1VQ4V

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq4V00
3G71V 2QEXV 1R73A 1NJIW 1VQOV 1VQLV 1K73W 4WCEV 3CPWU 1JJ2U 1VQKV 1YHQV 1VQ4V 3CCVV 1YJNV 2D3OW 4WFBV 3CCLV 3CCEV 3CCMV 3CC2V 1VQ9V 1KQSU 3CC7V 5DM6V 2OTLV 1VQ6V 1YITV 1W2BU 1K9MW 1YI2V 3CCJV 3CCSV 1VQMV 1VQPV 2OTJV 1KD1W 1Q86W 3CCQV 3CMAV 4WFAV 3CC4V 1N8RW 3CCRV 3CXCU 1Q7YW 1QVGU 1VQ5V 3I56V 3CMEV 1Q81W 2QA4V 1M1KW 3G4SV 1VQNV 3I55V 1YJWV 1K8AW 3CCUV 1VQ7V 1YIJV 4WF9V 1YJ9V 1S72V 1Q82W 1KC8W 1M90W 1VQ8V 1QVFU 3OW2U 3CD6V 3G6EV
chains in the Genus database with same CATH superfamily
1EM1A 4J80A 4HBNA 1KP3A 2B1IA 4U7OA 1K9MW 5CB4A 4LCUC 3ETEA 1K5SA 3IC7A 3D3QA 1AI5A 5IJ9B 3P3PA 3I56V 2EIMB 3QNEA 4E2LA 3LNNA 3OTOB 2WLLA 3BFRA 1KYOF 3ZHTA 1L0LH 3T4ZA 2FB5A 1WA8B 3AG2B 1ZTEA 4B7EA 4TV8A 1I94B 1BT8A 2ZE6A 2QJ1A 2QWNB 2KKWA 2QKCA 2B1GA 2VRZA 4G2KA 1QR8A 2GDSA 5EYPA 4RWUA 1WB7A 1N33B 3CRAA 3CRQA 2BOBC 3AEIA 4UCRA 4EFEA 2D2CB 2UXNA 4AHCA 5B66Z 2P4VA 4Q6GA 3THOA 3ASOB 1TVKA 1T5EA 4WFFA 4Z2WA 2ITDC 1OJHA 1MSWD 1PM9A 2DJVA 1F7YA 5EZYA 3J80N 4DV6B 3RYFB 2B5UA 3E8GA 3CRMA 3E83A 4JI1B 1AJNA 5H2FZ 5DN6G 4J42A 2Y48A 3S3XA 3ZMSA 4DK0A 2AXTZ 3K58A 1SA0A 2HEPA 1Y74B 4MTXA 2YUAA 4MVUA 3W7WA 1MZEA 2XAGA 4P9OA 1TVKB 5IT9N 3FKSG 1K97A 4PI2A 3CRCA 3P32A 3FX7A 4I4TB 3HKEA 4LF8O 1KMIZ 1YTFB 2DW4A 4AI8A 4LF7B 2DYRB 1KBHA 3HB3B 5JJNB 3K9SA 4IHJB 4A5UB 1E79G 3E89A 2KSDA 2VWJA 2QKAA 1NVPB 2A0LA 4PV1B 4JZ2A 1HDJA 4GX2A 2DMXA 2YIBD 2Y4TA 4CH6A 2BTQA 2EJRA 4O2BB 5HFMA 4JYAO 4ZI7A 5B1AB 2HJFC 4I9WA 2FMLA 2PZSA 3D3IA 5JVDB 3J81N 3E22A 5LYJA 2ITCC 1AI4A 1U96A 3K08A 3N2GA 3ABKC 1YHQV 2QM7A 3CWBH 4OPHA 2ZE7A 1XHZA 4MTOA 1ZAUA 2P6JA 2QTOA 4LF6O 2RMKB 1ZL8B 1YCIA 5J2TB 3OUFA 5HFLA 4P2ZA 2OCCC 2Y4UA 2GTSA 3U0ZA 5LP6B 4DW0A 3CSXA 4LFBO 4X65O 2ZIMA 3HKCB 3OEHG 1JFFB 4IYHA 5KAIZ 1BQ0A 1WN7A 1BCCH 4KP4A 1L8DA 3JD3A 2VQFB 4MSWC 4XBFA 2RCVA 3OR6C 2ZE5A 4X88A 5LA6B 3ZRSA 2IW5A 2XAQA 4DR3O 4BIUA 1KECA 5KHGA 1Y66A 4W4KA 4YHHB 3IAYA 1VQOV 2PUSA 4JI6O 4R8CA 3K59A 1NR7A 1WAZA 3JALB 5FNVB 2CDYA 4BAYA 4O4JA 4FFKA 3OTOO 4YY3O 2GBOA 5H6RA 3RW0A 3CEIA 1GN3A 1FXHA 2VQEB 1UFIA 1BMFG 3ZMVA 2WLHA 2EIMC 1K34A 3KKYA 2QEXV 2XOKG 2LP7A 1ENVA 4JYYA 3L70H 3QF7A 4LF9O 2UUAB 4DV3B 2QWPB 4FM1A 5JCOC 2JRIA 1VF6C 4LF9B 4JI4O 2ZDIC 5L3GA 1ORQC 3RYCA 1N0JA 1BGYH 1WP8A 4PA9A 2WLLB 3F7VC 5KLVH 1K7DA 1SKVA 4MW3A 3ZMZA 3A8TA 4I55A 1VQ5V 2F23A 4TSFG 3ABLC 3OMNB 3ZMUA 1PP9H 4WBNB 5KHIA 4H33A 1RPRA 4TV9A 3UT5A 2IU0A 1BS3A 4PA3A 3MD0A 2X7RB 1IBMB 3D36C 1JVMA 1M1KW 1CP9A 1FAFA 3G6BA 1IBMO 2W0XA 2LFSA 3AG3B 5H6QA 3QO8A 2KG7A 5B3SB 4OX9O 5IWAO 3CHXA 4PJ0Z 1GMGA 4GX0A 4U3JB 2LW7A 5TISZ 3STZC 4HZ3A 4Z1MG 1XMOO 3JD0A 5B1BC 1MOFA 2B9ZA 5BR8B 2JDIG 3CXHF 4MVMA 2JEXA 5IJ0A 1KU9A 3OR7C 5IE9A 2K1EA 2F4VO 5EYPB 2CGNA 1PNLA 2HVKC 1XMQO 2GTAA 3AK1A 3RFRA 1NBMG 4JI6B 4FZ0A 2QGNA 5EC2C 1FPOA 3W7UA 4YJ2B 1NZ6A 1W0KG 2A79B 3IFXA 4F4LA 1XI1A 3ABKB 4CBCA 2QM4A 2F43G 4J41A 3CS5A 1IBKB 3OAAG 1GN4A 3BHPA 2VWKA 1AP5A 1I0HA 2QWQB 3OGCC 3E35A 3JYCA 2LO1A 2QM8A 3F7YC 3ML0A 1YJWV 1MSDA 1HP8A 4JI2O 3UT5B 4UV9A 4WFEA 1KKDA 2ODMA 4X8AA 4W4LA 4PA4A 3ZRWB 5LOVA 2LGQA 3ZCCA 3ZRVA 3C90A 4PA6A 4JI8B 1JFFA 2EILC 3HKCA 2P7TC 3MDSA 3CJHA 1KB9F 2YEVA 5DECA 1R1BA 4X1IA 3SYOA 2IJJA 4JASA 1OCRB 3TXSA 2UXXA 4LR3A 4NXNB 1R6NA 3DTUB 2YICA 1PD3A 4B7KA 1URFA 1XNRB 3ZHRA 1TUEB 2KG7B 5LYJB 1S3JA 3BY6A 1DLBA 3JD2A 3R66A 4O2BA 4P9PA 4XDJA 4ZBMA 1COWG 2HG5C 1M57C 1FXKA 3N2KB 3KCXA 2IBZH 2EINB 3ZHVA 1OHHG 2ZM6B 4DV5O 3EHBB 5E79Z 1FFTB 2GSMB 1JR9A 2UXDB 2NN4A 4TOIA 4I0XA 2JK5C 5KHJA 1NT2B 4FJCC 3G6EV 4JI0B 1Y67A 5IWAB 5BMVB 5B5EZ 4B3SO 3FYEB 1SQVH 2EZPA 5CA0B 4B3MO 1VIBA 4DV4O 3B8MA 3CC2V 1YXBA 5B1NA 3H1KH 2QSAA 4LNUA 1WLEA 4XDLA 1YEWA 4IYIA 2JS3A 1UPGA 4G28B 2E76B 5IJ9A 4RQEA 1LUVA 2Z3YA 1P7GA 2DYRC 4IL6Z 2EULA 2R70A 2XHBA 4B3MB 1N36O 1Y76B 4EB6B 1XMQB 3H1LH 4B08A 4KHPB 3BCCH 1DF5A 4UB6Z 1FJGB 2UXDO 2WLIB 3G67A 2ZCEA 2BTOA 2X6AA 4YJ3A 1PNKA 2GUZA 4PI0A 4ZOLA 2WAMA 4B3RB 3ABMC 2NR5A 3SJAC 1EN6A 2RDCA 1RSOB 3N2GB 4JI5B 1S76D 1KD1W 5LMNO 1PKXA 3GVMA 2R9RB 4F6RB 4DR7O 3FB8C 1FFXB 3LDCA 4JYCA 4DV7O 2XAJA 1FXKC 1WPBA 3B8NA 5BZBA 3AG1B 1B06A 1G4YB 4PELA 4TUYB 5KA6A 3TJTA 3C3SA 3UO3A 3RVZA 4JYBA 1N32B 4AILC 3K5LA 1XOUA 3AG7A 5GONA 1TAEA 4FLWA 3OM3B 5BR8O 1JPXA 3PN1A 3M99B 3FYIB 1IVSA 1F4NA 2UXCB 1H2GA 1YJNV 3A2FA 3F5WC 4QPJA 5LHIA 1YF2A 2HHHB 1Q6UA 3UM7A 3CCQV 4UVBA 4FZ1A 1KUQA 1B6QA 4WFGA 4D6TH 3SYPA 1K4CC 1Q5OA 2ZKOA 4Q20A 2PTMA 3M8AA 4X1KA 2XAHA 4K8XA 4FLYA 3W7TA 1NTMH 1XL6A 4B3SB 1KKCA 4EEQA 2OIGA 2R9IA 2P90A 2L6LA 4NXMB 2CK3G 5KA5A 3H01A 5LMNB 1Q7YW 4HNAA 5IYBO 3K5NA 3TETA 1M56C 1XMOB 3KG2A 2EIKB 3FD9A 4K35A 1BQZA 1BL8A 1OCCB 1YVWA 3ETGA 1WA8A 2JIZG 1H2SB 2W6JG 2GV9A 1V9PA 3HKDB 4X1YA 2N04A 2K9PA 3BVOA 4DV2B 3DC6A 4TT3G 5GTHZ 1Q43A 2E5LO 1WJZA 1NTZH 1MZFA 1XHXA 1ZSPA 4FLUA 3ZHUA 1NVPD 1FS0G 1FYJA 3X2QB 3E8FA 2Y69C 2ZR2A 3RYFA 2E74B 5B1OA 5LHHA 1YI2V 1SZTA 2JEUA 2CH7B 4JI3B 1IX9A 3AG4B 4ZOLB 3TXQA 1K8AW 4WBNA 2Q7EA 3QVNA 3CJHB 2HLDG 4FIPC 5KAFZ 3L75H 4IIJA 2V1DA 2YIAA 3T4DA 4DUZO 1QQCA 3CCJV 4LFAO 3DXRA 2RJZA 2ADQB 1V55C 5EIBC 1XL4A 3OT7A 4Z1VA 5JQGB 1R6KA 2DYSC 2BSKB 2Q9LA 4MTFA 1G1XB 1ZLZA 1ZX3A 2X0LA 1VQLV 5EIBD 2MK3A 4K0KB 4CS3A 1LNQA 1MMMA 4DV0O 3B77A 5EC1C 1IDSA 4FLTA 1BZKA 5BXZA 4DR4O 1H8HG 