4JI2O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji2O00
1HNZO 1N34O 3O65A 4X64O 1HR0O 2ZM6O 3J81N 1X59A 4YHHO 5IT9N 1YZBA 5LL6Y 4OX9O 4X65O 5H5NA 1R6TA 1XMQO 3R66A 4X62O 5FLXN 1NS1A 4DUYO 4LF5O 1FYJA 2VQFO 2FKXA 2UUAO 4JYAO 2ZKOA 4LFAO 2DOSA 4LF8O 4DR1O 4DV0O 1FKAO 1XMOO 1IBMO 2LW7A 2UU9O 4JI5O 2UXBO 1KUQA 3SDLA 4DV7O 4DV5O 4OPAA 5BY1A 4LFBO 4DV1O 4YY3O 4LFCO 4NXMO 3T1HO 4JI4O 5A2QN 4A5UB 2UXCO 1AILA 1I94O 4JI1O 1XNRO 4DV2O 4DR5O 4K0KO 5LMNO 4JI7O 2DJVA 5BR8O 4JI6O 1DK1A 4B3TO 3J80N 3F5TA 1IBKO 4JI8O 4LF6O 2AGAA 2UUCO 1HNXO 4X66O 4B3MO 1AB3A 4JV5O 3M8AA 4DR2O 1F7YA 4GKKO 4DR4O 4OPHA 1D2DA 2F4VO 1N33O 1R1BA 2UXDO 4DV3O 4DV4O 1IBLO 1N32O 2HHHO 2VQEO 4NXNO 4DR7O 2UUBO 1G1XB 1FJGO 1XEQA 5BXZA 4JI2O 4LF7O 4AQYO 3JAMN 1A32A 4DUZO 4DV6O 1HNWO 4GKJO 4DR3O 4DR6O 4JI3O 4JI0O 1XNQO 4LF9O 4B3RO 1J5EO 4B3SO 5IWAO 1N36O 3OTOO 3J7AU 4KHPO 2E5LO 5LMUO 2JRIA 3RT3C 3T1YO 2N74A 4LF4O 2Z0AA
chains in the Genus database with same CATH superfamily
4LFCB 1Y76A 3APQA 2L35A 1P84F 4DRXA 5EBWC 4UV9A 1SQQH 4E4EA 5KX5A 4NTWA 4GT1A 1RPRA 5BR8B 3SPJA 5IYBO 2X0LA 2DYSB 2WA3A 4KL1A 3UO2A 2P67A 4PA9A 2Y0PA 1P7GA 1FKAO 3D3QA 3CJHA 3U11A 1HNXB 2UU9O 5KHGA 2EILB 4H37A 3N2KA 2DYRC 1W0JG 5KHIA 4BW5A 4KP4A 5KMGA 4FM2A 2HP8A 2HG5C 4F6RB 4NXNB 4HZ3A 3ZBHA 3W7WA 4MTXA 1SQBH 3MHHC 3K0GA 5JVDA 1OCRB 5CBHA 2DJVA 4ZOLA 3ZHUA 3CXHF 3F5TA 4LH7A 4UUJC 4B3RB 1JR9A 3JATA 4B3MO 2JJ2G 3SJAC 2DMXA 4KFMA 4DR7B 4OGQB 2N04A 1K97A 3RYIA 5B5EZ 2XT9A 5A9GA 5B66Z 4I5SA 1XHXA 3FD9A 4B7KA 4AHCA 4X1YA 4UCRA 2QDOA 2QSAA 5JCOA 1ZAUA 1N0NA 1Q90D 3OW2U 3AG3C 3ZHTA 2Q68A 1S5HC 4EEQA 1OCCC 2ODMA 3QTCA 1OCOB 3AG4B 4FMTA 4X64B 4WBNA 1CP9A 4DV7B 2YIBD 1NVPB 1NT2B 4CS4A 3J81N 3WB1A 3CC4V 2IJKA 4LF5B 3BRCA 2BCCH 2IH1C 4LF8B 2FMLA 1SC5B 4WFAV 3JAKB 2PYLA 4O2BB 1KKDA 1FYJA 3ASOC 2A79B 4ZHQA 1IBMB 3CYOA 4O4IA 4UCOA 3K5LA 1HP8A 2F1MA 2UUCB 4JYBA 3TXQA 1ORQC 1K3EA 5L3CA 4J11A 4LR3A 3ABKC 2XOKG 4IIJB 4X20A 5JJEB 3CHXA 3K79A 4ZBMA 5KA5A 3OFNG 4UVAA 5IJ0B 2LJ2A 2ZNJA 5H6RA 3SPGA 3JARB 1M1KW 4I55B 4TV9A 3NR7A 1XNQB 5IYZA 1YJ9V 2AZ0A 3K3WA 4NKGB 2F4VO 1PKXA 1HNZB 2KQXA 2HR3A 1IBLO 1L8DA 3ZMVA 3HKBB 1BCCH 4I9QA 2EINB 5B1NA 2IU0A 4AQYO 1VARA 3KZIZ 1CXZB 3L73H 1QLEC 1KECA 1JMKC 5C93A 2QR4A 1QNMA 4YJ3B 1Q3EA 2WLHA 4CC6A 5J2TA 4FM0A 2EIKC 5LOVA 3FAVA 2D3OW 1V9PA 2KSDA 1K8AW 2H3OA 1G8MA 5LL6Y 2OTLV 3RW0A 4P9OA 2H94A 1R6TA 2Q8VA 2HVJC 1SA0A 1HWYA 3DSQA 4PDVA 3ZJZA 3AK1A 4I9WA 4RAIA 3OGIB 4O4JA 3JALA 1VEWA 2OCCC 5JQGB 3N27A 4DR1O 4MVSA 1K33A 5C8YB 2NNUA 2E76B 3AG7A 2QTSA 1YTFB 4XBFA 4JI5O 3E8BA 3WB0A 4JV5B 2GHYA 5LBQA 1SQGA 2WLLA 4TV8A 1YEWA 4ZI7B 3RGBA 4PDRA 2UXCO 5JCOC 3E83A 3IFXA 5ITZA 1US6A 2EIMB 2A06H 1GM9A 5LMNO 4WFHA 2AXTZ 5J9PC 3E8FA 3FYEB 1SERA 2EIJB 4DK1A 4LF6O 3APOA 4I7ZB 4B3SB 2EBOA 3IJ4A 5EZYB 4GKKO 4KHPB 4J9ZB 5JH7A 2MW2B 3K06A 2RDCA 3OUSA 1P49A 4MTGA 2W6JG 3JCZA 4IHJB 1SQFA 4F6EA 2AW9A 5K1PA 4TSFG 2JK5C 4F4LA 1UPGA 4X62B 3ABMB 1A32A 5EIBC 3JSNA 2OYQA 1Y66A 3QO8A 4DR6O 4U3JA 3SGIA 1MA1A 3CRRA 1NTMH 3AG1C 4I50A 1AI7A 1QVGU 3FKSG 4HNAA 2BTQA 3L70H 2IJJA 4TQDA 2WLJA 1YSCA 1LUVA 4YY3B 3T1HB 2QKAA 1JCHA 2BSKA 3QNEA 2KKWA 3NXSA 4TQFA 2Z3YA 3OM3B 2QJ1A 5B1BC 4JI6B 4B3TB 4X1IA 1WPXA 4LNUA 3FB8C 2ZKOA 2JEXA 4J7KA 2R72A 1X4TA 4CS2A 2Q4PA 1L1FA 1EFRG 5LP6C 1B04A 3ZRWB 3K9AA 4IT5A 1F51A 5LXTB 3K03A 1H8HG 4LFCO 1SS3A 3DTUB 3SJCC 4CC5A 1ZX3A 2VQEB 2CGOA 5IY5B 1GRJA 5KHHA 1YIJV 3ML0A 5BR8O 1GMGA 1VQPV 2XUMA 2ZT9B 3ZHRA 2P7TC 2PYJA 2X6AA 4O2AB 3E8HA 3ETDA 1HNXO 3KG2A 5TISZ 1N36B 1FXKB 1PNLA 3RN4A 3K04A 3HB3B 1VQKV 1M56B 3IGAC 3SYPA 3VBBA 4NXNO 3ASNB 2JS3A 3CCJV 2QM4A 2W6IG 4HYOA 2CAZC 5EC2C 2E3CA 4R7CA 2LFSA 2BE3A 3I56V 3G6EV 1H2SB 4B3RO 1I08A 3LDEA 4FFKA 1Q43A 2CTPA 2WLMA 3P32A 2UXBB 4MW8A 2EJRA 1FFXA 3BCCH 1MZFA 1N34O 5IYCO 2P06A 1GM7A 1VQ6V 2WLIA 3CD6V 3SYOA 1GN2A 4J41A 2XAFA 4MVZA 1WJZA 3OE7G 4QIWF 4EB6B 2VWKA 5FLXN 1M90W 1F4MA 3ICXA 3SR2C 1TUBA 1N8RW 2WLNA 4WF9V 3B09A 1IX9A 2F95B 4JI5B 2CH7B 4WFGA 1SQPH 1GTOA 2QA4V 3CB2A 3GB7C 3S3XA 4L87A 3JSLA 4DV7O 4O4HB 5CA3A 1V54C 2RQ6A 5EIBD 4FZ0A 1AILA 4NTXA 4QPJA 4UCUA 4F6RA 3ABLC 3OUFA 5LYJB 4DUZB 2CTWA 1R6KA 4YJ2B 1RM1B 2AGAA 2UUCO 1JA8A 1P7BA 4KUMA 3GWOA 3RYCB 1FS0G 4CH3A 