1SQBH

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqbH00
3H1KH 3L75H 1SQPH 3H1LH 3H1HH 1KYOF 3BCCH 1SQQH 2FYUH 4D6TH 1PPJH 1SQVH 1NU1H 1BGYH 3CX5F 2BCCH 1BCCH 3L73H 1L0NH 4U3FH 1PP9H 3L70H 3CWBH 1SQXH 1P84F 3L74H 3H1JH 3TGUH 1KB9F 2IBZH 3L72H 3CXHF 3L71H 1SQBH 1BE3H 1L0LH 1NTZH 1NTKH 3H1IH 2A06H 5KLVH 1NTMH 1EZVH 4PD4F
chains in the Genus database with same CATH superfamily
4NB5A 5JCOC 4JI6B 3HKCA 4Q20A 5KMGA 2HKOA 1EFRG 3QG5A 3K04A 5LOVA 2MK3A 2O57A 1MNGA 2GSMB 3JASB 3KZIZ 4WFBV 2K1EA 3L71H 1IBLB 2NN4A 2Q7EA 5C8YB 4NXMO 1Y67A 4TV9A 1G1XB 2UUBB 5CB4A 4LCUC 2HR3A 3B2EE 4GKJO 3WB2A 1N32B 2VQEB 2K9PA 1XNQB 2PYJA 1G6UA 4MVRA 2CE4A 1XMOO 2BSKA 4KFMA 2YS8A 3K9AA 4Z1MG 4MTFA 2GBOA 4QE7A 3DSQA 2UUCB 4LH7A 2Q6AA 3LNNA 1Y74A 2Q4PA 4H44B 3DXRB 2VS0A 1BGYH 3BY6A 5EC2C 3A0HZ 2XAGA 3P3PA 1M1KW 4QIWF 4RO2A 4X88A 1VQLV 1YVWA 4FPPA 5JJEB 4K8ZA 2PTMA 3WU2Z 2Q5ZA 3F5TA 5L3DA 3H1LH 2R9AA 5IJ9A 4DW0A 1OCRC 4ZOLB 4E2LA 2HEPA 4O2AB 1SS3A 2BTOA 3RYCB 1HNWO 3BA9A 4I5SA 2DYSC 1H2NA 1R73A 1YJNV 4DV0O 5B3SB 2CTRA 2P7TC 3U10A 3BABA 3OMAB 1JMKC 3EHBB 2E5LO 1PNLA 1JX9A 1TAEA 3ZHRA 4I0XA 4FLVA 3W7SA 3RYIB 4IL6Z 2Y48A 1L1FA 3T4DA 1B6QA 4PDMA 5DN6G 2AHZA 1K3EA 3SPCA 3JATA 2QE7G 3GWOA 4X65B 3QVNA 2AZ2A 1HW7A 2Y4TA 4GX2A 5LHIA 1RFYA 3HKBB 1T5EA 2MW2B 4PDLA 4BR6A 4B3RB 1Q86W 3CB2A 1XNRB 1XUQA 5B3SC 4B3SO 3G80A 3ASNC 2ZQMA 2FB5A 4JI1O 4X8AA 4CS4A 2P4KA 3KCYA 4DUYB 4LF7O 3L70H 1F4MA 1EN4A 1XL6A 5GW7A 1XHXA 1AROP 3CC7V 5LA6A 2Q7HA 5IYDO 4IIJB 2E76B 1R6KA 2HVKC 1XMQO 4UV8A 4O4JB 4UVAA 1N0NA 2R70A 2JS5A 2ZIMA 3H01A 1NJIW 3IJ4A 2DJVA 2W6JG 2YICA 5CBGA 1I7FA 1V54B 4FM2A 3K06A 4I55A 3ZN1A 4YIOA 1MG1A 1M9NA 4GKJB 1SQQH 3KKYA 4UCOA 5LL6Y 2Z3YA 2KSDA 4X1YA 4DRXA 3UQ8A 5L3CA 1HWYA 2CH7A 1IVSA 2YIBA 2QSAA 3OE7G 1TUEB 2KG7A 4Z2WA 4FLTA 3ICXA 4DV5B 5CMUA 4PA9A 3BHPA 4A5UB 3HPLC 1QHTA 5DEDA 4YY3B 5IT9N 3O65A 1NS1A 3ZBHA 4RUFA 4WFFA 1D5AA 3ZHTA 1RSOA 2JDIG 4TQFA 2QWOB 3JAKB 3ZCCA 4D7SA 1AJQA 2QA4V 4JAVA 4I0XB 4H33A 2HHHO 1QLEB 4K35A 1SQGA 5LMUO 3MD0A 1W0KG 4JYAO 1AR4A 1S3JA 4DR4B 1MSDA 4RUEA 3SJCC 3B8MA 4DV4O 2LP7A 3JATB 4J9YB 3SYOA 1HR0O 4LFCO 5JWPA 1VARA 3AG2B 4DV0B 2P22C 1F51A 1XILA 3WFVA 1YJ9V 3OMNB 2ZE6A 4UCSA 2UXBB 4I7ZB 1NTZH 4ZHQB 3D36A 5IYZB 3CRRA 1AJPA 5KHIA 4DR7O 1KYOF 3K3WA 4XDKA 2HVJC 1JQ0A 3CRQA 5LA6B 4DR2B 1OHHG 3BEHA 4L87A 5IYCO 1Q81W 5IWAO 4P9OA 5GONA 3L74H 1FFXA 2X6CA 4O4LA 4GKKB 3VQVA 2ZE5A 4U7NA 4X64O 4BW5A 1VP7A 1K5QA 2QM7A 4UFZA 1JCHA 1AILA 2R9RB 5LP6B 4I50A 1R3LC 2JGUA 3E8BA 1CEZA 4I55B 3OUSA 2FMLA 4HNAB 3CMAV 4IHJA 2YIBD 2CTPA 3CSXA 3ML0A 5GTIZ 1NR1A 2ITCC 4CS2A 4H13B 5K1PA 3LSQA 2N74A 4DRXB 3FX7A 1NTKH 4J41A 1HNXB 1KBHA 1G4YB 1K8AW 4I4TA 5J2UB 2B1IA 3E2EA 1N4CA 3CX5F 3AK2A 4RQFA 4ZIBA 4DV2O 2A0LA 2QWPB 4FFBA 2F4VO 2RCVA 1P84F 4O2BA 4UUJC 5B1AC 3K5NA 4WCEV 2VWJA 4MTGA 4JZ2A 4GX5A 4FMTA 1Q6UA 3ZEDA 1FXHA 4CH5A 3N2GA 5JH7A 3JD4A 5B1OA 1LUVA 4YJ3A 1CPYA 4CH4A 1X4TA 4MT8A 2BTQA 4JTDB 3VQYA 1E1RG 2Q68A 4X1IA 1F4NA 3A0RA 5FLXN 4LF9O 2DE0X 1SA0B 3OGIB 2EIKB 4EB6B 1SQPH 4JI0O 2HLDG 2Q8VA 3T1CA 3S3XA 4WFEA 4PHZA 1VQKV 3IC9A 4IYHA 2AGAA 4WF9V 3GB7C 4YJ2B 1M4UA 5EC1C 3HKEA 4LFBB 3SJBC 1D2DA 2HHHB 5IYBO 3HB3B 4JGSA 4B3MO 1HDJA 2P6JA 4DV4B 4O4IB 4W4LA 4ZI7A 1SZTA 2H8PC 3BCCH 4L8JA 1U97A 2ZXWB 3ABUA 4LFCB 4B7EA 4LF4B 2UXXA 3ZMVA 2EZPA 2A9HA 4DR5O 5D5PA 5EBWC 3MAQA 3KCXA 1R3JC 4HZ3A 4J42A 3KG2A 1FD9A 2A79B 3UKMA 3CCLV 4I50B 2UUAB 4DR7B 1YF2A 1IBLO 2RN9A 3D36C 1K92A 1RM1C 3RYHA 2UUBO 3ABMB 5IWAB 5EK0A 2L6LA 1N32O 2VQEO 1I0HA 1XNQO 4P2ZA 3MDSA 4TV8B 3TCUA 3JALA 1BE3H 3ABTA 4GUNA 2ZXWC 3SYAA 2E74B 3LDCA 3ETGA 3PJSK 4YHHB 2GDSA 1AI6A 2UUCO 2A7WA 2QTSA 1FKAO 3Q4HA 3N27A 1QLNA 1SESA 1VF5B 1OV9A 1P4RA 4YJ3B 4J7KA 1AP6A 4I9QA 2LJ2A 5J2TA 1BZKA 3EXAA 4X1IB 4MSWC 2QR4A 1IURA 2JEXA 1EN6A 2WLNA 4D6TH 1NH2D 1YTFD 2Q7GA 4DV1B 3A8TA 3CJHA 4UCVA 