4JI2O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji2O00
1I94O 3SDLA 1D2DA 2Z0AA 4JYAO 2UXBO 2UU9O 4DR6O 5FLXN 4X65O 1A32A 1R1BA 2UUCO 2VQEO 2DOSA 5LMNO 4DV1O 1HNXO 4B3MO 4DV3O 3T1HO 4LFAO 4YY3O 4JI2O 1DK1A 1N32O 3R66A 4LF5O 2JRIA 1YZBA 4DUYO 4X66O 4OPHA 4A5UB 4DR1O 1HNWO 1N36O 1XMOO 4JI7O 4NXMO 4OPAA 2UXCO 4X64O 1FKAO 4JV5O 5LMUO 1AILA 1XEQA 5BXZA 4LF6O 2F4VO 4JI0O 4LFCO 4JI3O 1IBLO 4LF8O 4LF4O 4X62O 2AGAA 4JI5O 4OX9O 1AB3A 3J81N 5LL6Y 1J5EO 4DV5O 2HHHO 4JI4O 4JI6O 4DV2O 1N33O 1XNQO 1KUQA 3T1YO 4JI8O 4DV4O 3J80N 3O65A 5A2QN 1HR0O 4GKJO 2DJVA 2UXDO 1XNRO 3M8AA 2UUAO 4LF9O 2VQFO 1R6TA 1X59A 3F5TA 2N74A 4LF7O 4B3RO 5IWAO 1IBKO 5BR8O 2UUBO 3RT3C 4DUZO 1IBMO 4DR3O 4B3SO 4DV0O 2FKXA 4NXNO 4DR2O 4JI1O 4DR5O 1N34O 1XMQO 4KHPO 4DV6O 5IT9N 1FYJA 2ZM6O 2LW7A 1F7YA 1G1XB 2E5LO 4DR7O 4YHHO 1NS1A 5BY1A 1FJGO 4GKKO 3J7AU 4DV7O 4LFBO 1HNZO 5H5NA 4B3TO 3OTOO 2ZKOA 4K0KO 4DR4O 3JAMN 4AQYO
chains in the Genus database with same CATH superfamily
3MAQA 1K8AW 1GRJA 2AW9A 3JCZA 2QWRB 1AI6A 5KHIA 5GONB 5KAIZ 1AR5A 5C8YA 3RYHB 1VIBA 2QTOA 3BEHA 1Q81W 1NT2B 2CTWA 5DECA 4BAYA 4RUFA 1TVKA 1NTMH 2FL4A 3I55V 4DV5B 2A0LA 1JOYA 2Q9LA 4H13B 3CCEV 1FKAO 3Q4HA 5LMUO 4O4JB 3FYEB 4DO2A 1KQSU 3VQXA 4I9WA 2CH7B 4LR3A 2XT9A 3OFNG 4BIZA 2Z5UA 1OV9A 1G4YB 5KX5A 1IBKB 3BVOA 3GWKC 1V54B 5FPRA 1AP6A 3FX7A 1H2LA 1S76D 4UCSA 1N34B 4I50B 1HR0O 3TXQA 2ZM6B 5KAFZ 2VQFO 4FZ1A 3JAWA 2YI9A 1I08A 3WG7C 2XHBA 2X7RB 4OGQB 1NVPD 1IBMO 2YUAA 1TUEB 1OCCC 2QGNA 3D36A 2QTSA 5JVDA 1IBMB 3RVZA 2UU9B 1YSCA 5B66Z 3X2QB 5CA0A 5H6QA 2HJFC 2JGDB 2QEXV 2EIMB 3TJTA 4E4EA 1FJGO 3APOA 1FJGB 5H5NA 2KKWA 3E22A 2ZKOA 3BY6A 1P7GA 1Y74A 1K5QA 2YICA 3DTUB 2GTAA 2UXCB 4F6EA 4UV8A 2VQEO 3E8GA 4GX2A 3N2GB 5B1NA 1DF4A 4B3MO 4L8JA 4QNHB 4B08A 1WAZA 4LFAO 3D3QA 1KYOF 3DGEA 2C2AA 2ITCC 5LGNA 1J5EB 2ZE8A 1YCIA 1QBZA 4JTAB 3MD0A 3SYOA 4YJ3A 3ZRWA 4U3FH 3OD4A 3L72H 3CC7V 1PP9H 1GM8A 3N27A 1SC5B 2QR4A 4MVOA 1NH2D 1NZ6A 2GDSA 1ZLZA 4FFBA 2RDCA 4TV9A 2L6LA 2HHHO 5IJ0B 3EVKA 3S3WA 1BT8A 3QO5A 3ZMVA 3ABUA 2KQXA 4LWSB 1JJ2U 5FPOA 3FYIB 2DJVA 2W0FC 1K4DC 5EBMC 3NR7A 2ZDIC 3ABLB 1O9HA 3W7UA 1Q6IA 4PDMA 4U3JA 2AXTZ 3DSQA 4BW9A 3CE2A 2EJRA 4IHJA 4HZ3A 4JI1O 3BABA 3JAWB 4PD4F 2EX3A 2CE4A 2VS0A 4NVPA 5JQGA 2BE3A 4DV6O 4J7KA 4PI2A 3H9VA 4IIJA 1W0JG 4UB6Z 3SYPA 2QWQB 2Q68A 5LOVB 2GSMB 1P84F 1FXKC 3AG1C 4TV8A 2QM4A 3THOA 1KD1W 2P90A 5EYPA 2ZINA 5LYJB 4MTXA 1Q6UA 4JV5B 2LQTA 5IYDO 1R1BA 4RUEA 3KCYA 3QO8A 5E1AC 2H8PC 5CA1B 1Y74B 1IBLB 4LF8B 1AI4A 2XOKG 3B77A 2E76B 1N32O 4X89A 3B09A 5B3SC 2DYRB 1N32B 2EILB 3ASNC 3CCVV 2ZXWB 3A0RA 1M56B 1YVWA 4X1YB 1N33B 1PNKA 5BXZA 4D7TA 1QR9A 4JI3O 3K0GA 1SQFA 2W6IG 3ZMZA 3D3IA 1SZXA 3VOUA 4FM1A 1YXBA 4B3RB 3K0DA 5BR8B 4JI4O 3H1KH 4JI4B 3PJSK 2EULA 1VQ9V 1F4NA 2ZDIA 1L0LH 2RJZA 3CMAV 1X59A 1KP2A 3CMEV 4TUYA 2QA4V 4DR7B 1Y6XA 3JD1A 5EIBC 3T4ZA 4TWKA 4PA7A 3QG5A 2GHYA 5EZYA 2A3QA 4AQYB 4UCUA 3MHHC 3A2FA 4B7KA 3OM3B 1JVMA 3DXRB 3HKEB 2UUCB 2XAGA 4FIPC 3JALA 4XDKA 2BCCH 1NS1A 3RGBA 5BY1A 1VQKV 4LH6A 1Q6HA 1M4UA 3UM7A 4LNUA 2UXBO 2FMLA 2HEPA 4DR1B 1N0NA 4MS2A 1FAFA 1X4TA 2ZD9A 1D5NA 1JFFA 2DOSA 5EYPB 3TXSA 2W0XA 3L73H 3E86A 3SPJA 5AG2A 2F95B 1VQNV 2LGWA 1OCZC 2V1DA 2X6AA 1AILA 5KLVH 2JEXA 1VF5B 2OCCB 1K73W 2PI5A 4N21A 5FL7G 3ZIAG 3RYIB 1NR7A 1F4MA 5L3DA 4JF3A 1VF6A 4ZOLA 3B8MA 5L3CA 3RYFA 1VQLV 1IDSA 5JJEB 1H2NA 3RBZA 2Q0OC 2CDYA 1SQGA 5LHIA 2OIGA 3CC2V 1FFXA 3STLC 1VQPV 3H1HH 1VQ5V 5KMGA 3K57A 1BHAA 3HKDA 2FTKA 2XAJA 4GKJO 1PM9A 5KHJA 3NXSA 4ZHQB 3K59A 3LNNA 5B1BB 1SRYA 2P5OA 4J9YB 2AZ2A 3AG3C 3FB7C 3ZHTA 4NYKA 5LXTA 3S3XA 3ZHUA 4MVZA 4TUYB 1L1FA 2JJ2G 4UXNA 1I0HA 2JS5A 3L71H 2CGNA 1EBOA 4U7NA 4X1KB 3CRCA 5LMNB 4H0LB 4GKKO 4FVMA 1PL4A 4I0XB 3ZMTA 3LNMB 1YJNV 2P4KA 1I94O 4F6RA 2EINB 3CCJV 4GT1A 2Q5ZA 3N2KA 1I94B 4PA9A 2IJIA 3JASB 1GTOA 3K5OA 4X1IA 5ITZA 2ADQB 4DV3O 4LNUB 3SPHA 4UCVA 1QLNA 4MTOA 4R6ZA 1DK1A 4JI2O 1JX9A 3ML0A 4K35A 1RM1B 5KHHA 5GONA 2YIDA 1JFFB 2M7WA 4A5UB 4UFZA 2WAMA 3RYHA 2WA4A 3ZEDA 3AK3A 1T5EA 1LNQA 5LHGA 1XEQA 2BOBC 2ZNJA 1R3JC 4LFCO 2NR5A 4LFCB 4X62O 3AG2C 3ZBHA 4OX9O 4CS2A 4O4JA 5EBLC 4TT3G 4X62B 1BQ0A 3CCQV 2P6JA 3G71V 3W7XA 4DV2O 2BTOA 1MMMA 5A2QN 4O2AB 4XBFA 4X20B 1PKXA 3ZCCA 