5B1OA

Dhp domain structure of envz p248a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
AMAAGVKQLADDRTLLMAGVSHDLRTALTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Osmolarity sensor protein EnvZ
publication title Angucycline antibiotic waldiomycin recognizes common structural motif conserved in bacterial histidine kinases
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1oA00
5B1OA 3DGEA 1F51A 4JAUA 3ZRVA 4LC1A 3ZRXA 4KP4A 3NXSA 4Q20A 4JYBA 2FTKA 2WWWA 3A0RA 4U7OA 2LFSA 3ZRWB 2QM7A 1JOYA 3D36A 2P67A 4I5SA 2QM8A 4JAVA 3ZCCA 4MT8A 3ZRWA 4JYCA 4GT1A 2C2AA 1IXMA 4JASA 2LFRA 3TK1A 5IDJA 4GCZA 4MTXA 4BIUA 5B1NA 4QPJA 3MD0A 4U7NA 5C93A 4BIZA 4ZKIA 3P32A 4FMTA 4FPPA 4QPKA
chains in the Genus database with same CATH superfamily
2WSSG 3CXHF 3OT7A 3JAKA 4DR3B 3K59A 1X59A 3ABKB 3CCJV 5LGUA 1YF2A 4DO2A 2HVJC 3FKSG 3M99B 4NXNB 4ASUG 4L8JA 1D2DA 1LNQA 1N0JA 2UXXA 1ORQC 1R3KC 2UXDO 2WWWA 2BTQB 3ZIAG 4NB5A 5LBQA 2YIBA 2AXTZ 2IH1C 1MG1A 5B1BC 3N2KB 2KSDA 3K0GA 5H6RA 2V1DA 3OW2U 1RPOA 3VQWA 1AI5A 2ZNJA 1R3JC 2FL4A 1SF9A 1OCZC 4MVOA 1D5NA 4CH3A 4EFEA 3BEHA 2EIKB 4EKWA 1MA1A 4JZ2A 4TV8B 4WBNA 3W7SA 1QVFU 1AI7A 4I55A 3X2QB 1OCRB 4I9WA 4LFBO 1KQSU 1ZWIC 2XOKG 4I5SA 3SPCA 1WB8A 3VOUA 1PL4A 3MHHC 3AG1C 5KA5A 3G67A 5IWAB 3L9DA 3UQ8A 2XAQA 3AK1A 2X6BA 4DRXB 2ODMA 1GH6A 4UB6Z 4E4EA 1H2SB 4JI8O 2H94A 3CPWU 2E74B 1SZXA 4I4TA 3CP1A 4FIPC 4PDMA 5FL7G 4X20B 4X65B 1W0KG 4EB6B 3ZCCA 3L75H 2F66C 2DYSC 1YTFB 1JQ0A 5C8YA 5DN6G 5AG2A 5F2VO 2ZXWB 3OMAB 3OTFA 2JVDA 1HNXO 3D36C 2Q7GA 4XDJA 1M93A 3D8CA 5HFMA 4J7ZA 2ZIOA 4F6RB 4UB8Z 2OTJV 3JD1A 2V7QG 3P3PA 1V54B 3CEIA 4XDLA 3JATB 2H8PC 5B3SB 4MS2A 1R6NA 1IBLO 4B3TB 4RUEA 1WN7A 2PI4A 5CB4B 1R1BA 1ZUQA 5H6QA 1FD9A 2QM8A 1WPXA 4OPAA 4K8XA 1K73W 4X62O 3M8AA 1SRYA 2ETNA 2FB5A 2XASA 3B40A 3H1HH 2FMLA 1NVPD 2ZE6A 1KMIZ 1SA0A 1NR1A 4H44B 1O9GA 1PNMA 4DV2B 2PYJA 3OAAG 4JI4O 5TISZ 1FJGO 2NNUA 1E1RG 3JD3A 5JJNB 1GM9A 2VQFO 3BPZA 4LF5B 2DWEC 3ASOB 4DR5B 1NS1A 1YVWA 3OEHG 3OTOB 2R70A 3CSXA 3CCUV 2Q69A 4FK5C 1M4UA 4AI8A 3E2EA 2PY5A 3OGIB 3W7WA 2RMKB 3H1KH 2A0LA 3ZHRA 2LJ2A 3K5OA 5LHHA 3K58A 2F93B 4A5UB 4JF3A 1MZFA 1GTOA 3GB7C 1EN4A 3H1JH 4TUYA 4CS2A 3SPJA 3JSLA 1IBMB 1K5QA 3PJSK 4OX9B 1QNMA 3SJQC 3ABLB 4KP4A 4PI2A 4P9OA 4MVSA 5EIBC 3SPHA 3ZHQA 1OHHG 3B8NA 2RNBA 4RQFA 4N23A 2ZIMA 1H2KA 4KFMA 4B3RB 1DF5A 4PDLA 1OZ0A 4PDVA 2Q7EA 4DR3O 2VWKA 4WBNB 3IC7A 1DK1A 4AHCA 2EIJC 2GUZA 3U10A 4GUNA 1M57B 3ABMB 1HW7A 3FD9A 4YIPA 4X8AA 3AG2B 3SPGA 2HJDA 2F4VB 2OIGA 2QJ1A 2MK3A 1RM1C 1BE3H 5LP6A 4NXNO 3RYHA 1THZA 3QNEA 4YY3B 2JDIG 4LCUC 2CK3G 1PM9A 4LF4O 1N32B 4FLVA 4JGSA 4R6ZA 5KLVH 3RYIA 5JCOA 4KHPB 4JYBA 3BY6A 3SYCA 4PA4A 4ZBMA 4PA3A 2QWQB 5C8YB 4NXMO 1US6A 1CPYA 2UXCB 1WAZA 1XMOO 4UVCA 3FX7A 3ZMTA 2EJ7A 1YJNV 4WF9V 4W4LA 4BW9A 1EFRG 3B09A 1PP9H 3D3QA 4NTYA 3GWOA 1W2BU 2OCCB 2QM7A 5IY5C 4AQYB 3P3NA 2Y4UA 3OMIB 1XNQO 4PV1B 5CA1A 2P4VA 3TGUH 3CRMA 3CMAV 1Q5OA 3RT3C 1G1XB 2CH7A 2GSMB 3RYFA 1FS0G 1VQ5V 5KMGA 2WLJA 4IL6Z 4MVMA 3CXCU 4LFAB 1YEWA 4JAVA 3OR6C 1DF4A 3T1YB 3CHXA 5D5QA 2CTQA 3E22B 1SZTA 4ZOLA 1JR9A 4NKGB 4BR6A 1YHQV 1YXBA 4UXNA 1RSOB 4EFBA 3THOA 1GAXA 3JASA 4P30A 4RAIA 2ADPA 2W6JG 1FKAO 2UXDB 1TVKB 4GKKO 1F7YA 4MVRA 3ETDA 1AVMA 2YEVB 2VRZA 1E79G 4DV3B 1NQTA 1ZL8B 3FB5C 4WCEV 4PI0A 3ZBHA 1Q8IA 4O4JA 4LFBB 4TUYB 4DV2O 4LH6A 1B04A 2AGAA 4LBEC 3JCZA 3L71H 3KG2A 4X88A 3JARA 2QR4A 1BS3A 5KAIZ 4LF5O 1TUBA 3K08A 1XEQA 4DR5O 3WG7C 1XREA 4DXWA 1QBZA 1JPXA 1SQFA 1FPOA 1K3EA 2B1IA 2RN9A 1OJHA 2WA4A 2IBZH 3UO3A 2BE3A 2GUZB 4B7EA 5LHIA 1UFIA 1XMQB 1V55B 3R65A 3MHSC 2X6CA 3L72H 1RPRA 3ASNC 4LFCB 4TV9A 1I0HA 3G4SV 4DV7O 1HNXB 1Q6UA 5LP6B 3RYHB 4CS4A 3N2GA 3J81N 2BSKB 4TT3G 5KHIA 5KHHA 2CE4A 1VP7A 3RYIB 1GN6A 3TETA 4LC1A 2ZQMA 4MSWC 2UXNA 1AI4A 4WFAV 4B3RO 1FFXA 2E5LO 1U97A 2QA4V 4OGQB 3AG3C 4JV5B 2Y69C 1K7DA 1FXKA 3CRCA 2LGWA 3FB6C 1SQGA 3JYCA 2JS3A 1XL6A 2ILMA 3WU2Z 1H38A 3JALA 1TA8A 4JI4B 1EZJA 2RCVA 4XBFA 1FJGB 2P67A 5CA1B 4B08A 3QO7A 4JASA 1VQMV 1Q81W 4JI0O 1VQ7V 2VQFB 3LDCA 5J2UA 1N32O 2CH7B 1JJ2U 3RYFB 3IAYA 2HFEC 2F43G 1Q6IA 5KMGB 2DYRC 1IXBA 1NJIW 3CC2V 3OR7C 3ZRXA 4HBNA 3HR0A 2CTWA 3SPIA 1FAFA 3R66A 5IYCO 4JI6O 2QDOA 1NTZH 1BCCH 3K3WA 4G27B 3CC7V 2FYUH 4ZOLB 3H1IH 2VS0A 3MD0A 3W7TA 4J11A 1IVSA 1QVGU 1S76D 4Z2WA 4DR6O 2OTLV 1W59A 4YJ3A 4AQYO 3CRQA 5ITZA 1S5HC 3OUSA 1NVPB 4O4LA 4K35A 4O4HA 4J80A 2YSUB 1Y67A 5H2FZ 3F5TA 5CA3A 2N05A 1G8MA 1DLBA 2VQEO 4DV5O 1Y76B 2PTMA 1LUWA 2ZD9A 3SDLA 4NTWA 4YIOA 4EEQA 4JYYA 3U11A 1GN3A 4LFAO 2WLNA 4FFKA 2DQ3A 3BHPA 3F5WC 3K5LA 4HNAA 1EBOA 2EINB 3P30A 3T1YO 3BABA 3CJHA 3WB0A 3QTCA 2QSAA 1XDCA 4HZ3A 4Z1VA 5LMNO 2AW9A 3JARB 1OCOC 4JTAB 1TUBB 3F7YC 1EN5A 1B6QA 4GX2A 4LF4B 3BAAA 3VQVA 1K9MW 2QWPB 4YHHB 1J5EB 3J7AU 4X1KA 1K92A 2Y0PA 2YI8A 2EIMB 2P7TC 4KXRA 2W0XA 4DV3O 3CCRV 4U7NA 2YICA 1AB3A 3FFQA 4NXMB 2QTSA 2OWOA 4TV9B 1MABG 2L35A 1HNZO 1Q6HA 1XMOB 3CCMV 1R3LC 3C3TA 5IYZA 1SQVH 3N2GB 5CBHA 5JWPA 2IW5A 4JZGA 1AR1B 2QTOA 1ZAUA 5J9PC 4WFHA 3IGAC 4LP8A 5B1NA 5FNVA 2E76B 3MAQA 2XAFA 1XNQB 3FAVA 5BXZA 4UVAA 3S3WA 2KQXA 3BA8A 2JJ2G 3E8HA 4J7JA 1I7FA 1FFXB 1P7GA 1NZ6A 1KBHA 1YIJV 1T5EA 3HKEB 1FXKB 1KKDA 3ABUA 3W7XA 4MTGA 2YC0A 3KCXA 1QLEC 1XMQO 4LF7B 4GYCB 5KUKA 3L74H 2ARHA 4LFCO 4H37A 2CGNA 3E83A 1X4TA 