2QTSA

Structure of an acid-sensing ion channel 1 at 1.9 a resolution and low ph
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
417
structure length
417
Chain Sequence
LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel
publication title Structure of acid-sensing ion channel 1 at 1.9A resolution and low pH
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 110
structure length 417
sequence length 417
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 2qtsA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 2qtsA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 2qtsA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 2qtsA02
2L35A 4NTYA 4FZ1A 1WP8A 4NTXA 3S3WA 4NTWA 3N27A 3S3XA 1WP7A 3IJ4A 2QTSA 4FZ0A 2FB5A 4NYKA
chains in the Genus database with same CATH superfamily
4AHCA 4B3MO 5FLXN 3QO7A 3SPHA 3SYQA 2WLJA 2ZNJA 3FAVA 3A0HZ 1XMQB 5H2FZ 1GN3A 1H2MA 2RMKB 3E35A 5B3SB 4DRXB 1BQ0A 3F5WC 4O4JB 3H9VA 3APOA 4OPHA 2WLKA 3CS5A 4FLYA 1U97A 1K4DC 2YXLA 4B3RO 1FXHA 1P7GA 1KMIZ 1K5SA 2FL4A 2JK5C 3W7SA 2QEXV 4YHHO 3RYHA 1QLEC 2AXTZ 1H2KA 3F7VC 3M7MX 2AHZA 3E8FA 2QR4A 3UM7A 3OTOB 3Q4HA 4KHPO 4ZHQA 4BW9A 2PZSA 2EBOA 1BZKA 4N23A 4ZI7A 1TUBB 1GO3F 5AG2A 2R9IA 2F43G 5CMUA 4ZOLA 5H6QA 3T1HO 2JIZG 2DQ0A 2X6CA 5JH7A 3AG3B 5ITZB 2ADQB 2ZXWB 4DRXA 1NR1A 2XOKG 3SYOA 1YSCA 4JGSA 4O4JA 4CBCA 3WB2A 1OCOB 2XHBA 1US6A 4OGQB 4RUEA 3ZMVA 1TAEA 5EIBC 4MT8A 4UCOA 1HNWO 4G27B 3T1YO 4I9WA 2RNBA 5C93A 4LWSA 3T1CA 5KHJA 3FX7A 3QNEA 2UUCO 1W59A 4DUYO 3OR7C 3QO8A 1R3LC 4LF4B 2QWNB 3UO2A 2FKXA 3BABA 3H1JH 1TUBA 1D2DA 4H33A 1EN4A 1AR5A 4BR6A 2YI8A 1SZXA 4I7ZB 3U11A 4JASA 5ITZA 3E83A 4CH3A 2RQ6A 3SYPA 1EZVH 4FZ1A 4I4TB 2Q8VA 2HJFC 2F93B 4X9QA 2EILB 1VQ6V 4MTXA 2ZIMA 1ROPA 2YDEA 5E79Z 4DR7B 1MZEA 3B09A 3K0DA 3AG7A 1JMKC 3CC7V 5BMVB 1S77D 3CRRA 3OE7G 4JV5B 3K5MA 1NVPB 3JD4A 4TQFA 2JS5A 2IH3C 1Z2GA 4X62O 2UXDB 2BCCH 1YI2V 1K4CC 3P30A 1THZA 1I7FA 2C2AA 4I4TA 4DR1B 1K92A 1NH2B 4I0XB 4QPJA 4E4EA 2A79B 3BA9A 3CRAA 4XBFA 