR2A 4MW8A 5HFLA 5DM6V 3W7SA 3B77A 2B1GA 1Y4MA 2DYRB 1Q7YW 4MTFA 3OR6C 3H01A 1GKFA 3ZCCA 2WLIB 1FS0G 1R6NA 3W7WA 3ZMVA 3T2MA 4TSFG 2HG5C 2JEUA 1RM1B 3CC2V 3GWOA 3E8FA 2EIKC 2WLNA 3A0RA 3G4SV 1VQPV 1VQKV 5EC1C 3ABMB 1YITV 1XL6A 2A79B 3OM3B 4GX0A 3MD0A 4JAUA 4MVSA 1S3JA 4CZZA 3ABTA 2IU3A 3OUSA 1DLBA 2H8PC 2ZR3A 3X2QB 3B8MA 1GK9A 1P7BA 1SRYA 1XL4A 4QJFB 1OCZB 5EBMC 1NKDA 4JPRA 1QVFU 2HVJC 4WFAV 3NXSA 1BHBA 2QTOA 1VQNV 2KB1A 5HFMA 1SZTA 1FXHA 3FKSG 5GW7A 1AJNA 1CP9A 5IYBO 4GX5A 3LUTB 1DTOA 3SJQC 2IH1C 3UKMA 1QLEB 3X2QC 3K03A 3CP1A 3ASNC 4BIUA 1DF4A 2XAHA 5J9PC 4R8CA 2V1DA 1YJNV 2EBOA 3LSSA 1VQ8V 3STZC 2C2AA 1FXVA 1MABG 3QO7A 4XBFA 4WF9V 1KP3A 5B3SC 2F43G 1KD1W 3OR7C 3E83A 1QLEC 2WSSG 2IJHA 2LP7A 2QEXV 5KUMA 1V54B 1G8MA 2AHYA 5CBFA 1EFRG 4WFHA 3ZMUA 4G27B 2DQ3A 1VQ9V 1CPYA 4H37A 4UV8A 5CBGA 4L87A 4F4LA 1S5HC 4MS2A 1S72V 1KECA 4N21A 2EIMC 3AG2C 4RUEA 2QA4V 4QNHB 4HZ3A 3E8GA 3CMEV 1QVGU 1GM8A 5LGTA 2P7TC 1AI6A 3WG7B 4JTDB 3TCUA 4ZKIA 3K08A 5CBHA 3P32A 1RM1C 1OZ0A 2LFSA 1NH2D 5L3EA 3TK1A 3JD0A 2XOKG 1AI4A 4JASA 5L3CA 3ZMZA 1E1QG 3I55V 1NQTA 1EBOA 5KA6A 5LGUA 3D3IA 3E89A 4U7OA 2QM7A 1E1RG 3OMNB 1BHAA 3P30A 2B5UA 1MOFA 3W7TA 4GT1A 1VQOV 4J9ZB 5LHHA 4GX2A 2JK5C 2UXNA 1TUEB 3IC7A 3B8NA 1ROPA 2DYRC 2HKOA 5DN6G 5FL7G 1RPOA 1MSWD 3T4DA 1YJ9V 3OGCC 2HR3A 3CYOA 3OMAB 1H8EG 4RUFA 3ASOB 1NR1A 1QLNA 2GHYA 4H33A 2X6AA 1F4MA 2WAMA 2A0LA 3SPCA 3ZN0A 3ML0A 1BMFG 3KG2A 3CCMV 1NJIW 1M1KW 3K06A 4E2LA 5E1AC 1NR7A 1RPRA 5EBWC 3OEEG 3RVZA 1K92A 3T1CA 2LFRA 4G28B 2DYSB 5B3SB 3E35A 3CCRV 1W2BU 1YIJV 5B1BB 1H2GA 3DGEA 1K34A 4YXWG 5IYCO 3RVYA 4I9WA 5CN0A 5LBQA 2JJ1G 3SPHA 1OCOB 3SPIA 1V55C 3JYCA 2HJFC 3OEHG 1KC8W 1K4DC 4X8AA 3OW2U 1NVPB 1JVMA 3OUFA 3CC7V 3ZRWB 2EINB 4FJCC 2XASA 3E2EA 1S77D 2OT5A 5B1BC 1JJ2U 4PA7A 3W7XA 4UVCA 1YHQV 2GSMB 3G71V 4MTOA 4FK5C 3ABUA 1K5QA 2ZQMA 4LP8A 3AEIA 4UVBA 2HFEC 4QE9A 3RW0A 3FB5C 1M9NA 2W6IG 2WLLB 4X89A 1S76D 5B1OA 1PD3A 2X0LA 5IY5B 2Q6AA 2OTJV 3JD2A 1QBZA 1YTFD 2B1IA 3SPJA 4BW5A 3D36A 4RQFA 1M56B 5LGNA 4UXNA 3QNEA 4MVQA 3SYOA 1JCHA 1R3KC 2QE7G 1M57B 4FIPC 1YI2V 3IGAC 1VQLV 2YSUB 2IW5A 4WFEA 3LSQA 1I5YA 4JYCA 3WFVA 2JDIG 1NBMG 1FXKA 1W0JG 3LDDA 2WLHA 2EZOA 5L3GA 1AI7A 1EZJA 4CBCA 2EILC 1M56C 3HPLC 1R6KA 4Z1MG 3ASOC 1VQMV 1VQ4V 2JIZG 2ZDIA 4R7CA 4JAVA 3QO8A 4KUMA 2EJRA 1PNMA 2Q68A 4TWKA 3FYEB 1P4RA 1KKDA 2K1EA 2DW4A 4WFBV 4XDKA 1QR9A 3ETEA 1B6QA 1LNQA 1UJWB 2EILB 2XAJA 1J95A 2DYSC 3JCZA 3CCLV 1R73A 4QPKA 4JYBA 1JQ0A 5IDJA 3JD4A 2X6CA 3STLC 4DO2A 2XNDG 3ABLB 3FYIB 4XDLA 3F5WC 4UV9A 1V55B 2ATKC 1OCRB 1S0VA 4JF3A 1R3LC 1YSCA 1CEZA 1PNLA 1K5SA 4LC1A 4R50A 2EINC 2IU0A 1FFTB 1AROP 2R9RB 2ZD9A 2W6JG 1GM9A 5LHIA 5H9CA 1JPXA 5C93A 1GTOA 3RBZA 4MW3A 2WLKA 3AG1B 2H94A 5L3BA 4KFMA 1Y66A 3HB3B 3E86A 3FB7C 4PA9A 2HVKC 3ZMSA 4FMTA 3I56V 4GCZA 2IH3C 3DTUB 3JD1A 1OCOC 1VQ5V 3AG1C 4U7NA 5B1NA 3TETA 4ZBMA 3SPGA 2XAGA 3SYAA 3SYCA 2EZPA 4MVRA 2WLLA 2CK3G 3OMIB 2WPDG 5H6RA 2R9IA 1F4NA 2WLJA 3T4ZA 5EBLC 3K3WA 5EK0A 3LDCA 5LHGA 1K97A 2BOCC 4QPJA 3E8BA 4BAYA 1V54C 4LBEC 4PA6A 2PI5A 3K04A 1E79G 3CD6V 2DWEC 4P9OA 3CC4V 5IYDO 5L3FA 2WWWA 3FB8C 1K9MW 2ZXWC 2Z3YA 1AR1B 1GMGA 4RAIA 2V7QG 3ZJZA 2NNUA 2NLJC 1NVPD 1H38A 2W0FC 2OCCB 1MG1A 1IXMA 1ORQC 3BY6A 5H6QA 1AJQA 1OCRC 4JGSA 1R3IC 4PA4A 2ZXWB 4LCUC 4ASUG 5CMUA 2JJ2G 4MT8A 1FXKB 4JTCB 3JD3A 2P6JA 3ZRWA 4WFGA 1Q86W 4G2KA 2EIJC 2MK3A 1PKXA 1N8RW 4HAMA 4PDVA 1W0KG 1M90W 3F7VC 2YEVB 2ITCC 1JX9A 1SERA 2BOBC 2QKSA 1Q82W 4QIWF 2IJIA 3W7UA 2ZDIC 1KP2A 3E8HA 3ABMC 2IJJA 4GX1A 1FXKC 3ZRSA 1K33A 3K79A 1AJPA 4OXSA 2WLIA 1YTFB 4HYOA 4WCEV 4TT3G 3CPWU 1QR8A 3ABKC 3ABLC 4PDLA 2ITDC 2Z5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0L A;  3SPC A;  2EIN C;  3FB6 C;  4MVO A;  3KG2 A;  2Q69 A;  4MVS A;  1K4C C;  3K06 A;  1OCZ C;  5E1A C;  2R9R B;  1R3J C;  2ZD9 A;  5EBW C;  