2QTSA

Structure of an acid-sensing ion channel 1 at 1.9 a resolution and low ph
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
417
structure length
417
Chain Sequence
LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Acid-sensing ion channel
publication title Structure of acid-sensing ion channel 1 at 1.9A resolution and low pH
pubmed doi rcsb
source organism Gallus gallus
total genus 110
structure length 417
sequence length 417
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 2qtsA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 2qtsA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 2qtsA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 2qtsA02
1WP7A 2FB5A 3IJ4A 4NYKA 4FZ1A 4NTXA 2L35A 4NTWA 2QTSA 3N27A 3S3WA 4FZ0A 3S3XA 4NTYA 1WP8A
chains in the Genus database with same CATH superfamily
1YIJV 4XDLA 1IBLB 1XQ8A 5KUKA 2PGGA 4X20A 3WB1A 2XUMA 4CH5A 3ZMSA 3FAVA 3OD4A 3OEHG 4W4LA 1KD1W 5IJ9A 1XMOB 1KUQA 5L3CA 2QWNB 2Q7EA 1LR1A 5B3SC 3HKBA 1R3JC 1W0JG 1FJGB 3ABKC 3EVKA 1WA8B 3FX7A 2Z3YA 3RT3C 2P90A 3MD0A 3AK3A 2ITCC 3CPWU 1YF2A 4DV7O 3SPIA 4CH6A 2QE7G 5LMUB 3OMIB 3H01A 4O2BB 2LW7A 4QE9A 4LBEC 4AHCA 3CP1A 1B04A 4J10A 3ABKB 1KP2A 3LDCA 1BZKA 1R6TA 5EZYA 1K4CC 1MZFA 4BAYA 2MK3A 4FFBA 3STLC 4DR1O 3D3QA 4NXMO 3HPLC 1XL6A 2ZT9B 2OWOA 1COWG 4I55A 4FLXA 1NH2B 2AHYA 4O4HB 3MHHC 1HWYA 2NR5A 1Q90D 1SKVA 2Y0PA 4JI2O 3G80A 5LGTA 4FVMA 2PI4A 4H37A 1TUBB 3WB0A 1PNMA 3T4DA 2WAMA 3ETQA 3L74H 4TQFA 2QSAA 2BTOA 4JASA 5CB4A 2X0LA 2QJ1A 4N23A 1E1QG 1Z5VA 5LBQA 3G4SV 4TV9B 1Q8IA 1Q5OA 1B06A 1FPOA 5H6QA 2FMLA 4CS3A 1IBLO 3DSQA 1VQNV 2WA3A 3H1KH 4D7TA 2IJKA 4O2BA 3JD0A 2EJRA 3CB2A 1M5IA 1US6A 4PI0A 3HKEA 1BHBA 1XMOO 5IE9A 1MG1A 4XDJA 3CCVV 4DV4O 1K4DC 1FJGO 5KHHA 4LC1A 4FZ1A 2Q5ZA 1RP3B 2BSKB 4GKKB 2CK3G 5LA6A 5LMUO 4O4HA 1V55B 3ZRXA 4UCSA 5DEDA 2Q7GA 3MDSA 3MAQA 5KX5B 3PN1A 1M56C 4DV3B 2FKXA 2D3OW 1BSMA 1IBMO 1O9HA 3WG7C 4NR1A 1IX9A 3OTFA 4WFAV 1I0HA 2DQ0A 4DV2B 1OHHG 4TV9A 2Z0AA 4JF3A 3H1LH 3CRCA 3T2MA 1IVSA 3IFXA 1XBLA 3J7AU 2WLNA 4I7ZB 4JI6B 3WG7B 3JD3A 5FNVB 2P7TC 4P30A 3JAWA 4FM2A 2LP7A 3TGUH 5DECA 1MABG 1QCEA 1G4YB 3K5OA 3K59A 4ZHQB 4MTFA 5JVDA 4DXWA 1R3LC 2ZDIA 1AR4A 2OCHA 4L8JA 2BSKA 4O4LB 2X6BA 2E3CA 3H1HH 5BMVA 2DJVA 4X62B 3K08A 5KX5A 1SQXH 2PTMA 2V7QG 4PDRA 2UXNA 3OE7G 4IHJB 5H9CA 2G38A 4DV5B 1AR1B 4F6EA 4CBCA 2QDOA 1V54C 2XTAA 2FTKA 2JJ1G 3IC9A 2W6JG 2XHBA 1F23A 5CA0B 2PYJA 1N4CA 4GKKO 4X9QA 2C2AA 4KFMA 4DO2A 5LOVB 4JAUA 3SGIA 3QF7A 3UT5B 3L72H 3G6EV 1V54B 4FM1A 4DV3O 3OR6C 3E2EA 2KB1A 1SRYA 3FYIB 4B08A 4QPJA 5FNVA 2IU3A 5BXZA 3AEIA 4J41A 4HAMA 4MTOA 3L70H 3H1JH 3ETGA 2XAJA 2P5OA 4DV2O 4ZHQA 5EK0A 3TXSA 3UO2A 1NTZH 3CMEV 3ZRSA 3F7VC 4O4LA 5E79Z 3JSLA 4JI6O 1XHXA 1PL4A 1XREA 3CWBH 5J9PC 4FLZA 4JI3B 2UUAB 4I9WA 2EINB 4HNAB 1YVWA 3GVMA 5H6RA 5KA6A 5LGUA 3IJ4A 3GWOA 5J2TB 2ZM6B 2Q69A 4LH6A 1KECA 1N8RW 5B1OA 5CA0A 2CAZC 5LP6C 4DV0B 2QR4A 3W7XA 2EX3A 2JVDA 5LOVA 3STZC 1I7FA 4X62O 3JASB 1YITV 1KYOF 2ZE8A 1K9MW 1MA1A 1RM1C 1N33B 3RFRA 5B1NA 2GTAA 1IZ3A 4OX9B 4NTXA 1RPRA 5LGNA 1JCHA 3ZMZA 5JJEB 1S77D 2OT5A 4TUYB 4FLUA 3ABMC 5JJJB 4RWUA 1Y74B 3EXAA 4GT1A 4UXNA 3UKMA 1I08A 4LWSB 2M6YA 2IJIA 1VIBA 4HZ3A 1X59A 4RUFA 1PPJH 4YJ2A 1Q82W 1DF5A 3BA9A 2EIJC 4U3JB 2V1DA 5GTIZ 2BOBC 2YUAA 2Q73A 3RYHA 1EN4A 3UCSC 2ZXWC 4F4LA 5J2TA 1HNZB 1URFA 2Q6AA 3ICXA 2DQ3A 4PDVA 1H8HG 3QO5A 3CCJV 1PNKA 2EIJB 3E35A 3JASA 4YIOA 5F2VO 1IDSA 4JI3O 2LQTA 2Q8VA 4QPKA 2ZXWB 2UUAO 3AK1A 2BOCC 4DUYB 3O9OA 2ZM6O 5KAFZ 2DN9A 3IGAC 2YEVB 3RYCB 4DV0O 2VWKA 4O4JB 3E8BA 2HP8A 3CCUV 1U96A 2V4DA 3R66A 2WWWA 2OCCB 1AILA 3QNEA 2WLJA 1WB7A 1JFFB 2YDEA 3SPCA 3GB7C 1H2MA 1N33O 1H2LA 3Q4HB 3B77A 2IW5A 5KHJA 4OX9O 4DR2O 4NYKA 3WFVA 2JDIG 4EEQA 1G8MA 2P06A 2FB5A 2ZE7A 3O65A 2DMXA 4GCZA 2P6JA 4X1KB 2W6IG 