1VQ4V

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq4V00
1YI2V 1W2BU 4WFAV 3G4SV 2D3OW 3CCRV 1YJNV 1K73W 1NJIW 1VQ9V 3CD6V 4WCEV 1JJ2U 3CCMV 1YITV 1VQKV 1R73A 3CCQV 1VQOV 3G71V 3I55V 3CMEV 3CCSV 2OTLV 1VQMV 3CCEV 1QVGU 1M1KW 1KD1W 4WF9V 1Q86W 1KC8W 1K9MW 1VQ6V 3CPWU 3CMAV 1Q7YW 1N8RW 2OTJV 3CXCU 4WFBV 1VQLV 2QEXV 1YJWV 1VQ8V 5DM6V 1YHQV 1VQPV 1Q82W 3OW2U 1VQNV 1YJ9V 1KQSU 3CC2V 3CC4V 1S72V 1Q81W 1VQ5V 3CCJV 3CCLV 3CCVV 1K8AW 2QA4V 3CCUV 1M90W 1VQ4V 3G6EV 1QVFU 3I56V 3CC7V 1YIJV 1VQ7V
chains in the Genus database with same CATH superfamily
1A32A 2Y4TA 4FLZA 1AP6A 4TUYB 3CWBH 5HFLA 3NR7A 3SYAA 1R3KC 4KUMA 3FFQA 2QM7A 3CCLV 2UXDB 1E79G 4MVMA 3AG7A 4EEQA 4RUFA 2LGQA 4PV1B 4O2BA 2FTKA 4O4IA 5KUKA 1MA1A 3OEEG 4LF5B 1M1KW 5BY1A 1TUBB 4FJCC 4Q6GA 3AG4B 1JFFB 1OHHG 5LXTB 5C8YA 1IBKO 1RSOA 5CB4A 3AG1B 1DF4A 4P9OA 4LNUA 4X1YB 3HKCB 1VQ4V 2XT9A 1SQPH 2ZM6O 4U3JA 5B1AB 5LMUO 5KUMA 4LF8O 1PNMA 5JJNB 3STLC 5EZYA 2YICA 3ICXA 3JAMN 4WBNA 4FLUA 4H33A 2JDIG 3CXCU 2YEVB 1P4RA 2DYRB 4TV9A 2Y4UA 4MTGA 4GYCB 5IYZA 4E2LA 4I9WA 1L1FA 4DR7O 1S76D 3OMIB 3CYOA 3PN1A 4ABMA 2N04A 2EIJB 1MZFA 4GKKO 2XAJA 2QJ1A 4TOIA 4JI8B 1EBOA 1TUEB 3AG2C 3VQWA 4TQFA 1URFA 2DYSB 5LGUA 4DV1B 1R6NA 4R6ZA 1JCHA 1YVWA 2ITDC 4YY3O 2Y69C 2HR3A 5KHJA 1YITV 1HNZB 4MVUA 4JI3O 4JI4B 5LHIA 5J2UB 4Z2WA 3AG3C 4B7KA 3CS5A 4WFBV 4HYOA 3OTFA 3PJSK 1UFIA 5CA0B 3CC4V 2JGDB 1XNQO 3CRCA 3OAAG 2XAHA 4DUZB 2HHHO 2ZE5A 1BE3H 3SJBC 2NLJC 2BTQB 4LF4B 3B40A 4LBEC 3RN4A 4IYHA 4IL6Z 2JEXA 2DMXA 5KX5B 3S3WA 1Q6HA 1J5EB 2OTJV 3HR0A 4NVPA 1QCEA 4X64O 1AR1B 4TV8A 1N32B 3ABMB 3ASOC 1Y74A 3CB2A 2H8PC 5KHHA 2QTOA 2EIMC 2X7RB 1VQOV 2GBOA 2RCVA 1Z5WA 1F4NA 2JS5A 4YXWG 1Q86W 3ZEDA 5B1BC 3CRMA 5H5NA 2FYUH 3UO2A 1SA0A 4Q20A 1GK9A 1KP3A 4B7EA 5DM6V 3BCCH 5CA1A 3Q4HA 4DR2B 4FM0A 2QTSA 2EZOA 2YSUB 2WAMA 5BZBA 3J81N 2EZPA 5FLXN 3OR7C 1BMFG 4I0XA 3T4DA 3E35A 3FAVB 3VQYA 1QLEC 4MT8A 4JI2B 4YJ3B 2PF4E 2YXLA 2CH7B 4JI0B 4RQFA 5KA5A 2YUAA 4DV7O 4JASA 4O2AB 3RYIB 3SYCA 5IWAO 4JI6O 5IE9A 4TQDA 5LBQA 1QBZA 2QE7G 3SGIA 2RQ6A 2Q9LA 1IBMO 3WB2A 3L74H 4DV5B 4TWKA 3T1YO 1B06A 2JRIA 4BIOA 1VQ8V 4HNAA 1JX9A 5FL7G 4EFEA 3CCVV 2GUZA 3ZRWA 4DV3B 2QKSA 2WLHA 1P84F 2CK3G 4GX0A 2W6IG 2L6LA 1XMOO 2DQ0A 3H1KH 1ZAUA 4CS2A 4PI2A 4PI0A 1XILA 1Q7YW 1M56C 2UUBB 1XDCA 2P90A 3RVYA 4JYYA 1XI1A 3SYPA 1GN6A 5EC1C 4FLYA 4FZ0A 4GUNA 2K9PA 1PD3A 4F6RA 4XDLA 1HWYA 1JVMA 1BCCH 1VMGA 3OGIB 4O4IB 1IVSA 2GV9A 3IC7A 3ABUA 1K4DC 2VQFB 3APQA 2V1DA 1R3JC 1YCIA 3FYEB 3WB0A 4JF3A 1XMQB 3S3XA 2E5LO 1RSOB 5CB4B 1FXKB 2CTPA 2UUAO 4DRXA 2C2AA 1IBLO 3JAWA 4LNUB 4C7UA 4PD4F 2D3OW 4YJ2A 3J7AU 1H2MA 5IYBO 2ZE7A 4JGSA 3JCUZ 1XREA 3BRCA 3KKYA 4U3JB 2EIKB 2GTSA 3RGBA 3CJHA 3FX7A 5EZYB 1P7BA 1YHQV 4JTCB 4WBNB 3D36A 1M9NA 2HJFC 4DV4B 4TV9B 5CA3A 2KG7B 1OZ0A 5IYZB 1ZSPA 2Q0AA 1VIBA 2ZDIA 2Y0IA 3JSLA 2P5OA 3DGEA 5DECA 5A2QN 2A7WA 1MSWD 4EKWA 1JPXA 1EZJA 1Y67A 1CPYA 4UCTA 2PY5A 1PPJH 5B1AC 1SC5B 1L0LH 1VQKV 1O9GA 1S3JA 3CX5F 3ZRSA 1GKFA 2ZNIA 1GM7A 3MHSC 1G4YB 4JYAB 3M7MX 5D5PA 3UKMA 2W6JG 4DR1B 4QJFB 5E79Z 2UUCO 4DR4B 4AILC 2Q8VA 3F7YC 1LR1A 3SDLA 3JD2A 1F4MA 4R7CA 5LP6C 2OTLV 1SS3A 1Q6IA 3EHBB 2Q0OC 3GB7C 2A79B 4JAUA 1NVPD 2ZD9A 1JJOA 3JD4A 5K1PA 3JALA 4I4TA 3CMAV 1DK1A 2B1GA 2A9HA 3SPCA 3K9AA 3BFRA 3IGAC 4TV8B 5LMNO 2CDYA 1Y74B 4WCEV 1ZUQA 4N23A 3N2KA 1PV0A 2LQTA 2BTOA 4J7JA 4PDMA 1FJGO 1WB7A 2QEXV 2XAQA 1OCZC 4DXWA 1OCRB 1UJWB 2AZ0A 4K0KO 4JI7O 1SA0B 1N0JA 5BR8B 1ZTEA 3ZMZA 1R3IC 2OCCB 1SQFA 3Q4HB 3E83A 1HNXO 2ZXWB 2PI5A 1CXZB 4B3RO 1K9MW 2JVDA 4B3TO 1WNSA 2Q69A 4I0XB 4JV5B 2JGDA 3DSQA 1NI8A 3MD0A 1Q82W 2ZKOA 3ABKC 1US6A 2HG5C 4X20B 2NR5A 1DGSA 3W7TA 3ETEA 3UCSC 3CCSV 1N33O 1TVKA 5L3CA 4OX9B 4CH4A 4MVQA 1N34O 1YDXA 1QU7A 5FPRA 4X66O 1RM1B 2PYJA 2QM8A 5AG2A 2LFSA 4O4HB 4NTWA 3G4SV 3UT5A 2GUZB 4DR3B 3ZRWB 5JH7B 3QNEA 1HR0B 3ETQA 2EULA 4UVCA 2FB5A 3R66A 2VQEO 4FK5C 4MTFA 5H6QA 4DV2O 4BIUA 4J41A 1BGYH 1CEZA 1S0VA 2QA4V 4CBCA 4DO2A 2RMKB 4PA3A 1XNRO 1R3LC 1MG1A 1PNLA 3FAVA 5JVDB 1FPOA 1KKCA 4LFCO 2PI4A 4AQYB 4MS2A 4LFAO 4F6RB 2YXYA 2CTWA 2F1MA 2HLDG 3OM3B 4LR3A 1ZX3A 3ZHSA 2CGOA 3TGUH 4B3MO 4LF7B 2A3QA 1NKDA 4ZHQB 5LOVA 4DRXB 5LL6Y 4YJ2B 3KG2A 1JMKC 1K4CC 4DR6B 1WAZA 4FVMA 1GRJA 3CJHB 2PTMA 1XL4A 3B4SA 4XDKA 2Y48A 2EINC 4OPAA 4LH6A 3W7XA 3CC7V 2IW5A 1JQ0A 2B9ZA 1HNWO 1WP7A 2Q7GA 3THOA 2YIAA 3JSNA 4JI7B 2PGGA 4X89A 3TK1A 1I08A 2ADPA 4JI5O 5TISZ 3E86A 4UCVA 1YSCA 2AGAA 3OGCC 2Q7EA 1FKAO 3JCZA 5KAIZ 2Z0AA 2IU0A 2AZ2A 4U7NA 4UCRA 1EN5A 1YF2A 2Q6AA 1K5QA 3ZRVA 3L71H 5IJ9A 1NH2D 1GN3A 2RJZA 3E8FA 5CBFA 3OMNB 1GM9A 1FXKA 4KFMA 2R9RB 1H8EG 5FPOA 1XOUA 1VF7A 4DK0A 1AB3A 5D5QA 1XBLA 1DTOA 3K5LA 1R73A 3H1IH 3JARA 4L87A 2YIBD 4Z1MG 3TJTA 1VQMV 4JI1B 2LP7A 4FMTA 4U7OA 4GKJB 3JALB 4I4TB 4UFZA 1VQNV 2P4KA 4DR5B 2KG7A 4X8AA 2X0LA 1F23A 3LDEA 4DV6O 4UVBA 1YIJV 2EILC 1L0NH 3FB5C 4QE9A 5IY5B 4UUJC 2F66C 3E2EA 4IT5A 1L8DA 3WG7B 2DOSA 5L3BA 3ZMVA 3N2KB 4DUYB 1FD9A 2P22C 1SZTA 4LFBO 1BQ0A 3ABLC 3VBBA 3BVOA 2DW4A 4J42A 1AP5A 3OW2U 4KHPO 1TA8A 1XQ8A 2WLIA 1LUWA 4N21A 1M57C 1V9PA 5GTHZ 2N05A 1S5HC 4FFBA 1JJ2U 4ICGA 2UXBB 1I0HA 1N36O 2NN4A 1K34A 3U10A 4YHHB 1V54C 2WA4A 2DQ3A 1NTZH 2QKAA 4LF6B 2PYLA 4JYCA 1K7DA 1KU9A 3CXHF 3LNNA 3CC2V 3H1HH 3MHHC 5EBMC 1V55B 4RO2A 3KCYA 4CC6A 4D7SA 1K5SA 