3OUS A;  3RVZ A;  1ZWI C;  2H8P C;  3T1C A;  4P2Z A;  4EKW A;  1P7B A;  4G28 B;  1XL4 A;  4MSW C;  3RBZ A;  4MW3 A;  5EBM C;  2WLK A;  4QE7 A;  2Q67 A;  4KFM A;  3SYP A;  2HVJ C;  3RVY A;  4I9W A;  2QTO A;  3E86 A;  2KB1 A;  3FB7 C;  4PA9 A;  3K0G A;  3SPH A;  2HVK C;  3SPI A;  4DXW A;  1V55 C;  3JYC A;  3PJS K;  2HJF C;  5B1A C;  1K4D C;  4GX5 A;  4X8A A;  3LUT B;  3SJQ C;  2IH3 C;  2IH1 C;  4MVU A;  3UKM A;  3X2Q C;  3IFX A;  2AHZ A;  4XDJ A;  1BL8 A;  1JVM A;  1OCO C;  3ASN C;  3K03 A;  3OUF A;  4WFF A;  3AG1 C;  3TET A;  1OCC C;  4ZBM A;  4PDM A;  5B1B C;  3SPG A;  4R8C A;  3SYA A;  5J9P C;  3SYC A;  4MVR A;  2WLL A;  3STZ C;  4PA7 A;  4MVZ A;  4PA3 A;  3UM7 A;  4PDR A;  5EC2 C;  5B3S C;  3F7Y C;  2WLJ A;  3T4Z A;  2DWD C;  5EBL C;  4JTA B;  4MTO A;  5EK0 A;  3LDC A;  3OR7 C;  3GB7 C;  3E83 A;  1QLE C;  4P30 A;  4LP8 A;  3SYQ A;  2HFE C;  4QE9 A;  5BZB A;  4X88 A;  3RW0 A;  5KUM A;  3FB5 C;  2BOC C;  2WLL B;  3AG4 C;  3E8B A;  4X89 A;  2AHY A;  5CBF A;  4WFH A;  1V54 C;  2Q6A A;  4G27 B;  3BEH A;  4LBE C;  4PA6 A;  2WLM A;  5IY5 C;  3AG3 C;  2X6B A;  4H37 A;  3K04 A;  5CBG A;  3SPJ A;  4P9P A;  4BW5 A;  4F4L A;  1S5H C;  2DWE C;  4MS2 A;  4P9O A;  3R65 A;  4MVQ A;  3SYO A;  3WG7 C;  2EIM C;  3LDE A;  3AG2 C;  2Y69 C;  1R3K C;  2ZXW C;  3FB8 C;  4RO2 A;  4RUE A;  4QNH B;  4RAI A;  3IGA C;  4HZ3 A;  3ZJZ A;  1M57 C;  2NLJ C;  3E8G A;  4WFE A;  4J9Y B;  2A9H A;  2P7T C;  4UUJ C;  3K0D A;  4R6Z A;  2W0F C;  4JTD B;  3TCU A;  3K08 A;  3LDD A;  5CBH A;  4MVM A;  2WLH A;  3LNM B;  4MTG A;  5KUK A;  1ORQ C;  3VOU A;  2EIL C;  1M56 C;  3HPL C;  4CBC A;  1OCR C;  1G4Y B;  2OCC C;  3ASO C;  3EFF K;  1R3I C;  2YEV A;  4PA4 A;  4LCU C;  4R7C A;  3E89 A;  2Q68 A;  4JTC B;  4TWK A;  4WFG A;  4MW8 A;  1KKD A;  2K1E A;  2EIJ C;  4MTF A;  3OR6 C;  4PDV A;  4XDK A;  2WLI B;  4J9Z B;  4GX2 A;  1LNQ A;  2JK5 C;  2ITC C;  3F7V C;  1J95 A;  2DYS C;  2BOB C;  2QKS A;  2DYR C;  3T2M A;  3E8H A;  2HG5 C;  3ABM C;  3T4D A;  2X6C A;  3E8F A;  3OGC C;  4GX1 A;  3STL C;  2EIK C;  3ZRS A;  2WLN A;  4XDL A;  4OXS A;  3F5W C;  2WLI A;  4RUF A;  2ATK C;  5EC1 C;  1XL6 A;  1R3L C;  4HYO A;  2A79 B;  4GX0 A;  4H33 A;  3ABK C;  3ABL C;  2X6A A;  4PDL A;  2ITD C;  4R50 A; 
#chains in the Genus database with same CATH topology
 3CCQ V;  3UQ8 A;  2QJ1 A;  2ZIN A;  2YIC A;  1DF5 A;  1OHH G;  1ZWI C;  5KA5 A;  2JEX A;  4P2Z A;  2ZIM A;  2QGN A;  3DXR B;  2EUL A;  1OCC B;  2Q67 A;  1ENV A;  1ZAU A;  4W4L A;  4TV9 A;  1NU1 H;  3ASN B;  3EHB B;  1IDS A;  3M99 B;  4MVU A;  1YJW V;  4DW1 A;  3IFX A;  4WFF A;  1VQ7 V;  1HNW O;  1QNM A;  4MTX A;  1SES A;  2LW1 A;  5E79 Z;  4PDM A;  2IJK A;  4ZHQ A;  3VBB A;  4X64 O;  2ODM A;  1QQC A;  4PA3 A;  3UM7 A;  2E76 B;  3F7Y C;  5C8Y B;  4KP4 A;  3SJA C;  3SYQ A;  5IWA B;  3JAW B;  3G6B A;  4JI0 B;  2AW9 A;  2EIM B;  4DV0 O;  2WLM A;  2HLD G;  5IY5 C;  3CRC A;  2ZM6 O;  3K9A A;  1MMM A;  4WBN B;  2Y48 A;  1THZ A;  2Y69 C;  3A2F A;  4TQD A;  1K8A W;  1Y74 B;  3AG4 B;  2A9H A;  3CSX A;  3CCU V;  5BR8 O;  4MVM A;  4KHP O;  1N0N A;  4JI5 O;  1EM1 A;  1AI5 A;  4DV3 B;  3G67 A;  1K73 W;  3U11 A;  2OCC C;  3EFF K;  4D6T H;  4TV8 B;  1N34 O;  5LMN B;  1PL0 A;  3RYC A;  3G80 A;  3BAA A;  1WLE A;  4Q20 A;  1XEQ A;  1IZ3 A;  1Q6I A;  2Q73 A;  3W7S A;  1Z5W A;  4I0X B;  1Y4M A;  2AZ0 A;  3OT7 A;  3N27 A;  1QHT A;  2F93 B;  4DV2 B;  2R9A A;  4O2B B;  3T2M A;  1XI1 A;  2JEU A;  4I7Z B;  3VQY A;  3SR2 C;  2EIK C;  2PGG A;  5EC1 C;  3B2E E;  2A79 B;  4GX0 A;  2VWJ A;  4QGP A;  1WN7 A;  1IVS A;  2H8P C;  1URF A;  3X2Q B;  1BGY H;  1GK9 A;  1Y6X A;  3B8M A;  4QJF B;  1XUQ A;  4B3R O;  1XMQ O;  3BA8 A;  5JCO A;  1N36 B;  4ABM A;  2QTO A;  1SZT A;  4ZHQ B;  3FKS G;  5IYB O;  5LOV B;  4LFB O;  1QLE B;  1PPJ H;  2XHB A;  3ASN C;  2YXL A;  1XNR O;  2L35 A;  1VIB A;  1DF4 A;  2EBO A;  3STZ C;  1Z2G A;  1MAB G;  1Q6H A;  5DEC A;  5B3S C;  1OJH A;  2UXB O;  1SQP H;  1KD1 W;  4LH6 A;  3E83 A;  4O4I A;  3JAK A;  2Q0A A;  1RSO B;  1G8M A;  2AHY A;  5CBF A;  4WFH A;  3H1L H;  1VQ9 V;  1CPY A;  2W0X A;  4F4L A;  3VQV A;  2EIM C;  3AG2 C;  2VQE O;  4YY3 B;  3ZHV A;  4TV8 A;  1QVG U;  5LGT A;  2P7T C;  3WG7 B;  2FML A;  3AK1 A;  4K35 A;  4YHH B;  2QWQ B;  3TK1 A;  1SQV H;  4JV5 B;  2XOK G;  1AI4 A;  4JAS A;  5IJ9 B;  5L3C A;  4DR5 B;  4GKK B;  1E1Q G;  5LXT A;  5TIS Z;  5KA6 A;  5LGU A;  3E89 A;  2QM7 A;  4YJ2 A;  1JA8 A;  4U3J B;  2Q8V A;  3P30 A;  1ZSP A;  5LHH A;  2UXN A;  1AB3 A;  2EJ7 A;  3IC7 A;  3B8N A;  5LP6 B;  5FL7 G;  3JSL A;  4FM2 A;  1MSW D;  2HR3 A;  1XBL A;  4RUF A;  1NR1 A;  1S5L Z;  3O9O A;  4H33 A;  4DUZ O;  3ZN0 A;  3KG2 A;  2DN9 A;  1XNQ B;  4DUY B;  1HP8 A;  5E1A C;  3L71 H;  3RYI A;  5EBW C;  4J10 A;  1DK1 A;  3E35 A;  4DR1 O;  4YXW G;  1SA0 B;  3EXA A;  4I9W A;  5LBQ A;  4J41 A;  1OCO B;  2GDS A;  3JYC A;  3OEH G;  1KC8 W;  1K4D C;  3OW2 U;  1TA8 A;  4JI4 B;  2PYL A;  1MZE A;  3ZRW B;  2EIN B;  4FJC C;  3E2E A;  2DMX A;  5B1B C;  3M7M X;  1H2L A;  3CWB H;  3W7X A;  4X1I A;  3P3P A;  1YF2 A;  1YHQ V;  3SJC C;  3ABU A;  1K5Q A;  1A32 A;  1FD9 A;  5GON A;  2UXD O;  3RW0 A;  2RNB A;  1M9N A;  1TAE A;  4X89 A;  2F95 B;  2YXH A;  5IY5 B;  2Q6A A;  1D5A A;  3JD2 A;  1WP7 A;  1H2K A;  3D36 A;  4MVQ A;  1JCH A;  1R3K C;  2QE7 G;  1EN6 A;  2HP8 A;  2JGD A;  3LSQ A;  3WFV A;  1NBM G;  2WLH A;  1AI7 A;  3DC6 A;  4TQF A;  2EIL C;  3HPL C;  1VQ4 V;  1VAR A;  4JAV A;  3QO8 A;  4KUM A;  1PNM A;  5B5E Z;  5F2V O;  2JRI A;  4XDK A;  1QR9 A;  5BMV B;  2DYS C;  3JCZ A;  3CCL V;  3M8A A;  5JH7 B;  3JD4 A;  1ZL8 A;  3F5W C;  1FJG B;  1YCI A;  3EVK A;  1K5S A;  4A5U B;  2PY5 A;  2HEP A;  1ARO P;  4AQY O;  2ZD9 A;  4K0K O;  1GM9 A;  1Y76 A;  4X20 A;  5H9C A;  4LNU B;  2H94 A;  5L3B A;  2O57 A;  3HKD A;  2VWK A;  2UUB B;  4GCZ A;  4LH7 A;  3DTU B;  4NTW A;  3TET A;  4GKJ B;  3SPG A;  4IHJ A;  4JI3 O;  2YIB D;  3F5T A;  3HKE A;  4EEQ A;  1V9P A;  3RYF A;  1F4N A;  2Q7H A;  4JI6 O;  5EBL C;  4UFZ A;  5A2Q N;  4FLZ A;  1YDX A;  3WB0 A;  3ZED A;  1GAX A;  4LF9 B;  5J2T A;  4QPJ A;  1GH6 A;  3TXQ A;  1TGO A;  2GUZ A;  4PA6 A;  4UCV A;  2UUA B;  1F7Y A;  4X1Y A;  4P9O A;  1WA8 B;  1M93 A;  2CAZ C;  4K3A A;  3U0Z A;  1IBK B;  1NVP D;  2BTO A;  4GKK O;  2ZCE A;  2OCC B;  5CA1 A;  3J80 N;  3QVN A;  4DR2 O;  3T1H O;  1AJQ A;  4X9Q A;  4MT8 A;  1FXK B;  2XT9 A;  3K59 A;  1Q86 W;  4WFG A;  1IUR A;  3CRQ A;  2MK3 A;  1PKX A;  5FPR A;  2E75 B;  2YEV B;  1JX9 A;  2BOB C;  4LF7 O;  5JVD A;  2ZDI C;  4TOI A;  5LA6 A;  2XUM A;  4LF8 O;  4JI7 B;  1XQ8 A;  1K33 A;  2ZIO A;  4JI8 O;  2WLI A;  2CGO A;  1N32 B;  4ZI7 A;  1Y76 B;  4X20 B;  2OYQ A;  1QR8 A;  2YIB A;  3ZJZ A;  1N36 O;  1QU7 A;  3CJH A;  3FB6 C;  4MVO A;  4N23 A;  3HKD B;  1OCZ C;  4FPP A;  1R3J C;  3MHS C;  5KLV H;  4FZ1 A;  5D5Q A;  4UVA A;  1P84 F;  2QM8 A;  2Q4P A;  4IGG A;  1PNK A;  3H1I H;  2YXY A;  3OE7 G;  4FZ0 A;  3K0G A;  5IT9 N;  4DXW A;  3APQ A;  3MHH C;  3ZN1 A;  1I0H A;  2M7W A;  1GM7 A;  2QM4 A;  2AHZ A;  4XDJ A;  2AGA A;  1BE3 H;  1COW G;  1Q3E A;  2BTQ B;  4O4H A;  4CH4 A;  1ZTE A;  3BA9 A;  4I55 A;  3BRC A;  4J7J A;  3BFR A;  1H8H G;  4JTA B;  3CCJ V;  4J42 A;  3ZIA G;  4PHZ A;  1KQS U;  5BZB A;  4X62 B;  3CCS V;  3QO5 A;  2E5L O;  1W59 A;  2FTK A;  3AG2 B;  3GWK C;  3AG3 C;  3OD4 A;  4DV0 B;  2OIE A;  3R65 A;  2EIJ B;  3WG7 C;  1QCE A;  3LDE A;  3L72 H;  4OPA A;  4FLU A;  3ZX6 A;  2P4V A;  1GO3 F;  3J81 N;  3K0D A;  5IJ0 A;  4HBN A;  4FFB B;  3LNM B;  4MTG A;  5KUK A;  4FLW A;  3OFN G;  2Y0P A;  4KHP B;  3ETG A;  2QWP B;  1IX9 A;  1G4Y B;  