1VQ4V

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq4V00
3CC4V 1VQ6V 1YI2V 3CMEV 1VQLV 3CC2V 1NJIW 1YJ9V 1K8AW 3CCMV 1VQNV 1QVFU 1Q82W 3CCSV 3G4SV 1KD1W 1JJ2U 2QA4V 1YJNV 1R73A 3CCQV 1N8RW 1VQ7V 3G6EV 3CCEV 2QEXV 4WF9V 1QVGU 3G71V 3CCVV 5DM6V 1YJWV 3CCLV 3OW2U 2D3OW 1VQ9V 1Q81W 4WFBV 1YITV 3CC7V 1W2BU 3CCRV 3CCUV 1VQOV 3CD6V 3CMAV 4WCEV 1VQ4V 4WFAV 1VQPV 2OTJV 1KQSU 2OTLV 1YIJV 1M90W 1K9MW 3CCJV 1VQ5V 1KC8W 1VQ8V 3I55V 1M1KW 1K73W 3CXCU 1YHQV 1Q86W 1S72V 1VQKV 1Q7YW 3CPWU 3I56V 1VQMV
chains in the Genus database with same CATH superfamily
5LP6B 4QE9A 1ZLZA 3RVZA 1SETA 4JYCA 4OPHA 2ETNA 1N8RW 3LDCA 4WFGA 3LSSA 5IT9N 2QWRB 2UU9B 4GKKB 2JS3A 1KYOF 1ZX3A 4F6RB 1H2SB 2EIMC 4X9QA 4JI7B 4DV3B 1ZWIC 4DK1A 1PKXA 3G80A 3F5WC 3H01A 4O4IB 3K79A 2CTRA 2B5UA 4X62B 1N36B 2V4DA 2ADPA 4JAUA 3M99B 3M7MX 1RSOA 2RJZA 1QU7A 3HKBA 5K1XA 3OTOB 1Q6IA 1GN6A 3OFNG 4MVZA 3HKDA 2MW2B 4PA6A 2W6JG 1I0HA 3JARA 1XNQB 1QNMA 1AB3A 1SQPH 3I5DA 1GO3F 1NJIW 5L3FA 2A06H 4MVRA 5H9CA 3RVYA 2YIDA 3ABUA 2XAQA 4B3MO 4D7SA 1K7DA 3WG7C 3K5LA 1FJGO 3FB8C 3ABKC 4UCOA 4D7TA 3T2MA 4E4EA 1AROP 3A0RA 3N2KB 1MSWD 1XL6A 1NI8A 2ZNJA 4LF8O 2HJDA 2CH7B 4G27B 2VQEB 1R3LC 3U0ZA 4DR4B 3ZIAG 4CH4A 4LFBO 1Q81W 4JYBA 3KG2A 3CXHF 4A5UB 1EN4A 5KA6A 2ITDC 5KHGA 3FFQA 4X66O 3RYFB 1HR0B 1TAEA 2Y0IA 2CE4A 4PA4A 4FLWA 4BIZA 4DR2O 3EXAA 4U3JA 1XMOO 1WPBA 3A0HZ 4IHJA 3AG3B 1F4MA 3HKBB 4QIWF 3J80N 3ZX6A 4I0XB 3G6BA 1YI2V 3HKDB 4EB6B 2FKXA 1URFA 4YIPA 2HEPA 3CJHA 3JARB 4PDMA 3UM7A 1NTKH 4JAAA 2ZT9B 3CCEV 4AILC 1BMFG 2LJ2A 3RN4A 4CH6A 2PYJA 2BOBC 3ETEA 1QR8A 3AK3A 1VQOV 2WLKA 3CRQA 4BIUA 3IC7A 3BFRA 3OMAB 2HVJC 3S3XA 2N74A 1S77D 2WLMA 2XUMA 3SJAC 2BTQA 2YXHA 1WB8A 3VQXA 4X64O 1OCOB 1AR1B 1P7GA 1I94O 1W2BU 1VQ4V 1HW7A 2RN9A 4LP8A 4PDRA 5IE9A 2LFSA 3D36A 2GHYA 4MTGA 1QQCA 1W0KG 3K0GA 3APQA 2F23A 3K58A 1B6QA 3MHSC 4LF4O 4ZBMA 1F51A 4HAMA 5IJ9A 4ZIBA 1FJGB 4TV8B 4CH5A 3N2GB 1KKCA 3AK2A 3ETQA 4LF8B 1IX9A 3UT5A 3B2EE 1Q43A 2LQTA 5EIBD 1TUBB 3IFXA 1RM1C 1AJQA 3K0DA 3ZS8C 1P7BA 2ZE7A 5A2QN 2Y69B 4KHPO 4K0KB 1Y76B 5EZYA 3SYAA 1JCHA 3BY6A 2GDSA 1Q6HA 5IJ0A 1K5SA 2Q7HA 5IDJA 4X66B 2NR5A 1V9PA 1IXMA 1VF6A 2PI4A 5K1PA 3STLC 2QWOB 4W4KA 2DYRC 3J7AU 3SYPA 1XMOB 3RFRA 3QO5A 2RDCA 1Q90D 1K9MW 1KP2A 2V1DA 3JD2A 4GUNA 1VQLV 4I4TB 4TSFG 5KX5B 4UVCA 2WA4A 5DM6V 2HHHO 2EZOA 5KHIA 1XBLA 3E22B 2Y48A 3A0BZ 3A8TA 2EILB 4WFAV 4NXMO 4JF3A 3HKCA 3ZN1A 2ZE6A 4LR3A 3BVOA 3ASOB 1BCCH 5JQGB 1BL8A 3B40A 4IIJA 2VWJA 1OCZB 1F4NA 4YJ3B 3HB3B 1PM9A 2OT5A 2ZR3A 2VWKA 4NXNO 3FB6C 2PZSA 3OT7A 4X64B 3RW0A 1I94B 1RP3B 2P6JA 4R7CA 4PI0A 1L0NH 2KB1A 3FYEB 1VQNV 1QLNA 2UXNA 4DRXB 5EZYB 3X2QB 4N21A 2N05A 1H38A 5KAFZ 5IJ0B 2OYQA 4D6TH 1P49A 1YVWA 4DW1A 1R3IC 5LMUO 2YI8A 1FS0G 2JGDA 1M1KW 3K3WA 4JI8O 4J7ZA 3ZMSA 3GWKC 2ZKOA 2FTKA 3B8MA 1FFXA 4DK0A 5FNVA 1HP8A 4J9YB 4MT8A 3ML0A 1Y74A 1GKFA 3FB7C 3W7UA 1PL0A 3KCYA 2PF4E 4NYKA 3FB5C 3ZMUA 3JAKB 2DMXA 3QF7A 3KZIZ 4LF7O 2HR3A 5B3SC 2HJFC 5LYJA 4PV1B 1AI7A 5ITZA 2JS5A 1XHZA 2GV9A 4X65O 4FLTA 1FPOA 5LGNA 4QJFB 2DJVA 4U7NA 3WB2A 2BCCH 3M8AA 5AG2A 4IIJB 4DR5O 1M57C 2ZNIA 1G1XB 4FZ0A 4TQDA 5KLVH 1ZTEA 1Q5OA 1OHHG 1Q6UA 1CXZB 3CMEV 3W7WA 5GTIZ 2P7TC 1MMMA 2WLIA 3GVMA 1XI1A 5J2TB 5CN0A 1I5YA 3IJ4A 5BY1A 2ZE5A 3U10A 5JJEB 2LW1A 2EIMB 5EBMC 1LUWA 2YEVA 4LNUB 4NXMB 1JFFB 3AG1C 4ZHQA 4DR3B 2QKSA 4NTYA 1K33A 1R6NA 2Z0AA 4LF6O 4X1KA 2L35A 1M9NA 1I08A 2XAJA 1XEQA 4O4LA 1T5EA 1XHXA 5IYZB 1FFXB 1SC5B 3TETA 4RO2A 3FYIB 4NXNB 2WLNA 2WLHA 1P4RA 4KXRA 1Y74B 2YC0A 4O4JA 5IY5B 1Q8IA 3WFVA 1MG1A 2ZXWB 5FL7G 3RBZA 4WFEA 1Y4MA 4F4LA 2Q68A 4LF5O 4MVUA 4LH7A 4O4HA 4R8CA 5LP6A 2UXCO 5LMUB 3LDDA 1VQMV 4L87A 3H1JH 3OGCC 2OWOA 2H8PC 3Q4HA 1QBZA 2IJJA 1SERA 3ZHTA 3OEHG 1FXKB 2AW9A 3JSNA 2R9AA 4O4IA 2AXTZ 3CCJV 4UFZA 3CEIA 3QVNA 5L3EA 2EIJB 3SJCC 1OJHA 4LF7B 5KHKA 3UCSC 2IJHA 1S0VA 1MABG 4UXNA 5JH7B 4LBEC 5JVDB 4X65B 5LA6B 1IBKB 2ZM6O 5EK0A 2CGOA 4BIOA 1SQVH 4O4LB 3E2EA 4DR5B 5EYPA 1M5IA 3CXCU 1PNMA 5C8YA 2X6CA 2K9PA 4OXSA 1VQ6V 3F7VC 4YY3O 2EINB 2YICA 3CCSV 5EC2C 3N2KA 4O4JB 3TXSA 1EBOA 1O9GA 1D5NA 1GN3A 3DTUB 2E5LO 3CHXA 1SQQH 1H2NA 2F95B 2OCCB 4O4HB 1K3EA 5L3GA 2ITCC 1S5JA 1E1QG 1QLEC 2F4VO 1SF9A 4PHZA 3AG2B 4LF6B 1VARA 2QSAA 1NVPB 1FAFA 1YTFD 3Q4HB 3RWRD 5JJNB 3RYFA 1D5AA 3BA8A 2PGGA 4FLZA 3ABTA 4YJ2B 2ADQB 4P9PA 2IU3A 3B4SA 3JCZA 4J41A 4K35A 4JI3O 3CCUV 4I0XA 4LF5B 1W0JG 3K03A 1NU1H 4EB6A 2XAHA 2Y4TA 3AG7A 2E3CA 2YDEA 1H2LA 3T4ZA 2UXCB 4OGQB 3S3WA 5EYPB 4WFHA 1KD1W 2W0XA 2EIKC 1BHAA 4DW0A 5C8YB 1M56B 3RYCB 5CA0B 2YIBD 3K5MA 2GUZB 3LNMB 4FVMA 2ZIMA 1Y66A 1BHBA 2RNBA 1SKVA 1MSDA 3CSXA 2E76B 1BQZA 4YIOA 1VQ9V 3SPJA 1DK1A 3ABMB 3WU2Z 5GONA 4N23A 3LUTB 3ZRXA 3RT3C 4I9WA 1WB7A 1R6KA 3AG4C 4TWKA 4K0KO 2FL4A 2R70A 4KUMA 4IYHA 2ZM6B 4JTAB 1P84F 3F5TA 1HWYA 4MW3A 4C7UA 1NR7A 5LGTA 1F7YA 4LCUC 3DC6A 4YY3B 1IDSA 1VF7A 5LMNO 4TV8A 3KCXA 3KKYA 3N2GA 3PJSK 3OR7C 2WLLA 4WCEV 5B1NA 1OCCB 3RYIA 3ABLB 3OE7G 2XHBA 1YEWA 4OPAA 3L75H 1R1BA 3K9AA 1TUBA 5KHJA 2E5LB 1KKDA 2P90A 1LUVA 4PD4F 1K92A 4DV1B 3RGBA 2F4VB 1Y76A 3OTFA 1FYJA 1G8MA 2Q0AA 1N34O 3ASNC 4RUFA 3ZHUA 3FKSG 2LFRA 5B1BC 1IVSA 3JCUZ 5LHHA 4ABMA 5B1AC 3H1KH 3CWBH 4KFMA 2QA4V 1NS1A 1JA8A 3OMNB 2WLJA 2DQ3A 2ATKC 5GONB 4JI3B 3L9DA 4FZ1A 4I4TA 4JI5O 1NT2B 1SA0B 3H1LH 2DN9A 5E79Z 5KX5A 