5B1OA

Dhp domain structure of envz p248a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
AMAAGVKQLADDRTLLMAGVSHDLRTALTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ
publication title Angucycline antibiotic waldiomycin recognizes common structural motif conserved in bacterial histidine kinases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 25
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1oA00
4FMTA 2C2AA 4U7NA 3ZRVA 5IDJA 4KP4A 4JASA 4JAVA 2QM7A 4I5SA 4BIUA 4U7OA 4QPKA 2LFSA 4JAUA 3ZRWB 4JYBA 4FPPA 4JYCA 4MT8A 4GCZA 3MD0A 2LFRA 1F51A 3NXSA 5C93A 3D36A 4LC1A 4QPJA 4GT1A 3TK1A 4BIZA 4ZKIA 3DGEA 2FTKA 3P32A 1JOYA 5B1OA 3ZRWA 2WWWA 5B1NA 1IXMA 2P67A 3ZRXA 4MTXA 4Q20A 3A0RA 2QM8A 3ZCCA
chains in the Genus database with same CATH superfamily
4O4JB 3J7AU 2V4DA 2P5OA 4DR2O 1BMFG 2K9PA 4F6RA 4DV0O 4DV7B 2JEUA 1JA8A 1A32A 4I7ZB 2PY5A 4BWAA 2UXDB 3QVNA 3QO7A 3SJAC 5DM6V 4X1YB 2VWKA 2XT9A 3JAKB 2OWOA 4I4TA 4X89A 4DRXA 1XMOB 2JGUA 3GB7C 4JI4B 1KBHA 3ZBHA 3ZRWB 3VQXA 3B40A 3ZHUA 3ZRSA 1IURA 2Q6AA 3ICXA 5EK0A 2XAJA 4DV1O 4BIZA 3APQA 2LGWA 3LSQA 4PDRA 4OXSA 1QNMA 4YY3B 1QU7A 2HHHO 1N33O 4HYOA 1HNWO 5L3CA 3KCXA 1KP2A 3B8MA 1XMQO 4LFCB 1GAXA 4JAAA 1P7BA 2C2AA 4O4HA 2B5UA 5GTIZ 3W7UA 3T1CA 4UCSA 2YDEA 3LDDA 1VQPV 4B3SO 1WJZA 3A0BZ 5DN6G 2GBOA 1JJOA 4QNHB 5TISZ 4K35A 3AK3A 4DV2O 1QQCA 4WBNB 5L3DA 4N21A 2A06H 1WAZA 2WAMA 5KAFZ 1YZBA 2QR4A 2IM9A 4I5SA 2R9RB 4U3JA 4LFBB 3CRQA 3ZHRA 4LF8B 3LSSA 3BA9A 3TK1A 5CBFA 1BZKA 5DEDA 3GWKC 2D2CB 1JFFB 3SPJA 1RM1B 2WLLA 1M93A 4JPRA 3ZRVA 5B3SC 2P06A 2DW4A 2IJIA 4FLWA 3BA8A 2GUZA 2XUMA 4JI7B 2DWEC 3HKBA 2Y4UA 4GT1A 1YTFB 3G6BA 1V55C 1TUBA 5LGUA 3FB8C 3OM3B 1H8HG 3ABMB 3ETEA 3I56V 4FFBA 1Y66A 4MS2A 2ZIOA 2QM8A 3FYIB 4LFAB 3CD6V 3K59A 1Q90D 4BIUA 3CRCA 1OJHA 4DR1O 1H2GA 1KYOF 4FFKA 3A0HZ 4CS3A 3DTUB 4KHPB 3E89A 4PV1B 3HKEB 4F6EA 2F93B 5KHGA 1XI1A 1H8EG 2EIMB 2AXTZ 3EXAA 2WLIB 1AR1B 2ZXWC 3QF7A 3W7SA 3WB2A 1Z5WA 1FYJA 2YXYA 4FLYA 4O4LB 4OPAA 4ZOLB 4B3RO 3BFRA 4DUZO 1M4UA 4IHJB 2IJHA 3FFQA 1MG1A 4MTXA 3OMNB 2OCHA 4X66O 2WPDG 2EZOA 5LMNB 1Y76B 3OD4A 3STZC 1YJWV 3H01A 5B1AB 3RYIA 2QTSA 3T1HB 1XOUA 2EINB 4I50A 3VBBA 1Q7YW 3ETQA 1I94B 1F4MA 4N23A 4X1IA 5CBHA 1LNQA 3FD9A 3RYFA 2BTQA 1G8MA 1J5EB 1N34B 2H8PC 4P2ZA 2BE3A 3O65A 1KC8W 1QVFU 3AG4B 1XDCA 3BAAA 3IAYA 3ABUA 1E1QG 4NB5A 5JJNB 5IYZA 4WFBV 3ZMZA 3A8TA 3CE2A 1PNLA 5IJ0B 2W0XA 3H1LH 4O2AB 3F7VC 1K34A 4O2BB 2F23A 3CHXA 1K4CC 3SPGA 3MHHC 1TA8A 1NR1A 4HNAB 4RO2A 3ZN1A 3R66A 2KG7B 2K1EA 4LF7O 2GSMB 4JGSA 4DR5B 5BR8O 2BOCC 2QWQB 5IY5C 3OR6C 2LQTA 3P30A 5L3EA 1WA8B 2W6IG 4JAUA 5CN0A 4FM2A 4DW1A 1PNMA 1ZUQA 3CCRV 2YI8A 3HKCB 4D7TA 2UUAB 3ASNC 2EIKB 1SQXH 4GX5A 3SJBC 1K9MW 4TQFA 1RPOA 1VEWA 4GX2A 3E8FA 4CC6A 1IBKB 2CH7B 3K58A 4JYBA 5FNVB 4NXMO 4PA7A 4GUNA 2QTOA 4ZBMA 3FB7C 5EYPA 3RVYA 1OCCB 2EX3A 3DC5A 3ZMTA 2DYSB 3AG3C 1H2NA 2ZNIA 2CTWA 3JAWB 2O57A 2IU3A 1HP8A 3D3QA 3UT5B 2IH3C 1OCRB 3L74H 5CA1B 1HNXB 1OCOC 2ARHA 2GV9A 1N36B 1OCZB 1Z2GA 4X20A 1VQ9V 3ABKC 1ENVA 4KFMA 4JZGA 2OIGA 2EIJC 2F66C 2YC0A 2WLHA 3CS5A 4PI0A 2EILB 1B6QA 3UQ8A 1SA0B 2ITCC 5LOVB 4MVRA 3CCJV 4X1KA 2P7TC 3RYCA 2QWNB 3SR2C 4CC5A 2YIAA 4PA6A 2PI5A 4TOIA 4J10A 4TV9B 3MHSC 2VWJA 3JARA 1E79G 1Y4MA 3D36C 4FVMA 1L8DA 1M56B 1BL8A 2QWOB 1S5HC 4LR3A 4UVCA 2D3OW 4X65B 2CTPA 3L9DA 2BSKB 3K5NA 2Q7HA 4NR1A 4UB8Z 2QSAA 4EB6B 2GTSA 2F95B 4J80A 3NXSA 3G71V 1KKCA 3ZS8C 4A5UB 4P9PA 4LF4O 3M7MX 3RGBA 5GONB 1S76D 1GM8A 4JYAO 2IJJA 5JQGB 1SF9A 4LH6A 2ZIMA 3SGIA 4GKKB 2FB5A 3L75H 4PA9A 2Z3YA 2P4KA 2BTOA 4H37A 1H38A 1SQPH 4W4LA 4MW8A 2ZD9A 2XHBA 1YTFD 3N2GA 3ZJZA 1IZ3A 4YJ2A 1YI2V 4D7SA 1KMIZ 3RFRA 2F4VB 1NBMG 3OGCC 2ATKC 2ITDC 1ZAUA 4FLTA 2AHYA 3A0RA 3D8CA 4FIPC 4LF9O 3RWRD 5J2UA 5CMUA 3WG7C 5L3BA 1OV9A 3MDSA 4J7ZA 3MD0A 2VS0A 5GW7A 5LHGA 4DV6O 3K9AA 5LBQA 1IXBA 5CBGA 5EZYB 2DYRB 3CB2A 2CDYA 4R6ZA 4B3TB 3JD4A 3H1HH 1L1FA 2DE0X 4CZZA 4LNUA 4DW0A 4DR6B 2JS3A 3T1YO 5FPOA 4O4IB 3KKYA 4PA3A 4JI6O 2XASA 4TSFG 3T2MA 2ZR3A 1I0HA 1QVGU 5KMGA 3P3NA 4K8ZA 3N2KB 4MTFA 3JALB 3OT7A 4YHHB 4JI5B 1MSDA 1BE3H 3VQWA 4X64B 3KG2A 4PJ0Z 4ASUG 1BHAA 2LP7A 4ICGA 4UV8A 5JVDA 3HPLC 3OUSA 2UUBB 2Q7GA 5A2QN 3LDCA 2BOBC 5EC2C 3CRAA 4LC1A 3QO5A 4PDVA 2P90A 4I9WA 2IBZH 1SQQH 3IGAC 4DR4B 3OMAB 2R9IA 3VQYA 3HKDB 4PHZA 3RT3C 3OTOB 2ADPA 3STLC 3QTCA 4F4LA 2G38A 4DV7O 1FKAO 1BSMA 2PGGA 2UXDO 1FPOA 2Q68A 2UU9B 5K1PA 2N05A 4Q6GA 1RP3B 1ZL8A 2ODMA 2X6CA 1XMOO 4JI4O 3SYOA 1Y67A 2Y4TA 4JI2O 1QBZA 1P4RA 2JGDA 2CGOA 2UUCB 2ZDIA 1GK9A 2VQEB 2Q0AA 3E22A 1YDXA 4MVZA 1S5LZ 4TUYA 5IYBO 4JI1B 1CP9A 2XAGA 1I5YA 4LFCO 4DV3B 4XDJA 4KP4A 4JYYA 2RCVA 1ZWIC 1PL4A 5BMVB 4LF5O 1CEZA 1K4DC 1DK1A 2ZM6O 2DOSA 1SESA 1AVMA 5B3SB 1NS1A 2ZCEA 2NLJC 5LMUO 5EIBC 1QLNA 2R70A 4F6RB 1N4CA 3Q4HB 3ML0A 1KD1W 5LP6A 1KKDA 1V55B 1YXBA 2ZE5A 1NTKH 3JYCA 1EN4A 1MZFA 5B1BC 2A0LA 2ZE8A 4I4TB 3BCCH 5CA0B 1KUQA 4DRXB 1IX9A 3F7YC 1S5JA 1AP6A 3CCSV 4J42A 2Q4PA 2YS8A 1NJIW 2ILMA 1MSWD 2ADQB 3K79A 3G80A 2UXBB 1DGSA 2AGAA 3CPWU 1ROPA 4DR3B 3OEEG 1F4NA 3CCMV 4JI8O 2JIZG 1SERA 2QGNA 2PUSA 2BCCH 4QE9A 4JI7O 4O4HB 2LW7A 4GYCB 2ZXWB 2QKAA 3AG1C 2OIEA 3EFFK 4IYIA 5J9PC 1US6A 3J81N 2LJ2A 3ZEDA 5DECA 1MZEA 5A9GA 3E35A 4LFAO 1BS3A 2OT5A 4K0KO 1S3JA 4GLXA 4OX9O 4PELA 1EN5A 3FB5C 2X7RB 4NKGB 1VMGA 