1VF5B 5K1XA 4AQYO 3IGAC 3HKBB 4K8XA 1I94O 4FFKA 4YIOA 1AI6A 2FTKA 4Z1VA 4IYIA 4GKKO 4IGGA 1IBMO 1N32O 2QA4V 2HEPA 3K59A 3CX5F 5LMUO 4B7EA 4JI6B 3F5TA 2DE0X 4DW0A 3I5DA 4JI2O 3ASOC 1CP9A 2DYSC 5CBHA 1XBLA 4FLVA 1XMOB 5J9PC 3ZN0A 4J11A 2ZE8A 2DW4A 2LJ2A 5L3GA 1YZBA 2AZ2A 2BE3A 4JTDB 4DR5B 5L3DA 5LGUA 2JEUA 4QGPA 3SR2C 3LNMB 1SETA 4B3SO 5HFMA 2YSUB 3HKBA 4JI7B 3MD0A 3K03A 3GVMA 1IVSA 2WLIB 2WLLA 1JVMA 3T4ZA 1RPOA 2JS3A 2XASA 2Y4UA 5C8YB 2PI4A 4NYKA 2Z5UA 3BY6A 3JCZA 1Q5OA 2BTQA 2QKAA 2RCVA 3NR7A 1UFIA 3ZMTA 3L75H 4LF9B 2V4DA 3I56V 3EFFK 5KHHA 1IBKO 1R1BA 2B1IA 1SQXH 3ABMB 4UCSA 3ASOB 3RYCB 5LA6B 3RBZA 4RUFA 1SS3A 2QM8A 5CBGA 2ZNIA 1BQZA 4NTXA 3E22B 2YC0A 2ATKC 3APQA 2UXBB 2PYJA 4XDLA 3WU2Z 3VQVA 2GHYA 5FPRA 3RN4A 3ABKC 1S5LZ 2CUGA 2UUAO 4LH7A 3HKEB 3WG7C 1F51A 2DWEC 1WB7A 3JALA 3CCMV 4KL1A 4NXMB 2EULA 4X20B 3T2MA 4K0KB 1PD3A 4GUNA 5B1AC 1AJPA 1PL4A 5LHGA 3KZIZ 4Q6GA 1XEQA 2X6BA 5LA6A 2H8PC 2N05A 4U3JB 1R6TA 4WBNA 3E22A 1X59A 1VQ8V 4W4KA 1IBLB 3A0RA 2AW9A 4TV9B 1XUQA 4GYCB 3VQWA 4NXNB 4LFCO 1BHAA 4DV2B 1FFTB 1I08A 1HDJA 4P9PA 5KUMA 1VQ4V 4KFMA 3JYCA 1WJZA 1K8AW 3JAKA 3WG7B 4LF6B 1JJOA 3CXHF 4X20A 4UXNA 1ZSPA 2E5LB 1BE3H 4EB6B 3K5LA 2KKWA 4LNUB 3OT7A 3G4SV 3SYCA 4CH4A 4LFAO 4YY3B 4U3JA 4CS4A 2BTOA 3DC5A 2ZCEA 1RPRA 2KG7B 2ZKOA 3BHPA 2OT5A 1D5AA 5KX5A 3BVOA 2QWRB 4HNAA 2ETNA 5IYDO 1SF9A 4P9OA 1O9GA 1YXBA 1OCCC 3OMIB 4DO2A 1OHHG 2W0XA 2XAHA 2P4KA 1B3QA 3A8TA 4JI1B 3UO3A 4HAMA 4JYCA 1FKAO 1ZL8B 3H1HH 1OZ0A 4EB6A 4DV5O 1R73A 4O2BB 1M4UA 1HNZB 1Y76B 4LNUA 2YXYA 2Q67A 4JYAB 2Q73A 3OEEG 1J95A 3U0ZA 3L70H 3X2QC 3ZRXA 3MAQA 1XNQO 1YITV 1FXKC 2ODMA 4J10A 2KG7A 1S5HC 5LBQA 3L72H 5IY5C 1KU9A 4F4LA 1AROP 3K0GA 4D7TA 5LP6B 1NTKH 5KMGA 1KUQA 3QVNA 2X7RB 1ZUQA 1LUVA 2ZQMA 1H2NA 3B8MA 1N33B 3AG1C 1OCCB 1BT8A 2DYRB 4JI3B 4DR6B 1B04A 2WAMA 1WPXA 4B3TB 4PA7A 1I5YA 1NI8A 1GH6A 1RM1B 2JEXA 1DF4A 1URFA 1O9HA 3ZHSA 4LFBB 4O2BA 1Y76A 4XDKA 3ZHRA 1KKCA 2HJDA 3W7XA 3VOUA 2LO1A 4I50A 4X65B 4DV0B 2V7QG 3CYOA 3X2QB 3K5OA 2PF4E 3P32A 