1SQBH

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqbH00
3CXHF 3CX5F 1NU1H 1SQQH 1BCCH 4PD4F 1EZVH 3L71H 1L0LH 5KLVH 3H1HH 3TGUH 3H1LH 1KYOF 3H1IH 2A06H 3H1JH 1NTZH 3L72H 2IBZH 1P84F 1SQBH 1L0NH 1KB9F 1BGYH 1SQXH 3CWBH 1PPJH 1SQVH 2BCCH 3L74H 3L70H 4D6TH 3H1KH 4U3FH 1SQPH 1NTKH 1NTMH 1BE3H 1PP9H 3L73H 3L75H 2FYUH 3BCCH
chains in the Genus database with same CATH superfamily
2G38A 2Q4PA 1VQ7V 4HZ3A 4JYYA 2FTKA 5IYZB 5K1XA 3M7MX 5LGNA 3ABKB 1VIBA 3DXRA 1P84F 3SDLA 3SYQA 5DN6G 1VQ8V 1YJ9V 3K59A 2AGAA 3IJ4A 3BHPA 1Y74B 1R3KC 4JZ2A 4QGPA 1AI7A 3CCMV 5EZYA 3G71V 4X89A 2ZQMA 4QJFB 4X66O 4JTCB 5C93A 4I9WA 3W7XA 3CEIA 1YJWV 3AK1A 1EN6A 3CS5A 4LFBO 2Y4UA 5LGTA 1NQTA 3CC7V 1MZEA 2HHHO 2WLIA 4DV1B 2Q73A 5F2VO 2DYRC 5DEDA 1TAEA 4MW8A 2ZDIA 4GLXA 1SESA 4X65B 3HKEA 3LNNA 3STLC 3RWRD 2CTQA 2PI5A 3ZN1A 1M93A 2BTOA 4YHHO 2E3CA 4ABMA 4A5UB 3LSSA 4IYHA 2Y4TA 1FXKC 2DYSC 4W4KA 1U97A 4QPKA 4P9OA 4DW0A 3I5DA 2JDIG 1S5JA 3HKDA 4JI4O 1AJQA 3J7AU 4IIJB 4TV9B 2Y0IA 4WFEA 1XMQO 1YCIA 2YIBA 3GVMA 3CYOA 1IURA 2QM8A 1AR4A 3CX5F 1UJWB 1BCCH 3CRAA 2CGNA 4JPRA 5LXTA 1SERA 4JI0O 5CBHA 3LSUA 4J7ZA 1M4UA 2OWOA 3AG2B 2Q9LA 4O4IA 4DV4O 4G28B 3UCSC 1XHXA 2ZNJA 4B7EA 3UT5B 5BXZA 4WBNB 1NTMH 3IAYA 1M1KW 5JJJB 2UXBB 3I55V 1J95A 1UFIA 1JPXA 1XNRO 1TUBA 4QPJA 4LH7A 1M9NA 2IM9A 2MW2B 1Y6XA 3ABKC 4LF5B 1GN2A 4TQDA 1Z5WA 4TOIA 4DYLA 4EFEA 2XAQA 5KA5A 4P30A 4EEQA 3K06A 3MD0A 3SPHA 3N2GB 4UCUA 1PP9H 1X59A 2P67A 5EC1C 3OW2U 3K04A 2VS0A 1MNGA 5FL7G 3H1IH 4JI8O 1ZSPA 2IBZH 4JI3O 3MDSA 5B1AC 1P4RA 1PM9A 4DR5B 1MMMA 3ZIAG 2LFRA 5L3BA 4X1YB 2PYLA 3K08A 4QE9A 2DQ3A 4FLWA 4FVMA 4FFBB 3BRCA 1QHTA 1WN7A 2HJFC 1TGOA 2L35A 1AR5A 2HEPA 3JAMN 2PTMA 4DR2B 4ASUG 4CS4A 2Z0AA 4UCTA 2EIKC 5H9CA 1K8AW 5CA1B 3SPGA 3IC7A 2ZE7A 1GRJA 2ODMA 3OD4A 3AEIA 4P9PA 1HNZB 1D5NA 3SJBC 3T1HO 4MS2A 1AILA 1SRYA 2YXHA 4DR7O 3K9SA 1N32B 5KHGA 3HKBB 4MVRA 3CRCA 2VWKA 1N33O 1ZX3A 4O4HB 1WNSA 4LWSB 3JD0A 4RUFA 4MVQA 2ZM6B 2OYQA 2PYJA 3K5LA 4JI5O 1XREA 4I50A 1H38A 4JTDB 4RWUA 1PL0A 2BOCC 5D5PA 5L3EA 5IJ0B 2OIEA 4UFZA 2Z3YA 1M90W 1DK1A 3GWOA 2CAZC 3HB3B 2P06A 4GT1A 3THOA 1V54C 1F7YA 3CC2V 1KB9F 4RUEA 4WFHA 2GV9A 1MZFA 1RPRA 4DUYB 3KZIZ 3DC6A 4X1KA 3B2EE 4O2AA 4B3TO 4ZI7A 2KQXA 3AK3A 2HHHB 1XL4A 1WB8A 4I55A 3R65A 4PJ0Z 1R73A 1SQFA 4X64O 1EN4A 3JCUZ 5H6QA 1K7DA 2AHZA 3C90A 4K35A 3ZHVA 1PPJH 3K5MA 4YIPA 2NN4A 4DV2O 5GTIZ 4PI2A 1YTFB 1Z2GA 4TWKA 2CK3G 1VQOV 3LDEA 2UUCO 2AXTZ 3SJAC 4YJ2B 4GX5A 4GX1A 1HR0O 1ZTEA 4DRXA 3RVZA 2F95B 3ZRVA 3P3PA 4MW3A 2ETNA 2IJHA 2HP8A 1WP8A 5L3DA 4AILC 4Z1MG 3IGAC 4CC5A 4OPAA 3JALB 2RCVA 4PA6A 2WLLB 2QEXV 4FIPC 2B1GA 2WLKA 3X2QB 2F4VO 1N34O 2CUGA 1IBLO 4ZHQA 1QR8A 3WU2Z 1N33B 4DR3B 4DV3O 2QGNA 3E89A 4I0XB 2ZE5A 4LNUA 2ZNIA 2BSKB 4G27B 4KHPB 3Q4HA 2LO1A 4FM1A 3CWBH 3E22B 1BSMA 1VF6C 4TV8B 3DC5A 4QE7A 4TQFA 3RGBA 1N0JA 2BTQA 2ZKOA 4UCOA 4PELA 1AP6A 5J9PC 4UV9A 1D2DA 3DTUB 2CE4A 3L71H 3A2FA 4CS3A 5IJ9B 3ZS8C 3CRMA 5EK0A 5B1BB 1Q6UA 2YEVB 4JI0B 4H13B 4OX9O 4LFAO 1Y67A 4C7UA 1GN4A 2Q8VA 4JI7O 3CJHA 2KG7B 5LMNB 1R6NA 2EINB 5E1AC 2ADQB 1BHBA 2WAMA 3SPJA 2F66C 5CBFA 1MG1A 3K5OA 4DR1B 5LP6B 4DR1O 1XNQO 5H5NA 4BWAA 1GAXA 1K33A 3L73H 4UXNA 3H1LH 3CXHF 1BL8A 1TUEB 4X62B 2QR4A 4MVOA 3ABTA 4LF7B 4DV1O 4BW9A 3F7YC 1W0JG 3E2EA 2IU3A 3BFRA 1VQKV 3CCRV 5H2FZ 3W7SA 2DE0X 2RMKB 3ETDA 3K0GA 5LYJA 5K1PA 2QKSA 1JOYA 1VF6A 4LR3A 4FLUA 2A3QA 4O2BA 2EZPA 4TUYA 4CH3A 1YJNV 3CXCU 1VQ6V 3JD2A 3OR6C 4AHCA 4K0KO 1F4NA 5IYCO 4ZKIA 3FFQA 4B3RO 4JGSA 3OT7A 1TVKB 4FLVA 4GYCB 3K03A 3ZHTA 2YSUB 4GX0A 3D3QA 1SZXA 3LDCA 3RYFB 5B5EZ 3BA9A 3RYHB 1YF2A 5IYDO 2HVJC 2LQTA 5FNVB 1V54B 4BW5A 5KX5A 3SPIA 1Y74A 1I7FA 1V9PA 4HBNA 4ZOLA 1HNWB 2OT5A 4JF3A 1ZL8B 2ZIMA 2X6BA 2EIMB 4PA3A 1SS3A 1KYOF 4H44B 3K58A 1KUQA 1E1RG 4DUZB 1M57B 1FKAO 1NH2D 4B3RB 2XAHA 1DF5A 2HJDA 3G80A 2FB5A 5CA0B 5LMUB 3E8HA 