2YDEA 3AEIA 1H8HG 1MSDA 2UUCB 3BFRA 3B4SA 1BL8A 4CH6A 4I9QA 1NT2B 1VF7A 4DW1A 1URFA 1WP8A 1OCCB 4ZI7A 3K9SA 2QWOB 4MW3A 1W0JG 3K57A 1N0NA 3A2FA 2ADQB 1HR0O 3SGIA 3JSNA 4GKKB 4FZ0A 2EZPA 4DR1B 2XT9A 3OFNG 1VQNV 4DR4B 4NVPA 1YCIA 5DEDA 5BR8B 4O4IA 3APQA 2CDYA 3RWRD 2YXHA 1GN4A 4R7CA 2P22C 3ZMUA 1N33B 4JV5O 1XILA 1AILA 4X66B 4BW5A 1L0LH 3CCVV 2WLKA 1M56B 1VF6C 5EIBD 5ITZB 3HPLC 1GMGA 4X1IA 2EILB 3NXSA 4O4LB 1MZEA 3STLC 1JA8A 5GTIZ 4K0KO 1VQ9V 2LFSA 4O4HB 2B5UA 1Z5VA 4JTDB 2XTAA 5IJ0A 2CUGA 3QO8A 2ATKC 1R6KA 2PI5A 4B3MB 4DV0O 4UCVA 3ETEA 3JAKB 5B1OA 4R8CA 1JJOA 2QE7G 2CAZC 4HNAB 3OM3B 4GX0A 1H8EG 2NLJC 2IJIA 3F7VC 3K9AA 4K3AA 2Q0OC 3CB2A 3RGBA 2N74A 4DV7B 2BCCH 1VARA 2NN4A 4UCUA 3JD4A 4BIUA 1M90W 1Z5WA 3RVZA 3JAWA 1YZBA 2IJJA 2HHHB 4J9YB 1MMMA 5JH7A 4MVUA 1I94O 2XNDG 2QWRB 4X1KB 5BMVA 2HVKC 2WA3A 2D3OW 4TSFG 4LF9O 2DOSA 2GBOA 2R9RB 5B1AC 2ZE8A 4YJ2A 2E5LB 2PGGA 1QLNA 3AK3A 1VQPV 4DV1B 4BWAA 5IYZB 5EBLC 4I55B 5GTHZ 1SKVA 2HEPA 3WFVA 1SQXH 2Z0AA 2R9AA 2ZM6B 3D36A 1VQKV 5FNVB 4UVBA 3FAVB 2X0LA 2XAHA 4FVMA 2AZ0A 4JI0B 1TUEB 4JI1B 2A06H 4YHHO 2ZT9B 5EZYA 1EZVH 4I4TB 1J5EO 1WPBA 5KHGA 3CX5F 4QE7A 2R72A 1GN2A 5LA6A 4E2LA 5LOVA 3LSUA 4JYCA 4ZIBA 3DXRA 4FM1A 1FXHA 4JI6B 4I0XA 1XI1A 4TOIA 1GRJA 3G80A 4FFBA 3QF7A 4DR2B 1VQOV 2F95B 1A32A 2P90A 1JMKC 1B3QA 4GLXA 1Q3EA 2A7WA 2Z3YA 1YTFD 3KCYA 4Q20A 3NR7A 5CBGA 4ZI7B 4JI3O 2ITCC 4D7SA 2Y48A 4YXWG 4DR6B 1P7BA 1NH2D 1JOYA 1N8RW 1UPGA 2JJ1G 3OD4A 4WFGA 1IBKB 1L0NH 1JCHA 2ZCEA 2X6AA 2EIKC 1DTOA 3HKBA 4W4KA 4H0LB 2VQEB 3SYAA 2YXLA 4DV5B 3X2QC 1OCRC 5BY1A 3DSQA 4PJ0Z 2XUMA 4P9PA 3ZMSA 3JD0A 3I56V 1N4CA 3UT5A 1OV9A 4MT8A 3ZS8C 3TK1A 4LF7O 1GM7A 2PZSA 1B06A 4FLZA 1AJQA 2ZDIC 1SA0B 1VQ8V 1WJZA 4JPRA 1HNWO 1AJPA 4O2BA 3J80N 2RJZA 2UUCO 4QPKA 4X1IB 2A9HA 3FB7C 1U96A 4LWSA 5LMNB 4OPHA 5HFLA 1NTKH 3T1HO 5B1BB 4DR1O 4DR4O 2YIAA 2ZXWC 5BR8O 2LP7A 1OCZB 5L3BA 1AROP 4DR7B 4IYHA 3H9VA 4ICGA 2QGNA 1VQ4V 2A3QA 1N33O 1EM1A 5IYBO 2NR5A 1I5YA 1PNKA 1HNZB 1WNSA 4X66O 2KG7A 2WLMA 3AG4C 3ZRWA 3LDEA 5L3DA 1WP7A 3JAWB 1V54C 2H3OA 3AG1B 4U3FH 3JCUZ 5B3SC 5JH7B 2DW4A 1P84F 4NYKA 5BMVB 4FLYA 3ZEDA 3JAMN 4J7KA 4FLUA 3I5DA 4H33A 1WA8A 4FM0A 5KHJA 1S77D 1ROPA 4B3MO 3RBZA 4YJ2B 4DUZO 4DV6B 2C2AA 4I7ZB 4GCZA 1SQQH 1JX9A 2DYSB 1AP5A 1NBMG 3KZIZ 1CP9A 5E79Z 2UUBO 4BIZA 4U3JA 2F23A 4JYAB 4UCRA 5CN0A 5FPRA 5LL6Y 2Q0AA 3UM7A 1Z2GA 4BAYA 3A0RA 4QE9A 1TGOA 3C3SA 3ASOC 1O9HA 3DC5A 1N36O 1XHZA 1Q7YW 4J10A 1IZ3A 2QWNB 3CWBH 1M1KW 2DWDC 2HHHO 1CEZA 2UXBO 3SR2C 2LGQA 5KX5A 5EZYB 1HR0B 5H9CA 4LR3A 4CBCA 2JIZG 5LA6B 2Q73A 3A8TA 2GTAA 4GX5A 4IT5A 3DXRB 1VQ6V 1H2GA 4I0XB 2GV9A 4FFBB 4PA9A 3CD6V 2ZINA 4DV1O 1XUQA 4WFFA 2UU9B 3ABLC 1Q82W 4GX1A 4QJFB 2ZM6O 3BA9A 4MW8A 1NI8A 2DE0X 4UV8A 2CTPA 4K0KB 4CS3A 3OUFA 1F4MA 3HKBB 4JI1O 3T4ZA 3TXSA 2AHYA 3SJAC 1SERA 4DV0B 5JJEB 1M57C 3TJTA 4BIOA 3ABMC 3D3IA 4MVQA 3AG2C 1ZX3A 1G6UA 1S0VA 3DC6A 1BHAA 1Q86W 4UCSA 4IHJA 2BTOA 4DR2O 2K9PA 1SETA 4O2BB 1YI2V 2ZE5A 1LR1A 3ZN0A 3E8FA 4LWSB 4FZ1A 2JEXA 3JASB 2IJKA 2WLLA 3N27A 2O57A 5FPOA 5CB4A 3APOA 3G71V 3UO2A 4ZHQA 1I94B 1IBKO 3GVMA 3LSSA 5CBFA 1IXMA 2LFRA 1G4YB 4I50A 4LF9B 3CCLV 1AR5A 3WB1A 2WPDG 4O2AA 2P6JA 2Y4TA 3T2MA 3ZMVA 2EIJB 2KG7B 3ZRWB 1PKXA 4O4JB 1TAEA 2JGUA 4ABMA 4FM2A 5CA0A 1RM1B 4WFEA 5LHGA 3I55V 3AG7A 4PD4F 4B3SB 3E89A 4K8ZA 5LXTA 1M9NA 4MVZA 4UUJC 1H2NA 4JI5O 1WA8B 4CC5A 2Q7HA 1BGYH 1SS3A 4NR1A 5IE9A 3ABTA 2HJFC 1Y74A 1KP3A 2JK5C 1ZLZA 4U3JB 3SJBC 4DR7O 1R6TA 3IFXA 2Q5ZA 5EYPA 4JI7O 2B1GA 2YUAA 2IH3C 2JS5A 3E8GA 3CCSV 2ZE7A 5L3GA 5CMUA 5E1AC 5IY5B 1H2LA 1K33A 2EBOA 4JI3B 5KX5B 3LNNA 1KB9F 5KUMA 4TQFA 2N04A 1VF5B 3ML0A 3CS5A 4RWUA 1F23A 1K8AW 4UCTA 2ZR3A 4X64B 4DV6O 4DUYO 1LUVA 3EHBB 4PELA 2FKXA 2LQTA 4J9ZB 5GW7A 1N34B 2ZNIA 3CMEV 3HKCA 4CH4A 4Q6GA 3LDDA 4JYAO 4DV4O 2UUAB 4LF6B 1P4RA 1COWG 3ZN1A 1HNWB 5KA6A 4NTXA 4PDRA 4IYIA 4JTCB 3JALB 1KU9A 3K5NA 4DK1A 1YJ9V 1L8DA 2QEXV 2GDSA 5K1XA 5J2UB 4GT1A 1BQZA 1PL0A 1MSWD 4IIJA 3T1HB 1SQPH 1GO3F 4DK0A 2OT5A 1NH2B 1KD1W 1V55C 5LGTA 4J41A 3U0ZA 3FYIB 4GKJB 3E8BA 4U7OA 5EK0A 3L73H 4IHJB 5LP6C 1QCEA 2HLDG 3AG4B 1S5JA 5LMUO 1XQ8A 4WFBV 2UU9O 2AZ2A 5IT9N 5L3FA 2EJRA 4C7UA 5JCOC 1PNLA 2HKOA 4YJ3B 2WLLB 1F51A 4JAUA 3ZRVA 4MTOA 3HKDA 2E75B 3CE2A 4RO2A 4ZHQB 3E35A 4TWKA 2WLIA 2DMXA 3RW0A 3WG7B 4I50B 5H5NA 2PYLA 2DJVA 1V9PA 2PF4E 4DUZB 3B2EE 5J2TA 5A9GA 1QR8A 4O2AB 3CC4V 3E22A 2CGOA 3A0BZ 4R50A 1E1QG 2UUBB 3G6EV 3JD2A 3CYOA 1AI6A 2XAJA 5L3EA 1RSOA 1YJWV 2QM4A 3ASNB 5LGNA 1XNRB 3ZX6A 3Q4HA 2XAGA 1I08A 1S5LZ 1YSCA 5CA0B 2OCHA 1XOUA 1SQBH 3CJHB 4LF8O 2OYQA 1PD3A 4TQDA 1TVKA 1N36B 5LXTB 3SYOA 4F6EA 3LUTB 2KB1A 2Q4PA 2YEVA 4JI2O 2UXBB 1H2MA 3ZHSA 3VQYA 2Q9LA 1ZTEA 2E3CA 4CC6A 1ZL8A 3FYEB 1VIBA 3O9OA 1Y74B 1KC8W 4RUFA 5D5PA 1PPJH 3AG3B 5EYPB 2Y69B 1QQCA 1CXZB 1WLEA 5KAFZ 4FLTA 5IJ9A 2M7WA 3CRRA 5EBWC 2HP8A 5KHKA 4DW0A 1XL4A 1L1FA 1K34A 1JFFA 4B3SO 1QHTA 3W7UA 5DECA 2F1MA 2JEUA 1Q43A 2VWJA 3FB8C 5GONA 5JQGA 1QR9A 1GM8A 2P4KA 4GZRB 1K4CC 2DYRB 4CZZA 2EX3A 4H13B 1BHBA 3ABKC 1DGSA 2EINC 3RVYA 3K03A 3MDSA 3BRCA 1PV0A 3RYCA 1KYOF 3HKCB 4FLXA 2DQ0A 2BSKA 1RP3B 5L3CA 1JVMA 4XDKA 1HDJA 1BSMA 2IJHA 1VF6A 2L6LA 3C90A 1BMFG 2JGDA 2WLHA 2DN9A 1FFTB 5B5EZ 4LNUA 4IIJB 2EIMC 1VQLV 1ENVA 4DYLA 3TCUA 2QKCA 3IJ4A 4X64O 4O4IB 2YXYA 4G28B 2YI9A 