1JA8A 1XNRO 3FKSG 3ICXA 3L70H 2Y0PA 2PZSA 1XNRB 2JK5C 1URFA 5IWAO 1GN6A 5LP6A 4I50A 4TQDA 5IYBO 1Q86W 5CB4B 2BSKB 2ODMA 4B3TB 1FFTB 1RPRA 4FPPA 4O2BA 1AJQA 4DR2O 2LFSA 1G8MA 1ZUQA 4WFGA 1FYJA 1AJPA 1F7YA 4DW0A 2IH1C 5LXTB 1RP3B 1SA0B 5J2TB 2JGUA 2RMKB 2CAZC 1VEWA 4DR4O 2JGDA 4JYAO 4FK5C 4JZ2A 3IJ4A 4EKWA 5D5QA 4LCUC 1N36B 2NN4A 3TCUA 4EB6B 1TGOA 2F4VB 1QVFU 1MNGA 2CGOA 2Q67A 1GAXA 4UVAA 2JRIA 3H1IH 4NTWA 3E83A 3N2GA 4RAIA 4X1IB 1PNLA 2FB5A 4P9PA 4IGGA 3JD0A 4JAAA 1ZAUA 5BZBA 3OUFA 4DK0A 1M57B 1BL8A 2UXDB 4LF9B 4GLXA 4PDLA 3ABMB 2DYRC 1ZL8B 2EILC 4DV5O 3CX5F 2ZXWC 2G38A 3MDSA 1M56C 2A9HA 1YIJV 3H1JH 2ZQMA 4Q20A 2Q7EA 2QM7A 2WLNA 4DR5B 2P22C 4WBNA 3WU2Z 5EC1C 5IJ0A 2Q73A 4BWAA 1YJWV 1R6TA 4P2ZA 4R7CA 2HG5C 1IBKO 4LWSA 1H2SB 4NTYA 1NQTA 1SESA 1N8RW 2B1GA 4K0KB 3IFXA 3CCLV 1N34O 4XDLA 2GBOA 5LGUA 4I4TA 5LP6B 3KKYA 3K5MA 4I9QA 2ZM6O 3ZHQA 1AI5A 2ARHA 2Y48A 4DV1B 2ZE6A 1JMKC 3T1HB 4O2BB 1FXVA 4IT5A 4JTDB 2MW2B 4JZGA 1IZ3A 1BQZA 4YIPA 5H9CA 2ZIMA 4DUYB 1MZEA 5DEDA 2UU9O 5LOVA 3IC7A 3BHPA 2CTPA 4J11A 1AROP 4FM0A 4X64B 2V4DA 3QTCA 1SQPH 5LYJA 1WLEA 4IYHA 3CWBH 3TK1A 3CCSV 4JYBA 5IDJA 2EZPA 5E79Z 1S5LZ 1XMOO 2XAQA 5CA1A 2UXCO 3IC9A 2DYSC 1P49A 1XMOB 4F4LA 2PI4A 2D3OW 4QIWF 1SKVA 2PUSA 3BPZA 3W7TA 5LA6A 3A0BZ 2JS3A 4X1YA 5JH7B 1F51A 3CCRV 1J5EO 1N0JA 5B1AC 3B4SA 1XQ8A 3HB3B 1EZJA 4DUZB 3ZMSA 5IY5B 4DV0B 3J80N 2A79B 1H2MA 1CP9A 1GKFA 4H33A 1Q5OA 1EN4A 3ZN1A 1GMGA 5JJNB 1K3EA 2WPDG 1WPXA 1CXZB 4UCRA 4DV7B 1OZ0A 4LFBB 3HR0A 4WBNB 1QLEC 2IJHA 1VF7A 3ZN0A 3ABTA 3ASOB 2JIZG 2R72A 1YHQV 1ZSPA 1KKDA 2LW7A 4UV9A 2EIKB 2HFEC 1AR4A 2Q0AA 2CTQA 4AI8A 3OW2U 1TA8A 3DXRA 2EIJC 5CBGA 3HKEA 4I4TB 4L87A 4X66B 5K1XA 4CH6A 1HNWB 1WP8A 4JI7B 1Z5VA 1S77D 4J41A 1AR1B 4LF6B 1F23A 3KCXA 2PY5A 1GN2A 5DM6V 2YS8A 1VQ8V 1IXMA 1R6NA 2HKOA 1GM9A 3LSSA 5IJ9B 1QCEA 1JJOA 4FJCC 2H3OA 4GUNA 3JATA 1I7FA 3CJHA 4PA6A 3OTFA 3RVYA 1HW7A 2KB1A 4JV5O 1ZTEA 1Q82W 1OCOC 3JSNA 3HKBB 3CB2A 2WLMA 2DQ3A 1Y66A 1IBLO 4LF8O 1JCHA 4PDRA 1OCRB 2UUAB 1NR1A 2ZR2A 2ZE5A 3F7YC 3JD2A 4CZZA 2YIBD 4LF7B 2LGQA 3B2EE 3T2MA 3BA8A 5LA6B 1N33O 3C3SA 1XILA 2E75B 2Y69C 3RYIA 3E89A 4TSFG 2YIBA 3P32A 2JEUA 2ZR3A 1H8EG 4UCTA 3EFFK 4KHPB 2XAFA 4J10A 4B3RO 1Z2GA 3DC5A 5BR8O 1KC8W 4DR3O 1RPOA 4JYYA 3OTOB 4DR3B 1NKDA 4CC6A 2FKXA 4ZHQA 2R9AA 3R65A 4W4KA 5KHGA 2RCVA 4UCOA 1XHZA 2IBZH 1V9PA 2DW4A 1VF6C 4BIUA 4DR7O 1H2KA 1HNXB 2ATKC 1V55C 1KECA 2AHYA 5HFLA 3K06A 3SR2C 4FLTA 2F66C 1R3IC 4AQYO 4X1KA 2X0LA 4YXWG 1PNMA 2HLDG 2PF4E 1IX9A 1FD9A 5IYCO 4I0XA 2UXXA 3TETA 2UUCO 3CS5A 2QWNB 4Z2WA 3R66A 3GB7C 3ZJZA 4JAVA 3JASA 1DLBA 2GUZB 5GTHZ 2DE0X 4DR1O 4JI6B 5CMUA 2ADPA 3ZHVA 2OTLV 2W6JG 4IYIA 3IAYA 2A06H 4JI0O 3T1CA 1BCCH 4JI0B 3JATB 3CJHB 3LDDA 4GYCB 4X9QA 5LL6Y 4MSWC 3JD4A 4B3SB 5FNVB 1B3QA 3DC6A 3UCSC 5C93A 1SQVH 2OCHA 1Q3EA 1EZVH 4U7OA 1M57C 5IE9A 3A8TA 2ZT9B 2V7QG 2YIAA 3TGUH 1TAEA 2KSDA 4BIOA 4ZIBA 1XL4A 4O2AA 4X20A 2ZE7A 3OAAG 1MSWD 2P7TC 2HJDA 3HPLC 2QKCA 1SQXH 4WFEA 2DN9A 2YC0A 3G6EV 5CB4A 2EZOA 2BSKA 1GN3A 1GK9A 1YDXA 4J80A 5BMVB 4X8AA 4YY3B 1U97A 1WNSA 4CBCA 3JAMN 2E74B 3CCUV 1V54C 1N4CA 1UPGA 2XUMA 3QNEA 3K5LA 3SJAC 4MVUA 2Q7HA 1SA0A 5J2TA 4I7ZB 1SZTA 1XUQA 4QE7A 2IH3C 3UKMA 4EFBA 4X65O 3BAAA 3L75H 5LP6C 4KUMA 4BR6A 5LMNO 3ABKB 4FLVA 5JJJB 4X65B 3ZS8C 2B1IA 4HNAA 1K9MW 4LF4B 4P30A 2IW5A 4JI5B 4EB6A 2CTRA 4LF5O 1FPOA 2XAHA 1H2GA 5GTIZ 4LF5B 3CRQA 1AI7A 4PELA 2EJ7A 3UT5B 1P4RA 3SJBC 4CH4A 1J95A 2LFRA 3JAKB 3X2QC 4HBNA 4K8ZA 4FLUA 1QU7A 5IYZB 4FM2A 2EIMC 1FXKB 3AG1B 4ZI7B 4WFFA 5L3GA 1GH6A 1VQMV 2YXHA 3RW0A 4CH5A 1WB7A 1XNQO 3SPCA 4NXNB 1AVMA 1XNQB 1WP7A 1ZL8A 2ZNIA 3L9DA 5KUKA 3FB5C 5LHHA 3ZRVA 1WN7A 3ZX6A 3CRRA 3SPIA 2Q7GA 2P06A 5B3SB 1XBLA 4JTCB 3ETQA 1LUVA 1NU1H 3RT3C 3W7WA 2RQ6A 1Y76A 1HNZB 3ASNB 2A7WA 2WLHA 1L0NH 5K1PA 2RNBA 1LUWA 1Q90D 2IU0A 1TUBB 2X6CA 1YEWA 5IT9N 1FS0G 4Q6GA 3RWRD 2E5LO 3H01A 3K5NA 4FLZA 4YIOA 2E5LB 4FLWA 3J7AU 5KHKA 2OTJV 4H44B 3G6BA 2X6BA 3QO7A 5JCOA 4XDJA 4B3TO 4FLXA 3UQ8A 5HFMA 3ASOC 5CA3A 3BRCA 1M5IA 1BE3H 1K92A 4QPJA 4MVQA 1A32A 3G4SV 1K7DA 2ITDC 2VWJA 3CRAA 2EIKC 4HYOA 2QDOA 4MW3A 1S3JA 4WCEV 4H37A 5H2FZ 2WSSG 3ABLC 2Y4TA 1K33A 1COWG 4JAUA 3G80A 2LO1A 3OE7G 1S72V 4OPHA 4NKGB 3VQVA 3JD3A 1N36O 