1SQBH

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqbH00
3L71H 4PD4F 3L70H 1NTMH 3H1HH 1SQQH 4D6TH 3CWBH 2FYUH 1P84F 3L72H 1L0NH 1SQPH 3L75H 1NTZH 1SQBH 2IBZH 3BCCH 4U3FH 2A06H 3L73H 1EZVH 1NU1H 1BGYH 3CX5F 3H1IH 1NTKH 3H1LH 1BE3H 3L74H 1BCCH 5KLVH 1PP9H 1SQXH 3H1JH 1SQVH 1PPJH 2BCCH 1KYOF 1KB9F 1L0LH 3CXHF 3TGUH 3H1KH
chains in the Genus database with same CATH superfamily
4YJ2A 5H9CA 2LQTA 1K4DC 1GN6A 3UT5B 4I4TA 5CA1A 3R66A 4I55A 4ABMA 1EN6A 4CH5A 4DV0B 2MW2B 2Y0PA 4JI7O 1JJ2U 4RUEA 1OCCB 1YF2A 5LYJB 4RAIA 2RNBA 4LF8O 4RQEA 2YUAA 4X9QA 2ZNIA 2OIEA 4B7KA 2HKOA 3CRRA 5EBWC 2QKSA 1M9NA 2XAQA 1WLEA 1L1FA 5IT9N 3F5TA 4DUZB 4LF9O 5TISZ 4FVMA 3T1HO 1AP6A 2E5LB 4FM1A 3OW2U 1G4YB 2AZ0A 3RYIB 4PDVA 5KA6A 5L3DA 3SPHA 2GUZB 1S3JA 1UPGA 2Z5UA 4Z1MG 4JYCA 4G27B 4MVMA 4JTDB 3UM7A 3RT3C 1VQNV 1FPOA 1GM9A 2WLKA 2Q0AA 4DR1B 3P3PA 1R6NA 2PYJA 1NTZH 5A2QN 2ZKOA 1ZUQA 1XREA 2HHHO 1K34A 2P67A 3B77A 2BTQB 3SJAC 4K35A 1VQ7V 4MTXA 5DEDA 1ORQC 2EZPA 3ZJZA 5IYDO 1JMKC 4Z1VA 3AG2C 3ABUA 4FIPC 1KUQA 4Q6GA 1N34B 2KSDA 4JPRA 3SYQA 3F7VC 2JS3A 2M7WA 2FTKA 4MVUA 3CXCU 4QNHB 3E86A 2IBZH 5LMUO 2UXCO 1MABG 2Q67A 4UCUA 1ZAUA 4ZOLA 5BXZA 4B7EA 3ABLC 3H1JH 1WA8B 2HHHB 2RDCA 2HLDG 3D36A 2EILC 1GH6A 2YIBA 1IDSA 3FYEB 1K4CC 3K59A 1OZ0A 1WP8A 5DM6V 1HR0O 2R9IA 3CC7V 1AI6A 1IBKO 3JSLA 1OCRC 4YHHB 1OCCC 2HEPA 4I50B 5JJNB 2QWNB 1V54C 3SJBC 3SYAA 1Y6XA 3ZBHA 3NR7A 3IFXA 4JAAA 1Q81W 2RMKB 3A0HZ 5LGUA 2N04A 1SRYA 5KUMA 4FLZA 2A3QA 2H3OA 4X1IA 3CJHB 4TWKA 5JH7A 4IIJB 2A0LA 1EM1A 5L3CA 3L73H 4X66O 4X66B 3FYIB 4GX0A 3ZHTA 1PL4A 2CE4A 1G8MA 5EYPA 3S3XA 1AVMA 1TUEB 4DUYB 2ZXWC 3W7TA 2IU0A 1PV0A 2ZCEA 4I9WA 3APQA 5IWAB 4LF5O 3FB7C 1FXHA 4B3RB 5ITZA 1HNWB 5LL6Y 2AHYA 5FPRA 4DV7B 2WLIB 2WLLB 4B3TO 1VQMV 2QWPB 1TA8A 1YJNV 1S5LZ 1SQVH 1DF4A 4JI6B 1GN4A 3G71V 1L8DA 2HG5C 4BIZA 2ZXWB 2E76B 5F2VO 2UUAB 3IGAC 3CCQV 3BA8A 3G67A 4LWSB 4U3JB 4JI0O 2BSKA 4J7KA 4BWAA 1XUQA 1JX9A 4FFBB 2ZR3A 2UXCB 1EN4A 1H2MA 5LA6A 2IW5A 4O4LB 3S3WA 4R50A 2QKAA 5CA3A 2BTQA 3EVKA 1GMGA 4J41A 3TXSA 5JJEB 3ZMZA 4O2AA 1Q90D 2F95B 2P7TC 4N23A 3ZCCA 3ZEDA 2W0XA 4FZ1A 1GTOA 2EILB 1N36B 1GKFA 1SF9A 4GKKO 1MSWD 1FXKB 3CCMV 1V55B 2ZQMA 4I7ZB 1JVMA 1WN7A 3DXRA 2IJJA 2YI8A 3ABMC 1QBZA 3FB6C 5JCOA 1HP8A 2XAHA 3D3QA 3ZN1A 3JALB 1IXBA 2X6BA 3DGEA 3E83A 3T4ZA 1XI1A 3CCVV 3LUTB 1EN5A 5IJ9A 1DK1A 3M99B 2EINB 1GM8A 5EC2C 3STLC 4X88A 3CRMA 3HKDB 1I08A 1JCHA 2QJ1A 1Y76A 1WPXA 3ABKC 1WNSA 2IU3A 3SPIA 1WJZA 2JK5C 3IC7A 3HKCB 3LDCA 4GUNA 2PI5A 4XDLA 1VQ4V 4DV3B 4WFFA 1YITV 2P06A 3ZHQA 3SYOA 3ASNB 2JVDA 1KC8W 3JD0A 3ZMVA 3ICXA 1L0LH 5FLXN 5H5NA 1K3EA 4BIOA 1UFIA 4KHPO 1SQQH 3U10A 3K58A 2QTSA 4H44B 1AJNA 4EFBA 4ZKIA 1XDCA 2QTOA 4KFMA 3WG7B 4LBEC 1AROP 3PJSK 1K5SA 3A0BZ 3CCRV 4JV5O 5KHHA 2OTJV 2IJIA 2MK3A 2Q69A 3ZHVA 1R3LC 4B3SB 2IH1C 2HP8A 3RWRD 2DE0X 4MTOA 4LFCO 5LMNO 3W7WA 2Q6AA 2VQFB 3CYOA 3LSSA 2GDSA 1B04A 2ZINA 1SQFA 4R7CA 2VRZA 4GLXA 5EZYB 2A9HA 1SETA 2WA3A 1AR1B 4HZ3A 3D8CA 1Q6HA 2LJ2A 1N36O 3TXQA 2JGDA 3BABA 5GONB 4JI1O 3C3TA 3LDDA 3VOUA 3RGBA 4HYOA 1NZ6A 5KMGA 3OEEG 4LH6A 4DR3B 1KKCA 1BQ0A 1NS1A 5EZYA 4KHPB 4TQDA 4UV9A 1NBMG 5KLVH 3D3IA 2BTOA 1G1XB 5JWPA 3N27A 1P4RA 2WLNA 1K5QA 1N0JA 3QTCA 2YSUB 4NVPA 3M7MX 3APOA 1RSOA 2IJKA 1VP7A 1KMIZ 2YIAA 4LC1A 1SQGA 4U3FH 5IJ0A 2Y4TA 3BHPA 4A5UB 1N0NA 3R65A 3E22B 1B3QA 5J2TB 4I0XA 5J9PC 1BS3A 2BCCH 1YJWV 3Q4HA 2H94A 4DRXA 3K9AA 2EIMC 4DR5O 1JJOA 4MVSA 1RP3B 3B4SA 3FB8C 4J7JA 2ZM6B 3K03A 5JCOC 1XHZA 4PDRA 2XAJA 1EZVH 1M57B 3Q4HB 2D2CB 3N2KA 5LP6C 5B1AC 1XNRO 3ASOC 3L71H 4JI5O 3K5OA 2L6LA 2A79B 1TVKB 1Q6UA 1KP3A 2CTWA 4ICGA 3JCZA 4FLUA 3T2MA 3THOA 1M93A 1XL6A 2CAZC 4YY3B 3T4DA 4DV4B 5E79Z 3CC2V 3M8AA 5L3FA 1E1RG 3OFNG 2Q9LA 1IBLO 2OIGA 2DJVA 4GX1A 3QO5A 4DO2A 3OE7G 4DW1A 3JAMN 4DR4B 1XMQB 3QG5A 4X65O 2WLMA 4UVAA 5A9GA 1F4MA 3K5LA 1OCRB 2WLIA 