2E5LB 4DR4O 3EVKA 3ZMTA 4FJCC 1JVMA 4J80A 1OCZC 1HR0B 4UXNA 1YI2V 1VQMV 4UFZA 5E79Z 3B8MA 1VIBA 3LUTB 4DR6B 3CRMA 4JAVA 4NR1A 3OMIB 4LFAB 3SPCA 1XNQO 3UKMA 2FYUH 3RYFA 1O9HA 3WFVA 1NKDA 4FLTA 2JRIA 5B1OA 1HNZO 2Y69B 1K5SA 2M6YA 3L75H 2V4DA 1H2NA 1X59A 3MD0A 1M5IA 2HJFC 2ZE5A 3D3IA 5H2FZ 3L74H 4FLXA 5GW7A 2DWDC 2OIGA 4ASUG 3JAKA 3PJSK 1LUWA 4O2BA 3CMEV 1GO3F 1M93A 1V55C 3G6BA 1XMOO 4Q20A 1THZA 2YIAA 2K1EA 5IDJA 1YF2A 2Q69A 5CBGA 2QWPB 1ZL8A 4CS3A 4B08A 2WWWA 4ABMA 3E35A 4Z1VA 3K08A 1XUQA 1DLBA 5CBFA 3P30A 1PM9A 2Q7GA 1ZTEA 3ETEA 3STZC 3THOA 4MS2A 1YHQV 2Q5ZA 1N0JA 5IJ0A 4N23A 1B6QA 3N2GB 1W2BU 1Q81W 1XL4A 2HVKC 1GK9A 2EX3A 4JV5O 5B3SC 1M57C 4I0XA 2JS5A 1D2DA 1S5JA 1NH2B 5CA1A 1SETA 1YJWV 1EZVH 3B40A 1S5LZ 3JASA 3HKBA 2P22C 1EN5A 2YIDA 2OIEA 2DWEC 4P30A 3PN1A 1B3QA 4AILC 3AEIA 2EZPA 3HKCB 2GUZA 4B3SO 4XDLA 1NI8A 3FFQA 4H33A 1N34B 1TAEA 4KHPO 5CB4B 1MMMA 3OGCC 2Q73A 2XAHA 1OCCB 3T2MA 2DN9A 5FNVB 5EYPA 3CRAA 3ZCCA 2Q0AA 5H5NA 1OCRC 1Y74B 4DR5B 2LFRA 1Z5WA 4X62O 2YXLA 4DXWA 3ZIAG 2IU3A 4LWSB 4FVMA 2FKXA 4JYAO 4LP8A 3IC7A 4RWUA 2UXNA 3SYAA 4K35A 5JQGA 3QG5A 3ZHSA 1VQ5V 1RFYA 1PL4A 5FPRA 1N33B 3VQXA 4YY3O 4UCTA 1RPOA 3T1HO 1QQCA 5A2QN 4DV3B 5LHIA 4ZI7A 1O9GA 4W4KA 2ZE7A 3ABKB 1FJGB 1L0LH 3EHBB 5D5QA 4TWKA 1K9MW 4OXSA 4JI2B 4JI6O 3CXCU 4B3TO 2W0FC 1W59A 4IL6Z 1KU9A 1OCOC 4XDKA 3AG4C 4DR4B 3LSQA 4JTDB 3ZS8C 3M8AA 3H1HH 1K7DA 1AI4A 5LMUB 3EXAA 4BIOA 4TUYA 5DM6V 3JD4A 1Y76B 4X9QA 1GAXA 2VQEO 4YHHB 3STLC 4LC1A 4RO2A 5KUKA 2RNBA 1WB8A 4WFFA 4UB6Z 3L9DA 4DRXB 1XEQA 4DW1A 4IHJA 2RCVA 2ZIMA 4PHZA 5K1XA 3CPWU 5IJ9B 1QU7A 3DXRB 4ZIBA 4QE7A 1N36O 1OJHA 3CJHB 3UT5B 4D7TA 4RQEA 2OT5A 1QLEB 3N2KB 3EFFK 4LFBB 2PF4E 1E1QG 2A3QA 4JAAA 3WG7C 2XNDG 5KMGB 4FIPC 3TK1A 3K5MA 4IGGA 3RFRA 1H2MA 5KHKA 1UJWB 3CCMV 1XMQO 1YXBA 1Q86W 3W7TA 4ZOLB 2ZQMA 3ZMSA 1AI6A 1XMOB 4QE9A 3BABA 4DV0O 1Z2GA 1BSMA 4B7EA 1JJ2U 1S0VA 2LW7A 2UXBO 4X66B 3QO5A 3ZRWA 4DV1O 3H9VA 2OCHA 2KG7A 3SJBC 5LXTA 2VWJA 2Q67A 2P5OA 2EINC 3HKEA 4U7OA 1DK1A 4PELA 1IXBA 5F2VO 3ZMUA 3A0HZ 3LDCA 2NN4A 4CZZA 3ZMZA 1JOYA 5EC1C 2RJZA 3UCSC 4O2AA 3JD2A 4Q6GA 2A0LA 3CE2A 1I5XA 1FXKA 4OPHA 2QKCA 4LBEC 4EFEA 4LF4B 1JPXA 4WFEA 4G28B 1F23A 2EJ7A 1PP9H 4BIUA 1TGOA 5CMUA 3HKDB 2PGGA 3A0BZ 2CDYA 3LSSA 4QGPA 2YEVB 3X2QB 1AR1B 4DUZO 3UQ8A 2B9ZA 4FLWA 3BPZA 2L6LA 4O4IB 3SPHA 3CWBH 2W0XA 2YI8A 2E5LO 4D7SA 1G6UA 3KCYA 1MABG 1JJOA 2QGNA 3AG1B 2LP7A 1HR0O 2EIMC 4X20B 1BQ0A 4RUFA 3SJQC 3D8CA 1BL8A 1XNRB 4DV2B 4JYAB 1WB7A 3K59A 1RSOB 3FB7C 3F7YC 4EB6A 1JFFB 3G71V 4LFAO 3FB5C 4JI8B 3AK2A 2DQ3A 2VRZA 1SKVA 5GTIZ 5L3FA 4GCZA 4BIZA 4U7NA 5BY1A 4J9YB 4UVCA 1AR5A 2JGUA 3M7MX 5LA6A 5LP6B 1N32B 1Q7YW 2O57A 3B77A 5IE9A 1PL0A 3CCRV 3ABMC 1VQ7V 5EBLC 4J7ZA 2YDEA 4G2KA 4LF7B 1CEZA 3ZRVA 1IBKO 3B4SA 4GKJB 1W0KG 5LYJA 5LGNA 4JPRA 4FPPA 1DTOA 3G67A 1OZ0A 4MVMA 1K5QA 5L3GA 3DC6A 1TA8A 2LO1A 1F7YA 3OTFA 1KMIZ 5EBMC 3FB6C 1J95A 5B1AB 2V1DA 4CH6A 2VS0A 3JD3A 2PY5A 4WFBV 3CC7V 3UO3A 1MOFA 1QLNA 1MNGA 5KA6A 2UUAB 2GTSA 4O4JB 4L8JA 3JD0A 4PA6A 2X6BA 1ZSPA 2UXXA 5FPOA 5E1AC 3W7UA 2P4VA 3OD4A 1SQXH 4PA3A 5GONA 2WLLB 4NXMB 5IY5C 1XMQB 4BAYA 2F93B 3ZX6A 1QBZA 2HFEC 4JASA 3T4DA 5ITZB 4HAMA 1ZLZA 3E2EA 1D5AA 1XILA 3C3TA 4DV0B 4X1KA 3K58A 3WU2Z 2FB5A 4MTOA 2Q7HA 1FXKC 1ZUQA 4Z2WA 3M99B 4ZKIA 1XREA 4DV1B 1KUQA 4FFBB 1M56C 3LNMB 5IYDO 3CSXA 4E2LA 5JH7B 1H2GA 4DV4B 4PA7A 3JAWB 2EULA 3KKYA 2XAGA 3FX7A 1KB9F 5KUMA 4DR5O 2ZINA 4D6TH 2JVDA 1V54B 2F23A 2P90A 4NYKA 5CA0B 2HLDG 4GX5A 2ZCEA 4DR3B 4JI0B 1WA8B 3ABLB 2R9AA 4FZ1A 3N2GA 5KHJA 3TCUA 3H1IH 3OMNB 4DYLA 1WNSA 4HNAB 1KP2A 2PI4A 1N33O 1H2KA 1R1BA 2PTMA 2BTQB 2ZXWC 1VQOV 4DV3O 4GX2A 5FL7G 4JYYA 1G1XB 1K4DC 3VQWA 2ADPA 2BSKB 1FJGO 1SRYA 3D36A 4GZRB 1JQ0A 1U97A 4JI2O 3JAMN 1QHTA 2LQTA 4PV1B 2VQFB 1PNMA 4NVPA 3RYHB 3HKCA 5DEDA 5L3DA 3ETQA 4H13B 2IBZH 4K8XA 1P4RA 3JD1A 2AHZA 4JZGA 3ZRXA 4WCEV 3RVZA 5LMUO 4JTCB 4DV5B 5KAFZ 3CRQA 3O65A 4BR6A 3CCQV 3CP1A 2WPDG 4YHHO 5IT9N 4JF3A 3RWRD 2P4KA 4DK0A 5FNVA 2R9RB 1H38A 1GH6A 1Y74A 2ZE8A 2B1IA 1Q82W 3U10A 2Y0IA 1VF7A 4PD4F 2YSUB 1FD9A 4LH6A 2XAJA 2R9IA 3DC5A 1AP5A 5LGUA 1WAZA 2JDIG 1VF6A 4LFBO 1GN3A 4QJFB 4FLZA 4O4LB 5BZBA 1I0HA 2HHHB 3W7SA 1I94O 2UUBB 2AZ2A 2BTOA 4IYHA 1IBKB 1NR1A 