4NR1A 5D5PA 1Q43A 1NBMG 3T1YB 1L8DA 4HNAB 1MABG 2F4VO 2N05A 3LDCA 5KUMA 1B06A 2F1MA 3H1LH 2HR3A 4UB8Z 1AB3A 1O9GA 3J81N 1YF2A 2H94A 4JYCA 1QR8A 4EEQA 2UUBB 3EXAA 2F43G 4PHZA 1YTFB 2ZIOA 3O65A 5JH7A 1YI2V 4UVCA 2UXDO 3HKCA 3SYQA 4LF9O 1DGSA 2FYUH 2DQ0A 1SS3A 3VQYA 1M9NA 2KG7B 3WB0A 5A9GA 4QGPA 1KMIZ 4MTGA 2PGGA 2WLIA 1ORQC 2DMXA 3FAVB 2BTQA 1OCZB 5EBWC 4DR5O 4D7SA 4I55B 1K97A 1NJIW 4DK1A 1Y76B 4TQFA 2BOCC 1SF9A 3LSUA 4GX5A 2WLJA 1DF5A 1S5JA 3ETEA 2WA3A 2CUGA 3RYCB 1SERA 4K0KO 4K3AA 3ZMUA 3CC4V 1K4CC 3JARB 1M90W 3ZHSA 3M7MX 3UO3A 4OXSA 4FZ0A 3GWOA 3QF7A 1MSDA 2EBOA 3MHSC 5LMUB 2LW1A 4DV1O 1EN5A 3CXHF 2K9PA 3T1HO 3SJQC 2IM9A 4CC5A 1SQBH 4NTXA 1R3KC 4ASUG 4DUYO 3AG3B 4J7ZA 2ETNA 1AJNA 4GX0A 4GX1A 1QNMA 2YI8A 3LDEA 4X64O 2Q69A 1M93A 2JVDA 3CPWU 3CCMV 5IJ9A 3W7SA 1HR0B 1THZA 2IU3A 3E8BA 3FB6C 3E8FA 1Q7YW 2VQFB 3OMNB 3O9OA 1GM7A 2Q8VA 3HKBA 3BFRA 4JI8O 1H8HG 4DV4O 1U96A 3OGCC 1HDJA 2R9IA 4JI8B 4DV4B 1ENVA 1VARA 1UJWB 4DRXB 1I5XA 2QM8A 1R73A 3WFVA 4RQEA 4RO2A 4YJ2B 3F5TA 1E1RG 3OUSA 2YEVB 2YDEA 5CBHA 5H6RA 4DUZO 2Z3YA 3G67A 3K9SA 3AG4B 4GCZA 4QPKA 4DV0O 2PTMA 3HKCB 3PN1A 1WPBA 3K3WA 4D6TH 2OCCC 1IURA 5J9PC 2VQEB 1GN4A 2WLIB 3SYAA 2QKSA 4B3MB 2R70A 2F23A 4LC1A 2BTQB 3AG2B 1W59A 3FB8C 1MG1A 4DV7O 2NLJC 4LFAB 3VQWA 4LFBO 4B7EA 5C8YB 4DR6O 1XDCA 3M99B 3U11A 4PJ0Z 4DR6B 3K08A 1TVKB 3C90A 3KG2A 4J9ZB 1VMGA 3F7VC 2O57A 4W4LA 2WWWA 3Q4HB 5B1BC 2LJ2A 4MW8A 4X66O 1XL6A 1VP7A 1B6QA 2HHHB 2YXYA 2Y4UA 2WLLA 1HNWO 4JI7O 1R6KA 4OPAA 4BW5A 3OGIB 2L35A 3UO2A 5KX5B 4LF6O 1BHBA 3ABKC 2GUZA 2OIEA 1NTKH 2HP8A 2B5UA 1E1QG 2AGAA 4MTFA 2VWKA 3E35A 1BZKA 1NTZH 1HP8A 1FXHA 2EINC 1Z5WA 3QVNA 1Y67A 1MA1A 4JI1B 3SPGA 2ZCEA 1KBHA 5JVDB 2QKAA 3P3PA 4DV6B 2UUAO 5FNVA 3I5DA 3A0HZ 4HAMA 2N74A 4LF7O 1KP3A 1NVPB 5CA0B 1RM1C 4O4IA 3D8CA 4KP4A 1YITV 4ZBMA 4G27B 2XASA 3ZRSA 1JPXA 5B1OA 1PV0A 4UUJC 1M1KW 3E22B 5EK0A 4ABMA 4KHPO 1SETA 2CK3G 5L3EA 1JR9A 1S0VA 2OT5A 3SYCA 1H38A 3WB2A 1EN6A 2JJ1G 3OTOO 2M6YA 3K58A 2XTAA 3IGAC 5BMVA 2QWPB 5F2VO 4JPRA 1HNXO 2N04A 3AG7A 5J2UA 4JI3B 5GW7A 5CN0A 4YJ3B 3AK2A 1WJZA 3ZRWB 1YZBA 1VQ6V 5CBFA 1Y4MA 3B8NA 1K5SA 4FFBB 4P9OA 4TV9B 3BCCH 1ZWIC 3UT5A 4JGSA 1NH2B 2WLLB 1CPYA 4DW1A 1PPJH 3WG7B 1UFIA 1KKCA 3JAKA 1US6A 3K04A 1OJHA 1MZFA 1OCCB 5IYZA 1I5YA 4JI6O 5L3FA 1FXKA 1S5HC 2YSUB 4ZI7A 4WFAV 2VRZA 3FFQA 3AEIA 1P7BA 4PA3A 3U0ZA 4U3JB 2IJJA 2OYQA 1RFYA 1VQOV 4IHJB 2OWOA 2QE7G 3F5WC 4FLYA 2RN9A 2Y0IA 4R50A 2HVKC 4PI0A 5JQGB 2Q6AA 4B3SO 3OR7C 4IIJB 1WA8A 2DYSB 2UXBB 1QHTA 4TV8B 2DWDC 3B40A 3CRMA 3OR6C 3CHXA 5KA5A 2HVJC 2JDIG 3OEEG 4O4IB 5L3BA 3BA9A 1ZX3A 2D2CB 5LGTA 1QQCA 5B1AB 3ABMC 1TUBA 3T4DA 2Z0AA 4RQFA 2LP7A 1GO3F 5FLXN 1ROPA 2UXNA 4LBEC 2XNDG 3OMIB 1D5AA 3AK1A 3ETDA 4O4HA 1QVGU 4ICGA 5EIBD 4YY3O 4QE9A 5B5EZ 4MVMA 4KXRA 4FFKA 2AZ0A 1QLEB 3APQA 4NXMO 5J2UB 3KZIZ 3EHBB 4NXMB 3P30A 3SGIA 3LUTB 4PV1B 3VBBA 4C7UA 5JCOC 2GTSA 3GVMA 1BMFG 3OMAB 4KFMA 4GKJB 1EM1A 4LF4O 4JI5O 4AHCA 4X88A 1LR1A 2YXLA 4Z1MG 2WLKA 2EIJB 4LH7A 2PYJA 1KUQA 4EFEA 1YTFD 4N23A 4TOIA 3CYOA 1MOFA 3I56V 2QJ1A 1R3LC 2ILMA 4R8CA 5EZYB 3M8AA 1YJ9V 3U10A 1DTOA 4JASA 4MVSA 4GKKB 2QWOB 4CS3A 2PYLA 1JQ0A 3RFRA 3SJCC 3ETGA 1EFRG 4KL1A 4NXNO 3JALB 4O4LA 4MT8A 3E8HA 3JSLA 4ZKIA 1RSOA 2KG7A 1OCOB 4PDVA 2Q4PA 3L74H 2P4VA 1BS3A 1XREA 3FAVA 4YHHO 1IXBA 1WA8B 1XHXA 5LBQA 4DV3B 3C3TA 4WFBV 1WB8A 4YHHB 4DXWA 4I55A 1HNZO 4J7JA 4JI2B 3P3NA 3K79A 3AG4C 1D2DA 3SDLA 2F93B 1NI8A 1PL0A 1K34A 2Y69B 5IY5C 4I5SA 2E3CA 3JCUZ 1SQQH 3RYCA 2DWEC 1OHHG 1HWYA 3CXCU 3CD6V 3JARA 4RWUA 1W2BU 1W0KG 3JYCA 4K8XA 3OT7A 4MVRA 1BGYH 4OX9B 3OEHG 2CH7A 2K1EA 3K03A 3FD9A 4DYLA 1AP5A 4G2KA 2NNUA 2QSAA 4O4HB 4DV2B 5DN6G 4Z1VA 1VQ7V 4FMTA 2R9RB 1XOUA 4ZOLB 3RYFB 1V55B 5EC2C 4NB5A 5TISZ 1XI1A 1FFXB 1BSMA 3CSXA 2P67A 5KMGB 3HKDB 5IWAB 3CEIA 1Q8IA 4J42A 1IVSA 3RN4A 3T1YO 3E2EA 1VQ4V 1E79G 3ZRXA 4DR2B 4UVBA 3CP1A 1CEZA 2IJKA 4CH3A 3STZC 5JWPA 1PD3A 4G28B 2UUBO 4AILC 4E2LA 4CS4A 1KB9F 1KU9A 4GZRB 4DRXA 4PA4A 4DR4B 1B04A 4LP8A 3WB1A 4JYAB 1G6UA 4YJ2A 2MK3A 4WF9V 2YEVA 3ZHRA 2GV9A 1XMQO 3D36C 1G1XB 4F6RB 4IL6Z 1XMQB 2B9ZA 3LSQA 3N2KB 1OCRC 4O4LB 2AHZA 4WFHA 5KA6A 1RSOB 3K9AA 4QJFB 5ITZB
chains in the Genus database with same CATH topology
