5B1OA

Dhp domain structure of envz p248a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
AMAAGVKQLADDRTLLMAGVSHDLRTALTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Angucycline antibiotic waldiomycin recognizes common structural motif conserved in bacterial histidine kinases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Osmolarity sensor protein EnvZ
total genus 25
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1oA00
4FPPA 4BIZA 3MD0A 4QPKA 5B1OA 4ZKIA 2C2AA 3ZRVA 5B1NA 1JOYA 2LFRA 2P67A 4QPJA 4JYCA 1IXMA 2QM8A 4Q20A 2LFSA 3ZCCA 4JASA 4U7NA 2FTKA 3A0RA 4LC1A 4U7OA 2WWWA 4MT8A 4KP4A 4JYBA 4GT1A 4FMTA 4I5SA 3TK1A 4GCZA 4JAUA 1F51A 3ZRWB 5C93A 2QM7A 4JAVA 3ZRXA 3NXSA 4MTXA 3ZRWA 4BIUA 3P32A 5IDJA 3D36A 3DGEA
chains in the Genus database with same CATH superfamily
3H1LH 4TUYB 4RUEA 3B40A 5FPRA 5D5QA 3NR7A 4U3JA 2UU9O 1RFYA 1H2GA 2X6AA 2YIDA 3FB5C 5L3FA 1PPJH 3E86A 4DW0A 1ZUQA 5GW7A 1GMGA 2HJFC 5CA1A 3P3PA 4L87A 5H6QA 4DR7B 5KUMA 1D5AA 1BZKA 2DYSC 3ABKB 1W59A 2ZDIC 2IU0A 1B6QA 4HNAB 4Z1MG 1HR0O 2OCCC 2UUCB 3JASB 1IXBA 2M7WA 1SA0B 4PELA 1IURA 3BVOA 5JQGA 3E8FA 5CA0B 3L72H 5EIBC 4GKJO 5LA6B 5IT9N 5LYJB 3CCUV 1N0NA 2ADPA 3CB2A 1HWYA 4JASA 4LFAO 2P4VA 4MTOA 2WWWA 2WA4A 3SYPA 3LSQA 4PD4F 4GCZA 1MZEA 3R66A 4D7TA 5IJ0A 3JSNA 4CS3A 4N23A 1G8MA 4FLVA 3BRCA 1SQPH 4QPKA 4JI1O 5LMNB 1XL4A 3ZRVA 3K06A 1NVPD 2K9PA 2IJKA 3DSQA 1OCOC 4Q20A 3J81N 2HVJC 3K5MA 2QWOB 4JV5O 2BE3A 3C90A 2F4VO 4JTCB 4DR2O 2DMXA 5B66Z 5L3DA 1KB9F 4FZ0A 3RWRD 2AHZA 1R3IC 1QQCA 1IZ3A 1YJ9V 2ZD9A 4CBCA 4P9PA 1ZAUA 2ZNJA 5LMUO 1NJIW 3CMEV 1TGOA 1Z5VA 1F4MA 2HLDG 2AW9A 1BS3A 1BL8A 4EEQA 3RN4A 4UB8Z 2Q0AA 1VQ8V 4AHCA 3WG7B 4RO2A 3RYHB 4D7SA 1QR9A 4J41A 2QM4A 2YIBA 1F23A 2UXCO 1KC8W 2Q8VA 2PYJA 5J9PC 3H1HH 2X6BA 2IBZH 3UO2A 3OGIB 3RYCA 3QF7A 1N4CA 1BGYH 4WFBV 4IIJA 2DWEC 4HYOA 1WN7A 3B4SA 1R6NA 1I5XA 3A0BZ 3RBZA 2XAHA 2RJZA 4O2AB 4X8AA 2VQEB 2W0FC 2EIJC 3WB2A 5DEDA 2EZOA 3ZRSA 1U96A 3KCYA 2DW4A 1OZ0A 4O2AA 1Y74A 3OEEG 3O65A 3QNEA 3DTUB 4JI8B 1VF5B 3VOUA 1G6UA 1KUQA 2CTPA 2GSMB 2ZIOA 2CTWA 1VQ7V 2Y4TA 1YJWV 2WLKA 4PA7A 1S3JA 2DOSA 1QVFU 1WJZA 1S77D 3JALA 2R9RB 3ASNB 1N32O 1Q7YW 2JDIG 2JEXA 4I55B 4K0KB 5AG2A 3F7VC 4LNUA 4DR2B 3K3WA 2W6JG 2EULA 1DF5A 2CTRA 3FYIB 4X89A 2XOKG 4NXMB 3FB6C 2KG7A 1EZJA 2OCCB 5LGNA 4FK5C 3SPGA 3KG2A 1BQZA 1XMQB 1WB8A 1ZLZA 4UXNA 2PGGA 2Z5UA 1U97A 4J9YB 4BW9A 5JH7B 4JI5B 2P4KA 4MTGA 1COWG 2WAMA 4BAYA 5LOVB 3I56V 4NTWA 3OMAB 4G28B 3CMAV 4FM1A 4RUFA 1OJHA 5BMVA 4GKJB 2FYUH 1K33A 3UKMA 4TUYA 2HG5C 3D8CA 4LWSA 3HKBB 3IC9A 1F7YA 4DR4B 4B7EA 3OM3B 4LF8O 2K1EA 4MW3A 3ZRXA 3VBBA 4WFGA 5JJEB 4JI4O 1HNZB 1MOFA 1WNSA 3E8BA 5EK0A 2M6YA 4UCVA 2BTQB 1K4DC 4LFCO 5IYZB 3ASOB 1PNKA 3UT5A 4DR7O 1OCZC 1BHBA 1OV9A 4JI6O 2YIAA 4YHHO 4EFEA 1SF9A 1K92A 3S3WA 1HNXB 1MSDA 1VARA 1QNMA 3BCCH 4DR3B 2MK3A 1XNRO 4PJ0Z 2R9IA 1XNQB 1VQ6V 1XILA 4CS4A 1AI5A 4DR5O 4BWAA 2V4DA 2V1DA 1FFTB 1XEQA 2VS0A 1VQ5V 4JAAA 1QLEC 3EHBB 3W7TA 1R73A 2E5LO 5JWPA 2QJ1A 2N05A 1AI6A 1H2MA 3K9SA 5JH7A 3JYCA 2RCVA 3CPWU 2BCCH 1VF6A 1V9PA 4RAIA 1P7GA 2H94A 1YI2V 3P3NA 3W7WA 1FJGO 3VQVA 2PF4E 1YVWA 2QM7A 1PL4A 3APOA 4DK1A 1AROP 4NXNB 3CCJV 4B08A 2ZE5A 2EJRA 3X2QC 2ZE6A 3CCQV 4B3SO 4LF5O 5E79Z 2EX3A 1YTFB 4LF8B 2KQXA 1H38A 2F23A 4PV1B 3ML0A 1HR0B 3K58A 4B3MO 2QDOA 4FLYA 2EINB 4DV1B 3D36A 5C8YB 3JASA 1ORQC 2XUMA 1V54C 4K8XA 1FXHA 2QKCA 4X62O 2LO1A 4NXNO 1I94O 3T1HB 3MHHC 3CCMV 5BXZA 4FIPC 3QO8A 3AG2C 3ZN0A 4FMTA 3WG7C 1H8HG 2EIMC 1RSOA 5FPOA 4DO2A 1ZL8A 2H8PC 4LF5B 3C3SA 5H6RA 1AR4A 4JI2B 3SYAA 5GONB 1GN6A 2YIBD 3SPJA 3T1HO 2E5LB 5LYJA 1OHHG 2LGQA 3OEHG 1NR7A 1GK9A 3P30A 2Q69A 4JAVA 2EILB 5KAIZ 4UVAA 4X1YB 1GTOA 1OCCC 4DUYO 1US6A 4JYCA 5CA1B 4B3TB 3ZCCA 4KUMA 2ILMA 4I50B 4E4EA 1Q6UA 4MT8A 1PM9A 2W6IG 1EZVH 3RYCB 4DV2B 3OMNB 4GX1A 2CAZC 2UXBO 2O57A 1K5SA 2ZKOA 1KD1W 1R3JC 3N2KA 1SKVA 2V7QG 3LUTB 1NBMG 5B3SB 4X66B 4CH3A 3H1JH 1Q5OA 1SQQH 1J5EO 1K5QA 2YEVB 1W2BU 4F6RA 1LR1A 3S3XA 4JAUA 4J7KA 1YZBA 2JS3A 3FAVB 2QGNA 2YICA 1EN6A 3E22B 4R8CA 4F6RB 4Z2WA 2EBOA 5FLXN 4X64O 1GRJA 4NYKA 2YI9A 3SJCC 2Q7EA 1WP7A 3CC7V 3CCVV 4MVRA 4NTXA 3AG7A 2GHYA 4JYBA 2PUSA 4O2BB 1N33O 3CYOA 4MTXA 3RT3C 3OR6C 5GONA 4KHPO 5LBQA 1Q81W 4GX5A 3AK3A 3CC4V 5L3GA 2HHHB 1BQ0A 1VP7A 4N21A 3L75H 2HHHO 3G80A 1IDSA 3AEIA 2ZR2A 2JGUA 4TV8B 1P84F 1JJOA 5ITZA 4UB6Z 4X1KA 5KHKA 1Q6IA 2AHYA 4F6EA 4GT1A 4J10A 4ZHQB 4FLTA 2CDYA 1L0NH 3SPHA 2IJHA 2JK5C 3RVZA 4UVCA 3ZN1A 4DUYB 1XNRB 4WF9V 2ZQMA 1K73W 1BCCH 3CRMA 2GTAA 3OGCC 1RM1C 2CK3G 1HNXO 1O9GA 1WB7A 4JTDB 3G71V 3BABA 3LDCA 1QHTA 1Q86W 2OIEA 4JV5B 2Y0PA 3ABLB 4W4LA 2NLJC 1NTKH 1X59A 1P7BA 3AG3C 4LR3A 4XDKA 3CD6V 4R50A 3T1YB 3ZMSA 1AR1B 3MD0A 3HKDB 1VIBA 1QLEB 2A7WA 1IXMA 2Y4UA 1V55C 4O4HB 1IX9A 3H1KH 3F7YC 4X65O 5LOVA 3G4SV 2Q4PA 4H0LB 1FPOA 4MVQA 4YJ3B 3KKYA 4DUZB 1VMGA 4BIZA 4QNHB 3THOA 3RYFB 5F2VO 3K03A 4TOIA 3JAMN 4MVZA 1HDJA 4I4TB 1KECA 1M9NA 3BA9A 5KLVH 3CWBH 2F95B 1NQTA 1XMOO 4LBEC 1RPRA 5IDJA 5B1AB 3OUFA 3GVMA 3M7MX 4X1KB 1KQSU 3OTOB 2WLIB 1SQGA 2Q68A 3CRAA 1ENVA 4I9QA 1NKDA 1W0JG 4IHJA 2A3QA 1KKCA 5C8YA 2EINC 4UFZA 1M57C 2QTSA 1T5EA 2MW2B 3FKSG 1V54B 1N33B 1YCIA 3BA8A 2YSUB 1WLEA 4UVBA 4AI8A 2EIJB 3NXSA 1IBLO 1QBZA 2QKAA 4KHPB 2QWRB 2YS8A 4DV7O 3AG2B 4J42A 2JS5A 4FLXA 2Y69C 