5B1OA

Dhp domain structure of envz p248a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
AMAAGVKQLADDRTLLMAGVSHDLRTALTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Osmolarity sensor protein EnvZ
publication title Angucycline antibiotic waldiomycin recognizes common structural motif conserved in bacterial histidine kinases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 25
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1oA00
3ZRWB 4BIUA 4JASA 2QM8A 4MT8A 2FTKA 3TK1A 5IDJA 2QM7A 3A0RA 4JAVA 3P32A 4JYBA 3ZRXA 4QPJA 3ZCCA 4BIZA 4Q20A 4JAUA 3ZRVA 5B1NA 2LFSA 3MD0A 4KP4A 2P67A 4U7OA 4JYCA 4LC1A 3NXSA 4QPKA 4FMTA 4GCZA 2C2AA 3D36A 4FPPA 2LFRA 4I5SA 1JOYA 5B1OA 1IXMA 3ZRWA 3DGEA 4MTXA 5C93A 4GT1A 2WWWA 4U7NA 4ZKIA 1F51A
chains in the Genus database with same CATH superfamily
1XL4A 4DV3B 1XILA 4ZHQB 2JK5C 1N33B 4KXRA 3ZBHA 5KMGA 1NTMH 1WJZA 3JSNA 4FLTA 2ILMA 3QO7A 4I55A 2KKWA 3JARB 4X89A 3CCMV 4UCUA 3CRQA 3CEIA 1YI2V 3SYOA 2XOKG 2GV9A 4J11A 4TQDA 4TSFG 4HYOA 2B1GA 1FS0G 2AHYA 4O4HB 1AP6A 4LF4B 2DOSA 3J80N 3ZHVA 1SZTA 2BTQA 3WB2A 2JGUA 1MZEA 2ATKC 2IH1C 4DV0B 1E1QG 4UFZA 5KAIZ 4JI8B 1S77D 2DMXA 4I4TA 4I50B 3SPJA 1IBKO 4NXNO 1IZ3A 4DR6O 2ETNA 4ZIBA 2ZIMA 2EIKB 3GWOA 3K0GA 5L3EA 5KAFZ 4P2ZA 4X1KA 2F93B 4LFCB 1JOYA 5B1OA 3IAYA 1FXKC 4N21A 1Q82W 4HAMA 5BR8B 1QBZA 2OYQA 5JVDB 3LSSA 2BSKA 2UUCB 2W6JG 4X62O 2XTAA 3LSQA 3ZRSA 4BIOA 3RYIB 1KYOF 3U0ZA 1L0NH 4UCOA 5J9PC 5CA1A 1QNMA 2CH7A 2GBOA 4NR1A 1IBMO 3HKBA 2X6AA 2ZE5A 5LBQA 2QA4V 3JATB 4DV6O 5D5QA 1Q7YW 2YIAA 2WLNA 1P84F 3OUFA 1FJGO 1N36O 4UCSA 1OCRB 3L72H 4BWAA 4JI6O 3F7VC 4CH6A 3OAAG 2EIMC 4YJ2A 2GTSA 4H13B 4XDJA 3JASA 1AJNA 1JJ2U 2HFEC 2P22C 3SYQA 2F95B 2EJRA 2EJ7A 3ML0A 5K1PA 1G1XB 4R7CA 1G4YB 4DR1O 2QE7G 1OCZB 5KUKA 5JJJB 4XDKA 3HKDB 3CRMA 2DJVA 3TXSA 2UUBO 1BQZA 4ICGA 3UKMA 4UV8A 2OCCB 4KHPB 1K5QA 1KKCA 3T1HO 5LMNB 4NKGB 3CC4V 2JJ1G 3JCZA 4JYBA 2GTAA 4CBCA 3K06A 2DQ3A 1VQOV 1M90W 4MTOA 1AJQA 2AW9A 4JI7B 1J5EB 2WAMA 4JI0O 5J2TB 3T2MA 1EFRG 1L8DA 3B40A 2FKXA 4TWKA 3AG1B 4JGSA 1O9HA 1H2NA 3CCVV 1LR1A 3OTFA 4J10A 3ZMTA 1OCOC 1V54B 2W0FC 2QWNB 2P5OA 3LNNA 2HHHB 3OMNB 1IBLO 4J7KA 2CK3G 4DV1B 4DR5B 4FM2A 4LFBB 4FMTA 1PNLA 5BZBA 4NXMO 3RBZA 2RQ6A 3OT7A 4GX0A 3BAAA 5C93A 2CTPA 4LF9B 1S0VA 3N2GA 2WWWA 2XUMA 2Y69C 3FD9A 1HR0O 1I08A 2ZDIA 1YSCA 3W7TA 2YEVA 5JJEB 1Q86W 4CS3A 2PGGA 2PI4A 2IM9A 3VQYA 3CCSV 2LFSA 3EXAA 2Q7HA 2ODMA 3K5LA 3SR2C 4DV5O 1WPXA 3JSLA 1FXVA 3FAVB 4G27B 3SJCC 2YS8A 4J9YB 2MK3A 1IX9A 2OIEA 5B3SB 1Y74B 3EVKA 2RN9A 5EZYB 3QF7A 4GKKB 1MNGA 4CS2A 1P49A 5EIBD 1W2BU 5LP6B 2XHBA 3T1YO 1VEWA 4TV8B 1HNWO 2XNDG 1VQKV 3SPGA 3TXQA 3DGEA 1HNXO 3TCUA 5LXTA 4IT5A 4X88A 3RWRD 4FFBA 1RSOA 3UT5B 4BW5A 3OEEG 3OMIB 4DYLA 5FNVB 5A2QN 2UXXA 1VMGA 1PP9H 2ZXWC 1R3IC 3K03A 3CMEV 5BXZA 2EIKC 2P67A 1VQ5V 1S76D 3N2KB 2YIBD 2WA3A 1KB9F 4O4JB 5CBHA 4DR3O 3AG2B 4PELA 4UVCA 1V55B 5JQGA 4DR7O 1O9GA 4WCEV 1I5YA 2ZNIA 1Q5OA 4H44B 1ZX3A 1SETA 1UFIA 1XMOB 4GX2A 3L9DA 3MD0A 1S5HC 2RCVA 1RM1B 4NB5A 4TT3G 4YXWG 5EBWC 1AI7A 4JPRA 4JI5B 2NR5A 4MT8A 1N32B 2DW4A 3MHHC 3STZC 1YHQV 2OCHA 1M93A 2V4DA 1TUEB 3WG7C 5JH7A 1OCCB 4U3JB 5LMUB 1HW7A 3NXSA 4X1YB 4LNUB 1OCRC 3G6BA 3RVYA 2QGNA 4K0KO 4OX9O 4YY3B 3JALA 1QLNA 1FFTB 4KL1A 1H2LA 1JQ0A 4FLUA 4EB6B 2DQ0A 4IIJB 1K33A 3FB7C 4BAYA 2GUZA 1JR9A 1OCZC 4UCRA 4N23A 2GHYA 4LP8A 1Y76A 2B1IA 3RFRA 3APOA 3E86A 4B3TB 3UCSC 4PA4A 1QU7A 1LUWA 2RDCA 4OPAA 4AQYO 5BMVA 3K58A 2OCCC 3E35A 1K92A 4UVBA 2HKOA 3G80A 4F6RB 1HP8A 1JFFB 1Q43A 3JYCA 1UJWB 4RWUA 4PDMA 2QTSA 2VQEB 1R6NA 4PA6A 1X4TA 1DTOA 3IJ4A 4HBNA 4B08A 3TETA 4WF9V 1NZ6A 4CC5A 1G8MA 2QWQB 1V54C 1KU9A 3H1HH 1K97A 1HNZO 2WLIB 3ZX6A 3ETQA 1BT8A 4J80A 4DR2B 3Q4HA 2XAJA 4FIPC 3BFRA 3E89A 3H1JH 4LC1A 4FM0A 2A3QA 1MMMA 3KCXA 4B3RB 5IJ9B 1FXKB 5LHGA 1F4NA 1EZJA 3ETEA 3OW2U 4DV3O 3B2EE 1NR7A 3LDDA 1N33O 1TUBB 3CWBH 2ZIOA 4I0XA 3ZS8C 3X2QC 5FPRA 5IWAO 4DV2O 1URFA 1Q6UA 3OM3B 4W4LA 2E5LO 2CGNA 5CMUA 3JAKA 3BRCA 2X7RB 1SERA 1HWYA 4ZKIA 4NYKA 5B3SC 4LF4O 3BA9A 4FZ1A 4IL6Z 1IVSA 1RP3B 1M5IA 4JZGA 4LF7O 5LP6C 2NLJC 3OTOB 1JMKC 2LW1A 3OUSA 4YIOA 1DLBA 3JD4A 1XMQB 1I94B 2EIMB 1Q6HA 4DV0O 4JYAO 2PZSA 3D36C 1E79G 2Y0IA 4PI2A 4U7NA 1K5SA 4JI8O 1I7FA 3CCJV 3U10A 4RO2A 3SJQC 3HKEA 3E8BA 4AHCA 1SF9A 2Q5ZA 1Q8IA 2H3OA 2Q0AA 1VQ8V 3CRAA 1E1RG 4AILC 4I9WA 5J2UA 3AG2C 1S72V 1VIBA 3IC9A 1DF5A 3H1IH 4MVUA 1D5NA 4JI1O 2FTKA 4MTFA 2UUCO 4MTGA 1M57C 4DRXA 3W7WA 1BQ0A 1WB8A 4PV1B 4OXSA 3OR7C 3JARA 4H37A 4DR4B 1XBLA 4PA9A 2BCCH 4LCUC 4Q6GA 1NH2B 1RM1C 2UXCB 1SA0A 4YHHO 2ZM6O 3H9VA 1NJIW 4KUMA 5C8YB 1F7YA 5KHKA 2EILC 4F6EA 5LOVA 3K5NA 4DUYB 1KC8W 1YXBA 4JTAB 3PN1A 3ASNC 4Z1VA 3A8TA 1OCCC 4FLZA 2UXDB 2A06H 2HP8A 2FYUH 2HR3A 3VQXA 3UQ8A 1S3JA 1L1FA 3RVZA 2FB5A 1Q90D 1XHXA 3HR0A 3ABLC 1KQSU 4W4KA 4WBNB 5GTHZ 4EFBA 4FM1A 3ETGA 1L0LH 2OIGA 4TUYA 3ZHUA 1VQ7V 4YJ3A 4QE7A 4HNAA 3R66A 5IT9N 3RYCA 2HVJC 2QWOB 4FJCC 4E2LA 2KG7B 1ZL8B 2ITCC 4IYHA 2LP7A 2JDIG 3UO2A 4MSWC 4PDRA 3SYPA 2LQTA 2Q6AA 2JGDB 3F7YC 2ZKOA 4NTWA 4JI7O 4O4LB 1B3QA 1J5EO 4B3MB 1YJWV 2BE3A 2UU9O 2CTWA 4IHJA 3JATA 3CXCU 1WB7A 3T1CA 3CRCA 1FXHA 3CCRV 3A0BZ 4JASA 4DV7B 4PDVA 5JWPA 3E22B 4UCTA 2P4VA 2NNUA 4FFKA 4PA7A 5IYZB 5JCOC 2ZXWB 1B6QA 4DR5O 5E1AC 2ITDC 4CZZA 4FLWA 5GW7A 4DW1A 2C2AA 1G6UA 