2Y69B 4ZKIA 1R73A 1W0KG 2ZDIC 1Q6IA 4U3JB 1AJPA 4I0XB 3RN4A 5EBMC 2YIBD 4U7NA 1L0LH 2CE4A 4LH7A 5IYDO 2LFSA 1YITV 2PTMA 5LGTA 2WLLB 1SETA 4E2LA 1M5IA 1QHTA 3WB0A 1NKDA 3H1JH 4MVOA 3SYQA 4G28B 1AROP 4BW9A 2HHHB 1N33B 4BR6A 4YIOA 2GUZB 1HNWB 4J41A 2HVKC 1XMQB 5FLXN 4DR7O 1HR0O 2Y48A 3FX7A 4G27B 2ZE6A 5LP6C 3AG7A 3D3IA 4E4EA 2Q8VA 5F2VO 1TUBB 1K5QA 5LA6A 2YUAA 3H1KH 4FFBB 2Q69A 3T1HO 1VQKV 4DV2B 1YVWA 1YIJV 2Y0IA 1H2LA 4HAMA 1I94O 4I55B 5E79Z 3QG5A 5JWPA 5BZBA 3SPCA 1J5EO 2E5LO 2DMXA 3SPHA 5KLVH 4RUEA 3K57A 5B66Z 1VQLV 4C7UA 5IY5B 1S72V 3SYAA 2LO1A 1PKXA 1D5NA 4B7EA 3DXRA 1F23A 3NR7A 3IC9A 3K3WA 2B1GA 4DUYB 2YEVA 1XNQO 1AILA 5H5NA 3GWOA 3ASNB 1K3EA 5IT9N 4UFZA 4JI3B 2R9AA 1Q43A 4QIWF 3UKMA 1IBLO 4TV8A 1Y76A 3P32A 4FK5C 1GN2A 3P3PA 2W0FC 1HW7A 4DR5O 1VF6A 5D5PA 3RYIB 4JASA 1WPBA 4DR1B 3AG3B 3CCUV 4DV4O 2Q9LA 4W4KA 4X1IB 1OCOB 4FM0A 4J9ZB 1NQTA 3RYFB 1FXVA 2BTQB 3ABKB 3W7XA 4K8XA 2ZQMA 2JJ2G 2EIJB 4DV5O 5EBLC 1EN6A 4X62B 1URFA 4R8CA 5IYZB 3OR7C 4B3RB 4DUZB 2A9HA 4IT5A 4IIJA 1SC5B 4RAIA 1WB7A 4ZHQB 1RSOB 1FXKA 2RMKB 2EJ7A 1HNXO 4HNAA 4MTGA 2L6LA 4LCUC 2KG7A 4JYCA 3ABTA 3DC6A 1P7GA 4B7KA 5BXZA 3CCQV 1GKFA 1GN4A 1FFXB 1CXZB 3C3TA 2VQFO 3JSLA 3EVKA 1JOYA 1AJNA 2M6YA 1QCEA 1IDSA 3DSQA 2VRZA 3CXCU 5FL7G 4CS4A 2UXCO 1SZXA 1GO3F 3E86A 1DF4A 5H6QA 1AI4A 1G1XB 4H33A 5FNVA 2UXXA 1JVMA 3E83A 1VF6C 1VIBA 2KSDA 4NTWA 5EYPB 4JAVA 2QE7G 1HNZO 3GVMA 3OUFA 5D5QA 3L73H 1TUEB 1VF5B 3MAQA 5ITZA 3BEHA 4JI0O 2QEXV 5L3FA 4LF6O 3DGEA 3WG7B 3TJTA 2HJFC 4H13B 4LF7B 1FD9A 1VQ7V 3AG4C 5LYJB 1AR4A 5BR8B 1VQ8V 4CS2A 1DTOA 3CEIA 1FJGB 4WFGA 1Z5VA 1F7YA 5IYCO 1W59A 4UCTA 4MSWC 4DYLA 2A79B 4X9QA 2WA3A 4X1KB 4P9OA 3HR0A 4JV5B 3RYCB 2F4VO 1SKVA 1X59A 1FXKC 2IW5A 2JJ1G 3JD1A 1R3IC 5K1XA 4RWUA 4EKWA 4NXMB 1PV0A 2IH1C 2E3CA 1K7DA 1XHXA 3CC4V 3AEIA 1XREA 1FS0G 3K04A 2Z0AA 2WWWA 4B3TO 1N32O 4BW5A 1YEWA 1FAFA 1YHQV 5JH7A 3TGUH 3CCLV 3E8BA 3H1IH 3F5TA 1VF7A 2KB1A 2LFRA 4H0LB 2EJRA 4QGPA 2ZR2A 1G4YB 1JR9A 1X4TA 1OZ0A 2ETNA 1JMKC 3N2GB 4RUFA 1NR7A 4YJ2B 4YJ3B 4NXNB 4NTYA 4X64O 1SRYA 3TXSA 2YXHA 2R72A 1H2MA 1OCCC 5KA6A 3ETGA 1WP8A 2UUBO 4B3MB 1GH6A 4GCZA 5CB4B 1IVSA 1GM9A 3W7TA 3TETA 3CCEV 4WFHA 1GRJA 2OTJV 5B1OA 1M57C 3AK2A 3JATB 5IJ9A 3OTOO 5J2TA 4ZI7A 1KQSU 4YXWG 4QJFB 3G4SV 2NNUA 2AZ2A 4LWSB 3OTFA 1Q5OA 3ETDA 4FLUA 3FAVB 1V54C 3X2QC 3JD3A 4FZ1A 4LF4B 3M99B 3EHBB 4JYAB 1SQVH 4YIPA 1UFIA 1NVPB 3HB3B 3SPIA 1N0JA 2RDCA 3JASA 3WU2Z 5KMGB 4AQYO 3K06A 1IBMB 3ZMSA 4HBNA 1QR9A 4QPKA 2LGQA 4EFEA 3OFNG 2P4VA 3VOUA 1PD3A 3ZHTA 4CH6A 5JVDB 5KX5A 2WSSG 3CJHB 4NYKA 3O9OA 1PP9H 3ZHVA 3PJSK 4MVUA 1I5XA 3UO2A 4JI1O 4LF9B 3QO8A 5HFMA 2F1MA 2ZINA 3UCSC 5LHHA 2YSUB 4U7OA 1XL4A 4LBEC 1KU9A 3RYHA 2H3OA 4PDMA 2HLDG 1CPYA 1E1RG 4DV6B 3OEHG 4K3AA 3S3XA 2E74B 5EBWC 1PPJH 3W7WA 3IC7A 5C8YA 4GX1A 3K0DA 3ZRXA 4QE7A 4IGGA 3THOA 4Z1VA 3H9VA 1DF5A 3T1YB 2OCCC 4FMTA 3CX5F 1P84F 3AG1B 3K08A 3N27A 4UB6Z 5LXTA 3ABLC 2DQ0A 4JZ2A 2X6BA 3B2EE 3IFXA 1KB9F 1XNRB 1XL6A 5IWAB 1F51A 5C93A 2CGNA 1ZL8B 2HVJC 2FTKA 2QKCA 1AB3A 4Z2WA 1HDJA 4JTCB 4YY3O 1TVKB 2CUGA 4KL1A 1P49A 2JGDB 2UXBO 2HG5C 4BAYA 1BQ0A 1Y74A 3E22B 5FPRA 1YJNV 3ZHQA 1M1KW 3ASOC 4KXRA 4WCEV 4TUYB 1T5EA 1QLEC 1O9GA 4O4JA 4GX0A 3SJQC 4L87A 2JDIG 3JD0A 5BMVA 1WN7A 1XILA 2QWPB 2OYQA 4AI8A 1NI8A 1AR5A 2FL4A 1Q6UA 3B4SA 3K5OA 4X1YA 3LDEA 5HFLA 4LFBO 1G6UA 3Q4HA 3JAKA 4LF8O 1GM7A 1MABG 5LP6B 3K0GA 2X0LA 3ZRWA 4WFEA 1R3LC 3L70H 4UXNA 1B06A 4IL6Z 1Q86W 5CA0A 3WFVA 1VQOV 3OMIB 4JTDB 3A2FA 2N04A 1NTMH 3FB6C 1Q6HA 4FPPA 4J11A 4JI2B 4GKJB 3AG2C 3G6EV 2HFEC 4UV9A 2DWDC 1JPXA 4L8JA 2QWRB 3OW2U 2GTAA 1IXMA 2P6JA 2NR5A 1ZLZA 3I55V 1GN3A 2A7WA 1EBOA 4MVMA 4FLVA 3E2EA 4DR2B 4AHCA 3L72H 4UCVA 4LF5B 4WBNA 1R3KC 3JAMN 2ZM6B 1TGOA 4DV0B 3U0ZA 1RFYA 2JVDA 4Z1MG 2F43G 2XTAA 4PD4F 2AZ0A 4KHPO 5LMUB 2XAHA 1H2SB 1KP3A 2KQXA 1XUQA 3OGIB 2PYJA 4UVBA 5IDJA 2P22C 1MNGA 1NZ6A 4D6TH 1SZTA 4I0XA 3J80N 1JFFA 4NVPA 2E76B 1D5AA 4DV1B 1YJ9V 5EC1C 1YF2A 1W0JG 3ZMVA 2PI4A 1Q3EA 3CC7V 3U11A 1K92A 1OHHG 2XAFA 5IE9A 4DUYO 3ZCCA 1VARA 2IU0A 3HKBB 2WLNA 1LUVA 2RNBA 5LMNO 3FYEB 4JI8B 4B3SB 2MW2B 4JI3O 1WNSA 4R50A 1BGYH 3BRCA 2Q7EA 4CH5A 2WLJA 5LA6B 1JJ2U 2DJVA 5JJJB 4I9QA 1H2KA 1U96A 4K0KB 4OX9B 1N34O 3HKEA 3K5MA 4I55A 1R6NA 1PNKA 4J9YB 5L3GA 2QDOA 2WLIA 3CC2V 2Q0OC 1LR1A 2HR3A 2YIDA 2UXNA 4O4LA 4ZOLA 4X62O 3CMEV 4RQEA 3DXRB 3CMAV 5JJEB 2MK3A 4IHJA 4UCRA 3S3WA 2YEVB 1NVPD 4ZIBA 2XOKG 4UCUA 5B5EZ 4X88A 5KUKA 2CAZC 4DR7B 4KUMA 1HR0B 3JSNA 5EIBD 4PA4A 4TV8B 2Y69C 2V1DA 5H6RA 2Q5ZA 1Q82W 4I50B 4DO2A 1ZTEA 3C3SA 1B3QA 2YXLA 1W2BU 1K5SA 4FZ0A 1RM1C 2ZE7A 1NH2D 4XBFA 2V7QG 2UUAO 1S0VA 3OE7G 3SJCC 1AI5A 2HKOA 3APOA 4MW3A 2E5LB 1BQZA 2EULA 3RW0A 1U97A 1AI7A 1TAEA 3M8AA 1R3JC 2XAQA 1IBKO 4MT8A 1NTZH 1J95A 3ABMC 5GTHZ 3CXHF 2B1IA 1JX9A 5IJ0A 3BY6A 2HP8A 4O2AA 2X6AA 4O2BA 3E8HA 2E75B 5E1AC 4FJCC 4X66B 1XNQB 1SQGA 1NU1H 3LNMB 1N36O 5KA5A 2AHZA 3UO3A 4IIJB 2PF4E 4ZHQA 1RSOA 1SQBH 3RVZA 1K97A 4PI2A 1FXKB 3CCVV 2IJKA 2B9ZA 2DN9A 1IBLB 3D36A 3CWBH 1WP7A 2EIMC 5LL6Y 1WA8A 4CBCA 4CH3A 2JS5A 2WA4A 3T4DA 4WF9V 4IYHA 2L35A 1FJGO 1FFXA 4J7KA 5LGNA 3HKCA 1EZVH 1AI6A 4DV4B 1YCIA 3I5DA 5H2FZ 1UJWB 1Q8IA 2YI9A 2GHYA 2EBOA 4JV5O 4BIOA 1DLBA 4MVQA 5JCOA 2CH7A 4DV5B 1R6TA 4G2KA 3RBZA 4B08A 3FKSG 5H9CA 2Q67A 3IJ4A 3SYCA 4NTXA 