4FZ0A 2W0FC 4CH3A 3I55V 2ADPA 3CWBH 4FM1A 4DK0A 3RW0A 4G2KA 3J80N 4TSFG 1TGOA 1ZL8A 2IJKA 1AR5A 3E8HA 4BWAA 4TOIA 4CC6A 1TUBA 3T2MA 1SZXA 2EZOA 3I56V 1GMGA 1EBOA 5J9PC 4F6RA 5JVDA 1S5HC 4LF9B 4OPHA 1PP9H 1BSMA 3E8FA 3IC7A 1Y76A 1XOUA 3STLC 1THZA 1AI7A 4F4LA 1GK9A 4X65O 3E8GA 1H2KA 4AI8A 1H2LA 1IXMA 2D2CB 3ZMUA 4N21A 4UCRA 1IDSA 2FL4A 2R9IA 4O4HA 3AG4C 3G6EV 1XNRO 2GUZA 1TVKA 4DUYO 2AZ0A 2WA4A 1ZUQA 2GTAA 3ABLB 5IE9A 1EN5A 2F23A 5CA0A 2X6BA 3FKSG 1S5LZ 3H1HH 2YIAA 3B77A 3J81N 1BT8A 3FYEB 4DR5B 3OR6C 3K5LA 4U3JA 1L0NH 2CDYA 2PF4E 4KUMA 2L35A 4ABMA 1TA8A 3F5WC 1D5NA 4TUYB 3CEIA 5IY5C 1SF9A 3FD9A 3RYFB 1YITV 1UJWB 1S76D 1VF7A 4JYYA 3ABLC 1OCRB 2YC0A 1YDXA 4GYCB 5IJ0B 3LUTB 3O9OA 3CMEV 5KUMA 2DYSB 3L73H 4LFAB 5H6QA 4MVQA 3VBBA 2OCCC 4UCTA 3BRCA 4DV5O 2ZDIC 1QBZA 1VQ5V 2FYUH 5HFLA 5K1XA 4YY3O 2DYRC 1BMFG 5BR8O 1XDCA 3K08A 5JJNB 4X9QA 3SYCA 2DMXA 1NI8A 4JI8B 3CE2A 4DUZB 3DC6A 4FK5C 3FAVB 1W2BU 1H8HG 2A06H 5H9CA 2G38A 4JYBA 1L8DA 2WLIA 3TK1A 2HP8A 3ZRWB 3AG1B 3OAAG 4JI2B 4DR4O 2YEVA 3OEEG 1QU7A 4KXRA 5EZYB 1SC5B 1B04A 4U3FH 2R72A 4BW9A 3BVOA 2XOKG 2JGDA 3B8NA 2QM4A 1AJNA 2EIJB 3ASNB 3K03A 4O4HB 3VQXA 1NKDA 2V7QG 1NTMH 2UXBO 1VQ8V 2HG5C 4PA4A 1H2SB 2EINC 2F95B 1I08A 1O9HA 3UCSC 1Z5VA 1IBMB 2ZNJA 4UB8Z 3A0BZ 4TWKA 4DR2O 2ZINA 3HKCB 3AG1C 1GO3F 5KMGB 3QO8A 3TJTA 4IGGA 4GKKO 5LOVB 2ZR3A 4DR1O 1GN2A 4XDJA 1SQVH 3IFXA 2P5OA 2EIJC 1Z5WA 2ZT9B 3FFQA 3UO2A 3SPHA 4LF8B 1QVFU 4TV9B 2ARHA 1BL8A 3N2KA 5CB4B 1R3KC 2WLLA 3JAWA 2BSKB 4PD4F 1JPXA 3ETEA 2F1MA 1EM1A 2P67A 5FPRA 1HNXO 4FFKA 3IAYA 1OCCC 1JFFA 2X6AA 1W0JG 1VQ4V 2YI9A 3ZX6A 4B7KA 1H38A 3CC4V 1K97A 1U96A 2W6IG 4MTXA 2XNDG 1B06A 2AHYA 3CC2V 4WBNA 1QCEA 1Y74B 4K0KB 5LMNO 1OJHA 4PDVA 1EZVH 1R1BA 4JASA 2IU3A 3FB8C 1R3IC 3W7WA 3B4SA 2JJ2G 3LSSA 1QR8A 4PA6A 3JSLA 1Q90D 5L3EA 4H37A 2LQTA 1MZFA 5IJ9B 3U0ZA 3H9VA 2YEVB 4DV3B 3CHXA 4CS3A 1VQOV 4DV6B 4DYLA 2KB1A 3VOUA 2JGDB 1HNZB 4LF5O 5BR8B 2XAQA 3K57A 1SQXH 2P4VA 4LFBO 2YDEA 2Z5UA 4OGQB 5LXTA 1CP9A 5B66Z 1ZSPA 3E22A 3MHHC 4HBNA 4LF4O 3JD3A 4RAIA 1GN6A 1SETA 3ZMZA 4FLWA 1KP2A 4GX1A 4P9PA 2ZE7A 4J80A 3JD1A 5CA3A 2WWWA 2ZKOA 5ITZA 1GN3A 2UUAO 1QNMA 4KHPB 1QVGU 1M90W 4AQYB 1N34B 1S5JA 3JCZA 3D3IA 3JYCA 4NKGB 1BHAA 1Y66A 3ZMTA 4F6EA 2H94A 4AHCA 1MZEA 5KAIZ 2BOBC 4WFGA 3OEHG 5KLVH 4QJFB 4X62B 4DR1B 4FZ1A 5B1AB 2OCHA 1JR9A 1BQ0A 4YHHO 1OCZB 4Z1VA 5EBMC 1WPXA 3OD4A 2DWDC 4X66B 3JD0A 3ZHQA 2EIMC 4QE9A 4X1YB 1IZ3A 2CH7B 4LF6O 3APOA 2YSUB 5EIBD 2IH3C 4LP8A 1PPJH 2KG7B 1NU1H 3D8CA 3ZHVA 3CCEV 2QKAA 2DWEC 1ZAUA 4MW8A 1MMMA 4JAAA 2PGGA 3DC5A 3C3TA 3CS5A 4DV1O 3JSNA 5LMNB 1AI5A 3G67A 3A2FA 1PD3A 5BMVA 3OTOB 4PI2A 2M6YA 3JARA 1RSOB 4NYKA 3X2QC 3CCUV 2Y69C 1K5SA 2Q73A 1XREA 4JI3B 4U7OA 1OCZC 2CTWA 3AG3C 5KA6A 2PYLA 4UB6Z 2YXHA 1ZWIC 1DLBA 1KU9A 4OPAA 5A9GA 4Q6GA 3APQA 4IYIA 4J7ZA 4KP4A 4DR3B 1OZ0A 4UXNA 4XBFA 1I94B 4R7CA 5KX5A 4NVPA 2WAMA 2LGWA 3DGEA 1IBKB 1YI2V 1K33A 4FVMA 4TT3G 4LNUA 4CZZA 4LF5B 1S77D 2CTQA 2EJRA 4GZRB 1SERA 5CN0A 4X89A 2DW4A 1N33B 2IM9A 4GT1A 2JS3A 1O9GA 5EIBC 4E4EA 4BIZA 1P7BA 4PV1B 3RFRA 5ITZB 1RM1B 2LW7A 3SDLA 3W7UA 2ADQB 5CBFA 2HJFC 4DV7B 5TISZ 4MVMA 2ZM6B 1EZJA 5GONB 1FFXB 2IU0A 3LDEA 1GAXA 4O4LB 4LWSA 1DK1A 2QKCA 4MVSA 3SPGA 1JOYA 3K59A 3SYPA 3HR0A 3OMIB 5B1BB 4CBCA 3DTUB 2QWRB 3L9DA 2VWKA 4JAUA 4QNHB 1WP8A 3RWRD 1NR7A 3W7XA 1SRYA 3SPIA 1K4CC 4NTXA 4IHJB 2LO1A 4DXWA 2NR5A 2NLJC 3STZC 1BQZA 4I4TB 3T1HO 4FLYA 1PNKA 2YUAA 1H2MA 2WLMA 5LYJA 3TXQA 4NTYA 1FXKA 1VQPV 4BIOA 4YIPA 3UT5A 2UU9O 5B1NA 4IT5A 4FFBB 4X1KA 1WNSA 4LFAO 4O2BB 1P49A 2Q9LA 2RMKB 2JRIA 5B1BC 1GM8A 3IGAC 4LR3A 3ZS8C 2QTOA 4JV5B 4JI8O 3CCQV 3N2GB 5JH7B 1YXBA 1VQ9V 3JASA 4DUZO 3RN4A 4LF6B 2DN9A 2BTQB 2Q67A 4FLXA 1Y6XA 1WN7A 3CRMA 3FYIB 4JI2O 1Q3EA 2RDCA 4FJCC 2EX3A 4EEQA 4NXNO 4B08A 3E86A 3E89A 1V55B 3AG4B 3GVMA 3TXSA 1NVPD 1J5EB 1VF6A 1R6TA 