4QNHB

Calcium-calmodulin (t79d) complexed with the calmodulin binding domain from a small conductance potassium channel sk2-a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
molecule tags Ion transport/protein binding
source organism Rattus norvegicus
publication title Selective phosphorylation modulates the PIP2 sensitivity of the CaM-SK channel complex.
pubmed doi rcsb
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qnhB00
5E1AC 4PDVA 2NLJC 4MVSA 3FB5C 3SYPA 4MVMA 3TCUA 4MVRA 5EC1C 1OCRC 1XL4A 4HYOA 2HVKC 2X6BA 1K4DC 3LDCA 4ZBMA 5CBGA 5IY5C 4P9PA 3OUFA 3E8BA 3K06A 3AG3C 5KUKA 2WLLB 3IGAC 2W0FC 3AG4C 5EK0A 3F5WC 1R3JC 1LNQA 4R6ZA 3SPHA 4GX1A 4F4LA 3AG2C 2R9RB 4LCUC 2KB1A 2EINC 2WLIA 2WLLA 4MTGA 5EBMC 4JTDB 4R8CA 2X6CA 2ITCC 3TETA 3JYCA 2H8PC 3ZRSA 3ASNC 4MTOA 4HZ3A 3K03A 2QKSA 2WLMA 4MVOA 3RVZA 5EBWC 2BOBC 1M56C 4RUEA 1S5HC 4H37A 4X8AA 3K08A 3T4DA 2YEVA 4MVQA 5EBLC 3WG7C 5CBFA 3RBZA 2WLHA 4J9ZB 4R7CA 1J95A 1ORQC 3ABMC 3K04A 3PJSK 5CBHA 2Q68A 3SPJA 2DYRC 3F7VC 4GX2A 3SYCA 3T4ZA 1JVMA 1OCOC 2IH3C 3ABKC 4GX5A 4QNHB 3RVYA 2EIMC 4X88A 1QLEC 3LDEA 2K1EA 3E8FA 4DXWA 3BEHA 3SPCA 2EIKC 1R3LC 2WLJA 2ZD9A 3UM7A 2DWEC 3FB7C 3SYOA 2AHYA 4PDRA 3LUTB 3OUSA 2IH1C 4PA4A 3UKMA 2AHZA 5BZBA 3LDDA 2Q6AA 2X6AA 5B3SC 3E8GA 2HVJC 4XDJA 4EKWA 1M57C 4PDLA 4MVUA 3X2QC 4RO2A 4MVZA 3ZJZA 1KKDA 3K0DA 3OR7C 3STLC 4XDLA 3F7YC 4G28B 2ATKC 2HFEC 1G4YB 4R50A 4QE9A 3AG1C 4WFFA 3SYQA 2Q69A 3E8HA 2ZXWC 2EIJC 4LP8A 4KFMA 4PA9A 4QE7A 3GB7C 3ABLC 4XDKA 5KUMA 4UUJC 4WFEA 4GX0A 3OGCC 4MS2A 2WLKA 2Q67A 2HG5C 3E83A 1V54C 2DWDC 1R3IC 2EILC 4G27B 4J9YB 4MSWC 3OR6C 4P9OA 1ZWIC 3E89A 3KG2A 4H33A 2A79B 2BOCC 3K0GA 4WFGA 2OCCC 3EFFK 3VOUA 2WLNA 4I9WA 2Y69C 3SPGA 2HJFC 4JTAB 1R3KC 3ASOC 4OXSA 3T2MA 3RW0A 3SJQC 1OCZC 2QTOA 4MTFA 1BL8A 4WFHA 1V55C 4PDMA 5J9PC 4PA3A 4PA6A 3STZC 1OCCC 4P30A 4PA7A 3SYAA 4P2ZA 4JTCB 5B1AC 2A0LA 5EC2C 4MW8A 2JK5C 3R65A 1K4CC 3FB6C 1P7BA 3LNMB 3FB8C 2A9HA 2WLIB 4RAIA 1XL6A 4TWKA 2DYSC 3SPIA 3E86A 5B1BC 4RUFA 3IFXA 4BW5A 3T1CA 3HPLC 4LBEC 2P7TC 4MW3A 4X89A 2ITDC 4CBCA
chains in the Genus database with same CATH superfamily
4CH5A 4K3AA 1XQ8A 4LH6A 2PYLA 5IE9A 5LYJA 4BIOA 3CRRA 3T1HB 4UCUA 1JJ2U 4PI0A 4AQYB 4JI2B 1EZJA 4QJFB 1Y67A 3CYOA 4D7TA 1DK1A 1FJGO 3RVZA 4B3MO 2PZSA 3CRMA 4JZGA 1AI4A 3OFNG 1K7DA 3A8TA 4LF8B 5FL7G 5DM6V 4J9ZB 2BSKB 4NKGB 3T1YB 1I7FA 4BAYA 4X1YA 5JJNB 2YXYA 5LHHA 2B1IA 1BS3A 2VWKA 2B9ZA 3H1JH 3W7TA 3OMIB 1AVMA 3OAAG 1EN4A 2ODMA 4MVUA 4TQDA 3ZMSA 2AW9A 3CEIA 3STLC 1GK9A 4ABMA 1RFYA 1TA8A 2RMKB 4LR3A 5BMVB 3E8HA 4PA9A 2GSMB 4H44B 4IYIA 2HG5C 1R6TA 1NTKH 2ADQB 4MSWC 4P9OA 3OR6C 3ASNB 3KG2A 2EULA 1Q6UA 1VIBA 2ZDIC 1VF5B 2WPDG 1YSCA 1K5SA 1R3KC 3B77A 3GVMA 5LMUB 4RQEA 4O4LA 1RM1B 3STZC 3ABUA 5B1AC 3AG2B 1QVGU 2ZM6B 4TWKA 2E75B 1NT2B 4JI0B 2LFRA 5B3SB 5L3FA 1HNZO 2ZE6A 1N36B 1IURA 1ZTEA 3DC6A 3U11A 1H2SB 3CXHF 1WAZA 1Q81W 1PNLA 1S5JA 5KX5B 1YI2V 3JARA 4D6TH 2CGNA 1KUQA 4GKJB 4DV4O 2CAZC 2YSUB 4DR7B 2PF4E 1W0KG 2WA3A 1K33A 4JYAO 4DV2B 1SS3A 1K3EA 3LSUA 5EBMC 4NTXA 3TETA 3P32A 4FPPA 2QSAA 3K03A 5LP6A 2R9IA 4TT3G 1QR8A 3FAVA 1HNWB 2YEVA 1DTOA 3WB0A 1K8AW 2LGQA 4FJCC 3F7VC 5H9CA 2QM4A 1GAXA 4IGGA 1H8EG 2KG7A 3QO5A 1YTFB 1SA0A 5C8YA 4PD4F 1NH2B 3OUSA 2E3CA 1NVPD 2CDYA 5BZBA 4J11A 2CH7A 4XDJA 3THOA 4PDLA 1E79G 1BHAA 1SQBH 5JQGA 1AI6A 2A06H 4DV6B 1V54B 4JGSA 2IJHA 4Z1VA 4UV9A 3WU2Z 1WB7A 3SYQA 2ZIMA 4LFAB 4EFEA 4WFEA 5IJ0A 4J7ZA 5KHGA 1IBMO 1QVFU 1V54C 2R9AA 1R3IC 1RSOA 4FVMA 3E89A 2BOCC 3VOUA 1JFFB 5LA6B 1JPXA 3W7XA 5LMNB 4DUZO 4J7KA 1BMFG 3BCCH 1Q86W 2E5LB 2JGDB 1R6NA 2BE3A 3ZRWA 1IBMB 4KHPB 3UO2A 4B3TO 1FXKB 4EEQA 4JI7O 1VF6C 2FB5A 5H2FZ 2NLJC 4KUMA 4D7SA 1GN3A 2X6BA 3VQVA 4NTWA 3JD2A 2Y4TA 2DW4A 4YJ3B 3BY6A 2JVDA 3F5WC 2VRZA 4DR5B 2Y69B 2WLIA 2N05A 3UT5B 1FD9A 2YXHA 4O2AB 3HKBB 3CS5A 1SQXH 1YDXA 4FFKA 3JALA 1QBZA 3F5TA 2VQEB 3OD4A 5HFLA 4IIJA 4X20B 1KMIZ 3G4SV 2A3QA 1PPJH 4I4TB 3M7MX 4ZKIA 5LGNA 4XBFA 3JASB 3ZRVA 5IJ9A 4TV9A 3ASOB 2BTQB 3X2QC 4RO2A 1LR1A 1AB3A 3N2KA 2R70A 1Q3EA 3F7YC 1H2GA 4DK1A 2QKAA 2E74B 3GWKC 1JOYA 2P90A 4C7UA 3SGIA 3K59A 4CS2A 2Q67A 5FNVB 2JIZG 1XMQB 1HW7A 1N33O 4WFGA 3JCUZ 4I9WA 3SPGA 1MOFA 3JD0A 4CC5A 2P06A 1PM9A 5C93A 2F66C 4UB6Z 3A0HZ 1COWG 4P30A 2EZOA 4JI3O 4O4IA 1K4CC 2JS5A 2Z0AA 1JFFA 5LA6A 4JYCA 3CCVV 1W59A 1WP8A 3KCXA 3K58A 4DUYB 2OIGA 1NQTA 4PDVA 3FB5C 5JVDB 1S0VA 2UXDB 4LF9O 3WB1A 2F43G 2XUMA 4TUYA 2ZNIA 4K8XA 2PY5A 3L9DA 4DR4B 1QNMA 4MTOA 3K79A 5J2TB 2UXDO 1AP6A 4YJ2A 4DR1O 2Q8VA 4DV7O 3WG7C 1FYJA 1H2NA 3MHHC 2D2CB 1AR5A 4K0KB 1BE3H 5CA0B 3HKCB 2GBOA 1VQPV 2UUCO 5L3CA 2KSDA 2B1GA 2WLJA 4U7OA 1VARA 3HKCA 3RYHA 5L3GA 3BAAA 2H3OA 1K5QA 2UUAB 1BGYH 2Q6AA 4X20A 2Q4PA 3D36C 1D5AA 3TJTA 1M57C 3KKYA 3O65A 3G6EV 2WWWA 3BRCA 1VF7A 2QM8A 5EZYA 2JGDA 4KFMA 2QTSA 1FJGB 1QR9A 4FZ1A 3W7SA 4ZI7A 2Q7HA 1AJNA 1ZWIC 3DC5A 3K0GA 4OPHA 1URFA 2QKCA 2Y69C 1GN4A 5B1NA 5JJJB 1OZ0A 1ZL8A 2ZT9B 2Q5ZA 1B04A 4LC1A 1IDSA 1OCCC 4TQFA 2Z5UA 3K5LA 1CP9A 5CMUA 1HP8A 1THZA 2DQ0A 1VQOV 1M5IA 1DF4A 1K92A 2VWJA 2DYSC 1PL0A 4YXWG 2FKXA 1VQ9V 1PNMA 4MTXA 1KECA 1B6QA 1VF6A 5BXZA 1XMQO 3ABLB 3QNEA 3B4SA 4I55A 4HAMA 3LDCA 5CBGA 4KXRA 4NB5A 2YC0A 1KB9F 2QR4A 1IBKB 4R6ZA 4LCUC 1PD3A 5IYZA 1N34O 3IJ4A 4I50A 4CS4A 5A2QN 1YJWV 4B08A 1R6KA 3JYCA 2G38A 4YHHB 2F95B 2QWOB 4ICGA 4FM2A 3K08A 3JD4A 4TUYB 2OYQA 4J41A 2GDSA 1S77D 1N8RW 2DYRC 1IXMA 3ABMB 3RFRA 4QNHB 2QJ1A 1NR7A 2KG7B 4FLUA 1ZLZA 4G2KA 4B7KA 3E8GA 4PHZA 3QVNA 4WBNA 4MVZA 4NR1A 5IYCO 1XREA 4CH4A 4JI8O 1MSDA 2XNDG 1P84F 3L70H 1Q43A 5JH7B 5IY5B 1H2MA 3VQWA 2JEXA 3T4DA 3ZMUA 4DV1B 4QE7A 2EIJC 3I56V 5JH7A 4GX0A 2WLKA 4G27B 1HNWO 4PI2A 2EJRA 3JATA 2JGUA 1J5EB 5KX5A 1N36O 4MTFA 