4JI2B 4BIUA 4DYLA 1S76D 3UO2A 4CH3A 3AG1C 4FM0A 3RYHA 3ASNC 4D7SA 1Z2GA 1OCZB 3KZIZ 2ITDC 3N2GB 4UCTA 2BSKB 2CK3G 2NLJC 3CCLV 4LF5B 1HWYA 5DN6G 3OD4A 4U7NA 1RM1C 1M5IA 1H2GA 1XNQB 2UXNA 4DR6O 1LR1A 1DGSA 5KHJA 4IYHA 1UJWB 4DV6B 5HFMA 4IT5A 4UFZA 1AP5A 1U96A 1KU9A 2WSSG 4DR1O 4DXWA 3W7UA 3ZRVA 1U97A 4KUMA 1BSMA 1VQOV 1V55C 2YC0A 3SPGA 4RQFA 2CH7B 1OCZC 1VEWA 4LH7A 1NQTA 3JD2A 1VQLV 4JTAB 3TGUH 1FXKA 1HNZO 3VQWA 5IYBO 4DR5B 3B8NA 3VQYA 1I7FA 1RM1B 1XL4A 4O4JA 2BOBC 5CB4A 2ADQB 1ZTEA 4G28B 5LHHA 1YJ9V 3B8MA 1Q3EA 1OJHA 3JALA 2VWJA 1GM7A 1XQ8A 5B66Z 5GTIZ 2FMLA 2EIKB 2W6IG 1VQPV 2CUGA 3ZN0A 3L72H 2Z3YA 2PUSA 1HNZB 4LF8B 1HW7A 2LW1A 1I5XA 2EJRA 2LW7A 4LF6O 2NNUA 2K9PA 1N34O 5E1AC 1XEQA 2LGQA 3CCUV 4JI7B 3LNNA 1AI7A 2QKCA 4UCOA 5EC1C 3FD9A 1VMGA 4DV0O 2OCCC 4BAYA 4TT3G 5CBGA 2UUCO 1NH2D 3BPZA 1L0NH 1P7GA 2DW4A 3OR7C 3QNEA 1URFA 5IYZA 1XMQO 2HVKC 1IBMB 1CXZB 3QVNA 3RVYA 4JZ2A 4TV9B 1TUBB 5K1PA 1QQCA 4DR7O 3UT5A 3H1KH 4EKWA 4E2LA 4JGSA 1K97A 2YI9A 4PA6A 4D6TH 3BVOA 3F7YC 2UUCB 5CA0B 4FM2A 1QVGU 3FKSG 2X6CA 5B1AB 4N21A 1RFYA 5LMNB 3OTOB 1YTFD 2EINC 2QE7G 2W6JG 1IBMO 1ZL8B 2KQXA 1SZXA 5BY1A 4QPKA 1D5AA 3E8GA 4O4IB 3LDEA 2Q5ZA 4P30A 1F23A 5C8YA 4KL1A 4JV5B 4LNUA 1AJPA 4DV1O 1NR1A 1LUVA 3ETQA 3GWOA 4FZ0A 3CCEV 4QE9A 2UU9B 1YSCA 1GRJA 2CTRA 2ZDIA 1AJQA 1Q7YW 2F93B 4TV8A 1QLNA 3WB2A 3RYFB 5CBFA 4DV5O 1ZSPA 2XAGA 4CH6A 4FFKA 1QCEA 3OGIB 3CE2A 4J9ZB 3CEIA 2DWDC 1Y66A 2JJ1G 2JEXA 2RCVA 4MVOA 2FKXA 2WAMA 4B08A 1YI2V 1S0VA 2OWOA 3K9SA 1JFFA 2LFSA 4DRXB 2PZSA 3A2FA 1Q43A 1ENVA 4MTFA 4YJ3B 3ABTA 2CDYA 2JRIA 1DF5A 1WP7A 2V4DA 4AQYO 3CSXA 3DXRB 1M4UA 2UXDO 1K33A 5BR8O 1BCCH 3JATB 1COWG 4RWUA 1BMFG 1T5EA 3OR6C 3JYCA 3ZRXA 1OV9A 5AG2A 3DC6A 1NI8A 2X6AA 3SYCA 2UXBO 2Y0IA 5C93A 4J9YB 1Q8IA 2CTPA 3IAYA 4RUFA 2ITCC 2AZ2A 4JAUA 4U7OA 5JQGA 3K79A 3MHSC 3RN4A 4GX5A 4X64B 1KB9F 2B5UA 4B3MO 1R3JC 1TUBA 3AG7A 3G6BA 3STZC 4DR4O 5JJJB 4Q20A 1FXKC 4UCVA 3OUSA 3QF7A 4NB5A 2ETNA 2OTLV 2KG7A 2Y69B 4B3TB 1QU7A 1FKAO 1Y74A 4RO2A 1DTOA 1HNWO 1I0HA 1Z5WA 1SZTA 3AK3A 4B3RO 4X65B 2B9ZA 2KB1A 4JI6O 1H2LA 3B40A 4MTGA 1AR5A 1VF7A 3SYPA 3AG2B 2KG7B 4BW9A 2ATKC 4DUYO 3OUFA 1Q5OA 2ODMA 3O65A 4LFBB 3F5WC 2GV9A 4JI5B 4NXMB 3HKEA 3AK1A 4FLXA 3GVMA 3ABLB 2DQ0A 1SQXH 5GTHZ 2YXLA 4MT8A 1JQ0A 4WFEA 4JI4B 4X1KB 1FFXB 1O9HA 4JYAO 2EIJC 3RVZA 1PNLA 3AEIA 4Z2WA 4FLWA 3RFRA 1FFTB 3K0DA 3HKEB 2NR5A 4YXWG 2OT5A 3ETGA 3ZHRA 2GBOA 1AILA 2R72A 1GN2A 4FPPA 1WB7A 2V7QG 5LP6A 1BT8A 2K1EA 1R3KC 4MW3A 2Q4PA 5EBMC 1N33O 2IJHA 2JDIG 5B1OA 1VF5B 3OEHG 2EIJB 4G2KA 4K0KB 5KHIA 1VF6A 4PI0A 1IXMA 2QWOB 4OX9O 4LF7B 1XMOO 2DMXA 2WLHA 1LUWA 1HR0B 1JR9A 1S5HC 1F4NA 5LP6B 1NTKH 2HJFC 2DYRB 4PDMA 4LFAB 1GAXA 4PA3A 5IYCO 1YCIA 4ASUG 1SC5B 4J10A 2EIKC 3ZHUA 1OCOC 2YIDA 3AG3B 1KBHA 1A32A 4LP8A 1MZFA 3LSUA 3CP1A 4YIPA 1KP2A 1PKXA 1WAZA 4LF7O 2F1MA 1N32O 2FL4A 2PGGA 4PA7A 4JI0B 3RW0A 2UUAO 2GTSA 2EBOA 2QWQB 1FJGO 1FYJA 4HNAA 1Q6IA 4GX2A 2VWKA 4ZOLB 5B1BB 4DV7O 1TVKA 4B3SO 2P4KA 1BL8A 1Y74B 1QLEC 3HKDA 3VQVA 1J5EO 3VQXA 2Y48A 3CS5A 4TV9A 1H8EG 4PD4F 1Z5VA 2B1IA 2QSAA 4O2BA 3BFRA 3TCUA 3ZMUA 1P84F 5LHGA 1KECA 3JARA 4CH4A 5FL7G 2VS0A 4ZI7A 2ZE8A 4JYAB 2WLLA 3I5DA 2G38A 4X62B 1TAEA 1QLEB 1P49A 1FFXA 2P22C 1CP9A 3B09A 5IWAO 1ROPA 3J81N 1FD9A 5LXTA 1F7YA 2CTQA 4X20A 3O9OA 2F43G 5B3SB 5KUKA 2DYSC 2ZIOA 2AXTZ 2XUMA 4KXRA 2EX3A 3X2QC 2PTMA 2RJZA 3CB2A 2CGOA 2A06H 2WLJA 4CS3A 1G6UA 1NU1H 4JI3B 3CX5F 2ZNJA 5EBLC 4XDKA 5EK0A 2ZT9B 1NT2B 3ETEA 2HVJC 1PD3A 5CMUA 3BRCA 4UVCA 4EFEA 4IHJA 2N05A 4FK5C 1P7BA 1I94O 1I94B 3EHBB 1N32B 1R1BA 4O2AB 4WF9V 2HJDA 3JASA 3JATA 2R9AA 2XAFA 4NYKA 3SPCA 2BOCC 1PM9A 4IL6Z 3L75H 1YTFB 3EFFK 1BHBA 1I5YA 4I0XB 3HB3B 3DTUB 1FS0G 1VQ6V 1PP9H 2EZOA 3LSQA 2VQEO 3OTFA 1XILA 3BY6A 4KP4A 3OMNB 3T1HB 5BZBA 3W7XA 2GHYA 1M56C 1Q82W 1NKDA 1MG1A 2DYRC 3CMEV 3SR2C 3P30A 4CBCA 4JYBA 