5LXTB 1KYOF 1NTMH 4CZZA 1HNWO 2IJIA 3SYCA 3K0GA 2R72A 5FNVB 3L71H 5EBLC 4LFCB 1M56C 4CH4A 4UCUA 3SPIA 1OCRC 2DQ0A 3F5WC 3DXRB 5FNVA 3SGIA 2OTJV 5FL7G 3C3TA 1N34B 5B1OA 1MSWD 1VEWA 3ASNC 2C2AA 4B3SB 4XDJA 2JRIA 4UUJC 4JI0O 4LF4O 4U7NA 3K57A 4QE7A 4LFBO 5IJ9B 5K1PA 1H2NA 1S72V 3E89A 4O4LB 1AILA 4IYIA 3TETA 3RYFA 3E8GA 2QWNB 1XOUA 3N2GB 1K3EA 2B1IA 4MVOA 1NT2B 3LNMB 4LP8A 5KX5A 5JCOA 3AG4C 1JPXA 3JAKA 4J80A 2F4VB 1TVKB 2ZT9B 1FXKA 2DYRC 2QEXV 5IY5B 2YUAA 2R70A 2XT9A 3HPLC 2ZCEA 1F4NA 4X1IA 3ZRWB 5KHIA 3BEHA 1SERA 4FM2A 4PDRA 2P5OA 3A0HZ 4LF7O 3AG3B 4RQEA 1AVMA 2IH1C 1WPBA 1AJPA 4J7ZA 5HFLA 5J2UB 4O4IA 3VQYA 4I0XA 2HJDA 4CC6A 1QVGU 3SJQC 1KU9A 5BY1A 1H2KA 3JATA 5GTHZ 5H2FZ 5IYBO 3FYEB 2E75B 2XAQA 4DV5B 2XNDG 4X1IB 3ZRWA 1VF7A 3DGEA 4Q6GA 3JD4A 2F43G 3T4ZA 5H9CA 4O4LA 5B5EZ 2E3CA 4QGPA 2ZM6B 3ZHQA 3CHXA 5CB4A 3I5DA 3K5OA 4ZOLA 1LNQA 4X20A 2VWKA 2XAGA 3JARB 3JAWB 1FXKB 3MHSC 1ZWIC 4IT5A 1XREA 2QR4A 1QR8A 4GKKO 4YJ2B 1FYJA 1AP6A 3QTCA 3TXSA 3E8HA 3VQWA 2CH7B 3RVYA 2XAJA 1AJNA 4W4KA 1JMKC 2ODMA 1MA1A 1Z2GA 3T1CA 2XAFA 3RYIB 4G2KA 4JI5O 2VQFB 3IAYA 4B3RO 4B3MB 4JYAO 3CXCU 5TISZ 1M1KW 4DV3B 4IGGA 2Y0IA 3IC7A 1NI8A 2UUAB 4FLUA 3ABTA 1JVMA 5EC1C 4H13B 4BR6A 2H3OA 1WA8B 5A9GA 1TUEB 5BZBA 2A79B 1M56B 4KFMA 4DV6O 1S5HC 5B1NA 4NR1A 1HNWB 5IYDO 2QM8A 5KHHA 2Q5ZA 4G27B 3FAVA 3A0RA 4I50A 2ATKC 1XMOB 4KP4A 2DYSB 3ABKC 4DR6O 1YDXA 1NH2B 1SRYA 2VQFO 4B3RB 4JI8O 1J5EB 3HKCA 4ZKIA 2UUBO 2N04A 1KBHA 4PDVA 4HZ3A 4X64B 3WU2Z 4NB5A 1MMMA 1H8EG 3OD4A 3DC5A 3ZX6A 2DN9A 1YSCA 2GBOA 2JJ1G 4X20B 4PDLA 3ICXA 3ZMTA 2YDEA 3ETGA 4H33A 4JI3B 4DR4O 3R65A 4YHHB 4DV7B 2IH3C 3JSLA 1EFRG 3D3IA 2X0LA 1N34O 1M57B 3UT5B 2NNUA 3LSSA 4LF9B 2RQ6A 2B5UA 4DR1O 4O4HA 1WPXA 2EILC 2VRZA 2IW5A 4LC1A 1P49A 3EXAA 1XMQO 4CC5A 4KXRA 3T4DA 2ADQB 4UV9A 5LA6A 1L8DA 4PA9A 4J9ZB 4U3FH 3FD9A 4FJCC 1JR9A 4O4IB 1XHZA 3KCXA 5EYPA 3ZHTA 3TXQA 1GN3A 1S76D 1OCRB 5DM6V 3ETQA 2D3OW 4QE9A 1FFXA 1K97A 2ZINA 4AQYO 1ZL8B 3CX5F 3U10A 1CXZB 1VQKV 3Q4HB 5LP6B 3SJBC 2WLHA 4WBNB 1N0JA 3OTOO 1KKDA 4PHZA 1P4RA 3B8MA 4TV9B 1PD3A 1XUQA 1YIJV 1JJ2U 3LDDA 2OT5A 5EZYA 2Z3YA 2RNBA 4LF6B 1K8AW 5B1BB 4RWUA 4DV4O 3UCSC 4PA3A 4NTYA 3A8TA 3JCZA 2WSSG 1DTOA 3JD3A 3EVKA 4X88A 3ABMB 4UCSA 3JALB 3TCUA 1VQPV 3HKDA 2DYRB 1JCHA 4OXSA 1NTZH 2XHBA 4DRXB 4L8JA 4C7UA 1VQNV 2A0LA 4I7ZB 5EBMC 1S0VA 2G38A 4FLWA 4MVMA 4WFEA 1AR5A 1OCOB 3CE2A 2IJJA 2JVDA 1JOYA 3ZIAG 3OR7C 2CE4A 4JZGA 2W0XA 3RYHA 5LL6Y 2YXLA 1PV0A 3CC2V 2YEVA 3PJSK 4EFBA 1Z5WA 3ETDA 5DECA 5CN0A 2EIKC 4FPPA 5KMGA 1URFA 1IBLB 4YJ3A 1DLBA 2QE7G 3GWKC 3W7SA 1B06A 3QO7A 1Q8IA 4JI7B 5CMUA 1ZSPA 5JJJB 4AILC 2Y48A 5DN6G 4HBNA 3CJHB 2IM9A 2GUZB 2CH7A 4DUZO 1GM7A 2KB1A 4CH5A 1MABG 3ZJZA 2B1GA 5EBWC 1X4TA 4TV9A 1SZXA 4X65B 2CUGA 1UJWB 1N36O 2WLJA 1AI7A 1SQXH 2BSKB 4QJFB 1Y6XA 3DXRA 4FFBA 1FD9A 4I0XB 4YXWG 2UXDB 1Y67A 5BMVB 3WFVA 3WB1A 1R6KA 2P67A 1FAFA 2Q0OC 3D3QA 3HB3B 1I0HA 4I9WA 4ICGA 4TV8A 1Y4MA 4I4TA 3JCUZ 2YXHA 4ABMA 4MVSA 5JVDA 1GAXA 5LHIA 5CBGA 2PZSA 2RN9A 4PA4A 2P06A 3P32A 3G6EV 1CEZA 3OT7A 1K7DA 2HKOA 5LP6C 5CB4B 2CTQA 1HW7A 5IJ9A 1D2DA 4J11A 1VF6C 1I94B 5D5PA 4P2ZA 4GUNA 1SQVH 4TT3G 2ZM6O 2ZR3A 3BAAA 5KUKA 2ZNIA 4R7CA 1XDCA 1SC5B 3GB7C 5CBHA 2WPDG 3U11A 5B1BC 3BPZA 3K9AA 4IIJB 1NR1A 1E1RG 1XQ8A 4WFHA 1H2LA 1JX9A 4MVUA 3ABMC 1NVPB 1SZTA 5CA3A 4JI3O 1TVKA 4K0KO 4JF3A 3A2FA 2BOCC 3E2EA 2EJ7A 3IJ4A 3E83A 1IVSA 3CXHF 5H5NA 3KZIZ 2RDCA 4Z1VA 1SETA 3L9DA 4GYCB 2Q7GA 1L0LH 3SYOA 3E22A 1BSMA 4EB6B 5EC2C 4PI2A 1TUBB 3TK1A 3X2QB 1F51A 1GO3F 2L35A 4JYYA 5LMNO 2GUZA 2OTLV 3ASOC 2QWPB 3Q4HA 5IY5C 1YJNV 1OCZB 3AK1A 4DR5B 2HFEC 1GM8A 1S5JA 4JGSA 3ZHSA 4WCEV 1XNQO 3QO5A 1BE3H 3FB7C 1UFIA 5KX5B 1IBKO 2KKWA 4U3JB 1GM9A 1Y76A 2B9ZA 1GN2A 1DGSA 3ZHVA 5KHGA 1L1FA 4ZHQA 2UUAO 1I5YA 3N2KB 4LWSB 2EIMB 2Q9LA 4GLXA 5LMUB 3JAWA 3STZC 2GTSA 1FJGB 2LW7A 4JPRA 3IFXA 4LH7A 1JFFB 4BW5A 4K35A 4IYHA 4NVPA 1MG1A 2WLLA 2LQTA 2QKSA 3ZHRA 3JARA 4JI2O 4D6TH 3CCRV 3RGBA 1YITV 1WP8A 2FTKA 4F4LA 4TQFA 2LW1A 2P7TC 1VQMV 3VQXA 3G67A 4OPAA 1IBMB 2ZXWB 4IL6Z 4DYLA 4WFFA 2DJVA 4NKGB 5LHGA 2HVKC 4WBNA 1CP9A 5JVDB 1PNLA 2UXDO 3JAKB 3WB0A 5IWAB 5E1AC 2NR5A 4JI0B 4LF4B 2F66C 2QWQB 3LDEA 1S5LZ 2AZ2A 4CH6A 2PY5A 2OIGA 5JQGB 4MTFA 2CGOA 2NN4A 1WA8A 3UM7A 2PI4A 4JTAB 1J95A 4E2LA 5B3SC 1YHQV 1LUWA 4A5UB 4JI4B 1SESA 4UCOA 4LF7B 2VQEO 1JFFA 4LCUC 2P6JA 2EZPA 2LFSA 4B7KA 1MNGA 4FZ1A 1N36B 4LFBB 2PTMA 1I08A 5L3EA 2ZDIA 4OX9B 1TUBA 2DWDC 4DR6B 1AJQA 2HR3A 2Z0AA 1M4UA 5KA6A 4BIUA 3BHPA 2Q6AA 2UU9B 4R6ZA 2E74B 5EZYB 1N32B 3CCEV 4P30A 5KA5A 3K5LA 1OCCB 4MS2A 4DV0B 4YY3B 1DF4A 4FLZA 3HKEB 1R1BA 4ZOLB 3B09A 5HFMA 1NU1H 1Q82W 2P22C 1FKAO 2A06H 3AK2A 4HAMA 4TSFG 5EYPB 1PP9H 3FB8C 1YEWA 2ZE8A 2E76B 4JI6B 2PI5A 3BY6A 1R3LC 1XBLA 1QCEA 4DR3O 3ABLC 1H2SB 1JA8A 2WLIA 1Q43A 2KSDA 1E79G 2JJ2G 1AP5A 3OW2U 2UXCB 2Q73A 4EKWA 3FX7A 3JD2A 4BIOA 1EN5A 1DK1A 1V55B 2OYQA 3QG5A 3T1YO 2FMLA 1HNZO 2P90A 1Q90D 5BR8O 3OMIB 1NZ6A 4WFAV 1R3KC 3ZS8C 1JQ0A 4OGQB 3W7UA 1ZTEA 1RPOA 1WAZA 5LGUA 5IWAO 3L74H 4LF6O 4DRXA 2Q67A 4B3TO 2UXXA 3CP1A 2LP7A 3RFRA 4DV5O 3H1IH 2VWJA 2ZIMA 3CRCA 1GKFA 4GX0A 4NXMO 1R6TA 1IBMO 3GWOA 1YF2A 4ZI7B 2PYLA 4LH6A 3O9OA 5L3BA 4IHJB 4QPJA 1HP8A 1M90W 4YIPA 3STLC 4K8ZA 4ZI7A 1RM1B 2HEPA 5CA0A 3CJHA 4PI0A 5EIBD 1KMIZ 2UXNA 2QSAA 1XHXA 1M5IA 4UV8A 1E1QG 5IE9A 1M93A 3B2EE 1Y74B 4CS2A 5IYZA 4O4JB 2WA3A 2ITCC 3B77A 2R9AA 1N8RW 2ZE7A 2IU3A 2YI8A 4O4JA 3FFQA 3SDLA 5LP6A 4MSWC 3J7AU 2FL4A 4OPHA 4KL1A 4DV1O 4JZ2A 2GDSA 3RYIA 4PDMA 3CCSV 2ETNA 3N27A 2BOBC 4ZIBA 2AXTZ 4LF9O 2WLMA 3CS5A 1LUVA 3W7XA 2EIKB 3BFRA 2X6CA 5L3CA 3MDSA 1O9HA 1EBOA 1PL0A 1SS3A 2BSKA 1XI1A 2CGNA 3K5NA 3I55V 1BHAA 3OE7G 1B04A 3SYQA 1Q3EA 4GX2A 2ITDC 3LSUA 3OTFA 3TJTA 3AG1C 1YXBA 4JI7O 4X66O 1NH2D 2ZXWC 2UUCO 5B1AC 2HP8A 4AQYB 4TQDA 1XL6A 4DV0O 3CEIA 1ZX3A 4LNUB 4XBFA 2LJ2A 1VQOV 2JEUA 2BTQA 3CSXA 3CCLV 1RP3B 2LFRA 4TWKA 5J2UA 2JGDB 1AI4A 5LHHA 2Q7HA 3K08A 1VQLV 3ZBHA 4FM0A 1A32A 2JGDA 3OUSA 4OX9O 4H44B 2Y69B 1RSOB 4X9QA 5GTIZ 4DR1B 4JYAB 3JD0A 2UXBB 4LFAB 1EM1A 1TAEA 1K34A 3H9VA 4UCRA 4DV2O 3T2MA 3K0DA 3ZMVA 3K04A 4I5SA 3M99B 3JD1A 1PKXA 3EFFK 2D2CB 5C93A 2A9HA 5BR8B 4PA6A 1ROPA 3SR2C 4JI1B 1MZFA 1SA0A 2F93B 4DXWA 3ZMUA 5IYCO 2GV9A 3ABUA 4GKKB 2FKXA 4U7OA 1K9MW 1FXKC 3H01A 5J2TA 1FXVA 4XDLA 5JJNB 2KG7B 2AZ0A 2XTAA 2ARHA 4J7JA 3RW0A 5LGTA 3UQ8A 1QU7A 4FVMA 3AG4B 3SJAC 3ZEDA 4X1YA 5J2TB 3HR0A 1VQ9V 1D5NA 2RMKB 2OWOA 3JATB 4YJ2A 1G4YB 1YTFD 4UCTA 3HKBA 3APQA 5IJ0B 4HNAA 5K1XA 3J80N 2WLNA 3HKCB 3PN1A 1QLNA 5LXTA 3ZMZA 4H37A 2QTOA 1GN4A 1GH6A 4DK0A 1FS0G 4P9OA 2FB5A 4I55A 4YIOA 1I7FA 2AGAA 5KHJA 4FFBB 1B3QA 2X7RB 1SQBH 5KAFZ 3MAQA 1K4CC 1PNMA 1Y66A 1TA8A 2F1MA 3CRQA 1VQ4V 5CBFA 2LGWA 4RQFA 4DV6B 3L70H 3IGAC 2DE0X 1AB3A 2WLLB 2L6LA 4ASUG 4O2BA 1IBKB 1Y76B 2DQ3A 5A2QN 3N2GA 5JCOC 4QIWF 1NS1A 1SQFA 3K59A 4X62B 1KP3A 1EN4A 2BTOA 3DC6A 5ITZB 2N74A 3ETEA 3SPCA 3OAAG 1UPGA 3K79A 3UO3A 2YXYA 3M8AA 3AG1B 2UUBB 2YC0A 1G1XB 2JIZG 3CRRA 4FFKA 4ZBMA 4MW8A 4EB6A 3D36C 2QA4V 4GZRB 1Q6HA 3F5TA 3G6BA 4DV4B 3L73H 2XASA 3B8NA 3E35A 5KMGB 4K3AA 4DW1A 2OCHA 1CPYA 3ZHUA 1BT8A 3HKEA 1KP2A 4DV3O 4YY3O 3QVNA 1FFXB 3TGUH 1BMFG 3U0ZA 3OFNG 1THZA 1W0KG 3LNNA
chains in the Genus database with same CATH topology
1GTOA 1OCCC 1YHQV 4ZKIA 1SESA 4RUEA 4PDVA 4LCUC 4HZ3A 4JYCA 2P6JA 2EZPA 2LFSA 1H8EG 3ZCCA 1H2GA 2X6AA 4KUMA 3FB5C 5L3FA 1YSCA 2JJ1G 3E86A 4PDLA 4MT8A 2W6IG 5L3EA 3ZMTA 5GW7A 1GMGA 3ETGA 2HJFC 2ZDIA 4H33A 3R65A 4L87A 5H6QA 2DWDC 1AJQA 2HR3A 2IH3C 3OMNB 5KA6A 5KUMA 1EFRG 3D3IA 2X0LA 4GX1A 4BIUA 2Q6AA 1M57B 2NNUA 1K5SA 1KD1W 2DYSC 3ABKB 3LSSA 4R6ZA 1R3JC 2ZDIC 2IU0A 2B5UA 1B6QA 1WPXA 3CCEV 2EILC 2V7QG 4P30A 2IW5A 4LC1A 3LUTB 5KA5A 1NBMG 4Z1MG 5B3SB 2OCCC 1OCCB 4MS2A 2M7WA 3T4DA 1K5QA 2YEVB 4UV9A 1DF4A 1W2BU 4PELA 4JAUA 4PA9A 4J9ZB 3E8FA 4FJCC 5HFMA 4R8CA 2EBOA 1Q82W 3CCUV 1S76D 1OCRB 5DM6V 1HWYA 4JASA 2D3OW 3CC7V 4QE9A 4HAMA 4MTOA 2WWWA 1K97A 3CCVV 4MVRA 4TSFG 2GHYA 4JYBA 3SYPA 1VQKV 3FB8C 2WLHA 3LSQA 4GCZA 3CYOA 2PI5A 3BY6A 4N23A 1G8MA 1R3LC 4MTXA 3OR6C 1KKDA 4QPKA 1QCEA 3ABLC 5LBQA 1Q81W 1P4RA 3B8MA 2WLIA 4GX5A 1PD3A 1XL4A 1YIJV 3ZRVA 3CC4V 1JJ2U 5L3GA 3K06A 4N21A 1NVPD 3LDDA 2OT5A 2IJKA 3AEIA 1OCOC 1E79G 2ZR2A 2HVJC 2JJ2G 4Q20A 2Z3YA 1K8AW 5B1BB 3OW2U 4JTCB 2AHYA 4EKWA 4GT1A 4PA3A 5L3DA 3JCZA 3JD2A 2AHZA 3SPHA 1R3IC 2IJHA 2JK5C 1DTOA 2WSSG 4UVCA 3RVZA 1V55B 3JD3A 3ZN1A 4X88A 3ABMB 2ZQMA 2ZD9A 4CBCA 4WF9V 3TCUA 1YJ9V 1VQPV 3OGCC 1K73W 2DYRB 4P9PA 2P90A 1RM1C 1JCHA 4OXSA 2CK3G 1NJIW 3OMIB 4JTDB 4WFAV 3G71V 3CMEV 1R3KC 3LDCA 1JQ0A 3W7UA 1Q86W 1VQNV 2A0LA 1F4MA 1RPOA 5LGUA 5EBMC 2Q67A 3ABLB 2HLDG 2UXXA 3CP1A 2LP7A 1S0VA 2NLJC 1BL8A 4MVMA 4WFEA 1P7BA 3AG3C 4XDKA 3CD6V 1GKFA 4GX0A 1OCOB 4R50A 3ZMSA 3GWOA 1AR1B 3MD0A 1VQ8V 2IJJA 3WG7B 4RO2A 1QLEB 1JOYA 5L3BA 1QR9A 4QPJA 3ZIAG 1IXMA 3OR7C 1F23A 1V55C 1KC8W 1M90W 3STLC 5J9PC 3F7YC 1RM1B 2X6BA 3G4SV 4MVQA 3CC2V 2UXNA 2YEVA 3PJSK 4WFBV 3ETDA 2DWEC 4HYOA 4UV8A 5CN0A 1R6NA 2EIKC 1I5XA 4FPPA 1E1QG 3RBZA 4BIZA 4QNHB 2XAHA 4X8AA 1DLBA 2W0FC 2QE7G 3K03A 2EIJC 4UVAA 2ITCC 3W7SA 3B77A 2EZOA 3QO7A 3ZRSA 4MVZA 1N8RW 2DW4A 1OZ0A 1KECA 2IU3A 5CMUA 3OEEG 3QNEA 1M9NA 2Y48A 3DTUB 5DN6G 1NQTA 4MSWC 3VOUA 4LBEC 1GM7A 1RPRA 2KB1A 5IDJA 5B1AB 3OUFA 2GSMB 1VQ7V 1MABG 4PDMA 2B1GA 3ZJZA 3CCSV 1YJWV 1KQSU 2WLKA 5EBWC 2WLIB 2Q68A 2BOBC 1S3JA 4PA7A 2PI4A 1ENVA 1QVFU 1NKDA 1W0JG 1S77D 2WLMA 1UJWB 2EINC 2WLJA 1AI7A 1M57C 2R9RB 3ASNB 3W7XA 2EIKB 1Q7YW 2JDIG 2JEXA 3FKSG 4QJFB 2X6CA 1V54B 5L3CA 2YSUB 3F7VC 1WLEA 1EBOA 3K3WA 4UVBA 2W6JG 1PL0A 2EIJB 1DF5A 3NXSA 1QBZA 3FYIB 4X89A 2XOKG 3FB6C 2OCCB 1EZJA 4YXWG 5LGNA 3I55V 1BHAA 3OE7G 4FK5C 3SPGA 3AG2B 3WFVA 3KG2A 2Y69C 3SYQA 1R6KA 2P67A 4GX2A 2ITDC 3AG1C 4CZZA 2IJIA 4UXNA 2Z5UA 3HB3B 4I9WA 3SYCA 4J9YB 3K0GA 1NH2D 2ZXWC 1Y4MA 5EBLC 5B1AC 1M56C 4MVSA 3SPIA 1OCRC 2DQ0A 4MTGA 5LHIA 1COWG 1XL6A 3F5WC 5CBGA 4XBFA 4PA4A 2OTJV 2WAMA 3G6EV 3P32A 1CEZA 5FL7G 4BAYA 1MSWD 5B1OA 3ASNC 1K7DA 2HKOA 2C2AA 3I56V 1VQOV 2JEUA 3CCLV 4XDJA 3OMAB 4G28B 4UUJC 3CMAV 4RUFA 2LFRA 4TWKA 1K33A 1AI4A 5LHHA 4P2ZA 4U7NA 3K08A 3UKMA 4TT3G 1VQLV 4QE7A 2ZR3A 2HG5C 1S72V 3E89A 5KUKA 4R7CA 3OUSA 3TETA 3OM3B 3E8GA 2Y69B 2K1EA 1K3EA 4MW3A 2B1IA 3ZRXA 4MVOA 3GB7C 5CBHA 2WPDG 5B1BC 3VBBA 3LNMB 4LP8A 4WFGA 3K9AA 1MOFA 1NR1A 3E8BA 1E1RG 3JD0A 4WFHA 5EK0A 3AG4C 1JPXA 1JX9A 4MVUA 1K4DC 3ABMC 1FXKA 3ASOB 1NVPB 1PNKA 1SZTA 2DYRC 2QEXV 1K34A 5IY5B 3T2MA 1OCZC 3K0DA 3ZMVA 3HPLC 1BHBA 5CA3A 3K04A 4I5SA 3M99B 4JF3A 3JD1A 1F4NA 1PKXA 3EFFK 3ZRWB 5C93A 2A9HA 1K92A 4PA6A 1ROPA 2BOCC 3E2EA 3BEHA 1SERA 3E83A 2MK3A 4PDRA 4DXWA 