2OT5A 2FL4A 1I5XA 1XUQA 4R8CA 3H01A 4D7TA 4X1IB 4P9PA 2QM8A 3STLC 4FK5C 2QM4A 1MSWD 3FYEB 3CPWU 1OV9A 3VQWA 3BHPA 1SQVH 5EC2C 4D7SA 1TVKA 5EYPA 3KKYA 5KMGB 3ZN0A 2RNBA 4FVMA 4I55B 1EBOA 5LGNA 3RN4A 2DYSC 5DN6G 2QWRB 3C3TA 3CC7V 5KLVH 1VF5B 1NVPB 4GKKO 1AROP 4LF5O 2HJFC 3TK1A 3WG7B 3ZCCA 2Y4TA 1Y66A 1ZTEA 1RPRA 1SQGA 2QKSA 3RT3C 2IJIA 1GM8A 2X6BA 4I5SA 2BTQB 1Z2GA 2WLHA 2M7WA 2VQFO 1QVFU 2B5UA 3SDLA 2N05A 3JD1A 1XNRO 4KFMA 2P6JA 2AGAA 1VQMV 1YTFB 1VF6A 3CS5A 3L71H 3K5MA 4LFAO 4LWSA 3DTUB 1IXBA 5KA6A 1COWG 4PD4F 3OD4A 4X1KB 3ASOC 1K4DC 1PNKA 2AHZA 1D2DA 2GSMB 4Z1MG 4RUEA 3FFQA 1ZUQA 3W7SA 2BSKB 1SQPH 5CBGA 1F23A 2YIBA 3GB7C 5CA1B 2IW5A 3J7AU 2CH7B 3BY6A 1SZXA 4K8XA 3ZJZA 2PYLA 3SJAC 4JV5B 2RJZA 5B1BC 3HKBB 4GKJB 4JZ2A 5F2VO 1KKDA 4JAUA 4FZ0A 4PA3A 3B4SA 1N34O 2JRIA 3S3WA 1WPBA 2P7TC 3MAQA 3K08A 3G71V 1P7GA 4MVQA 4YJ2B 3FX7A 3T4ZA 4CH5A 1B06A 3JASB 3O9OA 3GWKC 2Z3YA 4LF6O 3CCEV 4CC6A 2NN4A 4NXNB 2K9PA 4DR6B 4CS4A 4X66O 1SQQH 3X2QB 1SS3A 4RUFA 1YEWA 2LFRA 2A9HA 5LA6A 1H2MA 4X9QA 3LNMB 1WA8A 5FL7G 1D5AA 4X62B 2DE0X 2E75B 4TOIA 2VQEO 1AR4A 1YJNV 3SGIA 1TGOA 5B5EZ 1Z5VA 4JI3B 4DUZO 2Q67A 1VQPV 1H2SB 2QEXV 2JEXA 1YITV 2DYRB 2N04A 4DV6B 2GDSA 2E76B 2QM7A 2F1MA 5H5NA 3P32A 1QLEC 4X1YA 4DK1A 4PJ0Z 5CB4B 1K8AW 3AEIA 1K7DA 3CJHA 4Q20A 1FJGB 1N36B 3KZIZ 4GYCB 2YXLA 2XASA 5LYJA 3FB8C 4JI6B 3EHBB 4RQEA 3AK2A 4J41A 4JI4O 4WFEA 4B3RO 3ZRWA 4L8JA 4MTXA 1AILA 3CP1A 3MHSC 1BE3H 3CB2A 1M57B 3N2GB 4DV4O 3TJTA 3IFXA 4UV9A 3ZRXA 4DR1B 4MVSA 4JI2O 2YEVB 1GTOA 4ABMA 4FLXA 2JIZG 2UXBO 2WLJA 4X64O 2HG5C 4O2BA 1M4UA 2IH3C 3C90A 3N27A 1FFXA 3OGCC 2W0XA 2EIJB 2WLLA 3HB3B 1VP7A 4DW0A 1PNMA 1JJOA 3ZIAG 5LL6Y 2XAQA 1HDJA 2EILB 3ABKB 2ZE8A 3T1HB 1MABG 3AK1A 1R6KA 2V1DA 3BA8A 3ASNB 3SYAA 1JX9A 2UUAO 2Q4PA 3SJBC 1PV0A 1XDCA 1QR8A 3K5OA 1Q6IA 3K79A 3ZHRA 2YC0A 4ZI7B 2R70A 3E2EA 1XOUA 2AZ2A 1R3LC 5LXTB 4TV9A 1SESA 3ABLB 4FFBB 1IBLB 1BHBA 1RSOB 4GX1A 4LF8O 1AJPA 1KMIZ 4U7OA 3ZMVA 1Y6XA 1FXKA 4NXMB 4LH6A 3H1LH 1OZ0A 2ZE7A 4EKWA 1GN3A 1HR0B 5JQGB 1PKXA 2PF4E 1ZLZA 4H0LB 1SKVA 4DR4O 1B04A 4X20A 1YDXA 2UXCO 2HEPA 4DV5B 1SC5B 5IJ0A 4O4IA 4DO2A 1AI4A 2VWKA 2IJHA 2Q8VA 3U11A 2ZQMA 2IBZH 4PHZA 2VWJA 4J7JA 5KX5A 3ABMC 1PD3A 3T1YB 4B3SO 2H94A 4JYYA 4HZ3A 1MZFA 4NTXA 3RYHA 1QR9A 1R73A 1HNWB 4Z2WA 5GONA 3G6EV 5CN0A 2ZD9A 4JAAA 3RYFA 5EC1C 3JALB 5L3CA 5ITZA 3ETDA 1P7BA 3CCUV 5IY5B 1XHZA 3APQA 1FD9A 2UXNA 2GUZB 5EIBC 3K0DA 3HKCA 5A9GA 2BOCC 3JAWA 3CMAV 1Y76B 4DR3B 2DYSB 5L3DA 1WN7A 1LNQA 2EZPA 3QG5A 4GLXA 4NVPA 4DR7B 2WPDG 4O2AB 5BMVB 1JVMA 1AP5A 4IYIA 1A32A 3DXRA 3QTCA 5L3BA 2PY5A 5D5PA 2EINC 3KG2A 3EFFK 3VOUA 1PL4A 1M1KW 3DC5A 1NQTA 1H8HG 2JEUA 4FPPA 1BGYH 3R65A 2ZCEA 1SQBH 4DV7O 3BPZA 1AB3A 2DYRC 2AZ0A 4LH7A 1MSDA 1X59A 2CAZC 4FLVA 4QPJA 1H38A 3LSUA 4P30A 2WSSG 1US6A 3CX5F 4G28B 2ZR2A 4C7UA 1TA8A 1JPXA 4ZOLB 1CXZB 4LFCO 1YIJV 1BZKA 4K0KB 4OX9B 3JD2A 5BR8O 3ASOB 2M6YA 4ZHQA 2R9RB 2VRZA 3UM7A 3QO5A 3GVMA 5B1AC 1H2KA 2P90A 1W0KG 2A0LA 2DWDC 2YIDA 2ZDIC 3P3PA 2KG7A 4I0XB 1W59A 4O4HA 3D3QA 4GT1A 2EIJC 1GN2A 2X0LA 4NTYA 2Y0PA 4GUNA 2YXHA 3JAKB 5CA0B 2WLKA 3QO8A 4OPHA 3ABKC 5B1BB 1BSMA 1Q3EA 1VQ6V 4JF3A 5HFMA 1EN5A 3B8MA 4D6TH 4JTCB 4I50A 2QR4A 3CCQV 1JA8A 3W7XA 1R6TA 1NH2D 1HNZB 1KP2A 2LW7A 2ZNJA 5L3GA 3HKEB 2V7QG 1PM9A 4B7KA 5CBFA 3D8CA 5JVDA 1M56C 2PI5A 2N74A 1GK9A 3KCYA 2YSUB 3ZEDA 5J2UB 1YVWA 4KHPO 1ENVA 2QKCA 2D2CB 1XL6A 5LMNO 3RYIA 1N4CA 2CDYA 4MVOA 4DRXB 3L73H 1P4RA 5EBMC 2YXYA 2KB1A 4UVAA 5IWAB 4DV2B 3OGIB 5L3FA 1AVMA 2E5LB 1SA0B 5JJNB 1F51A 2DWEC 3AG4B 2ZE6A 1MOFA 4JV5O 2HHHO 3F5WC 5LGTA 4GKJO 2WA4A 1QLEB 2LJ2A 4LF7B 2E3CA 3I5DA 5LOVB 4DV1O 2JS3A 5IYBO 4KP4A 4LFBO 3ABTA 2YUAA 3IGAC 2LO1A 3B77A 1GH6A 3E83A 3RGBA 4JYAB 4MS2A 3ICXA 2XAGA 4LF9O 4X65B 5K1XA 3B8NA 3S3XA 2IU0A 1ORQC 1MG1A 2R9AA 3HKDA 2LGWA 3CHXA 5IY5C 2Q7GA 5KHIA 3SYCA 3OR6C 5GTIZ 4P9OA 3CE2A 1DGSA 3A2FA 4TUYB 1JCHA 4YJ3B 4HNAB 3QVNA 3RYCB 3NR7A 4R50A 3AG7A 2EULA 4JI1B 1CEZA 3IC7A 2Q68A 3E8GA 1XNQB 3CYOA 5J2TA 4DXWA 1S5LZ 4RQFA 5EBLC 3WU2Z 4JI3O 3G67A 2F4VB 3UO3A 1QVGU 3E8FA 4YHHB 1NTZH 1TAEA 5KUMA 4IHJB 1NT2B 2ZM6B 4GX5A 1NU1H 1OJHA 2OWOA 2HJDA 4I7ZB 1YZBA 1KD1W 1FAFA 5E79Z 3M99B 4I4TB 2Q69A 4AI8A 5IYCO 2YICA 1FKAO 5TISZ 1NVPD 3JD0A 4LBEC 1WP8A 3FB6C 1KUQA 4L87A 5KHJA 2F23A 1H8EG 3O65A 3L74H 3AG3C 4UCVA 4X8AA 1XMOO 1WNSA 3CRRA 3FAVA 1LUVA 4WFAV 1TVKB 5EYPB 3K59A 1Y74A 1YF2A 5EZYA 1M9NA 2EBOA 2HLDG 4F4LA 1YTFD 2ARHA 4JI5O 2P4KA 2L6LA 4RAIA 5LP6A 1N32O 2XAHA 3C3SA 4J7ZA 4ASUG 3AK3A 1GMGA 5H2FZ 3ABMB 4TV8A 5LMUO 5LHHA 1CP9A 3D36A 1VQ9V 5LGUA 4E4EA 2UU9B 3WB1A 3M8AA 2Q0OC 4YY3O 3UT5A 1K4CC 2CUGA 5FPOA 1FYJA 2QKAA 3K04A 5FNVA 3ZMSA 2LGQA 3CCLV 5CB4A 2ADPA 1I0HA 1NBMG 4JAVA 1AR1B 1N0NA 1IBKB 3N2KA 1BCCH 5H9CA 3ZHTA 4H33A 4O4JA 2OTLV 2Z5UA 3P3NA 4QIWF 1N0JA 2Y48A 3H1KH 1BMFG 4B3TO 3LDCA 4LWSB 4J42A 5IYDO 1T5EA 5EK0A 2QSAA 2X6CA 2Z0AA 3K57A 5KA5A 2Q7EA 1MA1A 2O57A 2EINB 3ZMZA 2YDEA 4UXNA 4EEQA 2QTOA 1EM1A 4WFFA 3E8HA 3RW0A 1YJ9V 1GKFA 1QCEA 4GCZA 3WFVA 1R3KC 4TQFA 2YI8A 1IBMB 2JS5A 1R1BA 2R72A 1NTKH 5H6QA 4LF5B 3AG4C 2BOBC 2R9IA 3I55V 1U96A 1BL8A 4U3JA 1OHHG 1IDSA 2JJ2G 4LNUA 4IGGA 3K9SA 3ZRVA 4DR2O 1VARA 5H6RA 3OMAB 1H2GA 5B66Z 4ZI7A 4BW9A 2F43G 3SPIA 2Q73A 2VQFB 4EB6A 5CA3A 1XNRB 4IIJA 2CTQA 1GM9A 1ZWIC 4MVZA 2OTJV 4OGQB 