4JI2O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji2O00
1HNWO 2VQEO 2JRIA 1R6TA 4DV1O 4JI6O 3M8AA 4OPAA 1G1XB 4DV2O 1N34O 4LF9O 4DR2O 5IT9N 1D2DA 1KUQA 4JI7O 5H5NA 1YZBA 5LMUO 2UUAO 1IBLO 4DR6O 1AB3A 4DR4O 2FKXA 4DR3O 1HR0O 3O65A 4DV0O 3F5TA 2DOSA 5A2QN 4JI2O 4JV5O 2DJVA 4JI4O 1XMOO 1AILA 4YY3O 4LFBO 1N33O 4DR5O 5LMNO 3RT3C 3J80N 4DUZO 2HHHO 2UU9O 4X64O 4B3MO 2UXDO 2ZKOA 4X62O 1IBMO 4DV4O 3J81N 4GKJO 2VQFO 5BR8O 2UXBO 4OPHA 4JI5O 2UXCO 5FLXN 5IWAO 5LL6Y 1FKAO 1A32A 4LF4O 2F4VO 1FYJA 4AQYO 5BXZA 4DR1O 4JI1O 4B3SO 2ZM6O 4DV3O 4JI0O 2E5LO 4LF8O 4KHPO 3T1HO 2UUCO 4DR7O 2N74A 4YHHO 1HNXO 4JI3O 1DK1A 4A5UB 1R1BA 4X65O 2UUBO 2AGAA 1I94O 4DV7O 5BY1A 2Z0AA 4X66O 4B3RO 3R66A 4LF7O 1N36O 4OX9O 4JI8O 3SDLA 1N32O 1HNZO 1NS1A 3JAMN 4NXMO 4K0KO 4GKKO 1IBKO 3T1YO 1XMQO 1X59A 4DV6O 4DUYO 3OTOO 4NXNO 3J7AU 1XEQA 1FJGO 1J5EO 2LW7A 4LFCO 1XNRO 4LF5O 4LFAO 4B3TO 4LF6O 1XNQO 1F7YA 4JYAO 4DV5O
chains in the Genus database with same CATH superfamily
1AI6A 1NKDA 4EFBA 1Q81W 3JSLA 4UB6Z 1H2NA 2PI5A 2JRIA 2IJIA 3EHBB 1AP6A 5E1AC 1TA8A 2GTAA 3AG2B 5J2TB 1VF6A 1VQLV 1AI4A 1D5NA 2JDIG 4GKKB 3B2EE 3SJAC 2FMLA 3P30A 4DUYB 1NTKH 5IJ0B 5ITZA 4IYIA 2XTAA 4LF5B 2DJVA 2PTMA 3E8BA 1FXHA 4PI2A 3J80N 4JI6B 2HHHO 5CN0A 1XDCA 1DF4A 1H2SB 1FAFA 4H44B 3FB6C 2B5UA 3ABMB 2P7TC 3H1JH 3J81N 4JI7B 1L8DA 3FB8C 2IM9A 1JJOA 3B40A 1RFYA 3ETEA 4P9OA 5IDJA 1Q43A 2ZIOA 4LWSB 4LH6A 5FLXN 5LL6Y 1RPOA 2HJFC 2JGDB 3BABA 4FZ1A 4MVMA 5GTHZ 4PA4A 4DUZB 2BTQA 2A9HA 2P22C 4ABMA 5LXTB 2CH7B 3K58A 2QTSA 3N2GB 5CB4B 4PDRA 4JF3A 1M90W 1JA8A 5KHIA 4UVAA 2Q7GA 1W0KG 3JATA 3THOA 5GONB 2Y4UA 1AVMA 1SETA 1AI7A 2F95B 1WA8B 3CJHB 4FPPA 2JS5A 5B5EZ 3CC4V 4J10A 3U11A 4WFFA 4X8AA 1ZSPA 5IYDO 4X66B 4LF7B 3OEEG 4OPAA 1EZJA 5K1XA 4QPJA 1F4NA 2L6LA 3SPGA 1YEWA 1K73W 4DV0O 3JD2A 3F5TA 2LGQA 1M56B 5BZBA 2YXLA 2Y48A 5A2QN 5EZYA 4JI4O 2HFEC 1EN4A 3F7VC 4Q20A 3BA9A 3FYEB 4MVUA 2XUMA 4X1KA 4YJ2A 2QM8A 2FTKA 2ZKOA 3GWKC 2EILB 1K7DA 2JVDA 1S77D 5E79Z 4PJ0Z 1VQMV 5LOVA 3F5WC 3TGUH 4WFAV 5KA5A 3RN4A 2AW9A 5BMVB 2LW1A 1QU7A 5CBFA 4EB6A 3ZCCA 4ZI7A 1A32A 1FYJA 4X9QA 1MZEA 1SQFA 1KBHA 3ZRVA 1WLEA 4AILC 3D36C 1GTOA 4DK0A 1KKCA 3OGCC 1JMKC 3LUTB 3JSNA 1S0VA 1Y74A 2ZIMA 3HKDB 3N27A 1K4CC 2OIGA 4NXMO 4K0KO 3FAVB 1B3QA 3CPWU 3C90A 2LQTA 5JH7A 4I55A 4RUFA 3CCVV 2VRZA 1V55B 3BHPA 5EIBD 4O4LB 3K57A 3T1HB 2A79B 3CRRA 1PL0A 1BCCH 4KL1A 1G1XB 4U7OA 1Q6IA 5CA1A 1M1KW 4J7JA 1YSCA 2JEUA 3RYFA 4TT3G 1XMQB 3G6EV 1Y67A 4W4LA 2ODMA 3DTUB 2LGWA 4G2KA 3U10A 4PA6A 1KP3A 1R3KC 4FM2A 3K04A 4LFAB 2YS8A 3ZBHA 4LFBO 2QWQB 1N33O 1QHTA 1SZTA 1MG1A 2QM7A 1FXVA 4CS2A 3E83A 1BZKA 2ZCEA 1IBMO 1YDXA 2OWOA 2ZE6A 4ZIBA 4FM1A 3QVNA 4RUEA 3TETA 4DR6B 1SZXA 3SJQC 5DECA 3A8TA 2BE3A 2QKSA 5LGNA 1SERA 3OAAG 1JX9A 3ASNB 3FKSG 1PM9A 2ZDIC 3B4SA 3ETQA 5BXZA 4HYOA 4WBNA 4JI1O 2OTLV 3BA8A 4DV3O 1VQOV 3STZC 1VMGA 2X0LA 3E22A 3L75H 4X20A 1DK1A 4GKJB 4MW8A 3UKMA 5BY1A 5HFLA 1JFFB 1FXKC 3L73H 4IL6Z 1NS1A 1Q5OA 2A7WA 2PI4A 4X1YA 1XQ8A 3APOA 4D7SA 3DC5A 4O2BB 1CP9A 1GN4A 2OCCB 2PY5A 2E75B 1I5XA 2Q67A 4IHJA 2ILMA 5KUMA 2GV9A 3T1CA 3SGIA 3P3PA 2V1DA 4E4EA 2P5OA 4JI3B 3W7XA 1HNWO 1LUWA 1CPYA 1L1FA 1NVPB 2EIMB 1K33A 4DW1A 4F6RA 4DV1B 3MAQA 1N34O 5DM6V 4FZ0A 4TV9A 2VWJA 5H5NA 5B1AC 1YJNV 5KUKA 1MA1A 5KAIZ 3F7YC 2ZNJA 2R72A 1IDSA 4UCSA 2GBOA 2FYUH 3LNNA 2WLKA 5J2UA 1ZLZA 4P30A 2PYLA 2X7RB 4IIJA 4CBCA 5FPOA 4LF6B 1QNMA 1S3JA 2IU0A 4DV5B 3IGAC 1YHQV 1XMOB 1IZ3A 3CCEV 3FB7C 3RYCB 2F1MA 5LMNB 1W2BU 1B06A 1WPBA 5AG2A 2WLLB 2BTOA 4O4IA 4ZHQB 4FLXA 3QTCA 4X62O 3AG4B 1L0LH 3P3NA 3E8HA 2UUAB 3SPJA 4UVCA 4H13B 5L3CA 4DR3B 2JEXA 1ZL8B 4JI5B 1L0NH 1XOUA 4LF4O 5KHHA 1NR7A 4YY3B 2Z3YA 1BGYH 4WFHA 1PP9H 2YIDA 2XT9A 4PDLA 4DR7O 3HKBB 1FFTB 2NN4A 3ABKB 4R50A 2XAHA 5BR8B 1AR5A 4U3JB 4OX9O 3D8CA 1RP3B 1HNZO 3ZHVA 2EJ7A 2UXCB 2CDYA 3RYIB 1VQ6V 4KFMA 1H38A 3T1YO 3HB3B 1TVKA 3JAKB 4MTXA 3N2KA 4B3SB 1VQ8V 5L3DA 1K8AW 3JALB 3CD6V 2ZDIA 3SYCA 2NLJC 1VF6C 1F4MA 1S5LZ 2Y69C 5CA0A 4RO2A 2Q9LA 2RNBA 2Q6AA 3ASOB 2F43G 3OUSA 1VF5B 1VP7A 1YCIA 2RQ6A 3HKEB 5FL7G 4PHZA 2L35A 4ZOLA 2NNUA 1FXKA 3ICXA 2QSAA 1XREA 3ZN0A 1H2LA 1QBZA 1I5YA 1TGOA 1S72V 4KUMA 5JQGA 3OT7A 3DC6A 3T4DA 2UXDO 1U97A 4DV2B 5LGTA 3IJ4A 1D5AA 