4X65O 5B1AC 3LUTB 3WB1A 1EFRG 1PM9A 4P30A 1R6KA 3K03A 4OGQB 2EINC 2LW1A 4AILC 3KCYA 3JAWA 3UT5A 5CA1A 1COWG 2QKSA 4UUJC 4X20B 1BT8A 1LUWA 3CRMA 1EM1A 1GMGA 1FFTB 3ZMUA 5ITZB 3E8GA 1XHZA 4DXWA 4XDKA 4EFBA 1JQ0A 4GKKO 1SA0A 5LOVA 1M57B 1VQ4V 4ABMA 4PDLA 5LYJA 1ZX3A 1N0NA 2VQFB 3OAAG 4JF3A 4MTOA 5LHIA 4XDLA 1WB8A 1V54B 3CP1A 4TV9A 3X2QB 4NXNO 1SS3A 4FLZA 3JARB 2FMLA 2DQ3A 1UPGA 2UXCB 5KHKA 4B3MO 5KAIZ 2RN9A 1XEQA 1HWYA 4EEQA 2BSKA 1WLEA 3QNEA 3BVOA 1XBLA 4EB6A 3LSUA 1MA1A 1VQMV 2YIBA 5B1NA 2P67A 1QR8A 3C90A 4DK1A 1EZJA 1FXHA 3JCUZ 2QM7A 4DR6O 5GONA 1HNZB 1D2DA 1MMMA 1R1BA 3VQVA 2EIKC 5JQGA 4DK0A 2ZKOA 4JI0B 4LF6B 3K9SA 4J7JA 5JH7B 2QM4A 3LNNA 3SYPA 1NT2B 2Y0PA 5JCOC 3TCUA 4TWKA 4YHHO 4Q20A 4JI5O 1K8AW 4H44B 2Z5UA 1GTOA 1IBMO 5KUMA 3B8NA 1AJQA 1I7FA 3CRRA 1M90W 3ZN0A 1GN6A 4X8AA 2DYSC 4LP8A 4YJ3A 2HEPA 2OCCB 1OCRC 4WFFA 1VQ5V 3B09A 4FLXA 3JCZA 1OCZC 5J2UB 3ZIAG 2FKXA 2H94A 3ABLB 1VQ6V 2NN4A 5CB4A 4DR4O 2N74A 2EZPA 2ZNJA 2JK5C 4TQDA 2EILC 5EZYA 3B77A 4UVAA 4GZRB 4CH4A 1O9HA 2GDSA 3JATA 1I08A 2PZSA 3U10A 3JD2A 5IJ9B 2M7WA 5J2TB 4LNUB 4ZI7B 1THZA 1Y6XA 1BHBA 1K33A 5BY1A 4O4IA 1WPXA 2XNDG 2ZT9B 4LWSA 3CYOA 2UU9O 3PN1A 3ASOB 1N32B 1QLEB 3FAVA 2KKWA 3AK1A 4OPHA 3N2KA 3JALA 1B04A 3UM7A 1ORQC 1M56C 3JASB 1XNRO 3TXQA 1RPRA 2CTQA 5IWAO 4FM1A 4WFAV 2UUCO 1Q81W 2JEXA 2WLKA 3BHPA 2VQEO 3T4ZA 1NH2B 2FYUH 4TT3G 4UCOA 3K5LA 5B1BB 1BCCH 4DV3O 5KX5B 2RJZA 3CJHA 3KZIZ 1M9NA 3ZX6A 1AP5A 1PL0A 5KHJA 1YSCA 2A3QA 3BPZA 3HKDA 4RQFA 5AG2A 4QPJA 4MVSA 4R7CA 1ZSPA 2QA4V 3AG2B 2Q73A 3G67A 3RYHB 2RQ6A 2QJ1A 1XQ8A 1MOFA 3SDLA 4JI6B 5C8YB 3BABA 5CA3A 1SQFA 3F5WC 2JRIA 2AW9A 2HJDA 3R65A 4U3FH 1KECA 2PYLA 4HZ3A 5LXTB 2CTRA 1VP7A 4AQYB 2CK3G 1V9PA 1N8RW 1S77D 1K73W 4DR3O 2DYRC 2WLMA 5KHIA 4JTAB 1TVKA 2OTLV 4GKJO 1VQNV 2W6JG 1JCHA 5KHHA 1Y74B 3CSXA 1L0NH 3L71H 2YICA 3ZHSA
chains in the Genus database with same CATH topology
1QCEA 5CMUA 3WG7C 5L3BA 1BMFG 1R6NA 3CXCU 5FL7G 1PNKA 1GO3F 3E86A 3MD0A 2JEUA 4J9YB 5L3GA 1DF4A 5GW7A 5H6QA 2WLIA 5LHGA 3K9AA 3CC2V 5LBQA 3QO7A 5CBGA 1AI4A 2DYRB 5DM6V 4H33A 2HR3A 4R6ZA 2UXXA 1JVMA 3JD4A 2UXNA 1L1FA 4CZZA 3E83A 3CMEV 4X89A 4JAVA 4RQEA 3GB7C 2QE7G 4PA3A 2XASA 4TSFG 3CMAV 3T2MA 2MK3A 2ZR3A 3OUFA 3ZRWB 1TUEB 1QVGU 3ZRSA 3BEHA 2Q6AA 5EK0A 2YEVB 2XAJA 1NVPD 2QEXV 5L3FA 2XOKG 4BIZA 3DGEA 3LSQA 4PDRA 3WG7B 4MTFA 2HJFC 4OXSA 4X88A 5KUKA 1VQ7V 4HYOA 3AG4C 4KUMA 5L3CA 1VQ8V 1KP2A 3B8MA 1DTOA 3KG2A 4ASUG 1P7BA 4WFGA 2LP7A 4PA4A 2C2AA 4UV8A 1BHAA 2Y69C 2V1DA 5H6RA 2B5UA 3HPLC 3OUSA 1Q82W 5IYCO 3W7UA 4DO2A 3T1CA 4MSWC 3LDDA 2A79B 1VQPV 3LDCA 2BOBC 5EC2C 1W2BU 1K5SA 4LC1A 1RM1C 3QO5A 5DN6G 4P9OA 1NH2D 4QNHB 4XBFA 4PDVA 2V7QG 2P90A 4I9WA 1S0VA 3OE7G 1AI5A 2HKOA 3IGAC 5L3DA 1FXKC 3OMAB 2R9IA 4N21A 2IW5A 2JJ1G 2WAMA 3JD1A 4MW3A 1R3IC 4I5SA 3RW0A 4EKWA 2R9RB 1AI7A 1R3JC 2XAQA 3STLC 4MT8A 3LSSA 4F4LA 2IH1C 1J95A 1K7DA 3ABMC 3CC4V 2B1IA 1JX9A 3AEIA 3TK1A 5CBFA 1FS0G 3BY6A 3K04A 2Q68A 2X6AA 2WWWA 3E8HA 5E1AC 4FJCC 4BW5A 3SPJA 1RM1B 2WLLA 1YHQV 4JPRA 3ZRVA 3LNMB 3CCLV 5B3SC 2X6CA 3E8BA 5KA5A 2AHZA 2DW4A 2IJIA 3SYOA 2KB1A 3RVZA 1K97A 1FXKB 3CCVV 2IJKA 2LFRA 1QBZA 1P4RA 3D36A 2DWEC 2EIMC 2EJRA 4GT1A 2ZR2A 1G4YB 1YTFB 2ZDIA 1OZ0A 1GK9A 4CBCA 1V55C 5LGUA 3FB8C 3OM3B 4MVZA 1H8HG 3ABMB 3T4DA 4WF9V 3ETEA 4RUFA 3I56V 5IYBO 1NR7A 1Y66A 4MS2A 1CP9A 2XAGA 1I5YA 2QM8A 1SRYA 4XDJA 3FYIB 5LGNA 4KP4A 1OCCC 5KA6A 3CD6V 3ETGA 4BIUA 1AI6A 1ZWIC 1CEZA 1H2GA 1K4DC 4GCZA 1UJWB 3DTUB 1SESA 1GM9A 3W7TA 2GHYA 5B3SB 3E89A 2EBOA 3TETA 3CCEV 2NLJC 4WFHA 2OTJV 1DLBA 4MVQA 1QLNA 5B1OA 4G2KA 3RBZA 1M57C 3FKSG 5H9CA 2Q67A 3SYCA 1H8EG 2EIMB 5B1AC 3LUTB 3ML0A 1KD1W 1EFRG 2WLIB 1KQSU 1KKDA 4YXWG 4QJFB 1AR1B 4P30A 1V55B 1R6KA 2ZXWC 3K03A 3G4SV 2EINC 3W7SA 2NNUA 3ETDA 3JYCA 1V54C 3X2QC 1COWG 3JD3A 5B1BC 2QKSA 2A0LA 4UUJC 3M99B 3EHBB 3F7YC 1NVPB 3CCSV 3HB3B 3SPIA 2IJHA 1GMGA 1NJIW 1FFTB 3ZMUA 1MG1A 4MTXA 3OMNB 1MSWD 3K79A 3E8GA 4DXWA 2WPDG 4XDKA 3K06A 1JQ0A 3ZMSA 2EZOA 1ROPA 3CPWU 1QR9A 4QPKA 1M57B 1VQ4V 3OEEG 1F4NA 3STZC 1YJWV 3CCMV 1SERA 2JIZG 4PDLA 3OFNG 3VOUA 3H01A 1PD3A 5B1AB 4QE9A 3OAAG 2ZXWB 2EINB 3VBBA 1Q7YW 2WSSG 4JF3A 3AG1C 4MTOA 5LHIA 1F4MA 3EFFK 3CP1A 1I5XA 1V54B 3PJSK 4MVUA 4N23A 4XDLA 3X2QB 5J9PC 5CBHA 1LNQA 3QO8A 5HFMA 1G8MA 2DQ3A 5LHHA 3E35A 2H8PC 4P2ZA 2OT5A 2YSUB 4U7OA 1XL4A 1S3JA 4PELA 4LBEC 1KC8W 1QVFU 3AG4B 3FB5C 4PDMA 2HLDG 2X7RB 1HWYA 3ABUA 1CPYA 1E1QG 1E1RG 1WLEA 3OEHG 3QNEA 2Y69B 4ZKIA 1R73A 1W0KG 2ZDIC 5EBWC 1VQMV 3W7WA 3IC7A 1AJPA 4GX1A 3K0DA 5B1NA 2P67A 3ZRXA 4QE7A 4WFBV 1QR8A 3ZMZA 1DF5A 5EBMC 1PNLA 1EZJA 1FXHA 2OCCC 4FMTA 4U7NA 2QM7A 3AG1B 3K08A 5IYDO 2LFSA 1YITV 3F7VC 5LGTA 1K34A 3ABLC 2DQ0A 2EIKC 2X6BA 3IFXA 1XL6A 1F51A 1K4CC 2WLLB 1SETA 3SPGA 3MHHC 4E2LA 5C93A 1NKDA 1NR1A 4RO2A 3ZN1A 2HVJC 4MVOA 3SYQA 4G28B 1AROP 2FTKA 3SYPA 4JTCB 3TCUA 4TWKA 2K1EA 2HVKC 2GSMB 4JGSA 4Q20A 1K8AW 2BOCC 2Y48A 5IY5C 2Z5UA 2HG5C 3OR6C 4G27B 1GTOA 3P30A 5KUMA 5L3EA 3B8NA 4BAYA 3D3IA 1AJQA 2W6IG 1K5QA 4JAUA 5CN0A 1M90W 1YJNV 3ZN0A 4X8AA 1M1KW 2DYSC 4LP8A 3ASOC 1PNMA 4WCEV 1QLEC 2OCCB 3CCRV 1OCRC 4WFFA 4GX0A 3SJQC 1VQ5V 2Q69A 4L87A 3JCZA 1VQKV 1OCZC 2JDIG 3ZIAG 2H94A 3JD0A 3ABLB 3ASNC 2EIKB 1YIJV 1VQ6V 4GX5A 4HAMA 1K9MW 2EZPA 5BZBA 2JK5C 3SPCA 1RPOA 4GX2A 2EILC 3SPHA 3E8FA 3B77A 