5B1OA

Dhp domain structure of envz p248a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'AMAAGVKQLADDRTLLMAGVSHDLRTALTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ
publication title Angucycline antibiotic waldiomycin recognizes common structural motif conserved in bacterial histidine kinases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 25
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1oA00
4FMTA 4I5SA 3TK1A 4QPJA 2LFRA 1F51A 3P32A 2WWWA 4MT8A 4JYCA 3ZRWB 3ZRXA 2FTKA 4U7NA 4GCZA 5B1NA 5C93A 4JASA 4KP4A 3MD0A 1IXMA 4U7OA 2QM7A 4BIZA 3ZCCA 3A0RA 5B1OA 4GT1A 4JYBA 4LC1A 3ZRVA 2LFSA 4ZKIA 1JOYA 4MTXA 2C2AA 3NXSA 4JAUA 4QPKA 2QM8A 3DGEA 4JAVA 4Q20A 4BIUA 5IDJA 4FPPA 3D36A 2P67A 3ZRWA
chains in the Genus database with same CATH superfamily
1I0HA 2X7RB 3W7SA 3B8NA 3W7XA 2EILC 2B1IA 1FXKA 1SRYA 3VQWA 1SKVA 4G2KA 5JH7A 2EJRA 2A79B 3OGCC 4DR1B 1J5EO 2JEUA 2PZSA 5LL6Y 3CB2A 1EN5A 3AG3B 4DV1B 4UV8A 2LW1A 4DV5O 1RPRA 3S3WA 2CDYA 5JCOA 2ZDIA 4MTFA 4DR5O 3RT3C 3WG7C 2LFRA 2X6BA 2WLMA 3JSNA 1VEWA 3WB1A 1H2MA 4LF9B 2JS5A 5KHIA 2QWPB 3JARA 2Y69C 4DW1A 3AK2A 2PY5A 4FPPA 1D5AA 2IH1C 4GYCB 2CGOA 1YCIA 4YJ3B 3E22A 1Z5VA 2Y4UA 2ZM6O 4MVRA 2Q5ZA 4MVSA 1KD1W 1L0LH 3QNEA 1PNMA 5EK0A 2XAFA 1BGYH 4P2ZA 4X1YB 3G67A 3ABKB 3K03A 2AHYA 1VARA 4JYAO 3HKBB 4I9WA 5GW7A 3APOA 4YJ3A 4CS4A 3G80A 4ZKIA 2YICA 3J7AU 3RGBA 5IY5C 4U3JA 4X1YA 4PHZA 4IYHA 5C8YA 3N27A 4WBNB 3T1YO 4KHPB 1AR5A 4X1KB 2VQFO 3HKBA 4RO2A 4UFZA 5DEDA 4B3TO 2OIEA 4GLXA 4JZGA 1NVPB 3OMNB 4DR4B 4DV6B 4P30A 3SYQA 3B09A 3R65A 3HKEB 3ZN1A 2F23A 3JD1A 4DV7O 1XDCA 3K0DA 2PYLA 3UCSC 4X1KA 5BY1A 4X62O 3STLC 5IYCO 1Y6XA 1SS3A 1M56B 4DR3B 3JAWB 2VQEO 1WJZA 1B04A 1DLBA 3QVNA 3HKEA 4JI5B 4YIPA 4B3SO 4DR6B 2Z0AA 5IJ9B 5L3FA 2JVDA 2YIBA 3JAWA 3STZC 1S3JA 4JGSA 1TUBB 2F95B 4DW0A 2EILB 1XEQA 2P90A 5H2FZ 1XMQB 1AVMA 2EINB 1F23A 1VQMV 3DC5A 4B3RO 1OCRB 2R9RB 3WG7B 2DQ3A 1HNZO 2RQ6A 2XASA 1NR7A 4BR6A 3C90A 4K0KB 3ZRXA 3D3IA 3CRQA 4BW9A 2CTQA 5A9GA 4B08A 5FNVB 5IJ0B 4ZBMA 1COWG 5LP6C 2QM7A 2DE0X 2Y69B 3FKSG 4YXWG 4X1IA 3E8BA 2RJZA 5LXTB 3TCUA 1AJNA 4WFGA 4PA9A 2V4DA 1RPOA 5FNVA 2ZE5A 3OT7A 4QGPA 1Q3EA 4LNUA 3MHHC 2N04A 1KKCA 5HFMA 3W7WA 4TT3G 1OV9A 4DRXB 1Q7YW 1YVWA 4FLUA 1EBOA 3TXSA 1AR4A 2DQ0A 2A06H 5J9PC 1MG1A 4X64B 5IY5B 1CEZA 2ZR2A 4CH5A 2KQXA 4DV3B 1NU1H 3ZMUA 1TVKB 2W0FC 3SJCC 1AB3A 4DRXA 2B5UA 1H2LA 4B7EA 1E1QG 3T4ZA 3G71V 4X20B 3UO3A 4B3MO 3JCZA 4IT5A 4JI0O 1GKFA 3FAVB 2H3OA 2QM8A 1TVKA 2QKCA 5CA3A 2L35A 1YJ9V 2P5OA 3CCSV 2JJ1G 1P49A 2YEVB 4X20A 2QWOB 3BAAA 4FK5C 2VRZA 3QG5A 3FAVA 3HR0A 1NTKH 1U97A 5BXZA 1YXBA 3S3XA 1IVSA 1LUWA 3ZHVA 1S76D 3E35A 1L8DA 2UU9B 3ZRVA 1GTOA 4BIUA 4MVUA 2E3CA 3P3PA 3KCXA 4UCUA 3G6BA 4PDVA 1QLNA 5KAIZ 5EYPA 2ZE6A 1X4TA 3CHXA 1B3QA 2BSKB 3UQ8A 2IJKA 3CP1A 2X6CA 3ZMZA 3AK3A 3KZIZ 4I9QA 3LDDA 4TQDA 1Q90D 2WLKA 1F51A 3OTFA 3IAYA 1FFXB 4JYCA 1AI7A 3ZHSA 3ICXA 3TGUH 5LP6B 4HYOA 3RBZA 1E1RG 1HNXO 3G6EV 3BY6A 1GRJA 3HB3B 5LBQA 4EB6B 1NJIW 1K3EA 2HHHO 1F4MA 3CX5F 3KKYA 1P4RA 2F4VB 2IJHA 1FFXA 2Q7GA 5LP6A 4LFAB 4H37A 5IYBO 2AW9A 3TETA 3CJHB 4IGGA 4EB6A 3CRRA 5B1NA 1AP5A 3LNMB 4X8AA 3DSQA 5JJJB 4X65B 3HPLC 4MVZA 2E5LO 1GM8A 1QQCA 5A2QN 2H8PC 1XREA 2UUCO 4JI2O 3CJHA 4I7ZB 1L1FA 4LF6B 4G28B 2CGNA 2UXBB 1FKAO 5D5PA 3ZMTA 4J80A 2Q7HA 1NKDA 2LGWA 1DK1A 1TA8A 2YSUB 1VP7A 1XHZA 2DWEC 2O57A 2UUBO 1BZKA 3LSUA 1KC8W 3WB0A 1ZL8B 4J11A 1SQPH 1GN3A 2EBOA 2P4VA 2OTJV 3BRCA 1LR1A 2E75B 1ZL8A 4OX9B 1HWYA 4R7CA 2UXCO 1NVPD 4KFMA 2ADQB 5EZYB 2A7WA 2ZE7A 1IXBA 1VQNV 4GT1A 2ATKC 1FJGB 3FYIB 4I4TA 1FAFA 4DYLA 1S72V 2BCCH 2UXNA 1GM9A 3W7UA 2YS8A 4HBNA 2YIBD 4F4LA 3SYPA 5BR8B 2ZKOA 3CRMA 1F4NA 1UFIA 4J42A 2Y0IA 1F7YA 4NYKA 3AG1C 3B8MA 1SQVH 2Y48A 4TUYB 4F6RA 4K35A 5D5QA 3JAMN 5AG2A 1G4YB 4ICGA 2P22C 3LNNA 4UV9A 3BA9A 4JTDB 4FLZA 1VQ6V 4PDMA 4FM2A 2EZOA 4TV9B 4UVCA 1G8MA 3P32A 5B1BC 1SA0A 2R9AA 5KA6A 2EIJC 3ZRWB 3ZEDA 4TUYA 4GCZA 4O4HB 2DYSC 3K9SA 4RAIA 1H38A 1JJ2U 4FM1A 2XAJA 1V54C 5B1OA 3ZX6A 1UJWB 3J80N 4LF4B 1XNRB 3CCEV 1G1XB 3AG4C 3VQYA 4TV9A 3ZJZA 5L3GA 5IWAO 1A32A 4CH4A 3JATA 3ZRWA 4O4HA 2QDOA 3B4SA 1BHBA 4NXNO 1K92A 2AHZA 2OT5A 4JI3B 4BIZA 1N34O 2YC0A 3A0BZ 1K7DA 4J41A 4YJ2B 2DWDC 4BWAA 2B9ZA 3CEIA 2ZQMA 4R50A 4DR7O 1XQ8A 5BMVB 1XNQB 2JS3A 5LMNO 2P4KA 3H9VA 3OTOB 3TJTA 1H2KA 4TV8B 4JPRA 3RYFB 5KHJA 3M99B 3P3NA 5J2TB 3THOA 4LF8B 3HKDB 2LQTA 2A9HA 3ZS8C 1JMKC 3BVOA 3CD6V 5BMVA 3OEHG 1ENVA 4QPKA 4O4JB 5DECA 2GUZB 4TV8A 1ZTEA 1UPGA 3RYFA 1AILA 5J2TA 1N33B 3UT5B 4CBCA 2DOSA 2QKAA 5LMUO 4OGQB 2PTMA 4O4JA 2GUZA 4U3FH 5CA0B 2DJVA 4DV0B 2IU0A 3CCLV 4LH6A 4TOIA 4PA7A 5IYZB 4DR2O 1Q81W 4LWSB 1R3LC 3AG1B 4X66O 4LH7A 1YIJV 5LGTA 5CA0A 2L6LA 4PI0A 5FPRA 1J5EB 1M93A 2LGQA 3A0RA 4NKGB 4YHHO 4O4IB 1VIBA 4DV5B 3U0ZA 5IYZA 2OCCC 3CCVV 3SJAC 2QEXV 5B1BB 2YIAA 2EIJB 1AI4A 5IYDO 2JK5C 2WWWA 2LP7A 2DYSB 4JI8B 3D36C 4PDLA 1V54B 4DR1O 4CS2A 1N36B 3AG4B 3OR6C 2QTOA 1HNWO 4E2LA 3FFQA 1FD9A 2CTPA 3LDEA 1QVFU 4ZHQB 2ZM6B 5E79Z 1HP8A 4LF9O 3LSSA 1QU7A 1OZ0A 4LF7O 1JQ0A 1RSOB 4JYAB 1EM1A 2F66C 4ZHQA 2PI4A 5JQGB 2E76B 4BAYA 1MA1A 2ETNA 2PGGA 3L74H 4I0XB 5BZBA 3TK1A 2XT9A 1VQ8V 3ZBHA 4J7ZA 3K57A 2FL4A 2Q9LA 4J9ZB 2P7TC 3QO7A 1YITV 1RSOA 2VQFB 4I55B 4DV2O 2W0XA 2N74A 2EZPA 4B3TB 2QKSA 2JGDB 4X9QA 5K1XA 3N2GB 2EIKC 