3EFFK 1AJNA 2HG5C 4AILC 4L87A 2A79B 1AR4A 2ITDC 4OXSA 1KKCA 1N34O 5IWAO 2Y0IA 2GTSA 2UUAO 3EVKA 5JJJB 4LF6O 1S3JA 1NTMH 4UCOA 3SYPA 1K4DC 3OE7G 4ZKIA 3HKDB 1OCOB 4X65O 1YDXA 2WLIB 3K06A 4JI5B 4FJCC 1MOFA 3LNMB 2V4DA 3UKMA 1J95A 5IJ0B 1FXKC 2MW2B 5J2TB 5JVDA 2JRIA 1KECA 2IM9A 1ZSPA 3OEEG 1WB7A 5C93A 3ZHUA 3GWKC 4X89A 4GKJO 3PN1A 1NU1H 3Q4HB 2R9IA 2D2CB 1VEWA 4JI7B 1OCCC 2LW7A 4KUMA 4IGGA 3SJCC 4B3TO 1FYJA 3UCSC 2WAMA 1MNGA 3HB3B 1Y76A 2ZKOA 2X7RB 5LYJA 1VMGA 4X1YA 2Q68A 2BOCC 4PA6A 3H1LH 1F4NA 3KKYA 5EC1C 1Y66A 5B66Z 1XBLA 3LSQA 5A2QN 4X9QA 2W6IG 1HP8A 3ZHVA 4DUYB 2YIBD 1M56C 1Q90D 2P06A 3QG5A 4FPPA 4QIWF 1QLEB 5IJ9B 4PA7A 2EILC 2YIDA 4P2ZA 1XNRO 1QU7A 4DV4B 3ZJZA 4B7KA 3STZC 3K79A 2W0FC 2FTKA 1GKFA 3A0HZ 3G6BA 3M7MX 3OTOO 1K97A 1Y6XA 4JI8B 1JFFB 2BTQA 1M5IA 1RFYA 3N2KA 4QNHB 1KP2A 3E86A 5GONB 2KKWA 5JQGB 5BZBA 1IX9A 2ZR2A 3TXQA 1Y4MA 3P32A 5K1PA 2IU0A 1D5AA 2BOBC 2YS8A 3AK2A 1KUQA 3RYCB 4TV8A 3ICXA 5LOVB 2XHBA 2QKSA 2M6YA 3K04A 4RQEA 1IBMO 4OX9O 3VBBA 2EZOA 4PHZA 3CCQV 5EC2C 5LMUB 1FXVA 4FMTA 2P5OA 2EULA 2ZDIA 5EBMC 3H01A 2HR3A 4J42A 4DRXA 2JGDB 1BT8A 1IBLB 1EN6A 2LO1A 3B77A 2QKAA 4LNUB 4F4LA 4CH5A 1YITV 2IU3A 4FLWA 4Z1MG 4X20A 4EB6A 3HKEA 3CCEV 1I5XA 1NKDA 2Q6AA 2Q67A 4N21A 4X62B 3B8MA 2K1EA 3ETQA 3S3XA 2OIEA 4QGPA 2F4VO 4JAAA 1K5SA 1P49A 1BQ0A 4G2KA 3WB2A 3UT5B 3ZMZA 4YY3O 4MTFA 3OMNB 3K5MA 4F6RA 1R3IC 2Z5UA 1IURA 4MTXA 5IYDO 2AHZA 3O65A 3ZRSA 3ETGA 4LF8B 3RFRA 4KHPO 2CTRA 1UJWB 3IC9A 4UV9A 3ZHTA 3EXAA 3JATA 2RQ6A 4D6TH 3DTUB 2Q8VA 3RN4A 4JI2B 4HAMA 5JVDB 3OGCC 1R73A 2UXCO 2B9ZA 4LH7A 2GHYA 5IDJA 2G38A 3BVOA 3CRAA 4KL1A 1S72V 3SYQA 4QPJA 1SC5B 2LW1A 5B1AB 3VQXA 4HYOA 5DM6V 3T4DA 2RDCA 3DGEA 3BCCH 1HWYA 4UFZA 1IDSA 1GK9A 3L70H 3QO5A 1NR7A 2OCCC 1SESA 2PUSA 4D7TA 1AP6A 3T1CA 3QVNA 3K0DA 5LYJB 5FLXN 4X1YB 1BZKA 1XHXA
chains in the Genus database with same CATH topology
2HKOA 2WSSG 5LHIA 2P90A 2WLLB 1F51A 4JAUA 3ZRVA 1V55B 4MTOA 2Z3YA 3R65A 3MHSC 1YTFD 2X6CA 1RPRA 3ASNC 4Q20A 5CBGA 4RO2A 3G4SV 3ABKB 3CCJV 2ITCC 3E35A 2Y48A 5LGUA 4YXWG 1P7BA 4TWKA 2WLIA 3RW0A 3WG7B 1NH2D 1N8RW 1JOYA 4TT3G 2JJ1G 4WFGA 4DO2A 2HVJC 3FKSG 3M99B 1JCHA 1QR8A 2X6AA 2EIKC 4ASUG 3CC4V 1DTOA 1LNQA 3TETA 3SYAA 4R50A 2UXXA 1E1QG 4LC1A 1ORQC 3G6EV 2ZQMA 3JD2A 4MSWC 1R3KC 3CYOA 1AI6A 2UXNA 1OCRC 2XAJA 3X2QC 2WWWA 5L3EA 1AI4A 1YJWV 3ASNB 4P9PA 3ZIAG 4WFAV 3ZMSA 5LBQA 5LGNA 2IH1C 2XAGA 3JD0A 3I56V 1MG1A 1YSCA 5B1BC 4MT8A 3K0GA 5H6RA 2QA4V 2V1DA 3TK1A 1PD3A 1GM7A 3OW2U 1RPOA 1AI5A 3AG3C 1AJQA 2ZDIC 1VQ8V 1R3JC 2Y69C 3SYOA 4JPRA 3LUTB 1OCZC 1K7DA 1FXKA 4MVOA 1AJPA 2KB1A 2YEVA 4QPKA 2A9HA 3FB6C 3FB7C 3BEHA 2EIKB 4EKWA 3JYCA 1XL6A 3W7SA 1QVFU 1AI7A 1H38A 5HFLA 3X2QB 1OCRB 4I9WA 3FYEB 1EZJA 1KQSU 1ZWIC 4XBFA 1KC8W 2XOKG 2P67A 4I5SA 3SPCA 5B1BB 4RUFA 3QO7A 4JASA 3VOUA 3MHHC 1VQMV 1Q81W 3AG1C 1VQ7V 3LDCA 5KA5A 1JJ2U 3AG3B 2HFEC 2XAQA 2Y69B 2F43G 2X6BA 2ZXWC 2LP7A 1OCZB 5L3BA 1AROP 1WLEA 2DYRC 1NJIW 3CC2V 3OR7C 3ZRXA 2H94A 2M7WA 3CPWU 1VQ4V 3SPIA 5IYBO 5EBWC 3CP1A 4FIPC 4PDMA 5FL7G 1I5YA 1PNKA 5IYCO 1XL4A 2WLMA 1L1FA 3AG4C 1W0KG 3ZCCA 3ZRWA 3LDEA 5L3DA 3K3WA 1K34A 2DYSC 3W7UA 1V54C 4G27B 3CC7V 1YTFB 1JQ0A 3AG1B 3MD0A 5DN6G 3W7TA 5B3SC 2JEUA 2DW4A 1QVGU 3FB8C 2ZXWB 3OMAB 1S76D 1QR9A 1GM8A 1K4CC 2OTLV 2DYRB 4CZZA 4H33A 1BHBA 3ABKC 4XDJA 1S5HC 3OUSA 1NVPB 5HFMA 2EINC 3RVYA 3K03A 1S77D 2OTJV 1ROPA 3JD1A 3RBZA 2V7QG 2YSUB 2C2AA 2DQ0A 5CA3A 4GCZA 1JX9A 2DYSB 1G8MA 1V54B 1DLBA 1NBMG 1CP9A 4BIZA 2ZD9A 4XDLA 5L3CA 2H8PC 5B3SB 4MS2A 1R6NA 4RUEA 1JVMA 4XDKA 5CN0A 2WLNA 2PI4A 2IJHA 3UM7A 4BAYA 2DQ3A 3A0RA 3F5WC 1BMFG 4QE9A 2WLHA 5H6QA 1FFTB 3ASOC 1EBOA 2EINB 3P30A 2QM8A 1WPXA 1Q7YW 2EIMC 1VQLV 1K73W 1M1KW 2DWDC 1ENVA 1SRYA 2XASA 1CEZA 3TCUA 1NVPD 4HZ3A 1NR1A 1OCOC 1PNMA 5H9CA 3OAAG 4JTAB 3F7YC 4G28B 4CBCA 1B6QA 2JIZG 4GX2A 3EFFK 1AJNA 2HG5C 4L87A 2A79B 1K9MW 2NNUA 1E1RG 3JD3A 2ITDC 1GM9A 4GX5A 4OXSA 1K92A 2DWEC 1VQ6V 3ASOB 1H2GA 4PA9A 3OEHG 2EIMB 2P7TC 3CD6V 1S3JA 3CCUV 3SYPA 1K4DC 3CCRV 2Q69A 3OE7G 4FK5C 4U7NA 4WFFA 4ZKIA 3E2EA 3ABLC 1OCOB 1MABG 1Q82W 3W7WA 4GX1A 4QJFB 3CCMV 1R3LC 2A0LA 2WLIB 5CBHA 3K06A 2IW5A 5LHHA 4FJCC 1MOFA 3LNMB 2QTOA 3UKMA 1AR1B 4MW8A 1J95A 4JF3A 4UV8A 5J9PC 1FXKC 4WFHA 1GTOA 3IGAC 3GB7C 4LP8A 3OUFA 1KECA 1F4MA 3OEEG 5B1NA 3T4ZA 5C93A 2AHYA 4X89A 2XAFA 3SPJA 1K5QA 3PJSK 1SERA 3SJQC 4UVAA 1M57C 3ABLB 4KP4A 3ABMC 2JJ2G 3E8HA 3D3IA 2R9IA 4P9OA 4MVQA 4MVSA 3AG2C 1S0VA 1OCCC 3SPHA 4KUMA 1BHAA 1Q86W 1OHHG 3B8NA 1YIJV 4RQFA 4N23A 4KFMA 1SETA 1FXKB 1DF5A 4PDLA 1KKDA 1OZ0A 3ABUA 4MTGA 3W7XA 4PDVA 2WAMA 1YI2V 3HB3B 1QLEC 3ZN0A 3E8FA 5KUKA 2X7RB 4H37A 3E83A 2JEXA 2Q68A 3AEIA 1H8HG 3IC7A 2IJKA 2EIJC 2BOCC 2WLLA 1M57B 4PA6A 1BL8A 3ABMB 1F4NA 4X8AA 3AG2B 5EC1C 3SPGA 1Y66A 3G71V 1OCCB 3LSQA 2W6IG 4MW3A 2MK3A 3LSSA 1RM1C 1W0JG 5CBFA 1IXMA 2LFRA 1G4YB 1THZA 3QNEA 1M56C 3CCLV 2JDIG 4LCUC 2EZPA 2CK3G 4FPPA 4QIWF 1QLEB 3OFNG 2WPDG 1VQNV 4PA7A 2EILC 4JGSA 4P2ZA 4R6ZA 2P6JA 3ZJZA 3STZC 3T2MA 3K79A 2W0FC 4JYBA 3BY6A 2FTKA 3SYCA 3ZMVA 1GKFA 2EIJB 4PA4A 4R7CA 3ZMUA 1K97A 3ZRWB 4ZBMA 1PKXA 4PA3A 1RM1B 4BW5A 4QNHB 4WFEA 5LHGA 1KP2A 3E86A 3CCVV 3I55V 2WLKA 1CPYA 5BZBA 1M56B 2ZR2A 1Y4MA 3E89A 3P32A 4UVCA 2IU0A 1M9NA 3ZMTA 4MVZA 4UUJC 1YJNV 4WF9V 3HPLC 1GMGA 2EILB 1EFRG 3NXSA 2BOBC 