4RUEA 4UVAA 3LDEA 4JYBA 5HFLA 4PA7A 3JD2A 1VQLV 1GM7A 2QTOA 5IY5B 2M7WA 1S72V 1MABG 4ZBMA 3SYAA 1PKXA 3FB7C 1THZA 3K0GA 1OCCB 3RVYA 1BHBA 1K33A 1WPXA 2X0LA 1F23A 2XNDG 3ZMTA 3CYOA 2DYSB 3AG3C 3ASOB 4WFEA 3ZRWA 3K3WA 1QLEB 2IU3A 1R3LC 2B1GA 2IH3C 1OCRB 1OCOC 4UXNA 2YEVA 1Q86W 3WFVA 1VQOV 1OCZB 3OMIB 1VQ9V 3GWOA 4JTDB 3ASNB 3ABKC 3FB6C 1ENVA 1K3EA 3UM7A 4KFMA 1ORQC 1M56C 4FPPA 3AG2C 2EIJC 1RPRA 3G6EV 4QIWF 2WLHA 3UKMA 4WFAV 2EILB 1B6QA 2HFEC 4UV9A 3P32A 2DWDC 2ITCC 4FK5C 1Q81W 1JPXA 2JEXA 2WLKA 4MVRA 3T4ZA 3OW2U 1IXMA 2P6JA 1NH2B 2W0FC 4TT3G 5B1BB 3CCJV 3I55V 2P7TC 1EBOA 4JASA 4MVMA 4PA6A 3E2EA 1M9NA 3AG3B 3CCUV 2PI5A 1R3KC 1PL0A 1OCOB 3MHSC 1YSCA 4Z1MG 2F43G 4J9ZB 1NQTA 4RQFA 1FXVA 4QPJA 1E79G 1Y4MA 3ABKB 3W7XA 4MVSA 2XAHA 4R7CA 1M56B 2QA4V 1BL8A 2ZQMA 3AG2B 2JJ2G 2EIJB 1S5HC 4UVCA 2D3OW 1KP3A 5EBLC 4UVBA 1MOFA 4R8CA 5IDJA 5CA3A 3F5WC 1SZTA 3NXSA 3OR7C 3G71V 3R65A 1YJ9V 2A9HA 4P9PA 1S76D 5EC1C 1GM8A 1W0JG 3ZMVA 1KECA 2PI4A 4RAIA 4HZ3A 2IJJA 3CC7V 1FXKA 1K92A 2CK3G 1OHHG 2XAFA 3ZCCA 2IU0A 4MTGA 2WLNA 4PA9A 2Z3YA 1N8RW 1K73W 1S77D 3FYEB 4LCUC 2DYRC 4H37A 2WLMA 1H38A 4JYCA 3ABTA 4JTAB 4MW8A 2ZD9A 2OTLV 1VQNV 1YTFD 3ZJZA 2W6JG 1YI2V 3CCQV 1GKFA 1JCHA 4R50A 1JOYA 1AJNA 1NBMG 3OGCC 2ATKC 2ITDC 2WLJA 2AHYA 3A0RA 1JJ2U 4FIPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMT A;  2C2A A;  4U7N A;  3ZRV A;  5IDJ A;  4KP4 A;  4JAS A;  4JAV A;  2QM7 A;  4I5S A;  4BIU A;  4U7O A;  4QPK A;  2LFS A;  4JAU A;  3ZRW B;  4JYB A;  4FPP A;  4JYC A;  4MT8 A;  4GCZ A;  3MD0 A;  2LFR A;  1F51 A;  3NXS A;  5C93 A;  3D36 A;  4LC1 A;  4QPJ A;  4GT1 A;  3TK1 A;  4BIZ A;  4ZKI A;  3DGE A;  2FTK A;  3P32 A;  1JOY A;  5B1O A;  3ZRW A;  2WWW A;  5B1N A;  1IXM A;  2P67 A;  3ZRX A;  4MTX A;  4Q20 A;  3A0R A;  2QM8 A;  3ZCC A; 
#chains in the Genus database with same CATH topology
 4O4J B;  3J7A U;  2V4D A;  2P5O A;  4DR2 O;  1BMF G;  2K9P A;  4F6R A;  4DV0 O;  4DV7 B;  2JEU A;  1JA8 A;  1A32 A;  4I7Z B;  2PY5 A;  4BWA A;  2UXD B;  3QVN A;  3QO7 A;  3SJA C;  5DM6 V;  4X1Y B;  2VWK A;  2XT9 A;  3JAK B;  2OWO A;  4I4T A;  4X89 A;  4DRX A;  1XMO B;  2JGU A;  3GB7 C;  4JI4 B;  1KBH A;  3ZBH A;  3ZRW B;  3VQX A;  3B40 A;  3ZHU A;  3ZRS A;  1IUR A;  2Q6A A;  3ICX A;  5EK0 A;  2XAJ A;  4DV1 O;  4BIZ A;  3APQ A;  2LGW A;  3LSQ A;  4PDR A;  4OXS A;  1QNM A;  4YY3 B;  1QU7 A;  2HHH O;  1N33 O;  4HYO A;  1HNW O;  5L3C A;  3KCX A;  1KP2 A;  3B8M A;  1XMQ O;  4LFC B;  1GAX A;  4JAA A;  1P7B A;  2C2A A;  4O4H A;  2B5U A;  5GTI Z;  3W7U A;  3T1C A;  4UCS A;  2YDE A;  3LDD A;  1VQP V;  4B3S O;  1WJZ A;  3A0B Z;  5DN6 G;  2GBO A;  1JJO A;  4QNH B;  5TIS Z;  4K35 A;  3AK3 A;  4DV2 O;  1QQC A;  4WBN B;  5L3D A;  4N21 A;  2A06 H;  1WAZ A;  2WAM A;  5KAF Z;  1YZB A;  2QR4 A;  2IM9 A;  4I5S A;  2R9R B;  4U3J A;  4LFB B;  3CRQ A;  3ZHR A;  4LF8 B;  3LSS A;  3BA9 A;  3TK1 A;  5CBF A;  1BZK A;  5DED A;  3GWK C;  2D2C B;  1JFF B;  3SPJ A;  1RM1 B;  2WLL A;  1M93 A;  4JPR A;  3ZRV A;  5B3S C;  2P06 A;  2DW4 A;  2IJI A;  4FLW A;  3BA8 A;  2GUZ A;  2XUM A;  4JI7 B;  2DWE C;  3HKB A;  2Y4U A;  4GT1 A;  1YTF B;  3G6B A;  1V55 C;  1TUB A;  5LGU A;  3FB8 C;  3OM3 B;  1H8H G;  3ABM B;  3ETE A;  3I56 V;  4FFB A;  1Y66 A;  4MS2 A;  2ZIO A;  2QM8 A;  3FYI B;  4LFA B;  3CD6 V;  3K59 A;  1Q90 D;  4BIU A;  3CRC A;  1OJH A;  4DR1 O;  1H2G A;  1KYO F;  4FFK A;  3A0H Z;  4CS3 A;  3DTU B;  4KHP B;  3E89 A;  4PV1 B;  3HKE B;  4F6E A;  2F93 B;  5KHG A;  1XI1 A;  1H8E G;  2EIM B;  2AXT Z;  3EXA A;  2WLI B;  1AR1 B;  2ZXW C;  3QF7 A;  3W7S A;  3WB2 A;  1Z5W A;  1FYJ A;  2YXY A;  4FLY A;  4O4L B;  4OPA A;  4ZOL B;  4B3R O;  3BFR A;  4DUZ O;  1M4U A;  4IHJ B;  2IJH A;  3FFQ A;  1MG1 A;  4MTX A;  3OMN B;  2OCH A;  4X66 O;  2WPD G;  2EZO A;  5LMN B;  1Y76 B;  3OD4 A;  3STZ C;  1YJW V;  3H01 A;  5B1A B;  3RYI A;  2QTS A;  3T1H B;  1XOU A;  2EIN B;  4I50 A;  3VBB A;  1Q7Y W;  3ETQ A;  1I94 B;  1F4M A;  4N23 A;  4X1I A;  5CBH A;  1LNQ A;  3FD9 A;  3RYF A;  2BTQ A;  1G8M A;  1J5E B;  1N34 B;  2H8P C;  4P2Z A;  2BE3 A;  3O65 A;  1KC8 W;  1QVF U;  3AG4 B;  1XDC A;  3BAA A;  3IAY A;  3ABU A;  1E1Q G;  4NB5 A;  5JJN B;  5IYZ A;  4WFB V;  3ZMZ A;  3A8T A;  3CE2 A;  1PNL A;  5IJ0 B;  2W0X A;  3H1L H;  4O2A B;  3F7V C;  1K34 A;  4O2B B;  2F23 A;  3CHX A;  1K4C C;  3SPG A;  3MHH C;  1TA8 A;  1NR1 A;  4HNA B;  4RO2 A;  3ZN1 A;  3R66 A;  2KG7 B;  2K1E A;  4LF7 O;  2GSM B;  4JGS A;  4DR5 B;  5BR8 O;  2BOC C;  2QWQ B;  5IY5 C;  3OR6 C;  2LQT A;  3P30 A;  5L3E A;  1WA8 B;  2W6I G;  4JAU A;  5CN0 A;  4FM2 A;  4DW1 A;  1PNM A;  1ZUQ A;  3CCR V;  2YI8 A;  3HKC B;  4D7T A;  2UUA B;  3ASN C;  2EIK B;  1SQX H;  4GX5 A;  3SJB C;  1K9M W;  4TQF A;  1RPO A;  1VEW A;  4GX2 A;  3E8F A;  4CC6 A;  1IBK B;  2CH7 B;  3K58 A;  4JYB A;  5FNV B;  4NXM O;  4PA7 A;  4GUN A;  2QTO A;  4ZBM A;  3FB7 C;  5EYP A;  3RVY A;  1OCC B;  2EX3 A;  3DC5 A;  3ZMT A;  2DYS B;  3AG3 C;  1H2N A;  2ZNI A;  2CTW A;  3JAW B;  2O57 A;  2IU3 A;  1HP8 A;  3D3Q A;  3UT5 B;  2IH3 C;  1OCR B;  3L74 H;  5CA1 B;  1HNX B;  1OCO C;  2ARH A;  2GV9 A;  1N36 B;  1OCZ B;  1Z2G A;  4X20 A;  1VQ9 V;  3ABK C;  1ENV A;  4KFM A;  4JZG A;  2OIG A;  2EIJ C;  2F66 C;  2YC0 A;  2WLH