1SZXA 5KUMA 5LP6C 4QPKA 3JAMN 1ENVA 4R6ZA 5FPOA 3G4SV 4LWSA 1S5LZ 3E22A 1BE3H 3HR0A 1V55B 2ARHA 1QVGU 2XT9A 5IYDO 5A9GA 2ZCEA 2D2CB 3JASB 1BZKA 3F7YC 1XOUA 4RAIA 1GRJA 4BAYA 4ICGA 5FLXN 5JQGA 4CH3A 5J2UA 4GT1A 4F6EA 4YJ3A 2WLLB 2EX3A 4KP4A 2IH3C 4WBNB 3RYIB 4JZGA 1ZL8B 2Z3YA 4WFFA 4JI4O 4ASUG 4AQYO 4CC5A 4FM0A 4L8JA 2UXXA 4FJCC 3MD0A 2F1MA 4J7JA 3SPHA 1JPXA 4DRXA 4FIPC 1Q86W 4IT5A 5IWAO 4GZRB 4JPRA 2GSMB 2ZQMA 4MS2A 1YJNV 2YSUB 1DGSA 1HNXO 3AK1A 3FD9A 4EKWA 3CCLV 1PL4A 4B3SO 5LMNB 5L3CA 1GH6A 3TCUA 5CMUA 1YIJV 2UUAO 1OV9A 3JATB 1JX9A 2ZINA 1Z2GA 4MSWC 1XNRB 2XAFA 4FPPA 2QGNA 1B04A 1BGYH 3W7SA 2IJKA 3TXQA 1W59A 3RYHB 4CS3A 2B1IA 3UO2A 2OCHA 4P30A 4DV5O 1B3QA 3BCCH 4LWSB 4DV6O 1L8DA 3JAKA 4CC6A 3K9SA 4RWUA 2OTJV 1O9HA 2UXBO 2F43G 1N34B 1R3JC 5D5QA 5LHIA 1IZ3A 4DR3O 3MHHC 2BTOA 3I56V 5KAIZ 4I50B 2BOCC 2P06A 3CRRA 4GX1A 5J2UB 4FFKA 3SJBC 1YZBA 5JJJB 1GM7A 4P2ZA 3FX7A 4H13B 1QR9A 4JV5O 1DF4A 4DYLA 3AG3C 3L70H 1SQGA 1AR4A 2EJ7A 2A3QA 2V7QG 3SGIA 2JIZG 5H6QA 2Q0OC 2UXDO 4XDKA 3CB2A 1OZ0A 4I55A 5J2TA 4JI5B 2P4KA 2GTSA 1TVKA 1HNWO 2OIGA 4UVAA 3N27A 4FLVA 1SESA 3EFFK 4LNUA 3LSQA 5KHHA 4X88A 2IW5A 1JFFA 2QJ1A 2P5OA 1G4YB 1VIBA 4GX5A 4K3AA 2PI5A 5BR8O 1XDCA 1S72V 4LFAB 2X7RB 3T1YO 2VQFO 1XL4A 5IYZA 3H9VA 2JJ2G 3JALB 1RPOA 2RQ6A 4JI4B 1OCOC 2IJIA 2DYSB 1SS3A 4AQYB 2EJRA 3VOUA 4DR1O 1ZAUA 3ZHVA 2XOKG 4E2LA 1OCRB 1AJNA 4HNAA 4UCSA 4JASA 3NR7A 4CBCA 5KMGB 1V54B 4JTDB 5IWAB 1N32O 1MNGA 5E1AC 1KU9A 3WB0A 3W7TA 1RPRA 1IBKO 3ZRSA 4FFBB 1HNXB 4B3SB 1KQSU 1YCIA 1M90W 1D2DA 1EFRG 1COWG 2WSSG 4U3FH 2Q69A 2UUAB 2M7WA 2YUAA 1J5EO 1M4UA 2QWNB 2EBOA 1FXKA 1SRYA 3UO3A 2PYLA 4I55B 2XAGA 1WN7A 4O2AB 4FLUA 1TVKB 4DV5B 2QKCA 4CS2A 2Y69C 4DV6B 2VRZA 2NN4A 3MAQA 2ZDIA 4RQEA 1Q3EA 1IBMO 2UXBB 2HLDG 4KL1A 3ZMZA 4PJ0Z 5JH7A 1FXVA 5JVDA 1DTOA 5LA6A 2Q7GA 4R50A 4FM1A 2DWDC 2Q9LA 2JRIA 4B7KA 2QEXV 5LOVB 2A0LA 4J42A 3OGIB 5L3DA 5H6RA 2DW4A 4MTOA 2GBOA 2Y4UA 3IAYA 4I5SA 3CCRV 2PY5A 1YSCA 3ETDA 4JV5B 5LL6Y 2QTSA 3OUFA 2UUBO 4Q6GA 5IYCO 1AI4A 2IU0A 1NR1A 3ICXA 3ZMTA 3EHBB 4UCUA 1NH2D 1HDJA 3K08A 3BPZA 1GMGA 2UXDB 1GAXA 3D36C 4X8AA 3E8GA 1VP7A 4HNAB 4U7OA 4B3TO 4TT3G 3R65A 3WG7B 3L71H 4P9OA 1HNWB 4MTFA 1WPXA 3ABKB 3STZC 1FXHA 1K5QA 2EILC 3OAAG 4YHHO 1AI5A 2DQ0A 2F66C 4J80A 1VQKV 5C93A 3ZEDA 1K8AW 3VQWA 3ASOC 3B09A 5BR8B 1BS3A 4MVMA 2PTMA 4JGSA 3T1YB 2VQFB 1OCZC 4H37A 3G6EV 1JOYA 4UCTA 1WAZA 1GM9A 3P30A 5LXTA 4YJ2A 5BMVB 3I55V 2Q5ZA 2XNDG 3UQ8A 4DR1B 4MVOA 4FM2A 4I7ZB 3H1HH 1EM1A 2QTOA 4MTXA 2RCVA 3BEHA 3X2QC 2B1GA 1N32B 3ZMVA 1JQ0A 1WP8A 1YJWV 2CDYA 1BT8A 1L0LH 1Y6XA 4UV9A 2EZPA 4XDLA 2CGNA 1KB9F 1VF6C 5CBGA 4I9QA 2X0LA 3CP1A 3K04A 1K34A 1XMQB 2X6BA 2Q8VA 1WLEA 3RYCA 5CA0A 2CAZC 1J5EB 2GUZA 1N33B 1KBHA 2AHYA 3ZJZA 4JI6O 1US6A 2R9IA 4NR1A 2WPDG 4FLXA 2CK3G 4TOIA 2WA3A 4JTCB 3E35A 1DF5A 5EBLC 4ZOLB 5CB4B 3CRCA 3CPWU 1IBLO 3CC2V 1IBMB 4B3RO 2CTQA 5EBWC 3VQVA 4DV1O 2YIAA 4IGGA 3G71V 3L73H 3ZRVA 3NXSA 5EC1C 4JI1O 3FAVA 1CP9A 4DV0O 2QM7A 5L3BA 3CYOA 2XASA 2LP7A 4DUZB 2UUBB 1XREA 5J9PC 4Z1VA 5LXTB 1HNZO 4FMTA 1GK9A 2BE3A 1YTFB 3CCVV 2QE7G 4B3TB 4O2BB 2H94A 4PDVA 4G2KA 2IH1C 1NZ6A 4BR6A 4YHHB 1N4CA 3E8FA 2BSKB 3HPLC 1UPGA 4MVQA 2EULA 4NTXA 1CPYA 4DR7O 3JD4A 4UVBA 2CTPA 2RMKB 2Q73A 4ZI7B 5BXZA 1RM1B 1S3JA 3G67A 1AVMA 4JYAB 4X89A 1CEZA 2ZE8A 1JVMA 2QDOA 4CZZA 5KA5A 5HFLA 5LHGA 3CS5A 2FB5A 4IYIA 3O65A 3O9OA 3ZRWB 4CS4A 2HG5C 3DXRA 5TISZ 5IY5C 1N0NA 2ZXWC 4K8ZA 2YS8A 3C3TA 2QR4A 4H33A 3A2FA 3E8HA 2DYRB 4PA3A 1SQFA 2B9ZA 1SA0A 1AILA 3LDEA 2Q7EA 4TUYB 3SPIA 3BRCA 2WWWA 3FAVB 3CX5F 1Z5VA 1VMGA 1I5XA 4J11A 1LNQA 1JMKC 2LGWA 5IYBO 1QVFU 1Q82W 2WAMA 3JASA 2HKOA 2LW7A 4JZ2A 1SZTA 2Q67A 4WFBV 4JI6B 1MA1A 1FXKC 2KKWA 4GCZA 4WBNA 4J10A 2QWQB 1XNRO 1ZL8A 2E74B 1PPJH 4AHCA 2ZDIC 2EIJC 4JI0O 1M93A 1EZVH 1IBLB 4PA7A 4B3RB 4Q20A 1N0JA 3JSLA 3MDSA 2MK3A 2W0FC 4TQFA 1YITV 1RSOB 4JI1B 5JCOA 1VQ5V 3QG5A 4DV0B 4BWAA 3QTCA 1F23A 1PP9H 4EEQA 1RFYA 1DLBA 2EINC 4DO2A 1R73A 1A32A 3K5OA 2JGUA 3D3IA 1HNZB 5HFMA 1YDXA 3DXRB 3T1HO 1G6UA 2DE0X 1KUQA 5KUKA 4LFCO 3D3QA 3JATA 1IURA 4DV2O 2P22C 5CBHA 2UUCO 4XDJA 3CE2A 1ORQC 2CTWA 2OCCC 2R9RB 3RYHA 4HYOA 3E89A 4IL6Z 3CCMV 4DR7B 3DGEA 3AG2C 3JD3A 2JDIG 2DOSA 3CMAV 4DV4O 4HBNA 4DUYO 1GN2A 4I50A 1KC8W 3SJQC 4LFAO 1JR9A 1NBMG 3OM3B 1XILA 2JVDA 5B1OA 3TGUH 5B3SB 4JI2O 1AP6A 3D8CA 3DC5A 3CCQV 2FYUH 1BSMA 2D3OW 2JEXA 4B3MB 3SYOA 1ZSPA 1H2KA 4U3JB 4LF9O 1M57B 3LSUA 3OR6C 1H8HG 3ZBHA 3JYCA 4UB8Z 4IHJB 1WA8A 1U96A 1AP5A 3SR2C 3K57A 1WNSA 4B08A 4K8XA 3ZCCA 5H2FZ 2AHZA 3THOA 1M56C 5LGUA 5F2VO 3OW2U 3CJHB 3C90A 4LFBB 3CC7V 2YI9A 1UFIA 4W4LA 5DN6G 4JAVA 2OTLV 1WJZA 2HVKC 1K73W 1YHQV 3JALA 3AG1B 1Y67A 2F93B 3ABMC 4DR2B 4EFEA 4JI0B 1BQ0A 4WF9V 4DR6O 3SYCA 1KMIZ 4UV8A 3B8NA 2IM9A 3GWOA 2BTQB 2HP8A 5KMGA 3K59A 1YF2A 2AZ0A 1NKDA 4NKGB 3CC4V 3BAAA 2A7WA 1YJ9V 4QE7A 1E79G 2X6AA 4FFBA 2IBZH 4ZKIA 4X20A 2JK5C 2R72A 2ODMA 2HFEC 3PN1A 3TK1A 4FK5C 3T1HB 3J81N 1JJOA 5CA3A 2K1EA 4LFCB 3B77A 4RUEA 1OCCC 5IJ9B 4GKJO 3ABLC 4DV2B 2UUCB 1SQXH 5GTHZ 5LBQA 2O57A 3ZHSA 1YXBA 4O2AA 2DWEC 1WA8B 3UT5B 2XTAA 4MVSA 3OUSA 2GTAA 3CD6V 4B7EA 5H5NA 1XUQA 1AI6A 4DV4B 4DUYB 5JWPA 3K5NA 1AJPA 1UJWB 2G38A 4PELA 5LOVA 5FPRA 1EN6A 4JI2B 4PDLA 2P4VA 3JD0A 2NLJC 4DV7O 3ZHRA 4LF4B 1MOFA 2LGQA 4J7KA 2E75B 3VBBA 1PNLA 