2E76B 2BOCC 4PA6A 3HB3B 2E3CA 4NXMB 1FAFA 4P30A 3ZIAG 2WLMA 3ZCCA 2CE4A 3T1CA 2Q4PA 1M5IA 4DV0B 1TVKB 1UPGA 1OCRC 3K04A 3EXAA 1S5LZ 5H6RA 3D3QA 3P3NA 1M90W 1VF6A 1NS1A 3H9VA 3UT5B 1IX9A 4K8XA 1OCCC 3O9OA 5IJ0A 2JIZG 3ZMSA 2F4VO 3K5NA 2DJVA 2MK3A 5JJJB 2EX3A 2Z3YA 4G2KA 1KBHA 3F5WC 2LFRA 1BQZA 4CH6A 2GSMB 4L8JA 2YDEA 3ZHUA 4J9YB 4MSWC 4K35A 1IBKB 3OD4A 2ZR3A 4WFFA 1I94O 5CMUA 4X65O 3T4ZA 1SQXH 4F6EA 1KMIZ 3ZMTA 2DWDC 4QPKA 2ZM6B 1Y76A 4X20A 4B3SO 4LCUC 5B1OA 5LMUB 1RPOA 4MW3A 4LF8B 4J11A 1EM1A 2JS3A 1G6UA 2QR4A 3K0GA 1R1BA 1IDSA 1OCOC 3BABA 1FXHA 3H01A 3RT3C 1QLNA 1Z5VA 4EB6A 5LOVB 3ZX6A 1WN7A 4DR7B 4ZI7A 4X62O 3C3SA 4HBNA 1VQPV 4QE7A 3JAKA 4O4HA 4GKKB 2ZINA 1S77D 5B1NA 2XTAA 5JH7A 1Y66A 2ZE6A 2UXNA 5EBLC 3CE2A 5B3SB 2N74A 1AJPA 5L3GA 1F51A 4YY3B 1AJQA 4YIOA 2XOKG 3TETA 4H44B 3CCUV 1PM9A 4JI3B 2ATKC 3L70H 5JVDA 1K73W 3UQ8A 2ZE8A 3ZJZA 1QVGU 3N27A 2ETNA 3SYQA 1XNQB 4MVRA 3B77A 4LF9O 3A0RA 1SRYA 5IJ9B 2DWEC 2ITCC 2HHHB 4GX5A 2VS0A 3ASNC 3ETGA 1PP9H 3LSQA 4ZHQA 4TSFG 3G6BA 3JD0A 4H13B 1WJZA 5B5EZ 3DC5A 1I7FA 2AW9A 2R72A 4X64B 1NTMH 1NTKH 2ZDIC 3CRRA 3JARB 1MMMA 1Q6UA 4G27B 5FNVA 3ZN0A 1NR1A 2YI8A 4KL1A 1GN4A 2JJ2G 1G1XB 3BA9A 2MW2B 3QO5A 4IGGA 3VOUA 3RW0A 3K0DA 4FZ1A 4GX2A 1K3EA 1N4CA 2X6CA 1X4TA 4NTYA 2NNUA 3LDCA 4WF9V 4BWAA 3AG4C 4QNHB 2AHZA 4JAVA 3AG1C 3BA8A 1VF5B 1P7GA 2YIBA 1XHZA 1EZVH 3L73H 2VRZA 3RYHA 4X65B 1SQQH 4I9QA 2WLIB 2JEUA 2AHYA 2IBZH 2A06H 1WA8A 4FFBB 2QGNA 2UXCO 5GTIZ 1QQCA 4DV7B 4JTAB 2O57A 2YXHA 1ROPA 1Z2GA 3ZHQA 4H37A 2DYRC 4JI6B 5IWAB 2PZSA 4J7ZA 1YTFB 2X6AA 4PHZA 3LSSA 1IBMB 4DW1A 3T1YB 2EIJC 2ILMA 3IC9A 3WG7C 2R70A 3RBZA 2FMLA 1IXMA 1SF9A 2ZQMA 1CP9A 3OE7G 1DF5A 4X1IA 2DYSC 3RFRA 3N2GA 1N0NA 5JCOC 1YJWV 3K79A 1KQSU 5J2TA 4GX1A 4BW9A 1R6KA 1XMOB 4MVZA 5EIBC 2Y69B 2JJ1G 5HFMA 4OXSA 3AK2A 3SYOA 5IJ0B 2EJ7A 2RNBA 2H3OA 3F7VC 1V55C 4Z1VA 4AHCA 5ITZA 4UB6Z 3M8AA 2BOBC 3TXSA 1AILA 3T1HO 4NR1A 5LP6A 1WPXA 3ZN1A 1B3QA 3A2FA 2B1IA 3W7UA 4MTXA 4NB5A 1KECA 3WU2Z 4FM1A 4G28B 1KKDA 2E5LB 2Q7HA 1HW7A 2UUAB 4A5UB 1IBLB 4D6TH 2ZCEA 3ABMC 2QWOB 3ZRXA 3VQVA 3A0BZ 1GH6A 4QGPA 2QWPB 1Y76B 4U3FH 4WFAV 3R65A 4I50A 3OUFA 2Q67A 3BAAA 2EIMB 3U11A 1QHTA 2UXDO 1AI5A 3E8BA 4UCUA 5KHKA 1NBMG 4I7ZB 3E8HA 4I5SA 3K5MA 3LSUA 3QO8A 4WFGA 5B1BB 4J7KA 4EB6B 4HAMA 1AR5A 1JOYA 4OGQB 3RWRD 4LF5O 4ZI7B 3BHPA 3SPIA 4FIPC 3JAKB 2JK5C 4J9ZB 1BT8A 3WB1A 1MZEA 5LA6A 3IFXA 1XEQA 3DXRA 1ZL8A 4PA9A 3CEIA 2OIEA 1PL0A 5BXZA 3K58A 3QF7A 4BR6A 3BY6A 2QDOA 1FXVA 3TXQA 3GWOA 3OT7A 3SPJA 2OYQA 1VQ5V 1NT2B 3DTUB 1SESA 1W59A 5CBGA 4UXNA 5LGNA 2LW1A 2ZIMA 3CD6V 4X1KB 4NTXA 1VP7A 2ZIOA 4PDVA 1PNKA 1SQVH 1WPBA 4FFKA 3FYIB 2CAZC 2UUCB 1Q43A 3HKDA 1KB9F 5L3FA 4X9QA 2XNDG 1WLEA 1I5XA 2V4DA 5L3EA 4JI8O 1MSDA 2P67A 2XAFA 3CSXA 3OFNG 4NKGB 4IYIA 4FM2A 4DV1O 3K5OA 3GVMA 2F93B 2IH1C 3B2EE 5B3SC 2HP8A 2GTAA 4MTOA 1R6TA 3AK3A 1HNZO 1J95A 1K92A 4ZIBA 5KHGA 3K03A 5FNVB 5LMNB 4JI4O 1OJHA 4BW5A 3WFVA 1AVMA 3P3PA 4NYKA 2VWKA 1FJGB 3OUSA 1D5AA 4IHJA 4K0KB 2FKXA 4LF4O 4RWUA 1HNXB 1FXKC 5JQGA 3HKBA 4RQEA 1EFRG 4W4LA 1J5EO 4B3RB 4B3TB 1COWG 3FB6C 3FB8C 1N32O 3RYHB 2EBOA 1PKXA 2EIKC 5LHGA 4AI8A 3ZMUA 1VQ6V 1WA8B 5KMGA 2HVJC 3QTCA 3HKEA 1GN2A 4QIWF 2Q73A 2KKWA 1H2GA 2LJ2A 3SJAC 1SQGA 1K8AW 3APOA 1N33B 1RFYA 1K97A 4GLXA 3OEHG 1FFTB 1N34B 4F4LA 5C93A 4X66B 1BL8A 3G71V 1SERA 4I55A 3LDDA 4DR2O 3MDSA 4GZRB 2F95B 2W0XA 3CRQA 4X1IB 4O4JA 3SR2C 4JI2O 1B6QA 1FFXB 3N2GB 2VWJA 4JI0O 3QG5A 3JD3A 5J2TB 1NR7A 2HJDA 4XDJA 2VQEB 2OIGA 3ETDA 4DV2B 2G38A 3D8CA 2P6JA 1FYJA 1D5NA 4FLWA 3E22A 1XHXA 1IURA 1XNRB 1H8HG 2HEPA 3CCJV 4DV5O 1S5JA 4J10A 4LFCB 3ZBHA 4ZOLA 5ITZB 3RYCA 4LFAB 4MVSA 3IAYA 3U0ZA 5BMVA 5LYJA 3X2QB 4PA4A 3C90A 5LP6B 3FD9A 4DV3O 1EN4A 4B3MB 2R9IA 3JASA 3RYFA 2BSKA 5GONA 3P30A 3ZHVA 2GDSA 1ZLZA 3G6EV 1QVFU 3A0HZ 2UUBO 3B8NA 2X6BA 3KCXA 4XBFA 5K1XA 1RP3B 2WSSG 3SPGA 4CS3A 1VF6C 4E4EA 3CCQV 4I50B 3B09A 2OWOA 2H94A 3T2MA 1NQTA 5L3DA 1PL4A 4UCOA 2IJKA 1HNWB 1OCZB 1ZWIC 1Q81W 2RDCA 1H2LA 3H1LH 1Y6XA 1AR4A 2OCCC 2VQFO 3O65A 4R8CA 2WA3A 1XMQO 2ZXWC 2V7QG 4JI5B 3L9DA 1YZBA 4P2ZA 1JR9A 5B66Z 1ENVA 3E89A 5LA6B 5EIBD 5LGTA 2Y0PA 3DXRB 1ZL8B 4PDLA 4JZ2A 4D7TA 5H9CA 4FLTA 3CHXA 3ZS8C 1KYOF 3ABKB 2XASA 5EC2C 1VQ7V 4JPRA 1NJIW 3K06A 4DW0A 4LC1A 3M99B 3CMEV 2IJHA 1QR8A 1Q5OA 4FLVA 4KXRA 4DV4O 1K33A 4EFBA 1GAXA 3H1JH 3ZHRA 2WWWA 1RM1C 4O4LA 2ZR2A 2BE3A 4LP8A 4H0LB 3FB7C 3HKDB 5KHIA 4GCZA 1T5EA 5EYPB 1B04A 5DEDA 2OCHA 2P06A 3I56V 3CCRV 4X88A 1EN6A 1P49A 2PUSA 5EK0A 2F43G 1SETA 4J80A 1D2DA 1GTOA 4CZZA 4HZ3A 4CC5A 4DV6B 1MOFA 3SJCC 2ODMA 1VQLV 4DK1A 2A0LA 2QKCA 3JATA 3QVNA 4JYAO 2GHYA 3IJ4A 2E75B 5E1AC 4DR1O 4LFBB 1G8MA 4OPHA 4DR4O 2WLLA 4KHPB 4PDRA 3HPLC 1KC8W 4IIJB 4IHJB 4QPJA 3K59A 1MNGA 4ZBMA 1N36B 2YI9A 3K08A 4X1KA 2HVKC 4UV8A 5JQGB 2XUMA 3E8GA 3HKBB 2D2CB 1MABG 1AI4A 1KD1W 2W0FC 3A8TA 5CN0A 4B08A 1N8RW 1M4UA 4KP4A 5DN6G 3NXSA 2UU9O 5KMGB 2IJIA 3HKEB 2YIDA 1S72V 1W0JG 3BEHA 2QM4A 2EINB 2XHBA 1VQ9V 3D36C 4DYLA 3OTOO 2KSDA 3F5TA 1H38A 4O2BB 5BR8O 4I55B 4CH3A 2JGUA 3B8MA 3UM7A 1AI6A 1GMGA 2L35A 5C8YB 3K3WA 1RPRA 2IJJA 1WP8A 4O4JB 3RVZA 4JV5O 2F4VB 5IYDO 1H2SB 2B5UA 1XUQA 2FL4A 3I55V 4LWSA 1LUVA 5KLVH 3DC6A 4RUEA 4JTDB 5IDJA 4PELA 5KAFZ 2LGWA 4RAIA 1KUQA 4OX9O 3E22B 1BZKA 4WFHA 2KB1A 1I94B 1YI2V 4K8ZA 2CUGA 