5B1AB 3M7MX 2PYJA 2E74B 1GO3F 4R6ZA 4LFAB 4BR6A 3OE7G 2H8PC 4G2KA 5KHGA 2UUBB 2EZOA 2ZR3A 3JCUZ 1VQNV 4F6RA 1N8RW 1SQFA 2IJKA 1JFFA 2CE4A 5LA6B 1AI6A 2YI9A 1R3JC 4FLYA 1WA8B 2KQXA 1XI1A 1K9MW 1WAZA 2Q9LA 1ROPA 3VBBA 3OTOO 1U97A 4CH3A 1Z5WA 1XMQO 5DECA 1I94O 3QNEA 2DN9A 4JI0B 1BS3A 3W7UA 1KECA 2WLIA 3ZMUA 3J81N 1GN6A 5JCOA 3FB5C 2D3OW 3DC6A 1SRYA 1F4MA 1N34B 2XAFA 3CJHB 1SQXH 5AG2A 5IJ9A 3THOA 1KP3A 2W6IG 3TGUH 5LYJB 3BVOA 3LUTB 1IXMA 1UPGA 1M56B 1PL0A 1YCIA 3OFNG 2BTOA 1TUBA 4CH4A 3ZRWB 2CTRA 3WB0A 1GM7A 5KHHA 5DM6V 2FMLA 4LF6B 2A7WA 4X66B 1WP7A 4DK0A 3K3WA 4O2AA 3G4SV 3I56V 2EX3A 4O2BB 3FKSG 1FFXB 3SPCA 2L35A 2IU3A 2WLLB 4LR3A 1RFYA 4DUYO 4EFEA 2VS0A 1KBHA 5HFLA 4BIZA 3MDSA 5B1NA 4U3FH 1DF4A 3JD3A 2ADQB 4PDLA 4JTDB 2UXDO 2JVDA 1WLEA 4WFHA 5JH7B 5BY1A 4DUZB 3CD6V 5LHIA 3AG1C 1HNXB 3HPLC 3K9AA 3A0HZ 2B9ZA 1XREA 4WFGA 3JAMN 4J9ZB 4I9QA 1Y4MA 4TV9B 1S5JA 4ZOLA 3BCCH 1IURA 3P30A 2XT9A 2IJJA 4QNHB 1VF6C 4MW8A 3T4DA 4JI4B 4UUJC 2P06A 1BHAA 1EZVH 1NR1A 1AR5A 4XBFA 3L70H 4DV4B 3A0RA 3LDEA 4JI2B 1RPOA 3BEHA 4B3MO 2UXBB 2QDOA 4X64B 4X20B 2AXTZ 3D3IA 5CA0A 1NI8A 5C8YA 2G38A 5FLXN 2F66C 2ZT9B 4K35A 5IJ0B 1XQ8A 1GN4A 4O4IB 1GRJA 1QHTA 2QJ1A 5IDJA 3ZN1A 2CGOA 3CXHF 3CC2V 2RMKB 2WLMA 4JYCA 4QPKA 5KX5B 1VQ4V 1K73W 2UUAB 3Q4HB 5DEDA 1QQCA 4X65O 3RYHB 4B7EA 1ZSPA 5GONB 4ZBMA 4A5UB 2K1EA 4WBNA 3PJSK 3AG3B 4MVRA 4YIPA 3RYFB 4WFBV 4QGPA 3VQVA 3ZHQA 1XEQA 1VQLV 5ITZB 2QWPB 4LF8B 4K8ZA 1ZL8A 1EN4A 3CSXA 4MVMA 4PI0A 3L75H 3ABUA 1V9PA 3HKCB 1Y67A 1V55C 3JAWB 4AQYB 2ZINA 1Q81W 1FPOA 2KSDA 4BIUA 1XNQO 2JGDA 3ZHSA 3B09A 4GZRB 4O4LA 4UB8Z 1NKDA 2PUSA 3DXRB 5IE9A 2F4VO 3BABA 1K34A 3DSQA 3E22A 1OCOB 4QJFB 1J95A 1VF7A 4UB6Z 3FYIB 5IYZA 2PTMA 2HVKC 3SPHA 1AI5A 2A79B 4K3AA 1W0JG 4B3SB 4MW3A 2MW2B 1K3EA 2Y4UA 4QE9A 1CPYA 3OEHG 3F5TA 1ZAUA 1PPJH 1GAXA 1DK1A 4X1IA 1EN6A 1THZA 4XDLA 2Y69B 1NS1A
chains in the Genus database with same CATH topology
1XL4A 1NR7A 3CP1A 3MHSC 3LDDA 1M57B 2JK5C 3AG3C 3IFXA 4UV9A 4X8AA 3ZRXA 4MVSA 2YEVB 1GTOA 3QO7A 2JIZG 2WLJA 3X2QC 4X89A 2HG5C 4WFAV 3CCMV 2IH3C 3OGCC 1YI2V 3OM3B 3SYOA 1M9NA 2EBOA 2EIJB 2WLLA 3HB3B 5CMUA 1PNMA 2HLDG 2XOKG 2X7RB 1SERA 1HWYA 3ZIAG 4TSFG 4F4LA 1YTFD 4HYOA 4ZKIA 5B3SC 2B1GA 1FS0G 2AHYA 4RAIA 2XAQA 2XAHA 2EILB 3ABKB 4ASUG 1MABG 1R6KA 1GMGA 2V1DA 3ABMB 3ASNB 2NLJC 3SYAA 3OUSA 5LHHA 1CP9A 1SZTA 1JX9A 1DLBA 3D36A 1VQ9V 3JD4A 2EIMB 5LGUA 2ATKC 2IH1C 1QR8A 1E1QG 1K4CC 3K79A 1E79G 3K04A 4U7NA 1K5SA 3ZMSA 3E2EA 3CCLV 1R3LC 1S77D 1NBMG 1SESA 3ABLB 3SPJA 3CCJV 4JAVA 1AR1B 1BHBA 4RO2A 3SJQC 4GX1A 3E8BA 5H9CA 2EIKB 4H33A 2OTLV 2Z5UA 3GWOA 1AJPA 1VQ8V 4QIWF 4U7OA 3K0GA 2Y48A 5L3EA 3ZMVA 1BMFG 1FXKA 1E1RG 4I9WA 4P2ZA 3LDCA 1JOYA 5B1OA 5IYDO 1OZ0A 1FXKC 3AG2C 4N21A 5EK0A 2X6CA 4HAMA 1Q82W 1S72V 1QBZA 1DF5A 4EKWA 4MVUA 5KA5A 2FTKA 4MTFA 4MTGA 1M57C 3W7WA 3LSSA 1PKXA 2W6JG 4OXSA 2EINB 3OR7C 3ZMZA 3LSQA 4UXNA 4H37A 2QTOA 3ZRSA 4PA9A 4WFFA 3E8HA 3RW0A 4LCUC 1YJ9V 1GKFA 1QCEA 5J9PC 1RM1C 4GCZA 3WFVA 1NH2B 1R3KC 4DO2A 5H6QA 1AI4A 2X6AA 5LBQA 1NJIW 4KUMA 2QA4V 3AG4C 2IJHA 2BOBC 2EILC 2R9IA 2ZQMA 1KC8W 1Q7YW 3I55V 1BL8A 2WLNA 1OHHG 2JJ2G 3OUFA 4JTAB 3ABMC 3ZRVA 1PD3A 3ASNC 2H94A 4HZ3A 5H6RA 1OCCC 1OCRB 3F7VC 3OMAB 1H2GA 3OAAG 1QR9A 1R73A 2EIMC 2F43G 3G6EV 2HR3A 3SPIA 5CN0A 2ZD9A 4XDJA 5CA3A 1AJNA 1S3JA 1JJ2U 2HFEC 1L1FA 5EC1C 3RVZA 3SYQA 1GM9A 1ZWIC 4MVZA 2OTJV 5L3CA 2EJRA 3ABLC 3ML0A 3ETDA 4R7CA 5B1AB 1G4YB 1KQSU 1P7BA 3CCUV 5IY5B 2QE7G 1OCZB 5KUKA 4XDKA 3ETGA 1GO3F 4R6ZA 3OE7G 2UXNA 2H8PC 4G2KA 1VQ7V 3K0DA 4QE7A 2BOCC 2HVJC 3CMAV 2EZOA 2ZR3A 2DYSB 5L3DA 1VQNV 4E2LA 4FJCC 3UKMA 4UV8A 2OCCB 1LNQA 2ITCC 2EZPA 1N8RW 2LP7A 2IJKA 2WPDG 2JDIG 4MSWC 1AI6A 1K5QA 1JVMA 4PDRA 3SYPA 5L3BA 1R3JC 3CC4V 2Q6AA 2EINC 2JJ1G 3JCZA 3KG2A 4JYBA 4CBCA 1K9MW 1ROPA 3EFFK 3F7YC 3K06A 3VBBA 2DQ3A 3VOUA 1VQOV 1M90W 4MTOA 1M1KW 1AJQA 1NQTA 1H8HG 2JEUA 2WAMA 4FPPA 3QNEA 1YJWV 3T2MA 1EFRG 4TWKA 3AG1B 3R65A 4JGSA 3W7UA 3CXCU 3T1CA 3CCVV 1FXHA 3CCRV 1KECA 2WLIA 3ZMUA 3ZMTA 1OCOC 4JASA 1V54B 2W0FC 4PDVA 2DYRC 3FB5C 2D3OW 3OMNB 2NNUA 4QPJA 1SRYA 4PA7A 1H38A 2ZXWB 1B6QA 2CK3G 5E1AC 2ITDC 1F4MA 4P30A 2WSSG 4CZZA 2XAFA 4FMTA 1PNLA 5GW7A 5BZBA 4G28B 2C2AA 2ZR2A 3RBZA 1JPXA 1KP3A 1YIJV 2W6IG 2OT5A 4GX0A 3LUTB 1IXMA 1M56B 5C93A 1PL0A 3OFNG 3JD2A 1S0VA 2WWWA 3ASOB 1I5XA 2R9RB 2Y69C 4R8CA 3H01A 3ZRWB 4P9PA 2QM8A 3STLC 3UM7A 4FK5C 1GM7A 3QO5A 2ZDIA 5DM6V 1MSWD 3FYEB 3CPWU 1YSCA 5B1AC 2YEVA 3W7TA 2P90A 1W0KG 2A0LA 1Q86W 2DWDC 2ZDIC 5EC2C 2PI4A 3CCSV 2LFSA 3ZN0A 1WPXA 1EBOA 1FXVA 4G27B 5LGNA 2DYSC 5DN6G 3K3WA 3G4SV 3I56V 4GT1A 4J9YB 2EIJC 2MK3A 3FKSG 3SPCA 3CC7V 2X0LA 5B3SB 2IU3A 1NVPB 1AROP 2WLLB 2WLKA 3QO8A 2HJFC 3TK1A 3ABKC 5B1BB 5HFLA 1W2BU 3WG7B 3ZCCA 4BIZA 1Y66A 1RPRA 5B1NA 2QKSA 1VQ6V 4JF3A 1DF4A 2IJIA 1GM8A 3JD3A 2X6BA 4PDLA 4JTDB 5HFMA 3B8MA 1WLEA 4WFHA 2XNDG 4I5SA 1VQKV 3SPGA 3CD6V 5LHIA 2WLHA 3AG1C 3DGEA 2M7WA 3TCUA 4X88A 2B5UA 1QVFU 4JTCB 3HPLC 3JD1A 3K9AA 4KFMA 4WFGA 3CCQV 4BW5A 2P6JA 3W7XA 3OEEG 4J9ZB 3OMIB 1NH2D 1KP2A 1Y4MA 1VQMV 2UXXA 1YTFB 2ZXWC 1R3IC 3K03A 3CMEV 3P30A 2EIKC 2P67A 5L3GA 1VQ5V 2IJJA 2V7QG 1S76D 4QNHB 4MW8A 3T4DA 3DTUB 5CBFA 5CBHA 4UUJC 3AG2B 4PELA 4UVCA 5KA6A 1M56C 2PI5A 1COWG 1GK9A 1V55B 3ASOC 2YSUB 1K4DC 1PNKA 2AHZA 1BHAA 1ENVA 4WCEV 1I5YA 