3SYQA 1H8EG 3CRAA 2ILMA 4LF9B 3R66A 1H2GA 3LNNA 2AZ2A 1MZFA 1XQ8A 2W6IG 2OIEA 3BHPA 1NQTA 3JD1A 1JJ2U 4X1IA 2JEUA 1V55C 3C3SA 3HKEA 2Z5UA 4X20B 4YXWG 4QGPA 3P3PA 2L6LA 2KG7A 4KHPB 2YXYA 4MW8A 1J95A 1XMQO 1EZJA 2KSDA 1L1FA 2A79B 3HKCB 4X1YA 3GB7C 4FLYA 1N33O 4GLXA 1QLEB 4H44B 1R3KC 1VQ7V 3T4DA 2Y0PA 4Z1MG 3W7XA 2QM4A 1X4TA 3K06A 5BMVA 5DEDA 3E86A 4DR6B 1KECA 4OX9O 4AI8A 1GM8A 3CRMA 2QKAA 2FMLA 1QCEA 4TV9A 1SQBH 4BW5A 1MZEA 2VS0A 3VQYA 2Q6AA 1GN4A 5EIBC 5JCOC 4GYCB 1AR5A 3TJTA 1TUEB 3QO7A 2HHHB 4PI2A 2NNUA 5CA1A 5B66Z 1X59A 2LO1A 4DUZO 2QWPB 4GKJB 1R6TA 1FD9A 4LH6A 4XBFA 2JGDB 1VEWA 3T1CA 4HZ3A 2EIKB 1FKAO 5GW7A 4Z2WA 1ZUQA 5BZBA 1NTMH 2UU9O 2N04A 4GKKO 1VF5B 3OEEG 4G28B 4ZOLA 1TGOA 5CB4A 2A9HA 4X1IB 3JAWA 5FNVB 4JI7O 3H1IH 4DV3O 3IC9A 1Z5WA 4BW9A 4QPJA 3U11A 1VQ8V 1GTOA 3HKEB 3SPGA 4X62O 1NH2B 1N36O 2QM8A 4RQFA 4H0LB 2KG7B 3L72H 3E83A 2ZD9A 3OMIB 4UCRA 1S76D 3OTOO 4JYAO 1PV0A 5LYJB 4X1YB 3QO8A 5D5PA 4UB6Z 5ITZB 4DV7B 3AG4B 1PNKA 1XNQO 3P32A 3ZHQA 1U97A 3BABA 5B5EZ 1FFTB 3ZN0A 4JI8B 2ZR2A 3BA9A 2CUGA 4TV9B 4O2BA 4QNHB 4NB5A 4F6RA 2YXLA 3UKMA 2WLIB 1K4CC 2BSKA 3DSQA 3P3NA 2PUSA 2VQEO 4UCVA 4NTWA 1NTZH 4ZI7A 4PA9A 4DR4O 5CA1B 2YEVB 3APOA 4DXWA 2M6YA 3QNEA 4J9ZB 4ZHQB 3OD4A 4GX2A 3AEIA 5CBFA 1WP7A 4NVPA 4X1KB 3ETGA 2DYSC 3WB1A 3ZRWA 4EFBA 2JJ1G 2ZIOA 3ASNB 4OX9B 1S5HC 3IGAC 4LC1A 5B1BB 1HR0O 1OCRC 1Q7YW 1LR1A 2KQXA 2AGAA 3JAWB 1TA8A 5DECA 1QHTA 2H3OA 3L74H 2YIBA 5B1AB 1KP3A 1V54C 1K4DC 1EN5A 1H2MA 4GX0A 4JYYA 3SPCA 1ROPA 4UUJC 2C2AA 4TUYA 1NVPD 1E1RG 2CH7A 2Q4PA 1THZA 1B06A 1K97A 3E8BA 1VQPV 2P67A 3EVKA 1I7FA 1PD3A 1IXBA 3SDLA
chains in the Genus database with same CATH topology
3AG1C 1DLBA 4QE9A 2QKSA 1K33A 3RVZA 1R6NA 2EINC 4DO2A 1SETA 2BOCC 4JYCA 1M9NA 2XAJA 4GX1A 1R73A 1N8RW 3LDCA 3D3IA 5HFMA 4WFGA 3LSSA 1GM7A 4P2ZA 5KUKA 1QR9A 1DF4A 3TETA 3AG3C 4RO2A 3FYIB 5CBHA 4XDJA 2WLNA 2V7QG 2EIMC 2WLHA 2JIZG 5H6QA 1ZWIC 1ORQC 1P4RA 1PKXA 4XDKA 2OCCC 3F5WC 1OZ0A 3H01A 2R9RB 4HYOA 3E89A 3K79A 2B5UA 3CCMV 5IY5B 3WFVA 1MG1A 2ZXWB 4JAUA 5FL7G 3RBZA 3DGEA 3M99B 4WFEA 3AG2C 3JD3A 1Y4MA 2JDIG 4UVAA 4F4LA 2Q68A 4MVUA 1SESA 3EFFK 3OFNG 3CMAV 3LSQA 4MVZA 4X88A 2IW5A 4R8CA 4PA6A 2W6JG 1G4YB 1KC8W 4GX5A 3SJQC 2PI5A 3LDDA 1NBMG 3OM3B 1VQMV 1S72V 5B1OA 2X7RB 4L87A 1GO3F 5B3SB 1NJIW 1XL4A 3OGCC 2H8PC 5L3FA 4MVRA 5H9CA 2JJ2G 3RVYA 3CCQV 3ABUA 2XAQA 1K7DA 1RPOA 3WG7C 2D3OW 2JEXA 1QBZA 3SYOA 1OCOC 2IJJA 2IJIA 3FB8C 1SERA 3ABKC 2DYSB 3OEHG 1FXKB 2EJRA 1M57B 3OR6C 3T2MA 1AROP 3A0RA 3VOUA 1H8HG 1MSWD 1XL6A 3CCJV 3JYCA 2XOKG 4E2LA 1OCRB 1AJNA 4G27B 1R3LC 4JASA 4CBCA 1V54B 4JTDB 2EIJB 5L3EA 3ZCCA 5E1AC 3ZIAG 2AHZA 2IJHA 1S0VA 1MABG 1M56C 4UXNA 4LBEC 5LGUA 3W7TA 3OW2U 1RPRA 3ZRSA 1Q81W 4JYBA 3KG2A 3CC7V 5DN6G 5KA6A 5EK0A 2ITDC 4JAVA 1KQSU 2OTLV 3E2EA 1M90W 2HVKC 1K73W 3CXCU 1PNMA 1YHQV 1COWG 1EFRG 2WSSG 2X6CA 2Q69A 4OXSA 1VQ6V 3AG1B 2M7WA 3F7VC 4PA4A 2EBOA 2EINB 4BIZA 3CCSV 3ABMC 1FXKA 1SRYA 5EC2C 4WF9V 2XAGA 3SYCA 1EBOA 4UV8A 3B8NA 3GWOA 3AG3B 1F4MA 2Y69C 3DTUB 4QIWF 2ZDIA 4RQEA 1NKDA 2HLDG 2OCCB 1YI2V 5L3GA 1K3EA 3CC4V 2ITCC 3ZMZA 1YJ9V 4QE7A 1E79G 1FXVA 1DTOA 2X6AA 1E1QG 4PDMA 3UM7A 1QLEC 4R50A 4ZKIA 2DWDC 2QEXV 3AG2B 3CCEV 2JK5C 1BMFG 2A0LA 2HFEC 5L3DA 1NVPB 5H6RA 1YTFD 2BOBC 2DW4A 4MTOA 3ETEA 3TK1A 4FK5C 1QR8A 4I5SA 3CCRV 1YSCA 3ETDA 1VQOV 2WLKA 5CA3A 2K1EA 3B77A 4RUEA 1OCCC 4BIUA 3OUFA 3IC7A 3ABLC 3OMAB 5IYCO 2HVJC 1AI4A 2IU0A 1NR1A 3ZMTA 3ABTA 3EHBB 5LBQA 1NH2D 3K08A 1GMGA 1S77D 2WLMA 2DWEC 4P9PA 3E8GA 4X8AA 4U7OA 2IU3A 4TT3G 3R65A 3WG7B 3JCZA 4P9OA 4MVSA 1OCOB 4MTFA 3OUSA 1AR1B 1WPXA 3ABKB 1W2BU 3CCUV 3STZC 1FXHA 3CD6V 1K5QA 1VQ4V 2EILC 3OAAG 1W0JG 1AI5A 1AI6A 3K03A 2XAHA 4LP8A 2DQ0A 4PDRA 2LFSA 1AJPA 3D36A 1UJWB 1VQKV 3T4ZA 5C93A 1K8AW 2GHYA 4MTGA 4PELA 1W0KG 3K0GA 3ASOC 4MVMA 4WFHA 4JGSA 1KD1W 2EIKC 1BHAA 1OCZC 4H37A 4PDLA 1B6QA 3MHSC 3G6EV 3JD0A 2NLJC 4ZBMA 1F51A 1JOYA 1M56B 4HAMA 1GM9A 1MOFA 3LNMB 3VBBA 1Y66A 1BHBA 1PNLA 3P30A 3SYQA 1H8EG 3I55V 1H2GA 2XNDG 1VQ9V 4MVOA 3SPJA 2W6IG 2QTOA 4MTXA 1NQTA 3JD1A 1JJ2U 3ABMB 3BEHA 3X2QC 3IFXA 2JEUA 2B1GA 1RM1C 1AJQA 4N23A 1V55C 3K0DA 1JQ0A 3LUTB 3ZRXA 3ZMVA 1YJWV 4I9WA 4UV9A 2EZPA 1R6KA 4XDLA 3AG4C 1P7BA 4TWKA 2Z5UA 4YXWG 2Y69B 4KUMA 4MW8A 5CBGA 1J95A 2X0LA 3CP1A 1JCHA 4JTAB 1EZJA 3BY6A 3SYAA 3K04A 1K34A 1L1FA 2X6BA 1K5SA 2A79B 5IDJA 3GB7C 1WLEA 1HWYA 4MW3A 1NR7A 5LGTA 4LCUC 1QLEB 1IXMA 1R3KC 1VQ7V 2AHYA 3T4DA 2PI4A 4Z1MG 3ZJZA 3W7XA 2R9IA 2WPDG 3K06A 3STLC 3E86A 2DYRC 2CK3G 3SYPA 1KECA 3PJSK 4JTCB 3OR7C 2WLLA 4WCEV 3QO5A 3E35A 1DF5A 1GM8A 5EBLC 1OCCB 5B1NA 1K9MW 1QCEA 1KP2A 3ABLB 3OE7G 2V1DA 3JD2A 4BW5A 3K9AA 3CPWU 2Q6AA 1VQLV 3CC2V 5EBWC 1KKDA 2P90A 4TSFG 1K92A 4UVCA 3G71V 5DM6V 2EZOA 3ZRVA 3NXSA 5EC1C 1TUEB 3QO7A 1CP9A 2NNUA 2Y48A 1G8MA 2EILB 2QM7A 4WFAV 5L3BA 3ASNC 4JF3A 3CYOA 4RUFA 2XASA 3ZN1A 2LP7A 3FKSG 2LFRA 5B1BC 5LHHA 5J9PC 3ASOB 4XBFA 5B1AC 3T1CA 4HZ3A 2EIKB 4FMTA 1BL8A 1GK9A 4KFMA 2QA4V 5GW7A 1OCZB 1F4NA 5BZBA 3HB3B 1YTFB 3OMNB 3CCVV 3OEEG 2OT5A 4G28B 2ZR3A 2QE7G 2WLJA 2DQ3A 2A9HA 2H94A 3FB6C 4PDVA 2ATKC 4G2KA 3RW0A 4QPJA 2IH1C 1VQ8V 1GTOA 3E8FA 2P6JA 4R7CA 3SPGA 1NH2B 3HPLC 2QM8A 2KB1A 4MVQA 5KUMA 4RQFA 1CPYA 3JD4A 4QPKA 3FYEB 4UVBA 1ENVA 1VQNV 4R6ZA 1QLNA 2UXNA 3G4SV 3E83A 2ZD9A 3OMIB 1S76D 