2IH3C 4TUYA 4ZOLB 1NVPB 3RYCB 3EFFK 1I5YA 4B3SB 5BMVB 5LYJB 1HDJA 4DR3O 3CPWU 4R50A 3ML0A 3JYCA 1HR0O 4YIPA 2F23A 1YJ9V 2RN9A 3JASB 3RYFB 1NZ6A 1YEWA 2BSKB 4PA7A 5GONB 1BS3A 1W2BU 4K3AA 2Q68A 1O9HA 4MW8A 5F2VO 5IY5C 2EILB 1VARA 1BSMA 1TUBA 4X62B 2ZT9B 5KA6A 1JFFA 5LXTA 4NXNO 1AROP 3VQXA 1TGOA 1ORQC 2CGNA 2K1EA 4X1YA 3ABLB 3HKCA 1FFXA 1Q8IA 3AG2B 1WB8A 2WLJA 4AQYO 2M7WA 2ZNJA 3K57A 4CH5A 1M57B 2YS8A 3X2QC 4CS4A 2YC0A 4LF7O 2HKOA 3LNMB 2Z5UA 4TT3G 2YEVA 1H2KA 3W7SA 1VEWA 1V54B 1QNMA 1M93A 3AG3B 2KQXA 4UV9A 3J80N 3SJQC 1HP8A 1H2NA 2ADQB 4DR6O 1SKVA 1YTFD 4LH7A 5JJEB 1YJNV 3STZC 1OV9A 4LF9B 1AJNA 2UU9B 2WLKA 2CTQA 3TCUA 2DE0X 1GM8A 2AXTZ 2UXXA 1E1QG 5JCOA 4PJ0Z 3OTOB 3FKSG 1QR9A 1THZA 4GT1A 2CTRA 2QWNB 1NU1H 3UO3A 3MAQA 4O4LB 2OT5A 3LUTB 3ASOB 3L72H 5J9PC 2ARHA 5CA1B 1SQBH 1IXBA 5J2UA 2XAGA 1AI7A 3P32A 2BCCH 3W7WA 4FPPA 4W4KA 5JWPA 1OCCB 1FS0G 3SPHA 3C3TA 3CP1A 5IYCO 5CA0A 2WPDG 2P7TC 2LW7A 2BTQA 2QWQB 3JD1A 3JATB 3CCMV 1F7YA 4UVAA 1DLBA 5KX5A 3CCEV 4P9PA 3AEIA 5GW7A 3G67A 1LNQA 1GO3F 5H2FZ 1QLEB 3ZHTA 3OMAB 2WLLB 4JI1O 4HNAB 2R9AA 3KZIZ 4BIZA 1IZ3A 2UXCB 4GKJO 4JZGA 1SZXA 3BPZA 4MVOA 4DR5O 1OCOB 1U96A 4JAAA 4FLXA 4ZKIA 3I5DA 2E74B 3OR6C 2P4VA 3D3IA 3CRAA 3QO7A 5EYPA 4UCSA 4BAYA 3ABTA 1YXBA 4NXNB 2M6YA 4DUYO 2Q5ZA 1XL6A 1E1RG 3GWKC 4ASUG 2HFEC 3L75H 1U97A 4YJ3A 2CH7A 1Q3EA 1Q90D 2UXBO 1Y4MA 2WLNA 1KP2A 1M56B 1JA8A 4O2AA 4WFEA 4YHHO 3K9SA 3RYIA 5CBHA 2IM9A 4UB8Z 1BHBA 1X59A 4LF6O 3AK1A 3G80A 2QWRB 5EBWC 3JAWB 1NH2B 4IIJA 2QSAA 2LO1A 2IU3A 5A9GA 4DUZO 4LWSB 1W0KG 5IT9N 3T1HB 5LHHA 4NXMO 2DN9A 3EVKA 4JYBA 2EJRA 1TAEA 3ASNB 4DV0O 1BHAA
chains in the Genus database with same CATH topology
2OCCC 3JD0A 4R8CA 2OCCB 2ZXWC 2V7QG 3E83A 2ZXWB 4P2ZA 1ENVA 3E89A 2PI5A 5LGTA 2ZDIC 1K9MW 5HFLA 4G27B 4PDLA 2Q69A 3SYAA 1R3KC 3ZN0A 1NR1A 4KUMA 3MD0A 5H9CA 1Q82W 2QM7A 3CCLV 3ABKC 1E79G 2HG5C 4MVMA 3ABKB 2XASA 5EC2C 2JJ2G 4RUFA 1VQ7V 4JPRA 1NJIW 3K06A 3QO5A 2FTKA 3ETEA 3VOUA 3W7TA 3RW0A 3K0DA 4GX2A 4LC1A 1K3EA 3M99B 3CMEV 3CCSV 2IJHA 5KUKA 2X6CA 1QR8A 2NNUA 3LDCA 3OEEG 1M1KW 5L3CA 4WF9V 1K33A 3AG4C 4FJCC 4QNHB 4MVQA 2AHZA 3AG4B 1OHHG 4JAVA 2WWWA 1RM1C 3AG1C 1RM1B 2ZR2A 1DF4A 3AG1B 4LP8A 2QM8A 3FB7C 4P9OA 4GCZA 1VQ4V 2LFSA 3I56V 3G4SV 2WLIB 3CCRV 2JEUA 4X88A 2AHYA 5EK0A 3ZRWB 2F43G 1SETA 5B1AB 3QNEA 5KUMA 1GTOA 4CZZA 4HZ3A 1PNMA 4UVCA 3STLC 1MOFA 4JTAB 4H33A 2JDIG 1ROPA 4FK5C 4MTFA 5H6QA 2YEVB 2A0LA 3CXCU 4H37A 4BIUA 2DYRC 1VQLV 1P4RA 2DYRB 4MTGA 2X6AA 1YTFB 1CEZA 1S0VA 2GHYA 4E2LA 2QA4V 4I9WA 1L1FA 4CBCA 4DO2A 3LSSA 4PA3A 1S76D 5E1AC 3OMIB 1R3LC 3CYOA 1MG1A 2EIJC 1PNLA 2EIJB 3WG7C 1G8MA 3RBZA 2PI4A 2WLLA 1IXMA 2XAJA 2ZQMA 4PDRA 3HPLC 1KC8W 4MS2A 1CP9A 1EBOA 3OE7G 4QPJA 1DF5A 2DYSC 2HLDG 1TUEB 3AG2C 3OM3B 2DYSB 5LGUA 1YJWV 1R6NA 3K79A 4R6ZA 1KQSU 1JCHA 4ZBMA 4GX1A 1R6KA 2ITDC 3K08A 1NKDA 2HVKC 4MVZA 4UV8A 2Y69C 3E8GA 2Y69B 2HR3A 2JJ1G 1YITV 5HFMA 4MVUA 4OXSA 3KG2A 1MABG 1AI4A 1K4CC 1KD1W 2W0FC 5LHIA 5CN0A 3SYOA 3AG3C 1N8RW 5DN6G 4KP4A 4WFBV 3NXSA 4HYOA 3F7VC 1V55C 2IJIA 3PJSK 1XL4A 3CC4V 4XDKA 1S72V 2BOBC 1W0JG 2EINC 2Y48A 3BEHA 3OAAG 2XAHA 2EINB 3W7XA 3CC7V 2IW5A 1JQ0A 1VQ9V 1WPXA 2NLJC 3ZN1A 3W7UA 2B1IA 4LBEC 1H38A 4MTXA 2JEXA 1KECA 4X89A 4G28B 3TK1A 1KKDA 3B8MA 3UM7A 1AI6A 1GMGA 2OTJV 1QCEA 1AR1B 3K3WA 3ABMC 3E86A 3ZRXA 3ABMB 1YSCA 3ASOC 3OGCC 1RPRA 2IJJA 3JCZA 3RVZA 2H8PC 4WFAV 3R65A 2QTOA 3OUFA 2IU0A 2Q67A 5IYDO 2EIMC 2X7RB 1Q86W 2B5UA 4U7NA 2EIMB 1VQOV 3I55V 1AI5A 2Q6AA 1F4NA 3E8BA 1NBMG 4YXWG 1K5QA 3E8HA 4I5SA 4RUEA 3ZRVA 3QO8A 4JTDB 5B1BC 5IDJA 1NH2D 4WFGA 3E8FA 4PELA 5B1BB 5CBFA 4HAMA 4RAIA 4Q20A 1GK9A 1KP3A 3OMNB 1GM9A 1JOYA 1FXKA 5DM6V 4KFMA 2R9RB 1H8EG 3SPIA 4FIPC 4WFHA 2KB1A 2JK5C 4J9ZB 2EZOA 1YI2V 1DTOA 2YSUB 2IH3C 3IFXA 2WAMA 5BZBA 2EZPA 1NVPB 1R73A 4L87A 4PA9A 4Z1MG 3OR7C 1VQMV 1PL0A 1BMFG 3EFFK 3T4DA 3E35A 2LP7A 1I5YA 4FMTA 1QLEC 4MT8A 4U7OA 3CPWU 4R50A 3ML0A 3JYCA 3BY6A 4RQFA 5KA5A 1FXVA 3GWOA 1VQNV 1YJ9V 3SPJA 1VQ5V 3DTUB 2X0LA 4X8AA 1F23A 1SESA 3LDEA 4PA7A 5CBGA 4JASA 4UXNA 4UVBA 5LGNA 1YIJV 1W2BU 2EILC 3SYCA 2Q68A 4MW8A 5IY5C 2EILB 3FB5C 4QE9A 3CD6V 5IY5B 4UUJC 5LBQA 1QBZA 2QE7G 4PDVA 3E2EA 5KA6A 1PNKA 3WG7B 1AROP 3FYIB 5L3BA 3ZMVA 4TWKA 1ORQC 1SZTA 5L3FA 3ABLC 2K1EA 3VBBA 2DW4A 3ABLB 2XNDG 1WLEA 1VQ8V 3AG2B 1JX9A 2WLJA 3OW2U 1I5XA 5FL7G 2WLIA 3CCVV 5L3EA 2P67A 2XAFA 3OFNG 3ZRWA 4N21A 1M57C 2M7WA 2QKSA 1M57B 1S5HC 3X2QC 1JJ2U 2WLHA 2IH1C 2CK3G 4GX0A 5B3SC 2W6IG 4MTOA 1K34A 2HKOA 2DQ0A 3LNMB 2Z5UA 4TT3G 2YEVA 1V54C 3W7SA 1V54B 2DQ3A 1Q7YW 1M56C 1J95A 1K92A 2P90A 4JYCA 3AG3B 3K03A 3RVYA 1K7DA 4UV9A 3SJQC 3CC2V 3MHHC 5EBMC 3SYPA 1V55B 4BW5A 3WFVA 5EC1C 1YTFD 4RO2A 1YJNV 1K5SA 3STZC 2BOCC 4PA6A 3OUSA 3HB3B 1AJNA 2WLKA 1PD3A 4P30A 3ZIAG 2WLMA 4XDLA 3ZCCA 1HWYA 1JVMA 3T1CA 3TCUA 1GM8A 2UXXA 1E1QG 3IC7A 3ABUA 1K4DC 1OCRC 3FKSG 2V1DA 1QR9A 1R3JC 1THZA 4GT1A 3FYEB 3K04A 4JF3A 1FXKC 5H6RA 1FXKB 1M90W 2OT5A 4RQEA 1EFRG 3LUTB 3ASOB 2C2AA 5J9PC 2D3OW 1COWG 3FB6C 3FB8C 5IYBO 4JGSA 2XAGA 2EBOA 1AI7A 3P32A 1PKXA 1OCCC 3W7WA 2EIKC 2JIZG 4FPPA 1OCCB 3ZMSA 3ZMUA 5LHGA 1VQ6V 2EIKB 1FS0G 3SPHA 2HVJC 2MK3A 3CP1A 5IYCO 4QIWF 2Z3YA 1H2GA 4G2KA 2WPDG 3F5WC 2LFRA 1P7BA 1YHQV 4JTCB 2P7TC 1K8AW 3D36A 1M9NA 2HJFC 3JD1A 5CA3A 1K97A 2GSMB 1OZ0A 3OEHG 1FFTB 