2QTS A;  1RFY A;  3CX5 F;  2YEV A;  3JAT A;  4KL1 A;  5JVD B;  4CH5 A;  2ZR2 A;  4MW8 A;  3B77 A;  2B1G A;  1Q7Y W;  4MTF A;  3OR6 C;  3H01 A;  1GKF A;  2WLI B;  1FS0 G;  4W4K A;  3ZMV A;  5KHK A;  3GWO A;  3LSU A;  3E8F A;  4FM0 A;  4E4E A;  4ZOL A;  1KMI Z;  4UCU A;  1VQP V;  3CEI A;  1VQK V;  2JGU A;  1YIT V;  3ABM B;  1XL6 A;  4K0K B;  3D8C A;  2Y0I A;  4JAU A;  4MVS A;  1Q43 A;  1IBM B;  5EYP A;  1LUV A;  2HJD A;  2ZR3 A;  1P7B A;  4DR5 O;  1OCZ B;  3L70 H;  4NKG B;  4WFA V;  3NXS A;  4O4H B;  3K57 A;  5HFM A;  1SQB H;  3O65 A;  2QKA A;  1J5E B;  4H13 B;  2IH1 C;  3BVO A;  3UKM A;  2FYU H;  3K03 A;  4BIU A;  3T1Y B;  3UO3 A;  1XNR B;  2V1D A;  3KKY A;  1VQ8 V;  2C2A A;  2KG7 B;  3S3X A;  4XBF A;  4DV5 B;  4O2B A;  1KP3 A;  2JVD A;  1BSM A;  4IYH A;  1WAZ A;  5KUM A;  1XNQ O;  3ZMU A;  3K5O A;  3MAQ A;  5CBG A;  5K1P A;  4JI2 O;  1S72 V;  5CA0 B;  1KEC A;  1YEW A;  4QNH B;  1Z5V A;  1GM8 A;  4K8X A;  4DR6 O;  4JTD B;  4LF6 O;  5J2U B;  3E22 A;  4NR1 A;  1RM1 C;  1NH2 D;  4LF4 B;  4TV9 B;  4YJ3 A;  1ZUQ A;  3ZMZ A;  4B3T B;  5EZY A;  1LUW A;  1EBO A;  4I9Q A;  2RCV A;  3CRA A;  1IXB A;  1MOF A;  2Q7G A;  2P22 C;  4GX2 A;  2JK5 C;  1TUE B;  3K5L A;  5FLX N;  5JQG A;  2KKW A;  1RPO A;  3JAR B;  3T4D A;  3FD9 A;  2LGW A;  4O4L B;  3JAW A;  4JI1 O;  1TVK A;  4B7E A;  3ASO B;  2BCC H;  2VQF B;  2GHY A;  3RN4 A;  3RWR D;  1BMF G;  4B3R B;  3S3W A;  3CXH F;  3H9V A;  1K92 A;  4X1K A;  2LFR A;  2DYS B;  2ZNJ A;  4C7U A;  2F4V B;  5KX5 B;  1YIJ V;  4CS4 A;  4LFC B;  3DGE A;  1SZX A;  3FAV B;  2RN9 A;  3SPH A;  3SPI A;  2NN4 A;  2ZNI A;  4X8A A;  1P7G A;  1NVP B;  4PV1 B;  2CDY A;  4FVM A;  4CH3 A;  1WNS A;  1BS3 A;  4DV6 O;  2YDE A;  3SJB C;  2HHH B;  4UVC A;  2H3O A;  2GSM B;  4MTO A;  5KMG B;  2HFE C;  4DR7 O;  3C3S A;  2W6I G;  2WLL B;  3C90 A;  1FFX B;  3SPJ A;  4BW5 A;  2UXC B;  3T1H B;  2RQ6 A;  3U10 A;  2Q0O C;  2LJ2 A;  1NTM H;  1VF6 A;  3LDD A;  1SA0 A;  1EZJ A;  4IL6 Z;  4CBC A;  1XOU A;  4NVP A;  4DK1 A;  4LF7 B;  2ZDI A;  2Q68 A;  4TWK A;  1IBL B;  3FYE B;  1VMG A;  2K1E A;  4X64 B;  4WFB V;  3JCU Z;  1YVW A;  1NTZ H;  1KU9 A;  3JAL A;  1R73 A;  4I50 A;  4QPK A;  1I94 B;  1BT8 A;  2FKX A;  2K9P A;  4TUY A;  5IYZ B;  3FX7 A;  2YC0 A;  4O4I B;  4CC5 A;  4DO2 A;  1G1X B;  5GON B;  4XDL A;  1V55 B;  4X1K B;  1S0V A;  3MDS A;  4JF3 A;  1N4C A;  1YSC A;  2MW2 B;  4LF5 O;  1TUB B;  2R9R B;  1JPX A;  2JS5 A;  2Q7E A;  4MW3 A;  4U3F H;  4DR1 B;  5IJ9 A;  4PA9 A;  1SKV A;  4FMT A;  2IH3 C;  2RMK B;  3AG1 C;  5B1N A;  4DV1 B;  3UT5 B;  4MVR A;  4PD4 F;  2WLL A;  3OMI B;  4NXM B;  4IT5 A;  2R9I A;  2LQT A;  1N32 O;  3Q4H A;  2WLJ A;  4X66 O;  5EK0 A;  2B9Z A;  1N33 B;  4K8Z A;  1V54 C;  5H2F Z;  2PI5 A;  3HKB A;  1WPB A;  3CC4 V;  1SQX H;  5L3F A;  1B06 A;  3RYH B;  3FB8 C;  2Z3Y A;  2QWN B;  1AR1 B;  4PI2 A;  1D5N A;  2NLJ C;  2W0F C;  1MG1 A;  4JZG A;  4B7K A;  1ORQ C;  2QDO A;  2F1M A;  5H6Q A;  4JGS A;  2F23 A;  2ZXW B;  4LCU C;  4ASU G;  4JTC B;  3ZRW A;  4TUY B;  5CB4 B;  2EIJ C;  3F7V C;  2ITC C;  3K58 A;  4X1I B;  1Q82 W;  4QIW F;  2IJI A;  4JYA B;  2ZM6 B;  3E8H A;  3ABM C;  1VF6 C;  5EIB D;  2UU9 B;  1AJP A;  1PP9 H;  1YTF B;  4J80 A;  1BZK A;  1BCC H;  4HYO A;  3CPW U;  2Z5U A;  3APO A;  1K3E A;  1K4C C;  3P3N A;  4O2A A;  3CMA V;  1H2S B;  2EX3 A;  3WU2 Z;  4UCS A;  2V4D A;  1F23 A;  2JGD B;  2OTL V;  2QKC A;  3KCY A;  4MSW C;  1XDC A;  4QE7 A;  1SET A;  4FFK A;  2BSK A;  4OX9 O;  1VP7 A;  4DV4 B;  4I5S A;  3AK2 A;  1L0L H;  2CGN A;  1HW7 A;  1VEW A;  3B40 A;  1BL8 A;  4B3M B;  2CTR A;  2UU9 O;  4MVZ A;  5L3D A;  4L8J A;  4PDR A;  5B1A B;  5JH7 A;  5KAF Z;  3ETD A;  2Y69 B;  5GTI Z;  4P30 A;  4EFE A;  1MA1 A;  3CCE V;  3AG4 C;  1XHX A;  2WA4 A;  2ZT9 B;  4HNA A;  3BEH A;  2NR5 A;  3JAS A;  3N2K B;  4P9P A;  1NS1 A;  5ITZ A;  1FAF A;  5FNV B;  4BIZ A;  3JAM N;  1I5X A;  4J11 A;  1M57 C;  3SGI A;  5LXT B;  2VRZ A;  2D3O W;  3ZRX A;  4UUJ C;  4NB5 A;  4JI5 B;  1HWY A;  2PI4 A;  4YJ2 B;  4RQE A;  3VOU A;  1K7D A;  2YID A;  3ZMT A;  1P49 A;  3ABK B;  1AIL A;  3K5M A;  2Q9L A;  4H0L B;  2EIK B;  3R66 A;  5CA3 A;  1WPX A;  5DM6 V;  3ZHS A;  2DYR B;  1NI8 A;  2YI9 A;  1R6N A;  2AXT Z;  2UXB B;  4TSF G;  3KZI Z;  5JCO C;  2UXD B;  4JI7 O;  2WLN A;  3A0R A;  5LYJ A;  4OPH A;  1Q8I A;  2D2C B;  5AG2 A;  3WB1 A;  4DV7 O;  4LFC O;  3QG5 A;  1WP8 A;  4NYK A;  1S3J A;  4CZZ A;  2IU3 A;  3A8T A;  3BPZ A;  4BW9 A;  1FYJ A;  5EBM C;  3CB2 A;  5CA1 B;  4B3S B;  5K1X A;  1FXH A;  1HNZ B;  1AJN A;  5BXZ A;  3JAT B;  3LUT B;  1DTO A;  1R6T A;  3SJQ C;  4B08 A;  1B04 A;  3HR0 A;  1T5E A;  3CP1 A;  2FL4 A;  3CE2 A;  2XAH A;  4R8C A;  3OR7 C;  4DR4 B;  1QLE C;  2WSS G;  1XMO O;  2LW7 A;  3OTO B;  2DQ3 A;  1YXB A;  4UV8 A;  3CJH B;  2VS0 A;  3D3Q A;  4L87 A;  1AVM A;  1S5H C;  4MS2 A;  1G6U A;  4Q6G A;  4N21 A;  4NXN O;  1EN5 A;  2VQE B;  4HZ3 A;  3CME V;  4Z2W A;  1WB7 A;  3TCU A;  4ZKI A;  5CBH A;  5KHI A;  3P32 A;  4YHH O;  2OWO A;  5L3E A;  1Y74 A;  2PYJ A;  3ETQ A;  5BMV A;  1O9G A;  1NQT A;  4LWS B;  3I55 V;  3BAB A;  4KXR A;  3D3I A;  4DW0 A;  4NTY A;  4U7O A;  2BTQ A;  3L74 H;  3QF7 A;  1HNW B;  5LMU O;  1BHA A;  3W7T A;  1OV9 A;  4GT1 A;  4UB6 Z;  4UB8 Z;  1I08 A;  3K5N A;  2DYR C;  2DJV A;  2HKO A;  5DN6 G;  1SQF A;  3OGC C;  2N05 A;  1Q5O A;  1KKC A;  3VQW A;  2UUA O;  2DOS A;  2YIA A;  2X6A A;  1F4M A;  3SPC A;  3ML0 A;  2Y4U A;  4JYY A;  1NJI W;  3K06 A;  1SS3 A;  4DUY O;  1RPR A;  3OEE G;  4LFA O;  1AR4 A;  4G28 B;  3KCX A;  5B3S B;  4X65 B;  1J5E O;  1EN4 A;  2F4V O;  1W2B U;  4FFB A;  5B1B B;  5IYC O;  3RVY A;  2ILM A;  5CN0 A;  2QWO B;  1FPO A;  1HR0 B;  1V55 C;  4DR2 B;  1UFI A;  3C3T A;  1R1B A;  4DR3 O;  3CC7 V;  2XAS A;  3AK3 A;  1VF5 B;  2RJZ A;  3OTF A;  2YUA A;  1M5I A;  2KQX A;  5LOV A;  4ZIB A;  3JAR A;  4ZOL B;  2ZQM A;  4LP8 A;  4AQY B;  4O4L A;  4QE9 A;  5BY1 A;  1ZLZ A;  3IJ4 A;  5B1O A;  2E3C A;  4GYC B;  1QBZ A;  4ICG A;  2B1I A;  5KHG A;  4CS3 A;  4RQF A;  5KAI Z;  5LGN A;  3IAY A;  3QNE A;  3SYO A;  1M57 B;  4FIP C;  1YI2 V;  1VQL V;  2YSU B;  3J7A U;  4LWS A;  4JYC A;  2JDI G;  1Q90 D;  3DXR A;  3CRR A;  1FXK A;  1W0J G;  2P06 A;  1IBK O;  4DR6 B;  2EZO A;  5L3G A;  5FPO A;  1M56 C;  4Z1M G;  3RGB A;  1VQM V;  2JIZ G;  2CUG A;  4R7C A;  4NXM O;  2EJR A;  2YS8 A;  2CE4 A;  2JS3 A;  4JI3 B;  1KKD A;  5A9G A;  2DW4 A;  4J7Z A;  1PV0 A;  3ETE A;  4J7K A;  1B6Q A;  1LNQ A;  2P4K A;  2PF4 E;  4CS2 A;  2EIL B;  2XAJ A;  4JYB A;  1JQ0 A;  1RP3 B;  5IDJ A;  5IWA O;  4JI4 O;  1YZB A;  4GLX A;  2XND G;  3CRM A;  4UV9 A;  2ATK C;  2CTQ A;  2E5L B;  2P5O A;  2EIN C;  4JI2 B;  4LF5 B;  1JJO A;  3TGU H;  5LHI A;  1XHZ A;  3UCS C;  3ZHU A;  1GTO A;  2ZE8 A;  1CXZ B;  2WLK A;  3AG1 B;  5J2U A;  1Y66 A;  4YJ3 B;  1WB8 A;  3E86 A;  3FB7 C;  1GN3 A;  1N34 B;  2HVK C;  1U96 A;  1HNX O;  3RYC B;  1PM9 A;  4PJ0 Z;  3ZHR A;  5B66 Z;  4BIO A;  3D36 C;  2IBZ H;  3K9S A;  4U7N A;  3QTC A;  1GN2 A;  2XAG A;  2WPD G;  2A06 H;  1HDJ A;  4IYI A;  2PUS A;  3K3W A;  2R72 A;  5LHG A;  5IYZ A;  2CTP A;  3VQX A;  3WB2 A;  1K97 A;  3E8B A;  2M6Y A;  4BAY A;  4DUZ B;  4LBE C;  4JAA A;  1U97 A;  2VQF O;  1E79 G;  1IBM O;  2ZE6 A;  2LGQ A;  2A3Q A;  4GUN A;  2WWW A;  1TUB A;  1K9M W;  2ZXW C;  4RAI A;  2V7Q G;  2NNU A;  5D5P A;  5BR8 B;  1H38 A;  2UUC B;  3BHP A;  4NTX A;  1IXM A;  2LO1 A;  4DRX B;  4OGQ B;  1OCR C;  3OGI B;  1R3I C;  4PA4 A;  2JJ2 G;  3JD3 A;  3FFQ A;  4JV5 O;  1N8R W;  4HAM A;  4PDV A;  3H1J H;  1M90 W;  5JJJ B;  2QKS A;  3W7U A;  1KP2 A;  2QR4 A;  2IJJ A;  4GX1 