A;  3CS5 A;  4PI0 A;  2EIL B;  1B6Q A;  3UQ8 A;  1SA0 B;  2ITC C;  5LOV B;  4MVR A;  3CCJ V;  4X1K A;  2P7T C;  3RYC A;  2QWN B;  3SR2 C;  4CC5 A;  2YIA A;  4PA6 A;  2PI5 A;  4TOI A;  4J10 A;  4TV9 B;  3MHS C;  2VWJ A;  3JAR A;  1E79 G;  1Y4M A;  3D36 C;  4FVM A;  1L8D A;  1M56 B;  1BL8 A;  2QWO B;  1S5H C;  4LR3 A;  4UVC A;  2D3O W;  4X65 B;  2CTP A;  3L9D A;  2BSK B;  3K5N A;  2Q7H A;  4NR1 A;  4UB8 Z;  2QSA A;  4EB6 B;  2GTS A;  2F95 B;  4J80 A;  3NXS A;  3G71 V;  1KKC A;  3ZS8 C;  4A5U B;  4P9P A;  4LF4 O;  3M7M X;  3RGB A;  5GON B;  1S76 D;  1GM8 A;  4JYA O;  2IJJ A;  5JQG B;  1SF9 A;  4LH6 A;  2ZIM A;  3SGI A;  4GKK B;  2FB5 A;  3L75 H;  4PA9 A;  2Z3Y A;  2P4K A;  2BTO A;  4H37 A;  1H38 A;  1SQP H;  4W4L A;  4MW8 A;  2ZD9 A;  2XHB A;  1YTF D;  3N2G A;  3ZJZ A;  1IZ3 A;  4YJ2 A;  1YI2 V;  4D7S A;  1KMI Z;  3RFR A;  2F4V B;  1NBM G;  3OGC C;  2ATK C;  2ITD C;  1ZAU A;  4FLT A;  2AHY A;  3A0R A;  3D8C A;  4FIP C;  4LF9 O;  3RWR D;  5J2U A;  5CMU A;  3WG7 C;  5L3B A;  1OV9 A;  3MDS A;  4J7Z A;  3MD0 A;  2VS0 A;  5GW7 A;  5LHG A;  4DV6 O;  3K9A A;  5LBQ A;  1IXB A;  5CBG A;  5EZY B;  2DYR B;  3CB2 A;  2CDY A;  4R6Z A;  4B3T B;  3JD4 A;  3H1H H;  1L1F A;  2DE0 X;  4CZZ A;  4LNU A;  4DW0 A;  4DR6 B;  2JS3 A;  3T1Y O;  5FPO A;  4O4I B;  3KKY A;  4PA3 A;  4JI6 O;  2XAS A;  4TSF G;  3T2M A;  2ZR3 A;  1I0H A;  1QVG U;  5KMG A;  3P3N A;  4K8Z A;  3N2K B;  4MTF A;  3JAL B;  3OT7 A;  4YHH B;  4JI5 B;  1MSD A;  1BE3 H;  3VQW A;  4X64 B;  3KG2 A;  4PJ0 Z;  4ASU G;  1BHA A;  2LP7 A;  4ICG A;  4UV8 A;  5JVD A;  3HPL C;  3OUS A;  2UUB B;  2Q7G A;  5A2Q N;  3LDC A;  2BOB C;  5EC2 C;  3CRA A;  4LC1 A;  3QO5 A;  4PDV A;  2P90 A;  4I9W A;  2IBZ H;  1SQQ H;  3IGA C;  4DR4 B;  3OMA B;  2R9I A;  3VQY A;  3HKD B;  4PHZ A;  3RT3 C;  3OTO B;  2ADP A;  3STL C;  3QTC A;  4F4L A;  2G38 A;  4DV7 O;  1FKA O;  1BSM A;  2PGG A;  2UXD O;  1FPO A;  2Q68 A;  2UU9 B;  5K1P A;  2N05 A;  4Q6G A;  1RP3 B;  1ZL8 A;  2ODM A;  2X6C A;  1XMO O;  4JI4 O;  3SYO A;  1Y67 A;  2Y4T A;  4JI2 O;  1QBZ A;  1P4R A;  2JGD A;  2CGO A;  2UUC B;  2ZDI A;  1GK9 A;  2VQE B;  2Q0A A;  3E22 A;  1YDX A;  4MVZ A;  1S5L Z;  4TUY A;  5IYB O;  4JI1 B;  1CP9 A;  2XAG A;  1I5Y A;  4LFC O;  4DV3 B;  4XDJ A;  4KP4 A;  4JYY A;  2RCV A;  1ZWI C;  1PL4 A;  5BMV B;  4LF5 O;  1CEZ A;  1K4D C;  1DK1 A;  2ZM6 O;  2DOS A;  1SES A;  1AVM A;  5B3S B;  1NS1 A;  2ZCE A;  2NLJ C;  5LMU O;  5EIB C;  1QLN A;  2R70 A;  4F6R B;  1N4C A;  3Q4H B;  3ML0 A;  1KD1 W;  5LP6 A;  1KKD A;  1V55 B;  1YXB A;  2ZE5 A;  1NTK H;  3JYC A;  1EN4 A;  1MZF A;  5B1B C;  2A0L A;  2ZE8 A;  4I4T B;  3BCC H;  5CA0 B;  1KUQ A;  4DRX B;  1IX9 A;  3F7Y C;  1S5J A;  1AP6 A;  3CCS V;  4J42 A;  2Q4P A;  2YS8 A;  1NJI W;  2ILM A;  1MSW D;  2ADQ B;  3K79 A;  3G80 A;  2UXB B;  1DGS A;  2AGA A;  3CPW U;  1ROP A;  4DR3 B;  3OEE G;  1F4N A;  3CCM V;  4JI8 O;  2JIZ G;  1SER A;  2QGN A;  2PUS A;  2BCC H;  4QE9 A;  4JI7 O;  4O4H B;  2LW7 A;  4GYC B;  2ZXW B;  2QKA A;  3AG1 C;  2OIE A;  3EFF K;  4IYI A;  5J9P C;  1US6 A;  3J81 N;  2LJ2 A;  3ZED A;  5DEC A;  1MZE A;  5A9G A;  3E35 A;  4LFA O;  1BS3 A;  2OT5 A;  4K0K O;  1S3J A;  4GLX A;  4OX9 O;  4PEL A;  1EN5 A;  3FB5 C;  2X7R B;  4NKG B;  1VMG A;  2Y69 B;  4ZKI A;  1R73 A;  1W0K G;  2ZDI C;  1Q6I A;  4U3J B;  1AJP A;  4I0X B;  3RN4 A;  5EBM C;  2YIB D;  4U7N A;  1L0L H;  2CE4 A;  4LH7 A;  5IYD O;  2LFS A;  1YIT V;  2PTM A;  5LGT A;  2WLL B;  1SET A;  4E2L A;  1M5I A;  1QHT A;  3WB0 A;  1NKD A;  3H1J H;  4MVO A;  3SYQ A;  4G28 B;  1ARO P;  4BW9 A;  2HHH B;  1N33 B;  4BR6 A;  4YIO A;  2GUZ B;  1HNW B;  4J41 A;  2HVK C;  1XMQ B;  5FLX N;  4DR7 O;  1HR0 O;  2Y48 A;  3FX7 A;  4G27 B;  2ZE6 A;  5LP6 C;  3AG7 A;  3D3I A;  4E4E A;  2Q8V A;  5F2V O;  1TUB B;  1K5Q A;  5LA6 A;  2YUA A;  3H1K H;  4FFB B;  2Q69 A;  3T1H O;  1VQK V;  4DV2 B;  1YVW A;  1YIJ V;  2Y0I A;  1H2L A;  4HAM A;  1I94 O;  4I55 B;  5E79 Z;  3QG5 A;  5JWP A;  5BZB A;  3SPC A;  1J5E O;  2E5L O;  2DMX A;  3SPH A;  5KLV H;  4RUE A;  3K57 A;  5B66 Z;  1VQL V;  4C7U A;  5IY5 B;  1S72 V;  3SYA A;  2LO1 A;  1PKX A;  1D5N A;  4B7E A;  3DXR A;  1F23 A;  3NR7 A;  3IC9 A;  3K3W A;  2B1G A;  4DUY B;  2YEV A;  1XNQ O;  1AIL A;  5H5N A;  3GWO A;  3ASN B;  1K3E A;  5IT9 N;  4UFZ A;  4JI3 B;  2R9A A;  1Q43 A;  4QIW F;  3UKM A;  1IBL O;  4TV8 A;  1Y76 A;  3P32 A;  4FK5 C;  1GN2 A;  3P3P A;  2W0F C;  1HW7 A;  4DR5 O;  1VF6 A;  5D5P A;  3RYI B;  4JAS A;  1WPB A;  4DR1 B;  3AG3 B;  3CCU V;  4DV4 O;  2Q9L A;  4W4K A;  4X1I B;  1OCO B;  4FM0 A;  4J9Z B;  1NQT A;  3RYF B;  1FXV A;  2BTQ B;  3ABK B;  3W7X A;  4K8X A;  2ZQM A;  2JJ2 G;  2EIJ B;  4DV5 O;  5EBL C;  1EN6 A;  4X62 B;  1URF A;  4R8C A;  5IYZ B;  3OR7 C;  4B3R B;  4DUZ B;  2A9H A;  4IT5 A;  4IIJ A;  1SC5 B;  4RAI A;  1WB7 A;  4ZHQ B;  1RSO B;  1FXK A;  2RMK B;  2EJ7 A;  1HNX O;  4HNA A;  4MTG A;  2L6L A;  4LCU C;  2KG7 A;  4JYC A;  3ABT A;  3DC6 A;  1P7G A;  4B7K A;  5BXZ A;  3CCQ V;  1GKF A;  1GN4 A;  1FFX B;  1CXZ B;  3C3T A;  2VQF O;  3JSL A;  3EVK A;  1JOY A;  1AJN A;  2M6Y A;  1QCE A;  1IDS A;  3DSQ A;  2VRZ A;  3CXC U;  5FL7 G;  4CS4 A;  2UXC O;  1SZX A;  1GO3 F;  3E86 A;  1DF4 A;  5H6Q A;  