4F4LA 4J9YB 5C93A 3CCMV 4MSWC 1BL8A 4UVAA 1DLBA 3G71V 1SERA 2ZDIA 3LDDA 3CCEV 2ZR3A 4WFFA 4P9PA 3AEIA 5GW7A 5CMUA 1LNQA 3T4ZA 3DGEA 1GO3F 1QLEB 3OMAB 2WLLB 3ZMTA 2DWDC 4QPKA 4LCUC 5B1OA 1MSWD 1B6QA 1RPOA 4EKWA 1JPXA 4BIZA 4MW3A 1EZJA 1CPYA 3K0GA 3JD3A 4MVOA 5B1AC 1NR7A 1OCOC 4XDJA 1VQKV 1OCOB 1FXHA 1S3JA 3ETDA 3H01A 3ZRSA 1GKFA 1QLNA 2P6JA 1GM7A 4ZKIA 3MHSC 1G4YB 3OR6C 3D3IA 3QO7A 3UKMA 1H8HG 4BAYA 2W6JG 1VQPV 4QE7A 3ABTA 4QJFB 3CCJV 1S77D 5B1NA 1XL6A 1E1RG 1Y66A 3F7YC 4MVSA 4ASUG 2HFEC 2UXNA 3JD2A 1F4MA 4R7CA 4PA4A 5EBLC 3X2QB 2OTLV 3GB7C 3EHBB 4JAUA 2A79B 1NVPD 2ZD9A 5B3SB 3JD4A 1AJPA 3CMAV 5L3GA 1F51A 2B1GA 2R9IA 1Y4MA 2WLNA 1KP2A 2A9HA 1M56B 3P30A 3SPCA 1AJQA 4WFEA 3K9AA 2XOKG 3IGAC 5CBHA 3TETA 3CCUV 3G6EV 1QVFU 3B8NA 2X6BA 4XBFA 1BHBA 2ATKC 1K73W 2WSSG 4WCEV 3SPGA 5EBWC 4N23A 3CCQV 3ZJZA 1NH2B 1QVGU 2H94A 3SYQA 2IU3A 4MVRA 3T2MA 3B77A 1NQTA 4PDMA 3A0RA 5L3DA 1W0KG 2IJKA 5LHHA 1SRYA 2DWEC 2ITCC 2XAQA 2EJRA 4GX5A 4JYBA 2QEXV 1OCZC 4DXWA 1OCRB 1UJWB 3ASNC 1OCZB 1ZWIC 3ETGA 3LSQA 1Q81W 3ASNB 4TSFG 1BHAA 3ZMZA 1R3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 V;  1W2B U;  4WFA V;  3G4S V;  2D3O W;  3CCR V;  1YJN V;  1K73 W;  1NJI W;  1VQ9 V;  3CD6 V;  4WCE V;  1JJ2 U;  3CCM V;  1YIT V;  1VQK V;  1R73 A;  3CCQ V;  1VQO V;  3G71 V;  3I55 V;  3CME V;  3CCS V;  2OTL V;  1VQM V;  3CCE V;  1QVG U;  1M1K W;  1KD1 W;  4WF9 V;  1Q86 W;  1KC8 W;  1K9M W;  1VQ6 V;  3CPW U;  3CMA V;  1Q7Y W;  1N8R W;  2OTJ V;  3CXC U;  4WFB V;  1VQL V;  2QEX V;  1YJW V;  1VQ8 V;  5DM6 V;  1YHQ V;  1VQP V;  1Q82 W;  3OW2 U;  1VQN V;  1YJ9 V;  1KQS U;  3CC2 V;  3CC4 V;  1S72 V;  1Q81 W;  1VQ5 V;  3CCJ V;  3CCL V;  3CCV V;  1K8A W;  2QA4 V;  3CCU V;  1M90 W;  1VQ4 V;  3G6E V;  1QVF U;  3I56 V;  3CC7 V;  1YIJ V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 1A32 A;  2Y4T A;  4FLZ A;  1AP6 A;  4TUY B;  3CWB H;  5HFL A;  3NR7 A;  3SYA A;  1R3K C;  4KUM A;  3FFQ A;  2QM7 A;  3CCL V;  2UXD B;  1E79 G;  4MVM A;  3AG7 A;  4EEQ A;  4RUF A;  2LGQ A;  4PV1 B;  4O2B A;  2FTK A;  4O4I A;  5KUK A;  1MA1 A;  3OEE G;  4LF5 B;  1M1K W;  5BY1 A;  1TUB B;  4FJC C;  4Q6G A;  3AG4 B;  1JFF B;  1OHH G;  5LXT B;  5C8Y A;  1IBK O;  1RSO A;  5CB4 A;  3AG1 B;  1DF4 A;  4P9O A;  4LNU A;  4X1Y B;  3HKC B;  1VQ4 V;  2XT9 A;  1SQP H;  2ZM6 O;  4U3J A;  5B1A B;  5LMU O;  5KUM A;  4LF8 O;  1PNM A;  5JJN B;  3STL C;  5EZY A;  2YIC A;  3ICX A;  3JAM N;  4WBN A;  4FLU A;  4H33 A;  2JDI G;  3CXC U;  2YEV B;  1P4R A;  2DYR B;  4TV9 A;  2Y4U A;  4MTG A;  4GYC B;  5IYZ A;  4E2L A;  4I9W A;  1L1F A;  4DR7 O;  1S76 D;  3OMI B;  3CYO A;  3PN1 A;  4ABM A;  2N04 A;  2EIJ B;  1MZF A;  4GKK O;  2XAJ A;  2QJ1 A;  4TOI A;  4JI8 B;  1EBO A;  1TUE B;  3AG2 C;  3VQW A;  4TQF A;  1URF A;  2DYS B;  5LGU A;  4DV1 B;  1R6N A;  4R6Z A;  1JCH A;  1YVW A;  2ITD C;  4YY3 O;  2Y69 C;  2HR3 A;  5KHJ A;  1YIT V;  1HNZ B;  4MVU A;  4JI3 O;  4JI4 B;  5LHI A;  5J2U B;  4Z2W A;  3AG3 C;  4B7K A;  3CS5 A;  4WFB V;  4HYO A;  3OTF A;  3PJS K;  1UFI A;  5CA0 B;  3CC4 V;  2JGD B;  1XNQ O;  3CRC A;  3OAA G;  2XAH A;  4DUZ B;  2HHH O;  2ZE5 A;  1BE3 H;  3SJB C;  2NLJ C;  2BTQ B;  4LF4 B;  3B40 A;  4LBE C;  3RN4 A;  4IYH A;  4IL6 Z;  2JEX A;  2DMX A;  5KX5 B;  3S3W A;  1Q6H A;  1J5E B;  2OTJ V;  3HR0 A;  4NVP A;  1QCE A;  4X64 O;  1AR1 B;  4TV8 A;  1N32 B;  3ABM B;  3ASO C;  1Y74 A;  3CB2 A;  2H8P C;  5KHH A;  2QTO A;  2EIM C;  2X7R B;  1VQO V;  2GBO A;  2RCV A;  1Z5W A;  1F4N A;  2JS5 A;  4YXW G;  1Q86 W;  3ZED A;  5B1B C;  3CRM A;  5H5N A;  2FYU H;  3UO2 A;  1SA0 A;  4Q20 A;  1GK9 A;  1KP3 A;  4B7E A;  5DM6 V;  3BCC H;  5CA1 A;  3Q4H A;  4DR2 B;  4FM0 A;  2QTS A;  2EZO A;  2YSU B;  2WAM A;  5BZB A;  3J81 N;  2EZP A;  5FLX N;  3OR7 C;  1BMF G;  4I0X A;  3T4D A;  3E35 A;  3FAV B;  3VQY A;  1QLE C;  4MT8 A;  4JI2 B;  4YJ3 B;  2PF4 E;  2YXL A;  2CH7 B;  4JI0 B;  4RQF A;  5KA5 A;  2YUA A;  4DV7 O;  4JAS A;  4O2A B;  3RYI B;  3SYC A;  5IWA O;  4JI6 O;  5IE9 A;  4TQD A;  5LBQ A;  1QBZ A;  2QE7 G;  3SGI A;  2RQ6 A;  2Q9L A;  1IBM O;  3WB2 A;  3L74 H;  4DV5 B;  4TWK A;  3T1Y O;  1B06 A;  2JRI A;  4BIO A;  1VQ8 V;  4HNA A;  1JX9 A;  5FL7 G;  4EFE A;  3CCV V;  2GUZ A;  3ZRW A;  4DV3 B;  2QKS A;  2WLH A;  1P84 F;  2CK3 G;  4GX0 A;  2W6I G;  2L6L A;  1XMO O;  2DQ0 A;  3H1K H;  1ZAU A;  4CS2 A;  4PI2 A;  4PI0 A;  1XIL A;  1Q7Y W;  1M56 C;  2UUB B;  1XDC A;  2P90 A;  3RVY A;  4JYY A;  1XI1 A;  3SYP A;  1GN6 A;  5EC1 C;  4FLY A;  4FZ0 A;  4GUN A;  2K9P A;  1PD3 A;  4F6R A;  4XDL A;  1HWY A;  1JVM A;  1BCC H;  1VMG A;  3OGI B;  4O4I B;  1IVS A;  2GV9 A;  3IC7 A;  3ABU A;  1K4D C;  2VQF B;  3APQ A;  2V1D A;  1R3J C;  1YCI A;  3FYE B;  3WB0 A;  4JF3 A;  1XMQ B;  3S3X A;  2E5L O;  1RSO B;  5CB4 B;  1FXK B;  2CTP A;  2UUA O;  4DRX A;  2C2A A;  1IBL O;  3JAW A;  4LNU B;  4C7U A;  4PD4 F;  2D3O W;  4YJ2 A;  3J7A U;  1H2M A;  5IYB O;  2ZE7 A;  4JGS A;  3JCU Z;  1XRE A;  3BRC A;  3KKY A;  4U3J B;  2EIK B;  2GTS A;  3RGB A;  3CJH A;  3FX7 A;  5EZY B;  1P7B A;  1YHQ V;  4JTC B;  4WBN B;  3D36 A;  1M9N A;  2HJF C;  4DV4 B;  4TV9 B;  5CA3 A;  2KG7 B;  1OZ0 A;  5IYZ B;  1ZSP A;  2Q0A A;  1VIB A;  2ZDI A;  2Y0I A;  3JSL A;  2P5O A;  3DGE A;  