3NR7A 1P7BA 1VF6A 4YJ3A 3L9DA 2GTSA 1QLNA 2UXBB 1W0KG 3X2QC 1GMGA 4IIJB 4G28B 5DM6V 1FFXB 4PELA 5KHGA 1NBMG 4YHHB 3B09A 4LF5B 4LFBB 4DRXB 3JD1A 2YICA 4MT8A 4R7CA 4P2ZA 1HNZO 1AJNA 3SPHA 3SR2C 2YEVA 3RYCA 4YY3B 1YTFB 3X2QB 3MHSC 4J7ZA 2OTLV 2IH3C 2UXCB 1JFFA 1GK9A 4LFAO 4KXRA 2Y48A 2UUBB 4DUYO 5LHHA 3KCYA 2FYUH 5JCOA 4RQEA 4PA6A 1CP9A 3T4ZA 1WNSA 3FYEB 4I4TB 3VQXA 1S72V 3BHPA 3K0DA 1SQVH 1E79G 5KLVH 1E1RG 1QLEB 1QVFU 2CTPA 4X1KA 5C93A 4IGGA 2CDYA 2ZIOA 2KKWA 3SPGA 1NR1A 1MOFA 3OGCC 4MTGA 3SJCC 3CJHB 1AB3A 1NVPB 3ZHRA 1EM1A 2F66C 2YIDA 1FFXA 2IM9A 4UUJC 1OCRC 3OUFA 4JI7B 2XAQA 4K8ZA 4BR6A 2O57A 2B1GA 4DRXA 3H9VA 4GX5A 2UXDB 3KKYA 1SC5B 1M1KW 3RWRD 3OUSA 1SQGA 2WLMA 3BFRA 5BZBA 2UXBO 1QNMA 2EIKC 4P9OA 2F23A 3CS5A 3CXHF 3DC5A 1GM8A 1S76D 4YHHO 4I55B 1OCCC 1SZTA 4FLWA 4LF5O 1H2GA 3K79A 4LFBO 1SQBH 2GSMB 2R70A 4YY3O 2EIKB 2DE0X 4I4TA 1NI8A 3FB7C 5L3GA 1BCCH 2JS3A 2ODMA 3BY6A 2YS8A 1BGYH 2UXCO 1OCCB 3OR7C 5EIBD 5CB4B 2N05A 5KUMA 4U7OA 3U0ZA 3D36A 1OCOC 3CCSV 2A3QA 2UUBO 5IYDO 2P4VA 3VQVA 4DV4B 1X4TA 1J95A 3CJHA 1F4NA 3R65A 2AXTZ 3CCRV 2WLIB 5K1XA 1BE3H 1HW7A 5J2UB 1S5HC 3HKDB 4MW3A 1OCOB 2E76B 3K03A 4PA3A 1P4RA 1P49A 3HKEB 2Q68A 3W7TA 2B9ZA 2XASA 2ZD9A 4R8CA 5CN0A 1BL8A 2YI8A 4W4KA 4DR5B 1IBMB 1PM9A 4JI7O 5LA6B 3N2KB 3FB5C 4IL6Z 1LUWA 4GZRB 2ZKOA 1LNQA 1YEWA 2HJFC 2N74A 3SYCA 2UXDO 2EBOA 1KMIZ 1Q6UA 2JK5C 5B5EZ 1BHAA 3ETEA 4CS4A 1VQ9V 4DR7B 2ARHA 2HVKC 2A7WA 3ETDA 2PY5A 1NR7A 3CXCU 1VQ4V 2E74B 3JAKA 4J9YB 1LUVA 2WLHA 2CTRA 5ITZB 2WLIA 1NS1A 1YI2V 2ZDIC 5J2UA 1N0NA 3HKDA 2QM8A 3JAWB 1V55C 4X65B 2VWJA 3ASOB 3P3PA 2D2CB 1IBKB 1FFTB 5TISZ 1L0NH 1Q7YW 3QO7A 1WAZA 4J42A 3EHBB 4FLYA 3I55V 5JVDB 3CCMV 1CXZB 1PD3A 1Y4MA 2RMKB 1BT8A 2VQEB 1DK1A 4Q20A 2A0LA 1R6NA 1L0LH 3N2KA 4RO2A 3TCUA 1I94B 3VBBA 5BMVB 4LP8A 2F1MA 3B2EE 3BCCH 2JRIA 1MSWD 2WLLA 2XAGA 3A0BZ 1Q81W 1VF5B 3VQYA 2KQXA 1K5QA 1NKDA 5FPOA 1RPOA 1SF9A 1JJOA 1G1XB 4UB8Z 3H1IH 3OW2U 3CRRA 1ROPA 4DR5O 2JGDB 3JYCA 3OAAG 1VARA 3K9SA 4PA4A 4OPAA 1OJHA 4UFZA 2HFEC 3CCLV 2EZPA 2AHZA 3A2FA 5GTHZ 2VRZA 5ITZA 4JYAB 4DR7O 2PYLA 3CX5F 3SYOA 2LFRA 1N34B 2MW2B 2UUCB 1ZL8B 2X6CA 3SJBC 1DGSA 5EC1C 1R3KC 3AG3C 4O4IB 3AG1B 1HNXB 1HDJA 3A0HZ 4X65O 4Z1VA 1IBKO 3ZBHA 3K5NA 5A9GA 2ZNIA 3N2GA 1VEWA 1Y66A 2X7RB 2NLJC 4DYLA 1EN6A 1XDCA 3AG3B 1KP3A 2AGAA 2VQEO 2JGDA 1VP7A 4GUNA 1GTOA 1PKXA 5LL6Y 3CCQV 2R9IA 2LO1A 4YIPA 1I94O 3SPJA 2L35A 3KZIZ 1GN2A 4DR3B 1WLEA 4PDMA 5L3FA 3K9AA 2ZCEA 1ZSPA 1JPXA 1TVKA 3VQWA 1K8AW 1ZLZA 3CRQA 1S3JA 4CH4A 1Y6XA 1ZTEA 1GM9A 1F7YA 1ZL8A 2RQ6A 4FLVA 2EINC 4PV1B 5KA5A 3ZJZA 2CH7B 4YXWG 1FS0G 4PD4F 4JYAO 4JAAA 1XNQB 3SJQC 3SJAC 4O4IA 2EILC 4OPHA 4YJ2B 2CGNA 1SA0B 1JR9A 5FL7G 1NQTA 1N34O 2UUCO 3RYHB 1YCIA 3J80N 4H33A 1XL4A 4FK5C 2EILB 3BABA 4UV9A 1H2KA 4EKWA 1VQ5V 2QM4A 4MVZA 1HNXO 1J5EB 2A79B 3CRMA 4NVPA 2EIMB 3TXQA 1EFRG 1MZEA 3P30A 1AI4A 4B3RB 1L1FA 4X1IB 2UU9O 4EFEA 2A9HA 2BTQA 1VQLV 5K1PA 2CTWA 3UQ8A 2ZE6A 1SESA 4DR2B 3APOA 1WN7A 4IYIA 2LGQA 3QO8A 4K8XA 5KHIA 3W7SA 4UCOA 4UVAA 3JD4A 4MSWC 4JI5B 4JAVA 3JSNA 4DR3O 1D5AA 2VS0A 2CH7A 4B3SB 1EBOA 2EULA 3E8GA 3J81N 1Q86W 3I5DA 4DW0A 3CHXA 1GN3A 2GUZB 1VF6C 3CSXA 4UCTA 1VQ8V 5CMUA 4A5UB 1SA0A 2DYSC 1NTMH 3ZN0A 4Z2WA 1K5SA 1VQKV 2W0XA 1HP8A 1YZBA 1QU7A 4WBNB 1TGOA 1XILA 4BW9A 4JGSA 4YJ3B 1XNQO 1QHTA 3BRCA 3ZHVA 3P3NA 3AG4C 3E22B 1XI1A 3A8TA 2DYSB 4RQFA 1EZJA 4JZ2A 4QE7A 2OCCC 3LNNA 4LFAB 3ABUA 2DYRC 5LYJB 1NU1H 1O9GA 4GX1A 4X1IA 1FXHA 1QR8A 3K5MA 4BWAA 3D3IA 3G6BA 1Q43A 4JI8B 1WPXA 3AG4B 5LHGA 1S5JA 5JCOC 2Q7HA 2QKSA 4MVMA 1KU9A 3RBZA 1J5EO 2DYRB 4FJCC 3AG2B 3RGBA 4DK1A 5BY1A 1XMQB 1BQZA 4B3RO 1S5LZ 2ADPA 2H3OA 4JI0O 2Q67A 2GV9A 4LF9B 2GUZA 1R1BA 3EFFK 1SETA 2KG7B 4MVQA 3OTOB 3JARB 5B66Z 4MVOA 4EB6A 3E8HA 3SYQA 4JI5O 4B3SO 5D5PA 4WBNA 1WB8A 1H2NA 1VQOV 4JYBA 3E22A 4L87A 3RVZA 