5LL6Y 1P84F 3QO7A 1OCZB 4N23A 2JJ2G 1RFYA 3FFQA 1VQ7V 2XUMA 3HKEB 1SQGA 3D36A 3CRRA 3MHSC 2X6BA 1Z2GA 3DC5A 4H37A 4DYLA 2E75B 3CYOA 3B40A 3JD4A 4U3FH 1US6A 4DR3B 3CCMV 2HKOA 2IM9A 3ETQA 1Q86W 2ARHA 2PGGA 2YXLA 1D2DA 2IJKA 3SJBC 4X9QA 5EZYB 3JCZA 3ZS8C 4BW9A 4BWAA 4UV8A 4K3AA 1H2NA 4X65B 5CA1A 2OYQA 4ABMA 2EX3A 3JCUZ 1JX9A 2JGDA 3RYHB 3Q4HA 3T1CA 1PL0A 2PYJA 3DSQA 3OD4A 1QLEC 3JSLA 1X59A 3SYCA 1VF6A 3SJQC 1AJPA 1QVFU 1AJQA 2KB1A 4KHPO 2CUGA 4GT1A 3APOA 4FFBB 1K73W 1QU7A 4U7NA 3BEHA 4O4HA 1AILA 3A0HZ 3RGBA 4ZHQB 1AI7A 4R7CA 5FPOA 1M57B 1PV0A 3BA8A 1MNGA 1M5IA 2ETNA 4KFMA 4K0KO 5H9CA 4X1YB 4UCTA 3LDDA 2XAFA 4LFBB 2WLNA 4LC1A 2QKSA 2EIKC 2OIEA 4MVOA 3ZN0A 3LDEA 3CCLV 4MVZA 4LBEC 2NNUA 4GKJO 1VQMV 4DK1A 4UCVA 1Y4MA 1MG1A 5C8YB 2HVJC 3WB0A 4DRXB 5IYCO 2G38A 4J7JA 4NKGB 3B09A 2YXHA 3LSQA 1XBLA 5H5NA 2ZDIA 4KXRA 4DR4B 4NTXA 4WFAV 1JOYA 1TA8A 4NXMO 5LBQA 3SPJA 2EBOA 4CC6A 4LFCB 2F1MA 4X64B 5LA6A 1L0NH 4PDRA 3PJSK 1WPXA 4LFCO 4O4HB 4IT5A 2BSKA 3ZJZA 1N34O 1TUBA 3FAVA 4PD4F 2HFEC 3BABA 4DR5O 4JI4B 3LUTB 3RVYA 5KMGB 5B1AC 4RO2A 2QE7G 5CMUA 4JI7B 2JS5A 3HKBB 2ZQMA 4DUYO 2BCCH 1RP3B 3RT3C 1QCEA 3Q4HB 1MABG 4X62O 2KQXA 2YSUB 4RAIA 1J5EO 1YDXA 4FVMA 4LP8A 4YHHO 2F95B 5DM6V 4UCUA 1PNMA 4GUNA 3WB1A 4JI8O 3WFVA 3CB2A 1O9HA 4DR5B 3OGIB 1GAXA 5LMUB 2PI5A 1FXVA 2EIJC 5L3CA 3BPZA 2Q5ZA 2H3OA 4FPPA 3ZHQA 1R3IC 1OV9A 4LF4B 1VQ4V 4JI2B 3T1HB 4B3TB 3A0RA 1HWYA 3TGUH 5LXTB 2EJ7A 3E8BA 3JASB 5IYDO 2E5LB 1QBZA 2Q7GA 1EBOA 4CH4A 4JTCB 4N21A 1K92A 3JAMN 4LF5B 2WLJA 1CEZA 4R50A 2ZXWB 1Q8IA 4FFBA 2FKXA 4GX5A 3TK1A 4DR2O 2WA3A 1VMGA 2A3QA 2A06H 4GCZA 5J2UB 3SYQA 1D5NA 4TUYA 2R9AA 4OX9B 4I55B 4JI0O 4I7ZB 1KP2A 4I4TA 2XASA 3O65A 3CMAV 4BIZA 3SDLA 2FYUH 1XUQA 4X20A 3UCSC 1M56B 3HKDA 5EBLC 4EFBA 4FM2A 1HNZO 1K33A 2GHYA 1SQFA 3MAQA 2UU9O 1NR1A 2O57A 5FL7G 5LMUO 1GM8A 1K5QA 5JCOA 5BY1A 1L1FA 4L8JA 5IYZB 3JAWA 4DR1O 4CC5A 4NXNO 1VP7A 2YC0A 3EXAA 4ZKIA 1SS3A 4QGPA 4YJ3B 1GRJA 3K0DA 5LXTA 1NJIW 3P3NA 1S5HC 2BOCC 4ICGA 4I9QA 2UUBB 3LSSA 1BE3H 1B3QA 4G27B 2A9HA 2N74A 2Q0OC 5IY5C 3JAKA 1SETA 1NH2B 1M4UA 3E22B 2LW1A 3ASNB 4DV3O 1GN2A 3ABLB 4RQFA 2ILMA 1H38A 2UU9B 2Z0AA 1IBLO 5LP6C 3L74H 2ZNJA 2XT9A 5JQGA 4ZIBA 4DR7B 1EZVH 1VQPV 3IJ4A 4OGQB 4DV7B 2FL4A 2R72A 1H2LA 2ZD9A 4DUZB 4O4IB 3LSUA 2P5OA 5AG2A 2UUCB 1SRYA 2WPDG 3U10A 4DV1O 3WG7B 1Y6XA 1H8EG 1V54C 3NR7A 3EFFK 2Q7HA 4E4EA 3K03A 3ZN1A 2ZM6O 2Y0PA 5GTIZ 4DR1B 1P7BA 3HPLC 2AHZA 3OFNG 4F6RA 2LJ2A 3L72H 4TWKA 5CBHA 3RWRD 2RN9A 2P4KA 3T2MA 2OTLV 4GKKO 1IURA 1IXMA 3AK2A 3F5TA 4GX1A 1QR9A 3IC9A 4QJFB 2UUAO 1BSMA 1GM9A 2GUZB 3W7XA 2Q4PA 5EK0A 4EKWA 1Q82W 2ADPA 3OW2U 2XNDG 2YI8A 3ICXA 2Q69A 2VQEO 4FLZA 2EILB 2JGDB 3RYHA 3ZEDA 5FPRA 4UVAA 1I08A 3M7MX 3BA9A 4LNUB 5EBMC 1S72V 1QLEB 3G71V 3CE2A 5ITZB 4UCOA 1K4DC 4CH3A 3I5DA 3H1IH 3JAKB 1RSOA 1XREA 1K3EA 1WB8A 4JTAB 3NXSA 1S77D 1NS1A 1S0VA 1EN5A 4O4LA 4CS2A 2QR4A 4JYAB 4PA7A 3APQA 4UB8Z 2DWEC 4NB5A 1JJOA 3JATB 3OMAB 2HHHO 1XEQA 4JV5O 3U11A 3AK3A 4K8ZA 5LGTA 2Y0IA 5L3FA 5GW7A 4X66B 3K3WA 2IJHA 1S5LZ 5CA1B 2AZ0A 2D3OW 3W7SA 2BE3A 2EINC 4WFBV 1GKFA 5KHKA 1VQ6V 4GZRB 1G6UA 3FB5C 3T1YB 4O4LB 3QG5A 1I5YA 1F51A 2IH3C 4O2AB 1M9NA 3FAVB 2DE0X 1PL4A 4GKJB 3SYAA 4DV1B 2CAZC 1F23A 2QDOA 2UUCO 3CCEV 4TV9B 2M7WA 4QE7A 3MHHC 4O2AA 4DW1A 2IH1C 4FLXA 3WB2A 4O4IA 4RUEA 4X89A 4KUMA 4O4JB 4JTDB 1E1QG 2WA4A 1JMKC 3CCVV 4LWSA 4QNHB 2JJ1G 4P30A 5JJJB 1AR5A 5LGUA 1N32O 2PY5A 1RM1C 1Y74A 1Z5WA 3A0BZ 4X1KB 4CH5A 2AW9A 1XNQB 2WWWA 4UUJC 5L3DA 1J5EB 3JD1A 3E86A 3ZHSA 5F2VO 4DR6O 3JSNA 5D5QA 4I5SA 2QWOB 1R6TA 2PYLA 4QPKA 1VQKV 4JI7O 1JA8A 2OT5A 1IXBA 3STLC 2WLMA 5CA3A 4UXNA 1V54B 2YIBA 1OCRC 2Q67A 3CCRV 4UVCA 1GN6A 2VQFO 5IYZA 1NKDA 5C8YA 1XDCA 4JPRA 2CE4A 1ZL8A 3RN4A 3VOUA 2WLIA 3ZRXA 2L35A 1EFRG 1JJ2U 2CTRA 3BRCA 2ZNIA 2DOSA 3JALA 4TV8B 1Z5VA 1RPOA 4J7KA 5CBGA 3CXCU 2NLJC 4MVQA 5K1XA 3I55V 4LF6B 1I94O 3K0GA 3FB6C 3GB7C 2Q0AA 2IJIA 1HNWB 5J9PC 3E2EA 3B2EE 4X62B 1JQ0A 1SESA 1PPJH 4OXSA 4LF5O 3SJCC 1SQPH 4DV2O 2ZE8A 1CPYA 2RQ6A 5JJEB 5L3BA 1WP7A 3CMEV 1Q6HA 1NTKH 1GM7A 2WLKA 1DTOA 3OE7G 4J11A 2HJDA 3WU2Z 3T1HO 1TGOA 3ZMTA 2ZIOA 3QTCA 3CP1A 2F66C 5K1PA 2W0FC 3AG3C 4DR6B 1J95A 3R65A 4BR6A 3JAWB 2ATKC 3C3TA 5JWPA 1NU1H 2CTWA 2LFRA 5LHGA 1I5XA 3EVKA 4HAMA 5B1BB 3CC4V 3J7AU 4X20B 1QHTA 5ITZA 3S3WA 5JVDA 5FNVA 4CZZA 1VF5B 3KCYA 4MS2A 1LR1A 4AQYO 3SPCA 4PDMA 3K5MA 5KX5A 3ABMB 4MVSA 1H2MA 1LUWA 4YIPA 3OEEG 3CCSV 4JZGA 4FLVA 1QVGU 1OCOC 1S5JA 1Q81W 4LFAB 4JAVA 3N27A 4NYKA 4HYOA 5C93A 3ASNC 3SPHA 4AQYB 5FLXN 2A7WA 1N0NA 1SC5B 4TQFA 4D7SA 1HNWO 5KUMA 1FXKB 4JGSA 2UXBB 1HR0B 2XTAA 2IU3A 1VQ9V 3CC7V 1YZBA 1SF9A 4NTWA 3JASA 1SERA 2QWRB 1SA0B 4R6ZA 1FFXA 4C7UA 4JI3O 4DV5B 2MW2B 3ZBHA 2H94A 1HNXB 4BW5A 5A2QN 2DWDC 4KL1A 3K5OA 2YI9A 1HR0O 1P49A 2ZT9B 3WG7C 1VF7A 1U97A 1V55B 2AZ2A 3CX5F 4X1IB 1GH6A 4L87A 4MVRA 4ZHQA 2E3CA 1XNRO 4XDKA 3O9OA 1VQNV 1NI8A 1H2KA 1YIJV 4WF9V 1YJ9V 1EN4A 3AG1C 2P22C 1WNSA 4UFZA 4LF4O 1N33O 3OTFA 2H8PC 1HNZB 4CS4A 5A9GA 1OZ0A 1ZWIC 3H9VA 1XQ8A 2OTJV 2YS8A 3SPGA 1JCHA 1XILA 3OUSA 3UKMA 1THZA 3KZIZ 2YXYA 5KX5B 3N2KA 4I50B 3VQVA 4QE9A 4LF8B 4I50A 2AGAA 1E1RG 1FD9A 3ASOC 2AHYA 1BHBA 4H0LB 4PDLA 5CB4B 2M6YA 5E1AC 1IZ3A 5BMVA 2Q6AA 1NQTA 2RNBA 4DV6O 1Q3EA 3ABUA 4JI1O 2Q73A 5IDJA 1IBKO 4DRXA 2HP8A 1M90W 4J9YB 