4P30A 2BE3A 2WLJA 1QR9A 1NH2B 1YTFB 1M93A 1XL4A 3HKEB 4ZBMA 1WPBA 1NVPB 3ZHSA 4LBEC 1YJWV 1VMGA 1BCCH 1JA8A 2AW9A 1IBMO 1KKCA 2YXLA 3RVZA 1J95A 2OIGA 2IW5A 3THOA 1VQ7V 2GTSA 2X7RB 3DXRA 4ZI7B 2V1DA 3K9SA 5C93A 1AB3A 1KECA 1FAFA 5F2VO 2E75B 3JD2A 2ODMA 5BY1A 1V55C 3FB6C 5IY5B 4ZOLA 1AVMA 5H2FZ 1XQ8A 3WB1A 4O2AA 5FL7G 1WJZA 2H3OA 4LF8O 4G28B 1L0LH 1FXVA 5DECA 3RYHB 5KUKA 2VQFB 2XAJA 1F7YA 2LFSA 3K5MA 5LHGA 5KHHA 4RWUA 1SQFA 3JALB 4MVUA 5LYJB 1CXZB 5L3GA 2JJ1G 2OCCB 3RT3C 1BHBA 4MS2A 3RYIA 2X0LA 2DYRB 2UXNA 4QPJA 1AP5A 4LH6A 3WB0A 4K0KO 4BAYA 3PN1A 1GM9A 4X20A 3Q4HB 3ETDA 3HKBA 5IDJA 1YEWA 4OX9B 2IJIA 3SJQC 2YI8A 2EBOA 3T1HB 1K34A 5J2TB 3OFNG 2JIZG 4JI5O 2UU9B 4B3TB 2OTLV 1VEWA 1I5YA 1N36B 1FXKC 3L75H 4DV3O 3CJHB 2UXDB 1XEQA 1PL0A 4DV6O 5BZBA 1ORQC 1UPGA 4IIJA 1JJ2U 2ATKC 2BCCH 2ETNA 2ZIOA 1PL4A 5AG2A 4UVCA 3ABKB 4CC5A 1HNZO 4O4JA 1W59A 1ZL8B 2EINB 5A2QN 3M7MX 1AI4A 2N04A 4CH6A 2WSSG 1V9PA 2Y0PA 3UM7A 3ZRSA 1TUBB 5EBLC 3ZMSA 2QKSA 4F6RB 3RGBA 5JVDB 2EILB 3G6BA 2QEXV 2WPDG 1US6A 5EYPA 2JVDA 2NNUA 1Y76B 4NXNB 3CCRV 3CXCU 2ZNIA 3QTCA 1NT2B 2ZCEA 1PV0A 5B5EZ 1N0JA 2LFRA 3J7AU 1JVMA 1VF6C 5JJJB 4R50A 1XBLA 3ABKC 2GUZB 1RPOA 2Q0AA 2QWQB 1TVKB 1NBMG 4KL1A 1Q6IA 4KHPO 2B9ZA 1B3QA 1ROPA 3QNEA 4AQYO 3C3SA 2M7WA 2YXYA 4ICGA 2D3OW 1N34O 2ILMA 5CA0B 1OCCB 1GTOA 1SQBH 2EILC 3E35A 3JAKA 3K58A 2B1GA 1FYJA 4JI7B 1LR1A 4U3JB 2FKXA 2ZD9A 3EVKA 4X62O 4UVBA 1Q43A 1PM9A 3D3QA 4G27B 3RBZA 1COWG 4JZGA 4DR6B 1LNQA 4X20B 3BPZA 5LHHA 1MOFA 3CCSV 2LW1A 1NQTA 4ZKIA 3T4ZA 1FJGB 4X66O 3K0DA 2ZE8A 3M8AA 1E79G 2F93B 1SKVA 2HFEC 4MVOA 3ZRVA 1MA1A 1WLEA 4ZHQA 5IYZA 2IJJA 4JI4B 3JAMN 2C2AA 3FB7C 3LDDA 5E79Z 5KAFZ 3TETA 5KHGA 3OTOO 4JTAB 4WFHA 5JQGA 2KQXA 2DOSA 1KUQA 1K9MW 3SR2C 2PI4A 4QPKA 4JI3O 3ZIAG 3SPJA 2EULA 4UV9A 3F7YC 4LC1A 2HJDA 3RVYA 2WLIB 3BAAA 3OW2U 4JI5B 4NXMB 2WLHA 3K0GA 1KC8W 5LP6A 4TQDA 5EYPB 2QM8A 2LGQA 3QO5A 4FLUA 5E1AC 1P7GA 4DR3O 3ZRXA 4HNAA 4HYOA 1I94O 4JYCA 3NXSA 3CCVV 3LSUA 3UO3A 4DW1A 1IBKO 1XMOB 2P90A 2CGOA 1GH6A 3R65A 3MHSC 2N05A 1M56B 3R66A 1WP7A 5J2UA 1N33O 4FLZA 2YIDA 2QGNA 3AG7A 3CPWU 4K3AA 5KHJA 3FB5C 1YIJV 2P06A 3BFRA 1M57B 4DV7O 2KKWA 1ZX3A 4WFAV 1KP3A 2ZM6O 2Y4UA 4GX0A 1Q82W 2W0XA 1H8EG 2A3QA 2XASA 3F7VC 3C90A 1V54C 5D5QA 3H1JH 3L72H 3ASOB 4W4KA 5LGNA 2GV9A 3ZN0A 1IX9A 2Q69A 3OUFA 5BXZA 1RPRA 3AK1A 1M56C 2V4DA 2CAZC 1DTOA 1AR1B 2CUGA 2EIMB 1F23A 1HNWB 3N2KB 1SA0A 2WLLB 5FNVA 4EB6A 2OWOA 3JAWB 3P3NA 4PELA 3TGUH 1M57C 2XHBA 2E5LB 4YJ2A 1QQCA 1JFFB 3T1YO 5LGUA 1RP3B 3G4SV 1GM7A 1YZBA 4WBNB 3ZHUA 3ASOC 3NR7A 2F43G 2PI5A 1QLEC 4O4IA 3X2QB 2Y69B 3OT7A 3AG3B 1WA8A 5JQGB 4DK1A 2CGNA 1FFTB 3SGIA 1DGSA 1S72V 4R6ZA 4BIUA 4JV5O 3AG2C 4B3SB 4JI1B 3VQWA 4LF7B 4J11A 1MABG 1Q6HA 2Q0OC 2GHYA 3WG7B 1ZLZA 3CCMV 2XAFA 1KMIZ 4JTCB 1XMQB 1PKXA 2BOCC 3BA8A 4PA3A 1J5EO 3CYOA 4TV8A 5CA1A 4RQEA 2XT9A 4NR1A 1ENVA 4HAMA 3E83A 1XI1A 2XUMA 5LXTB 3AEIA 1BS3A 1PNMA 2WA3A 3E22B 5HFMA 2OTJV 2XAHA 5LP6C 3H1IH 2XTAA 1K73W 4K8XA 5FPOA 1VQNV 2QWNB 3WG7C 3S3WA 3QF7A 3G71V 1R6NA 3EFFK 1S0VA 1N8RW 3CP1A 3HKDA 4PA7A 5DM6V 2VRZA 4YXWG 1Q5OA 2B5UA 5H5NA 4EFBA 2Y0IA 1X59A 2JEUA 4PDRA 4D7TA 5FNVB 2UXCO 1XHZA 2Z0AA 3LNMB 4J7JA 2VQFO 3OTFA 3SJAC 1KD1W 3U11A 4JF3A 5LBQA 3K79A 5LMUB 2IBZH 3B40A 4JPRA 4JYAB 1WB8A 1FPOA 2ITDC 5JCOA 4OXSA 3CCJV 1DF4A 3H1KH 1HR0B 1E1QG 1HP8A 4MVZA 4N23A 1WA8B 4JI6O 3B09A 2PUSA 1DF5A 1MSWD 5KHKA 2EIKC 1JJOA 1GRJA 4OX9O 5LGTA 3CD6V 1KKDA 2PY5A 3T1YB 1NZ6A 4J10A 1IXBA 1Q7YW 2QJ1A 2RQ6A 5L3FA 2OIEA 4B3TO 4EKWA 5KA5A 1N36O 2OT5A 2UXDO 5BMVB 1VIBA 1Y4MA 3JARB 3SYQA 3GWKC 5CA1B 4I9WA 1WB7A 2ZDIA 4NTWA 4X64B 5CBHA 2WLKA 3AK3A 5C8YA 3I5DA 4TUYA 2ZR2A 3JCUZ 4R8CA 5KX5B 2EJ7A 1VQMV 1KQSU 1WAZA 1YHQV 3P30A 4LNUB 3RYFA 1K4DC 3M99B 4EFEA 3QO7A 4J9ZB 4GLXA 2E3CA 1OCOB 3ABMC 3CRAA 3HKDB 5IJ0A 4MTOA 3ZJZA 4DV2B 1I5XA 2QDOA 2CK3G 2F4VB 5GTHZ 3P32A 2DQ0A 1VQ6V 3CRCA 4PI0A 1G8MA 1GN4A 1KB9F 4FM0A 3CXHF 4LWSB 3W7TA 1LUWA 4JI7O 4H0LB 2F66C 4MW3A 4QGPA 3OGCC 3FAVA 1UFIA 4AILC 2AXTZ 3ZRWA 3OR7C 1GKFA 2IH1C 1OCOC 2RJZA 3OM3B 2FTKA 3K5OA 2OYQA 4FIPC 3RYCA 4DR6O 2UXCB 4JI0B 5EZYA 1ZTEA 1Q8IA 1FJGO 1Z2GA 5L3BA 2PZSA 4B3RO 1M5IA 1YSCA 4XDLA 1FXKB 2DQ3A 4C7UA 4ASUG 4GCZA 2IJHA 2JK5C 1FS0G 5H6RA 1H2GA 1YCIA 3UT5B 4DO2A 1A32A 4B3MB 2RNBA 4PJ0Z 1K7DA 4X1KB 4JI4O 4UCUA 1URFA 3ETQA
