4QNHB

Calcium-calmodulin (t79d) complexed with the calmodulin binding domain from a small conductance potassium channel sk2-a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Selective phosphorylation modulates the PIP2 sensitivity of the CaM-SK channel complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ion transport/protein binding
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qnhB00
3FB6C 2WLLA 3JYCA 3K03A 4TWKA 1R3IC 4MVSA 5B1AC 3AG3C 1R3KC 3SPGA 4UUJC 3IFXA 3UM7A 5CBGA 2DYRC 4R6ZA 2Y69C 5E1AC 4GX2A 3KG2A 5KUKA 3E8BA 2ITDC 4XDJA 3SYQA 3LNMB 2X6CA 3K0DA 4RUEA 4RUFA 3K04A 2HFEC 4X88A 3FB5C 3ABMC 4MTFA 1XL4A 2WLIA 2A79B 2HJFC 3IGAC 4JTDB 2QKSA 2A9HA 3R65A 2IH3C 4QE9A 3RVZA 2X6BA 4ZBMA 1V55C 1BL8A 1V54C 3OGCC 2W0FC 3K06A 3T1CA 2DWEC 4LBEC 2HG5C 2HVKC 3T2MA 3ASNC 3T4ZA 3ZRSA 3ABKC 4H33A 4J9ZB 2A0LA 2Q67A 2EILC 5EC1C 3OUFA 4MVUA 2ITCC 2BOCC 4X89A 4XDLA 1OCCC 3LDDA 2WLLB 4DXWA 4QNHB 2Q69A 2EIMC 4H37A 4R7CA 2EIKC 4PA4A 2WLNA 4MW8A 4J9YB 1OCZC 1R3LC 3BEHA 3SPIA 3E83A 2HVJC 2NLJC 5B3SC 4JTAB 5IY5C 3LDCA 3RW0A 3SPCA 4P9PA 5J9PC 2WLJA 4GX1A 4PA7A 1K4DC 4MTOA 3E8GA 3ABLC 4MVOA 3F7VC 2P7TC 4GX5A 4KFMA 3ZJZA 4MVRA 3T4DA 2K1EA 4MVZA 3OR7C 2OCCC 3FB8C 4PDLA 5EBMC 4PDVA 4P30A 3RBZA 2AHYA 2WLKA 4XDKA 3LDEA 2ZD9A 2ATKC 3AG2C 3ASOC 3F7YC 2WLHA 3SPJA 4RO2A 4MSWC 3STLC 2QTOA 1J95A 4GX0A 3E86A 4HYOA 5CBFA 4G28B 1KKDA 1P7BA 3FB7C 4LP8A 1LNQA 3TETA 3F5WC 3X2QC 4F4LA 2H8PC 2KB1A 2JK5C 4RAIA 3WG7C 4PDMA 4MS2A 3E89A 4PA3A 2WLIB 4BW5A 4WFHA 4PA9A 3UKMA 1QLEC 1JVMA 2WLMA 3AG4C 2EIJC 4WFEA 1OCRC 2EINC 4PDRA 1ORQC 1K4CC 2DWDC 1R3JC 2BOBC 3LUTB 3OR6C 4MVMA 3OUSA 3SPHA 2YEVA 3AG1C 3GB7C 2AHZA 1OCOC 5EBLC 1XL6A 2X6AA 3SJQC 4PA6A 4OXSA 3HPLC 2Q68A 3PJSK 4G27B 3RVYA 2R9RB 4HZ3A 3SYCA 2ZXWC 4EKWA 4LCUC 1S5HC 3E8FA 3K0GA 3TCUA 5EC2C 3EFFK 1M56C 3SYAA 1ZWIC 1M57C 4X8AA 5EBWC 5B1BC 3SYPA 4CBCA 4I9WA 2Q6AA 4WFFA 4JTCB 4QE7A 1G4YB 3SYOA 5EK0A 4WFGA 4R8CA 3STZC 5CBHA 4MW3A 4MTGA 3VOUA 2DYSC 4MVQA 3E8HA 4P2ZA 2IH1C 5BZBA 4R50A 3K08A 5KUMA 4P9OA
chains in the Genus database with same CATH superfamily
1GTOA 5B1AC 4JI2B 4AQYO 4F6EA 4LWSA 2YSUB 4H0LB 4GX2A 1EFRG 4TSFG 2DYRB 2ZXWB 2VWKA 3HKEA 1LUVA 1XMQO 4J11A 3M99B 1S76D 5KAFZ 3UO2A 1XUQA 2EULA 4I0XA 2UUAB 3FFQA 3ZEDA 3CPWU 3B2EE 2VQFO 4R7CA 1SQGA 4UCVA 1KUQA 4GLXA 4Z1MG 1R3LC 4J10A 5GW7A 3CMAV 5LL6Y 1FAFA 1D2DA 2EZOA 4CS2A 1PNMA 4GCZA 1E1RG 4DV2O 2MK3A 4LFBB 4FFKA 2QM7A 1IBMB 4JI6O 4MVRA 3FB8C 3HB3B 1F4MA 3MDSA 4XDKA 2F93B 4YY3O 2ZQMA 3B8NA 3K5MA 3SPJA 3AG2B 1Q6HA 4WFBV 2QTSA 1CP9A 4B3SO 5GONB 2XAFA 4ZHQB 5C93A 4DK0A 3E89A 2F23A 2EIJC 4UCTA 5IYBO 1G6UA 1YXBA 3CE2A 1R3JC 4K0KB 4LNUB 1GN6A 4CC6A 3TK1A 4PA6A 3SDLA 5LOVB 1D5AA 1SQXH 4HZ3A 4X20B 1N33B 4ZKIA 4JI4O 3JD4A 3B4SA 4DV1O 2UUCB 3HKCB 5F2VO 1R6TA 4TV8A 3OMAB 4WFFA 1Q6UA 3CC2V 3HKDA 1WP8A 3QO7A 4LF7O 1RP3B 1H38A 3P32A 2OCHA 4DR2B 4X66O 1BHAA 1R3KC 4JI1O 3UM7A 2QR4A 5DECA 4FLVA 1RSOB 3RGBA 2ITDC 4RUEA 3OTOO 1YHQV 4AI8A 1E1QG 5KX5A 4DR6B 4X65B 2UUBB 1VQ9V 4HNAB 1P7GA 1ZTEA 1Y67A 1M4UA 4O4JB 3L73H 2EILC 1IVSA 1EBOA 3BAAA 3OW2U 4MW8A 5JJEB 1HNZB 3MD0A 1EM1A 2ZDIC 4J7JA 2CH7A 3E83A 1JMKC 3ZRXA 4FZ1A 3LDCA 3SPCA 2JRIA 1QHTA 4FFBB 4YIOA 1GAXA 3C90A 4KXRA 4X64O 1HW7A 2K1EA 2XAJA 3FX7A 2DMXA 2OCCB 4G2KA 3ASOC 3VQVA 1AILA 4DRXA 4LFCO 5CBFA 3ETQA 3CRQA 4LWSB 4PI0A 3RYFA 3A2FA 2KSDA 3CYOA 3BA9A 5BY1A 4DR1O 3A0BZ 3HKEB 1IBKO 3BCCH 1SESA 1Y66A 2OIGA 1J5EB 1QBZA 2YEVA 1OCOC 4DV6B 2VRZA 4I0XB 1S0VA 4G27B 2R9RB 1Q81W 4JYAO 1GRJA 4UVCA 3STZC 3CEIA 2E76B 4DR3O 2HJDA 2Y4UA 5AG2A 1YDXA 3K08A 2WLLA 1YIJV 2OTJV 2CTQA 1GKFA 1S72V 3GWOA 1KKCA 3CCRV 4AQYB 2RQ6A 2GHYA 2DN9A 2Q5ZA 2W6JG 2FKXA 3WFVA 1NZ6A 1V55C 3OGCC 5L3DA 4LBEC 1XMQB 4X1IB 4MVUA 5E79Z 1XREA 3A8TA 2VQFB 3BEHA 1R6NA 1YTFB 4O4IA 2KQXA 3H01A 1MABG 2V7QG 5IWAO 4TV8B 4FJCC 1NR7A 4DV2B 4DK1A 3HKDB 1MA1A 1Y4MA 4D6TH 4JI6B 4GYCB 3K79A 3QVNA 2GBOA 2YUAA 4YY3B 1RFYA 4YIPA 1NH2B 2YXLA 2N04A 2H8PC 2CTPA 1W0JG 4B3SB 2YIBD 2X7RB 4WFAV 4JASA 5KX5B 3ZCCA 4UB6Z 4I55B 4YJ2B 1FFXB 3PJSK 2HEPA 4IYHA 2IW5A 1PM9A 3LSUA 3ZS8C 2LGQA 1ZWIC 5DM6V 2F95B 4JI4B 1N0JA 1SERA 4JYBA 2AZ0A 1PD3A 4QGPA 1VQKV 1FJGB 4LF7B 4CH4A 3K03A 2Y4TA 1IDSA 2QM8A 3IFXA 4X66B 2Y69C 4JI1B 4HBNA 5CA1A 3CCLV 1K9MW 4RUFA 4OPAA 4FK5C 1Q5OA 4DRXB 3OTOB 1X4TA 2LW1A 2V4DA 3BY6A 1X59A 2X0LA 1TUBA 5LYJA 4J9ZB 2JIZG 5EC1C 1NT2B 1K97A 4TUYB 2QWNB 1L0LH 1I94O 3IC7A 4Q6GA 1S77D 1K34A 4NTWA 1TA8A 5B66Z 4P9PA 1RPOA 2P67A 2PI5A 4ASUG 4PA7A 2B1IA 1WA8A 4EB6A 4X64B 1XILA 5JJNB 4BW9A 4L87A 5JQGA 2PZSA 3J81N 2WWWA 1AJQA 5LMUO 4RO2A 4GX0A 1EZVH 1GM9A 3JATB 3G6EV 2Y0IA 1LNQA 4LF5O 4LFCB 1VQ5V 3K3WA 5C8YA 2QEXV 1S5JA 4KUMA 4DR1B 1IURA 4E4EA 4WFEA 1IBKB 1DLBA 5IJ9A 1N0NA 4MVMA 1H2GA 1OCRB 2EINB 2EBOA 5EBLC 4BWAA 1F51A 1GMGA 4U3JA 2CAZC 1RM1B 1IXMA 3K9AA 5J2TA 3K0GA 3RYCA 1IX9A 1A32A 1H2LA 4JYAB 4IL6Z 4MTXA 4I9QA 1L1FA 1RPRA 5LMNO 1JR9A 2YIBA 1AP5A 4R8CA 3BABA 4H13B 4O4IB 1AROP 4JI5O 2PUSA 3L9DA 3WU2Z 4DR3B 2XAHA 4TWKA 3JYCA 4QPKA 3TGUH 3JAWA 4K35A 5LP6C 1FPOA 1R73A 1OZ0A 3TXQA 1M1KW 5FPRA 2OYQA 5H5NA 4BIUA 4QE9A 3OFNG 3K06A 4PJ0Z 3RFRA 2QA4V 4FM1A 5DN6G 4LF6O 1YI2V 2JEXA 5CA0A 4OPHA 4XDLA 1FXKA 4PV1B 2G38A 2EIKC 2WLNA 2ETNA 5JCOC 4LF4O 2HVJC 5B3SC 2N05A 1N36O 2UXCO 3ZHQA 2PY5A 4NB5A 5L3GA 2Q4PA 1BQ0A 1QR9A 2AXTZ 1XHZA 2P7TC 5KLVH 5IWAB 4JYCA 5JVDA 4J7ZA 1US6A 4PDVA 2IU3A 3HKCA 1ZUQA 2RMKB 3T1HO 3F5WC 3ML0A 1KQSU 5CA1B 3DC5A 4O4HB 5L3FA 4DW0A 1GH6A 4MS2A 4PA3A 1QLEC 1JVMA 3AG4C 3CSXA 5GTIZ 1ENVA 3APQA 3OR6C 3K59A 5LYJB 2QWQB 2ZXWC 3DXRB 5IDJA 2M6YA 1KBHA 3E8FA 1TVKA 1MSWD 1M56B 2YDEA 4QIWF 5L3BA 3Q4HA 4YXWG 1H8HG 4UCUA 5CBHA 3CCQV 5A9GA 4B3MO 2Z3YA 1S3JA 1WA8B 5KUMA 