2Q68A 4J10A 1AROP 1A32A 3G80A 3JATA 4PDVA 1KQSU 1XNQO 5GONB 3ETDA 3X2QC 4NR1A 1W2BU 4EB6A 4LH6A 1AB3A 1M93A 1ZUQA 2C2AA 3RYIB 2OWOA 2P06A 2V7QG 3HR0A 3AG4C 5EBWC 1YTFD 5DEDA 2UUBO 1W59A 4X66O 5JH7A 1X4TA 3RBZA 4GLXA 3UQ8A 1F4MA 3VQXA 4JV5B 2YEVB 3K06A 2JGUA 2PI4A 2VS0A 4IIJB 5KMGA 1NH2D 5KUKA 1Q6IA 2X6CA 4FK5C 2DYSB 3L71H 4I0XB 5LP6A 1GO3F 3H1HH 2Z5UA 4FMTA 1Q90D 3DGEA 1VARA 4RUFA 2ZR3A 2DQ3A 3OMIB 5J2TA 5D5PA 4FM0A 3UO2A 1R3LC 1OCOB 1SQQH 4U3JA 4YIOA 3RYCB 4WCEV 5LGNA 1AR1B 3L73H 4J9ZB 4YJ2A 4JAUA 1SZXA 2FTKA 3P30A 4ZI7B 3K57A 4H13B 2OCHA 3VQWA 1RM1B 2CTPA 2QTSA 4MT8A 4GKKB 1QLNA 2W6IG 2LQTA 3AG2C 5J2UA 4UCSA 1N8RW 3HKBA 3CD6V 1DF4A 5LOVB 4H44B 3CPWU 3FB7C 4IHJA 3K79A 2PF4E 4LF7O 2F93B 2JVDA 5KHHA 2CTQA 4ASUG 2EZOA 3ZIAG 4MTGA 4TQDA 4DV4B 3BAAA 4DR2B 2WSSG 1GTOA 1UJWB 2V4DA 2UXBO 3TCUA 1HNXO 1AR4A 2UXCO 3DXRB 4IGGA 1OCCC 3GWOA 1B04A 4J7ZA 4HNAB 1DK1A 2QA4V 1FJGO 2Q8VA 1AVMA 2EIJB 2LGWA 1CXZB 3CCUV 1D5AA 2YDEA 3E8HA 4DO2A 5IJ0B 3SPIA 4LH7A 3JARB 4B3TO 1R3JC 1BHAA 4DV0B 3JARA 4JF3A 4NVPA 1DGSA 3LNMB 1QNMA 5JH7B 1SQXH 1O9GA 2Y69B 1Y76A 4JAAA 1R3KC 3RYIA 1SQBH 1EZJA 1TUBB 4YY3B 2ZXWC 3T1YO 1HW7A 4JI5O 4D7TA 4DUYB 4PHZA 3SGIA 2N05A 4LWSB 3H1JH 4MW8A 1YITV 1FKAO 4B3RO 1AI6A 2HR3A 1I7FA 4WFHA 1N34B 1W0JG 4YXWG 5B3SC 1YSCA 3ZRWA 4F6EA 1G8MA 2P67A 1IBLB 4QIWF 4X64O 3VBBA 1ROPA 1GK9A 4BIOA 1N36B 3B4SA 2CGOA 2ZINA 2OCCB 4OPAA 2F4VB 3GWKC 4NTYA 2YIDA 1VEWA 1AP6A 1KC8W 3K04A 1OCZC 1P4RA 5CN0A 1R73A 3QO5A 2DQ0A 1MA1A 3K9AA 5L3EA 5IY5B 2DN9A 3ABTA 3D8CA 3L9DA 2BTQB 5CBFA 3G4SV 1N4CA 2CH7A 4GYCB 3VQYA 3ZX6A 3SR2C 1VQ8V 5CA0A 4DXWA 3IGAC
chains in the Genus database with same CATH topology
1QCEA 2W0FC 3AG3C 3FYEB 2EZPA 1J95A 1MABG 3R65A 2YSUB 4RAIA 3B8MA 2ATKC 4LP8A 1KP3A 2B1IA 3CC2V 2LFRA 5DM6V 5B1NA 4U7OA 1K9MW 1PNMA 5LHGA 4LCUC 3ETEA 1K5SA 3WFVA 1I5XA 1WLEA 3IC7A 4HAMA 5B1BB 3CC4V 4XDLA 1AI5A 3I56V 4G28B 2EIMB 3QNEA 4E2LA 4CZZA 2PI5A 4RQEA 2WLLA 1FXVA 2Z3YA 2DYRC 2EIJC 5L3CA 3T4ZA 4MS2A 3AG2B 3SPCA 4PDMA 4FPPA 1R3IC 1VQ4V 3ABMB 1DF5A 3A0RA 4MVSA 3OEEG 1HWYA 2WLIB 3E8BA 3CCSV 5IYDO 1QBZA 2B1GA 1EBOA 4G2KA 2X6AA 1QVGU 1OCOC 4JTCB 1PNKA 1QR8A 4N21A 1Q81W 1K92A 2WLJA 4JAVA 1CEZA 4HYOA 2BOBC 2WAMA 3ASNC 3AEIA 5C93A 4R50A 2ZXWB 3SPHA 2UXNA 4GX5A 3ABMC 3TK1A 3ASOB 4GCZA 5KUMA 3SYQA 1FXKB 4JGSA 4WFFA 2ITDC 2IU3A 1VQ9V 3CC7V 1MSWD 1S76D 1KP2A 1SERA 2XASA 1KD1W 1PKXA 3CMAV 2B5UA 2R9RB 4R6ZA 3E8GA 3E83A 4BIZA 1AJNA 3FB8C 3LDCA 4JYCA 5DN6G 2Y48A 2H94A 3ZMSA 1M56B 5EBLC 4BW5A 2XAJA 2DWDC 1FXKC 4MTXA 4MVUA 3W7WA 3B8NA 5BZBA 3AG1B 2XAGA 4P9OA 1K33A 1G4YB 3FKSG 1K97A 2GHYA 4PELA 5KA6A 3P32A 3WG7C 1V55B 1NR1A 3RVZA 5FL7G 1GM8A 1K5QA 4JYBA 4L87A 4MVRA 1L1FA 1YTFB 2DW4A 2DYRB 4XDKA 3HB3B 1VQNV 3OM3B 1JPXA 1E79G 4ZKIA 1YIJV 3E89A 4WF9V 1YJ9V 3AG1C 3M99B 1NVPB 2A0LA 3K0DA 3FYIB 1NJIW 1F4NA 1H2GA 1S5HC 2BOCC 4GX2A 1YJNV 3LSSA 2H8PC 3F5WC 4QPJA 1OZ0A 5LHIA 1ZWIC 2EJRA 2OTJV 4G27B 2A9HA 3SPGA 1JCHA 3UM7A 3OUSA 3UKMA 1THZA 5HFMA 1SETA 5IY5C 3CCQV 4UVBA 1NH2B 1B6QA 5B1AB 2HJFC 4I9WA 3ASNB 4WFGA 3ABLB 3D3IA 3SYPA 1K4CC 4QE9A 4Q20A 1E1RG 4RQFA 3ASOC 1H38A 2ITCC 1AI4A 2AHYA 2XAHA 1BHBA 4PDLA 3K08A 3ABKC 1YHQV 3W7TA 1XL6A 2QM7A 5E1AC 4MTOA 2R9IA 2P90A 2Q6AA 1VQPV 1NQTA 2P6JA 2QTOA 2CK3G 5KA5A 3H01A 3OUFA 1Q7YW 5HFLA 4P2ZA 2OCCC 2ZD9A 3ABUA 5IYBO 3TETA 1M56C 5IDJA 3KG2A 1M90W 4J9YB 2EIKB 1SRYA 2Q68A 2WPDG 1AROP 3OEHG 1BL8A 3WG7B 1H8EG 4PDVA 1V54C 1OCCB 3EFFK 1KQSU 3ETGA 2JIZG 3ETDA 3K03A 3X2QC 1W2BU 3ZN1A 2W6JG 4KP4A 3JD3A 1P7BA 3HPLC 4TT3G 4MSWC 4XBFA 2C2AA 2AHZA 3OFNG 3OR6C 4TWKA 2V7QG 4X88A 3ZRSA 2IW5A 3AG4C 2XAQA 5EBWC 1YTFD 4BIUA 5CBHA 1KECA 1Y66A 1NVPD 1FS0G 1VQOV 3RBZA 4R8CA 3X2QB 3E8FA 1F4MA 1NR7A 3T2MA 2Y69C 2ZR2A 5B1OA 2OTLV 4BAYA 1IXMA 5LHHA 1YI2V 2YEVB 4GX1A 1QR9A 1SZTA 2JEUA 3K06A 4QJFB 1GM9A 5H6RA 3RW0A 2PI4A 3AG4B 3W7XA 1FXHA 5EK0A 4EKWA 1BMFG 1K8AW 3ZMVA 1NH2D 2WLHA 1Q82W 5KUKA 2EIMC 2X6CA 1K34A 2DYSB 4FK5C 2XNDG 3OW2U 2QEXV 2HLDG 4FIPC 2XOKG 2LP7A 1ENVA 1GO3F 2Z5UA 2V1DA 2Q69A 4FMTA 3DGEA 3T4DA 4RUFA 2ZR3A 2DQ3A 3CCJV 3OMIB 1V55C 2EILB 1XL4A 4UVAA 2ZDIC 1R6KA 5L3GA 2DYSC 1ORQC 1R3LC 1OCOB 4MTFA 5EBMC 1S72V 1QLEB 3G71V 4PA9A 2X0LA 1VQLV 2MK3A 4WCEV 5LGNA 1AR1B 2WLLB 3F7VC 1K4DC 1K7DA 1LNQA 4J9ZB 4MW3A 3ZMZA 4JAUA 1K3EA 2FTKA 3P30A 4JTAB 3NXSA 1S77D 1S0VA 3B77A 5EC1C 4PA7A 2DWEC 1H8HG 3OMAB 1VQ5V 3QO7A 1RM1B 1OCZB 4N23A 4MT8A 1QLNA 2JJ2G 2W6IG 4TSFG 1VQ7V 3AG2C 3D36A 1N8RW 3ABLC 3CD6V 3MHSC 2X6BA 5LGTA 1DF4A 4H37A 3OMNB 3ZMUA 5GW7A 5L3FA 3K3WA 3CPWU 2IJHA 3CYOA 3JD4A 3W7SA 2D3OW 3FB7C 2EINC 4H33A 1RPRA 4WFBV 3CCMV 1GKFA 2HKOA 3K79A 1VQ6V 3FB5C 2IU0A 1I5YA 1F51A 4PA3A 3MD0A 2IH3C 1Q86W 2X7RB 1M9NA 1JVMA 4ASUG 2EZOA 2IJKA 1M1KW 1CP9A 3ZIAG 2LFSA 4MTGA 3AG3B 5H6QA 3JCZA 3QO8A 5B3SB 3SYAA 2WSSG 1GTOA 1UJWB 1F23A 4UV8A 3TCUA 1GMGA 4GX0A 3STZC 3CCEV 4HZ3A 4Z1MG 2M7WA 3JD0A 5B1BC 4QE7A 1JX9A 1OCCC 1MOFA 3GWOA 3MHHC 3T1CA 2IH1C 1PL0A 2JDIG 4MVMA 2JEXA 4RUEA 4X89A 3OR7C 2QA4V 2EIJB 4KUMA 1QLEC 2K1EA 1PNLA 2HVKC 3CCUV 3E8HA 3SYCA 4DO2A 3SJQC 3SPIA 1AJPA 1QVFU 1AJQA 2KB1A 1NBMG 4JTDB 1R3JC 4GT1A 1BHAA 1E1QG 5EC2C 3W7UA 1K73W 1W0KG 2A79B 4JF3A 3CCVV 3IFXA 4QNHB 4F4LA 3LNMB 4U7NA 3ABKB 3BEHA 2JJ1G 4P30A 4CBCA 2F43G 2Y69B 5LGUA 1AI7A 4R7CA 1M57B 1RM1C 3OAAG 1R3KC 