4QNHB

Calcium-calmodulin (t79d) complexed with the calmodulin binding domain from a small conductance potassium channel sk2-a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective phosphorylation modulates the PIP2 sensitivity of the CaM-SK channel complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ion transport/protein binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qnhB00
2W0FC 3OR6C 4GX1A 4QNHB 3LDCA 1R3JC 4JTCB 4HYOA 4RUEA 5CBHA 3OGCC 1R3KC 3ASNC 4LCUC 3STZC 3SYPA 2AHZA 4PDRA 4WFGA 2EILC 2WLIB 3T4DA 3T2MA 4BW5A 3K0GA 4WFHA 4EKWA 3UM7A 3ZJZA 2IH3C 3ABMC 3LDDA 4R6ZA 5EC1C 3GB7C 1J95A 3OR7C 3AG3C 2R9RB 4G27B 3SPCA 5J9PC 3PJSK 5CBFA 3FB8C 2ZD9A 3STLC 2X6BA 4MVZA 3E8BA 3KG2A 2A9HA 3AG2C 1P7BA 3FB6C 4GX2A 4MTFA 4MVMA 2WLKA 3E8FA 3F5WC 2X6AA 1R3LC 2EIJC 2ITCC 3OUSA 1OCCC 4MVUA 4PA4A 3ABLC 4KFMA 4XDLA 4P9PA 2WLLB 3IGAC 2DYRC 2OCCC 3HPLC 2YEVA 1OCZC 5IY5C 4PA9A 4H37A 1K4DC 3SYAA 3E86A 4MW3A 4I9WA 5EK0A 3RBZA 3JYCA 3K03A 5EBWC 1G4YB 4X89A 3F7YC 4X88A 3RW0A 4PDMA 1KKDA 4F4LA 3LUTB 4LP8A 2QTOA 2WLIA 2IH1C 5B1BC 1BL8A 4PA3A 3E8HA 5B1AC 2WLJA 3TETA 1XL4A 3E8GA 3X2QC 3SPHA 4PDLA 3OUFA 5CBGA 4XDKA 1ZWIC 4PA6A 2P7TC 2EIMC 3SYOA 2NLJC 4P9OA 1LNQA 2ATKC 3SPJA 2DWDC 1R3IC 2HVKC 4WFFA 2Q68A 4G28B 4JTDB 4XDJA 3F7VC 3RVZA 4ZBMA 1ORQC 3FB5C 1M56C 4CBCA 4R50A 1XL6A 3AG1C 3R65A 4WFEA 4MSWC 5KUKA 4P30A 3UKMA 4MVQA 4RAIA 4QE9A 3K06A 1V55C 2JK5C 2A79B 3T1CA 3LDEA 2H8PC 4OXSA 4RUFA 4QE7A 4UUJC 5E1AC 2ITDC 2Q67A 5EBLC 3WG7C 2BOCC 4R8CA 3ABKC 2DWEC 4TWKA 3RVYA 2BOBC 4MS2A 4MVRA 4X8AA 3K04A 2ZXWC 3BEHA 5BZBA 2AHYA 2WLMA 2WLNA 2HG5C 3LNMB 3SYQA 2QKSA 1V54C 5EC2C 5KUMA 3TCUA 4MTOA 2Q69A 1S5HC 4GX0A 1QLEC 2DYSC 2KB1A 3E83A 3E89A 3ASOC 2HJFC 3IFXA 3EFFK 3FB7C 4J9YB 4MVOA 2WLHA 2EIKC 3SPGA 3SPIA 3VOUA 2HVJC 1K4CC 1JVMA 4MW8A 3ZRSA 2K1EA 1M57C 4RO2A 4HZ3A 1OCOC 3K08A 3T4ZA 4H33A 4J9ZB 4LBEC 1OCRC 4PA7A 3AG4C 4JTAB 4MVSA 4GX5A 4MTGA 3SYCA 4DXWA 2X6CA 2EINC 5EBMC 2A0LA 2Q6AA 2Y69C 3K0DA 3SJQC 4P2ZA 4R7CA 4PDVA 2HFEC 5B3SC 2WLLA
chains in the Genus database with same CATH superfamily
4NKGB 3ZMVA 4DV4O 1YTFB 2CK3G 1VQ6V 2JGDB 5H9CA 1BCCH 2PGGA 5JJNB 2JIZG 4JPRA 1AI7A 4DW1A 1CEZA 4BIZA 4R6ZA 1GMGA 1OHHG 2HEPA 4DV4B 3FYIB 4PHZA 2FYUH 2F1MA 5DEDA 1IX9A 2A9HA 4GX2A 1FJGB 2X6AA 3U11A 2RCVA 3IGAC 3OGIB 1Q3EA 5H6QA 4JI4O 5KMGB 4H37A 5BY1A 2Q0OC 1LR1A 4EB6B 1H2NA 2YI9A 5LMUB 1KYOF 3ABKB 4X88A 3SJAC 2IJIA 1KKDA 2CTWA 5EIBC 1P84F 1HNZO 4JI6B 1BMFG 2YXYA 4LFBO 2JS5A 2P7TC 2ZR3A 5L3CA 3SYOA 1KB9F 2UUAO 3SPJA 3H1JH 1Q6UA 4QGPA 4CS4A 4LFCO 1JFFA 4XDJA 2EJRA 1H2LA 1LUWA 4D7TA 2QGNA 3FKSG 5TISZ 3VQYA 4QIWF 5CA3A 3RYHA 3T1HB 4LF6B 3AG3B 1N36B 3DSQA 4WCEV 2UXNA 4WFAV 2Z3YA 1XNRO 1QHTA 5L3DA 1XBLA 3J81N 2P67A 1PV0A 2QM7A 3CJHA 2MK3A 4PJ0Z 2GSMB 2UUAB 3L9DA 4MTOA 1L8DA 3ZMSA 1QLEC 2YS8A 2XNDG 3CCSV 1FAFA 1L0LH 5C93A 1QCEA 2AXTZ 4GUNA 4EFEA 4AHCA 4LH7A 4DR5B 3W7TA 4MVSA 2VWJA 3ZEDA 5IE9A 4IYIA 1UJWB 4X20B 4HNAA 4YJ3B 3SJQC 4NVPA 3OR6C 5CA1B 3E2EA 3CEIA 4LF5B 1VQ4V 1RP3B 3UM7A 3ABMC 1O9HA 2QEXV 3B2EE 4JI8B 1SQFA 2XAFA 2LFSA 1T5EA 2CGOA 1A32A 4JF3A 4N23A 3AG2C 1IDSA 1AB3A 3ZCCA 1TUBB 2FMLA 1Q43A 1K4DC 2PI5A 3RYHB 4I9WA 5JJJB 1KP2A 4UXNA 3AG1B 5J2UB 3RW0A 4PDMA 3JALB 1SERA 2KQXA 1P4RA 2RNBA 2IH1C 5JCOA 2XAJA 3AG2B 2ZNIA 2JEXA 2BE3A 4JI0O 3OM3B 2Q5ZA 1ZWIC 2UU9O 4YY3O 4J80A 3UQ8A 4C7UA 3JSLA 1BHAA 2VQFO 3UKMA 1VQOV 4X1IA 1FFXB 1JR9A 2Q67A 5LYJA 5B66Z 3ABKC 5B1NA 3RVYA 3I56V 5JJEB 3BHPA 4H13B 2WLNA 4K0KB 4FM1A 3JCZA 5EC2C 4LF8B 1JCHA 2Q69A 4YHHO 3WB2A 5D5PA 3IFXA 1NBMG 1N34B 1EN6A 5KHIA 5IWAB 2P4KA 3FD9A 3OFNG 4TV8A 3HKEA 2E5LO 2VWKA 4L87A 2DN9A 2RJZA 4J9ZB 1XMOB 1BT8A 2Y69C 3FX7A 4H0LB 2KG7A 1L1FA 3J80N 3HKDB 4JI7B 3OMAB 3OMNB 3K58A 1VP7A 2UXXA 4U3JB 4DR7B 3OGCC 2N74A 4K35A 4U3JA 1VQ7V 1Y66A 3BVOA 4WFGA 2QWPB 1Y6XA 5LA6B 4G27B 3AG3C 1IXMA 3PJSK 3FAVA 2DJVA 4O4LA 2X6BA 2ZDIA 1YJNV 5CB4A 5B5EZ 2F23A 5CB4B 4PA4A 1VF6A 1SETA 1M4UA 2WLLB 2XTAA 1Y76B 3P32A 1N36O 1DK1A 1FJGO 2CTQA 1VARA 3ETGA 2F4VB 1AJNA 1G4YB 4X89A 1R6TA 1GM9A 1XMQB 4F4LA 1H2MA 2UUBB 4IGGA 2JEUA 2DQ3A 2E75B 5J2TA 1FPOA 4HNAB 4B7KA 1RFYA 4JTDB 3G80A 1XOUA 4O4IA 2IU0A 4RQFA 4QE9A 2A79B 3LDEA 4X65B 2QSAA 4E4EA 4J42A 5K1PA 3CCLV 5LHIA 3BAAA 1AI6A 3DTUB 1Q8IA 2ZDIC 1BGYH 3K04A 1GAXA 1YITV 2FTKA 3LNMB 1SA0B 1H2GA 1QU7A 1XI1A 4GX0A 2AW9A 4X62O 1TUBA 2E74B 5IT9N 3G6EV 4LF9O 2ZT9B 1COWG 3CCEV 4DV2O 1BE3H 2DMXA 2IJHA 2ARHA 3UO2A 1NTZH 1FXKB 1MA1A 4JTCB 4RUEA 3ZS8C 1URFA 1WNSA 3RYIB 1THZA 4LCUC 3LSSA 4LF7B 2UXCO 3RN4A 1NZ6A 5IYBO 3T2MA 2PUSA 1Q82W 1XILA 1AROP 1ZUQA 2NN4A 5EC1C 1NTKH 4EB6A 3G6BA 4FJCC 3G67A 3K79A 1GM7A 3JATB 2CE4A 2LJ2A 4WBNB 4LF4O 4JASA 4LFAO 1QR8A 2EIMB 4NYKA 4LF8O 4PA9A 1HW7A 1BS3A 4B3MO 2ZCEA 1HR0B 2E5LB 1GTOA 3TGUH 1N4CA 5LMNO 3PN1A 2WLJA 4I7ZB 1YVWA 2DOSA 2Q7HA 1FXVA 4XDKA 1FFTB 5KLVH 2EIMC 5LXTA 1NJIW 4IYHA 4O2AA 2YI8A 4CH6A 4WFFA 1X59A 2OCHA 1K7DA 4R50A 2ZR2A 5B1OA 2A7WA 2IJJA 5LXTB 1TGOA 3O9OA 3RGBA 5LHGA 4B7EA 2XAHA 2XAGA 3L73H 4DO2A 1IBLB 1YTFD 1K33A 1NH2D 2HP8A 3H1HH 5KAFZ 5KUMA 3TCUA 1QLEB 1GM8A 1I5XA 3APOA 4LFCB 4UV8A 2QM4A 2GUZB 2D3OW 1GN3A 3OEEG 5BR8O 1K4CC 3H1LH 1SRYA 3CPWU 4FLWA 3ZMTA 3M8AA 1NU1H 4D6TH 4UVAA 3FYEB 4PELA 1ZL8B 1TUEB 1HNXO 4UCUA 1FYJA 2JS3A 5B3SC 2M7WA 1Q7YW 1Z2GA 3CRAA 3JASA 1HNWB 5KHJA 2UUBO 2DE0X 3QO8A 4IT5A 2DYSB 3ZJZA 3A0BZ 4D7SA 5IYDO 3P3NA 1W0JG 3OUSA 1QQCA 4TV9B 3T1HO 2QR4A 4KXRA 3JD4A 1SA0A 1N34O 3RT3C 4GLXA 4GKJB 4ZI7B 1ZSPA 1VQ8V 5B1AC 1XL4A 4DV2B 1XUQA 2QWNB 1IBMO 1G1XB 2P6JA 2A06H 2ZXWB 4ZOLB 4CBCA 1M56C 1MZFA 1XL6A 4J11A 2C2AA 3HKBA 4EEQA 4QPJA 5KMGA 3Q4HA 4GKKB 3W7WA 2QWRB 2JGUA 4ZKIA 2BOBC 2N05A 2HR3A 2ZXWC 1FD9A 1VQMV 5H2FZ 3DGEA 