2QKSA 1YITV 1SESA 5KLVH 1Y6XA 2QWNB 4YIPA 4R8CA 2XHBA 3P3NA 4J7JA 3H01A 3K5NA 1J5EB 5CN0A 4UV8A 5JJJB 4X66O 1PV0A 2KB1A 4UCVA 3AG2C 4DO2A 2GDSA 4IIJA 3T1YB 1CPYA 2DYRB 1KD1W 1NJIW 1ROPA 2ZM6B 3B8NA 5B3SB 1M57B 2Y48A 2DW4A 4N21A 1EM1A 1VMGA 1VP7A 3JARA 4I4TB 5LHHA 2D2CB 3Q4HB 4I55A 1K4CC 2ILMA 2QWRB 1PPJH 1TUBB 1Z5VA 4ICGA 3VOUA 3CCEV 5D5PA 5IJ9A 3DXRA 3E22B 1H2LA 2B1GA 2DQ0A 4GUNA 2IM9A 1ENVA 3UT5A 2A9HA 1T5EA 2WSSG 2N74A 3T4ZA 1IVSA 4LF4O 1KKCA 5BMVB 2ITCC 2DYSC 3BY6A 4OX9O 1SQVH 4X65O 3CMAV 1GN4A 2A7WA 3OMAB 3ZN1A 1UFIA 4K0KB 1E79G 2QM7A 3R66A 3BA8A 1BT8A 4J42A 2AHYA 2EILC 1R73A 2DOSA 2PI5A 1WP7A 4YJ3A 3AG3B 2LW1A 3L71H 3E8GA 3G80A 2IJIA 5DECA 1QCEA 3VQVA 3E89A 3HR0A 3D36C 3OR7C 1D5NA 4A5UB 1R3LC 1G4YB 1TVKB 3I55V 3CCSV 1XNRO 4DV2O 3LDDA 1BZKA 1Q6HA 3ZEDA 1AJPA 1AROP 3RVYA 5LGTA 3CX5F 2Q0OC 4DV6B 3J80N 2X7RB 1HNWB 5C8YA 4JI8O 3UM7A 4HBNA 3ASOB 1XQ8A 2R70A 3GVMA 1YDXA 3RYFB 1DGSA 2YS8A 4QPKA 3TGUH 3IAYA 2XASA 1R3IC 1N32O 1KC8W 1R3KC 1ZWIC 1TUEB 5J2UB 4BW9A 3LNNA 1XDCA 4LCUC 4BWAA 2LGWA 4MVQA 5KAIZ 3OR6C 2Q6AA 3SYCA 4LF7O 1BGYH 2ZR2A 3HKDA 1IZ3A 4DUYB 4GKJO 2HJDA 2CGNA 2YEVA 4JI3O 1VF6C 2ETNA 2QE7G 5EZYA 4PI2A 2JGDB 3W7XA 2ITDC 3RT3C 1COWG 1XHZA 4XDJA 4JI4B 3FYIB 1U96A 1YZBA 1ZL8B 1QR9A 1S72V 3ETGA 1B06A 1RP3B 3L72H 4AI8A 5KX5B 1MSWD 3BEHA 2DE0X 3TJTA 1S76D 4JI7B 2FL4A 5H6QA 3WG7B 4JGSA 2UUAO 4MT8A 2QWOB 2B5UA 1RSOA 3BVOA 4PJ0Z 4KXRA 1BMFG 1JFFA 4G27B 4FM1A 2OTJV 1LR1A 3ZHQA 3DGEA 3KCXA 2PUSA 1Y67A 1FAFA 1AR4A 1K92A 1L0NH 4OPAA 4I0XB 1I94B 2UXDB 4NXMO 1XBLA 2EIKB 2NR5A 5CA1B 4X8AA 4MSWC 4UVBA 4JI1O 5JVDB 5LP6A 3MHSC 4JZ2A 4CH4A 2QEXV 4RQFA 3JASB 2QWQB 4X88A 1BS3A 3LSUA 1BE3H 3JCUZ 4R50A 2Y4UA 4LF9B 2GUZB 2G38A 3JATB 2JIZG 2OCCB 2CE4A 5IWAB 2ZR3A 1AP6A 1MSDA 2F43G 4DR2O 4K3AA 1N4CA 3OT7A 2GSMB 3RYIB 1BHBA 2Q9LA 1E1RG 2IW5A 4DV4O 3F7VC 4X1YB 1JX9A 5EYPB 2IJHA 3VQYA 4GLXA 2YXYA 5BXZA 3WB2A 1IXMA 1NH2D 1S77D 5LHGA 1URFA 4DR3O 4JI0O 1IURA 4QNHB 4WBNB 1AVMA 3A2FA 3I5DA 2UU9B 2Q7EA 2Z5UA 4U3FH 4OX9B 1HDJA 4X65B 3H1KH 2FTKA 3C90A 2HEPA 3C3SA 3A0RA 4CBCA 1WN7A 4ZHQB 2PZSA 3ZRSA 2VQFO 3K9SA 1OV9A 2RN9A 3ZHVA 1PD3A 4H44B 2ZDIA 4X89A 4FLVA 4B3MB 2WA4A 4P9PA 1R3JC 1LNQA 3HPLC 4YXWG 5GTHZ 4DV5O 4FFBA 1MZEA 4FLYA 4TUYB 3F5WC 4PDLA 4J10A 4EFBA 1NVPD 3BHPA 3JAWA 2EIJC 3X2QC 4PI0A 5EK0A 2JEUA 2Y4TA 4TV9B 4NB5A 2CH7A 5B1BB 5CA0A 3CCLV 2JJ1G 3JYCA 5IYZB 3MDSA 2YXHA 1WA8A 3P3PA 1QR8A 2HKOA 4O4HA 2CK3G 3BA9A 1K73W 1DF4A 2E75B 1AJNA 5L3BA 3TXSA 2P6JA 3OAAG 3CCUV 1WLEA 3IC9A 3SPIA 2HHHO 2UUBO 2XTAA 2ZIOA 1VQ9V 3ABUA 1KBHA 2CTRA 1KP3A 3BFRA 1XI1A 4JI3B 2YI9A 4JYCA 4YJ2A 4W4LA 4EKWA 3AK3A 5J2TB 2YIBA 1J5EO 3RYCA 5HFLA 1YVWA 3OTOO 3J7AU 3RYHA 5LOVB 1NR7A 3FAVB 1GM8A 1NQTA 4FK5C 3T1YO 1I7FA 1VQ8V 2ZM6O 2KG7B 1M9NA 3T1CA 3R65A 1VQLV 1SA0B 2K9PA 3HKEB 3JALB 3ZN0A 1NS1A 4MVUA 1SF9A 1EN4A 1FFTB 3QVNA 1IDSA 3H1JH 5JWPA 1KQSU 4UCSA 1BHAA 1I5YA 4K8ZA 1SZXA 3SYQA 2OWOA 2X6CA 4TV8B 4MW3A 2QTOA 3H1LH 4DW0A 3SDLA 2C2AA 2F4VB 4JI1B 5B1AC 2XAQA 3ABTA 1IBLB 1EZJA 4O4LA 2WLKA 3B2EE 1FPOA 3OEEG 3TETA 3S3WA 4K0KO 4C7UA 3RBZA 4AQYB 2V7QG 2YICA 4P2ZA 4RUEA 5DN6G 1FXHA 4CH5A 4DR2B 3QF7A 3CEIA 4TT3G 2ZE6A 3ASNC 2IH3C 3U0ZA 1EBOA 1XL6A 1YTFD 4R6ZA 2N05A 1VF5B 2ADQB 1NTZH 4H0LB 4DR7O 1YCIA 2QM8A 3BAAA 2ZXWB 5HFMA 2ZD9A 1EN6A 4U3JB 1HW7A 4DV6O 2ZDIC 1HNWO 4MVRA 3A8TA 1FXVA 4I50B 4I4TA 1OHHG 5H9CA 3Q4HA 3G4SV 3K57A 4DR1B 2CTQA 1AJQA 1PNKA 1XOUA 2H8PC 2RMKB 4JTAB 3E22A 2YC0A 1S3JA 1H8EG 3GWKC 1VQNV 1QVFU 2Z0AA 4X64O 1SZTA 3CRCA 2UXCB 1BQZA 1OCZB 5BMVA 5LA6B 2E74B 4X1IB 1KYOF 5LMNB 4LNUB 2GBOA 4DUYO 4LF5O 3OEHG 2NLJC 2EZOA 4LF8O 3MAQA 2MK3A 4LF6B 1M4UA 4MTFA 1IBMO 4GX1A 5CB4A 1NZ6A 4PA4A 4GKKB 4JAUA 4MVOA 1Q8IA 4JI4O 4GYCB 3K5OA 2ZNIA 3CS5A 2M7WA 4TOIA 1Y4MA 2GTAA 1NTKH 1TVKA 1RM1C 1NBMG 4JI7O 1Q6IA 4LWSA 2ATKC 4YIOA 5AG2A 3O9OA 1YJNV 4FLUA 1R6NA 3QO7A 1GKFA 3CCVV 4UB8Z 1AB3A 1V55B 1K34A 5L3EA 1GN6A 1AI5A 5JJNB 1VQ4V 2ARHA 2UXDO 4IYIA 5GONB 4NTYA 1MG1A 3AG2B 2BOCC 3K0DA 1NU1H 4Z1MG 5J2UA 1Q5OA 2CUGA 1DF5A 4X1KB 1WP8A 3OTOB 1F4NA 1WPBA 4PDMA 4LF9O 2GV9A 3CC2V 2Y69C 5IWAO 1Q6UA 2BOBC 2WAMA 1FFXB 2LGQA 2YUAA 3E86A 4GX0A 2JGDA 2F66C 2WLIB
chains in the Genus database with same CATH topology