A;  1FXK C;  1MZF A;  2PZS A;  3JAK B;  2DE0 X;  4TT3 G;  2WA3 A;  4LFA B;  2ITD C;  3N2G B;  2Q69 A;  4WBN A;  1X4T A;  1KUQ A;  2XAF A;  4F6R B;  3OAA G;  3RYH A;  1Q81 W;  2F66 C;  1F51 A;  4EKW A;  1BQZ A;  4O4J A;  1UPG A;  3SYP A;  2P67 A;  3CXC U;  3G6E V;  4B3T O;  1FKA O;  1NT2 B;  3PJS K;  5B1A C;  4LFB B;  4LNU A;  2UXX A;  3B4S A;  4I0X A;  1OCC C;  5CB4 A;  2QSA A;  4DV3 O;  3AG3 B;  5EC2 C;  2DWD C;  2CH7 B;  5LP6 A;  4FLT A;  1US6 A;  2P90 A;  3GB7 C;  1L8D A;  1SQQ H;  5CA0 A;  1VQ6 V;  4X88 A;  3CCV V;  3HKE B;  4JI1 B;  1MSD A;  2N74 A;  1Y67 A;  2X6B A;  2R70 A;  3E22 B;  2DQ0 A;  2OCH A;  4DYL A;  1AP6 A;  4O2A B;  4RO2 A;  4DRX A;  5KHJ A;  4J9Y B;  4R6Z A;  4YIP A;  4PEL A;  3ZRV A;  1NH2 B;  2BSK B;  4YY3 O;  2XAQ A;  2UUB O;  3RFR A;  4DV5 O;  1JOY A;  2X7R B;  1SC5 B;  1L1F A;  5HFL A;  1JFF B;  4DV6 B;  1PL4 A;  1TVK B;  3ZCC A;  1N0J A;  3W7W A;  3BCC H;  3Q4H B;  2QWR B;  3UO2 A;  2HG5 C;  1RM1 B;  3CC2 V;  3N2G A;  4DR7 B;  3RT3 C;  4UCO A;  4F6R A;  3G4S V;  3ICX A;  1RSO A;  4FLY A;  2GBO A;  4LF9 O;  3OM3 B;  3JAS B;  3L9D A;  3ZS8 C;  5KX5 A;  3MD0 A;  4O4J B;  3HKB B;  3TJT A;  2CTW A;  4DV7 B;  5ITZ B;  3ABT A;  5FNV A;  3OUS A;  1DLB A;  4ZI7 B;  4IIJ A;  1XMQ B;  1FJG O;  1SRY A;  1XL4 A;  1NKD A;  4JPR A;  1QVF U;  2HVJ C;  1BHB A;  1VQN V;  1AR5 A;  2KB1 A;  5GW7 A;  5LMU B;  1CP9 A;  4GX5 A;  3X2Q C;  2CH7 A;  4AHC A;  4I4T B;  2G38 A;  1IBL O;  4U3J A;  3TXS A;  5J9P C;  1YJN V;  5LMN O;  3LSS A;  2BE3 A;  4EB6 A;  2GV9 A;  1FXV A;  3QO7 A;  4WF9 V;  1I94 O;  5DED A;  2Q5Z A;  4FLV A;  1FFX A;  2F43 G;  4JI8 B;  1ZL8 B;  2IJH A;  2LP7 A;  5LYJ B;  2QEX V;  1V54 B;  2A7W A;  1EFR G;  4G27 B;  2ADQ B;  3IC9 A;  4H37 A;  1BQ0 A;  5H5N A;  3RYI B;  2ZE7 A;  4RUE A;  2QA4 V;  4NXN B;  4JI0 O;  3E8G A;  4F6E A;  1KBH A;  1AI6 A;  4H44 B;  3K08 A;  3H1K H;  1O9H A;  1OZ0 A;  2LFS A;  5JJN B;  4D7T A;  3JD0 A;  1JFF A;  4LF4 O;  4DV4 O;  1D2D A;  3JAL B;  1E1R G;  3OMN B;  3JSN A;  2B5U A;  1VQO V;  4J9Z B;  2L6L A;  3DC5 A;  1ROP A;  3CS5 A;  1XIL A;  1YJ9 V;  3CYO A;  1I7F A;  1XRE A;  3OMA B;  1ZX3 A;  1H8E G;  1QLN A;  4IIJ B;  4DV2 O;  1DGS A;  3N2K A;  4D7S A;  2GUZ B;  1MNG A;  2WAM A;  2A0L A;  4X1Y B;  2ZE5 A;  2UXC O;  4BWA A;  3CCM V;  1M1K W;  1WA8 A;  4E2L A;  1NR7 A;  3RVZ A;  3T1C A;  1HNX B;  1HNZ O;  3CCR V;  1H2G A;  4I4T A;  1K34 A;  3LNN A;  4B3S O;  5EYP B;  3L73 H;  1VF7 A;  2JJ1 G;  3UT5 A;  4EB6 B;  2HJF C;  1KB9 F;  4LR3 A;  1JVM A;  2XTA A;  3OUF A;  4LF6 B;  1EZV H;  1NZ6 A;  1S77 D;  2OT5 A;  1JJ2 U;  5GTH Z;  4PA7 A;  4Z1V A;  3A0B Z;  2RDC A;  4LF8 B;  3HKC B;  3G71 V;  4JYA O;  5KHH A;  5LA6 B;  4FK5 C;  4FLX A;  3I5D A;  2AZ2 A;  3AEI A;  4UVB A;  3FB5 C;  1S76 D;  1XMO B;  1PD3 A;  2KG7 A;  2X0L A;  4X65 O;  2OTJ V;  1YTF D;  4EFB A;  2Z0A A;  3NR7 A;  1M56 B;  2Y4T A;  4UXN A;  1AP5 A;  3IGA C;  3GVM A;  2IW5 A;  4WFE A;  1H2N A;  1I5Y A;  1JR9 A;  2GTS A;  4UCR A;  4AI8 A;  1GN4 A;  4AIL C;  1R6K A;  3ASO C;  4CC6 A;  3THO A;  1SF9 A;  3T1Y O;  1WJZ A;  1P4R A;  1N33 O;  4IHJ B;  1Q6U A;  5IE9 A;  1H2M A;  5EZY B;  1GN6 A;  1UJW B;  4I55 B;  3RYF B;  1J95 A;  2X6C A;  4X62 O;  3STL C;  3SDL A;  3ABL B;  2ZKO A;  3FYI B;  5J2T B;  4GKJ O;  3ZHT A;  2FB5 A;  1OCR B;  4RWU A;  1R3L C;  1CEZ A;  1PNL A;  5JQG B;  4UCT A;  5EIB C;  2HHH O;  4LC1 A;  4R50 A;  2IU0 A;  1FFT B;  2PTM A;  3AG7 A;  1S5J A;  2N04 A;  3A0H Z;  1SQG A;  2W6J G;  1GRJ A;  2E74 B;  5C93 A;  2OIG A;  3RBZ A;  2YI8 A;  5IJ0 B;  4DK0 A;  4KFM A;  3HB3 B;  4OX9 B;  3ZMS A;  3I56 V;  3HKC A;  3JD1 A;  1OCO C;  1VQ5 V;  3FAV A;  3B09 A;  4ZBM A;  3H1H H;  3SYA A;  2IM9 A;  3SYC A;  2ETN A;  2EZP A;  2CK3 G;  5H6R A;  3OTO O;  4HNA B;  3T4Z A;  5LL6 Y;  1X59 A;  3LDC A;  3ZBH A;  2BOC C;  5JJE B;  4JZ2 A;  1KYO F;  3K04 A;  3CD6 V;  5C8Y A;  2DWE C;  5KMG A;  5IYD O;  4YIO A;  1GMG A;  4BR6 A;  5JWP A;  4B3M O;  4PI0 A;  3CHX A;  2UUC O;  3DSQ A;  4CH6 A;  4FM1 A;  3BY6 A;  1HR0 O;  5CMU A;  1B3Q A;  1L0N H;  2GTA A;  2P6J A;  4DR3 B;  4G2K A;  1NTK H;  1W0K G;  4DV1 O;  3PN1 A;  1SER A;  2ADP A;  3ZHQ A;  5LP6 C;  4X66 B;  3ZRS A;  4DR4 O;  3K79 A;  3L75 H;  4OXS A;  1LR1 A;  2KSD A;  4GZR B;  4JI6 B;  4WCE V;  4I50 B;  1JMK C;  3ABK C;  2ARH A;  3ABL C;  4PDL A;  1M4U A; 