1S77D 1IBKB 4JAAA 3O65A 3J7AU 3BY6A 4YJ2A 2CGNA 3ZRSA 1K97A 2K1EA 2OT5A 4PA7A 3JATA 4UFZA 4DXWA 5KA5A 4NB5A 1HP8A 1JQ0A 1TAEA 2RMKB 4PD4F 4JI4B 1F4NA 4KL1A 3N2GA 1Q86W 3LNNA 4KHPB 1M5IA 1NI8A 5GONA 1FXKA 4JI0B 1SQQH 1B6QA 4Z2WA 2VS0A 1N0JA 3OT7A 2YEVB 5IYZA 1QR9A 3HR0A 3SGIA 3FB6C 1WB8A 2WWWA 4NTXA 4NTYA 5DM6V 5C8YA 1S0VA 2LQTA 5E79Z 2VQEB 2V1DA 1SC5B 3K03A 4UCVA 2E3CA 5LGUA 2L35A 5LA6A 5KHKA 3ZRXA 1YXBA 4Q6GA 4DUYB 3ZBHA 4DR1O 1BL8A 4PA3A 2CH7A 4YXWG 1CXZB 3ETDA 4UVCA 3E8GA 5KHHA 5LGNA 4PA6A 3BFRA 3FFQA 4X1IB 2KG7B 1EBOA 2ATKC 2DWDC 4O4IB 1EZVH 1VQNV 2JJ1G 1PP9H 3HKEB 1QBZA 4FM2A 3K3WA 4FK5C 4UUJC 1BSMA 2P22C 1EN4A 3HKBB 5KAIZ 4CS3A 3DC5A 2WLMA 4DUZB 3LSQA 5FL7G 2QKSA 4UV9A 4QPKA 1XREA 1NVPB 1DGSA 2QM8A 3N2KB 2EIKC 2M6YA 4LC1A 3CWBH 4B3MB 1KBHA 2V7QG 2GHYA 3AG4C 1WP7A 2ZE5A 1AJQA 5GONB 2Q73A 2IU3A 1IZ3A 3ZN0A 1SQXH 3QF7A 4FLUA 2OIEA 4PDRA 3ZRWA 4X62B 3D8CA 4WFHA 2VQFB 1K3EA 4DV1O 1DTOA 5CBFA 3OW2U 1M90W 3STLC 1ZTEA 4TOIA 3K5NA 2QTSA 1MSWD 1N8RW 1Y74B 2PF4E 4X1YA 1OCZB 2RQ6A 5IY5B 4MVMA 2QE7G 2GBOA 1SQVH 4XBFA 4Q20A 3OTOB 2HLDG 4JYBA 4P9PA 2LGWA 2GTAA 4X65O 3SYAA 4H44B 3ML0A 3UT5A 5EBWC 3TK1A 2EZPA 5EZYB 4FLXA 2KKWA 3P3PA 3U10A 3TJTA 4IIJB 1RM1C 4LP8A 3E8HA 5CBGA 3CCVV 2QWQB 1EN5A 1ORQC 4K8XA 4MSWC 1S3JA 2Q9LA 4TUYA 2H8PC 2K9PA 3BCCH 4O4JB 1K5QA 1MABG 2Y69B 5EIBD 3SJCC 2YDEA 4O4JA 2BTQA 1MOFA 1HR0O 1I5YA 4X64O 3NXSA 2JDIG 3SYQA 4OX9B 1KMIZ 5JVDB 4YIPA 2KB1A 3E89A 1H2SB 4NTWA 3BPZA 4JI1O 5FNVA 3BRCA 3CCJV 5ITZB 2AZ2A 1M9NA 1E1QG 4MW8A 4RO2A 2F93B 4O2BA 1E79G 4U3FH 3WFVA 4DK1A 2H94A 1JFFB 3ZMUA 3CC4V 4PDVA 2IBZH 4FVMA 3AG4B 1XNRB 3JD3A 1WAZA 4L8JA 3DXRB 1F23A 2WLIB 4GT1A 3W7SA 5JVDA 2IH3C 3ZHVA 3SPCA 3ZHTA 4UB8Z 2EBOA 2DW4A 1KD1W 5KA6A 1NKDA 4MVZA 1P7BA 2YUAA 3CCQV 4MTFA 3CMAV 4IHJA 2HKOA 3ETQA 2EIJC 2LO1A 1JX9A 3C90A 4AQYB 4NXNB 1OCZC 5IY5C 4LF6O 5BMVA 3F7YC 3CJHB 3SR2C 1JJOA 4OGQB 3LUTB 1NH2B 4FZ0A 1JMKC 3JAMN 2JGDA 2UXDO 4PDLA 1U97A 4BR6A 3CRCA 3A0RA 1ROPA 3KCXA 3OD4A 3BABA 1KUQA 2HJDA 5CN0A 2PTMA 1AI5A 3AG1C 3OTOO 4P30A 4FM0A 1DF5A 4J7JA 2UUCO 2LFRA 4BIUA 3CE2A 1NQTA 4YIOA 4W4LA 1AP6A 3C3TA 3A0HZ 3CS5A 4BAYA 1I94O 1NT2B 4DV0B 3SPIA 2HVJC 1HDJA 1RPRA 1MZEA 4HZ3A 3UCSC 1WLEA 5LP6B 4LBEC 5EZYA 3L74H 4P2ZA 4R7CA 2A3QA 1VQ5V 3K9AA 4FLYA 4QNHB 4HYOA 5CBHA 5H5NA 4O4HA 4OX9O 1WA8B 1JJ2U 3STZC 3SYPA 5LOVA 5CA0B 4RWUA 4NXMB 4CH4A 4FLVA 3LDDA 1QLNA 3FAVB 2R9RB 3OMIB 1Q5OA 3OAAG 1N0NA 5IWAO 3JARA 1PNLA 3RYCA 1HWYA 4YY3B 3K57A 4K8ZA 2X7RB 2L6LA 4CC6A 1XMOO 4EFBA 2W6JG 5KHGA 1AR5A 3VQVA 1GKFA 1I94B 3L72H 5CMUA 4Z1VA 4OPAA 3JCUZ 4DR7O 2ZE6A 1YEWA 5LOVB 2W6IG 4I0XA 3D3IA 1CP9A 4K3AA 2ZINA 3ABTA 3SPHA 4B3SO 1YJ9V 2ZIMA 2QWOB 4B3TO 4I50A 2Z5UA 1W0KG 5HFMA 4G2KA 3CB2A 3FB5C 3VQXA 1R1BA 4IL6Z 2CTPA 1CPYA 5IJ9B 4X1KB 3CCUV 3BA8A 2ITDC 5D5QA 2BOCC 3ABLB 1K92A 2BSKA 1VMGA 2Q0AA 3U0ZA 4X8AA 2ILMA 2UXDB 2AGAA 2EIJB 1MMMA 4F6RA 3OTFA 1E1RG 2ETNA 3ZX6A 5H6RA 3CC2V 1BZKA 4LWSA 4B3TB 1GRJA 2DYSC 3L75H 4MVOA 3H9VA 5A2QN 1F4MA 1WA8A 2WLHA 3CHXA 3SPGA 5DN6G 1HNXB 1ZX3A 2QDOA 4PI0A 3WB1A 3VQWA 1WPBA 5J2UA 2VRZA 2X6CA 5BXZA 3WU2Z 2Y4UA 5KX5B 3CRMA 1N32O 3S3XA 2XUMA 1WB7A 4DR6O 2FKXA 3T4DA 1F7YA 4BW5A 3K59A 3GB7C 3M7MX 1VF7A 3OR7C 2R9IA 2QA4V 2WAMA 1VQKV 4UCTA 2QKAA 2CTRA 3E22B 3EVKA 3ZHQA 1NR1A 2ADPA 4YJ3A 3A2FA 2UXBB 4UB6Z 4B3RB 2Q8VA 4Z1MG 2QTOA 2WLIA 5B1BC 3IC9A 4I50B 4JI5O 1NS1A 3IC7A 4B3RO 3RYFB 4E2LA 1NVPD 1VF5B 3MD0A 1BQZA 1Q81W 2G38A 1DF4A 4JI5B 1YCIA 4O2BB 4I55B 1R6NA 5HFLA 2YIBD 1V55C 2UXBO 3K9SA 2WA3A 2VQEO 2IM9A 5FPRA 3ABMB 1RSOA 4DRXA 1XHXA 2NR5A 4HAMA 3SDLA 3HKCB 5LMUO 1B3QA 5EYPB 3CSXA 2OCCB 1VQPV 3B8MA 5BZBA 1EZJA 4DYLA 1V54C 5JH7A 2HJFC 1S5LZ 3QVNA 3DXRA 2P4VA 2EZOA 4DR2O 3APQA 3K08A 4DV3O 4H33A 3B40A 4TQDA 1UFIA 1ZL8A 2A0LA 1Q6IA 1M93A 3D36A 4JAVA 3G4SV 3AK3A 1IBLO 4U7NA 5FPOA 5JQGA 3CRRA 3K5MA 2OTJV 1KECA 4JYCA 3JAKB 3JAWB 4IIJA 2GUZA 2ZNJA 5GTIZ 3CRQA 4LR3A 4I9QA 2ZD9A 3E22A 4CH5A 3THOA 2WSSG 4OPHA 3WG7B 4JI2O 2WLKA 1OCCC 2YIDA 2DYRC 3ETEA 2DYRB 1GN6A 2XAQA 1I0HA 1K34A 1M1KW 1IURA 4JGSA 3JAWA 1KC8W 5ITZA 1GN4A 4X66O 1WPXA 1YJWV 2ZQMA 1R3IC 2R72A 1HNWO 2YIBA 4ZHQB 4LF9B 4MVQA 2XASA 1KU9A 1MSDA 4JI3O 4R8CA 1TVKA 3JSNA 2P06A 4TWKA 1PD3A 1TA8A 2AHYA 2Y0PA 4F6RB 2EIKB 4N21A 1WJZA 2R70A 4LFAB 1PL4A 2ZM6O 2Y4TA 3E83A 3CYOA 2Y48A 4DW0A 3ZRWB 2EULA 2F66C 3VOUA 3ZHUA 3SJBC 1WN7A 2Y0IA 3RYIA 1BQ0A 2JJ2G 4A5UB 1XHZA 5JQGB 4MTGA 1N33B 3B77A 3W7XA 4DV0O 4MTXA 3UT5B 1M57B 3ASNB 1W2BU 2UXCB 2FB5A 2W0XA 2ZIOA 2WLLA 3T1YB 4GX1A 3AK2A 4GCZA 3ZHSA 4DV6O 5FNVB 3K0GA 4EKWA 4J7ZA 3A8TA 2QJ1A 2XHBA 5LBQA 2LP7A 3F5TA 2UUCB 5J9PC 1EFRG 1ZAUA 5IJ0B 4DR2B 3QTCA 3E8BA 3KG2A 4FFBB 4FFKA 4UCRA 2X0LA 5AG2A 3CP1A 5LP6C 4W4KA 4DV7O 2H3OA 4I55A 2PZSA 1S5JA 4TV8B 3TETA 4CH3A 3X2QC 2OTLV 3EHBB 5KX5A 2NLJC 4JZGA 1PNKA 2Q68A 4G28B 3F7VC 1SESA 3HB3B 4LF7O 1OZ0A 5KUKA 3W7UA 1ZLZA 2Q7EA 2PYLA 3DC6A 1UPGA 2F43G 1JPXA 5EBLC 1AVMA 1SQGA 4MS2A 2EILB 4WF9V 1OCRB 5F2VO 1YHQV 3AK1A 4O4LB 4BIOA 2CDYA 4UCSA 2IJKA 1VEWA 2B5UA 3MHHC 1S76D 1XQ8A 2FL4A 5J2TB 3ZHRA 1YDXA 5IYCO 4DUYO 4YHHB 1Q6HA 5L3BA 4JTAB 5EBMC 2Q6AA 4JI2B 4JI1B 2ZKOA 4FZ1A 4DR6B 2R9AA 1GN2A 3H1IH 2W0FC 3D36C 4TSFG 1H8HG 2Z0AA 1X4TA 4JYAB 3QG5A 1PL0A 4YJ2B 1YF2A 4ZI7A 1HNZB 3CX5F 1IXBA 5BMVB 4LWSB 1Y4MA 3K5LA 1G8MA 1H2KA 3L70H 4PV1B 1B06A 2AZ0A 1IVSA 3GVMA 3RFRA 3ABLC 4FFBA 3JARB 2OCCC 3HKDA 2JRIA 4MW3A 4X20A 5EK0A 3RBZA 2DQ0A 3JYCA 4KUMA 1OCCB 3VBBA 3CD6V 1H38A 2GTSA 3MHSC 1RPOA 1N33O 3OUFA 3UO3A 3B8NA 2B1IA 4F6EA 1VIBA 4CZZA 3JD1A 1AILA 1K8AW 3MDSA 1GO3F 3QNEA 1I7FA 1XNQB 2IW5A 1L0NH 4DR4B 5B1BB 4X9QA 1YSCA 4OXSA 4RUFA 4QE7A 4TV9A 2RN9A 5C8YB 1IBKO 3T1YO 1P49A 4DV6B 1VQ9V 1K9MW 4QJFB 5IYZB 1GK9A 3CMEV 3ZMZA 