3U0ZA 2ZE7A 3JCUZ 1SQPH 2M6YA 1NVPB 3CJHA 3WB0A 2R9RB 4L87A 2F66C 1HDJA 3DC5A 4AILC 2UUBO 4OPHA 1YZBA 3CPWU 1Y76B 1K92A 4JYYA 3UO3A 4CC6A 3E8FA 2WA4A 2RN9A 4F6RB 3AG4C 1IURA 2P5OA 4DV1B 4QIWF 4QGPA 5B3SC 1GN3A 4D7TA 2UUBB 3JAWB 4DR6B 4X1IB 4J7ZA 4NXNB 4X20B 3CRAA 5B1BC 2EIMB 4XDJA 3ETDA 3SJCC 3MHHC 3QO7A 1YEWA 1VIBA 4O4IA 4QJFB 5KHKA 3D36C 3CD6V 3K0GA 4PHZA 3H9VA 4PJ0Z 5EYPB 2ZD9A 3WG7C 3FB5C 3JAWA 3OMIB 3RYIA 5IDJA 3ZS8C 3ZMSA 1BZKA 2QWRB 2ZDIC 3JD3A 5LA6B 3KCYA 3QO8A 3U11A 3ABKB 3T1CA 1SERA 2DN9A 4NTYA 2O57A 2LP7A 5HFLA 4UVBA 3CC4V 3G4SV 3CWBH 5D5QA 3RYFA 1THZA 2VQEB 4LF6B 3J80N 3K06A 5KAIZ 2W0FC 3C90A 1EBOA 4H0LB 3E22A 1VQ8V 2RQ6A 1XHXA 2Q7HA 3SPJA 4J42A 4HAMA 3H1HH 5KAFZ 2Z0AA 3JSNA 4O4LA 1VF6C 1JFFB 1K8AW 4NTXA 3E8BA 4GCZA 2UXDB 3OT7A 1X59A 4FLTA 3W7SA 1CPYA 4BW5A 1BQZA 5KA5A 4MVQA 4JI3O 5IY5C 4AI8A 3MAQA 2DWEC 1W0KG 1M56B 2PI4A 1AI5A 1Y67A 3G80A 1PL0A 2FYUH 4K3AA 4FMTA 4UXNA 1EFRG 5JVDA 1H38A 4MW8A 5LHIA 3VBBA 4PDLA 2ZM6O 1R6KA 1YDXA 4AHCA 5LOVB 1E1QG 3L74H 1VQ9V 1CEZA 3ZRSA 2YEVB 1S77D 4MVZA 5JQGB 1R73A 1AB3A 2XOKG 4FLYA 4WCEV 2A7WA 1VQ5V 4YJ2B 4JTCB 3MDSA 4DUZO 3IC9A 1OHHG 3B2EE 4GZRB 4LF9B 1M1KW 1JA8A 1KQSU 1M57C 4NXMO 1K9MW 1S5JA 4LFBO 4IIJA 5IE9A 4FJCC 2QDOA 1PNMA 3K57A 1SA0B 4W4LA 4I4TB 5CA1B 1WB8A 2ARHA 1XNQO 4DV3O 2XHBA 4JASA 2CGNA 3ZX6A 1R3IC 1YVWA 2YIBD 4UCSA 4I5SA 4X62O 3A0RA 3OMAB 4MS2A 4LF4B 4NKGB 2NN4A 3GWKC 3RYHB 2JGUA 4OPAA 4PI2A 4DW0A 1J95A 3BAAA 4TQFA 5LYJA 5FNVB 2EULA 1IZ3A 3J7AU 4JAVA 4TOIA 2KKWA 4NR1A 1MMMA 4WBNA 4JI8O 3I55V 2QM7A 3P3NA 1SESA 2AW9A 4CS4A 4DK0A 4X1KA 1FJGB 4OGQB 1VQKV 3ML0A 1PPJH 1IBLB 2Q7GA 3HKBB 5KX5B 3WB1A 3UQ8A 2Y69C 2B1GA 3SDLA 2WPDG 3MD0A 5L3BA 3ZMTA 2R70A 1MNGA 1QHTA 2QM8A 1F51A 4R8CA 5KX5A 3K3WA 4TV8B 1XBLA 4F6EA 2JGDB 4E4EA 3K5NA 4H13B 2QEXV 1DLBA 4DR2B 1Y4MA 2P4VA 3JASB 1OCOB 2YDEA 1W2BU 4ZHQB 5BMVA 4CC5A 4IGGA 4DV2B 1N33B 4P9OA 3T1YB 4TUYB 4UCRA 4GKJB 2Q73A 2P90A 1XMOB 4UUJC 4DV5B 1KYOF 4O4HB 1RSOB 5D5PA 4LCUC 1WA8A 4FLVA 2YEVA 3I56V 2ADPA 3DSQA 1TGOA 3BA9A 4PA4A 5IJ0B 5K1XA 3L9DA 4J80A 4DV2O 2P6JA 2GTAA 2XT9A 3H01A 4X8AA 1B6QA 4HNAB 2HFEC 2Q8VA 1H2KA 2FB5A 4JI1B 1D5NA 1HNXB 2AHZA 3OGCC 2DOSA 2DQ3A 4UB6Z 1SQBH 5H6RA 1WPBA 4DR3O 3CRQA 5L3EA 5B5EZ 2IH3C 2YXYA 2X0LA 3JARB 2GSMB 2Y4UA 2F4VB 1RPRA 3CHXA 3LNMB 1XOUA 4NTWA 4I55B 3ZIAG 2Q68A 4LR3A 5LGTA 4YHHO 5FNVA 5KHGA 4EB6A 2ZR2A 1BHAA 4LNUB 4ZI7B 4JI8B 1W59A 1NVPD 4HBNA 5EIBC 5ITZB 4WBNB 1V9PA 3TK1A 4LFCB 4WFGA 4JF3A 3FAVA 3CXHF 4PA9A 1US6A 4EB6B 2LO1A 3JD1A 4BR6A 4QPJA 3E35A 1KKDA 3HKBA 1N4CA 5LXTB 2DYSB 1SKVA 2PYLA 5H6QA 2UXBB 2ZIMA 3FAVB 2BE3A 2OYQA 1QVFU 1S72V 3K08A 1SS3A 2CH7A 3C3SA 1MA1A 4LWSA 4U3JA 3ASOB 3GB7C 2OCHA 4H33A 2JIZG 4CZZA 3N2GA 2JS5A 4K8ZA 4K0KO 1MOFA 4R6ZA 2ILMA 4O4JB 3FX7A 4GYCB 2AGAA 1ZX3A 1X4TA 4ZHQA 5BMVB 5CB4B 2JJ2G 4IHJB 5BR8B 2PY5A 4YJ3A 2LGWA 2WWWA 3E89A 1J5EB 4TUYA 4OXSA 1QR8A 4DR2O 4EEQA 5J2TA 2ZE5A 5J2UA 4QE7A 4H37A 4ZIBA 3IJ4A 3HPLC 4GKKB 2E5LO 1PNKA 1QR9A 1BGYH 3UCSC 1Q86W 2L35A 3CCSV 3T1YO 4JI4O 2V1DA 5J2UB 3CRCA 5LOVA 2YS8A 5IJ9B 3TETA 2QM4A 1H2SB 1MZEA 1VARA 2XNDG 3N2KB 3K04A 5LGNA 3L70H 2OCCB 1K7DA 4TSFG 2X7RB 1AI4A 3K5MA 3AK2A 4IYIA 1FXVA 3H1IH 5L3GA 3RYCA 1YHQV 3HKCA 3HR0A 1GK9A 2QR4A 3OTOO 1ZLZA 3CMAV 1N8RW 2JEUA 3WFVA 2D3OW 1M90W 1SA0A 4LFAO 4JI2O 2IM9A 4I9QA 1NJIW 1H8HG 4WFBV 1O9GA 1ZWIC 4CS2A 1RPOA 3ZRWA 4I50A 4OX9B 3SJQC 3AG4B 4MVRA 4YIOA 1BE3H 2H8PC 3WU2Z 1W0JG 3OM3B 2F4VO 3A8TA 4P2ZA 2Q0OC 1ZL8A 5JH7B 4NXNO 2C2AA 4F6RA 3ZRWB 2Q7EA 4DV4O 1NH2B 1EZJA 4YY3O 1KD1W 3BCCH 2XASA 4DR7B 1HNXO 4W4KA 3AG1B 5CN0A 4UV8A 2QA4V 5IY5B 4LF4O 2YICA 1XNRB 2F23A 5CA0A 5B1NA 1IX9A 3KCXA 4J11A 1B06A 1JOYA 1LNQA 1NR7A 5FPOA 4X89A 5KMGB 3BEHA 4C7UA 5CBHA 1R6TA 3SGIA 4WFAV 2PF4E 1IBKB 5C8YB 3G6EV 1GO3F 1MSDA 5GONA 3X2QB 3ABMB 4P9PA 4GKJO 3JAKA 4MSWC 2E74B 4FFBA 1H2NA 3RBZA 4ZBMA 1NTMH 3KKYA 3OAAG 5EIBD 1YXBA 2GUZA 4PV1B 2HR3A 3KG2A 3NXSA 2E3CA 3TJTA 2EJ7A 4XBFA 3JAKB 1K73W 4WFHA 4UB8Z 4JZGA 4B3MB 3CCJV 2UXXA 4X64O 4GT1A 1QNMA 2UU9O 2YXHA 1V54B 4O4HA 5LMUB 1D2DA 5H2FZ 3E8HA 5LBQA 5JVDB 4X1YA 2QGNA 3P32A 1E79G 1IVSA 3H1LH 4PELA 3RYCB 3AG3C 4L8JA 4F4LA 3EXAA 3E2EA 3PN1A 2XTAA 4AQYB 4DV6O 2N74A 3JD4A 4K8XA 3FFQA 4X1YB 2ZE6A 4DK1A 4O2BB 2LFRA 2E75B 5DECA 1YIJV 3UKMA 5GW7A 1AR4A 5IYZB 2VQFO 1FAFA 1JPXA 3ZHSA