1I94O 3SDLA 1D2DA 2Z0AA 4JYAO 2UXBO 2UU9O 4DR6O 5FLXN 4X65O 1A32A 1R1BA 2UUCO 2VQEO 2DOSA 5LMNO 4DV1O 1HNXO 4B3MO 4DV3O 3T1HO 4LFAO 4YY3O 4JI2O 1DK1A 1N32O 3R66A 4LF5O 2JRIA 1YZBA 4DUYO 4X66O 4OPHA 4A5UB 4DR1O 1HNWO 1N36O 1XMOO 4JI7O 4NXMO 4OPAA 2UXCO 4X64O 1FKAO 4JV5O 5LMUO 1AILA 1XEQA 5BXZA 4LF6O 2F4VO 4JI0O 4LFCO 4JI3O 1IBLO 4LF8O 4LF4O 4X62O 2AGAA 4JI5O 4OX9O 1AB3A 3J81N 5LL6Y 1J5EO 4DV5O 2HHHO 4JI4O 4JI6O 4DV2O 1N33O 1XNQO 1KUQA 3T1YO 4JI8O 4DV4O 3J80N 3O65A 5A2QN 1HR0O 4GKJO 2DJVA 2UXDO 1XNRO 3M8AA 2UUAO 4LF9O 2VQFO 1R6TA 1X59A 3F5TA 2N74A 4LF7O 4B3RO 5IWAO 1IBKO 5BR8O 2UUBO 3RT3C 4DUZO 1IBMO 4DR3O 4B3SO 4DV0O 2FKXA 4NXNO 4DR2O 4JI1O 4DR5O 1N34O 1XMQO 4KHPO 4DV6O 5IT9N 1FYJA 2ZM6O 2LW7A 1F7YA 1G1XB 2E5LO 4DR7O 4YHHO 1NS1A 5BY1A 1FJGO 4GKKO 3J7AU 4DV7O 4LFBO 1HNZO 5H5NA 4B3TO 3OTOO 2ZKOA 4K0KO 4DR4O 3JAMN 4AQYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 O;  3SDL A;  1D2D A;  2Z0A A;  4JYA O;  2UXB O;  2UU9 O;  4DR6 O;  5FLX N;  4X65 O;  1A32 A;  1R1B A;  2UUC O;  2VQE O;  2DOS A;  5LMN O;  4DV1 O;  1HNX O;  4B3M O;  4DV3 O;  3T1H O;  4LFA O;  4YY3 O;  4JI2 O;  1DK1 A;  1N32 O;  3R66 A;  4LF5 O;  2JRI A;  1YZB A;  4DUY O;  4X66 O;  4OPH A;  4A5U B;  4DR1 O;  1HNW O;  1N36 O;  1XMO O;  4JI7 O;  4NXM O;  4OPA A;  2UXC O;  4X64 O;  1FKA O;  4JV5 O;  5LMU O;  1AIL A;  1XEQ A;  5BXZ A;  4LF6 O;  2F4V O;  4JI0 O;  4LFC O;  4JI3 O;  1IBL O;  4LF8 O;  4LF4 O;  4X62 O;  2AGA A;  4JI5 O;  4OX9 O;  1AB3 A;  3J81 N;  5LL6 Y;  1J5E O;  4DV5 O;  2HHH O;  4JI4 O;  4JI6 O;  4DV2 O;  1N33 O;  1XNQ O;  1KUQ A;  3T1Y O;  4JI8 O;  4DV4 O;  3J80 N;  3O65 A;  5A2Q N;  1HR0 O;  4GKJ O;  2DJV A;  2UXD O;  1XNR O;  3M8A A;  2UUA O;  4LF9 O;  2VQF O;  1R6T A;  1X59 A;  3F5T A;  2N74 A;  4LF7 O;  4B3R O;  5IWA O;  1IBK O;  5BR8 O;  2UUB O;  3RT3 C;  4DUZ O;  1IBM O;  4DR3 O;  4B3S O;  4DV0 O;  2FKX A;  4NXN O;  4DR2 O;  4JI1 O;  4DR5 O;  1N34 O;  1XMQ O;  4KHP O;  4DV6 O;  5IT9 N;  1FYJ A;  2ZM6 O;  2LW7 A;  1F7Y A;  1G1X B;  2E5L O;  4DR7 O;  4YHH O;  1NS1 A;  5BY1 A;  1FJG O;  4GKK O;  3J7A U;  4DV7 O;  4LFB O;  1HNZ O;  5H5N A;  4B3T O;  3OTO O;  2ZKO A;  4K0K O;  4DR4 O;  3JAM N;  4AQY O; 
#chains in the Genus database with same CATH topology
 3MAQ A;  1K8A W;  1GRJ A;  2AW9 A;  3JCZ A;  2QWR B;  1AI6 A;  5KHI A;  5GON B;  5KAI Z;  1AR5 A;  5C8Y A;  3RYH B;  1VIB A;  2QTO A;  3BEH A;  1Q81 W;  1NT2 B;  2CTW A;  5DEC A;  4BAY A;  4RUF A;  1TVK A;  1NTM H;  2FL4 A;  3I55 V;  4DV5 B;  2A0L A;  1JOY A;  2Q9L A;  4H13 B;  3CCE V;  1FKA O;  3Q4H A;  5LMU O;  4O4J B;  3FYE B;  4DO2 A;  1KQS U;  3VQX A;  4I9W A;  2CH7 B;  4LR3 A;  2XT9 A;  3OFN G;  4BIZ A;  2Z5U A;  1OV9 A;  1G4Y B;  5KX5 A;  1IBK B;  3BVO A;  3GWK C;  1V54 B;  5FPR A;  1AP6 A;  3FX7 A;  1H2L A;  1S76 D;  4UCS A;  1N34 B;  4I50 B;  1HR0 O;  3TXQ A;  2ZM6 B;  5KAF Z;  2VQF O;  4FZ1 A;  3JAW A;  2YI9 A;  1I08 A;  3WG7 C;  2XHB A;  2X7R B;  4OGQ B;  1NVP D;  1IBM O;  2YUA A;  1TUE B;  1OCC C;  2QGN A;  3D36 A;  2QTS A;  5JVD A;  1IBM B;  3RVZ A;  2UU9 B;  1YSC A;  5B66 Z;  3X2Q B;  5CA0 A;  5H6Q A;  2HJF C;  2JGD B;  2QEX V;  2EIM B;  3TJT A;  4E4E A;  1FJG O;  3APO A;  1FJG B;  5H5N A;  2KKW A;  3E22 A;  2ZKO A;  3BY6 A;  1P7G A;  1Y74 A;  1K5Q A;  2YIC A;  3DTU B;  2GTA A;  2UXC B;  4F6E A;  4UV8 A;  2VQE O;  3E8G A;  4GX2 A;  3N2G B;  5B1N A;  1DF4 A;  4B3M O;  4L8J A;  4QNH B;  4B08 A;  1WAZ A;  4LFA O;  3D3Q A;  1KYO F;  3DGE A;  2C2A A;  2ITC C;  5LGN A;  1J5E B;  2ZE8 A;  1YCI A;  1QBZ A;  4JTA B;  3MD0 A;  3SYO A;  4YJ3 A;  3ZRW A;  4U3F H;  3OD4 A;  3L72 H;  3CC7 V;  1PP9 H;  1GM8 A;  3N27 A;  1SC5 B;  2QR4 A;  4MVO A;  1NH2 D;  1NZ6 A;  2GDS A;  1ZLZ A;  4FFB A;  2RDC A;  4TV9 A;  2L6L A;  2HHH O;  5IJ0 B;  3EVK A;  3S3W A;  1BT8 A;  3QO5 A;  3ZMV A;  3ABU A;  2KQX A;  4LWS B;  1JJ2 U;  5FPO A;  3FYI B;  2DJV A;  2W0F C;  1K4D C;  5EBM C;  3NR7 A;  2ZDI C;  3ABL B;  1O9H A;  3W7U A;  1Q6I A;  4PDM A;  4U3J A;  2AXT Z;  3DSQ A;  4BW9 A;  3CE2 A;  2EJR A;  4IHJ A;  4HZ3 A;  4JI1 O;  3BAB A;  3JAW B;  4PD4 F;  2EX3 A;  2CE4 A;  2VS0 A;  4NVP A;  5JQG A;  2BE3 A;  4DV6 O;  4J7K A;  4PI2 A;  