1P7GA 1SS3A 2BTQB 2WA4A 3EFFK 3CXHF 1AP5A 5CA0A 2OWOA 1F51A 4GZRB 1M57C 2ADQB 2ZM6B 5CA1A 3JALA 2EINC 4ABMA 1R73A 3K0DA 1IBMB 1JOYA 4NXMO 2HFEC 4X64B 3CC7V 1V55B 5FLXN 1R3KC 4J41A 1H8EG 5LMNB 1B04A 3I5DA 4ASUG 3S3WA 2OYQA 2UU9B 2KSDA 1YZBA 3B09A 3MAQA 1U96A 4FLTA 5LHHA 4K0KO 4WBNA 1JA8A 3EXAA 3F5WC 1PNMA 5JH7B 1OCOB 1D5NA 1R6KA 1K5SA 3CXCU 2YXLA 3X2QB 4PI2A 3KZIZ 1EM1A 3ZRVA 4ZOLA 4FPPA 5EYPA 4RQEA 2P90A 4JV5B 1TVKB 2O57A 4DV5O 1RSOB 4DRXB 2YSUB 3H01A 2V4DA 4P9OA 4U7OA 2JVDA 4X66B 4ZHQA 3WB0A 3NR7A 2XT9A 4KHPO 4TQFA 4LF5O 5L3GA 5BR8B 4J7KA 4BWAA 4DV1B 5E1AC 4I4TA 3WG7C 3QO7A 2LW7A 2DWEC 1AR1B 1KKCA 5LL6Y 4MVRA 4BW9A 3GWOA 2ZE8A 3ASOB 3BEHA 1KP3A 1YIJV 2N04A 4DV5B 4JYAO 4UVBA 1XDCA 1SQBH 1S5HC 2F4VO 1US6A 4DV7B 4TUYB 3JASB 1JVMA 3B4SA 4ZIBA 1Y74A 1SF9A 3LSUA 1J5EO 4AQYO 4NXNO 2YIAA 4LH6A 3GWKC 2NNUA 4GX5A 5GTHZ 5B3SB 2WPDG 3JAKA 4JI8O 4UCOA 1SKVA 4GKJO 1OJHA 3I55V 1RM1B 2MW2B 2YXHA 2F95B 4CC5A 4JYYA 3QO5A 3OE7G 1QNMA 2YC0A 1Y76A 4LNUA 3ICXA 5B1AB 2GV9A 4DR3B 4DUZO 1VQLV 1QVFU 3M99B 1AR4A 3E8FA 1GH6A 3AEIA 4MVUA 4X1YB 1QVGU 2GDSA 4KFMA 4XDLA 3N2KA 2P5OA 4GKKO 4DR3O 3CCRV 2EX3A 4LFBB 4O2AB 4DR5O 4TT3G 3HKCA 2E76B 4FLZA 3ZIAG 5DECA 3L71H 1D5AA 3AG7A 1S72V 1O9GA 1Z5VA 4X1KA 2BCCH 4JI7O 1LNQA 1FS0G 1N32B 4MT8A 1OV9A 1D2DA 4WFEA 1BHBA 3T1CA 1G6UA 3ZN1A 1MNGA 3RYFA 1NR7A 1XNQO 2HHHO 2ZE7A 4I0XB 2CH7B 1V54B 1XMQO 3KCYA 2QKCA 5IDJA 4JV5O 4FMTA 2HG5C 1W59A 1ENVA 2BSKB 2Q7GA 3FB7C 2XOKG 1Z5WA 1FFXA 2RDCA 1PPJH 5IJ9A 3G71V 3C3SA 3TXSA 4JI6O 2EJ7A 3T4ZA 1OCRC 4DR1B 3R66A 2LGQA 3JD0A 3SYCA 4B3SB 2LW1A 1LUVA 2D2CB 3JD2A 3KKYA 2Q4PA 3LDCA 1R3JC 1FKAO 5L3FA 3E35A 3ASNC 2EINB 3OEHG 2AHZA 2EILC 5JCOC 1WP8A 4DR4O 3N2GB 1J95A 4KP4A 2HHHB 3FB8C 5JWPA 1AJPA 2PY5A 1V9PA 4J10A 5GW7A 1KQSU 3IJ4A 3ABUA 4FIPC 1R3LC 2ITCC 4DK0A 3CCMV 3RYCB 2B9ZA 3HPLC 2YEVA 3E86A 4WFBV 1SZXA 2YICA 5L3EA 1Y67A 2PYJA 5A9GA 4O4HB 3K5OA 3RWRD 2HVKC 3RVZA 4HBNA 1PKXA 4ZBMA 4JI3B 2OIGA 2B1GA 3H1KH 3R65A 1MG1A 5LP6A 3N27A 4LF4B 1NTMH 4AILC 3IAYA 4RAIA 4I5SA 3K06A 2JK5C 4ICGA 1M56B 3BA9A 2CAZC 4GYCB 5LYJB 4I4TB 1J5EB 3P30A 4NR1A 1PM9A 1VF6C 4LNUB 2PI4A 1XEQA 3TXQA 4JAUA 3D3QA 1YI2V 4JZ2A 1FXKC 1K73W 4DV3B 4AI8A 2ODMA 3ASOC 4J9YB 1I08A 3Q4HB 4IHJB 1OCOC 2CUGA 4CS2A 5LGTA 1Q90D 1AI4A 1SQPH 5IJ0A 5K1XA 4B08A 1FXHA 1DLBA 2BTOA 1SZTA
chains in the Genus database with same CATH topology
2W0FC 4QNHB 3ZMVA 4HYOA 1YTFB 2M7WA 5CBHA 1Q7YW 2CK3G 1H8HG 4TSFG 1VQ6V 5H9CA 1PL0A 1JJ2U 3STZC 3SYPA 2JIZG 4JPRA 1AI7A 3QO8A 1CEZA 2DYSB 4BIZA 3ZJZA 4R6ZA 3LDDA 1GMGA 1OHHG 1QLNA 2R9RB 3FYIB 1Y4MA 3OMIB 3OAAG 1PNLA 5IYDO 1HWYA 1G8MA 2A9HA 4GX2A 1W0JG 2X7RB 2X6AA 3OUSA 3ABLC 2W6JG 3IGAC 2OCCC 5H6QA 1GKFA 4H37A 3JD4A 4MW3A 5EK0A 5CMUA 3RBZA 2DQ0A 3JYCA 3ABKB 4X88A 4KUMA 1OCCB 2IJIA 3VBBA 3CD6V 1KKDA 1H38A 1VQ8V 2W6IG 5B1AC 1XL4A 3MHSC 1RPOA 1BMFG 3D3IA 1CP9A 3SPHA 3ABTA 3OUFA 1YJ9V 3B8NA 2B1IA 2P7TC 2ZR3A 5L3CA 3SYOA 2P6JA 2Z5UA 1W0KG 2ZXWB 3SPJA 3JD1A 4CZZA 4XDJA 5HFMA 2EJRA 4G2KA 1K8AW 1GO3F 3QNEA 3FB5C 1M56C 3FKSG 4CBCA 4QIWF 1XL6A 5CA3A 2IW5A 2C2AA 1CPYA 4QPJA 5B1BB 3CCUV 1YSCA 4OXSA 4RUFA 3AG3B 4QE7A 2ITDC 4WCEV 3W7WA 2UXNA 2BOCC 4WFAV 2Z3YA 3ABLB 1K92A 4ZKIA 2BOBC 5L3DA 4X8AA 2HR3A 2ZXWC 1VQ9V 1K9MW 2P67A 1VQMV 2EIJB 2QM7A 4QJFB 3DGEA 2MK3A 1E1RG 1S77D 1GK9A 5H6RA 3CC2V 2GSMB 3CMEV 3ZMZA 4MTOA 3ZMSA 1QLEC 2DYSC 2XNDG 3CCSV 5C93A 3EFFK 4MVOA 3BY6A 1F4MA 2WLHA 3SPGA 1QCEA 5DN6G 1F51A 3ZRSA 1K97A 1M57C 2K1EA 2OT5A 4PA7A 3W7TA 4MVSA 4DXWA 5KA5A 2X6CA 2EINC 1JQ0A 1R73A 3K0DA 1UJWB 1JOYA 3SJQC 1F4NA 2HFEC 1Q86W 3OR6C 3CC7V 3E2EA 1V55B 1R3KC 1VQ4V 1H8EG 3T4DA 4BW5A 3UM7A 1FXKA 1B6QA 3ABMC 4ASUG 3GB7C 3OR7C 2QEXV 2R9IA 2XAFA 2YEVB 2LFSA 1QR9A 2QA4V 2WAMA 1VQKV 4JF3A 4N23A 3FB6C 3AG2C 2WWWA 5LHHA 3F5WC 5DM6V 1S0VA 1PNMA 3ZCCA 1K4DC 1NR1A 1OCOB 2PI5A 1R6KA 1K5SA 4I9WA 2V1DA 3CXCU 1KP2A 3K03A 5LGUA 4UXNA 3X2QB 4Z1MG 3AG1B 3RW0A 4PDMA 3ZRXA 1SERA 3ZRVA 1P4RA 2QTOA 2WLIA 2IH1C 2XAJA 4FPPA 1BL8A 4PA3A 5B1BC 3AG2B 4YXWG 2P90A 4RQEA 3ETDA 3IC7A 4UVCA 3E8GA 2JEXA 3OM3B 4E2LA 5LGNA 1NVPD 2YSUB 1ZWIC 3H01A 4PA6A 3MD0A 1Q81W 4P9OA 1EBOA 2ATKC 1DF4A 4U7OA 2DWDC 1VQNV 1R6NA 1BHAA 5HFLA 2JJ1G 5L3GA 3UKMA 1V55C 1VQOV 1QBZA 3K3WA 4FK5C 4UUJC 5E1AC 2Q67A 3WG7C 3ABMB 3QO7A 3ABKC 2DWEC 4HAMA 5B1NA 3RVYA 1AR1B 4MVRA 3I56V 3GWOA 3ASOB 2OCCB 1VQPV 3B8MA 3BEHA 1KP3A 5BZBA 2WLMA 1YIJV 2WLNA 1EZJA 3LSQA 5FL7G 3JCZA 2QKSA 1V54C 4QPKA 4UVBA 4UV9A 5EC2C 1NVPB 1JCHA 2Q69A 2QM8A 1S5HC 2HJFC 3IFXA 1NBMG 2EIKC 4LC1A 3OFNG 1JVMA 2EZOA 3K08A 4L87A 2V7QG 2GHYA 4H33A 4J9ZB 3AG4C 2A0LA 2Y69C 3D36A 4JAVA 3G4SV 1L1FA 1AJQA 3OMAB 3OMNB 4U7NA 2NNUA 4GX5A 5B3SB 2UXXA 2IU3A 2WPDG 2OTJV 1KECA 4JYCA 3OGCC 3ZN0A 1VQ7V 1Y66A 4PDRA 4WFGA 3I55V 3ZRWA 1RM1B 4WFHA 1K3EA 1DTOA 4G27B 3AG3C 3QO5A 3OE7G 1IXMA 3PJSK 5CBFA 3OW2U 1M90W 2ZD9A 3STLC 2X6BA 1MSWD 2WSSG 2ZDIA 1N8RW 5B1AB 3WG7B 1VQLV 1YJNV 1QVFU 1OCZB 5IY5B 3M99B 4MVMA 2QE7G 2WLKA 3E8FA 3AEIA 4MVUA 4Q20A 2HLDG 4XBFA 4PA4A 1OCCC 4JYBA 1QVGU 1SETA 4KFMA 4XDLA 4P9PA 2WLLB 2DYRC 3ETEA 3P32A 2DYRB 3SYAA 3CCRV 3ML0A 2XAQA 3ETGA 1AJNA 5EBWC 1G4YB 4X89A 3TK1A 2EZPA 1K34A 1GM9A 4F4LA 1RM1C 4LP8A 1M1KW 4JGSA 1KC8W 3E8HA 4TT3G 2JEUA 5CBGA 2DQ3A 3ZIAG 1WPXA 1YJWV 1S72V 2ZQMA 1LNQA 1FS0G 1R3IC 3CCVV 4JTDB 4MT8A 1ORQC 4WFEA 4MSWC 1S3JA 2IU0A 4MVQA 2XASA 4RQFA 4QE9A 1BHBA 2A79B 3T1CA 3LDEA 2H8PC 3ZN1A 1K5QA 4R8CA 1MABG 1NR7A 2Y69B 4TWKA 3CCLV 5LHIA 1AI6A 1MOFA 3DTUB 2ZDIC 1V54B 1I5YA 1PD3A 3K04A 5IDJA 1YITV 2AHYA 3NXSA 4FMTA 2FTKA 2JDIG 2HG5C 2EIKB 3LNMB 4N21A 3SYQA 1H2GA 1ENVA 4GX0A 2KB1A 3E83A 3E89A 3CYOA 2Y48A 3ZRWB 3FB7C 2XOKG 3G6EV 3CCJV 3VOUA 1M9NA 1COWG 1E1QG 4MW8A 3G71V 2JJ2G 4RO2A 3CCEV 