2ZINA 4PA3A 2QWQB 4I0XA 4PA7A 1H8HG 4IHJB 2DQ3A 2ZE5A 3FB6C 3X2QB 4JZ2A 4RAIA 2OCCB 3E22A 1J5EO 2XOKG 3HPLC 5GTIZ 3AEIA 4MVSA 4LFCO 2CK3G 1Q7YW 3CSXA 3OUFA 2XAJA 4LF6O 3AG4C 4UVBA 5EK0A 1GM8A 3UQ8A 1XBLA 4ZHQA 1B3QA 1IX9A 2WLLA 1FPOA 1XHZA 2IJKA 1FXHA 4YIOA 1DLBA 3P3PA 3UT5A 4LFCB 4B3RO 1AP5A 2N74A 1EZVH 3SJCC 4GKKO 1D5NA 1OCRB 3K5MA 5BY1A 1WN7A 2JDIG 4GUNA 2DE0X 2VS0A 3RGBA 3J80N 2Q68A 4MT8A 4B3TB 5EZYB 3D8CA 3T4ZA 2IH3C 4CS3A 3KZIZ 2DYSB 1SQQH 5CB4B 5FLXN 1L8DA 1ENVA 4I7ZB 3BEHA 3L74H 4B3RB 2F93B 1BZKA 2ZD9A 4K35A 1Y76B 3B8NA 4PDRA 3OMAB 5DECA 3A0RA 4B3SO 2P22C 1DGSA 4L8JA 3OW2U 2AZ0A 3MD0A 1Y74B 4LF4O 1G8MA 2HFEC 3BA9A 4R50A 1JJOA 3CP1A 5KMGB 5LBQA 3DGEA 4WFBV 2EIKB 3FFQA 4UUJC 3CXCU 4UVCA 2YS8A 1XMOB 1GRJA 1VQ4V 2X0LA 1BCCH 2XHBA 5IYBO 1P49A 2VQFO 1NBMG 4I5SA 4I55B 5KHJA 4OXSA 2CTRA 1M56B 1OJHA 4PDMA 2LFSA 1IBLB 3OEHG 4YJ3A 1Y4MA 1AJQA 2KQXA 4JI0O 2IU0A 3CCMV 2JK5C 1W2BU 2ETNA 3MDSA 4I50B 2EIMB 1MMMA 5LL6Y 5LGUA 3BPZA 4JYBA 5L3DA 2JEUA 2Y4UA 3SJAC 3JAMN 1AI7A 3RYCB 4IYHA 5IY5C 3S3XA 4JI6B 5JWPA 2KB1A 5LHIA 2ITCC 3ZRSA 4HZ3A 2WLMA 1TAEA 3HR0A 3CE2A 3N2GA 1BT8A 3RBZA 2WLHA 2CTQA 3ABMC 4ZOLA 4JF3A 2Q0AA 3W7UA 3K57A 5KA5A 2F4VB 4LF7B 5JQGB 3E8FA 4GKJO 2ILMA 3SPCA 4PELA 4YY3B 2QEXV 1N0NA 1YVWA 5KHIA 4DV2O 1WJZA 5J2UB 1N33B 2F4VO 1M9NA 1K34A 2GTSA 4KL1A 3SR2C 1YTFD 3U0ZA 3CRAA 1K73W 4ZIBA 4QE9A 4X66O 2RNBA 5IJ0B 2OCHA 1Z5WA 2DMXA 3AG1B 4DR1B 5BMVA 3JCZA 5HFMA 4WF9V 1PV0A 5JVDA 5K1XA 4FLTA 4FFBA 2XAFA 2QTOA 4DUYO 2QDOA 3K3WA 3FKSG 5EC2C 5LXTA 1P7BA 2A9HA 4Z2WA 2FMLA 4LNUB 3G71V 5B1BC 4LF5O 1XHXA 4LBEC 2LP7A 1MNGA 3CX5F 3I5DA 2ZQMA 4Q20A 5FPRA 2KKWA 1WNSA 3K06A 5CA0A 2WLLB 1TUEB 4ASUG 3T1HO 4K0KO 1H38A 3K5NA 3ZHUA 5IWAB 2ZR2A 3DXRA 1VQ6V 3CCUV 1KC8W 2QWNB 3L71H 3K9SA 3DXRB 5CB4A 1BHBA 3D3IA 1HNXB 1KKCA 1MABG 2EIMC 5KA6A 4I4TA 2IU3A 3CCEV 2UXNA 4O4HA 1XI1A 2AHZA 4DR2O 2X6AA 3TK1A 4DV0O 4GCZA 4AQYO 3VQYA 4JI2O 3OGIB 1VQKV 4OGQB 4PV1B 3GB7C 4XDKA 5JJEB 4JASA 5C8YB 3WFVA 3OE7G 5J2UA 4B3MB 4FK5C 2DWDC 2EILC 1I5YA 3JAKB 1JA8A 4HNAA 3PN1A 3A0BZ 3OTOB 3JATB 1R73A 4JI5B 4AI8A 3KCYA 1KD1W 3QG5A 4JV5B 2UXBB 2ARHA 2IM9A 5J9PC 1VQNV 3B2EE 2HHHO 1TVKA 2EBOA 1I94O 4B7EA 3OMNB 4DV3B 2ZE7A 2OWOA 4Q6GA 4MW3A 3JAWA 4LF9B 1YHQV 2BCCH 3HKEA 1RPRA 2UXCO 4RQFA 1XL4A 4U3FH 5J2TA 4GLXA 2OTLV 1JMKC 2ZCEA 3B8MA 3E22B 4LWSB 2YEVB 1F7YA 2FTKA 2EINC 5H6RA 4JI3B 2X6CA 4QPJA 4LF5B 4DV5O 4UCOA 4H37A 5EBLC 1XNRB 4GT1A 1NVPB 4U3JA 2YDEA 2A7WA 4GX2A 4KP4A 1AR4A 1OCOC 3ABKC 1GKFA 2LJ2A 1M4UA 2H94A 1TGOA 1UPGA 3CD6V 2RN9A 1NS1A 1SZTA 4DV1O 4DV5B 2QE7G 4PA4A 4K8ZA 4J80A 2V7QG 1P7GA 4DR4O 1AILA 1Y74A 3Q4HA 4OPAA 1JX9A 3OR7C 4IIJB 2ATKC 2DN9A 1L1FA 2LGWA 3TXQA 4X65B 2WAMA 1TUBA 2YUAA 3E83A 4JI1B 1CXZB 2PTMA 1SKVA 2WLNA 1FKAO 4YIPA 1VQ8V 3ASOC 3GWOA 3R66A 1ZUQA 4UCVA 2YICA 5LXTB 4NXMB 1NU1H 2YXLA 2NR5A 4P2ZA 1L0NH 4BIUA 3ZHSA 1XL6A 3A2FA 1QLEB 1QU7A 3T1CA 5KHKA 4CBCA 2WA4A 4JI7B 1VP7A 2RJZA 3AK2A 3D3QA 4FLYA 1K4DC 3HKBA 4TV8A 3G80A 3DTUB 1OHHG 4JI5O 1XOUA 1Z2GA 1MG1A 4TV8B 3FX7A 4JV5O 2UXBO 1PP9H 3UCSC 5JCOA 4JTDB 4E2LA 2EJ7A 4UCSA 1M90W 4DV3O 3N2GB 1T5EA 2BOBC 1M56C 1K97A 3ETDA 5CA3A 3APOA 1VMGA 4O4JB 3C3SA 4UV8A 3SYCA 1JVMA 5ITZB 2BTQA 3OT7A 1R1BA 4DW1A 5B66Z 2PUSA 4ZHQB 3W7WA 2UUBO 2RCVA 3MAQA 3FB7C 1H2KA 1GN2A 4NXNO 5B3SC 5L3EA 2F1MA 1PNKA 1I5XA 3ZRXA 4DR5O 1GN6A 3QO7A 2UU9B 2UUBB 2CGOA 4BWAA 2QM7A 3LNNA 3RN4A 5L3BA 4NXNB 3O9OA 3OGCC 3ZMZA 3ZHVA 1HR0O 3FYIB 4UXNA 1JCHA 4RWUA 5F2VO 4N21A 2DOSA 1KQSU 3ICXA 3T2MA 5K1PA 2HJDA 1TVKB 1PL4A 3ZEDA 5B5EZ 1YZBA 2ZM6O 4BIZA 2V4DA 2OIEA 4W4LA 1SF9A 4JI4B 2N04A 3S3WA 3AG4B 4GYCB 1SRYA 4X65O 4X64O 5KAFZ 4DR6O 1VQ5V 3CRQA 3CCSV 2OTJV 4DV4B 4MVMA 4O2BA 1EBOA 3TCUA 4LWSA 4HYOA 3ZS8C 2HVKC 2GUZA 4ZBMA 2LW7A 3FD9A 4X1YB 1SC5B 2NN4A 1RPOA 2ZIOA 2R72A 2DYRB 5E79Z 1IZ3A 4F4LA 4GX1A 2R9RB 1KU9A 1GM9A 1CEZA 1YITV 3BFRA 1YIJV 4LF7O 1SQGA 3ASNC 1Q5OA 1Q8IA 3CHXA 4FLWA 5DEDA 5EBWC 2CE4A 1OCZB 4FLXA 3CCRV 1S5HC 1WP7A 1ROPA 4MVQA 1SQVH 3FYEB 3ZX6A 3ZHTA 3CWBH 2P5OA 3ABTA 1OV9A 4BR6A 5IYZB 3RYFA 2EIJB 2E5LO 1NI8A 3CC4V 2EX3A 2ZE8A 1VQ7V 5D5PA 3N2KB 1KP3A 5DN6G 4LF4B 3RYIA 4EKWA 4DV6O 2EINB 2Z3YA 4FLZA 4NTYA 1E1QG 5KLVH 1XNQO 4XDLA 2ADPA 1G4YB 5CN0A 3IAYA 2XAHA 1WA8B 1XUQA 4X9QA 1S76D 2VQFB 2Y0PA 3RW0A 1BQZA 3H01A 5LMNO 1G1XB 3EFFK 4IL6Z 5FNVA 2LW1A 4JTAB 1IBLO 4B3SB 1BL8A 1EN6A 4CC6A 4NYKA 3ZCCA 4OX9O 1MA1A 1Q90D 1CPYA 2A0LA 5EYPB 4MW8A 3LNMB 3SPIA 1F4NA 2HR3A 1MSWD 5EYPA 5AG2A 3ZHQA 5B1BB 3CMEV 1F23A 5E1AC 3FAVB 3SYPA 3ZRWB 2AZ2A 4FFBB 1S5LZ 2PI5A 1SQFA 4X1IA 2HKOA 4F6RA 1FXKA 3IGAC 2W0FC 1W0JG 3H1IH 4TSFG 3AG2C 1E1RG 3ETEA 4X62O 5GTHZ 1M57B 4MTGA 1IBKO 4DO2A 2P6JA 2EZPA 3CRCA 2GUZB 4U7NA 5LYJB 2QKSA 3MHSC 2YIDA 4FZ0A 5ITZA 4UCTA 3H9VA 1OCOB 1Y6XA 3ABKB 1N32O 4YJ2B 4NVPA 4LF8O 4U3JB 1FAFA 4O2AA 1NKDA 1HDJA 1NZ6A 2Q9LA 4JAAA 4UFZA 1JR9A 1S72V 3LUTB 5LHGA 3JAKA 2QA4V 4J7JA 3RYHB 1ZX3A 5EIBC 1O9GA 1X59A 1U97A 1EFRG 2HLDG 4HBNA 2P4VA 3APQA 1YJ9V 3ZJZA 1KKDA 1LUVA 1M93A 4L87A 4JYYA 1GO3F 2XASA 1N34B 2JRIA 3UO3A 3EVKA 3IC9A 1K9MW 3K5OA 4WFFA 3ABLC 3BHPA 4YHHO 5KUMA 4DW0A 1HWYA 3RYIB 4PJ0Z 4LFBB 2ZR3A 3OEEG 5KMGA 4UB8Z 5CA1A 2A79B 3JAWB 3WB2A 1AJPA 2HJFC 4O2BB 1ZAUA 2UXXA 3SJQC 3B40A 2YI9A 3ZHRA 5LOVA 5LMUO 4LNUA 1Q6IA 3RT3C 5LOVB 3ETQA 3ZMTA 3H1HH 3WG7B 5GONB 3JARB 4MVRA 2M7WA 2Y0IA 2ZXWB 2O57A 3C3TA 5KUKA 4CH3A 3P30A 1SETA 3RYCA 1LNQA 4FM1A 2B5UA 2IBZH 2D3OW 3CC2V 4DR7O 1N0JA 1OCCB 3HKDB 2CUGA 1BQ0A 2L35A 4E4EA 3CCQV 2QWPB 2M6YA 3HB3B 1NH2D 2GV9A 2PYJA 3SPJA 4LFAO 2LO1A 4JPRA 4DR3O 1IXBA 3JSLA 4X88A 1QLEC 5IYDO 2XT9A 2UUAO 2NNUA 3VQXA 4X1KB 3UKMA 2Q7GA 3LDDA 5TISZ 5IDJA 4FIPC 4JI1O 5IWAO 2HVJC 1WB8A 3K0DA 4HNAB 4LH7A 1N32B 4W4KA 3H1LH 