3X2QB 4N21A 1RM1B 1H38A 1V55B 1QVGU 1S3JA 5IYDO 3QO8A 4X89A 1CEZA 1JVMA 3AG4B 1PNKA 3F7YC 4CZZA 5HFLA 5KA5A 4RAIA 5LHGA 1R3IC 3P32A 1FS0G 4BAYA 1M1KW 3K3WA 4GT1A 3ZRWB 2HG5C 1FFTB 2WLLB 3ZN0A 3ZMSA 4KP4A 2ZR2A 2IH3C 2FTKA 5IY5C 3B8MA 2ZXWC 2Z3YA 4WFFA 4QNHB 4ASUG 4J9YB 4H33A 3E8HA 2DYRB 4PA3A 3UKMA 2UXXA 4FJCC 2WLIB 1K4CC 4MT8A 3ML0A 3LDEA 1GKFA 3MD0A 3FB7C 3W7UA 1PL0A 3SPHA 1JPXA 3SPIA 3FB5C 3ZMUA 2WWWA 4FIPC 1Q86W 4PA9A 1I5XA 1LNQA 2HR3A 5IYBO 5B3SC 2HJFC 4JPRA 1QVFU 2GSMB 2ZQMA 1Q82W 2YEVB 1AI7A 4MS2A 2WAMA 4DXWA 1YJNV 3QNEA 2HKOA 4J9ZB 2YSUB 4GX2A 1SZTA 3AEIA 2Q67A 4EKWA 5CBFA 5LGNA 3CCLV 4QJFB 3ETGA 4U7NA 4WFBV 2DYSC 1FXKC 3ZRWA 1M57C 5L3CA 3TCUA 2JJ1G 4GCZA 3ASNB 5CMUA 1YIJV 1S5HC 3IGAC 4LC1A 1JX9A 5B1BB 1OHHG 1OCRC 1Q7YW 4MSWC 3CMEV 2XAFA 4FPPA 5B1AB 1KP3A 1V54C 2ZDIC 2EIJC 1K4DC 2IJKA 3W7SA 3W7WA 2P7TC 4PA7A 4Q20A 2WLIA 4GX0A 5CN0A 2B1IA 1I5YA 2MK3A 4P30A 2W0FC 3SPCA 1ROPA 1YITV 4UUJC 2C2AA 1NVPD 1E1RG 1THZA 1K97A 3E8BA 1VQPV 2OTJV 2EIMB 2P67A 1VQ5V 2F43G 5EBMC 1PD3A 1R3JC 2YEVA 5LHIA 3MHHC 1F23A 3I56V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 V;  1VQ6 V;  1YI2 V;  3CME V;  1VQL V;  3CC2 V;  1NJI W;  1YJ9 V;  1K8A W;  3CCM V;  1VQN V;  1QVF U;  1Q82 W;  3CCS V;  3G4S V;  1KD1 W;  1JJ2 U;  2QA4 V;  1YJN V;  1R73 A;  3CCQ V;  1N8R W;  1VQ7 V;  3G6E V;  3CCE V;  2QEX V;  4WF9 V;  1QVG U;  3G71 V;  3CCV V;  5DM6 V;  1YJW V;  3CCL V;  3OW2 U;  2D3O W;  1VQ9 V;  1Q81 W;  4WFB V;  1YIT V;  3CC7 V;  1W2B U;  3CCR V;  3CCU V;  1VQO V;  3CD6 V;  3CMA V;  4WCE V;  1VQ4 V;  4WFA V;  1VQP V;  2OTJ V;  1KQS U;  2OTL V;  1YIJ V;  1M90 W;  1K9M W;  3CCJ V;  1VQ5 V;  1KC8 W;  1VQ8 V;  3I55 V;  1M1K W;  1K73 W;  3CXC U;  1YHQ V;  1Q86 W;  1S72 V;  1VQK V;  1Q7Y W;  3CPW U;  3I56 V;  1VQM V; 
#chains in the Genus database with same CATH topology
 5LP6 B;  4QE9 A;  1ZLZ A;  3RVZ A;  1SET A;  4JYC A;  4OPH A;  2ETN A;  1N8R W;  3LDC A;  4WFG A;  3LSS A;  5IT9 N;  2QWR B;  2UU9 B;  4GKK B;  2JS3 A;  1KYO F;  1ZX3 A;  4F6R B;  1H2S B;  2EIM C;  4X9Q A;  4JI7 B;  4DV3 B;  1ZWI C;  4DK1 A;  1PKX A;  3G80 A;  3F5W C;  3H01 A;  4O4I B;  3K79 A;  2CTR A;  2B5U A;  4X62 B;  1N36 B;  2V4D A;  2ADP A;  4JAU A;  3M99 B;  3M7M X;  1RSO A;  2RJZ A;  1QU7 A;  3HKB A;  5K1X A;  3OTO B;  1Q6I A;  1GN6 A;  3OFN G;  4MVZ A;  3HKD A;  2MW2 B;  4PA6 A;  2W6J G;  1I0H A;  3JAR A;  1XNQ B;  1QNM A;  1AB3 A;  1SQP H;  3I5D A;  1GO3 F;  1NJI W;  5L3F A;  2A06 H;  4MVR A;  5H9C A;  3RVY A;  2YID A;  3ABU A;  2XAQ A;  4B3M O;  4D7S A;  1K7D A;  3WG7 C;  3K5L A;  1FJG O;  3FB8 C;  3ABK C;  4UCO A;  4D7T A;  3T2M A;  4E4E A;  1ARO P;  3A0R A;  3N2K B;  1MSW D;  1XL6 A;  1NI8 A;  2ZNJ A;  4LF8 O;  2HJD A;  2CH7 B;  4G27 B;  2VQE B;  1R3L C;  3U0Z A;  4DR4 B;  3ZIA G;  4CH4 A;  4LFB O;  1Q81 W;  4JYB A;  3KG2 A;  3CXH F;  4A5U B;  1EN4 A;  5KA6 A;  2ITD C;  5KHG A;  3FFQ A;  4X66 O;  3RYF B;  1HR0 B;  1TAE A;  2Y0I A;  2CE4 A;  4PA4 A;  4FLW A;  4BIZ A;  4DR2 O;  3EXA A;  4U3J A;  1XMO O;  1WPB A;  3A0H Z;  4IHJ A;  3AG3 B;  1F4M A;  3HKB B;  4QIW F;  3J80 N;  3ZX6 A;  4I0X B;  3G6B A;  1YI2 V;  3HKD B;  4EB6 B;  2FKX A;  1URF A;  4YIP A;  2HEP A;  3CJH A;  3JAR B;  4PDM A;  3UM7 A;  1NTK H;  4JAA A;  2ZT9 B;  3CCE V;  4AIL C;  1BMF G;  2LJ2 A;  3RN4 A;  4CH6 A;  2PYJ A;  2BOB C;  3ETE A;  1QR8 A;  3AK3 A;  1VQO V;  2WLK A;  3CRQ A;  4BIU A;  3IC7 A;  3BFR A;  3OMA B;  2HVJ C;  3S3X A;  2N74 A;  1S77 D;  2WLM A;  2XUM A;  3SJA C;  2BTQ A;  2YXH A;  1WB8 A;  3VQX A;  4X64 O;  1OCO B;  1AR1 B;  1P7G A;  1I94 O;  1W2B U;  1VQ4 V;  1HW7 A;  2RN9 A;  4LP8 A;  4PDR A;  5IE9 A;  2LFS A;  3D36 A;  2GHY A;  4MTG A;  1QQC A;  1W0K G;  3K0G A;  3APQ A;  2F23 A;  3K58 A;  1B6Q A;  3MHS C;  4LF4 O;  4ZBM A;  1F51 A;  4HAM A;  5IJ9 A;  4ZIB A;  1FJG B;  4TV8 B;  4CH5 A;  3N2G B;  1KKC A;  3AK2 A;  3ETQ A;  4LF8 B;  1IX9 A;  3UT5 A;  3B2E E;  1Q43 A;  2LQT A;  5EIB D;  1TUB B;  3IFX A;  1RM1 C;  1AJQ A;  3K0D A;  3ZS8 C;  1P7B A;  2ZE7 A;  5A2Q N;  2Y69 B;  4KHP O;  4K0K B;  1Y76 B;  5EZY A;  3SYA A;  1JCH A;  3BY6 A;  2GDS A;  1Q6H A;  5IJ0 A;  1K5S A;  2Q7H A;  5IDJ A;  4X66 B;  2NR5 A;  1V9P A;  1IXM A;  1VF6 A;  2PI4 A;  5K1P A;  3STL C;  2QWO B;  4W4K A;  2DYR C;  3J7A U;  3SYP A;  1XMO B;  3RFR A;  3QO5 A;  2RDC A;  1Q90 D;  1K9M W;  1KP2 A;  2V1D A;  3JD2 A;  4GUN A;  1VQL V;  4I4T B;  4TSF G;  5KX5 B;  4UVC A;  2WA4 A;  5DM6 V;  2HHH O;  2EZO A;  5KHI A;  1XBL A;  3E22 B;  2Y48 A;  3A0B Z;  3A8T A;  2EIL B;  4WFA V;  4NXM O;  4JF3 A;  3HKC A;  3ZN1 A;  2ZE6 A;  4LR3 A;  3BVO A;  3ASO B;  1BCC H;  5JQG B;  1BL8 A;  3B40 A;  4IIJ A;  2VWJ A;  1OCZ B;  1F4N A;  4YJ3 B;  3HB3 B;  1PM9 A;  2OT5 A;  2ZR3 A;  2VWK A;  4NXN O;  3FB6 C;  2PZS A;  3OT7 A;  4X64 B;  3RW0 A;  1I94 B;  1RP3 B;  2P6J A;  4R7C A;  4PI0 A;  1L0N H;  2KB1 A;  3FYE B;  1VQN V;  1QLN A;  2UXN A;  4DRX B;  5EZY B;  3X2Q B;  4N21 A;  2N05 A;  1H38 A;  5KAF Z;  5IJ0 B;  2OYQ A;  4D6T H;  1P49 A;  1YVW A;  4DW1 A;  1R3I C;  5LMU O;  2YI8 A;  1FS0 G;  2JGD A;  1M1K W;  3K3W A;  4JI8 O;  4J7Z A;  3ZMS A;  3GWK C;  2ZKO A;  2FTK A;  3B8M A;  1FFX A;  4DK0 A;  5FNV A;  1HP8 A;  4J9Y B;  4MT8 A;  3ML0 A;  