3OEEG 4G2KA 1AI5A 5EC2C 2WA4A 2XNDG 4D7SA 1JMKC 1P49A 2EULA 3JCZA 1A32A 5B66Z 5KUKA 1BT8A 1FJGO 4TV9A 4H37A 1Q7YW 5IDJA 4NTWA 4UCRA 4BIUA 4FK5C 5EBMC 1THZA 4MTFA 2VQEO 1P7BA 2CDYA 5LXTB 3JD4A 4GKJO 1XMOO 1YSCA 3CSXA 2UXDB 4CH6A 1XEQA 3JAWB 1DTOA 4JI6O 2LP7A 4KHPO 2QWPB 1Z5VA 3QO8A 3QVNA 1G4YB 2JGUA 4PA4A 4EB6A 1N36B 4I4TA 3JD1A 3A8TA 2JGDA 5J2TB 1ZAUA 3MHHC 3HKCA 5KMGA 4JI8B 2F93B 2ATKC 3TCUA 4LFAB 1OZ0A 4WFFA 3L74H 4DR3O 2HLDG 1YIJV 3CCUV 3CCSV 1PNLA 2Y69C 1R6TA 1T5EA 4GKKB 5B1OA 1OCZC 1CPYA 4LF5O 3QO7A 3ZHQA 4X1YA 1L0NH 4DV6O 4NXMO 2P4VA 1QQCA 1KKDA 4FFBA 1NR1A 3ZHUA 4O4JA 3ZRWB 4DR4B 2PGGA 4X20A 1VP7A 2E76B 1Q5OA 5KUMA 4DV7O 1AROP 1OCOC 3B40A 4RQEA 2QJ1A 3OMIB 4DV4B 1FS0G 2D3OW 4DV2B 3A0HZ 1KU9A 2EJ7A 3FAVA 2YC0A 2LW7A 2V1DA 5BMVA 1WPBA 2GUZA 5CA3A 4JYAO 2ILMA 4R8CA 2X7RB 5IY5B 3T4ZA 2ZXWC 1K9MW 3JSLA 1HP8A 1PD3A 4B3MO 3AG1B 5IYBO 4UVCA 2GSMB 4J11A 1GKFA 1ZUQA 2A06H 2EIJB 4LF6O 2P6JA 4I50B 3M8AA 3HPLC 3JSNA 4U3FH 4X9QA 4J10A 5JQGA 1HNWO 4NVPA 1JJOA 4PDLA 4B3TB 4F6RA 1V55B 3R66A 1H2KA 1H2LA 1IBMO 2WLHA 1NVPB 3D8CA 2AZ0A 4WF9V 2CH7A 2LGWA 1XNQB 4HNAB 3O9OA 3UKMA 2L6LA 4X1KB 4X66B 1FXKB 2DYSB 5GW7A 4ZI7B 1H2GA 3CCLV 5H6RA 3L75H 2Q69A 1XOUA 4RO2A 4QIWF 1AP5A 3QG5A 4X88A 2P5OA 3SGIA 1NJIW 3FYIB 2GDSA 2PUSA 3H1HH 3TGUH 1IDSA 3DGEA 4O4LB 4JYAB 2GHYA 1M56C 4K3AA 2X0LA 1E1QG 4J9YB 4H0LB 2OCCB 1AR1B 4GUNA 4MVUA 1SQXH 3P3NA 1JA8A 2YUAA 4E2LA 3FB7C 2XUMA 3QF7A 4H33A 3ZN0A 2H94A 1OCCB 2XAJA 3G4SV 3NXSA 1Y76B 4J7JA 3ICXA 3C3SA 3JASB 1SKVA 2RQ6A 5LOVB 3JARB 4B3SB 5J2UA 4YY3O 5JH7B 1AI4A 4JI3B 5LA6B 2R70A 1VQNV 3K0DA 3WB2A 3ZX6A 2ZE6A 3AK2A 1YITV 2OCHA 4K8XA 1XBLA 2YI9A 3FB6C 3T2MA 3S3WA 2P22C 2Q7EA 1N34B 1Q81W 3UQ8A 4J41A 3VQYA 5CBGA 1N0NA 3SPCA 4I9QA 1VF5B 1SETA 5LMNO 1SF9A 4Z2WA 2EIMC 4JI2B 4PV1B 1EN5A 2VQFB 3U0ZA 4GKKO 3DXRB 1FYJA 1PV0A 3ZHSA 2PF4E 3EVKA 1OV9A 3T4DA 2JJ2G 1OJHA 4J9ZB 1YZBA 1Q82W 3WG7B 1B04A 1SZTA 3SYCA 4E4EA 1HNXO 3JAKA 2RJZA 1G8MA 5L3CA 4W4LA 4JI2O 3U10A 3SR2C 5B1BC 3SYOA 4L87A 1PKXA 3OEHG 4PD4F 1L0LH 3SJCC 4IHJA 5IWAB 4MSWC 1RFYA 1W2BU 2QWQB 2WLMA 1AI6A 3FYEB 4DK1A 1JR9A 1K34A 1OCCC 5C8YB 3H1KH 5EBLC 3CJHB 5KHIA 4YJ3A 1WLEA 4I5SA 4X8AA 3PJSK 5LHGA 2YDEA 2Z5UA 3ABMC 3ETQA 5LP6C 2HVKC 2DQ0A 1YDXA 2UUBB 4GZRB 3K79A 5DM6V 5CB4B 1BZKA 3L9DA 5EIBD 4J42A 3BEHA 2HFEC 5HFLA 3FX7A 3G6EV 4KP4A 2IH3C 4N21A 2Q67A 4LF6B 1H2SB 3LNMB 4FJCC 1XUQA 5B3SB 1CEZA 4ZBMA 3CPWU 3JATB 2UXDO 2DWEC 2B1IA 4J80A 1NTZH 5CMUA 2UUCB 1KP2A 3AG3C 4LFBB 1VF7A 5FLXN 3HR0A 2YS8A 1S76D 2ZXWB 1WA8A 3RBZA 1JFFB 4TUYB 3BVOA 3RFRA 4DV0B 2R72A 4X1IA 5LBQA 2Q68A 4KL1A 2EIJC 1KECA 5JCOA 3B4SA 3U11A 4IL6Z 2D2CB 4BIZA 4D6TH 1K73W 3CCEV 4DR6B 2UXNA 3RYFA 2KB1A 4X62O 3H01A 3RYHA 3FB5C 1NU1H 2ZT9B 2DOSA 4JTAB 3A0RA 2GBOA 5FNVA 3D3IA 1QLNA 2Q5ZA 1DF4A 1LR1A 2PY5A 3AG2C 2QDOA 4B3MB 1S77D 4U3JA 1AJPA 1WP7A 2W0FC 4UB6Z 3OM3B 4RAIA 4BR6A 1QNMA 1KD1W 1EZVH 4KUMA 1YI2V 3CCQV 3E86A 2IH1C 2LJ2A 3X2QC 3FKSG 3M99B 4JZGA 1H2NA 3BABA 2Y69B 5IYZA 4TSFG 5IWAO 3G6BA 1HW7A 3B77A 1XDCA 2AW9A 1WJZA 3HKBA 3N2KB 2W6IG 2P7TC 1RM1B 1RPOA 4I7ZB 3OTOB 4JI7B 2B5UA 5GONA 2W6JG 4XBFA 1XMOB 3ZMTA 4GCZA 3BY6A 1G1XB 3OUSA 4JI1O 2YI8A 3AG3B 2EX3A 3IFXA 2RN9A 3JD3A 4KFMA 5IT9N 4FLXA 1KP3A 3ZHRA 3QNEA 5KA6A 1UPGA 1CXZB 1R1BA 1M5IA 3HKEB 1VQ9V 1NKDA 4PA9A 3ASNB 2QTOA 3AG1C 3ABLB 4PI0A 4JI4B 4JI5B 1FXHA 1HNXB 3FD9A 1BS3A 4I4TB 4OX9B 4DV3B 4R50A 2RDCA 1N36O 3P30A 3F5TA 1GK9A 3MHSC 1AJNA 1NS1A 4IIJA 1KMIZ 5LHIA 4DK0A 2JGDB 4FZ1A 5JJEB 3MAQA 2EILC 3HKCB 5KMGB 2IU0A 2IJIA 2M7WA 5B1AB 2P90A 1H2MA 4MVZA 4YY3B 2FMLA 1O9HA 4TT3G 1IXMA 3ZBHA 1BQ0A 4O4IB 1R3JC 2FKXA 2VQEB 3ABUA 2X6CA 4WBNA 2IJJA 4JV5B 2ZINA 2QSAA 3BPZA 4Q6GA 4DV0O 2YXLA 1IBLB 2A7WA 2F43G 1TUBB 4O4JB 2VQFO 2PZSA 3OGIB 1HR0B 4DR5O 1RP3B 1CP9A 1JJ2U 1L8DA 1IBMB 3F5WC 2F23A 4NXNO 4L8JA 2A79B 3N2GA 2UXCO 3E8GA 1ORQC 