1F51A 1X4TA 4BW9A 4J10A 1YEWA 1AI5A 4N23A 2AXTZ 4H33A 3J7AU 3EHBB 4GZRB 2OCCC 1XMOO 5LP6C 2HP8A 1OCZC 1D2DA 4O4IB 4X1IB 5B1OA 3HKEB 4PA6A 4CZZA 3B09A 3T1YO 1GM7A 3R65A 2GHYA 3JD3A 1GH6A 2UXCB 4JAVA 4BW5A 3OTFA 5A9GA 4X89A 4LFBO 1N4CA 4FM0A 3AK1A 2DJVA 1OCRC 4P9PA 1M1KW 2ZNJA 1G6UA 1FXKC 2P4KA 3VBBA 1Z5VA 3ML0A 1SA0B 2JS3A 4I9QA 5KAIZ 3AG7A 2HHHB 4JI6O 5FPOA 2H8PC 4J42A 3BABA 2W6IG 3N27A 1SERA 2AGAA 2ZDIA 3JALB 1ZSPA 4EB6B 3E2EA 4X8AA 2BSKA 3RWRD 5CBFA 1L0LH 1NTMH 4EB6A 2F23A 2PI4A 2CTWA 2E76B 1Y76A 1QLNA 1US6A 3RYFB 5D5QA 3LDEA 2K1EA 5EIBD 4IT5A 2IJIA 1XILA 4DR6B 2EIKC 1R3LC 5B1AB 3UM7A 2DWEC 2AHYA 2ZKOA 5H5NA 4YY3O 4Z1MG 1Q6HA 1HNZB 4A5UB 1HR0B 1VQMV 3D36A 3G6BA 3SDLA 2JJ2G 2EILB 2IW5A 4DRXA 1FFXA 4LP8A 4WCEV 1S3JA 2ZXWC 5JCOC 5IJ9B 4AHCA 4LF6B 1NTZH 1WA8A 4DRXB 4DR3B 2QWRB 4WBNB 1EN5A 4JAUA 2IJJA 4J9YB 1KBHA 1B06A 1UJWB 5GONA 3C90A 4O4LB 1Y66A 1LUWA 4QIWF 1YXBA 3K9AA 3NXSA 1PKXA 3SYAA 3L72H 1RM1C 3H1KH 1F4MA 1SESA 3CB2A 3FB8C 2GTAA 1I0HA 2WLIB 4DUZB 3M99B 1A32A 1GTOA 3ZN1A 2XAQA 2YI8A 4X66B 1I08A 4KHPO 3CCLV 3E8BA 1GMGA 1KP2A 1QHTA 3ZIAG 2HEPA 2YIBA 5BR8B 3NR7A 4FLVA 3G67A 2RQ6A 1R3JC 3SPHA 4NXMO 1VEWA 2XAGA 3JASA 2LQTA 2YIBD 1V55B 3SJBC 4MVOA 5BR8O 4OX9B 3JD1A 1VQLV 4R7CA 3K04A 3ETGA 1AROP 4GX5A 3RVYA 1XNQB 3CC7V 3SYOA 3L75H 2IH1C 2X7RB 3I55V 1V9PA 2VQEO 2C2AA 4UVAA 2UU9O 1U96A 5KHHA 1KYOF 1FFTB 1SQPH 3U10A 4X62B 2MK3A 2Q0OC 3LSSA 1SZXA 3LSQA 2JJ1G 1WLEA 4F6EA 3QTCA 1BSMA 1TUBB 2L6LA 5CA1B 3BA8A 2P67A 3JSNA 3CPWU 1WPXA 1FXVA 1FFXB 1UFIA 4UCRA 3OTOO 4WFHA 3CCJV 4TOIA 1EM1A 1JQ0A 3J81N 3E35A 4X64B 3ZMVA 4FMTA 1YJNV 4DR2B 2CTPA 2FL4A 4RUFA 3IFXA 1I94B 4DV0B 2ITDC 4H13B 3QO8A 2YIAA 2W0XA 3ZN0A 5EC1C 1QQCA 1IVSA 2BTOA 3AG3C 1H2LA 1DF5A 3AK3A 3TGUH 2PGGA 2RDCA 1YF2A 4H0LB 3L73H 3EXAA 1MZFA 4R8CA 2WSSG 1MZEA 3CJHA 4JI4O 4JI8B 2Q7EA 4RUEA 1AR1B 5LP6B 3CJHB 2XTAA 3PJSK 1J95A 1ORQC 5CBHA 1RP3B 1QCEA 4TV9B 4F6RB 3HKDA 3Q4HB 4DXWA 1Q82W 3DSQA 2QGNA 3P3NA 2OT5A 4DK0A 2W6JG 4DV7B 4ZOLB 4WFAV 3CMAV 5LGTA 1FS0G 4O4HB 4EFBA 3TXSA 1ZL8B 3IC7A 4O4JA 4G28B 1NR1A 3AG3B 3M8AA 4AILC 4X1KA 3AG1C 2FYUH 2Q69A 4QPKA 1XEQA 4MS2A 4QGPA 2Q73A 2K9PA 2MW2B 5GW7A 3ZBHA 5IT9N 3QF7A 1P4RA 2CH7B 1XNRO 1XDCA 1O9HA 3OM3B 4CH6A 4I0XB 1V55C 4IHJA 1NJIW 4JYAB 2Y48A 4JTCB 4DYLA 2V1DA 1YCIA 5H6QA 1HNXO 1WPBA 3E86A 4GKKB 3BVOA 2UUCB 1RSOB 4ZI7B 2P7TC
chains in the Genus database with same CATH topology
3WG7B 3ABLB 3QNEA 4MVRA 4HAMA 4RQFA 2M7WA 1XL4A 2ZXWB 3LDCA 5CBGA 5KUKA 3P30A 2OTLV 1JJ2U 1SETA 3B8MA 1LNQA 1EZJA 2YEVB 4R6ZA 2B5UA 1PD3A 4LCUC 4QJFB 2FTKA 2D3OW 2EINC 3CYOA 3CC2V 5H6RA 1YJWV 2X6CA 1R6KA 1OCCB 3JYCA 4QPJA 3RVZA 3CCQV 1AI4A 3OFNG 4H37A 1K7DA 3HB3B 3JD4A 3K08A 5EBLC 1NH2D 5FL7G 4GT1A 4J9ZB 5DM6V 1NVPB 1S77D 4BAYA 3SPJA 1N8RW 2DYRC 4JPRA 4GX2A 1IXMA 4KP4A 3ABMB 1OCOC 3ABKC 1GKFA 4QNHB 5LHHA 2B1IA 4X88A 1QLEC 5IYDO 1NR7A 2NNUA 2H94A 3CD6V 1SZTA 2QE7G 3W7TA 3OMIB 4PA4A 3UKMA 3OAAG 3LDDA 4G2KA 5IDJA 2V7QG 3E8GA 4FIPC 2HVJC 4MVUA 4MVZA 5IYCO 3ZMSA 3K0DA 1JX9A 3OR7C 1GK9A 3STLC 2XNDG 2ATKC 5IY5B 2JEXA 1L1FA 3T4DA 3ZMUA 3E8HA 4PA9A 2EIJC 4QE7A 3I56V 2GSMB 1F51A 2WAMA 4GX0A 2WLKA 3E83A 2HG5C 4MSWC 4G27B 4P9OA 1AI5A 3ASNB 3KG2A 3OR6C 4N23A 4H33A 3EHBB 2OCCC 2EJRA 2WLNA 2ZDIC 2WPDG 1YSCA 1K5SA 1R3KC 3ASOC 3B77A 3GWOA 1VQ8V 4RQEA 1OCZC 4MTFA 1RM1B 5B1OA 4PA3A 4PA6A 3STZC 4PA7A 3ABUA 1H8HG 4P2ZA 2DQ3A 5B1AC 4CZZA 1GM7A 4BIUA 3R65A 3FB6C 3X2QB 3AG2B 2GHYA 4RAIA 1QVGU 1XL6A 4TWKA 1QLEB 3JD3A 2LFRA 4JAVA 4BW5A 5B3SB 5L3FA 2OCCB 3T1CA 2XOKG 3HPLC 4X89A 4CBCA 3AEIA 4MVSA 2CK3G 1Q7YW 1Q81W 1PNLA 1OCRC 1YI2V 1K4DC 3DTUB 4P9PA 3OUFA 1OHHG 2XAJA 1M1KW 1MG1A 2YSUB 3AG4C 4UVBA 5EK0A 1FXKC 3VBBA 1GM8A 3ML0A 1W0KG 1K33A 1K3EA 2WLLA 2IJKA 5EBMC 4JTDB 4E2LA 3TETA 3P32A 1FXHA 2H8PC 1DLBA 4FPPA 2W6IG 1SERA 3K03A 2ZDIA 1M90W 2R9IA 4TT3G 1QR8A 2BOBC 1M56C 1K97A 1OCRB 3E2EA 4X8AA 2JDIG 2YEVA 5CBFA 1DTOA 3ETDA 1K8AW 5CA3A 4FJCC 2Q68A 4MT8A 3F7VC 4UV8A 2PI4A 3SYCA 3T4ZA 1JVMA 5H9CA 2IH3C 1QLNA 2DYSB 3LDEA 1H8EG 2K1EA 1ENVA 3QO5A 3BEHA 2IJIA 3W7WA 1YTFB 2EIKC 1R3LC 2ZD9A 5B1AB 3UM7A 3B8NA 2DWEC 3FB7C 2AHYA 1NH2B 4PDRA 3OMAB 3OUSA 1NVPD 3A0RA 5BZBA 4Z1MG 5B3SC 5L3EA 3OW2U 1PNKA 4XDJA 4PDLA 1VQMV 1E79G 1I5XA 3D36A 1BHAA 3ZRXA 3MD0A 2JJ2G 1AI6A 1G8MA 3QO7A 1V54B 2HFEC 2EILB 2IJHA 2IW5A 4JGSA 4R50A 4UV9A 3CP1A 3SYQA 4LP8A 5LBQA 1S3JA 2ZXWC 2EIKB 2QM7A 3DGEA 4WFBV 4WCEV 4UUJC 5L3BA 4UVCA 4WFEA 3CXCU 1VQ4V 3OGCC 3ZMZA 2X0LA 4JAUA 2IJJA 1V54C 4J9YB 1R3IC 1QVFU 5IYBO 3E89A 3FYIB 4UXNA 2BOCC 1JCHA 3VOUA 1UJWB 1JPXA 4N21A 1NBMG 3W7XA 4I5SA 1Y66A 1KQSU 4OXSA 3T2MA 1BMFG 1M56B 4QIWF 3K9AA 4PDMA 2LFSA 1Q86W 3OEHG 3NXSA 1PKXA 1Y4MA 3SYAA 1R6NA 1AJQA 1RM1C 3ZRWA 1F4MA 2IU0A 4BIZA 3CCMV 1SESA 2JK5C 1W2BU 3FB8C 2WLIB 2EIMB 3AG4B 1FXKB 1SRYA 3M99B 5LGUA 1VQ5V 4JYBA 5L3DA 2JEUA 2NLJC 4KUMA 1GTOA 2XAQA 3ZN1A 3CCSV 4MVMA 3TCUA 1EBOA 2OTJV 1AI7A 4HYOA 2HVKC 2X6BA 4ZBMA 5IY5C 3CCLV 3E8BA 1GMGA 1KP2A 3JD2A 3ZIAG 1RPOA 2DW4A 2DYRB 3BY6A 1R3JC 3F5WC 3SPHA 4F4LA 4GX1A 2R9RB 1GM9A 1CEZA 2KB1A 1YITV 2Y69B 2WLIA 1YIJV 5LHIA 2XAGA 2ITCC 3ZRSA 3ASNC 4HZ3A 2WLMA 1V55B 4MVOA 5EBWC 1OCZB 3CCRV 1S5HC 1ROPA 4MVQA 1QBZA 3RBZA 3FYEB 2WLHA 3JD1A 1VQLV 4R7CA 3ABMC 3K04A 5HFLA 4JF3A 3ETGA 3W7UA 1AROP 5KA5A 3G4SV 3ABTA 4GX5A 3RVYA 3E8FA 3CC7V 2EIJB 3SPCA 4PELA 3CC4V 3SYOA 4ZKIA 2QEXV 5LGNA 4XBFA 2IH1C 2X7RB 1VQ7V 3I55V 3ZRVA 1KP3A 5DN6G 3ASOB 4EKWA 2C2AA 2EINB 4UVAA 2Z3YA 3X2QC 4RO2A 1M9NA 1K34A 1YTFD 1E1QG 1FFTB 4XDLA 3F7YC 1H2GA 2MK3A 3LSSA 1G4YB 5CN0A 1K73W 4QE9A 2XAHA 3LSQA 2JJ1G 1JOYA 2P90A 1S76D 3AG1B 1WLEA 2Q67A 3RW0A 2JIZG 3H01A 3JCZA 5HFMA 4WFGA 3EFFK 4I9WA 3SPGA 2P67A 4WF9V 1MOFA 3CPWU 1WPXA 4JTAB 3JD0A 