3H9V A;  4IIJ A;  1W0J G;  4UB6 Z;  3SYP A;  2QWQ B;  2Q68 A;  5LOV B;  2GSM B;  1P84 F;  1FXK C;  3AG1 C;  4TV8 A;  2QM4 A;  3THO A;  1KD1 W;  2P90 A;  5EYP A;  2ZIN A;  5LYJ B;  4MTX A;  1Q6U A;  4JV5 B;  2LQT A;  5IYD O;  1R1B A;  4RUE A;  3KCY A;  3QO8 A;  5E1A C;  2H8P C;  5CA1 B;  1Y74 B;  1IBL B;  4LF8 B;  1AI4 A;  2XOK G;  3B77 A;  2E76 B;  1N32 O;  4X89 A;  3B09 A;  5B3S C;  2DYR B;  1N32 B;  2EIL B;  3ASN C;  3CCV V;  2ZXW B;  3A0R A;  1M56 B;  1YVW A;  4X1Y B;  1N33 B;  1PNK A;  5BXZ A;  4D7T A;  1QR9 A;  4JI3 O;  3K0G A;  1SQF A;  2W6I G;  3ZMZ A;  3D3I A;  1SZX A;  3VOU A;  4FM1 A;  1YXB A;  4B3R B;  3K0D A;  5BR8 B;  4JI4 O;  3H1K H;  4JI4 B;  3PJS K;  2EUL A;  1VQ9 V;  1F4N A;  2ZDI A;  1L0L H;  2RJZ A;  3CMA V;  1X59 A;  1KP2 A;  3CME V;  4TUY A;  2QA4 V;  4DR7 B;  1Y6X A;  3JD1 A;  5EIB C;  3T4Z A;  4TWK A;  4PA7 A;  3QG5 A;  2GHY A;  5EZY A;  2A3Q A;  4AQY B;  4UCU A;  3MHH C;  3A2F A;  4B7K A;  3OM3 B;  1JVM A;  3DXR B;  3HKE B;  2UUC B;  2XAG A;  4FIP C;  3JAL A;  4XDK A;  2BCC H;  1NS1 A;  3RGB A;  5BY1 A;  1VQK V;  4LH6 A;  1Q6H A;  1M4U A;  3UM7 A;  4LNU A;  2UXB O;  2FML A;  2HEP A;  4DR1 B;  1N0N A;  4MS2 A;  1FAF A;  1X4T A;  2ZD9 A;  1D5N A;  1JFF A;  2DOS A;  5EYP B;  3TXS A;  2W0X A;  3L73 H;  3E86 A;  3SPJ A;  5AG2 A;  2F95 B;  1VQN V;  2LGW A;  1OCZ C;  2V1D A;  2X6A A;  1AIL A;  5KLV H;  2JEX A;  1VF5 B;  2OCC B;  1K73 W;  2PI5 A;  4N21 A;  5FL7 G;  3ZIA G;  3RYI B;  1NR7 A;  1F4M A;  5L3D A;  4JF3 A;  1VF6 A;  4ZOL A;  3B8M A;  5L3C A;  3RYF A;  1VQL V;  1IDS A;  5JJE B;  1H2N A;  3RBZ A;  2Q0O C;  2CDY A;  1SQG A;  5LHI A;  2OIG A;  3CC2 V;  1FFX A;  3STL C;  1VQP V;  3H1H H;  1VQ5 V;  5KMG A;  3K57 A;  1BHA A;  3HKD A;  2FTK A;  2XAJ A;  4GKJ O;  1PM9 A;  5KHJ A;  3NXS A;  4ZHQ B;  3K59 A;  3LNN A;  5B1B B;  1SRY A;  2P5O A;  4J9Y B;  2AZ2 A;  3AG3 C;  3FB7 C;  3ZHT A;  4NYK A;  5LXT A;  3S3X A;  3ZHU A;  4MVZ A;  4TUY B;  1L1F A;  2JJ2 G;  4UXN A;  1I0H A;  2JS5 A;  3L71 H;  2CGN A;  1EBO A;  4U7N A;  4X1K B;  3CRC A;  5LMN B;  4H0L B;  4GKK O;  4FVM A;  1PL4 A;  4I0X B;  3ZMT A;  3LNM B;  1YJN V;  2P4K A;  1I94 O;  4F6R A;  2EIN B;  3CCJ V;  4GT1 A;  2Q5Z A;  3N2K A;  1I94 B;  4PA9 A;  2IJI A;  3JAS B;  1GTO A;  3K5O A;  4X1I A;  5ITZ A;  2ADQ B;  4DV3 O;  4LNU B;  3SPH A;  4UCV A;  1QLN A;  4MTO A;  4R6Z A;  1DK1 A;  4JI2 O;  1JX9 A;  3ML0 A;  4K35 A;  1RM1 B;  5KHH A;  5GON A;  2YID A;  1JFF B;  2M7W A;  4A5U B;  4UFZ A;  2WAM A;  3RYH A;  2WA4 A;  3ZED A;  3AK3 A;  1T5E A;  1LNQ A;  5LHG A;  1XEQ A;  2BOB C;  2ZNJ A;  1R3J C;  4LFC O;  2NR5 A;  4LFC B;  4X62 O;  3AG2 C;  3ZBH A;  4OX9 O;  4CS2 A;  4O4J A;  5EBL C;  4TT3 G;  4X62 B;  1BQ0 A;  3CCQ V;  2P6J A;  3G71 V;  3W7X A;  4DV2 O;  2BTO A;  1MMM A;  5A2Q N;  4O2A B;  4XBF A;  4X20 B;  1PKX A;  3ZCC A;  1JA8 A;  1XNR O;  3FKS G;  3ICX A;  3L70 H;  2Y0P A;  2PZS A;  1XNR B;  2JK5 C;  1URF A;  5IWA O;  1GN6 A;  5LP6 A;  4I50 A;  4TQD A;  5IYB O;  1Q86 W;  5CB4 B;  2BSK B;  2ODM A;  4B3T B;  1FFT B;  1RPR A;  4FPP A;  4O2B A;  1AJQ A;  4DR2 O;  2LFS A;  1G8M A;  1ZUQ A;  4WFG A;  1FYJ A;  1AJP A;  1F7Y A;  4DW0 A;  2IH1 C;  5LXT B;  1RP3 B;  1SA0 B;  5J2T B;  2JGU A;  2RMK B;  2CAZ C;  1VEW A;  4DR4 O;  2JGD A;  4JYA O;  4FK5 C;  4JZ2 A;  3IJ4 A;  4EKW A;  5D5Q A;  4LCU C;  1N36 B;  2NN4 A;  3TCU A;  4EB6 B;  1TGO A;  2F4V B;  1QVF U;  1MNG A;  2CGO A;  2Q67 A;  1GAX A;  4UVA A;  2JRI A;  3H1I H;  4NTW A;  3E83 A;  3N2G A;  4RAI A;  4X1I B;  1PNL A;  2FB5 A;  4P9P A;  4IGG A;  3JD0 A;  4JAA A;  1ZAU A;  5BZB A;  3OUF A;  4DK0 A;  1M57 B;  1BL8 A;  2UXD B;  4LF9 B;  4GLX A;  4PDL A;  3ABM B;  2DYR C;  1ZL8 B;  2EIL C;  4DV5 O;  3CX5 F;  2ZXW C;  2G38 A;  3MDS A;  1M56 C;  2A9H A;  1YIJ V;  3H1J H;  2ZQM A;  4Q20 A;  2Q7E A;  2QM7 A;  2WLN A;  4DR5 B;  2P22 C;  4WBN A;  3WU2 Z;  5EC1 C;  5IJ0 A;  2Q73 A;  4BWA A;  1YJW V;  1R6T A;  4P2Z A;  4R7C A;  2HG5 C;  1IBK O;  4LWS A;  1H2S B;  4NTY A;  1NQT A;  1SES A;  1N8R W;  2B1G A;  4K0K B;  3IFX A;  3CCL V;  1N34 O;  4XDL A;  2GBO A;  5LGU A;  4I4T A;  5LP6 B;  3KKY A;  3K5M A;  4I9Q A;  2ZM6 O;  3ZHQ A;  1AI5 A;  2ARH A;  2Y48 A;  4DV1 B;  2ZE6 A;  1JMK C;  3T1H B;  4O2B B;  1FXV A;  4IT5 A;  4JTD B;  2MW2 B;  4JZG A;  1IZ3 A;  1BQZ A;  4YIP A;  5H9C A;  2ZIM A;  4DUY B;  1MZE A;  5DED A;  2UU9 O;  5LOV A;  3IC7 A;  3BHP A;  2CTP A;  4J11 A;  1ARO P;  4FM0 A;  4X64 B;  2V4D A;  3QTC A;  1SQP H;  5LYJ A;  1WLE A;  4IYH A;  3CWB H;  3TK1 A;  3CCS V;  4JYB A;  5IDJ A;  2EZP A;  5E79 Z;  1S5L Z;  1XMO O;  2XAQ A;  5CA1 A;  2UXC O;  3IC9 A;  2DYS C;  1P49 A;  1XMO B;  4F4L A;  2PI4 A;  2D3O W;  4QIW F;  1SKV A;  2PUS A;  3BPZ A;  3W7T A;  5LA6 A;  3A0B Z;  2JS3 A;  4X1Y A;  5JH7 B;  1F51 A;  3CCR V;  1J5E O;  1N0J A;  5B1A C;  3B4S A;  1XQ8 A;  3HB3 B;  1EZJ A;  4DUZ B;  3ZMS A;  5IY5 B;  4DV0 B;  3J80 N;  2A79 B;  1H2M A;  1CP9 A;  1GKF A;  4H33 A;  1Q5O A;  1EN4 A;  3ZN1 A;  1GMG A;  5JJN B;  1K3E A;  2WPD G;  1WPX A;  1CXZ B;  4UCR A;  4DV7 B;  1OZ0 A;  4LFB B;  3HR0 A;  4WBN B;  1QLE C;  2IJH A;  1VF7 A;  3ZN0 A;  3ABT A;  3ASO B;  2JIZ G;  2R72 A;  1YHQ V;  1ZSP A;  1KKD A;  2LW7 A;  4UV9 A;  2EIK B;  2HFE C;  1AR4 A;  2Q0A A;  2CTQ A;  4AI8 A;  3OW2 U;  1TA8 A;  3DXR A;  2EIJ C;  5CBG A;  3HKE A;  4I4T B;  4L87 A;  4X66 B;  5K1X A;  4CH6 A;  1HNW B;  1WP8 A;  4JI7 B;  1Z5V A;  1S77 D;  4J41 A;  1AR1 B;  4LF6 B;  1F23 A;  3KCX A;  2PY5 A;  1GN2 A;  5DM6 V;  2YS8 A;  1VQ8 V;  1IXM A;  1R6N A;  2HKO A;  1GM9 A;  3LSS A;  5IJ9 B;  1QCE A;  1JJO A;  4FJC C;  2H3O A;  4GUN A;  3JAT A;  1I7F A;  3CJH A;  4PA6 A;  3OTF A;  3RVY A;  1HW7 A;  2KB1 A;  4JV5 O;  1ZTE A;  1Q82 W;  1OCO C;  3JSN A;  3HKB B;  3CB2 A;  2WLM A;  2DQ3 A;  1Y66 A;  1IBL O;  4LF8 O;  1JCH A;  4PDR A;  1OCR B;  2UUA B;  1NR1 A;  2ZR2 A;  2ZE5 A;  3F7Y C;  3JD2 A;  4CZZ A;  2YIB D;  4LF7 B;  2LGQ A;  3B2E E;  3T2M A;  3BA8 A;  5LA6 B;  1N33 O;  3C3S A;  1XIL A;  2E75 B;  2Y69 C;  3RYI A;  3E89 A;  4TSF G;  2YIB A;  3P32 A;  2JEU A;  2ZR3 A;  1H8E G;  4UCT A;  3EFF K;  4KHP B;  2XAF A;  4J10 A;  4B3R O;  1Z2G A;  3DC5 A;  5BR8 O;  1KC8 W;  4DR3 O;  1RPO A;  4JYY A;  3OTO B;  4DR3 B;  1NKD A;  4CC6 A;  2FKX A;  4ZHQ A;  2R9A A;  3R65 A;  4W4K A;  5KHG A;  2RCV A;  4UCO A;  1XHZ A;  2IBZ H;  1V9P A;  2DW4 A;  1VF6 C;  4BIU A;  4DR7 O;  1H2K A;  1HNX B;  2ATK C;  1V55 C;  1KEC A;  2AHY A;  5HFL A;  3K06 A;  3SR2 C;  4FLT A;  2F66 C;  1R3I C;  4AQY O;  4X1K A;  2X0L A;  4YXW G;  1PNM A;  2HLD G;  2PF4 E;  1IX9 A;  1FD9 A;  5IYC O;  4I0X A;  2UXX A;  3TET A;  2UUC O;  3CS5 A;  2QWN B;  4Z2W A;  3R66 A;  3GB7 C;  3ZJZ A;  4JAV A;  3JAS A;  1DLB A;  2GUZ B;  5GTH Z;  2DE0 X;  4DR1 O;  4JI6 B;  5CMU A;  2ADP A;  3ZHV A;  2OTL V;  2W6J G;  4IYI A;  3IAY A;  2A06 H;  4JI0 O;  3T1C A;  1BCC H;  4JI0 B;  3JAT B;  3CJH B;  3LDD A;  4GYC B;  4X9Q A;  5LL6 Y;  4MSW C;  3JD4 A;  4B3S B;  5FNV B;  1B3Q A;  3DC6 A;  3UCS C;  5C93 A;  1SQV H;  2OCH A;  1Q3E A;  1EZV H;  4U7O A;  1M57 C;  5IE9 A;  3A8T A;  2ZT9 B;  2V7Q G;  2YIA A;  3TGU H;  1TAE A;  2KSD A;  4BIO A;  4ZIB A;  1XL4 A;  4O2A A;  4X20 A;  2ZE7 A;  3OAA G;  1MSW D;  2P7T C;  2HJD A;  3HPL C;  2QKC A;  1SQX H;  4WFE A;  2DN9 A;  2YC0 A;  3G6E V;  5CB4 A;  2EZO A;  2BSK A;  1GN3 A;  1GK9 A;  1YDX A;  4J80 A;  5BMV B;  4X8A A;  4YY3 B;  1U97 A;  1WNS A;  4CBC A;  3JAM N;  2E74 B;  3CCU V;  1V54 C;  1N4C A;  1UPG A;  2XUM A;  3QNE A;  3K5L A;  3SJA C;  4MVU A;  2Q7H A;  1SA0 A;  5J2T A;  4I7Z B;  1SZT A;  1XUQ A;  4QE7 A;  2IH3 C;  3UKM A;  4EFB A;  4X65 O;  3BAA A;  3L75 H;  5LP6 C;  4KUM A;  4BR6 A;  5LMN O;  3ABK B;  4FLV A;  5JJJ B;  4X65 B;  3ZS8 C;  2B1I A;  4HNA A;  1K9M W;  4LF4 B;  4P30 A;  2IW5 A;  4JI5 B;  4EB6 A;  2CTR A;  4LF5 O;  1FPO A;  2XAH A;  1H2G A;  5GTI Z;  4LF5 B;  3CRQ A;  1AI7 A;  4PEL A;  2EJ7 A;  3UT5 B;  1P4R A;  3SJB C;  4CH4 A;  1J95 A;  2LFR A;  3JAK B;  3X2Q C;  4HBN A;  4K8Z A;  4FLU A;  1QU7 A;  5IYZ B;  4FM2 A;  2EIM C;  1FXK B;  3AG1 B;  4ZI7 B;  4WFF A;  5L3G A;  1GH6 A;  1VQM V;  2YXH A;  3RW0 A;  4CH5 A;  1WB7 A;  1XNQ O;  3SPC A;  4NXN B;  1AVM A;  1XNQ B;  1WP7 A;  1ZL8 A;  2ZNI A;  3L9D A;  5KUK A;  3FB5 C;  5LHH A;  3ZRV A;  1WN7 A;  3ZX6 A;  3CRR A;  3SPI A;  2Q7G A;  2P06 A;  5B3S B;  1XBL