3T4ZA 1OCRC 4MTGA 3JD0A 3SYCA 3B77A 1E79G 3W7XA 3WFVA 2IJHA 2H94A 4MTXA 1M57B 3ASNB 3JD2A 3ZMUA 1W2BU 3CC4V 1FXKB 4PDVA 3AG4B 2WLLA 3JD3A 4GX1A 3LDCA 1R3JC 4GCZA 4JTCB 4RUEA 5L3FA 3E35A 1THZA 3ASNC 2EINB 3LSSA 4LCUC 3OEHG 2AHZA 1F23A 2EILC 2WLIB 4GT1A 5IYBO 3T2MA 3K0GA 4EKWA 1Q82W 3W7SA 1AROP 2IH3C 5LBQA 5EC1C 2LP7A 1J95A 4KP4A 5J9PC 3SPCA 4FJCC 1EFRG 3K79A 3FB8C 1GM7A 2EBOA 2DW4A 1KD1W 1AJPA 5KA6A 1NKDA 4MVZA 3E8BA 3KG2A 1P7BA 5GW7A 1KQSU 3CCQV 4MTFA 3CMAV 2HKOA 3ABUA 4FIPC 1R3LC 2ITCC 2EIJC 4JASA 1JX9A 1QR8A 3CCMV 2X0LA 2EIMB 3CP1A 3HPLC 2YEVA 1OCZC 5IY5C 4PA9A 3E86A 4WFBV 3F7YC 3LUTB 5L3EA 1GTOA 1NH2B 2WLJA 3TETA 3X2QC 4PDLA 2OTLV 1FXVA 4XDKA 1FFTB 3EHBB 2EIMC 1NJIW 3A0RA 1ROPA 2NLJC 1PNKA 2HVKC 2Q68A 4G28B 4WFFA 5CN0A 3F7VC 1PKXA 1SESA 4ZBMA 3RVZA 1K7DA 3HB3B 1OZ0A 2B1GA 4R50A 1AI5A 2ZR2A 3AG1C 3R65A 1MG1A 5B1OA 2IJJA 5KUKA 3W7UA 4P30A 4RAIA 4I5SA 3K06A 2JK5C 1M56B 2F43G 1DF5A 1JPXA 5LHGA 5EBLC 2XAHA 4MS2A 2LFRA 2XAGA 2EILB 4BIUA 3P30A 4WF9V 4DO2A 1NQTA 1YTFD 1K33A 1OCRB 1NH2D 1YHQV 2PI4A 2IJKA 4JAUA 5KUMA 1YI2V 1FXKC 1K73W 2B5UA 3TCUA 1QLEB 1GM8A 1I5XA 3MHHC 1S76D 4UV8A 3ASOC 4BAYA 2D3OW 4J9YB 3OEEG 3SPIA 5IYCO 2HVJC 1K4CC 1SRYA 3CPWU 1RPRA 4HZ3A 1OCOC 1WLEA 3ZMTA 5LGTA 4LBEC 1AI4A 5L3BA 4JTAB 1FXHA 5EBMC 2Q6AA 4UVAA 1DLBA 3FYEB 4PELA 1TUEB 4P2ZA 1SZTA 4R7CA 1VQ5V 5B3SC 3K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0F C;  3OR6 C;  4GX1 A;  4QNH B;  3LDC A;  1R3J C;  4JTC B;  4HYO A;  4RUE A;  5CBH A;  3OGC C;  1R3K C;  3ASN C;  4LCU C;  3STZ C;  3SYP A;  2AHZ A;  4PDR A;  4WFG A;  2EIL C;  2WLI B;  3T4D A;  3T2M A;  4BW5 A;  3K0G A;  4WFH A;  4EKW A;  3UM7 A;  3ZJZ A;  2IH3 C;  3ABM C;  3LDD A;  4R6Z A;  5EC1 C;  3GB7 C;  1J95 A;  3OR7 C;  3AG3 C;  2R9R B;  4G27 B;  3SPC A;  5J9P C;  3PJS K;  5CBF A;  3FB8 C;  2ZD9 A;  3STL C;  2X6B A;  4MVZ A;  3E8B A;  3KG2 A;  2A9H A;  3AG2 C;  1P7B A;  3FB6 C;  4GX2 A;  4MTF A;  4MVM A;  2WLK A;  3E8F A;  3F5W C;  2X6A A;  1R3L C;  2EIJ C;  2ITC C;  3OUS A;  1OCC C;  4MVU A;  4PA4 A;  3ABL C;  4KFM A;  4XDL A;  4P9P A;  2WLL B;  3IGA C;  2DYR C;  2OCC C;  3HPL C;  2YEV A;  1OCZ C;  5IY5 C;  4PA9 A;  4H37 A;  1K4D C;  3SYA A;  3E86 A;  4MW3 A;  4I9W A;  5EK0 A;  3RBZ A;  3JYC A;  3K03 A;  5EBW C;  1G4Y B;  4X89 A;  3F7Y C;  4X88 A;  3RW0 A;  4PDM A;  1KKD A;  4F4L A;  3LUT B;  4LP8 A;  2QTO A;  2WLI A;  2IH1 C;  5B1B C;  1BL8 A;  4PA3 A;  3E8H A;  5B1A C;  2WLJ A;  3TET A;  1XL4 A;  3E8G A;  3X2Q C;  3SPH A;  4PDL A;  3OUF A;  5CBG A;  4XDK A;  1ZWI C;  4PA6 A;  2P7T C;  2EIM C;  3SYO A;  2NLJ C;  4P9O A;  1LNQ A;  2ATK C;  3SPJ A;  2DWD C;  1R3I C;  2HVK C;  4WFF A;  2Q68 A;  4G28 B;  4JTD B;  4XDJ A;  3F7V C;  3RVZ A;  4ZBM A;  1ORQ C;  3FB5 C;  1M56 C;  4CBC A;  4R50 A;  1XL6 A;  3AG1 C;  3R65 A;  4WFE A;  4MSW C;  5KUK A;  4P30 A;  3UKM A;  4MVQ A;  4RAI A;  4QE9 A;  3K06 A;  1V55 C;  2JK5 C;  2A79 B;  3T1C A;  3LDE A;  2H8P C;  4OXS A;  4RUF A;  4QE7 A;  4UUJ C;  5E1A C;  2ITD C;  2Q67 A;  5EBL C;  3WG7 C;  2BOC C;  4R8C A;  3ABK C;  2DWE C;  4TWK A;  3RVY A;  2BOB C;  4MS2 A;  4MVR A;  4X8A A;  3K04 A;  2ZXW C;  3BEH A;  5BZB A;  2AHY A;  2WLM A;  2WLN A;  2HG5 C;  3LNM B;  3SYQ A;  2QKS A;  1V54 C;  5EC2 C;  5KUM A;  3TCU A;  4MTO A;  2Q69 A;  1S5H C;  4GX0 A;  1QLE C;  2DYS C;  2KB1 A;  3E83 A;  3E89 A;  3ASO C;  2HJF C;  3IFX A;  3EFF K;  3FB7 C;  4J9Y B;  4MVO A;  2WLH A;  2EIK C;  3SPG A;  3SPI A;  3VOU A;  2HVJ C;  1K4C C;  1JVM A;  4MW8 A;  3ZRS A;  2K1E A;  1M57 C;  4RO2 A;  4HZ3 A;  1OCO C;  3K08 A;  3T4Z A;  4H33 A;  4J9Z B;  4LBE C;  1OCR C;  4PA7 A;  3AG4 C;  4JTA B;  4MVS A;  4GX5 A;  4MTG A;  3SYC A;  4DXW A;  2X6C A;  2EIN C;  5EBM C;  2A0L A;  2Q6A A;  2Y69 C;  3K0D A;  3SJQ C;  4P2Z A;  4R7C A;  4PDV A;  2HFE C;  5B3S C;  2WLL A; 
#chains in the Genus database with same CATH topology
 4NKG B;  3ZMV A;  4DV4 O;  1YTF B;  2CK3 G;  1VQ6 V;  2JGD B;  5H9C A;  1BCC H;  2PGG A;  5JJN B;  2JIZ G;  4JPR A;  1AI7 A;  4DW1 A;  1CEZ A;  4BIZ A;  4R6Z A;  1GMG A;  1OHH G;  2HEP A;  4DV4 B;  3FYI B;  4PHZ A;  2FYU H;  2F1M A;  5DED A;  1IX9 A;  2A9H A;  4GX2 A;  1FJG B;  2X6A A;  3U11 A;  2RCV A;  3IGA C;  3OGI B;  1Q3E A;  5H6Q A;  4JI4 O;  5KMG B;  4H37 A;  5BY1 A;  2Q0O C;  1LR1 A;  4EB6 B;  1H2N A;  2YI9 A;  5LMU B;  1KYO F;  3ABK B;  4X88 A;  3SJA C;  2IJI A;  1KKD A;  2CTW A;  5EIB C;  1P84 F;  1HNZ O;  4JI6 B;  1BMF G;  2YXY A;  4LFB O;  2JS5 A;  2P7T C;  2ZR3 A;  5L3C A;  3SYO A;  1KB9 F;  2UUA O;  3SPJ A;  3H1J H;  1Q6U A;  4QGP A;  4CS4 A;  4LFC O;  1JFF A;  4XDJ A;  2EJR A;  1H2L A;  1LUW A;  4D7T A;  2QGN A;  3FKS G;  5TIS Z;  3VQY A;  4QIW F;  5CA3 A;  3RYH A;  3T1H B;  4LF6 B;  3AG3 B;  1N36 B;  3DSQ A;  4WCE V;  2UXN A;  4WFA V;  2Z3Y A;  1XNR O;  1QHT A;  5L3D A;  1XBL A;  3J81 N;  2P67 A;  1PV0 A;  2QM7 A;  3CJH A;  2MK3 A;  4PJ0 Z;  2GSM B;  2UUA B;  3L9D A;  4MTO A;  1L8D A;  3ZMS A;  1QLE C;  2YS8 A;  2XND G;  3CCS V;  1FAF A;  1L0L H;  5C93 A;  1QCE A;  2AXT Z;  4GUN A;  4EFE A;  4AHC A;  4LH7 A;  4DR5 B;  3W7T A;  4MVS A;  2VWJ A;  3ZED A;  5IE9 A;  4IYI A;  1UJW B;  4X20 B;  4HNA A;  4YJ3 B;  3SJQ C;  4NVP A;  3OR6 C;  5CA1 B;  3E2E A;  3CEI A;  4LF5 B;  1VQ4 V;  1RP3 B;  3UM7 A;  3ABM C;  1O9H A;  2QEX V;  3B2E E;  4JI8 B;  1SQF A;  2XAF A;  2LFS A;  1T5E A;  2CGO A;  1A32 A;  4JF3 A;  4N23 A;  3AG2 C;  1IDS A;  1AB3 A;  3ZCC A;  1TUB B;  2FML A;  1Q43 A;  1K4D C;  2PI5 A;  3RYH B;  4I9W A;  5JJJ B;  1KP2 A;  4UXN A;  3AG1 B;  5J2U B;  3RW0 A;  4PDM A;  3JAL B;  1SER A;  2KQX A;  1P4R A;  2RNB A;  2IH1 C;  5JCO A;  2XAJ A;  3AG2 B;  2ZNI A;  2JEX A;  2BE3 A;  4JI0 O;  3OM3 B;  2Q5Z A;  1ZWI C;  2UU9 O;  4YY3 O;  4J80 A;  3UQ8 A;  4C7U A;  3JSL A;  1BHA A;  2VQF O;  3UKM A;  1VQO V;  4X1I A;  1FFX B;  1JR9 A;  2Q67 A;  5LYJ A;  5B66 Z;  3ABK C;  5B1N A;  3RVY A;  3I56 V;  5JJE B;  3BHP A;  4H13 B;  2WLN A;  4K0K B;  4FM1 A;  3JCZ A;  5EC2 C;  4LF8 B;  1JCH A;  2Q69 A;  4YHH O;  3WB2 A;  5D5P A;  3IFX A;  1NBM G;  1N34 B;  1EN6 A;  5KHI A;  5IWA B;  2P4K A;  3FD9 A;  3OFN G;  4TV8 A;  3HKE A;  2E5L O;  2VWK A;  4L87 A;  2DN9 A;  2RJZ A;  4J9Z B;  1XMO B;  1BT8 A;  2Y69 C;  3FX7 A;  4H0L B;  2KG7 A;  1L1F A;  3J80 N;  3HKD B;  4JI7 B;  3OMA B;  3OMN B;  3K58 A;  1VP7 A;  2UXX A;  4U3J B;  4DR7 B;  3OGC C;  2N74 A;  4K35 A;  4U3J A;  1VQ7 V;  1Y66 A;  3BVO A;  4WFG A;  2QWP B;  1Y6X A;  5LA6 B;  4G27 B;  3AG3 C;  1IXM A;  3PJS K;  3FAV A;  2DJV A;  4O4L A;  2X6B A;  2ZDI A;  1YJN V;  5CB4 A;  5B5E Z;  2F23 A;  5CB4 B;  4PA4 A;  1VF6 A;  1SET A;  1M4U A;  2WLL B;  2XTA A;  1Y76 B;  3P32 A;  1N36 O;  1DK1 A;  1FJG O;  2CTQ A;  1VAR A;  3ETG A;  2F4V B;  1AJN A;  1G4Y B;  4X89 A;  1R6T A;  1GM9 A;  1XMQ B;  4F4L A;  1H2M A;  2UUB B;  4IGG A;  2JEU A;  2DQ3 A;  2E75 B;  5J2T A;  1FPO A;  4HNA B;  4B7K A;  1RFY A;  4JTD B;  3G80 A;  1XOU A;  4O4I A;  2IU0 A;  4RQF A;  4QE9 A;  2A79 B;  3LDE A;  4X65 B;  2QSA A;  4E4E A;  4J42 A;  5K1P A;  3CCL V;  5LHI A;  3BAA A;  1AI6 A;  3DTU B;  1Q8I A;  2ZDI C;  1BGY H;  3K04 A;  1GAX A;  1YIT V;  2FTK A;  3LNM B;  1SA0 B;  1H2G A;  1QU7 A;  1XI1 A;  4GX0 A;  2AW9 A;  4X62 O;  1TUB A;  2E74 B;  5IT9 N;  3G6E V;  4LF9 O;  2ZT9 B;  1COW G;  3CCE V;  4DV2 O;  1BE3 H;  2DMX A;  2IJH A;  2ARH A;  3UO2 A;  1NTZ H;  1FXK B;  1MA1 A;  4JTC B;  4RUE A;  3ZS8 C;  1URF A;  1WNS A;  3RYI B;  1THZ A;  4LCU C;  3LSS A;  4LF7 B;  2UXC O;  3RN4 A;  1NZ6 A;  5IYB O;  3T2M A;  2PUS A;  1Q82 W;  1XIL A;  1ARO P;  1ZUQ A;  2NN4 A;  5EC1 C;  1NTK H;  4EB6 A;  3G6B A;  4FJC C;  3G67 A;  3K79 A;  1GM7 A;  3JAT B;  2CE4 A;  2LJ2 A;  4WBN B;  4LF4 O;  4JAS A;  4LFA O;  1QR8 A;  2EIM B;  4NYK A;  4LF8 O;  4PA9 A;  1HW7 A;  1BS3 A;  4B3M O;  2ZCE A;  1HR0 B;  2E5L B;  1GTO A;  3TGU H;  1N4C A;  5LMN O;  3PN1 A;  2WLJ A;  4I7Z B;  1YVW A;  2DOS A;  2Q7H A;  1FXV A;  4XDK A;  1FFT B;  5KLV H;  2EIM C;  5LXT A;  1NJI W;  4IYH A;  4O2A A;  2YI8 A;  4CH6 A;  4WFF A;  1X59 A;  2OCH A;  1K7D A;  4R50 A;  2ZR2 A;  5B1O A;  2A7W A;  2IJJ A;  5LXT B;  1TGO A;  3O9O A;  3RGB A;  5LHG A;  4B7E A;  2XAH A;  2XAG A;  3L73 H;  4DO2 A;  1IBL B;  1YTF D;  1K33 A;  1NH2 D;  2HP8 A;  3H1H H;  5KAF Z;  5KUM A;  3TCU A;  1QLE B;  1GM8 A;  1I5X A;  3APO A;  4LFC B;  4UV8 A;  2QM4 A;  2GUZ B;  2D3O W;  1GN3 A;  3OEE G;  5BR8 O;  1K4C C;  3H1L H;  1SRY A;  3CPW U;  4FLW A;  3ZMT A;  3M8A A;  1NU1 H;  4D6T H;  4UVA A;  3FYE B;  4PEL A;  1ZL8 B;  1TUE B;  1HNX O;  4UCU A;  1FYJ A;  2JS3 A;  5B3S C;  2M7W A;  1Q7Y W;  1Z2G A;  3CRA A;  3JAS A;  1HNW B;  5KHJ A;  2UUB O;  2DE0 X;  3QO8 A;  4IT5 A;  2DYS B;  3ZJZ A;  3A0B Z;  4D7S A;  5IYD O;  3P3N A;  1W0J G;  3OUS A;  1QQC A;  4TV9 B;  3T1H O;  2QR4 A;  4KXR A;  3JD4 A;  1SA0 A;  1N34 O;  3RT3 C;  4GLX A;  4GKJ B;  4ZI7 B;  1ZSP A;  1VQ8 V;  5B1A C;  1XL4 A;  4DV2 B;  1XUQ A;  2QWN B;  1IBM O;  1G1X B;  2P6J A;  2A06 H;  2ZXW B;  4ZOL B;  4CBC A;  1M56 C;  1MZF A;  1XL6 A;  4J11 A;  2C2A A;  3HKB A;  4EEQ A;  4QPJ A;  5KMG A;  3Q4H A;  4GKK B;  3W7W A;  2QWR B;  2JGU A;  4ZKI A;  2BOB C;  2N05 A;  2HR3 A;  2ZXW C;  1FD9 A;  1VQM V;  5H2F Z;  3DGE A;  1S77 D;  1IBK B;  4JAA A;  3O65 A;  3J7A U;  3BY6 A;  4YJ2 A;  2CGN A;  3ZRS A;  1K97 A;  2K1E A;  2OT5 A;  4PA7 A;  3JAT A;  4UFZ A;  4DXW A;  5KA5 A;  4NB5 A;  1HP8 A;  1JQ0 A;  1TAE A;  2RMK B;  4PD4 F;  4JI4 B;  1F4N A;  4KL1 A;  3N2G A;  1Q86 W;  3LNN A;  4KHP B;  1M5I A;  1NI8 A;  5GON A;  1FXK A;  4JI0 B;  1SQQ H;  1B6Q A;  4Z2W A;  2VS0 A;  1N0J A;  3OT7 A;  2YEV B;  5IYZ A;  1QR9 A;  3HR0 A;  3SGI A;  3FB6 C;  1WB8 A;  2WWW A;  4NTX A;  4NTY A;  5DM6 V;  5C8Y A;  1S0V A;  2LQT A;  5E79 Z;  2VQE B;  2V1D A;  1SC5 B;  3K03 A;  4UCV A;  2E3C A;  5LGU A;  2L35 A;  5LA6 A;  5KHK A;  3ZRX A;  1YXB A;  4Q6G A;  4DUY B;  3ZBH A;  4DR1 O;  1BL8 A;  4PA3 A;  2CH7 A;  4YXW G;  1CXZ B;  3ETD A;  4UVC A;  3E8G A;  5KHH A;  5LGN A;  4PA6 A;  3BFR A;  3FFQ A;  4X1I B;  2KG7 B;  1EBO A;  2ATK C;  2DWD C;  4O4I B;  1EZV H;  1VQN V;  2JJ1 G;  1PP9 H;  3HKE B;  1QBZ A;  4FM2 A;  3K3W A;  4FK5 C;  4UUJ C;  1BSM A;  2P22 C;  1EN4 A;  3HKB B;  5KAI Z;  4CS3 A;  3DC5 A;  2WLM A;  4DUZ B;  3LSQ A;  5FL7 G;  2QKS A;  4UV9 A;  4QPK A;  1XRE A;  1NVP B;  1DGS A;  2QM8 A;  3N2K B;  2EIK C;  2M6Y A;  4LC1 A;  3CWB H;  4B3M B;  1KBH A;  2V7Q G;  2GHY A;  3AG4 C;  1WP7 A;  2ZE5 A;  1AJQ A;  5GON B;  2Q73 A;  2IU3 A;  1IZ3 A;  3ZN0 A;  1SQX H;  3QF7 A;  4FLU A;  2OIE A;  4PDR A;  3ZRW A;  4X62 B;  3D8C A;  4WFH A;  2VQF B;  1K3E A;  4DV1 O;  1DTO A;  5CBF A;  3OW2 U;  1M90 W;  3STL C;  1ZTE A;  4TOI A;  3K5N A;  2QTS A;  1MSW D;  1N8R W;  1Y74 B;  2PF4 E;  4X1Y A;  1OCZ B;  2RQ6 A;  5IY5 B;  4MVM A;  2QE7 G;  2GBO A;  1SQV H;  4XBF A;  4Q20 A;  3OTO B;  2HLD G;  4JYB A;  4P9P A;  2LGW A;  2GTA A;  4X65 O;  3SYA A;  4H44 B;  3ML0 A;  3UT5 A;  5EBW C;  3TK1 A;  2EZP A;  5EZY B;  4FLX A;  2KKW A;  3P3P A;  3U10 A;  3TJT A;  4IIJ B;  1RM1 C;  4LP8 A;  3E8H A;  5CBG A;  3CCV V;  2QWQ B;  1EN5 A;  1ORQ C;  4K8X A;  4MSW C;  1S3J A;  2Q9L A;  4TUY A;  2H8P C;  2K9P A;  3BCC H;  4O4J B;  1K5Q A;  1MAB G;  2Y69 B;  5EIB D;  3SJC C;  2YDE A;  4O4J A;  2BTQ A;  1MOF A;  1HR0 O;  1I5Y