1FXVA 2XAFA 2QTOA 1BL8A 4WFHA 5C93A 1COWG 4P30A 3CCJV 3ZCCA 3K3WA 1JQ0A 1CPYA 2EZOA 3FKSG 2A0LA 5EC2C 3E35A 4MW8A 1K4CC 1P7BA 3LNMB 2A9HA 3ZMVA 4FMTA 1YJNV 3SPIA 1F4NA 2HR3A 4JYCA 5B1BC 3G71V 4RUFA 3IFXA 3CCVV 1MSWD 4LBEC 2ITDC 2LP7A 5B1BB 3CMEV 3QO8A 1F23A 5E1AC 1NQTA 4PDVA 3SYPA 3FB5C 2ZQMA 3ZRWB 1S0VA 3ZN0A 4Q20A 5EC1C 2PI5A 2HKOA 3K06A 3AG3C 1FXKA 2F43G 2WLLB 1TUEB 3IGAC 2W0FC 1DF5A 1W0JG 4TSFG 4ASUG 3AG2C 1E1RG 3ETEA 1M57B 1H38A 4MTGA 4DO2A 4R8CA 2WSSG 2P6JA 2EZPA 2ZR2A 4MTOA 3K79A 4U7NA 2QKSA 3MHSC 1VQ6V 3CCUV 4RUEA 1KC8W 3WG7C 1AR1B 3MHHC 1OCOB 1J95A 1ORQC 3ABKB 3PJSK 5CBHA 1BHBA 1QCEA 3D3IA 1MABG 1NKDA 2EIMC 1VQPV 5KA6A 4DXWA 5L3CA 1Q82W 2B1GA 2WLJA 4U7OA 2IU3A 3CCEV 2OT5A 5L3GA 1S72V 2UXNA 3LUTB 5LHGA 2QA4V 2W6JG 1K5QA 2AHZA 4WFAV 2Q6AA 2X6AA 3TK1A 3CMAV 5LGTA 1FS0G 1M57C 1EFRG 3G6EV 2HLDG 2WWWA 1YJ9V 3IC7A 4GCZA 3ZJZA 1KKDA 4L87A 1GO3F 2XASA 4G28B 1NR1A 3AG3B 1VQKV 2QM8A 3AG1C 1K9MW 4WFFA 2Q69A 4KFMA 4QPKA 3GB7C 3ABLC 4XDKA 5KUMA 4JASA 1HWYA 3WFVA 3OE7G 2ZR3A 4MS2A 3OEEG 4FK5C 1QR9A 2DWDC 3W7SA 2EILC 1I5YA 5GW7A 1AJNA 1ZWIC 2A79B 3K0GA 1P4RA 1AJPA 2Y69C 5B1NA 3OM3B 2HJFC 1R73A 1OZ0A 2UXXA 3SJQC 1KD1W 1V55C 4LC1A 5J9PC 1NJIW 1OCCC 1VQNV 2Z5UA 2Y48A 1CP9A 4JTCB 5CMUA 1THZA 2EBOA 2DQ0A 1VQOV 1DF4A 2V1DA 3OMNB 5H6QA 1K92A 2DYSC 1PL0A 3E86A 4YXWG 3ZMTA 1VQ9V 1PNMA 4MTXA 1KECA 2P7TC 1B6QA 4MW3A 1YHQV 1RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1A C;  4PDV A;  2NLJ C;  4MVS A;  3FB5 C;  3SYP A;  4MVM A;  3TCU A;  4MVR A;  5EC1 C;  1OCR C;  1XL4 A;  4HYO A;  2HVK C;  2X6B A;  1K4D C;  3LDC A;  4ZBM A;  5CBG A;  5IY5 C;  4P9P A;  3OUF A;  3E8B A;  3K06 A;  3AG3 C;  5KUK A;  2WLL B;  3IGA C;  2W0F C;  3AG4 C;  5EK0 A;  3F5W C;  1R3J C;  1LNQ A;  4R6Z A;  3SPH A;  4GX1 A;  4F4L A;  3AG2 C;  2R9R B;  4LCU C;  2KB1 A;  2EIN C;  2WLI A;  2WLL A;  4MTG A;  5EBM C;  4JTD B;  4R8C A;  2X6C A;  2ITC C;  3TET A;  3JYC A;  2H8P C;  3ZRS A;  3ASN C;  4MTO A;  4HZ3 A;  3K03 A;  2QKS A;  2WLM A;  4MVO A;  3RVZ A;  5EBW C;  2BOB C;  1M56 C;  4RUE A;  1S5H C;  4H37 A;  4X8A A;  3K08 A;  3T4D A;  2YEV A;  4MVQ A;  5EBL C;  3WG7 C;  5CBF A;  3RBZ A;  2WLH A;  4J9Z B;  4R7C A;  1J95 A;  1ORQ C;  3ABM C;  3K04 A;  3PJS K;  5CBH A;  2Q68 A;  3SPJ A;  2DYR C;  3F7V C;  4GX2 A;  3SYC A;  3T4Z A;  1JVM A;  1OCO C;  2IH3 C;  3ABK C;  4GX5 A;  4QNH B;  3RVY A;  2EIM C;  4X88 A;  1QLE C;  3LDE A;  2K1E A;  3E8F A;  4DXW A;  3BEH A;  3SPC A;  2EIK C;  1R3L C;  2WLJ A;  2ZD9 A;  3UM7 A;  2DWE C;  3FB7 C;  3SYO A;  2AHY A;  4PDR A;  3LUT B;  3OUS A;  2IH1 C;  4PA4 A;  3UKM A;  2AHZ A;  5BZB A;  3LDD A;  2Q6A A;  2X6A A;  5B3S C;  3E8G A;  2HVJ C;  4XDJ A;  4EKW A;  1M57 C;  4PDL A;  4MVU A;  3X2Q C;  4RO2 A;  4MVZ A;  3ZJZ A;  1KKD A;  3K0D A;  3OR7 C;  3STL C;  4XDL A;  3F7Y C;  4G28 B;  2ATK C;  2HFE C;  1G4Y B;  4R50 A;  4QE9 A;  3AG1 C;  4WFF A;  3SYQ A;  2Q69 A;  3E8H A;  2ZXW C;  2EIJ C;  4LP8 A;  4KFM A;  4PA9 A;  4QE7 A;  3GB7 C;  3ABL C;  4XDK A;  5KUM A;  4UUJ C;  4WFE A;  4GX0 A;  3OGC C;  4MS2 A;  2WLK A;  2Q67 A;  2HG5 C;  3E83 A;  1V54 C;  2DWD C;  1R3I C;  2EIL C;  4G27 B;  4J9Y B;  4MSW C;  3OR6 C;  4P9O A;  1ZWI C;  3E89 A;  3KG2 A;  4H33 A;  2A79 B;  2BOC C;  3K0G A;  4WFG A;  2OCC C;  3EFF K;  3VOU A;  2WLN A;  4I9W A;  2Y69 C;  3SPG A;  2HJF C;  4JTA B;  1R3K C;  3ASO C;  4OXS A;  3T2M A;  3RW0 A;  3SJQ C;  1OCZ C;  2QTO A;  4MTF A;  1BL8 A;  4WFH A;  1V55 C;  4PDM A;  5J9P C;  4PA3 A;  4PA6 A;  3STZ C;  1OCC C;  4P30 A;  4PA7 A;  3SYA A;  4P2Z A;  4JTC B;  5B1A C;  2A0L A;  5EC2 C;  4MW8 A;  2JK5 C;  3R65 A;  1K4C C;  3FB6 C;  1P7B A;  3LNM B;  3FB8 C;  2A9H A;  2WLI B;  4RAI A;  1XL6 A;  4TWK A;  2DYS C;  3SPI A;  3E86 A;  5B1B C;  4RUF A;  3IFX A;  4BW5 A;  3T1C A;  3HPL C;  4LBE C;  2P7T C;  4MW3 A;  4X89 A;  2ITD C;  4CBC A; 
#chains in the Genus database with same CATH topology
 4CH5 A;  4K3A A;  1XQ8 A;  4LH6 A;  2PYL A;  5IE9 A;  5LYJ A;  4BIO A;  3CRR A;  3T1H B;  4UCU A;  1JJ2 U;  4PI0 A;  4AQY B;  4JI2 B;  1EZJ A;  4QJF B;  1Y67 A;  3CYO A;  4D7T A;  1DK1 A;  1FJG O;  3RVZ A;  4B3M O;  2PZS A;  3CRM A;  4JZG A;  1AI4 A;  3OFN G;  1K7D A;  3A8T A;  4LF8 B;  5FL7 G;  5DM6 V;  4J9Z B;  2BSK B;  4NKG B;  3T1Y B;  1I7F A;  4BAY A;  4X1Y A;  5JJN B;  2YXY A;  5LHH A;  2B1I A;  1BS3 A;  2VWK A;  2B9Z A;  3H1J H;  3W7T A;  3OMI B;  1AVM A;  3OAA G;  1EN4 A;  2ODM A;  4MVU A;  4TQD A;  3ZMS A;  2AW9 A;  3CEI A;  3STL C;  1GK9 A;  4ABM A;  1RFY A;  1TA8 A;  2RMK B;  4LR3 A;  5BMV B;  3E8H A;  4PA9 A;  2GSM B;  4H44 B;  4IYI A;  2HG5 C;  1R6T A;  1NTK H;  2ADQ B;  4MSW C;  4P9O A;  3OR6 C;  3ASN B;  3KG2 A;  2EUL A;  1Q6U A;  1VIB A;  2ZDI C;  1VF5 B;  2WPD G;  1YSC A;  1K5S A;  1R3K C;  3B77 A;  3GVM A;  5LMU B;  4RQE A;  4O4L A;  1RM1 B;  3STZ C;  3ABU A;  5B1A C;  3AG2 B;  1QVG U;  2ZM6 B;  4TWK A;  2E75 B;  1NT2 B;  4JI0 B;  2LFR A;  5B3S B;  5L3F A;  1HNZ O;  2ZE6 A;  1N36 B;  1IUR A;  1ZTE A;  3DC6 A;  3U11 A;  1H2S B;  3CXH F;  1WAZ A;  1Q81 W;  1PNL A;  1S5J A;  5KX5 B;  1YI2 V;  3JAR A;  4D6T H;  2CGN A;  1KUQ A;  4GKJ B;  4DV4 O;  2CAZ C;  2YSU B;  4DR7 B;  2PF4 E;  1W0K G;  2WA3 A;  1K33 A;  4JYA O;  4DV2 B;  1SS3 A;  1K3E A;  3LSU A;  5EBM C;  4NTX A;  3TET A;  3P32 A;  4FPP A;  2QSA A;  3K03 A;  5LP6 A;  2R9I A;  4TT3 G;  1QR8 A;  3FAV A;  1HNW B;  2YEV A;  1DTO A;  3WB0 A;  1K8A W;  2LGQ A;  4FJC C;  3F7V C;  5H9C A;  2QM4 A;  1GAX A;  4IGG A;  1H8E G;  2KG7 A;  3QO5 A;  1YTF B;  1SA0 A;  5C8Y A;  4PD4 F;  1NH2 B;  3OUS A;  2E3C A;  1NVP D;  2CDY A;  5BZB A;  4J11 A;  2CH7 A;  4XDJ A;  3THO A;  