3K57A 5HFMA 1MA1A 4FMTA 3WG7C 3OMNB 3JALA 2JEUA 3FAVB 1MOFA 1BQZA 4XDJA 1GM8A 2Y48A 4LCUC 5LGUA 3ZMUA 4R6ZA 4YHHB 2E5LB 2N05A 2CTWA 2ZCEA 1FAFA 1P7GA 5L3FA 5ITZB 3UM7A 1OCRB 4ZHQB 1QU7A 1FPOA 5B3SC 2F1MA 4LNUB 4FM2A 1AB3A 3E22A 4TV8A 2P4KA 4F6EA 2BTQB 5DECA 2M6YA 4LBEC 3K3WA 4F6RB 1VQLV 1N32O 2EILB 5BR8O 1R3IC 1FFXB 2R9RB 2YIDA 4UUJC 1BMFG 3OE7G 4KXRA 2YEVA 3CMEV 1K5SA 2JRIA 1BGYH 3LSQA 1QVGU 4DUZO 1NVPD 4BIOA 5JVDB 3CC4V 2Q7GA 4PHZA 2ITCC 3OTFA 3CRRA 4XDKA 2NLJC 5IJ0A 4NR1A 4CBCA 3SYAA 1S0VA 1WPXA 4LF4B 3T1HB 3RYCA 4LC1A 3APQA 5EYPB 1MSDA 2WLNA 4IYIA 4DUYO 2A9HA 3ZEDA 1I08A 2QM7A 5FPOA 3VOUA 1S5HC 5LOVA 3JARA 1E79G 3OGCC 3P32A 3W7WA 1K4DC 1WB7A 3STZC 5LA6A 3H1JH 2WLJA 1O9GA 4I55B 1YTFD 1B06A 4N23A 1K5QA 3WFVA 2O57A 4K0KB 3RYIA 1B6QA 5LYJB 4DR4O 3EXAA 3APOA 1ENVA 4FLTA 4LF9O 4DV6B 1LUVA 2ZM6O 3E35A 4FLZA 4DR2O 4DV5O 4DV5B 4WCEV 1GM9A 5TISZ 4YJ2A 4MTOA 4JAAA 4JYBA 2R9AA 1Q6IA 2QTSA 1GTOA 3ZMZA 1Q8IA 4RQFA 1Q3EA 1BHAA 3SJQC 1RSOB 1SA0A 5JCOC 5L3GA 3RW0A 4QNHB 3GWKC 1FJGB 3JAKB 1Q86W 3D36A 1JQ0A 1U96A 2QE7G 3VQXA 3OMAB 1NTKH 2N04A 1QCEA 3B8NA 5KAFZ 4AQYO 4U7NA 1QR9A 2E74B 3AG7A 5LMUO 4UVBA 4FZ0A 1KKCA 2UUAO 4GKJB 2LGQA 2R9IA 2EJRA 3CE2A 3LUTB 4YJ3B 3A0BZ 2UU9B 5CA0A 1K97A 4WFAV 2GTSA 2ZIOA 3TXSA 2JK5C 3ASNC 1QBZA 2FYUH 1G6UA 4LFCO 4OXSA 5EZYB 5CB4A 2E75B 1EFRG 1F51A 2ZD9A 4NXNB 4LF9B 2XASA 4F4LA 4WFGA 5IJ9A 2VRZA 1DLBA 2A0LA 4PDMA 2CGOA 2WLIB 3LDDA 5A9GA 1W0KG 3JAWA 4JV5O 2XAFA 4DW1A 3KKYA 2YIAA 3TETA 2DW4A 2DYRB 4DR7B 1F23A 2HR3A 5BY1A 1RM1C 4X65O 2XHBA 2JIZG 3CP1A 4NXMB 3RVYA 4BAYA 3OAAG 1QLEC 3UO2A 3HKDB 1M56B 2WA3A 1EM1A 4ZIBA 4DXWA 2E5LO 1AVMA 2YXYA 3VQWA 1LNQA 3EHBB 1Q43A 2EINC 3I56V 2Q0OC 3TJTA 1VARA 2ZR2A 3AG4C 3KCXA 4FPPA 4NYKA 4UV8A 2IW5A 2W0XA 3ZMSA 3E8FA 5JWPA 4NTYA 4DR6O 5GTHZ 2QWNB 4Z1VA 2QKCA 3K5NA 1QVFU 1OCOB 3UT5A 1I5XA 5E79Z 3CCJV 4JYCA 4CC6A 3PN1A 2ADPA 3ASOC 3J80N 3TXQA 4MVMA 1FFTB 1FD9A 4X20B 3RN4A 1OCRC 1VQPV 1MSWD 1M57C 2OIGA 2QA4V 1SQVH 2UU9O 2V4DA 4JAUA 1IX9A 4DV7B 4NTXA 2ITDC 1HWYA 2RNBA 1HNZO 3BAAA 3ETGA 1TVKA 1J5EO 4LF8O 3FB8C 4CS2A 3OTOO 4LF7O 2AHYA 2IJKA 2JS3A 5EBWC 5A2QN 5BMVB 4YIOA 1TA8A 4GX2A 1H8EG 2DWDC 4Q20A 4FLYA 4AI8A 3N2KA 1US6A 1D5AA 2JS5A 5KX5B 3VQVA 2QKAA 5GONB 1PL4A 3ZRXA 4ZOLB 5CN0A 2DN9A 1R6KA 4MVSA 1IVSA 2EZOA 1XQ8A 1ZL8A 1HDJA 1XMQB 1JX9A 2MK3A 1N4CA 3G67A 1GO3F 5CA1A 5JQGB 1JCHA 4LF4O 2KSDA 3ETEA 3WB1A 1PNKA 2X6AA 3EFFK 1YVWA 4B08A 1K92A 3QO5A 3CD6V 1EBOA 1NR7A 2H3OA 4J7KA 4D7TA 4IT5A 1IBKB 2XT9A 4HNAA 3AG4B 2JJ1G 3ZRSA 4O4HA 1FXKA 2HG5C 4NKGB 1XNRB 2Q7HA 3UO3A 5BZBA 4LWSA 5KHJA 2K1EA 2KKWA 4LP8A 2ARHA 4EFBA 1NZ6A 2V7QG 4O4LA 5LL6Y 2EBOA 5KLVH 1ZLZA 3B09A 3CB2A 3T1YB 1OCZB 2WPDG 3RT3C 1I0HA 4UCVA 1WAZA 4UCSA 3L70H 1GN3A 2QWRB 4UB8Z 5KAIZ 2AZ2A 1ZWIC 5EIBC 4MTGA 2QWOB 4EB6B 3JASA 1MABG 1EZJA 4O2AB 2WSSG 2ZR3A 5JH7A 3C3TA 2C2AA 4JAVA 4CZZA 3VBBA 3CHXA 1SQBH 4X64B 2OTJV 3W7TA 5J2TA 2NR5A 4NB5A 2DMXA 1VEWA 1NH2B 1NT2B 4JI6B 5IY5C 1LUWA 2UXXA 4MT8A 4HYOA 1J5EB 1VQ5V 4LF8B 1SC5B 2XAGA 4AQYB 2GTAA 1X4TA 3O65A 3IC9A 1KBHA 4P2ZA 5ITZA 1NI8A 5D5QA 1I94O 2K9PA 4PDRA 2YIBD 2WWWA 4DRXB 3J81N 3ZRWA 4MTXA 1L1FA 1Q6HA 4EKWA 2LW1A 2B9ZA 2XOKG 1V55C 3E83A 4HAMA 1Y4MA 2JVDA 2CTPA 5BR8B 1Q90D 4LFCB 5IE9A 4K8ZA 3K9AA 3SYPA 1K3EA 4DO2A 1QLEB 3W7UA 3T1YO 1S3JA 2GUZB 2PI4A 1I5YA 2WLLA 3JYCA 3ABMB 1FFXA 2Y0PA 4IHJB 4CH4A 3CCVV 5B1NA 2UUAB 2UUBO 3NR7A 2N74A 3ML0A 2UXCB 3ZMVA 1K4CC 5C8YA 2DJVA 4I0XA 5JVDA 1GMGA 1N8RW 3QTCA 2JEXA 3ZCCA 2BSKA 3CMAV 1NBMG 3Q4HB 1XL6A 1R3LC 1BE3H 1VQ4V 4ICGA 1W59A 2Q0AA 3OUFA 1SQQH 3RYCB 4XDLA 1B3QA 1FXVA 5JJNB 3ASOB 5EYPA 1GH6A 2F4VB 3L72H 3S3XA 4PDVA 4JI1B 1VMGA 1OHHG 2VWJA 5KHHA 1DGSA 3CRQA 3E8BA 2YICA 3ZJZA 2CH7B 5FPRA 3WB0A 3JATA 4FM0A 4CH5A 4JASA 2UXBO 3KCYA 3ABLC 4R7CA 4WFBV 1GM7A 3B8MA 3KG2A 2EIKB 1XILA 1KQSU 5LHHA 2KG7A 1ROPA 3RYIB 2ZE8A 4U7OA 1PNMA 2LFSA 2NNUA 2ZDIC 2Q6AA 2BCCH 2CTRA 2FL4A 1SQPH 1WA8B 1VQMV 5LP6A 1JFFA 1F4MA 3TK1A 1YEWA 4FFKA 1XI1A 3H9VA 2BOBC 4X1IB 1IZ3A 3D36C 3GB7C 2XTAA 1IBKO 4YXWG 3F7VC 1S72V 1GN6A 1Y76A 4PA7A 3DSQA 3OR7C 4IGGA 1I94B 2OCCC 1URFA 5J2UB 1KC8W 1COWG 3N27A 1IXBA 3BCCH 4LH6A 1RSOA 1SA0B 3OFNG 1YXBA 1JVMA 1S5LZ 2H8PC 2OTLV 4UVAA 3T1CA 1YHQV 4OPHA 4B3SO 2HKOA 4U3JB 1H8HG 5KHKA 4O2BB 1XHZA 4B7KA 1Y66A 2BE3A 2QM4A 3BA8A 4OGQB 1SQGA 5AG2A