3DXRB 1SRYA 5LA6A 1ORQC 1SQQH 3VBBA 2YXYA 3KCYA 3I55V 2ZE5A 1Q86W 3AG1B 2QKAA 5LBQA 4BW5A 4J9ZB 5CBGA 3ZRWB 1GM9A 3JYCA 4JI0O 3OFNG 1KYOF 3QO8A 2KKWA 4PDMA 4CC5A 3L70H 2WLIB 1R1BA 1BL8A 1I94O 1TUBB 2Z0AA 4TV8A 4YXWG 4GUNA 2O57A 4I9QA 3E8FA 4P9PA 4CZZA 2WA3A 3FYIB 4IYHA 1GK9A 1P7GA 2YSUB 3AG3C 3QO7A 5TISZ 4NR1A 5IY5B 3X2QC 5C93A 1XL6A 1SA0A 2ZE8A 2XAGA 1J5EO 1XL4A 2XAFA 3JD3A 4FLUA 1M57C 4JYAO 3Q4HA 1S5JA 1HNXB 1P49A 2JJ2G 3HKCB 4X1IA 3HPLC 4HZ3A 5IJ0A 1RM1C 5IT9N 4YJ3B 1YVWA 3UM7A 4EFEA 5KX5B 1IBLO 3L9DA 3OTOB 2X6AA 1AB3A 2WLHA 4PI0A 1HWYA 4MTGA 5B1BC 3JD1A 5FNVA 4LFCB 3GVMA 5IJ9A 1IVSA 2EULA 3CE2A 3S3XA 1K5SA 2H8PC 3TXQA 1AP5A 3RT3C 2BSKB 2EBOA 1OCOC 4FFBA 5KMGB 2DYRB 3DGEA 1PNLA 2A0LA 5K1PA 3ZMZA 1MABG 4I50A 2MK3A 4JYYA 5L3FA 1Z2GA 1Q8IA 5EIBC 2F4VO 1KU9A 2UXNA 2YIAA 4DR5B 4GX1A 3ABLC 4UB8Z 1NT2B 5F2VO 3N2GA 1QCEA 3PJSK 2MW2B 3B09A 1WN7A 3U0ZA 4X65O 3JAWA 2UXBB 1Y76A 4TSFG 2ZQMA 4JI8O 1DTOA 2JJ1G 3ZHTA 2FB5A 1PD3A 4AHCA 5IWAB 4PD4F 4F6EA 2ATKC 1NTMH 2DWEC 1IBKO 1XHXA 3JD4A 1JPXA 3SYPA 3BRCA 4NXNO 3OD4A 1MSWD 4DR1B 1FJGO 1V9PA 1JJ2U 4NB5A 4B3TO 2DWDC 4MS2A 4YHHB 4MTOA 5ITZB 1URFA 2QGNA 3PN1A 1NBMG 4BIUA 3E89A 4O4JB 1N32B 1OCZB 2WLJA 1KB9F 5LMUO 4N21A 3JASA 2AZ0A 4CH5A 4DR4O 3QNEA 3B8MA 2EX3A 2ZINA 1BT8A 4LR3A 3G4SV 4FLWA 3ZN1A 4JV5O 3H1KH 1S5HC 2CK3G 3OR7C 3RFRA 3LSSA 3IC9A 1GN2A 4DV4O 4Q6GA 2HG5C 3OE7G 2VQFO 2Y0PA 2YC0A 4NTXA 3UCSC 4NVPA 2LFRA 1BS3A 2GHYA 2ZR2A 1JVMA 5KHKA 4MVZA 1P4RA 1VQ9V 4LC1A 3TJTA 2K1EA 1GM7A 3DSQA 4WFGA 1E79G 2B1GA 4LBEC 5JVDA 1EZVH 4DYLA 3ZMSA 2E5LO 2UU9B 4RWUA 3LDEA 2EIKC 3HKDA 3OMIB 1HP8A 2CTWA 2V7QG 1UJWB 3VQWA 2ITDC 4J11A 2DQ0A 4JGSA 4GKKO 3CCJV 4AQYB 4UCUA 4UUJC 4DUYO 3K59A 1QQCA 3WU2Z 1VIBA 3ETDA 2ZM6B 1PKXA 2HR3A 1OCCC 5C8YA 1IX9A 3UO3A 4LF5O 3G6BA 1F7YA 2UUBB 1THZA 5B3SC 4JI6O 5EZYB 1XI1A 2V4DA 5IYCO 2EIJC 3T2MA 4JI7O 3BAAA 1Y66A 4TQDA 4DV6B 4X1KB 4YJ2B 3ZMVA 2LO1A 2P4KA 3JCZA 5LOVB 3CEIA 4JI2O 1HDJA 3A0RA 3RYHA 4DUZO 4EB6B 4ZI7B 3BVOA 4DR2B 2C2AA 2A06H 5LYJA 1OJHA 1ZUQA 3FFQA 2QKCA 3ZMUA 1QR9A 2Y4TA 3NXSA 3K5OA 1ENVA 1K9MW 4Z2WA 1WPXA 5KAFZ 3CXCU 3G80A 4X64B 2X6BA 1Q82W 5JH7B 4I55B 2W0XA 1CXZB 2IW5A 2WSSG 5CBHA 3A2FA 4X66O 4LF7O 1SF9A 4C7UA 4AI8A 5L3BA 3L72H 3LDCA 2CTPA 1OCRC 3WG7C 5DEDA 2YICA 2OYQA 4O2AA 2Q7EA 1OZ0A 5CA1B 3S3WA 1K34A 5EC2C 3RYFB 2UUCB 1EN5A 3KZIZ 1SC5B 3D3QA 3LSQA 4UCOA 2K9PA 4CH4A 2Q73A 1GO3F 4DV7B 3C3SA 4D6TH 1N36B 3M8AA 2HVKC 4NTYA 3SJCC 4FMTA 2Q0OC 1KQSU 3O9OA 1D2DA 1KUQA 2AHYA 3JCUZ 3W7WA 4O4HA 3UT5A 5GTIZ 1KMIZ 4HNAA 5EYPA 2YIBD 1QLEC 1XILA 1EBOA 1R3JC 5KA6A 4B08A 4GX0A 4J42A 4JZ2A 1NVPD 1XNRB 5CMUA 1N4CA 4MVSA 4R6ZA 1XNQB 2OIEA 1ZTEA 2VWKA 2HEPA 4TUYA 4CC6A 2F93B 4ZHQA 2VQEB 3RVYA 4QPKA 1TUEB 1YXBA 2B9ZA 1V54C 4BW9A 3M99B 4WBNB 2Q4PA 3ZMTA 5LGUA 2DMXA 2Q0AA 2DYSC 3H9VA 4OPHA 2JGUA 4X20B 1Y6XA 4GYCB 2DW4A 4F4LA 1R6KA 4DK1A 4OGQB 4QE7A 2XAQA 3E35A 2D2CB 2R9IA 3GB7C 1K92A 1JR9A 3EFFK 5DN6G 1LUVA 4B3MB 4BIZA 3T1HO 4U7NA 1H2GA 4RQFA 4K3AA 3CMAV 5KHJA 4J80A 3AEIA 3CCMV 3K79A 4IHJB 1Q6HA 1GN6A 2AHZA 3CS5A 4QJFB 2HJDA 2H94A 2P06A 1RSOA 3EXAA 1NH2D 1Q7YW 1XMQO 1IXBA 3OTFA 3AG2C 2CAZC 1NH2B 1HW7A 1U96A 4LF8B 4XDJA 4KHPB 4LFAO 1GRJA 2BCCH 1SESA 2P90A 2Q8VA 1SQPH 5FPRA 1CEZA 3ETGA 2KG7A 4B3RB 5J2UB 3ZS8C 2ZXWC 3CB2A 4IIJB 3P32A 5A9GA 4LNUA 4LF9O 2UXXA 2YEVA 2ZT9B 2OTJV 1VARA 1P84F 2Z5UA 3K06A 4DR6O 1FFXA 1IXMA 3TXSA 3K03A 3ABMC 1IBLB 4O4IB 4TQFA 1GAXA 4JASA 3QG5A 2DOSA 5JCOC 1AR1B 4LCUC 1AILA 1WB7A 3G67A 4MW3A 1BHAA 1I7FA 1VF7A 4JTAB 3WB2A 2EZPA 3KG2A 5EBWC 5EC1C 4I0XA 1RPRA 3ZX6A 3WFVA 4GKJO 4PELA 1R73A 4X88A 2GUZB 2RDCA 1WJZA 1MNGA 4CS3A 3JARA 4H37A 3C3TA 4R8CA 1M5IA 2ZNIA 3SJBC 3R65A 4UV8A 3UO2A 2HHHB 2M6YA 1TUBA 3ZIAG 1MOFA 2HLDG 4K35A 1YIJV 3H01A 4JI3O 1TVKB 5B1OA 2F23A 3N2KB 2EZOA 4IT5A 3R66A 2F66C 4G28B 4MVRA 3SDLA 3KKYA 3JAMN 5CA0B 2IJHA 3APQA 5IYZA 3IAYA 2QJ1A 2XOKG 3ZHSA 1UPGA 1FD9A 2EINC 4EKWA 5LP6A 4WFBV 4LH7A 4FVMA 1Q6UA 4DO2A 2QEXV 3K5LA 4LF6O 5LHIA 1NR1A 4ZOLB 4DV5O 1FXKB 3B8NA 3QO5A 1WAZA 1M56C 4PV1B 4FIPC 1Z5VA 3L71H 5JQGB 2QM4A 4D7TA 1YITV 4DRXB 2AXTZ 5B1NA 4I4TB 4N23A 2UUAO 1KP2A 3G71V 5LMUB 2EILC 4CH6A 2FKXA 4DR3O 3WB0A 5L3GA 4QIWF 5LA6B 1YTFB 5J2TA 4YY3O 1G4YB 4HAMA 1B04A 