1NR1A 2GSMB 1XL6A 4Z1MG 4XBFA 3A0RA 4RUEA 4MVOA 3W7SA 1SETA 3LDEA 4GX2A 1P4RA 1RPOA 5EBMC 3MD0A 1S5HC 3BEHA 1RM1B 5CBGA 2KB1A 4UVAA 5L3FA 1F23A 3D3IA 4TT3G 4YXWG 3GB7C 2IW5A 3BY6A 5EBWC 1AI7A 1F51A 3ZJZA 4JPRA 2DWEC 3AG4B 4MT8A 1MOFA 2DW4A 3MHHC 3STZC 1YHQV 3OW2U 3F5WC 5LGTA 5B1BC 5IDJA 3ZN1A 1TUEB 1QLEB 3WG7C 1KKDA 3CC2V 4JAUA 4PA3A 1OCCB 5IYBO 4KP4A 2WLMA 4JYCA 3ABTA 3NXSA 4QPKA 3IGAC 1VQ4V 1K73W 1OCRC 2P7TC 3B77A 3RVYA 3E83A 3K08A 3G71V 4MS2A 2XAGA 4MVQA 1QLNA 3B8NA 1FFTB 4ZBMA 2IU0A 1ORQC 1JQ0A 3T4ZA 1MG1A 2K1EA 3PJSK 3AG3B 2DQ0A 2Z3YA 4MVRA 1K33A 4WFBV 3FB7C 4BAYA 3CCEV 1VQLV 5IY5C 1OCZC 3SYCA 3OR6C 4N23A 2GHYA 4LP8A 2B1IA 3X2QB 4P9OA 3E86A 4PA4A 2LFRA 4RUFA 4MVMA 2A9HA 1JCHA 3ABUA 1V55C 2OCCC 4R50A 3E35A 1K92A 1Q81W 4UVBA 2HKOA 3LNMB 4BIUA 1CEZA 3IC7A 2Q68A 3E8GA 5FL7G 3JYCA 1UJWB 1NKDA 3CYOA 4PDMA 1YJNV 4DXWA 4RQFA 5EBLC 1R6NA 4PA6A 1K34A 1DTOA 2Q67A 1QVGU 3E8FA 3TETA 4WF9V 1VQPV 2QEXV 5KUMA 1OCOB 2JEXA 4QJFB 1J95A 1YITV 4GX5A 1G8MA 2DYRB 3FYIB 1V54C 2HVKC 1K97A 3SPHA 2WLIB 2QM7A 3P32A 1QLEC 1KD1W 1AI5A 2A79B 3M99B 3AEIA 1K7DA 4Q20A 1K8AW 1W0JG 2XAJA 4FIPC 2Q69A 5IYCO 3E89A 4MW3A 2XASA 1K3EA 4LC1A 3FB8C 4QE9A 3EHBB 1NVPD 1CPYA 3OEHG 4RQEA 3JD0A 4LBEC 4WFEA 3ZRWA 3FB6C 4MTXA 1FXKB 1THZA 4XDLA 5LHGA 1F4NA 1EZJA 2Y69B 3ETEA 4L87A 1H8EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRW B;  4BIU A;  4JAS A;  2QM8 A;  4MT8 A;  2FTK A;  3TK1 A;  5IDJ A;  2QM7 A;  3A0R A;  4JAV A;  3P32 A;  4JYB A;  3ZRX A;  4QPJ A;  3ZCC A;  4BIZ A;  4Q20 A;  4JAU A;  3ZRV A;  5B1N A;  2LFS A;  3MD0 A;  4KP4 A;  2P67 A;  4U7O A;  4JYC A;  4LC1 A;  3NXS A;  4QPK A;  4FMT A;  4GCZ A;  2C2A A;  3D36 A;  4FPP A;  2LFR A;  4I5S A;  1JOY A;  5B1O A;  1IXM A;  3ZRW A;  3DGE A;  4MTX A;  5C93 A;  4GT1 A;  2WWW A;  4U7N A;  4ZKI A;  1F51 A; 
#chains in the Genus database with same CATH topology
 1XL4 A;  4DV3 B;  1XIL A;  4ZHQ B;  2JK5 C;  1N33 B;  4KXR A;  3ZBH A;  5KMG A;  1NTM H;  1WJZ A;  3JSN A;  4FLT A;  2ILM A;  3QO7 A;  4I55 A;  2KKW A;  3JAR B;  4X89 A;  3CCM V;  4UCU A;  3CRQ A;  3CEI A;  1YI2 V;  3SYO A;  2XOK G;  2GV9 A;  4J11 A;  4TQD A;  4TSF G;  4HYO A;  2B1G A;  1FS0 G;  2AHY A;  4O4H B;  1AP6 A;  4LF4 B;  2DOS A;  3J80 N;  3ZHV A;  1SZT A;  2BTQ A;  3WB2 A;  2JGU A;  1MZE A;  2ATK C;  2IH1 C;  4DV0 B;  1E1Q G;  4UFZ A;  5KAI Z;  4JI8 B;  1S77 D;  2DMX A;  4I4T A;  4I50 B;  3SPJ A;  1IBK O;  4NXN O;  1IZ3 A;  4DR6 O;  2ETN A;  4ZIB A;  2ZIM A;  2EIK B;  3GWO A;  3K0G A;  5L3E A;  5KAF Z;  4P2Z A;  4X1K A;  2F93 B;  4LFC B;  1JOY A;  5B1O A;  3IAY A;  1FXK C;  4N21 A;  1Q82 W;  4HAM A;  5BR8 B;  1QBZ A;  2OYQ A;  5JVD B;  3LSS A;  2BSK A;  2UUC B;  2W6J G;  4X62 O;  2XTA A;  3LSQ A;  3ZRS A;  4BIO A;  3RYI B;  1KYO F;  3U0Z A;  1L0N H;  4UCO A;  5J9P C;  5CA1 A;  1QNM A;  2CH7 A;  2GBO A;  4NR1 A;  1IBM O;  3HKB A;  2X6A A;  2ZE5 A;  5LBQ A;  2QA4 V;  3JAT B;  4DV6 O;  5D5Q A;  1Q7Y W;  2YIA A;  2WLN A;  1P84 F;  3OUF A;  1FJG O;  1N36 O;  4UCS A;  1OCR B;  3L72 H;  4BWA A;  4JI6 O;  3F7V C;  4CH6 A;  3OAA G;  2EIM C;  4YJ2 A;  2GTS A;  4H13 B;  4XDJ A;  3JAS A;  1AJN A;  1JJ2 U;  2HFE C;  2P22 C;  3SYQ A;  2F95 B;  2EJR A;  2EJ7 A;  3ML0 A;  5K1P A;  1G1X B;  4R7C A;  1G4Y B;  4DR1 O;  2QE7 G;  1OCZ B;  5KUK A;  5JJJ B;  4XDK A;  3HKD B;  3CRM A;  2DJV A;  3TXS A;  2UUB O;  1BQZ A;  4ICG A;  3UKM A;  4UV8 A;  2OCC B;  4KHP B;  1K5Q A;  1KKC A;  3T1H O;  5LMN B;  4NKG B;  3CC4 V;  2JJ1 G;  3JCZ A;  4JYB A;  2GTA A;  4CBC A;  3K06 A;  2DQ3 A;  1VQO V;  1M90 W;  4MTO A;  1AJQ A;  2AW9 A;  4JI7 B;  1J5E B;  2WAM A;  4JI0 O;  5J2T B;  3T2M A;  1EFR G;  1L8D A;  3B40 A;  2FKX A;  4TWK A;  3AG1 B;  4JGS A;  1O9H A;  1H2N A;  3CCV V;  1LR1 A;  3OTF A;  4J10 A;  3ZMT A;  1OCO C;  1V54 B;  2W0F C;  2QWN B;  2P5O A;  3LNN A;  2HHH B;  3OMN B;  1IBL O;  4J7K A;  2CK3 G;  4DV1 B;  4DR5 B;  4FM2 A;  4LFB B;  4FMT A;  1PNL A;  5BZB A;  4NXM O;  3RBZ A;  2RQ6 A;  3OT7 A;  4GX0 A;  3BAA A;  5C93 A;  2CTP A;  4LF9 B;  1S0V A;  3N2G A;  2WWW A;  2XUM A;  2Y69 C;  3FD9 A;  1HR0 O;  1I08 A;  2ZDI A;  1YSC A;  3W7T A;  2YEV A;  5JJE B;  1Q86 W;  4CS3 A;  2PGG A;  2PI4 A;  2IM9 A;  3VQY A;  3CCS V;  2LFS A;  3EXA A;  2Q7H A;  2ODM A;  3K5L A;  3SR2 C;  4DV5 O;  1WPX A;  3JSL A;  1FXV A;  3FAV B;  4G27 B;  3SJC C;  2YS8 A;  4J9Y B;  2MK3 A;  1IX9 A;  2OIE A;  5B3S B;  1Y74 B;  3EVK A;  2RN9 A;  5EZY B;  3QF7 A;  4GKK B;  1MNG A;  4CS2 A;  1P49 A;  5EIB D;  1W2B U;  5LP6 B;  2XHB A;  3T1Y O;  1VEW A;  4TV8 B;  1HNW O;  2XND G;  1VQK V;  3SPG A;  3TXQ A;  3DGE A;  1HNX O;  3TCU A;  5LXT A;  4IT5 A;  4X88 A;  3RWR D;  4FFB A;  1RSO A;  3UT5 B;  4BW5 A;  3OEE G;  3OMI B;  4DYL A;  5FNV B;  5A2Q N;  2UXX A;  1VMG A;  1PP9 H;  2ZXW C;  1R3I C;  3K03 A;  3CME V;  5BXZ A;  2EIK C;  2P67 A;  1VQ5 V;  1S76 D;  3N2K B;  2YIB D;  2WA3 A;  1KB9 F;  4O4J B;  5CBH A;  4DR3 O;  3AG2 B;  4PEL A;  4UVC A;  1V55 B;  5JQG A;  4DR7 O;  1O9G A;  4WCE V;  1I5Y A;  2ZNI A;  1Q5O A;  4H44 B;  1ZX3 A;  1SET A;  1UFI A;  1XMO B;  4GX2 A;  3L9D A;  3MD0 A;  1S5H C;  2RCV A;  1RM1 B;  4NB5 A;  4TT3 G;  4YXW G;  5EBW C;  1AI7 A;  4JPR A;  4JI5 B;  2NR5 A;  4MT8 A;  1N32 B;  2DW4 A;  3MHH