chains in the Genus database with same CATH topology
3CXHF 3CX5F 1NU1H 1SQQH 1BCCH 4PD4F 1EZVH 3L71H 1L0LH 5KLVH 3H1HH 3TGUH 3H1LH 1KYOF 3H1IH 2A06H 3H1JH 1NTZH 3L72H 2IBZH 1P84F 1SQBH 1L0NH 1KB9F 1BGYH 1SQXH 3CWBH 1PPJH 1SQVH 2BCCH 3L74H 3L70H 4D6TH 3H1KH 4U3FH 1SQPH 1NTKH 1NTMH 1BE3H 1PP9H 3L73H 3L75H 2FYUH 3BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH F;  3CX5 F;  1NU1 H;  1SQQ H;  1BCC H;  4PD4 F;  1EZV H;  3L71 H;  1L0L H;  5KLV H;  3H1H H;  3TGU H;  3H1L H;  1KYO F;  3H1I H;  2A06 H;  3H1J H;  1NTZ H;  3L72 H;  2IBZ H;  1P84 F;  1SQB H;  1L0N H;  1KB9 F;  1BGY H;  1SQX H;  3CWB H;  1PPJ H;  1SQV H;  2BCC H;  3L74 H;  3L70 H;  4D6T H;  3H1K H;  4U3F H;  1SQP H;  1NTK H;  1NTM H;  1BE3 H;  1PP9 H;  3L73 H;  3L75 H;  2FYU H;  3BCC H; 
#chains in the Genus database with same CATH topology
 2G38 A;  2Q4P A;  1VQ7 V;  4HZ3 A;  4JYY A;  2FTK A;  5IYZ B;  5K1X A;  3M7M X;  5LGN A;  3ABK B;  1VIB A;  3DXR A;  1P84 F;  3SDL A;  3SYQ A;  5DN6 G;  1VQ8 V;  1YJ9 V;  3K59 A;  2AGA A;  3IJ4 A;  3BHP A;  1Y74 B;  1R3K C;  4JZ2 A;  4QGP A;  1AI7 A;  3CCM V;  5EZY A;  3G71 V;  4X89 A;  2ZQM A;  4QJF B;  4X66 O;  4JTC B;  5C93 A;  4I9W A;  3W7X A;  3CEI A;  1YJW V;  3AK1 A;  1EN6 A;  3CS5 A;  4LFB O;  2Y4U A;  5LGT A;  1NQT A;  3CC7 V;  1MZE A;  2HHH O;  2WLI A;  4DV1 B;  2Q73 A;  5F2V O;  2DYR C;  5DED A;  1TAE A;  4MW8 A;  2ZDI A;  4GLX A;  1SES A;  4X65 B;  3HKE A;  3LNN A;  3STL C;  3RWR D;  2CTQ A;  2PI5 A;  3ZN1 A;  1M93 A;  2BTO A;  4YHH O;  2E3C A;  4ABM A;  4A5U B;  3LSS A;  4IYH A;  2Y4T A;  1FXK C;  2DYS C;  4W4K A;  1U97 A;  4QPK A;  4P9O A;  4DW0 A;  3I5D A;  2JDI G;  1S5J A;  3HKD A;  4JI4 O;  1AJQ A;  3J7A U;  4IIJ B;  4TV9 B;  2Y0I A;  4WFE A;  1XMQ O;  1YCI A;  2YIB A;  3GVM A;  3CYO A;  1IUR A;  2QM8 A;  1AR4 A;  3CX5 F;  1UJW B;  1BCC H;  3CRA A;  2CGN A;  4JPR A;  5LXT A;  1SER A;  4JI0 O;  5CBH A;  3LSU A;  4J7Z A;  1M4U A;  2OWO A;  3AG2 B;  2Q9L A;  4O4I A;  4DV4 O;  4G28 B;  3UCS C;  1XHX A;  2ZNJ A;  4B7E A;  3UT5 B;  5BXZ A;  4WBN B;  1NTM H;  3IAY A;  1M1K W;  5JJJ B;  2UXB B;  3I55 V;  1J95 A;  1UFI A;  1JPX A;  1XNR O;  1TUB A;  4QPJ A;  4LH7 A;  1M9N A;  2IM9 A;  2MW2 B;  1Y6X A;  3ABK C;  4LF5 B;  1GN2 A;  4TQD A;  1Z5W A;  4TOI A;  4DYL A;  4EFE A;  2XAQ A;  5KA5 A;  4P30 A;  4EEQ A;  3K06 A;  3MD0 A;  3SPH A;  3N2G B;  4UCU A;  1PP9 H;  1X59 A;  2P67 A;  5EC1 C;  3OW2 U;  3K04 A;  2VS0 A;  1MNG A;  5FL7 G;  3H1I H;  4JI8 O;  1ZSP A;  2IBZ H;  4JI3 O;  3MDS A;  5B1A C;  1P4R A;  1PM9 A;  4DR5 B;  1MMM A;  3ZIA G;  2LFR A;  5L3B A;  4X1Y B;  2PYL A;  3K08 A;  4QE9 A;  2DQ3 A;  4FLW A;  4FVM A;  4FFB B;  3BRC A;  1QHT A;  1WN7 A;  2HJF C;  1TGO A;  2L35 A;  1AR5 A;  2HEP A;  3JAM N;  2PTM A;  4DR2 B;  4ASU G;  4CS4 A;  2Z0A A;  4UCT A;  2EIK C;  5H9C A;  1K8A W;  5CA1 B;  3SPG A;  3IC7 A;  2ZE7 A;  1GRJ A;  2ODM A;  3OD4 A;  3AEI A;  4P9P A;  1HNZ B;  1D5N A;  3SJB C;  3T1H O;  4MS2 A;  1AIL A;  1SRY A;  2YXH A;  4DR7 O;  3K9S A;  1N32 B;  5KHG A;  3HKB B;  4MVR A;  3CRC A;  2VWK A;  1N33 O;  1ZX3 A;  4O4H B;  1WNS A;  4LWS B;  3JD0 A;  4RUF A;  4MVQ A;  2ZM6 B;  2OYQ A;  2PYJ A;  3K5L A;  4JI5 O;  1XRE A;  4I50 A;  1H38 A;  4JTD B;  4RWU A;  1PL0 A;  2BOC C;  5D5P A;  5L3E A;  5IJ0 B;  2OIE A;  4UFZ A;  2Z3Y A;  1M90 W;  1DK1 A;  3GWO