#chains in the Genus database with same CATH homology
 3CCQ V;  3FB6 C;  4MVO A;  4N23 A;  1K3E A;  2Q69 A;  1K4C C;  2XAF A;  1OCZ C;  1DF5 A;  3OAA G;  4FPP A;  3CMA V;  1OHH G;  1R3J C;  1Q81 W;  1ZWI C;  5KA5 A;  1F51 A;  2JEX A;  1F23 A;  3MHS C;  4P2Z A;  2OTL V;  4EKW A;  4MSW C;  1OCC B;  4UVA A;  4QE7 A;  2Q67 A;  1SET A;  2QM8 A;  3SYP A;  1PNK A;  2P67 A;  1ENV A;  3CXC U;  3OE7 G;  3G6E V;  3K0G A;  4DXW A;  3ASN B;  4I5S A;  3PJS K;  5B1A C;  3EHB B;  3MHH C;  3ZN1 A;  2M7W A;  2UXX A;  1GM7 A;  3M99 B;  4MVU A;  1YJW V;  3IFX A;  2AHZ A;  4XDJ A;  1BL8 A;  4WFF A;  1VQ7 V;  1COW G;  4MTX A;  1OCC C;  1SES A;  4PDM A;  2IJK A;  3VBB A;  3AG3 B;  4MVZ A;  5L3D A;  4PA3 A;  3UM7 A;  4PDR A;  5EC2 C;  3F7Y C;  5B1A B;  2DWD C;  1H8H G;  4JTA B;  3CCJ V;  3ETD A;  2P90 A;  2Y69 B;  3GB7 C;  4KP4 A;  3ZIA G;  4P30 A;  3SYQ A;  1KQS U;  5BZB A;  4X88 A;  3CCE V;  1VQ6 V;  3CCV V;  3CCS V;  3AG4 C;  3QO5 A;  3BEH A;  2EIM B;  2FTK A;  3AG2 B;  2WLM A;  2HLD G;  3AG3 C;  2X6B A;  5IY5 C;  4P9P A;  3K9A A;  2DQ0 A;  2Y48 A;  1THZ A;  2EIJ B;  3R65 A;  3WG7 C;  1QCE A;  3LDE A;  2Y69 C;  4BIZ A;  1K8A W;  4RO2 A;  1I5X A;  1M57 C;  3AG4 B;  4J9Y B;  1GO3 F;  2A9H A;  3ZRX A;  2D3O W;  4UUJ C;  3K0D A;  4R6Z A;  3CCU V;  4MVM A;  1HWY A;  4PEL A;  3ZRV A;  2PI4 A;  3LNM B;  1NH2 B;  4MTG A;  5KUK A;  4RQE A;  3OFN G;  1AI5 A;  3ETG A;  3VOU A;  2XAQ A;  1K7D A;  1K73 W;  1G4Y B;  2OCC C;  3EFF K;  3ZMT A;  2YEV A;  1JOY A;  1PL0 A;  2X7R B;  3ABK B;  2EIK B;  1WLE A;  4Q20 A;  1L1F A;  5CA3 A;  1WPX A;  2ZR2 A;  4MW8 A;  5HFL A;  5DM6 V;  3W7S A;  3B77 A;  2B1G A;  1Y4M A;  2DYR B;  1Q7Y W;  4MTF A;  3OR6 C;  3H01 A;  1GKF A;  3ZCC A;  2WLI B;  1FS0 G;  1R6N A;  3W7W A;  3ZMV A;  3T2M A;  4TSF G;  2HG5 C;  2JEU A;  1RM1 B;  3CC2 V;  3GWO A;  3E8F A;  2EIK C;  2WLN A;  3A0R A;  3G4S V;  1VQP V;  1VQK V;  5EC1 C;  3ABM B;  1YIT V;  1XL6 A;  2A79 B;  3OM3 B;  4GX0 A;  3MD0 A;  4JAU A;  4MVS A;  1S3J A;  4CZZ A;  3ABT A;  2IU3 A;  3OUS A;  1DLB A;  2H8P C;  2ZR3 A;  3X2Q B;  3B8M A;  1GK9 A;  1P7B A;  1SRY A;  1XL4 A;  4QJF B;  1OCZ B;  5EBM C;  1NKD A;  4JPR A;  1QVF U;  2HVJ C;  4WFA V;  3NXS A;  1BHB A;  2QTO A;  1VQN V;  2KB1 A;  5HFM A;  1SZT A;  1FXH A;  3FKS G;  5GW7 A;  1AJN A;  1CP9 A;  5IYB O;  4GX5 A;  3LUT B;  1DTO A;  3SJQ C;  2IH1 C;  3UKM A;  1QLE B;  3X2Q C;  3K03 A;  3CP1 A;  3ASN C;  4BIU A;  1DF4 A;  2XAH A;  5J9P C;  4R8C A;  2V1D A;  1YJN V;  2EBO A;  3LSS A;  1VQ8 V;  3STZ C;  2C2A A;  1FXV A;  1MAB G;  3QO7 A;  4XBF A;  4WF9 V;  1KP3 A;  5B3S C;  2F43 G;  1KD1 W;  3OR7 C;  3E83 A;  1QLE C;  2WSS G;  2IJH A;  2LP7 A;  2QEX V;  5KUM A;  1V54 B;  1G8M A;  2AHY A;  5CBF A;  1EFR G;  4WFH A;  3ZMU A;  4G27 B;  2DQ3 A;  1VQ9 V;  1CPY A;  4H37 A;  4UV8 A;  5CBG A;  4L87 A;  4F4L A;  1S5H C;  4MS2 A;  1S72 V;  1KEC A;  4N21 A;  2EIM C;  3AG2 C;  4RUE A;  2QA4 V;  4QNH B;  4HZ3 A;  3E8G A;  3CME V;  1QVG U;  1GM8 A;  5LGT A;  2P7T C;  1AI6 A;  3WG7 B;  4JTD B;  3TCU A;  4ZKI A;  3K08 A;  5CBH A;  3P32 A;  1RM1 C;  1OZ0 A;  2LFS A;  1NH2 D;  5L3E A;  3TK1 A;  3JD0 A;  2XOK G;  1AI4 A;  4JAS A;  5L3C A;  3ZMZ A;  1E1Q G;  3I55 V;  1NQT A;  1EBO A;  