C;  3STZ C;  1YHQ V;  2OCH A;  1M93 A;  2V4D A;  1TUE B;  3WG7 C;  5JH7 A;  1OCC B;  4U3J B;  5LMU B;  1HW7 A;  3NXS A;  4X1Y B;  4LNU B;  1OCR C;  3G6B A;  3RVY A;  2QGN A;  4K0K O;  4OX9 O;  4YY3 B;  3JAL A;  1QLN A;  1FFT B;  4KL1 A;  1H2L A;  1JQ0 A;  4FLU A;  4EB6 B;  2DQ0 A;  4IIJ B;  1K33 A;  3FB7 C;  4BAY A;  2GUZ A;  1JR9 A;  1OCZ C;  4UCR A;  4N23 A;  2GHY A;  4LP8 A;  1Y76 A;  2B1I A;  3RFR A;  3APO A;  3E86 A;  4B3T B;  3UCS C;  4PA4 A;  1QU7 A;  1LUW A;  2RDC A;  4OPA A;  4AQY O;  5BMV A;  3K58 A;  2OCC C;  3E35 A;  1K92 A;  4UVB A;  2HKO A;  3G80 A;  4F6R B;  1HP8 A;  1JFF B;  1Q43 A;  3JYC A;  1UJW B;  4RWU A;  4PDM A;  2QTS A;  2VQE B;  1R6N A;  4PA6 A;  1X4T A;  1DTO A;  3IJ4 A;  4HBN A;  4B08 A;  3TET A;  4WF9 V;  1NZ6 A;  4CC5 A;  1G8M A;  2QWQ B;  1V54 C;  1KU9 A;  3H1H H;  1K97 A;  1HNZ O;  2WLI B;  3ZX6 A;  3ETQ A;  1BT8 A;  4J80 A;  4DR2 B;  3Q4H A;  2XAJ A;  4FIP C;  3BFR A;  3E89 A;  3H1J H;  4LC1 A;  4FM0 A;  2A3Q A;  1MMM A;  3KCX A;  4B3R B;  5IJ9 B;  1FXK B;  5LHG A;  1F4N A;  1EZJ A;  3ETE A;  3OW2 U;  4DV3 O;  3B2E E;  1NR7 A;  3LDD A;  1N33 O;  1TUB B;  3CWB H;  2ZIO A;  4I0X A;  3ZS8 C;  3X2Q C;  5FPR A;  5IWA O;  4DV2 O;  1URF A;  1Q6U A;  3OM3 B;  4W4L A;  2E5L O;  2CGN A;  5CMU A;  3JAK A;  3BRC A;  2X7R B;  1SER A;  1HWY A;  4ZKI A;  4NYK A;  5B3S C;  4LF4 O;  3BA9 A;  4FZ1 A;  4IL6 Z;  1IVS A;  1RP3 B;  1M5I A;  4JZG A;  4LF7 O;  5LP6 C;  2NLJ C;  3OTO B;  1JMK C;  2LW1 A;  3OUS A;  4YIO A;  1DLB A;  3JD4 A;  1XMQ B;  1I94 B;  2EIM B;  1Q6H A;  4DV0 O;  4JYA O;  2PZS A;  3D36 C;  1E79 G;  2Y0I A;  4PI2 A;  4U7N A;  1K5S A;  4JI8 O;  1I7F A;  3CCJ V;  3U10 A;  4RO2 A;  3SJQ C;  3HKE A;  3E8B A;  4AHC A;  1SF9 A;  2Q5Z A;  1Q8I A;  2H3O A;  2Q0A A;  1VQ8 V;  3CRA A;  1E1R G;  4AIL C;  4I9W A;  5J2U A;  3AG2 C;  1S72 V;  1VIB A;  3IC9 A;  1DF5 A;  3H1I H;  4MVU A;  1D5N A;  4JI1 O;  2FTK A;  4MTF A;  2UUC O;  4MTG A;  1M57 C;  4DRX A;  3W7W A;  1BQ0 A;  1WB8 A;  4PV1 B;  4OXS A;  3OR7 C;  3JAR A;  4H37 A;  4DR4 B;  1XBL A;  4PA9 A;  2BCC H;  4LCU C;  4Q6G A;  1NH2 B;  1RM1 C;  2UXC B;  1SA0 A;  4YHH O;  2ZM6 O;  3H9V A;  1NJI W;  4KUM A;  5C8Y B;  1F7Y A;  5KHK A;  2EIL C;  4F6E A;  5LOV A;  3K5N A;  4DUY B;  1KC8 W;  1YXB A;  4JTA B;  3PN1 A;  3ASN C;  4Z1V A;  3A8T A;  1OCC C;  4FLZ A;  2UXD B;  2A06 H;  2HP8 A;  2FYU H;  2HR3 A;  3VQX A;  3UQ8 A;  1S3J A;  1L1F A;  3RVZ A;  2FB5 A;  1Q90 D;  1XHX A;  3HR0 A;  3ABL C;  1KQS U;  4W4K A;  4WBN B;  5GTH Z;  4EFB A;  4FM1 A;  3ETG A;  1L0L H;  2OIG A;  4TUY A;  3ZHU A;  1VQ7 V;  4YJ3 A;  4QE7 A;  4HNA A;  3R66 A;  5IT9 N;  3RYC A;  2HVJ C;  2QWO B;  4FJC C;  4E2L A;  2KG7 B;  1ZL8 B;  2ITC C;  4IYH A;  2LP7 A;  2JDI G;  3UO2 A;  4MSW C;  4PDR A;  3SYP A;  2LQT A;  2Q6A A;  2JGD B;  3F7Y C;  2ZKO A;  4NTW A;  4JI7 O;  4O4L B;  1B3Q A;  1J5E O;  4B3M B;  1YJW V;  2BE3 A;  2UU9 O;  2CTW A;  4IHJ A;  3JAT A;  3CXC U;  1WB7 A;  3T1C A;  3CRC A;  1FXH A;  3CCR V;  3A0B Z;  4JAS A;  4DV7 B;  4PDV A;  5JWP A;  3E22 B;  4UCT A;  2P4V A;  2NNU A;  4FFK A;  4PA7 A;  5IYZ B;  5JCO C;  2ZXW B;  1B6Q A;  4DR5 O;  5E1A C;  2ITD C;  4CZZ A;  4FLW A;  5GW7 A;  4DW1 A;  2C2A A;  1G6U A;  2OT5 A;  2FL4 A;  1I5X A;  1XUQ A;  4R8C A;  3H01 A;  4D7T A;  4X1I B;  4P9P A;  2QM8 A;  3STL C;  4FK5 C;  2QM4 A;  1MSW D;  3FYE B;  3CPW U;  1OV9 A;  3VQW A;  3BHP A;  1SQV H;  5EC2 C;  4D7S A;  1TVK A;  5EYP A;  3KKY A;  5KMG B;  3ZN0 A;  2RNB A;  4FVM A;  4I55 B;  1EBO A;  5LGN A;  3RN4 A;  2DYS C;  5DN6 G;  2QWR B;  3C3T A;  3CC7 V;  5KLV H;  1VF5 B;  1NVP B;  4GKK O;  1ARO P;  4LF5 O;  2HJF C;  3TK1 A;  3WG7 B;  3ZCC A;  2Y4T A;  1Y66 A;  1ZTE A;  1RPR A;  1SQG A;  2QKS A;  3RT3 C;  2IJI A;  1GM8 A;  2X6B A;  4I5S A;  2BTQ B;  1Z2G A;  2WLH A;  2M7W A;  2VQF O;  1QVF U;  2B5U A;  3SDL A;  2N05 A;  3JD1 A;  1XNR O;  4KFM A;  2P6J A;  2AGA A;  1VQM V;  1YTF B;  1VF6 A;  3CS5 A;  3L71 H;  3K5M A;  4LFA O;  4LWS A;  3DTU B;  1IXB A;  5KA6 A;  1COW G;  4PD4 F;  3OD4 A;  4X1K B;  3ASO C;  1K4D C;  1PNK A;  2AHZ A;  1D2D A;  2GSM B;  4Z1M G;  4RUE A;  3FFQ A;  1ZUQ A;  3W7S A;  2BSK B;  1SQP H;  5CBG A;  1F23 A;  2YIB A;  3GB7 C;  5CA1 B;  2IW5 A;  3J7A U;  2CH7 B;  3BY6 A;  1SZX A;  4K8X A;  3ZJZ A;  2PYL A;  3SJA C;  4JV5 B;  2RJZ A;  5B1B C;  3HKB B;  4GKJ B;  4JZ2 A;  5F2V O;  1KKD A;  4JAU A;  4FZ0 A;  4PA3 A;  3B4S A;  1N34 O;  2JRI A;  3S3W A;  1WPB A;  2P7T C;  3MAQ A;  3K08 A;  3G71 V;  1P7G A;  4MVQ A;  4YJ2 B;  3FX7 A;  3T4Z A;  4CH5 A;  1B06 A;  3JAS B;  3O9O A;  3GWK C;  2Z3Y A;  4LF6 O;  3CCE V;  4CC6 A;  2NN4 A;  4NXN B;  2K9P A;  4DR6 B;  4CS4 A;  4X66 O;  1SQQ H;  3X2Q B;  1SS3 A;  4RUF A;  1YEW A;  2LFR A;  2A9H A;  5LA6 A;  1H2M A;  4X9Q A;  3LNM B;  1WA8 A;  5FL7 G;  1D5A A;  4X62 B;  2DE0 X;  2E75 B;  4TOI A;  2VQE O;  1AR4 A;  1YJN V;  3SGI A;  1TGO A;  5B5E Z;  1Z5V A;  4JI3 B;  4DUZ O;  2Q67 A;  1VQP V;  1H2S B;  2QEX V;  2JEX A;  1YIT V;  2DYR B;  2N04 A;  4DV6 B;  2GDS A;  2E76 B;  2QM7 A;  2F1M A;  5H5N A;  3P32 A;  1QLE C;  4X1Y A;  4DK1 A;  4PJ0 Z;  5CB4 B;  1K8A W;  3AEI A;  1K7D A;  3CJH A;  4Q20 A;  1FJG B;  1N36 B;  3KZI Z;  4GYC B;  2YXL A;  2XAS