3E8GA 5B5EZ 5JQGA 4EFEA 1BE3H 4DV7B 1I7FA 4UCTA 1N0JA 1O9GA 4QNHB 5IT9N 1ROPA 1KECA 2HFEC 3ZIAG 4WBNA 1SQBH 3LDCA 4X62B 4I55A 3I55V 1N32O 1Q82W 1BS3A 5GONB 2XAHA 3ZN0A 3N2GA 2VWKA 1QLEC 2VQEB 4TSFG 4UCOA 2WLJA 2E74B 3RYCB 1V55C 4K8ZA 4QE7A 4B3SB 3ML0A 2HJDA 3F5WC 4JYBA 3K5NA 3K08A 2Q6AA 4JI4O 4NXMO 2CTWA 4EKWA 5GONA 4GKJO 3W7TA 2ITDC 1GMGA 3RYCA 4DR3O 2OCHA 4DUZO 5B1AC 3ABLC 5KMGB 1OCZC 3SYCA 2IW5A 2F93B 3UM7A 5IJ9A 2OCCB 5HFLA 3I56V 1B06A 1YJNV 4B3RB 1KQSU 1IBKB 1T5EA 4JV5O 3APQA 1TUBA 1HNZB 2XOKG 1M5IA 2EIMC 5KMGA 1S5LZ 4ASUG 1HR0O 3OEEG 3MHSC 5FLXN 1KP3A 1MSWD 2YIDA 5JJNB 2Q7EA 1XMOO 5LHGA 3CCQV 3B40A 5EC1C 3NXSA 1BHAA 4UCSA 1N0NA 5KX5B 3D36A 3D3QA 2OYQA 5FL7G 3CWBH 2ILMA 1Q5OA 3FB6C 4YY3O 1H8EG 5IJ0A 1SZTA 3T1HO 4PA6A 2BOBC 2XAQA 3CYOA 3ASOC 3E86A 4QIWF 1AI5A 2M6YA 3CXHF 5LXTA 1FPOA 3E83A 4R6ZA 5KX5A 1NT2B 1IBLO 1QHTA 1PNLA 1WAZA 2KG7B 3ZMSA 2CE4A 2ADPA 1I5YA 2OWOA 5GTHZ 1IX9A 2GTSA 1ZLZA 1PM9A 2Q67A 3OFNG 4JASA 2EIKB 5LA6B 1WNSA 1M1KW 2KG7A 5DM6V 4B3MB 2Q8VA 4JF3A 1Z5WA 4JI0B 4LCUC 2ZXWC 3SR2C 4DV3O 4O2AB 1BSMA 3RFRA 1QLEB 3QTCA 5LA6A 2UUAO 1V55B 3I5DA 2WLNA 1D2DA 1IBMO 2R70A 1Q43A 2YXLA 1BCCH 3K9AA 5L3CA 1JJOA 2KB1A 4H44B 4I50B 1BL8A 4O2AA 2H94A 4KL1A 3L73H 1VF7A 1OJHA 4CS3A 4Q20A 4QPJA 5B1AB 2DMXA 3SPIA 3ABLB 2QGNA 4PELA 2YEVA 3OGIB 1GH6A 5C93A 4I50A 4D6TH 4NTYA 4GKKO 3L75H 3ABUA 2XUMA 4J10A 2FMLA 1YI2V 2QWRB 2EIMB 4K8XA 3NR7A 3H1IH 3P30A 5KAFZ 2HR3A 1HNXB 1R6KA 4E4EA 2BSKA 2Q68A 4O2BB 1SQFA 3OE7G 1AJPA 4JI1O 2IBZH 1PP9H 1IZ3A 2HHHB 5LOVB 2HJFC 1FXVA 2Q69A 2D2CB 3ZRSA 4BIOA 2AZ0A 4O2BA 3CMAV 5EBWC 3ASOB 1JPXA 4D7SA 5TISZ 5EBMC 3H1KH 5E1AC 2IM9A 3GB7C 5LOVA 1WA8B 4FZ1A 2E5LB 2UUCB 3PN1A 3UO2A 1GM7A 4JI2B 2P67A 3T4DA 4J7KA 4JI7O 1WLEA 2RCVA 2ARHA 1Y66A 4MS2A 2P6JA 4FLYA 4NB5A 4RWUA 4U7OA 1NR1A 3F5TA 3T1CA 5DN6G 3H1LH 3CCUV 1GO3F 1JR9A 2ZXWB 4PJ0Z 3CCJV 2UUBB 4AI8A 1XHXA 5IE9A 1H2GA 3CRCA 4DV4O 2QTSA 2Y4TA 4UCVA 1AI6A 1O9HA 5JJEB 5KA5A 2BTOA 3JD0A 2GBOA 3JASB 1IXMA 3KCYA 4J9YB 4ZI7B 1K9MW 4P9PA 4EEQA 1WB7A 1NH2B 2WLIB 3FD9A 4WFFA 4WFHA 3K59A 1XOUA 3SPCA 4HAMA 3BCCH 2UXCB 3JASA 1MSDA 1K34A 2LW7A 1SERA 4LFCB 3JSLA 4ZI7A 5KUKA 3OW2U 2WLLB 2ZCEA 2WLIA 5B66Z 4PA4A 1I94B 4TWKA 2QA4V 5CBGA 3SDLA 4JI6O 3DGEA 1X59A 2ODMA 1DGSA 4I5SA 2CTRA 5KHKA 3B2EE 2CAZC 2RDCA 1ORQC 2Z5UA 2M7WA 2WLLA 4IYIA 5EZYA 1XL4A 4IHJB 1AR1B 3CC2V 2NN4A 4FFKA 1R3JC 1Z2GA 3OAAG 1OCCC 1FXKC 1R73A 1JCHA 4XDKA 4D7TA 4CC5A 1K73W 4CH6A 4MTGA 3SPHA 3H1JH 4HNAB 3CCRV 3WFVA 4JAAA 4WFEA 4LF5O 2ZDIC 4LBEC 5CA1B 1Q86W 3EVKA 3IFXA 3EXAA 4RQEA 5IWAB 1PKXA 4MTOA 4HNAA 1YTFB 1S0VA 4NR1A 3FX7A 4AHCA 4NXNB 5CA1A 3C3SA 3AK1A 1PPJH 1XL6A 2UXDO 1N34B 3UKMA 3ZCCA 5LYJB 3VOUA 1RP3B 1M9NA 1JVMA 1WPBA 2LFSA 2AXTZ 4DR7B 1Q6UA 2QM4A 5LMNB 1ZUQA 1FYJA 1EN4A 4UVAA 4Z2WA 4NTWA 3C3TA 4LFBO 4FZ0A 1W0JG 4AQYO 3EFFK 4YJ2A 4GUNA 1PNKA 4UVBA 1GN4A 4JYYA 4LP8A 1E79G 3FB8C 4AILC 1M57C 3K5LA 4PV1B 3H1HH 4HZ3A 3HKDA 2HVJC 1Q6IA 4Z1VA 1BQ0A 3L9DA 5LMUB 2D3OW 3M8AA 3CC7V 5EBLC 3FYEB 1CXZB 2YI9A 2PI5A 1S5JA 1NTMH 4KXRA 4DR2B 3UT5A 1SZXA 3VQVA 3RVYA 4H33A 3ETGA 4X66B 4L8JA 2N05A 5L3EA 2ZE8A 4KP4A 2MW2B 2GHYA 4X88A 4YHHB 3K5MA 2DW4A 1ZAUA 2IU3A 1JX9A 5JH7B 1D5NA 3K58A 2BE3A 3K79A 1NQTA 1S5HC 4LWSA 4DK0A 4DUYO 1TGOA 3CRAA 4DR5B 1LUVA 1OCOC 2K9PA 1MZEA 4B7KA 1DTOA 3H01A 1QCEA 1XBLA 4O4IA 4PD4F 2EINC 4P9OA 1HNWB 4ZOLB 4DV1O 5LGUA 3ASNC 4Q6GA 2F1MA 1GN2A 3JARB 4R8CA 2AGAA 3OR7C 1OCRC 2EJ7A 3QO8A 5J2UB 2QJ1A 3E22B 4JI8O 4ZOLA 1VQ4V 4LF7B 1R1BA 1N36O 3T2MA 1J95A 1YF2A 3WU2Z 4CZZA 4CC6A 2ZNIA 2C2AA 2ZR3A 1GN6A 1WN7A 3IC7A 5J2UA 2XHBA 2WA4A 2IJJA 1YZBA 4RUEA 1GK9A 1EN6A 4W4KA 3T1YB 2WSSG 4L87A 4U3JB 4DV2B 3IJ4A 5C8YB 5EIBC 3OUFA 3PJSK 3RVZA 3VBBA 3JALB 2CUGA 1NBMG 2ZD9A 1KB9F 4I0XA 4WF9V 2NNUA 2ZNJA 4Z1MG 3ZHTA 2KSDA 4JTAB 3E89A 3AG7A 1M57B 4FM0A 3CXCU 1SC5B 1P7GA 3JAKB 3OUSA 1N32B 3A2FA 1JFFB 1GAXA 2JGDA 4KHPO 3JALA 1SF9A 2CH7B 1L0NH 4RQFA 4DR4O 4DV6O 3X2QC 1Y74B 2CK3G 4JI4B 4NXMB 3JAKA 1QNMA 2JEXA 3OD4A 1XI1A 2WAMA 1JFFA 4KUMA 4GKJB 3ETDA 3E2EA 4F6EA 2VWJA 4DUZB 3IGAC 4G27B 5CMUA 2YI8A 2QR4A 2CH7A 4QE9A 1Y76B 4PA3A 1Y74A 3A8TA 4H13B 2YUAA 4JI5O 4DR6O 1NH2D 2WLHA 3LUTB 1QR9A 4JV5B 1K4CC 1OCOB 3K06A 2YDEA 4GX0A 4FMTA 3RWRD 2QE7G 1M4UA 1URFA 1Y76A 1AP6A 4GX5A 4GX2A 1HR0B 1K5SA 1XMQO 2F43G 3SYOA 2BOCC 1K5QA 3ASNB 2JGUA 1XMOB 2Q0OC 1S77D 3DXRB 4YIOA 1IBKO 4WCEV 4JAUA 3G4SV 4X1IB 2A0LA 4ABMA 3AG2C 3SJQC 4C7UA 4YY3B 4JZ2A 5KUMA 5B3SC 4K0KO 4DXWA 3T1HB 1MMMA 1KYOF 3CCMV 1HW7A 3DXRA 4MVMA 4LNUB 4N21A 3OM3B 3TXQA 1VQPV 2W6JG 1B6QA 1IBLB 5ITZB 4UCRA 2IH3C 4FLWA 2ZINA 3CS5A 1H2SB 1VF5B 3BPZA 4XBFA 4FIPC 4UB8Z 2HKOA 2GV9A 4ZIBA 1ZX3A 4TQFA 4K3AA 1QBZA 2Y0PA 4J7JA 1FFTB 5KHHA 3BHPA 5ITZA 3GWOA 4MW8A 4PDRA 1G6UA 2XAGA 3HKCB 4X64O 4OPHA 1MOFA 1YTFD 1H2NA 4W4LA 4FVMA 2UUAB 2FTKA 4UB6Z 4EFBA 1EFRG 1IBMB 3R66A 2Q73A 3X2QB 3DTUB 3BEHA 3HKCA 4GZRB 4FLXA 2XTAA 1NI8A 1YSCA 1Y67A 3SJBC 4FFBB 1RFYA 2BTQB 4UUJC 1FS0G 3K04A 4X89A 2P06A 3SPGA 2OIGA 1OCZB 2LJ2A 4XDLA 1N4CA 5H6RA 2DN9A 2VS0A 2YXYA 4CH3A 4GKKB 3L72H 3F7YC 4FFBA 2BTQA 4MVQA 5EYPB 3N2KB 2UU9O 4FLVA 5H5NA 1QR8A 4OPAA 1PL0A 2YXHA 1PD3A 2FKXA 2IJIA 1I08A 2WPDG 3N2KA 3D8CA 2DYRC 5K1PA 4JI1B 4LR3A 3ABTA 1ZSPA 1IDSA 3OMIB 4JAVA 3AG2B 1K8AW 5B3SB 1RM1C 2LO1A 1VQKV 2JDIG 2RNBA 