1HNZO 1N34O 3O65A 4X64O 1HR0O 2ZM6O 3J81N 1X59A 4YHHO 5IT9N 1YZBA 5LL6Y 4OX9O 4X65O 5H5NA 1R6TA 1XMQO 3R66A 4X62O 5FLXN 1NS1A 4DUYO 4LF5O 1FYJA 2VQFO 2FKXA 2UUAO 4JYAO 2ZKOA 4LFAO 2DOSA 4LF8O 4DR1O 4DV0O 1FKAO 1XMOO 1IBMO 2LW7A 2UU9O 4JI5O 2UXBO 1KUQA 3SDLA 4DV7O 4DV5O 4OPAA 5BY1A 4LFBO 4DV1O 4YY3O 4LFCO 4NXMO 3T1HO 4JI4O 5A2QN 4A5UB 2UXCO 1AILA 1I94O 4JI1O 1XNRO 4DV2O 4DR5O 4K0KO 5LMNO 4JI7O 2DJVA 5BR8O 4JI6O 1DK1A 4B3TO 3J80N 3F5TA 1IBKO 4JI8O 4LF6O 2AGAA 2UUCO 1HNXO 4X66O 4B3MO 1AB3A 4JV5O 3M8AA 4DR2O 1F7YA 4GKKO 4DR4O 4OPHA 1D2DA 2F4VO 1N33O 1R1BA 2UXDO 4DV3O 4DV4O 1IBLO 1N32O 2HHHO 2VQEO 4NXNO 4DR7O 2UUBO 1G1XB 1FJGO 1XEQA 5BXZA 4JI2O 4LF7O 4AQYO 3JAMN 1A32A 4DUZO 4DV6O 1HNWO 4GKJO 4DR3O 4DR6O 4JI3O 4JI0O 1XNQO 4LF9O 4B3RO 1J5EO 4B3SO 5IWAO 1N36O 3OTOO 3J7AU 4KHPO 2E5LO 5LMUO 2JRIA 3RT3C 3T1YO 2N74A 4LF4O 2Z0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ O;  1N34 O;  3O65 A;  4X64 O;  1HR0 O;  2ZM6 O;  3J81 N;  1X59 A;  4YHH O;  5IT9 N;  1YZB A;  5LL6 Y;  4OX9 O;  4X65 O;  5H5N A;  1R6T A;  1XMQ O;  3R66 A;  4X62 O;  5FLX N;  1NS1 A;  4DUY O;  4LF5 O;  1FYJ A;  2VQF O;  2FKX A;  2UUA O;  4JYA O;  2ZKO A;  4LFA O;  2DOS A;  4LF8 O;  4DR1 O;  4DV0 O;  1FKA O;  1XMO O;  1IBM O;  2LW7 A;  2UU9 O;  4JI5 O;  2UXB O;  1KUQ A;  3SDL A;  4DV7 O;  4DV5 O;  4OPA A;  5BY1 A;  4LFB O;  4DV1 O;  4YY3 O;  4LFC O;  4NXM O;  3T1H O;  4JI4 O;  5A2Q N;  4A5U B;  2UXC O;  1AIL A;  1I94 O;  4JI1 O;  1XNR O;  4DV2 O;  4DR5 O;  4K0K O;  5LMN O;  4JI7 O;  2DJV A;  5BR8 O;  4JI6 O;  1DK1 A;  4B3T O;  3J80 N;  3F5T A;  1IBK O;  4JI8 O;  4LF6 O;  2AGA A;  2UUC O;  1HNX O;  4X66 O;  4B3M O;  1AB3 A;  4JV5 O;  3M8A A;  4DR2 O;  1F7Y A;  4GKK O;  4DR4 O;  4OPH A;  1D2D A;  2F4V O;  1N33 O;  1R1B A;  2UXD O;  4DV3 O;  4DV4 O;  1IBL O;  1N32 O;  2HHH O;  2VQE O;  4NXN O;  4DR7 O;  2UUB O;  1G1X B;  1FJG O;  1XEQ A;  5BXZ A;  4JI2 O;  4LF7 O;  4AQY O;  3JAM N;  1A32 A;  4DUZ O;  4DV6 O;  1HNW O;  4GKJ O;  4DR3 O;  4DR6 O;  4JI3 O;  4JI0 O;  1XNQ O;  4LF9 O;  4B3R O;  1J5E O;  4B3S O;  5IWA O;  1N36 O;  3OTO O;  3J7A U;  4KHP O;  2E5L O;  5LMU O;  2JRI A;  3RT3 C;  3T1Y O;  2N74 A;  4LF4 O;  2Z0A A; 
#chains in the Genus database with same CATH topology
 4LFC B;  1Y76 A;  3APQ A;  2L35 A;  1P84 F;  4DRX A;  5EBW C;  4UV9 A;  1SQQ H;  4E4E A;  5KX5 A;  4NTW A;  4GT1 A;  1RPR A;  5BR8 B;  3SPJ A;  5IYB O;  2X0L A;  2DYS B;  2WA3 A;  4KL1 A;  3UO2 A;  2P67 A;  4PA9 A;  2Y0P A;  1P7G A;  1FKA O;  3D3Q A;  3CJH A;  3U11 A;  1HNX B;  2UU9 O;  5KHG A;  2EIL B;  4H37 A;  3N2K A;  2DYR C;  1W0J G;  5KHI A;  4BW5 A;  4KP4 A;  5KMG A;  4FM2 A;  2HP8 A;  2HG5 C;  4F6R B;  4NXN B;  4HZ3 A;  3ZBH A;  3W7W A;  4MTX A;  1SQB H;  3MHH C;  3K0G A;  5JVD A;  1OCR B;  5CBH A;  2DJV A;  4ZOL A;  3ZHU A;  3CXH F;  3F5T A;  4LH7 A;  4UUJ C;  4B3R B;  1JR9 A;  3JAT A;  4B3M O;  2JJ2 G;  3SJA C;  2DMX A;  4KFM A;  4DR7 B;  4OGQ B;  2N04 A;  1K97 A;  3RYI A;  5B5E Z;  2XT9 A;  5A9G A;  5B66 Z;  4I5S A;  1XHX A;  3FD9 A;  4B7K A;  4AHC A;  4X1Y A;  4UCR A;  2QDO A;  2QSA A;  5JCO A;  1ZAU A;  1N0N A;  1Q90 D;  3OW2 U;  3AG3 C;  3ZHT A;  2Q68 A;  1S5H C;  4EEQ A;  1OCC C;  2ODM A;  3QTC A;  1OCO B;  3AG4 B;  4FMT A;  4X64 B;  4WBN A;  1CP9 A;  4DV7 B;  2YIB D;  1NVP B;  1NT2 B;  4CS4 A;  3J81 N;  3WB1 A;  3CC4 V;  2IJK A;  4LF5 B;  3BRC A;  2BCC H;  2IH1 C;  4LF8 B;  2FML A;  1SC5 B;  4WFA V;  3JAK B;  2PYL A;  4O2B B;  1KKD A;  1FYJ A;  3ASO C;  2A79 B;  4ZHQ A;  1IBM B;  3CYO A;  4O4I A;  4UCO A;  3K5L A;  1HP8 A;  2F1M A;  2UUC B;  4JYB A;  3TXQ A;  1ORQ C;  1K3E A;  5L3C A;  4J11 A;  4LR3 A;  3ABK C;  2XOK G;  4IIJ B;  4X20 A;  5JJE B;  3CHX A;  3K79 A;  4ZBM A;  5KA5 A;  3OFN G;  4UVA A;  5IJ0 B;  2LJ2 A;  2ZNJ A;  5H6R A;  3SPG A;  3JAR B;  1M1K W;  4I55 B;  4TV9 A;  3NR7 A;  1XNQ B;  5IYZ A;  1YJ9 V;  2AZ0 A;  3K3W A;  4NKG B;  2F4V O;  1PKX A;  1HNZ B;  2KQX A;  2HR3 A;  1IBL O;  1L8D A;  3ZMV A;  3HKB B;  1BCC H;  4I9Q A;  2EIN B;  5B1N A;  2IU0 A;  4AQY O;  1VAR A;  3KZI Z;  1CXZ B;  3L73 H;  1QLE C;  1KEC A;  1JMK C;  5C93 A;  2QR4 A;  1QNM A;  4YJ3 B;  1Q3E A;  2WLH A;  4CC6 A;  