2R9IA 3ZMUA 3AG3B 5IYCO 1VQ6V 4RQEA 2IH1C 3ABUA 1AI5A 1SETA 1AJPA 5HFLA 4U7OA 1K9MW 2V1DA 1FXKC 1FFTB 3H01A 3SYOA 1FXVA 4XDLA 3SJQC 1QVGU 1VQ5V 5EC2C 1QLEC 3RW0A 3EHBB 5LGTA 3W7TA 3TK1A 1R73A 5IYBO 3X2QB 3FYEB 3AG4B 1F51A 1GO3F 2XAQA 2OTLV 2XNDG 3ZRWA 3ASOC 1VQ9V 1AI6A 3DGEA 3JD4A 2F43G 5IY5C 1YJNV 1OCZB 3JYCA 1G4YB 3CPWU 1YTFD 2HFEC 1GM8A 3T4ZA 5H9CA 4JGSA 4RAIA 2WLNA 4WCEV 1QLNA 3ZMZA 2H94A 1YI2V 4H37A 2QTOA 3QO5A 3FB7C 3W7WA 1FS0G 4P9OA 1GM9A 2QM7A 1LNQA 2X7RB 2XAGA 1K4CC 1AROP 1FXKB 3MHSC 1L1FA 1ZWIC 1I5YA 1PNMA 1Y66A 3CCJV 1QR8A 1VQ4V 5CBFA 2EIMB 2EJRA 3X2QC 3CCQV 4RQFA 3STZC 3E8HA 3IGAC 3RVYA 2XAJA 1AJNA 4JPRA 2WLLB 3IFXA 1YTFB 3T1CA 4BW5A 2XAFA 4ASUG 1H38A 4G2KA 3ML0A 1MG1A 2WLLA 2DQ3A 2EINB 3D36A 3CXCU 1M1KW 2QKSA 1ORQC 4QIWF 1V54C 3IC7A 1FXHA 3CCRV 1KP3A 1YITV 2FTKA 3MHHC 3CCMV 4F4LA 3ETEA 3ABTA 4FIPC 3SPCA 3QO8A 1JVMA 5EC1C 3AG2C 3ZN0A 3OAAG 4FMTA 3WG7C 3K79A 2P7TC 1VQMV 1H8HG 2EIMC 3AG1B 1TUEB 4DO2A 2ZXWB 5BZBA 2H8PC 2A79B 1M56B 2JIZG 4WFFA 5LHGA 4KFMA 2HVKC 4ZBMA 4MW8A 2QA4V 1S5HC 5B1NA 1CP9A 5IYDO 5H6RA 1PNLA 4JTAB 4E2LA 2QM8A 3SYAA 4G27B 2XASA 3A0RA 3E35A 3B8NA 2ATKC 3SPJA 5E1AC 1OHHG 2DYSB 3ABKC 3LDEA 4KP4A 3OEHG 1CPYA 1NH2B 1SRYA 1KP2A 1NR7A 1GK9A 4MTFA 3P30A 2Q69A 4JAVA 2EILB 1BMFG 3UM7A 3OFNG 1J95A 1THZA 5B3SC 1W0KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FPP A;  4BIZ A;  3MD0 A;  4QPK A;  5B1O A;  4ZKI A;  2C2A A;  3ZRV A;  5B1N A;  1JOY A;  2LFR A;  2P67 A;  4QPJ A;  4JYC A;  1IXM A;  2QM8 A;  4Q20 A;  2LFS A;  3ZCC A;  4JAS A;  4U7N A;  2FTK A;  3A0R A;  4LC1 A;  4U7O A;  2WWW A;  4MT8 A;  4KP4 A;  4JYB A;  4GT1 A;  4FMT A;  4I5S A;  3TK1 A;  4GCZ A;  4JAU A;  1F51 A;  3ZRW B;  5C93 A;  2QM7 A;  4JAV A;  3ZRX A;  3NXS A;  4MTX A;  3ZRW A;  4BIU A;  3P32 A;  5IDJ A;  3D36 A;  3DGE A; 
#chains in the Genus database with same CATH topology
 3H1L H;  4TUY B;  4RUE A;  3B40 A;  5FPR A;  5D5Q A;  3NR7 A;  4U3J A;  2UU9 O;  1RFY A;  1H2G A;  2X6A A;  2YID A;  3FB5 C;  5L3F A;  1PPJ H;  3E86 A;  4DW0 A;  1ZUQ A;  5GW7 A;  1GMG A;  2HJF C;  5CA1 A;  3P3P A;  4L87 A;  5H6Q A;  4DR7 B;  5KUM A;  1D5A A;  1BZK A;  2DYS C;  3ABK B;  1W59 A;  2ZDI C;  2IU0 A;  1B6Q A;  4HNA B;  4Z1M G;  1HR0 O;  2OCC C;  2UUC B;  3JAS B;  1IXB A;  2M7W A;  1SA0 B;  4PEL A;  1IUR A;  3BVO A;  5JQG A;  3E8F A;  5CA0 B;  3L72 H;  5EIB C;  4GKJ O;  5LA6 B;  5IT9 N;  5LYJ B;  3CCU V;  1N0N A;  2ADP A;  3CB2 A;  1HWY A;  4JAS A;  4LFA O;  2P4V A;  4MTO A;  2WWW A;  2WA4 A;  3SYP A;  3LSQ A;  4PD4 F;  4GCZ A;  1MZE A;  3R66 A;  4D7T A;  5IJ0 A;  3JSN A;  4CS3 A;  4N23 A;  1G8M A;  4FLV A;  3BRC A;  1SQP H;  4QPK A;  4JI1 O;  5LMN B;  1XL4 A;  3ZRV A;  3K06 A;  1NVP D;  2K9P A;  2IJK A;  3DSQ A;  1OCO C;  4Q20 A;  3J81 N;  2HVJ C;  3K5M A;  2QWO B;  4JV5 O;  2BE3 A;  3C90 A;  2F4V O;  4JTC B;  4DR2 O;  2DMX A;  5B66 Z;  5L3D A;  1KB9 F;  4FZ0 A;  3RWR D;  2AHZ A;  1R3I C;  1QQC A;  1IZ3 A;  1YJ9 V;  2ZD9 A;  4CBC A;  4P9P A;  1ZAU A;  2ZNJ A;  5LMU O;  1NJI W;  3CME V;  1TGO A;  1Z5V A;  1F4M A;  2HLD G;  2AW9 A;  1BS3 A;  1BL8 A;  4EEQ A;  3RN4 A;  4UB8 Z;  2Q0A A;  1VQ8 V;  4AHC A;  3WG7 B;  4RO2 A;  3RYH B;  4D7S A;  1QR9 A;  4J41 A;  2QM4 A;  2YIB A;  1F23 A;  2UXC O;  1KC8 W;  2Q8V A;  2PYJ A;  5J9P C;  3H1H H;  2X6B A;  2IBZ H;  3UO2 A;  3OGI B;  3RYC A;  3QF7 A;  1N4C A;  1BGY H;  4WFB V;  4IIJ A;  2DWE C;  4HYO A;  1WN7 A;  3B4S A;  1R6N A;  1I5X A;  3A0B Z;  3RBZ A;  2XAH A;  2RJZ A;  4O2A B;  4X8A A;  2VQE B;  2W0F C;  2EIJ C;  3WB2 A;  5DED A;  2EZO A;  3ZRS A;  1U96 A;  3KCY A;  2DW4 A;  1OZ0 A;  4O2A A;  1Y74 A;  3OEE G;  3O65 A;  3QNE A;  3DTU B;  4JI8 B;  1VF5 B;  3VOU A;  1G6U A;  1KUQ A;  2CTP A;  2GSM B;  2ZIO A;  2CTW A;  1VQ7 V;  2Y4T A;  1YJW V;  2WLK A;  4PA7 A;  1S3J A;  2DOS A;  1QVF U;  1WJZ A;  1S77 D;  3JAL A;  2R9R B;  3ASN B;  1N32 O;  1Q7Y W;  2JDI G;  2JEX A;  4I55 B;  4K0K B;  5AG2 A;  3F7V C;  4LNU A;  4DR2 B;  3K3W A;  2W6J G;  2EUL A;  1DF5 A;  2CTR A;  3FYI B;  4X89 A;  2XOK G;  4NXM B;  3FB6 C;  2KG7 A;  1EZJ A;  2OCC B;  5LGN A;  4FK5 C;  3SPG A;  3KG2 A;  1BQZ A;  1XMQ B;  1WB8 A;  1ZLZ A;  4UXN A;  2PGG A;  2Z5U A;  1U97 A;  4J9Y B;  4BW9 A;  5JH7 B;  4JI5 B;  2P4K A;  4MTG A;  1COW G;  2WAM A;  4BAY A;  5LOV B;  3I56 V;  4NTW A;  3OMA B;  4G28 B;  3CMA V;  4FM1 A;  4RUF A;  1OJH A;  5BMV A;  4GKJ B;  2FYU H;  1K33 A;  3UKM A;  4TUY A;  2HG5 C;  3D8C A;  4LWS A;  3HKB B;  3IC9 A;  1F7Y A;  4DR4 B;  4B7E A;  3OM3 B;  4LF8 O;  2K1E A;  4MW3 A;  3ZRX A;  3VBB A;  4WFG A;  5JJE B;  4JI4 O;  1HNZ B;  1MOF A;  1WNS A;  3E8B A;  5EK0 A;  2M6Y A;  4UCV A;  2BTQ B;  1K4D C;  4LFC O;  5IYZ B;  3ASO B;  1PNK A;  3UT5 A;  4DR7 O;  1OCZ C;  1BHB A;  1OV9 A;  4JI6 O;  2YIA A;  4YHH O;  4EFE A;  1SF9 A;  1K92 A;  3S3W A;  1HNX B;  1MSD A;  1VAR A;  1QNM A;  3BCC H;  4DR3 B;  2MK3 A;  1XNR O;  4PJ0 Z;  2R9I A;  1XNQ B;  1VQ6 V;  1XIL A;  4CS4 A;  1AI5 A;  4DR5 O;  4BWA A;  2V4D A;  2V1D A;  1FFT B;  1XEQ A;  2VS0 A;  1VQ5 V;  4JAA A;  1QLE C;  3EHB B;  3W7T A;  1R73 A;  2E5L O;  5JWP A;  2QJ1 A;  2N05 A;  1AI6 A;  1H2M A;  3K9S A;  5JH7 A;  3JYC A;  2RCV A;  3CPW U;  2BCC H;  1VF6 A;  1V9P A;  4RAI A;  1P7G A;  