2HG5C 2EJ7A 3ASNB 4U3FH 1XEQA 4B7KA 1Y67A 4DV6O 4Q6GA 5LYJA 1P7GA 1WJZA 1PV0A 2N04A 1W2BU 2HHHB 2JS5A 3ZRWB 4WF9V 3CMAV 4JYYA 1THZA 2QGNA 1EN5A 3C90A 1GH6A 1TA8A 4PA9A 3WB2A 5E1AC 2GBOA 1M93A 5IYCO 2YXLA 1QLEC 3B8NA 2HLDG 3ZCCA 4XBFA 3WU2Z 3K0GA 3DXRB 4BW5A 5H2FZ 1EZVH 3D36C 2YI9A 3M8AA 2RJZA 4JI8O 4AILC 1Q6IA 2HJDA 2KG7A 2P4KA 2JEUA 5JWPA 2Q0OC 2YC0A 3JARA 1YSCA 4TSFG 2HVJC 3ABLB 2W0FC 1ZX3A 3JALA 1KBHA 3ZMTA 4HYOA 4C7UA 1XUQA 1XMQO 2Q4PA 4FMTA 4LNUB 3U11A 3LUTB 3RW0A 2M7WA 3CYOA 2Y4TA 4LF9O 3ZHTA 2YIBD 1K92A 2AZ0A 1YJWV 4LF4B 1Z5WA 3OTOO 1FXKB 1K7DA 1M57C 4X1YB 5GW7A 1KC8W 2OTJV 1K97A 3ZRWA 1JOYA 4JV5B 2Y0IA 1CPYA 5CBFA 1K3EA 2WA4A 5JQGB 2ZNJA 1Z2GA 4I9QA 4CC5A 1M57B 4LF8O 1YXBA 2F95B 1VQ7V 3DXRA 2IJJA 3K3WA 2LFSA 2JJ2G 2HHHO 2ZIMA 1AP6A 4UCUA 5IY5B 1BMFG 4FIPC 5BR8O 2UXXA 3CCEV 3T1YB 1SS3A 1NTKH 3ZS8C 1P84F 1VQ6V 4H13B 3K04A 3ZHQA 4TT3G 4KP4A 4LNUA 5A2QN 2QWOB 2ZINA 4X64B 3JAKB 4X88A 1AROP 1MSDA 2F43G 1FXKA 1S0VA 4NXNB 1W59A 5GONA 2BE3A 1M4UA 2ZQMA 3ML0A 1TUEB 1QR9A 4FLTA 2CUGA 4X1YA 3C3SA 2XT9A 1DLBA 1SQPH 3FFQA 4MW8A 5JQGA 1A32A 1G6UA 4J9ZB 4B3MB 1R3IC 4LF4O 4OGQB 4LCUC 3CD6V 3OMNB 4ZOLA 2YSUB 5B3SB 1BQ0A 3DC6A 3FB8C 2P22C 5KAIZ 3CE2A 3K57A 2ILMA 3L73H 2E5LB 2RCVA 3NXSA 2GHYA 3HKCB 4JV5O 2OIGA 2WLLB 1SERA 4LF7B 1L8DA 1JJ2U 5AG2A 1K73W 3K06A 4I0XB 1JQ0A 1NH2D 2CE4A 4IYHA 1K34A 3ASOC 4FPPA 3UM7A 3T1HB 5EBMC 1GO3F 5LXTB 1R73A 1Q6HA 2NNUA 3ZX6A 2WLKA 3M99B 1YJ9V 4P9PA 1JMKC 3T1YO 4JI4B 2JGUA 5IT9N 5HFLA 3U10A 4ABMA 1GAXA 4NTWA 1WA8A 4X64O 3DTUB 2A06H 3G67A 2IH1C 4NXNO 3PJSK 1PNLA 4NTYA 3JATB 2WSSG 4ICGA 4X8AA 1D2DA 4GLXA 1GRJA 3LSUA 3HKCA 4JTCB 1I5YA 2QA4V 3N2GB 1SZXA 4RUEA 2DWDC 2PZSA 4B3MO 3QVNA 4GX2A 1AI5A 2QWRB 4CC6A 2ADQB 4XDKA 2B5UA 5C8YB 2CGOA 1VMGA 4I0XA 4O2AB 3D8CA 1F4MA 5LHIA 5IYZB 1ZAUA 3RYFB 4PHZA 1TUBA 1WP8A 2E5LO 2QEXV 4J11A 2QKAA 4D7SA 5LXTA 1VF7A 1YJNV 1GN6A 3LSSA 4CH3A 4LF7O 1TVKB 3APQA 3CRAA 4H0LB 1IXBA 1SQFA 4J7KA 2DOSA 4BIZA 4E2LA 3GWKC 4MS2A 3L71H 3AG1C 3TJTA 1M56B 4JZGA 4TQDA 3ZHUA 4PA7A 1F51A 4H44B 2LJ2A 5KMGB 1HNWB 3T1HO 4ZBMA 5FPRA 4ZI7B 4CZZA 4LFCB 4WCEV 3JATA 3BA8A 1RFYA 4JI4O 4KHPB 2PUSA 3ZEDA 4PI2A 4WFEA 2QTSA 2XAFA 3E89A 2NN4A 2UU9B 4PJ0Z 4Z1MG 1CEZA 1SQQH 2YIAA 5C8YA 4UCRA 4O2AA 1VQPV 1N32B 1DF4A 5IYZA 3RYFA 1TAEA 3SDLA 4QJFB 3CEIA 4UVBA 3LDDA 1OZ0A 4FFKA 4F6RB 1OV9A 1RSOB 4JI1B 2BTQB 2DW4A 3K5LA 3RYIB 4R50A 1YHQV 1N36B 3T1CA 2CTQA 3ZHSA 4X66B 3F5WC 4DW1A 3AK2A 3JAMN 4BIUA 4DR4B 4JTAB 5EC2C 3B40A 4OXSA 2BCCH 5KMGA 3ZIAG 1IXMA 2PF4E 4KUMA 4ZI7A 1D5NA 4EFBA 1AI6A 4D6TH 3RVYA 2JEXA 5CBHA 3FB6C 4B7EA 5H5NA 3G71V 4R6ZA 1N0JA 4ZIBA 2EIMC 1KKCA 1UJWB 3OEEG 3LDEA 1M90W 1HNWO 4DV1B 4DR6B 3LSQA 5EYPB 4LFCO 2DWEC 3W7WA 2E75B 5IWAB 2ETNA 4I50B 4UB6Z 4KHPO 5B1BC 3C3TA 4IHJA 3OT7A 1AP5A 2F4VB 4F6RA 1RSOA 4GKJB 4DUZB 1B6QA 4JI0B 1JA8A 1ZUQA 3RYIA 3UO3A 1ZWIC 2IBZH 4FM0A 2P67A 4MTXA 3ZMVA 1QQCA 5JH7B 5B1BB 1WPBA 1N32O 3UT5A 2GDSA 1FYJA 4WFGA 4DV5O 1FAFA 5IDJA 1M9NA 4JTDB 5LP6B 4JI1O 2QTOA 4QIWF 4BIOA 2Q9LA 4RAIA 5LMNB 1N36O 1FXVA 1R6KA 3F7YC 4AQYB 3HR0A 4E4EA 4J7JA 3ZN1A 4X66O 4EB6B 4DV6B 3JD2A 4FZ0A 4ZKIA 1RM1B 4K35A 4DR4O 2B1IA 2XNDG 4QGPA 3IC7A 3E83A 2Q0AA 5EYPA 4WFFA 1XNRB 4NKGB 4WFHA 1FD9A 4K3AA 3ABMB 4I50A 2OYQA 4HNAA 2RDCA 4I5SA 2YXHA 3ZMUA 2F93B 2L6LA 1H8EG 3QG5A 4GX0A 2ZR2A 3AG2C 3W7UA 2R9RB 5DN6G 1U97A 2XAHA 4B3TB 4DV1O 1OCZC 4DR6O 4KL1A 3KG2A 1JVMA 4ASUG 5JH7A 4X89A 5IWAO 1NT2B 1XOUA 2RNBA 2ATKC 3IAYA 5D5QA 1AJQA 1PL0A 1GM7A 2HKOA 2XOKG 2F4VO 1HR0B 1H2SB 5L3EA 1OCZB 4CS2A 5LP6A 1BS3A 4GKJO 5CA1B 4DUZO 5FLXN 2KSDA 4HBNA 4LR3A 4TUYA 1Y74A 3ASNC 3OMAB 4N21A 3S3XA 2K1EA 1AVMA 2FL4A 3JALB 3RN4A 5L3BA 1QBZA 1UPGA 1MMMA 4LWSA 2VQFB 1AR5A 1V9PA 1ENVA 1KKDA 4AI8A 3FD9A 4LF6B 4JPRA 5LMNO 2JIZG 3ZRVA 4WFBV 4U3JA 4UCVA 1NZ6A 4AQYO 1Y76B 3CC2V 