4NVPA 4DO2A 1KBHA 4QJFB 2X6AA 4UXNA 5L3BA 3EHBB 1SETA 4WFAV 1R6NA 1US6A 3JCUZ 3U10A 2EULA 2HEPA 4H0LB 4MTXA 3M7MX 3K3WA 2F4VO 3QO5A 1VMGA 4JI7B 4LFAO 3BA8A 1LNQA 1DF5A 2GTAA 2K1EA 4OXSA 2NLJC 1WA8A 4X65O 2HLDG 1EZVH 3CMEV 1MABG 2V1DA 2Q4PA 1WB8A 4LC1A 3BABA 5LHIA 1JOYA 3AEIA 1NS1A 3L70H 1V9PA 3CSXA 2FYUH 3OMAB 4DV4B 4PI2A 2V7QG 3RW0A 4O4LB 4LF6O 1SQGA 2UXBO 1VQ7V 3E8FA 3SGIA 5KLVH 2ZIMA 2ZIOA 3KG2A 1VF6C 1W2BU 4MW3A 4N23A 1IURA 3RYHB 3Q4HB 4WFBV 1Y4MA 1VQOV 4FLTA 3SYAA 2Q0AA 2QWQB 2XNDG 5EC2C 5H6QA 3ETQA 4O4LA 1KUQA 1W59A 1P84F 5CBFA 5F2VO 3J81N 1I5XA 3E8HA 4JTCB 3RYHA 3Q4HA 3DC6A 2R9IA 1JA8A 1PL4A 1WPXA 1BQZA 4JI6B 4OX9O 1NTZH 3RYIB 1YDXA 3IC9A 4I4TB 5KHGA 4RUFA 2X0LA 3ZHRA 4DK1A 2HP8A 4LFCO 5L3DA 1W0KG 1THZA 2DYRB 3K0GA 3WB2A 1MNGA 1XUQA 2ZT9B 1I94O 2FB5A 4NTXA 1CPYA 3RYIA 1FJGO 3L71H 4F6RB 1R6TA 1RM1B 3RN4A 3ABMC 3O9OA 3MAQA 4IHJA 5BR8O 2GSMB 2RN9A 4LF5B 2QSAA 3SPJA 3CPWU 1SA0B 3LSQA 5JCOC 4MVOA 3JD4A 3QF7A 1VQLV 5JVDB 4IIJB 3AG3C 1TUEB 1R3KC 1FXHA 1VQ9V 3ZHUA 5GTIZ 5CBHA 3BFRA 3JATB 4MT8A 2HVKC 3K5OA 4XDJA 4GX1A 1WP7A 2UXDB 3O65A 3F7VC 1DF4A 2G38A 4IIJA 5JVDA 3JD3A 2B1GA 1KP2A 1YHQV 4LF4O 1K97A 4FJCC 3VQXA 1XNRO 3A0HZ 1XILA 5IDJA 2W6IG 2Z3YA 4IL6Z 3MDSA 2NR5A 3GVMA 3FB7C 1N8RW 1QVGU 4U7NA 4LFBB 5LYJA 3ZMVA 5H9CA 4AQYB 4JI3O 1SQQH 2A3QA 2PUSA 3ABKC 2GDSA 3B77A 1BT8A 1KKDA 2AZ2A 1TAEA 1R3IC 1YEWA 3ETEA 1PV0A 3U11A 1SQXH 2JJ2G 1XNQO 1VF6A 1VQ5V 5JWPA 3JD2A 1H8HG 3OTOO 5EIBD 2WA3A 1WP8A 4A5UB 2JRIA 2ITCC 1ZWIC 4MSWC 2OTLV 3MD0A 4LF8O 3CC4V 2EX3A 5CB4B 2KKWA 1KMIZ 3CE2A 2QWNB 1CP9A 1MZFA 2PYJA 1K33A 2HG5C 2R72A 2PF4E 1K4DC 1BMFG 1OHHG 4BW5A 2UXXA 1Q6HA 5FPOA 2RMKB 1N33O 5CB4A 2JIZG 1M56C 3JYCA 1YJWV 1U96A 5LGNA 1EZJA 1SESA 1HDJA 1AJQA 3FB5C 2MK3A 1OCCB 1FXKB 1M90W 1NZ6A 3GWKC 1P7BA 1KU9A 3ZHQA 4DV0O 1AROP 5LHHA 3ABMB 5CN0A 4DUYB 1Q8IA
chains in the Genus database with same CATH topology
4FMTA 3W7UA 2QE7G 2X7RB 4F4LA 3W7SA 3P30A 4GX5A 3SYPA 1F4NA 4GX2A 2HR3A 3B8NA 1K5SA 3W7XA 2EILC 2B1IA 1FXKA 1SRYA 3AG1C 1R6KA 2F43G 2Q68A 3B8MA 4G2KA 3SYOA 2BOCC 2EJRA 2A79B 3OGCC 1K5QA 2Y48A 2JEUA 1AJPA 3ASNB 3OE7G 1S77D 3AG3B 4UV8A 1G4YB 1RPRA 4WCEV 4JAUA 3G4SV 4UV9A 4JTDB 2HJFC 2A0LA 2ZDIA 4MTFA 1FXVA 1VQ6V 2Q69A 4PDMA 3WG7C 2LFRA 2EZOA 4UVCA 3ZRSA 3AG2C 3SJQC 2X6BA 1G8MA 2WLMA 3P32A 5B1BC 5KA6A 5KUMA 5B3SC 2EIJC 3ZRWB 5EBWC 3CMAV 3ASOB 1JPXA 4DXWA 4GCZA 5EBMC 3CCMV 2DYSC 4MVMA 5E1AC 4RAIA 4N21A 3OM3B 1H38A 1JJ2U 3GB7C 1VQPV 2W6JG 2XAJA 1V54C 5B1OA 1UJWB 1B6QA 3CCEV 2Y69C 2IH3C 3AG4C 3ZJZA 5L3GA 4FPPA 2IH1C 1GM7A 2P67A 3T4DA 3ZRWA 4XBFA 4FIPC 1WLEA 4MVRA 2HKOA 4MVSA 1KD1W 1BHBA 3QNEA 1PNMA 5EK0A 1K92A 1Y66A 2XAFA 1QBZA 4MS2A 4P2ZA 2AHZA 1FFTB 2P6JA 2OT5A 3ABKB 3K03A 1NR1A 4U7OA 4BIZA 2AHYA 3T1CA 5DN6G 3GWOA 4MW8A 4PDRA 3CCUV 1K7DA 2XAGA 4I9WA 5GW7A 1GO3F 2ZXWB 2DWDC 4ZKIA 3CCJV 1MOFA 1YTFD 1H2GA 2ZQMA 4R50A 5IY5C 1AI6A 5KA5A 4JPRA 2FTKA 4RO2A 4GX0A 3JD0A 1EFRG 3M99B 1IXMA 3X2QB 1NVPB 4J9YB 3DTUB 3BEHA 3OMNB 2A9HA 1K9MW 4P9PA 4P30A 3SYQA 3CD6V 3R65A 3ZN1A 1NH2B 3JD1A 3OEHG 1YSCA 3K0DA 1ENVA 2WLIB 4QPKA 4WFFA 4UUJC 1FS0G 3K04A 4WFHA 4X89A 3SPCA 3SPGA 3STLC 5IYCO 4HAMA 1M56B 1K34A 1SERA 1OCZB 4CBCA 5KUKA 4XDLA 5H6RA 1DLBA 3OW2U 2WLLB 3F7YC 2WLIA 4PA4A 4MVQA 4TWKA 2QA4V 5CBGA 3DGEA 2IU0A 3CCLV 5L3FA 1QR8A 4PA7A 4I5SA 1Q81W 3STZC 1S3JA 4JGSA 1ORQC 1R3LC 2EILB 2M7WA 2Z5UA 2WLLA 3AG1B 1PL0A 2P90A 1PD3A 1YIJV 1XL4A 5LGTA 2IJIA 2EINB 2WPDG 1AR1B 3CC2V 1F23A 3A0RA 2DYRC 1R3JC 3OAAG 1VQMV 1OCCC 1FXKC 1R73A 3ABTA 2OCCC 3CCVV 1JCHA 1OCRB 2R9RB 3OMIB 2DQ3A 4JAVA 4XDKA 3WG7B 3AG2B 2QEXV 5B1BB 2XASA 1NR7A 1K73W 1K8AW 5B3SB 1RM1C 2EIJB 4MTGA 1AI4A 5IYDO 2JK5C 3SPHA 2WWWA 1VQKV 2LP7A 2JDIG 2DYSB 3CCRV 3ZRXA 3WFVA 3D3IA 4DO2A 4WFEA 4QJFB 2ZDIC 2X6AA 4PDLA 4UXNA 5L3BA 3EHBB 4ZBMA 1COWG 1V54B 4LBEC 1SETA 2QM7A 1Q86W 4WFAV 1R6NA 3IFXA 2Y69B 3FKSG 3AG4B 3OR6C 2QTOA 4YXWG 3E8BA 4E2LA 4MTXA 4RQEA 3TCUA 3K3WA 1PKXA 4MTOA 1AJNA 3QO5A 4WFGA 4PA9A 3LDEA 1QVFU 1YTFB 1S0VA 1RPOA 1LNQA 1DF5A 3MHHC 3LSSA 2K1EA 4OXSA 2NLJC 1XL6A 5HFMA 3W7WA 1OZ0A 4TT3G 1JQ0A 3UKMA 3ZCCA 1Q7YW 2HLDG 3CMEV 3VOUA 1MABG 2V1DA 1M9NA 1EBOA 1JVMA 4LC1A 2DQ0A 2LFSA 5J9PC 5LHIA 2PI4A 3AEIA 1MG1A 1JOYA 5IY5B 1CEZA 2ZR2A 4BAYA 5BZBA 3OMAB 3TK1A 1VQ8V 3ZMUA 2V7QG 3RW0A 4J9ZB 2P7TC 2W0FC 3QO7A 4UVAA 1YITV 1VQ7V 2B5UA 3E8FA 2EZPA 1E1QG 1W0JG 2QKSA 3KG2A 1W2BU 3EFFK 4MW3A 4N23A 1PNKA 4UVBA 3T4ZA 2EIKC 4WFBV 1Y4MA 3E8GA 1VQOV 3G71V 3JCZA 1GKFA 3SYAA 2XNDG 5EC2C 2QM8A 5H6QA 4QNHB 5CA3A 4LP8A 1ROPA 1YJ9V 5CBFA 1KECA 2HFEC 3ZIAG 3LDCA 1E79G 3FB8C 3CCSV 3I55V 1I5XA 1Q82W 3E8HA 1M57C 2JJ1G 4JTCB 3ZN0A 2XAHA 4HZ3A 1QLEC 2HVJC 4TSFG 2YEVB 2WLJA 4FK5C 1V55C 2R9IA 4QE7A 3ML0A 2D3OW 3F5WC 3CC7V 4JYBA 5EBLC 3E35A 1S76D 3K08A 3ZRVA 1WPXA 2Q6AA 3FYEB 1GTOA 4BIUA 4MVUA 4EKWA 2PI5A 3W7TA 2ITDC 1GMGA 4RUFA 2X0LA 3RVYA 4H33A 5B1AC 3ETGA 3ABLC 5L3DA 1W0KG 4PDVA 5L3EA 1OCZC 1THZA 4KP4A 1QLNA 3SYCA 2IW5A 2DYRB 3K0GA 2GHYA 4X88A 3UM7A 2OCCB 2DW4A 1CPYA 5HFLA 3I56V 2IJKA 1YJNV 2IU3A 1JX9A 3CP1A 2X6CA 1KQSU 3ZMZA 3K79A 1RM1B 1NQTA 1S5HC 3LDDA 2WLKA 2XOKG 3ABMC 2EIMC 1F51A 1OCOC 4ASUG 2GSMB 4JYCA 1AI7A 1DTOA 3OEEG 4HYOA 3RBZA 3MHSC 3SPJA 1KP3A 1E1RG 3H01A 1QCEA 3LSQA 3BY6A 3G6EV 3CPWU 4MVOA 1MSWD 3HB3B 5LBQA 2EINC 3JD4A 1VQLV 