3VQYA 1P49A 3AG3C 3SPGA 2P5OA 4JI8O 3LSQA 3ZHTA 2FMLA 1WAZA 3HKBA 3SYQA 4D7TA 5JQGB 2HLDG 3FB5C 3M7MX 4MTFA 1YEWA 2N74A 3O9OA 4I7ZB 2W0FC 2HVKC 3ASNC 2JVDA 5DEDA 4CS3A 2Q67A 5FPOA 1VQ7V 4LFAO 1HP8A 5IJ9B 2RJZA 4H37A 1Q6IA 4UV8A 2Q0AA 1K33A 1I94B 1K8AW 4U3JB 2LFRA 2FTKA 5J2TB 2Q9LA 3RN4A 3D3QA 3RW0A 3RYCB 5IY5B 4TQFA 3JCZA 1GN3A 3E8GA 4JI3O 1TAEA 4I4TA 3NR7A 2EZPA 3BA8A 4WF9V 2XOKG 3JD1A 4JAVA 4LF9O 1LR1A 3JAWB 4G28B 5LMUB 1MZEA 2BTQA 2V1DA 1R1BA 2NNUA 3SJBC 4LF5B 1F23A 3JD3A 5K1XA 3WG7B 4PA9A 3K57A 2UXXA 2ARHA 2UXDO 4J42A 1MMMA 2RCVA 1IBLO 3APOA 2YIDA 2X6AA 1WNSA 3JALB 2UXBO 3WB1A 5CA0B 1KECA 2ZDIA 1FXKB 3TCUA 4AHCA 1AI6A 1SETA 1FS0G 5CN0A 3SYPA 3THOA 4DV4O 1HNXO 1M57B 3ETEA 2Q7EA 1S5LZ 5EK0A 5LMNB 5LA6A 4MTGA 4X1IA 5KAIZ 4JI5B 2LGWA 1M90W 5JVDB 3VBBA 3K9SA 3AK2A 3ZN1A 4NKGB 5LGTA 4DR4O 3E8BA 2YXYA 1O9HA 4GKKO 1Q3EA 1OV9A 2H3OA 2GTSA 4RQEA 3CRRA 3CCEV 3AK3A 3ZN0A 1WPXA 3KCXA 2RNBA 3OUFA 2Y0PA 4LF6B 1KP2A 1M9NA 3LDDA 2KG7B 3ZIAG 3CCJV 4FLUA 4J9YB 2FYUH 3B77A 2ZM6O 2OTLV 1O9GA 1SQQH 4LF4B 2BTOA 1TVKB 1ZL8B 2C2AA 1NBMG 1N36B 2UXCB 1YJ9V 4E2LA 4I55A 2B1GA 4FM0A 4FM2A 3Q4HB 3CRAA 2CUGA 4YJ2A 3J7AU 4B7KA 1FFXA 2IBZH 3PN1A 5EIBC 1W59A 4CH6A 4K8ZA 1VF5B 2ZD9A 1FYJA 4OX9B 1J95A 4HYOA 1KKDA 2IU0A 3OT7A 2R70A 3HKBB 4F4LA 3N2KA 2KB1A 3U11A 2XAQA 3T1HB 1K7DA 2D2CB 3CS5A 1YZBA 4PDMA 1HNWB 2ZNIA 1WPBA 2CTWA 2ADQB 2DQ0A 1BGYH 4WFHA 4NR1A 2DWDC 1PV0A 2EIJB 3SPHA 5CA3A 4PELA 4Q20A 1NKDA 4AILC 5B1BC 3JCUZ 4I9WA 2IM9A 5LHHA 3ETDA 1BHBA 2Y48A 4B3MB 4UCSA 4TUYA 3CC4V 1CEZA 1R6KA 3W7XA 4I4TB 5B1NA 3AG1B 1N4CA 1K92A 4JI8B 3LNMB 4ICGA 2A9HA 2BTQB 1V54C 1KMIZ 4U3FH 3EHBB 3ZMZA 4NXMO 1Q86W 2DYSB 2ZINA 4LFAB 1VF6A 2EILB 2QJ1A 2EIMC 2A06H 3JATA 5IT9N 2QM4A 2ADPA 3GVMA 1KP3A 2HP8A 2Q7HA 5KHJA 3MHHC 4JAAA 1KYOF 5LA6B 4JI3B 1WB8A 4P30A 2WLKA 2QE7G 3SJCC 2WLHA 1H2MA 1MZFA 1OCCB 3G6BA 4LF9B 3ASOB 3FB7C 3ZRWA 4J41A 2WLMA 1NQTA 3WB2A 3CCVV 2E5LO 2UXDB 3QNEA 1IBLB 1OCOB 4CH3A 1WLEA 3VQWA 3FKSG 2R9AA 2UXBB 2DQ3A 5GTHZ 4QJFB 5KA6A 2A7WA 2RDCA 4DV7O 4DV4B 1HNXB 1B06A 5FNVB 1CXZB 4D7SA 4X1YA 1NS1A 5BZBA 5EYPA 4B3TO 1KU9A 1QNMA 1B6QA 3T2MA 2XAGA 1LUWA 4WBNA 3JASA 1XEQA 3JSLA 4B7EA 4JF3A 4ZOLA 2F66C 4DR4B 1AR1B 1FXHA 2ZT9B 2WLIA 2WPDG 2Z5UA 4DV1B 2HJFC 2QKSA 4DUYO 4FLZA 4GKKB 2GDSA 3N2KB 2ZIMA 1V55B 2DWEC 1B04A 4H33A 2A0LA 2MW2B 2BOCC 2M7WA 2JS3A 2Q69A 5IYDO 4UFZA 3UT5A 3NXSA 4O4LB 1E79G 1XOUA 3I55V 4O4HA 2ZM6B 3IJ4A 3UO3A 1MG1A 2JS5A 4CH5A 5J9PC 3G67A 4CC5A 3CWBH 1G8MA 1CPYA 3ABMB 3CJHA 5TISZ 4IHJA 2ZE7A 3ABLC 3ZJZA 3F7VC 4GT1A 2JJ1G 1JQ0A 3DXRA 1RM1C 2XNDG 5LGNA 3ABKB 2B9ZA 3F7YC 4MSWC 4KHPO 1Q43A 3S3WA 4NTYA 3S3XA 3VQXA 3QF7A 3X2QC 5IYZA 3B8MA 4L8JA 5KMGA 4RAIA 3FYEB 1MSDA 2BOBC 1K3EA 3OUSA 1VF7A 4O2BA 3SJQC 4LCUC 1S5HC 1Z5VA 4OGQB 5EC2C 2OIEA 2RN9A 1G4YB 2AGAA 1IXBA 1M93A 2IJHA 2R72A 2R9IA 2WAMA 3VOUA 3KCYA 3RT3C 5JWPA 4P2ZA 3BHPA 5JH7B 1R3IC 3H1KH 3D36A 3G80A 4MT8A 2JEUA 2F1MA 2YI9A 1XNRO 4YJ3A 4A5UB 2YICA 1JJ2U 3WB0A 3ZRWB 4FLYA 4LF8O 3P3NA 4ZBMA 1URFA 4HAMA 2BSKA 5LXTB 3ZRSA 3C3TA 1I0HA 4NXMB 1JFFA 1V9PA 1BS3A 2ZKOA 1Q90D 3OAAG 4WCEV 3I5DA 1K5QA 1WJZA 2OWOA 1XNQO 1OCZC 4RWUA 1VQMV 1P4RA 1FFTB 2P90A 2VQEO 1P84F 1QQCA 5H6RA 4MTOA 4MVOA 1NJIW 4GX5A 3ZRVA 4PDLA 1L8DA 3JALA 4X1YB 1VQPV 5KHIA 1BQZA 1K73W 2AHYA 5EYPB 3CRCA 2ATKC 1Y76B 3OMIB 3ETGA 4WBNB 3JASB 1W0KG 4ZOLB 2JK5C 2WLIB 3L75H 4O2AB 4N23A 5EIBD 3OD4A 2E5LB 4OXSA 3HPLC 2Q68A 1EZJA 2E74B 2DW4A 3ZBHA 4EKWA 3ZMUA 2YI8A 3EFFK 1COWG 5J2UB 4DUZO 3UT5B 5EBWC 2ZE8A 3H9VA 4QE7A 3BPZA 2JJ2G 4DV7B 4FLTA 3I56V 2QKAA 4X9QA 3L74H 3CJHB 4IHJB 1SQFA 3R66A 2KG7A 4B3TB 4DV3O 1KC8W 1VARA 2DYRC 5LP6B 2PI4A 4Z1VA 4LH7A 1ZL8A 2HFEC 1H8EG 3OTFA 1XL4A 3RVZA 5CB4A 5A2QN 4TT3G 4DUYB 1NR1A 5IYZB 3T1CA 5KMGB 4ZI7A 1YVWA 4U7NA 4YHHO 1SZTA 4O2BB 1DGSA 5B3SB 5H6QA 3W7TA 2L6LA 1TGOA 1NVPD 1QCEA 3UCSC 4ABMA 4ZIBA 1XI1A 2CGNA 2QGNA 1FXKC 1U96A 3AG2C 1UJWB 3TETA 4KHPB 4YJ3B 3W7WA 5LBQA 4DR7O 2QWOB 1DK1A 1AP6A 2ZE6A 1Y74A 1H2KA 3EVKA 3ZMTA 1AVMA 4X62O 3JAKA 1QLEB 5D5QA 3AG4B 2BSKB 2AHZA 4FVMA 2YC0A 2EX3A 3RVYA 3M8AA 3O65A 1JFFB 3SYAA 3CCMV 1PPJH 1GK9A 4X8AA 1BCCH 3LNNA 3JARA 1JX9A 2PF4E 2DOSA 1ZSPA 1HWYA 3UQ8A 4R50A 4JGSA 1YJNV 3AG3B 2EJRA 2UXNA 3KG2A 4JV5O 1XNRB 2X6CA 3DC6A 4K3AA 4LH6A 3KKYA 1BL8A 1QVFU 5HFLA 4LF8B 3FD9A 3ASNB 3H1IH 4X89A 3A0HZ 1Q8IA 2ILMA 5B1AB 1AJPA 1SQPH 2CE4A 2GV9A 2B5UA 1AI5A 1XNQB 3CD6V 2NLJC 1JOYA 3BRCA 1BMFG 4X1KA 2GUZA 1K4DC 2OT5A 2VQEB 3KZIZ 4GZRB 3JAMN 2QWRB 2VS0A 3ZHVA 3RWRD 2OCCC 1NTKH 1VQ6V 5IYCO 4FLXA 4NTXA 4J80A 1BZKA 4NYKA 2KKWA 1ZAUA 1NU1H 5D5PA 3STLC 5L3CA 1FJGO 3H1JH 3H1LH 5FNVA 4B3RO 3OEHG 2ZE5A 2P22C 4BW5A 4I50B 5CB4B 1K4CC 2CK3G 3LUTB 4KP4A 4TV9B 1VMGA 3AG1C 5IJ0B 4LR3A 3K5OA 2JGUA 5LHIA 2F4VO 4F6RB 4ZI7B 3T1YO 3SYCA 3ZHUA 2JDIG 3OM3B 2D3OW 1SA0A 1SKVA 4XBFA 5BMVA 4CBCA 4DUZB 2PTMA 2Q6AA 1ROPA 2UU9O 1AI4A 1Z2GA 2DYSC 3N2GA 3FAVA 2AZ2A 3FB6C 1PP9H 4UVAA 4UUJC 5CBGA 4BIOA 4O4LA 4DV3B 5E1AC 4N21A 1YSCA 3N27A 1ZLZA 4JYYA 4GKJO 2P6JA 2A79B 3IGAC 2H94A 1NTMH 2IH3C 2PYLA 5B5EZ 3EXAA 1XMOO 1JCHA 3W7SA 4W4LA 2IJKA 1Y74B 4K8XA 4DW1A 4YHHB 3JAKB 1VQLV 1OCCC 1EN5A 4DXWA 4DV5O 2IJJA 2P4KA 1EN6A 1XHXA 4IGGA 1H2SB 4JTAB 2HHHO 4JZ2A 3G71V 1AR4A 3CCUV 5CMUA 2YS8A 4KFMA 4UV9A 1JA8A 3SR2C 3J80N 2HR3A 5KHGA 3JARB 2XT9A 1SRYA 1I08A 3DSQA 2W6IG 4CZZA 1ZX3A 2QTOA 2LQTA 3A0RA 2LJ2A 4I5SA 3CMEV 2NN4A 5KHHA 4DR7B 1F4NA 4QPJA 5JH7A 2JGDA 1ORQC 5BR8O 4NXNO 1WB7A 4X62B 1SQBH 3GB7C 3QG5A 1M5IA 4IIJA 3ICXA 4DYLA 1PL4A 3W7UA 3CP1A 3K5NA 4B08A 2QKCA 2LFSA 1VP7A 4GUNA 4BIZA 5IE9A 4JTCB 4DR5O 3SYOA 5LXTA 5B1BB 2DE0X 4PD4F 4WFGA 1AB3A 3U10A 1DF5A 4EFBA 4X1KB 1K5SA 2IH1C 2GUZB 2XTAA 1YCIA 4P9OA 4JPRA 4MVSA 4UCOA 2LW7A 3C3SA 