1EZJA 3OGCC 3E35A 3JYCA 2ZXWC 2QM8A 2WWWA 4KFMA 3F7YC 4UUJC 3ML0A 5L3DA 1YJWV 3JD1A 3E86A 5H9CA 3LDDA 2XAFA 4UV9A 2WLNA 4I5SA 4LC1A 4WFEA 2QKSA 1KKDA 2EIKC 4QPKA 1VQKV 2OT5A 4MVOA 3ZN0A 3LDEA 3CCLV 4MVZA 3STLC 4LBEC 4MW8A 2WLMA 1YITV 4X8AA 4PA4A 5CA3A 2NNUA 4UXNA 1AI6A 2HR3A 1V54B 1VQMV 3ZRWB 1Y4MA 1OCRC 3ZRVA 2Q67A 3ZCCA 1MG1A 4WFHA 3CCRV 2HVJC 4UVCA 4PA6A 5IYCO 4DXWA 1W0JG 4YXWG 1NKDA 5B3SC 4JPRA 2EILC 2P7TC 1YSCA 3ZRWA 1G8MA 2YEVA 3VOUA 2WLIA 2P67A 3ZRXA 4QIWF 3VBBA 1EFRG 1ROPA 1JJ2U 3SYOA 3LSQA 1GK9A 2IJJA 4JASA 1OCRB 2ZDIA 1RPOA 2OCCB 2UXXA 5CBGA 1R6NA 3DTUB 4WFAV 1JOYA 3CXCU 2NLJC 4MVQA 1PD3A 5LBQA 3SPJA 3I55V 3K0GA 3FB6C 2EBOA 3GB7C 1KC8W 3K04A 1TUEB 1OCZC 1P4RA 2IJIA 5CN0A 1S3JA 3BY6A 5J9PC 1R73A 3QO5A 3E2EA 1DLBA 4PDRA 3JD2A 3PJSK 1WPXA 4P9PA 2DQ0A 1JQ0A 1SESA 3ZJZA 4XDJA 1COWG 2HG5C 3K9AA 1M57C 4ZBMA 4OXSA 1FXKA 5IY5B 5L3EA 2HFEC 2EINB 3LUTB 3ABTA 3RVYA 1OHHG 5B1AC 4RO2A 2QE7G 1CPYA 3EHBB 5L3BA 5CBFA 5CMUA 3CMEV 1FFTB 2GSMB 1GM7A 2WLKA 3G4SV 1DTOA 2JK5C 3OE7G 2ZQMA 1VQ8V 4FJCC 3ZMTA 3G6EV 3IGAC 3CP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 V;  2QEX V;  1R73 A;  1NJI W;  1VQO V;  1VQL V;  1K73 W;  4WCE V;  3CPW U;  1JJ2 U;  1VQK V;  1YHQ V;  1VQ4 V;  3CCV V;  1YJN V;  2D3O W;  4WFB V;  3CCL V;  3CCE V;  3CCM V;  3CC2 V;  1VQ9 V;  1KQS U;  3CC7 V;  5DM6 V;  2OTL V;  1VQ6 V;  1YIT V;  1W2B U;  1K9M W;  1YI2 V;  3CCJ V;  3CCS V;  1VQM V;  1VQP V;  2OTJ V;  1KD1 W;  1Q86 W;  3CCQ V;  3CMA V;  4WFA V;  3CC4 V;  1N8R W;  3CCR V;  3CXC U;  1Q7Y W;  1QVG U;  1VQ5 V;  3I56 V;  3CME V;  1Q81 W;  2QA4 V;  1M1K W;  3G4S V;  1VQN V;  3I55 V;  1YJW V;  1K8A W;  3CCU V;  1VQ7 V;  1YIJ V;  4WF9 V;  1YJ9 V;  1S72 V;  1Q82 W;  1KC8 W;  1M90 W;  1VQ8 V;  1QVF U;  3OW2 U;  3CD6 V;  3G6E V; 
#chains in the Genus database with same CATH topology
 1EM1 A;  4J80 A;  4HBN A;  1KP3 A;  2B1I A;  4U7O A;  1K9M W;  5CB4 A;  4LCU C;  3ETE A;  1K5S A;  3IC7 A;  3D3Q A;  1AI5 A;  5IJ9 B;  3P3P A;  3I56 V;  2EIM B;  3QNE A;  4E2L A;  3LNN A;  3OTO B;  2WLL A;  3BFR A;  1KYO F;  3ZHT A;  1L0L H;  3T4Z A;  2FB5 A;  1WA8 B;  3AG2 B;  1ZTE A;  4B7E A;  4TV8 A;  1I94 B;  1BT8 A;  2ZE6 A;  2QJ1 A;  2QWN B;  2KKW A;  2QKC A;  2B1G A;  2VRZ A;  4G2K A;  1QR8 A;  2GDS A;  5EYP A;  4RWU A;  1WB7 A;  1N33 B;  3CRA A;  3CRQ A;  2BOB C;  3AEI A;  4UCR A;  4EFE A;  2D2C B;  2UXN A;  4AHC A;  5B66 Z;  2P4V A;  4Q6G A;  3THO A;  3ASO B;  1TVK A;  1T5E A;  4WFF A;  4Z2W A;  2ITD C;  1OJH A;  1MSW D;  1PM9 A;  2DJV A;  1F7Y A;  5EZY A;  3J80 N;  4DV6 B;  3RYF B;  2B5U A;  3E8G A;  3CRM A;  3E83 A;  4JI1 B;  1AJN A;  5H2F Z;  5DN6 G;  4J42 A;  2Y48 A;  3S3X A;  3ZMS A;  4DK0 A;  2AXT Z;  3K58 A;  1SA0 A;  2HEP A;  1Y74 B;  4MTX A;  2YUA A;  4MVU A;  3W7W A;  1MZE A;  2XAG A;  4P9O A;  1TVK B;  5IT9 N;  3FKS G;  1K97 A;  4PI2 A;  3CRC A;  3P32 A;  3FX7 A;  4I4T B;  3HKE A;  4LF8 O;  1KMI Z;  1YTF B;  2DW4 A;  4AI8 A;  4LF7 B;  2DYR B;  1KBH A;  3HB3 B;  5JJN B;  3K9S A;  4IHJ B;  4A5U B;  1E79 G;  3E89 A;  2KSD A;  2VWJ A;  2QKA A;  1NVP B;  2A0L A;  4PV1 B;  4JZ2 A;  1HDJ A;  4GX2 A;  2DMX A;  2YIB D;  2Y4T A;  4CH6 A;  2BTQ A;  2EJR A;  4O2B B;  5HFM A;  4JYA O;  4ZI7 A;  5B1A B;  2HJF C;  4I9W A;  2FML A;  2PZS A;  3D3I A;  5JVD B;  3J81 N;  3E22 A;  5LYJ A;  2ITC C;  1AI4 A;  1U96 A;  3K08 A;  3N2G A;  3ABK C;  1YHQ V;  2QM7 A;  3CWB H;  4OPH A;  2ZE7 A;  1XHZ A;  4MTO A;  1ZAU A;  2P6J A;  2QTO A;  4LF6 O;  2RMK B;  1ZL8 B;  1YCI A;  5J2T B;  3OUF A;  5HFL A;  4P2Z A;  2OCC C;  2Y4U A;  2GTS A;  3U0Z A;  5LP6 B;  4DW0 A;  3CSX A;  4LFB O;  4X65 O;  2ZIM A;  3HKC B;  3OEH G;  1JFF B;  4IYH A;  5KAI Z;  1BQ0 A;  1WN7 A;  1BCC H;  4KP4 A;  1L8D A;  3JD3 A;  2VQF B;  4MSW C;  4XBF A;  2RCV A;  3OR6 C;  2ZE5 A;  4X88 A;  5LA6 B;  3ZRS A;  2IW5 A;  2XAQ A;  4DR3 O;  4BIU A;  1KEC A;  5KHG A;  1Y66 A;  4W4K A;  4YHH B;  3IAY A;  1VQO V;  2PUS A;  4JI6 O;  4R8C A;  3K59 A;  1NR7 A;  1WAZ A;  3JAL B;  5FNV B;  2CDY A;  4BAY A;  4O4J A;  4FFK A;  3OTO O;  4YY3 O;  2GBO A;  5H6R A;  3RW0 A;  3CEI A;  1GN3 A;  1FXH A;  2VQE B;  1UFI A;  1BMF G;  3ZMV A;  2WLH A;  2EIM C;  1K34 A;  3KKY A;  2QEX V;  2XOK G;  2LP7 A;  1ENV A;  4JYY A;  3L70 H;  3QF7 A;  4LF9 O;  2UUA B;  4DV3 B;  2QWP B;  4FM1 A;  5JCO C;  2JRI A;  1VF6 C;  4LF9 B;  4JI4 O;  2ZDI C;  5L3G A;  1ORQ C;  3RYC A;  1N0J A;  1BGY H;  1WP8 A;  4PA9 A;  2WLL B;  3F7V C;  5KLV H;  1K7D A;  1SKV A;  4MW3 A;  3ZMZ A;  3A8T A;  4I55 A;  1VQ5 V;  2F23 A;  4TSF G;  3ABL C;  3OMN B;  3ZMU A;  1PP9 H;  4WBN B;  5KHI A;  4H33 A;  1RPR A;  4TV9 A;  3UT5 A;  2IU0 A;  1BS3 A;  4PA3 A;  3MD0 A;  2X7R B;  1IBM B;  3D36 C;  1JVM A;  1M1K W;  1CP9 A;  1FAF A;  3G6B A;  1IBM O;  2W0X A;  2LFS A;  3AG3 B;  5H6Q A;  3QO8 A;  2KG7 A;  5B3S B;  4OX9 O;  5IWA O;  3CHX A;  4PJ0 Z;  1GMG A;  4GX0 A;  4U3J B;  2LW7 A;  5TIS Z;  3STZ C;  4HZ3 A;  4Z1M G;  1XMO O;  3JD0 A;  5B1B C;  1MOF A;  2B9Z A;  5BR8 B;  2JDI G;  3CXH F;  4MVM A;  2JEX A;  5IJ0 A;  1KU9 A;  3OR7 C;  5IE9 A;  2K1E A;  2F4V O;  5EYP B;  2CGN A;  1PNL A;  2HVK C;  1XMQ O;  2GTA A;  3AK1 A;  3RFR A;  1NBM G;  4JI6 B;  4FZ0 A;  2QGN A;  5EC2 C;  1FPO A;  3W7U A;  