4PDL A;  1E79 G;  1BHA A;  1SQB H;  5JQG A;  1AI6 A;  2A06 H;  4DV6 B;  1V54 B;  4JGS A;  2IJH A;  4Z1V A;  4UV9 A;  3WU2 Z;  1WB7 A;  3SYQ A;  2ZIM A;  4LFA B;  4EFE A;  4WFE A;  5IJ0 A;  4J7Z A;  5KHG A;  1IBM O;  1QVF U;  1V54 C;  2R9A A;  1R3I C;  1RSO A;  4FVM A;  3E89 A;  2BOC C;  3VOU A;  1JFF B;  5LA6 B;  1JPX A;  3W7X A;  5LMN B;  4DUZ O;  4J7K A;  1BMF G;  3BCC H;  1Q86 W;  2E5L B;  2JGD B;  1R6N A;  2BE3 A;  3ZRW A;  1IBM B;  4KHP B;  3UO2 A;  4B3T O;  1FXK B;  4EEQ A;  4JI7 O;  1VF6 C;  2FB5 A;  5H2F Z;  2NLJ C;  4KUM A;  4D7S A;  1GN3 A;  2X6B A;  3VQV A;  4NTW A;  3JD2 A;  2Y4T A;  2DW4 A;  4YJ3 B;  3BY6 A;  2JVD A;  3F5W C;  2VRZ A;  4DR5 B;  2Y69 B;  2WLI A;  2N05 A;  3UT5 B;  1FD9 A;  2YXH A;  4O2A B;  3HKB B;  3CS5 A;  1SQX H;  1YDX A;  4FFK A;  3JAL A;  1QBZ A;  3F5T A;  2VQE B;  3OD4 A;  5HFL A;  4IIJ A;  4X20 B;  1KMI Z;  3G4S V;  2A3Q A;  1PPJ H;  4I4T B;  3M7M X;  4ZKI A;  5LGN A;  4XBF A;  3JAS B;  3ZRV A;  5IJ9 A;  4TV9 A;  3ASO B;  2BTQ B;  3X2Q C;  4RO2 A;  1LR1 A;  1AB3 A;  3N2K A;  2R70 A;  1Q3E A;  3F7Y C;  1H2G A;  4DK1 A;  2QKA A;  2E74 B;  3GWK C;  1JOY A;  2P90 A;  4C7U A;  3SGI A;  3K59 A;  4CS2 A;  2Q67 A;  5FNV B;  2JIZ G;  1XMQ B;  1HW7 A;  1N33 O;  4WFG A;  3JCU Z;  4I9W A;  3SPG A;  1MOF A;  3JD0 A;  4CC5 A;  2P06 A;  1PM9 A;  5C93 A;  2F66 C;  4UB6 Z;  3A0H Z;  1COW G;  4P30 A;  2EZO A;  4JI3 O;  4O4I A;  1K4C C;  2JS5 A;  2Z0A A;  1JFF A;  5LA6 A;  4JYC A;  3CCV V;  1W59 A;  1WP8 A;  3KCX A;  3K58 A;  4DUY B;  2OIG A;  1NQT A;  4PDV A;  3FB5 C;  5JVD B;  1S0V A;  2UXD B;  4LF9 O;  3WB1 A;  2F43 G;  2XUM A;  4TUY A;  2ZNI A;  4K8X A;  2PY5 A;  3L9D A;  4DR4 B;  1QNM A;  4MTO A;  3K79 A;  5J2T B;  2UXD O;  1AP6 A;  4YJ2 A;  4DR1 O;  2Q8V A;  4DV7 O;  3WG7 C;  1FYJ A;  1H2N A;  3MHH C;  2D2C B;  1AR5 A;  4K0K B;  1BE3 H;  5CA0 B;  3HKC B;  2GBO A;  1VQP V;  2UUC O;  5L3C A;  2KSD A;  2B1G A;  2WLJ A;  4U7O A;  1VAR A;  3HKC A;  3RYH A;  5L3G A;  3BAA A;  2H3O A;  1K5Q A;  2UUA B;  1BGY H;  2Q6A A;  4X20 A;  2Q4P A;  3D36 C;  1D5A A;  3TJT A;  1M57 C;  3KKY A;  3O65 A;  3G6E V;  2WWW A;  3BRC A;  1VF7 A;  2QM8 A;  5EZY A;  2JGD A;  4KFM A;  2QTS A;  1FJG B;  1QR9 A;  4FZ1 A;  3W7S A;  4ZI7 A;  2Q7H A;  1AJN A;  1ZWI C;  3DC5 A;  3K0G A;  4OPH A;  1URF A;  2QKC A;  2Y69 C;  1GN4 A;  5B1N A;  5JJJ B;  1OZ0 A;  1ZL8 A;  2ZT9 B;  2Q5Z A;  1B04 A;  4LC1 A;  1IDS A;  1OCC C;  4TQF A;  2Z5U A;  3K5L A;  1CP9 A;  5CMU A;  1HP8 A;  1THZ A;  2DQ0 A;  1VQO V;  1M5I A;  1DF4 A;  1K92 A;  2VWJ A;  2DYS C;  1PL0 A;  4YXW G;  2FKX A;  1VQ9 V;  1PNM A;  4MTX A;  1KEC A;  1B6Q A;  1VF6 A;  5BXZ A;  1XMQ O;  3ABL B;  3QNE A;  3B4S A;  4I55 A;  4HAM A;  3LDC A;  5CBG A;  4KXR A;  4NB5 A;  2YC0 A;  1KB9 F;  2QR4 A;  1IBK B;  4R6Z A;  4LCU C;  1PD3 A;  5IYZ A;  1N34 O;  3IJ4 A;  4I50 A;  4CS4 A;  5A2Q N;  1YJW V;  4B08 A;  1R6K A;  3JYC A;  2G38 A;  4YHH B;  2F95 B;  2QWO B;  4ICG A;  4FM2 A;  3K08 A;  3JD4 A;  4TUY B;  2OYQ A;  4J41 A;  2GDS A;  1S77 D;  1N8R W;  2DYR C;  1IXM A;  3ABM B;  3RFR A;  4QNH B;  2QJ1 A;  1NR7 A;  2KG7 B;  4FLU A;  1ZLZ A;  4G2K A;  4B7K A;  3E8G A;  4PHZ A;  3QVN A;  4WBN A;  4MVZ A;  4NR1 A;  5IYC O;  1XRE A;  4CH4 A;  4JI8 O;  1MSD A;  2XND G;  1P84 F;  3L70 H;  1Q43 A;  5JH7 B;  5IY5 B;  1H2M A;  3VQW A;  2JEX A;  3T4D A;  3ZMU A;  4DV1 B;  4QE7 A;  2EIJ C;  3I56 V;  5JH7 A;  4GX0 A;  2WLK A;  4G27 B;  1HNW O;  4PI2 A;  2EJR A;  3JAT A;  2JGU A;  1J5E B;  5KX5 A;  1N36 O;  4MTF A;  2ZIN A;  4PA3 A;  2QWQ B;  4I0X A;  4PA7 A;  1H8H G;  4IHJ B;  2DQ3 A;  2ZE5 A;  3FB6 C;  3X2Q B;  4JZ2 A;  4RAI A;  2OCC B;  3E22 A;  1J5E O;  2XOK G;  3HPL C;  5GTI Z;  3AEI A;  4MVS A;  4LFC O;  2CK3 G;  1Q7Y W;  3CSX A;  3OUF A;  2XAJ A;  4LF6 O;  3AG4 C;  4UVB A;  5EK0 A;  1GM8 A;  3UQ8 A;  1XBL A;  4ZHQ A;  1B3Q A;  1IX9 A;  2WLL A;  1FPO A;  1XHZ A;  2IJK A;  1FXH A;  4YIO A;  1DLB A;  3P3P A;  3UT5 A;  4LFC B;  4B3R O;  1AP5 A;  2N74 A;  1EZV H;  3SJC C;  4GKK O;  1D5N A;  1OCR B;  3K5M A;  5BY1 A;  1WN7 A;  2JDI G;  4GUN A;  2DE0 X;  2VS0 A;  3RGB A;  3J80 N;  2Q68 A;  4MT8 A;  4B3T B;  5EZY B;  3D8C A;  3T4Z A;  2IH3 C;  4CS3 A;  3KZI Z;  2DYS B;  1SQQ H;  5CB4 B;  5FLX N;  1L8D A;  1ENV A;  4I7Z B;  3BEH A;  3L74 H;  4B3R B;  2F93 B;  1BZK A;  2ZD9 A;  4K35 A;  1Y76 B;  3B8N A;  4PDR A;  3OMA B;  5DEC A;  3A0R A;  4B3S O;  2P22 C;  1DGS A;  4L8J A;  3OW2 U;  2AZ0 A;  3MD0 A;  1Y74 B;  4LF4 O;  1G8M A;  2HFE C;  3BA9 A;  4R50 A;  1JJO A;  3CP1 A;  5KMG B;  5LBQ A;  3DGE A;  4WFB V;  2EIK B;  3FFQ A;  4UUJ C;  3CXC U;  4UVC A;  2YS8 A;  1XMO B;  1GRJ A;  1VQ4 V;  2X0L A;  1BCC H;  2XHB A;  5IYB O;  1P49 A;  2VQF O;  1NBM G;  4I5S A;  4I55 B;  5KHJ A;  4OXS A;  2CTR A;  1M56 B;  1OJH A;  4PDM A;  2LFS A;  1IBL B;  3OEH G;  4YJ3 A;  1Y4M A;  1AJQ A;  2KQX A;  4JI0 O;  2IU0 A;  3CCM V;  2JK5 C;  1W2B U;  2ETN A;  3MDS A;  4I50 B;  2EIM B;  1MMM A;  5LL6 Y;  5LGU A;  3BPZ A;  4JYB A;  5L3D A;  2JEU A;  2Y4U A;  3SJA C;  3JAM N;  1AI7 A;  3RYC B;  4IYH A;  5IY5 C;  3S3X A;  4JI6 B;  5JWP A;  2KB1 A;  5LHI A;  2ITC C;  3ZRS A;  4HZ3 A;  2WLM A;  1TAE A;  3HR0 A;  3CE2 A;  3N2G A;  1BT8 A;  3RBZ A;  2WLH A;  2CTQ A;  3ABM C;  4ZOL A;  4JF3 A;  2Q0A A;  3W7U A;  3K57 A;  5KA5 A;  2F4V B;  4LF7 B;  5JQG B;  3E8F A;  4GKJ O;  2ILM A;  3SPC A;  4PEL A;  4YY3 B;  2QEX V;  1N0N A;  1YVW A;  5KHI A;  4DV2 O;  1WJZ A;  5J2U B;  1N33 B;  2F4V O;  1M9N A;  1K34 A;  2GTS A;  4KL1 A;  3SR2 C;  1YTF D;  3U0Z A;  3CRA A;  1K73 W;  4ZIB A;  4QE9 A;  4X66 O;  2RNB A;  5IJ0 B;  2OCH A;  1Z5W A;  2DMX