1WP8A 5B1AB 1MMMA 3CXHF 4UV9A 3SPCA 2B1IA 1YJ9V 2KSDA 2OT5A 1GKFA 1WNSA 2EJRA 4HBNA 2QWOB 2DQ3A 2YXHA 2CE4A 2VQFB 4JTCB 5BR8O 3SYQA 1QVFU 4ZBMA 2QWNB 2ZD9A 1SQXH 4DV0B 4B7EA 3LNMB 2UXCO 2WPDG 2ITCC 4X89A 4EEQA 1H8EG 4TV8B 4JI4B 3H1IH 2LFSA 4B3SO 5JCOA 3OMAB 2GTSA 2N74A 4LWSA 2YI9A 2WA4A 4BWAA 1XBLA 1SA0B 1V55C 2CUGA 1KD1W 2JGDA 3CMEV 1H2KA 2W6JG 4B7KA 3Q4HB 4X1IB 4J7KA 2GDSA 3K08A 1X59A 4LP8A 3OGIB 2CH7A 5LXTA 3RVZA 5CB4A 4GZRB 3CRAA 3SYAA 3D3IA 1KKDA 4O4JA 2ZXWB 5GONA 1TAEA 5FNVB 4I5SA 5IJ9B 3M7MX 1WA8A 3LSUA 4DV2O 4FLYA 4UCTA 3FX7A 4H33A 4NXMB 3CJHA 1Q90D 4K0KB 2LJ2A 4FM0A 2DE0X 2XNDG 5H6QA 1HR0O 1S76D 4FFBB 3O65A 4QNHB 2Y69B 1Z5WA 1X4TA 1BMFG 3E8GA 1VQPV 2WWWA 4JI2B 4I50B 3K5MA 3W7SA 3MHSC 3TCUA 2Q69A 3ASNC 3E2EA 5H2FZ 4DW0A 1F51A 4CS4A 4FK5C 3FD9A 2JIZG 5JJEB 3VQVA 5J9PC 4GX2A 1DLBA 4PA3A 2E74B 1NJIW 1FKAO 2D3OW 1VQ5V 3JAWB 1Y76B 3CCSV 4LFBB 1N33B 3CC7V 2XHBA 1ZWIC 3MD0A 5BMVA 1EN6A 2OCCC 1BQZA 1IBMB 3K9AA 1HNXO 1PL4A 2AGAA 2BTQB 4FLZA 1R6NA 1MSDA 1ZAUA 4GCZA 1BQ0A 5D5QA 2EIMC 2EINB 4BR6A 3OTOO 1JQ0A 1K3EA 3J7AU 4ASUG 3JATB 4JI1B 2LW7A 4LFCO 1E1QG 4DV3B 2HKOA 1KC8W 1XHZA 5IYBO 3JASB 1PNKA 2XAJA 3CCQV 3FAVA 5LHGA 1PV0A 1R6TA 3I5DA 1NI8A 2PUSA 3AG3B 4RQEA 3X2QB 2DN9A 4O4LA 3TK1A 4PA9A 1AJNA 3CCLV 1M57B 3BY6A 3RBZA 3AG4C 5CA3A 3ZRXA 2NR5A 4JYBA 3OW2U 4IGGA 3CCRV 2ADQB 4BAYA 4QE9A 1HNWB 1RM1B 4DR5O 1G6UA 3ZHUA 1VQNV 1N34B 1ZX3A 5B1BB 3K0DA 5GW7A 1VEWA 4ICGA 5JVDB 4FFKA 1JOYA 2QR4A 2UXBO 2PYJA 2W6IG 2JS3A 3ABKC 3CRMA 4MT8A 4WFEA 3ZJZA 5IWAO 1MZFA 1SQVH 1DF5A 1OCOB 1QR8A 3CCUV 4DR1O 1XUQA 4YIPA 1H8HG 3SR2C 3VQXA 3OEHG 2LP7A 5JJJB 3K5NA 4YHHO 4X62B 1QVGU 2RN9A 3OUFA 4MVQA 4K8XA 1EM1A 1T5EA 5C8YB 5D5PA 1SS3A 1N32O 3SPHA 1US6A 3GWOA 4OXSA 3ZEDA 5KHGA 4FLTA 3ABLB 4LF4B 1Y74B 3ASOC 3WB1A 5EBLC 3KCXA 1NU1H 1BHBA 1K97A 4W4KA 4DR7B 4MTFA 1JFFA 5JWPA 2KQXA 4O2BA 4OX9B 3CRQA 4NYKA 1HNZB 1E1RG 3W7UA 4LF9B 1M9NA 1AJQA 2XASA 3RYHB 1YF2A 3T1YB 2YIBA 1VQKV 4JYCA 1JCHA 2VS0A 4Z1MG 1NQTA 3ZRSA 2CGOA 2ZR3A 5LYJB 2Y0IA 1GMGA 1LNQA 4BIOA 1N0NA 4P2ZA 2IU3A 3CHXA 2UU9O 3AG1C 1WP7A 2PF4E 2CGNA 1K5QA 4K8ZA 1IURA 5HFMA 3BCCH 4MSWC 1BE3H 4MVOA 1J95A 3H1HH 3VQYA 1VQ7V 1B6QA 2ARHA 2R9RB 3AK1A 4L87A 3B77A 2QTOA 5L3EA 3RYCA 2IBZH 3W7TA 3ML0A 2E3CA 1GH6A 5JJNB 2E76B 2CTRA 2Q5ZA 2WLLA 4AQYO 2RJZA 1QLNA 4L8JA 3OR6C 3MHHC 2ZM6O 2UXDB 5IY5C 1G8MA 4O2AB 1ROPA 4CH3A 1H2MA 1GN3A 1ZL8A 2ADPA 3CYOA 1YI2V 2QWPB 2UUBO 2OCHA 1W0JG 3E22B 4NKGB 3D36A 2HP8A 4G27B 5LP6C 2P6JA 4JAUA 2YUAA 3HKBA 4DV6O 3SPIA 3CRCA 2QA4V 4X1YB 2EIKB 2YDEA 1GM8A 2R70A 4XDLA 1R3LC 4JI0B 4O4HB 4U3JA 1Y4MA 3UT5B 1SQBH 4HNAB 4UVBA 5EYPB 1M93A 1O9HA 2P4VA 3RYIA 4GLXA 3CC2V 1I94B 4KP4A 1SQGA 4J7ZA 3JAKA 4RAIA 2WLNA 4DR2O 3BFRA 3BPZA 4TUYB 3JALA 4F6RB 4UFZA 2BOBC 2QE7G 2Q7HA 1OCCB 4TV9B 2DYRC 2WAMA 2RCVA 3BEHA 1UFIA 3CWBH 3UQ8A 4WCEV 1J5EB 4DXWA 5B3SB 3AK2A 4JYAB 2Q68A 4XBFA 2PGGA 5LHHA 2RMKB 2G38A 2EIJB 1VQ4V 3HKEA 2N05A 2JK5C 4I7ZB 4X64O 4QGPA 2GUZA 2KB1A 4J41A 4PDVA 2X6CA 4JTDB 4KXRA 2IJKA 2IH3C 2PZSA 1AJPA 3ABUA 1F23A 2P67A 1COWG 5KLVH 4R7CA 4JZGA 4J9YB 3DXRA 1RSOB 3K9SA 2UUCO 1W59A 3RGBA 4XDKA 3CX5F 2QWRB 3STLC 4YIOA 4DV7O 1N36O 5B66Z 3EVKA 3AK3A 5EK0A 3ZRWA 4JPRA 2QDOA 2F4VB 3RW0A 2KG7B 2WLIA 1OCZC 4LNUB 3ZHQA 3FB5C 3RWRD 4ZKIA 2YEVB 1XNRO 2FL4A 3IFXA 3AG7A 1WB8A 4UCVA 1XNQO 3QF7A 4WF9V 2GSMB 1FFXB 4X65B 3LDDA 3ABTA 1N0JA 2VQEO 5H9CA 4DV1O 1OCRB 4DRXA 2IJJA 3WG7B 2H3OA 4I4TA 3E86A 4JAVA 4JI8B 1YZBA 1IBKB 1AROP 4UXNA 1AI5A 2WLMA 3SYOA 4NXNB 3K0GA 1PNMA 3HKCA 4H0LB 4I0XB 2ZE7A 1FJGB 2HVJC 4NTWA 1HR0B 1FPOA 2AZ2A 3A0HZ 1FS0G 5IE9A 4B3TB 1XMOO 3CP1A 4YJ3A 5LMNO 1OV9A 5KX5A 2YI8A 1R3IC 3VOUA 4Z1VA 4B3MO 1QLEB 1I08A 3JARB 1N8RW 3H1LH 4FLVA 3HR0A 1O9GA 1AR4A 4TOIA 4U3FH 3IC7A 4FJCC 1YTFD 4DR4B 1LR1A 2N04A 4JI5O 4GT1A 1PPJH 3OM3B 1EFRG 2BSKA 4JV5B 1OHHG 5KMGA 1I0HA 1V54B 2ETNA 1NZ6A 3NR7A 4LF8O 4KHPO 2DYSB 3MDSA 3ZHRA 5IYZB 2A3QA 3T4ZA 4DV4B 5H6RA 4A5UB 2CTQA 4UCRA 1KECA 3L74H 5LP6B 4B3RO 2IH1C 1K4DC 1M4UA 2R9AA 1DGSA 3A0BZ 1Q3EA 4I9WA 1NTZH 2BOCC 1BSMA 1YJWV 3OMNB 4TWKA 4PA7A 4GX5A 3I56V 3K3WA 5EBMC 1SKVA 2W0FC 1XEQA 2M7WA 1P7BA 2E5LB 4E2LA 3CSXA 4JAAA 3JD0A
chains in the Genus database with same CATH topology