4YJ2 B;  1NZ6 A;  1W0K G;  2A79 B;  3IFX A;  4F4L A;  1XI1 A;  3ABK B;  4CBC A;  2QM4 A;  2F43 G;  4J41 A;  3CS5 A;  1IBK B;  3OAA G;  1GN4 A;  3BHP A;  2VWK A;  1AP5 A;  1I0H A;  2QWQ B;  3OGC C;  3E35 A;  3JYC A;  2LO1 A;  2QM8 A;  3F7Y C;  3ML0 A;  1YJW V;  1MSD A;  1HP8 A;  4JI2 O;  3UT5 B;  4UV9 A;  4WFE A;  1KKD A;  2ODM A;  4X8A A;  4W4L A;  4PA4 A;  3ZRW B;  5LOV A;  2LGQ A;  3ZCC A;  3ZRV A;  3C90 A;  4PA6 A;  4JI8 B;  1JFF A;  2EIL C;  3HKC A;  2P7T C;  3MDS A;  3CJH A;  1KB9 F;  2YEV A;  5DEC A;  1R1B A;  4X1I A;  3SYO A;  2IJJ A;  4JAS A;  1OCR B;  3TXS A;  2UXX A;  4LR3 A;  4NXN B;  1R6N A;  3DTU B;  2YIC A;  1PD3 A;  4B7K A;  1URF A;  1XNR B;  3ZHR A;  1TUE B;  2KG7 B;  5LYJ B;  1S3J A;  3BY6 A;  1DLB A;  3JD2 A;  3R66 A;  4O2B A;  4P9P A;  4XDJ A;  4ZBM A;  1COW G;  2HG5 C;  1M57 C;  1FXK A;  3N2K B;  3KCX A;  2IBZ H;  2EIN B;  3ZHV A;  1OHH G;  2ZM6 B;  4DV5 O;  3EHB B;  5E79 Z;  1FFT B;  2GSM B;  1JR9 A;  2UXD B;  2NN4 A;  4TOI A;  4I0X A;  2JK5 C;  5KHJ A;  1NT2 B;  4FJC C;  3G6E V;  4JI0 B;  1Y67 A;  5IWA B;  5BMV B;  5B5E Z;  4B3S O;  3FYE B;  1SQV H;  2EZP A;  5CA0 B;  4B3M O;  1VIB A;  4DV4 O;  3B8M A;  3CC2 V;  1YXB A;  5B1N A;  3H1K H;  2QSA A;  4LNU A;  1WLE A;  4XDL A;  1YEW A;  4IYI A;  2JS3 A;  1UPG A;  4G28 B;  2E76 B;  5IJ9 A;  4RQE A;  1LUV A;  2Z3Y A;  1P7G A;  2DYR C;  4IL6 Z;  2EUL A;  2R70 A;  2XHB A;  4B3M B;  1N36 O;  1Y76 B;  4EB6 B;  1XMQ B;  3H1L H;  4B08 A;  4KHP B;  3BCC H;  1DF5 A;  4UB6 Z;  1FJG B;  2UXD O;  2WLI B;  3G67 A;  2ZCE A;  2BTO A;  2X6A A;  4YJ3 A;  1PNK A;  2GUZ A;  4PI0 A;  4ZOL A;  2WAM A;  4B3R B;  3ABM C;  2NR5 A;  3SJA C;  1EN6 A;  2RDC A;  1RSO B;  3N2G B;  4JI5 B;  1S76 D;  1KD1 W;  5LMN O;  1PKX A;  3GVM A;  2R9R B;  4F6R B;  4DR7 O;  3FB8 C;  1FFX B;  3LDC A;  4JYC A;  4DV7 O;  2XAJ A;  1FXK C;  1WPB A;  3B8N A;  5BZB A;  3AG1 B;  1B06 A;  1G4Y B;  4PEL A;  4TUY B;  5KA6 A;  3TJT A;  3C3S A;  3UO3 A;  3RVZ A;  4JYB A;  1N32 B;  4AIL C;  3K5L A;  1XOU A;  3AG7 A;  5GON A;  1TAE A;  4FLW A;  3OM3 B;  5BR8 O;  1JPX A;  3PN1 A;  3M99 B;  3FYI B;  1IVS A;  1F4N A;  2UXC B;  1H2G A;  1YJN V;  3A2F A;  3F5W C;  4QPJ A;  5LHI A;  1YF2 A;  2HHH B;  1Q6U A;  3UM7 A;  3CCQ V;  4UVB A;  4FZ1 A;  1KUQ A;  1B6Q A;  4WFG A;  4D6T H;  3SYP A;  1K4C C;  1Q5O A;  2ZKO A;  4Q20 A;  2PTM A;  3M8A A;  4X1K A;  2XAH A;  4K8X A;  4FLY A;  3W7T A;  1NTM H;  1XL6 A;  4B3S B;  1KKC A;  4EEQ A;  2OIG A;  2R9I A;  2P90 A;  2L6L A;  4NXM B;  2CK3 G;  5KA5 A;  3H01 A;  5LMN B;  1Q7Y W;  4HNA A;  5IYB O;  3K5N A;  3TET A;  1M56 C;  1XMO B;  3KG2 A;  2EIK B;  3FD9 A;  4K35 A;  1BQZ A;  1BL8 A;  1OCC B;  1YVW A;  3ETG A;  1WA8 A;  2JIZ G;  1H2S B;  2W6J G;  2GV9 A;  1V9P A;  3HKD B;  4X1Y A;  2N04 A;  2K9P A;  3BVO A;  4DV2 B;  3DC6 A;  4TT3 G;  5GTH Z;  1Q43 A;  2E5L O;  1WJZ A;  1NTZ H;  1MZF A;  1XHX A;  1ZSP A;  4FLU A;  3ZHU A;  1NVP D;  1FS0 G;  1FYJ A;  3X2Q B;  3E8F A;  2Y69 C;  2ZR2 A;  3RYF A;  2E74 B;  5B1O A;  5LHH A;  1YI2 V;  1SZT A;  2JEU A;  2CH7 B;  4JI3 B;  1IX9 A;  3AG4 B;  4ZOL B;  3TXQ A;  1K8A W;  4WBN A;  2Q7E A;  3QVN A;  3CJH B;  2HLD G;  4FIP C;  5KAF Z;  3L75 H;  4IIJ A;  2V1D A;  2YIA A;  3T4D A;  4DUZ O;  1QQC A;  3CCJ V;  4LFA O;  3DXR A;  2RJZ A;  2ADQ B;  1V55 C;  5EIB C;  1XL4 A;  3OT7 A;  4Z1V A;  5JQG B;  1R6K A;  2DYS C;  2BSK B;  2Q9L A;  4MTF A;  1G1X B;  1ZLZ A;  1ZX3 A;  2X0L A;  1VQL V;  5EIB D;  2MK3 A;  4K0K B;  4CS3 A;  1LNQ A;  1MMM A;  4DV0 O;  3B77 A;  5EC1 C;  1IDS A;  4FLT A;  1BZK A;  5BXZ A;  4DR4 O;  1H8H G;  5LL6 Y;  1P84 F;  3QO7 A;  1OCZ B;  4N23 A;  2JJ2 G;  1RFY A;  3FFQ A;  1VQ7 V;  2XUM A;  3HKE B;  1SQG A;  3D36 A;  3CRR A;  3MHS C;  2X6B A;  1Z2G A;  3DC5 A;  4H37 A;  4DYL A;  2E75 B;  3CYO A;  3B40 A;  3JD4 A;  4U3F H;  1US6 A;  4DR3 B;  3CCM V;  2HKO A;  2IM9 A;  3ETQ A;  1Q86 W;  2ARH A;  2PGG A;  2YXL A;  1D2D A;  2IJK A;  3SJB C;  4X9Q A;  5EZY B;  3JCZ A;  3ZS8 C;  4BW9 A;  4BWA A;  4UV8 A;  4K3A A;  1H2N A;  4X65 B;  5CA1 A;  2OYQ A;  4ABM A;  2EX3 A;  3JCU Z;  1JX9 A;  2JGD A;  3RYH B;  3Q4H A;  3T1C A;  1PL0 A;  2PYJ A;  3DSQ A;  3OD4 A;  1QLE C;  3JSL A;  1X59 A;  3SYC A;  1VF6 A;  3SJQ C;  1AJP A;  1QVF U;  1AJQ A;  2KB1 A;  4KHP O;  2CUG A;  4GT1 A;  3APO A;  4FFB B;  1K73 W;  1QU7 A;  4U7N A;  3BEH A;  4O4H A;  1AIL A;  3A0H Z;  3RGB A;  4ZHQ B;  1AI7 A;  4R7C A;  5FPO A;  1M57 B;  1PV0 A;  3BA8 A;  1MNG A;  1M5I A;  2ETN A;  4KFM A;  4K0K O;  5H9C A;  4X1Y B;  4UCT A;  3LDD A;  2XAF A;  4LFB B;  2WLN A;  4LC1 A;  2QKS A;  2EIK C;  2OIE A;  4MVO A;  3ZN0 A;  3LDE A;  3CCL V;  4MVZ A;  4LBE C;  2NNU A;  4GKJ O;  1VQM V;  4DK1 A;  4UCV A;  1Y4M A;  1MG1 A;  5C8Y B;  2HVJ C;  3WB0 A;  4DRX B;  5IYC O;  2G38 A;  4J7J A;  4NKG B;  3B09 A;  2YXH A;  3LSQ A;  1XBL A;  5H5N A;  2ZDI A;  4KXR A;  4DR4 B;  4NTX A;  4WFA V;  1JOY A;  1TA8 A;  4NXM O;  5LBQ A;  3SPJ A;  2EBO A;  4CC6 A;  4LFC B;  2F1M A;  4X64 B;  5LA6 A;  1L0N H;  4PDR A;  3PJS K;  1WPX A;  4LFC O;  4O4H B;  4IT5 A;  2BSK A;  3ZJZ A;  1N34 O;  1TUB A;  3FAV A;  4PD4 F;  2HFE C;  3BAB A;  4DR5 O;  4JI4 B;  3LUT B;  3RVY A;  5KMG B;  5B1A C;  4RO2 A;  2QE7 G;  5CMU