chains in the Genus database with same CATH topology
3H1KH 3L75H 1SQPH 3H1LH 3H1HH 1KYOF 3BCCH 1SQQH 2FYUH 4D6TH 1PPJH 1SQVH 1NU1H 1BGYH 3CX5F 2BCCH 1BCCH 3L73H 1L0NH 4U3FH 1PP9H 3L70H 3CWBH 1SQXH 1P84F 3L74H 3H1JH 3TGUH 1KB9F 2IBZH 3L72H 3CXHF 3L71H 1SQBH 1BE3H 1L0LH 1NTZH 1NTKH 3H1IH 2A06H 5KLVH 1NTMH 1EZVH 4PD4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K H;  3L75 H;  1SQP H;  3H1L H;  3H1H H;  1KYO F;  3BCC H;  1SQQ H;  2FYU H;  4D6T H;  1PPJ H;  1SQV H;  1NU1 H;  1BGY H;  3CX5 F;  2BCC H;  1BCC H;  3L73 H;  1L0N H;  4U3F H;  1PP9 H;  3L70 H;  3CWB H;  1SQX H;  1P84 F;  3L74 H;  3H1J H;  3TGU H;  1KB9 F;  2IBZ H;  3L72 H;  3CXH F;  3L71 H;  1SQB H;  1BE3 H;  1L0L H;  1NTZ H;  1NTK H;  3H1I H;  2A06 H;  5KLV H;  1NTM H;  1EZV H;  4PD4 F; 
#chains in the Genus database with same CATH topology
 4NB5 A;  5JCO C;  4JI6 B;  3HKC A;  4Q20 A;  5KMG A;  2HKO A;  1EFR G;  3QG5 A;  3K04 A;  5LOV A;  2MK3 A;  2O57 A;  1MNG A;  2GSM B;  3JAS B;  3KZI Z;  4WFB V;  2K1E A;  3L71 H;  1IBL B;  2NN4 A;  2Q7E A;  5C8Y B;  4NXM O;  1Y67 A;  4TV9 A;  1G1X B;  2UUB B;  5CB4 A;  4LCU C;  2HR3 A;  3B2E E;  4GKJ O;  3WB2 A;  1N32 B;  2VQE B;  2K9P A;  1XNQ B;  2PYJ A;  1G6U A;  4MVR A;  2CE4 A;  1XMO O;  2BSK A;  4KFM A;  2YS8 A;  3K9A A;  4Z1M G;  4MTF A;  2GBO A;  4QE7 A;  3DSQ A;  2UUC B;  4LH7 A;  2Q6A A;  3LNN A;  1Y74 A;  2Q4P A;  4H44 B;  3DXR B;  2VS0 A;  1BGY H;  3BY6 A;  5EC2 C;  3A0H Z;  2XAG A;  3P3P A;  1M1K W;  4QIW F;  4RO2 A;  4X88 A;  1VQL V;  1YVW A;  4FPP A;  5JJE B;  4K8Z A;  2PTM A;  3WU2 Z;  2Q5Z A;  3F5T A;  5L3D A;  3H1L H;  2R9A A;  5IJ9 A;  4DW0 A;  1OCR C;  4ZOL B;  4E2L A;  2HEP A;  4O2A B;  1SS3 A;  2BTO A;  3RYC B;  1HNW O;  3BA9 A;  4I5S A;  2DYS C;  1H2N A;  1R73 A;  1YJN V;  4DV0 O;  5B3S B;  2CTR A;  2P7T C;  3U10 A;  3BAB A;  3OMA B;  1JMK C;  3EHB B;  2E5L O;  1PNL A;  1JX9 A;  1TAE A;  3ZHR A;  4I0X A;  4FLV A;  3W7S A;  3RYI B;  4IL6 Z;  2Y48 A;  1L1F A;  3T4D A;  1B6Q A;  4PDM A;  5DN6 G;  2AHZ A;  1K3E A;  3SPC A;  3JAT A;  2QE7 G;  3GWO A;  4X65 B;  3QVN A;  2AZ2 A;  1HW7 A;  2Y4T A;  4GX2 A;  5LHI A;  1RFY A;  3HKB B;  1T5E A;  2MW2 B;  4PDL A;  4BR6 A;  4B3R B;  1Q86 W;  3CB2 A;  1XNR B;  1XUQ A;  5B3S C;  4B3S O;  3G80 A;  3ASN C;  2ZQM A;  2FB5 A;  4JI1 O;  4X8A A;  4CS4 A;  2P4K A;  3KCY A;  4DUY B;  4LF7 O;  3L70 H;  1F4M A;  1EN4 A;  1XL6 A;  5GW7 A;  1XHX A;  1ARO P;  3CC7 V;  5LA6 A;  2Q7H A;  5IYD O;  4IIJ B;  2E76 B;  1R6K A;  2HVK C;  1XMQ O;  4UV8 A;  4O4J B;  4UVA A;  1N0N A;  2R70 A;  2JS5 A;  2ZIM A;  3H01 A;  1NJI W;  3IJ4 A;  2DJV A;  2W6J G;  2YIC A;  5CBG A;  1I7F A;  1V54 B;  4FM2 A;  3K06 A;  4I55 A;  3ZN1 A;  4YIO A;  1MG1 A;  1M9N A;  4GKJ B;  1SQQ H;  3KKY A;  4UCO A;  5LL6 Y;  2Z3Y A;  2KSD A;  4X1Y A;  4DRX A;  3UQ8 A;  5L3C A;  1HWY A;  2CH7 A;  1IVS A;  2YIB A;  2QSA A;  3OE7 G;  1TUE B;  2KG7 A;  4Z2W A;  4FLT A;  3ICX A;  4DV5 B;  5CMU A;  4PA9 A;  3BHP A;  4A5U B;  3HPL C;  1QHT A;  5DED A;  4YY3 B;  5IT9 N;  3O65 A;  1NS1 A;  3ZBH A;  4RUF A;  4WFF A;  1D5A A;  3ZHT A;  1RSO A;  2JDI G;  4TQF A;  2QWO B;  3JAK B;  3ZCC A;  4D7S A;  1AJQ A;  2QA4 V;  4JAV A;  4I0X B;  4H33 A;  2HHH O;  1QLE B;  4K35 A;  1SQG A;  5LMU O;  3MD0 A;  1W0K G;  4JYA O;  1AR4 A;  1S3J A;  4DR4 B;  1MSD A;  4RUE A;  3SJC C;  3B8M