1HNWO 2VQEO 2JRIA 1R6TA 4DV1O 4JI6O 3M8AA 4OPAA 1G1XB 4DV2O 1N34O 4LF9O 4DR2O 5IT9N 1D2DA 1KUQA 4JI7O 5H5NA 1YZBA 5LMUO 2UUAO 1IBLO 4DR6O 1AB3A 4DR4O 2FKXA 4DR3O 1HR0O 3O65A 4DV0O 3F5TA 2DOSA 5A2QN 4JI2O 4JV5O 2DJVA 4JI4O 1XMOO 1AILA 4YY3O 4LFBO 1N33O 4DR5O 5LMNO 3RT3C 3J80N 4DUZO 2HHHO 2UU9O 4X64O 4B3MO 2UXDO 2ZKOA 4X62O 1IBMO 4DV4O 3J81N 4GKJO 2VQFO 5BR8O 2UXBO 4OPHA 4JI5O 2UXCO 5FLXN 5IWAO 5LL6Y 1FKAO 1A32A 4LF4O 2F4VO 1FYJA 4AQYO 5BXZA 4DR1O 4JI1O 4B3SO 2ZM6O 4DV3O 4JI0O 2E5LO 4LF8O 4KHPO 3T1HO 2UUCO 4DR7O 2N74A 4YHHO 1HNXO 4JI3O 1DK1A 4A5UB 1R1BA 4X65O 2UUBO 2AGAA 1I94O 4DV7O 5BY1A 2Z0AA 4X66O 4B3RO 3R66A 4LF7O 1N36O 4OX9O 4JI8O 3SDLA 1N32O 1HNZO 1NS1A 3JAMN 4NXMO 4K0KO 4GKKO 1IBKO 3T1YO 1XMQO 1X59A 4DV6O 4DUYO 3OTOO 4NXNO 3J7AU 1XEQA 1FJGO 1J5EO 2LW7A 4LFCO 1XNRO 4LF5O 4LFAO 4B3TO 4LF6O 1XNQO 1F7YA 4JYAO 4DV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW O;  2VQE O;  2JRI A;  1R6T A;  4DV1 O;  4JI6 O;  3M8A A;  4OPA A;  1G1X B;  4DV2 O;  1N34 O;  4LF9 O;  4DR2 O;  5IT9 N;  1D2D A;  1KUQ A;  4JI7 O;  5H5N A;  1YZB A;  5LMU O;  2UUA O;  1IBL O;  4DR6 O;  1AB3 A;  4DR4 O;  2FKX A;  4DR3 O;  1HR0 O;  3O65 A;  4DV0 O;  3F5T A;  2DOS A;  5A2Q N;  4JI2 O;  4JV5 O;  2DJV A;  4JI4 O;  1XMO O;  1AIL A;  4YY3 O;  4LFB O;  1N33 O;  4DR5 O;  5LMN O;  3RT3 C;  3J80 N;  4DUZ O;  2HHH O;  2UU9 O;  4X64 O;  4B3M O;  2UXD O;  2ZKO A;  4X62 O;  1IBM O;  4DV4 O;  3J81 N;  4GKJ O;  2VQF O;  5BR8 O;  2UXB O;  4OPH A;  4JI5 O;  2UXC O;  5FLX N;  5IWA O;  5LL6 Y;  1FKA O;  1A32 A;  4LF4 O;  2F4V O;  1FYJ A;  4AQY O;  5BXZ A;  4DR1 O;  4JI1 O;  4B3S O;  2ZM6 O;  4DV3 O;  4JI0 O;  2E5L O;  4LF8 O;  4KHP O;  3T1H O;  2UUC O;  4DR7 O;  2N74 A;  4YHH O;  1HNX O;  4JI3 O;  1DK1 A;  4A5U B;  1R1B A;  4X65 O;  2UUB O;  2AGA A;  1I94 O;  4DV7 O;  5BY1 A;  2Z0A A;  4X66 O;  4B3R O;  3R66 A;  4LF7 O;  1N36 O;  4OX9 O;  4JI8 O;  3SDL A;  1N32 O;  1HNZ O;  1NS1 A;  3JAM N;  4NXM O;  4K0K O;  4GKK O;  1IBK O;  3T1Y O;  1XMQ O;  1X59 A;  4DV6 O;  4DUY O;  3OTO O;  4NXN O;  3J7A U;  1XEQ A;  1FJG O;  1J5E O;  2LW7 A;  4LFC O;  1XNR O;  4LF5 O;  4LFA O;  4B3T O;  4LF6 O;  1XNQ O;  1F7Y A;  4JYA O;  4DV5 O; 
#chains in the Genus database with same CATH topology
 1AI6 A;  1NKD A;  4EFB A;  1Q81 W;  3JSL A;  4UB6 Z;  1H2N A;  2PI5 A;  2JRI A;  2IJI A;  3EHB B;  1AP6 A;  5E1A C;  1TA8 A;  2GTA A;  3AG2 B;  5J2T B;  1VF6 A;  1VQL V;  1AI4 A;  1D5N A;  2JDI G;  4GKK B;  3B2E E;  3SJA C;  2FML A;  3P30 A;  4DUY B;  1NTK H;  5IJ0 B;  5ITZ A;  4IYI A;  2XTA A;  4LF5 B;  2DJV A;  2PTM A;  3E8B A;  1FXH A;  4PI2 A;  3J80 N;  4JI6 B;  2HHH O;  5CN0 A;  1XDC A;  1DF4 A;  1H2S B;  1FAF A;  4H44 B;  3FB6 C;  2B5U A;  3ABM B;  2P7T C;  3H1J H;  3J81 N;  4JI7 B;  1L8D A;  3FB8 C;  2IM9 A;  1JJO A;  3B40 A;  1RFY A;  3ETE A;  4P9O A;  5IDJ A;  1Q43 A;  2ZIO A;  4LWS B;  4LH6 A;  5FLX N;  5LL6 Y;  1RPO A;  2HJF C;  2JGD B;  3BAB A;  4FZ1 A;  4MVM A;  5GTH Z;  4PA4 A;  4DUZ B;  2BTQ A;  2A9H A;  2P22 C;  4ABM A;  5LXT B;  2CH7 B;  3K58 A;  2QTS A;  3N2G B;  5CB4 B;  4PDR A;  4JF3 A;  1M90 W;  1JA8 A;  5KHI A;  4UVA A;  2Q7G A;  1W0K G;  3JAT A;  3THO A;  5GON B;  2Y4U A;  1AVM A;  1SET A;  1AI7 A;  2F95 B;  1WA8 B;  3CJH B;  4FPP A;  2JS5 A;  5B5E Z;  3CC4 V;  4J10 A;  3U11 A;  4WFF A;  4X8A A;  1ZSP A;  5IYD O;  4X66 B;  4LF7 B;  3OEE G;  4OPA A;  1EZJ A;  5K1X A;  4QPJ A;  1F4N A;  2L6L A;  3SPG A;  1YEW A;  1K73 W;  4DV0 O;  3JD2 A;  3F5T A;  2LGQ A;  1M56 B;  5BZB A;  2YXL A;  2Y48 A;  5A2Q N;  5EZY A;  4JI4 O;  2HFE C;  1EN4 A;  3F7V C;  4Q20 A;  3BA9 A;  3FYE B;  4MVU A;  2XUM A;  4X1K A;  4YJ2 A;  2QM8 A;  2FTK A;  2ZKO A;  3GWK C;  2EIL B;  1K7D A;  2JVD A;  1S77 D;  5E79 Z;  4PJ0 Z;  1VQM V;  5LOV A;  3F5W C;  3TGU H;  4WFA V;  5KA5 A;  3RN4 A;  2AW9 A;  5BMV B;  2LW1 A;  1QU7 A;  5CBF A;  4EB6 A;  3ZCC A;  4ZI7 A;  1A32 A;  1FYJ A;  4X9Q A;  1MZE A;  1SQF A;  1KBH A;  3ZRV A;  1WLE A;  4AIL C;  3D36 C;  1GTO A;  4DK0 A;  1KKC A;  3OGC C;  1JMK C;  3LUT B;  3JSN A;  1S0V A;  1Y74 A;  2ZIM A;  3HKD B;  3N27 A;  1K4C C;  2OIG A;  4NXM O;  4K0K O;  3FAV B;  1B3Q A;  3CPW U;  3C90 A;  