A;  4JI7 B;  2JS5 A;  3HKB B;  2ZQM A;  4DUY O;  2BCC H;  1RP3 B;  3RT3 C;  1QCE A;  3Q4H B;  1MAB G;  4X62 O;  2KQX A;  2YSU B;  4RAI A;  1J5E O;  1YDX A;  4FVM A;  4LP8 A;  4YHH O;  2F95 B;  5DM6 V;  4UCU A;  1PNM A;  4GUN A;  3WB1 A;  4JI8 O;  3WFV A;  3CB2 A;  1O9H A;  4DR5 B;  3OGI B;  1GAX A;  5LMU B;  2PI5 A;  1FXV A;  2EIJ C;  5L3C A;  3BPZ A;  2Q5Z A;  2H3O A;  4FPP A;  3ZHQ A;  1R3I C;  1OV9 A;  4LF4 B;  1VQ4 V;  4JI2 B;  3T1H B;  4B3T B;  3A0R A;  1HWY A;  3TGU H;  5LXT B;  2EJ7 A;  3E8B A;  3JAS B;  5IYD O;  2E5L B;  1QBZ A;  2Q7G A;  1EBO A;  4CH4 A;  4JTC B;  4N21 A;  1K92 A;  3JAM N;  4LF5 B;  2WLJ A;  1CEZ A;  4R50 A;  2ZXW B;  1Q8I A;  4FFB A;  2FKX A;  4GX5 A;  3TK1 A;  4DR2 O;  2WA3 A;  1VMG A;  2A3Q A;  2A06 H;  4GCZ A;  5J2U B;  3SYQ A;  1D5N A;  4TUY A;  2R9A A;  4OX9 B;  4I55 B;  4JI0 O;  4I7Z B;  1KP2 A;  4I4T A;  2XAS A;  3O65 A;  3CMA V;  4BIZ A;  3SDL A;  2FYU H;  1XUQ A;  4X20 A;  3UCS C;  1M56 B;  3HKD A;  5EBL C;  4EFB A;  4FM2 A;  1HNZ O;  1K33 A;  2GHY A;  1SQF A;  3MAQ A;  2UU9 O;  1NR1 A;  2O57 A;  5FL7 G;  5LMU O;  1GM8 A;  1K5Q A;  5JCO A;  5BY1 A;  1L1F A;  4L8J A;  5IYZ B;  3JAW A;  4DR1 O;  4CC5 A;  4NXN O;  1VP7 A;  2YC0 A;  3EXA A;  4ZKI A;  1SS3 A;  4QGP A;  4YJ3 B;  1GRJ A;  3K0D A;  5LXT A;  1NJI W;  3P3N A;  1S5H C;  2BOC C;  4ICG A;  4I9Q A;  2UUB B;  3LSS A;  1BE3 H;  1B3Q A;  4G27 B;  2A9H A;  2N74 A;  2Q0O C;  5IY5 C;  3JAK A;  1SET A;  1NH2 B;  1M4U A;  3E22 B;  2LW1 A;  3ASN B;  4DV3 O;  1GN2 A;  3ABL B;  4RQF A;  2ILM A;  1H38 A;  2UU9 B;  2Z0A A;  1IBL O;  5LP6 C;  3L74 H;  2ZNJ A;  2XT9 A;  5JQG A;  4ZIB A;  4DR7 B;  1EZV H;  1VQP V;  3IJ4 A;  4OGQ B;  4DV7 B;  2FL4 A;  2R72 A;  1H2L A;  2ZD9 A;  4DUZ B;  4O4I B;  3LSU A;  2P5O A;  5AG2 A;  2UUC B;  1SRY A;  2WPD G;  3U10 A;  4DV1 O;  3WG7 B;  1Y6X A;  1H8E G;  1V54 C;  3NR7 A;  3EFF K;  2Q7H A;  4E4E A;  3K03 A;  3ZN1 A;  2ZM6 O;  2Y0P A;  5GTI Z;  4DR1 B;  1P7B A;  3HPL C;  2AHZ A;  3OFN G;  4F6R A;  2LJ2 A;  3L72 H;  4TWK A;  5CBH A;  3RWR D;  2RN9 A;  2P4K A;  3T2M A;  2OTL V;  4GKK O;  1IUR A;  1IXM A;  3AK2 A;  3F5T A;  4GX1 A;  1QR9 A;  3IC9 A;  4QJF B;  2UUA O;  1BSM A;  1GM9 A;  2GUZ B;  3W7X A;  2Q4P A;  5EK0 A;  4EKW A;  1Q82 W;  2ADP A;  3OW2 U;  2XND G;  2YI8 A;  3ICX A;  2Q69 A;  2VQE O;  4FLZ A;  2EIL B;  2JGD B;  3RYH A;  3ZED A;  5FPR A;  4UVA A;  1I08 A;  3M7M X;  3BA9 A;  4LNU B;  5EBM C;  1S72 V;  1QLE B;  3G71 V;  3CE2 A;  5ITZ B;  4UCO A;  1K4D C;  4CH3 A;  3I5D A;  3H1I H;  3JAK B;  1RSO A;  1XRE A;  1K3E A;  1WB8 A;  4JTA B;  3NXS A;  1S77 D;  1NS1 A;  1S0V A;  1EN5 A;  4O4L A;  4CS2 A;  2QR4 A;  4JYA B;  4PA7 A;  3APQ A;  4UB8 Z;  2DWE C;  4NB5 A;  1JJO A;  3JAT B;  3OMA B;  2HHH O;  1XEQ A;  4JV5 O;  3U11 A;  3AK3 A;  4K8Z A;  5LGT A;  2Y0I A;  5L3F A;  5GW7 A;  4X66 B;  3K3W A;  2IJH A;  1S5L Z;  5CA1 B;  2AZ0 A;  2D3O W;  3W7S A;  2BE3 A;  2EIN C;  4WFB V;  1GKF A;  5KHK A;  1VQ6 V;  4GZR B;  1G6U A;  3FB5 C;  3T1Y B;  4O4L B;  3QG5 A;  1I5Y A;  1F51 A;  2IH3 C;  4O2A B;  1M9N A;  3FAV B;  2DE0 X;  1PL4 A;  4GKJ B;  3SYA A;  4DV1 B;  2CAZ C;  1F23 A;  2QDO A;  2UUC O;  3CCE V;  4TV9 B;  2M7W A;  4QE7 A;  3MHH C;  4O2A A;  4DW1 A;  2IH1 C;  4FLX A;  3WB2 A;  4O4I A;  4RUE A;  4X89 A;  4KUM A;  4O4J B;  4JTD B;  1E1Q G;  2WA4 A;  1JMK C;  3CCV V;  4LWS A;  4QNH B;  2JJ1 G;  4P30 A;  5JJJ B;  1AR5 A;  5LGU A;  1N32 O;  2PY5 A;  1RM1 C;  1Y74 A;  1Z5W A;  3A0B Z;  4X1K B;  4CH5 A;  2AW9 A;  1XNQ B;  2WWW A;  4UUJ C;  5L3D A;  1J5E B;  3JD1 A;  3E86 A;  3ZHS A;  5F2V O;  4DR6 O;  3JSN A;  5D5Q A;  4I5S A;  2QWO B;  1R6T A;  2PYL A;  4QPK A;  1VQK V;  4JI7 O;  1JA8 A;  2OT5 A;  1IXB A;  3STL C;  2WLM A;  5CA3 A;  4UXN A;  1V54 B;  2YIB A;  1OCR C;  2Q67 A;  3CCR V;  4UVC A;  1GN6 A;  2VQF O;  5IYZ A;  1NKD A;  5C8Y A;  1XDC A;  4JPR A;  2CE4 A;  1ZL8 A;  3RN4 A;  3VOU A;  2WLI A;  3ZRX A;  2L35 A;  1EFR G;  1JJ2 U;  2CTR A;  3BRC A;  2ZNI A;  2DOS A;  3JAL A;  4TV8 B;  1Z5V A;  1RPO A;  4J7K A;  5CBG A;  3CXC U;  2NLJ C;  4MVQ A;  5K1X A;  3I55 V;  4LF6 B;  1I94 O;  3K0G A;  3FB6 C;  3GB7 C;  2Q0A A;  2IJI A;  1HNW B;  5J9P C;  3E2E A;  3B2E E;  4X62 B;  1JQ0 A;  1SES A;  1PPJ H;  4OXS A;  4LF5 O;  3SJC C;  1SQP H;  4DV2 O;  2ZE8 A;  1CPY A;  2RQ6 A;  5JJE B;  5L3B A;  1WP7 A;  3CME V;  1Q6H A;  1NTK H;  1GM7 A;  2WLK A;  1DTO A;  3OE7 G;  4J11 A;  2HJD A;  3WU2 Z;  3T1H O;  1TGO A;  3ZMT A;  2ZIO A;  3QTC A;  3CP1 A;  2F66 C;  5K1P A;  2W0F C;  3AG3 C;  4DR6 B;  1J95 A;  3R65 A;  4BR6 A;  3JAW B;  2ATK C;  3C3T A;  5JWP A;  1NU1 H;  2CTW A;  2LFR A;  5LHG A;  1I5X A;  3EVK A;  4HAM A;  5B1B B;  3CC4 V;  3J7A U;  4X20 B;  1QHT A;  5ITZ A;  3S3W A;  5JVD A;  5FNV A;  4CZZ A;  1VF5 B;  3KCY A;  4MS2 A;  1LR1 A;  4AQY O;  3SPC A;  4PDM A;  3K5M A;  5KX5 A;  3ABM B;  4MVS A;  1H2M A;  1LUW A;  4YIP A;  3OEE G;  3CCS V;  4JZG A;  4FLV A;  1QVG U;  1OCO C;  1S5J A;  1Q81 W;  4LFA B;  4JAV A;  3N27 A;  4NYK A;  4HYO A;  5C93 A;  3ASN C;  3SPH A;  4AQY B;  5FLX N;  2A7W A;  1N0N A;  1SC5 B;  4TQF A;  4D7S A;  1HNW O;  5KUM A;  1FXK B;  4JGS A;  2UXB B;  1HR0 B;  2XTA A;  2IU3 A;  1VQ9 V;  3CC7 V;  1YZB A;  