5J2T A;  4FM0 A;  2EIK C;  5LOV A;  3FAV A;  2D3O W;  1V9P A;  2KSD A;  1K8A W;  2H3O A;  1G8M A;  5LL6 Y;  2OTL V;  3RW0 A;  4P9O A;  2H94 A;  1R6T A;  2Q8V A;  2HVJ C;  1SA0 A;  1HWY A;  3DSQ A;  4PDV A;  3ZJZ A;  3AK1 A;  4I9W A;  4RAI A;  3OGI B;  4O4J A;  3JAL A;  1VEW A;  2OCC C;  5JQG B;  3N27 A;  4DR1 O;  4MVS A;  1K33 A;  5C8Y B;  2NNU A;  2E76 B;  3AG7 A;  2QTS A;  1YTF B;  4XBF A;  4JI5 O;  3E8B A;  3WB0 A;  4JV5 B;  2GHY A;  5LBQ A;  1SQG A;  2WLL A;  4TV8 A;  1YEW A;  4ZI7 B;  3RGB A;  4PDR A;  2UXC O;  5JCO C;  3E83 A;  3IFX A;  5ITZ A;  1US6 A;  2EIM B;  2A06 H;  1GM9 A;  5LMN O;  4WFH A;  2AXT Z;  5J9P C;  3E8F A;  3FYE B;  1SER A;  2EIJ B;  4DK1 A;  4LF6 O;  3APO A;  4I7Z B;  4B3S B;  2EBO A;  3IJ4 A;  5EZY B;  4GKK O;  4KHP B;  4J9Z B;  5JH7 A;  2MW2 B;  3K06 A;  2RDC A;  3OUS A;  1P49 A;  4MTG A;  2W6J G;  3JCZ A;  4IHJ B;  1SQF A;  4F6E A;  2AW9 A;  5K1P A;  4TSF G;  2JK5 C;  4F4L A;  1UPG A;  4X62 B;  3ABM B;  1A32 A;  5EIB C;  3JSN A;  2OYQ A;  1Y66 A;  3QO8 A;  4DR6 O;  4U3J A;  3SGI A;  1MA1 A;  3CRR A;  1NTM H;  3AG1 C;  4I50 A;  1AI7 A;  1QVG U;  3FKS G;  4HNA A;  2BTQ A;  3L70 H;  2IJJ A;  4TQD A;  2WLJ A;  1YSC A;  1LUV A;  4YY3 B;  3T1H B;  2QKA A;  1JCH A;  2BSK A;  3QNE A;  2KKW A;  3NXS A;  4TQF A;  2Z3Y A;  3OM3 B;  2QJ1 A;  5B1B C;  4JI6 B;  4B3T B;  4X1I A;  1WPX A;  4LNU A;  3FB8 C;  2ZKO A;  2JEX A;  4J7K A;  2R72 A;  1X4T A;  4CS2 A;  2Q4P A;  1L1F A;  1EFR G;  5LP6 C;  1B04 A;  3ZRW B;  3K9A A;  4IT5 A;  1F51 A;  5LXT B;  3K03 A;  1H8H G;  4LFC O;  1SS3 A;  3DTU B;  3SJC C;  4CC5 A;  1ZX3 A;  2VQE B;  2CGO A;  5IY5 B;  1GRJ A;  5KHH A;  1YIJ V;  3ML0 A;  5BR8 O;  1GMG A;  1VQP V;  2XUM A;  2ZT9 B;  3ZHR A;  2P7T C;  2PYJ A;  2X6A A;  4O2A B;  3E8H A;  3ETD A;  1HNX O;  3KG2 A;  5TIS Z;  1N36 B;  1FXK B;  1PNL A;  3RN4 A;  3K04 A;  3HB3 B;  1VQK V;  1M56 B;  3IGA C;  3SYP A;  3VBB A;  4NXN O;  3ASN B;  2JS3 A;  3CCJ V;  2QM4 A;  2W6I G;  4HYO A;  2CAZ C;  5EC2 C;  2E3C A;  4R7C A;  2LFS A;  2BE3 A;  3I56 V;  3G6E V;  1H2S B;  4B3R O;  1I08 A;  3LDE A;  4FFK A;  1Q43 A;  2CTP A;  2WLM A;  3P32 A;  2UXB B;  4MW8 A;  2EJR A;  1FFX A;  3BCC H;  1MZF A;  1N34 O;  5IYC O;  2P06 A;  1GM7 A;  1VQ6 V;  2WLI A;  3CD6 V;  3SYO A;  1GN2 A;  4J41 A;  2XAF A;  4MVZ A;  1WJZ A;  3OE7 G;  4QIW F;  4EB6 B;  2VWK A;  5FLX N;  1M90 W;  1F4M A;  3ICX A;  3SR2 C;  1TUB A;  1N8R W;  2WLN A;  4WF9 V;  3B09 A;  1IX9 A;  2F95 B;  4JI5 B;  2CH7 B;  4WFG A;  1SQP H;  1GTO A;  2QA4 V;  3CB2 A;  3GB7 C;  3S3X A;  4L87 A;  3JSL A;  4DV7 O;  4O4H B;  5CA3 A;  1V54 C;  2RQ6 A;  5EIB D;  4FZ0 A;  1AIL A;  4NTX A;  4QPJ A;  4UCU A;  4F6R A;  3ABL C;  3OUF A;  5LYJ B;  4DUZ B;  2CTW A;  1R6K A;  4YJ2 B;  1RM1 B;  2AGA A;  2UUC O;  1JA8 A;  1P7B A;  4KUM A;  3GWO A;  3RYC B;  1FS0 G;  4CH3 A;  2E5L B;  4DR4 O;  3EVK A;  3ZMT A;  4FJC C;  1JVM A;  4J80 A;  1OCZ C;  1HR0 B;  4UXN A;  1YI2 V;  1VQM V;  4UFZ A;  5E79 Z;  3B8M A;  1VIB A;  3LUT B;  4DR6 B;  3CRM A;  4JAV A;  4NR1 A;  3OMI B;  4LFA B;  3SPC A;  1XNQ O;  3UKM A;  2FYU H;  3RYF A;  1O9H A;  3WFV A;  1NKD A;  4FLT A;  2JRI A;  5B1O A;  1HNZ O;  2Y69 B;  1K5S A;  2M6Y A;  3L75 H;  2V4D A;  1H2N A;  1X59 A;  3MD0 A;  1M5I A;  2HJF C;  2ZE5 A;  3D3I A;  5H2F Z;  3L74 H;  4FLX A;  5GW7 A;  2DWD C;  2OIG A;  4ASU G;  3JAK A;  3PJS K;  1LUW A;  4O2B A;  3CME V;  1GO3 F;  1M93 A;  1V55 C;  3G6B A;  1XMO O;  4Q20 A;  1THZ A;  2YIA A;  2K1E A;  5IDJ A;  1YF2 A;  2Q69 A;  5CBG A;  2QWP B;  1ZL8 A;  4CS3 A;  4B08 A;  2WWW A;  4ABM A;  3E35 A;  4Z1V A;  3K08 A;  1XUQ A;  1DLB A;  5CBF A;  3P30 A;  1PM9 A;  2Q7G A;  1ZTE A;  3ETE A;  3STZ C;  3THO A;  4MS2 A;  1YHQ V;  2Q5Z A;  1N0J A;  5IJ0 A;  4N23 A;  1B6Q A;  3N2G B;  1W2B U;  1Q81 W;  1XL4 A;  2HVK C;  1GK9 A;  2EX3 A;  4JV5 O;  5B3S C;  1M57 C;  4I0X A;  2JS5 A;  1D2D A;  1S5J A;  1NH2 B;  5CA1 A;  1SET A;  1YJW V;  1EZV H;  3B40 A;  1S5L Z;  3JAS A;  3HKB A;  2P22 C;  1EN5 A;  2YID A;  2OIE A;  2DWE C;  4P30 A;  3PN1 A;  1B3Q A;  4AIL C;  3AEI A;  2EZP A;  3HKC B;  2GUZ A;  4B3S O;  4XDL A;  1NI8 A;  3FFQ A;  4H33 A;  1N34 B;  1TAE