1Y74 A;  1GKF A;  3FB7 C;  3W7U A;  1PL0 A;  3KCY A;  2PF4 E;  4NYK A;  3FB5 C;  3ZMU A;  3JAK B;  2DMX A;  3QF7 A;  3KZI Z;  4LF7 O;  2HR3 A;  5B3S C;  2HJF C;  5LYJ A;  4PV1 B;  1AI7 A;  5ITZ A;  2JS5 A;  1XHZ A;  2GV9 A;  4X65 O;  4FLT A;  1FPO A;  5LGN A;  4QJF B;  2DJV A;  4U7N A;  3WB2 A;  2BCC H;  3M8A A;  5AG2 A;  4IIJ B;  4DR5 O;  1M57 C;  2ZNI A;  1G1X B;  4FZ0 A;  4TQD A;  5KLV H;  1ZTE A;  1Q5O A;  1OHH G;  1Q6U A;  1CXZ B;  3CME V;  3W7W A;  5GTI Z;  2P7T C;  1MMM A;  2WLI A;  3GVM A;  1XI1 A;  5J2T B;  5CN0 A;  1I5Y A;  3IJ4 A;  5BY1 A;  2ZE5 A;  3U10 A;  5JJE B;  2LW1 A;  2EIM B;  5EBM C;  1LUW A;  2YEV A;  4LNU B;  4NXM B;  1JFF B;  3AG1 C;  4ZHQ A;  4DR3 B;  2QKS A;  4NTY A;  1K33 A;  1R6N A;  2Z0A A;  4LF6 O;  4X1K A;  2L35 A;  1M9N A;  1I08 A;  2XAJ A;  1XEQ A;  4O4L A;  1T5E A;  1XHX A;  5IYZ B;  1FFX B;  1SC5 B;  3TET A;  4RO2 A;  3FYI B;  4NXN B;  2WLN A;  2WLH A;  1P4R A;  4KXR A;  1Y74 B;  2YC0 A;  4O4J A;  5IY5 B;  1Q8I A;  3WFV A;  1MG1 A;  2ZXW B;  5FL7 G;  3RBZ A;  4WFE A;  1Y4M A;  4F4L A;  2Q68 A;  4LF5 O;  4MVU A;  4LH7 A;  4O4H A;  4R8C A;  5LP6 A;  2UXC O;  5LMU B;  3LDD A;  1VQM V;  4L87 A;  3H1J H;  3OGC C;  2OWO A;  2H8P C;  3Q4H A;  1QBZ A;  2IJJ A;  1SER A;  3ZHT A;  3OEH G;  1FXK B;  2AW9 A;  3JSN A;  2R9A A;  4O4I A;  2AXT Z;  3CCJ V;  4UFZ A;  3CEI A;  3QVN A;  5L3E A;  2EIJ B;  3SJC C;  1OJH A;  4LF7 B;  5KHK A;  3UCS C;  2IJH A;  1S0V A;  1MAB G;  4UXN A;  5JH7 B;  4LBE C;  5JVD B;  4X65 B;  5LA6 B;  1IBK B;  2ZM6 O;  5EK0 A;  2CGO A;  4BIO A;  1SQV H;  4O4L B;  3E2E A;  4DR5 B;  5EYP A;  1M5I A;  3CXC U;  1PNM A;  5C8Y A;  2X6C A;  2K9P A;  4OXS A;  1VQ6 V;  3F7V C;  4YY3 O;  2EIN B;  2YIC A;  3CCS V;  5EC2 C;  3N2K A;  4O4J B;  3TXS A;  1EBO A;  1O9G A;  1D5N A;  1GN3 A;  3DTU B;  2E5L O;  3CHX A;  1SQQ H;  1H2N A;  2F95 B;  2OCC B;  4O4H B;  1K3E A;  5L3G A;  2ITC C;  1S5J A;  1E1Q G;  1QLE C;  2F4V O;  1SF9 A;  4PHZ A;  3AG2 B;  4LF6 B;  1VAR A;  2QSA A;  1NVP B;  1FAF A;  1YTF D;  3Q4H B;  3RWR D;  5JJN B;  3RYF A;  1D5A A;  3BA8 A;  2PGG A;  4FLZ A;  3ABT A;  4YJ2 B;  2ADQ B;  4P9P A;  2IU3 A;  3B4S A;  3JCZ A;  4J41 A;  4K35 A;  4JI3 O;  3CCU V;  4I0X A;  4LF5 B;  1W0J G;  3K03 A;  1NU1 H;  4EB6 A;  2XAH A;  2Y4T A;  3AG7 A;  2E3C A;  2YDE A;  1H2L A;  3T4Z A;  2UXC B;  4OGQ B;  3S3W A;  5EYP B;  4WFH A;  1KD1 W;  2W0X A;  2EIK C;  1BHA A;  4DW0 A;  5C8Y B;  1M56 B;  3RYC B;  5CA0 B;  2YIB D;  3K5M A;  2GUZ B;  3LNM B;  4FVM A;  2ZIM A;  1Y66 A;  1BHB A;  2RNB A;  1SKV A;  1MSD A;  3CSX A;  2E76 B;  1BQZ A;  4YIO A;  1VQ9 V;  3SPJ A;  1DK1 A;  3ABM B;  3WU2 Z;  5GON A;  4N23 A;  3LUT B;  3ZRX A;  3RT3 C;  4I9W A;  1WB7 A;  1R6K A;  3AG4 C;  4TWK A;  4K0K O;  2FL4 A;  2R70 A;  4KUM A;  4IYH A;  2ZM6 B;  4JTA B;  1P84 F;  3F5T A;  1HWY A;  4MW3 A;  4C7U A;  1NR7 A;  5LGT A;  1F7Y A;  4LCU C;  3DC6 A;  4YY3 B;  1IDS A;  1VF7 A;  5LMN O;  4TV8 A;  3KCX A;  3KKY A;  3N2G A;  3PJS K;  3OR7 C;  2WLL A;  4WCE V;  5B1N A;  1OCC B;  3RYI A;  3ABL B;  3OE7 G;  2XHB A;  1YEW A;  4OPA A;  3L75 H;  1R1B A;  3K9A A;  1TUB A;  5KHJ A;  2E5L B;  1KKD A;  2P90 A;  1LUV A;  4PD4 F;  1K92 A;  4DV1 B;  3RGB A;  2F4V B;  1Y76 A;  3OTF A;  1FYJ A;  1G8M A;  2Q0A A;  1N34 O;  3ASN C;  4RUF A;  3ZHU A;  3FKS G;  2LFR A;  5B1B C;  1IVS A;  3JCU Z;  5LHH A;  4ABM A;  5B1A C;  3H1K H;  3CWB H;  4KFM A;  2QA4 V;  1NS1 A;  1JA8 A;  3OMN B;  2WLJ A;  2DQ3 A;  2ATK C;  5GON B;  4JI3 B;  3L9D A;  4FZ1 A;  4I4T A;  4JI5 O;  1NT2 B;  1SA0 B;  3H1L H;  2DN9 A;  5E79 Z;  5KX5 A;  1SZX A;  5KUM A;  5LP6 C;  4QPK A;  3JAM N;  1ENV A;  4R6Z A;  5FPO A;  3G4S V;  4LWS A;  1S5L Z;  3E22 A;  1BE3 H;  3HR0 A;  1V55 B;  2ARH A;  1QVG U;  2XT9 A;  5IYD O;  5A9G A;  2ZCE A;  2D2C B;  3JAS B;  1BZK A;  3F7Y C;  1XOU A;  4RAI A;  1GRJ A;  4BAY A;  4ICG A;  5FLX N;  5JQG A;  4CH3 A;  5J2U A;  4GT1 A;  4F6E A;  4YJ3 A;  2WLL B;  2EX3 A;  4KP4 A;  2IH3 C;  4WBN B;  3RYI B;  4JZG A;  1ZL8 B;  2Z3Y A;  4WFF A;  4JI4 O;  4ASU G;  4AQY O;  4CC5 A;  4FM0 A;  4L8J A;  2UXX A;  4FJC C;  3MD0 A;  2F1M A;  4J7J A;  3SPH A;  1JPX A;  4DRX A;  4FIP C;  1Q86 W;  4IT5 A;  5IWA O;  4GZR B;  4JPR A;  2GSM B;  2ZQM A;  4MS2 A;  1YJN V;  2YSU B;  1DGS A;  1HNX O;  3AK1 A;  3FD9 A;  4EKW A;  3CCL V;  1PL4 A;  4B3S O;  5LMN B;  5L3C A;  1GH6 A;  3TCU A;  5CMU A;  1YIJ V;  2UUA O;  1OV9 A;  3JAT B;  1JX9 A;  2ZIN A;  1Z2G A;  4MSW C;  1XNR B;  2XAF A;  4FPP A;  2QGN A;  1B04 A;  1BGY H;  3W7S A;  2IJK A;  3TXQ A;  1W59 A;  3RYH B;  4CS3 A;  2B1I A;  3UO2 A;  2OCH A;  4P30 A;  4DV5 O;  1B3Q A;  3BCC H;  4LWS B;  4DV6 O;  1L8D A;  3JAK A;  4CC6 A;  3K9S A;  4RWU A;  2OTJ V;  1O9H A;  2UXB O;  2F43 G;  1N34 B;  1R3J C;  5D5Q A;  5LHI A;  1IZ3 A;  4DR3 O;  3MHH C;  2BTO A;  3I56 V;  5KAI Z;  4I50 B;  2BOC C;  2P06 A;  3CRR A;  4GX1 A;  5J2U B;  4FFK A;  3SJB C;  1YZB A;  5JJJ B;  1GM7 A;  4P2Z A;  3FX7 A;  4H13 B;  1QR9 A;  4JV5 O;  1DF4 A;  4DYL A;  3AG3 C;  3L70 H;  1SQG A;  1AR4 A;  2EJ7 A;  2A3Q A;  2V7Q G;  3SGI A;  2JIZ G;  5H6Q A;  2Q0O C;  2UXD O;  4XDK A;  3CB2 A;  1OZ0 A;  4I55 A;  5J2T A;  4JI5 B;  2P4K A;  2GTS A;  1TVK A;  1HNW O;  2OIG