3STLC 1W2BU 3GWOA 1VQ9V 2LFSA 2OCCB 2QM7A 5IY5C 2B5UA 2QKSA 3ABTA 4JTDB 2HJFC 3K04A 3OMIB 2JK5C 1KP3A 4RQEA 3QO8A 2ATKC 1R6KA 2PI5A 3VBBA 2EZOA 3CCQV 5EC2C 3CMAV 1FXVA 4FMTA 3ETEA 2GSMB 3IFXA 5B1OA 2ZDIA 4R8CA 2B1GA 1FS0G 5EBMC 2QE7G 3H01A 2HR3A 2IH3C 1VQ5V 3E8GA 3OM3B 4GX0A 2WLJA 4MVMA 3CCSV 1H8EG 3B77A 2NLJC 3CXCU 4F4LA 5L3GA 5CMUA 2IJIA 3F7VC 3K9AA 5E1AC 1YITV 5IY5B 2IU3A 4JAVA 4Z1MG 1K33A 2EBOA 3OR6C 1DF4A 3JD4A 4BIUA 1M90W 3CCEV 1I5XA 1NKDA 2Q6AA 5KUMA 3RVZA 2Q67A 4N21A 1SZTA 3B8MA 2K1EA 2IJJA 3ML0A 4J9YB 1YHQV 4MVUA 4UXNA 1F23A 2XNDG 1K8AW 1K5SA 2ZR3A 4P30A 4RAIA 2HVKC 4G2KA 3EHBB 2D3OW 2W6JG 4TSFG 3ZMZA 4PELA 4MTFA 3OMNB 4J9ZB 2R9RB 1R3IC 4MVRA 2Z5UA 5GW7A 3ETDA 4MTXA 5B1AC 5IYDO 3CMEV 2AHZA 3ZRSA 3LDDA 3ETGA 2YEVB 1QLNA 1E79G 1P4RA 1VQPV 1UJWB 4UV9A 1COWG 3ZN1A 1NQTA 5EBLC 5KA6A 4PDRA 3FB5C 4JTCB 4WCEV 3DTUB 1YJ9V 3WFVA 2QEXV 3D36A 4HAMA 3OGCC 1R73A 1VQKV 2GHYA 4GT1A 4UVBA 5IDJA 1PL0A 1MSWD 1S72V 3SYQA 4QPJA 5B1AB 1GO3F 4HYOA 5DM6V 2X0LA 2XAHA 2OT5A 1NH2B 3T4DA 1KD1W 1V55C 4LBEC 1TUEB 3JCZA 5LGTA 3DGEA 3KG2A 4X88A 3FYIB 1HWYA 3E8BA 3K08A 1GK9A 3QO5A 4U7OA 5EK0A 1NR7A 4QE7A 2OCCC 1SESA 3WG7C 4DXWA 1QBZA 1QCEA 2HLDG 4E2LA 3T1CA 1JPXA 3AG4B 1K3EA 2B1IA 4JYCA 4WFBV 1FXHA 5L3FA 2EJRA 3K0DA 1VQOV 1PNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1O A;  3DGE A;  1F51 A;  4JAU A;  3ZRV A;  4LC1 A;  3ZRX A;  4KP4 A;  3NXS A;  4Q20 A;  4JYB A;  2FTK A;  2WWW A;  3A0R A;  4U7O A;  2LFS A;  3ZRW B;  2QM7 A;  1JOY A;  3D36 A;  2P67 A;  4I5S A;  2QM8 A;  4JAV A;  3ZCC A;  4MT8 A;  3ZRW A;  4JYC A;  4GT1 A;  2C2A A;  1IXM A;  4JAS A;  2LFR A;  3TK1 A;  5IDJ A;  4GCZ A;  4MTX A;  4BIU A;  5B1N A;  4QPJ A;  3MD0 A;  4U7N A;  5C93 A;  4BIZ A;  4ZKI A;  3P32 A;  4FMT A;  4FPP A;  4QPK A; 
#chains in the Genus database with same CATH topology
 2WSS G;  3CXH F;  3OT7 A;  3JAK A;  4DR3 B;  3K59 A;  1X59 A;  3ABK B;  3CCJ V;  5LGU A;  1YF2 A;  4DO2 A;  2HVJ C;  3FKS G;  3M99 B;  4NXN B;  4ASU G;  4L8J A;  1D2D A;  1LNQ A;  1N0J A;  2UXX A;  1ORQ C;  1R3K C;  2UXD O;  2WWW A;  2BTQ B;  3ZIA G;  4NB5 A;  5LBQ A;  2YIB A;  2AXT Z;  2IH1 C;  1MG1 A;  5B1B C;  3N2K B;  2KSD A;  3K0G A;  5H6R A;  2V1D A;  3OW2 U;  1RPO A;  3VQW A;  1AI5 A;  2ZNJ A;  1R3J C;  2FL4 A;  1SF9 A;  1OCZ C;  4MVO A;  1D5N A;  4CH3 A;  4EFE A;  3BEH A;  2EIK B;  4EKW A;  1MA1 A;  4JZ2 A;  4TV8 B;  4WBN A;  3W7S A;  1QVF U;  1AI7 A;  4I55 A;  3X2Q B;  1OCR B;  4I9W A;  4LFB O;  1KQS U;  1ZWI C;  2XOK G;  4I5S A;  3SPC A;  1WB8 A;  3VOU A;  1PL4 A;  3MHH C;  3AG1 C;  5KA5 A;  3G67 A;  5IWA B;  3L9D A;  3UQ8 A;  2XAQ A;  3AK1 A;  2X6B A;  4DRX B;  2ODM A;  1GH6 A;  4UB6 Z;  4E4E A;  1H2S B;  4JI8 O;  2H94 A;  3CPW U;  2E74 B;  1SZX A;  4I4T A;  3CP1 A;  4FIP C;  4PDM A;  5FL7 G;  4X20 B;  4X65 B;  1W0K G;  4EB6 B;  3ZCC A;  3L75 H;  2F66 C;  2DYS C;  1YTF B;  1JQ0 A;  5C8Y A;  5DN6 G;  5AG2 A;  5F2V O;  2ZXW B;  3OMA B;  3OTF A;  2JVD A;  1HNX O;  3D36 C;  2Q7G A;  4XDJ A;  1M93 A;  3D8C A;  5HFM A;  4J7Z A;  2ZIO A;  4F6R B;  4UB8 Z;  2OTJ V;  3JD1 A;  2V7Q G;  3P3P A;  1V54 B;  3CEI A;  4XDL A;  3JAT B;  2H8P C;  5B3S B;  4MS2 A;  1R6N A;  1IBL O;  4B3T B;  4RUE A;  1WN7 A;  2PI4 A;  5CB4 B;  1R1B A;  1ZUQ A;  5H6Q A;  1FD9 A;  2QM8 A;  1WPX A;  4OPA A;  4K8X A;  1K73 W;  4X62 O;  3M8A A;  1SRY A;  2ETN A;  2FB5 A;  2XAS A;  3B40 A;  3H1H H;  2FML A;  1NVP D;  2ZE6 A;  1KMI Z;  1SA0 A;  1NR1 A;  4H44 B;  1O9G A;  1PNM A;  4DV2 B;  2PYJ A;  3OAA G;  4JI4 O;  5TIS Z;  1FJG O;  2NNU A;  1E1R G;  3JD3 A;  5JJN B;  1GM9 A;  2VQF O;  3BPZ A;  4LF5 B;  2DWE C;  3ASO B;  4DR5 B;  1NS1 A;  1YVW A;  3OEH G;  3OTO B;  2R70 A;  3CSX A;  3CCU V;  2Q69 A;  4FK5 C;  1M4U A;  4AI8 A;  3E2E A;  2PY5 A;  3OGI B;  3W7W A;  2RMK B;  3H1K H;  2A0L A;  3ZHR A;  2LJ2 A;  3K5O A;  5LHH A;  3K58 A;  2F93 B;  4A5U B;  4JF3 A;  1MZF A;  1GTO A;  3GB7 C;  1EN4 A;  3H1J H;  4TUY A;  4CS2 A;  3SPJ A;  3JSL A;  1IBM B;  1K5Q A;  3PJS K;  4OX9 B;  1QNM A;  3SJQ C;  3ABL B;  4KP4 A;  4PI2 A;  4P9O A;  4MVS A;  5EIB C;  3SPH A;  3ZHQ A;  1OHH G;  3B8N A;  2RNB A;  4RQF A;  4N23 A;  2ZIM A;  1H2K A;  4KFM A;  4B3R B;  1DF5 A;  4PDL A;  1OZ0 A;  4PDV A;  2Q7E A;  4DR3 O;  2VWK A;  4WBN B;  3IC7 A;  1DK1 A;  4AHC A;  2EIJ C;  2GUZ A;  3U10 A;  4GUN A;  1M57 B;  3ABM B;  1HW7 A;  3FD9 A;  4YIP A;  4X8A A;  3AG2 B;  3SPG A;  2HJD A;  2F4V B;  2OIG A;  2QJ1 A;  2MK3 A;  1RM1 C;  1BE3 H;  5LP6 A;  4NXN O;  3RYH A;  1THZ A;  3QNE A;  4YY3 B;  2JDI G;  4LCU C;  2CK3 G;  1PM9 A;  4LF4 O;  1N32 B;  4FLV A;  4JGS A;  4R6Z A;  5KLV H;  3RYI A;  5JCO A;  4KHP B;  4JYB A;  3BY6 A;  3SYC A;  4PA4 A;  4ZBM A;  4PA3 A;  2QWQ B;  5C8Y B;  4NXM O;  1US6 A;  1CPY A;  2UXC B;  1WAZ A;  1XMO O;  4UVC A;  3FX7 A;  3ZMT A;  2EJ7 A;  1YJN V;  4WF9 V;  4W4L A;  4BW9 A;  1EFR G;  3B09 A;  1PP9 H;  3D3Q A;  4NTY A;  3GWO A;  1W2B U;  2OCC B;  2QM7 A;  5IY5 C;  4AQY B;  3P3N A;  2Y4U A;  3OMI B;  1XNQ O;  4PV1 B;  5CA1 A;  2P4V A;  3TGU H;  3CRM A;  3CMA V;  1Q5O A;  3RT3 C;  1G1X B;  2CH7 A;  2GSM B;  3RYF A;  1FS0 G;  1VQ5 V;  5KMG A;  2WLJ A;  4IL6 Z;  4MVM A;  3CXC U;  4LFA B;  1YEW A;  4JAV A;  3OR6 C;  1DF4 A;  3T1Y B;  