5DEC A;  5A2Q N;  2A7W A;  1MSW D;  4EKW A;  1JPX A;  1EZJ A;  1Y67 A;  1CPY A;  4UCT A;  2PY5 A;  1PPJ H;  5B1A C;  1SC5 B;  1L0L H;  1VQK V;  1O9G A;  1S3J A;  3CX5 F;  3ZRS A;  1GKF A;  2ZNI A;  1GM7 A;  3MHS C;  1G4Y B;  4JYA B;  3M7M X;  5D5P A;  3UKM A;  2W6J G;  4DR1 B;  4QJF B;  5E79 Z;  2UUC O;  4DR4 B;  4AIL C;  2Q8V A;  3F7Y C;  1LR1 A;  3SDL A;  3JD2 A;  1F4M A;  4R7C A;  5LP6 C;  2OTL V;  1SS3 A;  1Q6I A;  3EHB B;  2Q0O C;  3GB7 C;  2A79 B;  4JAU A;  1NVP D;  2ZD9 A;  1JJO A;  3JD4 A;  5K1P A;  3JAL A;  4I4T A;  3CMA V;  1DK1 A;  2B1G A;  2A9H A;  3SPC A;  3K9A A;  3BFR A;  3IGA C;  4TV8 B;  5LMN O;  2CDY A;  1Y74 B;  4WCE V;  1ZUQ A;  4N23 A;  3N2K A;  1PV0 A;  2LQT A;  2BTO A;  4J7J A;  4PDM A;  1FJG O;  1WB7 A;  2QEX V;  2XAQ A;  1OCZ C;  4DXW A;  1OCR B;  1UJW B;  2AZ0 A;  4K0K O;  4JI7 O;  1SA0 B;  1N0J A;  5BR8 B;  1ZTE A;  3ZMZ A;  1R3I C;  2OCC B;  1SQF A;  3Q4H B;  3E83 A;  1HNX O;  2ZXW B;  2PI5 A;  1CXZ B;  4B3R O;  1K9M W;  2JVD A;  4B3T O;  1WNS A;  2Q69 A;  4I0X B;  4JV5 B;  2JGD A;  3DSQ A;  1NI8 A;  3MD0 A;  1Q82 W;  2ZKO A;  3ABK C;  1US6 A;  2HG5 C;  4X20 B;  2NR5 A;  1DGS A;  3W7T A;  3ETE A;  3UCS C;  3CCS V;  1N33 O;  1TVK A;  5L3C A;  4OX9 B;  4CH4 A;  4MVQ A;  1N34 O;  1YDX A;  1QU7 A;  5FPR A;  4X66 O;  1RM1 B;  2PYJ A;  2QM8 A;  5AG2 A;  2LFS A;  4O4H B;  4NTW A;  3G4S V;  3UT5 A;  2GUZ B;  4DR3 B;  3ZRW B;  5JH7 B;  3QNE A;  1HR0 B;  3ETQ A;  2EUL A;  4UVC A;  2FB5 A;  3R66 A;  2VQE O;  4FK5 C;  4MTF A;  5H6Q A;  4DV2 O;  4BIU A;  4J41 A;  1BGY H;  1CEZ A;  1S0V A;  2QA4 V;  4CBC A;  4DO2 A;  2RMK B;  4PA3 A;  1XNR O;  1R3L C;  1MG1 A;  1PNL A;  3FAV A;  5JVD B;  1FPO A;  1KKC A;  4LFC O;  2PI4 A;  4AQY B;  4MS2 A;  4LFA O;  4F6R B;  2YXY A;  2CTW A;  2F1M A;  2HLD G;  3OM3 B;  4LR3 A;  1ZX3 A;  3ZHS A;  2CGO A;  3TGU H;  4B3M O;  4LF7 B;  2A3Q A;  1NKD A;  4ZHQ B;  5LOV A;  4DRX B;  5LL6 Y;  4YJ2 B;  3KG2 A;  1JMK C;  1K4C C;  4DR6 B;  1WAZ A;  4FVM A;  1GRJ A;  3CJH B;  2PTM A;  1XL4 A;  3B4S A;  4XDK A;  2Y48 A;  2EIN C;  4OPA A;  4LH6 A;  3W7X A;  3CC7 V;  2IW5 A;  1JQ0 A;  2B9Z A;  1HNW O;  1WP7 A;  2Q7G A;  3THO A;  2YIA A;  3JSN A;  4JI7 B;  2PGG A;  4X89 A;  3TK1 A;  1I08 A;  2ADP A;  4JI5 O;  5TIS Z;  3E86 A;  4UCV A;  1YSC A;  2AGA A;  3OGC C;  2Q7E A;  1FKA O;  3JCZ A;  5KAI Z;  2Z0A A;  2IU0 A;  2AZ2 A;  4U7N A;  4UCR A;  1EN5 A;  1YF2 A;  2Q6A A;  1K5Q A;  3ZRV A;  3L71 H;  5IJ9 A;  1NH2 D;  1GN3 A;  2RJZ A;  3E8F A;  5CBF A;  3OMN B;  1GM9 A;  1FXK A;  4KFM A;  2R9R B;  1H8E G;  5FPO A;  1XOU A;  1VF7 A;  4DK0 A;  1AB3 A;  5D5Q A;  1XBL A;  1DTO A;  3K5L A;  1R73 A;  3H1I H;  3JAR A;  4L87 A;  2YIB D;  4Z1M G;  3TJT A;  1VQM V;  4JI1 B;  2LP7 A;  4FMT A;  4U7O A;  4GKJ B;  3JAL B;  4I4T B;  4UFZ A;  1VQN V;  2P4K A;  4DR5 B;  2KG7 A;  4X8A A;  2X0L A;  1F23 A;  3LDE A;  4DV6 O;  4UVB A;  1YIJ V;  2EIL C;  1L0N H;  3FB5 C;  4QE9 A;  5IY5 B;  4UUJ C;  2F66 C;  3E2E A;  4IT5 A;  1L8D A;  3WG7 B;  2DOS A;  5L3B A;  3ZMV A;  3N2K B;  4DUY B;  1FD9 A;  2P22 C;  1SZT A;  4LFB O;  1BQ0 A;  3ABL C;  3VBB A;  3BVO A;  2DW4 A;  4J42 A;  1AP5 A;  3OW2 U;  4KHP O;  1TA8 A;  1XQ8 A;  2WLI A;  1LUW A;  4N21 A;  1M57 C;  1V9P A;  5GTH Z;  2N05 A;  1S5H C;  4FFB A;  1JJ2 U;  4ICG A;  2UXB B;  1I0H A;  1N36 O;  2NN4 A;  1K34 A;  3U10 A;  4YHH B;  1V54 C;  2WA4 A;  2DQ3 A;  1NTZ H;  2QKA A;  4LF6 B;  2PYL A;  4JYC A;  1K7D A;  1KU9 A;  3CXH F;  3LNN A;  3CC2 V;  3H1H H;  3MHH C;  5EBM C;  1V55 B;  4RO2 A;  3KCY A;  4CC6 A;  4D7S A;  1K5S A;  2E76 B;  2BOC C;  4PA6 A;  3HB3 B;  2E3C A;  4NXM B;  1FAF A;  4P30 A;  3ZIA G;  2WLM A;  3ZCC A;  2CE4 A;  3T1C A;  2Q4P A;  1M5I A;  4DV0 B;  1TVK B;  1UPG A;  1OCR C;  3K04 A;  3EXA A;  1S5L Z;  5H6R A;  3D3Q A;  3P3N A;  1M90 W;  1VF6 A;  1NS1 A;  3H9V A;  3UT5 B;  1IX9 A;  4K8X A;  1OCC C;  3O9O A;  5IJ0 A;  2JIZ G;  3ZMS A;  2F4V O;  3K5N A;  2DJV A;  2MK3 A;  5JJJ B;  2EX3 A;  2Z3Y A;  4G2K A;  1KBH A;  3F5W C;  2LFR A;  1BQZ A;  4CH6 A;  2GSM B;  4L8J A;  2YDE A;  3ZHU A;  4J9Y B;  4MSW C;  4K35 A;  1IBK B;  3OD4 A;  2ZR3 A;  4WFF A;  1I94 O;  5CMU A;  4X65 O;  3T4Z A;  1SQX H;  4F6E A;  1KMI Z;  3ZMT A;  2DWD C;  4QPK A;  2ZM6 B;  1Y76 A;  4X20 A;  4B3S O;  4LCU C;  5B1O A;  5LMU B;  1RPO A;  4MW3 A;  4LF8 B;  4J11 A;  1EM1 A;  2JS3 A;  1G6U A;  2QR4 A;  3K0G A;  1R1B A;  1IDS A;  1OCO C;  3BAB A;  1FXH A;  3H01 A;  3RT3 C;  1QLN A;  1Z5V A;  4EB6 A;  5LOV B;  3ZX6 A;  1WN7 A;  4DR7 B;  4ZI7 A;  4X62 O;  3C3S A;  4HBN A;  1VQP V;  4QE7 A;  3JAK A;  4O4H A;  4GKK B;  2ZIN A;  1S77 D;  5B1N A;  2XTA A;  5JH7 A;  1Y66 A;  2ZE6 A;  2UXN A;  5EBL C;  3CE2 A;  5B3S B;  2N74 A;  1AJP A;  5L3G A;  1F51 A;  4YY3 B;  1AJQ A;  4YIO A;  2XOK G;  3TET A;  4H44 B;  3CCU V;  1PM9 A;  4JI3 B;  2ATK C;  3L70 H;  5JVD A;  1K73 W;  3UQ8 A;  2ZE8 A;  3ZJZ A;  1QVG U;  3N27 A;  2ETN A;  3SYQ A;  1XNQ B;  4MVR A;  3B77 A;  4LF9 O;  3A0R A;  1SRY A;  5IJ9 B;  2DWE C;  2ITC C;  2HHH B;  4GX5 A;  2VS0 A;  3ASN C;  3ETG A;  1PP9 H;  3LSQ A;  4ZHQ A;  4TSF G;  3G6B A;  3JD0 A;  4H13 B;  1WJZ A;  5B5E Z;  3DC5 A;  1I7F A;  2AW9 A;  2R72 A;  4X64 B;  1NTM H;  1NTK H;  