A;  4JTC B;  3ETQ A;  1LUV A;  1NU1 H;  3RT3 C;  3W7W A;  2RQ6 A;  1Y76 A;  1HNZ B;  3ASN B;  2A7W A;  2WLH A;  1L0N H;  5K1P A;  2RNB A;  1LUW A;  1Q90 D;  2IU0 A;  1TUB B;  2X6C A;  1YEW A;  5IT9 N;  1FS0 G;  4Q6G A;  3RWR D;  2E5L O;  3H01 A;  3K5N A;  4FLZ A;  4YIO A;  2E5L B;  4FLW A;  3J7A U;  5KHK A;  2OTJ V;  4H44 B;  3G6B A;  2X6B A;  3QO7 A;  5JCO A;  4XDJ A;  4B3T O;  4FLX A;  3UQ8 A;  5HFM A;  3ASO C;  5CA3 A;  3BRC A;  1M5I A;  1BE3 H;  1K92 A;  4QPJ A;  4MVQ A;  1A32 A;  3G4S V;  1K7D A;  2ITD C;  2VWJ A;  3CRA A;  2EIK C;  4HYO A;  2QDO A;  4MW3 A;  1S3J A;  4WCE V;  4H37 A;  5H2F Z;  2WSS G;  3ABL C;  2Y4T A;  1K33 A;  1COW G;  4JAU A;  3G80 A;  2LO1 A;  3OE7 G;  1S72 V;  4OPH A;  4NKG B;  3VQV A;  3JD3 A;  1N36 O;  4NR1 A;  5D5P A;  1Q43 A;  1NBM G;  3T1Y B;  1L8D A;  4HNA B;  1MAB G;  2F4V O;  2N05 A;  3LDC A;  5KUM A;  1B06 A;  2F1M A;  3H1L H;  2HR3 A;  4UB8 Z;  1AB3 A;  1O9G A;  3J81 N;  1YF2 A;  2H94 A;  4JYC A;  1QR8 A;  4EEQ A;  2UUB B;  3EXA A;  2F43 G;  4PHZ A;  1YTF B;  2ZIO A;  3O65 A;  5JH7 A;  1YI2 V;  4UVC A;  2UXD O;  3HKC A;  3SYQ A;  4LF9 O;  1DGS A;  2FYU H;  2DQ0 A;  1SS3 A;  3VQY A;  1M9N A;  2KG7 B;  3WB0 A;  5A9G A;  4QGP A;  1KMI Z;  4MTG A;  2PGG A;  2WLI A;  1ORQ C;  2DMX A;  3FAV B;  2BTQ A;  1OCZ B;  5EBW C;  4DR5 O;  4D7S A;  4I55 B;  1K97 A;  1NJI W;  4DK1 A;  1Y76 B;  4TQF A;  2BOC C;  1SF9 A;  3LSU A;  4GX5 A;  2WLJ A;  1DF5 A;  1S5J A;  3ETE A;  2WA3 A;  2CUG A;  3RYC B;  1SER A;  4K0K O;  4K3A A;  3ZMU A;  3CC4 V;  1K4C C;  3JAR B;  1M90 W;  3ZHS A;  3M7M X;  3UO3 A;  4OXS A;  4FZ0 A;  3GWO A;  3QF7 A;  1MSD A;  2EBO A;  3MHS C;  5LMU B;  2LW1 A;  4DV1 O;  1EN5 A;  3CXH F;  2K9P A;  3T1H O;  3SJQ C;  2IM9 A;  4CC5 A;  1SQB H;  4NTX A;  1R3K C;  4ASU G;  4DUY O;  3AG3 B;  4J7Z A;  2ETN A;  1AJN A;  4GX0 A;  4GX1 A;  1QNM A;  2YI8 A;  3LDE A;  4X64 O;  2Q69 A;  1M93 A;  2JVD A;  3CPW U;  3CCM V;  5IJ9 A;  3W7S A;  1HR0 B;  1THZ A;  2IU3 A;  3E8B A;  3FB6 C;  3E8F A;  1Q7Y W;  2VQF B;  3OMN B;  3O9O A;  1GM7 A;  2Q8V A;  3HKB A;  3BFR A;  4JI8 O;  1H8H G;  4DV4 O;  1U96 A;  3OGC C;  1HDJ A;  2R9I A;  4JI8 B;  4DV4 B;  1ENV A;  1VAR A;  1UJW B;  4DRX B;  1I5X A;  2QM8 A;  1R73 A;  3WFV A;  4RQE A;  4RO2 A;  4YJ2 B;  3F5T A;  1E1R G;  3OUS A;  2YEV B;  2YDE A;  5CBH A;  5H6R A;  4DUZ O;  2Z3Y A;  3G67 A;  3K9S A;  3AG4 B;  4GCZ A;  4QPK A;  4DV0 O;  2PTM A;  3HKC B;  3PN1 A;  1WPB A;  3K3W A;  4D6T H;  2OCC C;  1IUR A;  5J9P C;  2VQE B;  1GN4 A;  2WLI B;  3SYA A;  2QKS A;  4B3M B;  2R70 A;  2F23 A;  4LC1 A;  2BTQ B;  3AG2 B;  1W59 A;  3FB8 C;  1MG1 A;  4DV7 O;  2NLJ C;  4LFA B;  3VQW A;  4LFB O;  4B7E A;  5C8Y B;  4DR6 O;  1XDC A;  3M99 B;  3U11 A;  4PJ0 Z;  4DR6 B;  3K08 A;  1TVK B;  3C90 A;  3KG2 A;  4J9Z B;  1VMG A;  3F7V C;  2O57 A;  4W4L A;  2WWW A;  3Q4H B;  5B1B C;  2LJ2 A;  4MW8 A;  4X66 O;  1XL6 A;  1VP7 A;  1B6Q A;  2HHH B;  2YXY A;  2Y4U A;  2WLL A;  1HNW O;  4JI7 O;  1R6K A;  4OPA A;  4BW5 A;  3OGI B;  2L35 A;  3UO2 A;  5KX5 B;  4LF6 O;  1BHB A;  3ABK C;  2GUZ A;  2OIE A;  1NTK H;  2HP8 A;  2B5U A;  1E1Q G;  2AGA A;  4MTF A;  2VWK A;  3E35 A;  1BZK A;  1NTZ H;  1HP8 A;  1FXH A;  2EIN C;  1Z5W A;  3QVN A;  1Y67 A;  1MA1 A;  4JI1 B;  3SPG A;  2ZCE A;  1KBH A;  5JVD B;  2QKA A;  3P3P A;  4DV6 B;  2UUA O;  5FNV A;  3I5D A;  3A0H Z;  4HAM A;  2N74 A;  4LF7 O;  1KP3 A;  1NVP B;  5CA0 B;  1RM1 C;  4O4I A;  3D8C A;  4KP4 A;  1YIT V;  4ZBM A;  4G27 B;  2XAS A;  3ZRS A;  1JPX A;  5B1O A;  1PV0 A;  4UUJ C;  1M1K W;  3E22 B;  5EK0 A;  4ABM A;  4KHP O;  1SET A;  2CK3 G;  5L3E A;  1JR9 A;  1S0V A;  2OT5 A;  3SYC A;  1H38 A;  3WB2 A;  1EN6 A;  2JJ1 G;  3OTO O;  2M6Y A;  3K58 A;  2XTA A;  3IGA C;  5BMV A;  2QWP B;  5F2V O;  4JPR A;  1HNX O;  2N04 A;  3AG7 A;  5J2U A;  4JI3 B;  5GW7 A;  5CN0 A;  4YJ3 B;  3AK2 A;  1WJZ A;  3ZRW B;  1YZB A;  1VQ6 V;  5CBF A;  1Y4M A;  3B8N A;  1K5S A;  4FFB B;  4P9O A;  4TV9 B;  3BCC H;  1ZWI C;  3UT5 A;  4JGS A;  1NH2 B;  2WLL B;  1CPY A;  4DW1 A;  1PPJ H;  3WG7 B;  1UFI A;  1KKC A;  3JAK A;  1US6 A;  3K04 A;  1OJH A;  1MZF A;  1OCC B;  5IYZ A;  1I5Y A;  4JI6 O;  