A;  2CAZ C;  3HB3 B;  2P06 A;  4GT1 A;  3THO A;  1V54 C;  1F7Y A;  3CC2 V;  1KB9 F;  4RUE A;  4WFH A;  2GV9 A;  1MZF A;  1RPR A;  4DUY B;  3KZI Z;  3DC6 A;  4X1K A;  3B2E E;  4O2A A;  4B3T O;  4ZI7 A;  2KQX A;  3AK3 A;  2HHH B;  1XL4 A;  1WB8 A;  4I55 A;  3R65 A;  4PJ0 Z;  1R73 A;  1SQF A;  4X64 O;  1EN4 A;  3JCU Z;  5H6Q A;  1K7D A;  2AHZ A;  3C90 A;  4K35 A;  3ZHV A;  1PPJ H;  3K5M A;  4YIP A;  2NN4 A;  4DV2 O;  5GTI Z;  4PI2 A;  1YTF B;  1Z2G A;  4TWK A;  2CK3 G;  1VQO V;  3LDE A;  2UUC O;  2AXT Z;  3SJA C;  4YJ2 B;  4GX5 A;  4GX1 A;  1HR0 O;  1ZTE A;  4DRX A;  3RVZ A;  2F95 B;  3ZRV A;  3P3P A;  4MW3 A;  2ETN A;  2IJH A;  2HP8 A;  1WP8 A;  5L3D A;  4AIL C;  4Z1M G;  3IGA C;  4CC5 A;  4OPA A;  3JAL B;  2RCV A;  4PA6 A;  2WLL B;  2QEX V;  4FIP C;  2B1G A;  2WLK A;  3X2Q B;  2F4V O;  1N34 O;  2CUG A;  1IBL O;  4ZHQ A;  1QR8 A;  3WU2 Z;  1N33 B;  4DR3 B;  4DV3 O;  2QGN A;  3E89 A;  4I0X B;  2ZE5 A;  4LNU A;  2ZNI A;  2BSK B;  4G27 B;  4KHP B;  3Q4H A;  2LO1 A;  4FM1 A;  3CWB H;  3E22 B;  1BSM A;  1VF6 C;  4TV8 B;  3DC5 A;  4QE7 A;  4TQF A;  3RGB A;  1N0J A;  2BTQ A;  2ZKO A;  4UCO A;  4PEL A;  1AP6 A;  5J9P C;  4UV9 A;  1D2D A;  3DTU B;  2CE4 A;  3L71 H;  3A2F A;  4CS3 A;  5IJ9 B;  3ZS8 C;  3CRM A;  5EK0 A;  5B1B B;  1Q6U A;  2YEV B;  4JI0 B;  4H13 B;  4OX9 O;  4LFA O;  1Y67 A;  4C7U A;  1GN4 A;  2Q8V A;  4JI7 O;  3CJH A;  2KG7 B;  5LMN B;  1R6N A;  2EIN B;  5E1A C;  2ADQ B;  1BHB A;  2WAM A;  3SPJ A;  2F66 C;  5CBF A;  1MG1 A;  3K5O A;  4DR1 B;  5LP6 B;  4DR1 O;  1XNQ O;  5H5N A;  4BWA A;  1GAX A;  1K33 A;  3L73 H;  4UXN A;  3H1L H;  3CXH F;  1BL8 A;  1TUE B;  4X62 B;  2QR4 A;  4MVO A;  3ABT A;  4LF7 B;  4DV1 O;  4BW9 A;  3F7Y C;  1W0J G;  3E2E A;  2IU3 A;  3BFR A;  1VQK V;  3CCR V;  5H2F Z;  3W7S A;  2DE0 X;  2RMK B;  3ETD A;  3K0G A;  5LYJ A;  5K1P A;  2QKS A;  1JOY A;  1VF6 A;  4LR3 A;  4FLU A;  2A3Q A;  4O2B A;  2EZP A;  4TUY A;  4CH3 A;  1YJN V;  3CXC U;  1VQ6 V;  3JD2 A;  3OR6 C;  4AHC A;  4K0K O;  1F4N A;  5IYC O;  4ZKI A;  3FFQ A;  4B3R O;  4JGS A;  3OT7 A;  1TVK B;  4FLV A;  4GYC B;  3K03 A;  3ZHT A;  2YSU B;  4GX0 A;  3D3Q A;  1SZX A;  3LDC A;  3RYF B;  5B5E Z;  3BA9 A;  3RYH B;  1YF2 A;  5IYD O;  2HVJ C;  2LQT A;  5FNV B;  1V54 B;  4BW5 A;  5KX5 A;  3SPI A;  1Y74 A;  1I7F A;  1V9P A;  4HBN A;  4ZOL A;  1HNW B;  2OT5 A;  4JF3 A;  1ZL8 B;  2ZIM A;  2X6B A;  2EIM B;  4PA3 A;  1SS3 A;  1KYO F;  4H44 B;  3K58 A;  1KUQ A;  1E1R G;  4DUZ B;  1M57 B;  1FKA O;  1NH2 D;  4B3R B;  2XAH A;  1DF5 A;  2HJD A;  3G80 A;  2FB5 A;  5CA0 B;  5LMU B;  3E8H A;  3OEE G;  4G2K A;  1AI5 A;  5EC2 C;  2WA4 A;  2XND G;  4D7S A;  1JMK C;  1P49 A;  2EUL A;  3JCZ A;  1A32 A;  5B66 Z;  5KUK A;  1BT8 A;  1FJG O;  4TV9 A;  4H37 A;  1Q7Y W;  5IDJ A;  4NTW A;  4UCR A;  4BIU A;  4FK5 C;  5EBM C;  1THZ A;  4MTF A;  2VQE O;  1P7B A;  2CDY A;  5LXT B;  3JD4 A;  4GKJ O;  1XMO O;  1YSC A;  3CSX A;  2UXD B;  4CH6 A;  1XEQ A;  3JAW B;  1DTO A;  4JI6 O;  2LP7 A;  4KHP O;  2QWP B;  1Z5V A;  3QO8 A;  3QVN A;  1G4Y B;  2JGU A;  4PA4 A;  4EB6 A;  1N36 B;  4I4T A;  3JD1 A;  3A8T A;  2JGD A;  5J2T B;  1ZAU A;  3MHH C;  3HKC A;  5KMG A;  4JI8 B;  2F93 B;  2ATK C;  3TCU A;  4LFA B;  1OZ0 A;  4WFF A;  3L74 H;  4DR3 O;  2HLD G;  1YIJ V;  3CCU V;  3CCS V;  1PNL A;  2Y69 C;  1R6T A;  1T5E A;  4GKK B;  5B1O A;  1OCZ C;  1CPY A;  4LF5 O;  3QO7 A;  3ZHQ A;  4X1Y A;  1L0N H;  4DV6 O;  4NXM O;  2P4V A;  1QQC A;  1KKD A;  4FFB A;  1NR1 A;  3ZHU A;  4O4J A;  3ZRW B;  4DR4 B;  2PGG A;  4X20 A;  1VP7 A;  2E76 B;  1Q5O A;  5KUM A;  4DV7 O;  1ARO P;  1OCO C;  3B40 A;  4RQE A;  2QJ1 A;  3OMI B;  4DV4 B;  1FS0 G;  2D3O W;  4DV2 B;  3A0H Z;  1KU9 A;  2EJ7 A;  3FAV A;  2YC0 A;  2LW7 A;  2V1D A;  5BMV A;  1WPB A;  2GUZ A;  5CA3 A;  4JYA O;  2ILM A;  