A;  5LYJ A;  3FB8 C;  4JI6 B;  3EHB B;  4RQE A;  3AK2 A;  4J41 A;  4JI4 O;  4WFE A;  4B3R O;  3ZRW A;  4L8J A;  4MTX A;  1AIL A;  3CP1 A;  3MHS C;  1BE3 H;  3CB2 A;  1M57 B;  3N2G B;  4DV4 O;  3TJT A;  3IFX A;  4UV9 A;  3ZRX A;  4DR1 B;  4MVS A;  4JI2 O;  2YEV B;  1GTO A;  4ABM A;  4FLX A;  2JIZ G;  2UXB O;  2WLJ A;  4X64 O;  2HG5 C;  4O2B A;  1M4U A;  2IH3 C;  3C90 A;  3N27 A;  1FFX A;  3OGC C;  2W0X A;  2EIJ B;  2WLL A;  3HB3 B;  1VP7 A;  4DW0 A;  1PNM A;  1JJO A;  3ZIA G;  5LL6 Y;  2XAQ A;  1HDJ A;  2EIL B;  3ABK B;  2ZE8 A;  3T1H B;  1MAB G;  3AK1 A;  1R6K A;  2V1D A;  3BA8 A;  3ASN B;  3SYA A;  1JX9 A;  2UUA O;  2Q4P A;  3SJB C;  1PV0 A;  1XDC A;  1QR8 A;  3K5O A;  1Q6I A;  3K79 A;  3ZHR A;  2YC0 A;  4ZI7 B;  2R70 A;  3E2E A;  1XOU A;  2AZ2 A;  1R3L C;  5LXT B;  4TV9 A;  1SES A;  3ABL B;  4FFB B;  1IBL B;  1BHB A;  1RSO B;  4GX1 A;  4LF8 O;  1AJP A;  1KMI Z;  4U7O A;  3ZMV A;  1Y6X A;  1FXK A;  4NXM B;  4LH6 A;  3H1L H;  1OZ0 A;  2ZE7 A;  4EKW A;  1GN3 A;  1HR0 B;  5JQG B;  1PKX A;  2PF4 E;  1ZLZ A;  4H0L B;  1SKV A;  4DR4 O;  1B04 A;  4X20 A;  1YDX A;  2UXC O;  2HEP A;  4DV5 B;  1SC5 B;  5IJ0 A;  4O4I A;  4DO2 A;  1AI4 A;  2VWK A;  2IJH A;  2Q8V A;  3U11 A;  2ZQM A;  2IBZ H;  4PHZ A;  2VWJ A;  4J7J A;  5KX5 A;  3ABM C;  1PD3 A;  3T1Y B;  4B3S O;  2H94 A;  4JYY A;  4HZ3 A;  1MZF A;  4NTX A;  3RYH A;  1QR9 A;  1R73 A;  1HNW B;  4Z2W A;  5GON A;  3G6E V;  5CN0 A;  2ZD9 A;  4JAA A;  3RYF A;  5EC1 C;  3JAL B;  5L3C A;  5ITZ A;  3ETD A;  1P7B A;  3CCU V;  5IY5 B;  1XHZ A;  3APQ A;  1FD9 A;  2UXN A;  2GUZ B;  5EIB C;  3K0D A;  3HKC A;  5A9G A;  2BOC C;  3JAW A;  3CMA V;  1Y76 B;  4DR3 B;  2DYS B;  5L3D A;  1WN7 A;  1LNQ A;  2EZP A;  3QG5 A;  4GLX A;  4NVP A;  4DR7 B;  2WPD G;  4O2A B;  5BMV B;  1JVM A;  1AP5 A;  4IYI A;  1A32 A;  3DXR A;  3QTC A;  5L3B A;  2PY5 A;  5D5P A;  2EIN C;  3KG2 A;  3EFF K;  3VOU A;  1PL4 A;  1M1K W;  3DC5 A;  1NQT A;  1H8H G;  2JEU A;  4FPP A;  1BGY H;  3R65 A;  2ZCE A;  1SQB H;  4DV7 O;  3BPZ A;  1AB3 A;  2DYR C;  2AZ0 A;  4LH7 A;  1MSD A;  1X59 A;  2CAZ C;  4FLV A;  4QPJ A;  1H38 A;  3LSU A;  4P30 A;  2WSS G;  1US6 A;  3CX5 F;  4G28 B;  2ZR2 A;  4C7U A;  1TA8 A;  1JPX A;  4ZOL B;  1CXZ B;  4LFC O;  1YIJ V;  1BZK A;  4K0K B;  4OX9 B;  3JD2 A;  5BR8 O;  3ASO B;  2M6Y A;  4ZHQ A;  2R9R B;  2VRZ A;  3UM7 A;  3QO5 A;  3GVM A;  5B1A C;  1H2K A;  2P90 A;  1W0K G;  2A0L A;  2DWD C;  2YID A;  2ZDI C;  3P3P A;  2KG7 A;  4I0X B;  1W59 A;  4O4H A;  3D3Q A;  4GT1 A;  2EIJ C;  1GN2 A;  2X0L A;  4NTY A;  2Y0P A;  4GUN A;  2YXH A;  3JAK B;  5CA0 B;  2WLK A;  3QO8 A;  4OPH A;  3ABK C;  5B1B B;  1BSM A;  1Q3E A;  1VQ6 V;  4JF3 A;  5HFM A;  1EN5 A;  3B8M A;  4D6T H;  4JTC B;  4I50 A;  2QR4 A;  3CCQ V;  1JA8 A;  3W7X A;  1R6T A;  1NH2 D;  1HNZ B;  1KP2 A;  2LW7 A;  2ZNJ A;  5L3G A;  3HKE B;  2V7Q G;  1PM9 A;  4B7K A;  5CBF A;  3D8C A;  5JVD A;  1M56 C;  2PI5 A;  2N74 A;  1GK9 A;  3KCY A;  2YSU B;  3ZED A;  5J2U B;  1YVW A;  4KHP O;  1ENV A;  2QKC A;  2D2C B;  1XL6 A;  5LMN O;  3RYI A;  1N4C A;  2CDY A;  4MVO A;  4DRX B;  3L73 H;  1P4R A;  5EBM C;  2YXY A;  2KB1 A;  4UVA A;  5IWA B;  4DV2 B;  3OGI B;  5L3F A;  1AVM A;  2E5L B;  1SA0 B;  5JJN B;  1F51 A;  2DWE C;  3AG4 B;  2ZE6 A;  1MOF A;  4JV5 O;  2HHH O;  3F5W C;  5LGT A;  4GKJ O;  2WA4 A;  1QLE B;  2LJ2 A;  4LF7 B;  2E3C A;  3I5D A;  5LOV B;  4DV1 O;  2JS3 A;  5IYB O;  4KP4 A;  4LFB O;  3ABT A;  2YUA A;  3IGA C;  2LO1 A;  3B77 A;  1GH6 A;  3E83 A;  3RGB A;  4JYA B;  4MS2 A;  3ICX A;  2XAG A;  4LF9 O;  4X65 B;  5K1X A;  3B8N A;  3S3X A;  2IU0 A;  1ORQ C;  1MG1 A;  2R9A A;  3HKD A;  2LGW A;  3CHX A;  5IY5 C;  2Q7G A;  5KHI A;  3SYC A;  3OR6 C;  5GTI Z;  4P9O A;  3CE2 A;  1DGS A;  3A2F A;  4TUY B;  1JCH A;  4YJ3 B;  4HNA B;  3QVN A;  3RYC B;  3NR7 A;  4R50 A;  3AG7 A;  2EUL A;  4JI1 B;  1CEZ A;  3IC7 A;  2Q68 A;  3E8G A;  1XNQ B;  3CYO A;  5J2T A;  4DXW A;  1S5L Z;  4RQF A;  5EBL C;  3WU2 Z;  4JI3 O;  3G67 A;  2F4V B;  3UO3 A;  1QVG U;  3E8F A;  4YHH B;  1NTZ H;  1TAE A;  5KUM A;  4IHJ B;  1NT2 B;  2ZM6 B;  4GX5 A;  1NU1 H;  1OJH A;  2OWO A;  2HJD A;  4I7Z B;  1YZB A;  1KD1 W;  1FAF A;  5E79 Z;  3M99 B;  4I4T B;  2Q69 A;  4AI8 A;  5IYC O;  2YIC A;  1FKA O;  5TIS Z;  1NVP D;  3JD0 A;  4LBE C;  1WP8 A;  3FB6 C;  1KUQ A;  4L87 A;  5KHJ A;  2F23 A;  1H8E G;  3O65 A;  3L74 H;  3AG3 C;  4UCV A;  4X8A A;  1XMO O;  1WNS A;  3CRR A;  3FAV A;  1LUV A;  4WFA V;  1TVK B;  5EYP B;  3K59 A;  1Y74 A;  1YF2 A;  5EZY A;  1M9N A;  2EBO A;  2HLD G;  4F4L A;  1YTF D;  2ARH A;  4JI5 O;  2P4K A;  2L6L A;  4RAI A;  5LP6 A;  1N32 O;  2XAH A;  3C3S A;  4J7Z A;  4ASU G;  3AK3 A;  1GMG A;  5H2F Z;  3ABM B;  4TV8 A;  5LMU O;  5LHH A;  1CP9 A;  3D36 A;  1VQ9 V;  5LGU A;  4E4E A;  2UU9 B;  3WB1 A;  3M8A A;  2Q0O C;  4YY3 O;  3UT5 A;  1K4C C;  2CUG A;  5FPO A;  1FYJ A;  2QKA A;  3K04 A;  5FNV A;  3ZMS A;  2LGQ A;  3CCL V;  5CB4 A;  2ADP A;  1I0H A;  1NBM G;  4JAV A;  1AR1 B;  1N0N A;  1IBK B;  3N2K A;  1BCC H;  5H9C A;  3ZHT A;  4H33 A;  4O4J A;  2OTL V;  2Z5U A;  3P3N A;  4QIW F;  1N0J A;  2Y48 A;  3H1K H;  1BMF G;  4B3T O;  3LDC A;  4LWS B;  4J42 A;  5IYD O;  1T5E A;  5EK0 A;  2QSA A;  2X6C A;  2Z0A