1SF9 A;  4NTW A;  3JAS A;  1SER A;  2QWR B;  1SA0 B;  4R6Z A;  1FFX A;  4C7U A;  4JI3 O;  4DV5 B;  2MW2 B;  3ZBH A;  2H94 A;  1HNX B;  4BW5 A;  5A2Q N;  2DWD C;  4KL1 A;  3K5O A;  2YI9 A;  1HR0 O;  1P49 A;  2ZT9 B;  3WG7 C;  1VF7 A;  1U97 A;  1V55 B;  2AZ2 A;  3CX5 F;  4X1I B;  1GH6 A;  4L87 A;  4MVR A;  4ZHQ A;  2E3C A;  1XNR O;  4XDK A;  3O9O A;  1VQN V;  1NI8 A;  1H2K A;  1YIJ V;  4WF9 V;  1YJ9 V;  1EN4 A;  3AG1 C;  2P22 C;  1WNS A;  4UFZ A;  4LF4 O;  1N33 O;  3OTF A;  2H8P C;  1HNZ B;  4CS4 A;  5A9G A;  1OZ0 A;  1ZWI C;  3H9V A;  1XQ8 A;  2OTJ V;  2YS8 A;  3SPG A;  1JCH A;  1XIL A;  3OUS A;  3UKM A;  1THZ A;  3KZI Z;  2YXY A;  5KX5 B;  3N2K A;  4I50 B;  3VQV A;  4QE9 A;  4LF8 B;  4I50 A;  2AGA A;  1E1R G;  1FD9 A;  3ASO C;  2AHY A;  1BHB A;  4H0L B;  4PDL A;  5CB4 B;  2M6Y A;  5E1A C;  1IZ3 A;  5BMV A;  2Q6A A;  1NQT A;  2RNB A;  4DV6 O;  1Q3E A;  3ABU A;  4JI1 O;  2Q73 A;  5IDJ A;  1IBK O;  4DRX A;  2HP8 A;  1M90 W;  4J9Y B;  2Q68 A;  4J10 A;  1ARO P;  1A32 A;  3G80 A;  3JAT A;  4PDV A;  1KQS U;  1XNQ O;  5GON B;  3ETD A;  3X2Q C;  4NR1 A;  1W2B U;  4EB6 A;  4LH6 A;  1AB3 A;  1M93 A;  1ZUQ A;  2C2A A;  3RYI B;  2OWO A;  2P06 A;  2V7Q G;  3HR0 A;  3AG4 C;  5EBW C;  1YTF D;  5DED A;  2UUB O;  1W59 A;  4X66 O;  5JH7 A;  1X4T A;  3RBZ A;  4GLX A;  3UQ8 A;  1F4M A;  3VQX A;  4JV5 B;  2YEV B;  3K06 A;  2JGU A;  2PI4 A;  2VS0 A;  4IIJ B;  5KMG A;  1NH2 D;  5KUK A;  1Q6I A;  2X6C A;  4FK5 C;  2DYS B;  3L71 H;  4I0X B;  5LP6 A;  1GO3 F;  3H1H H;  2Z5U A;  4FMT A;  1Q90 D;  3DGE A;  1VAR A;  4RUF A;  2ZR3 A;  2DQ3 A;  3OMI B;  5J2T A;  5D5P A;  4FM0 A;  3UO2 A;  1R3L C;  1OCO B;  1SQQ H;  4U3J A;  4YIO A;  3RYC B;  4WCE V;  5LGN A;  1AR1 B;  3L73 H;  4J9Z B;  4YJ2 A;  4JAU A;  1SZX A;  2FTK A;  3P30 A;  4ZI7 B;  3K57 A;  4H13 B;  2OCH A;  3VQW A;  1RM1 B;  2CTP A;  2QTS A;  4MT8 A;  4GKK B;  1QLN A;  2W6I G;  2LQT A;  3AG2 C;  5J2U A;  4UCS A;  1N8R W;  3HKB A;  3CD6 V;  1DF4 A;  5LOV B;  4H44 B;  3CPW U;  3FB7 C;  4IHJ A;  3K79 A;  2PF4 E;  4LF7 O;  2F93 B;  2JVD A;  5KHH A;  2CTQ A;  4ASU G;  2EZO A;  3ZIA G;  4MTG A;  4TQD A;  4DV4 B;  3BAA A;  4DR2 B;  2WSS G;  1GTO A;  1UJW B;  2V4D A;  2UXB O;  3TCU A;  1HNX O;  1AR4 A;  2UXC O;  3DXR B;  4IGG A;  1OCC C;  3GWO A;  1B04 A;  4J7Z A;  4HNA B;  1DK1 A;  2QA4 V;  1FJG O;  2Q8V A;  1AVM A;  2EIJ B;  2LGW A;  1CXZ B;  3CCU V;  1D5A A;  2YDE A;  3E8H A;  4DO2 A;  5IJ0 B;  3SPI A;  4LH7 A;  3JAR B;  4B3T O;  1R3J C;  1BHA A;  4DV0 B;  3JAR A;  4JF3 A;  4NVP A;  1DGS A;  3LNM B;  1QNM A;  5JH7 B;  1SQX H;  1O9G A;  2Y69 B;  1Y76 A;  4JAA A;  1R3K C;  3RYI A;  1SQB H;  1EZJ A;  1TUB B;  4YY3 B;  2ZXW C;  3T1Y O;  1HW7 A;  4JI5 O;  4D7T A;  4DUY B;  4PHZ A;  3SGI A;  2N05 A;  4LWS B;  3H1J H;  4MW8 A;  1YIT V;  1FKA O;  4B3R O;  1AI6 A;  2HR3 A;  1I7F A;  4WFH A;  1N34 B;  1W0J G;  4YXW G;  5B3S C;  1YSC A;  3ZRW A;  4F6E A;  1G8M A;  2P67 A;  1IBL B;  4QIW F;  4X64 O;  3VBB A;  1ROP A;  1GK9 A;  4BIO A;  1N36 B;  3B4S A;  2CGO A;  2ZIN A;  2OCC B;  4OPA A;  2F4V B;  3GWK C;  4NTY A;  2YID A;  1VEW A;  1AP6 A;  1KC8 W;  3K04 A;  1OCZ C;  1P4R A;  5CN0 A;  1R73 A;  3QO5 A;  2DQ0 A;  1MA1 A;  3K9A A;  5L3E A;  5IY5 B;  2DN9 A;  3ABT A;  3D8C A;  3L9D A;  2BTQ B;  5CBF A;  3G4S V;  1N4C A;  2CH7 A;  4GYC B;  3VQY A;  3ZX6 A;  3SR2 C;  1VQ8 V;  5CA0 A;  4DXW A;  3IGA C; 
#chains in the Genus database with same CATH homology
 1QCE A;  2W0F C;  3AG3 C;  3FYE B;  2EZP A;  1J95 A;  1MAB G;  3R65 A;  2YSU B;  4RAI A;  3B8M A;  2ATK C;  4LP8 A;  1KP3 A;  2B1I A;  3CC2 V;  2LFR A;  5DM6 V;  5B1N A;  4U7O A;  1K9M W;  1PNM A;  5LHG A;  4LCU C;  3ETE A;  1K5S A;  3WFV A;  1I5X A;  1WLE A;  3IC7 A;  4HAM A;  5B1B B;  3CC4 V;  4XDL A;  1AI5 A;  3I56 V;  4G28 B;  2EIM B;  3QNE A;  4E2L A;  4CZZ A;  2PI5 A;  4RQE A;  2WLL A;  1FXV A;  2Z3Y A;  2DYR C;  2EIJ C;  5L3C A;  3T4Z A;  4MS2 A;  3AG2 B;  3SPC A;  4PDM A;  4FPP A;  1R3I C;  1VQ4 V;  3ABM B;  1DF5 A;  3A0R A;  4MVS A;  3OEE G;  1HWY A;  2WLI B;  3E8B A;  3CCS V;  5IYD O;  1QBZ A;  2B1G A;  1EBO A;  4G2K A;  2X6A A;  1QVG U;  1OCO C;  4JTC B;  1PNK A;  1QR8 A;  4N21 A;  1Q81 W;  1K92 A;  2WLJ A;  4JAV A;  1CEZ A;  4HYO A;  2BOB C;  2WAM A;  3ASN C;  3AEI A;  5C93 A;  4R50 A;  2ZXW B;  3SPH A;  2UXN A;  4GX5 A;  3ABM C;  3TK1 A;  3ASO B;  4GCZ A;  5KUM A;  3SYQ A;  1FXK B;  4JGS A;  4WFF A;  2ITD C;  2IU3 A;  1VQ9 V;  3CC7 V;  1MSW D;  1S76 D;  1KP2 A;  1SER A;  2XAS A;  1KD1 W;  1PKX A;  3CMA V;  2B5U A;  2R9R B;  4R6Z A;  3E8G A;  3E83 A;  4BIZ A;  1AJN A;  3FB8 C;  3LDC A;  4JYC A;  5DN6 G;  2Y48 A;  2H94 A;  3ZMS A;  1M56 B;  5EBL C;  4BW5 A;  2XAJ A;  2DWD C;  1FXK C;  4MTX A;  4MVU A;  3W7W A;  3B8N A;  5BZB A;  3AG1 B;  2XAG A;  4P9O A;  1K33 A;  1G4Y B;  3FKS G;  1K97 A;  2GHY A;  4PEL A;  5KA6 A;  3P32 A;  3WG7 C;  1V55 B;  1NR1 A;  3RVZ A;  5FL7 G;  1GM8 A;  1K5Q A;  4JYB A;  4L87 A;  4MVR A;  1L1F A;  1YTF B;  2DW4 A;  2DYR B;  4XDK A;  3HB3 B;  1VQN V;  3OM3 B;  1JPX A;  1E79 G;  4ZKI A;  1YIJ V;  3E89 A;  4WF9 V;  1YJ9 V;  3AG1 C;  3M99 B;  1NVP B;  2A0L A;  3K0D A;  3FYI B;  1NJI W;  1F4N A;  1H2G A;  1S5H C;  2BOC C;  4GX2 A;  