2H94 A;  1YI2 V;  3P3N A;  3W7W A;  1FJG O;  3VQV A;  2PF4 E;  1YVW A;  2QM7 A;  1PL4 A;  3APO A;  4DK1 A;  1ARO P;  4NXN B;  3CCJ V;  4B08 A;  2ZE5 A;  2EJR A;  3X2Q C;  2ZE6 A;  3CCQ V;  4B3S O;  4LF5 O;  5E79 Z;  2EX3 A;  1YTF B;  4LF8 B;  2KQX A;  1H38 A;  2F23 A;  4PV1 B;  3ML0 A;  1HR0 B;  3K58 A;  4B3M O;  2QDO A;  4FLY A;  2EIN B;  4DV1 B;  3D36 A;  5C8Y B;  3JAS A;  1ORQ C;  2XUM A;  1V54 C;  4K8X A;  1FXH A;  2QKC A;  4X62 O;  2LO1 A;  4NXN O;  1I94 O;  3T1H B;  3MHH C;  3CCM V;  5BXZ A;  4FIP C;  3QO8 A;  3AG2 C;  3ZN0 A;  4FMT A;  3WG7 C;  1H8H G;  2EIM C;  1RSO A;  5FPO A;  4DO2 A;  1ZL8 A;  2H8P C;  4LF5 B;  3C3S A;  5H6R A;  1AR4 A;  4JI2 B;  3SYA A;  5GON B;  1GN6 A;  2YIB D;  3SPJ A;  3T1H O;  2E5L B;  5LYJ A;  1OHH G;  2LGQ A;  3OEH G;  1NR7 A;  1GK9 A;  3P30 A;  2Q69 A;  4JAV A;  2EIL B;  5KAI Z;  4UVA A;  4X1Y B;  1GTO A;  1OCC C;  4DUY O;  1US6 A;  4JYC A;  5CA1 B;  4B3T B;  3ZCC A;  4KUM A;  2ILM A;  4I50 B;  4E4E A;  1Q6U A;  4MT8 A;  1PM9 A;  2W6I G;  1EZV H;  3RYC B;  4DV2 B;  3OMN B;  4GX1 A;  2CAZ C;  2UXB O;  2O57 A;  1K5S A;  2ZKO A;  1KD1 W;  1R3J C;  3N2K A;  1SKV A;  2V7Q G;  3LUT B;  1NBM G;  5B3S B;  4X66 B;  4CH3 A;  3H1J H;  1Q5O A;  1SQQ H;  1J5E O;  1K5Q A;  2YEV B;  1W2B U;  4F6R A;  1LR1 A;  3S3X A;  4JAU A;  4J7K A;  1YZB A;  2JS3 A;  3FAV B;  2QGN A;  2YIC A;  1EN6 A;  3E22 B;  4R8C A;  4F6R B;  4Z2W A;  2EBO A;  5FLX N;  4X64 O;  1GRJ A;  4NYK A;  2YI9 A;  3SJC C;  2Q7E A;  1WP7 A;  3CC7 V;  3CCV V;  4MVR A;  4NTX A;  3AG7 A;  2GHY A;  4JYB A;  2PUS A;  4O2B B;  1N33 O;  3CYO A;  4MTX A;  3RT3 C;  3OR6 C;  5GON A;  4KHP O;  5LBQ A;  1Q81 W;  4GX5 A;  3AK3 A;  3CC4 V;  5L3G A;  2HHH B;  1BQ0 A;  1VP7 A;  4N21 A;  3L75 H;  2HHH O;  3G80 A;  1IDS A;  3AEI A;  2ZR2 A;  2JGU A;  4TV8 B;  1P84 F;  1JJO A;  5ITZ A;  4UB6 Z;  4X1K A;  5KHK A;  1Q6I A;  2AHY A;  4F6E A;  4GT1 A;  4J10 A;  4ZHQ B;  4FLT A;  2CDY A;  1L0N H;  3SPH A;  2IJH A;  2JK5 C;  3RVZ A;  4UVC A;  3ZN1 A;  4DUY B;  1XNR B;  4WF9 V;  2ZQM A;  1K73 W;  1BCC H;  3CRM A;  2GTA A;  3OGC C;  1RM1 C;  2CK3 G;  1HNX O;  1O9G A;  1WB7 A;  4JTD B;  3G71 V;  3BAB A;  3LDC A;  1QHT A;  1Q86 W;  2OIE A;  4JV5 B;  2Y0P A;  3ABL B;  4W4L A;  2NLJ C;  1NTK H;  1X59 A;  1P7B A;  3AG3 C;  4LR3 A;  4XDK A;  3CD6 V;  4R50 A;  3T1Y B;  3ZMS A;  1AR1 B;  3MD0 A;  3HKD B;  1VIB A;  1QLE B;  2A7W A;  1IXM A;  2Y4U A;  1V55 C;  4O4H B;  1IX9 A;  3H1K H;  3F7Y C;  4X65 O;  5LOV A;  3G4S V;  2Q4P A;  4H0L B;  1FPO A;  4MVQ A;  4YJ3 B;  3KKY A;  4DUZ B;  1VMG A;  4BIZ A;  4QNH B;  3THO A;  3RYF B;  5F2V O;  3K03 A;  4TOI A;  3JAM N;  4MVZ A;  1HDJ A;  4I4T B;  1KEC A;  1M9N A;  3BA9 A;  5KLV H;  3CWB H;  2F95 B;  1NQT A;  1XMO O;  4LBE C;  1RPR A;  5IDJ A;  5B1A B;  3OUF A;  3GVM A;  3M7M X;  4X1K B;  1KQS U;  3OTO B;  2WLI B;  1SQG A;  2Q68 A;  3CRA A;  1ENV A;  4I9Q A;  1NKD A;  1W0J G;  4IHJ A;  2A3Q A;  1KKC A;  5C8Y A;  2EIN C;  4UFZ A;  1M57 C;  2QTS A;  1T5E A;  2MW2 B;  3FKS G;  1V54 B;  1N33 B;  1YCI A;  3BA8 A;  2YSU B;  1WLE A;  4UVB A;  4AI8 A;  2EIJ B;  3NXS A;  1IBL O;  1QBZ A;  2QKA A;  4KHP B;  2QWR B;  2YS8 A;  4DV7 O;  3AG2 B;  4J42 A;  2JS5 A;  4FLX A;  2Y69 C;  5LXT B;  1KYO F;  1NTM H;  4CZZ A;  1HNW O;  2IJI A;  3SYC A;  3K0G A;  2R72 A;  5FNV B;  3L71 H;  5EBL C;  4LFC B;  1M56 C;  4CH4 A;  4UCU A;  3SPI A;  1OCR C;  2DQ0 A;  3F5W C;  3DXR B;  5FNV A;  3SGI A;  2OTJ V;  5FL7 G;  3C3T A;  1N34 B;  5B1O A;  1MSW D;  1VEW A;  3ASN C;  2C2A A;  4B3S B;  4XDJ A;  2JRI A;  4UUJ C;  4JI0 O;  4LF4 O;  4U7N A;  3K57 A;  4QE7 A;  4LFB O;  5IJ9 B;  5K1P A;  1H2N A;  1S72 V;  3E89 A;  4O4L B;  1AIL A;  4IYI A;  3TET A;  3RYF A;  3E8G A;  2QWN B;  1XOU A;  3N2G B;  1K3E A;  2B1I A;  4MVO A;  1NT2 B;  3LNM B;  4LP8 A;  5KX5 A;  5JCO A;  3AG4 C;  1JPX A;  3JAK A;  4J80 A;  2F4V B;  1TVK B;  2ZT9 B;  1FXK A;  2DYR C;  2QEX V;  5IY5 B;  2YUA A;  2R70 A;  2XT9 A;  3HPL C;  2ZCE A;  1F4N A;  4X1I A;  3ZRW B;  5KHI A;  3BEH A;  1SER A;  4FM2 A;  4PDR A;  2P5O A;  3A0H Z;  4LF7 O;  3AG3 B;  4RQE A;  1AVM A;  2IH1 C;  1WPB A;  1AJP A;  4J7Z A;  5HFL A;  5J2U B;  4O4I A;  3VQY A;  4I0X A;  2HJD A;  4CC6 A;  1QVG U;  3SJQ C;  1KU9 A;  5BY1 A;  1H2K A;  3JAT A;  5GTH Z;  5H2F Z;  5IYB O;  3FYE B;  2E75 B;  2XAQ A;  4DV5 B;  2XND G;  4X1I B;  3ZRW A;  1VF7 A;  3DGE A;  4Q6G A;  3JD4 A;  2F43 G;  3T4Z A;  5H9C A;  4O4L A;  5B5E Z;  2E3C A;  4QGP A;  2ZM6 B;  3ZHQ A;  3CHX A;  5CB4 A;  3I5D A;  3K5O A;  4ZOL A;  1LNQ A;  4X20 A;  2VWK A;  2XAG A;  3JAR B;  3JAW B;  1FXK B;  3MHS C;  1ZWI C;  4IT5 A;  1XRE A;  2QR4 A;  1QR8 A;  4GKK O;  4YJ2 B;  1FYJ A;  1AP6 A;  3QTC A;  3TXS A;  3E8H A;  3VQW A;  2CH7 B;  3RVY A;  2XAJ A;  1AJN A;  4W4K A;  1JMK C;  2ODM A;  1MA1 A;  1Z2G A;  3T1C A;  2XAF A;  3RYI B;  4G2K A;  4JI5 O;  2VQF B;  3IAY A;  4B3R O;  4B3M B;  4JYA O;  3CXC U;  5TIS Z;  1M1K W;  4DV3 B;  4IGG A;  2Y0I A;  3IC7 A;  1NI8 A;  2UUA B;  4FLU A;  3ABT A;  1JVM A;  5EC1 C;  4H13 B;  4BR6 A;  2H3O A;  1WA8 B;  5A9G A;  1TUE B;  5BZB A;  2A79 B;  1M56 B;  4KFM A;  4DV6 O;  1S5H C;  5B1N A;  4NR1 A;  1HNW B;  5IYD O;  2QM8 A;  5KHH A;  2Q5Z A;  4G27 B;  