A;  4KHP O;  5CB4 B;  1MMM A;  3OGC C;  2Q73 A;  2XAH A;  1OCC B;  3T2M A;  2DN9 A;  5FNV B;  5EYP A;  3CRA A;  3ZCC A;  2Q0A A;  5H5N A;  1OCR C;  1Y74 B;  4DR5 B;  2LFR A;  1Z5W A;  4X62 O;  2YXL A;  4DXW A;  3ZIA G;  2IU3 A;  4LWS B;  4FVM A;  2FKX A;  4JYA O;  4LP8 A;  3IC7 A;  4RWU A;  2UXN A;  3SYA A;  4K35 A;  5JQG A;  3QG5 A;  3ZHS A;  1VQ5 V;  1RFY A;  1PL4 A;  5FPR A;  1N33 B;  3VQX A;  4YY3 O;  4UCT A;  1RPO A;  3T1H O;  1QQC A;  5A2Q N;  4DV3 B;  5LHI A;  4ZI7 A;  1O9G A;  4W4K A;  2ZE7 A;  3ABK B;  1FJG B;  1L0L H;  3EHB B;  5D5Q A;  4TWK A;  1K9M W;  4OXS A;  4JI2 B;  4JI6 O;  3CXC U;  4B3T O;  2W0F C;  1W59 A;  4IL6 Z;  1KU9 A;  1OCO C;  4XDK A;  3AG4 C;  4DR4 B;  3LSQ A;  4JTD B;  3ZS8 C;  3M8A A;  3H1H H;  1K7D A;  1AI4 A;  5LMU B;  3EXA A;  4BIO A;  4TUY A;  5DM6 V;  3JD4 A;  1Y76 B;  4X9Q A;  1GAX A;  2VQE O;  4YHH B;  3STL C;  4LC1 A;  4RO2 A;  5KUK A;  2RNB A;  1WB8 A;  4WFF A;  4UB6 Z;  3L9D A;  4DRX B;  1XEQ A;  4DW1 A;  4IHJ A;  2RCV A;  2ZIM A;  4PHZ A;  5K1X A;  3CPW U;  5IJ9 B;  1QU7 A;  3DXR B;  4ZIB A;  4QE7 A;  1N36 O;  1OJH A;  3CJH B;  3UT5 B;  4D7T A;  4RQE A;  2OT5 A;  1QLE B;  3N2K B;  3EFF K;  4LFB B;  2PF4 E;  1E1Q G;  2A3Q A;  4JAA A;  3WG7 C;  2XND G;  5KMG B;  4FIP C;  3TK1 A;  3K5M A;  4IGG A;  3RFR A;  1H2M A;  5KHK A;  1UJW B;  3CCM V;  1XMQ O;  1YXB A;  1Q86 W;  3W7T A;  4ZOL B;  2ZQM A;  3ZMS A;  1AI6 A;  1XMO B;  4QE9 A;  3BAB A;  4DV0 O;  1Z2G A;  1BSM A;  4B7E A;  1JJ2 U;  1S0V A;  2LW7 A;  2UXB O;  4X66 B;  3QO5 A;  3ZRW A;  4DV1 O;  3H9V A;  2OCH A;  2KG7 A;  3SJB C;  5LXT A;  2VWJ A;  2Q67 A;  2P5O A;  2EIN C;  3HKE A;  4U7O A;  1DK1 A;  4PEL A;  1IXB A;  5F2V O;  3ZMU A;  3A0H Z;  3LDC A;  2NN4 A;  4CZZ A;  3ZMZ A;  1JOY A;  5EC1 C;  2RJZ A;  3UCS C;  4O2A A;  3JD2 A;  4Q6G A;  2A0L A;  3CE2 A;  1I5X A;  1FXK A;  4OPH A;  2QKC A;  4LBE C;  4EFE A;  4LF4 B;  1JPX A;  4WFE A;  4G28 B;  1F23 A;  2EJ7 A;  1PP9 H;  4BIU A;  1TGO A;  5CMU A;  3HKD B;  2PGG A;  3A0B Z;  2CDY A;  3LSS A;  4QGP A;  2YEV B;  3X2Q B;  1AR1 B;  4DUZ O;  3UQ8 A;  2B9Z A;  4FLW A;  3BPZ A;  2L6L A;  4O4I B;  3SPH A;  3CWB H;  2W0X A;  2YI8 A;  2E5L O;  4D7S A;  1G6U A;  3KCY A;  1MAB G;  1JJO A;  2QGN A;  3AG1 B;  2LP7 A;  1HR0 O;  2EIM C;  4X20 B;  1BQ0 A;  4RUF A;  3SJQ C;  3D8C A;  1BL8 A;  1XNR B;  4DV2 B;  4JYA B;  1WB7 A;  3K59 A;  1RSO B;  3FB7 C;  3F7Y C;  4EB6 A;  1JFF B;  3G71 V;  4LFA O;  3FB5 C;  4JI8 B;  3AK2 A;  2DQ3 A;  2VRZ A;  1SKV A;  5GTI Z;  5L3F A;  4GCZ A;  4BIZ A;  4U7N A;  5BY1 A;  4J9Y B;  4UVC A;  1AR5 A;  2JGU A;  3M7M X;  5LA6 A;  5LP6 B;  1N32 B;  1Q7Y W;  2O57 A;  3B77 A;  5IE9 A;  1PL0 A;  3CCR V;  3ABM C;  1VQ7 V;  5EBL C;  4J7Z A;  2YDE A;  4G2K A;  4LF7 B;  1CEZ A;  3ZRV A;  1IBK O;  3B4S A;  4GKJ B;  1W0K G;  5LYJ A;  5LGN A;  4JPR A;  4FPP A;  1DTO A;  3G67 A;  1OZ0 A;  4MVM A;  1K5Q A;  5L3G A;  3DC6 A;  1TA8 A;  2LO1 A;  1F7Y A;  3OTF A;  1KMI Z;  5EBM C;  3FB6 C;  1J95 A;  5B1A B;  2V1D A;  4CH6 A;  2VS0 A;  3JD3 A;  2PY5 A;  4WFB V;  3CC7 V;  3UO3 A;  1MOF A;  1QLN A;  1MNG A;  5KA6 A;  2UUA B;  2GTS A;  4O4J B;  4L8J A;  3JD0 A;  4PA6 A;  2X6B A;  1ZSP A;  2UXX A;  5FPO A;  5E1A C;  3W7U A;  2P4V A;  3OD4 A;  1SQX H;  4PA3 A;  5GON A;  2WLL B;  4NXM B;  5IY5 C;  1XMQ B;  4BAY A;  2F93 B;  3ZX6 A;  1QBZ A;  2HFE C;  4JAS A;  3T4D A;  5ITZ B;  4HAM A;  1ZLZ A;  3E2E A;  1D5A A;  1XIL A;  3C3T A;  4DV0 B;  4X1K A;  3K58 A;  3WU2 Z;  2FB5 A;  4MTO A;  2Q7H A;  1FXK C;  1ZUQ A;  4Z2W A;  3M99 B;  4ZKI A;  1XRE A;  4DV1 B;  1KUQ A;  4FFB B;  1M56 C;  3LNM B;  5IYD O;  3CSX A;  4E2L A;  5JH7 B;  1H2G A;  4DV4 B;  4PA7 A;  3JAW B;  2EUL A;  3KKY A;  2XAG A;  3FX7 A;  1KB9 F;  5KUM A;  4DR5 O;  2ZIN A;  4D6T H;  2JVD A;  1V54 B;  2F23 A;  2P90 A;  4NYK A;  5CA0 B;  2HLD G;  4GX5 A;  2ZCE A;  4DR3 B;  4JI0 B;  1WA8 B;  3ABL B;  2R9A A;  4FZ1 A;  3N2G A;  5KHJ A;  3TCU A;  3H1I H;  3OMN B;  4DYL A;  1WNS A;  4HNA B;  1KP2 A;  2PI4 A;  1N33 O;  1H2K A;  1R1B A;  2PTM A;  2BTQ B;  2ZXW C;  1VQO V;  4DV3 O;  4GX2 A;  5FL7 G;  4JYY A;  1G1X B;  1K4D C;  3VQW A;  2ADP A;  2BSK B;  1FJG O;  