2ZDI C;  3CRR A;  3JAR B;  1MMM A;  1Q6U A;  4G27 B;  5FNV A;  3ZN0 A;  1NR1 A;  2YI8 A;  4KL1 A;  1GN4 A;  2JJ2 G;  1G1X B;  3BA9 A;  2MW2 B;  3QO5 A;  4IGG A;  3VOU A;  3RW0 A;  3K0D A;  4FZ1 A;  4GX2 A;  1K3E A;  1N4C A;  2X6C A;  1X4T A;  4NTY A;  2NNU A;  3LDC A;  4WF9 V;  4BWA A;  3AG4 C;  4QNH B;  2AHZ A;  4JAV A;  3AG1 C;  3BA8 A;  1VF5 B;  1P7G A;  2YIB A;  1XHZ A;  1EZV H;  3L73 H;  2VRZ A;  3RYH A;  4X65 B;  1SQQ H;  4I9Q A;  2WLI B;  2JEU A;  2AHY A;  2IBZ H;  2A06 H;  1WA8 A;  4FFB B;  2QGN A;  2UXC O;  5GTI Z;  1QQC A;  4DV7 B;  4JTA B;  2O57 A;  2YXH A;  1ROP A;  1Z2G A;  3ZHQ A;  4H37 A;  2DYR C;  4JI6 B;  5IWA B;  2PZS A;  4J7Z A;  1YTF B;  2X6A A;  4PHZ A;  3LSS A;  1IBM B;  4DW1 A;  3T1Y B;  2EIJ C;  2ILM A;  3IC9 A;  3WG7 C;  2R70 A;  3RBZ A;  2FML A;  1IXM A;  1SF9 A;  2ZQM A;  1CP9 A;  3OE7 G;  1DF5 A;  4X1I A;  2DYS C;  3RFR A;  3N2G A;  1N0N A;  5JCO C;  1YJW V;  3K79 A;  1KQS U;  5J2T A;  4GX1 A;  4BW9 A;  1R6K A;  1XMO B;  4MVZ A;  5EIB C;  2Y69 B;  2JJ1 G;  5HFM A;  4OXS A;  3AK2 A;  3SYO A;  5IJ0 B;  2EJ7 A;  2RNB A;  2H3O A;  3F7V C;  1V55 C;  4Z1V A;  4AHC A;  5ITZ A;  4UB6 Z;  3M8A A;  2BOB C;  3TXS A;  1AIL A;  3T1H O;  4NR1 A;  5LP6 A;  1WPX A;  3ZN1 A;  1B3Q A;  3A2F A;  2B1I A;  3W7U A;  4MTX A;  4NB5 A;  1KEC A;  3WU2 Z;  4FM1 A;  4G28 B;  1KKD A;  2E5L B;  2Q7H A;  1HW7 A;  2UUA B;  4A5U B;  1IBL B;  4D6T H;  2ZCE A;  3ABM C;  2QWO B;  3ZRX A;  3VQV A;  3A0B Z;  1GH6 A;  4QGP A;  2QWP B;  1Y76 B;  4U3F H;  4WFA V;  3R65 A;  4I50 A;  3OUF A;  2Q67 A;  3BAA A;  2EIM B;  3U11 A;  1QHT A;  2UXD O;  1AI5 A;  3E8B A;  4UCU A;  5KHK A;  1NBM G;  4I7Z B;  3E8H A;  4I5S A;  3K5M A;  3LSU A;  3QO8 A;  4WFG A;  5B1B B;  4J7K A;  4EB6 B;  4HAM A;  1AR5 A;  1JOY A;  4OGQ B;  3RWR D;  4LF5 O;  4ZI7 B;  3BHP A;  3SPI A;  4FIP C;  3JAK B;  2JK5 C;  4J9Z B;  1BT8 A;  3WB1 A;  1MZE A;  5LA6 A;  3IFX A;  1XEQ A;  3DXR A;  1ZL8 A;  4PA9 A;  3CEI A;  2OIE A;  1PL0 A;  5BXZ A;  3K58 A;  3QF7 A;  4BR6 A;  3BY6 A;  2QDO A;  1FXV A;  3TXQ A;  3GWO A;  3OT7 A;  3SPJ A;  2OYQ A;  1VQ5 V;  1NT2 B;  3DTU B;  1SES A;  1W59 A;  5CBG A;  4UXN A;  5LGN A;  2LW1 A;  2ZIM A;  3CD6 V;  4X1K B;  4NTX A;  1VP7 A;  2ZIO A;  4PDV A;  1PNK A;  1SQV H;  1WPB A;  4FFK A;  3FYI B;  2CAZ C;  2UUC B;  1Q43 A;  3HKD A;  1KB9 F;  5L3F A;  4X9Q A;  2XND G;  1WLE A;  1I5X A;  2V4D A;  5L3E A;  4JI8 O;  1MSD A;  2P67 A;  2XAF A;  3CSX A;  3OFN G;  4NKG B;  4IYI A;  4FM2 A;  4DV1 O;  3K5O A;  3GVM A;  2F93 B;  2IH1 C;  3B2E E;  5B3S C;  2HP8 A;  2GTA A;  4MTO A;  1R6T A;  3AK3 A;  1HNZ O;  1J95 A;  1K92 A;  4ZIB A;  5KHG A;  3K03 A;  5FNV B;  5LMN B;  4JI4 O;  1OJH A;  4BW5 A;  3WFV A;  1AVM A;  3P3P A;  4NYK A;  2VWK A;  1FJG B;  3OUS A;  1D5A A;  4IHJ A;  4K0K B;  2FKX A;  4LF4 O;  4RWU A;  1HNX B;  1FXK C;  5JQG A;  3HKB A;  4RQE A;  1EFR G;  4W4L A;  1J5E O;  4B3R B;  4B3T B;  1COW G;  3FB6 C;  3FB8 C;  1N32 O;  3RYH B;  2EBO A;  1PKX A;  2EIK C;  5LHG A;  4AI8 A;  3ZMU A;  1VQ6 V;  1WA8 B;  5KMG A;  2HVJ C;  3QTC A;  3HKE A;  1GN2 A;  4QIW F;  2Q73 A;  2KKW A;  1H2G A;  2LJ2 A;  3SJA C;  1SQG A;  1K8A W;  3APO A;  1N33 B;  1RFY A;  1K97 A;  4GLX A;  3OEH G;  1FFT B;  1N34 B;  4F4L A;  5C93 A;  4X66 B;  1BL8 A;  3G71 V;  1SER A;  4I55 A;  3LDD A;  4DR2 O;  3MDS A;  4GZR B;  2F95 B;  2W0X A;  3CRQ A;  4X1I B;  4O4J A;  3SR2 C;  4JI2 O;  1B6Q A;  1FFX B;  3N2G B;  2VWJ A;  4JI0 O;  3QG5 A;  3JD3 A;  5J2T B;  1NR7 A;  2HJD A;  4XDJ A;  2VQE B;  2OIG A;  3ETD A;  4DV2 B;  2G38 A;  3D8C A;  2P6J A;  1FYJ A;  1D5N A;  4FLW A;  3E22 A;  1XHX A;  1IUR A;  1XNR B;  1H8H G;  2HEP A;  3CCJ V;  4DV5 O;  1S5J A;  4J10 A;  4LFC B;  3ZBH A;  4ZOL A;  5ITZ B;  3RYC A;  4LFA B;  4MVS A;  3IAY A;  3U0Z A;  5BMV A;  5LYJ A;  3X2Q B;  4PA4 A;  3C90 A;  5LP6 B;  3FD9 A;  4DV3 O;  1EN4 A;  4B3M B;  2R9I A;  3JAS A;  3RYF A;  2BSK A;  5GON A;  3P30 A;  3ZHV A;  2GDS A;  1ZLZ A;  3G6E V;  1QVF U;  3A0H Z;  2UUB O;  3B8N A;  2X6B A;  3KCX A;  4XBF A;  5K1X A;  1RP3 B;  2WSS G;  3SPG A;  4CS3 A;  1VF6 C;  4E4E A;  3CCQ V;  4I50 B;  3B09 A;  2OWO A;  2H94 A;  3T2M A;  1NQT A;  5L3D A;  1PL4 A;  4UCO A;  2IJK A;  1HNW B;  1OCZ B;  1ZWI C;  1Q81 W;  2RDC A;  1H2L A;  3H1L H;  1Y6X A;  1AR4 A;  2OCC C;  2VQF O;  3O65 A;  4R8C A;  2WA3 A;  1XMQ O;  2ZXW C;  2V7Q G;  4JI5 B;  3L9D A;  1YZB A;  4P2Z A;  1JR9 A;  5B66 Z;  1ENV A;  3E89 A;  5LA6 B;  5EIB D;  5LGT A;  2Y0P A;  3DXR B;  1ZL8 B;  4PDL A;  4JZ2 A;  4D7T A;  5H9C A;  4FLT A;  3CHX A;  3ZS8 C;  1KYO F;  3ABK B;  2XAS A;  5EC2 C;  1VQ7 V;  4JPR A;  1NJI W;  3K06 A;  4DW0 A;  4LC1 A;  3M99 B;  3CME V;  2IJH A;  1QR8 A;  1Q5O A;  4FLV A;  4KXR A;  4DV4 O;  1K33 A;  4EFB A;  1GAX A;  3H1J H;  3ZHR A;  2WWW A;  1RM1 C;  4O4L A;  2ZR2 A;  2BE3 A;  4LP8 A;  4H0L B;  3FB7 C;  3HKD B;  5KHI A;  4GCZ A;  1T5E A;  5EYP B;  1B04 A;  5DED A;  2OCH A;  2P06 A;  3I56 V;  3CCR V;  4X88 A;  1EN6 A;  1P49 A;  2PUS A;  5EK0 A;  2F43 G;  1SET A;  4J80 A;  1D2D A;  1GTO A;  4CZZ A;  4HZ3 A;  4CC5 A;  4DV6 B;  1MOF A;  3SJC C;  2ODM A;  1VQL V;  4DK1 A;  2A0L A;  2QKC A;  3JAT A;  3QVN A;  4JYA O;  2GHY A;  3IJ4 A;  2E75 B;  