A;  4DV4 O;  2LP7 A;  3JAT B;  4J9Y B;  3SYO A;  1HR0 O;  4LFC O;  5JWP A;  1VAR A;  3AG2 B;  4DV0 B;  2P22 C;  1F51 A;  1XIL A;  3WFV A;  1YJ9 V;  3OMN B;  2ZE6 A;  4UCS A;  2UXB B;  4I7Z B;  1NTZ H;  4ZHQ B;  3D36 A;  5IYZ B;  3CRR A;  1AJP A;  5KHI A;  4DR7 O;  1KYO F;  3K3W A;  4XDK A;  2HVJ C;  1JQ0 A;  3CRQ A;  5LA6 B;  4DR2 B;  1OHH G;  3BEH A;  4L87 A;  5IYC O;  1Q81 W;  5IWA O;  4P9O A;  5GON A;  3L74 H;  1FFX A;  2X6C A;  4O4L A;  4GKK B;  3VQV A;  2ZE5 A;  4U7N A;  4X64 O;  4BW5 A;  1VP7 A;  1K5Q A;  2QM7 A;  4UFZ A;  1JCH A;  1AIL A;  2R9R B;  5LP6 B;  4I50 A;  1R3L C;  2JGU A;  3E8B A;  1CEZ A;  4I55 B;  3OUS A;  2FML A;  4HNA B;  3CMA V;  4IHJ A;  2YIB D;  2CTP A;  3CSX A;  3ML0 A;  5GTI Z;  1NR1 A;  2ITC C;  4CS2 A;  4H13 B;  5K1P A;  3LSQ A;  2N74 A;  4DRX B;  3FX7 A;  1NTK H;  4J41 A;  1HNX B;  1KBH A;  1G4Y B;  1K8A W;  4I4T A;  5J2U B;  2B1I A;  3E2E A;  1N4C A;  3CX5 F;  3AK2 A;  4RQF A;  4ZIB A;  4DV2 O;  2A0L A;  2QWP B;  4FFB A;  2F4V O;  2RCV A;  1P84 F;  4O2B A;  4UUJ C;  5B1A C;  3K5N A;  4WCE V;  2VWJ A;  4MTG A;  4JZ2 A;  4GX5 A;  4FMT A;  1Q6U A;  3ZED A;  1FXH A;  4CH5 A;  3N2G A;  5JH7 A;  3JD4 A;  5B1O A;  1LUV A;  4YJ3 A;  1CPY A;  4CH4 A;  1X4T A;  4MT8 A;  2BTQ A;  4JTD B;  3VQY A;  1E1R G;  2Q68 A;  4X1I A;  1F4N A;  3A0R A;  5FLX N;  4LF9 O;  2DE0 X;  1SA0 B;  3OGI B;  2EIK B;  4EB6 B;  1SQP H;  4JI0 O;  2HLD G;  2Q8V A;  3T1C A;  3S3X A;  4WFE A;  4PHZ A;  1VQK V;  3IC9 A;  4IYH A;  2AGA A;  4WF9 V;  3GB7 C;  4YJ2 B;  1M4U A;  5EC1 C;  3HKE A;  4LFB B;  3SJB C;  1D2D A;  2HHH B;  5IYB O;  3HB3 B;  4JGS A;  4B3M O;  1HDJ A;  2P6J A;  4DV4 B;  4O4I B;  4W4L A;  4ZI7 A;  1SZT A;  2H8P C;  3BCC H;  4L8J A;  1U97 A;  2ZXW B;  3ABU A;  4LFC B;  4B7E A;  4LF4 B;  2UXX A;  3ZMV A;  2EZP A;  2A9H A;  4DR5 O;  5D5P A;  5EBW C;  3MAQ A;  3KCX A;  1R3J C;  4HZ3 A;  4J42 A;  3KG2 A;  1FD9 A;  2A79 B;  3UKM A;  3CCL V;  4I50 B;  2UUA B;  4DR7 B;  1YF2 A;  1IBL O;  2RN9 A;  3D36 C;  1K92 A;  1RM1 C;  3RYH A;  2UUB O;  3ABM B;  5IWA B;  5EK0 A;  2L6L A;  1N32 O;  2VQE O;  1I0H A;  1XNQ O;  4P2Z A;  3MDS A;  4TV8 B;  3TCU A;  3JAL A;  1BE3 H;  3ABT A;  4GUN A;  2ZXW C;  3SYA A;  2E74 B;  3LDC A;  3ETG A;  3PJS K;  4YHH B;  2GDS A;  1AI6 A;  2UUC O;  2A7W A;  2QTS A;  1FKA O;  3Q4H A;  3N27 A;  1QLN A;  1SES A;  1VF5 B;  1OV9 A;  1P4R A;  4YJ3 B;  4J7K A;  1AP6 A;  4I9Q A;  2LJ2 A;  5J2T A;  1BZK A;  3EXA A;  4X1I B;  4MSW C;  2QR4 A;  1IUR A;  2JEX A;  1EN6 A;  2WLN A;  4D6T H;  1NH2 D;  1YTF D;  2Q7G A;  4DV1 B;  3A8T A;  3CJH A;  4UCV A;  4FZ0 A;  2W0F C;  4CH3 A;  3I55 V;  2ADP A;  3CWB H;  4FM1 A;  4DK0 A;  3RW0 A;  4G2K A;  3J80 N;  4TSF G;  1TGO A;  1ZL8 A;  2IJK A;  1AR5 A;  3E8H A;  4BWA A;  4TOI A;  4CC6 A;  1TUB A;  3T2M A;  1SZX A;  2EZO A;  3I56 V;  1GMG A;  1EBO A;  5J9P C;  4F6R A;  5JVD A;  1S5H C;  4LF9 B;  4OPH A;  1PP9 H;  1BSM A;  3E8F A;  3IC7 A;  1Y76 A;  1XOU A;  3STL C;  1THZ A;  1AI7 A;  4F4L A;  1GK9 A;  4X65 O;  3E8G A;  1H2K A;  4AI8 A;  1H2L A;  1IXM A;  2D2C B;  3ZMU A;  4N21 A;  4UCR A;  1IDS A;  2FL4 A;  2R9I A;  4O4H A;  3AG4 C;  3G6E V;  1XNR O;  2GUZ A;  1TVK A;  4DUY O;  2AZ0 A;  2WA4 A;  1ZUQ A;  2GTA A;  3ABL B;  5IE9 A;  1EN5 A;  2F23 A;  5CA0 A;  2X6B A;  3FKS G;  1S5L Z;  3H1H H;  2YIA A;  3B77 A;  3J81 N;  1BT8 A;  3FYE B;  4DR5 B;  3OR6 C;  3K5L A;  4U3J A;  1L0N H;  2CDY A;  2PF4 E;  4KUM A;  2L35 A;  4ABM A;  1TA8 A;  3F5W C;  1D5N A;  4TUY B;  3CEI A;  5IY5 C;  1SF9 A;  3FD9 A;  3RYF B;  1YIT V;  1UJW B;  1S76 D;  1VF7 A;  4JYY A;  3ABL C;  1OCR B;  2YC0 A;  1YDX A;  4GYC B;  5IJ0 B;  3LUT B;  3O9O A;  3CME V;  5KUM A;  2DYS B;  3L73 H;  4LFA B;  5H6Q A;  4MVQ A;  3VBB A;  2OCC C;  4UCT A;  3BRC A;  4DV5 O;  2ZDI C;  1QBZ A;  