5L3F A;  1FXK A;  1S5H C;  2YSU B;  4ZI7 A;  4WFA V;  2VRZ A;  3FFQ A;  3AEI A;  1P7B A;  4PA3 A;  3U0Z A;  4U3J B;  2IJJ A;  2OYQ A;  1RFY A;  1VQO V;  4IHJ B;  2OWO A;  2QE7 G;  3F5W C;  4FLY A;  2RN9 A;  2Y0I A;  4R50 A;  2HVK C;  4PI0 A;  5JQG B;  2Q6A A;  4B3S O;  3OR7 C;  4IIJ B;  1WA8 A;  2DYS B;  2UXB B;  1QHT A;  4TV8 B;  2DWD C;  3B40 A;  3CRM A;  3OR6 C;  3CHX A;  5KA5 A;  2HVJ C;  2JDI G;  3OEE G;  4O4I B;  5L3B A;  3BA9 A;  1ZX3 A;  2D2C B;  5LGT A;  1QQC A;  5B1A B;  3ABM C;  1TUB A;  3T4D A;  2Z0A A;  4RQF A;  2LP7 A;  1GO3 F;  5FLX N;  1ROP A;  2UXN A;  4LBE C;  2XND G;  3OMI B;  1D5A A;  3AK1 A;  3ETD A;  4O4H A;  1QVG U;  4ICG A;  5EIB D;  4YY3 O;  4QE9 A;  5B5E Z;  4MVM A;  4KXR A;  4FFK A;  2AZ0 A;  1QLE B;  3APQ A;  4NXM O;  5J2U B;  3KZI Z;  3EHB B;  4NXM B;  3P30 A;  3SGI A;  3LUT B;  4PV1 B;  3VBB A;  4C7U A;  5JCO C;  2GTS A;  3GVM A;  1BMF G;  3OMA B;  4KFM A;  4GKJ B;  1EM1 A;  4LF4 O;  4JI5 O;  4AHC A;  4X88 A;  1LR1 A;  2YXL A;  4Z1M G;  2WLK A;  2EIJ B;  4LH7 A;  2PYJ A;  1KUQ A;  4EFE A;  1YTF D;  4N23 A;  4TOI A;  3CYO A;  1MOF A;  3I56 V;  2QJ1 A;  1R3L C;  2ILM A;  4R8C A;  5EZY B;  3M8A A;  1YJ9 V;  3U10 A;  1DTO A;  4JAS A;  4MVS A;  4GKK B;  2QWO B;  4CS3 A;  2PYL A;  1JQ0 A;  3RFR A;  3SJC C;  3ETG A;  1EFR G;  4KL1 A;  4NXN O;  3JAL B;  4O4L A;  4MT8 A;  3E8H A;  3JSL A;  4ZKI A;  1RSO A;  2KG7 A;  1OCO B;  4PDV A;  2Q4P A;  3L74 H;  2P4V A;  1BS3 A;  1XRE A;  3FAV A;  4YHH O;  1IXB A;  1WA8 B;  1XHX A;  5LBQ A;  4DV3 B;  3C3T A;  4WFB V;  1WB8 A;  4YHH B;  4DXW A;  4I55 A;  1HNZ O;  4J7J A;  4JI2 B;  3P3N A;  3K79 A;  3AG4 C;  1D2D A;  3SDL A;  2F93 B;  1NI8 A;  1PL0 A;  1K34 A;  2Y69 B;  5IY5 C;  4I5S A;  2E3C A;  3JCU Z;  1SQQ H;  3RYC A;  2DWE C;  1OHH G;  1HWY A;  3CXC U;  3CD6 V;  3JAR A;  4RWU A;  1W2B U;  1W0K G;  3JYC A;  4K8X A;  3OT7 A;  4MVR A;  1BGY H;  4OX9 B;  3OEH G;  2CH7 A;  2K1E A;  3K03 A;  3FD9 A;  4DYL A;  1AP5 A;  4G2K A;  2NNU A;  2QSA A;  4O4H B;  4DV2 B;  5DN6 G;  4Z1V A;  1VQ7 V;  4FMT A;  2R9R B;  1XOU A;  4ZOL B;  3RYF B;  1V55 B;  5EC2 C;  4NB5 A;  5TIS Z;  1XI1 A;  1FFX B;  1BSM A;  3CSX A;  2P67 A;  5KMG B;  3HKD B;  5IWA B;  3CEI A;  1Q8I A;  4J42 A;  1IVS A;  3RN4 A;  3T1Y O;  3E2E A;  1VQ4 V;  1E79 G;  3ZRX A;  4DR2 B;  4UVB A;  3CP1 A;  1CEZ A;  2IJK A;  4CH3 A;  3STZ C;  5JWP A;  1PD3 A;  4G28 B;  2UUB O;  4AIL C;  4E2L A;  4CS4 A;  1KB9 F;  1KU9 A;  4GZR B;  4DRX A;  4PA4 A;  4DR4 B;  1B04 A;  4LP8 A;  3WB1 A;  4JYA B;  1G6U A;  4YJ2 A;  2MK3 A;  4WF9 V;  2YEV A;  3ZHR A;  2GV9 A;  1XMQ O;  3D36 C;  1G1X B;  4F6R B;  4IL6 Z;  1XMQ B;  2B9Z A;  3LSQ A;  3N2K B;  1OCR C;  4O4L B;  2AHZ A;  4WFH A;  5KA6 A;  1RSO B;  3K9A A;  4QJF B;  5ITZ B; 
#chains in the Genus database with same CATH homology
 1I94 O;  3SDL A;  1D2D A;  2Z0A A;  4JYA O;  2UXB O;  2UU9 O;  4DR6 O;  5FLX N;  4X65 O;  1A32 A;  1R1B A;  2UUC O;  2VQE O;  2DOS A;  5LMN O;  4DV1 O;  1HNX O;  4B3M O;  4DV3 O;  3T1H O;  4LFA O;  4YY3 O;  4JI2 O;  1DK1 A;  1N32 O;  3R66 A;  4LF5 O;  2JRI A;  1YZB A;  4DUY O;  4X66 O;  4OPH A;  4A5U B;  4DR1 O;  1HNW O;  1N36 O;  1XMO O;  4JI7 O;  4NXM O;  4OPA A;  2UXC O;  4X64 O;  1FKA O;  4JV5 O;  5LMU O;  1AIL A;  1XEQ A;  5BXZ A;  4LF6 O;  2F4V O;  4JI0 O;  4LFC O;  4JI3 O;  1IBL O;  4LF8 O;  4LF4 O;  4X62 O;  2AGA A;  4JI5 O;  4OX9 O;  1AB3 A;  3J81 N;  5LL6 Y;  1J5E O;  4DV5 O;  2HHH O;  4JI4 O;  4JI6 O;  4DV2 O;  1N33 O;  1XNQ O;  1KUQ A;  3T1Y O;  4JI8 O;  4DV4 O;  3J80 N;  3O65 A;  5A2Q N;  1HR0 O;  4GKJ O;  2DJV A;  2UXD O;  1XNR O;  3M8A A;  2UUA O;  4LF9 O;  2VQF O;  1R6T A;  1X59 A;  3F5T A;  2N74 A;  4LF7 O;  4B3R O;  5IWA O;  1IBK O;  5BR8 O;  2UUB O;  3RT3 C;  4DUZ O;  1IBM O;  4DR3 O;  4B3S O;  4DV0 O;  2FKX A;  4NXN O;  4DR2 O;  4JI1 O;  4DR5 O;  1N34 O;  1XMQ O;  4KHP O;  4DV6 O;  5IT9 N;  1FYJ A;  2ZM6 O;  2LW7 A;  1F7Y A;  1G1X B;  2E5L O;  4DR7 O;  4YHH O;  1NS1 A;  5BY1 A;  1FJG O;  4GKK O;  3J7A U;  4DV7 O;  4LFB O;  1HNZ O;  5H5N A;  4B3T O;  3OTO O;  2ZKO A;  4K0K O;  4DR4 O;  3JAM N;  4AQY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...