1AI4 A;  1G1X B;  4H33 A;  5FNV A;  2UXX A;  1JVM A;  3E83 A;  1VF6 C;  1VIB A;  2KSD A;  4NTW A;  5EYP B;  4JAV A;  2QE7 G;  1HNZ O;  3GVM A;  3OUF A;  5D5Q A;  3L73 H;  1TUE B;  1VF5 B;  3MAQ A;  5ITZ A;  3BEH A;  4JI0 O;  2QEX V;  5L3F A;  4LF6 O;  3DGE A;  3WG7 B;  3TJT A;  2HJF C;  4H13 B;  4LF7 B;  1FD9 A;  1VQ7 V;  3AG4 C;  5LYJ B;  1AR4 A;  5BR8 B;  1VQ8 V;  4CS2 A;  1DTO A;  3CEI A;  1FJG B;  4WFG A;  1Z5V A;  1F7Y A;  5IYC O;  1W59 A;  4UCT A;  4MSW C;  4DYL A;  2A79 B;  4X9Q A;  2WA3 A;  4X1K B;  4P9O A;  3HR0 A;  4JV5 B;  3RYC B;  2F4V O;  1SKV A;  1X59 A;  1FXK C;  2IW5 A;  2JJ1 G;  3JD1 A;  1R3I C;  5K1X A;  4RWU A;  4EKW A;  4NXM B;  1PV0 A;  2IH1 C;  2E3C A;  1K7D A;  1XHX A;  3CC4 V;  3AEI A;  1XRE A;  1FS0 G;  3K04 A;  2Z0A A;  2WWW A;  4B3T O;  1N32 O;  4BW5 A;  1YEW A;  1FAF A;  1YHQ V;  5JH7 A;  3TGU H;  3CCL V;  3E8B A;  3H1I H;  3F5T A;  1VF7 A;  2KB1 A;  2LFR A;  4H0L B;  2EJR A;  4QGP A;  2ZR2 A;  1G4Y B;  1JR9 A;  1X4T A;  1OZ0 A;  2ETN A;  1JMK C;  3N2G B;  4RUF A;  1NR7 A;  4YJ2 B;  4YJ3 B;  4NXN B;  4NTY A;  4X64 O;  1SRY A;  3TXS A;  2YXH A;  2R72 A;  1H2M A;  1OCC C;  5KA6 A;  3ETG A;  1WP8 A;  2UUB O;  4B3M B;  1GH6 A;  4GCZ A;  5CB4 B;  1IVS A;  1GM9 A;  3W7T A;  3TET A;  3CCE V;  4WFH A;  1GRJ A;  2OTJ V;  5B1O A;  1M57 C;  3AK2 A;  3JAT B;  5IJ9 A;  3OTO O;  5J2T A;  4ZI7 A;  1KQS U;  4YXW G;  4QJF B;  3G4S V;  2NNU A;  2AZ2 A;  4LWS B;  3OTF A;  1Q5O A;  3ETD A;  4FLU A;  3FAV B;  1V54 C;  3X2Q C;  3JD3 A;  4FZ1 A;  4LF4 B;  3M99 B;  3EHB B;  4JYA B;  1SQV H;  4YIP A;  1UFI A;  1NVP B;  3HB3 B;  3SPI A;  1N0J A;  2RDC A;  3JAS A;  3WU2 Z;  5KMG B;  4AQY O;  3K06 A;  1IBM B;  3ZMS A;  4HBN A;  1QR9 A;  4QPK A;  2LGQ A;  4EFE A;  3OFN G;  2P4V A;  3VOU A;  1PD3 A;  3ZHT A;  4CH6 A;  5JVD B;  5KX5 A;  2WSS G;  3CJH B;  4NYK A;  3O9O A;  1PP9 H;  3ZHV A;  3PJS K;  4MVU A;  1I5X A;  3UO2 A;  4JI1 O;  4LF9 B;  3QO8 A;  5HFM A;  2F1M A;  2ZIN A;  3UCS C;  5LHH A;  2YSU B;  4U7O A;  1XL4 A;  4LBE C;  1KU9 A;  3RYH A;  2H3O A;  4PDM A;  2HLD G;  1CPY A;  1E1R G;  4DV6 B;  3OEH G;  4K3A A;  3S3X A;  2E74 B;  5EBW C;  1PPJ H;  3W7W A;  3IC7 A;  5C8Y A;  4GX1 A;  3K0D A;  3ZRX A;  4QE7 A;  4IGG A;  3THO A;  4Z1V A;  3H9V A;  1DF5 A;  3T1Y B;  2OCC C;  4FMT A;  3CX5 F;  1P84 F;  3AG1 B;  3K08 A;  3N27 A;  4UB6 Z;  5LXT A;  3ABL C;  2DQ0 A;  4JZ2 A;  2X6B A;  3B2E E;  3IFX A;  1KB9 F;  1XNR B;  1XL6 A;  5IWA B;  1F51 A;  5C93 A;  2CGN A;  1ZL8 B;  2HVJ C;  2FTK A;  2QKC A;  1AB3 A;  4Z2W A;  1HDJ A;  4JTC B;  4YY3 O;  1TVK B;  2CUG A;  4KL1 A;  1P49 A;  2JGD B;  2UXB O;  2HG5 C;  4BAY A;  1BQ0 A;  1Y74 A;  3E22 B;  5FPR A;  1YJN V;  3ZHQ A;  1M1K W;  3ASO C;  4KXR A;  4WCE V;  4TUY B;  1T5E A;  1QLE C;  1O9G A;  4O4J A;  4GX0 A;  3SJQ C;  4L87 A;  2JDI G;  3JD0 A;  5BMV A;  1WN7 A;  1XIL A;  2QWP B;  2OYQ A;  4AI8 A;  1NI8 A;  1AR5 A;  2FL4 A;  1Q6U A;  3B4S A;  3K5O A;  4X1Y A;  3LDE A;  5HFL A;  4LFB O;  1G6U A;  3Q4H A;  3JAK A;  4LF8 O;  1GM7 A;  1MAB G;  5LP6 B;  3K0G A;  2X0L A;  3ZRW A;  4WFE A;  1R3L C;  3L70 H;  4UXN A;  1B06 A;  4IL6 Z;  1Q86 W;  5CA0 A;  3WFV A;  1VQO V;  3OMI B;  4JTD B;  3A2F A;  2N04 A;  1NTM H;  3FB6 C;  1Q6H A;  4FPP A;  4J11 A;  4JI2 B;  4GKJ B;  3AG2 C;  3G6E V;  2HFE C;  4UV9 A;  2DWD C;  1JPX A;  4L8J A;  2QWR B;  3OW2 U;  2GTA A;  1IXM A;  2P6J A;  2NR5 A;  1ZLZ A;  3I55 V;  1GN3 A;  2A7W A;  1EBO A;  4MVM A;  4FLV A;  3E2E A;  4DR2 B;  4AHC A;  3L72 H;  4UCV A;  4LF5 B;  4WBN A;  1R3K C;  3JAM N;  2ZM6 B;  1TGO A;  4DV0 B;  3U0Z A;  1RFY A;  2JVD A;  4Z1M G;  2F43 G;  2XTA A;  4PD4 F;  2AZ0 A;  4KHP O;  5LMU B;  2XAH A;  1H2S B;  1KP3 A;  2KQX A;  1XUQ A;  3OGI B;  2PYJ A;  4UVB A;  5IDJ A;  2P22 C;  1MNG A;  1NZ6 A;  4D6T H;  1SZT A;  4I0X A;  3J80 N;  1JFF A;  4NVP A;  2E76 B;  1D5A A;  4DV1 B;  1YJ9 V;  5EC1 C;  1YF2 A;  1W0J G;  3ZMV A;  2PI4 A;  1Q3E A;  3CC7 V;  3U11 A;  1K92 A;  1OHH G;  2XAF A;  5IE9 A;  4DUY O;  3ZCC A;  1VAR A;  2IU0 A;  3HKB B;  2WLN A;  1LUV A;  2RNB A;  5LMN O;  3FYE B;  4JI8 B;  4B3S B;  2MW2 B;  4JI3 O;  1WNS A;  4R50 A;  1BGY H;  3BRC A;  2Q7E A;  4CH5 A;  2WLJ A;  5LA6 B;  1JJ2 U;  2DJV A;  5JJJ B;  4I9Q A;  1H2K A;  1U96 A;  4K0K B;  4OX9 B;  1N34 O;  3HKE A;  3K5M A;  4I55 A;  1R6N A;  1PNK A;  4J9Y B;  5L3G A;  2QDO A;  2WLI A;  3CC2 V;  2Q0O C;  1LR1 A;  2HR3 A;  2YID A;  2UXN A;  4O4L A;  4ZOL A;  4X62 O;  3CME V;  4RQE A;  3DXR B;  3CMA V;  5JJE B;  2MK3 A;  4IHJ A;  4UCR A;  3S3W A;  2YEV B;  1NVP D;  4ZIB A;  2XOK G;  4UCU A;  5B5E Z;  4X88 A;  5KUK A;  2CAZ C;  4DR7 B;  4KUM A;  1HR0 B;  3JSN A;  5EIB D;  4PA4 A;  4TV8 B;  2Y69 C;  2V1D A;  5H6R A;  2Q5Z A;  1Q82 W;  4I50 B;  4DO2 A;  1ZTE A;  3C3S A;  1B3Q A;  2YXL A;  1W2B U;  1K5S A;  4FZ0 A;  1RM1 C;  2ZE7 A;  1NH2 D;  4XBF A;  2V7Q G;  2UUA O;  1S0V A;  3OE7 G;  3SJC C;  1AI5 A;  2HKO A;  3APO A;  4MW3 A;  2E5L B;  1BQZ A;  2EUL A;  3RW0 A;  1U97 A;  1AI7 A;  1TAE A;  3M8A A;  1R3J C;  2XAQ A;  1IBK O;  4MT8 A;  1NTZ H;  1J95 A;  3ABM C;  5GTH Z;  3CXH F;  2B1I A;  1JX9 A;  5IJ0 A;  3BY6 A;  2HP8 A;  4O2A A;  2X6A A;  4O2B A;  3E8H A;  2E75 B;  5E1A C;  4FJC C;  4X66 