5E1A C;  4DR1 O;  4LFB B;  1G8M A;  4OPH A;  4DR4 O;  2WLL A;  4KHP B;  4PDR A;  3HPL C;  1KC8 W;  4IIJ B;  4IHJ B;  4QPJ A;  3K59 A;  1MNG A;  4ZBM A;  1N36 B;  2YI9 A;  3K08 A;  4X1K A;  2HVK C;  4UV8 A;  5JQG B;  2XUM A;  3E8G A;  3HKB B;  2D2C B;  1MAB G;  1AI4 A;  1KD1 W;  2W0F C;  3A8T A;  5CN0 A;  4B08 A;  1N8R W;  1M4U A;  4KP4 A;  5DN6 G;  3NXS A;  2UU9 O;  5KMG B;  2IJI A;  3HKE B;  2YID A;  1S72 V;  1W0J G;  3BEH A;  2QM4 A;  2EIN B;  2XHB A;  1VQ9 V;  3D36 C;  4DYL A;  3OTO O;  2KSD A;  3F5T A;  1H38 A;  4O2B B;  5BR8 O;  4I55 B;  4CH3 A;  2JGU A;  3B8M A;  3UM7 A;  1AI6 A;  1GMG A;  2L35 A;  5C8Y B;  3K3W A;  1RPR A;  2IJJ A;  1WP8 A;  4O4J B;  3RVZ A;  4JV5 O;  2F4V B;  5IYD O;  1H2S B;  2B5U A;  1XUQ A;  2FL4 A;  3I55 V;  4LWS A;  1LUV A;  5KLV H;  3DC6 A;  4RUE A;  4JTD B;  5IDJ A;  4PEL A;  5KAF Z;  2LGW A;  4RAI A;  1KUQ A;  4OX9 O;  3E22 B;  1BZK A;  4WFH A;  2KB1 A;  1I94 B;  1YI2 V;  4K8Z A;  2CUG A;  2IH3 C;  4TUY A;  4ZOL B;  1NVP B;  3RYC B;  3EFF K;  1I5Y A;  4B3S B;  5BMV B;  5LYJ B;  1HDJ A;  4DR3 O;  3CPW U;  4R50 A;  3ML0 A;  3JYC A;  1HR0 O;  4YIP A;  2F23 A;  1YJ9 V;  2RN9 A;  3JAS B;  3RYF B;  1NZ6 A;  1YEW A;  2BSK B;  4PA7 A;  5GON B;  1BS3 A;  1W2B U;  4K3A A;  2Q68 A;  1O9H A;  4MW8 A;  5F2V O;  5IY5 C;  2EIL B;  1VAR A;  1BSM A;  1TUB A;  4X62 B;  2ZT9 B;  5KA6 A;  1JFF A;  5LXT A;  4NXN O;  1ARO P;  3VQX A;  1TGO A;  1ORQ C;  2CGN A;  2K1E A;  4X1Y A;  3ABL B;  3HKC A;  1FFX A;  1Q8I A;  3AG2 B;  1WB8 A;  2WLJ A;  4AQY O;  2M7W A;  2ZNJ A;  3K57 A;  4CH5 A;  1M57 B;  2YS8 A;  3X2Q C;  4CS4 A;  2YC0 A;  4LF7 O;  2HKO A;  3LNM B;  2Z5U A;  4TT3 G;  2YEV A;  1H2K A;  3W7S A;  1VEW A;  1V54 B;  1QNM A;  1M93 A;  3AG3 B;  2KQX A;  4UV9 A;  3J80 N;  3SJQ C;  1HP8 A;  1H2N A;  2ADQ B;  4DR6 O;  1SKV A;  1YTF D;  4LH7 A;  5JJE B;  1YJN V;  3STZ C;  1OV9 A;  4LF9 B;  1AJN A;  2UU9 B;  2WLK A;  2CTQ A;  3TCU A;  2DE0 X;  1GM8 A;  2AXT Z;  2UXX A;  1E1Q G;  5JCO A;  4PJ0 Z;  3OTO B;  3FKS G;  1QR9 A;  1THZ A;  4GT1 A;  2CTR A;  2QWN B;  1NU1 H;  3UO3 A;  3MAQ A;  4O4L B;  2OT5 A;  3LUT B;  3ASO B;  3L72 H;  5J9P C;  2ARH A;  5CA1 B;  1SQB H;  1IXB A;  5J2U A;  2XAG A;  1AI7 A;  3P32 A;  2BCC H;  3W7W A;  4FPP A;  4W4K A;  5JWP A;  1OCC B;  1FS0 G;  3SPH A;  3C3T A;  3CP1 A;  5IYC O;  5CA0 A;  2WPD G;  2P7T C;  2LW7 A;  2BTQ A;  2QWQ B;  3JD1 A;  3JAT B;  3CCM V;  1F7Y A;  4UVA A;  1DLB A;  5KX5 A;  3CCE V;  4P9P A;  3AEI A;  5GW7 A;  3G67 A;  1LNQ A;  1GO3 F;  5H2F Z;  1QLE B;  3ZHT A;  3OMA B;  2WLL B;  4JI1 O;  4HNA B;  2R9A A;  3KZI Z;  4BIZ A;  1IZ3 A;  2UXC B;  4GKJ O;  4JZG A;  1SZX A;  3BPZ A;  4MVO A;  4DR5 O;  1OCO B;  1U96 A;  4JAA A;  4FLX A;  4ZKI A;  3I5D A;  2E74 B;  3OR6 C;  2P4V A;  3D3I A;  3CRA A;  3QO7 A;  5EYP A;  4UCS A;  4BAY A;  3ABT A;  1YXB A;  4NXN B;  2M6Y A;  4DUY O;  2Q5Z A;  1XL6 A;  1E1R G;  3GWK C;  4ASU G;  2HFE C;  3L75 H;  1U97 A;  4YJ3 A;  2CH7 A;  1Q3E A;  1Q90 D;  2UXB O;  1Y4M A;  2WLN A;  1KP2 A;  1M56 B;  1JA8 A;  4O2A A;  4WFE A;  4YHH O;  3K9S A;  3RYI A;  5CBH A;  2IM9 A;  4UB8 Z;  1BHB A;  1X59 A;  4LF6 O;  3AK1 A;  3G80 A;  2QWR B;  5EBW C;  3JAW B;  1NH2 B;  4IIJ A;  2QSA A;  2LO1 A;  2IU3 A;  5A9G A;  4DUZ O;  4LWS B;  1W0K G;  5IT9 N;  3T1H B;  5LHH A;  4NXM O;  2DN9 A;  3EVK A;  4JYB A;  2EJR A;  1TAE A;  3ASN B;  4DV0 O;  1BHA A; 
#chains in the Genus database with same CATH homology
 2OCC C;  3JD0 A;  4R8C A;  2OCC B;  2ZXW C;  2V7Q G;  3E83 A;  2ZXW B;  4P2Z A;  1ENV A;  3E89 A;  2PI5 A;  5LGT A;  2ZDI C;  1K9M W;  5HFL A;  4G27 B;  4PDL A;  2Q69 A;  3SYA A;  1R3K C;  3ZN0 A;  1NR1 A;  4KUM A;  3MD0 A;  5H9C A;  1Q82 W;  2QM7 A;  3CCL V;  3ABK C;  1E79 G;  2HG5 C;  4MVM A;  3ABK B;  2XAS A;  5EC2 C;  2JJ2 G;  4RUF A;  1VQ7 V;  4JPR A;  1NJI W;  3K06 A;  3QO5 A;  2FTK A;  3ETE A;  3VOU A;  3W7T A;  3RW0 A;  3K0D A;  4GX2 A;  4LC1 A;  1K3E A;  3M99 B;  3CME V;  3CCS V;  2IJH A;  5KUK A;  2X6C A;  1QR8 A;  2NNU A;  3LDC A;  3OEE G;  1M1K W;  5L3C A;  4WF9 V;  1K33 A;  3AG4 C;  4FJC C;  4QNH B;  4MVQ A;  2AHZ A;  3AG4 B;  1OHH G;  4JAV A;  2WWW A;  1RM1 C;  3AG1 C;  1RM1 B;  2ZR2 A;  1DF4 A;  3AG1 B;  4LP8 A;  2QM8 A;  3FB7 C;  4P9O A;  4GCZ A;  1VQ4 V;  2LFS A;  3I56 V;  3G4S V;  2WLI B;  3CCR V;  2JEU A;  4X88 A;  2AHY A;  5EK0 A;  3ZRW B;  2F43 G;  1SET A;  5B1A B;  3QNE A;  5KUM A;  1GTO A;  4CZZ A;  4HZ3 A;  1PNM A;  4UVC A;  3STL C;  1MOF A;  4JTA B;  4H33 A;  2JDI G;  1ROP A;  4FK5 C;  4MTF A;  5H6Q A;  2YEV B;  2A0L A;  3CXC U;  4H37 A;  4BIU A;  2DYR C;  1VQL V;  1P4R A;  2DYR B;  4MTG A;  2X6A A;  1YTF B;  1CEZ A;  1S0V A;  2GHY A;  4E2L A;  2QA4 V;  4I9W A;  1L1F A;  4CBC A;  4DO2 A;  3LSS A;  4PA3 A;  1S76 D;  5E1A C;  3OMI B;  1R3L C;  3CYO A;  1MG1 A;  2EIJ C;  1PNL A;  2EIJ B;  3WG7 C;  1G8M A;  3RBZ A;  2PI4 A;  2WLL A;  1IXM A;  2XAJ A;  2ZQM A;  4PDR A;  3HPL C;  1KC8 W;  4MS2 A;  1CP9 A;  1EBO A;  3OE7 G;  4QPJ A;  1DF5 A;  2DYS C;  2HLD G;  1TUE B;  3AG2 C;  3OM3 B;  2DYS B;  5LGU A;  1YJW V;  1R6N A;  3K79 A;  4R6Z A;  1KQS U;  1JCH A;  4ZBM A;  4GX1 A;  1R6K A;  2ITD C;  3K08 A;  1NKD A;  2HVK C;  4MVZ A;  4UV8 A;  2Y69 C;  3E8G