1SZXA 2F43G 3D8CA 3K5LA 1I7FA 1L0NH 3K0DA 2WA3A 1T5EA 4JV5B 3RYHA 1PNLA 3ABMC 4FZ0A 2ZNJA 4JTDB 4JZGA 2ZIOA 5BXZA 1FKAO 1QVGU 1SS3A 3T4ZA 1V54B 3TXSA 2LO1A 2L35A 3ABKC 4TOIA 1VQNV 1GM8A 1SC5B 1NVPB 1Y6XA 1NI8A 3FYIB 1Y76A 2E75B 3E35A 3CXHF 3MHSC 2EIMB 1VQ4V 3SPIA 3OE7G 3F5TA 2GTAA 1QR8A 3P30A 1SA0B 4JI7O 4O2AA 5BMVB 5FL7G 2ODMA 1PL0A 2QDOA 3T4DA 4MVZA 4IT5A 2K9PA 3N2GB 1PKXA 3FAVB 4JI0O 3RBZA 1Q7YW 1DTOA 1VF6C 5J2UA 1MNGA 1XBLA 4TQDA 2EJ7A 1BSMA 3SGIA 3QTCA 2CH7B 4DV0O 1N32O 3BFRA 4B3RB 1N34O 2P4VA 1OCRC 2EINC 1HDJA 2FL4A 5KHKA 4DO2A 1H2NA 2CGOA 1VEWA 1DF4A 1XL6A 5LP6A 3CXCU 4KL1A 2IJIA 4FIPC 2F4VB 3T1YB 3BVOA 1HR0O 3RYIA 3CX5F 3ZHSA 3OEEG 3RYFB 2UU9B 3E22A 2WA4A 4MW3A 2BE3A 3E8HA 4JI2O 3DTUB 5HFMA 2YEVB 4R6ZA 5LGUA 5JCOA 1D5NA 4XDJA 1AI7A 1TUEB 3K04A 4X88A 2PYJA 4GKJB 1KB9F 3R65A 1JPXA 4CS4A 2ZR3A 2X6BA 3OGIB 2QSAA 2UUAO 2HG5C 1U97A 1XMOB 1I5YA 5K1PA 5L3EA 5ITZA 2JGDB 2ITCC 3D3IA 2PGGA 2WLLB 4QNHB 2QWPB 4IIJB 1VIBA 4Z2WA 2DJVA 1QU7A 4DV5B 5EZYA 2Y69B 4NVPA 1WP7A 4LFBO 2Z0AA 2HHHB 1IBMO 3ZMSA 2WSSG 1YF2A 3H1HH 3ABLB 3OR7C 3QO8A 5H2FZ 1B3QA 3JSNA 2CTRA 2NR5A 3LDEA 5JJJB 3L70H 5FLXN 3IAYA 3GWKC 3ABUA 4EFEA 3E86A 1P7BA 4UCRA 1Q82W 3X2QB 4EEQA 1QLNA 3RYHB 2O57A 1AR5A 2E3CA 4K0KO 3ZHRA 5B1OA 4PDRA 4FLWA 2YXHA 5BR8B 1EN4A 4NXNB 1N33O 3IC9A 3CHXA 2XUMA 1BE3H 1GO3F 2UUCO 1M56C 2LP7A 3ZX6A 1VQ8V 3CCSV 3AEIA 3CC7V 4DR5B 5LHGA 1OJHA 1THZA 3SJAC 4MVQA 5H9CA 1SQVH 3JD2A 4H44B 1WN7A 4DR2O 1XDCA 3QO5A 1SF9A 3AG7A 4UXNA 4BAYA 5KUKA 3L71H 4BR6A 3AK1A 1VQOV 1YITV 5GONA 4ZHQA 4DR6O 4PHZA 4X65O 2UUBO 3HR0A 1IZ3A 1F7YA 3OMNB 2W0XA 2P06A 4LNUA 2FB5A 4PI2A 5LOVA 1G1XB 2Q7GA 4X20A 3DGEA 4UB8Z 4OX9O 3D36C 1HNZO 2YIAA 3CB2A 4PA4A 1GN4A 2ZR2A 1FD9A 4FMTA 1OCZB 5IY5C 1HNWO 1Z5WA 2AW9A 1MOFA 3G4SV 2WLJA 3JD0A 1OHHG 4I50A 3RYIB 4GX1A 1KD1W 2Q0OC 3L72H 2GSMB 4FPPA 4JI7B 4TV9A 5IJ0A 3CRMA 2A3QA 2HKOA 3E22B 1BT8A 1W2BU 4C7UA 4F6RA 4JAUA 3B09A 1TUBB 1NTZH 5EBMC 1RSOA 3B40A 1FXVA 4W4KA 4JI0B 4U7OA 1YTFD 1PNKA 2EIKB 2VWJA 4LP8A 1YJWV 4IYIA 4HNAA 1XQ8A 3K58A 3WG7C 1I5XA 4DV0B 4O4JA 3E2EA 1N32B 1J5EO 2BCCH 4UVBA 3UKMA 1N8RW 1N34B 1UFIA 4DV6O 1AJNA 1UPGA 3ZMVA 3P3PA 4EB6B 3U0ZA 2Q73A 3ABTA 1GN2A 4LC1A 5ITZB 2XASA 1NH2D 4J7KA 3MAQA 4FFBA 1M57C 5KA5A 1HR0B 5EZYB 2ZCEA 5C8YB 2CDYA 2Q8VA 1GM7A 1JJOA 3LSSA 3TJTA 4RQFA 2XHBA
chains in the Genus database with same CATH topology
2XAHA 3FB6C 3JYCA 4QPKA 4TWKA 2XAGA 1GTOA 5B1AC 4UVAA 1R73A 4UUJC 1OZ0A 5CBGA 5E1AC 2YSUB 4N21A 1M1KW 1YSCA 4GX2A 1EFRG 4JF3A 4TSFG 2DYRB 2ZXWB 2P6JA 1FXHA 1AR1B 2WLIA 2WPDG 2A79B 2Z5UA 2HJFC 3IGAC 2H94A 2QKSA 4QE9A 2IH3C 3OFNG 4BIUA 3M99B 1S76D 3K06A 2QA4V 1JCHA 3W7SA 1V55B 2DWEC 2IJKA 4H33A 5DN6G 2A0LA 1YI2V 2JEXA 2BOCC 4XDLA 3CPWU 1VQLV 1OCCC 2M7WA 1FXKA 4DXWA 2Q69A 4R7CA 5IYDO 2EIKC 2WLNA 2IJJA 3NXSA 1E79G 4Z1MG 1R3LC 5GW7A 3I55V 2HVJC 5B3SC 4JTAB 3CMAV 2EZOA 1MG1A 1PNMA 5J9PC 4GCZA 1E1RG 3G71V 1G8MA 2MK3A 1CPYA 3ABMB 5L3GA 3CCUV 5CMUA 3ABLC 1QR9A 2QM7A 3ZJZA 3F7VC 2P7TC 4KFMA 4UV9A 4GT1A 4MVRA 4JYCA 2HR3A 2JJ1G 1JQ0A 3FB8C 1SRYA 3HB3B 1F4MA 4PDVA 1RM1C 2XNDG 5LGNA 3ABKB 4XDKA 2IU3A 2ZQMA 3B8NA 2W6IG 3F7YC 4CZZA 3SPJA 4MSWC 2QTOA 3AG2B 3A0RA 4WFBV 4I5SA 3CMEV 3F5WC 3ML0A 3X2QC 1KQSU 1CP9A 3B8MA 4RAIA 5L3FA 5C93A 2XAFA 3FYEB 4MS2A 3E89A 4PA3A 1F4NA 4QPJA 1QLEC 1JVMA 3AG4C 2EIJC 5IYBO 1ORQC 1ENVA 1R3JC 2BOBC 3OR6C 1K3EA 3OUSA 3GB7C 3SJQC 3TK1A 4PA6A 4HZ3A 2ZXWC 3W7UA 5IDJA 3CP1A 4LCUC 1S5HC 4ZKIA 3E8FA 5EC2C 3JD4A 1MSWD 1M56B 2LFSA 4BIZA 4QIWF 3OMAB 4WFFA 4JTCB 3CC2V 1G4YB 3SYOA 5B1BB 5L3BA 4YXWG 1H8HG 4WFGA 2IJHA 2WAMA 2R9IA 5CBHA 3CCQV 3VOUA 3QO7A 1DF5A 2Z3YA 1S3JA 1K5SA 4P2ZA 2IH1C 1H38A 3P32A 5KUMA 4P9OA 1R3IC 4JPRA 4MVSA 1BHAA 3AG3C 1R3KC 3D36A 3SPGA 4MT8A 2JEUA 3UM7A 2F43G 3LSQA 2ITDC 3SYQA 4RUEA 3K0DA 1YHQV 2HLDG 1PNLA 3FB5C 1E1QG 3ABMC 4MTFA 1JJ2U 4JTDB 3ZRWB 1VQ9V 4ZBMA 4HAMA 2W0FC 1QVGU 2HVKC 1V54B 3T4ZA 3ASNC 3ZRSA 3ABKC 1VQNV 1GM8A 2Q67A 1NVPB 2EILC 1VQ7V 3FYIB 1EBOA 3E35A 4H37A 4UV8A 3OW2U 1K33A 3OAAG 3MHSC 4WCEV 4MW8A 1K8AW 1K5QA 2EIMB 3MD0A 1VQ4V 1OCZC 2LFRA 2FTKA 2ZDIC 3SPIA 3E83A 1VQMV 1P4RA 3OE7G 3ZRXA 3LDCA 3RW0A 3SPCA 1FFTB 2P90A 5H6RA 5IY5B 1QR8A 3P30A 3JCZA 4MTOA 5FL7G 3E8GA 4MVOA 1NJIW 1PL0A 4GX5A 3T4DA 2K1EA 2XAJA 4MVZA 3ZRVA 2EZPA 4PDLA 1VQPV 1PKXA 2OCCB 1Q7YW 3RBZA 1K73W 2AHYA 1DTOA 4WF9V 4G2KA 2XOKG 3JD1A 2ATKC 4JAVA 3ASOC 3OMIB 3ETGA 5CBFA 4G28B 2V1DA 1W0KG 2NNUA 3CYOA 1F23A 2JK5C 3JD3A 2WLIB 3WG7B 4PA9A 1SESA 1OCRC 1Y66A 2EINC 2UXXA 4DO2A 1QBZA 4N23A 2YEVA 1DF4A 1OCOC 1XL6A 2X6AA 3CXCU 1S0VA 4OXSA 3HPLC 2Q68A 1EZJA 4G27B 2R9RB 2DW4A 4EKWA 2IJIA 4FIPC 3ZMUA 1KECA 2ZDIA 1FXKB 3TCUA 1Q81W 3EFFK 1COWG 1AI6A 1SETA 4UVCA 1FS0G 5CN0A 5EBWC 3SYPA 3OEEG 1M57B 3ETEA 4QE7A 5EK0A 3STZC 2JJ2G 4MW3A 4MTGA 3E8HA 3I56V 3K08A 2WLLA 1YIJV 1KC8W 2OTJV 3DTUB 3VBBA 1M90W 5HFMA 2YEVB 1GKFA 1S72V 2DYRC 3GWOA 4R6ZA 3ZN1A 2PI4A 3CCRV 5LGUA 5LGTA 3E8BA 4XDJA 2GHYA 1AI7A 1TUEB 3K04A 2HFEC 4X88A 1H8EG 2W6JG 1XL4A 4RQEA 3RVZA 3CCEV 3R65A 1JPXA 2ZR3A 3WFVA 2X6BA 1V55C 4TT3G 3OGCC 1NR1A 3T1CA 5L3DA 4LBEC 2HG5C 3ZN0A 1WPXA 1I5YA 5L3EA 4U7NA 3OUFA 4MVUA 1SZTA 2ITCC 1KP2A 3D3IA 1M9NA 3LDDA 2WLLB 4QNHB 3ZIAG 3CCJV 4J9YB 3B77A 3BEHA 2Y69B 2OTLV 1R6NA 1YTFB 5B3SB 3H01A 2C2AA 5H6QA 3W7TA 1NBMG 1MABG 1YJ9V 4E2LA 2V7QG 3ZMSA 2WSSG 4FJCC 1NR7A 2B1GA 1NVPD 1QCEA 3ABLB 3OR7C 3QO8A 1Y4MA 1FXKC 3K79A 3LDEA 2ZD9A 3AG2C 3ABUA 1UJWB 1J95A 3E86A 4HYOA 1KKDA 1P7BA 2IU0A 3TETA 1NH2B 3W7WA 4F4LA 2H8PC 2KB1A 5LBQA 2XAQA 1Q82W 1K7DA 1W0JG 3X2QB 4PDMA 1QLNA 2X7RB 4WFAV 4JASA 2DQ0A 4WFHA 3ZMTA 5B1OA 3ZCCA 4PDRA 2DWDC 1QLEB 3AG4B 2EIJB 3SPHA 5CA3A 2AHZA 4PELA 4Q20A 3PJSK 3RVYA 2IW5A 1GO3F 1M56C 1NKDA 