4LF8B 4TOIA 3SYPA 3QTCA 1K33A 2HEPA 2H94A 4K0KB 1UFIA 1XNRO 1B3QA 1JX9A 3CC4V 1NJIW 3OFNG 3THOA 5BR8B 2EZOA 3HB3B 3OM3B 3ABTA 4J80A 5IYBO 3A0RA 3ABLC 2QM7A 5CBGA 2RN9A 5CA1A 5CA3A 2YXYA 4B3TO 4JYCA 1H38A 1MNGA 1YDXA 4O4JA 2X6AA 1PP9H 1I5XA 1YTFD 1GKFA 3E86A 1QVGU 2ZE5A 3I56V 4MVSA 2QKCA 1FXKC 3SYAA 5HFMA 4DK0A 1AJPA 1ORQC 4TV8B 5IJ0B 2HR3A 1HR0O 2IU0A 3L75H 2LGWA 3BVOA 4IT5A 3OGIB 3Q4HA 3TK1A 5EBWC 2IJHA 2WPDG 2Y69C 3P32A 4DV7B 4MVUA 3VOUA 1Y76A 3JCZA 3E8FA 4X20B 3BAAA 4G2KA 3AG7A 5GONB 5L3DA 3TETA 1IURA 2Z5UA 2R72A 4TWKA 4UVCA 3FAVB 2ZR3A 5IJ9B 3S3WA 4NB5A 1VQMV 1KQSU 3M7MX 3CC7V 3HKBB 4QNHB 2VQFO 2R9AA 2OIEA 2Y69B 4DR1B 2H8PC 4PDLA 2AW9A 2AZ2A 4LF6O 4G27B 4IIJA 4NXMB 1KB9F 1NVPD 2K9PA 3K58A 5EIBC 5IY5C 3B4SA 4U7NA 4ZOLB 3LNMB 1T5EA 5B1AC 3DGEA 5JJNB 3N27A 4JI2B 3FKSG 2QWQB 4K0KO 5EZYB 4UV8A 3BEHA 4FFBB 3KCXA 1AI7A 2PI5A 1WP7A 2Y4UA 1OCRB 4GYCB 1GN4A 4LH7A 3F5TA 1XHZA 4TV8A 5B1AB 5IJ0A 2ITDC 2QWPB 3B8MA 5KHKA 3BPZA 3JCUZ 2YIBA 1Q3EA 1FKAO 4MVRA 1DTOA 5EBLC 2LW1A
chains in the Genus database with same CATH topology
1WP7A 2FB5A 3IJ4A 4NYKA 4FZ1A 4NTXA 2L35A 4NTWA 2QTSA 3N27A 3S3WA 4FZ0A 3S3XA 4NTYA 1WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP7 A;  2FB5 A;  3IJ4 A;  4NYK A;  4FZ1 A;  4NTX A;  2L35 A;  4NTW A;  2QTS A;  3N27 A;  3S3W A;  4FZ0 A;  3S3X A;  4NTY A;  1WP8 A; 
#chains in the Genus database with same CATH topology
 1YIJ V;  4XDL A;  1IBL B;  1XQ8 A;  5KUK A;  2PGG A;  4X20 A;  3WB1 A;  2XUM A;  4CH5 A;  3ZMS A;  3FAV A;  3OD4 A;  3OEH G;  4W4L A;  1KD1 W;  5IJ9 A;  1XMO B;  1KUQ A;  5L3C A;  2QWN B;  2Q7E A;  1LR1 A;  5B3S C;  3HKB A;  1R3J C;  1W0J G;  1FJG B;  3ABK C;  3EVK A;  1WA8 B;  3FX7 A;  2Z3Y A;  3RT3 C;  2P90 A;  3MD0 A;  3AK3 A;  2ITC C;  3CPW U;  1YF2 A;  4DV7 O;  3SPI A;  4CH6 A;  2QE7 G;  5LMU B;  3OMI B;  3H01 A;  4O2B B;  2LW7 A;  4QE9 A;  4LBE C;  4AHC A;  3CP1 A;  1B04 A;  4J10 A;  3ABK B;  1KP2 A;  3LDC A;  1BZK A;  1R6T A;  5EZY A;  1K4C C;  1MZF A;  4BAY A;  2MK3 A;  4FFB A;  3STL C;  4DR1 O;  3D3Q A;  4NXM O;  3HPL C;  1XL6 A;  2ZT9 B;  2OWO A;  1COW G;  4I55 A;  4FLX A;  1NH2 B;  2AHY A;  4O4H B;  3MHH C;  1HWY A;  2NR5 A;  1Q90 D;  1SKV A;  2Y0P A;  4JI2 O;  3G80 A;  5LGT A;  4FVM A;  2PI4 A;  4H37 A;  1TUB B;  3WB0 A;  1PNM A;  3T4D A;  2WAM A;  3ETQ A;  3L74 H;  4TQF A;  2QSA A;  2BTO A;  4JAS A;  5CB4 A;  2X0L A;  2QJ1 A;  4N23 A;  1E1Q G;  1Z5V A;  5LBQ A;  3G4S V;  4TV9 B;  1Q8I A;  1Q5O A;  1B06 A;  1FPO A;  5H6Q A;  2FML A;  4CS3 A;  1IBL O;  3DSQ A;  1VQN V;  2WA3 A;  3H1K H;  4D7T A;  2IJK A;  4O2B A;  3JD0 A;  2EJR A;  3CB2 A;  1M5I A;  1US6 A;  4PI0 A;  3HKE A;  1BHB A;  1XMO O;  5IE9 A;  1MG1 A;  4XDJ A;  3CCV V;  4DV4 O;  1K4D C;  1FJG O;  5KHH A;  4LC1 A;  4FZ1 A;  2Q5Z A;  1RP3 B;  2BSK B;  4GKK B;  2CK3 G;  5LA6 A;  5LMU O;  4O4H A;  1V55 B;  3ZRX A;  4UCS A;  5DED A;  2Q7G A;  3MDS A;  3MAQ A;  5KX5 B;  3PN1 A;  1M56 C;  4DV3 B;  2FKX A;  2D3O W;  1BSM A;  1IBM O;  1O9H A;  3WG7 C;  4NR1 A;  1IX9 A;  3OTF A;  4WFA V;  1I0H A;  2DQ0 A;  4DV2 B;  1OHH G;  4TV9 A;  2Z0A A;  4JF3 A;  3H1L H;  3CRC A;  3T2M A;  1IVS A;  3IFX A;  1XBL A;  3J7A U;  2WLN A;  4I7Z B;  4JI6 B;  3WG7 B;  3JD3 A;  5FNV B;  2P7T C;  4P30 A;  3JAW A;  4FM2 A;  2LP7 A;  3TGU H;  5DEC A;  1MAB G;  1QCE A;  1G4Y B;  3K5O A;  3K59 A;  4ZHQ B;  4MTF A;  5JVD A;  4DXW A;  1R3L C;  2ZDI A;  1AR4 A;  2OCH A;  4L8J A;  2BSK A;  4O4L B;  2X6B A;  2E3C A;  3H1H H;  5BMV A;  2DJV A;  4X62 B;  3K08 A;  5KX5 A;  1SQX H;  2PTM A;  2V7Q G;  4PDR A;  2UXN A;  3OE7 G;  4IHJ B;  5H9C A;  2G38 A;  4DV5 B;  1AR1 B;  4F6E A;  4CBC A;  2QDO A;  1V54 C;  2XTA A;  2FTK A;  2JJ1 G;  3IC9 A;  2W6J G;  2XHB A;  1F23 A;  5CA0 B;  2PYJ A;  1N4C A;  4GKK O;  4X9Q