A;  4UVA A;  3N27 A;  4FLV A;  1SES A;  3EFF K;  4LNU A;  3LSQ A;  5KHH A;  4X88 A;  2IW5 A;  1JFF A;  2QJ1 A;  2P5O A;  1G4Y B;  1VIB A;  4GX5 A;  4K3A A;  2PI5 A;  5BR8 O;  1XDC A;  1S72 V;  4LFA B;  2X7R B;  3T1Y O;  2VQF O;  1XL4 A;  5IYZ A;  3H9V A;  2JJ2 G;  3JAL B;  1RPO A;  2RQ6 A;  4JI4 B;  1OCO C;  2IJI A;  2DYS B;  1SS3 A;  4AQY B;  2EJR A;  3VOU A;  4DR1 O;  1ZAU A;  3ZHV A;  2XOK G;  4E2L A;  1OCR B;  1AJN A;  4HNA A;  4UCS A;  4JAS A;  3NR7 A;  4CBC A;  5KMG B;  1V54 B;  4JTD B;  5IWA B;  1N32 O;  1MNG A;  5E1A C;  1KU9 A;  3WB0 A;  3W7T A;  1RPR A;  1IBK O;  3ZRS A;  4FFB B;  1HNX B;  4B3S B;  1KQS U;  1YCI A;  1M90 W;  1D2D A;  1EFR G;  1COW G;  2WSS G;  4U3F H;  2Q69 A;  2UUA B;  2M7W A;  2YUA A;  1J5E O;  1M4U A;  2QWN B;  2EBO A;  1FXK A;  1SRY A;  3UO3 A;  2PYL A;  4I55 B;  2XAG A;  1WN7 A;  4O2A B;  4FLU A;  1TVK B;  4DV5 B;  2QKC A;  4CS2 A;  2Y69 C;  4DV6 B;  2VRZ A;  2NN4 A;  3MAQ A;  2ZDI A;  4RQE A;  1Q3E A;  1IBM O;  2UXB B;  2HLD G;  4KL1 A;  3ZMZ A;  4PJ0 Z;  5JH7 A;  1FXV A;  5JVD A;  1DTO A;  5LA6 A;  2Q7G A;  4R50 A;  4FM1 A;  2DWD C;  2Q9L A;  2JRI A;  4B7K A;  2QEX V;  5LOV B;  2A0L A;  4J42 A;  3OGI B;  5L3D A;  5H6R A;  2DW4 A;  4MTO A;  2GBO A;  2Y4U A;  3IAY A;  4I5S A;  3CCR V;  2PY5 A;  1YSC A;  3ETD A;  4JV5 B;  5LL6 Y;  2QTS A;  3OUF A;  2UUB O;  4Q6G A;  5IYC O;  1AI4 A;  2IU0 A;  1NR1 A;  3ICX A;  3ZMT A;  3EHB B;  4UCU A;  1NH2 D;  1HDJ A;  3K08 A;  3BPZ A;  1GMG A;  2UXD B;  1GAX A;  3D36 C;  4X8A A;  3E8G A;  1VP7 A;  4HNA B;  4U7O A;  4B3T O;  4TT3 G;  3R65 A;  3WG7 B;  3L71 H;  4P9O A;  1HNW B;  4MTF A;  1WPX A;  3ABK B;  3STZ C;  1FXH A;  1K5Q A;  2EIL C;  3OAA G;  4YHH O;  1AI5 A;  2DQ0 A;  2F66 C;  4J80 A;  1VQK V;  5C93 A;  3ZED A;  1K8A W;  3VQW A;  3ASO C;  3B09 A;  5BR8 B;  1BS3 A;  4MVM A;  2PTM A;  4JGS A;  3T1Y B;  2VQF B;  1OCZ C;  4H37 A;  3G6E V;  1JOY A;  4UCT A;  1WAZ A;  1GM9 A;  3P30 A;  5LXT A;  4YJ2 A;  5BMV B;  3I55 V;  2Q5Z A;  2XND G;  3UQ8 A;  4DR1 B;  4MVO A;  4FM2 A;  4I7Z B;  3H1H H;  1EM1 A;  2QTO A;  4MTX A;  2RCV A;  3BEH A;  3X2Q C;  2B1G A;  1N32 B;  3ZMV A;  1JQ0 A;  1WP8 A;  1YJW V;  2CDY A;  1BT8 A;  1L0L H;  1Y6X A;  4UV9 A;  2EZP A;  4XDL A;  2CGN A;  1KB9 F;  1VF6 C;  5CBG A;  4I9Q A;  2X0L A;  3CP1 A;  3K04 A;  1K34 A;  1XMQ B;  2X6B A;  2Q8V A;  1WLE A;  3RYC A;  5CA0 A;  2CAZ C;  1J5E B;  2GUZ A;  1N33 B;  1KBH A;  2AHY A;  3ZJZ A;  4JI6 O;  1US6 A;  2R9I A;  4NR1 A;  2WPD G;  4FLX A;  2CK3 G;  4TOI A;  2WA3 A;  4JTC B;  3E35 A;  1DF5 A;  5EBL C;  4ZOL B;  5CB4 B;  3CRC A;  3CPW U;  1IBL O;  3CC2 V;  1IBM B;  4B3R O;  2CTQ A;  5EBW C;  3VQV A;  4DV1 O;  2YIA A;  4IGG A;  3G71 V;  3L73 H;  3ZRV A;  3NXS A;  5EC1 C;  4JI1 O;  3FAV A;  1CP9 A;  4DV0 O;  2QM7 A;  5L3B A;  3CYO A;  2XAS A;  2LP7 A;  4DUZ B;  2UUB B;  1XRE A;  5J9P C;  4Z1V A;  5LXT B;  1HNZ O;  4FMT A;  1GK9 A;  2BE3 A;  1YTF B;  3CCV V;  2QE7 G;  4B3T B;  4O2B B;  2H94 A;  4PDV A;  4G2K A;  2IH1 C;  1NZ6 A;  4BR6 A;  4YHH B;  1N4C A;  3E8F A;  2BSK B;  3HPL C;  1UPG A;  4MVQ A;  2EUL A;  4NTX A;  1CPY A;  4DR7 O;  3JD4 A;  4UVB A;  2CTP A;  2RMK B;  2Q73 A;  4ZI7 B;  5BXZ A;  1RM1 B;  1S3J A;  3G67 A;  1AVM A;  4JYA B;  4X89 A;  1CEZ A;  2ZE8 A;  1JVM A;  2QDO A;  4CZZ A;  5KA5 A;  5HFL A;  5LHG A;  3CS5 A;  2FB5 A;  4IYI A;  3O65 A;  3O9O A;  3ZRW B;  4CS4 A;  2HG5 C;  3DXR A;  5TIS Z;  5IY5 C;  1N0N A;  2ZXW C;  4K8Z A;  2YS8 A;  3C3T A;  2QR4 A;  4H33 A;  3A2F A;  3E8H A;  2DYR B;  4PA3 A;  1SQF A;  2B9Z A;  1SA0 A;  1AIL A;  3LDE A;  2Q7E A;  4TUY B;  3SPI A;  3BRC A;  2WWW A;  3FAV B;  3CX5 F;  1Z5V A;  1VMG A;  1I5X A;  4J11 A;  1LNQ A;  1JMK C;  2LGW A;  5IYB O;  1QVF U;  1Q82 W;  2WAM A;  3JAS A;  2HKO A;  2LW7 A;  4JZ2 A;  1SZT A;  2Q67 A;  4WFB V;  4JI6 B;  1MA1 A;  1FXK C;  2KKW A;  4GCZ A;  4WBN A;  4J10 A;  2QWQ B;  1XNR O;  1ZL8 A;  2E74 B;  1PPJ H;  4AHC A;  2ZDI C;  2EIJ C;  4JI0 O;  1M93 A;  1EZV H;  1IBL B;  4PA7 A;  4B3R B;  4Q20 A;  1N0J A;  3JSL A;  3MDS A;  2MK3 A;  2W0F C;  4TQF A;  1YIT V;  1RSO B;  4JI1 B;  5JCO A;  1VQ5 V;  3QG5 A;  4DV0 B;  4BWA A;  3QTC A;  1F23 A;  1PP9 H;  4EEQ A;  1RFY A;  1DLB A;  2EIN C;  4DO2 A;  1R73 A;  1A32 A;  3K5O A;  2JGU A;  3D3I A;  1HNZ B;  5HFM A;  1YDX A;  3DXR B;  3T1H O;  1G6U A;  2DE0 X;  1KUQ A;  5KUK A;  4LFC O;  3D3Q A;  3JAT A;  1IUR A;  4DV2 O;  2P22 C;  5CBH A;  2UUC O;  4XDJ A;  3CE2 A;  1ORQ C;  2CTW A;  2OCC C;  2R9R B;  3RYH A;  4HYO A;  3E89 A;  4IL6 Z;  3CCM V;  4DR7 B;  3DGE A;  3AG2 C;  3JD3 A;  2JDI G;  2DOS A;  3CMA V;  4DV4 O;  4HBN A;  4DUY O;  1GN2 A;  4I50 A;  1KC8 W;  3SJQ C;  4LFA O;  1JR9 A;  1NBM G;  3OM3 B;  1XIL A;  2JVD A;  5B1O A;  3TGU H;  5B3S B;  4JI2 O;  1AP6 A;  3D8C A;  3DC5 A;  3CCQ V;  2FYU H;  1BSM A;  2D3O W;  2JEX A;  4B3M B;  3SYO A;  1ZSP A;  1H2K A;  4U3J B;  4LF9 O;  1M57 B;  3LSU A;  3OR6 C;  1H8H G;  3ZBH A;  3JYC A;  4UB8 Z;  4IHJ B;  1WA8 A;  1U96 A;  1AP5 A;  3SR2 C;  3K57 A;  1WNS A;  4B08 A;  4K8X A;  3ZCC A;  5H2F Z;  2AHZ A;  3THO A;  1M56 C;  5LGU A;  5F2V O;  3OW2 U;  3CJH B;  3C90 A;  4LFB B;  3CC7 V;  2YI9 A;  1UFI A;  4W4L A;  5DN6 G;  4JAV A;  2OTL V;  