4R8C A;  2X7R B;  5IY5 B;  3T4Z A;  2ZXW C;  1K9M W;  3JSL A;  1HP8 A;  1PD3 A;  4B3M O;  3AG1 B;  5IYB O;  4UVC A;  2GSM B;  4J11 A;  1GKF A;  1ZUQ A;  2A06 H;  2EIJ B;  4LF6 O;  2P6J A;  4I50 B;  3M8A A;  3HPL C;  3JSN A;  4U3F H;  4X9Q A;  4J10 A;  5JQG A;  1HNW O;  4NVP A;  1JJO A;  4PDL A;  4B3T B;  4F6R A;  1V55 B;  3R66 A;  1H2K A;  1H2L A;  1IBM O;  2WLH A;  1NVP B;  3D8C A;  2AZ0 A;  4WF9 V;  2CH7 A;  2LGW A;  1XNQ B;  4HNA B;  3O9O A;  3UKM A;  2L6L A;  4X1K B;  4X66 B;  1FXK B;  2DYS B;  5GW7 A;  4ZI7 B;  1H2G A;  3CCL V;  5H6R A;  3L75 H;  2Q69 A;  1XOU A;  4RO2 A;  4QIW F;  1AP5 A;  3QG5 A;  4X88 A;  2P5O A;  3SGI A;  1NJI W;  3FYI B;  2GDS A;  2PUS A;  3H1H H;  3TGU H;  1IDS A;  3DGE A;  4O4L B;  4JYA B;  2GHY A;  1M56 C;  4K3A A;  2X0L A;  1E1Q G;  4J9Y B;  4H0L B;  2OCC B;  1AR1 B;  4GUN A;  4MVU A;  1SQX H;  3P3N A;  1JA8 A;  2YUA A;  4E2L A;  3FB7 C;  2XUM A;  3QF7 A;  4H33 A;  3ZN0 A;  2H94 A;  1OCC B;  2XAJ A;  3G4S V;  3NXS A;  1Y76 B;  4J7J A;  3ICX A;  3C3S A;  3JAS B;  1SKV A;  2RQ6 A;  5LOV B;  3JAR B;  4B3S B;  5J2U A;  4YY3 O;  5JH7 B;  1AI4 A;  4JI3 B;  5LA6 B;  2R70 A;  1VQN V;  3K0D A;  3WB2 A;  3ZX6 A;  2ZE6 A;  3AK2 A;  1YIT V;  2OCH A;  4K8X A;  1XBL A;  2YI9 A;  3FB6 C;  3T2M A;  3S3W A;  2P22 C;  2Q7E A;  1N34 B;  1Q81 W;  3UQ8 A;  4J41 A;  3VQY A;  5CBG A;  1N0N A;  3SPC A;  4I9Q A;  1VF5 B;  1SET A;  5LMN O;  1SF9 A;  4Z2W A;  2EIM C;  4JI2 B;  4PV1 B;  1EN5 A;  2VQF B;  3U0Z A;  4GKK O;  3DXR B;  1FYJ A;  1PV0 A;  3ZHS A;  2PF4 E;  3EVK A;  1OV9 A;  3T4D A;  2JJ2 G;  1OJH A;  4J9Z B;  1YZB A;  1Q82 W;  3WG7 B;  1B04 A;  1SZT A;  3SYC A;  4E4E A;  1HNX O;  3JAK A;  2RJZ A;  1G8M A;  5L3C A;  4W4L A;  4JI2 O;  3U10 A;  3SR2 C;  5B1B C;  3SYO A;  4L87 A;  1PKX A;  3OEH G;  4PD4 F;  1L0L H;  3SJC C;  4IHJ A;  5IWA B;  4MSW C;  1RFY A;  1W2B U;  2QWQ B;  2WLM A;  1AI6 A;  3FYE B;  4DK1 A;  1JR9 A;  1K34 A;  1OCC C;  5C8Y B;  3H1K H;  5EBL C;  3CJH B;  5KHI A;  4YJ3 A;  1WLE A;  4I5S A;  4X8A A;  3PJS K;  5LHG A;  2YDE A;  2Z5U A;  3ABM C;  3ETQ A;  5LP6 C;  2HVK C;  2DQ0 A;  1YDX A;  2UUB B;  4GZR B;  3K79 A;  5DM6 V;  5CB4 B;  1BZK A;  3L9D A;  5EIB D;  4J42 A;  3BEH A;  2HFE C;  5HFL A;  3FX7 A;  3G6E V;  4KP4 A;  2IH3 C;  4N21 A;  2Q67 A;  4LF6 B;  1H2S B;  3LNM B;  4FJC C;  1XUQ A;  5B3S B;  1CEZ A;  4ZBM A;  3CPW U;  3JAT B;  2UXD O;  2DWE C;  2B1I A;  4J80 A;  1NTZ H;  5CMU A;  2UUC B;  1KP2 A;  3AG3 C;  4LFB B;  1VF7 A;  5FLX N;  3HR0 A;  2YS8 A;  1S76 D;  2ZXW B;  1WA8 A;  3RBZ A;  1JFF B;  4TUY B;  3BVO A;  3RFR A;  4DV0 B;  2R72 A;  4X1I A;  5LBQ A;  2Q68 A;  4KL1 A;  2EIJ C;  1KEC A;  5JCO A;  3B4S A;  3U11 A;  4IL6 Z;  2D2C B;  4BIZ A;  4D6T H;  1K73 W;  3CCE V;  4DR6 B;  2UXN A;  3RYF A;  2KB1 A;  4X62 O;  3H01 A;  3RYH A;  3FB5 C;  1NU1 H;  2ZT9 B;  2DOS A;  4JTA B;  3A0R A;  2GBO A;  5FNV A;  3D3I A;  1QLN A;  2Q5Z A;  1DF4 A;  1LR1 A;  2PY5 A;  3AG2 C;  2QDO A;  4B3M B;  1S77 D;  4U3J A;  1AJP A;  1WP7 A;  2W0F C;  4UB6 Z;  3OM3 B;  4RAI A;  4BR6 A;  1QNM A;  1KD1 W;  1EZV H;  4KUM A;  1YI2 V;  3CCQ V;  3E86 A;  2IH1 C;  2LJ2 A;  3X2Q C;  3FKS G;  3M99 B;  4JZG A;  1H2N A;  3BAB A;  2Y69 B;  5IYZ A;  4TSF G;  5IWA O;  3G6B A;  1HW7 A;  3B77 A;  1XDC A;  2AW9 A;  1WJZ A;  3HKB A;  3N2K B;  2W6I G;  2P7T C;  1RM1 B;  1RPO A;  4I7Z B;  3OTO B;  4JI7 B;  2B5U A;  5GON A;  2W6J G;  4XBF A;  1XMO B;  3ZMT A;  4GCZ A;  3BY6 A;  1G1X B;  3OUS A;  4JI1 O;  2YI8 A;  3AG3 B;  2EX3 A;  3IFX A;  2RN9 A;  3JD3 A;  4KFM A;  5IT9 N;  4FLX A;  1KP3 A;  3ZHR A;  3QNE A;  5KA6 A;  1UPG A;  1CXZ B;  1R1B A;  1M5I A;  3HKE B;  1VQ9 V;  1NKD A;  4PA9 A;  3ASN B;  2QTO A;  3AG1 C;  3ABL B;  4PI0 A;  4JI4 B;  4JI5 B;  1FXH A;  1HNX B;  3FD9 A;  1BS3 A;  4I4T B;  4OX9 