1NJIW 4P9OA 5LGUA 1K3EA 3ASNC 5LHGA 3CCQV 5EC1C 3NXSA 1F4MA 1BHAA 3AG3C 1P4RA 1TUEB 2IJHA 4R8CA 1R3KC 3D36A 3OR7C 1OCRC 5FL7G 1FXHA 1VQ9V 5CBHA 3FB6C 4H37A 3QO8A 1H8EG 4MT8A 5IYBO 1SZTA 2HVKC 3TETA 4PA6A 5B1NA 2BOBC 2XAQA 3CYOA 3ASOC 3E86A 4GX1A 4QIWF 1AI5A 4XDJA 1VQ4V 3LNMB 4X8AA 3F7VC 1DF4A 3JD3A 2B1GA 3E83A 3T2MA 4R6ZA 1J95A 3HPLC 1KP2A 4MVZA 1PNLA 4CZZA 1K97A 1GM8A 4FJCC 1YHQV 2H8PC 2C2AA 3ZMSA 2ZR3A 5IDJA 3IC7A 2W6IG 1I5YA 2Z3YA 2IJJA 3FB7C 4RUEA 1GK9A 1N8RW 1L1FA 4G28B 1QVGU 2Q67A 4U7NA 2WSSG 3OFNG 4JASA 4L87A 3ZMTA 3ZMVA 2EIKB 5H9CA 1M1KW 3OUFA 3PJSK 3RVZA 5DM6V 3VBBA 1NKDA 1NBMG 2ZD9A 3ABKC 2YSUB 3B77A 4JF3A 1KKDA 2DWEC 4WF9V 1R3IC 2NNUA 4Z1MG 4LCUC 3ETEA 2ZXWC 2JJ2G 4JTAB 3E89A 1KC8W 1M57B 3CXCU 1VQ5V 3JD2A 1H8HG 1QLEB 3OUSA 1V55B 2ITCC 2WLNA 2EBOA 1ZWIC 4MSWC 2OTLV 2OTJV 3MD0A 3CC4V 4RQFA 3K9AA 5L3CA 3X2QC 2KB1A 1BL8A 2CK3G 2H94A 1CP9A 4Q20A 2JEXA 1K33A 2WAMA 4KUMA 4QPJA 2HG5C 5B1AB 3ETDA 3E2EA 3SPIA 3ABLB 4PELA 1HWYA 4R7CA 1K4DC 1BMFG 1OHHG 2YEVA 4BW5A 2UXXA 3IGAC 4G27B 5CMUA 4QE9A 1NVPD 5C93A 2JIZG 1M56C 4PA3A 3JYCA 4KFMA 1YJWV 5LGNA 1EZJA 1SESA 1AJQA 3FB5C 2MK3A 1OCCB 1FXKB 1NH2D 1M90W 3ABUA 1VQNV 1P7BA 4GT1A 2ATKC 2WLHA 1YI2V 3FYIB 3LUTB 1QR9A 1AROP 5LHHA 3ABMB 1K4CC 2EIMB 5CN0A 1S72V 1OCOB 3K06A 1GM9A 2UXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMT A;  4I5S A;  3TK1 A;  4QPJ A;  2LFR A;  1F51 A;  3P32 A;  2WWW A;  4MT8 A;  4JYC A;  3ZRW B;  3ZRX A;  2FTK A;  4U7N A;  4GCZ A;  5B1N A;  5C93 A;  4JAS A;  4KP4 A;  3MD0 A;  1IXM A;  4U7O A;  2QM7 A;  4BIZ A;  3ZCC A;  3A0R A;  5B1O A;  4GT1 A;  4JYB A;  4LC1 A;  3ZRV A;  2LFS A;  4ZKI A;  1JOY A;  4MTX A;  2C2A A;  3NXS A;  4JAU A;  4QPK A;  2QM8 A;  3DGE A;  4JAV A;  4Q20 A;  4BIU A;  5IDJ A;  4FPP A;  3D36 A;  2P67 A;  3ZRW A; 
#chains in the Genus database with same CATH topology
 1I0H A;  2X7R B;  3W7S A;  3B8N A;  3W7X A;  2EIL C;  2B1I A;  1FXK A;  1SRY A;  3VQW A;  1SKV A;  4G2K A;  5JH7 A;  2EJR A;  2A79 B;  3OGC C;  4DR1 B;  1J5E O;  2JEU A;  2PZS A;  5LL6 Y;  3CB2 A;  1EN5 A;  3AG3 B;  4DV1 B;  4UV8 A;  2LW1 A;  4DV5 O;  1RPR A;  3S3W A;  2CDY A;  5JCO A;  2ZDI A;  4MTF A;  4DR5 O;  3RT3 C;  3WG7 C;  2LFR A;  2X6B A;  2WLM A;  3JSN A;  1VEW A;  3WB1 A;  1H2M A;  4LF9 B;  2JS5 A;  5KHI A;  2QWP B;  3JAR A;  2Y69 C;  4DW1 A;  3AK2 A;  2PY5 A;  4FPP A;  1D5A A;  2IH1 C;  4GYC B;  2CGO A;  1YCI A;  4YJ3 B;  3E22 A;  1Z5V A;  2Y4U A;  2ZM6 O;  4MVR A;  2Q5Z A;  4MVS A;  1KD1 W;  1L0L H;  3QNE A;  1PNM A;  5EK0 A;  2XAF A;  1BGY H;  4P2Z A;  4X1Y B;  3G67 A;  3ABK B;  3K03 A;  2AHY A;  1VAR A;  4JYA O;  3HKB B;  4I9W A;  5GW7 A;  3APO A;  4YJ3 A;  4CS4 A;  3G80 A;  4ZKI A;  2YIC A;  3J7A U;  3RGB A;  5IY5 C;  4U3J A;  4X1Y A;  4PHZ A;  4IYH A;  5C8Y A;  3N27 A;  4WBN B;  3T1Y O;  4KHP B;  1AR5 A;  4X1K B;  2VQF O;  3HKB A;  4RO2 A;  4UFZ A;  5DED A;  4B3T O;  2OIE A;  4GLX A;  4JZG A;  1NVP B;  3OMN B;  4DR4 B;  4DV6 B;  4P30 A;  3SYQ A;  3B09 A;  3R65 A;  3HKE B;  3ZN1 A;  2F23 A;  3JD1 A;  4DV7 O;  1XDC A;  3K0D A;  2PYL A;  3UCS C;  4X1K A;  5BY1 A;  4X62 O;  3STL C;  5IYC O;  1Y6X A;  1SS3 A;  1M56 B;  4DR3 B;  3JAW B;  2VQE O;  1WJZ A;  1B04 A;  1DLB A;  3QVN A;  3HKE A;  4JI5 B;  4YIP A;  4B3S O;  4DR6 B;  2Z0A A;  5IJ9 B;  5L3F A;  2JVD A;  2YIB A;  3JAW A;  3STZ C;  1S3J A;  4JGS A;  1TUB B;  2F95 B;  4DW0 A;  2EIL B;  1XEQ A;  2P90 A;  5H2F Z;  1XMQ B;  1AVM A;  2EIN B;  1F23 A;  1VQM V;  3DC5 A;  4B3R O;  1OCR B;  2R9R B;  3WG7 B;  2DQ3 A;  1HNZ O;  2RQ6 A;  2XAS A;  1NR7 A;  4BR6 A;  3C90 A;  4K0K B;  3ZRX A;  3D3I A;  3CRQ A;  4BW9 A;  2CTQ A;  5A9G A;  4B08 A;  5FNV B;  5IJ0 B;  4ZBM A;  1COW G;  5LP6 C;  2QM7 A;  2DE0 X;  2Y69 B;  3FKS G;  4YXW G;  4X1I A;  3E8B A;  2RJZ A;  5LXT B;  3TCU A;  1AJN A;  4WFG A;  4PA9 A;  2V4D A;  1RPO A;  5FNV A;  2ZE5 A;  3OT7 A;  4QGP A;  1Q3E A;  4LNU A;  3MHH C;  2N04 A;  1KKC A;  5HFM A;  3W7W A;  4TT3 G;  1OV9 A;  4DRX B;  1Q7Y W;  1YVW A;  4FLU A;  1EBO A;  3TXS A;  1AR4 A;  2DQ0 A;  2A06 H;  5J9P C;  1MG1 A;  4X64 B;  5IY5 B;  1CEZ A;  2ZR2 A;  4CH5 A;  2KQX A;  4DV3 B;  1NU1 H;  3ZMU A;  1TVK B;  2W0F C;  3SJC C;  1AB3 A;  4DRX A;  2B5U A;  1H2L A;  4B7E A;  1E1Q G;  3T4Z A;  3G71 V;  4X20 B;  3UO3 A;  4B3M O;  3JCZ A;  4IT5 A;  4JI0 O;  1GKF A;  3FAV B;  2H3O A;  2QM8 A;  1TVK A;  2QKC A;  5CA3 A;  2L35 A;  1YJ9 V;  2P5O A;  3CCS V;  2JJ1 G;  1P49 A;  2YEV B;  4X20 A;  2QWO B;  3BAA A;  4FK5 C;  2VRZ A;  3QG5 A;  3FAV A;  3HR0 A;  1NTK H;  1U97 A;  5BXZ A;  1YXB A;  3S3X A;  1IVS A;  1LUW A;  3ZHV A;  1S76 D;  3E35 A;  1L8D A;  2UU9 B;  3ZRV A;  1GTO A;  4BIU A;  4MVU A;  2E3C A;  3P3P A;  3KCX A;  4UCU A;  3G6B A;  4PDV A;  1QLN A;  5KAI Z;  5EYP A;  2ZE6 A;  1X4T A;  3CHX A;  1B3Q A;  2BSK B;  3UQ8 A;  2IJK A;  3CP1 A;  2X6C A;  3ZMZ A;  3AK3 A;  3KZI Z;  4I9Q A;  3LDD A;  4TQD A;  1Q90 D;  2WLK A;  1F51 A;  3OTF A;  3IAY A;  1FFX B;  4JYC A;  1AI7 A;  3ZHS A;  3ICX A;  3TGU H;  5LP6 B;  4HYO A;  3RBZ A;  1E1R G;  1HNX O;  3G6E V;  3BY6 A;  1GRJ A;  3HB3 B;  5LBQ A;  4EB6 B;  1NJI W;  1K3E A;  2HHH O;  1F4M A;  3CX5 F;  3KKY A;  1P4R A;  2F4V B;  2IJH A;  1FFX A;  2Q7G A;  5LP6 A;  4LFA B;  4H37 