1VQ5 V;  2FYU H;  5HFL A;  5K1X A;  4YY3 O;  2DYR C;  1BMF G;  5BR8 O;  1XDC A;  3K08 A;  5JJN B;  4X9Q A;  3SYC A;  2DMX A;  1NI8 A;  4JI8 B;  3CE2 A;  4DUZ B;  3DC6 A;  4FK5 C;  3FAV B;  1W2B U;  1H8H G;  2A06 H;  5H9C A;  2G38 A;  4JYB A;  1L8D A;  2WLI A;  3TK1 A;  2HP8 A;  3ZRW B;  3AG1 B;  3OAA G;  4JI2 B;  4DR4 O;  2YEV A;  3OEE G;  1QU7 A;  4KXR A;  5EZY B;  1SC5 B;  1B04 A;  4U3F H;  2R72 A;  4BW9 A;  3BVO A;  2XOK G;  2JGD A;  3B8N A;  2QM4 A;  1AJN A;  2EIJ B;  3ASN B;  3K03 A;  4O4H B;  3VQX A;  1NKD A;  2V7Q G;  1NTM H;  2UXB O;  1VQ8 V;  2HG5 C;  4PA4 A;  1H2S B;  2EIN C;  2F95 B;  1I08 A;  1O9H A;  3UCS C;  1Z5V A;  1IBM B;  2ZNJ A;  4UB8 Z;  3A0B Z;  4TWK A;  4DR2 O;  2ZIN A;  3HKC B;  3AG1 C;  1GO3 F;  5KMG B;  3QO8 A;  3TJT A;  4IGG A;  4GKK O;  5LOV B;  2ZR3 A;  4DR1 O;  1GN2 A;  4XDJ A;  1SQV H;  3IFX A;  2P5O A;  2EIJ C;  1Z5W A;  2ZT9 B;  3FFQ A;  3UO2 A;  3SPH A;  4LF8 B;  1QVF U;  4TV9 B;  2ARH A;  1BL8 A;  3N2K A;  5CB4 B;  1R3K C;  2WLL A;  3JAW A;  2BSK B;  4PD4 F;  1JPX A;  3ETE A;  2F1M A;  1EM1 A;  2P67 A;  5FPR A;  1HNX O;  4FFK A;  3IAY A;  1OCC C;  1JFF A;  2X6A A;  1W0J G;  1VQ4 V;  2YI9 A;  3ZX6 A;  4B7K A;  1H38 A;  3CC4 V;  1K97 A;  1U96 A;  2W6I G;  4MTX A;  2XND G;  1B06 A;  2AHY A;  3CC2 V;  4WBN A;  1QCE A;  1Y74 B;  4K0K B;  5LMN O;  1OJH A;  4PDV A;  1EZV H;  1R1B A;  4JAS A;  2IU3 A;  3FB8 C;  1R3I C;  3W7W A;  3B4S A;  2JJ2 G;  3LSS A;  1QR8 A;  4PA6 A;  3JSL A;  1Q90 D;  5L3E A;  4H37 A;  2LQT A;  1MZF A;  5IJ9 B;  3U0Z A;  3H9V A;  2YEV B;  4DV3 B;  3CHX A;  4CS3 A;  1VQO V;  4DV6 B;  4DYL A;  2KB1 A;  3VOU A;  2JGD B;  1HNZ B;  4LF5 O;  5BR8 B;  2XAQ A;  3K57 A;  1SQX H;  2P4V A;  4LFB O;  2YDE A;  2Z5U A;  4OGQ B;  5LXT A;  1CP9 A;  5B66 Z;  1ZSP A;  3E22 A;  3MHH C;  4HBN A;  4LF4 O;  3JD3 A;  4RAI A;  1GN6 A;  1SET A;  3ZMZ A;  4FLW A;  1KP2 A;  4GX1 A;  4P9P A;  2ZE7 A;  4J80 A;  3JD1 A;  5CA3 A;  2WWW A;  2ZKO A;  5ITZ A;  1GN3 A;  2UUA O;  1QNM A;  4KHP B;  1QVG U;  1M90 W;  4AQY B;  1N34 B;  1S5J A;  3JCZ A;  3D3I A;  3JYC A;  4NKG B;  1BHA A;  1Y66 A;  3ZMT A;  4F6E A;  2H94 A;  4AHC A;  1MZE A;  5KAI Z;  2BOB C;  4WFG A;  3OEH G;  5KLV H;  4QJF B;  4X62 B;  4DR1 B;  4FZ1 A;  5B1A B;  2OCH A;  1JR9 A;  1BQ0 A;  4YHH O;  1OCZ B;  4Z1V A;  5EBM C;  1WPX A;  3OD4 A;  2DWD C;  4X66 B;  3JD0 A;  3ZHQ A;  2EIM C;  4QE9 A;  4X1Y B;  1IZ3 A;  2CH7 B;  4LF6 O;  3APO A;  2YSU B;  5EIB D;  2IH3 C;  4LP8 A;  1PPJ H;  2KG7 B;  1NU1 H;  3D8C A;  3ZHV A;  3CCE V;  2QKA A;  2DWE C;  1ZAU A;  4MW8 A;  1MMM A;  4JAA A;  2PGG A;  3DC5 A;  3C3T A;  3CS5 A;  4DV1 O;  3JSN A;  5LMN B;  1AI5 A;  3G67 A;  3A2F A;  1PD3 A;  5BMV A;  3OTO B;  4PI2 A;  2M6Y A;  3JAR A;  1RSO B;  4NYK A;  3X2Q C;  3CCU V;  2Y69 C;  1K5S A;  2Q73 A;  1XRE A;  4JI3 B;  4U7O A;  1OCZ C;  2CTW A;  3AG3 C;  5KA6 A;  2PYL A;  4UB6 Z;  2YXH A;  1ZWI C;  1DLB A;  1KU9 A;  4OPA A;  5A9G A;  4Q6G A;  3APQ A;  4IYI A;  4J7Z A;  4KP4 A;  4DR3 B;  1OZ0 A;  4UXN A;  4XBF A;  1I94 B;  4R7C A;  5KX5 A;  4NVP A;  2WAM A;  2LGW A;  3DGE A;  1IBK B;  1YI2 V;  1K33 A;  4FVM A;  4TT3 G;  4LNU A;  4CZZ A;  4LF5 B;  1S77 D;  2CTQ A;  2EJR A;  4GZR B;  1SER A;  5CN0 A;  4X89 A;  2DW4 A;  1N33 B;  2IM9 A;  4GT1 A;  2JS3 A;  1O9G A;  5EIB C;  4E4E A;  4BIZ A;  1P7B A;  4PV1 B;  3RFR A;  5ITZ B;  1RM1 B;  2LW7 A;  3SDL A;  3W7U A;  2ADQ B;  5CBF A;  2HJF C;  4DV7 B;  5TIS Z;  4MVM A;  2ZM6 B;  1EZJ A;  5GON B;  1FFX B;  2IU0 A;  3LDE A;  1GAX A;  4O4L B;  4LWS A;  1DK1 A;  2QKC A;  4MVS A;  3SPG A;  1JOY A;  3K59 A;  3SYP A;  3HR0 A;  3OMI B;  5B1B B;  4CBC A;  3DTU B;  2QWR B;  3L9D A;  2VWK A;  4JAU A;  4QNH B;  1WP8 A;  3RWR D;  1NR7 A;  3W7X A;  1SRY A;  3SPI A;  1K4C C;  4NTX A;  4IHJ B;  2LO1 A;  4DXW