3SYAA 3CCMV 1ZWIC 5DM6V 2LP7A 1GK9A 1SERA 4X8AA 5B1BC 4I9WA 1VQ8V 4JYBA 3CCSV 3AEIA 1PD3A 3CC7V 5LHHA 3ETDA 5LHGA 1THZA 1JX9A 1VQKV 1BHBA 4MVQA 5H9CA 2Y48A 1HWYA 3JD2A 4R50A 4JGSA 3CC4V 1CEZA 1YJNV 3K03A 3QO5A 4UXNA 1R6KA 3W7XA 2QM8A 3IFXA 4BAYA 5B1NA 3AG1B 2Y69C 3AG3B 2EJRA 1K92A 2UXNA 3KG2A 5KUKA 3CCLV 1K9MW 1VQOV 3LNMB 2X6CA 4RUFA 1YITV 4FK5C 2A9HA 3BY6A 1BL8A 1V54C 5HFLA 1QVFU 3OMNB 2X0LA 3EHBB 3ZMZA 4J9ZB 1Q86W 2DYSB 2JIZG 3ASNB 5EC1C 1K97A 3DGEA 4X89A 2EILB 3IC7A 2EIMC 1S77D 4PA4A 5B1AB 2ZR2A 1AJPA 1K34A 4FMTA 3CD6V 2B5UA 1AI5A 1JOYA 2NLJC 1OCZB 5IY5C 1KP3A 1MOFA 3G4SV 4P9PA 1BMFG 1RPOA 2P67A 2WLJA 3JD0A 1OHHG 4ASUG 2PI5A 4GX1A 4PA7A 1K4DC 2B1IA 2OT5A 1KD1W 2GSMB 4FPPA 3MHHC 2HKOA 2OCCC 1W2BU 4JAUA 5EBMC 1VQ6V 4P30A 5IYCO 2WLKA 2QE7G 4L87A 1FXVA 4U7OA 1YTFD 2WLHA 1AJQA 1OCCB 2WWWA 4RO2A 1PNKA 3STLC 4GX0A 1GM9A 3ASOB 2EIKB 3FB7C 4LP8A 3G6EV 1LNQA 1YJWV 3ZRWA 1VQ5V 3K3WA 5L3CA 2QEXV 3OEHG 3WG7C 1I5XA 4KUMA 4BW5A 3E2EA 4UVBA 3UKMA 1N8RW 2WLMA 1NQTA 4WFEA 1DLBA 1K4CC 3CCVV 2CK3G 1H2GA 1AJNA 3LUTB 4KP4A 4MVMA 3ZMVA 1OCRB 2EINB 3AG1C 3ABTA 3QNEA 2EBOA 5EBLC 1F51A 1GMGA 4LC1A 5LHIA 1OCOB 3SYCA 2XASA 1WLEA 1RM1B 1NH2D 1IXMA 3K9AA 3FKSG 3K0GA 2JDIG 3OM3B 2D3OW 1M57C 2DQ3A 5KA5A 4XBFA 4QJFB 4CBCA 5KA6A 2Q6AA 4MTXA 1ROPA 1L1FA 1RPRA 1AI4A 4R8CA 1GM7A 1AROP 2DYSC 3LSSA 4RQFA 5BZBA 1B6QA 3T2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB6 C;  2WLL A;  3JYC A;  3K03 A;  4TWK A;  1R3I C;  4MVS A;  5B1A C;  3AG3 C;  1R3K C;  3SPG A;  4UUJ C;  3IFX A;  3UM7 A;  5CBG A;  2DYR C;  4R6Z A;  2Y69 C;  5E1A C;  4GX2 A;  3KG2 A;  5KUK A;  3E8B A;  2ITD C;  4XDJ A;  3SYQ A;  3LNM B;  2X6C A;  3K0D A;  4RUE A;  4RUF A;  3K04 A;  2HFE C;  4X88 A;  3FB5 C;  3ABM C;  4MTF A;  1XL4 A;  2WLI A;  2A79 B;  2HJF C;  3IGA C;  4JTD B;  2QKS A;  2A9H A;  3R65 A;  2IH3 C;  4QE9 A;  3RVZ A;  2X6B A;  4ZBM A;  1V55 C;  1BL8 A;  1V54 C;  3OGC C;  2W0F C;  3K06 A;  3T1C A;  2DWE C;  4LBE C;  2HG5 C;  2HVK C;  3T2M A;  3ASN C;  3T4Z A;  3ZRS A;  3ABK C;  4H33 A;  4J9Z B;  2A0L A;  2Q67 A;  2EIL C;  5EC1 C;  3OUF A;  4MVU A;  2ITC C;  2BOC C;  4X89 A;  4XDL A;  1OCC C;  3LDD A;  2WLL B;  4DXW A;  4QNH B;  2Q69 A;  2EIM C;  4H37 A;  4R7C A;  2EIK C;  4PA4 A;  2WLN A;  4MW8 A;  4J9Y B;  1OCZ C;  1R3L C;  3BEH A;  3SPI A;  3E83 A;  2HVJ C;  2NLJ C;  5B3S C;  4JTA B;  5IY5 C;  3LDC A;  3RW0 A;  3SPC A;  4P9P A;  5J9P C;  2WLJ A;  4GX1 A;  4PA7 A;  1K4D C;  4MTO A;  3E8G A;  3ABL C;  4MVO A;  3F7V C;  2P7T C;  4GX5 A;  4KFM A;  3ZJZ A;  4MVR A;  3T4D A;  2K1E A;  4MVZ A;  3OR7 C;  2OCC C;  3FB8 C;  4PDL A;  5EBM C;  4PDV A;  4P30 A;  3RBZ A;  2AHY A;  2WLK A;  4XDK A;  3LDE A;  2ZD9 A;  2ATK C;  3AG2 C;  3ASO C;  3F7Y C;  2WLH A;  3SPJ A;  4RO2 A;  4MSW C;  3STL C;  2QTO A;  1J95 A;  4GX0 A;  3E86 A;  4HYO A;  5CBF A;  4G28 B;  1KKD A;  1P7B A;  3FB7 C;  4LP8 A;  1LNQ A;  3TET A;  3F5W C;  3X2Q C;  4F4L A;  2H8P C;  2KB1 A;  2JK5 C;  4RAI A;  3WG7 C;  4PDM A;  4MS2 A;  3E89 A;  4PA3 A;  2WLI B;  4BW5 A;  4WFH A;  4PA9 A;  3UKM A;  1QLE C;  1JVM A;  2WLM A;  3AG4 C;  2EIJ C;  4WFE A;  1OCR C;  2EIN C;  4PDR A;  1ORQ C;  1K4C C;  2DWD C;  1R3J C;  2BOB C;  3LUT B;  3OR6 C;  4MVM A;  3OUS A;  3SPH A;  2YEV A;  3AG1 C;  3GB7 C;  2AHZ A;  1OCO C;  5EBL C;  1XL6 A;  2X6A A;  3SJQ C;  4PA6 A;  4OXS A;  3HPL C;  2Q68 A;  3PJS K;  4G27 B;  3RVY A;  2R9R B;  4HZ3 A;  3SYC A;  2ZXW C;  4EKW A;  4LCU C;  1S5H C;  3E8F A;  3K0G A;  3TCU A;  5EC2 C;  3EFF K;  1M56 C;  3SYA A;  1ZWI C;  1M57 C;  4X8A A;  5EBW C;  5B1B C;  3SYP A;  4CBC A;  4I9W A;  2Q6A A;  4WFF A;  4JTC B;  4QE7 A;  1G4Y B;  3SYO A;  5EK0 A;  4WFG A;  4R8C A;  3STZ C;  5CBH A;  4MW3 A;  4MTG A;  3VOU A;  2DYS C;  4MVQ A;  3E8H A;  4P2Z A;  2IH1 C;  5BZB A;  4R50 A;  3K08 A;  5KUM A;  4P9O A; 
#chains in the Genus database with same CATH topology
 1GTO A;  5B1A C;  4JI2 B;  4AQY O;  4F6E A;  4LWS A;  2YSU B;  4H0L B;  4GX2 A;  1EFR G;  4TSF G;  2DYR B;  2ZXW B;  2VWK A;  3HKE A;  1LUV A;  1XMQ O;  4J11 A;  3M99 B;  1S76 D;  5KAF Z;  3UO2 A;  1XUQ A;  2EUL A;  4I0X A;  2UUA B;  3FFQ A;  3ZED A;  3CPW U;  3B2E E;  2VQF O;  4R7C A;  1SQG A;  4UCV A;  1KUQ A;  4GLX A;  4Z1M G;  1R3L C;  4J10 A;  5GW7 A;  3CMA V;  5LL6 Y;  1FAF A;  1D2D A;  2EZO A;  4CS2 A;  1PNM A;  4GCZ A;  1E1R G;  4DV2 O;  2MK3 A;  4LFB B;  4FFK A;  2QM7 A;  1IBM B;  4JI6 O;  4MVR A;  3FB8 C;  3HB3 B;  1F4M A;  3MDS A;  4XDK A;  2F93 B;  4YY3 O;  2ZQM A;  3B8N A;  3K5M A;  3SPJ A;  3AG2 B;  1Q6H A;  4WFB V;  2QTS A;  1CP9 A;  4B3S O;  5GON B;  2XAF A;  4ZHQ B;  5C93 A;  4DK0 A;  3E89 A;  2F23 A;  2EIJ C;  4UCT A;  5IYB O;  1G6U A;  1YXB A;  3CE2 A;  1R3J C;  4K0K B;  4LNU B;  1GN6 A;  4CC6 A;  3TK1 A;  4PA6 A;  3SDL A;  5LOV B;  1D5A A;  1SQX H;  4HZ3 A;  4X20 B;  1N33 B;  4ZKI A;  4JI4 O;  3JD4 A;  3B4S A;  4DV1 O;  2UUC B;  3HKC B;  5F2V O;  1R6T A;  4TV8 A;  3OMA B;  4WFF A;  1Q6U A;  3CC2 V;  3HKD A;  1WP8 A;  3QO7 A;  4LF7 O;  1RP3 B;  1H38 A;  3P32 A;  2OCH A;  4DR2 B;  4X66 O;  1BHA A;  1R3K C;  4JI1 O;  3UM7 A;  2QR4 A;  5DEC A;  4FLV A;  1RSO B;  3RGB A;  2ITD C;  4RUE A;  3OTO O;  1YHQ V;  4AI8 A;  1E1Q G;  5KX5 A;  4DR6 B;  4X65 B;  2UUB B;  1VQ9 V;  4HNA B;  1P7G A;  1ZTE A;  1Y67 A;  1M4U A;  4O4J B;  3L73 H;  2EIL C;  1IVS A;  1EBO A;  3BAA A;  3OW2 U;  4MW8 A;  5JJE B;  1HNZ B;  3MD0 A;  1EM1 A;  2ZDI C;  4J7J A;  2CH7 A;  3E83 A;  1JMK C;  3ZRX A;  4FZ1 A;  3LDC A;  3SPC A;  2JRI A;  1QHT A;  4FFB B;  4YIO A;  1GAX A;  3C90 A;  4KXR A;  4X64 O;  1HW7 A;  2K1E A;  2XAJ A;  3FX7 A;  2DMX A;  2OCC B;  4G2K A;  