3CHX A;  5D5Q A;  2CTQ A;  3E22 B;  1SZT A;  4ZOL A;  1JR9 A;  4NKG B;  4BR6 A;  1YHQ V;  1YXB A;  4UXN A;  1RSO B;  4EFB A;  3THO A;  1GAX A;  3JAS A;  4P30 A;  4RAI A;  2ADP A;  2W6J G;  1FKA O;  2UXD B;  1TVK B;  4GKK O;  1F7Y A;  4MVR A;  3ETD A;  1AVM A;  2YEV B;  2VRZ A;  1E79 G;  4DV3 B;  1NQT A;  1ZL8 B;  3FB5 C;  4WCE V;  4PI0 A;  3ZBH A;  1Q8I A;  4O4J A;  4LFB B;  4TUY B;  4DV2 O;  4LH6 A;  1B04 A;  2AGA A;  4LBE C;  3JCZ A;  3L71 H;  3KG2 A;  4X88 A;  3JAR A;  2QR4 A;  1BS3 A;  5KAI Z;  4LF5 O;  1TUB A;  3K08 A;  1XEQ A;  4DR5 O;  3WG7 C;  1XRE A;  4DXW A;  1QBZ A;  1JPX A;  1SQF A;  1FPO A;  1K3E A;  2B1I A;  2RN9 A;  1OJH A;  2WA4 A;  2IBZ H;  3UO3 A;  2BE3 A;  2GUZ B;  4B7E A;  5LHI A;  1UFI A;  1XMQ B;  1V55 B;  3R65 A;  3MHS C;  2X6C A;  3L72 H;  1RPR A;  3ASN C;  4LFC B;  4TV9 A;  1I0H A;  3G4S V;  4DV7 O;  1HNX B;  1Q6U A;  5LP6 B;  3RYH B;  4CS4 A;  3N2G A;  3J81 N;  2BSK B;  4TT3 G;  5KHI A;  5KHH A;  2CE4 A;  1VP7 A;  3RYI B;  1GN6 A;  3TET A;  4LC1 A;  2ZQM A;  4MSW C;  2UXN A;  1AI4 A;  4WFA V;  4B3R O;  1FFX A;  2E5L O;  1U97 A;  2QA4 V;  4OGQ B;  3AG3 C;  4JV5 B;  2Y69 C;  1K7D A;  1FXK A;  3CRC A;  2LGW A;  3FB6 C;  1SQG A;  3JYC A;  2JS3 A;  1XL6 A;  2ILM A;  3WU2 Z;  1H38 A;  3JAL A;  1TA8 A;  4JI4 B;  1EZJ A;  2RCV A;  4XBF A;  1FJG B;  2P67 A;  5CA1 B;  4B08 A;  3QO7 A;  4JAS A;  1VQM V;  1Q81 W;  4JI0 O;  1VQ7 V;  2VQF B;  3LDC A;  5J2U A;  1N32 O;  2CH7 B;  1JJ2 U;  3RYF B;  3IAY A;  2HFE C;  2F43 G;  1Q6I A;  5KMG B;  2DYR C;  1IXB A;  1NJI W;  3CC2 V;  3OR7 C;  3ZRX A;  4HBN A;  3HR0 A;  2CTW A;  3SPI A;  1FAF A;  3R66 A;  5IYC O;  4JI6 O;  2QDO A;  1NTZ H;  1BCC H;  3K3W A;  4G27 B;  3CC7 V;  2FYU H;  4ZOL B;  3H1I H;  2VS0 A;  3MD0 A;  3W7T A;  4J11 A;  1IVS A;  1QVG U;  1S76 D;  4Z2W A;  4DR6 O;  2OTL V;  1W59 A;  4YJ3 A;  4AQY O;  3CRQ A;  5ITZ A;  1S5H C;  3OUS A;  1NVP B;  4O4L A;  4K35 A;  4O4H A;  4J80 A;  2YSU B;  1Y67 A;  5H2F Z;  3F5T A;  5CA3 A;  2N05 A;  1G8M A;  1DLB A;  2VQE O;  4DV5 O;  1Y76 B;  2PTM A;  1LUW A;  2ZD9 A;  3SDL A;  4NTW A;  4YIO A;  4EEQ A;  4JYY A;  3U11 A;  1GN3 A;  4LFA O;  2WLN A;  4FFK A;  2DQ3 A;  3BHP A;  3F5W C;  3K5L A;  4HNA A;  1EBO A;  2EIN B;  3P30 A;  3T1Y O;  3BAB A;  3CJH A;  3WB0 A;  3QTC A;  2QSA A;  1XDC A;  4HZ3 A;  4Z1V A;  5LMN O;  2AW9 A;  3JAR B;  1OCO C;  4JTA B;  1TUB B;  3F7Y C;  1EN5 A;  1B6Q A;  4GX2 A;  4LF4 B;  3BAA A;  3VQV A;  1K9M W;  2QWP B;  4YHH B;  1J5E B;  3J7A U;  4X1K A;  1K92 A;  2Y0P A;  2YI8 A;  2EIM B;  2P7T C;  4KXR A;  2W0X A;  4DV3 O;  3CCR V;  4U7N A;  2YIC A;  1AB3 A;  3FFQ A;  4NXM B;  2QTS A;  2OWO A;  4TV9 B;  1MAB G;  2L35 A;  1HNZ O;  1Q6H A;  1XMO B;  3CCM V;  1R3L C;  3C3T A;  5IYZ A;  1SQV H;  3N2G B;  5CBH A;  5JWP A;  2IW5 A;  4JZG A;  1AR1 B;  2QTO A;  1ZAU A;  5J9P C;  4WFH A;  3IGA C;  4LP8 A;  5B1N A;  5FNV A;  2E76 B;  3MAQ A;  2XAF A;  1XNQ B;  3FAV A;  5BXZ A;  4UVA A;  3S3W A;  2KQX A;  3BA8 A;  2JJ2 G;  3E8H A;  4J7J A;  1I7F A;  1FFX B;  1P7G A;  1NZ6 A;  1KBH A;  1YIJ V;  1T5E A;  3HKE B;  1FXK B;  1KKD A;  3ABU A;  3W7X A;  4MTG A;  2YC0 A;  3KCX A;  1QLE C;  1XMQ O;  4LF7 B;  4GYC B;  5KUK A;  3L74 H;  2ARH A;  4LFC O;  4H37 A;  2CGN A;  3E83 A;  1X4T A;  2YDE A;  3AEI A;  1H8H G;  1MSD A;  2UUC B;  3BFR A;  3B4S A;  1BL8 A;  4CH6 A;  4I9Q A;  1NT2 B;  1VF7 A;  4DW1 A;  1URF A;  1WP8 A;  1OCC B;  4ZI7 A;  3K9S A;  2QWO B;  4MW3 A;  1W0J G;  3K57 A;  1N0N A;  3A2F A;  2ADQ B;  1HR0 O;  3SGI A;  3JSN A;  4GKK B;  4FZ0 A;  2EZP A;  4DR1 B;  2XT9 A;  3OFN G;  1VQN V;  4DR4 B;  4NVP A;  1YCI A;  5DED A;  5BR8 B;  4O4I A;  3APQ A;  2CDY A;  3RWR D;  2YXH A;  1GN4 A;  4R7C A;  2P22 C;  3ZMU A;  1N33 B;  4JV5 O;  1XIL A;  1AIL A;  4X66 B;  4BW5 A;  1L0L H;  3CCV V;  2WLK A;  1M56 B;  1VF6 C;  5EIB D;  5ITZ B;  3HPL C;  1GMG A;  4X1I A;  2EIL B;  3NXS A;  4O4L B;  1MZE A;  3STL C;  1JA8 A;  5GTI Z;  4K0K O;  1VQ9 V;  2LFS A;  4O4H B;  2B5U A;  1Z5V A;  4JTD B;  2XTA A;  5IJ0 A;  2CUG A;  3QO8 A;  2ATK C;  1R6K A;  2PI5 A;  4B3M B;  4DV0 O;  4UCV A;  3ETE A;  3JAK B;  5B1O A;  4R8C A;  1JJO A;  2QE7 G;  2CAZ C;  4HNA B;  3OM3 B;  4GX0 A;  1H8E G;  2NLJ C;  2IJI A;  3F7V C;  3K9A A;  4K3A A;  2Q0O C;  3CB2 A;  3RGB A;  2N74 A;  4DV7 B;  2BCC H;  1VAR A;  2NN4 A;  4UCU A;  3JD4 A;  4BIU A;  1M90 W;  1Z5W A;  3RVZ A;  3JAW A;  1YZB A;  2IJJ A;  2HHH B;  4J9Y B;  1MMM A;  5JH7 A;  4MVU A;  1I94 O;  2XND G;  2QWR B;  4X1K B;  5BMV A;  2HVK C;  2WA3 A;  2D3O W;  4TSF G;  4LF9 O;  2DOS A;  2GBO A;  2R9R B;  5B1A C;  2ZE8 A;  4YJ2 A;  2E5L B;  2PGG A;  1QLN A;  3AK3 A;  1VQP V;  4DV1 B;  4BWA A;  5IYZ B;  5EBL C;  4I55 B;  5GTH Z;  1SKV A;  2HEP A;  3WFV A;  1SQX H;  2Z0A A;  2R9A A;  2ZM6 B;  3D36 A;  1VQK V;  5FNV B;  4UVB A;  3FAV B;  2X0L A;  2XAH A;  4FVM A;  2AZ0 A;  4JI0 B;  1TUE B;  4JI1 B;  2A06 H;  4YHH O;  2ZT9 B;  5EZY A;  1EZV H;  4I4T B;  1J5E O;  1WPB A;  5KHG A;  3CX5 F;  4QE7 A;  2R72 A;  1GN2 A;  5LA6 A;  4E2L A;  5LOV A;  3LSU A;  4JYC A;  4ZIB A;  3DXR A;  4FM1 A;  1FXH A;  4JI6 B;  4I0X A;  1XI1 A;  4TOI A;  1GRJ A;  3G80 A;  4FFB A;  3QF7 A;  4DR2 B;  1VQO V;  2F95 B;  1A32 A;  