A;  2NR5 A;  2NLJ C;  3STZ C;  1BQZ A;  4I4T B;  3T1H O;  4FLY A;  1PNK A;  2YUA A;  1H2M A;  2WLM A;  5LYJ A;  3TXQ A;  4NTY A;  1FXK A;  1VQP V;  4BIO A;  4YIP A;  3UT5 A;  2UU9 O;  5B1N A;  4IT5 A;  4FFB B;  4X1K A;  1WNS A;  4LFA O;  4O2B B;  1P49 A;  2Q9L A;  2RMK B;  2JRI A;  5B1B C;  1GM8 A;  3IGA C;  4LR3 A;  3ZS8 C;  2QTO A;  4JV5 B;  4JI8 O;  3CCQ V;  3N2G B;  5JH7 B;  1YXB A;  1VQ9 V;  3JAS A;  4DUZ O;  3RN4 A;  4LF6 B;  2DN9 A;  2BTQ B;  2Q67 A;  4FLX A;  1Y6X A;  1WN7 A;  3CRM A;  3FYI B;  4JI2 O;  1Q3E A;  2RDC A;  4FJC C;  2EX3 A;  4EEQ A;  4NXN O;  4B08 A;  3E86 A;  3E89 A;  1V55 B;  3AG4 B;  3GVM A;  3TXS A;  1NVP D;  1J5E B;  1VF6 A;  1R6T A;  4P30 A;  2BE3 A;  2WLJ A;  1QR9 A;  1NH2 B;  1YTF B;  1M93 A;  1XL4 A;  3HKE B;  4ZBM A;  1WPB A;  1NVP B;  3ZHS A;  4LBE C;  1YJW V;  1VMG A;  1BCC H;  1JA8 A;  2AW9 A;  1IBM O;  1KKC A;  2YXL A;  3RVZ A;  1J95 A;  2OIG A;  2IW5 A;  3THO A;  1VQ7 V;  2GTS A;  2X7R B;  3DXR A;  4ZI7 B;  2V1D A;  3K9S A;  5C93 A;  1AB3 A;  1KEC A;  1FAF A;  5F2V O;  2E75 B;  3JD2 A;  2ODM A;  5BY1 A;  1V55 C;  3FB6 C;  5IY5 B;  4ZOL A;  1AVM A;  5H2F Z;  1XQ8 A;  3WB1 A;  4O2A A;  5FL7 G;  1WJZ A;  2H3O A;  4LF8 O;  4G28 B;  1L0L H;  1FXV A;  5DEC A;  3RYH B;  5KUK A;  2VQF B;  2XAJ A;  1F7Y A;  2LFS A;  3K5M A;  5LHG A;  5KHH A;  4RWU A;  1SQF A;  3JAL B;  4MVU A;  5LYJ B;  1CXZ B;  5L3G A;  2JJ1 G;  2OCC B;  3RT3 C;  1BHB A;  4MS2 A;  3RYI A;  2X0L A;  2DYR B;  2UXN A;  4QPJ A;  1AP5 A;  4LH6 A;  3WB0 A;  4K0K O;  4BAY A;  3PN1 A;  1GM9 A;  4X20 A;  3Q4H B;  3ETD A;  3HKB A;  5IDJ A;  1YEW A;  4OX9 B;  2IJI A;  3SJQ C;  2YI8 A;  2EBO A;  3T1H B;  1K34 A;  5J2T B;  3OFN G;  2JIZ G;  4JI5 O;  2UU9 B;  4B3T B;  2OTL V;  1VEW A;  1I5Y A;  1N36 B;  1FXK C;  3L75 H;  4DV3 O;  3CJH B;  2UXD B;  1XEQ A;  1PL0 A;  4DV6 O;  5BZB A;  1ORQ C;  1UPG A;  4IIJ A;  1JJ2 U;  2ATK C;  2BCC H;  2ETN A;  2ZIO A;  1PL4 A;  5AG2 A;  4UVC A;  3ABK B;  4CC5 A;  1HNZ O;  4O4J A;  1W59 A;  1ZL8 B;  2EIN B;  5A2Q N;  3M7M X;  1AI4 A;  2N04 A;  4CH6 A;  2WSS G;  1V9P A;  2Y0P A;  3UM7 A;  3ZRS A;  1TUB B;  5EBL C;  3ZMS A;  2QKS A;  4F6R B;  3RGB A;  5JVD B;  2EIL B;  3G6B A;  2QEX V;  2WPD G;  1US6 A;  5EYP A;  2JVD A;  2NNU A;  1Y76 B;  4NXN B;  3CCR V;  3CXC U;  2ZNI A;  3QTC A;  1NT2 B;  2ZCE A;  1PV0 A;  5B5E Z;  1N0J A;  2LFR A;  3J7A U;  1JVM A;  1VF6 C;  5JJJ B;  4R50 A;  1XBL A;  3ABK C;  2GUZ B;  1RPO A;  2Q0A A;  2QWQ B;  1TVK B;  1NBM G;  4KL1 A;  1Q6I A;  4KHP O;  2B9Z A;  1B3Q A;  1ROP A;  3QNE A;  4AQY O;  3C3S A;  2M7W A;  2YXY A;  4ICG A;  2D3O W;  1N34 O;  2ILM A;  5CA0 B;  1OCC B;  1GTO A;  1SQB H;  2EIL C;  3E35 A;  3JAK A;  3K58 A;  2B1G A;  1FYJ A;  4JI7 B;  1LR1 A;  4U3J B;  2FKX A;  2ZD9 A;  3EVK A;  4X62 O;  4UVB A;  1Q43 A;  1PM9 A;  3D3Q A;  4G27 B;  3RBZ A;  1COW G;  4JZG A;  4DR6 B;  1LNQ A;  4X20 B;  3BPZ A;  5LHH A;  1MOF A;  3CCS V;  2LW1 A;  1NQT A;  4ZKI A;  3T4Z A;  1FJG B;  4X66 O;  3K0D A;  2ZE8 A;  3M8A A;  1E79 G;  2F93 B;  1SKV A;  2HFE C;  4MVO A;  3ZRV A;  1MA1 A;  1WLE A;  4ZHQ A;  5IYZ A;  2IJJ A;  4JI4 B;  3JAM N;  2C2A A;  3FB7 C;  3LDD A;  5E79 Z;  5KAF Z;  3TET A;  5KHG A;  3OTO O;  4JTA B;  4WFH A;  5JQG A;  2KQX A;  2DOS A;  1KUQ A;  1K9M W;  3SR2 C;  2PI4 A;  4QPK A;  4JI3 O;  3ZIA G;  3SPJ A;  2EUL A;  4UV9 A;  3F7Y C;  4LC1 A;  2HJD A;  3RVY A;  2WLI B;  3BAA A;  3OW2 U;  4JI5 B;  4NXM B;  2WLH A;  3K0G A;  1KC8 W;  5LP6 A;  4TQD A;  5EYP B;  2QM8 A;  2LGQ A;  3QO5 A;  4FLU A;  5E1A C;  1P7G A;  4DR3 O;  3ZRX A;  4HNA A;  4HYO A;  1I94 O;  4JYC A;  3NXS A;  3CCV V;  3LSU A;  3UO3 A;  4DW1 A;  1IBK O;  1XMO B;  2P90 A;  2CGO A;  1GH6 A;  3R65 A;  3MHS C;  2N05 A;  1M56 B;  3R66 A;  1WP7 A;  5J2U A;  1N33 O;  4FLZ A;  2YID A;  