2K1EA 4JF3A 5EK0A 1NT2B 2EJRA 3LSSA 3OFNG 5LP6A 4TSFG 5CBFA 5KLVH 1M5IA 4UCTA 3ZBHA 1FFXA 3CXCU 2QTSA 4RAIA 4DUZO 4MVOA 1Y6XA 2IM9A 1A32A 4DV7O 4NVPA 1N8RW 3CCSV 1NJIW 2AHYA 4EFBA 3TETA 1Q6HA 4JYYA 3DSQA 2LQTA 1WA8B 5B3SC 4X88A 4O4HB 2AZ0A 2IU0A 3GB7C 4WF9V 3IC7A 4UVAA 2B1GA 5KAIZ 4QJFB 3VQYA 3OMAB 1R6NA 1OCRC 1L0LH 1FXKA 1AI5A 2UUBO 2FMLA 4NTYA 1K33A 3N2GB 1ZTEA 3OAAG 3TCUA 4I9QA 1XNRB 2L6LA 2ZDIC 3S3XA 4JZ2A 2VQEB 3PN1A 3MHHC 4LF8B 2Y0IA 4PI0A 4K35A 2AGAA 2WWWA 1M1KW 1N34B 1QVFU 2F4VO 4GZRB 1Q43A 1HNXO 4LR3A 3FD9A 1WA8A 2DOSA 2ZXWC 1AR1B 4JI4B 4O4HA 2E3CA 2PGGA 1OCOC 5A2QN 4D7SA 2JGDB 3FFQA 3TXQA 1Q81W 1SQPH 2W0FC 5H9CA 3HKCB 1KBHA 3EHBB 2DMXA 1BGYH 1OCRB 2V1DA 4LH6A 4GLXA 2GTAA 1Y4MA 3N2GA 1VMGA 5JCOC 3AK1A 5LXTB 2NNUA 4LC1A 5GONB 1JOYA 4PELA 3K04A 3OTFA 5LGTA 5LL6Y 4ICGA 2Q9LA 1YJWV 3ZHVA 3JATB 2EINB 5DECA 4RQFA 4JI5O 3ZHTA 3E8GA 1WLEA 2EILC 1QBZA 4MW8A 2JGDA 4PA6A 1FS0G 2UU9O 4X1IB 4DV6O 4QIWF 4YJ2B 1KKDA 5D5QA 3HKCA 4H37A 2W6IG 3W7TA 1GRJA 4CC5A 4UUJC 3O65A 1R6KA 4RWUA 4P30A 2EZPA 5IWAO 4BAYA 2Q4PA 2M7WA 1KYOF 1XQ8A 5LXTA 5CA3A 1NTZH 1YIJV 1H2SB 2ZDIA 3L9DA 1B06A 2QTOA 2CTRA 3IAYA 1KD1W 2QE7G 3G6EV 4YIPA 1IDSA 3SJCC 3UCSC 1S5JA 1QLNA 4YXWG 1BS3A 5LMNO 1AB3A 3GWKC 5EZYB 4I5SA 1YEWA 3SJBC 1SZTA 1Q8IA 1YVWA 3JAWB 3LDDA 1Q6IA 2A0LA 2IW5A 4MVSA 4X1IA 3EVKA 4YJ2A 3G6BA 1K5QA 2A7WA 2HVJC 2G38A 3ETEA 1B6QA 3HKDB 4OX9B 5EBLC 2R9RB 2A9HA 5JCOA 2VWKA 2W6JG 5EBWC 2QWQB 2ILMA 1XHZA 1J5EO 1H8HG 3ZMUA 4FZ0A 1VEWA 1LR1A 1ENVA 3SPCA 2P5OA 2HHHO 2YXHA 1GM8A 2Q6AA 1JPXA 4JI0O 5IJ9B 1P7BA 3JARB 4ZKIA 2EZOA 4X64B 2VQFO 4H13B 2CTWA 2ZE7A 2JGUA 2OWOA 5DEDA 1LNQA 2GUZB 3A0BZ 1AILA 2WLHA 1Y67A 4FLXA 4DV1B 1K97A 3HKDA 4MVQA 1RFYA 2PUSA 2DQ3A 4J7JA 5BMVA 3K79A 4GKJB 4PA9A 3OR6C 2QWPB 1R3KC 1VF6C 2QKSA 1BL8A 1S72V 1P84F 1TA8A 1F4NA 1AI4A 2UXCB 4LF7B 1BHBA 3ABMC 1U96A 2CTQA 4QPKA 1XMQO 2EIKB 3K9AA 3JD3A 3SPIA 4O4LB 2WLNA 2ZM6B 4HYOA 2P90A 2ZIOA 4I0XA 5IJ9A 1K73W 4MTGA 3JARA 4IT5A 3K58A 3CPWU 2YIDA 3LSQA 4TUYB 4I55B 2GTSA 