chains in the Genus database with same CATH topology
3L71H 4PD4F 3L70H 1NTMH 3H1HH 1SQQH 4D6TH 3CWBH 2FYUH 1P84F 3L72H 1L0NH 1SQPH 3L75H 1NTZH 1SQBH 2IBZH 3BCCH 4U3FH 2A06H 3L73H 1EZVH 1NU1H 1BGYH 3CX5F 3H1IH 1NTKH 3H1LH 1BE3H 3L74H 1BCCH 5KLVH 1PP9H 1SQXH 3H1JH 1SQVH 1PPJH 2BCCH 1KYOF 1KB9F 1L0LH 3CXHF 3TGUH 3H1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 H;  4PD4 F;  3L70 H;  1NTM H;  3H1H H;  1SQQ H;  4D6T H;  3CWB H;  2FYU H;  1P84 F;  3L72 H;  1L0N H;  1SQP H;  3L75 H;  1NTZ H;  1SQB H;  2IBZ H;  3BCC H;  4U3F H;  2A06 H;  3L73 H;  1EZV H;  1NU1 H;  1BGY H;  3CX5 F;  3H1I H;  1NTK H;  3H1L H;  1BE3 H;  3L74 H;  1BCC H;  5KLV H;  1PP9 H;  1SQX H;  3H1J H;  1SQV H;  1PPJ H;  2BCC H;  1KYO F;  1KB9 F;  1L0L H;  3CXH F;  3TGU H;  3H1K H; 
#chains in the Genus database with same CATH topology
 4YJ2 A;  5H9C A;  2LQT A;  1K4D C;  1GN6 A;  3UT5 B;  4I4T A;  5CA1 A;  3R66 A;  4I55 A;  4ABM A;  1EN6 A;  4CH5 A;  4DV0 B;  2MW2 B;  2Y0P A;  4JI7 O;  1JJ2 U;  4RUE A;  1OCC B;  1YF2 A;  5LYJ B;  4RAI A;  2RNB A;  4LF8 O;  4RQE A;  2YUA A;  4X9Q A;  2ZNI A;  2OIE A;  4B7K A;  2HKO A;  3CRR A;  5EBW C;  2QKS A;  1M9N A;  2XAQ A;  1WLE A;  1L1F A;  5IT9 N;  3F5T A;  4DUZ B;  4LF9 O;  5TIS Z;  4FVM A;  3T1H O;  1AP6 A;  2E5L B;  4FM1 A;  3OW2 U;  1G4Y B;  2AZ0 A;  3RYI B;  4PDV A;  5KA6 A;  5L3D A;  3SPH A;  2GUZ B;  1S3J A;  1UPG A;  2Z5U A;  4Z1M G;  4JYC A;  4G27 B;  4MVM A;  4JTD B;  3UM7 A;  3RT3 C;  1VQN V;  1FPO A;  1GM9 A;  2WLK A;  2Q0A A;  4DR1 B;  3P3P A;  1R6N A;  2PYJ A;  1NTZ H;  5A2Q N;  2ZKO A;  1ZUQ A;  1XRE A;  2HHH O;  1K34 A;  2P67 A;  3B77 A;  2BTQ B;  3SJA C;  4K35 A;  1VQ7 V;  4MTX A;  5DED A;  1ORQ C;  2EZP A;  3ZJZ A;  5IYD O;  1JMK C;  4Z1V A;  3AG2 C;  3ABU A;  4FIP C;  1KUQ A;  4Q6G A;  1N34 B;  2KSD A;  4JPR A;  3SYQ A;  3F7V C;  2JS3 A;  2M7W A;  2FTK A;  4MVU A;  3CXC U;  4QNH B;  3E86 A;  2IBZ H;  5LMU O;  2UXC O;  1MAB G;  2Q67 A;  4UCU A;  1ZAU A;  4ZOL A;  5BXZ A;  4B7E A;  3ABL C;  3H1J H;  1WA8 B;  2HHH B;  2RDC A;  2HLD G;  3D36 A;  2EIL C;  1GH6 A;  2YIB A;  1IDS A;  3FYE B;  1K4C C;  3K59 A;  1OZ0 A;  1WP8 A;  5DM6 V;  1HR0 O;  2R9I A;  3CC7 V;  1AI6 A;  1IBK O;  3JSL A;  1OCR C;  4YHH B;  1OCC C;  2HEP A;  4I50 B;  5JJN B;  2QWN B;  1V54 C;  3SJB C;  3SYA A;  1Y6X A;  3ZBH A;  3NR7 A;  3IFX A;  4JAA A;  1Q81 W;  2RMK B;  3A0H Z;  5LGU A;  2N04 A;  1SRY A;  5KUM A;  4FLZ A;  2A3Q A;  2H3O A;  4X1I A;  3CJH B;  4TWK A;  5JH7 A;  4IIJ B;  2A0L A;  1EM1 A;  5L3C A;  3L73 H;  4X66 O;  4X66 B;  3FYI B;  4GX0 A;  3ZHT A;  1PL4 A;  2CE4 A;  1G8M A;  5EYP A;  3S3X A;  1AVM A;  1TUE B;  4DUY B;  2ZXW C;  3W7T A;  2IU0 A;  1PV0 A;  2ZCE A;  4I9W A;  3APQ A;  5IWA B;  4LF5 O;  3FB7 C;  1FXH A;  4B3R B;  5ITZ A;  1HNW B;  5LL6 Y;  2AHY A;  5FPR A;  4DV7 B;  2WLI B;  2WLL B;  4B3T O;  1VQM V;  2QWP B;  1TA8 A;  1YJN V;  1S5L Z;  1SQV H;  1DF4 A;  4JI6 B;  1GN4 A;  3G71 V;  1L8D A;  2HG5 C;  4BIZ A;  2ZXW B;  2E76 B;  5F2V O;  2UUA B;  3IGA C;  3CCQ V;  3BA8 A;  3G67 A;  4LWS B;  4U3J B;  4JI0 O;  2BSK A;  4J7K A;  4BWA A;  1XUQ A;  1JX9 A;  4FFB B;  2ZR3 A;  2UXC B;  1EN4 A;  1H2M A;  5LA6 A;  2IW5 A;  4O4L B;  3S3W A;  4R50 A;  2QKA A;  5CA3 A;  2BTQ A;  3EVK A;  1GMG A;  4J41 A;  3TXS A;  5JJE B;  3ZMZ A;  4O2A A;  1Q90 D;  2F95 B;  2P7T