A;  3AG1 B;  4DR1 B;  5BMV A;  3JCZ A;  5HFM A;  4WF9 V;  1PV0 A;  5JVD A;  5K1X A;  4FLT A;  4FFB A;  2XAF A;  2QTO A;  4DUY O;  2QDO A;  3K3W A;  3FKS G;  5EC2 C;  5LXT A;  1P7B A;  2A9H A;  4Z2W A;  2FML A;  4LNU B;  3G71 V;  5B1B C;  4LF5 O;  1XHX A;  4LBE C;  2LP7 A;  1MNG A;  3CX5 F;  3I5D A;  2ZQM A;  4Q20 A;  5FPR A;  2KKW A;  1WNS A;  3K06 A;  5CA0 A;  2WLL B;  1TUE B;  4ASU G;  3T1H O;  4K0K O;  1H38 A;  3K5N A;  3ZHU A;  5IWA B;  2ZR2 A;  3DXR A;  1VQ6 V;  3CCU V;  1KC8 W;  2QWN B;  3L71 H;  3K9S A;  3DXR B;  5CB4 A;  1BHB A;  3D3I A;  1HNX B;  1KKC A;  1MAB G;  2EIM C;  5KA6 A;  4I4T A;  2IU3 A;  3CCE V;  2UXN A;  4O4H A;  1XI1 A;  2AHZ A;  4DR2 O;  2X6A A;  3TK1 A;  4DV0 O;  4GCZ A;  4AQY O;  3VQY A;  4JI2 O;  3OGI B;  1VQK V;  4OGQ B;  4PV1 B;  3GB7 C;  4XDK A;  5JJE B;  4JAS A;  5C8Y B;  3WFV A;  3OE7 G;  5J2U A;  4B3M B;  4FK5 C;  2DWD C;  2EIL C;  1I5Y A;  3JAK B;  1JA8 A;  4HNA A;  3PN1 A;  3A0B Z;  3OTO B;  3JAT B;  1R73 A;  4JI5 B;  4AI8 A;  3KCY A;  1KD1 W;  3QG5 A;  4JV5 B;  2UXB B;  2ARH A;  2IM9 A;  5J9P C;  1VQN V;  3B2E E;  2HHH O;  1TVK A;  2EBO A;  1I94 O;  4B7E A;  3OMN B;  4DV3 B;  2ZE7 A;  2OWO A;  4Q6G A;  4MW3 A;  3JAW A;  4LF9 B;  1YHQ V;  2BCC H;  3HKE A;  1RPR A;  2UXC O;  4RQF A;  1XL4 A;  4U3F H;  5J2T A;  4GLX A;  2OTL V;  1JMK C;  2ZCE A;  3B8M A;  3E22 B;  4LWS B;  2YEV B;  1F7Y A;  2FTK A;  2EIN C;  5H6R A;  4JI3 B;  2X6C A;  4QPJ A;  4LF5 B;  4DV5 O;  4UCO A;  4H37 A;  5EBL C;  1XNR B;  4GT1 A;  1NVP B;  4U3J A;  2YDE A;  2A7W A;  4GX2 A;  4KP4 A;  1AR4 A;  1OCO C;  3ABK C;  1GKF A;  2LJ2 A;  1M4U A;  2H94 A;  1TGO A;  1UPG A;  3CD6 V;  2RN9 A;  1NS1 A;  1SZT A;  4DV1 O;  4DV5 B;  2QE7 G;  4PA4 A;  4K8Z A;  4J80 A;  2V7Q G;  1P7G A;  4DR4 O;  1AIL A;  1Y74 A;  3Q4H A;  4OPA A;  1JX9 A;  3OR7 C;  4IIJ B;  2ATK C;  2DN9 A;  1L1F A;  2LGW A;  3TXQ A;  4X65 B;  2WAM A;  1TUB A;  2YUA A;  3E83 A;  4JI1 B;  1CXZ B;  2PTM A;  1SKV A;  2WLN A;  1FKA O;  4YIP A;  1VQ8 V;  3ASO C;  3GWO A;  3R66 A;  1ZUQ A;  4UCV A;  2YIC A;  5LXT B;  4NXM B;  1NU1 H;  2YXL A;  2NR5 A;  4P2Z A;  1L0N H;  4BIU A;  3ZHS A;  1XL6 A;  3A2F A;  1QLE B;  1QU7 A;  3T1C A;  5KHK A;  4CBC A;  2WA4 A;  4JI7 B;  1VP7 A;  2RJZ A;  3AK2 A;  3D3Q A;  4FLY A;  1K4D C;  3HKB A;  4TV8 A;  3G80 A;  3DTU B;  1OHH G;  4JI5 O;  1XOU A;  1Z2G A;  1MG1 A;  4TV8 B;  3FX7 A;  4JV5 O;  2UXB O;  1PP9 H;  3UCS C;  5JCO A;  4JTD B;  4E2L A;  2EJ7 A;  4UCS A;  1M90 W;  4DV3 O;  3N2G B;  1T5E A;  2BOB C;  1M56 C;  1K97 A;  3ETD A;  5CA3 A;  3APO A;  1VMG A;  4O4J B;  3C3S A;  4UV8 A;  3SYC A;  1JVM A;  5ITZ B;  2BTQ A;  3OT7 A;  1R1B A;  4DW1 A;  5B66 Z;  2PUS A;  4ZHQ B;  3W7W A;  2UUB O;  2RCV A;  3MAQ A;  3FB7 C;  1H2K A;  1GN2 A;  4NXN O;  5B3S C;  5L3E A;  2F1M A;  1PNK A;  1I5X A;  3ZRX A;  4DR5 O;  1GN6 A;  3QO7 A;  2UU9 B;  2UUB B;  2CGO A;  4BWA A;  2QM7 A;  3LNN A;  3RN4 A;  5L3B A;  4NXN B;  3O9O A;  3OGC C;  3ZMZ A;  3ZHV A;  1HR0 O;  3FYI B;  4UXN A;  1JCH A;  4RWU A;  5F2V O;  4N21 A;  2DOS A;  1KQS U;  3ICX A;  3T2M A;  5K1P A;  2HJD A;  1TVK B;  1PL4 A;  3ZED A;  5B5E Z;  1YZB A;  2ZM6 O;  4BIZ A;  2V4D A;  2OIE A;  4W4L A;  1SF9 A;  4JI4 B;  2N04 A;  3S3W A;  3AG4 B;  4GYC B;  1SRY A;  4X65 O;  4X64 O;  5KAF Z;  4DR6 O;  1VQ5 V;  3CRQ A;  3CCS V;  2OTJ V;  4DV4 B;  4MVM A;  4O2B A;  1EBO A;  3TCU A;  4LWS A;  4HYO A;  3ZS8 C;  2HVK C;  2GUZ A;  4ZBM A;  2LW7 A;  3FD9 A;  4X1Y B;  1SC5 B;  2NN4 A;  1RPO A;  2ZIO A;  2R72 A;  2DYR B;  5E79 Z;  1IZ3 A;  4F4L A;  4GX1 A;  2R9R B;  1KU9 A;  1GM9 A;  1CEZ A;  1YIT V;  3BFR A;  1YIJ V;  4LF7 O;  1SQG A;  3ASN C;  1Q5O A;  1Q8I A;  3CHX A;  4FLW A;  5DED A;  5EBW C;  2CE4 A;  1OCZ B;  4FLX A;  3CCR V;  1S5H C;  1WP7 A;  1ROP A;  4MVQ A;  1SQV H;  3FYE B;  3ZX6 A;  3ZHT A;  3CWB H;  2P5O A;  3ABT A;  1OV9 A;  4BR6 A;  5IYZ B;  3RYF A;  2EIJ B;  2E5L O;  1NI8 A;  3CC4 V;  2EX3 A;  2ZE8 A;  1VQ7 V;  5D5P A;  3N2K B;  1KP3 A;  5DN6 G;  4LF4 B;  3RYI A;  4EKW A;  4DV6 O;  2EIN B;  2Z3Y A;  4FLZ A;  4NTY A;  1E1Q G;  5KLV H;  1XNQ O;  4XDL A;  2ADP A;  1G4Y B;  5CN0 A;  3IAY A;  2XAH A;  1WA8 B;  1XUQ A;  4X9Q A;  1S76 D;  2VQF B;  2Y0P A;  3RW0 A;  1BQZ A;  3H01 A;  5LMN O;  1G1X B;  3EFF K;  4IL6 Z;  5FNV A;  2LW1 A;  4JTA B;  1IBL O;  4B3S B;  1BL8 A;  1EN6 A;  4CC6 A;  4NYK A;  3ZCC A;  4OX9 O;  1MA1 A;  1Q90 D;  1CPY A;  2A0L A;  5EYP B;  4MW8 A;  3LNM B;  3SPI A;  1F4N A;  2HR3 A;  1MSW D;  5EYP A;  5AG2 A;  3ZHQ A;  5B1B B;  3CME V;  1F23 A;  5E1A C;  3FAV B;  3SYP A;  3ZRW B;  2AZ2 A;  4FFB B;  1S5L Z;  2PI5 A;  1SQF A;  4X1I A;  2HKO A;  4F6R A;  1FXK A;  3IGA C;  2W0F C;  1W0J G;  3H1I H;  4TSF G;  3AG2 C;  1E1R G;  3ETE A;  4X62 O;  5GTH Z;  1M57 B;  4MTG A;  1IBK O;  4DO2 A;  2P6J A;  2EZP A;  3CRC A;  2GUZ B;  4U7N A;  5LYJ B;  2QKS A;  3MHS C;  2YID A;  4FZ0 A;  5ITZ A;  4UCT A;  3H9V A;  1OCO B;  1Y6X A;  3ABK B;  1N32 O;  4YJ2 B;  4NVP A;  4LF8 O;  4U3J B;  1FAF A;  4O2A A;  1NKD A;  1HDJ A;  1NZ6 A;  2Q9L A;  4JAA A;  4UFZ A;  1JR9 A;  1S72 V;  3LUT B;  5LHG A;  3JAK A;  2QA4 V;  4J7J A;  3RYH B;  1ZX3 A;  5EIB C;  1O9G A;  1X59 A;  1U97 A;  1EFR G;  2HLD G;  4HBN A;  2P4V A;  3APQ A;  1YJ9 V;  3ZJZ A;  1KKD A;  1LUV A;  1M93 A;  4L87 A;  4JYY A;  1GO3 F;  2XAS A;  1N34 B;  2JRI A;  3UO3 A;  3EVK A;  3IC9 A;  1K9M W;  3K5O A;  4WFF A;  3ABL C;  3BHP A;  4YHH O;  5KUM A;  4DW0 A;  1HWY A;  3RYI B;  4PJ0 Z;  4LFB B;  2ZR3 A;  3OEE G;  5KMG A;  4UB8 Z;  5CA1 A;  2A79 B;  3JAW B;  3WB2 A;  1AJP A;  2HJF C;  4O2B B;  1ZAU A;  2UXX A;  3SJQ C;  3B40 A;  2YI9 A;  