3ASO C;  3VQV A;  1AIL A;  4DRX A;  4LFC O;  5CBF A;  3ETQ A;  3CRQ A;  4LWS B;  4PI0 A;  3RYF A;  3A2F A;  2KSD A;  3CYO A;  3BA9 A;  5BY1 A;  4DR1 O;  3A0B Z;  3HKE B;  1IBK O;  3BCC H;  1SES A;  1Y66 A;  2OIG A;  1J5E B;  1QBZ A;  2YEV A;  1OCO C;  4DV6 B;  2VRZ A;  4I0X B;  1S0V A;  4G27 B;  2R9R B;  1Q81 W;  4JYA O;  1GRJ A;  4UVC A;  3STZ C;  3CEI A;  2E76 B;  4DR3 O;  2HJD A;  2Y4U A;  5AG2 A;  1YDX A;  3K08 A;  2WLL A;  1YIJ V;  2OTJ V;  2CTQ A;  1GKF A;  1S72 V;  3GWO A;  1KKC A;  3CCR V;  4AQY B;  2RQ6 A;  2GHY A;  2DN9 A;  2Q5Z A;  2W6J G;  2FKX A;  3WFV A;  1NZ6 A;  1V55 C;  3OGC C;  5L3D A;  4LBE C;  1XMQ B;  4X1I B;  4MVU A;  5E79 Z;  1XRE A;  3A8T A;  2VQF B;  3BEH A;  1R6N A;  1YTF B;  4O4I A;  2KQX A;  3H01 A;  1MAB G;  2V7Q G;  5IWA O;  4TV8 B;  4FJC C;  1NR7 A;  4DV2 B;  4DK1 A;  3HKD B;  1MA1 A;  1Y4M A;  4D6T H;  4JI6 B;  4GYC B;  3K79 A;  3QVN A;  2GBO A;  2YUA A;  4YY3 B;  1RFY A;  4YIP A;  1NH2 B;  2YXL A;  2N04 A;  2H8P C;  2CTP A;  1W0J G;  4B3S B;  2YIB D;  2X7R B;  4WFA V;  4JAS A;  5KX5 B;  3ZCC A;  4UB6 Z;  4I55 B;  4YJ2 B;  1FFX B;  3PJS K;  2HEP A;  4IYH A;  2IW5 A;  1PM9 A;  3LSU A;  3ZS8 C;  2LGQ A;  1ZWI C;  5DM6 V;  2F95 B;  4JI4 B;  1N0J A;  1SER A;  4JYB A;  2AZ0 A;  1PD3 A;  4QGP A;  1VQK V;  1FJG B;  4LF7 B;  4CH4 A;  3K03 A;  2Y4T A;  1IDS A;  2QM8 A;  3IFX A;  4X66 B;  2Y69 C;  4JI1 B;  4HBN A;  5CA1 A;  3CCL V;  1K9M W;  4RUF A;  4OPA A;  4FK5 C;  1Q5O A;  4DRX B;  3OTO B;  1X4T A;  2LW1 A;  2V4D A;  3BY6 A;  1X59 A;  2X0L A;  1TUB A;  5LYJ A;  4J9Z B;  2JIZ G;  5EC1 C;  1NT2 B;  1K97 A;  4TUY B;  2QWN B;  1L0L H;  1I94 O;  3IC7 A;  4Q6G A;  1S77 D;  1K34 A;  4NTW A;  1TA8 A;  5B66 Z;  4P9P A;  1RPO A;  2P67 A;  2PI5 A;  4ASU G;  4PA7 A;  2B1I A;  1WA8 A;  4EB6 A;  4X64 B;  1XIL A;  5JJN B;  4BW9 A;  4L87 A;  5JQG A;  2PZS A;  3J81 N;  2WWW A;  1AJQ A;  5LMU O;  4RO2 A;  4GX0 A;  1EZV H;  1GM9 A;  3JAT B;  3G6E V;  2Y0I A;  1LNQ A;  4LF5 O;  4LFC B;  1VQ5 V;  3K3W A;  5C8Y A;  2QEX V;  1S5J A;  4KUM A;  4DR1 B;  1IUR A;  4E4E A;  4WFE A;  1IBK B;  1DLB A;  5IJ9 A;  1N0N A;  4MVM A;  1H2G A;  1OCR B;  2EIN B;  2EBO A;  5EBL C;  4BWA A;  1F51 A;  1GMG A;  4U3J A;  2CAZ C;  1RM1 B;  1IXM A;  3K9A A;  5J2T A;  3K0G A;  3RYC A;  1IX9 A;  1A32 A;  1H2L A;  4JYA B;  4IL6 Z;  4MTX A;  4I9Q A;  1L1F A;  1RPR A;  5LMN O;  1JR9 A;  2YIB A;  1AP5 A;  4R8C A;  3BAB A;  4H13 B;  4O4I B;  1ARO P;  4JI5 O;  2PUS A;  3L9D A;  3WU2 Z;  4DR3 B;  2XAH A;  4TWK A;  3JYC A;  4QPK A;  3TGU H;  3JAW A;  4K35 A;  5LP6 C;  1FPO A;  1R73 A;  1OZ0 A;  3TXQ A;  1M1K W;  5FPR A;  2OYQ A;  5H5N A;  4BIU A;  4QE9 A;  3OFN G;  3K06 A;  4PJ0 Z;  3RFR A;  2QA4 V;  4FM1 A;  5DN6 G;  4LF6 O;  1YI2 V;  2JEX A;  5CA0 A;  4OPH A;  4XDL A;  1FXK A;  4PV1 B;  2G38 A;  2EIK C;  2WLN A;  2ETN A;  5JCO C;  4LF4 O;  2HVJ C;  5B3S C;  2N05 A;  1N36 O;  2UXC O;  3ZHQ A;  2PY5 A;  4NB5 A;  5L3G A;  2Q4P A;  1BQ0 A;  1QR9 A;  2AXT Z;  1XHZ A;  2P7T C;  5KLV H;  5IWA B;  4JYC A;  5JVD A;  4J7Z A;  1US6 A;  4PDV A;  2IU3 A;  3HKC A;  1ZUQ A;  2RMK B;  3T1H O;  3F5W C;  3ML0 A;  1KQS U;  5CA1 B;  3DC5 A;  4O4H B;  5L3F A;  4DW0 A;  1GH6 A;  4MS2 A;  4PA3 A;  1QLE C;  1JVM A;  3AG4 C;  3CSX A;  5GTI Z;  1ENV A;  3APQ A;  3OR6 C;  3K59 A;  5LYJ B;  2QWQ B;  2ZXW C;  3DXR B;  5IDJ A;  2M6Y A;  1KBH A;  3E8F A;  1TVK A;  1MSW D;  1M56 B;  2YDE A;  4QIW F;  5L3B A;  3Q4H A;  4YXW G;  1H8H G;  4UCU A;  5CBH A;  3CCQ V;  5A9G A;  4B3M O;  2Z3Y A;  1S3J A;  1WA8 B;  5KUM A;  3VQY A;  1P49 A;  3AG3 C;  3SPG A;  2P5O A;  4JI8 O;  3LSQ A;  3ZHT A;  2FML A;  1WAZ A;  3HKB A;  3SYQ A;  4D7T A;  5JQG B;  2HLD G;  3FB5 C;  3M7M X;  4MTF A;  1YEW A;  2N74 A;  3O9O A;  4I7Z B;  2W0F C;  2HVK C;  3ASN C;  2JVD A;  5DED A;  4CS3 A;  2Q67 A;  5FPO A;  1VQ7 V;  4LFA O;  1HP8 A;  5IJ9 B;  2RJZ A;  4H37 A;  1Q6I A;  4UV8 A;  2Q0A A;  1K33 A;  1I94 B;  1K8A W;  4U3J B;  2LFR A;  2FTK A;  5J2T B;  2Q9L A;  3RN4 A;  3D3Q A;  3RW0 A;  3RYC B;  5IY5 B;  4TQF A;  3JCZ A;  1GN3 A;  3E8G A;  4JI3 O;  1TAE A;  4I4T A;  3NR7 A;  2EZP A;  3BA8 A;  4WF9 V;  2XOK G;  3JD1 A;  4JAV A;  4LF9 O;  1LR1 A;  3JAW B;  4G28 B;  5LMU B;  1MZE A;  2BTQ A;  2V1D A;  1R1B A;  2NNU A;  3SJB C;  4LF5 B;  1F23 A;  3JD3 A;  5K1X A;  3WG7 B;  4PA9 A;  3K57 A;  2UXX A;  2ARH A;  2UXD O;  4J42 A;  1MMM A;  2RCV A;  1IBL O;  3APO A;  2YID A;  2X6A A;  1WNS A;  3JAL B;  2UXB O;  3WB1 A;  5CA0 B;  1KEC A;  2ZDI A;  1FXK B;  3TCU A;  4AHC A;  1AI6 A;  1SET A;  1FS0 G;  5CN0 A;  3SYP A;  3THO A;  4DV4 O;  1HNX O;  1M57 B;  3ETE A;  2Q7E A;  1S5L Z;  5EK0 A;  5LMN B;  5LA6 A;  4MTG A;  4X1I A;  5KAI Z;  4JI5 B;  2LGW A;  1M90 W;  5JVD B;  3VBB A;  3K9S A;  3AK2 A;  3ZN1 A;  4NKG B;  5LGT A;  4DR4 O;  3E8B A;  2YXY A;  1O9H A;  4GKK O;  1Q3E A;  1OV9 A;  2H3O A;  2GTS A;  4RQE A;  3CRR A;  3CCE V;  3AK3 A;  3ZN0 A;  1WPX A;  3KCX A;  2RNB A;  3OUF A;  2Y0P A;  4LF6 B;  1KP2 A;  1M9N A;  3LDD A;  2KG7 B;  3ZIA G;  3CCJ V;  4FLU A;  4J9Y B;  2FYU H;  3B77 A;  2ZM6 O;  2OTL V;  1O9G A;  1SQQ H;  4LF4 B;  2BTO A;  1TVK B;  1ZL8 B;  2C2A A;  1NBM G;  1N36 B;  2UXC B;  1YJ9 V;  4E2L A;  4I55 A;  2B1G A;  4FM0 A;  4FM2 A;  3Q4H B;  3CRA A;  2CUG A;  4YJ2 A;  3J7A U;  4B7K A;  1FFX A;  2IBZ H;  3PN1 A;  5EIB C;  1W59 A;  4CH6 A;  4K8Z A;  1VF5 B;  2ZD9 A;  1FYJ A;  4OX9 B;  1J95 A;  4HYO A;  1KKD A;  2IU0 A;  3OT7 A;  2R70 A;  3HKB B;  4F4L A;  3N2K A;  2KB1 A;  3U11 A;  2XAQ A;  3T1H B;  1K7D A;  2D2C B;  3CS5 A;  1YZB A;  4PDM A;  1HNW B;  2ZNI A;  1WPB A;  2CTW A;  2ADQ B;  2DQ0 A;  