C;  4N23 A;  3ZCC A;  3ZED A;  2W0X A;  4FZ1 A;  1GTO A;  2EIL B;  1N36 B;  1GKF A;  1SF9 A;  4GKK O;  1MSW D;  1FXK B;  3CCM V;  1V55 B;  2ZQM A;  4I7Z B;  1JVM A;  1WN7 A;  3DXR A;  2IJJ A;  2YI8 A;  3ABM C;  1QBZ A;  3FB6 C;  5JCO A;  1HP8 A;  2XAH A;  3D3Q A;  3ZN1 A;  3JAL B;  1IXB A;  2X6B A;  3DGE A;  3E83 A;  3T4Z A;  1XI1 A;  3CCV V;  3LUT B;  1EN5 A;  5IJ9 A;  1DK1 A;  3M99 B;  2EIN B;  1GM8 A;  5EC2 C;  3STL C;  4X88 A;  3CRM A;  3HKD B;  1I08 A;  1JCH A;  2QJ1 A;  1Y76 A;  1WPX A;  3ABK C;  1WNS A;  2IU3 A;  3SPI A;  1WJZ A;  2JK5 C;  3IC7 A;  3HKC B;  3LDC A;  4GUN A;  2PI5 A;  4XDL A;  1VQ4 V;  4DV3 B;  4WFF A;  1YIT V;  2P06 A;  3ZHQ A;  3SYO A;  3ASN B;  2JVD A;  1KC8 W;  3JD0 A;  3ZMV A;  3ICX A;  1L0L H;  5FLX N;  5H5N A;  1K3E A;  4BIO A;  1UFI A;  4KHP O;  1SQQ H;  3U10 A;  3K58 A;  2QTS A;  4H44 B;  1AJN A;  4EFB A;  4ZKI A;  1XDC A;  2QTO A;  4KFM A;  3WG7 B;  4LBE C;  1ARO P;  3PJS K;  1K5S A;  3A0B Z;  3CCR V;  4JV5 O;  5KHH A;  2OTJ V;  2IJI A;  2MK3 A;  2Q69 A;  3ZHV A;  1R3L C;  4B3S B;  2IH1 C;  2HP8 A;  3RWR D;  2DE0 X;  4MTO A;  4LFC O;  5LMN O;  3W7W A;  2Q6A A;  2VQF B;  3CYO A;  3LSS A;  2GDS A;  1B04 A;  2ZIN A;  1SQF A;  4R7C A;  2VRZ A;  4GLX A;  5EZY B;  2A9H A;  1SET A;  2WA3 A;  1AR1 B;  4HZ3 A;  3D8C A;  1Q6H A;  2LJ2 A;  1N36 O;  3TXQ A;  2JGD A;  3BAB A;  5GON B;  4JI1 O;  3C3T A;  3LDD A;  3VOU A;  3RGB A;  4HYO A;  1NZ6 A;  5KMG A;  3OEE G;  4LH6 A;  4DR3 B;  1KKC A;  1BQ0 A;  1NS1 A;  5EZY A;  4KHP B;  4TQD A;  4UV9 A;  1NBM G;  5KLV H;  3D3I A;  2BTO A;  1G1X B;  5JWP A;  3N27 A;  1P4R A;  2WLN A;  1K5Q A;  1N0J A;  3QTC A;  2YSU B;  4NVP A;  3M7M X;  3APO A;  1RSO A;  2IJK A;  1VP7 A;  1KMI Z;  2YIA A;  4LC1 A;  1SQG A;  4U3F H;  5IJ0 A;  2Y4T A;  3BHP A;  4A5U B;  1N0N A;  3R65 A;  3E22 B;  1B3Q A;  5J2T B;  4I0X A;  5J9P C;  1BS3 A;  2BCC H;  1YJW V;  3Q4H A;  2H94 A;  4DRX A;  3K9A A;  2EIM C;  4DR5 O;  1JJO A;  4MVS A;  1RP3 B;  3B4S A;  3FB8 C;  4J7J A;  2ZM6 B;  3K03 A;  5JCO C;  1XHZ A;  4PDR A;  2XAJ A;  1EZV H;  1M57 B;  3Q4H B;  2D2C B;  3N2K A;  5LP6 C;  5B1A C;  1XNR O;  3ASO C;  3L71 H;  4JI5 O;  3K5O A;  2L6L A;  2A79 B;  1TVK B;  1Q6U A;  1KP3 A;  2CTW A;  4ICG A;  3JCZ A;  4FLU A;  3T2M A;  3THO A;  1M93 A;  1XL6 A;  2CAZ C;  4YY3 B;  3T4D A;  4DV4 B;  5E79 Z;  3CC2 V;  3M8A A;  5L3F A;  1E1R G;  3OFN G;  2Q9L A;  1IBL O;  2OIG A;  2DJV A;  4GX1 A;  3QO5 A;  4DO2 A;  3OE7 G;  4DW1 A;  3JAM N;  4DR4 B;  1XMQ B;  3QG5 A;  4X65 O;  2WLM A;  4UVA A;  5A9G A;  1F4M A;  3K5L A;  1OCR B;  2WLI A;  4JI2 B;  4BIU A;  4DYL A;  1S76 D;  3UO2 A;  4CH3 A;  3AG1 C;  4FM0 A;  3RYH A;  3ASN C;  4D7S A;  1Z2G A;  1OCZ B;  3KZI Z;  2ITD C;  3N2G B;  4UCT A;  2BSK B;  2CK3 G;  2NLJ C;  3CCL V;  4LF5 B;  1HWY A;  5DN6 G;  3OD4 A;  4U7N A;  1RM1 C;  1M5I A;  1H2G A;  1XNQ B;  2UXN A;  4DR6 O;  1LR1 A;  1DGS A;  5KHJ A;  4IYH A;  1UJW B;  4DV6 B;  5HFM A;  4IT5 A;  4UFZ A;  1AP5 A;  1U96 A;  1KU9 A;  2WSS G;  4DR1 O;  4DXW A;  3W7U A;  3ZRV A;  1U97 A;  4KUM A;  1BSM A;  1VQO V;  1V55 C;  2YC0 A;  3SPG A;  4RQF A;  2CH7 B;  1OCZ C;  1VEW A;  4LH7 A;  1NQT A;  3JD2 A;  1VQL V;  4JTA B;  3TGU H;  1FXK A;  1HNZ O;  3VQW A;  5IYB O;  4DR5 B;  3B8N A;  3VQY A;  1I7F A;  1RM1 B;  1XL4 A;  4O4J A;  2BOB C;  5CB4 A;  2ADQ B;  1ZTE A;  4G28 B;  5LHH A;  1YJ9 V;  3B8M A;  1Q3E A;  1OJH A;  3JAL A;  2VWJ A;  1GM7 A;  1XQ8 A;  5B66 Z;  5GTI Z;  2FML A;  2EIK B;  2W6I G;  1VQP V;  2CUG A;  3ZN0 A;  3L72 H;  2Z3Y A;  2PUS A;  1HNZ B;  4LF8 B;  1HW7 A;  2LW1 A;  1I5X A;  2EJR A;  2LW7 A;  4LF6 O;  2NNU A;  2K9P A;  1N34 O;  5E1A C;  1XEQ A;  2LGQ A;  3CCU V;  4JI7 B;  3LNN A;  1AI7 A;  2QKC A;  4UCO A;  5EC1 C;  3FD9 A;  1VMG A;  4DV0 O;  2OCC C;  4BAY A;  4TT3 G;  