3ZHR A;  5LOV A;  5LMU O;  4LNU A;  1Q6I A;  3RT3 C;  5LOV B;  3ETQ A;  3ZMT A;  3H1H H;  3WG7 B;  5GON B;  3JAR B;  4MVR A;  2M7W A;  2Y0I A;  2ZXW B;  2O57 A;  3C3T A;  5KUK A;  4CH3 A;  3P30 A;  1SET A;  3RYC A;  1LNQ A;  4FM1 A;  2B5U A;  2IBZ H;  2D3O W;  3CC2 V;  4DR7 O;  1N0J A;  1OCC B;  3HKD B;  2CUG A;  1BQ0 A;  2L35 A;  4E4E A;  3CCQ V;  2QWP B;  2M6Y A;  3HB3 B;  1NH2 D;  2GV9 A;  2PYJ A;  3SPJ A;  4LFA O;  2LO1 A;  4JPR A;  4DR3 O;  1IXB A;  3JSL A;  4X88 A;  1QLE C;  5IYD O;  2XT9 A;  2UUA O;  2NNU A;  3VQX A;  4X1K B;  3UKM A;  2Q7G A;  3LDD A;  5TIS Z;  5IDJ A;  4FIP C;  4JI1 O;  5IWA O;  2HVJ C;  1WB8 A;  3K0D A;  4HNA B;  4LH7 A;  1N32 B;  4W4K A;  3H1L H;  1F51 A;  1X4T A;  4BW9 A;  4J10 A;  1YEW A;  1AI5 A;  4N23 A;  2AXT Z;  4H33 A;  3J7A U;  3EHB B;  4GZR B;  2OCC C;  1XMO O;  5LP6 C;  2HP8 A;  1OCZ C;  1D2D A;  4O4I B;  4X1I B;  5B1O A;  3HKE B;  4PA6 A;  4CZZ A;  3B09 A;  3T1Y O;  1GM7 A;  3R65 A;  2GHY A;  3JD3 A;  1GH6 A;  2UXC B;  4JAV A;  4BW5 A;  3OTF A;  5A9G A;  4X89 A;  4LFB O;  1N4C A;  4FM0 A;  3AK1 A;  2DJV A;  1OCR C;  4P9P A;  1M1K W;  2ZNJ A;  1G6U A;  1FXK C;  2P4K A;  3VBB A;  1Z5V A;  3ML0 A;  1SA0 B;  2JS3 A;  4I9Q A;  5KAI Z;  3AG7 A;  2HHH B;  4JI6 O;  5FPO A;  2H8P C;  4J42 A;  3BAB A;  2W6I G;  3N27 A;  1SER A;  2AGA A;  2ZDI A;  3JAL B;  1ZSP A;  4EB6 B;  3E2E A;  4X8A A;  2BSK A;  3RWR D;  5CBF A;  1L0L H;  1NTM H;  4EB6 A;  2F23 A;  2PI4 A;  2CTW A;  2E76 B;  1Y76 A;  1QLN A;  1US6 A;  3RYF B;  5D5Q A;  3LDE A;  2K1E A;  5EIB D;  4IT5 A;  2IJI A;  1XIL A;  4DR6 B;  2EIK C;  1R3L C;  5B1A B;  3UM7 A;  2DWE C;  2AHY A;  2ZKO A;  5H5N A;  4YY3 O;  4Z1M G;  1Q6H A;  1HNZ B;  4A5U B;  1HR0 B;  1VQM V;  3D36 A;  3G6B A;  3SDL A;  2JJ2 G;  2EIL B;  2IW5 A;  4DRX A;  1FFX A;  4LP8 A;  4WCE V;  1S3J A;  2ZXW C;  5JCO C;  5IJ9 B;  4AHC A;  4LF6 B;  1NTZ H;  1WA8 A;  4DRX B;  4DR3 B;  2QWR B;  4WBN B;  1EN5 A;  4JAU A;  2IJJ A;  4J9Y B;  1KBH A;  1B06 A;  1UJW B;  5GON A;  3C90 A;  4O4L B;  1Y66 A;  1LUW A;  4QIW F;  1YXB A;  3K9A A;  3NXS A;  1PKX A;  3SYA A;  3L72 H;  1RM1 C;  3H1K H;  1F4M A;  1SES A;  3CB2 A;  3FB8 C;  2GTA A;  1I0H A;  2WLI B;  4DUZ B;  3M99 B;  1A32 A;  1GTO A;  3ZN1 A;  2XAQ A;  2YI8 A;  4X66 B;  1I08 A;  4KHP O;  3CCL V;  3E8B A;  1GMG A;  1KP2 A;  1QHT A;  3ZIA G;  2HEP A;  2YIB A;  5BR8 B;  3NR7 A;  4FLV A;  3G67 A;  2RQ6 A;  1R3J C;  3SPH A;  4NXM O;  1VEW A;  2XAG A;  3JAS A;  2LQT A;  2YIB D;  1V55 B;  3SJB C;  4MVO A;  5BR8 O;  4OX9 B;  3JD1 A;  1VQL V;  4R7C A;  3K04 A;  3ETG A;  1ARO P;  4GX5 A;  3RVY A;  1XNQ B;  3CC7 V;  3SYO A;  3L75 H;  2IH1 C;  2X7R B;  3I55 V;  1V9P A;  2VQE O;  2C2A A;  4UVA A;  2UU9 O;  1U96 A;  5KHH A;  1KYO F;  1FFT B;  1SQP H;  3U10 A;  4X62 B;  2MK3 A;  2Q0O C;  3LSS A;  1SZX A;  3LSQ A;  2JJ1 G;  1WLE A;  4F6E A;  3QTC A;  1BSM A;  1TUB B;  2L6L A;  5CA1 B;  3BA8 A;  2P67 A;  3JSN A;  3CPW U;  1WPX A;  1FXV A;  1FFX B;  1UFI A;  4UCR A;  3OTO O;  4WFH A;  3CCJ V;  4TOI A;  1EM1 A;  1JQ0 A;  3J81 N;  3E35 A;  4X64 B;  3ZMV A;  4FMT A;  1YJN V;  4DR2 B;  2CTP A;  2FL4 A;  4RUF A;  3IFX A;  1I94 B;  4DV0 B;  2ITD C;  4H13 B;  3QO8 A;  2YIA A;  2W0X A;  3ZN0 A;  5EC1 C;  1QQC A;  1IVS A;  2BTO A;  3AG3 C;  1H2L A;  1DF5 A;  3AK3 A;  3TGU H;  2PGG A;  2RDC A;  1YF2 A;  4H0L B;  3L73 H;  3EXA A;  1MZF A;  4R8C A;  2WSS G;  1MZE A;  3CJH A;  4JI4 O;  4JI8 B;  2Q7E A;  4RUE A;  1AR1 B;  5LP6 B;  3CJH B;  2XTA A;  3PJS K;  1J95 A;  1ORQ C;  5CBH A;  1RP3 B;  1QCE A;  4TV9 B;  4F6R B;  3HKD A;  3Q4H B;  4DXW A;  1Q82 W;  3DSQ A;  2QGN A;  3P3N A;  2OT5 A;  4DK0 A;  2W6J G;  4DV7 B;  4ZOL B;  4WFA V;  3CMA V;  5LGT A;  1FS0 G;  4O4H B;  4EFB A;  3TXS A;  1ZL8 B;  3IC7 A;  4O4J A;  4G28 B;  1NR1 A;  3AG3 B;  3M8A A;  4AIL C;  4X1K A;  3AG1 C;  2FYU H;  2Q69 A;  4QPK A;  1XEQ A;  4MS2 A;  4QGP A;  2Q73 A;  2K9P A;  2MW2 B;  5GW7 A;  3ZBH A;  5IT9 N;  3QF7 A;  1P4R A;  2CH7 B;  1XNR O;  1XDC A;  1O9H A;  3OM3 B;  4CH6 A;  4I0X B;  1V55 C;  4IHJ A;  1NJI W;  4JYA B;  2Y48 A;  4JTC B;  4DYL A;  2V1D A;  1YCI A;  5H6Q A;  1HNX O;  1WPB A;  3E86 A;  4GKK B;  3BVO A;  2UUC B;  1RSO B;  4ZI7 B;  2P7T C; 
#chains in the Genus database with same CATH homology
 3WG7 B;  3ABL B;  3QNE A;  4MVR A;  4HAM A;  4RQF A;  2M7W A;  1XL4 A;  2ZXW B;  3LDC A;  5CBG A;  5KUK A;  3P30 A;  2OTL V;  1JJ2 U;  1SET A;  3B8M A;  1LNQ A;  1EZJ A;  2YEV B;  4R6Z A;  2B5U A;  1PD3 A;  4LCU C;  4QJF B;  2FTK A;  2D3O W;  2EIN C;  3CYO A;  3CC2 V;  5H6R A;  1YJW V;  2X6C A;  1R6K A;  1OCC B;  3JYC A;  4QPJ A;  3RVZ A;  3CCQ V;  1AI4 A;  3OFN G;  4H37 A;  1K7D A;  3HB3 B;  3JD4 A;  3K08 A;  5EBL C;  1NH2 D;  5FL7 G;  4GT1 A;  4J9Z B;  5DM6 V;  1NVP B;  1S77 D;  4BAY A;  3SPJ A;  1N8R W;  2DYR C;  4JPR A;  4GX2 A;  1IXM A;  4KP4 A;  3ABM B;  1OCO C;  3ABK C;  1GKF A;  4QNH B;  5LHH A;  2B1I A;  4X88 A;  1QLE C;  5IYD O;  1NR7 A;  2NNU A;  2H94 A;  3CD6 V;  1SZT A;  2QE7 G;  3W7T A;  3OMI B;  4PA4 A;  3UKM A;  3OAA G;  3LDD A;  4G2K A;  5IDJ A;  2V7Q G;  3E8G A;  4FIP C;  2HVJ C;  4MVU A;  4MVZ A;  5IYC O;  3ZMS A;  3K0D A;  1JX9 A;  3OR7 C;  1GK9 A;  3STL C;  2XND G;  2ATK C;  5IY5 B;  2JEX A;  1L1F A;  3T4D A;  3ZMU A;  3E8H A;  4PA9 A;  2EIJ C;  4QE7 A;  3I56 V;  2GSM B;  1F51 A;  2WAM A;  4GX0 A;  2WLK A;  3E83 A;  2HG5 C;  4MSW C;  4G27 B;  4P9O A;  1AI5 A;  3ASN B;  3KG2 A;  3OR6 C;  4N23 A;  4H33 A;  3EHB B;  2OCC C;  2EJR A;  2WLN A;  2ZDI C;  2WPD G;  1YSC A;  1K5S A;  1R3K C;  3ASO C;  3B77 A;  3GWO A;  1VQ8 V;  4RQE A;  1OCZ C;  4MTF A;  1RM1 B;  