A;  2C2A A;  4KFM A;  4DO2 A;  5LOV B;  4JAU A;  3SGI A;  3QF7 A;  3UT5 B;  3L72 H;  3G6E V;  1V54 B;  4FM1 A;  4DV3 O;  3OR6 C;  3E2E A;  2KB1 A;  1SRY A;  3FYI B;  4B08 A;  4QPJ A;  5FNV A;  2IU3 A;  5BXZ A;  3AEI A;  4J41 A;  4HAM A;  4MTO A;  3L70 H;  3H1J H;  3ETG A;  2XAJ A;  2P5O A;  4DV2 O;  4ZHQ A;  5EK0 A;  3TXS A;  3UO2 A;  1NTZ H;  3CME V;  3ZRS A;  3F7V C;  4O4L A;  5E79 Z;  3JSL A;  4JI6 O;  1XHX A;  1PL4 A;  1XRE A;  3CWB H;  5J9P C;  4FLZ A;  4JI3 B;  2UUA B;  4I9W A;  2EIN B;  4HNA B;  1YVW A;  3GVM A;  5H6R A;  5KA6 A;  5LGU A;  3IJ4 A;  3GWO A;  5J2T B;  2ZM6 B;  2Q69 A;  4LH6 A;  1KEC A;  1N8R W;  5B1O A;  5CA0 A;  2CAZ C;  5LP6 C;  4DV0 B;  2QR4 A;  3W7X A;  2EX3 A;  2JVD A;  5LOV A;  3STZ C;  1I7F A;  4X62 O;  3JAS B;  1YIT V;  1KYO F;  2ZE8 A;  1K9M W;  1MA1 A;  1RM1 C;  1N33 B;  3RFR A;  5B1N A;  2GTA A;  1IZ3 A;  4OX9 B;  4NTX A;  1RPR A;  5LGN A;  1JCH A;  3ZMZ A;  5JJE B;  1S77 D;  2OT5 A;  4TUY B;  4FLU A;  3ABM C;  5JJJ B;  4RWU A;  1Y74 B;  3EXA A;  4GT1 A;  4UXN A;  3UKM A;  1I08 A;  4LWS B;  2M6Y A;  2IJI A;  1VIB A;  4HZ3 A;  1X59 A;  4RUF A;  1PPJ H;  4YJ2 A;  1Q82 W;  1DF5 A;  3BA9 A;  2EIJ C;  4U3J B;  2V1D A;  5GTI Z;  2BOB C;  2YUA A;  2Q73 A;  3RYH A;  1EN4 A;  3UCS C;  2ZXW C;  4F4L A;  5J2T A;  1HNZ B;  1URF A;  2Q6A A;  3ICX A;  2DQ3 A;  4PDV A;  1H8H G;  3QO5 A;  3CCJ V;  1PNK A;  2EIJ B;  3E35 A;  3JAS A;  4YIO A;  5F2V O;  1IDS A;  4JI3 O;  2LQT A;  2Q8V A;  4QPK A;  2ZXW B;  2UUA O;  3AK1 A;  2BOC C;  4DUY B;  3O9O A;  2ZM6 O;  5KAF Z;  2DN9 A;  3IGA C;  2YEV B;  3RYC B;  4DV0 O;  2VWK A;  4O4J B;  3E8B A;  2HP8 A;  3CCU V;  1U96 A;  2V4D A;  3R66 A;  2WWW A;  2OCC B;  1AIL A;  3QNE A;  2WLJ A;  1WB7 A;  1JFF B;  2YDE A;  3SPC A;  3GB7 C;  1H2M A;  1N33 O;  1H2L A;  3Q4H B;  3B77 A;  2IW5 A;  5KHJ A;  4OX9 O;  4DR2 O;  4NYK A;  3WFV A;  2JDI G;  4EEQ A;  1G8M A;  2P06 A;  2FB5 A;  2ZE7 A;  3O65 A;  2DMX A;  4GCZ A;  2P6J A;  4X1K B;  2W6I G;  3NR7 A;  1P7B A;  1VF6 A;  4YJ3 A;  3L9D A;  2GTS A;  1QLN A;  2UXB B;  1W0K G;  3X2Q C;  1GMG A;  4IIJ B;  4G28 B;  5DM6 V;  1FFX B;  4PEL A;  5KHG A;  1NBM G;  4YHH B;  3B09 A;  4LF5 B;  4LFB B;  4DRX B;  3JD1 A;  2YIC A;  4MT8 A;  4R7C A;  4P2Z A;  1HNZ O;  1AJN A;  3SPH A;  3SR2 C;  2YEV A;  3RYC A;  4YY3 B;  1YTF B;  3X2Q B;  3MHS C;  4J7Z A;  2OTL V;  2IH3 C;  2UXC B;  1JFF A;  1GK9 A;  4LFA O;  4KXR A;  2Y48 A;  2UUB B;  4DUY O;  5LHH A;  3KCY A;  2FYU H;  5JCO A;  4RQE A;  4PA6 A;  1CP9 A;  3T4Z A;  1WNS A;  3FYE B;  4I4T B;  3VQX A;  1S72 V;  3BHP A;  3K0D A;  1SQV H;  1E79 G;  5KLV H;  1E1R G;  1QLE B;  1QVF U;  2CTP A;  4X1K A;  5C93 A;  4IGG A;  2CDY A;  2ZIO A;  2KKW A;  3SPG A;  1NR1 A;  1MOF A;  3OGC C;  4MTG A;  3SJC C;  3CJH B;  1AB3 A;  1NVP B;  3ZHR A;  1EM1 A;  2F66 C;  2YID A;  1FFX A;  2IM9 A;  4UUJ C;  1OCR C;  3OUF A;  4JI7 B;  2XAQ A;  4K8Z A;  4BR6 A;  2O57 A;  2B1G A;  4DRX A;  3H9V A;  4GX5 A;  2UXD B;  3KKY A;  1SC5 B;  1M1K W;  3RWR D;  3OUS A;  1SQG A;  2WLM A;  3BFR A;  5BZB A;  2UXB O;  1QNM A;  2EIK C;  4P9O A;  2F23 A;  3CS5 A;  3CXH F;  3DC5 A;  1GM8 A;  1S76 D;  4YHH O;  4I55 B;  1OCC C;  1SZT A;  4FLW A;  4LF5 O;  1H2G A;  3K79 A;  4LFB O;  1SQB H;  2GSM B;  2R70 A;  4YY3 O;  2EIK B;  2DE0 X;  4I4T A;  1NI8 A;  3FB7 C;  5L3G A;  1BCC H;  2JS3 A;  2ODM A;  3BY6 A;  2YS8 A;  1BGY H;  2UXC O;  1OCC B;  3OR7 C;  5EIB D;  5CB4 B;  2N05 A;  5KUM A;  4U7O A;  3U0Z A;  3D36 A;  1OCO C;  3CCS V;  2A3Q A;  2UUB O;  5IYD O;  2P4V A;  3VQV A;  4DV4 B;  1X4T A;  1J95 A;  3CJH A;  1F4N A;  3R65 A;  2AXT Z;  3CCR V;  2WLI B;  5K1X A;  1BE3 H;  1HW7 A;  5J2U B;  1S5H C;  3HKD B;  4MW3 A;  1OCO B;  2E76 B;  3K03 A;  4PA3 A;  1P4R A;  1P49 A;  3HKE B;  2Q68 