A;  5IYB O;  2AW9 A;  3TET A;  3CJH B;  4IGG A;  4EB6 A;  3CRR A;  5B1N A;  1AP5 A;  3LNM B;  4X8A A;  3DSQ A;  5JJJ B;  4X65 B;  3HPL C;  4MVZ A;  2E5L O;  1GM8 A;  1QQC A;  5A2Q N;  2H8P C;  1XRE A;  2UUC O;  4JI2 O;  3CJH A;  4I7Z B;  1L1F A;  4LF6 B;  4G28 B;  2CGN A;  2UXB B;  1FKA O;  5D5P A;  3ZMT A;  4J80 A;  2Q7H A;  1NKD A;  2LGW A;  1DK1 A;  1TA8 A;  2YSU B;  1VP7 A;  1XHZ A;  2DWE C;  2O57 A;  2UUB O;  1BZK A;  3LSU A;  1KC8 W;  3WB0 A;  1ZL8 B;  4J11 A;  1SQP H;  1GN3 A;  2EBO A;  2P4V A;  2OTJ V;  3BRC A;  1LR1 A;  2E75 B;  1ZL8 A;  4OX9 B;  1HWY A;  4R7C A;  2UXC O;  1NVP D;  4KFM A;  2ADQ B;  5EZY B;  2A7W A;  2ZE7 A;  1IXB A;  1VQN V;  4GT1 A;  2ATK C;  1FJG B;  3FYI B;  4I4T A;  1FAF A;  4DYL A;  1S72 V;  2BCC H;  2UXN A;  1GM9 A;  3W7U A;  2YS8 A;  4HBN A;  2YIB D;  4F4L A;  3SYP A;  5BR8 B;  2ZKO A;  3CRM A;  1F4N A;  1UFI A;  4J42 A;  2Y0I A;  1F7Y A;  4NYK A;  3AG1 C;  3B8M A;  1SQV H;  2Y48 A;  4TUY B;  4F6R A;  4K35 A;  5D5Q A;  3JAM N;  5AG2 A;  1G4Y B;  4ICG A;  2P22 C;  3LNN A;  4UV9 A;  3BA9 A;  4JTD B;  4FLZ A;  1VQ6 V;  4PDM A;  4FM2 A;  2EZO A;  4TV9 B;  4UVC A;  1G8M A;  3P32 A;  5B1B C;  1SA0 A;  2R9A A;  5KA6 A;  2EIJ C;  3ZRW B;  3ZED A;  4TUY A;  4GCZ A;  4O4H B;  2DYS C;  3K9S A;  4RAI A;  1H38 A;  1JJ2 U;  4FM1 A;  2XAJ A;  1V54 C;  5B1O A;  3ZX6 A;  1UJW B;  3J80 N;  4LF4 B;  1XNR B;  3CCE V;  1G1X B;  3AG4 C;  3VQY A;  4TV9 A;  3ZJZ A;  5L3G A;  5IWA O;  1A32 A;  4CH4 A;  3JAT A;  3ZRW A;  4O4H A;  2QDO A;  3B4S A;  1BHB A;  4NXN O;  1K92 A;  2AHZ A;  2OT5 A;  4JI3 B;  4BIZ A;  1N34 O;  2YC0 A;  3A0B Z;  1K7D A;  4J41 A;  4YJ2 B;  2DWD C;  4BWA A;  2B9Z A;  3CEI A;  2ZQM A;  4R50 A;  4DR7 O;  1XQ8 A;  5BMV B;  1XNQ B;  2JS3 A;  5LMN O;  2P4K A;  3H9V A;  3OTO B;  3TJT A;  1H2K A;  4TV8 B;  4JPR A;  3RYF B;  5KHJ A;  3M99 B;  3P3N A;  5J2T B;  3THO A;  4LF8 B;  3HKD B;  2LQT A;  2A9H A;  3ZS8 C;  1JMK C;  3BVO A;  3CD6 V;  5BMV A;  3OEH G;  1ENV A;  4QPK A;  4O4J B;  5DEC A;  2GUZ B;  4TV8 A;  1ZTE A;  1UPG A;  3RYF A;  1AIL A;  5J2T A;  1N33 B;  3UT5 B;  4CBC A;  2DOS A;  2QKA A;  5LMU O;  4OGQ B;  2PTM A;  4O4J A;  2GUZ A;  4U3F H;  5CA0 B;  2DJV A;  4DV0 B;  2IU0 A;  3CCL V;  4LH6 A;  4TOI A;  4PA7 A;  5IYZ B;  4DR2 O;  1Q81 W;  4LWS B;  1R3L C;  3AG1 B;  4X66 O;  4LH7 A;  1YIJ V;  5LGT A;  5CA0 A;  2L6L A;  4PI0 A;  5FPR A;  1J5E B;  1M93 A;  2LGQ A;  3A0R A;  4NKG B;  4YHH O;  4O4I B;  1VIB A;  4DV5 B;  3U0Z A;  5IYZ A;  2OCC C;  3CCV V;  3SJA C;  2QEX V;  5B1B B;  2YIA A;  2EIJ B;  1AI4 A;  5IYD O;  2JK5 C;  2WWW A;  2LP7 A;  2DYS B;  4JI8 B;  3D36 C;  4PDL A;  1V54 B;  4DR1 O;  4CS2 A;  1N36 B;  3AG4 B;  3OR6 C;  2QTO A;  1HNW O;  4E2L A;  3FFQ A;  1FD9 A;  2CTP A;  3LDE A;  1QVF U;  4ZHQ B;  2ZM6 B;  5E79 Z;  1HP8 A;  4LF9 O;  3LSS A;  1QU7 A;  1OZ0 A;  4LF7 O;  1JQ0 A;  1RSO B;  4JYA B;  1EM1 A;  2F66 C;  4ZHQ A;  2PI4 A;  5JQG B;  2E76 B;  4BAY A;  1MA1 A;  2ETN A;  2PGG A;  3L74 H;  4I0X B;  5BZB A;  3TK1 A;  2XT9 A;  1VQ8 V;  3ZBH A;  4J7Z A;  3K57 A;  2FL4 A;  2Q9L A;  4J9Z B;  2P7T C;  3QO7 A;  1YIT V;  1RSO A;  2VQF B;  4I55 B;  4DV2 O;  2W0X A;  2N74 A;  2EZP A;  4B3T B;  2QKS A;  2JGD B;  4X9Q A;  5K1X A;  3N2G B;  2EIK C;  3E8G A;  5B5E Z;  5JQG A;  4EFE A;  1BE3 H;  4DV7 B;  1I7F A;  4UCT A;  1N0J A;  1O9G A;  4QNH B;  5IT9 N;  1ROP A;  1KEC A;  2HFE C;  3ZIA G;  4WBN A;  1SQB H;  3LDC A;  4X62 B;  4I55 A;  3I55 V;  1N32 O;  1Q82 W;  1BS3 A;  5GON B;  2XAH A;  3ZN0 A;  3N2G A;  2VWK A;  1QLE C;  2VQE B;  4TSF G;  4UCO A;  2WLJ A;  2E74 B;  3RYC B;  1V55 C;  4K8Z A;  4QE7 A;  4B3S B;  3ML0 A;  2HJD A;  3F5W C;  4JYB A;  3K5N A;  3K08 A;  2Q6A A;  4JI4 O;  4NXM O;  2CTW A;  4EKW A;  5GON A;  4GKJ O;  3W7T A;  2ITD C;  1GMG A;  3RYC A;  4DR3 O;  2OCH A;  4DUZ O;  5B1A C;  3ABL C;  5KMG B;  1OCZ C;  3SYC A;  2IW5 A;  2F93 B;  3UM7 A;  5IJ9 A;  2OCC B;  5HFL A;  3I56 V;  1B06 A;  1YJN V;  4B3R B;  1KQS U;  1IBK B;  1T5E A;  4JV5 O;  3APQ A;  1TUB A;  1HNZ B;  2XOK G;  1M5I A;  2EIM C;  5KMG A;  1S5L Z;  4ASU G;  1HR0 O;  3OEE G;  3MHS C;  5FLX N;  1KP3 A;  1MSW D;  2YID A;  5JJN B;  2Q7E A;  1XMO O;  5LHG A;  3CCQ V;  3B40 A;  5EC1 C;  3NXS A;  1BHA A;  4UCS A;  1N0N A;  5KX5 B;  3D36 A;  3D3Q A;  2OYQ A;  5FL7 G;  3CWB H;  2ILM A;  1Q5O A;  3FB6 C;  4YY3 O;  1H8E G;  5IJ0 A;  1SZT A;  3T1H O;  4PA6 A;  2BOB C;  2XAQ A;  3CYO A;  3ASO C;  3E86 A;  4QIW F;  1AI5 A;  2M6Y A;  3CXH F;  5LXT A;  1FPO A;  3E83 A;  4R6Z A;  5KX5 A;  1NT2 B;  1IBL O;  1QHT A;  1PNL A;  1WAZ A;  2KG7 B;  3ZMS A;  2CE4 A;  2ADP A;  1I5Y A;  2OWO A;  5GTH Z;  1IX9 A;  2GTS A;  1ZLZ A;  1PM9 A;  2Q67 A;  3OFN G;  4JAS A;  2EIK B;  5LA6 B;  1WNS A;  1M1K W;  2KG7 A;  5DM6 V;  4B3M B;  2Q8V A;  4JF3 A;  1Z5W A;  4JI0 B;  4LCU C;  2ZXW C;  3SR2 C;  4DV3 O;  4O2A B;  1BSM A;  3RFR A;  1QLE B;  3QTC A;  5LA6 A;  2UUA O;  1V55 B;  3I5D A;  2WLN A;  1D2D A;  1IBM O;  2R70 A;  1Q43 A;  2YXL A;  1BCC H;  3K9A A;  5L3C A;  1JJO A;  2KB1 A;  4H44 B;  4I50 B;  1BL8 A;  4O2A A;  2H94 A;  4KL1 A;  3L73 H;  1VF7 A;  1OJH A;  4CS3 A;  4Q20 A;  4QPJ A;  5B1A B;  2DMX A;  3SPI A;  3ABL B;  2QGN A;  4PEL A;  2YEV A;  