5B1O A;  4PA3 A;  4PA6 A;  3STZ C;  4PA7 A;  3ABU A;  1H8H G;  4P2Z A;  2DQ3 A;  5B1A C;  4CZZ A;  1GM7 A;  4BIU A;  3R65 A;  3FB6 C;  3X2Q B;  3AG2 B;  2GHY A;  4RAI A;  1QVG U;  1XL6 A;  4TWK A;  1QLE B;  3JD3 A;  2LFR A;  4JAV A;  4BW5 A;  5B3S B;  5L3F A;  2OCC B;  3T1C A;  2XOK G;  3HPL C;  4X89 A;  4CBC A;  3AEI A;  4MVS A;  2CK3 G;  1Q7Y W;  1Q81 W;  1PNL A;  1OCR C;  1YI2 V;  1K4D C;  3DTU B;  4P9P A;  3OUF A;  1OHH G;  2XAJ A;  1M1K W;  1MG1 A;  2YSU B;  3AG4 C;  4UVB A;  5EK0 A;  1FXK C;  3VBB A;  1GM8 A;  3ML0 A;  1W0K G;  1K33 A;  1K3E A;  2WLL A;  2IJK A;  5EBM C;  4JTD B;  4E2L A;  3TET A;  3P32 A;  1FXH A;  2H8P C;  1DLB A;  4FPP A;  2W6I G;  1SER A;  3K03 A;  2ZDI A;  1M90 W;  2R9I A;  4TT3 G;  1QR8 A;  2BOB C;  1M56 C;  1K97 A;  1OCR B;  3E2E A;  4X8A A;  2JDI G;  2YEV A;  5CBF A;  1DTO A;  3ETD A;  1K8A W;  5CA3 A;  4FJC C;  2Q68 A;  4MT8 A;  3F7V C;  4UV8 A;  2PI4 A;  3SYC A;  3T4Z A;  1JVM A;  5H9C A;  2IH3 C;  1QLN A;  2DYS B;  3LDE A;  1H8E G;  2K1E A;  1ENV A;  3QO5 A;  3BEH A;  2IJI A;  3W7W A;  1YTF B;  2EIK C;  1R3L C;  2ZD9 A;  5B1A B;  3UM7 A;  3B8N A;  2DWE C;  3FB7 C;  2AHY A;  1NH2 B;  4PDR A;  3OMA B;  3OUS A;  1NVP D;  3A0R A;  5BZB A;  4Z1M G;  5B3S C;  5L3E A;  3OW2 U;  1PNK A;  4XDJ A;  4PDL A;  1VQM V;  1E79 G;  1I5X A;  3D36 A;  1BHA A;  3ZRX A;  3MD0 A;  2JJ2 G;  1AI6 A;  1G8M A;  3QO7 A;  1V54 B;  2HFE C;  2EIL B;  2IJH A;  2IW5 A;  4JGS A;  4R50 A;  4UV9 A;  3CP1 A;  3SYQ A;  4LP8 A;  5LBQ A;  1S3J A;  2ZXW C;  2EIK B;  2QM7 A;  3DGE A;  4WFB V;  4WCE V;  4UUJ C;  5L3B A;  4UVC A;  4WFE A;  3CXC U;  1VQ4 V;  3OGC C;  3ZMZ A;  2X0L A;  4JAU A;  2IJJ A;  1V54 C;  4J9Y B;  1R3I C;  1QVF U;  5IYB O;  3E89 A;  3FYI B;  4UXN A;  2BOC C;  1JCH A;  3VOU A;  1UJW B;  1JPX A;  4N21 A;  1NBM G;  3W7X A;  4I5S A;  1Y66 A;  1KQS U;  4OXS A;  3T2M A;  1BMF G;  1M56 B;  4QIW F;  3K9A A;  4PDM A;  2LFS A;  1Q86 W;  3OEH G;  3NXS A;  1PKX A;  1Y4M A;  3SYA A;  1R6N A;  1AJQ A;  1RM1 C;  3ZRW A;  1F4M A;  2IU0 A;  4BIZ A;  3CCM V;  1SES A;  2JK5 C;  1W2B U;  3FB8 C;  2WLI B;  2EIM B;  3AG4 B;  1FXK B;  1SRY A;  3M99 B;  5LGU A;  1VQ5 V;  4JYB A;  5L3D A;  2JEU A;  2NLJ C;  4KUM A;  1GTO A;  2XAQ A;  3ZN1 A;  3CCS V;  4MVM A;  3TCU A;  1EBO A;  2OTJ V;  1AI7 A;  4HYO A;  2HVK C;  2X6B A;  4ZBM A;  5IY5 C;  3CCL V;  3E8B A;  1GMG A;  1KP2 A;  3JD2 A;  3ZIA G;  1RPO A;  2DW4 A;  2DYR B;  3BY6 A;  1R3J C;  3F5W C;  3SPH A;  4F4L A;  4GX1 A;  2R9R B;  1GM9 A;  1CEZ A;  2KB1 A;  1YIT V;  2Y69 B;  2WLI A;  1YIJ V;  5LHI A;  2XAG A;  2ITC C;  3ZRS A;  3ASN C;  4HZ3 A;  2WLM A;  1V55 B;  4MVO A;  5EBW C;  1OCZ B;  3CCR V;  1S5H C;  1ROP A;  4MVQ A;  1QBZ A;  3RBZ A;  3FYE B;  2WLH A;  3JD1 A;  1VQL V;  4R7C A;  3ABM C;  3K04 A;  5HFL A;  4JF3 A;  3ETG A;  3W7U A;  1ARO P;  5KA5 A;  3G4S V;  3ABT A;  4GX5 A;  3RVY A;  3E8F A;  3CC7 V;  2EIJ B;  3SPC A;  4PEL A;  3CC4 V;  3SYO A;  4ZKI A;  2QEX V;  5LGN A;  4XBF A;  2IH1 C;  2X7R B;  1VQ7 V;  3I55 V;  3ZRV A;  1KP3 A;  5DN6 G;  3ASO B;  4EKW A;  2C2A A;  2EIN B;  4UVA A;  2Z3Y A;  3X2Q C;  4RO2 A;  1M9N A;  1K34 A;  1YTF D;  1E1Q G;  1FFT B;  4XDL A;  3F7Y C;  1H2G A;  2MK3 A;  3LSS A;  1G4Y B;  5CN0 A;  1K73 W;  4QE9 A;  2XAH A;  3LSQ A;  2JJ1 G;  1JOY A;  2P90 A;  1S76 D;  3AG1 B;  1WLE A;  2Q67 A;  3RW0 A;  2JIZ G;  3H01 A;  3JCZ A;  5HFM A;  4WFG A;  3EFF K;  4I9W A;  3SPG A;  2P67 A;  4WF9 V;  1MOF A;  3CPW U;  1WPX A;  4JTA B;  3JD0 A;  1FXV A;  2XAF A;  2QTO A;  1BL8 A;  4WFH A;  5C93 A;  1COW G;  4P30 A;  3CCJ V;  3ZCC A;  3K3W A;  1JQ0 A;  1CPY A;  2EZO A;  3FKS G;  2A0L A;  5EC2 C;  3E35 A;  4MW8 A;  1K4C C;  1P7B A;  3LNM B;  2A9H A;  3ZMV A;  4FMT A;  1YJN V;  3SPI A;  1F4N A;  2HR3 A;  4JYC A;  5B1B C;  3G71 V;  4RUF A;  3IFX A;  3CCV V;  1MSW D;  4LBE C;  2ITD C;  2LP7 A;  5B1B B;  3CME V;  3QO8 A;  1F23 A;  5E1A C;  1NQT A;  4PDV A;  3SYP A;  3FB5 C;  2ZQM A;  3ZRW B;  1S0V A;  3ZN0 A;  4Q20 A;  5EC1 C;  2PI5 A;  2HKO A;  3K06 A;  3AG3 C;  1FXK A;  2F43 G;  2WLL B;  1TUE B;  3IGA C;  2W0F C;  1DF5 A;  1W0J G;  4TSF G;  4ASU G;  3AG2 C;  1E1R G;  3ETE A;  1M57 B;  1H38 A;  4MTG A;  4DO2 A;  4R8C A;  2WSS G;  2P6J A;  2EZP A;  2ZR2 A;  4MTO A;  3K79 A;  4U7N A;  2QKS A;  3MHS C;  1VQ6 V;  3CCU V;  4RUE A;  1KC8 W;  3WG7 C;  1AR1 B;  3MHH C;  1OCO B;  1J95 A;  1ORQ C;  3ABK B;  3PJS K;  5CBH A;  1BHB A;  1QCE A;  3D3I A;  1MAB G;  1NKD A;  2EIM C;  1VQP V;  5KA6 A;  4DXW A;  5L3C A;  1Q82 W;  2B1G A;  2WLJ A;  4U7O A;  2IU3 A;  3CCE V;  2OT5 A;  5L3G A;  1S72 V;  2UXN A;  3LUT B;  5LHG A;  2QA4 V;  2W6J G;  1K5Q A;  2AHZ A;  4WFA V;  2Q6A A;  2X6A A;  3TK1 A;  3CMA V;  5LGT A;  1FS0 G;  1M57 C;  1EFR G;  3G6E V;  2HLD G;  2WWW A;  1YJ9 V;  3IC7 A;  4GCZ A;  3ZJZ A;  1KKD A;  4L87 A;  1GO3 F;  2XAS A;  4G28 B;  1NR1 A;  3AG3 B;  1VQK V;  2QM8 A;  3AG1 C;  1K9M W;  4WFF A;  2Q69 A;  4KFM A;  4QPK A;  3GB7 C;  3ABL C;  4XDK A;  5KUM A;  4JAS A;  1HWY A;  3WFV A;  3OE7 G;  2ZR3 A;  4MS2 A;  3OEE G;  4FK5 C;  1QR9 A;  2DWD C;  3W7S A;  2EIL C;  1I5Y A;  5GW7 A;  1AJN A;  1ZWI C;  2A79 B;  3K0G A;  1P4R A;  1AJP A;  2Y69 C;  5B1N A;  3OM3 B;  2HJF C;  1R73 A;  1OZ0 A;  2UXX A;  3SJQ C;  1KD1 W;  1V55 C;  4LC1 A;  5J9P C;  1NJI W;  1OCC C;  1VQN V;  2Z5U A;  2Y48 A;  1CP9 A;  4JTC B;  5CMU A;  1THZ A;  2EBO A;  2DQ0 A;  1VQO V;  1DF4 A;  2V1D A;  3OMN B;  5H6Q A;  1K92 A;  2DYS C;  1PL0 A;  3E86 A;  4YXW G;  3ZMT A;  1VQ9 V;  1PNM A;  4MTX A;  1KEC A;  2P7T C;  1B6Q A;  4MW3 A;  1YHQ V;  1RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...