1BGY H;  4WFH A;  4NR1 A;  2DWD C;  1PV0 A;  2EIJ B;  3SPH A;  5CA3 A;  4PEL A;  4Q20 A;  1NKD A;  4AIL C;  5B1B C;  3JCU Z;  4I9W A;  2IM9 A;  5LHH A;  3ETD A;  1BHB A;  2Y48 A;  4B3M B;  4UCS A;  4TUY A;  3CC4 V;  1CEZ A;  1R6K A;  3W7X A;  4I4T B;  5B1N A;  3AG1 B;  1N4C A;  1K92 A;  4JI8 B;  3LNM B;  4ICG A;  2A9H A;  2BTQ B;  1V54 C;  1KMI Z;  4U3F H;  3EHB B;  3ZMZ A;  4NXM O;  1Q86 W;  2DYS B;  2ZIN A;  4LFA B;  1VF6 A;  2EIL B;  2QJ1 A;  2EIM C;  2A06 H;  3JAT A;  5IT9 N;  2QM4 A;  2ADP A;  3GVM A;  1KP3 A;  2HP8 A;  2Q7H A;  5KHJ A;  3MHH C;  4JAA A;  1KYO F;  5LA6 B;  4JI3 B;  1WB8 A;  4P30 A;  2WLK A;  2QE7 G;  3SJC C;  2WLH A;  1H2M A;  1MZF A;  1OCC B;  3G6B A;  4LF9 B;  3ASO B;  3FB7 C;  3ZRW A;  4J41 A;  2WLM A;  1NQT A;  3WB2 A;  3CCV V;  2E5L O;  2UXD B;  3QNE A;  1IBL B;  1OCO B;  4CH3 A;  1WLE A;  3VQW A;  3FKS G;  2R9A A;  2UXB B;  2DQ3 A;  5GTH Z;  4QJF B;  5KA6 A;  2A7W A;  2RDC A;  4DV7 O;  4DV4 B;  1HNX B;  1B06 A;  5FNV B;  1CXZ B;  4D7S A;  4X1Y A;  1NS1 A;  5BZB A;  5EYP A;  4B3T O;  1KU9 A;  1QNM A;  1B6Q A;  3T2M A;  2XAG A;  1LUW A;  4WBN A;  3JAS A;  1XEQ A;  3JSL A;  4B7E A;  4JF3 A;  4ZOL A;  2F66 C;  4DR4 B;  1AR1 B;  1FXH A;  2ZT9 B;  2WLI A;  2WPD G;  2Z5U A;  4DV1 B;  2HJF C;  2QKS A;  4DUY O;  4FLZ A;  4GKK B;  2GDS A;  3N2K B;  2ZIM A;  1V55 B;  2DWE C;  1B04 A;  4H33 A;  2A0L A;  2MW2 B;  2BOC C;  2M7W A;  2JS3 A;  2Q69 A;  5IYD O;  4UFZ A;  3UT5 A;  3NXS A;  4O4L B;  1E79 G;  1XOU A;  3I55 V;  4O4H A;  2ZM6 B;  3IJ4 A;  3UO3 A;  1MG1 A;  2JS5 A;  4CH5 A;  5J9P C;  3G67 A;  4CC5 A;  3CWB H;  1G8M A;  1CPY A;  3ABM B;  3CJH A;  5TIS Z;  4IHJ A;  2ZE7 A;  3ABL C;  3ZJZ A;  3F7V C;  4GT1 A;  2JJ1 G;  1JQ0 A;  3DXR A;  1RM1 C;  2XND G;  5LGN A;  3ABK B;  2B9Z A;  3F7Y C;  4MSW C;  4KHP O;  1Q43 A;  3S3W A;  4NTY A;  3S3X A;  3VQX A;  3QF7 A;  3X2Q C;  5IYZ A;  3B8M A;  4L8J A;  5KMG A;  4RAI A;  3FYE B;  1MSD A;  2BOB C;  1K3E A;  3OUS A;  1VF7 A;  4O2B A;  3SJQ C;  4LCU C;  1S5H C;  1Z5V A;  4OGQ B;  5EC2 C;  2OIE A;  2RN9 A;  1G4Y B;  2AGA A;  1IXB A;  1M93 A;  2IJH A;  2R72 A;  2R9I A;  2WAM A;  3VOU A;  3KCY A;  3RT3 C;  5JWP A;  4P2Z A;  3BHP A;  5JH7 B;  1R3I C;  3H1K H;  3D36 A;  3G80 A;  4MT8 A;  2JEU A;  2F1M A;  2YI9 A;  1XNR O;  4YJ3 A;  4A5U B;  2YIC A;  1JJ2 U;  3WB0 A;  3ZRW B;  4FLY A;  4LF8 O;  3P3N A;  4ZBM A;  1URF A;  4HAM A;  2BSK A;  5LXT B;  3ZRS A;  3C3T A;  1I0H A;  4NXM B;  1JFF A;  1V9P A;  1BS3 A;  2ZKO A;  1Q90 D;  3OAA G;  4WCE V;  3I5D A;  1K5Q A;  1WJZ A;  2OWO A;  1XNQ O;  1OCZ C;  4RWU A;  1VQM V;  1P4R A;  1FFT B;  2P90 A;  2VQE O;  1P84 F;  1QQC A;  5H6R A;  4MTO A;  4MVO A;  1NJI W;  4GX5 A;  3ZRV A;  4PDL A;  1L8D A;  3JAL A;  4X1Y B;  1VQP V;  5KHI A;  1BQZ A;  1K73 W;  2AHY A;  5EYP B;  3CRC A;  2ATK C;  1Y76 B;  3OMI B;  3ETG A;  4WBN B;  3JAS B;  1W0K G;  4ZOL B;  2JK5 C;  2WLI B;  3L75 H;  4O2A B;  4N23 A;  5EIB D;  3OD4 A;  2E5L B;  4OXS A;  3HPL C;  2Q68 A;  1EZJ A;  2E74 B;  2DW4 A;  3ZBH A;  4EKW A;  3ZMU A;  2YI8 A;  3EFF K;  1COW G;  5J2U B;  4DUZ O;  3UT5 B;  5EBW C;  2ZE8 A;  3H9V A;  4QE7 A;  3BPZ A;  2JJ2 G;  4DV7 B;  4FLT A;  3I56 V;  2QKA A;  4X9Q A;  3L74 H;  3CJH B;  4IHJ B;  1SQF A;  3R66 A;  2KG7 A;  4B3T B;  4DV3 O;  1KC8 W;  1VAR A;  2DYR C;  5LP6 B;  2PI4 A;  4Z1V A;  4LH7 A;  1ZL8 A;  2HFE C;  1H8E G;  3OTF A;  1XL4 A;  3RVZ A;  5CB4 A;  5A2Q N;  4TT3 G;  4DUY B;  1NR1 A;  5IYZ B;  3T1C A;  5KMG B;  4ZI7 A;  1YVW A;  4U7N A;  4YHH O;  1SZT A;  4O2B B;  1DGS A;  5B3S B;  5H6Q A;  3W7T A;  2L6L A;  1TGO A;  1NVP D;  1QCE A;  3UCS C;  4ABM A;  4ZIB A;  1XI1 A;  2CGN A;  2QGN A;  1FXK C;  1U96 A;  3AG2 C;  1UJW B;  3TET A;  4KHP B;  4YJ3 B;  3W7W A;  5LBQ A;  4DR7 O;  2QWO B;  1DK1 A;  1AP6 A;  2ZE6 A;  1Y74 A;  1H2K A;  3EVK A;  3ZMT A;  1AVM A;  4X62 O;  3JAK A;  1QLE B;  5D5Q A;  3AG4 B;  2BSK B;  2AHZ A;  4FVM A;  2YC0 A;  2EX3 A;  3RVY A;  3M8A A;  3O65 A;  1JFF B;  3SYA A;  3CCM V;  1PPJ H;  1GK9 A;  4X8A A;  1BCC H;  3LNN A;  3JAR A;  1JX9 A;  2PF4 E;  2DOS A;  1ZSP A;  1HWY A;  3UQ8 A;  4R50 A;  4JGS A;  1YJN V;  3AG3 B;  2EJR A;  2UXN A;  3KG2 A;  4JV5 O;  1XNR B;  2X6C A;  3DC6 A;  4K3A A;  4LH6 A;  3KKY A;  1BL8 A;  1QVF U;  5HFL A;  4LF8 B;  3FD9 A;  3ASN B;  3H1I H;  4X89 A;  3A0H Z;  1Q8I A;  2ILM A;  5B1A B;  1AJP A;  1SQP H;  2CE4 A;  2GV9 A;  2B5U A;  1AI5 A;  1XNQ B;  3CD6 V;  2NLJ C;  1JOY A;  3BRC A;  1BMF G;  4X1K A;  2GUZ A;  1K4D C;  2OT5 A;  2VQE B;  3KZI Z;  4GZR B;  3JAM N;  2QWR B;  2VS0 A;  3ZHV A;  3RWR D;  2OCC C;  1NTK H;  1VQ6 V;  5IYC O;  4FLX A;  4NTX A;  4J80 A;  1BZK A;  4NYK A;  2KKW A;  1ZAU A;  1NU1 H;  5D5P A;  3STL C;  5L3C A;  1FJG O;  3H1J H;  3H1L H;  5FNV A;  4B3R O;  3OEH G;  2ZE5 A;  2P22 C;  4BW5 A;  4I50 B;  5CB4 B;  1K4C C;  2CK3 G;  3LUT B;  4KP4 A;  4TV9 B;  1VMG A;  3AG1 C;  5IJ0 B;  4LR3 A;  3K5O A;  2JGU A;  5LHI A;  2F4V O;  4F6R B;  4ZI7 B;  3T1Y O;  3SYC A;  3ZHU A;  2JDI G;  3OM3 B;  2D3O W;  1SA0 A;  1SKV A;  4XBF A;  5BMV A;  4CBC A;  4DUZ B;  2PTM A;  2Q6A A;  1ROP A;  2UU9 O;  1AI4 A;  1Z2G A;  2DYS C;  3N2G A;  3FAV A;  2AZ2 A;  3FB6 C;  1PP9 H;  4UVA A;  4UUJ C;  5CBG A;  4BIO A;  4O4L A;  4DV3 B;  5E1A C;  4N21 A;  1YSC A;  3N27 A;  1ZLZ A;  4JYY A;  4GKJ O;  2P6J A;  2A79 B;  3IGA C;  2H94 A;  1NTM H;  2IH3 C;  2PYL A;  5B5E Z;  3EXA A;  1XMO O;  1JCH A;  3W7S A;  4W4L A;  2IJK A;  1Y74 B;  4K8X A;  4DW1 A;  4YHH B;  3JAK B;  1VQL V;  1OCC C;  1EN5 A;  4DXW A;  4DV5 O;  2IJJ A;  2P4K A;  1EN6 A;  1XHX A;  4IGG A;  1H2S B;  4JTA B;  2HHH O;  4JZ2 A;  