B;  4DV3 B;  4R50 A;  2RDC A;  1N36 O;  3P30 A;  3F5T A;  1GK9 A;  3MHS C;  1AJN A;  1NS1 A;  4IIJ A;  1KMI Z;  5LHI A;  4DK0 A;  2JGD B;  4FZ1 A;  5JJE B;  3MAQ A;  2EIL C;  3HKC B;  5KMG B;  2IU0 A;  2IJI A;  2M7W A;  5B1A B;  2P90 A;  1H2M A;  4MVZ A;  4YY3 B;  2FML A;  1O9H A;  4TT3 G;  1IXM A;  3ZBH A;  1BQ0 A;  4O4I B;  1R3J C;  2FKX A;  2VQE B;  3ABU A;  2X6C A;  4WBN A;  2IJJ A;  4JV5 B;  2ZIN A;  2QSA A;  3BPZ A;  4Q6G A;  4DV0 O;  2YXL A;  1IBL B;  2A7W A;  2F43 G;  1TUB B;  4O4J B;  2VQF O;  2PZS A;  3OGI B;  1HR0 B;  4DR5 O;  1RP3 B;  1CP9 A;  1JJ2 U;  1L8D A;  1IBM B;  3F5W C;  2F23 A;  4NXN O;  4L8J A;  2A79 B;  3N2G A;  2UXC O;  3E8G A;  1ORQ C;  3K57 A;  5HFM A;  1MA1 A;  4FMT A;  3WG7 C;  3OMN B;  3JAL A;  2JEU A;  3FAV B;  1MOF A;  1BQZ A;  4XDJ A;  1GM8 A;  2Y48 A;  4LCU C;  5LGU A;  3ZMU A;  4R6Z A;  4YHH B;  2E5L B;  2N05 A;  2CTW A;  2ZCE A;  1FAF A;  1P7G A;  5L3F A;  5ITZ B;  3UM7 A;  1OCR B;  4ZHQ B;  1QU7 A;  1FPO A;  5B3S C;  2F1M A;  4LNU B;  4FM2 A;  1AB3 A;  3E22 A;  4TV8 A;  2P4K A;  4F6E A;  2BTQ B;  5DEC A;  2M6Y A;  4LBE C;  3K3W A;  4F6R B;  1VQL V;  1N32 O;  2EIL B;  5BR8 O;  1R3I C;  1FFX B;  2R9R B;  2YID A;  4UUJ C;  1BMF G;  3OE7 G;  4KXR A;  2YEV A;  3CME V;  1K5S A;  2JRI A;  1BGY H;  3LSQ A;  1QVG U;  4DUZ O;  1NVP D;  4BIO A;  5JVD B;  3CC4 V;  2Q7G A;  4PHZ A;  2ITC C;  3OTF A;  3CRR A;  4XDK A;  2NLJ C;  5IJ0 A;  4NR1 A;  4CBC A;  3SYA A;  1S0V A;  1WPX A;  4LF4 B;  3T1H B;  3RYC A;  4LC1 A;  3APQ A;  5EYP B;  1MSD A;  2WLN A;  4IYI A;  4DUY O;  2A9H A;  3ZED A;  1I08 A;  2QM7 A;  5FPO A;  3VOU A;  1S5H C;  5LOV A;  3JAR A;  1E79 G;  3OGC C;  3P32 A;  3W7W A;  1K4D C;  1WB7 A;  3STZ C;  5LA6 A;  3H1J H;  2WLJ A;  1O9G A;  4I55 B;  1YTF D;  1B06 A;  4N23 A;  1K5Q A;  3WFV A;  2O57 A;  4K0K B;  3RYI A;  1B6Q A;  5LYJ B;  4DR4 O;  3EXA A;  3APO A;  1ENV A;  4FLT A;  4LF9 O;  4DV6 B;  1LUV A;  2ZM6 O;  3E35 A;  4FLZ A;  4DR2 O;  4DV5 O;  4DV5 B;  4WCE V;  1GM9 A;  5TIS Z;  4YJ2 A;  4MTO A;  4JAA A;  4JYB A;  2R9A A;  1Q6I A;  2QTS A;  1GTO A;  3ZMZ A;  1Q8I A;  4RQF A;  1Q3E A;  1BHA A;  3SJQ C;  1RSO B;  1SA0 A;  5JCO C;  5L3G A;  3RW0 A;  4QNH B;  3GWK C;  1FJG B;  3JAK B;  1Q86 W;  3D36 A;  1JQ0 A;  1U96 A;  2QE7 G;  3VQX A;  3OMA B;  1NTK H;  2N04 A;  1QCE A;  3B8N A;  5KAF Z;  4AQY O;  4U7N A;  1QR9 A;  2E74 B;  3AG7 A;  5LMU O;  4UVB A;  4FZ0 A;  1KKC A;  2UUA O;  4GKJ B;  2LGQ A;  2R9I A;  2EJR A;  3CE2 A;  3LUT B;  4YJ3 B;  3A0B Z;  2UU9 B;  5CA0 A;  1K97 A;  4WFA V;  2GTS A;  2ZIO A;  3TXS A;  2JK5 C;  3ASN C;  1QBZ A;  2FYU H;  1G6U A;  4LFC O;  4OXS A;  5EZY B;  5CB4 A;  2E75 B;  1EFR G;  1F51 A;  2ZD9 A;  4NXN B;  4LF9 B;  2XAS A;  4F4L A;  4WFG A;  5IJ9 A;  2VRZ A;  1DLB A;  2A0L A;  4PDM A;  2CGO A;  2WLI B;  3LDD A;  5A9G A;  1W0K G;  3JAW A;  4JV5 O;  2XAF A;  4DW1 A;  3KKY A;  2YIA A;  3TET A;  2DW4 A;  2DYR B;  4DR7 B;  1F23 A;  2HR3 A;  5BY1 A;  1RM1 C;  4X65 O;  2XHB A;  2JIZ G;  3CP1 A;  4NXM B;  3RVY A;  4BAY A;  3OAA G;  1QLE C;  3UO2 A;  3HKD B;  1M56 B;  2WA3 A;  1EM1 A;  4ZIB A;  4DXW A;  2E5L O;  1AVM A;  2YXY A;  3VQW A;  1LNQ A;  3EHB B;  1Q43 A;  2EIN C;  3I56 V;  2Q0O C;  3TJT A;  1VAR A;  2ZR2 A;  3AG4 C;  3KCX A;  4FPP A;  4NYK A;  4UV8 A;  2IW5 A;  2W0X A;  3ZMS A;  3E8F A;  5JWP A;  4NTY A;  4DR6 O;  5GTH Z;  2QWN B;  4Z1V A;  2QKC A;  3K5N A;  1QVF U;  1OCO B;  3UT5 A;  1I5X A;  5E79 Z;  3CCJ V;  4JYC A;  4CC6 A;  3PN1 A;  2ADP A;  3ASO C;  3J80 N;  3TXQ A;  4MVM A;  1FFT B;  1FD9 A;  4X20 B;  3RN4 A;  1OCR C;  1VQP V;  1MSW D;  1M57 C;  2OIG A;  2QA4 V;  1SQV H;  2UU9 O;  2V4D A;  4JAU A;  1IX9 A;  4DV7 B;  4NTX A;  2ITD C;  1HWY A;  2RNB A;  1HNZ O;  3BAA A;  3ETG A;  1TVK A;  1J5E O;  4LF8 O;  3FB8 C;  4CS2 A;  