1SRY A;  3D36 A;  4GZR B;  1JQ0 A;  1U97 A;  4JI2 O;  3JAM N;  1QHT A;  2LQT A;  4PV1 B;  2VQF B;  1PNM A;  4NVP A;  3RYH B;  3HKC A;  5DED A;  5L3D A;  3ETQ A;  4H13 B;  2IBZ H;  4K8X A;  1P4R A;  3JD1 A;  2AHZ A;  4JZG A;  3ZRX A;  4WCE V;  3RVZ A;  5LMU O;  4JTC B;  4DV5 B;  5KAF Z;  3CRQ A;  3O65 A;  4BR6 A;  3CCQ V;  3CP1 A;  2WPD G;  4YHH O;  5IT9 N;  4JF3 A;  3RWR D;  2P4K A;  4DK0 A;  5FNV A;  2R9R B;  1H38 A;  1GH6 A;  1Y74 A;  2ZE8 A;  2B1I A;  1Q82 W;  3U10 A;  2Y0I A;  1VF7 A;  4PD4 F;  2YSU B;  1FD9 A;  4LH6 A;  2XAJ A;  2R9I A;  3DC5 A;  1AP5 A;  5LGU A;  1WAZ A;  2JDI G;  1VF6 A;  4LFB O;  1GN3 A;  4QJF B;  4FLZ A;  4O4L B;  5BZB A;  1I0H A;  2HHH B;  3W7S A;  1I94 O;  2UUB B;  2AZ2 A;  2BTO A;  4IYH A;  1IBK B;  1NR1 A;  2QKS A;  1YIT V;  1SES A;  5KLV H;  1Y6X A;  2QWN B;  4YIP A;  4R8C A;  2XHB A;  3P3N A;  4J7J A;  3H01 A;  3K5N A;  1J5E B;  5CN0 A;  4UV8 A;  5JJJ B;  4X66 O;  1PV0 A;  2KB1 A;  4UCV A;  3AG2 C;  4DO2 A;  2GDS A;  4IIJ A;  3T1Y B;  1CPY A;  2DYR B;  1KD1 W;  1NJI W;  1ROP A;  2ZM6 B;  3B8N A;  5B3S B;  1M57 B;  2Y48 A;  2DW4 A;  4N21 A;  1EM1 A;  1VMG A;  1VP7 A;  3JAR A;  4I4T B;  5LHH A;  2D2C B;  3Q4H B;  4I55 A;  1K4C C;  2ILM A;  2QWR B;  1PPJ H;  1TUB B;  1Z5V A;  4ICG A;  3VOU A;  3CCE V;  5D5P A;  5IJ9 A;  3DXR A;  3E22 B;  1H2L A;  2B1G A;  2DQ0 A;  4GUN A;  2IM9 A;  1ENV A;  3UT5 A;  2A9H A;  1T5E A;  2WSS G;  2N74 A;  3T4Z A;  1IVS A;  4LF4 O;  1KKC A;  5BMV B;  2ITC C;  2DYS C;  3BY6 A;  4OX9 O;  1SQV H;  4X65 O;  3CMA V;  1GN4 A;  2A7W A;  3OMA B;  3ZN1 A;  1UFI A;  4K0K B;  1E79 G;  2QM7 A;  3R66 A;  3BA8 A;  1BT8 A;  4J42 A;  2AHY A;  2EIL C;  1R73 A;  2DOS A;  2PI5 A;  1WP7 A;  4YJ3 A;  3AG3 B;  2LW1 A;  3L71 H;  3E8G A;  3G80 A;  2IJI A;  5DEC A;  1QCE A;  3VQV A;  3E89 A;  3HR0 A;  3D36 C;  3OR7 C;  1D5N A;  4A5U B;  1R3L C;  1G4Y B;  1TVK B;  3I55 V;  3CCS V;  1XNR O;  4DV2 O;  3LDD A;  1BZK A;  1Q6H A;  3ZED A;  1AJP A;  1ARO P;  3RVY A;  5LGT A;  3CX5 F;  2Q0O C;  4DV6 B;  3J80 N;  2X7R B;  1HNW B;  5C8Y A;  4JI8 O;  3UM7 A;  4HBN A;  3ASO B;  1XQ8 A;  2R70 A;  3GVM A;  1YDX A;  3RYF B;  1DGS A;  2YS8 A;  4QPK A;  3TGU H;  3IAY A;  2XAS A;  1R3I C;  1N32 O;  1KC8 W;  1R3K C;  1ZWI C;  1TUE B;  5J2U B;  4BW9 A;  3LNN A;  1XDC A;  4LCU C;  4BWA A;  2LGW A;  4MVQ A;  5KAI Z;  3OR6 C;  2Q6A A;  3SYC A;  4LF7 O;  1BGY H;  2ZR2 A;  3HKD A;  1IZ3 A;  4DUY B;  4GKJ O;  2HJD A;  2CGN A;  2YEV A;  4JI3 O;  1VF6 C;  2ETN A;  2QE7 G;  5EZY A;  4PI2 A;  2JGD B;  3W7X A;  2ITD C;  3RT3 C;  1COW G;  1XHZ A;  4XDJ A;  4JI4 B;  3FYI B;  1U96 A;  1YZB A;  1ZL8 B;  1QR9 A;  1S72 V;  3ETG A;  1B06 A;  1RP3 B;  3L72 H;  4AI8 A;  5KX5 B;  1MSW D;  3BEH A;  2DE0 X;  3TJT A;  1S76 D;  4JI7 B;  2FL4 A;  5H6Q A;  3WG7 B;  4JGS A;  2UUA O;  4MT8 A;  2QWO B;  2B5U A;  1RSO A;  3BVO A;  4PJ0 Z;  4KXR A;  1BMF G;  1JFF A;  4G27 B;  4FM1 A;  2OTJ V;  1LR1 A;  3ZHQ A;  3DGE A;  3KCX A;  2PUS A;  1Y67 A;  1FAF A;  1AR4 A;  1K92 A;  1L0N H;  4OPA A;  4I0X B;  1I94 B;  2UXD B;  4NXM O;  1XBL A;  2EIK B;  2NR5 A;  5CA1 B;  4X8A A;  4MSW C;  4UVB A;  4JI1 O;  5JVD B;  5LP6 A;  3MHS C;  4JZ2 A;  4CH4 A;  2QEX V;  4RQF A;  3JAS B;  2QWQ B;  4X88 A;  1BS3 A;  3LSU A;  1BE3 H;  3JCU Z;  4R50 A;  2Y4U A;  4LF9 B;  2GUZ B;  2G38 A;  3JAT B;  2JIZ G;  2OCC B;  2CE4 A;  5IWA B;  2ZR3 A;  1AP6 A;  1MSD A;  2F43 G;  4DR2 O;  4K3A A;  1N4C A;  3OT7 A;  2GSM B;  3RYI B;  1BHB A;  2Q9L A;  1E1R G;  2IW5 A;  4DV4 O;  3F7V C;  4X1Y B;  1JX9 A;  5EYP B;  2IJH A;  3VQY A;  4GLX A;  2YXY A;  5BXZ A;  3WB2 A;  1IXM A;  1NH2 D;  1S77 D;  5LHG A;  1URF A;  4DR3 O;  4JI0 O;  1IUR A;  4QNH B;  4WBN B;  1AVM A;  3A2F A;  3I5D A;  2UU9 B;  2Q7E A;  2Z5U A;  4U3F H;  4OX9 B;  1HDJ A;  4X65 B;  3H1K H;  2FTK A;  3C90 A;  2HEP A;  3C3S A;  3A0R A;  4CBC A;  1WN7 A;  4ZHQ B;  2PZS A;  3ZRS A;  2VQF O;  3K9S A;  1OV9 A;  2RN9 A;  3ZHV A;  1PD3 A;  4H44 B;  2ZDI A;  4X89 A;  4FLV A;  4B3M B;  2WA4 A;  4P9P A;  1R3J C;  1LNQ A;  3HPL C;  4YXW G;  5GTH Z;  4DV5 O;  4FFB A;  1MZE A;  4FLY A;  4TUY B;  3F5W C;  4PDL A;  4J10 A;  4EFB A;  1NVP D;  3BHP A;  