3G71 V;  1AR4 A;  3CCU V;  5CMU A;  2YS8 A;  4KFM A;  4UV9 A;  1JA8 A;  3SR2 C;  3J80 N;  2HR3 A;  5KHG A;  3JAR B;  2XT9 A;  1SRY A;  1I08 A;  3DSQ A;  2W6I G;  4CZZ A;  1ZX3 A;  2QTO A;  2LQT A;  3A0R A;  2LJ2 A;  4I5S A;  3CME V;  2NN4 A;  5KHH A;  4DR7 B;  1F4N A;  4QPJ A;  5JH7 A;  2JGD A;  1ORQ C;  5BR8 O;  4NXN O;  1WB7 A;  4X62 B;  1SQB H;  3GB7 C;  3QG5 A;  1M5I A;  4IIJ A;  3ICX A;  4DYL A;  1PL4 A;  3W7U A;  3CP1 A;  3K5N A;  4B08 A;  2QKC A;  2LFS A;  1VP7 A;  4GUN A;  4BIZ A;  5IE9 A;  4JTC B;  4DR5 O;  3SYO A;  5LXT A;  5B1B B;  2DE0 X;  4PD4 F;  4WFG A;  1AB3 A;  3U10 A;  1DF5 A;  4EFB A;  4X1K B;  1K5S A;  2IH1 C;  2GUZ B;  2XTA A;  1YCI A;  4P9O A;  4JPR A;  4MVS A;  4UCO A;  2LW7 A;  3C3S A;  1SZX A;  2F43 G;  3D8C A;  3K5L A;  1I7F A;  1L0N H;  3K0D A;  2WA3 A;  1T5E A;  4JV5 B;  3RYH A;  1PNL A;  3ABM C;  4FZ0 A;  2ZNJ A;  4JTD B;  4JZG A;  2ZIO A;  5BXZ A;  1FKA O;  1QVG U;  1SS3 A;  3T4Z A;  1V54 B;  3TXS A;  2LO1 A;  2L35 A;  3ABK C;  4TOI A;  1VQN V;  1GM8 A;  1SC5 B;  1NVP B;  1Y6X A;  1NI8 A;  3FYI B;  1Y76 A;  2E75 B;  3E35 A;  3CXH F;  3MHS C;  2EIM B;  1VQ4 V;  3SPI A;  3OE7 G;  3F5T A;  2GTA A;  1QR8 A;  3P30 A;  1SA0 B;  4JI7 O;  4O2A A;  5BMV B;  5FL7 G;  2ODM A;  1PL0 A;  2QDO A;  3T4D A;  4MVZ A;  4IT5 A;  2K9P A;  3N2G B;  1PKX A;  3FAV B;  4JI0 O;  3RBZ A;  1Q7Y W;  1DTO A;  1VF6 C;  5J2U A;  1MNG A;  1XBL A;  4TQD A;  2EJ7 A;  1BSM A;  3SGI A;  3QTC A;  2CH7 B;  4DV0 O;  1N32 O;  3BFR A;  4B3R B;  1N34 O;  2P4V A;  1OCR C;  2EIN C;  1HDJ A;  2FL4 A;  5KHK A;  4DO2 A;  1H2N A;  2CGO A;  1VEW A;  1DF4 A;  1XL6 A;  5LP6 A;  3CXC U;  4KL1 A;  2IJI A;  4FIP C;  2F4V B;  3T1Y B;  3BVO A;  1HR0 O;  3RYI A;  3CX5 F;  3ZHS A;  3OEE G;  3RYF B;  2UU9 B;  3E22 A;  2WA4 A;  4MW3 A;  2BE3 A;  3E8H A;  4JI2 O;  3DTU B;  5HFM A;  2YEV B;  4R6Z A;  5LGU A;  5JCO A;  1D5N A;  4XDJ A;  1AI7 A;  1TUE B;  3K04 A;  4X88 A;  2PYJ A;  4GKJ B;  1KB9 F;  3R65 A;  1JPX A;  4CS4 A;  2ZR3 A;  2X6B A;  3OGI B;  2QSA A;  2UUA O;  2HG5 C;  1U97 A;  1XMO B;  1I5Y A;  5K1P A;  5L3E A;  5ITZ A;  2JGD B;  2ITC C;  3D3I A;  2PGG A;  2WLL B;  4QNH B;  2QWP B;  4IIJ B;  1VIB A;  4Z2W A;  2DJV A;  1QU7 A;  4DV5 B;  5EZY A;  2Y69 B;  4NVP A;  1WP7 A;  4LFB O;  2Z0A A;  2HHH B;  1IBM O;  3ZMS A;  2WSS G;  1YF2 A;  3H1H H;  3ABL B;  3OR7 C;  3QO8 A;  5H2F Z;  1B3Q A;  3JSN A;  2CTR A;  2NR5 A;  3LDE A;  5JJJ B;  3L70 H;  5FLX N;  3IAY A;  3GWK C;  3ABU A;  4EFE A;  3E86 A;  1P7B A;  4UCR A;  1Q82 W;  3X2Q B;  4EEQ A;  1QLN A;  3RYH B;  2O57 A;  1AR5 A;  2E3C A;  4K0K O;  3ZHR A;  5B1O A;  4PDR A;  4FLW A;  2YXH A;  5BR8 B;  1EN4 A;  4NXN B;  1N33 O;  3IC9 A;  3CHX A;  2XUM A;  1BE3 H;  1GO3 F;  2UUC O;  1M56 C;  2LP7 A;  3ZX6 A;  1VQ8 V;  3CCS V;  3AEI A;  3CC7 V;  4DR5 B;  5LHG A;  1OJH A;  1THZ A;  3SJA C;  4MVQ A;  5H9C A;  1SQV H;  3JD2 A;  4H44 B;  1WN7 A;  4DR2 O;  1XDC A;  3QO5 A;  1SF9 A;  3AG7 A;  4UXN A;  4BAY A;  5KUK A;  3L71 H;  4BR6 A;  3AK1 A;  1VQO V;  1YIT V;  5GON A;  4ZHQ A;  4DR6 O;  4PHZ A;  4X65 O;  2UUB O;  3HR0 A;  1IZ3 A;  1F7Y A;  3OMN B;  2W0X A;  2P06 A;  4LNU A;  2FB5 A;  4PI2 A;  5LOV A;  1G1X B;  2Q7G A;  4X20 A;  3DGE A;  4UB8 Z;  4OX9 O;  3D36 C;  1HNZ O;  2YIA A;  3CB2 A;  4PA4 A;  1GN4 A;  2ZR2 A;  1FD9 A;  4FMT A;  1OCZ B;  5IY5 C;  1HNW O;  1Z5W A;  2AW9 A;  1MOF A;  3G4S V;  2WLJ A;  3JD0 A;  1OHH G;  4I50 A;  3RYI B;  4GX1 A;  1KD1 W;  2Q0O C;  3L72 H;  2GSM B;  4FPP A;  4JI7 B;  4TV9 A;  5IJ0 A;  3CRM A;  2A3Q A;  2HKO A;  3E22 B;  1BT8 A;  1W2B U;  4C7U A;  4F6R A;  4JAU A;  3B09 A;  1TUB B;  1NTZ H;  5EBM C;  1RSO A;  3B40 A;  1FXV A;  4W4K A;  4JI0 B;  4U7O A;  1YTF D;  1PNK A;  2EIK B;  2VWJ A;  4LP8 A;  1YJW V;  4IYI A;  4HNA A;  1XQ8 A;  3K58 A;  3WG7 C;  1I5X A;  4DV0 B;  4O4J A;  3E2E A;  1N32 B;  1J5E O;  2BCC H;  4UVB A;  3UKM A;  1N8R W;  1N34 B;  1UFI A;  4DV6 O;  1AJN A;  1UPG A;  3ZMV A;  3P3P A;  4EB6 B;  3U0Z A;  2Q73 A;  3ABT A;  1GN2 A;  4LC1 A;  5ITZ B;  2XAS A;  1NH2 D;  4J7K A;  3MAQ A;  4FFB A;  1M57 C;  5KA5 A;  1HR0 B;  5EZY B;  2ZCE A;  5C8Y B;  2CDY A;  2Q8V A;  1GM7 A;  1JJO A;  3LSS A;  3TJT A;  4RQF A;  2XHB A; 
#chains in the Genus database with same CATH homology
 2XAH A;  3FB6 C;  3JYC A;  4QPK A;  4TWK A;  2XAG A;  1GTO A;  5B1A C;  4UVA A;  1R73 A;  4UUJ C;  1OZ0 A;  5CBG A;  5E1A C;  2YSU B;  4N21 A;  1M1K W;  1YSC A;  4GX2 A;  1EFR G;  4JF3 A;  4TSF G;  2DYR B;  2ZXW B;  2P6J A;  1FXH A;  1AR1 B;  2WLI A;  2WPD G;  2A79 B;  2Z5U A;  2HJF C;  3IGA C;  2H94 A;  2QKS A;  4QE9 A;  2IH3 C;  3OFN G;  4BIU A;  3M99 B;  1S76 D;  3K06 A;  2QA4 V;  1JCH A;  3W7S A;  1V55 B;  2DWE C;  2IJK A;  4H33 A;  5DN6 G;  2A0L A;  1YI2 V;  2JEX A;  2BOC C;  4XDL A;  3CPW U;  1VQL V;  1OCC C;  2M7W A;  1FXK A;  4DXW A;  2Q69 A;  4R7C A;  5IYD O;  2EIK C;  2WLN A;  2IJJ A;  3NXS A;  1E79 G;  4Z1M G;  1R3L C;  5GW7 A;  3I55 V;  2HVJ C;  5B3S C;  4JTA B;  3CMA V;  2EZO A;  1MG1 A;  1PNM A;  5J9P C;  4GCZ A;  1E1R G;  3G71 V;  1G8M A;  2MK3 A;  1CPY A;  3ABM B;  5L3G A;  3CCU V;  5CMU A;  3ABL C;  1QR9 A;  2QM7 A;  3ZJZ A;  3F7V C;  2P7T C;  4KFM A;  4UV9 A;  4GT1 A;  4MVR A;  4JYC A;  2HR3 A;  2JJ1 G;  1JQ0 A;  3FB8 C;  1SRY A;  3HB3 B;  1F4M A;  4PDV A;  1RM1 C;  2XND G;  5LGN A;  3ABK B;  4XDK A;  2IU3 A;  2ZQM A;  3B8N A;  2W6I G;  3F7Y C;  4CZZ A;  3SPJ A;  4MSW C;  2QTO A;  3AG2 B;  3A0R A;  4WFB V;  4I5S A;  3CME V;  3F5W C;  3ML0 A;  3X2Q C;  1KQS U;  1CP9 A;  3B8M A;  4RAI A;  5L3F A;  5C93 A;  2XAF A;  3FYE B;  4MS2 A;  3E89 A;  4PA3 A;  1F4N A;  4QPJ A;  1QLE C;  1JVM A;  3AG4 C;  2EIJ C;  5IYB O;  1ORQ C;  1ENV A;  1R3J C;  2BOB C;  3OR6 C;  1K3E A;  3OUS A;  3GB7 C;  3SJQ C;  3TK1 A;  4PA6 A;  4HZ3 A;  2ZXW C;  3W7U A;  5IDJ A;  3CP1 A;  4LCU C;  1S5H C;  4ZKI A;  3E8F A;  5EC2 C;  3JD4 A;  1MSW D;  1M56 B;  2LFS A;  4BIZ A;  4QIW F;  3OMA B;  4WFF A;  4JTC B;  3CC2 V;  1G4Y B;  3SYO A;  5B1B B;  5L3B A;  4YXW G;  1H8H G;  4WFG A;  2IJH A;  2WAM A;  2R9I A;  5CBH A;  3CCQ V;  3VOU A;  3QO7 A;  1DF5 A;  2Z3Y A;  1S3J A;  1K5S A;  4P2Z A;  2IH1 C;  1H38 A;  3P32 A;  5KUM A;  4P9O A;  1R3I C;  4JPR A;  4MVS A;  1BHA A;  3AG3 C;  1R3K C;  3D36 A;  3SPG A;  4MT8 A;  2JEU A;  3UM7 A;  2F43 G;  3LSQ A;  2ITD C;  3SYQ A;  4RUE A;  3K0D A;  1YHQ V;  2HLD G;  1PNL A;  3FB5 C;  1E1Q G;  3ABM C;  4MTF A;  1JJ2 U;  4JTD B;  3ZRW B;  1VQ9 V;  4ZBM A;  4HAM A;  2W0F C;  1QVG U;  2HVK C;  1V54 B;  3T4Z A;  3ASN C;  3ZRS A;  3ABK C;  1VQN V;  1GM8 A;  2Q67 A;  1NVP B;  2EIL C;  1VQ7 V;  3FYI B;  1EBO A;  3E35 A;  4H37 A;  4UV8 A;  3OW2 U;  1K33 A;  3OAA G;  3MHS C;  4WCE V;  4MW8 A;  1K8A W;  1K5Q A;  2EIM B;  3MD0 A;  1VQ4 V;  1OCZ C;  2LFR A;  2FTK A;  2ZDI C;  3SPI A;  3E83 A;  1VQM V;  1P4R A;  3OE7 G;  3ZRX A;  3LDC A;  3RW0 A;  3SPC A;  1FFT B;  2P90 A;  5H6R A;  5IY5 B;  1QR8 A;  3P30 A;  3JCZ A;  4MTO A;  5FL7 G;  3E8G A;  4MVO A;  1NJI W;  1PL0 A;  4GX5 A;  3T4D A;  2K1E A;  2XAJ A;  4MVZ A;  3ZRV A;  2EZP A;  4PDL A;  1VQP V;  1PKX A;  2OCC B;  1Q7Y W;  3RBZ A;  1K73 W;  2AHY A;  1DTO A;  4WF9 V;  4G2K A;  2XOK G;  3JD1 A;  2ATK C;  4JAV A;  3ASO C;  3OMI B;  3ETG A;  5CBF A;  4G28 B;  2V1D A;  1W0K G;  2NNU A;  3CYO A;  1F23 A;  2JK5 C;  3JD3 A;  2WLI B;  3WG7 B;  4PA9 A;  1SES A;  1OCR C;  1Y66 A;  2EIN C;  2UXX A;  4DO2 A;  1QBZ A;  4N23 A;  2YEV A;  1DF4 A;  1OCO C;  1XL6 A;  2X6A A;  3CXC U;  1S0V A;  4OXS A;  3HPL C;  2Q68 A;  1EZJ A;  4G27 B;  2R9R B;  2DW4 A;  4EKW A;  2IJI A;  4FIP C;  3ZMU A;  1KEC A;  2ZDI A;  1FXK B;  3TCU A;  1Q81 W;  3EFF K;  1COW G;  1AI6 A;  1SET A;  4UVC A;  1FS0 G;  5CN0 A;  5EBW C;  3SYP A;  3OEE G;  1M57 B;  3ETE A;  4QE7 A;  5EK0 A;  3STZ C;  2JJ2 G;  4MW3 A;  4MTG A;  3E8H A;  3I56 V;  3K08 A;  2WLL A;  1YIJ V;  1KC8 W;  2OTJ V;  3DTU B;  3VBB A;  1M90 W;  5HFM A;  2YEV B;  1GKF A;  1S72 V;  2DYR C;  3GWO A;  4R6Z A;  3ZN1 A;  2PI4 A;  3CCR V;  5LGU A;  5LGT A;  3E8B A;  4XDJ A;  2GHY A;  1AI7 A;  1TUE B;  3K04 A;  2HFE C;  4X88 A;  1H8E G;  2W6J G;  1XL4 A;  4RQE A;  3RVZ A;  3CCE V;  3R65 A;  1JPX A;  2ZR3 A;  3WFV A;  2X6B A;  1V55 C;  4TT3 G;  3OGC C;  1NR1 A;  3T1C A;  5L3D A;  4LBE C;  2HG5 C;  3ZN0 A;  1WPX A;  1I5Y A;  5L3E A;  4U7N A;  3OUF A;  4MVU A;  1SZT A;  2ITC C;  1KP2 A;  3D3I A;  1M9N A;  3LDD A;  2WLL B;  4QNH B;  3ZIA G;  3CCJ V;  4J9Y B;  3B77 A;  3BEH A;  2Y69 B;  2OTL V;  1R6N A;  1YTF B;  5B3S B;  3H01 A;  2C2A A;  5H6Q A;  3W7T A;  1NBM G;  1MAB G;  1YJ9 V;  4E2L A;  2V7Q G;  3ZMS A;  2WSS G;  4FJC C;  1NR7 A;  2B1G A;  1NVP D;  1QCE A;  3ABL B;  3OR7 C;  3QO8 A;  1Y4M A;  1FXK C;  3K79 A;  3LDE A;  2ZD9 A;  3AG2 C;  3ABU A;  1UJW B;  1J95 A;  3E86 A;  4HYO A;  1KKD A;  1P7B A;  2IU0 A;  3TET A;  1NH2 B;  3W7W A;  4F4L A;  2H8P C;  2KB1 A;  5LBQ A;  2XAQ A;  1Q82 W;  1K7D A;  1W0J G;  3X2Q B;  4PDM A;  1QLN A;  2X7R B;  4WFA V;  4JAS A;  2DQ0 A;  4WFH A;  3ZMT A;  5B1O A;  3ZCC A;  4PDR A;  2DWD C;  1QLE B;  3AG4 B;  2EIJ B;  3SPH A;  5CA3 A;  2AHZ A;  4PEL A;  4Q20 A;  3PJS K;  3RVY A;  2IW5 A;  1GO3 F;  1M56 C;  1NKD A;  3SYA A;  3CCM V;  1ZWI C;  5DM6 V;  2LP7 A;  1GK9 A;  1SER A;  4X8A A;  5B1B C;  4I9W A;  1VQ8 V;  4JYB A;  3CCS V;  3AEI A;  1PD3 A;  3CC7 V;  5LHH A;  3ETD A;  5LHG A;  1THZ A;  1JX9 A;  1VQK V;  1BHB A;  4MVQ A;  5H9C A;  2Y48 A;  1HWY A;  3JD2 A;  4R50 A;  4JGS A;  3CC4 V;  1CEZ A;  1YJN V;  3K03 A;  3QO5 A;  4UXN A;  1R6K A;  3W7X A;  2QM8 A;  3IFX A;  4BAY A;  5B1N A;  3AG1 B;  2Y69 C;  3AG3 B;  2EJR A;  1K92 A;  2UXN A;  3KG2 A;  5KUK A;  3CCL V;  1K9M W;  1VQO V;  3LNM B;  2X6C A;  4RUF A;  1YIT V;  4FK5 C;  2A9H A;  3BY6 A;  1BL8 A;  1V54 C;  5HFL A;  1QVF U;  3OMN B;  2X0L A;  3EHB B;  3ZMZ A;  4J9Z B;  1Q86 W;  2DYS B;  2JIZ G;  3ASN B;  5EC1 C;  1K97 A;  3DGE A;  4X89 A;  2EIL B;  3IC7 A;  2EIM C;  1S77 D;  4PA4 A;  5B1A B;  2ZR2 A;  1AJP A;  1K34 A;  4FMT A;  3CD6 V;  2B5U A;  1AI5 A;  1JOY A;  2NLJ C;  1OCZ B;  5IY5 C;  1KP3 A;  1MOF A;  3G4S V;  4P9P A;  1BMF G;  1RPO A;  2P67 A;  2WLJ A;  3JD0 A;  1OHH G;  4ASU G;  2PI5 A;  4GX1 A;  4PA7 A;  1K4D C;  2B1I A;  2OT5 A;  1KD1 W;  2GSM B;  4FPP A;  3MHH C;  2HKO A;  2OCC C;  1W2B U;  4JAU A;  5EBM C;  1VQ6 V;  4P30 A;  5IYC O;  2WLK A;  2QE7 G;  4L87 A;  1FXV A;  4U7O A;  1YTF D;  2WLH A;  1AJQ A;  1OCC B;  2WWW A;  4RO2 A;  1PNK A;  3STL C;  4GX0 A;  1GM9 A;  3ASO B;  2EIK B;  3FB7 C;  4LP8 A;  3G6E V;  1LNQ A;  1YJW V;  3ZRW A;  1VQ5 V;  3K3W A;  5L3C A;  2QEX V;  3OEH G;  3WG7 C;  1I5X A;  4KUM A;  4BW5 A;  3E2E A;  4UVB A;  3UKM A;  1N8R W;  2WLM A;  1NQT A;  4WFE A;  1DLB A;  1K4C C;  3CCV V;  2CK3 G;  1H2G A;  1AJN A;  3LUT B;  4KP4 A;  4MVM A;  3ZMV A;  1OCR B;  2EIN B;  3AG1 C;  3ABT A;  3QNE A;  2EBO A;  5EBL C;  1F51 A;  1GMG A;  4LC1 A;  5LHI A;  1OCO B;  3SYC A;  2XAS A;  1WLE A;  1RM1 B;  1NH2 D;  1IXM A;  3K9A A;  3FKS G;  3K0G A;  2JDI G;  3OM3 B;  2D3O W;  1M57 C;  2DQ3 A;  5KA5 A;  4XBF A;  4QJF B;  4CBC A;  5KA6 A;  2Q6A A;  4MTX A;  1ROP A;  1L1F A;  1RPR A;  1AI4 A;  4R8C A;  1GM7 A;  1ARO P;  2DYS C;  3LSS A;  4RQF A;  5BZB A;  1B6Q A;  3T2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...