1YJN V;  3LSS A;  2H8P C;  3F5W C;  4QPJ A;  1OZ0 A;  5LHI A;  1ZWI C;  2EJR A;  2OTJ V;  4G27 B;  2A9H A;  3SPG A;  1JCH A;  3UM7 A;  3OUS A;  3UKM A;  1THZ A;  5HFM A;  1SET A;  5IY5 C;  3CCQ V;  4UVB A;  1NH2 B;  1B6Q A;  5B1A B;  2HJF C;  4I9W A;  3ASN B;  4WFG A;  3ABL B;  3D3I A;  3SYP A;  1K4C C;  4QE9 A;  4Q20 A;  1E1R G;  4RQF A;  3ASO C;  1H38 A;  2ITC C;  1AI4 A;  2AHY A;  2XAH A;  1BHB A;  4PDL A;  3K08 A;  3ABK C;  1YHQ V;  3W7T A;  1XL6 A;  2QM7 A;  5E1A C;  4MTO A;  2R9I A;  2P90 A;  2Q6A A;  1VQP V;  1NQT A;  2P6J A;  2QTO A;  2CK3 G;  5KA5 A;  3H01 A;  3OUF A;  1Q7Y W;  5HFL A;  4P2Z A;  2OCC C;  2ZD9 A;  3ABU A;  5IYB O;  3TET A;  1M56 C;  5IDJ A;  3KG2 A;  1M90 W;  4J9Y B;  2EIK B;  1SRY A;  2Q68 A;  2WPD G;  1ARO P;  3OEH G;  1BL8 A;  3WG7 B;  1H8E G;  4PDV A;  1V54 C;  1OCC B;  3EFF K;  1KQS U;  3ETG A;  2JIZ G;  3ETD A;  3K03 A;  3X2Q C;  1W2B U;  3ZN1 A;  2W6J G;  4KP4 A;  3JD3 A;  1P7B A;  3HPL C;  4TT3 G;  4MSW C;  4XBF A;  2C2A A;  2AHZ A;  3OFN G;  3OR6 C;  4TWK A;  2V7Q G;  4X88 A;  3ZRS A;  2IW5 A;  3AG4 C;  2XAQ A;  5EBW C;  1YTF D;  4BIU A;  5CBH A;  1KEC A;  1Y66 A;  1NVP D;  1FS0 G;  1VQO V;  3RBZ A;  4R8C A;  3X2Q B;  3E8F A;  1F4M A;  1NR7 A;  3T2M A;  2Y69 C;  2ZR2 A;  5B1O A;  2OTL V;  4BAY A;  1IXM A;  5LHH A;  1YI2 V;  2YEV B;  4GX1 A;  1QR9 A;  1SZT A;  2JEU A;  3K06 A;  4QJF B;  1GM9 A;  5H6R A;  3RW0 A;  2PI4 A;  3AG4 B;  3W7X A;  1FXH A;  5EK0 A;  4EKW A;  1BMF G;  1K8A W;  3ZMV A;  1NH2 D;  2WLH A;  1Q82 W;  5KUK A;  2EIM C;  2X6C A;  1K34 A;  2DYS B;  4FK5 C;  2XND G;  3OW2 U;  2QEX V;  2HLD G;  4FIP C;  2XOK G;  2LP7 A;  1ENV A;  1GO3 F;  2Z5U A;  2V1D A;  2Q69 A;  4FMT A;  3DGE A;  3T4D A;  4RUF A;  2ZR3 A;  2DQ3 A;  3CCJ V;  3OMI B;  1V55 C;  2EIL B;  1XL4 A;  4UVA A;  2ZDI C;  1R6K A;  5L3G A;  2DYS C;  1ORQ C;  1R3L C;  1OCO B;  4MTF A;  5EBM C;  1S72 V;  1QLE B;  3G71 V;  4PA9 A;  2X0L A;  1VQL V;  2MK3 A;  4WCE V;  5LGN A;  1AR1 B;  2WLL B;  3F7V C;  1K4D C;  1K7D A;  1LNQ A;  4J9Z B;  4MW3 A;  3ZMZ A;  4JAU A;  1K3E A;  2FTK A;  3P30 A;  4JTA B;  3NXS A;  1S77 D;  1S0V A;  3B77 A;  5EC1 C;  4PA7 A;  2DWE C;  1H8H G;  3OMA B;  1VQ5 V;  3QO7 A;  1RM1 B;  1OCZ B;  4N23 A;  4MT8 A;  1QLN A;  2JJ2 G;  2W6I G;  4TSF G;  1VQ7 V;  3AG2 C;  3D36 A;  1N8R W;  3ABL C;  3CD6 V;  3MHS C;  2X6B A;  5LGT A;  1DF4 A;  4H37 A;  3OMN B;  3ZMU A;  5GW7 A;  5L3F A;  3K3W A;  3CPW U;  2IJH A;  3CYO A;  3JD4 A;  3W7S A;  2D3O W;  3FB7 C;  2EIN C;  4H33 A;  1RPR A;  4WFB V;  3CCM V;  1GKF A;  2HKO A;  3K79 A;  1VQ6 V;  3FB5 C;  2IU0 A;  1I5Y A;  1F51 A;  4PA3 A;  3MD0 A;  2IH3 C;  1Q86 W;  2X7R B;  1M9N A;  1JVM A;  4ASU G;  2EZO A;  2IJK A;  1M1K W;  1CP9 A;  3ZIA G;  2LFS A;  4MTG A;  3AG3 B;  5H6Q A;  3JCZ A;  3QO8 A;  5B3S B;  3SYA A;  2WSS G;  1GTO A;  1UJW B;  1F23 A;  4UV8 A;  3TCU A;  1GMG A;  4GX0 A;  3STZ C;  3CCE V;  4HZ3 A;  4Z1M G;  2M7W A;  3JD0 A;  5B1B C;  4QE7 A;  1JX9 A;  1OCC C;  1MOF A;  3GWO A;  3MHH C;  3T1C A;  2IH1 C;  1PL0 A;  2JDI G;  4MVM A;  2JEX A;  4RUE A;  4X89 A;  3OR7 C;  2QA4 V;  2EIJ B;  4KUM A;  1QLE C;  2K1E A;  1PNL A;  2HVK C;  3CCU V;  3E8H A;  3SYC A;  4DO2 A;  3SJQ C;  3SPI A;  1AJP A;  1QVF U;  1AJQ A;  2KB1 A;  1NBM G;  4JTD B;  1R3J C;  4GT1 A;  1BHA A;  1E1Q G;  5EC2 C;  3W7U A;  1K73 W;  1W0K G;  2A79 B;  4JF3 A;  3CCV V;  3IFX A;  4QNH B;  4F4L A;  3LNM B;  4U7N A;  3ABK B;  3BEH A;  2JJ1 G;  4P30 A;  4CBC A;  2F43 G;  2Y69 B;  5LGU A;  1AI7 A;  4R7C A;  1M57 B;  1RM1 C;  3OAA G;  1R3K C;  1EZJ A;  3OGC C;  3E35 A;  3JYC A;  2ZXW C;  2QM8 A;  2WWW A;  4KFM A;  3F7Y C;  4UUJ C;  3ML0 A;  5L3D A;  1YJW V;  3JD1 A;  3E86 A;  5H9C A;  3LDD A;  2XAF A;  4UV9 A;  2WLN A;  4I5S A;  4LC1 A;  4WFE A;  2QKS A;  1KKD A;  2EIK C;  4QPK A;  1VQK V;  2OT5 A;  4MVO A;  3ZN0 A;  3LDE A;  3CCL V;  4MVZ A;  3STL C;  4LBE C;  4MW8 A;  2WLM A;  1YIT V;  4X8A A;  4PA4 A;  5CA3 A;  2NNU A;  4UXN A;  1AI6 A;  2HR3 A;  1V54 B;  1VQM V;  3ZRW B;  1Y4M A;  1OCR C;  3ZRV A;  2Q67 A;  3ZCC A;  1MG1 A;  4WFH A;  3CCR V;  2HVJ C;  4UVC A;  4PA6 A;  5IYC O;  4DXW A;  1W0J G;  4YXW G;  1NKD A;  5B3S C;  4JPR A;  2EIL C;  2P7T C;  1YSC A;  3ZRW A;  1G8M A;  2YEV A;  3VOU A;  2WLI A;  2P67 A;  3ZRX A;  4QIW F;  3VBB A;  1EFR G;  1ROP A;  1JJ2 U;  3SYO A;  3LSQ A;  1GK9 A;  2IJJ A;  4JAS A;  1OCR B;  2ZDI A;  1RPO A;  2OCC B;  2UXX A;  5CBG A;  1R6N A;  3DTU B;  4WFA V;  1JOY A;  3CXC U;  2NLJ C;  4MVQ A;  1PD3 A;  5LBQ A;  3SPJ A;  3I55 V;  3K0G A;  3FB6 C;  2EBO A;  3GB7 C;  1KC8 W;  3K04 A;  1TUE B;  1OCZ C;  1P4R A;  2IJI A;  5CN0 A;  1S3J A;  3BY6 A;  5J9P C;  1R73 A;  3QO5 A;  3E2E A;  1DLB A;  4PDR A;  3JD2 A;  3PJS K;  1WPX A;  4P9P A;  2DQ0 A;  1JQ0 A;  1SES A;  3ZJZ A;  4XDJ A;  1COW G;  2HG5 C;  3K9A A;  1M57 C;  4ZBM A;  4OXS A;  1FXK A;  5IY5 B;  5L3E A;  2HFE C;  2EIN B;  3LUT B;  3ABT A;  3RVY A;  1OHH G;  5B1A C;  4RO2 A;  2QE7 G;  1CPY A;  3EHB B;  5L3B A;  5CBF A;  5CMU A;  3CME V;  1FFT B;  2GSM B;  1GM7 A;  2WLK A;  3G4S V;  1DTO A;  2JK5 C;  3OE7 G;  2ZQM A;  1VQ8 V;  4FJC C;  3ZMT A;  3G6E V;  3IGA C;  3CP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...