A;  2Y69 B;  2HR3 A;  2JJ1 G;  1YIT V;  5HFM A;  4MVU A;  4OXS A;  3KG2 A;  1MAB G;  1AI4 A;  1K4C C;  1KD1 W;  2W0F C;  5LHI A;  5CN0 A;  3SYO A;  3AG3 C;  1N8R W;  5DN6 G;  4KP4 A;  4WFB V;  3NXS A;  4HYO A;  3F7V C;  1V55 C;  2IJI A;  3PJS K;  1XL4 A;  3CC4 V;  4XDK A;  1S72 V;  2BOB C;  1W0J G;  2EIN C;  2Y48 A;  3BEH A;  3OAA G;  2XAH A;  2EIN B;  3W7X A;  3CC7 V;  2IW5 A;  1JQ0 A;  1VQ9 V;  1WPX A;  2NLJ C;  3ZN1 A;  3W7U A;  2B1I A;  4LBE C;  1H38 A;  4MTX A;  2JEX A;  1KEC A;  4X89 A;  4G28 B;  3TK1 A;  1KKD A;  3B8M A;  3UM7 A;  1AI6 A;  1GMG A;  2OTJ V;  1QCE A;  1AR1 B;  3K3W A;  3ABM C;  3E86 A;  3ZRX A;  3ABM B;  1YSC A;  3ASO C;  3OGC C;  1RPR A;  2IJJ A;  3JCZ A;  3RVZ A;  2H8P C;  4WFA V;  3R65 A;  2QTO A;  3OUF A;  2IU0 A;  2Q67 A;  5IYD O;  2EIM C;  2X7R B;  1Q86 W;  2B5U A;  4U7N A;  2EIM B;  1VQO V;  3I55 V;  1AI5 A;  2Q6A A;  1F4N A;  3E8B A;  1NBM G;  4YXW G;  1K5Q A;  3E8H A;  4I5S A;  4RUE A;  3ZRV A;  3QO8 A;  4JTD B;  5B1B C;  5IDJ A;  1NH2 D;  4WFG A;  3E8F A;  4PEL A;  5B1B B;  5CBF A;  4HAM A;  4RAI A;  4Q20 A;  1GK9 A;  1KP3 A;  3OMN B;  1GM9 A;  1JOY A;  1FXK A;  5DM6 V;  4KFM A;  2R9R B;  1H8E G;  3SPI A;  4FIP C;  4WFH A;  2KB1 A;  2JK5 C;  4J9Z B;  2EZO A;  1YI2 V;  1DTO A;  2YSU B;  2IH3 C;  3IFX A;  2WAM A;  5BZB A;  2EZP A;  1NVP B;  1R73 A;  4L87 A;  4PA9 A;  4Z1M G;  3OR7 C;  1VQM V;  1PL0 A;  1BMF G;  3EFF K;  3T4D A;  3E35 A;  2LP7 A;  1I5Y A;  4FMT A;  1QLE C;  4MT8 A;  4U7O A;  3CPW U;  4R50 A;  3ML0 A;  3JYC A;  3BY6 A;  4RQF A;  5KA5 A;  1FXV A;  3GWO A;  1VQN V;  1YJ9 V;  3SPJ A;  1VQ5 V;  3DTU B;  2X0L A;  4X8A A;  1F23 A;  1SES A;  3LDE A;  4PA7 A;  5CBG A;  4JAS A;  4UXN A;  4UVB A;  5LGN A;  1YIJ V;  1W2B U;  2EIL C;  3SYC A;  2Q68 A;  4MW8 A;  5IY5 C;  2EIL B;  3FB5 C;  4QE9 A;  3CD6 V;  5IY5 B;  4UUJ C;  5LBQ A;  1QBZ A;  2QE7 G;  4PDV A;  3E2E A;  5KA6 A;  1PNK A;  3WG7 B;  1ARO P;  3FYI B;  5L3B A;  3ZMV A;  4TWK A;  1ORQ C;  1SZT A;  5L3F A;  3ABL C;  2K1E A;  3VBB A;  2DW4 A;  3ABL B;  2XND G;  1WLE A;  1VQ8 V;  3AG2 B;  1JX9 A;  2WLJ A;  3OW2 U;  1I5X A;  5FL7 G;  2WLI A;  3CCV V;  5L3E A;  2P67 A;  2XAF A;  3OFN G;  3ZRW A;  4N21 A;  1M57 C;  2M7W A;  2QKS A;  1M57 B;  1S5H C;  3X2Q C;  1JJ2 U;  2WLH A;  2IH1 C;  2CK3 G;  4GX0 A;  5B3S C;  2W6I G;  4MTO A;  1K34 A;  2HKO A;  2DQ0 A;  3LNM B;  2Z5U A;  4TT3 G;  2YEV A;  1V54 C;  3W7S A;  1V54 B;  2DQ3 A;  1Q7Y W;  1M56 C;  1J95 A;  1K92 A;  2P90 A;  4JYC A;  3AG3 B;  3K03 A;  3RVY A;  1K7D A;  4UV9 A;  3SJQ C;  3CC2 V;  3MHH C;  5EBM C;  3SYP A;  1V55 B;  4BW5 A;  3WFV A;  5EC1 C;  1YTF D;  4RO2 A;  1YJN V;  1K5S A;  3STZ C;  2BOC C;  4PA6 A;  3OUS A;  3HB3 B;  1AJN A;  2WLK A;  1PD3 A;  4P30 A;  3ZIA G;  2WLM A;  4XDL A;  3ZCC A;  1HWY A;  1JVM A;  3T1C A;  3TCU A;  1GM8 A;  2UXX A;  1E1Q G;  3IC7 A;  3ABU A;  1K4D C;  1OCR C;  3FKS G;  2V1D A;  1QR9 A;  1R3J C;  1THZ A;  4GT1 A;  3FYE B;  3K04 A;  4JF3 A;  1FXK C;  5H6R A;  1FXK B;  1M90 W;  2OT5 A;  4RQE A;  1EFR G;  3LUT B;  3ASO B;  2C2A A;  5J9P C;  2D3O W;  1COW G;  3FB6 C;  3FB8 C;  5IYB O;  4JGS A;  2XAG A;  2EBO A;  1AI7 A;  3P32 A;  1PKX A;  1OCC C;  3W7W A;  2EIK C;  2JIZ G;  4FPP A;  1OCC B;  3ZMS A;  3ZMU A;  5LHG A;  1VQ6 V;  2EIK B;  1FS0 G;  3SPH A;  2HVJ C;  2MK3 A;  3CP1 A;  5IYC O;  4QIW F;  2Z3Y A;  1H2G A;  4G2K A;  2WPD G;  3F5W C;  2LFR A;  1P7B A;  1YHQ V;  4JTC B;  2P7T C;  1K8A W;  3D36 A;  1M9N A;  2HJF C;  3JD1 A;  5CA3 A;  1K97 A;  2GSM B;  1OZ0 A;  3OEH G;  1FFT B;  4F4L A;  4J9Y B;  5C93 A;  3CCM V;  4MSW C;  1BL8 A;  4UVA A;  1DLB A;  3G71 V;  1SER A;  2ZDI A;  3LDD A;  3CCE V;  2ZR3 A;  4WFF A;  4P9P A;  3AEI A;  5GW7 A;  5CMU A;  1LNQ A;  3T4Z A;  3DGE A;  1GO3 F;  1QLE B;  3OMA B;  2WLL B;  3ZMT A;  2DWD C;  4QPK A;  4LCU C;  5B1O A;  1MSW D;  1B6Q A;  1RPO A;  4EKW A;  1JPX A;  4BIZ A;  4MW3 A;  1EZJ A;  1CPY A;  3K0G A;  3JD3 A;  4MVO A;  5B1A C;  1NR7 A;  1OCO C;  4XDJ A;  1VQK V;  1OCO B;  1FXH A;  1S3J A;  3ETD A;  3H01 A;  3ZRS A;  1GKF A;  1QLN A;  2P6J A;  1GM7 A;  4ZKI A;  3MHS C;  1G4Y B;  3OR6 C;  3D3I A;  3QO7 A;  3UKM A;  1H8H G;  4BAY A;  2W6J G;  1VQP V;  4QE7 A;  3ABT A;  4QJF B;  3CCJ V;  1S77 D;  5B1N A;  1XL6 A;  1E1R G;  1Y66 A;  3F7Y C;  4MVS A;  4ASU G;  2HFE C;  2UXN A;  3JD2 A;  1F4M A;  4R7C A;  4PA4 A;  5EBL C;  3X2Q B;  2OTL V;  3GB7 C;  3EHB B;  4JAU A;  2A79 B;  1NVP D;  2ZD9 A;  5B3S B;  3JD4 A;  1AJP A;  3CMA V;  5L3G A;  1F51 A;  2B1G A;  2R9I A;  1Y4M A;  2WLN A;  1KP2 A;  2A9H A;  1M56 B;  3P30 A;  3SPC A;  1AJQ A;  4WFE A;  3K9A A;  2XOK G;  3IGA C;  5CBH A;  3TET A;  3CCU V;  3G6E V;  1QVF U;  3B8N A;  2X6B A;  4XBF A;  1BHB A;  2ATK C;  1K73 W;  2WSS G;  4WCE V;  3SPG A;  5EBW C;  4N23 A;  3CCQ V;  3ZJZ A;  1NH2 B;  1QVG U;  2H94 A;  3SYQ A;  2IU3 A;  4MVR A;  3T2M A;  3B77 A;  1NQT A;  4PDM A;  3A0R A;  5L3D A;  1W0K G;  2IJK A;  5LHH A;  1SRY A;  2DWE C;  2ITC C;  2XAQ A;  2EJR A;  4GX5 A;  4JYB A;  2QEX V;  1OCZ C;  4DXW A;  1OCR B;  1UJW B;  3ASN C;  1OCZ B;  1ZWI C;  3ETG A;  3LSQ A;  1Q81 W;  3ASN B;  4TSF G;  1BHA A;  3ZMZ A;  1R3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...