A;  3W7T A;  2B9Z A;  2XAS A;  2ZD9 A;  4R8C A;  5CN0 A;  1BL8 A;  2YI8 A;  4W4K A;  4DR5 B;  1IBM B;  1PM9 A;  4JI7 O;  5LA6 B;  3N2K B;  3FB5 C;  4IL6 Z;  1LUW A;  4GZR B;  2ZKO A;  1LNQ A;  1YEW A;  2HJF C;  2N74 A;  3SYC A;  2UXD O;  2EBO A;  1KMI Z;  1Q6U A;  2JK5 C;  5B5E Z;  1BHA A;  3ETE A;  4CS4 A;  1VQ9 V;  4DR7 B;  2ARH A;  2HVK C;  2A7W A;  3ETD A;  2PY5 A;  1NR7 A;  3CXC U;  1VQ4 V;  2E74 B;  3JAK A;  4J9Y B;  1LUV A;  2WLH A;  2CTR A;  5ITZ B;  2WLI A;  1NS1 A;  1YI2 V;  2ZDI C;  5J2U A;  1N0N A;  3HKD A;  2QM8 A;  3JAW B;  1V55 C;  4X65 B;  2VWJ A;  3ASO B;  3P3P A;  2D2C B;  1IBK B;  1FFT B;  5TIS Z;  1L0N H;  1Q7Y W;  3QO7 A;  1WAZ A;  4J42 A;  3EHB B;  4FLY A;  3I55 V;  5JVD B;  3CCM V;  1CXZ B;  1PD3 A;  1Y4M A;  2RMK B;  1BT8 A;  2VQE B;  1DK1 A;  4Q20 A;  2A0L A;  1R6N A;  1L0L H;  3N2K A;  4RO2 A;  3TCU A;  1I94 B;  3VBB A;  5BMV B;  4LP8 A;  2F1M A;  3B2E E;  3BCC H;  2JRI A;  1MSW D;  2WLL A;  2XAG A;  3A0B Z;  1Q81 W;  1VF5 B;  3VQY A;  2KQX A;  1K5Q A;  1NKD A;  5FPO A;  1RPO A;  1SF9 A;  1JJO A;  1G1X B;  4UB8 Z;  3H1I H;  3OW2 U;  3CRR A;  1ROP A;  4DR5 O;  2JGD B;  3JYC A;  3OAA G;  1VAR A;  3K9S A;  4PA4 A;  4OPA A;  1OJH A;  4UFZ A;  2HFE C;  3CCL V;  2EZP A;  2AHZ A;  3A2F A;  5GTH Z;  2VRZ A;  5ITZ A;  4JYA B;  4DR7 O;  2PYL A;  3CX5 F;  3SYO A;  2LFR A;  1N34 B;  2MW2 B;  2UUC B;  1ZL8 B;  2X6C A;  3SJB C;  1DGS A;  5EC1 C;  1R3K C;  3AG3 C;  4O4I B;  3AG1 B;  1HNX B;  1HDJ A;  3A0H Z;  4X65 O;  4Z1V A;  1IBK O;  3ZBH A;  3K5N A;  5A9G A;  2ZNI A;  3N2G A;  1VEW A;  1Y66 A;  2X7R B;  2NLJ C;  4DYL A;  1EN6 A;  1XDC A;  3AG3 B;  1KP3 A;  2AGA A;  2VQE O;  2JGD A;  1VP7 A;  4GUN A;  1GTO A;  1PKX A;  5LL6 Y;  3CCQ V;  2R9I A;  2LO1 A;  4YIP A;  1I94 O;  3SPJ A;  2L35 A;  3KZI Z;  1GN2 A;  4DR3 B;  1WLE A;  4PDM A;  5L3F A;  3K9A A;  2ZCE A;  1ZSP A;  1JPX A;  1TVK A;  3VQW A;  1K8A W;  1ZLZ A;  3CRQ A;  1S3J A;  4CH4 A;  1Y6X A;  1ZTE A;  1GM9 A;  1F7Y A;  1ZL8 A;  2RQ6 A;  4FLV A;  2EIN C;  4PV1 B;  5KA5 A;  3ZJZ A;  2CH7 B;  4YXW G;  1FS0 G;  4PD4 F;  4JYA O;  4JAA A;  1XNQ B;  3SJQ C;  3SJA C;  4O4I A;  2EIL C;  4OPH A;  4YJ2 B;  2CGN A;  1SA0 B;  1JR9 A;  5FL7 G;  1NQT A;  1N34 O;  2UUC O;  3RYH B;  1YCI A;  3J80 N;  4H33 A;  1XL4 A;  4FK5 C;  2EIL B;  3BAB A;  4UV9 A;  1H2K A;  4EKW A;  1VQ5 V;  2QM4 A;  4MVZ A;  1HNX O;  1J5E B;  2A79 B;  3CRM A;  4NVP A;  2EIM B;  3TXQ A;  1EFR G;  1MZE A;  3P30 A;  1AI4 A;  4B3R B;  1L1F A;  4X1I B;  2UU9 O;  4EFE A;  2A9H A;  2BTQ A;  1VQL V;  5K1P A;  2CTW A;  3UQ8 A;  2ZE6 A;  1SES A;  4DR2 B;  3APO A;  1WN7 A;  4IYI A;  2LGQ A;  3QO8 A;  4K8X A;  5KHI A;  3W7S A;  4UCO A;  4UVA A;  3JD4 A;  4MSW C;  4JI5 B;  4JAV A;  3JSN A;  4DR3 O;  1D5A A;  2VS0 A;  2CH7 A;  4B3S B;  1EBO A;  2EUL A;  3E8G A;  3J81 N;  1Q86 W;  3I5D A;  4DW0 A;  3CHX A;  1GN3 A;  2GUZ B;  1VF6 C;  3CSX A;  4UCT A;  1VQ8 V;  5CMU A;  4A5U B;  1SA0 A;  2DYS C;  1NTM H;  3ZN0 A;  4Z2W A;  1K5S A;  1VQK V;  2W0X A;  1HP8 A;  1YZB A;  1QU7 A;  4WBN B;  1TGO A;  1XIL A;  4BW9 A;  4JGS A;  4YJ3 B;  1XNQ O;  1QHT A;  3BRC A;  3ZHV A;  3P3N A;  3AG4 C;  3E22 B;  1XI1 A;  3A8T A;  2DYS B;  4RQF A;  1EZJ A;  4JZ2 A;  4QE7 A;  2OCC C;  3LNN A;  4LFA B;  3ABU A;  2DYR C;  5LYJ B;  1NU1 H;  1O9G A;  4GX1 A;  4X1I A;  1FXH A;  1QR8 A;  3K5M A;  4BWA A;  3D3I A;  3G6B A;  1Q43 A;  4JI8 B;  1WPX A;  3AG4 B;  5LHG A;  1S5J A;  5JCO C;  2Q7H A;  2QKS A;  4MVM A;  1KU9 A;  3RBZ A;  1J5E O;  2DYR B;  4FJC C;  3AG2 B;  3RGB A;  4DK1 A;  5BY1 A;  1XMQ B;  1BQZ A;  4B3R O;  1S5L Z;  2ADP A;  2H3O A;  4JI0 O;  2Q67 A;  2GV9 A;  4LF9 B;  2GUZ A;  1R1B A;  3EFF K;  1SET A;  2KG7 B;  4MVQ A;  3OTO B;  3JAR B;  5B66 Z;  4MVO A;  4EB6 A;  3E8H