A;  4X64 O;  3NXS A;  2JDI G;  3SYQ A;  4OX9 B;  1KMI Z;  5JVD B;  4YIP A;  2KB1 A;  3E89 A;  1H2S B;  4NTW A;  3BPZ A;  4JI1 O;  5FNV A;  3BRC A;  3CCJ V;  5ITZ B;  2AZ2 A;  1M9N A;  1E1Q G;  4MW8 A;  4RO2 A;  2F93 B;  4O2B A;  1E79 G;  4U3F H;  3WFV A;  4DK1 A;  2H94 A;  1JFF B;  3ZMU A;  3CC4 V;  4PDV A;  2IBZ H;  4FVM A;  3AG4 B;  1XNR B;  3JD3 A;  1WAZ A;  4L8J A;  3DXR B;  1F23 A;  2WLI B;  4GT1 A;  3W7S A;  5JVD A;  2IH3 C;  3ZHV A;  3SPC A;  3ZHT A;  4UB8 Z;  2EBO A;  2DW4 A;  1KD1 W;  5KA6 A;  1NKD A;  4MVZ A;  1P7B A;  2YUA A;  3CCQ V;  4MTF A;  3CMA V;  4IHJ A;  2HKO A;  3ETQ A;  2EIJ C;  2LO1 A;  1JX9 A;  3C90 A;  4AQY B;  4NXN B;  1OCZ C;  5IY5 C;  4LF6 O;  5BMV A;  3F7Y C;  3CJH B;  3SR2 C;  1JJO A;  4OGQ B;  3LUT B;  1NH2 B;  4FZ0 A;  1JMK C;  3JAM N;  2JGD A;  2UXD O;  4PDL A;  1U97 A;  4BR6 A;  3CRC A;  3A0R A;  1ROP A;  3KCX A;  3OD4 A;  3BAB A;  1KUQ A;  2HJD A;  5CN0 A;  2PTM A;  1AI5 A;  3AG1 C;  3OTO O;  4P30 A;  4FM0 A;  1DF5 A;  4J7J A;  2UUC O;  2LFR A;  4BIU A;  3CE2 A;  1NQT A;  4YIO A;  4W4L A;  1AP6 A;  3C3T A;  3A0H Z;  3CS5 A;  4BAY A;  1I94 O;  1NT2 B;  4DV0 B;  3SPI A;  2HVJ C;  1HDJ A;  1RPR A;  1MZE A;  4HZ3 A;  3UCS C;  1WLE A;  5LP6 B;  4LBE C;  5EZY A;  3L74 H;  4P2Z A;  4R7C A;  2A3Q A;  1VQ5 V;  3K9A A;  4FLY A;  4QNH B;  4HYO A;  5CBH A;  5H5N A;  4O4H A;  4OX9 O;  1WA8 B;  1JJ2 U;  3STZ C;  3SYP A;  5LOV A;  5CA0 B;  4RWU A;  4NXM B;  4CH4 A;  4FLV A;  3LDD A;  1QLN A;  3FAV B;  2R9R B;  3OMI B;  1Q5O A;  3OAA G;  1N0N A;  5IWA O;  3JAR A;  1PNL A;  3RYC A;  1HWY A;  4YY3 B;  3K57 A;  4K8Z A;  2X7R B;  2L6L A;  4CC6 A;  1XMO O;  4EFB A;  2W6J G;  5KHG A;  1AR5 A;  3VQV A;  1GKF A;  1I94 B;  3L72 H;  5CMU A;  4Z1V A;  4OPA A;  3JCU Z;  4DR7 O;  2ZE6 A;  1YEW A;  5LOV B;  2W6I G;  4I0X A;  3D3I A;  1CP9 A;  4K3A A;  2ZIN A;  3ABT A;  3SPH A;  4B3S O;  1YJ9 V;  2ZIM A;  2QWO B;  4B3T O;  4I50 A;  2Z5U A;  1W0K G;  5HFM A;  4G2K A;  3CB2 A;  3FB5 C;  3VQX A;  1R1B A;  4IL6 Z;  2CTP A;  1CPY A;  5IJ9 B;  4X1K B;  3CCU V;  3BA8 A;  2ITD C;  5D5Q A;  2BOC C;  3ABL B;  1K92 A;  2BSK A;  1VMG A;  2Q0A A;  3U0Z A;  4X8A A;  2ILM A;  2UXD B;  2AGA A;  2EIJ B;  1MMM A;  4F6R A;  3OTF A;  1E1R G;  2ETN A;  3ZX6 A;  5H6R A;  3CC2 V;  1BZK A;  4LWS A;  4B3T B;  1GRJ A;  2DYS C;  3L75 H;  4MVO A;  3H9V A;  5A2Q N;  1F4M A;  1WA8 A;  2WLH A;  3CHX A;  3SPG A;  5DN6 G;  1HNX B;  1ZX3 A;  2QDO A;  4PI0 A;  3WB1 A;  3VQW A;  1WPB A;  5J2U A;  2VRZ A;  2X6C A;  5BXZ A;  3WU2 Z;  2Y4U A;  5KX5 B;  3CRM A;  1N32 O;  3S3X A;  2XUM A;  1WB7 A;  4DR6 O;  2FKX A;  3T4D A;  1F7Y A;  4BW5 A;  3K59 A;  3GB7 C;  3M7M X;  1VF7 A;  3OR7 C;  2R9I A;  2QA4 V;  2WAM A;  1VQK V;  4UCT A;  2QKA A;  2CTR A;  3E22 B;  3EVK A;  3ZHQ A;  1NR1 A;  2ADP A;  4YJ3 A;  3A2F A;  2UXB B;  4UB6 Z;  4B3R B;  2Q8V A;  4Z1M G;  2QTO A;  2WLI A;  5B1B C;  3IC9 A;  4I50 B;  4JI5 O;  1NS1 A;  3IC7 A;  4B3R O;  3RYF B;  4E2L A;  1NVP D;  1VF5 B;  3MD0 A;  1BQZ A;  1Q81 W;  2G38 A;  1DF4 A;  4JI5 B;  1YCI A;  4O2B B;  4I55 B;  1R6N A;  5HFL A;  2YIB D;  1V55 C;  2UXB O;  3K9S A;  2WA3 A;  2VQE O;  2IM9 A;  5FPR A;  3ABM B;  1RSO A;  4DRX A;  1XHX A;  2NR5 A;  4HAM A;  3SDL A;  3HKC B;  5LMU O;  1B3Q A;  5EYP B;  3CSX A;  2OCC B;  1VQP V;  3B8M A;  5BZB A;  1EZJ A;  4DYL A;  1V54 C;  5JH7 A;  2HJF C;  1S5L Z;  3QVN A;  3DXR A;  2P4V A;  2EZO A;  4DR2 O;  3APQ A;  3K08 A;  4DV3 O;  4H33 A;  3B40 A;  4TQD A;  1UFI A;  1ZL8 A;  2A0L A;  1Q6I A;  1M93 A;  3D36 A;  4JAV A;  3G4S V;  3AK3 A;  1IBL O;  4U7N A;  5FPO A;  5JQG A;  3CRR A;  3K5M A;  2OTJ V;  1KEC A;  4JYC A;  3JAK B;  3JAW B;  4IIJ A;  2GUZ A;  2ZNJ A;  5GTI Z;  3CRQ A;  4LR3 A;  4I9Q A;  2ZD9 A;  3E22 A;  4CH5 A;  3THO A;  2WSS G;  4OPH A;  3WG7 B;  4JI2 O;  2WLK A;  1OCC C;  2YID A;  2DYR C;  3ETE A;  2DYR B;  1GN6 A;  2XAQ A;  1I0H A;  1K34 A;  1M1K W;  1IUR A;  4JGS A;  3JAW A;  1KC8 W;  5ITZ A;  1GN4 A;  4X66 O;  1WPX A;  1YJW V;  2ZQM A;  1R3I C;  2R72 A;  1HNW O;  2YIB A;  4ZHQ B;  4LF9 B;  4MVQ A;  2XAS A;  1KU9 A;  1MSD A;  4JI3 O;  4R8C A;  1TVK A;  3JSN A;  2P06 A;  4TWK A;  1PD3 A;  1TA8 A;  2AHY A;  2Y0P A;  4F6R B;  2EIK B;  4N21 A;  1WJZ A;  2R70 A;  4LFA B;  1PL4 A;  2ZM6 O;  2Y4T A;  3E83 A;  3CYO A;  2Y48 A;  4DW0 A;  3ZRW B;  2EUL A;  2F66 C;  3VOU A;  3ZHU A;  3SJB C;  1WN7 A;  2Y0I A;  3RYI A;  1BQ0 A;  2JJ2 G;  4A5U B;  1XHZ A;  5JQG B;  4MTG A;  1N33 B;  3B77 A;  3W7X A;  4DV0 O;  4MTX A;  3UT5 B;  1M57 B;  3ASN B;  1W2B U;  2UXC B;  2FB5 A;  2W0X A;  2ZIO A;  2WLL A;  3T1Y B;  4GX1 A;  3AK2 A;  4GCZ A;  3ZHS A;  4DV6 O;  5FNV B;  3K0G A;  4EKW A;  4J7Z A;  3A8T A;  2QJ1 A;  2XHB A;  5LBQ A;  2LP7 A;  3F5T A;  2UUC B;  5J9P C;  1EFR G;  1ZAU A;  5IJ0 B;  4DR2 B;  3QTC A;  3E8B A;  3KG2 A;  4FFB B;  4FFK A;  4UCR A;  2X0L A;  5AG2 A;  3CP1 A;  5LP6 C;  4W4K A;  4DV7 O;  2H3O A;  4I55 A;  2PZS A;  1S5J A;  4TV8 B;  3TET A;  4CH3 A;  3X2Q C;  2OTL V;  3EHB B;  5KX5 A;  2NLJ C;  4JZG A;  1PNK A;  2Q68 A;  4G28 B;  3F7V C;  1SES A;  3HB3 B;  4LF7 O;  1OZ0 A;  5KUK A;  3W7U A;  1ZLZ A;  2Q7E A;  2PYL A;  3DC6 A;  1UPG A;  2F43 G;  1JPX A;  5EBL C;  1AVM A;  1SQG A;  4MS2 A;  2EIL B;  4WF9 V;  1OCR B;  5F2V O;  1YHQ V;  3AK1 A;  4O4L B;  4BIO A;  2CDY A;  4UCS A;  2IJK A;  1VEW A;  2B5U A;  3MHH C;  1S76 D;  1XQ8 A;  2FL4 A;  5J2T B;  3ZHR A;  1YDX A;  5IYC O;  4DUY O;  4YHH B;  1Q6H A;  5L3B A;  4JTA B;  5EBM C;  2Q6A A;  4JI2 B;  4JI1 B;  2ZKO A;  4FZ1 A;  4DR6 B;  2R9A A;  1GN2 A;  3H1I H;  2W0F C;  3D36 C;  4TSF G;  1H8H G;  2Z0A A;  1X4T A;  