B;  1XNQ B;  1SQG A;  1NU1 H;  3LNM B;  1N36 O;  5KA5 A;  2AHZ A;  3UO3 A;  4IIJ B;  2PF4 E;  4ZHQ A;  1RSO A;  1SQB H;  3RVZ A;  1K97 A;  4PI2 A;  1FXK B;  3CCV V;  2IJK A;  2B9Z A;  2DN9 A;  1IBL B;  3D36 A;  3CWB H;  1WP7 A;  2EIM C;  5LL6 Y;  1WA8 A;  4CBC A;  4CH3 A;  2JS5 A;  2WA4 A;  3T4D A;  4WF9 V;  4IYH A;  2L35 A;  1FJG O;  1FFX A;  4J7K A;  5LGN A;  3HKC A;  1EZV H;  1AI6 A;  4DV4 B;  1YCI A;  3I5D A;  5H2F Z;  1UJW B;  1Q8I A;  2YI9 A;  2GHY A;  2EBO A;  4JV5 O;  4BIO A;  1DLB A;  4MVQ A;  5JCO A;  2CH7 A;  4DV5 B;  1R6T A;  4G2K A;  3RBZ A;  4B08 A;  3FKS G;  5H9C A;  2Q67 A;  3IJ4 A;  3SYC A;  4NTX A;  4X65 O;  5B1A C;  3LUT B;  3WB1 A;  1EFR G;  1PM9 A;  4P30 A;  1R6K A;  3K03 A;  4OGQ B;  2EIN C;  2LW1 A;  4AIL C;  3KCY A;  3JAW A;  3UT5 A;  5CA1 A;  1COW G;  2QKS A;  4UUJ C;  4X20 B;  1BT8 A;  1LUW A;  3CRM A;  1EM1 A;  1GMG A;  1FFT B;  3ZMU A;  5ITZ B;  3E8G A;  1XHZ A;  4DXW A;  4XDK A;  4EFB A;  1JQ0 A;  4GKK O;  1SA0 A;  5LOV A;  1M57 B;  1VQ4 V;  4ABM A;  4PDL A;  5LYJ A;  1ZX3 A;  1N0N A;  2VQF B;  3OAA G;  4JF3 A;  4MTO A;  5LHI A;  4XDL A;  1WB8 A;  1V54 B;  3CP1 A;  4TV9 A;  3X2Q B;  4NXN O;  1SS3 A;  4FLZ A;  3JAR B;  2FML A;  2DQ3 A;  1UPG A;  2UXC B;  5KHK A;  4B3M O;  5KAI Z;  2RN9 A;  1XEQ A;  1HWY A;  4EEQ A;  2BSK A;  1WLE A;  3QNE A;  3BVO A;  1XBL A;  4EB6 A;  3LSU A;  1MA1 A;  1VQM V;  2YIB A;  5B1N A;  2P67 A;  1QR8 A;  3C90 A;  4DK1 A;  1EZJ A;  1FXH A;  3JCU Z;  2QM7 A;  4DR6 O;  5GON A;  1HNZ B;  1D2D A;  1MMM A;  1R1B A;  3VQV A;  2EIK C;  5JQG A;  4DK0 A;  2ZKO A;  4JI0 B;  4LF6 B;  3K9S A;  4J7J A;  5JH7 B;  2QM4 A;  3LNN A;  3SYP A;  1NT2 B;  2Y0P A;  5JCO C;  3TCU A;  4TWK A;  4YHH O;  4Q20 A;  4JI5 O;  1K8A W;  4H44 B;  2Z5U A;  1GTO A;  1IBM O;  5KUM A;  3B8N A;  1AJQ A;  1I7F A;  3CRR A;  1M90 W;  3ZN0 A;  1GN6 A;  4X8A A;  2DYS C;  4LP8 A;  4YJ3 A;  2HEP A;  2OCC B;  1OCR C;  4WFF A;  1VQ5 V;  3B09 A;  4FLX A;  3JCZ A;  1OCZ C;  5J2U B;  3ZIA G;  2FKX A;  2H94 A;  3ABL B;  1VQ6 V;  2NN4 A;  5CB4 A;  4DR4 O;  2N74 A;  2EZP A;  2ZNJ A;  2JK5 C;  4TQD A;  2EIL C;  5EZY A;  3B77 A;  4UVA A;  4GZR B;  4CH4 A;  1O9H A;  2GDS A;  3JAT A;  1I08 A;  2PZS A;  3U10 A;  3JD2 A;  5IJ9 B;  2M7W A;  5J2T B;  4LNU B;  4ZI7 B;  1THZ A;  1Y6X A;  1BHB A;  1K33 A;  5BY1 A;  4O4I A;  1WPX A;  2XND G;  2ZT9 B;  4LWS A;  3CYO A;  2UU9 O;  3PN1 A;  3ASO B;  1N32 B;  1QLE B;  3FAV A;  2KKW A;  3AK1 A;  4OPH A;  3N2K A;  3JAL A;  1B04 A;  3UM7 A;  1ORQ C;  1M56 C;  3JAS B;  1XNR O;  3TXQ A;  1RPR A;  2CTQ A;  5IWA O;  4FM1 A;  4WFA V;  2UUC O;  1Q81 W;  2JEX A;  2WLK A;  3BHP A;  2VQE O;  3T4Z A;  1NH2 B;  2FYU H;  4TT3 G;  4UCO A;  3K5L A;  5B1B B;  1BCC H;  4DV3 O;  5KX5 B;  2RJZ A;  3CJH A;  3KZI Z;  1M9N A;  3ZX6 A;  1AP5 A;  1PL0 A;  5KHJ A;  1YSC A;  2A3Q A;  3BPZ A;  3HKD A;  4RQF A;  5AG2 A;  4QPJ A;  4MVS A;  4R7C A;  1ZSP A;  2QA4 V;  3AG2 B;  2Q73 A;  3G67 A;  3RYH B;  2RQ6 A;  2QJ1 A;  1XQ8 A;  1MOF A;  3SDL A;  4JI6 B;  5C8Y B;  3BAB A;  5CA3 A;  1SQF A;  3F5W C;  2JRI A;  2AW9 A;  2HJD A;  3R65 A;  4U3F H;  1KEC A;  2PYL A;  4HZ3 A;  5LXT B;  2CTR A;  1VP7 A;  4AQY B;  2CK3 G;  1V9P A;  1N8R W;  1S77 D;  1K73 W;  4DR3 O;  2DYR C;  2WLM A;  5KHI A;  4JTA B;  1TVK A;  2OTL V;  4GKJ O;  1VQN V;  2W6J G;  1JCH A;  5KHH A;  1Y74 B;  3CSX A;  1L0N H;  3L71 H;  2YIC A;  3ZHS A; 
#chains in the Genus database with same CATH homology
 1QCE A;  5CMU A;  3WG7 C;  5L3B A;  1BMF G;  1R6N A;  3CXC U;  5FL7 G;  1PNK A;  1GO3 F;  3E86 A;  3MD0 A;  2JEU A;  4J9Y B;  5L3G A;  1DF4 A;  5GW7 A;  5H6Q A;  2WLI A;  5LHG A;  3K9A A;  3CC2 V;  5LBQ A;  3QO7 A;  5CBG A;  1AI4 A;  2DYR B;  5DM6 V;  4H33 A;  2HR3 A;  4R6Z A;  2UXX A;  1JVM A;  3JD4 A;  2UXN A;  1L1F A;  4CZZ A;  3E83 A;  3CME V;  4X89 A;  4JAV A;  4RQE A;  3GB7 C;  2QE7 G;  4PA3 A;  2XAS A;  4TSF G;  3CMA V;  3T2M A;  2MK3 A;  2ZR3 A;  3OUF A;  3ZRW B;  1TUE B;  1QVG U;  3ZRS A;  3BEH A;  2Q6A A;  5EK0 A;  2YEV B;  2XAJ A;  1NVP D;  2QEX V;  5L3F A;  2XOK G;  4BIZ A;  3DGE A;  3LSQ A;  4PDR A;  3WG7 B;  4MTF A;  2HJF C;  4OXS A;  4X88 A;  5KUK A;  1VQ7 V;  4HYO A;  3AG4 C;  4KUM A;  5L3C A;  1VQ8 V;  1KP2 A;  3B8M A;  1DTO A;  3KG2 A;  4ASU G;  1P7B A;  4WFG A;  2LP7 A;  4PA4 A;  2C2A A;  4UV8 A;  1BHA A;  2Y69 C;  2V1D A;  5H6R A;  2B5U A;  3HPL C;  3OUS A;  1Q82 W;  5IYC O;  3W7U A;  4DO2 A;  3T1C A;  4MSW C;  3LDD A;  2A79 B;  1VQP V;  3LDC A;  2BOB C;  5EC2 C;  1W2B U;  1K5S A;  4LC1 A;  1RM1 C;  3QO5 A;  5DN6 G;  4P9O A;  1NH2 D;  4QNH B;  4XBF A;  4PDV A;  2V7Q G;  2P90 A;  4I9W A;  1S0V A;  3OE7 G;  1AI5 A;  2HKO A;  3IGA C;  5L3D A;  1FXK C;  3OMA B;  2R9I A;  4N21 A;  2IW5 A;  2JJ1 G;  2WAM A;  3JD1 A;  4MW3 A;  1R3I C;  4I5S A;  3RW0 A;  4EKW A;  2R9R B;  1AI7 A;  1R3J C;  2XAQ A;  3STL C;  4MT8 A;  3LSS A;  4F4L A;  2IH1 C;  1J95 A;  1K7D A;  3ABM C;  3CC4 V;  2B1I A;  1JX9 A;  3AEI A;  3TK1 A;  5CBF A;  1FS0 G;  3BY6 A;  3K04 A;  2Q68 A;  2X6A A;  2WWW A;  3E8H A;  5E1A C;  4FJC C;  4BW5 A;  3SPJ A;  1RM1 B;  2WLL A;  1YHQ V;  4JPR A;  3ZRV A;  3LNM B;  3CCL V;  5B3S C;  2X6C A;  3E8B A;  5KA5 A;  2AHZ A;  2DW4 A;  2IJI A;  3SYO A;  