2LQT A;  5JH7 A;  4I55 A;  4RUF A;  3CCV V;  2VRZ A;  1V55 B;  3BHP A;  5EIB D;  4O4L B;  3K57 A;  3T1H B;  2A79 B;  3CRR A;  1PL0 A;  1BCC H;  4KL1 A;  1G1X B;  4U7O A;  1Q6I A;  5CA1 A;  1M1K W;  4J7J A;  1YSC A;  2JEU A;  3RYF A;  4TT3 G;  1XMQ B;  3G6E V;  1Y67 A;  4W4L A;  2ODM A;  3DTU B;  2LGW A;  4G2K A;  3U10 A;  4PA6 A;  1KP3 A;  1R3K C;  4FM2 A;  3K04 A;  4LFA B;  2YS8 A;  3ZBH A;  4LFB O;  2QWQ B;  1N33 O;  1QHT A;  1SZT A;  1MG1 A;  2QM7 A;  1FXV A;  4CS2 A;  3E83 A;  1BZK A;  2ZCE A;  1IBM O;  1YDX A;  2OWO A;  2ZE6 A;  4ZIB A;  4FM1 A;  3QVN A;  4RUE A;  3TET A;  4DR6 B;  1SZX A;  3SJQ C;  5DEC A;  3A8T A;  2BE3 A;  2QKS A;  5LGN A;  1SER A;  3OAA G;  1JX9 A;  3ASN B;  3FKS G;  1PM9 A;  2ZDI C;  3B4S A;  3ETQ A;  5BXZ A;  4HYO A;  4WBN A;  4JI1 O;  2OTL V;  3BA8 A;  4DV3 O;  1VQO V;  3STZ C;  1VMG A;  2X0L A;  3E22 A;  3L75 H;  4X20 A;  1DK1 A;  4GKJ B;  4MW8 A;  3UKM A;  5BY1 A;  5HFL A;  1JFF B;  1FXK C;  3L73 H;  4IL6 Z;  1NS1 A;  1Q5O A;  2A7W A;  2PI4 A;  4X1Y A;  1XQ8 A;  3APO A;  4D7S A;  3DC5 A;  4O2B B;  1CP9 A;  1GN4 A;  2OCC B;  2PY5 A;  2E75 B;  1I5X A;  2Q67 A;  4IHJ A;  2ILM A;  5KUM A;  2GV9 A;  3T1C A;  3SGI A;  3P3P A;  2V1D A;  4E4E A;  2P5O A;  4JI3 B;  3W7X A;  1HNW O;  1LUW A;  1CPY A;  1L1F A;  1NVP B;  2EIM B;  1K33 A;  4DW1 A;  4F6R A;  4DV1 B;  3MAQ A;  1N34 O;  5DM6 V;  4FZ0 A;  4TV9 A;  2VWJ A;  5H5N A;  5B1A C;  1YJN V;  5KUK A;  1MA1 A;  5KAI Z;  3F7Y C;  2ZNJ A;  2R72 A;  1IDS A;  4UCS A;  2GBO A;  2FYU H;  3LNN A;  2WLK A;  5J2U A;  1ZLZ A;  4P30 A;  2PYL A;  2X7R B;  4IIJ A;  4CBC A;  5FPO A;  4LF6 B;  1QNM A;  1S3J A;  2IU0 A;  4DV5 B;  3IGA C;  1YHQ V;  1XMO B;  1IZ3 A;  3CCE V;  3FB7 C;  3RYC B;  2F1M A;  5LMN B;  1W2B U;  1B06 A;  1WPB A;  5AG2 A;  2WLL B;  2BTO A;  4O4I A;  4ZHQ B;  4FLX A;  3QTC A;  4X62 O;  3AG4 B;  1L0L H;  3P3N A;  3E8H A;  2UUA B;  3SPJ A;  4UVC A;  4H13 B;  5L3C A;  4DR3 B;  2JEX A;  1ZL8 B;  4JI5 B;  1L0N H;  1XOU A;  4LF4 O;  5KHH A;  1NR7 A;  4YY3 B;  2Z3Y A;  1BGY H;  4WFH A;  1PP9 H;  2YID A;  2XT9 A;  4PDL A;  4DR7 O;  3HKB B;  1FFT B;  2NN4 A;  3ABK B;  4R50 A;  2XAH A;  5BR8 B;  1AR5 A;  4U3J B;  4OX9 O;  3D8C A;  1RP3 B;  1HNZ O;  3ZHV A;  2EJ7 A;  2UXC B;  2CDY A;  3RYI B;  1VQ6 V;  4KFM A;  1H38 A;  3T1Y O;  3HB3 B;  1TVK A;  3JAK B;  4MTX A;  3N2K A;  4B3S B;  1VQ8 V;  5L3D A;  1K8A W;  3JAL B;  3CD6 V;  2ZDI A;  3SYC A;  2NLJ C;  1VF6 C;  1F4M A;  1S5L Z;  2Y69 C;  5CA0 A;  4RO2 A;  2Q9L A;  2RNB A;  2Q6A A;  3ASO B;  2F43 G;  3OUS A;  1VF5 B;  1VP7 A;  1YCI A;  2RQ6 A;  3HKE B;  5FL7 G;  4PHZ A;  2L35 A;  4ZOL A;  2NNU A;  1FXK A;  3ICX A;  2QSA A;  1XRE A;  3ZN0 A;  1H2L A;  1QBZ A;  1I5Y A;  1TGO A;  1S72 V;  4KUM A;  5JQG A;  3OT7 A;  3DC6 A;  3T4D A;  2UXD O;  1U97 A;  4DV2 B;  5LGT A;  3IJ4 A;  1D5A A;  3DXR B;  1SRY A;  5LA6 A;  1ORQ C;  1SQQ H;  3VBB A;  2YXY A;  3KCY A;  3I55 V;  2ZE5 A;  1Q86 W;  3AG1 B;  2QKA A;  5LBQ A;  4BW5 A;  4J9Z B;  5CBG A;  3ZRW B;  1GM9 A;  3JYC A;  4JI0 O;  3OFN G;  1KYO F;  3QO8 A;  2KKW A;  4PDM A;  4CC5 A;  3L70 H;  2WLI B;  1R1B A;  1BL8 A;  1I94 O;  1TUB B;  2Z0A A;  4TV8 A;  4YXW G;  4GUN A;  2O57 A;  4I9Q A;  3E8F A;  4P9P A;  4CZZ A;  2WA3 A;  3FYI B;  4IYH A;  1GK9 A;  1P7G A;  2YSU B;  3AG3 C;  3QO7 A;  5TIS Z;  4NR1 A;  5IY5 B;  3X2Q C;  5C93 A;  1XL6 A;  1SA0 A;  2ZE8 A;  2XAG A;  1J5E O;  1XL4 A;  2XAF A;  3JD3 A;  4FLU A;  1M57 C;  4JYA O;  3Q4H A;  1S5J A;  1HNX B;  1P49 A;  2JJ2 G;  3HKC B;  4X1I A;  3HPL C;  4HZ3 A;  5IJ0 A;  1RM1 C;  5IT9 N;  4YJ3 B;  1YVW A;  3UM7 A;  4EFE A;  5KX5 B;  1IBL O;  3L9D A;  3OTO B;  2X6A A;  1AB3 A;  2WLH A;  4PI0 A;  1HWY A;  4MTG A;  5B1B C;  3JD1 A;  5FNV A;  4LFC B;  3GVM A;  5IJ9 A;  1IVS A;  2EUL A;  3CE2 A;  3S3X A;  1K5S A;  2H8P C;  3TXQ A;  1AP5 A;  3RT3 C;  2BSK B;  2EBO A;  1OCO C;  4FFB A;  5KMG B;  2DYR B;  3DGE A;  1PNL A;  2A0L A;  5K1P A;  3ZMZ A;  1MAB G;  4I50 A;  2MK3 A;  4JYY A;  5L3F A;  1Z2G A;  1Q8I A;  5EIB C;  2F4V O;  1KU9 A;  2UXN A;  2YIA A;  4DR5 B;  4GX1 A;  3ABL C;  4UB8 Z;  1NT2 B;  5F2V O;  3N2G A;  1QCE A;  3PJS K;  2MW2 B;  3B09 