3OTO O;  4LF7 O;  2AHY A;  2IJK A;  2JS3 A;  5EBW C;  5A2Q N;  5BMV B;  4YIO A;  1TA8 A;  4GX2 A;  1H8E G;  2DWD C;  4Q20 A;  4FLY A;  4AI8 A;  3N2K A;  1US6 A;  1D5A A;  2JS5 A;  5KX5 B;  3VQV A;  2QKA A;  5GON B;  1PL4 A;  3ZRX A;  4ZOL B;  5CN0 A;  2DN9 A;  1R6K A;  4MVS A;  1IVS A;  2EZO A;  1XQ8 A;  1ZL8 A;  1HDJ A;  1XMQ B;  1JX9 A;  2MK3 A;  1N4C A;  3G67 A;  1GO3 F;  5CA1 A;  5JQG B;  1JCH A;  4LF4 O;  2KSD A;  3ETE A;  3WB1 A;  1PNK A;  2X6A A;  3EFF K;  1YVW A;  4B08 A;  1K92 A;  3QO5 A;  3CD6 V;  1EBO A;  1NR7 A;  2H3O A;  4J7K A;  4D7T A;  4IT5 A;  1IBK B;  2XT9 A;  4HNA A;  3AG4 B;  2JJ1 G;  3ZRS A;  4O4H A;  1FXK A;  2HG5 C;  4NKG B;  1XNR B;  2Q7H A;  3UO3 A;  5BZB A;  4LWS A;  5KHJ A;  2K1E A;  2KKW A;  4LP8 A;  2ARH A;  4EFB A;  1NZ6 A;  2V7Q G;  4O4L A;  5LL6 Y;  2EBO A;  5KLV H;  1ZLZ A;  3B09 A;  3CB2 A;  3T1Y B;  1OCZ B;  2WPD G;  3RT3 C;  1I0H A;  4UCV A;  1WAZ A;  4UCS A;  3L70 H;  1GN3 A;  2QWR B;  4UB8 Z;  5KAI Z;  2AZ2 A;  1ZWI C;  5EIB C;  4MTG A;  2QWO B;  4EB6 B;  3JAS A;  1MAB G;  1EZJ A;  4O2A B;  2WSS G;  2ZR3 A;  5JH7 A;  3C3T A;  2C2A A;  4JAV A;  4CZZ A;  3VBB A;  3CHX A;  1SQB H;  4X64 B;  2OTJ V;  3W7T A;  5J2T A;  2NR5 A;  4NB5 A;  2DMX A;  1VEW A;  1NH2 B;  1NT2 B;  4JI6 B;  5IY5 C;  1LUW A;  2UXX A;  4MT8 A;  4HYO A;  1J5E B;  1VQ5 V;  4LF8 B;  1SC5 B;  2XAG A;  4AQY B;  2GTA A;  1X4T A;  3O65 A;  3IC9 A;  1KBH A;  4P2Z A;  5ITZ A;  1NI8 A;  5D5Q A;  1I94 O;  2K9P A;  4PDR A;  2YIB D;  2WWW A;  4DRX B;  3J81 N;  3ZRW A;  4MTX A;  1L1F A;  1Q6H A;  4EKW A;  2LW1 A;  2B9Z A;  2XOK G;  1V55 C;  3E83 A;  4HAM A;  1Y4M A;  2JVD A;  2CTP A;  5BR8 B;  1Q90 D;  4LFC B;  5IE9 A;  4K8Z A;  3K9A A;  3SYP A;  1K3E A;  4DO2 A;  1QLE B;  3W7U A;  3T1Y O;  1S3J A;  2GUZ B;  2PI4 A;  1I5Y A;  2WLL A;  3JYC A;  3ABM B;  1FFX A;  2Y0P A;  4IHJ B;  4CH4 A;  3CCV V;  5B1N A;  2UUA B;  2UUB O;  3NR7 A;  2N74 A;  3ML0 A;  2UXC B;  3ZMV A;  1K4C C;  5C8Y A;  2DJV A;  4I0X A;  5JVD A;  1GMG A;  1N8R W;  3QTC A;  2JEX A;  3ZCC A;  2BSK A;  3CMA V;  1NBM G;  3Q4H B;  1XL6 A;  1R3L C;  1BE3 H;  1VQ4 V;  4ICG A;  1W59 A;  2Q0A A;  3OUF A;  1SQQ H;  3RYC B;  4XDL A;  1B3Q A;  1FXV A;  5JJN B;  3ASO B;  5EYP A;  1GH6 A;  2F4V B;  3L72 H;  3S3X A;  4PDV A;  4JI1 B;  1VMG A;  1OHH G;  2VWJ A;  5KHH A;  1DGS A;  3CRQ A;  3E8B A;  2YIC A;  3ZJZ A;  2CH7 B;  5FPR A;  3WB0 A;  3JAT A;  4FM0 A;  4CH5 A;  4JAS A;  2UXB O;  3KCY A;  3ABL C;  4R7C A;  4WFB V;  1GM7 A;  3B8M A;  3KG2 A;  2EIK B;  1XIL A;  1KQS U;  5LHH A;  2KG7 A;  1ROP A;  3RYI B;  2ZE8 A;  4U7O A;  1PNM A;  2LFS A;  2NNU A;  2ZDI C;  2Q6A A;  2BCC H;  2CTR A;  2FL4 A;  1SQP H;  1WA8 B;  1VQM V;  5LP6 A;  1JFF A;  1F4M A;  3TK1 A;  1YEW A;  4FFK A;  1XI1 A;  3H9V A;  2BOB C;  4X1I B;  1IZ3 A;  3D36 C;  3GB7 C;  2XTA A;  1IBK O;  4YXW G;  3F7V C;  1S72 V;  1GN6 A;  1Y76 A;  4PA7 A;  3DSQ A;  3OR7 C;  4IGG A;  1I94 B;  2OCC C;  1URF A;  5J2U B;  1KC8 W;  1COW G;  3N27 A;  1IXB A;  3BCC H;  4LH6 A;  1RSO A;  1SA0 B;  3OFN G;  1YXB A;  1JVM A;  1S5L Z;  2H8P C;  2OTL V;  4UVA A;  3T1C A;  1YHQ V;  4OPH A;  4B3S O;  2HKO A;  4U3J B;  1H8H G;  5KHK A;  4O2B B;  1XHZ A;  4B7K A;  1Y66 A;  2BE3 A;  2QM4 A;  3BA8 A;  4OGQ B;  1SQG A;  5AG2 A; 
#chains in the Genus database with same CATH homology
 3CXH F;  3CX5 F;  1NU1 H;  1SQQ H;  1BCC H;  4PD4 F;  1EZV H;  3L71 H;  1L0L H;  5KLV H;  3H1H H;  3TGU H;  3H1L H;  1KYO F;  3H1I H;  2A06 H;  3H1J H;  1NTZ H;  3L72 H;  2IBZ H;  1P84 F;  1SQB H;  1L0N H;  1KB9 F;  1BGY H;  1SQX H;  3CWB H;  1PPJ H;  1SQV H;  2BCC H;  3L74 H;  3L70 H;  4D6T H;  3H1K H;  4U3F H;  1SQP H;  1NTK H;  1NTM H;  1BE3 H;  1PP9 H;  3L73 H;  3L75 H;  2FYU H;  3BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...