3OGI B;  1GH6 A;  5C93 A;  4I50 A;  4D6T H;  4NTY A;  4GKK O;  3L75 H;  3ABU A;  2XUM A;  4J10 A;  2FML A;  1YI2 V;  2QWR B;  2EIM B;  4K8X A;  3NR7 A;  3H1I H;  3P30 A;  5KAF Z;  2HR3 A;  1HNX B;  1R6K A;  4E4E A;  2BSK A;  2Q68 A;  4O2B B;  1SQF A;  3OE7 G;  1AJP A;  4JI1 O;  2IBZ H;  1PP9 H;  1IZ3 A;  2HHH B;  5LOV B;  2HJF C;  1FXV A;  2Q69 A;  2D2C B;  3ZRS A;  4BIO A;  2AZ0 A;  4O2B A;  3CMA V;  5EBW C;  3ASO B;  1JPX A;  4D7S A;  5TIS Z;  5EBM C;  3H1K H;  5E1A C;  2IM9 A;  3GB7 C;  5LOV A;  1WA8 B;  4FZ1 A;  2E5L B;  2UUC B;  3PN1 A;  3UO2 A;  1GM7 A;  4JI2 B;  2P67 A;  3T4D A;  4J7K A;  4JI7 O;  1WLE A;  2RCV A;  2ARH A;  1Y66 A;  4MS2 A;  2P6J A;  4FLY A;  4NB5 A;  4RWU A;  4U7O A;  1NR1 A;  3F5T A;  3T1C A;  5DN6 G;  3H1L H;  3CCU V;  1GO3 F;  1JR9 A;  2ZXW B;  4PJ0 Z;  3CCJ V;  2UUB B;  4AI8 A;  1XHX A;  5IE9 A;  1H2G A;  3CRC A;  4DV4 O;  2QTS A;  2Y4T A;  4UCV A;  1AI6 A;  1O9H A;  5JJE B;  5KA5 A;  2BTO A;  3JD0 A;  2GBO A;  3JAS B;  1IXM A;  3KCY A;  4J9Y B;  4ZI7 B;  1K9M W;  4P9P A;  4EEQ A;  1WB7 A;  1NH2 B;  2WLI B;  3FD9 A;  4WFF A;  4WFH A;  3K59 A;  1XOU A;  3SPC A;  4HAM A;  3BCC H;  2UXC B;  3JAS A;  1MSD A;  1K34 A;  2LW7 A;  1SER A;  4LFC B;  3JSL A;  4ZI7 A;  5KUK A;  3OW2 U;  2WLL B;  2ZCE A;  2WLI A;  5B66 Z;  4PA4 A;  1I94 B;  4TWK A;  2QA4 V;  5CBG A;  3SDL A;  4JI6 O;  3DGE A;  1X59 A;  2ODM A;  1DGS A;  4I5S A;  2CTR A;  5KHK A;  3B2E E;  2CAZ C;  2RDC A;  1ORQ C;  2Z5U A;  2M7W A;  2WLL A;  4IYI A;  5EZY A;  1XL4 A;  4IHJ B;  1AR1 B;  3CC2 V;  2NN4 A;  4FFK A;  1R3J C;  1Z2G A;  3OAA G;  1OCC C;  1FXK C;  1R73 A;  1JCH A;  4XDK A;  4D7T A;  4CC5 A;  1K73 W;  4CH6 A;  4MTG A;  3SPH A;  3H1J H;  4HNA B;  3CCR V;  3WFV A;  4JAA A;  4WFE A;  4LF5 O;  2ZDI C;  4LBE C;  5CA1 B;  1Q86 W;  3EVK A;  3IFX A;  3EXA A;  4RQE A;  5IWA B;  1PKX A;  4MTO A;  4HNA A;  1YTF B;  1S0V A;  4NR1 A;  3FX7 A;  4AHC A;  4NXN B;  5CA1 A;  3C3S A;  3AK1 A;  1PPJ H;  1XL6 A;  2UXD O;  1N34 B;  3UKM A;  3ZCC A;  5LYJ B;  3VOU A;  1RP3 B;  1M9N A;  1JVM A;  1WPB A;  2LFS A;  2AXT Z;  4DR7 B;  1Q6U A;  2QM4 A;  5LMN B;  1ZUQ A;  1FYJ A;  1EN4 A;  4UVA A;  4Z2W A;  4NTW A;  3C3T A;  4LFB O;  4FZ0 A;  1W0J G;  4AQY O;  3EFF K;  4YJ2 A;  4GUN A;  1PNK A;  4UVB A;  1GN4 A;  4JYY A;  4LP8 A;  1E79 G;  3FB8 C;  4AIL C;  1M57 C;  3K5L A;  4PV1 B;  3H1H H;  4HZ3 A;  3HKD A;  2HVJ C;  1Q6I A;  4Z1V A;  1BQ0 A;  3L9D A;  5LMU B;  2D3O W;  3M8A A;  3CC7 V;  5EBL C;  3FYE B;  1CXZ B;  2YI9 A;  2PI5 A;  1S5J A;  1NTM H;  4KXR A;  4DR2 B;  3UT5 A;  1SZX A;  3VQV A;  3RVY A;  4H33 A;  3ETG A;  4X66 B;  4L8J A;  2N05 A;  5L3E A;  2ZE8 A;  4KP4 A;  2MW2 B;  2GHY A;  4X88 A;  4YHH B;  3K5M A;  2DW4 A;  1ZAU A;  2IU3 A;  1JX9 A;  5JH7 B;  1D5N A;  3K58 A;  2BE3 A;  3K79 A;  1NQT A;  1S5H C;  4LWS A;  4DK0 A;  4DUY O;  1TGO A;  3CRA A;  4DR5 B;  1LUV A;  1OCO C;  2K9P A;  1MZE A;  4B7K A;  1DTO A;  3H01 A;  1QCE A;  1XBL A;  4O4I A;  4PD4 F;  2EIN C;  4P9O A;  1HNW B;  4ZOL B;  4DV1 O;  5LGU A;  3ASN C;  4Q6G A;  2F1M A;  1GN2 A;  3JAR B;  4R8C A;  2AGA A;  3OR7 C;  1OCR C;  2EJ7 A;  3QO8 A;  5J2U B;  2QJ1 A;  3E22 B;  4JI8 O;  4ZOL A;  1VQ4 V;  4LF7 B;  1R1B A;  1N36 O;  3T2M A;  1J95 A;  1YF2 A;  3WU2 Z;  4CZZ A;  4CC6 A;  2ZNI A;  2C2A A;  2ZR3 A;  1GN6 A;  1WN7 A;  3IC7 A;  5J2U A;  2XHB A;  2WA4 A;  2IJJ A;  1YZB A;  4RUE A;  1GK9 A;  1EN6 A;  4W4K A;  3T1Y B;  2WSS G;  4L87 A;  4U3J B;  4DV2 B;  3IJ4 A;  5C8Y B;  5EIB C;  3OUF A;  3PJS K;  3RVZ A;  3VBB A;  3JAL B;  2CUG A;  1NBM G;  2ZD9 A;  1KB9 F;  4I0X A;  4WF9 V;  2NNU A;  2ZNJ A;  4Z1M G;  3ZHT A;  2KSD A;  4JTA B;  3E89 A;  3AG7 A;  1M57 B;  4FM0 A;  3CXC U;  1SC5 B;  1P7G A;  3JAK B;  3OUS A;  1N32 B;  3A2F A;  1JFF B;  1GAX A;  2JGD A;  4KHP O;  3JAL A;  1SF9 A;  2CH7 B;  1L0N H;  4RQF A;  4DR4 O;  4DV6 O;  3X2Q C;  1Y74 B;  2CK3 G;  4JI4 B;  4NXM B;  3JAK A;  1QNM A;  2JEX A;  3OD4 A;  1XI1 A;  2WAM A;  1JFF A;  4KUM A;  4GKJ B;  3ETD A;  3E2E A;  4F6E A;  2VWJ A;  4DUZ B;  3IGA C;  4G27 B;  5CMU A;  2YI8 A;  2QR4 A;  2CH7 A;  4QE9 A;  1Y76 B;  4PA3 A;  1Y74 A;  3A8T A;  4H13 B;  2YUA A;  4JI5 O;  4DR6 O;  1NH2 D;  2WLH A;  3LUT B;  1QR9 A;  4JV5 B;  1K4C C;  1OCO B;  3K06 A;  2YDE A;  4GX0 A;  4FMT A;  3RWR D;  2QE7 G;  1M4U A;  1URF A;  1Y76 A;  1AP6 A;  4GX5 A;  4GX2 A;  1HR0 B;  1K5S A;  1XMQ O;  2F43 G;  3SYO A;  2BOC C;  1K5Q A;  3ASN B;  2JGU A;  1XMO B;  2Q0O C;  1S77 D;  3DXR B;  4YIO A;  1IBK O;  4WCE V;  4JAU A;  3G4S V;  4X1I B;  2A0L A;  4ABM A;  3AG2 C;  3SJQ C;  4C7U A;  4YY3 B;  4JZ2 A;  5KUM A;  5B3S C;  4K0K O;  4DXW A;  3T1H B;  1MMM A;  1KYO F;  3CCM V;  1HW7 A;  3DXR A;  4MVM A;  4LNU B;  4N21 A;  3OM3 B;  3TXQ A;  1VQP V;  2W6J G;  1B6Q A;  1IBL B;  5ITZ B;  4UCR A;  2IH3 C;  4FLW A;  2ZIN A;  3CS5 A;  1H2S B;  1VF5 B;  3BPZ A;  4XBF A;  4FIP C;  4UB8 Z;  2HKO A;  2GV9 A;  4ZIB A;  1ZX3 A;  4TQF A;  4K3A A;  1QBZ A;  2Y0P A;  4J7J A;  1FFT B;  5KHH A;  3BHP A;  5ITZ A;  3GWO A;  4MW8 A;  4PDR A;  1G6U A;  2XAG A;  3HKC B;  4X64 O;  4OPH A;  1MOF A;  1YTF D;  1H2N A;  4W4L A;  4FVM A;  2UUA B;  2FTK A;  4UB6 Z;  4EFB A;  1EFR G;  1IBM B;  3R66 A;  2Q73 