A;  3K57 A;  5KA5 A;  2Q7E A;  1MA1 A;  2O57 A;  2EIN B;  3ZMZ A;  2YDE A;  4UXN A;  4EEQ A;  2QTO A;  1EM1 A;  4WFF A;  3E8H A;  3RW0 A;  1YJ9 V;  1GKF A;  1QCE A;  4GCZ A;  3WFV A;  1R3K C;  4TQF A;  2YI8 A;  1IBM B;  2JS5 A;  1R1B A;  2R72 A;  1NTK H;  5H6Q A;  4LF5 B;  3AG4 C;  2BOB C;  2R9I A;  3I55 V;  1U96 A;  1BL8 A;  4U3J A;  1OHH G;  1IDS A;  2JJ2 G;  4LNU A;  4IGG A;  3K9S A;  3ZRV A;  4DR2 O;  1VAR A;  5H6R A;  3OMA B;  1H2G A;  5B66 Z;  4ZI7 A;  4BW9 A;  2F43 G;  3SPI A;  2Q73 A;  2VQF B;  4EB6 A;  5CA3 A;  1XNR B;  4IIJ A;  2CTQ A;  1GM9 A;  1ZWI C;  4MVZ A;  2OTJ V;  4OGQ B;  5B1A B;  3M7M X;  2PYJ A;  2E74 B;  1GO3 F;  4R6Z A;  4LFA B;  4BR6 A;  3OE7 G;  2H8P C;  4G2K A;  5KHG A;  2UUB B;  2EZO A;  2ZR3 A;  3JCU Z;  1VQN V;  4F6R A;  1N8R W;  1SQF A;  2IJK A;  1JFF A;  2CE4 A;  5LA6 B;  1AI6 A;  2YI9 A;  1R3J C;  4FLY A;  1WA8 B;  2KQX A;  1XI1 A;  1K9M W;  1WAZ A;  2Q9L A;  1ROP A;  3VBB A;  3OTO O;  1U97 A;  4CH3 A;  1Z5W A;  1XMQ O;  5DEC A;  1I94 O;  3QNE A;  2DN9 A;  4JI0 B;  1BS3 A;  3W7U A;  1KEC A;  2WLI A;  3ZMU A;  3J81 N;  1GN6 A;  5JCO A;  3FB5 C;  2D3O W;  3DC6 A;  1SRY A;  1F4M A;  1N34 B;  2XAF A;  3CJH B;  1SQX H;  5AG2 A;  5IJ9 A;  3THO A;  1KP3 A;  2W6I G;  3TGU H;  5LYJ B;  3BVO A;  3LUT B;  1IXM A;  1UPG A;  1M56 B;  1PL0 A;  1YCI A;  3OFN G;  2BTO A;  1TUB A;  4CH4 A;  3ZRW B;  2CTR A;  3WB0 A;  1GM7 A;  5KHH A;  5DM6 V;  2FML A;  4LF6 B;  2A7W A;  4X66 B;  1WP7 A;  4DK0 A;  3K3W A;  4O2A A;  3G4S V;  3I56 V;  2EX3 A;  4O2B B;  3FKS G;  1FFX B;  3SPC A;  2L35 A;  2IU3 A;  2WLL B;  4LR3 A;  1RFY A;  4DUY O;  4EFE A;  2VS0 A;  1KBH A;  5HFL A;  4BIZ A;  3MDS A;  5B1N A;  4U3F H;  1DF4 A;  3JD3 A;  2ADQ B;  4PDL A;  4JTD B;  2UXD O;  2JVD A;  1WLE A;  4WFH A;  5JH7 B;  5BY1 A;  4DUZ B;  3CD6 V;  5LHI A;  3AG1 C;  1HNX B;  3HPL C;  3K9A A;  3A0H Z;  2B9Z A;  1XRE A;  4WFG A;  3JAM N;  4J9Z B;  4I9Q A;  1Y4M A;  4TV9 B;  1S5J A;  4ZOL A;  3BCC H;  1IUR A;  3P30 A;  2XT9 A;  2IJJ A;  4QNH B;  1VF6 C;  4MW8 A;  3T4D A;  4JI4 B;  4UUJ C;  2P06 A;  1BHA A;  1EZV H;  1NR1 A;  1AR5 A;  4XBF A;  3L70 H;  4DV4 B;  3A0R A;  3LDE A;  4JI2 B;  1RPO A;  3BEH A;  4B3M O;  2UXB B;  2QDO A;  4X64 B;  4X20 B;  2AXT Z;  3D3I A;  5CA0 A;  1NI8 A;  5C8Y A;  2G38 A;  5FLX N;  2F66 C;  2ZT9 B;  4K35 A;  5IJ0 B;  1XQ8 A;  1GN4 A;  4O4I B;  1GRJ A;  1QHT A;  2QJ1 A;  5IDJ A;  3ZN1 A;  2CGO A;  3CXH F;  3CC2 V;  2RMK B;  2WLM A;  4JYC A;  4QPK A;  5KX5 B;  1VQ4 V;  1K73 W;  2UUA B;  3Q4H B;  5DED A;  1QQC A;  4X65 O;  3RYH B;  4B7E A;  1ZSP A;  5GON B;  4ZBM A;  4A5U B;  2K1E A;  4WBN A;  3PJS K;  3AG3 B;  4MVR A;  4YIP A;  3RYF B;  4WFB V;  4QGP A;  3VQV A;  3ZHQ A;  1XEQ A;  1VQL V;  5ITZ B;  2QWP B;  4LF8 B;  4K8Z A;  1ZL8 A;  1EN4 A;  3CSX A;  4MVM A;  4PI0 A;  3L75 H;  3ABU A;  1V9P A;  3HKC B;  1Y67 A;  1V55 C;  3JAW B;  4AQY B;  2ZIN A;  1Q81 W;  1FPO A;  2KSD A;  4BIU A;  1XNQ O;  2JGD A;  3ZHS A;  3B09 A;  4GZR B;  4O4L A;  4UB8 Z;  1NKD A;  2PUS A;  3DXR B;  5IE9 A;  2F4V O;  3BAB A;  1K34 A;  3DSQ A;  3E22 A;  1OCO B;  4QJF B;  1J95 A;  1VF7 A;  4UB6 Z;  3FYI B;  5IYZ A;  2PTM A;  2HVK C;  3SPH A;  1AI5 A;  2A79 B;  4K3A A;  1W0J G;  4B3S B;  4MW3 A;  2MW2 B;  1K3E A;  2Y4U A;  4QE9 A;  1CPY A;  3OEH G;  3F5T A;  1ZAU A;  1PPJ H;  1GAX A;  1DK1 A;  4X1I A;  1EN6 A;  1THZ A;  4XDL A;  2Y69 B;  1NS1 A; 
#chains in the Genus database with same CATH homology
 1XL4 A;  1NR7 A;  3CP1 A;  3MHS C;  3LDD A;  1M57 B;  2JK5 C;  3AG3 C;  3IFX A;  4UV9 A;  4X8A A;  3ZRX A;  4MVS A;  2YEV B;  1GTO A;  3QO7 A;  2JIZ G;  2WLJ A;  3X2Q C;  4X89 A;  2HG5 C;  4WFA V;  3CCM V;  2IH3 C;  3OGC C;  1YI2 V;  3OM3 B;  3SYO A;  1M9N A;  2EBO A;  2EIJ B;  2WLL A;  3HB3 B;  5CMU A;  1PNM A;  2HLD G;  2XOK G;  2X7R B;  1SER A;  1HWY A;  3ZIA G;  4TSF G;  4F4L A;  1YTF D;  4HYO A;  4ZKI A;  5B3S C;  2B1G A;  1FS0 G;  2AHY A;  4RAI A;  2XAQ A;  2XAH A;  2EIL B;  3ABK B;  4ASU G;  1MAB G;  1R6K A;  1GMG A;  2V1D A;  3ABM B;  3ASN B;  2NLJ C;  3SYA A;  3OUS A;  5LHH A;  1CP9 A;  1SZT A;  1JX9 A;  1DLB A;  3D36 A;  1VQ9 V;  3JD4 A;  2EIM B;  5LGU A;  2ATK C;  2IH1 C;  1QR8 A;  1E1Q G;  1K4C C;  3K79 A;  1E79 G;  3K04 A;  4U7N A;  1K5S A;  3ZMS A;  3E2E A;  3CCL V;  1R3L C;  1S77 D;  1NBM G;  1SES A;  3ABL B;  3SPJ A;  3CCJ V;  4JAV A;  1AR1 B;  1BHB A;  4RO2 A;  3SJQ C;  4GX1 A;  3E8B A;  5H9C A;  2EIK B;  4H33 A;  2OTL V;  2Z5U A;  3GWO A;  1AJP A;  1VQ8 V;  4QIW F;  4U7O A;  3K0G A;  2Y48 A;  5L3E A;  3ZMV A;  1BMF G;  1FXK A;  1E1R G;  4I9W A;  4P2Z A;  3LDC A;  1JOY A;  5B1O A;  5IYD O;  1OZ0 A;  1FXK C;  3AG2 C;  4N21 A;  5EK0 A;  2X6C A;  4HAM A;  1Q82 W;  1S72 V;  1QBZ A;  1DF5 A;  4EKW A;  4MVU A;  5KA5 A;  2FTK A;  4MTF A;  4MTG A;  1M57 C;  3W7W A;  3LSS A;  1PKX A;  2W6J G;  4OXS A;  2EIN B;  3OR7 C;  3ZMZ A;  3LSQ A;  4UXN A;  4H37 A;  2QTO A;  3ZRS A;  4PA9 A;  4WFF A;  3E8H A;  3RW0 A;  4LCU C;  1YJ9 V;  1GKF A;  1QCE A;  5J9P C;  1RM1 C;  4GCZ A;  3WFV A;  1NH2 B;  1R3K C;  4DO2 A;  5H6Q A;  1AI4 A;  2X6A A;  5LBQ A;  1NJI W;  4KUM A;  2QA4 V;  3AG4 C;  2IJH A;  2BOB C;  2EIL C;  2R9I A;  2ZQM A;  1KC8 W;  1Q7Y W;  3I55 V;  1BL8 