A;  3SYQ A;  4JI5 O;  4B3S O;  5D5P A;  4WBN A;  1WB8 A;  1H2N A;  1VQO V;  4JYB A;  3E22 A;  4L87 A;  3RVZ A;  2HG5 C;  2EJ7 A;  3ASN B;  4U3F H;  1XEQ A;  4B7K A;  1Y67 A;  4DV6 O;  4Q6G A;  5LYJ A;  1P7G A;  1WJZ A;  1PV0 A;  2N04 A;  1W2B U;  2HHH B;  2JS5 A;  3ZRW B;  4WF9 V;  3CMA V;  4JYY A;  1THZ A;  2QGN A;  1EN5 A;  3C90 A;  1GH6 A;  1TA8 A;  4PA9 A;  3WB2 A;  5E1A C;  2GBO A;  1M93 A;  5IYC O;  2YXL A;  1QLE C;  3B8N A;  2HLD G;  3ZCC A;  4XBF A;  3WU2 Z;  3K0G A;  3DXR B;  4BW5 A;  5H2F Z;  1EZV H;  3D36 C;  2YI9 A;  3M8A A;  2RJZ A;  4JI8 O;  4AIL C;  1Q6I A;  2HJD A;  2KG7 A;  2P4K A;  2JEU A;  5JWP A;  2Q0O C;  2YC0 A;  3JAR A;  1YSC A;  4TSF G;  2HVJ C;  3ABL B;  2W0F C;  1ZX3 A;  3JAL A;  1KBH A;  3ZMT A;  4HYO A;  4C7U A;  1XUQ A;  1XMQ O;  2Q4P A;  4FMT A;  4LNU B;  3U11 A;  3LUT B;  3RW0 A;  2M7W A;  3CYO A;  2Y4T A;  4LF9 O;  3ZHT A;  2YIB D;  1K92 A;  2AZ0 A;  1YJW V;  4LF4 B;  1Z5W A;  3OTO O;  1FXK B;  1K7D A;  1M57 C;  4X1Y B;  5GW7 A;  1KC8 W;  2OTJ V;  1K97 A;  3ZRW A;  1JOY A;  4JV5 B;  2Y0I A;  1CPY A;  5CBF A;  1K3E A;  2WA4 A;  5JQG B;  2ZNJ A;  1Z2G A;  4I9Q A;  4CC5 A;  1M57 B;  4LF8 O;  1YXB A;  2F95 B;  1VQ7 V;  3DXR A;  2IJJ A;  3K3W A;  2LFS A;  2JJ2 G;  2HHH O;  2ZIM A;  1AP6 A;  4UCU A;  5IY5 B;  1BMF G;  4FIP C;  5BR8 O;  2UXX A;  3CCE V;  3T1Y B;  1SS3 A;  1NTK H;  3ZS8 C;  1P84 F;  1VQ6 V;  4H13 B;  3K04 A;  3ZHQ A;  4TT3 G;  4KP4 A;  4LNU A;  5A2Q N;  2QWO B;  2ZIN A;  4X64 B;  3JAK B;  4X88 A;  1ARO P;  1MSD A;  2F43 G;  1FXK A;  1S0V A;  4NXN B;  1W59 A;  5GON A;  2BE3 A;  1M4U A;  2ZQM A;  3ML0 A;  1TUE B;  1QR9 A;  4FLT A;  2CUG A;  4X1Y A;  3C3S A;  2XT9 A;  1DLB A;  1SQP H;  3FFQ A;  4MW8 A;  5JQG A;  1A32 A;  1G6U A;  4J9Z B;  4B3M B;  1R3I C;  4LF4 O;  4OGQ B;  4LCU C;  3CD6 V;  3OMN B;  4ZOL A;  2YSU B;  5B3S B;  1BQ0 A;  3DC6 A;  3FB8 C;  2P22 C;  5KAI Z;  3CE2 A;  3K57 A;  2ILM A;  3L73 H;  2E5L B;  2RCV A;  3NXS A;  2GHY A;  3HKC B;  4JV5 O;  2OIG A;  2WLL B;  1SER A;  4LF7 B;  1L8D A;  1JJ2 U;  5AG2 A;  1K73 W;  3K06 A;  4I0X B;  1JQ0 A;  1NH2 D;  2CE4 A;  4IYH A;  1K34 A;  3ASO C;  4FPP A;  3UM7 A;  3T1H B;  5EBM C;  1GO3 F;  5LXT B;  1R73 A;  1Q6H A;  2NNU A;  3ZX6 A;  2WLK A;  3M99 B;  1YJ9 V;  4P9P A;  1JMK C;  3T1Y O;  4JI4 B;  2JGU A;  5IT9 N;  5HFL A;  3U10 A;  4ABM A;  1GAX A;  4NTW A;  1WA8 A;  4X64 O;  3DTU B;  2A06 H;  3G67 A;  2IH1 C;  4NXN O;  3PJS K;  1PNL A;  4NTY A;  3JAT B;  2WSS G;  4ICG A;  4X8A A;  1D2D A;  4GLX A;  1GRJ A;  3LSU A;  3HKC A;  4JTC B;  1I5Y A;  2QA4 V;  3N2G B;  1SZX A;  4RUE A;  2DWD C;  2PZS A;  4B3M O;  3QVN A;  4GX2 A;  1AI5 A;  2QWR B;  4CC6 A;  2ADQ B;  4XDK A;  2B5U A;  5C8Y B;  2CGO A;  1VMG A;  4I0X A;  4O2A B;  3D8C A;  1F4M A;  5LHI A;  5IYZ B;  1ZAU A;  3RYF B;  4PHZ A;  1TUB A;  1WP8 A;  2E5L O;  2QEX V;  4J11 A;  2QKA A;  4D7S A;  5LXT A;  1VF7 A;  1YJN V;  1GN6 A;  3LSS A;  4CH3 A;  4LF7 O;  1TVK B;  3APQ A;  3CRA A;  4H0L B;  1IXB A;  1SQF A;  4J7K A;  2DOS A;  4BIZ A;  4E2L A;  3GWK C;  4MS2 A;  3L71 H;  3AG1 C;  3TJT A;  1M56 B;  4JZG A;  4TQD A;  3ZHU A;  4PA7 A;  1F51 A;  4H44 B;  2LJ2 A;  5KMG B;  1HNW B;  3T1H O;  4ZBM A;  5FPR A;  4ZI7 B;  4CZZ A;  4LFC B;  4WCE V;  3JAT A;  3BA8 A;  1RFY A;  4JI4 O;  4KHP B;  2PUS A;  3ZED A;  4PI2 A;  4WFE A;  2QTS A;  2XAF A;  3E89 A;  2NN4 A;  2UU9 B;  4PJ0 Z;  4Z1M G;  1CEZ A;  1SQQ H;  2YIA A;  5C8Y A;  4UCR A;  4O2A A;  1VQP V;  1N32 B;  1DF4 A;  5IYZ A;  3RYF A;  1TAE A;  3SDL A;  4QJF B;  3CEI A;  4UVB A;  3LDD A;  1OZ0 A;  4FFK A;  4F6R B;  1OV9 A;  1RSO B;  4JI1 B;  2BTQ B;  2DW4 A;  3K5L A;  3RYI B;  4R50 A;  1YHQ V;  1N36 B;  3T1C A;  2CTQ A;  3ZHS A;  4X66 B;  3F5W C;  4DW1 A;  3AK2 A;  3JAM N;  4BIU