4JYA B;  3QG5 A;  1PL0 A;  4YJ2 B;  1YF2 A;  4ZI7 A;  1HNZ B;  3CX5 F;  1IXB A;  5BMV B;  4LWS B;  1Y4M A;  3K5L A;  1G8M A;  1H2K A;  3L70 H;  4PV1 B;  1B06 A;  2AZ0 A;  1IVS A;  3GVM A;  3RFR A;  3ABL C;  4FFB A;  3JAR B;  2OCC C;  3HKD A;  2JRI A;  4MW3 A;  4X20 A;  5EK0 A;  3RBZ A;  2DQ0 A;  3JYC A;  4KUM A;  1OCC B;  3VBB A;  3CD6 V;  1H38 A;  2GTS A;  3MHS C;  1RPO A;  1N33 O;  3OUF A;  3UO3 A;  3B8N A;  2B1I A;  4F6E A;  1VIB A;  4CZZ A;  3JD1 A;  1AIL A;  1K8A W;  3MDS A;  1GO3 F;  3QNE A;  1I7F A;  1XNQ B;  2IW5 A;  1L0N H;  4DR4 B;  5B1B B;  4X9Q A;  1YSC A;  4OXS A;  4RUF A;  4QE7 A;  4TV9 A;  2RN9 A;  5C8Y B;  1IBK O;  3T1Y O;  1P49 A;  4DV6 B;  1VQ9 V;  1K9M W;  4QJF B;  5IYZ B;  1GK9 A;  3CME V;  3ZMZ A;  1P7G A;  1SS3 A;  2BTQ B;  2WA4 A;  3EFF K;  3CXH F;  1AP5 A;  5CA0 A;  2OWO A;  1F51 A;  4GZR B;  1M57 C;  2ADQ B;  2ZM6 B;  5CA1 A;  3JAL A;  2EIN C;  4ABM A;  1R73 A;  3K0D A;  1IBM B;  1JOY A;  4NXM O;  2HFE C;  4X64 B;  3CC7 V;  1V55 B;  5FLX N;  1R3K C;  4J41 A;  1H8E G;  5LMN B;  1B04 A;  3I5D A;  4ASU G;  3S3W A;  2OYQ A;  2UU9 B;  2KSD A;  1YZB A;  3B09 A;  3MAQ A;  1U96 A;  4FLT A;  5LHH A;  4K0K O;  4WBN A;  1JA8 A;  3EXA A;  3F5W C;  1PNM A;  5JH7 B;  1OCO B;  1D5N A;  1R6K A;  1K5S A;  3CXC U;  2YXL A;  3X2Q B;  4PI2 A;  3KZI Z;  1EM1 A;  3ZRV A;  4ZOL A;  4FPP A;  5EYP A;  4RQE A;  2P90 A;  4JV5 B;  1TVK B;  2O57 A;  4DV5 O;  1RSO B;  4DRX B;  2YSU B;  3H01 A;  2V4D A;  4P9O A;  4U7O A;  2JVD A;  4X66 B;  4ZHQ A;  3WB0 A;  3NR7 A;  2XT9 A;  4KHP O;  4TQF A;  4LF5 O;  5L3G A;  5BR8 B;  4J7K A;  4BWA A;  4DV1 B;  5E1A C;  4I4T A;  3WG7 C;  3QO7 A;  2LW7 A;  2DWE C;  1AR1 B;  1KKC A;  5LL6 Y;  4MVR A;  4BW9 A;  3GWO A;  2ZE8 A;  3ASO B;  3BEH A;  1KP3 A;  1YIJ V;  2N04 A;  4DV5 B;  4JYA O;  4UVB A;  1XDC A;  1SQB H;  1S5H C;  2F4V O;  1US6 A;  4DV7 B;  4TUY B;  3JAS B;  1JVM A;  3B4S A;  4ZIB A;  1Y74 A;  1SF9 A;  3LSU A;  1J5E O;  4AQY O;  4NXN O;  2YIA A;  4LH6 A;  3GWK C;  2NNU A;  4GX5 A;  5GTH Z;  5B3S B;  2WPD G;  3JAK A;  4JI8 O;  4UCO A;  1SKV A;  4GKJ O;  1OJH A;  3I55 V;  1RM1 B;  2MW2 B;  2YXH A;  2F95 B;  4CC5 A;  4JYY A;  3QO5 A;  3OE7 G;  1QNM A;  2YC0 A;  1Y76 A;  4LNU A;  3ICX A;  5B1A B;  2GV9 A;  4DR3 B;  4DUZ O;  1VQL V;  1QVF U;  3M99 B;  1AR4 A;  3E8F A;  1GH6 A;  3AEI A;  4MVU A;  4X1Y B;  1QVG U;  2GDS A;  4KFM A;  4XDL A;  3N2K A;  2P5O A;  4GKK O;  4DR3 O;  3CCR V;  2EX3 A;  4LFB B;  4O2A B;  4DR5 O;  4TT3 G;  3HKC A;  2E76 B;  4FLZ A;  3ZIA G;  5DEC A;  3L71 H;  1D5A A;  3AG7 A;  1S72 V;  1O9G A;  1Z5V A;  4X1K A;  2BCC H;  4JI7 O;  1LNQ A;  1FS0 G;  1N32 B;  4MT8 A;  1OV9 A;  1D2D A;  4WFE A;  1BHB A;  3T1C A;  1G6U A;  3ZN1 A;  1MNG A;  3RYF A;  1NR7 A;  1XNQ O;  2HHH O;  2ZE7 A;  4I0X B;  2CH7 B;  1V54 B;  1XMQ O;  3KCY A;  2QKC A;  5IDJ A;  4JV5 O;  4FMT A;  2HG5 C;  1W59 A;  1ENV A;  2BSK B;  2Q7G A;  3FB7 C;  2XOK G;  1Z5W A;  1FFX A;  2RDC A;  1PPJ H;  5IJ9 A;  3G71 V;  3C3S A;  3TXS A;  4JI6 O;  2EJ7 A;  3T4Z A;  1OCR C;  4DR1 B;  3R66 A;  2LGQ A;  3JD0 A;  3SYC A;  4B3S B;  2LW1 A;  1LUV A;  2D2C B;  3JD2 A;  3KKY A;  2Q4P A;  3LDC A;  1R3J C;  1FKA O;  5L3F A;  3E35 A;  3ASN C;  2EIN B;  3OEH G;  2AHZ A;  2EIL C;  5JCO C;  1WP8 A;  4DR4 O;  3N2G B;  1J95 A;  4KP4 A;  2HHH B;  3FB8 C;  5JWP A;  1AJP A;  2PY5 A;  1V9P A;  4J10 A;  5GW7 A;  1KQS U;  3IJ4 A;  3ABU A;  4FIP C;  1R3L C;  2ITC C;  4DK0 A;  3CCM V;  3RYC B;  2B9Z A;  3HPL C;  2YEV A;  3E86 A;  4WFB V;  1SZX A;  2YIC A;  5L3E A;  1Y67 A;  2PYJ A;  5A9G A;  4O4H B;  3K5O A;  3RWR D;  2HVK C;  3RVZ A;  4HBN A;  1PKX A;  4ZBM A;  4JI3 B;  2OIG A;  2B1G A;  3H1K H;  3R65 A;  1MG1 A;  5LP6 A;  3N27 A;  4LF4 B;  1NTM H;  4AIL C;  3IAY A;  4RAI A;  4I5S A;  3K06 A;  2JK5 C;  4ICG A;  1M56 B;  3BA9 A;  2CAZ C;  4GYC B;  5LYJ B;  4I4T B;  1J5E B;  3P30 A;  4NR1 A;  1PM9 A;  1VF6 C;  4LNU B;  2PI4 A;  1XEQ A;  3TXQ A;  4JAU A;  3D3Q A;  1YI2 V;  4JZ2 A;  1FXK C;  1K73 W;  4DV3 B;  4AI8 A;  2ODM A;  3ASO C;  4J9Y B;  1I08 A;  3Q4H B;  4IHJ B;  1OCO C;  2CUG A;  4CS2 A;  5LGT A;  1Q90 D;  1AI4 A;  1SQP H;  5IJ0 A;  5K1X A;  4B08 A;  1FXH A;  1DLB A;  2BTO A;  1SZT A; 
#chains in the Genus database with same CATH homology
 2W0F C;  4QNH B;  3ZMV A;  4HYO A;  1YTF B;  2M7W A;  5CBH A;  1Q7Y W;  2CK3 G;  1H8H G;  4TSF G;  1VQ6 V;  5H9C A;  1PL0 A;  1JJ2 U;  3STZ C;  3SYP A;  2JIZ G;  4JPR A;  1AI7 A;  3QO8 A;  1CEZ A;  2DYS B;  4BIZ A;  3ZJZ A;  4R6Z A;  3LDD A;  1GMG A;  1OHH G;  1QLN A;  2R9R B;  3FYI B;  1Y4M A;  3OMI B;  3OAA G;  1PNL A;  5IYD O;  1HWY A;  1G8M A;  2A9H A;  4GX2 A;  1W0J G;  2X7R B;  2X6A A;  3OUS A;  3ABL C;  2W6J G;  3IGA C;  2OCC C;  5H6Q A;  1GKF A;  4H37 A;  3JD4 A;  4MW3 A;  5EK0 A;  5CMU A;  3RBZ A;  2DQ0 A;  3JYC A;  3ABK B;  4X88 A;  4KUM A;  1OCC B;  2IJI A;  3VBB A;  3CD6 V;  1KKD A;  1H38 A;  1VQ8 V;  2W6I G;  5B1A C;  1XL4 A;  3MHS C;  1RPO A;  1BMF G;  3D3I A;  1CP9 A;  3SPH A;  3ABT A;  3OUF A;  1YJ9 V;  3B8N A;  2B1I A;  2P7T C;  2ZR3 A;  5L3C A;  3SYO A;  2P6J A;  2Z5U A;  1W0K G;  2ZXW B;  3SPJ A;  3JD1 A;  4CZZ A;  4XDJ A;  5HFM A;  2EJR A;  4G2K A;  1K8A W;  1GO3 F;  3QNE A;  3FB5 C;  1M56 C;  3FKS G;  4CBC A;  4QIW F;  1XL6 A;  5CA3 A;  2IW5 A;  2C2A A;  1CPY A;  4QPJ A;  5B1B B;  3CCU V;  1YSC A;  4OXS A;  4RUF A;  3AG3 B;  4QE7 A;  2ITD C;  4WCE V;  3W7W A;  2UXN A;  2BOC C;  4WFA V;  2Z3Y A;  3ABL B;  1K92 A;  4ZKI A;  2BOB C;  5L3D A;  4X8A A;  2HR3 A;  2ZXW C;  1VQ9 V;  1K9M W;  2P67 A;  1VQM V;  2EIJ B;  2QM7 A;  4QJF B;  3DGE A;  2MK3 A;  1E1R G;  1S77 