3FAV A;  3A0R A;  4I50 A;  2ATK C;  1XMO B;  4KP4 A;  2DYS B;  3ABK C;  4DR6 O;  1YDX A;  1NH2 B;  1SRY A;  2VQF O;  4B3R B;  4JI8 O;  1J5E B;  3HKC A;  4ZKI A;  2UUB O;  2N04 A;  1KBH A;  4PDV A;  4HZ3 A;  4X64 B;  3WU2 Z;  4NB5 A;  1MMM A;  1H8E G;  3OD4 A;  3DC5 A;  3ZX6 A;  2DN9 A;  1YSC A;  2GBO A;  2JJ1 G;  4X20 B;  4PDL A;  3ICX A;  3ZMT A;  2YDE A;  3ETG A;  4H33 A;  4JI3 B;  4DR4 O;  3R65 A;  4YHH B;  4DV7 B;  2IH3 C;  3JSL A;  1EFR G;  3D3I A;  2X0L A;  1N34 O;  1M57 B;  3UT5 B;  2NNU A;  3LSS A;  4LF9 B;  2RQ6 A;  2B5U A;  4DR1 O;  4O4H A;  1WPX A;  2EIL C;  2VRZ A;  2IW5 A;  4LC1 A;  1P49 A;  3EXA A;  1XMQ O;  4CC5 A;  4KXR A;  3T4D A;  2ADQ B;  4UV9 A;  5LA6 A;  1L8D A;  4PA9 A;  4J9Z B;  4U3F H;  3FD9 A;  4FJC C;  1JR9 A;  4O4I B;  1XHZ A;  3KCX A;  5EYP A;  3ZHT A;  3TXQ A;  1GN3 A;  1S76 D;  1OCR B;  5DM6 V;  3ETQ A;  2D3O W;  4QE9 A;  1FFX A;  1K97 A;  2ZIN A;  4AQY O;  1ZL8 B;  3CX5 F;  3U10 A;  1CXZ B;  1VQK V;  3Q4H B;  5LP6 B;  3SJB C;  2WLH A;  4WBN B;  1N0J A;  3OTO O;  1KKD A;  4PHZ A;  1P4R A;  3B8M A;  4TV9 B;  1PD3 A;  1XUQ A;  1YIJ V;  1JJ2 U;  3LDD A;  2OT5 A;  5EZY A;  2Z3Y A;  2RNB A;  4LF6 B;  1K8A W;  5B1B B;  4RWU A;  4DV4 O;  3UCS C;  4PA3 A;  4NTY A;  3A8T A;  3JCZ A;  2WSS G;  1DTO A;  3JD3 A;  3EVK A;  4X88 A;  3ABM B;  4UCS A;  3JAL B;  3TCU A;  1VQP V;  3HKD A;  2DYR B;  1JCH A;  4OXS A;  1NTZ H;  2XHB A;  4DRX B;  4L8J A;  4C7U A;  1VQN V;  2A0L A;  4I7Z B;  5EBM C;  1S0V A;  2G38 A;  4FLW A;  4MVM A;  4WFE A;  1AR5 A;  1OCO B;  3CE2 A;  2IJJ A;  2JVD A;  1JOY A;  3ZIA G;  3OR7 C;  2CE4 A;  4JZG A;  2W0X A;  3RYH A;  5LL6 Y;  2YXL A;  1PV0 A;  3CC2 V;  2YEV A;  3PJS K;  4EFB A;  1Z5W A;  3ETD A;  5DEC A;  5CN0 A;  2EIK C;  4FPP A;  5KMG A;  1URF A;  1IBL B;  4YJ3 A;  1DLB A;  2QE7 G;  3GWK C;  3W7S A;  1B06 A;  3QO7 A;  1Q8I A;  4JI7 B;  5CMU A;  1ZSP A;  5JJJ B;  4AIL C;  2Y48 A;  5DN6 G;  4HBN A;  3CJH B;  2IM9 A;  2GUZ B;  2CH7 A;  4DUZ O;  1GM7 A;  2KB1 A;  4CH5 A;  1MAB G;  3ZJZ A;  2B1G A;  5EBW C;  1X4T A;  4TV9 A;  1SZX A;  4X65 B;  2CUG A;  1UJW B;  1N36 O;  2WLJ A;  1AI7 A;  1SQX H;  2BSK B;  4QJF B;  1Y6X A;  3DXR A;  4FFB A;  1FD9 A;  4I0X B;  4YXW G;  2UXD B;  1Y67 A;  5BMV B;  3WFV A;  3WB1 A;  1R6K A;  2P67 A;  1FAF A;  2Q0O C;  3D3Q A;  3HB3 B;  1I0H A;  4I9W A;  4ICG A;  4TV8 A;  1Y4M A;  4I4T A;  3JCU Z;  2YXH A;  4ABM A;  4MVS A;  5JVD A;  1GAX A;  5LHI A;  5CBG A;  2PZS A;  2RN9 A;  4PA4 A;  2P06 A;  3P32 A;  3G6E V;  1CEZ A;  3OT7 A;  1K7D A;  2HKO A;  5LP6 C;  5CB4 B;  2CTQ A;  1HW7 A;  5IJ9 A;  1D2D A;  4J11 A;  1VF6 C;  1I94 B;  5D5P A;  4P2Z A;  4GUN A;  1SQV H;  4TT3 G;  2ZM6 O;  2ZR3 A;  3BAA A;  5KUK A;  2ZNI A;  4R7C A;  1XDC A;  1SC5 B;  3GB7 C;  5CBH A;  2WPD G;  3U11 A;  5B1B C;  3BPZ A;  3K9A A;  4IIJ B;  1NR1 A;  1E1R G;  1XQ8 A;  4WFH A;  1H2L A;  1JX9 A;  4MVU A;  3ABM C;  1NVP B;  1SZT A;  5CA3 A;  4JI3 O;  1TVK A;  4K0K O;  4JF3 A;  3A2F A;  2BOC C;  3E2E A;  2EJ7 A;  3IJ4 A;  3E83 A;  1IVS A;  3CXH F;  5H5N A;  3KZI Z;  2RDC A;  4Z1V A;  1SET A;  3L9D A;  4GYC B;  2Q7G A;  1L0L H;  3SYO A;  3E22 A;  1BSM A;  4EB6 B;  5EC2 C;  4PI2 A;  1TUB B;  3TK1 A;  3X2Q B;  1F51 A;  1GO3 F;  2L35 A;  4JYY A;  5LMN O;  2GUZ A;  2OTL V;  3ASO C;  2QWP B;  3Q4H A;  5IY5 C;  1YJN V;  1OCZ B;  3AK1 A;  4DR5 B;  2HFE C;  1GM8 A;  1S5J A;  4JGS A;  3ZHS A;  4WCE V;  1XNQ O;  3QO5 A;  1BE3 H;  3FB7 C;  1UFI A;  5KX5 B;  1IBK O;  2KKW A;  4U3J B;  1GM9 A;  1Y76 A;  2B9Z A;  1GN2 A;  1DGS A;  3ZHV A;  5KHG A;  1L1F A;  4ZHQ A;  2UUA O;  1I5Y A;  3N2K B;  4LWS B;  2EIM B;  2Q9L A;  4GLX A;  5LMU B;  3JAW A;  3STZ C;  2GTS A;  1FJG B;  2LW7 A;  4JPR A;  3IFX A;  4LH7 A;  1JFF B;  4BW5 A;  4K35 A;  4IYH A;  4NVP A;  1MG1 A;  2WLL A;  2LQT A;  2QKS A;  3ZHR A;  3JAR A;  4JI2 O;  4D6T H;  3CCR V;  3RGB A;  1YIT V;  1WP8 A;  2FTK A;  4F4L A;  4TQF A;  2LW1 A;  2P7T C;  1VQM V;  3VQX A;  3G67 A;  4OPA A;  1IBM B;  2ZXW B;  4IL6 Z;  4DYL A;  4WFF A;  2DJV A;  4NKG B;  5LHG A;  2HVK C;  4WBN A;  1CP9 A;  5JVD B;  1PNL A;  2UXD O;  3JAK B;  3WB0 A;  5IWA B;  5E1A C;  2NR5 A;  4JI0 B;  4LF4 B;  2F66 C;  2QWQ B;  3LDE A;  1S5L Z;  2AZ2 A;  4CH6 A;  2PY5 A;  2OIG A;  5JQG B;  4MTF A;  2CGO A;  2NN4 A;  1WA8 A;  3UM7 A;  2PI4 A;  4JTA B;  1J95 A;  4E2L A;  5B3S C;  1YHQ V;  1LUW A;  4A5U B;  4JI4 B;  1SES A;  4UCO A;  4LF7 B;  2VQE O;  1JFF A;  4LCU C;  2P6J A;  2EZP A;  2LFS A;  4B7K A;  1MNG A;  4FZ1 A;  1N36 B;  4LFB B;  2PTM A;  1I08 A;  5L3E A;  2ZDI A;  4OX9 B;  1TUB A;  2DWD C;  4DR6 B;  1AJQ A;  2HR3 A;  2Z0A A;  1M4U A;  5KA6 A;  4BIU A;  3BHP A;  2Q6A A;  2UU9 B;  4R6Z A;  2E74 B;  5EZY B;  1N32 B;  3CCE V;  4P30 A;  5KA5 A;  3K5L A;  1OCC B;  4MS2 A;  4DV0 B;  4YY3 B;  1DF4 A;  4FLZ A;  3HKE B;  1R1B A;  4ZOL B;  3B09 A;  5HFM A;  1NU1 H;  1Q82 W;  2P22 C;  1FKA O;  2A06 H;  3AK2 A;  4HAM A;  4TSF G;  5EYP B;  1PP9 H;  3FB8 C;  1YEW A;  2ZE8 A;  2E76 B;  4JI6 B;  2PI5 A;  3BY6 A;  1R3L C;  1XBL A;  1QCE A;  4DR3 O;  3ABL C;  1H2S B;  1JA8 A;  2WLI A;  1Q43 A;  2KSD A;  1E79 G;  2JJ2 G;  1AP5 A;  3OW2 U;  2UXC B;  2Q73 A;  4EKW A;  3FX7 A;  3JD2 A;  4BIO A;  1EN5 A;  1DK1 A;  