A;  1WN7 A;  3U0Z A;  4X65 O;  3JAW A;  2UXB B;  1Y76 A;  4TSF G;  2ZQM A;  4JI8 O;  1DTO A;  2JJ1 G;  3ZHT A;  2FB5 A;  1PD3 A;  4AHC A;  5IWA B;  4PD4 F;  4F6E A;  2ATK C;  1NTM H;  2DWE C;  1IBK O;  1XHX A;  3JD4 A;  1JPX A;  3SYP A;  3BRC A;  4NXN O;  3OD4 A;  1MSW D;  4DR1 B;  1FJG O;  1V9P A;  1JJ2 U;  4NB5 A;  4B3T O;  2DWD C;  4MS2 A;  4YHH B;  4MTO A;  5ITZ B;  1URF A;  2QGN A;  3PN1 A;  1NBM G;  4BIU A;  3E89 A;  4O4J B;  1N32 B;  1OCZ B;  2WLJ A;  1KB9 F;  5LMU O;  4N21 A;  3JAS A;  2AZ0 A;  4CH5 A;  4DR4 O;  3QNE A;  3B8M A;  2EX3 A;  2ZIN A;  1BT8 A;  4LR3 A;  3G4S V;  4FLW A;  3ZN1 A;  4JV5 O;  3H1K H;  1S5H C;  2CK3 G;  3OR7 C;  3RFR A;  3LSS A;  3IC9 A;  1GN2 A;  4DV4 O;  4Q6G A;  2HG5 C;  3OE7 G;  2VQF O;  2Y0P A;  2YC0 A;  4NTX A;  3UCS C;  4NVP A;  2LFR A;  1BS3 A;  2GHY A;  2ZR2 A;  1JVM A;  5KHK A;  4MVZ A;  1P4R A;  1VQ9 V;  4LC1 A;  3TJT A;  2K1E A;  1GM7 A;  3DSQ A;  4WFG A;  1E79 G;  2B1G A;  4LBE C;  5JVD A;  1EZV H;  4DYL A;  3ZMS A;  2E5L O;  2UU9 B;  4RWU A;  3LDE A;  2EIK C;  3HKD A;  3OMI B;  1HP8 A;  2CTW A;  2V7Q G;  1UJW B;  3VQW A;  2ITD C;  4J11 A;  2DQ0 A;  4JGS A;  4GKK O;  3CCJ V;  4AQY B;  4UCU A;  4UUJ C;  4DUY O;  3K59 A;  1QQC A;  3WU2 Z;  1VIB A;  3ETD A;  2ZM6 B;  1PKX A;  2HR3 A;  1OCC C;  5C8Y A;  1IX9 A;  3UO3 A;  4LF5 O;  3G6B A;  1F7Y A;  2UUB B;  1THZ A;  5B3S C;  4JI6 O;  5EZY B;  1XI1 A;  2V4D A;  5IYC O;  2EIJ C;  3T2M A;  4JI7 O;  3BAA A;  1Y66 A;  4TQD A;  4DV6 B;  4X1K B;  4YJ2 B;  3ZMV A;  2LO1 A;  2P4K A;  3JCZ A;  5LOV B;  3CEI A;  4JI2 O;  1HDJ A;  3A0R A;  3RYH A;  4DUZ O;  4EB6 B;  4ZI7 B;  3BVO A;  4DR2 B;  2C2A A;  2A06 H;  5LYJ A;  1OJH A;  1ZUQ A;  3FFQ A;  2QKC A;  3ZMU A;  1QR9 A;  2Y4T A;  3NXS A;  3K5O A;  1ENV A;  1K9M W;  4Z2W A;  1WPX A;  5KAF Z;  3CXC U;  3G80 A;  4X64 B;  2X6B A;  1Q82 W;  5JH7 B;  4I55 B;  2W0X A;  1CXZ B;  2IW5 A;  2WSS G;  5CBH A;  3A2F A;  4X66 O;  4LF7 O;  1SF9 A;  4C7U A;  4AI8 A;  5L3B A;  3L72 H;  3LDC A;  2CTP A;  1OCR C;  3WG7 C;  5DED A;  2YIC A;  2OYQ A;  4O2A A;  2Q7E A;  1OZ0 A;  5CA1 B;  3S3W A;  1K34 A;  5EC2 C;  3RYF B;  2UUC B;  1EN5 A;  3KZI Z;  1SC5 B;  3D3Q A;  3LSQ A;  4UCO A;  2K9P A;  4CH4 A;  2Q73 A;  1GO3 F;  4DV7 B;  3C3S A;  4D6T H;  1N36 B;  3M8A A;  2HVK C;  4NTY A;  3SJC C;  4FMT A;  2Q0O C;  1KQS U;  3O9O A;  1D2D A;  1KUQ A;  2AHY A;  3JCU Z;  3W7W A;  4O4H A;  3UT5 A;  5GTI Z;  1KMI Z;  4HNA A;  5EYP A;  2YIB D;  1QLE C;  1XIL A;  1EBO A;  1R3J C;  5KA6 A;  4B08 A;  4GX0 A;  4J42 A;  4JZ2 A;  1NVP D;  1XNR B;  5CMU A;  1N4C A;  4MVS A;  4R6Z A;  1XNQ B;  2OIE A;  1ZTE A;  2VWK A;  2HEP A;  4TUY A;  4CC6 A;  2F93 B;  4ZHQ A;  2VQE B;  3RVY A;  4QPK A;  1TUE B;  1YXB A;  2B9Z A;  1V54 C;  4BW9 A;  3M99 B;  4WBN B;  2Q4P A;  3ZMT A;  5LGU A;  2DMX A;  2Q0A A;  2DYS C;  3H9V A;  4OPH A;  2JGU A;  4X20 B;  1Y6X A;  4GYC B;  2DW4 A;  4F4L A;  1R6K A;  4DK1 A;  4OGQ B;  4QE7 A;  2XAQ A;  3E35 A;  2D2C B;  2R9I A;  3GB7 C;  1K92 A;  1JR9 A;  3EFF K;  5DN6 G;  1LUV A;  4B3M B;  4BIZ A;  3T1H O;  4U7N A;  1H2G A;  4RQF A;  4K3A A;  3CMA V;  5KHJ A;  4J80 A;  3AEI A;  3CCM V;  3K79 A;  4IHJ B;  1Q6H A;  1GN6 A;  2AHZ A;  3CS5 A;  4QJF B;  2HJD A;  2H94 A;  2P06 A;  1RSO A;  3EXA A;  1NH2 D;  1Q7Y W;  1XMQ O;  1IXB A;  3OTF A;  3AG2 C;  2CAZ C;  1NH2 B;  1HW7 A;  1U96 A;  4LF8 B;  4XDJ A;  4KHP B;  4LFA O;  1GRJ A;  2BCC H;  1SES A;  2P90 A;  2Q8V A;  1SQP H;  5FPR A;  1CEZ A;  3ETG A;  2KG7 A;  4B3R B;  5J2U B;  3ZS8 C;  2ZXW C;  3CB2 A;  4IIJ B;  3P32 A;  5A9G A;  4LNU A;  4LF9 O;  2UXX A;  2YEV A;  2ZT9 B;  2OTJ V;  1VAR A;  1P84 F;  2Z5U A;  3K06 A;  4DR6 O;  1FFX A;  1IXM A;  3TXS A;  3K03 A;  3ABM C;  1IBL B;  4O4I B;  4TQF A;  1GAX A;  4JAS A;  3QG5 A;  2DOS A;  5JCO C;  1AR1 B;  4LCU C;  1AIL A;  1WB7 A;  3G67 A;  4MW3 A;  1BHA A;  1I7F A;  1VF7 A;  4JTA B;  3WB2 A;  2EZP A;  3KG2 A;  5EBW C;  5EC1 C;  4I0X A;  1RPR A;  3ZX6 A;  3WFV A;  4GKJ O;  4PEL A;  1R73 A;  4X88 A;  2GUZ B;  2RDC A;  1WJZ A;  1MNG A;  4CS3 A;  3JAR A;  4H37 A;  3C3T A;  4R8C A;  1M5I A;  2ZNI A;  3SJB C;  3R65 A;  4UV8 A;  3UO2 A;  2HHH B;  