5CBG A;  2UUC O;  1NH2 D;  3BPZ A;  1L0N H;  1P7G A;  2DW4 A;  3OR7 C;  3QNE A;  1URF A;  5IYZ A;  1XMQ O;  2HVK C;  1IBM B;  1CXZ B;  3QVN A;  3RVY A;  4JZ2 A;  4TV9 B;  1TUB B;  5K1P A;  1QQC A;  4DR7 O;  3UT5 A;  3H1K H;  4EKW A;  4E2L A;  4JGS A;  1K97 A;  2YI9 A;  4PA6 A;  4D6T H;  3BVO A;  3F7Y C;  2UUC B;  5CA0 B;  4FM2 A;  1QVG U;  3FKS G;  2X6C A;  5B1A B;  4N21 A;  1RFY A;  5LMN B;  3OTO B;  1YTF D;  2EIN C;  2QE7 G;  2W6J G;  1IBM O;  1ZL8 B;  2KQX A;  1SZX A;  5BY1 A;  4QPK A;  1D5A A;  3E8G A;  4O4I B;  3LDE A;  2Q5Z A;  4P30 A;  1F23 A;  5C8Y A;  4KL1 A;  4JV5 B;  4LNU A;  1AJP A;  4DV1 O;  1NR1 A;  1LUV A;  3ETQ A;  3GWO A;  4FZ0 A;  3CCE V;  4QE9 A;  2UU9 B;  1YSC A;  1GRJ A;  2CTR A;  2ZDI A;  1AJQ A;  1Q7Y W;  2F93 B;  4TV8 A;  1QLN A;  3WB2 A;  3RYF B;  5CBF A;  4DV5 O;  1ZSP A;  2XAG A;  4CH6 A;  4FFK A;  1QCE A;  3OGI B;  3CE2 A;  4J9Z B;  3CEI A;  2DWD C;  1Y66 A;  2JJ1 G;  2JEX A;  2RCV A;  4MVO A;  2FKX A;  2WAM A;  4B08 A;  1YI2 V;  1S0V A;  2OWO A;  3K9S A;  1JFF A;  2LFS A;  4DRX B;  2PZS A;  3A2F A;  1Q43 A;  1ENV A;  4MTF A;  4YJ3 B;  3ABT A;  2CDY A;  2JRI A;  1DF5 A;  1WP7 A;  2V4D A;  4AQY O;  3CSX A;  3DXR B;  1M4U A;  2UXD O;  1K33 A;  5BR8 O;  1BCC H;  3JAT B;  1COW G;  4RWU A;  1BMF G;  1T5E A;  3OR6 C;  3JYC A;  3ZRX A;  1OV9 A;  5AG2 A;  3DC6 A;  1NI8 A;  2X6A A;  3SYC A;  2UXB O;  2Y0I A;  5C93 A;  4J9Y B;  1Q8I A;  2CTP A;  3IAY A;  4RUF A;  2ITC C;  2AZ2 A;  4JAU A;  4U7O A;  5JQG A;  3K79 A;  3MHS C;  3RN4 A;  4GX5 A;  4X64 B;  1KB9 F;  2B5U A;  4B3M O;  1R3J C;  1TUB A;  3AG7 A;  3G6B A;  3STZ C;  4DR4 O;  5JJJ B;  4Q20 A;  1FXK C;  4UCV A;  3OUS A;  3QF7 A;  4NB5 A;  2ETN A;  2OTL V;  2KG7 A;  2Y69 B;  4B3T B;  1QU7 A;  1FKA O;  1Y74 A;  4RO2 A;  1DTO A;  1HNW O;  1I0H A;  1Z5W A;  1SZT A;  3AK3 A;  4B3R O;  4X65 B;  2B9Z A;  2KB1 A;  4JI6 O;  1H2L A;  3B40 A;  4MTG A;  1AR5 A;  1VF7 A;  3SYP A;  3AG2 B;  2KG7 B;  4BW9 A;  2ATK C;  4DUY O;  3OUF A;  1Q5O A;  2ODM A;  3O65 A;  4LFB B;  3F5W C;  2GV9 A;  4JI5 B;  4NXM B;  3HKE A;  3AK1 A;  4FLX A;  3GVM A;  3ABL B;  2DQ0 A;  1SQX H;  5GTH Z;  2YXL A;  4MT8 A;  1JQ0 A;  4WFE A;  4JI4 B;  4X1K B;  1FFX B;  1O9H A;  4JYA O;  2EIJ C;  3RVZ A;  1PNL A;  3AEI A;  4Z2W A;  4FLW A;  3RFR A;  1FFT B;  3K0D A;  3HKE B;  2NR5 A;  4YXW G;  2OT5 A;  3ETG A;  3ZHR A;  2GBO A;  1AIL A;  2R72 A;  1GN2 A;  4FPP A;  1WB7 A;  2V7Q G;  5LP6 A;  1BT8 A;  2K1E A;  1R3K C;  4MW3 A;  2Q4P A;  5EBM C;  1N33 O;  2IJH A;  2JDI G;  5B1O A;  1VF5 B;  3OEH G;  2EIJ B;  4G2K A;  4K0K B;  5KHI A;  1VF6 A;  4PI0 A;  1IXM A;  2QWO B;  4OX9 O;  4LF7 B;  1XMO O;  2DMX A;  2WLH A;  1LUW A;  1HR0 B;  1JR9 A;  1S5H C;  1F4N A;  5LP6 B;  1NTK H;  2HJF C;  2DYR B;  4PDM A;  4LFA B;  1GAX A;  4PA3 A;  5IYC O;  1YCI A;  4ASU G;  1SC5 B;  4J10 A;  2EIK C;  3ZHU A;  1OCO C;  2YID A;  3AG3 B;  1KBH A;  1A32 A;  4LP8 A;  1MZF A;  3LSU A;  3CP1 A;  4YIP A;  1KP2 A;  1PKX A;  1WAZ A;  4LF7 O;  2F1M A;  1N32 O;  2FL4 A;  2PGG A;  4PA7 A;  4JI0 B;  3RW0 A;  2UUA O;  2GTS A;  2EBO A;  2QWQ B;  1FJG O;  1FYJ A;  4HNA A;  1Q6I A;  4GX2 A;  2VWK A;  4ZOL B;  5B1B B;  4DV7 O;  1TVK A;  4B3S O;  2P4K A;  1BL8 A;  1Y74 B;  1QLE C;  3HKD A;  3VQV A;  1J5E O;  3VQX A;  2Y48 A;  3CS5 A;  4TV9 A;  1H8E G;  4PD4 F;  1Z5V A;  2B1I A;  2QSA A;  4O2B A;  3BFR A;  3TCU A;  3ZMU A;  1P84 F;  5LHG A;  1KEC A;  3JAR A;  4CH4 A;  5FL7 G;  2VS0 A;  4ZI7 A;  2ZE8 A;  4JYA B;  2WLL A;  3I5D A;  2G38 A;  4X62 B;  1TAE A;  1QLE B;  1P49 A;  1FFX A;  2P22 C;  1CP9 A;  3B09 A;  5IWA O;  1ROP A;  3J81 N;  1FD9 A;  5LXT A;  1F7Y A;  2CTQ A;  4X20 A;  3O9O A;  2F43 G;  5B3S B;  5KUK A;  2DYS C;  2ZIO A;  2AXT Z;  2XUM A;  4KXR A;  2EX3 A;  3X2Q C;  2PTM A;  2RJZ A;  3CB2 A;  2CGO