3JAW A;  2EIJ C;  3X2Q C;  4PI0 A;  5EK0 A;  2JEU A;  2Y4T A;  4TV9 B;  4NB5 A;  2CH7 A;  5B1B B;  5CA0 A;  3CCL V;  2JJ1 G;  3JYC A;  5IYZ B;  3MDS A;  2YXH A;  1WA8 A;  3P3P A;  1QR8 A;  2HKO A;  4O4H A;  2CK3 G;  3BA9 A;  1K73 W;  1DF4 A;  2E75 B;  1AJN A;  5L3B A;  3TXS A;  2P6J A;  3OAA G;  3CCU V;  1WLE A;  3IC9 A;  3SPI A;  2HHH O;  2UUB O;  2XTA A;  2ZIO A;  1VQ9 V;  3ABU A;  1KBH A;  2CTR A;  1KP3 A;  3BFR A;  1XI1 A;  4JI3 B;  2YI9 A;  4JYC A;  4YJ2 A;  4W4L A;  4EKW A;  3AK3 A;  5J2T B;  2YIB A;  1J5E O;  3RYC A;  5HFL A;  1YVW A;  3OTO O;  3J7A U;  3RYH A;  5LOV B;  1NR7 A;  3FAV B;  1GM8 A;  1NQT A;  4FK5 C;  3T1Y O;  1I7F A;  1VQ8 V;  2ZM6 O;  2KG7 B;  1M9N A;  3T1C A;  3R65 A;  1VQL V;  1SA0 B;  2K9P A;  3HKE B;  3JAL B;  3ZN0 A;  1NS1 A;  4MVU A;  1SF9 A;  1EN4 A;  1FFT B;  3QVN A;  1IDS A;  3H1J H;  5JWP A;  1KQS U;  4UCS A;  1BHA A;  1I5Y A;  4K8Z A;  1SZX A;  3SYQ A;  2OWO A;  2X6C A;  4TV8 B;  4MW3 A;  2QTO A;  3H1L H;  4DW0 A;  3SDL A;  2C2A A;  2F4V B;  4JI1 B;  5B1A C;  2XAQ A;  3ABT A;  1IBL B;  1EZJ A;  4O4L A;  2WLK A;  3B2E E;  1FPO A;  3OEE G;  3TET A;  3S3W A;  4K0K O;  4C7U A;  3RBZ A;  4AQY B;  2V7Q G;  2YIC A;  4P2Z A;  4RUE A;  5DN6 G;  1FXH A;  4CH5 A;  4DR2 B;  3QF7 A;  3CEI A;  4TT3 G;  2ZE6 A;  3ASN C;  2IH3 C;  3U0Z A;  1EBO A;  1XL6 A;  1YTF D;  4R6Z A;  2N05 A;  1VF5 B;  2ADQ B;  1NTZ H;  4H0L B;  4DR7 O;  1YCI A;  2QM8 A;  3BAA A;  2ZXW B;  5HFM A;  2ZD9 A;  1EN6 A;  4U3J B;  1HW7 A;  4DV6 O;  2ZDI C;  1HNW O;  4MVR A;  3A8T A;  1FXV A;  4I50 B;  4I4T A;  1OHH G;  5H9C A;  3Q4H A;  3G4S V;  3K57 A;  4DR1 B;  2CTQ A;  1AJQ A;  1PNK A;  1XOU A;  2H8P C;  2RMK B;  4JTA B;  3E22 A;  2YC0 A;  1S3J A;  1H8E G;  3GWK C;  1VQN V;  1QVF U;  2Z0A A;  4X64 O;  1SZT A;  3CRC A;  2UXC B;  1BQZ A;  1OCZ B;  5BMV A;  5LA6 B;  2E74 B;  4X1I B;  1KYO F;  5LMN B;  4LNU B;  2GBO A;  4DUY O;  4LF5 O;  3OEH G;  2NLJ C;  2EZO A;  4LF8 O;  3MAQ A;  2MK3 A;  4LF6 B;  1M4U A;  4MTF A;  1IBM O;  4GX1 A;  5CB4 A;  1NZ6 A;  4PA4 A;  4GKK B;  4JAU A;  4MVO A;  1Q8I A;  4JI4 O;  4GYC B;  3K5O A;  2ZNI A;  3CS5 A;  2M7W A;  4TOI A;  1Y4M A;  2GTA A;  1NTK H;  1TVK A;  1RM1 C;  1NBM G;  4JI7 O;  1Q6I A;  4LWS A;  2ATK C;  4YIO A;  5AG2 A;  3O9O A;  1YJN V;  4FLU A;  1R6N A;  3QO7 A;  1GKF A;  3CCV V;  4UB8 Z;  1AB3 A;  1V55 B;  1K34 A;  5L3E A;  1GN6 A;  1AI5 A;  5JJN B;  1VQ4 V;  2ARH A;  2UXD O;  4IYI A;  5GON B;  4NTY A;  1MG1 A;  3AG2 B;  2BOC C;  3K0D A;  1NU1 H;  4Z1M G;  5J2U A;  1Q5O A;  2CUG A;  1DF5 A;  4X1K B;  1WP8 A;  3OTO B;  1F4N A;  1WPB A;  4PDM A;  4LF9 O;  2GV9 A;  3CC2 V;  2Y69 C;  5IWA O;  1Q6U A;  2BOB C;  2WAM A;  1FFX B;  2LGQ A;  2YUA A;  3E86 A;  4GX0 A;  2JGD A;  2F66 C;  2WLI B; 
#chains in the Genus database with same CATH homology
 1HNZ O;  1N34 O;  3O65 A;  4X64 O;  1HR0 O;  2ZM6 O;  3J81 N;  1X59 A;  4YHH O;  5IT9 N;  1YZB A;  5LL6 Y;  4OX9 O;  4X65 O;  5H5N A;  1R6T A;  1XMQ O;  3R66 A;  4X62 O;  5FLX N;  1NS1 A;  4DUY O;  4LF5 O;  1FYJ A;  2VQF O;  2FKX A;  2UUA O;  4JYA O;  2ZKO A;  4LFA O;  2DOS A;  4LF8 O;  4DR1 O;  4DV0 O;  1FKA O;  1XMO O;  1IBM O;  2LW7 A;  2UU9 O;  4JI5 O;  2UXB O;  1KUQ A;  3SDL A;  4DV7 O;  4DV5 O;  4OPA A;  5BY1 A;  4LFB O;  4DV1 O;  4YY3 O;  4LFC O;  4NXM O;  3T1H O;  4JI4 O;  5A2Q N;  4A5U B;  2UXC O;  1AIL A;  1I94 O;  4JI1 O;  1XNR O;  4DV2 O;  4DR5 O;  4K0K O;  5LMN O;  4JI7 O;  2DJV A;  5BR8 O;  4JI6 O;  1DK1 A;  4B3T O;  3J80 N;  3F5T A;  1IBK O;  4JI8 O;  4LF6 O;  2AGA A;  2UUC O;  1HNX O;  4X66 O;  4B3M O;  1AB3 A;  4JV5 O;  3M8A A;  4DR2 O;  1F7Y A;  4GKK O;  4DR4 O;  4OPH A;  1D2D A;  2F4V O;  1N33 O;  1R1B A;  2UXD O;  4DV3 O;  4DV4 O;  1IBL O;  1N32 O;  2HHH O;  2VQE O;  4NXN O;  4DR7 O;  2UUB O;  1G1X B;  1FJG O;  1XEQ A;  5BXZ A;  4JI2 O;  4LF7 O;  4AQY O;  3JAM N;  1A32 A;  4DUZ O;  4DV6 O;  1HNW O;  4GKJ O;  4DR3 O;  4DR6 O;  4JI3 O;  4JI0 O;  1XNQ O;  4LF9 O;  4B3R O;  1J5E O;  4B3S O;  5IWA O;  1N36 O;  3OTO O;  3J7A U;  4KHP O;  2E5L O;  5LMU O;  2JRI A;  3RT3 C;  3T1Y O;  2N74 A;  4LF4 O;  2Z0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...