2M6Y A;  1TUB A;  3ZIA G;  1MOF A;  2HLD G;  4K35 A;  1YIJ V;  3H01 A;  4JI3 O;  1TVK B;  5B1O A;  2F23 A;  3N2K B;  2EZO A;  4IT5 A;  3R66 A;  2F66 C;  4G28 B;  4MVR A;  3SDL A;  3KKY A;  3JAM N;  5CA0 B;  2IJH A;  3APQ A;  5IYZ A;  3IAY A;  2QJ1 A;  2XOK G;  3ZHS A;  1UPG A;  1FD9 A;  2EIN C;  4EKW A;  5LP6 A;  4WFB V;  4LH7 A;  4FVM A;  1Q6U A;  4DO2 A;  2QEX V;  3K5L A;  4LF6 O;  5LHI A;  1NR1 A;  4ZOL B;  4DV5 O;  1FXK B;  3B8N A;  3QO5 A;  1WAZ A;  1M56 C;  4PV1 B;  4FIP C;  1Z5V A;  3L71 H;  5JQG B;  2QM4 A;  4D7T A;  1YIT V;  4DRX B;  2AXT Z;  5B1N A;  4I4T B;  4N23 A;  2UUA O;  1KP2 A;  3G71 V;  5LMU B;  2EIL C;  4CH6 A;  2FKX A;  4DR3 O;  3WB0 A;  5L3G A;  4QIW F;  5LA6 B;  1YTF B;  5J2T A;  4YY3 O;  1G4Y B;  4HAM A;  1B04 A;  1WP8 A;  5B1A B;  1MMM A;  3CXH F;  4UV9 A;  3SPC A;  2B1I A;  1YJ9 V;  2KSD A;  2OT5 A;  1GKF A;  1WNS A;  2EJR A;  4HBN A;  2QWO B;  2DQ3 A;  2YXH A;  2CE4 A;  2VQF B;  4JTC B;  5BR8 O;  3SYQ A;  1QVF U;  4ZBM A;  2QWN B;  2ZD9 A;  1SQX H;  4DV0 B;  4B7E A;  3LNM B;  2UXC O;  2WPD G;  2ITC C;  4X89 A;  4EEQ A;  1H8E G;  4TV8 B;  4JI4 B;  3H1I H;  2LFS A;  4B3S O;  5JCO A;  3OMA B;  2GTS A;  2N74 A;  4LWS A;  2YI9 A;  2WA4 A;  4BWA A;  1XBL A;  1SA0 B;  1V55 C;  2CUG A;  1KD1 W;  2JGD A;  3CME V;  1H2K A;  2W6J G;  4B7K A;  3Q4H B;  4X1I B;  4J7K A;  2GDS A;  3K08 A;  1X59 A;  4LP8 A;  3OGI B;  2CH7 A;  5LXT A;  3RVZ A;  5CB4 A;  4GZR B;  3CRA A;  3SYA A;  3D3I A;  1KKD A;  4O4J A;  2ZXW B;  5GON A;  1TAE A;  5FNV B;  4I5S A;  5IJ9 B;  3M7M X;  1WA8 A;  3LSU A;  4DV2 O;  4FLY A;  4UCT A;  3FX7 A;  4H33 A;  4NXM B;  3CJH A;  1Q90 D;  4K0K B;  2LJ2 A;  4FM0 A;  2DE0 X;  2XND G;  5H6Q A;  1HR0 O;  1S76 D;  4FFB B;  3O65 A;  4QNH B;  2Y69 B;  1Z5W A;  1X4T A;  1BMF G;  3E8G A;  1VQP V;  2WWW A;  4JI2 B;  4I50 B;  3K5M A;  3W7S A;  3MHS C;  3TCU A;  2Q69 A;  3ASN C;  3E2E A;  5H2F Z;  4DW0 A;  1F51 A;  4CS4 A;  4FK5 C;  3FD9 A;  2JIZ G;  5JJE B;  3VQV A;  5J9P C;  4GX2 A;  1DLB A;  4PA3 A;  2E74 B;  1NJI W;  1FKA O;  2D3O W;  1VQ5 V;  3JAW B;  1Y76 B;  3CCS V;  4LFB B;  1N33 B;  3CC7 V;  2XHB A;  1ZWI C;  3MD0 A;  5BMV A;  1EN6 A;  2OCC C;  1BQZ A;  1IBM B;  3K9A A;  1HNX O;  1PL4 A;  2AGA A;  2BTQ B;  4FLZ A;  1R6N A;  1MSD A;  1ZAU A;  4GCZ A;  1BQ0 A;  5D5Q A;  2EIM C;  2EIN B;  4BR6 A;  3OTO O;  1JQ0 A;  1K3E A;  3J7A U;  4ASU G;  3JAT B;  4JI1 B;  2LW7 A;  4LFC O;  1E1Q G;  4DV3 B;  2HKO A;  1KC8 W;  1XHZ A;  5IYB O;  3JAS B;  1PNK A;  2XAJ A;  3CCQ V;  3FAV A;  5LHG A;  1PV0 A;  1R6T A;  3I5D A;  1NI8 A;  2PUS A;  3AG3 B;  4RQE A;  3X2Q B;  2DN9 A;  4O4L A;  3TK1 A;  4PA9 A;  1AJN A;  3CCL V;  1M57 B;  3BY6 A;  3RBZ A;  3AG4 C;  5CA3 A;  3ZRX A;  2NR5 A;  4JYB A;  3OW2 U;  4IGG A;  3CCR V;  2ADQ B;  4BAY A;  4QE9 A;  1HNW B;  1RM1 B;  4DR5 O;  1G6U A;  3ZHU A;  1VQN V;  1N34 B;  1ZX3 A;  5B1B B;  3K0D A;  5GW7 A;  1VEW A;  4ICG A;  5JVD B;  4FFK A;  1JOY A;  2QR4 A;  2UXB O;  2PYJ A;  2W6I G;  2JS3 A;  3ABK C;  3CRM A;  4MT8 A;  4WFE A;  3ZJZ A;  5IWA O;  1MZF A;  1SQV H;  1DF5 A;  1OCO B;  1QR8 A;  3CCU V;  4DR1 O;  1XUQ A;  4YIP A;  1H8H G;  3SR2 C;  3VQX A;  3OEH G;  2LP7 A;  5JJJ B;  3K5N A;  4YHH O;  4X62 B;  1QVG U;  2RN9 A;  3OUF A;  4MVQ A;  4K8X A;  1EM1 A;  1T5E A;  5C8Y B;  5D5P A;  1SS3 A;  1N32 O;  3SPH A;  1US6 A;  3GWO A;  4OXS A;  3ZED A;  5KHG A;  4FLT A;  3ABL B;  4LF4 B;  1Y74 B;  3ASO C;  3WB1 A;  5EBL C;  3KCX A;  1NU1 H;  1BHB A;  1K97 A;  4W4K A;  4DR7 B;  4MTF A;  1JFF A;  5JWP A;  2KQX A;  4O2B A;  4OX9 B;  3CRQ A;  4NYK A;  1HNZ B;  1E1R G;  3W7U A;  4LF9 B;  1M9N A;  1AJQ A;  2XAS A;  3RYH B;  1YF2 A;  3T1Y B;  2YIB A;  1VQK V;  4JYC A;  1JCH A;  2VS0 A;  4Z1M G;  1NQT A;  3ZRS A;  2CGO A;  2ZR3 A;  5LYJ B;  2Y0I A;  1GMG A;  1LNQ A;  4BIO A;  1N0N A;  4P2Z A;  2IU3 A;  3CHX A;  2UU9 O;  3AG1 C;  1WP7 A;  2PF4 E;  2CGN A;  1K5Q A;  4K8Z A;  1IUR A;  5HFM A;  3BCC H;  4MSW C;  1BE3 H;  4MVO A;  1J95 A;  3H1H H;  3VQY A;  1VQ7 V;  1B6Q A;  2ARH A;  2R9R B;  3AK1 A;  4L87 A;  3B77 A;  2QTO A;  5L3E A;  3RYC A;  2IBZ H;  3W7T A;  3ML0 A;  2E3C A;  1GH6 A;  5JJN B;  2E76 B;  2CTR A;  