A;  3X2Q B;  3DTU B;  3BEH A;  3HKC A;  4GZR B;  4FLX A;  2XTA A;  1NI8 A;  1YSC A;  1Y67 A;  3SJB C;  4FFB B;  1RFY A;  2BTQ B;  4UUJ C;  1FS0 G;  3K04 A;  4X89 A;  2P06 A;  3SPG A;  2OIG A;  1OCZ B;  2LJ2 A;  4XDL A;  1N4C A;  5H6R A;  2DN9 A;  2VS0 A;  2YXY A;  4CH3 A;  4GKK B;  3L72 H;  3F7Y C;  4FFB A;  2BTQ A;  4MVQ A;  5EYP B;  3N2K B;  2UU9 O;  4FLV A;  5H5N A;  1QR8 A;  4OPA A;  1PL0 A;  2YXH A;  1PD3 A;  2FKX A;  2IJI A;  1I08 A;  2WPD G;  3N2K A;  3D8C A;  2DYR C;  5K1P A;  4JI1 B;  4LR3 A;  3ABT A;  1ZSP A;  1IDS A;  3OMI B;  4JAV A;  3AG2 B;  1K8A W;  5B3S B;  1RM1 C;  2LO1 A;  1VQK V;  2JDI G;  2RNB A;  4NVP A;  4DO2 A;  1KBH A;  4QJF B;  2X6A A;  4UXN A;  5L3B A;  3EHB B;  1SET A;  4WFA V;  1R6N A;  1US6 A;  3JCU Z;  3U10 A;  2EUL A;  2HEP A;  4H0L B;  4MTX A;  3M7M X;  3K3W A;  2F4V O;  3QO5 A;  1VMG A;  4JI7 B;  4LFA O;  3BA8 A;  1LNQ A;  1DF5 A;  2GTA A;  2K1E A;  4OXS A;  2NLJ C;  1WA8 A;  4X65 O;  2HLD G;  1EZV H;  3CME V;  1MAB G;  2V1D A;  2Q4P A;  1WB8 A;  4LC1 A;  3BAB A;  5LHI A;  1JOY A;  3AEI A;  1NS1 A;  3L70 H;  1V9P A;  3CSX A;  2FYU H;  3OMA B;  4DV4 B;  4PI2 A;  2V7Q G;  3RW0 A;  4O4L B;  4LF6 O;  1SQG A;  2UXB O;  1VQ7 V;  3E8F A;  3SGI A;  5KLV H;  2ZIM A;  2ZIO A;  3KG2 A;  1VF6 C;  1W2B U;  4MW3 A;  4N23 A;  1IUR A;  3RYH B;  3Q4H B;  4WFB V;  1Y4M A;  1VQO V;  4FLT A;  3SYA A;  2Q0A A;  2QWQ B;  2XND G;  5EC2 C;  5H6Q A;  3ETQ A;  4O4L A;  1KUQ A;  1W59 A;  1P84 F;  5CBF A;  5F2V O;  3J81 N;  1I5X A;  3E8H A;  4JTC B;  3RYH A;  3Q4H A;  3DC6 A;  2R9I A;  1JA8 A;  1PL4 A;  1WPX A;  1BQZ A;  4JI6 B;  4OX9 O;  1NTZ H;  3RYI B;  1YDX A;  3IC9 A;  4I4T B;  5KHG A;  4RUF A;  2X0L A;  3ZHR A;  4DK1 A;  2HP8 A;  4LFC O;  5L3D A;  1W0K G;  1THZ A;  2DYR B;  3K0G A;  3WB2 A;  1MNG A;  1XUQ A;  2ZT9 B;  1I94 O;  2FB5 A;  4NTX A;  1CPY A;  3RYI A;  1FJG O;  3L71 H;  4F6R B;  1R6T A;  1RM1 B;  3RN4 A;  3ABM C;  3O9O A;  3MAQ A;  4IHJ A;  5BR8 O;  2GSM B;  2RN9 A;  4LF5 B;  2QSA A;  3SPJ A;  3CPW U;  1SA0 B;  3LSQ A;  5JCO C;  4MVO A;  3JD4 A;  3QF7 A;  1VQL V;  5JVD B;  4IIJ B;  3AG3 C;  1TUE B;  1R3K C;  1FXH A;  1VQ9 V;  3ZHU A;  5GTI Z;  5CBH A;  3BFR A;  3JAT B;  4MT8 A;  2HVK C;  3K5O A;  4XDJ A;  4GX1 A;  1WP7 A;  2UXD B;  3O65 A;  3F7V C;  1DF4 A;  2G38 A;  4IIJ A;  5JVD A;  3JD3 A;  2B1G A;  1KP2 A;  1YHQ V;  4LF4 O;  1K97 A;  4FJC C;  3VQX A;  1XNR O;  3A0H Z;  1XIL A;  5IDJ A;  2W6I G;  2Z3Y A;  4IL6 Z;  3MDS A;  2NR5 A;  3GVM A;  3FB7 C;  1N8R W;  1QVG U;  4U7N A;  4LFB B;  5LYJ A;  3ZMV A;  5H9C A;  4AQY B;  4JI3 O;  1SQQ H;  2A3Q A;  2PUS A;  3ABK C;  2GDS A;  3B77 A;  1BT8 A;  1KKD A;  2AZ2 A;  1TAE A;  1R3I C;  1YEW A;  3ETE A;  1PV0 A;  3U11 A;  1SQX H;  2JJ2 G;  1XNQ O;  1VF6 A;  1VQ5 V;  5JWP A;  3JD2 A;  1H8H G;  3OTO O;  5EIB D;  2WA3 A;  1WP8 A;  4A5U B;  2JRI A;  2ITC C;  1ZWI C;  4MSW C;  2OTL V;  3MD0 A;  4LF8 O;  3CC4 V;  2EX3 A;  5CB4 B;  2KKW A;  1KMI Z;  3CE2 A;  2QWN B;  1CP9 A;  1MZF A;  2PYJ A;  1K33 A;  2HG5 C;  2R72 A;  2PF4 E;  1K4D C;  1BMF G;  1OHH G;  4BW5 A;  2UXX A;  1Q6H A;  5FPO A;  2RMK B;  1N33 O;  5CB4 A;  2JIZ G;  1M56 C;  3JYC A;  1YJW V;  1U96 A;  5LGN A;  1EZJ A;  1SES A;  1HDJ A;  1AJQ A;  3FB5 C;  2MK3 A;  1OCC B;  1FXK B;  1M90 W;  1NZ6 A;  3GWK C;  1P7B A;  1KU9 A;  3ZHQ A;  4DV0 O;  1ARO P;  5LHH A;  3ABM B;  5CN0 A;  4DUY B;  1Q8I A; 
#chains in the Genus database with same CATH homology
 4FMT A;  3W7U A;  2QE7 G;  2X7R B;  4F4L A;  3W7S A;  3P30 A;  4GX5 A;  3SYP A;  1F4N A;  4GX2 A;  2HR3 A;  3B8N A;  1K5S A;  3W7X A;  2EIL C;  2B1I A;  1FXK A;  1SRY A;  3AG1 C;  1R6K A;  2F43 G;  2Q68 A;  3B8M A;  4G2K A;  3SYO A;  2BOC C;  2EJR A;  2A79 B;  3OGC C;  1K5Q A;  2Y48 A;  2JEU A;  1AJP A;  3ASN B;  3OE7 G;  1S77 D;  3AG3 B;  4UV8 A;  1G4Y B;  1RPR A;  4WCE V;  4JAU A;  3G4S V;  4UV9 A;  4JTD B;  2HJF C;  2A0L A;  2ZDI A;  4MTF A;  1FXV A;  1VQ6 V;  2Q69 A;  4PDM A;  3WG7 C;  2LFR A;  2EZO A;  4UVC A;  3ZRS A;  3AG2 C;  3SJQ C;  2X6B A;  1G8M A;  2WLM A;  3P32 A;  5B1B C;  5KA6 A;  5KUM A;  5B3S C;  2EIJ C;  3ZRW B;  5EBW C;  3CMA V;  3ASO B;  1JPX A;  4DXW A;  4GCZ A;  5EBM C;  3CCM V;  2DYS C;  4MVM A;  5E1A C;  4RAI A;  4N21 A;  3OM3 B;  1H38 A;  1JJ2 U;  3GB7 C;  1VQP V;  2W6J G;  2XAJ A;  1V54 C;  5B1O A;  1UJW B;  1B6Q A;  3CCE V;  2Y69 C;  2IH3 C;  3AG4 C;  3ZJZ A;  5L3G A;  4FPP A;  2IH1 C;  1GM7 A;  2P67 A;  3T4D A;  3ZRW A;  4XBF A;  4FIP C;  1WLE A;  4MVR A;  2HKO A;  4MVS A;  1KD1 W;  1BHB A;  3QNE A;  1PNM A;  5EK0 A;  1K92 A;  1Y66 A;  2XAF A;  1QBZ A;  4MS2 A;  4P2Z A;  2AHZ A;  1FFT B;  2P6J A;  2OT5 A;  3ABK B;  3K03 A;  1NR1 A;  4U7O A;  4BIZ A;  2AHY A;  3T1C A;  5DN6 G;  3GWO A;  4MW8 A;  4PDR A;  3CCU V;  1K7D A;  2XAG A;  4I9W A;  5GW7 A;  1GO3 F;  2ZXW B;  2DWD C;  4ZKI A;  3CCJ V;  1MOF A;  1YTF D;  1H2G A;  2ZQM A;  4R50 A;  5IY5 C;  1AI6 A;  5KA5 A;  4JPR A;  2FTK A;  4RO2 A;  4GX0 A;  3JD0 A;  1EFR G;  3M99 B;  1IXM A;  3X2Q B;  1NVP B;  4J9Y B;  3DTU B;  3BEH A;  3OMN B;  2A9H A;  1K9M W;  4P9P A;  4P30 A;  3SYQ A;  3CD6 V;  3R65 A;  3ZN1 A;  1NH2 B;  3JD1 A;  3OEH G;  1YSC A;  3K0D A;  1ENV A;  2WLI B;  4QPK A;  4WFF A;  