1V55 B;  2OYQ A;  3QG5 A;  3T1Y O;  2FML A;  1HNZ O;  2P90 A;  1Q90 D;  5BR8 O;  3OMI B;  1NZ6 A;  4WFA V;  1R3K C;  3ZS8 C;  1JQ0 A;  4OGQ B;  3W7U A;  1ZTE A;  1RPO A;  1WAZ A;  5LGU A;  5IWA O;  3L74 H;  4LF6 O;  4DRX A;  2Q67 A;  4B3T O;  2UXX A;  3CP1 A;  2LP7 A;  3RFR A;  4DV5 O;  3H1I H;  2VWJ A;  2ZIM A;  3CRC A;  1GKF A;  4GX0 A;  4NXM O;  1R6T A;  1IBM O;  3GWO A;  1YF2 A;  4ZI7 B;  2PYL A;  4LH6 A;  3O9O A;  5L3B A;  4IHJ B;  4QPJ A;  1HP8 A;  1M90 W;  4YIP A;  3STL C;  4K8Z A;  4ZI7 A;  1RM1 B;  2HEP A;  5CA0 A;  3CJH A;  4PI0 A;  5EIB D;  1KMI Z;  2UXN A;  2QSA A;  1XHX A;  1M5I A;  4UV8 A;  1E1Q G;  5IE9 A;  1M93 A;  3B2E E;  1Y74 B;  4CS2 A;  5IYZ A;  4O4J B;  2WA3 A;  2ITC C;  3B77 A;  2R9A A;  1N8R W;  2ZE7 A;  2IU3 A;  2YI8 A;  4O4J A;  3FFQ A;  3SDL A;  5LP6 A;  4MSW C;  3J7A U;  2FL4 A;  4OPH A;  4KL1 A;  4DV1 O;  4JZ2 A;  2GDS A;  3RYI A;  4PDM A;  3CCS V;  2ETN A;  3N27 A;  2BOB C;  4ZIB A;  2AXT Z;  4LF9 O;  2WLM A;  3CS5 A;  1LUV A;  3W7X A;  2EIK B;  3BFR A;  2X6C A;  5L3C A;  3MDS A;  1O9H A;  1EBO A;  1PL0 A;  1SS3 A;  2BSK A;  1XI1 A;  2CGN A;  3K5N A;  3I55 V;  1BHA A;  3OE7 G;  1B04 A;  3SYQ A;  1Q3E A;  4GX2 A;  2ITD C;  3LSU A;  3OTF A;  3TJT A;  3AG1 C;  1YXB A;  4JI7 O;  4X66 O;  1NH2 D;  2ZXW C;  2UUC O;  5B1A C;  2HP8 A;  4AQY B;  4TQD A;  1XL6 A;  4DV0 O;  3CEI A;  1ZX3 A;  4LNU B;  4XBF A;  2LJ2 A;  1VQO V;  2JEU A;  2BTQ A;  3CSX A;  3CCL V;  1RP3 B;  2LFR A;  4TWK A;  5J2U A;  2JGD B;  1AI4 A;  5LHH A;  2Q7H A;  3K08 A;  1VQL V;  3ZBH A;  4FM0 A;  1A32 A;  2JGD A;  3OUS A;  4OX9 O;  4H44 B;  2Y69 B;  1RSO B;  4X9Q A;  5GTI Z;  4DR1 B;  4JYA B;  3JD0 A;  2UXB B;  4LFA B;  1EM1 A;  1TAE A;  1K34 A;  3H9V A;  4UCR A;  4DV2 O;  3T2M A;  3K0D A;  3ZMV A;  3K04 A;  4I5S A;  3M99 B;  3JD1 A;  1PKX A;  3EFF K;  2D2C B;  5C93 A;  2A9H A;  5BR8 B;  4PA6 A;  1ROP A;  3SR2 C;  4JI1 B;  1MZF A;  1SA0 A;  2F93 B;  4DXW A;  3ZMU A;  5IYC O;  2GV9 A;  3ABU A;  4GKK B;  2FKX A;  4U7O A;  1K9M W;  1FXK C;  3H01 A;  5J2T A;  1FXV A;  4XDL A;  5JJN B;  2KG7 B;  2AZ0 A;  2XTA A;  2ARH A;  4J7J A;  3RW0 A;  5LGT A;  3UQ8 A;  1QU7 A;  4FVM A;  3AG4 B;  3SJA C;  3ZED A;  4X1Y A;  5J2T B;  3HR0 A;  1VQ9 V;  1D5N A;  2RMK B;  2OWO A;  3JAT B;  4YJ2 A;  1G4Y B;  1YTF D;  4UCT A;  3HKB A;  3APQ A;  5IJ0 B;  4HNA A;  5K1X A;  3J80 N;  2WLN A;  3HKC B;  3PN1 A;  1QLN A;  5LXT A;  3ZMZ A;  4H37 A;  2QTO A;  1GN4 A;  1GH6 A;  4DK0 A;  1FS0 G;  4P9O A;  2FB5 A;  4I55 A;  4YIO A;  1I7F A;  2AGA A;  5KHJ A;  4FFB B;  1B3Q A;  2X7R B;  1SQB H;  5KAF Z;  3MAQ A;  1K4C C;  1PNM A;  1Y66 A;  1TA8 A;  2F1M A;  3CRQ A;  1VQ4 V;  5CBF A;  2LGW A;  4RQF A;  4DV6 B;  3L70 H;  3IGA C;  2DE0 X;  1AB3 A;  2WLL B;  2L6L A;  4ASU G;  4O2B A;  1IBK B;  1Y76 B;  2DQ3 A;  5A2Q N;  3N2G A;  5JCO C;  4QIW F;  1NS1 A;  1SQF A;  3K59 A;  4X62 B;  1KP3 A;  1EN4 A;  2BTO A;  3DC6 A;  5ITZ B;  2N74 A;  3ETE A;  3SPC A;  3OAA G;  1UPG A;  3K79 A;  3UO3 A;  2YXY A;  3M8A A;  3AG1 B;  2UUB B;  2YC0 A;  1G1X B;  2JIZ G;  3CRR A;  4FFK A;  4ZBM A;  4MW8 A;  4EB6 A;  3D36 C;  2QA4 V;  4GZR B;  1Q6H A;  3F5T A;  3G6B A;  4DV4 B;  3L73 H;  2XAS A;  3B8N A;  3E35 A;  5KMG B;  4K3A A;  4DW1 A;  2OCH A;  1CPY A;  3ZHU A;  1BT8 A;  3HKE A;  1KP2 A;  4DV3 O;  4YY3 O;  3QVN A;  1FFX B;  3TGU H;  1BMF G;  3U0Z A;  3OFN G;  1THZ A;  1W0K G;  3LNN A; 
#chains in the Genus database with same CATH homology
 1GTO A;  1OCC C;  1YHQ V;  4ZKI A;  1SES A;  4RUE A;  4PDV A;  4LCU C;  4HZ3 A;  4JYC A;  2P6J A;  2EZP A;  2LFS A;  1H8E G;  3ZCC A;  1H2G A;  2X6A A;  4KUM A;  3FB5 C;  5L3F A;  1YSC A;  2JJ1 G;  3E86 A;  4PDL A;  4MT8 A;  2W6I G;  5L3E A;  3ZMT A;  5GW7 A;  1GMG A;  3ETG A;  2HJF C;  2ZDI A;  4H33 A;  3R65 A;  4L87 A;  5H6Q A;  2DWD C;  1AJQ A;  2HR3 A;  2IH3 C;  3OMN B;  5KA6 A;  5KUM A;  1EFR G;  3D3I A;  2X0L A;  4GX1 A;  4BIU A;  2Q6A A;  1M57 B;  2NNU A;  1K5S A;  1KD1 W;  2DYS C;  3ABK B;  3LSS A;  4R6Z A;  1R3J C;  2ZDI C;  2IU0 A;  2B5U A;  1B6Q A;  1WPX A;  3CCE V;  2EIL C;  2V7Q G;  4P30 A;  2IW5 A;  4LC1 A;  3LUT B;  5KA5 A;  1NBM G;  4Z1M G;  5B3S B;  2OCC C;  1OCC B;  4MS2 A;  2M7W A;  3T4D A;  1K5Q A;  2YEV B;  4UV9 A;  1DF4 A;  1W2B U;  4PEL A;  4JAU A;  4PA9 A;  4J9Z B;  3E8F A;  4FJC C;  5HFM A;  4R8C A;  2EBO A;  1Q82 W;  3CCU V;  1S76 D;  1OCR B;  5DM6 V;  1HWY A;  4JAS A;  2D3O W;  3CC7 V;  4QE9 A;  4HAM A;  4MTO A;  2WWW A;  1K97 A;  3CCV V;  4MVR A;  4TSF G;  2GHY A;  4JYB A;  3SYP A;  1VQK V;  3FB8 C;  2WLH A;  3LSQ A;  4GCZ A;  3CYO A;  2PI5 A;  3BY6 A;  4N23 A;  1G8M A;  1R3L C;  4MTX A;  3OR6 C;  1KKD A;  4QPK A;  1QCE A;  3ABL C;  5LBQ A;  1Q81 W;  1P4R A;  3B8M A;  2WLI A;  4GX5 A;  1PD3 A;  1XL4 A;  1YIJ V;  3ZRV A;  3CC4 V;  1JJ2 U;  5L3G A;  3K06 A;  4N21 A;  1NVP D;  3LDD A;  2OT5 A;  2IJK A;  3AEI A;  1OCO C;  1E79 G;  2ZR2 A;  2HVJ C;  2JJ2 G;  4Q20 A;  2Z3Y A;  1K8A W;  5B1B B;  3OW2 U;  4JTC B;  2AHY A;  4EKW A;  4GT1 A;  4PA3 A;  5L3D A;  3JCZ A;  3JD2 A;  2AHZ A;  3SPH A;  1R3I C;  2IJH A;  2JK5 C;  1DTO A;  2WSS G;  4UVC A;  3RVZ A;  1V55 B;  3JD3 A;  3ZN1 A;  4X88 A;  3ABM B;  2ZQM A;  2ZD9 A;  4CBC A;  4WF9 V;  3TCU