2KB1 A;  3RVZ A;  1K97 A;  1FXK B;  3CCV V;  2IJK A;  2LFR A;  1QBZ A;  1P4R A;  3D36 A;  2DWE C;  2EIM C;  2EJR A;  4GT1 A;  2ZR2 A;  1G4Y B;  1YTF B;  2ZDI A;  1OZ0 A;  1GK9 A;  4CBC A;  1V55 C;  5LGU A;  3FB8 C;  3OM3 B;  4MVZ A;  1H8H G;  3ABM B;  3T4D A;  4WF9 V;  3ETE A;  4RUF A;  3I56 V;  5IYB O;  1NR7 A;  1Y66 A;  4MS2 A;  1CP9 A;  2XAG A;  1I5Y A;  2QM8 A;  1SRY A;  4XDJ A;  3FYI B;  5LGN A;  4KP4 A;  1OCC C;  5KA6 A;  3CD6 V;  3ETG A;  4BIU A;  1AI6 A;  1ZWI C;  1CEZ A;  1H2G A;  1K4D C;  4GCZ A;  1UJW B;  3DTU B;  1SES A;  1GM9 A;  3W7T A;  2GHY A;  5B3S B;  3E89 A;  2EBO A;  3TET A;  3CCE V;  2NLJ C;  4WFH A;  2OTJ V;  1DLB A;  4MVQ A;  1QLN A;  5B1O A;  4G2K A;  3RBZ A;  1M57 C;  3FKS G;  5H9C A;  2Q67 A;  3SYC A;  1H8E G;  2EIM B;  5B1A C;  3LUT B;  3ML0 A;  1KD1 W;  1EFR G;  2WLI B;  1KQS U;  1KKD A;  4YXW G;  4QJF B;  1AR1 B;  4P30 A;  1V55 B;  1R6K A;  2ZXW C;  3K03 A;  3G4S V;  2EIN C;  3W7S A;  2NNU A;  3ETD A;  3JYC A;  1V54 C;  3X2Q C;  1COW G;  3JD3 A;  5B1B C;  2QKS A;  2A0L A;  4UUJ C;  3M99 B;  3EHB B;  3F7Y C;  1NVP B;  3CCS V;  3HB3 B;  3SPI A;  2IJH A;  1GMG A;  1NJI W;  1FFT B;  3ZMU A;  1MG1 A;  4MTX A;  3OMN B;  1MSW D;  3K79 A;  3E8G A;  4DXW A;  2WPD G;  4XDK A;  3K06 A;  1JQ0 A;  3ZMS A;  2EZO A;  1ROP A;  3CPW U;  1QR9 A;  4QPK A;  1M57 B;  1VQ4 V;  3OEE G;  1F4N A;  3STZ C;  1YJW V;  3CCM V;  1SER A;  2JIZ G;  4PDL A;  3OFN G;  3VOU A;  3H01 A;  1PD3 A;  5B1A B;  4QE9 A;  3OAA G;  2ZXW B;  2EIN B;  3VBB A;  1Q7Y W;  2WSS G;  4JF3 A;  3AG1 C;  4MTO A;  5LHI A;  1F4M A;  3EFF K;  3CP1 A;  1I5X A;  1V54 B;  3PJS K;  4MVU A;  4N23 A;  4XDL A;  3X2Q B;  5J9P C;  5CBH A;  1LNQ A;  3QO8 A;  5HFM A;  1G8M A;  2DQ3 A;  5LHH A;  3E35 A;  2H8P C;  4P2Z A;  2OT5 A;  2YSU B;  4U7O A;  1XL4 A;  1S3J A;  4PEL A;  4LBE C;  1KC8 W;  1QVF U;  3AG4 B;  3FB5 C;  4PDM A;  2HLD G;  2X7R B;  1HWY A;  3ABU A;  1CPY A;  1E1Q G;  1E1R G;  1WLE A;  3OEH G;  3QNE A;  2Y69 B;  4ZKI A;  1R73 A;  1W0K G;  2ZDI C;  5EBW C;  1VQM V;  3W7W A;  3IC7 A;  1AJP A;  4GX1 A;  3K0D A;  5B1N A;  2P67 A;  3ZRX A;  4QE7 A;  4WFB V;  1QR8 A;  3ZMZ A;  1DF5 A;  5EBM C;  1PNL A;  1EZJ A;  1FXH A;  2OCC C;  4FMT A;  4U7N A;  2QM7 A;  3AG1 B;  3K08 A;  5IYD O;  2LFS A;  1YIT V;  3F7V C;  5LGT A;  1K34 A;  3ABL C;  2DQ0 A;  2EIK C;  2X6B A;  3IFX A;  1XL6 A;  1F51 A;  1K4C C;  2WLL B;  1SET A;  3SPG A;  3MHH C;  4E2L A;  5C93 A;  1NKD A;  1NR1 A;  4RO2 A;  3ZN1 A;  2HVJ C;  4MVO A;  3SYQ A;  4G28 B;  1ARO P;  2FTK A;  3SYP A;  4JTC B;  3TCU A;  4TWK A;  2K1E A;  2HVK C;  2GSM B;  4JGS A;  4Q20 A;  1K8A W;  2BOC C;  2Y48 A;  5IY5 C;  2Z5U A;  2HG5 C;  3OR6 C;  4G27 B;  1GTO A;  3P30 A;  5KUM A;  5L3E A;  3B8N A;  4BAY A;  3D3I A;  1AJQ A;  2W6I G;  1K5Q A;  4JAU A;  5CN0 A;  1M90 W;  1YJN V;  3ZN0 A;  4X8A A;  1M1K W;  2DYS C;  4LP8 A;  3ASO C;  1PNM A;  4WCE V;  1QLE C;  2OCC B;  3CCR V;  1OCR C;  4WFF A;  4GX0 A;  3SJQ C;  1VQ5 V;  2Q69 A;  4L87 A;  3JCZ A;  1VQK V;  1OCZ C;  2JDI G;  3ZIA G;  2H94 A;  3JD0 A;  3ABL B;  3ASN C;  2EIK B;  1YIJ V;  1VQ6 V;  4GX5 A;  4HAM A;  1K9M W;  2EZP A;  5BZB A;  2JK5 C;  3SPC A;  1RPO A;  4GX2 A;  2EIL C;  3SPH A;  3E8F A;  3B77 A;  4RUE A;  4UVA A;  3LDE A;  4JYB A;  5HFL A;  4PA7 A;  3JD2 A;  1VQL V;  1GM7 A;  2QTO A;  5IY5 B;  2M7W A;  1S72 V;  1MAB G;  4ZBM A;  3SYA A;  1PKX A;  3FB7 C;  1THZ A;  3K0G A;  1OCC B;  3RVY A;  1BHB A;  1K33 A;  1WPX A;  2X0L A;  1F23 A;  2XND G;  3ZMT A;  3CYO A;  2DYS B;  3AG3 C;  3ASO B;  4WFE A;  3ZRW A;  3K3W A;  1QLE B;  2IU3 A;  1R3L C;  2B1G A;  2IH3 C;  1OCR B;  1OCO C;  4UXN A;  2YEV A;  1Q86 W;  3WFV A;  1VQO V;  1OCZ B;  3OMI B;  1VQ9 V;  3GWO A;  4JTD B;  3ASN B;  3ABK C;  3FB6 C;  1ENV A;  1K3E A;  3UM7 A;  4KFM A;  1ORQ C;  1M56 C;  4FPP A;  3AG2 C;  2EIJ C;  1RPR A;  3G6E V;  4QIW F;  2WLH A;  3UKM A;  4WFA V;  2EIL B;  1B6Q A;  2HFE C;  4UV9 A;  3P32 A;  2DWD C;  2ITC C;  4FK5 C;  1Q81 W;  1JPX A;  2JEX A;  2WLK A;  4MVR A;  3T4Z A;  3OW2 U;  1IXM A;  2P6J A;  1NH2 B;  2W0F C;  4TT3 G;  5B1B B;  3CCJ V;  3I55 V;  2P7T C;  1EBO A;  4JAS A;  4MVM A;  4PA6 A;  3E2E A;  1M9N A;  3AG3 B;  3CCU V;  2PI5 A;  1R3K C;  1PL0 A;  1OCO B;  3MHS C;  1YSC A;  4Z1M G;  2F43 G;  4J9Z B;  1NQT A;  4RQF A;  1FXV A;  4QPJ A;  1E79 G;  1Y4M A;  3ABK B;  3W7X A;  4MVS A;  2XAH A;  4R7C A;  1M56 B;  2QA4 V;  1BL8 A;  2ZQM A;  3AG2 B;  2JJ2 G;  2EIJ B;  1S5H C;  4UVC A;  2D3O W;  1KP3 A;  5EBL C;  4UVB A;  1MOF A;  4R8C A;  5IDJ A;  5CA3 A;  3F5W C;  1SZT A;  3NXS A;  3OR7 C;  3G71 V;  3R65 A;  1YJ9 V;  2A9H A;  4P9P A;  1S76 D;  5EC1 C;  1GM8 A;  1W0J G;  3ZMV A;  1KEC A;  2PI4 A;  4RAI A;  4HZ3 A;  2IJJ A;  3CC7 V;  1FXK A;  1K92 A;  2CK3 G;  1OHH G;  2XAF A;  3ZCC A;  2IU0 A;  4MTG A;  2WLN A;  4PA9 A;  2Z3Y A;  1N8R W;  1K73 W;  1S77 D;  3FYE B;  4LCU C;  2DYR C;  4H37 A;  2WLM A;  1H38 A;  4JYC A;  3ABT A;  4JTA B;  4MW8 A;  2ZD9 A;  2OTL V;  1VQN V;  1YTF D;  3ZJZ A;  2W6J G;  1YI2 V;  3CCQ V;  1GKF A;  1JCH A;  4R50 A;  1JOY A;  1AJN A;  1NBM G;  3OGC C;  2ATK C;  2ITD C;  2WLJ A;  2AHY A;  3A0R A;  1JJ2 U;  4FIP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...