A;  2WLN A;  1OHH G;  2JJ2 G;  3OUF A;  4JTA B;  3ABM C;  3ZRV A;  1PD3 A;  3ASN C;  2H94 A;  4HZ3 A;  5H6R A;  1OCC C;  1OCR B;  3F7V C;  3OMA B;  1H2G A;  3OAA G;  1QR9 A;  1R73 A;  2EIM C;  2F43 G;  3G6E V;  2HR3 A;  3SPI A;  5CN0 A;  2ZD9 A;  4XDJ A;  5CA3 A;  1AJN A;  1S3J A;  1JJ2 U;  2HFE C;  1L1F A;  5EC1 C;  3RVZ A;  3SYQ A;  1GM9 A;  1ZWI C;  4MVZ A;  2OTJ V;  5L3C A;  2EJR A;  3ABL C;  3ML0 A;  3ETD A;  4R7C A;  5B1A B;  1G4Y B;  1KQS U;  1P7B A;  3CCU V;  5IY5 B;  2QE7 G;  1OCZ B;  5KUK A;  4XDK A;  3ETG A;  1GO3 F;  4R6Z A;  3OE7 G;  2UXN A;  2H8P C;  4G2K A;  1VQ7 V;  3K0D A;  4QE7 A;  2BOC C;  2HVJ C;  3CMA V;  2EZO A;  2ZR3 A;  2DYS B;  5L3D A;  1VQN V;  4E2L A;  4FJC C;  3UKM A;  4UV8 A;  2OCC B;  1LNQ A;  2ITC C;  2EZP A;  1N8R W;  2LP7 A;  2IJK A;  2WPD G;  2JDI G;  4MSW C;  1AI6 A;  1K5Q A;  1JVM A;  4PDR A;  3SYP A;  5L3B A;  1R3J C;  3CC4 V;  2Q6A A;  2EIN C;  2JJ1 G;  3JCZ A;  3KG2 A;  4JYB A;  4CBC A;  1K9M W;  1ROP A;  3EFF K;  3F7Y C;  3K06 A;  3VBB A;  2DQ3 A;  3VOU A;  1VQO V;  1M90 W;  4MTO A;  1M1K W;  1AJQ A;  1NQT A;  1H8H G;  2JEU A;  2WAM A;  4FPP A;  3QNE A;  1YJW V;  3T2M A;  1EFR G;  4TWK A;  3AG1 B;  3R65 A;  4JGS A;  3W7U A;  3CXC U;  3T1C A;  3CCV V;  1FXH A;  3CCR V;  1KEC A;  2WLI A;  3ZMU A;  3ZMT A;  1OCO C;  4JAS A;  1V54 B;  2W0F C;  4PDV A;  2DYR C;  3FB5 C;  2D3O W;  3OMN B;  2NNU A;  4QPJ A;  1SRY A;  4PA7 A;  1H38 A;  2ZXW B;  1B6Q A;  2CK3 G;  5E1A C;  2ITD C;  1F4M A;  4P30 A;  2WSS G;  4CZZ A;  2XAF A;  4FMT A;  1PNL A;  5GW7 A;  5BZB A;  4G28 B;  2C2A A;  2ZR2 A;  3RBZ A;  1JPX A;  1KP3 A;  1YIJ V;  2W6I G;  2OT5 A;  4GX0 A;  3LUT B;  1IXM A;  1M56 B;  5C93 A;  1PL0 A;  3OFN G;  3JD2 A;  1S0V A;  2WWW A;  3ASO B;  1I5X A;  2R9R B;  2Y69 C;  4R8C A;  3H01 A;  3ZRW B;  4P9P A;  2QM8 A;  3STL C;  3UM7 A;  4FK5 C;  1GM7 A;  3QO5 A;  2ZDI A;  5DM6 V;  1MSW D;  3FYE B;  3CPW U;  1YSC A;  5B1A C;  2YEV A;  3W7T A;  2P90 A;  1W0K G;  2A0L A;  1Q86 W;  2DWD C;  2ZDI C;  5EC2 C;  2PI4 A;  3CCS V;  2LFS A;  3ZN0 A;  1WPX A;  1EBO A;  1FXV A;  4G27 B;  5LGN A;  2DYS C;  5DN6 G;  3K3W A;  3G4S V;  3I56 V;  4GT1 A;  4J9Y B;  2EIJ C;  2MK3 A;  3FKS G;  3SPC A;  3CC7 V;  2X0L A;  5B3S B;  2IU3 A;  1NVP B;  1ARO P;  2WLL B;  2WLK A;  3QO8 A;  2HJF C;  3TK1 A;  3ABK C;  5B1B B;  5HFL A;  1W2B U;  3WG7 B;  3ZCC A;  4BIZ A;  1Y66 A;  1RPR A;  5B1N A;  2QKS A;  1VQ6 V;  4JF3 A;  1DF4 A;  2IJI A;  1GM8 A;  3JD3 A;  2X6B A;  4PDL A;  4JTD B;  5HFM A;  3B8M A;  1WLE A;  4WFH A;  2XND G;  4I5S A;  1VQK V;  3SPG A;  3CD6 V;  5LHI A;  2WLH A;  3AG1 C;  3DGE A;  2M7W A;  3TCU A;  4X88 A;  2B5U A;  1QVF U;  4JTC B;  3HPL C;  3JD1 A;  3K9A A;  4KFM A;  4WFG A;  3CCQ V;  4BW5 A;  2P6J A;  3W7X A;  3OEE G;  4J9Z B;  3OMI B;  1NH2 D;  1KP2 A;  1Y4M A;  1VQM V;  2UXX A;  1YTF B;  2ZXW C;  1R3I C;  3K03 A;  3CME V;  3P30 A;  2EIK C;  2P67 A;  5L3G A;  1VQ5 V;  2IJJ A;  2V7Q G;  1S76 D;  4QNH B;  4MW8 A;  3T4D A;  3DTU B;  5CBF A;  5CBH A;  4UUJ C;  3AG2 B;  4PEL A;  4UVC A;  5KA6 A;  1M56 C;  2PI5 A;  1COW G;  1GK9 A;  1V55 B;  3ASO C;  2YSU B;  1K4D C;  1PNK A;  2AHZ A;  1BHA A;  1ENV A;  4WCE V;  1I5Y A;  1NR1 A;  2GSM B;  1XL6 A;  4Z1M G;  4XBF A;  3A0R A;  4RUE A;  4MVO A;  3W7S A;  1SET A;  3LDE A;  4GX2 A;  1P4R A;  1RPO A;  5EBM C;  3MD0 A;  1S5H C;  3BEH A;  1RM1 B;  5CBG A;  2KB1 A;  4UVA A;  5L3F A;  1F23 A;  3D3I A;  4TT3 G;  4YXW G;  3GB7 C;  2IW5 A;  3BY6 A;  5EBW C;  1AI7 A;  1F51 A;  3ZJZ A;  4JPR A;  2DWE C;  3AG4 B;  4MT8 A;  1MOF A;  2DW4 A;  3MHH C;  3STZ C;  1YHQ V;  3OW2 U;  3F5W C;  5LGT A;  5B1B C;  5IDJ A;  3ZN1 A;  1TUE B;  1QLE B;  3WG7 C;  1KKD A;  3CC2 V;  4JAU A;  4PA3 A;  1OCC B;  5IYB O;  4KP4 A;  2WLM A;  4JYC A;  3ABT A;  3NXS A;  4QPK A;  3IGA C;  1VQ4 V;  1K73 W;  1OCR C;  2P7T C;  3B77 A;  3RVY A;  3E83 A;  3K08 A;  3G71 V;  4MS2 A;  2XAG A;  4MVQ A;  1QLN A;  3B8N A;  1FFT B;  4ZBM A;  2IU0 A;  1ORQ C;  1JQ0 A;  3T4Z A;  1MG1 A;  2K1E A;  3PJS K;  3AG3 B;  2DQ0 A;  2Z3Y A;  4MVR A;  1K33 A;  4WFB V;  3FB7 C;  4BAY A;  3CCE V;  1VQL V;  5IY5 C;  1OCZ C;  3SYC A;  3OR6 C;  4N23 A;  2GHY A;  4LP8 A;  2B1I A;  3X2Q B;  4P9O A;  3E86 A;  4PA4 A;  2LFR A;  4RUF A;  4MVM A;  2A9H A;  1JCH A;  3ABU A;  1V55 C;  2OCC C;  4R50 A;  3E35 A;  1K92 A;  1Q81 W;  4UVB A;  2HKO A;  3LNM B;  4BIU A;  1CEZ A;  3IC7 A;  2Q68 A;  3E8G A;  5FL7 G;  3JYC A;  1UJW B;  1NKD A;  3CYO A;  4PDM A;  1YJN V;  4DXW A;  4RQF A;  5EBL C;  1R6N A;  4PA6 A;  1K34 A;  1DTO A;  2Q67 A;  1QVG U;  3E8F A;  3TET A;  4WF9 V;  1VQP V;  2QEX V;  5KUM A;  1OCO B;  2JEX A;  4QJF B;  1J95 A;  1YIT V;  4GX5 A;  1G8M A;  2DYR B;  3FYI B;  1V54 C;  2HVK C;  1K97 A;  3SPH A;  2WLI B;  2QM7 A;  3P32 A;  1QLE C;  1KD1 W;  1AI5 A;  2A79 B;  3M99 B;  3AEI A;  1K7D A;  4Q20 A;  1K8A W;  1W0J G;  2XAJ A;  4FIP C;  2Q69 A;  5IYC O;  3E89 A;  4MW3 A;  2XAS A;  1K3E A;  4LC1 A;  3FB8 C;  4QE9 A;  3EHB B;  1NVP D;  1CPY A;  3OEH G;  4RQE A;  3JD0 A;  4LBE C;  4WFE A;  3ZRW A;  3FB6 C;  4MTX A;  1FXK B;  1THZ A;  4XDL A;  5LHG A;  1F4N A;  1EZJ A;  2Y69 B;  3ETE A;  4L87 A;  1H8E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...