1WJZ A;  2HVK C;  1K73 W;  1YHQ V;  3JAL A;  3AG1 B;  1Y67 A;  2F93 B;  3ABM C;  4DR2 B;  4EFE A;  4JI0 B;  1BQ0 A;  4WF9 V;  4DR6 O;  3SYC A;  1KMI Z;  4UV8 A;  3B8N A;  2IM9 A;  3GWO A;  2BTQ B;  2HP8 A;  5KMG A;  3K59 A;  1YF2 A;  2AZ0 A;  1NKD A;  4NKG B;  3CC4 V;  3BAA A;  2A7W A;  1YJ9 V;  4QE7 A;  1E79 G;  2X6A A;  4FFB A;  2IBZ H;  4ZKI A;  4X20 A;  2JK5 C;  2R72 A;  2ODM A;  2HFE C;  3PN1 A;  3TK1 A;  4FK5 C;  3T1H B;  3J81 N;  1JJO A;  5CA3 A;  2K1E A;  4LFC B;  3B77 A;  4RUE A;  1OCC C;  5IJ9 B;  4GKJ O;  3ABL C;  4DV2 B;  2UUC B;  1SQX H;  5GTH Z;  5LBQ A;  2O57 A;  3ZHS A;  1YXB A;  4O2A A;  2DWE C;  1WA8 B;  3UT5 B;  2XTA A;  4MVS A;  3OUS A;  2GTA A;  3CD6 V;  4B7E A;  5H5N A;  1XUQ A;  1AI6 A;  4DV4 B;  4DUY B;  5JWP A;  3K5N A;  1AJP A;  1UJW B;  2G38 A;  4PEL A;  5LOV A;  5FPR A;  1EN6 A;  4JI2 B;  4PDL A;  2P4V A;  3JD0 A;  2NLJ C;  4DV7 O;  3ZHR A;  4LF4 B;  1MOF A;  2LGQ A;  4J7K A;  2E75 B;  3VBB A;  1PNL A;  3SYQ A;  1H8E G;  3CRA A;  2ILM A;  4LF9 B;  3R66 A;  1H2G A;  3LNN A;  2AZ2 A;  1MZF A;  1XQ8 A;  2W6I G;  2OIE A;  3BHP A;  1NQT A;  3JD1 A;  1JJ2 U;  4X1I A;  2JEU A;  1V55 C;  3C3S A;  3HKE A;  2Z5U A;  4X20 B;  4YXW G;  4QGP A;  3P3P A;  2L6L A;  2KG7 A;  4KHP B;  2YXY A;  4MW8 A;  1J95 A;  1XMQ O;  1EZJ A;  2KSD A;  1L1F A;  2A79 B;  3HKC B;  4X1Y A;  3GB7 C;  4FLY A;  1N33 O;  4GLX A;  1QLE B;  4H44 B;  1R3K C;  1VQ7 V;  3T4D A;  2Y0P A;  4Z1M G;  3W7X A;  2QM4 A;  1X4T A;  3K06 A;  5BMV A;  5DED A;  3E86 A;  4DR6 B;  1KEC A;  4OX9 O;  4AI8 A;  1GM8 A;  3CRM A;  2QKA A;  2FML A;  1QCE A;  4TV9 A;  1SQB H;  4BW5 A;  1MZE A;  2VS0 A;  3VQY A;  2Q6A A;  1GN4 A;  5EIB C;  5JCO C;  4GYC B;  1AR5 A;  3TJT A;  1TUE B;  3QO7 A;  2HHH B;  4PI2 A;  2NNU A;  5CA1 A;  5B66 Z;  1X59 A;  2LO1 A;  4DUZ O;  2QWP B;  4GKJ B;  1R6T A;  1FD9 A;  4LH6 A;  4XBF A;  2JGD B;  1VEW A;  3T1C A;  4HZ3 A;  2EIK B;  1FKA O;  5GW7 A;  4Z2W A;  1ZUQ A;  5BZB A;  1NTM H;  2UU9 O;  2N04 A;  4GKK O;  1VF5 B;  3OEE G;  4G28 B;  4ZOL A;  1TGO A;  5CB4 A;  2A9H A;  4X1I B;  3JAW A;  5FNV B;  4JI7 O;  3H1I H;  4DV3 O;  3IC9 A;  1Z5W A;  4BW9 A;  4QPJ A;  3U11 A;  1VQ8 V;  1GTO A;  3HKE B;  3SPG A;  4X62 O;  1NH2 B;  1N36 O;  2QM8 A;  4RQF A;  4H0L B;  2KG7 B;  3L72 H;  3E83 A;  2ZD9 A;  3OMI B;  4UCR A;  1S76 D;  3OTO O;  4JYA O;  1PV0 A;  5LYJ B;  4X1Y B;  3QO8 A;  5D5P A;  4UB6 Z;  5ITZ B;  4DV7 B;  3AG4 B;  1PNK A;  1XNQ O;  3P32 A;  3ZHQ A;  1U97 A;  3BAB A;  5B5E Z;  1FFT B;  3ZN0 A;  4JI8 B;  2ZR2 A;  3BA9 A;  2CUG A;  4TV9 B;  4O2B A;  4QNH B;  4NB5 A;  4F6R A;  2YXL A;  3UKM A;  2WLI B;  1K4C C;  2BSK A;  3DSQ A;  3P3N A;  2PUS A;  2VQE O;  4UCV A;  4NTW A;  1NTZ H;  4ZI7 A;  4PA9 A;  4DR4 O;  5CA1 B;  2YEV B;  3APO A;  4DXW A;  2M6Y A;  3QNE A;  4J9Z B;  4ZHQ B;  3OD4 A;  4GX2 A;  3AEI A;  5CBF A;  1WP7 A;  4NVP A;  4X1K B;  3ETG A;  2DYS C;  3WB1 A;  3ZRW A;  4EFB A;  2JJ1 G;  2ZIO A;  3ASN B;  4OX9 B;  1S5H C;  3IGA C;  4LC1 A;  5B1B B;  1HR0 O;  1OCR C;  1Q7Y W;  1LR1 A;  2KQX A;  2AGA A;  3JAW B;  1TA8 A;  5DEC A;  1QHT A;  2H3O A;  3L74 H;  2YIB A;  5B1A B;  1KP3 A;  1V54 C;  1K4D C;  1EN5 A;  1H2M A;  4GX0 A;  4JYY A;  3SPC A;  1ROP A;  4UUJ C;  2C2A A;  4TUY A;  1NVP D;  1E1R G;  2CH7 A;  2Q4P A;  1THZ A;  1B06 A;  1K97 A;  3E8B A;  1VQP V;  2P67 A;  3EVK A;  1I7F A;  1PD3 A;  1IXB A;  3SDL A; 
#chains in the Genus database with same CATH homology
 3AG1 C;  1DLB A;  4QE9 A;  2QKS A;  1K33 A;  3RVZ A;  1R6N A;  2EIN C;  4DO2 A;  1SET A;  2BOC C;  4JYC A;  1M9N A;  2XAJ A;  4GX1 A;  1R73 A;  1N8R W;  3LDC A;  3D3I A;  5HFM A;  4WFG A;  3LSS A;  1GM7 A;  4P2Z A;  5KUK A;  1QR9 A;  1DF4 A;  3TET A;  3AG3 C;  4RO2 A;  3FYI B;  5CBH A;  4XDJ A;  2WLN A;  2V7Q G;  2EIM C;  2WLH A;  2JIZ G;  5H6Q A;  1ZWI C;  1ORQ C;  1P4R A;  1PKX A;  4XDK A;  2OCC C;  3F5W C;  1OZ0 A;  3H01 A;  2R9R B;  4HYO A;  3E89 A;  3K79 A;  2B5U A;  3CCM V;  5IY5 B;  3WFV A;  1MG1 A;  2ZXW B;  4JAU A;  5FL7 G;  3RBZ A;  3DGE A;  3M99 B;  4WFE A;  3AG2 C;  3JD3 A;  1Y4M A;  2JDI G;  4UVA A;  4F4L A;  2Q68 A;  4MVU A;  1SES A;  3EFF K;  3OFN G;  3CMA V;  3LSQ A;  4MVZ A;  4X88 A;  2IW5 A;  4R8C A;  4PA6 A;  2W6J G;  1G4Y B;  1KC8 W;  4GX5 A;  3SJQ C;  2PI5 A;  3LDD A;  1NBM G;  3OM3 B;  1VQM V;  1S72 V;  5B1O A;  2X7R B;  4L87 A;  1GO3 F;  5B3S B;  1NJI W;  1XL4 A;  3OGC C;  2H8P C;  5L3F A;  4MVR A;  5H9C A;  2JJ2 G;  3RVY A;  3CCQ V;  3ABU A;  2XAQ A;  1K7D A;  1RPO A;  3WG7 C;  2D3O W;  2JEX A;  1QBZ A;  3SYO A;  1OCO C;  2IJJ A;  2IJI A;  3FB8 C;  1SER A;  3ABK C;  2DYS B;  3OEH G;  1FXK B;  2EJR A;  1M57 B;  3OR6 C;  3T2M A;  1ARO P;  3A0R A;  3VOU A;  1H8H G;  1MSW D;  1XL6 A;  3CCJ V;  3JYC A;  2XOK G;  4E2L A;  1OCR B;  1AJN A;  4G27 B;  1R3L C;  4JAS A;  4CBC A;  1V54 B;  4JTD B;  2EIJ B;  5L3E A;  3ZCC A;  5E1A C;  3ZIA G;  2AHZ A;  2IJH A;  1S0V A;  1MAB G;  1M56 C;  4UXN A;  4LBE C;  5LGU A;  3W7T A;  3OW2 U;  1RPR A;  3ZRS A;  1Q81 W;  4JYB A;  3KG2 A;  3CC7 V;  5DN6 G;  5KA6 A;  5EK0 A;  2ITD C;  4JAV A;  1KQS U;  2OTL V;  3E2E A;  1M90 W;  2HVK C;  1K73 W;  3CXC U;  1PNM A;  1YHQ V;  1COW G;  1EFR G;  2WSS G;  2X6C A;  2Q69 A;  4OXS