2P90 A;  1JMK C;  1B3Q A;  4GLX A;  1Q3E A;  2A7W A;  2Z3Y A;  1YTF D;  3KCY A;  4Q20 A;  3NR7 A;  5CBG A;  4ZI7 B;  4JI3 O;  2ITC C;  4D7S A;  2Y48 A;  4YXW G;  4DR6 B;  1P7B A;  1NH2 D;  1JOY A;  1N8R W;  1UPG A;  2JJ1 G;  3OD4 A;  4WFG A;  1IBK B;  1L0N H;  1JCH A;  2ZCE A;  2X6A A;  2EIK C;  1DTO A;  3HKB A;  4W4K A;  4H0L B;  2VQE B;  3SYA A;  2YXL A;  4DV5 B;  3X2Q C;  1OCR C;  5BY1 A;  3DSQ A;  4PJ0 Z;  2XUM A;  4P9P A;  3ZMS A;  3JD0 A;  3I56 V;  1N4C A;  3UT5 A;  1OV9 A;  4MT8 A;  3ZS8 C;  3TK1 A;  4LF7 O;  1GM7 A;  2PZS A;  1B06 A;  4FLZ A;  1AJQ A;  2ZDI C;  1SA0 B;  1VQ8 V;  1WJZ A;  4JPR A;  1HNW O;  1AJP A;  4O2B A;  3J80 N;  2RJZ A;  2UUC O;  4QPK A;  4X1I B;  2A9H A;  3FB7 C;  1U96 A;  4LWS A;  5LMN B;  4OPH A;  5HFL A;  1NTK H;  3T1H O;  5B1B B;  4DR1 O;  4DR4 O;  2YIA A;  2ZXW C;  5BR8 O;  2LP7 A;  1OCZ B;  5L3B A;  1ARO P;  4DR7 B;  4IYH A;  3H9V A;  4ICG A;  2QGN A;  1VQ4 V;  2A3Q A;  1N33 O;  1EM1 A;  5IYB O;  2NR5 A;  1I5Y A;  1PNK A;  1HNZ B;  1WNS A;  4X66 O;  2KG7 A;  2WLM A;  3AG4 C;  3ZRW A;  3LDE A;  5L3D A;  1WP7 A;  3JAW B;  1V54 C;  2H3O A;  3AG1 B;  4U3F H;  3JCU Z;  5B3S C;  5JH7 B;  2DW4 A;  1P84 F;  4NYK A;  5BMV B;  4FLY A;  3ZED A;  3JAM N;  4J7K A;  4FLU A;  3I5D A;  4H33 A;  1WA8 A;  4FM0 A;  5KHJ A;  1S77 D;  1ROP A;  4B3M O;  3RBZ A;  4YJ2 B;  4DUZ O;  4DV6 B;  2C2A A;  4I7Z B;  4GCZ A;  1SQQ H;  1JX9 A;  2DYS B;  1AP5 A;  1NBM G;  3KZI Z;  1CP9 A;  5E79 Z;  2UUB O;  4BIZ A;  4U3J A;  2F23 A;  4JYA B;  4UCR A;  5CN0 A;  5FPR A;  5LL6 Y;  2Q0A A;  3UM7 A;  1Z2G A;  4BAY A;  3A0R A;  4QE9 A;  1TGO A;  3C3S A;  3ASO C;  1O9H A;  3DC5 A;  1N36 O;  1XHZ A;  1Q7Y W;  4J10 A;  1IZ3 A;  2QWN B;  3CWB H;  1M1K W;  2DWD C;  2HHH O;  1CEZ A;  2UXB O;  3SR2 C;  2LGQ A;  5KX5 A;  5EZY B;  1HR0 B;  5H9C A;  4LR3 A;  4CBC A;  2JIZ G;  5LA6 B;  2Q73 A;  3A8T A;  2GTA A;  4GX5 A;  4IT5 A;  3DXR B;  1VQ6 V;  1H2G A;  4I0X B;  2GV9 A;  4FFB B;  4PA9 A;  3CD6 V;  2ZIN A;  4DV1 O;  1XUQ A;  4WFF A;  2UU9 B;  3ABL C;  1Q82 W;  4GX1 A;  4QJF B;  2ZM6 O;  3BA9 A;  4MW8 A;  1NI8 A;  2DE0 X;  4UV8 A;  2CTP A;  4K0K B;  4CS3 A;  3OUF A;  1F4M A;  3HKB B;  4JI1 O;  3T4Z A;  3TXS A;  2AHY A;  3SJA C;  1SER A;  4DV0 B;  5JJE B;  1M57 C;  3TJT A;  4BIO A;  3ABM C;  3D3I A;  4MVQ A;  3AG2 C;  1ZX3 A;  1G6U A;  1S0V A;  3DC6 A;  1BHA A;  1Q86 W;  4UCS A;  4IHJ A;  2BTO A;  4DR2 O;  2K9P A;  1SET A;  4O2B B;  1YI2 V;  2ZE5 A;  1LR1 A;  3ZN0 A;  3E8F A;  4LWS B;  4FZ1 A;  2JEX A;  3JAS B;  2IJK A;  2WLL A;  3N27 A;  2O57 A;  5FPO A;  5CB4 A;  3APO A;  3G71 V;  3UO2 A;  4ZHQ A;  1I94 B;  1IBK O;  3GVM A;  3LSS A;  5CBF A;  1IXM A;  2LFR A;  1G4Y B;  4I50 A;  4LF9 B;  3CCL V;  1AR5 A;  3WB1 A;  2WPD G;  4O2A A;  2P6J A;  2Y4T A;  3T2M A;  3ZMV A;  2EIJ B;  2KG7 B;  3ZRW B;  1PKX A;  4O4J B;  1TAE A;  2JGU A;  4ABM A;  4FM2 A;  5CA0 A;  1RM1 B;  4WFE A;  5LHG A;  3I55 V;  3AG7 A;  4PD4 F;  4B3S B;  3E89 A;  4K8Z A;  5LXT A;  1M9N A;  4MVZ A;  4UUJ C;  1H2N A;  4JI5 O;  1WA8 B;  4CC5 A;  2Q7H A;  1BGY H;  1SS3 A;  4NR1 A;  5IE9 A;  3ABT A;  2HJF C;  1Y74 A;  1KP3 A;  2JK5 C;  1ZLZ A;  4U3J B;  3SJB C;  4DR7 O;  1R6T A;  3IFX A;  2Q5Z A;  5EYP A;  4JI7 O;  2B1G A;  2YUA A;  2IH3 C;  2JS5 A;  3E8G A;  3CCS V;  2ZE7 A;  5L3G A;  5CMU A;  5E1A C;  5IY5 B;  1H2L A;  1K33 A;  2EBO A;  4JI3 B;  5KX5 B;  3LNN A;  1KB9 F;  5KUM A;  4TQF A;  2N04 A;  1VF5 B;  3ML0 A;  3CS5 A;  4RWU A;  1F23 A;  1K8A W;  4UCT A;  2ZR3 A;  4X64 B;  4DV6 O;  4DUY O;  1LUV A;  3EHB B;  4PEL A;  2FKX A;  2LQT A;  4J9Z B;  5GW7 A;  1N34 B;  2ZNI A;  3CME V;  3HKC A;  4CH4 A;  4Q6G A;  3LDD A;  4JYA O;  4DV4 O;  2UUA B;  4LF6 B;  1P4R A;  1COW G;  3ZN1 A;  1HNW B;  5KA6 A;  4NTX A;  4PDR A;  4IYI A;  4JTC B;  3JAL B;  1KU9 A;  3K5N A;  4DK1 A;  1YJ9 V;  1L8D A;  2QEX V;  2GDS A;  5K1X A;  5J2U B;  4GT1 A;  1BQZ A;  1PL0 A;  1MSW D;  4IIJ A;  3T1H B;  1SQP H;  1GO3 F;  4DK0 A;  2OT5 A;  1NH2 B;  1KD1 W;  1V55 C;  5LGT A;  4J41 A;  3U0Z A;  3FYI B;  4GKJ B;  3E8B A;  4U7O A;  5EK0 A;  3L73 H;  4IHJ B;  5LP6 C;  1QCE A;  2HLD G;  3AG4 B;  1S5J A;  5LMU O;  1XQ8 A;  4WFB V;  2UU9 O;  2AZ2 A;  5IT9 N;  5L3F A;  2EJR A;  4C7U A;  5JCO C;  1PNL A;  2HKO A;  4YJ3 B;  2WLL B;  1F51 A;  4JAU A;  3ZRV A;  4MTO A;  3HKD A;  2E75 B;  3CE2 A;  4RO2 A;  4ZHQ B;  3E35 A;  4TWK A;  2WLI A;  2DMX A;  3RW0 A;  3WG7 B;  4I50 B;  5H5N A;  2PYL A;  2DJV A;  1V9P A;  2PF4 E;  4DUZ B;  3B2E E;  5J2T A;  5A9G A;  1QR8 A;  4O2A B;  3CC4 V;  3E22 A;  2CGO A;  3A0B Z;  4R50 A;  1E1Q G;  2UUB B;  3G6E V;  3JD2 A;  3CYO A;  1AI6 A;  2XAJ A;  5L3E A;  1RSO A;  1YJW V;  2QM4 A;  3ASN B;  5LGN A;  1XNR B;  3ZX6 A;  3Q4H A;  2XAG A;  1I08 A;  1S5L Z;  1YSC A;  5CA0 B;  2OCH A;  1XOU A;  1SQB H;  3CJH B;  4LF8 O;  2OYQ A;  1PD3 A;  4TQD A;  1TVK A;  1N36 B;  5LXT B;  3SYO A;  4F6E A;  3LUT B;  2KB1 A;  2Q4P A;  2YEV A;  4JI2 O;  2UXB B;  1H2M A;  3ZHS A;  3VQY A;  2Q9L A;  1ZTE A;  2E3C A;  4CC6 A;  1ZL8 A;  3FYE B;  1VIB A;  3O9O A;  1Y74 B;  1KC8 W;  4RUF A;  5D5P A;  1PPJ H;  3AG3 B;  5EYP B;  2Y69 B;  1QQC A;  1CXZ B;  1WLE A;  5KAF Z;  4FLT A;  5IJ9 A;  2M7W A;  3CRR A;  5EBW C;  2HP8 A;  5KHK A;  4DW0 A;  1XL4 A;  1L1F A;  1K34 A;  1JFF A;  4B3S O;  1QHT A;  3W7U A;  5DEC A;  2F1M A;  2JEU A;  1Q43 A;  2VWJ A;  3FB8 C;  5GON A;  5JQG A;  1QR9 A;  1GM8 A;  2P4K A;  4GZR B;  1K4C C;  2DYR B;  4CZZ A;  2EX3 A;  4H13 B;  1BHB A;  3ABK C;  1DGS A;  2EIN C;  3RVY A;  3K03 A;  3MDS A;  3BRC A;  1PV0 A;  3RYC A;  1KYO F;  3HKC B;  4FLX A;  2DQ0 A;  2BSK A;  1RP3 B;  5L3C A;  1JVM A;  4XDK A;  1HDJ A;  1BSM A;  2IJH A;  1VF6 A;  2L6L A;  3C90 A;  1BMF G;  2JGD A;  2WLH A;  2DN9 A;  1FFT B;  5B5E Z;  4LNU A;  4IIJ B;  2EIM C;  1VQL V;  1ENV A;  4DYL A;  3TCU A;  2QKC A;  3IJ4 A;  4X64 O;  4O4I B;  2YXY A;  4G28 B;  2YI9 A;  3EFF K;  1AJN A;  2HG5 C;  4AIL C;  4L87 A;  2A79 B;  1AR4 A;  2ITD C;  4OXS A;  1KKC A;  1N34 O;  5IWA O;  2Y0I A;  2GTS A;  2UUA O;  3EVK A;  5JJJ B;  4LF6 O;  1S3J A;  1NTM H;  4UCO A;  3SYP A;  1K4D C;  3OE7 G;  4ZKI A;  3HKD B;  1OCO B;  4X65 O;  1YDX A;  2WLI B;  3K06 A;  4JI5 B;  4FJC C;  1MOF A;  3LNM B;  2V4D A;  3UKM A;  1J95 A;  5IJ0 B;  1FXK C;  2MW2 B;  5J2T B;  5JVD A;  2JRI A;  1KEC A;  2IM9 A;  1ZSP A;  3OEE G;  1WB7 A;  5C93 A;  3ZHU A;  3GWK C;  4X89 A;  4GKJ O;  3PN1 A;  1NU1 H;  3Q4H B;  2R9I A;  2D2C B;  1VEW A;  4JI7 B;  1OCC C;  2LW7 A;  4KUM A;  4IGG A;  3SJC C;  4B3T O;  1FYJ A;  3UCS C;  2WAM A;  1MNG A;  3HB3 B;  1Y76 A;  2ZKO A;  2X7R B;  5LYJ A;  1VMG A;  4X1Y A;  2Q68 A;  2BOC C;  4PA6 A;  3H1L H;  1F4N A;  3KKY A;  5EC1 C;  1Y66 A;  5B66 Z;  1XBL A;  3LSQ A;  5A2Q N;  4X9Q A;  2W6I G;  1HP8 A;  3ZHV A;  4DUY B;  2YIB D;  1M56 C;  1Q90 D;  2P06 A;  3QG5 A;  4FPP A;  4QIW F;  1QLE B;  5IJ9 B;  4PA7 A;  2EIL C;  2YID A;  4P2Z A;  1XNR O;  1QU7 A;  4DV4 B;  3ZJZ A;  4B7K A;  3STZ C;  3K79 A;  2W0F C;  2FTK A;  1GKF A;  3A0H Z;  3G6B A;  3M7M X;  3OTO O;  1K97 A;  1Y6X A;  4JI8 B;  1JFF B;  2BTQ A;  1M5I A;  1RFY A;  3N2K A;  4QNH B;  1KP2 A;  3E86 A;  5GON B;  2KKW A;  5JQG B;  5BZB A;  1IX9 A;  2ZR2 A;  3TXQ A;  1Y4M A;  3P32 A;  5K1P A;  2IU0 A;  1D5A A;  2BOB C;  2YS8 A;  3AK2 A;  1KUQ A;  3RYC B;  4TV8 A;  3ICX A;  5LOV B;  2XHB A;  2QKS A;  2M6Y A;  3K04 A;  4RQE A;  1IBM O;  4OX9 O;  3VBB A;  2EZO A;  4PHZ A;  3CCQ V;  5EC2 C;  5LMU B;  1FXV A;  4FMT A;  2P5O A;  2EUL A;  2ZDI A;  5EBM C;  3H01 A;  2HR3 A;  4J42 A;  4DRX A;  2JGD B;  1BT8 A;  1IBL B;  1EN6 A;  2LO1 A;  3B77 A;  2QKA A;  4LNU B;  4F4L A;  4CH5 A;  1YIT V;  2IU3 A;  4FLW A;  4Z1M G;  4X20 A;  4EB6 A;  3HKE A;  3CCE V;  1I5X A;  1NKD A;  2Q6A A;  2Q67 A;  4N21 A;  4X62 B;  3B8M A;  2K1E A;  3ETQ A;  3S3X A;  2OIE A;  4QGP A;  2F4V O;  4JAA A;  1K5S A;  1P49 A;  1BQ0 A;  4G2K A;  3WB2 A;  3UT5 B;  3ZMZ A;  4YY3 O;  4MTF A;  3OMN B;  3K5M A;  4F6R A;  1R3I C;  2Z5U A;  1IUR A;  4MTX A;  5IYD O;  2AHZ A;  3O65 A;  3ZRS A;  3ETG A;  4LF8 B;  3RFR A;  4KHP O;  2CTR A;  1UJW B;  3IC9 A;  4UV9 A;  3ZHT A;  3EXA A;  3JAT A;  2RQ6 A;  4D6T H;  3DTU B;  2Q8V A;  3RN4 A;  4JI2 B;  4HAM A;  5JVD B;  3OGC C;  1R73 A;  2UXC O;  2B9Z A;  4LH7 A;  2GHY A;  5IDJ A;  2G38 A;  3BVO A;  3CRA A;  4KL1 A;  1S72 V;  3SYQ A;  4QPJ A;  1SC5 B;  2LW1 A;  5B1A B;  3VQX A;  4HYO A;  5DM6 V;  3T4D A;  2RDC A;  3DGE A;  3BCC H;  1HWY A;  4UFZ A;  1IDS A;  1GK9 A;  3L70 H;  3QO5 A;  1NR7 A;  2OCC C;  1SES A;  2PUS A;  4D7T A;  1AP6 A;  3T1C A;  3QVN A;  3K0D A;  5LYJ B;  5FLX N;  4X1Y B;  1BZK A;  1XHX A; 
#chains in the Genus database with same CATH homology
 2HKO A;  2WSS G;  5LHI A;  2P90 A;  2WLL B;  1F51 A;  4JAU A;  3ZRV A;  1V55 B;  4MTO A;  2Z3Y A;  3R65 A;  3MHS C;  1YTF D;  2X6C A;  1RPR A;  3ASN C;  4Q20 A;  5CBG A;  4RO2 A;  3G4S V;  3ABK B;  3CCJ V;  2ITC C;  3E35 A;  2Y48 A;  5LGU A;  4YXW G;  1P7B A;  4TWK A;  2WLI A;  3RW0 A;  3WG7 B;  1NH2 D;  1N8R W;  1JOY A;  4TT3 G;  2JJ1 G;  4WFG A;  4DO2 A;  2HVJ C;  3FKS G;  3M99 B;  1JCH A;  1QR8 A;  2X6A A;  2EIK C;  4ASU G;  3CC4 V;  1DTO A;  1LNQ A;  3TET A;  3SYA A;  4R50 A;  2UXX A;  1E1Q G;  4LC1 A;  1ORQ C;  3G6E V;  2ZQM A;  3JD2 A;  4MSW C;  1R3K C;  3CYO A;  1AI6 A;  2UXN A;  1OCR C;  2XAJ A;  3X2Q C;  2WWW A;  5L3E A;  1AI4 A;  1YJW V;  3ASN B;  4P9P A;  3ZIA G;  4WFA V;  3ZMS A;  5LBQ A;  5LGN A;  2IH1 C;  2XAG A;  3JD0 A;  3I56 V;  1MG1 A;  1YSC A;  5B1B C;  4MT8 A;  3K0G A;  5H6R A;  2QA4 V;  2V1D A;  3TK1 A;  1PD3 A;  1GM7 A;  3OW2 U;  1RPO A;  1AI5 A;  3AG3 C;  1AJQ A;  2ZDI C;  1VQ8 V;  1R3J C;  2Y69 C;  3SYO A;  4JPR A;  3LUT B;  1OCZ C;  1K7D A;  1FXK A;  4MVO A;  1AJP A;  2KB1 A;  2YEV A;  4QPK A;  2A9H A;  3FB6 C;  3FB7 C;  3BEH A;  2EIK B;  4EKW A;  3JYC A;  1XL6 A;  3W7S A;  1QVF U;  1AI7 A;  1H38 A;  5HFL A;  3X2Q B;  1OCR B;  4I9W A;  3FYE B;  1EZJ A;  1KQS U;  1ZWI C;  4XBF A;  1KC8 W;  2XOK G;  2P67 A;  4I5S A;  3SPC A;  5B1B B;  4RUF A;  3QO7 A;  4JAS A;  3VOU A;  3MHH C;  1VQM V;  1Q81 W;  3AG1 C;  1VQ7 V;  3LDC A;  5KA5 A;  1JJ2 U;  3AG3 B;  2HFE C;  2XAQ A;  2Y69 B;  2F43 G;  2X6B A;  2ZXW C;  2LP7 A;  1OCZ B;  5L3B A;  1ARO P;  1WLE A;  2DYR C;  1NJI W;  3CC2 V;  3OR7 C;  3ZRX A;  2H94 A;  2M7W A;  3CPW U;  1VQ4 V;  3SPI A;  5IYB O;  5EBW C;  3CP1 A;  4FIP C;  4PDM A;  5FL7 G;  1I5Y A;  1PNK A;  5IYC O;  1XL4 A;  2WLM A;  1L1F A;  3AG4 