A;  2A06 H;  2WLJ A;  4CS3 A;  1G6U A;  1NU1 H;  4JI3 B;  3CX5 F;  2ZNJ A;  5EBL C;  4XDK A;  5EK0 A;  2ZT9 B;  1NT2 B;  3ETE A;  2HVJ C;  1PD3 A;  5CMU A;  3BRC A;  4UVC A;  4EFE A;  4IHJ A;  2N05 A;  4FK5 C;  1P7B A;  1I94 O;  1I94 B;  3EHB B;  1N32 B;  1R1B A;  4O2A B;  4WF9 V;  2HJD A;  3JAS A;  3JAT A;  2R9A A;  2XAF A;  4NYK A;  3SPC A;  2BOC C;  1PM9 A;  4IL6 Z;  3L75 H;  1YTF B;  3EFF K;  1BHB A;  1I5Y A;  4I0X B;  3HB3 B;  3DTU B;  1FS0 G;  1VQ6 V;  1PP9 H;  2EZO A;  3LSQ A;  2VQE O;  3OTF A;  1XIL A;  3BY6 A;  4KP4 A;  3OMN B;  3T1H B;  5BZB A;  3W7X A;  2GHY A;  1M56 C;  1Q82 W;  1NKD A;  1MG1 A;  2DYR C;  3CME V;  3SR2 C;  3P30 A;  4CBC A;  4JYB A;  3U0Z A;  2ZE7 A;  3JCU Z;  1SQP H;  2M6Y A;  1NVP B;  3CJH A;  3WB0 A;  2R9R B;  4L87 A;  2F66 C;  1HDJ A;  3DC5 A;  4AIL C;  2UUB O;  4OPH A;  1YZB A;  3CPW U;  1Y76 B;  1K92 A;  4JYY A;  3UO3 A;  4CC6 A;  3E8F A;  2WA4 A;  2RN9 A;  4F6R B;  3AG4 C;  1IUR A;  2P5O A;  4DV1 B;  4QIW F;  4QGP A;  5B3S C;  1GN3 A;  4D7T A;  2UUB B;  3JAW B;  4DR6 B;  4X1I B;  4J7Z A;  4NXN B;  4X20 B;  3CRA A;  5B1B C;  2EIM B;  4XDJ A;  3ETD A;  3SJC C;  3MHH C;  3QO7 A;  1YEW A;  1VIB A;  4O4I A;  4QJF B;  5KHK A;  3D36 C;  3CD6 V;  3K0G A;  4PHZ A;  3H9V A;  4PJ0 Z;  5EYP B;  2ZD9 A;  3WG7 C;  3FB5 C;  3JAW A;  3OMI B;  3RYI A;  5IDJ A;  3ZS8 C;  3ZMS A;  1BZK A;  2QWR B;  2ZDI C;  3JD3 A;  5LA6 B;  3KCY A;  3QO8 A;  3U11 A;  3ABK B;  3T1C A;  1SER A;  2DN9 A;  4NTY A;  2O57 A;  2LP7 A;  5HFL A;  4UVB A;  3CC4 V;  3G4S V;  3CWB H;  5D5Q A;  3RYF A;  1THZ A;  2VQE B;  4LF6 B;  3J80 N;  3K06 A;  5KAI Z;  2W0F C;  3C90 A;  1EBO A;  4H0L B;  3E22 A;  1VQ8 V;  2RQ6 A;  1XHX A;  2Q7H A;  3SPJ A;  4J42 A;  4HAM A;  3H1H H;  5KAF Z;  2Z0A A;  3JSN A;  4O4L A;  1VF6 C;  1JFF B;  1K8A W;  4NTX A;  3E8B A;  4GCZ A;  2UXD B;  3OT7 A;  1X59 A;  4FLT A;  3W7S A;  1CPY A;  4BW5 A;  1BQZ A;  5KA5 A;  4MVQ A;  4JI3 O;  5IY5 C;  4AI8 A;  3MAQ A;  2DWE C;  1W0K G;  1M56 B;  2PI4 A;  1AI5 A;  1Y67 A;  3G80 A;  1PL0 A;  2FYU H;  4K3A A;  4FMT A;  4UXN A;  1EFR G;  5JVD A;  1H38 A;  4MW8 A;  5LHI A;  3VBB A;  4PDL A;  2ZM6 O;  1R6K A;  1YDX A;  4AHC A;  5LOV B;  1E1Q G;  3L74 H;  1VQ9 V;  1CEZ A;  3ZRS A;  2YEV B;  1S77 D;  4MVZ A;  5JQG B;  1R73 A;  1AB3 A;  2XOK G;  4FLY A;  4WCE V;  2A7W A;  1VQ5 V;  4YJ2 B;  4JTC B;  3MDS A;  4DUZ O;  3IC9 A;  1OHH G;  3B2E E;  4GZR B;  4LF9 B;  1M1K W;  1JA8 A;  1KQS U;  1M57 C;  4NXM O;  1K9M W;  1S5J A;  4LFB O;  4IIJ A;  5IE9 A;  4FJC C;  2QDO A;  1PNM A;  3K57 A;  1SA0 B;  4W4L A;  4I4T B;  5CA1 B;  1WB8 A;  2ARH A;  1XNQ O;  4DV3 O;  2XHB A;  4JAS A;  2CGN A;  3ZX6 A;  1R3I C;  1YVW A;  2YIB D;  4UCS A;  4I5S A;  4X62 O;  3A0R A;  3OMA B;  4MS2 A;  4LF4 B;  4NKG B;  2NN4 A;  3GWK C;  3RYH B;  2JGU A;  4OPA A;  4PI2 A;  4DW0 A;  1J95 A;  3BAA A;  4TQF A;  5LYJ A;  5FNV B;  2EUL A;  1IZ3 A;  3J7A U;  4JAV A;  4TOI A;  2KKW A;  4NR1 A;  1MMM A;  4WBN A;  4JI8 O;  3I55 V;  2QM7 A;  3P3N A;  1SES A;  2AW9 A;  4CS4 A;  4DK0 A;  4X1K A;  1FJG B;  4OGQ B;  1VQK V;  3ML0 A;  1PPJ H;  1IBL B;  2Q7G A;  3HKB B;  5KX5 B;  3WB1 A;  3UQ8 A;  2Y69 C;  2B1G A;  3SDL A;  2WPD G;  3MD0 A;  5L3B A;  3ZMT A;  2R70 A;  1MNG A;  1QHT A;  2QM8 A;  1F51 A;  4R8C A;  5KX5 A;  3K3W A;  4TV8 B;  1XBL A;  4F6E A;  2JGD B;  4E4E A;  3K5N A;  4H13 B;  2QEX V;  1DLB A;  4DR2 B;  1Y4M A;  2P4V A;  3JAS B;  1OCO B;  2YDE A;  1W2B U;  4ZHQ B;  5BMV A;  4CC5 A;  4IGG A;  4DV2 B;  1N33 B;  4P9O A;  3T1Y B;  4TUY B;  4UCR A;  4GKJ B;  2Q73 A;  2P90 A;  1XMO B;  4UUJ C;  4DV5 B;  1KYO F;  4O4H B;  1RSO B;  5D5P A;  4LCU C;  1WA8 A;  4FLV A;  2YEV A;  3I56 V;  2ADP A;  3DSQ A;  1TGO A;  3BA9 A;  4PA4 A;  5IJ0 B;  5K1X A;  3L9D A;  4J80 A;  4DV2 O;  2P6J A;  2GTA A;  