D;  1GK9 A;  5H6R A;  3CC2 V;  2GSM B;  3CME V;  3ZMZ A;  4MTO A;  3ZMS A;  1QLE C;  2DYS C;  2XND G;  3CCS V;  5C93 A;  3EFF K;  4MVO A;  3BY6 A;  1F4M A;  2WLH A;  3SPG A;  1QCE A;  5DN6 G;  1F51 A;  3ZRS A;  1K97 A;  1M57 C;  2K1E A;  2OT5 A;  4PA7 A;  3W7T A;  4MVS A;  4DXW A;  5KA5 A;  2X6C A;  2EIN C;  1JQ0 A;  1R73 A;  3K0D A;  1UJW B;  1JOY A;  3SJQ C;  1F4N A;  2HFE C;  1Q86 W;  3OR6 C;  3CC7 V;  3E2E A;  1V55 B;  1R3K C;  1VQ4 V;  1H8E G;  3T4D A;  4BW5 A;  3UM7 A;  1FXK A;  1B6Q A;  3ABM C;  4ASU G;  3GB7 C;  3OR7 C;  2QEX V;  2R9I A;  2XAF A;  2YEV B;  2LFS A;  1QR9 A;  2QA4 V;  2WAM A;  1VQK V;  4JF3 A;  4N23 A;  3FB6 C;  3AG2 C;  2WWW A;  5LHH A;  3F5W C;  5DM6 V;  1S0V A;  1PNM A;  3ZCC A;  1K4D C;  1NR1 A;  1OCO B;  2PI5 A;  1R6K A;  1K5S A;  4I9W A;  2V1D A;  3CXC U;  1KP2 A;  3K03 A;  5LGU A;  4UXN A;  3X2Q B;  4Z1M G;  3AG1 B;  3RW0 A;  4PDM A;  3ZRX A;  1SER A;  3ZRV A;  1P4R A;  2QTO A;  2WLI A;  2IH1 C;  2XAJ A;  4FPP A;  1BL8 A;  4PA3 A;  5B1B C;  3AG2 B;  4YXW G;  2P90 A;  4RQE A;  3ETD A;  3IC7 A;  4UVC A;  3E8G A;  2JEX A;  3OM3 B;  4E2L A;  5LGN A;  1NVP D;  2YSU B;  1ZWI C;  3H01 A;  4PA6 A;  3MD0 A;  1Q81 W;  4P9O A;  1EBO A;  2ATK C;  1DF4 A;  4U7O A;  2DWD C;  1VQN V;  1R6N A;  1BHA A;  5HFL A;  2JJ1 G;  5L3G A;  3UKM A;  1V55 C;  1VQO V;  1QBZ A;  3K3W A;  4FK5 C;  4UUJ C;  5E1A C;  2Q67 A;  3WG7 C;  3ABM B;  3QO7 A;  3ABK C;  2DWE C;  4HAM A;  5B1N A;  3RVY A;  1AR1 B;  4MVR A;  3I56 V;  3GWO A;  3ASO B;  2OCC B;  1VQP V;  3B8M A;  3BEH A;  1KP3 A;  5BZB A;  2WLM A;  1YIJ V;  2WLN A;  1EZJ A;  3LSQ A;  5FL7 G;  3JCZ A;  2QKS A;  1V54 C;  4QPK A;  4UVB A;  4UV9 A;  5EC2 C;  1NVP B;  1JCH A;  2Q69 A;  2QM8 A;  1S5H C;  2HJF C;  3IFX A;  1NBM G;  2EIK C;  4LC1 A;  3OFN G;  1JVM A;  2EZO A;  3K08 A;  4L87 A;  2V7Q G;  2GHY A;  4H33 A;  4J9Z B;  3AG4 C;  2A0L A;  2Y69 C;  3D36 A;  4JAV A;  3G4S V;  1L1F A;  1AJQ A;  3OMA B;  3OMN B;  4U7N A;  2NNU A;  4GX5 A;  5B3S B;  2UXX A;  2IU3 A;  2WPD G;  2OTJ V;  1KEC A;  4JYC A;  3OGC C;  3ZN0 A;  1VQ7 V;  1Y66 A;  4PDR A;  4WFG A;  3I55 V;  3ZRW A;  1RM1 B;  4WFH A;  1K3E A;  1DTO A;  4G27 B;  3AG3 C;  3QO5 A;  3OE7 G;  1IXM A;  3PJS K;  5CBF A;  3OW2 U;  1M90 W;  2ZD9 A;  3STL C;  2X6B A;  1MSW D;  2WSS G;  2ZDI A;  1N8R W;  5B1A B;  3WG7 B;  1VQL V;  1YJN V;  1QVF U;  1OCZ B;  5IY5 B;  3M99 B;  4MVM A;  2QE7 G;  2WLK A;  3E8F A;  3AEI A;  4MVU A;  4Q20 A;  2HLD G;  4XBF A;  4PA4 A;  1OCC C;  4JYB A;  1QVG U;  1SET A;  4KFM A;  4XDL A;  4P9P A;  2WLL B;  2DYR C;  3ETE A;  3P32 A;  2DYR B;  3SYA A;  3CCR V;  3ML0 A;  2XAQ A;  3ETG A;  1AJN A;  5EBW C;  1G4Y B;  4X89 A;  3TK1 A;  2EZP A;  1K34 A;  1GM9 A;  4F4L A;  1RM1 C;  4LP8 A;  1M1K W;  4JGS A;  1KC8 W;  3E8H A;  4TT3 G;  2JEU A;  5CBG A;  2DQ3 A;  3ZIA G;  1WPX A;  1YJW V;  1S72 V;  2ZQM A;  1LNQ A;  1FS0 G;  1R3I C;  3CCV V;  4JTD B;  4MT8 A;  1ORQ C;  4WFE A;  4MSW C;  1S3J A;  2IU0 A;  4MVQ A;  2XAS A;  4RQF A;  4QE9 A;  1BHB A;  2A79 B;  3T1C A;  3LDE A;  2H8P C;  3ZN1 A;  1K5Q A;  4R8C A;  1MAB G;  1NR7 A;  2Y69 B;  4TWK A;  3CCL V;  5LHI A;  1AI6 A;  1MOF A;  3DTU B;  2ZDI C;  1V54 B;  1I5Y A;  1PD3 A;  3K04 A;  5IDJ A;  1YIT V;  2AHY A;  3NXS A;  4FMT A;  2FTK A;  2JDI G;  2HG5 C;  2EIK B;  3LNM B;  4N21 A;  3SYQ A;  1H2G A;  1ENV A;  4GX0 A;  2KB1 A;  3E83 A;  3E89 A;  3CYO A;  2Y48 A;  3ZRW B;  3FB7 C;  2XOK G;  3G6E V;  3CCJ V;  3VOU A;  1M9N A;  1COW G;  1E1Q G;  4MW8 A;  3G71 V;  2JJ2 G;  4RO2 A;  3CCE V;  3T4Z A;  1OCR C;  4MTG A;  3JD0 A;  3SYC A;  3B77 A;  1E79 G;  3W7X A;  3WFV A;  2IJH A;  2H94 A;  4MTX A;  1M57 B;  3ASN B;  3JD2 A;  3ZMU A;  1W2B U;  3CC4 V;  1FXK B;  4PDV A;  3AG4 B;  2WLL A;  3JD3 A;  4GX1 A;  3LDC A;  1R3J C;  4GCZ A;  4JTC B;  4RUE A;  5L3F A;  3E35 A;  1THZ A;  3ASN C;  2EIN B;  3LSS A;  4LCU C;  3OEH G;  2AHZ A;  1F23 A;  2EIL C;  2WLI B;  4GT1 A;  5IYB O;  3T2M A;  3K0G A;  4EKW A;  1Q82 W;  3W7S A;  1ARO P;  2IH3 C;  5LBQ A;  5EC1 C;  2LP7 A;  1J95 A;  4KP4 A;  5J9P C;  3SPC A;  4FJC C;  1EFR G;  3K79 A;  3FB8 C;  1GM7 A;  2EBO A;  2DW4 A;  1KD1 W;  1AJP A;  5KA6 A;  1NKD A;  4MVZ A;  3E8B A;  3KG2 A;  1P7B A;  5GW7 A;  1KQS U;  3CCQ V;  4MTF A;  3CMA V;  2HKO A;  3ABU A;  4FIP C;  1R3L C;  2ITC C;  2EIJ C;  4JAS A;  1JX9 A;  1QR8 A;  3CCM V;  2X0L A;  2EIM B;  3CP1 A;  3HPL C;  2YEV A;  1OCZ C;  5IY5 C;  4PA9 A;  3E86 A;  4WFB V;  3F7Y C;  3LUT B;  5L3E A;  1GTO A;  1NH2 B;  2WLJ A;  3TET A;  3X2Q C;  4PDL A;  2OTL V;  1FXV A;  4XDK A;  1FFT B;  3EHB B;  2EIM C;  1NJI W;  3A0R A;  1ROP A;  2NLJ C;  1PNK A;  2HVK C;  2Q68 A;  4G28 B;  4WFF A;  5CN0 A;  3F7V C;  1PKX A;  1SES A;  4ZBM A;  3RVZ A;  1K7D A;  3HB3 B;  1OZ0 A;  2B1G A;  4R50 A;  1AI5 A;  2ZR2 A;  3AG1 C;  3R65 A;  1MG1 A;  5B1O A;  2IJJ A;  5KUK A;  3W7U A;  4P30 A;  4RAI A;  4I5S A;  3K06 A;  2JK5 C;  1M56 B;  2F43 G;  1DF5 A;  1JPX A;  5LHG A;  5EBL C;  2XAH A;  4MS2 A;  2LFR A;  2XAG A;  2EIL B;  4BIU A;  3P30 A;  4WF9 V;  4DO2 A;  1NQT A;  1YTF D;  1K33 A;  1OCR B;  1NH2 D;  1YHQ V;  2PI4 A;  2IJK A;  4JAU A;  5KUM A;  1YI2 V;  1FXK C;  1K73 W;  2B5U A;  3TCU A;  1QLE B;  1GM8 A;  1I5X A;  3MHH C;  1S76 D;  4UV8 A;  3ASO C;  4BAY A;  2D3O W;  4J9Y B;  3OEE G;  3SPI A;  5IYC O;  2HVJ C;  1K4C C;  1SRY A;  3CPW U;  1RPR A;  4HZ3 A;  1OCO C;  1WLE A;  3ZMT A;  5LGT A;  4LBE C;  1AI4 A;  5L3B A;  4JTA B;  1FXH A;  5EBM C;  2Q6A A;  4UVA A;  1DLB A;  3FYE B;  4PEL A;  1TUE B;  4P2Z A;  1SZT A;  4R7C A;  1VQ5 V;  5B3S C;  3K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...