C;  1W0K G;  3ZCC A;  3ZRW A;  3LDE A;  5L3D A;  3K3W A;  1K34 A;  2DYS C;  3W7U A;  1V54 C;  4G27 B;  3CC7 V;  1YTF B;  1JQ0 A;  3AG1 B;  3MD0 A;  5DN6 G;  3W7T A;  5B3S C;  2JEU A;  2DW4 A;  1QVG U;  3FB8 C;  2ZXW B;  3OMA B;  1S76 D;  1QR9 A;  1GM8 A;  1K4C C;  2OTL V;  2DYR B;  4CZZ A;  4H33 A;  1BHB A;  3ABK C;  4XDJ A;  1S5H C;  3OUS A;  1NVP B;  5HFM A;  2EIN C;  3RVY A;  3K03 A;  1S77 D;  2OTJ V;  1ROP A;  3JD1 A;  3RBZ A;  2V7Q G;  2YSU B;  2C2A A;  2DQ0 A;  5CA3 A;  4GCZ A;  1JX9 A;  2DYS B;  1G8M A;  1V54 B;  1DLB A;  1NBM G;  1CP9 A;  4BIZ A;  2ZD9 A;  4XDL A;  5L3C A;  2H8P C;  5B3S B;  4MS2 A;  1R6N A;  4RUE A;  1JVM A;  4XDK A;  5CN0 A;  2WLN A;  2PI4 A;  2IJH A;  3UM7 A;  4BAY A;  2DQ3 A;  3A0R A;  3F5W C;  1BMF G;  4QE9 A;  2WLH A;  5H6Q A;  1FFT B;  3ASO C;  1EBO A;  2EIN B;  3P30 A;  2QM8 A;  1WPX A;  1Q7Y W;  2EIM C;  1VQL V;  1K73 W;  1M1K W;  2DWD C;  1ENV A;  1SRY A;  2XAS A;  1CEZ A;  3TCU A;  1NVP D;  4HZ3 A;  1NR1 A;  1OCO C;  1PNM A;  5H9C A;  3OAA G;  4JTA B;  3F7Y C;  4G28 B;  4CBC A;  1B6Q A;  2JIZ G;  4GX2 A;  3EFF K;  1AJN A;  2HG5 C;  4L87 A;  2A79 B;  1K9M W;  2NNU A;  1E1R G;  3JD3 A;  2ITD C;  1GM9 A;  4GX5 A;  4OXS A;  1K92 A;  2DWE C;  1VQ6 V;  3ASO B;  1H2G A;  4PA9 A;  3OEH G;  2EIM B;  2P7T C;  3CD6 V;  1S3J A;  3CCU V;  3SYP A;  1K4D C;  3CCR V;  2Q69 A;  3OE7 G;  4FK5 C;  4U7N A;  4WFF A;  4ZKI A;  3E2E A;  3ABL C;  1OCO B;  1MAB G;  1Q82 W;  3W7W A;  4GX1 A;  4QJF B;  3CCM V;  1R3L C;  2A0L A;  2WLI B;  5CBH A;  3K06 A;  2IW5 A;  5LHH A;  4FJC C;  1MOF A;  3LNM B;  2QTO A;  3UKM A;  1AR1 B;  4MW8 A;  1J95 A;  4JF3 A;  4UV8 A;  5J9P C;  1FXK C;  4WFH A;  1GTO A;  3IGA C;  3GB7 C;  4LP8 A;  3OUF A;  1KEC A;  1F4M A;  3OEE G;  5B1N A;  3T4Z A;  5C93 A;  2AHY A;  4X89 A;  2XAF A;  3SPJ A;  1K5Q A;  3PJS K;  1SER A;  3SJQ C;  4UVA A;  1M57 C;  3ABL B;  4KP4 A;  3ABM C;  2JJ2 G;  3E8H A;  3D3I A;  2R9I A;  4P9O A;  4MVQ A;  4MVS A;  3AG2 C;  1S0V A;  1OCC C;  3SPH A;  4KUM A;  1BHA A;  1Q86 W;  1OHH G;  3B8N A;  1YIJ V;  4RQF A;  4N23 A;  4KFM A;  1SET A;  1FXK B;  1DF5 A;  4PDL A;  1KKD A;  1OZ0 A;  3ABU A;  4MTG A;  3W7X A;  4PDV A;  2WAM A;  1YI2 V;  3HB3 B;  1QLE C;  3ZN0 A;  3E8F A;  5KUK A;  2X7R B;  4H37 A;  3E83 A;  2JEX A;  2Q68 A;  3AEI A;  1H8H G;  3IC7 A;  2IJK A;  2EIJ C;  2BOC C;  2WLL A;  1M57 B;  4PA6 A;  1BL8 A;  3ABM B;  1F4N A;  4X8A A;  3AG2 B;  5EC1 C;  3SPG A;  1Y66 A;  3G71 V;  1OCC B;  3LSQ A;  2W6I G;  4MW3 A;  2MK3 A;  3LSS A;  1RM1 C;  1W0J G;  5CBF A;  1IXM A;  2LFR A;  1G4Y B;  1THZ A;  3QNE A;  1M56 C;  3CCL V;  2JDI G;  4LCU C;  2EZP A;  2CK3 G;  4FPP A;  4QIW F;  1QLE B;  3OFN G;  2WPD G;  1VQN V;  4PA7 A;  2EIL C;  4JGS A;  4P2Z A;  4R6Z A;  2P6J A;  3ZJZ A;  3STZ C;  3T2M A;  3K79 A;  2W0F C;  4JYB A;  3BY6 A;  2FTK A;  3SYC A;  3ZMV A;  1GKF A;  2EIJ B;  4PA4 A;  4R7C A;  3ZMU A;  1K97 A;  3ZRW B;  4ZBM A;  1PKX A;  4PA3 A;  1RM1 B;  4BW5 A;  4QNH B;  4WFE A;  5LHG A;  1KP2 A;  3E86 A;  3CCV V;  3I55 V;  2WLK A;  1CPY A;  5BZB A;  1M56 B;  2ZR2 A;  1Y4M A;  3E89 A;  3P32 A;  4UVC A;  2IU0 A;  1M9N A;  3ZMT A;  4MVZ A;  4UUJ C;  1YJN V;  4WF9 V;  3HPL C;  1GMG A;  2EIL B;  1EFR G;  3NXS A;  2BOB C;  3STL C;  1W2B U;  3GWO A;  1VQ9 V;  2LFS A;  2OCC B;  2QM7 A;  5IY5 C;  2B5U A;  2QKS A;  3ABT A;  4JTD B;  2HJF C;  3K04 A;  3OMI B;  2JK5 C;  1KP3 A;  4RQE A;  3QO8 A;  2ATK C;  1R6K A;  2PI5 A;  3VBB A;  2EZO A;  3CCQ V;  5EC2 C;  3CMA V;  1FXV A;  4FMT A;  3ETE A;  2GSM B;  3IFX A;  5B1O A;  2ZDI A;  4R8C A;  2B1G A;  1FS0 G;  5EBM C;  2QE7 G;  3H01 A;  2HR3 A;  2IH3 C;  1VQ5 V;  3E8G A;  3OM3 B;  4GX0 A;  2WLJ A;  4MVM A;  3CCS V;  1H8E G;  3B77 A;  2NLJ C;  3CXC U;  4F4L A;  5L3G A;  5CMU A;  2IJI A;  3F7V C;  3K9A A;  5E1A C;  1YIT V;  5IY5 B;  2IU3 A;  4JAV A;  4Z1M G;  1K33 A;  2EBO A;  3OR6 C;  1DF4 A;  3JD4 A;  4BIU A;  1M90 W;  3CCE V;  1I5X A;  1NKD A;  2Q6A A;  5KUM A;  3RVZ A;  2Q67 A;  4N21 A;  1SZT A;  3B8M A;  2K1E A;  2IJJ A;  3ML0 A;  4J9Y B;  1YHQ V;  4MVU A;  4UXN A;  1F23 A;  2XND G;  1K8A W;  1K5S A;  2ZR3 A;  4P30 A;  4RAI A;  2HVK C;  4G2K A;  3EHB B;  2D3O W;  2W6J G;  4TSF G;  3ZMZ A;  4PEL A;  4MTF A;  3OMN B;  4J9Z B;  2R9R B;  1R3I C;  4MVR A;  2Z5U A;  5GW7 A;  3ETD A;  4MTX A;  5B1A C;  5IYD O;  3CME V;  2AHZ A;  3ZRS A;  3LDD A;  3ETG A;  2YEV B;  1QLN A;  1E79 G;  1P4R A;  1VQP V;  1UJW B;  4UV9 A;  1COW G;  3ZN1 A;  1NQT A;  5EBL C;  5KA6 A;  4PDR A;  3FB5 C;  4JTC B;  4WCE V;  3DTU B;  1YJ9 V;  3WFV A;  2QEX V;  3D36 A;  4HAM A;  3OGC C;  1R73 A;  1VQK V;  2GHY A;  4GT1 A;  4UVB A;  5IDJ A;  1PL0 A;  1MSW D;  1S72 V;  3SYQ A;  4QPJ A;  5B1A B;  1GO3 F;  4HYO A;  5DM6 V;  2X0L A;  2XAH A;  2OT5 A;  1NH2 B;  3T4D A;  1KD1 W;  1V55 C;  4LBE C;  1TUE B;  3JCZ A;  5LGT A;  3DGE A;  3KG2 A;  4X88 A;  3FYI B;  1HWY A;  3E8B A;  3K08 A;  1GK9 A;  3QO5 A;  4U7O A;  5EK0 A;  1NR7 A;  4QE7 A;  2OCC C;  1SES A;  3WG7 C;  4DXW A;  1QBZ A;  1QCE A;  2HLD G;  4E2L A;  3T1C A;  1JPX A;  3AG4 B;  1K3E A;  2B1I A;  4JYC A;  4WFB V;  1FXH A;  5L3F A;  2EJR A;  3K0D A;  1VQO V;  1PNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...