2Q5Z A;  2WLL A;  4AQY O;  2RJZ A;  1QLN A;  4L8J A;  3OR6 C;  3MHH C;  2ZM6 O;  2UXD B;  5IY5 C;  1G8M A;  4O2A B;  1ROP A;  4CH3 A;  1H2M A;  1GN3 A;  1ZL8 A;  2ADP A;  3CYO A;  1YI2 V;  2QWP B;  2UUB O;  2OCH A;  1W0J G;  3E22 B;  4NKG B;  3D36 A;  2HP8 A;  4G27 B;  5LP6 C;  2P6J A;  4JAU A;  2YUA A;  3HKB A;  4DV6 O;  3SPI A;  3CRC A;  2QA4 V;  4X1Y B;  2EIK B;  2YDE A;  1GM8 A;  2R70 A;  4XDL A;  1R3L C;  4JI0 B;  4O4H B;  4U3J A;  1Y4M A;  3UT5 B;  1SQB H;  4HNA B;  4UVB A;  5EYP B;  1M93 A;  1O9H A;  2P4V A;  3RYI A;  4GLX A;  3CC2 V;  1I94 B;  4KP4 A;  1SQG A;  4J7Z A;  3JAK A;  4RAI A;  2WLN A;  4DR2 O;  3BFR A;  3BPZ A;  4TUY B;  3JAL A;  4F6R B;  4UFZ A;  2BOB C;  2QE7 G;  2Q7H A;  1OCC B;  4TV9 B;  2DYR C;  2WAM A;  2RCV A;  3BEH A;  1UFI A;  3CWB H;  3UQ8 A;  4WCE V;  1J5E B;  4DXW A;  5B3S B;  3AK2 A;  4JYA B;  2Q68 A;  4XBF A;  2PGG A;  5LHH A;  2RMK B;  2G38 A;  2EIJ B;  1VQ4 V;  3HKE A;  2N05 A;  2JK5 C;  4I7Z B;  4X64 O;  4QGP A;  2GUZ A;  2KB1 A;  4J41 A;  4PDV A;  2X6C A;  4JTD B;  4KXR A;  2IJK A;  2IH3 C;  2PZS A;  1AJP A;  3ABU A;  1F23 A;  2P67 A;  1COW G;  5KLV H;  4R7C A;  4JZG A;  4J9Y B;  3DXR A;  1RSO B;  3K9S A;  2UUC O;  1W59 A;  3RGB A;  4XDK A;  3CX5 F;  2QWR B;  3STL C;  4YIO A;  4DV7 O;  1N36 O;  5B66 Z;  3EVK A;  3AK3 A;  5EK0 A;  3ZRW A;  4JPR A;  2QDO A;  2F4V B;  3RW0 A;  2KG7 B;  2WLI A;  1OCZ C;  4LNU B;  3ZHQ A;  3FB5 C;  3RWR D;  4ZKI A;  2YEV B;  1XNR O;  2FL4 A;  3IFX A;  3AG7 A;  1WB8 A;  4UCV A;  1XNQ O;  3QF7 A;  4WF9 V;  2GSM B;  1FFX B;  4X65 B;  3LDD A;  3ABT A;  1N0J A;  2VQE O;  5H9C A;  4DV1 O;  1OCR B;  4DRX A;  2IJJ A;  3WG7 B;  2H3O A;  4I4T A;  3E86 A;  4JAV A;  4JI8 B;  1YZB A;  1IBK B;  1ARO P;  4UXN A;  1AI5 A;  2WLM A;  3SYO A;  4NXN B;  3K0G A;  1PNM A;  3HKC A;  4H0L B;  4I0X B;  2ZE7 A;  1FJG B;  2HVJ C;  4NTW A;  1HR0 B;  1FPO A;  2AZ2 A;  3A0H Z;  1FS0 G;  5IE9 A;  4B3T B;  1XMO O;  3CP1 A;  4YJ3 A;  5LMN O;  1OV9 A;  5KX5 A;  2YI8 A;  1R3I C;  3VOU A;  4Z1V A;  4B3M O;  1QLE B;  1I08 A;  3JAR B;  1N8R W;  3H1L H;  4FLV A;  3HR0 A;  1O9G A;  1AR4 A;  4TOI A;  4U3F H;  3IC7 A;  4FJC C;  1YTF D;  4DR4 B;  1LR1 A;  2N04 A;  4JI5 O;  4GT1 A;  1PPJ H;  3OM3 B;  1EFR G;  2BSK A;  4JV5 B;  1OHH G;  5KMG A;  1I0H A;  1V54 B;  2ETN A;  1NZ6 A;  3NR7 A;  4LF8 O;  4KHP O;  2DYS B;  3MDS A;  3ZHR A;  5IYZ B;  2A3Q A;  3T4Z A;  4DV4 B;  5H6R A;  4A5U B;  2CTQ A;  4UCR A;  1KEC A;  3L74 H;  5LP6 B;  4B3R O;  2IH1 C;  1K4D C;  1M4U A;  2R9A A;  1DGS A;  3A0B Z;  1Q3E A;  4I9W A;  1NTZ H;  2BOC C;  1BSM A;  1YJW V;  3OMN B;  4TWK A;  4PA7 A;  4GX5 A;  3I56 V;  3K3W A;  5EBM C;  1SKV A;  2W0F C;  1XEQ A;  2M7W A;  1P7B A;  2E5L B;  4E2L A;  3CSX A;  4JAA A;  3JD0 A; 
#chains in the Genus database with same CATH homology
 1HNW O;  2VQE O;  2JRI A;  1R6T A;  4DV1 O;  4JI6 O;  3M8A A;  4OPA A;  1G1X B;  4DV2 O;  1N34 O;  4LF9 O;  4DR2 O;  5IT9 N;  1D2D A;  1KUQ A;  4JI7 O;  5H5N A;  1YZB A;  5LMU O;  2UUA O;  1IBL O;  4DR6 O;  1AB3 A;  4DR4 O;  2FKX A;  4DR3 O;  1HR0 O;  3O65 A;  4DV0 O;  3F5T A;  2DOS A;  5A2Q N;  4JI2 O;  4JV5 O;  2DJV A;  4JI4 O;  1XMO O;  1AIL A;  4YY3 O;  4LFB O;  1N33 O;  4DR5 O;  5LMN O;  3RT3 C;  3J80 N;  4DUZ O;  2HHH O;  2UU9 O;  4X64 O;  4B3M O;  2UXD O;  2ZKO A;  4X62 O;  1IBM O;  4DV4 O;  3J81 N;  4GKJ O;  2VQF O;  5BR8 O;  2UXB O;  4OPH A;  4JI5 O;  2UXC O;  5FLX N;  5IWA O;  5LL6 Y;  1FKA O;  1A32 A;  4LF4 O;  2F4V O;  1FYJ A;  4AQY O;  5BXZ A;  4DR1 O;  4JI1 O;  4B3S O;  2ZM6 O;  4DV3 O;  4JI0 O;  2E5L O;  4LF8 O;  4KHP O;  3T1H O;  2UUC O;  4DR7 O;  2N74 A;  4YHH O;  1HNX O;  4JI3 O;  1DK1 A;  4A5U B;  1R1B A;  4X65 O;  2UUB O;  2AGA A;  1I94 O;  4DV7 O;  5BY1 A;  2Z0A A;  4X66 O;  4B3R O;  3R66 A;  4LF7 O;  1N36 O;  4OX9 O;  4JI8 O;  3SDL A;  1N32 O;  1HNZ O;  1NS1 A;  3JAM N;  4NXM O;  4K0K O;  4GKK O;  1IBK O;  3T1Y O;  1XMQ O;  1X59 A;  4DV6 O;  4DUY O;  3OTO O;  4NXN O;  3J7A U;  1XEQ A;  1FJG O;  1J5E O;  2LW7 A;  4LFC O;  1XNR O;  4LF5 O;  4LFA O;  4B3T O;  4LF6 O;  1XNQ O;  1F7Y A;  4JYA O;  4DV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...