5KA6 A;  5LGU A;  3D3I A;  3E89 A;  4U7O A;  2QM7 A;  1E1R G;  3OMN B;  1BHA A;  3P30 A;  2B5U A;  1MOF A;  3W7T A;  4GT1 A;  1VQO V;  4J9Z B;  5LHH A;  4GX2 A;  2JK5 C;  2UXN A;  1TUE B;  3IC7 A;  3B8N A;  1ROP A;  2DYR C;  2HKO A;  5DN6 G;  5FL7 G;  1RPO A;  1MSW D;  3T4D A;  1YJ9 V;  3OGC C;  2HR3 A;  3CYO A;  3OMA B;  1H8E G;  4RUF A;  3ASO B;  1NR1 A;  1QLN A;  2GHY A;  4H33 A;  2X6A A;  1F4M A;  2WAM A;  2A0L A;  3SPC A;  3ZN0 A;  3ML0 A;  1BMF G;  3KG2 A;  3CCM V;  1NJI W;  1M1K W;  3K06 A;  4E2L A;  5E1A C;  1NR7 A;  1RPR A;  5EBW C;  3OEE G;  3RVZ A;  1K92 A;  3T1C A;  2LFR A;  4G28 B;  2DYS B;  5B3S B;  3E35 A;  3CCR V;  1W2B U;  1YIJ V;  5B1B B;  1H2G A;  3DGE A;  1K34 A;  4YXW G;  5IYC O;  3RVY A;  4I9W A;  5CN0 A;  5LBQ A;  2JJ1 G;  3SPH A;  1OCO B;  3SPI A;  1V55 C;  3JYC A;  2HJF C;  3OEH G;  1KC8 W;  1K4D C;  4X8A A;  3OW2 U;  1NVP B;  1JVM A;  3OUF A;  3CC7 V;  3ZRW B;  2EIN B;  4FJC C;  2XAS A;  3E2E A;  1S77 D;  2OT5 A;  5B1B C;  1JJ2 U;  4PA7 A;  3W7X A;  4UVC A;  1YHQ V;  2GSM B;  3G71 V;  4MTO A;  4FK5 C;  3ABU A;  1K5Q A;  2ZQM A;  4LP8 A;  3AEI A;  4UVB A;  2HFE C;  4QE9 A;  3RW0 A;  3FB5 C;  1M9N A;  2W6I G;  2WLL B;  4X89 A;  1S76 D;  5B1O A;  1PD3 A;  2X0L A;  5IY5 B;  2Q6A A;  2OTJ V;  3JD2 A;  1QBZ A;  1YTF D;  2B1I A;  3SPJ A;  4BW5 A;  3D36 A;  4RQF A;  1M56 B;  5LGN A;  4UXN A;  3QNE A;  4MVQ A;  3SYO A;  1JCH A;  1R3K C;  2QE7 G;  1M57 B;  4FIP C;  1YI2 V;  3IGA C;  1VQL V;  2YSU B;  2IW5 A;  4WFE A;  3LSQ A;  1I5Y A;  4JYC A;  3WFV A;  2JDI G;  1NBM G;  1FXK A;  1W0J G;  3LDD A;  2WLH A;  2EZO A;  5L3G A;  1AI7 A;  1EZJ A;  4CBC A;  2EIL C;  1M56 C;  3HPL C;  1R6K A;  4Z1M G;  3ASO C;  1VQM V;  1VQ4 V;  2JIZ G;  2ZDI A;  4R7C A;  4JAV A;  3QO8 A;  4KUM A;  2EJR A;  1PNM A;  2Q68 A;  4TWK A;  3FYE B;  1P4R A;  1KKD A;  2K1E A;  2DW4 A;  4WFB V;  4XDK A;  1QR9 A;  3ETE A;  1B6Q A;  1LNQ A;  1UJW B;  2EIL B;  2XAJ A;  1J95 A;  2DYS C;  3JCZ A;  3CCL V;  1R73 A;  4QPK A;  4JYB A;  1JQ0 A;  5IDJ A;  3JD4 A;  2X6C A;  3STL C;  4DO2 A;  2XND G;  3ABL B;  3FYI B;  4XDL A;  3F5W C;  4UV9 A;  1V55 B;  2ATK C;  1OCR B;  1S0V A;  4JF3 A;  1R3L C;  1YSC A;  1CEZ A;  1PNL A;  1K5S A;  4LC1 A;  4R50 A;  2EIN C;  2IU0 A;  1FFT B;  1ARO P;  2R9R B;  2ZD9 A;  2W6J G;  1GM9 A;  5LHI A;  5H9C A;  1JPX A;  5C93 A;  1GTO A;  3RBZ A;  4MW3 A;  2WLK A;  3AG1 B;  2H94 A;  5L3B A;  4KFM A;  1Y66 A;  3HB3 B;  3E86 A;  3FB7 C;  4PA9 A;  2HVK C;  3ZMS A;  4FMT A;  3I56 V;  4GCZ A;  2IH3 C;  3DTU B;  3JD1 A;  1OCO C;  1VQ5 V;  3AG1 C;  4U7N A;  5B1N A;  3TET A;  4ZBM A;  3SPG A;  2XAG A;  3SYA A;  3SYC A;  2EZP A;  4MVR A;  2WLL A;  2CK3 G;  3OMI B;  2WPD G;  5H6R A;  2R9I A;  1F4N A;  2WLJ A;  3T4Z A;  5EBL C;  3K3W A;  5EK0 A;  3LDC A;  5LHG A;  1K97 A;  2BOC C;  4QPJ A;  3E8B A;  4BAY A;  1V54 C;  4LBE C;  4PA6 A;  2PI5 A;  3K04 A;  1E79 G;  3CD6 V;  2DWE C;  4P9O A;  3CC4 V;  5IYD O;  5L3F A;  2WWW A;  3FB8 C;  1K9M W;  2ZXW C;  2Z3Y A;  1AR1 B;  1GMG A;  4RAI A;  2V7Q G;  3ZJZ A;  2NNU A;  2NLJ C;  1NVP D;  1H38 A;  2W0F C;  2OCC B;  1MG1 A;  1IXM A;  1ORQ C;  3BY6 A;  5H6Q A;  1AJQ A;  1OCR C;  4JGS A;  1R3I C;  4PA4 A;  2ZXW B;  4LCU C;  4ASU G;  5CMU A;  2JJ2 G;  4MT8 A;  1FXK B;  4JTC B;  3JD3 A;  2P6J A;  3ZRW A;  4WFG A;  1Q86 W;  4G2K A;  2EIJ C;  2MK3 A;  1PKX A;  1N8R W;  4HAM A;  4PDV A;  1W0K G;  1M90 W;  3F7V C;  2YEV B;  2ITC C;  1JX9 A;  1SER A;  2BOB C;  2QKS A;  1Q82 W;  4QIW F;  2IJI A;  3W7U A;  2ZDI C;  1KP2 A;  3E8H A;  3ABM C;  2IJJ A;  4GX1 A;  1FXK C;  3ZRS A;  1K33 A;  3K79 A;  1AJP A;  4OXS A;  2WLI A;  1YTF B;  4HYO A;  4WCE V;  4TT3 G;  3CPW U;  1QR8 A;  3ABK C;  3ABL C;  4PDL A;  2ITD C;  2Z5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...