4UUJ C;  1FS0 G;  3K04 A;  4WFH A;  4X89 A;  3SPC A;  3SPG A;  3STL C;  5IYC O;  4HAM A;  1M56 B;  1K34 A;  1SER A;  1OCZ B;  4CBC A;  5KUK A;  4XDL A;  5H6R A;  1DLB A;  3OW2 U;  2WLL B;  3F7Y C;  2WLI A;  4PA4 A;  4MVQ A;  4TWK A;  2QA4 V;  5CBG A;  3DGE A;  2IU0 A;  3CCL V;  5L3F A;  1QR8 A;  4PA7 A;  4I5S A;  1Q81 W;  3STZ C;  1S3J A;  4JGS A;  1ORQ C;  1R3L C;  2EIL B;  2M7W A;  2Z5U A;  2WLL A;  3AG1 B;  1PL0 A;  2P90 A;  1PD3 A;  1YIJ V;  1XL4 A;  5LGT A;  2IJI A;  2EIN B;  2WPD G;  1AR1 B;  3CC2 V;  1F23 A;  3A0R A;  2DYR C;  1R3J C;  3OAA G;  1VQM V;  1OCC C;  1FXK C;  1R73 A;  3ABT A;  2OCC C;  3CCV V;  1JCH A;  1OCR B;  2R9R B;  3OMI B;  2DQ3 A;  4JAV A;  4XDK A;  3WG7 B;  3AG2 B;  2QEX V;  5B1B B;  2XAS A;  1NR7 A;  1K73 W;  1K8A W;  5B3S B;  1RM1 C;  2EIJ B;  4MTG A;  1AI4 A;  5IYD O;  2JK5 C;  3SPH A;  2WWW A;  1VQK V;  2LP7 A;  2JDI G;  2DYS B;  3CCR V;  3ZRX A;  3WFV A;  3D3I A;  4DO2 A;  4WFE A;  4QJF B;  2ZDI C;  2X6A A;  4PDL A;  4UXN A;  5L3B A;  3EHB B;  4ZBM A;  1COW G;  1V54 B;  4LBE C;  1SET A;  2QM7 A;  1Q86 W;  4WFA V;  1R6N A;  3IFX A;  2Y69 B;  3FKS G;  3AG4 B;  3OR6 C;  2QTO A;  4YXW G;  3E8B A;  4E2L A;  4MTX A;  4RQE A;  3TCU A;  3K3W A;  1PKX A;  4MTO A;  1AJN A;  3QO5 A;  4WFG A;  4PA9 A;  3LDE A;  1QVF U;  1YTF B;  1S0V A;  1RPO A;  1LNQ A;  1DF5 A;  3MHH C;  3LSS A;  2K1E A;  4OXS A;  2NLJ C;  1XL6 A;  5HFM A;  3W7W A;  1OZ0 A;  4TT3 G;  1JQ0 A;  3UKM A;  3ZCC A;  1Q7Y W;  2HLD G;  3CME V;  3VOU A;  1MAB G;  2V1D A;  1M9N A;  1EBO A;  1JVM A;  4LC1 A;  2DQ0 A;  2LFS A;  5J9P C;  5LHI A;  2PI4 A;  3AEI A;  1MG1 A;  1JOY A;  5IY5 B;  1CEZ A;  2ZR2 A;  4BAY A;  5BZB A;  3OMA B;  3TK1 A;  1VQ8 V;  3ZMU A;  2V7Q G;  3RW0 A;  4J9Z B;  2P7T C;  2W0F C;  3QO7 A;  4UVA A;  1YIT V;  1VQ7 V;  2B5U A;  3E8F A;  2EZP A;  1E1Q G;  1W0J G;  2QKS A;  3KG2 A;  1W2B U;  3EFF K;  4MW3 A;  4N23 A;  1PNK A;  4UVB A;  3T4Z A;  2EIK C;  4WFB V;  1Y4M A;  3E8G A;  1VQO V;  3G71 V;  3JCZ A;  1GKF A;  3SYA A;  2XND G;  5EC2 C;  2QM8 A;  5H6Q A;  4QNH B;  5CA3 A;  4LP8 A;  1ROP A;  1YJ9 V;  5CBF A;  1KEC A;  2HFE C;  3ZIA G;  3LDC A;  1E79 G;  3FB8 C;  3CCS V;  3I55 V;  1I5X A;  1Q82 W;  3E8H A;  1M57 C;  2JJ1 G;  4JTC B;  3ZN0 A;  2XAH A;  4HZ3 A;  1QLE C;  2HVJ C;  4TSF G;  2YEV B;  2WLJ A;  4FK5 C;  1V55 C;  2R9I A;  4QE7 A;  3ML0 A;  2D3O W;  3F5W C;  3CC7 V;  4JYB A;  5EBL C;  3E35 A;  1S76 D;  3K08 A;  3ZRV A;  1WPX A;  2Q6A A;  3FYE B;  1GTO A;  4BIU A;  4MVU A;  4EKW A;  2PI5 A;  3W7T A;  2ITD C;  1GMG A;  4RUF A;  2X0L A;  3RVY A;  4H33 A;  5B1A C;  3ETG A;  3ABL C;  5L3D A;  1W0K G;  4PDV A;  5L3E A;  1OCZ C;  1THZ A;  4KP4 A;  1QLN A;  3SYC A;  2IW5 A;  2DYR B;  3K0G A;  2GHY A;  4X88 A;  3UM7 A;  2OCC B;  2DW4 A;  1CPY A;  5HFL A;  3I56 V;  2IJK A;  1YJN V;  2IU3 A;  1JX9 A;  3CP1 A;  2X6C A;  1KQS U;  3ZMZ A;  3K79 A;  1RM1 B;  1NQT A;  1S5H C;  3LDD A;  2WLK A;  2XOK G;  3ABM C;  2EIM C;  1F51 A;  1OCO C;  4ASU G;  2GSM B;  4JYC A;  1AI7 A;  1DTO A;  3OEE G;  4HYO A;  3RBZ A;  3MHS C;  3SPJ A;  1KP3 A;  1E1R G;  3H01 A;  1QCE A;  3LSQ A;  3BY6 A;  3G6E V;  3CPW U;  4MVO A;  1MSW D;  3HB3 B;  5LBQ A;  2EIN C;  3JD4 A;  1VQL V;  1NJI W;  4P9O A;  5LGU A;  1K3E A;  3ASN C;  5LHG A;  3CCQ V;  5EC1 C;  3NXS A;  1F4M A;  1BHA A;  3AG3 C;  1P4R A;  1TUE B;  2IJH A;  4R8C A;  1R3K C;  3D36 A;  3OR7 C;  1OCR C;  5FL7 G;  1FXH A;  1VQ9 V;  5CBH A;  3FB6 C;  4H37 A;  3QO8 A;  1H8E G;  4MT8 A;  5IYB O;  1SZT A;  2HVK C;  3TET A;  4PA6 A;  5B1N A;  2BOB C;  2XAQ A;  3CYO A;  3ASO C;  3E86 A;  4GX1 A;  4QIW F;  1AI5 A;  4XDJ A;  1VQ4 V;  3LNM B;  4X8A A;  3F7V C;  1DF4 A;  3JD3 A;  2B1G A;  3E83 A;  3T2M A;  4R6Z A;  1J95 A;  3HPL C;  1KP2 A;  4MVZ A;  1PNL A;  4CZZ A;  1K97 A;  1GM8 A;  4FJC C;  1YHQ V;  2H8P C;  2C2A A;  3ZMS A;  2ZR3 A;  5IDJ A;  3IC7 A;  2W6I G;  1I5Y A;  2Z3Y A;  2IJJ A;  3FB7 C;  4RUE A;  1GK9 A;  1N8R W;  1L1F A;  4G28 B;  1QVG U;  2Q67 A;  4U7N A;  2WSS G;  3OFN G;  4JAS A;  4L87 A;  3ZMT A;  3ZMV A;  2EIK B;  5H9C A;  1M1K W;  3OUF A;  3PJS K;  3RVZ A;  5DM6 V;  3VBB A;  1NKD A;  1NBM G;  2ZD9 A;  3ABK C;  2YSU B;  3B77 A;  4JF3 A;  1KKD A;  2DWE C;  4WF9 V;  1R3I C;  2NNU A;  4Z1M G;  4LCU C;  3ETE A;  2ZXW C;  2JJ2 G;  4JTA B;  3E89 A;  1KC8 W;  1M57 B;  3CXC U;  1VQ5 V;  3JD2 A;  1H8H G;  1QLE B;  3OUS A;  1V55 B;  2ITC C;  2WLN A;  2EBO A;  1ZWI C;  4MSW C;  2OTL V;  2OTJ V;  3MD0 A;  3CC4 V;  4RQF A;  3K9A A;  5L3C A;  3X2Q C;  2KB1 A;  1BL8 A;  2CK3 G;  2H94 A;  1CP9 A;  4Q20 A;  2JEX A;  1K33 A;  2WAM A;  4KUM A;  4QPJ A;  2HG5 C;  5B1A B;  3ETD A;  3E2E A;  3SPI A;  3ABL B;  4PEL A;  1HWY A;  4R7C A;  1K4D C;  1BMF G;  1OHH G;  2YEV A;  4BW5 A;  2UXX A;  3IGA C;  4G27 B;  5CMU A;  4QE9 A;  1NVP D;  5C93 A;  2JIZ G;  1M56 C;  4PA3 A;  3JYC A;  4KFM A;  1YJW V;  5LGN A;  1EZJ A;  1SES A;  1AJQ A;  3FB5 C;  2MK3 A;  1OCC B;  1FXK B;  1NH2 D;  1M90 W;  3ABU A;  1VQN V;  1P7B A;  4GT1 A;  2ATK C;  2WLH A;  1YI2 V;  3FYI B;  3LUT B;  1QR9 A;  1ARO P;  5LHH A;  3ABM B;  1K4C C;  2EIM B;  5CN0 A;  1S72 V;  1OCO B;  3K06 A;  1GM9 A;  2UXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...