A;  4DR4 B;  4JTA B;  5EC2 C;  3B40 A;  4OXS A;  2BCC H;  5KMG A;  3ZIA G;  1IXM A;  2PF4 E;  4KUM A;  4ZI7 A;  1D5N A;  4EFB A;  1AI6 A;  4D6T H;  3RVY A;  2JEX A;  5CBH A;  3FB6 C;  4B7E A;  5H5N A;  3G71 V;  4R6Z A;  1N0J A;  4ZIB A;  2EIM C;  1KKC A;  1UJW B;  3OEE G;  3LDE A;  1M90 W;  1HNW O;  4DV1 B;  4DR6 B;  3LSQ A;  5EYP B;  4LFC O;  2DWE C;  3W7W A;  2E75 B;  5IWA B;  2ETN A;  4I50 B;  4UB6 Z;  4KHP O;  5B1B C;  3C3T A;  4IHJ A;  3OT7 A;  1AP5 A;  2F4V B;  4F6R A;  1RSO A;  4GKJ B;  4DUZ B;  1B6Q A;  4JI0 B;  1JA8 A;  1ZUQ A;  3RYI A;  3UO3 A;  1ZWI C;  2IBZ H;  4FM0 A;  2P67 A;  4MTX A;  3ZMV A;  1QQC A;  5JH7 B;  5B1B B;  1WPB A;  1N32 O;  3UT5 A;  2GDS A;  1FYJ A;  4WFG A;  4DV5 O;  1FAF A;  5IDJ A;  1M9N A;  4JTD B;  5LP6 B;  4JI1 O;  2QTO A;  4QIW F;  4BIO A;  2Q9L A;  4RAI A;  5LMN B;  1N36 O;  1FXV A;  1R6K A;  3F7Y C;  4AQY B;  3HR0 A;  4E4E A;  4J7J A;  3ZN1 A;  4X66 O;  4EB6 B;  4DV6 B;  3JD2 A;  4FZ0 A;  4ZKI A;  1RM1 B;  4K35 A;  4DR4 O;  2B1I A;  2XND G;  4QGP A;  3IC7 A;  3E83 A;  2Q0A A;  5EYP A;  4WFF A;  1XNR B;  4NKG B;  4WFH A;  1FD9 A;  4K3A A;  3ABM B;  4I50 A;  2OYQ A;  4HNA A;  2RDC A;  4I5S A;  2YXH A;  3ZMU A;  2F93 B;  2L6L A;  1H8E G;  3QG5 A;  4GX0 A;  2ZR2 A;  3AG2 C;  3W7U A;  2R9R B;  5DN6 G;  1U97 A;  2XAH A;  4B3T B;  4DV1 O;  1OCZ C;  4DR6 O;  4KL1 A;  3KG2 A;  1JVM A;  4ASU G;  5JH7 A;  4X89 A;  5IWA O;  1NT2 B;  1XOU A;  2RNB A;  2ATK C;  3IAY A;  5D5Q A;  1AJQ A;  1PL0 A;  1GM7 A;  2HKO A;  2XOK G;  2F4V O;  1HR0 B;  1H2S B;  5L3E A;  1OCZ B;  4CS2 A;  5LP6 A;  1BS3 A;  4GKJ O;  5CA1 B;  4DUZ O;  5FLX N;  2KSD A;  4HBN A;  4LR3 A;  4TUY A;  1Y74 A;  3ASN C;  3OMA B;  4N21 A;  3S3X A;  2K1E A;  1AVM A;  2FL4 A;  3JAL B;  3RN4 A;  5L3B A;  1QBZ A;  1UPG A;  1MMM A;  4LWS A;  2VQF B;  1AR5 A;  1V9P A;  1ENV A;  1KKD A;  4AI8 A;  3FD9 A;  4LF6 B;  4JPR A;  5LMN O;  2JIZ G;  3ZRV A;  4WFB V;  4U3J A;  4UCV A;  1NZ6 A;  4AQY O;  1Y76 B;  3CC2 V;  4LF8 B;  4TOI A;  3SYP A;  3QTC A;  1K33 A;  2HEP A;  2H94 A;  4K0K B;  1UFI A;  1XNR O;  1B3Q A;  1JX9 A;  3CC4 V;  1NJI W;  3OFN G;  3THO A;  5BR8 B;  2EZO A;  3HB3 B;  3OM3 B;  3ABT A;  4J80 A;  5IYB O;  3A0R A;  3ABL C;  2QM7 A;  5CBG A;  2RN9 A;  5CA1 A;  5CA3 A;  2YXY A;  4B3T O;  4JYC A;  1H38 A;  1MNG A;  1YDX A;  4O4J A;  2X6A A;  1PP9 H;  1I5X A;  1YTF D;  1GKF A;  3E86 A;  1QVG U;  2ZE5 A;  3I56 V;  4MVS A;  2QKC A;  1FXK C;  3SYA A;  5HFM A;  4DK0 A;  1AJP A;  1ORQ C;  4TV8 B;  5IJ0 B;  2HR3 A;  1HR0 O;  2IU0 A;  3L75 H;  2LGW A;  3BVO A;  4IT5 A;  3OGI B;  3Q4H A;  3TK1 A;  5EBW C;  2IJH A;  2WPD G;  2Y69 C;  3P32 A;  4DV7 B;  4MVU A;  3VOU A;  1Y76 A;  3JCZ A;  3E8F A;  4X20 B;  3BAA A;  4G2K A;  3AG7 A;  5GON B;  5L3D A;  3TET A;  1IUR A;  2Z5U A;  2R72 A;  4TWK A;  4UVC A;  3FAV B;  2ZR3 A;  5IJ9 B;  3S3W A;  4NB5 A;  1VQM V;  1KQS U;  3M7M X;  3CC7 V;  3HKB B;  4QNH B;  2VQF O;  2R9A A;  2OIE A;  2Y69 B;  4DR1 B;  2H8P C;  4PDL A;  2AW9 A;  2AZ2 A;  4LF6 O;  4G27 B;  4IIJ A;  4NXM B;  1KB9 F;  1NVP D;  2K9P A;  3K58 A;  5EIB C;  5IY5 C;  3B4S A;  4U7N A;  4ZOL B;  3LNM B;  1T5E A;  5B1A C;  3DGE A;  5JJN B;  3N27 A;  4JI2 B;  3FKS G;  2QWQ B;  4K0K O;  5EZY B;  4UV8 A;  3BEH A;  4FFB B;  3KCX A;  1AI7 A;  2PI5 A;  1WP7 A;  2Y4U A;  1OCR B;  4GYC B;  1GN4 A;  4LH7 A;  3F5T A;  1XHZ A;  4TV8 A;  5B1A B;  5IJ0 A;  2ITD C;  2QWP B;  3B8M A;  5KHK A;  3BPZ A;  3JCU Z;  2YIB A;  1Q3E A;  1FKA O;  4MVR A;  1DTO A;  5EBL C;  2LW1 A; 
#chains in the Genus database with same CATH homology
 1WP7 A;  2FB5 A;  3IJ4 A;  4NYK A;  4FZ1 A;  4NTX A;  2L35 A;  4NTW A;  2QTS A;  3N27 A;  3S3W A;  4FZ0 A;  3S3X A;  4NTY A;  1WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...