A;  1VQ6 V;  3AG1 B;  2M7W A;  3F7V C;  4PA4 A;  2EBO A;  2EIN B;  4BIZ A;  3CCS V;  3ABM C;  1FXK A;  1SRY A;  5EC2 C;  4WF9 V;  2XAG A;  3SYC A;  1EBO A;  4UV8 A;  3B8N A;  3GWO A;  3AG3 B;  1F4M A;  2Y69 C;  3DTU B;  4QIW F;  2ZDI A;  4RQE A;  1NKD A;  2HLD G;  2OCC B;  1YI2 V;  5L3G A;  1K3E A;  3CC4 V;  2ITC C;  3ZMZ A;  1YJ9 V;  4QE7 A;  1E79 G;  1FXV A;  1DTO A;  2X6A A;  1E1Q G;  4PDM A;  3UM7 A;  1QLE C;  4R50 A;  4ZKI A;  2DWD C;  2QEX V;  3AG2 B;  3CCE V;  2JK5 C;  1BMF G;  2A0L A;  2HFE C;  5L3D A;  1NVP B;  5H6R A;  1YTF D;  2BOB C;  2DW4 A;  4MTO A;  3ETE A;  3TK1 A;  4FK5 C;  1QR8 A;  4I5S A;  3CCR V;  1YSC A;  3ETD A;  1VQO V;  2WLK A;  5CA3 A;  2K1E A;  3B77 A;  4RUE A;  1OCC C;  4BIU A;  3OUF A;  3IC7 A;  3ABL C;  3OMA B;  5IYC O;  2HVJ C;  1AI4 A;  2IU0 A;  1NR1 A;  3ZMT A;  3ABT A;  3EHB B;  5LBQ A;  1NH2 D;  3K08 A;  1GMG A;  1S77 D;  2WLM A;  2DWE C;  4P9P A;  3E8G A;  4X8A A;  4U7O A;  2IU3 A;  4TT3 G;  3R65 A;  3WG7 B;  3JCZ A;  4P9O A;  4MVS A;  1OCO B;  4MTF A;  3OUS A;  1AR1 B;  1WPX A;  3ABK B;  1W2B U;  3CCU V;  3STZ C;  1FXH A;  3CD6 V;  1K5Q A;  1VQ4 V;  2EIL C;  3OAA G;  1W0J G;  1AI5 A;  1AI6 A;  3K03 A;  2XAH A;  4LP8 A;  2DQ0 A;  4PDR A;  2LFS A;  1AJP A;  3D36 A;  1UJW B;  1VQK V;  3T4Z A;  5C93 A;  1K8A W;  2GHY A;  4MTG A;  4PEL A;  1W0K G;  3K0G A;  3ASO C;  4MVM A;  4WFH A;  4JGS A;  1KD1 W;  2EIK C;  1BHA A;  1OCZ C;  4H37 A;  4PDL A;  1B6Q A;  3MHS C;  3G6E V;  3JD0 A;  2NLJ C;  4ZBM A;  1F51 A;  1JOY A;  1M56 B;  4HAM A;  1GM9 A;  1MOF A;  3LNM B;  3VBB A;  1Y66 A;  1BHB A;  1PNL A;  3P30 A;  3SYQ A;  1H8E G;  3I55 V;  1H2G A;  2XND G;  1VQ9 V;  4MVO A;  3SPJ A;  2W6I G;  2QTO A;  4MTX A;  1NQT A;  3JD1 A;  1JJ2 U;  3ABM B;  3BEH A;  3X2Q C;  3IFX A;  2JEU A;  2B1G A;  1RM1 C;  1AJQ A;  4N23 A;  1V55 C;  3K0D A;  1JQ0 A;  3LUT B;  3ZRX A;  3ZMV A;  1YJW V;  4I9W A;  4UV9 A;  2EZP A;  1R6K A;  4XDL A;  3AG4 C;  1P7B A;  4TWK A;  2Z5U A;  4YXW G;  2Y69 B;  4KUM A;  4MW8 A;  5CBG A;  1J95 A;  2X0L A;  3CP1 A;  1JCH A;  4JTA B;  1EZJ A;  3BY6 A;  3SYA A;  3K04 A;  1K34 A;  1L1F A;  2X6B A;  1K5S A;  2A79 B;  5IDJ A;  3GB7 C;  1WLE A;  1HWY A;  4MW3 A;  1NR7 A;  5LGT A;  4LCU C;  1QLE B;  1IXM A;  1R3K C;  1VQ7 V;  2AHY A;  3T4D A;  2PI4 A;  4Z1M G;  3ZJZ A;  3W7X A;  2R9I A;  2WPD G;  3K06 A;  3STL C;  3E86 A;  2DYR C;  2CK3 G;  3SYP A;  1KEC A;  3PJS K;  4JTC B;  3OR7 C;  2WLL A;  4WCE V;  3QO5 A;  3E35 A;  1DF5 A;  1GM8 A;  5EBL C;  1OCC B;  5B1N A;  1K9M W;  1QCE A;  1KP2 A;  3ABL B;  3OE7 G;  2V1D A;  3JD2 A;  4BW5 A;  3K9A A;  3CPW U;  2Q6A A;  1VQL V;  3CC2 V;  5EBW C;  1KKD A;  2P90 A;  4TSF G;  1K92 A;  4UVC A;  3G71 V;  5DM6 V;  2EZO A;  3ZRV A;  3NXS A;  5EC1 C;  1TUE B;  3QO7 A;  1CP9 A;  2NNU A;  2Y48 A;  1G8M A;  2EIL B;  2QM7 A;  4WFA V;  5L3B A;  3ASN C;  4JF3 A;  3CYO A;  4RUF A;  2XAS A;  3ZN1 A;  2LP7 A;  3FKS G;  2LFR A;  5B1B C;  5LHH A;  5J9P C;  3ASO B;  4XBF A;  5B1A C;  3T1C A;  4HZ3 A;  2EIK B;  4FMT A;  1BL8 A;  1GK9 A;  4KFM A;  2QA4 V;  5GW7 A;  1OCZ B;  1F4N A;  5BZB A;  3HB3 B;  1YTF B;  3OMN B;  3CCV V;  3OEE G;  2OT5 A;  4G28 B;  2ZR3 A;  2QE7 G;  2WLJ A;  2DQ3 A;  2A9H A;  2H94 A;  3FB6 C;  4PDV A;  2ATK C;  4G2K A;  3RW0 A;  4QPJ A;  2IH1 C;  1VQ8 V;  1GTO A;  3E8F A;  2P6J A;  4R7C A;  3SPG A;  1NH2 B;  3HPL C;  2QM8 A;  2KB1 A;  4MVQ A;  5KUM A;  4RQF A;  1CPY A;  3JD4 A;  4QPK A;  3FYE B;  4UVB A;  1ENV A;  1VQN V;  4R6Z A;  1QLN A;  2UXN A;  3G4S V;  3E83 A;  2ZD9 A;  3OMI B;  1S76 D;  3X2Q B;  4N21 A;  1RM1 B;  1H38 A;  1V55 B;  1QVG U;  1S3J A;  5IYD O;  3QO8 A;  4X89 A;  1CEZ A;  1JVM A;  3AG4 B;  1PNK A;  3F7Y C;  4CZZ A;  5HFL A;  5KA5 A;  4RAI A;  5LHG A;  1R3I C;  3P32 A;  1FS0 G;  4BAY A;  1M1K W;  3K3W A;  4GT1 A;  3ZRW B;  2HG5 C;  1FFT B;  2WLL B;  3ZN0 A;  3ZMS A;  4KP4 A;  2ZR2 A;  2IH3 C;  2FTK A;  5IY5 C;  3B8M A;  2ZXW C;  2Z3Y A;  4WFF A;  4QNH B;  4ASU G;  4J9Y B;  4H33 A;  3E8H A;  2DYR B;  4PA3 A;  3UKM A;  2UXX A;  4FJC C;  2WLI B;  1K4C C;  4MT8 A;  3ML0 A;  3LDE A;  1GKF A;  3MD0 A;  3FB7 C;  3W7U A;  1PL0 A;  3SPH A;  1JPX A;  3SPI A;  3FB5 C;  3ZMU A;  2WWW A;  4FIP C;  1Q86 W;  4PA9 A;  1I5X A;  1LNQ A;  2HR3 A;  5IYB O;  5B3S C;  2HJF C;  4JPR A;  1QVF U;  2GSM B;  2ZQM A;  1Q82 W;  2YEV B;  1AI7 A;  4MS2 A;  2WAM A;  4DXW A;  1YJN V;  3QNE A;  2HKO A;  4J9Z B;  2YSU B;  4GX2 A;  1SZT A;  3AEI A;  2Q67 A;  4EKW A;  5CBF A;  5LGN A;  3CCL V;  4QJF B;  3ETG A;  4U7N A;  4WFB V;  2DYS C;  1FXK C;  3ZRW A;  1M57 C;  5L3C A;  3TCU A;  2JJ1 G;  4GCZ A;  3ASN B;  5CMU A;  1YIJ V;  1S5H C;  3IGA C;  4LC1 A;  1JX9 A;  5B1B B;  1OHH G;  1OCR C;  1Q7Y W;  4MSW C;  3CME V;  2XAF A;  4FPP A;  5B1A B;  1KP3 A;  1V54 C;  2ZDI C;  2EIJ C;  1K4D C;  2IJK A;  3W7S A;  3W7W A;  2P7T C;  4PA7 A;  4Q20 A;  2WLI A;  4GX0 A;  5CN0 A;  2B1I A;  1I5Y A;  2MK3 A;  4P30 A;  2W0F C;  3SPC A;  1ROP A;  1YIT V;  4UUJ C;  2C2A A;  1NVP D;  1E1R G;  1THZ A;  1K97 A;  3E8B A;  1VQP V;  2OTJ V;  2EIM B;  2P67 A;  1VQ5 V;  2F43 G;  5EBM C;  1PD3 A;  1R3J C;  2YEV A;  5LHI A;  3MHH C;  1F23 A;  3I56 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...