2QGN A;  3AG7 A;  3CPW U;  4K3A A;  5KHJ A;  3FB5 C;  1YIJ V;  2P06 A;  3BFR A;  1M57 B;  4DV7 O;  2KKW A;  1ZX3 A;  4WFA V;  1KP3 A;  2ZM6 O;  2Y4U A;  4GX0 A;  1Q82 W;  2W0X A;  1H8E G;  2A3Q A;  2XAS A;  3F7V C;  3C90 A;  1V54 C;  5D5Q A;  3H1J H;  3L72 H;  3ASO B;  4W4K A;  5LGN A;  2GV9 A;  3ZN0 A;  1IX9 A;  2Q69 A;  3OUF A;  5BXZ A;  1RPR A;  3AK1 A;  1M56 C;  2V4D A;  2CAZ C;  1DTO A;  1AR1 B;  2CUG A;  2EIM B;  1F23 A;  1HNW B;  3N2K B;  1SA0 A;  2WLL B;  5FNV A;  4EB6 A;  2OWO A;  3JAW B;  3P3N A;  4PEL A;  3TGU H;  1M57 C;  2XHB A;  2E5L B;  4YJ2 A;  1QQC A;  1JFF B;  3T1Y O;  5LGU A;  1RP3 B;  3G4S V;  1GM7 A;  1YZB A;  4WBN B;  3ZHU A;  3ASO C;  3NR7 A;  2F43 G;  2PI5 A;  1QLE C;  4O4I A;  3X2Q B;  2Y69 B;  3OT7 A;  3AG3 B;  1WA8 A;  5JQG B;  4DK1 A;  2CGN A;  1FFT B;  3SGI A;  1DGS A;  1S72 V;  4R6Z A;  4BIU A;  4JV5 O;  3AG2 C;  4B3S B;  4JI1 B;  3VQW A;  4LF7 B;  4J11 A;  1MAB G;  1Q6H A;  2Q0O C;  2GHY A;  3WG7 B;  1ZLZ A;  3CCM V;  2XAF A;  1KMI Z;  4JTC B;  1XMQ B;  1PKX A;  2BOC C;  3BA8 A;  4PA3 A;  1J5E O;  3CYO A;  4TV8 A;  5CA1 A;  4RQE A;  2XT9 A;  4NR1 A;  1ENV A;  4HAM A;  3E83 A;  1XI1 A;  2XUM A;  5LXT B;  3AEI A;  1BS3 A;  1PNM A;  2WA3 A;  3E22 B;  5HFM A;  2OTJ V;  2XAH A;  5LP6 C;  3H1I H;  2XTA A;  1K73 W;  4K8X A;  5FPO A;  1VQN V;  2QWN B;  3WG7 C;  3S3W A;  3QF7 A;  3G71 V;  1R6N A;  3EFF K;  1S0V A;  1N8R W;  3CP1 A;  3HKD A;  4PA7 A;  5DM6 V;  2VRZ A;  4YXW G;  1Q5O A;  2B5U A;  5H5N A;  4EFB A;  2Y0I A;  1X59 A;  2JEU A;  4PDR A;  4D7T A;  5FNV B;  2UXC O;  1XHZ A;  2Z0A A;  3LNM B;  4J7J A;  2VQF O;  3OTF A;  3SJA C;  1KD1 W;  3U11 A;  4JF3 A;  5LBQ A;  3K79 A;  5LMU B;  2IBZ H;  3B40 A;  4JPR A;  4JYA B;  1WB8 A;  1FPO A;  2ITD C;  5JCO A;  4OXS A;  3CCJ V;  1DF4 A;  3H1K H;  1HR0 B;  1E1Q G;  1HP8 A;  4MVZ A;  4N23 A;  1WA8 B;  4JI6 O;  3B09 A;  2PUS A;  1DF5 A;  1MSW D;  5KHK A;  2EIK C;  1JJO A;  1GRJ A;  4OX9 O;  5LGT A;  3CD6 V;  1KKD A;  2PY5 A;  3T1Y B;  1NZ6 A;  4J10 A;  1IXB A;  1Q7Y W;  2QJ1 A;  2RQ6 A;  5L3F A;  2OIE A;  4B3T O;  4EKW A;  5KA5 A;  1N36 O;  2OT5 A;  2UXD O;  5BMV B;  1VIB A;  1Y4M A;  3JAR B;  3SYQ A;  3GWK C;  5CA1 B;  4I9W A;  1WB7 A;  2ZDI A;  4NTW A;  4X64 B;  5CBH A;  2WLK A;  3AK3 A;  5C8Y A;  3I5D A;  4TUY A;  2ZR2 A;  3JCU Z;  4R8C A;  5KX5 B;  2EJ7 A;  1VQM V;  1KQS U;  1WAZ A;  1YHQ V;  3P30 A;  4LNU B;  3RYF A;  1K4D C;  3M99 B;  4EFE A;  3QO7 A;  4J9Z B;  4GLX A;  2E3C A;  1OCO B;  3ABM C;  3CRA A;  3HKD B;  5IJ0 A;  4MTO A;  3ZJZ A;  4DV2 B;  1I5X A;  2QDO A;  2CK3 G;  2F4V B;  5GTH Z;  3P32 A;  2DQ0 A;  1VQ6 V;  3CRC A;  4PI0 A;  1G8M A;  1GN4 A;  1KB9 F;  4FM0 A;  3CXH F;  4LWS B;  3W7T A;  1LUW A;  4JI7 O;  4H0L B;  2F66 C;  4MW3 A;  4QGP A;  3OGC C;  3FAV A;  1UFI A;  4AIL C;  2AXT Z;  3ZRW A;  3OR7 C;  1GKF A;  2IH1 C;  1OCO C;  2RJZ A;  3OM3 B;  2FTK A;  3K5O A;  2OYQ A;  4FIP C;  3RYC A;  4DR6 O;  2UXC B;  4JI0 B;  5EZY A;  1ZTE A;  1Q8I A;  1FJG O;  1Z2G A;  5L3B A;  2PZS A;  4B3R O;  1M5I A;  1YSC A;  4XDL A;  1FXK B;  2DQ3 A;  4C7U A;  4ASU G;  4GCZ A;  2IJH A;  2JK5 C;  1FS0 G;  5H6R A;  1H2G A;  1YCI A;  3UT5 B;  4DO2 A;  1A32 A;  4B3M B;  2RNB A;  4PJ0 Z;  1K7D A;  4X1K B;  4JI4 O;  4UCU A;  1URF A;  3ETQ A; 
#chains in the Genus database with same CATH homology
 3H1K H;  3L75 H;  1SQP H;  3H1L H;  3H1H H;  1KYO F;  3BCC H;  1SQQ H;  2FYU H;  4D6T H;  1PPJ H;  1SQV H;  1NU1 H;  1BGY H;  3CX5 F;  2BCC H;  1BCC H;  3L73 H;  1L0N H;  4U3F H;  1PP9 H;  3L70 H;  3CWB H;  1SQX H;  1P84 F;  3L74 H;  3H1J H;  3TGU H;  1KB9 F;  2IBZ H;  3L72 H;  3CXH F;  3L71 H;  1SQB H;  1BE3 H;  1L0L H;  1NTZ H;  1NTK H;  3H1I H;  2A06 H;  5KLV H;  1NTM H;  1EZV H;  4PD4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...