2XT9 A;  3H01 A;  4X8A A;  1B6Q A;  4HNA B;  2HFE C;  2Q8V A;  1H2K A;  2FB5 A;  4JI1 B;  1D5N A;  1HNX B;  2AHZ A;  3OGC C;  2DOS A;  2DQ3 A;  4UB6 Z;  1SQB H;  5H6R A;  1WPB A;  4DR3 O;  3CRQ A;  5L3E A;  5B5E Z;  2IH3 C;  2YXY A;  2X0L A;  3JAR B;  2GSM B;  2Y4U A;  2F4V B;  1RPR A;  3CHX A;  3LNM B;  1XOU A;  4NTW A;  4I55 B;  3ZIA G;  2Q68 A;  4LR3 A;  5LGT A;  4YHH O;  5FNV A;  5KHG A;  4EB6 A;  2ZR2 A;  1BHA A;  4LNU B;  4ZI7 B;  4JI8 B;  1W59 A;  1NVP D;  4HBN A;  5EIB C;  5ITZ B;  4WBN B;  1V9P A;  3TK1 A;  4LFC B;  4WFG A;  4JF3 A;  3FAV A;  3CXH F;  4PA9 A;  1US6 A;  4EB6 B;  2LO1 A;  3JD1 A;  4BR6 A;  4QPJ A;  3E35 A;  1KKD A;  3HKB A;  1N4C A;  5LXT B;  2DYS B;  1SKV A;  2PYL A;  5H6Q A;  2UXB B;  2ZIM A;  3FAV B;  2BE3 A;  2OYQ A;  1QVF U;  1S72 V;  3K08 A;  1SS3 A;  2CH7 A;  3C3S A;  1MA1 A;  4LWS A;  4U3J A;  3ASO B;  3GB7 C;  2OCH A;  4H33 A;  2JIZ G;  4CZZ A;  3N2G A;  2JS5 A;  4K8Z A;  4K0K O;  1MOF A;  4R6Z A;  2ILM A;  4O4J B;  3FX7 A;  4GYC B;  2AGA A;  1ZX3 A;  1X4T A;  4ZHQ A;  5BMV B;  5CB4 B;  2JJ2 G;  4IHJ B;  5BR8 B;  2PY5 A;  4YJ3 A;  2LGW A;  2WWW A;  3E89 A;  1J5E B;  4TUY A;  4OXS A;  1QR8 A;  4DR2 O;  4EEQ A;  5J2T A;  2ZE5 A;  5J2U A;  4QE7 A;  4H37 A;  4ZIB A;  3IJ4 A;  3HPL C;  4GKK B;  2E5L O;  1PNK A;  1QR9 A;  1BGY H;  3UCS C;  1Q86 W;  2L35 A;  3CCS V;  3T1Y O;  4JI4 O;  2V1D A;  5J2U B;  3CRC A;  5LOV A;  2YS8 A;  5IJ9 B;  3TET A;  2QM4 A;  1H2S B;  1MZE A;  1VAR A;  2XND G;  3N2K B;  3K04 A;  5LGN A;  3L70 H;  2OCC B;  1K7D A;  4TSF G;  2X7R B;  1AI4 A;  3K5M A;  3AK2 A;  4IYI A;  1FXV A;  3H1I H;  5L3G A;  3RYC A;  1YHQ V;  3HKC A;  3HR0 A;  1GK9 A;  2QR4 A;  3OTO O;  1ZLZ A;  3CMA V;  1N8R W;  2JEU A;  3WFV A;  2D3O W;  1M90 W;  1SA0 A;  4LFA O;  4JI2 O;  2IM9 A;  4I9Q A;  1NJI W;  1H8H G;  4WFB V;  1O9G A;  1ZWI C;  4CS2 A;  1RPO A;  3ZRW A;  4I50 A;  4OX9 B;  3SJQ C;  3AG4 B;  4MVR A;  4YIO A;  1BE3 H;  2H8P C;  3WU2 Z;  1W0J G;  3OM3 B;  2F4V O;  3A8T A;  4P2Z A;  2Q0O C;  1ZL8 A;  5JH7 B;  4NXN O;  2C2A A;  4F6R A;  3ZRW B;  2Q7E A;  4DV4 O;  1NH2 B;  1EZJ A;  4YY3 O;  1KD1 W;  3BCC H;  2XAS A;  4DR7 B;  1HNX O;  4W4K A;  3AG1 B;  5CN0 A;  4UV8 A;  2QA4 V;  5IY5 B;  4LF4 O;  2YIC A;  1XNR B;  2F23 A;  5CA0 A;  5B1N A;  1IX9 A;  3KCX A;  4J11 A;  1B06 A;  1JOY A;  1LNQ A;  1NR7 A;  5FPO A;  4X89 A;  5KMG B;  3BEH A;  4C7U A;  5CBH A;  1R6T A;  3SGI A;  4WFA V;  2PF4 E;  1IBK B;  5C8Y B;  3G6E V;  1GO3 F;  1MSD A;  5GON A;  3X2Q B;  3ABM B;  4P9P A;  4GKJ O;  3JAK A;  4MSW C;  2E74 B;  4FFB A;  1H2N A;  3RBZ A;  4ZBM A;  1NTM H;  3KKY A;  3OAA G;  5EIB D;  1YXB A;  2GUZ A;  4PV1 B;  2HR3 A;  3KG2 A;  3NXS A;  2E3C A;  3TJT A;  2EJ7 A;  4XBF A;  3JAK B;  1K73 W;  4WFH A;  4UB8 Z;  4JZG A;  4B3M B;  3CCJ V;  2UXX A;  4X64 O;  4GT1 A;  1QNM A;  2UU9 O;  2YXH A;  1V54 B;  4O4H A;  5LMU B;  1D2D A;  5H2F Z;  3E8H A;  5LBQ A;  5JVD B;  4X1Y A;  2QGN A;  3P32 A;  1E79 G;  1IVS A;  3H1L H;  4PEL A;  3RYC B;  3AG3 C;  4L8J A;  4F4L A;  3EXA A;  3E2E A;  3PN1 A;  2XTA A;  4AQY B;  4DV6 O;  2N74 A;  3JD4 A;  4K8X A;  3FFQ A;  4X1Y B;  2ZE6 A;  4DK1 A;  4O2B B;  2LFR A;  2E75 B;  5DEC A;  1YIJ V;  3UKM A;  5GW7 A;  1AR4 A;  5IYZ B;  2VQF O;  1FAF A;  1JPX A;  3ZHS A; 
#chains in the Genus database with same CATH homology
 3L71 H;  4PD4 F;  3L70 H;  1NTM H;  3H1H H;  1SQQ H;  4D6T H;  3CWB H;  2FYU H;  1P84 F;  3L72 H;  1L0N H;  1SQP H;  3L75 H;  1NTZ H;  1SQB H;  2IBZ H;  3BCC H;  4U3F H;  2A06 H;  3L73 H;  1EZV H;  1NU1 H;  1BGY H;  3CX5 F;  3H1I H;  1NTK H;  3H1L H;  1BE3 H;  3L74 H;  1BCC H;  5KLV H;  1PP9 H;  1SQX H;  3H1J H;  1SQV H;  1PPJ H;  2BCC H;  1KYO F;  1KB9 F;  1L0L H;  3CXH F;  3TGU H;  3H1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...