A;  1YJ9 V;  1VQP V;  3OGC C;  1K73 W;  2DYR B;  4P9P A;  2P90 A;  1RM1 C;  1JCH A;  4OXS A;  2CK3 G;  1NJI W;  3OMI B;  4JTD B;  4WFA V;  3G71 V;  3CME V;  1R3K C;  3LDC A;  1JQ0 A;  3W7U A;  1Q86 W;  1VQN V;  2A0L A;  1F4M A;  1RPO A;  5LGU A;  5EBM C;  2Q67 A;  3ABL B;  2HLD G;  2UXX A;  3CP1 A;  2LP7 A;  1S0V A;  2NLJ C;  1BL8 A;  4MVM A;  4WFE A;  1P7B A;  3AG3 C;  4XDK A;  3CD6 V;  1GKF A;  4GX0 A;  1OCO B;  4R50 A;  3ZMS A;  3GWO A;  1AR1 B;  3MD0 A;  1VQ8 V;  2IJJ A;  3WG7 B;  4RO2 A;  1QLE B;  1JOY A;  5L3B A;  1QR9 A;  4QPJ A;  3ZIA G;  1IXM A;  3OR7 C;  1F23 A;  1V55 C;  1KC8 W;  1M90 W;  3STL C;  5J9P C;  3F7Y C;  1RM1 B;  2X6B A;  3G4S V;  4MVQ A;  3CC2 V;  2UXN A;  2YEV A;  3PJS K;  4WFB V;  3ETD A;  2DWE C;  4HYO A;  4UV8 A;  5CN0 A;  1R6N A;  2EIK C;  1I5X A;  4FPP A;  1E1Q G;  3RBZ A;  4BIZ A;  4QNH B;  2XAH A;  4X8A A;  1DLB A;  2W0F C;  2QE7 G;  3K03 A;  2EIJ C;  4UVA A;  2ITC C;  3W7S A;  3B77 A;  2EZO A;  3QO7 A;  3ZRS A;  4MVZ A;  1N8R W;  2DW4 A;  1OZ0 A;  1KEC A;  2IU3 A;  5CMU A;  3OEE G;  3QNE A;  1M9N A;  2Y48 A;  3DTU B;  5DN6 G;  1NQT A;  4MSW C;  3VOU A;  4LBE C;  1GM7 A;  1RPR A;  2KB1 A;  5IDJ A;  5B1A B;  3OUF A;  2GSM B;  1VQ7 V;  1MAB G;  4PDM A;  2B1G A;  3ZJZ A;  3CCS V;  1YJW V;  1KQS U;  2WLK A;  5EBW C;  2WLI B;  2Q68 A;  2BOB C;  1S3J A;  4PA7 A;  2PI4 A;  1ENV A;  1QVF U;  1NKD A;  1W0J G;  1S77 D;  2WLM A;  1UJW B;  2EIN C;  2WLJ A;  1AI7 A;  1M57 C;  2R9R B;  3ASN B;  3W7X A;  2EIK B;  1Q7Y W;  2JDI G;  2JEX A;  3FKS G;  4QJF B;  2X6C A;  1V54 B;  5L3C A;  2YSU B;  3F7V C;  1WLE A;  1EBO A;  3K3W A;  4UVB A;  2W6J G;  1PL0 A;  2EIJ B;  1DF5 A;  3NXS A;  1QBZ A;  3FYI B;  4X89 A;  2XOK G;  3FB6 C;  2OCC B;  1EZJ A;  4YXW G;  5LGN A;  3I55 V;  1BHA A;  3OE7 G;  4FK5 C;  3SPG A;  3AG2 B;  3WFV A;  3KG2 A;  2Y69 C;  3SYQ A;  1R6K A;  2P67 A;  4GX2 A;  2ITD C;  3AG1 C;  4CZZ A;  2IJI A;  4UXN A;  2Z5U A;  3HB3 B;  4I9W A;  3SYC A;  4J9Y B;  3K0G A;  1NH2 D;  2ZXW C;  1Y4M A;  5EBL C;  5B1A C;  1M56 C;  4MVS A;  3SPI A;  1OCR C;  2DQ0 A;  4MTG A;  5LHI A;  1COW G;  1XL6 A;  3F5W C;  5CBG A;  4XBF A;  4PA4 A;  2OTJ V;  2WAM A;  3G6E V;  3P32 A;  1CEZ A;  5FL7 G;  4BAY A;  1MSW D;  5B1O A;  3ASN C;  1K7D A;  2HKO A;  2C2A A;  3I56 V;  1VQO V;  2JEU A;  3CCL V;  4XDJ A;  3OMA B;  4G28 B;  4UUJ C;  3CMA V;  4RUF A;  2LFR A;  4TWK A;  1K33 A;  1AI4 A;  5LHH A;  4P2Z A;  4U7N A;  3K08 A;  3UKM A;  4TT3 G;  1VQL V;  4QE7 A;  2ZR3 A;  2HG5 C;  1S72 V;  3E89 A;  5KUK A;  4R7C A;  3OUS A;  3TET A;  3OM3 B;  3E8G A;  2Y69 B;  2K1E A;  1K3E A;  4MW3 A;  2B1I A;  3ZRX A;  4MVO A;  3GB7 C;  5CBH A;  2WPD G;  5B1B C;  3VBB A;  3LNM B;  4LP8 A;  4WFG A;  3K9A A;  1MOF A;  1NR1 A;  3E8B A;  1E1R G;  3JD0 A;  4WFH A;  5EK0 A;  3AG4 C;  1JPX A;  1JX9 A;  4MVU A;  1K4D C;  3ABM C;  1FXK A;  3ASO B;  1NVP B;  1PNK A;  1SZT A;  2DYR C;  2QEX V;  1K34 A;  5IY5 B;  3T2M A;  1OCZ C;  3K0D A;  3ZMV A;  3HPL C;  1BHB A;  5CA3 A;  3K04 A;  4I5S A;  3M99 B;  4JF3 A;  3JD1 A;  1F4N A;  1PKX A;  3EFF K;  3ZRW B;  5C93 A;  2A9H A;  1K92 A;  4PA6 A;  1ROP A;  2BOC C;  3E2E A;  3BEH A;  1SER A;  3E83 A;  2MK3 A;  4PDR A;  4DXW A;  2R9I A;  3ZMU A;  3AG3 B;  5IYC O;  1VQ6 V;  4RQE A;  2IH1 C;  3ABU A;  1AI5 A;  1SET A;  1AJP A;  5HFL A;  4U7O A;  1K9M W;  2V1D A;  1FXK C;  1FFT B;  3H01 A;  3SYO A;  1FXV A;  4XDL A;  3SJQ C;  1QVG U;  1VQ5 V;  5EC2 C;  1QLE C;  3RW0 A;  3EHB B;  5LGT A;  3W7T A;  3TK1 A;  1R73 A;  5IYB O;  3X2Q B;  3FYE B;  3AG4 B;  1F51 A;  1GO3 F;  2XAQ A;  2OTL V;  2XND G;  3ZRW A;  3ASO C;  1VQ9 V;  1AI6 A;  3DGE A;  3JD4 A;  2F43 G;  5IY5 C;  1YJN V;  1OCZ B;  3JYC A;  1G4Y B;  3CPW U;  1YTF D;  2HFE C;  1GM8 A;  3T4Z A;  5H9C A;  4JGS A;  4RAI A;  2WLN A;  4WCE V;  1QLN A;  3ZMZ A;  2H94 A;  1YI2 V;  4H37 A;  2QTO A;  3QO5 A;  3FB7 C;  3W7W A;  1FS0 G;  4P9O A;  1GM9 A;  2QM7 A;  1LNQ A;  2X7R B;  2XAG A;  1K4C C;  1ARO P;  1FXK B;  3MHS C;  1L1F A;  1ZWI C;  1I5Y A;  1PNM A;  1Y66 A;  3CCJ V;  1QR8 A;  1VQ4 V;  5CBF A;  2EIM B;  2EJR A;  3X2Q C;  3CCQ V;  4RQF A;  3STZ C;  3E8H A;  3IGA C;  3RVY A;  2XAJ A;  1AJN A;  4JPR A;  2WLL B;  3IFX A;  1YTF B;  3T1C A;  4BW5 A;  2XAF A;  4ASU G;  1H38 A;  4G2K A;  3ML0 A;  1MG1 A;  2WLL A;  2DQ3 A;  2EIN B;  3D36 A;  3CXC U;  1M1K W;  2QKS A;  1ORQ C;  4QIW F;  1V54 C;  3IC7 A;  1FXH A;  3CCR V;  1KP3 A;  1YIT V;  2FTK A;  3MHH C;  3CCM V;  4F4L A;  3ETE A;  3ABT A;  4FIP C;  3SPC A;  3QO8 A;  1JVM A;  5EC1 C;  3AG2 C;  3ZN0 A;  3OAA G;  4FMT A;  3WG7 C;  3K79 A;  2P7T C;  1VQM V;  1H8H G;  2EIM C;  3AG1 B;  1TUE B;  4DO2 A;  2ZXW B;  5BZB A;  2H8P C;  2A79 B;  1M56 B;  2JIZ G;  4WFF A;  5LHG A;  4KFM A;  2HVK C;  4ZBM A;  4MW8 A;  2QA4 V;  1S5H C;  5B1N A;  1CP9 A;  5IYD O;  5H6R A;  1PNL A;  4JTA B;  4E2L A;  2QM8 A;  3SYA A;  4G27 B;  2XAS A;  3A0R A;  3E35 A;  3B8N A;  2ATK C;  3SPJ A;  5E1A C;  1OHH G;  2DYS B;  3ABK C;  3LDE A;  4KP4 A;  3OEH G;  1CPY A;  1NH2 B;  1SRY A;  1KP2 A;  1NR7 A;  1GK9 A;  4MTF A;  3P30 A;  2Q69 A;  4JAV A;  2EIL B;  1BMF G;  3UM7 A;  3OFN G;  1J95 A;  1THZ A;  5B3S C;  1W0K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...