3ETQA 2VWJA 4LBEC 1AJQA 2GUZA 2Y48A 5GTHZ 4DR2B 1FAFA 4FM0A 2YUAA 4DR3B 1NQTA 3OTOO 4AILC 4R8CA 2OTJV 2XAQA 1IURA 5J2TB 4DV4B 2X6AA 1MNGA 3RWRD 3SYAA 1ZAUA 5FNVB 4N21A 4U7NA 3ZN1A 3C3SA 3E86A 2CDYA 1YDXA 3KKYA 1JJ2U 1QCEA 3S3WA 4O4LA 2N74A 3LNNA 3K5NA 5CA0B 3OEHG 3CCVV 3O9OA 1S3JA 1GKFA 2GV9A 2F23A 3DC6A 4I55A 4DK1A 2XNDG 2QKCA 4HZ3A 2Y0PA 4ZIBA 5JJJB 3J7AU 1CEZA 2QJ1A 2ZE5A 2WLIA 3K08A 4L87A 5HFLA 3ZRSA 4J42A 5C8YA 4BIOA 5J2TA 4LF4O 4DR4B 3FYEB 3BPZA 3IC9A 3CCJV 4UB6Z 5FNVA 1VF6A 1JFFB 3ICXA 5BY1A 5KA5A 4DV3B 2WPDG 1ORQC 4UFZA 3HPLC 1HWYA 1PPJH 1N36B 3SJAC 5H5NA 1CXZB 3RYCA 3ABLB 1QQCA 4UB8Z 2YIBD 3MHSC 1HP8A 5BR8B 2JRIA 3K57A 1HR0B 5CA0A 4FJCC 4JI8B 3NXSA 3ZHUA 4X1YB 2IJHA 4DR7O 4B7KA 3ZRVA 3QF7A 1WN7A 2LW1A 4GX2A 3CRQA 1EFRG 3HKEA 1COWG 1QR9A 1DLBA 1SKVA 3TJTA 3L74H 4JV5O 1NBMG 1JFFA 1QVGU 1SQQH 3B4SA 2Q0OC 1AJNA 2YEVB 4IHJB 2UXDO 4FVMA 4LP8A 1FD9A 3JAMN 1FJGB 4Z2WA 2OIEA 2P6JA 1E1RG 4JAUA 1UJWB 1E1QG 3ZCCA 4PDRA 4DR1O 4YJ3B 4B08A 2EIMC 2XTAA 3UQ8A 1N4CA 1PNLA 3TGUH 2OCHA 2Q7GA 4X66B 5J2UB 2HLDG 4B3MB 5EYPB 5LP6C 1M57B 1DTOA 1RSOB 2XAJA 4TV9A 1IXMA 3OUFA 1R3IC 3D8CA 3H1KH 2DYRC 1VARA 2P22C 3W7WA 4L8JA 4B3RB 4UCVA 1RM1C 1EN6A 1PNMA 4YHHB 4JI6O 2ZD9A 2F66C 4IHJA 4UVCA 4GX5A 1JA8A 2B5UA 2XT9A 1XMOO 4KHPB 4K3AA 1NZ6A 1G1XB 4AI8A 5JJEB 4YJ3A 2HKOA 2Q7HA 3JSNA 3T1HB 5J2UA 2EIMB 4DR5O 5EYPA 1IZ3A 1RSOA 3J80N 3OUSA 2WLMA 5KHKA 4JI7O 5IDJA 3QO5A 1MMMA 2H94A 1K3EA 3CJHB 5IJ0B 3CRCA 3B8NA 3P3NA 2QSAA 4Q20A 1S0VA 1KC8W 1SQBH 1CPYA 3T1YB 4BW5A 2QM4A 4LF9O 1ZL8A 1ZX3A 5BXZA 4MVRA 1QU7A 4WFEA 5IYCO 3SGIA 2UUCB 2Q5ZA 4DUYB 3CE2A 1ZWIC 4TOIA 1XILA 3HR0A 1V9PA 1N0NA 2DWDC 3LDEA 5H6RA 2UXBO 2JJ2G 1EBOA 5L3EA 3AEIA 1XL6A 2BOCC 4Z1MG 3SJQC 1GN2A 4DK0A 3KCXA 2CK3G 4G2KA 3CJHA 5IJ0A 3G71V 1GTOA 1PKXA 4F6EA 4DYLA 3N2KB 1YJNV 2VRZA 3FB5C 4EKWA 4NXMO 1V55C 1M56B 2ITCC 1KECA 1MSWD 4K0KO 4JTAB 1KB9F 4UV8A 3CMAV 1W0JG 4BIZA 4QNHB 5B5EZ 1XREA 2WA4A 1F7YA 1QNMA 2A3QA 4TWKA 3DGEA 3E2EA 4BWAA 3B40A 3CP1A 4JAVA 3SDLA 3CCLV 1H2GA 3RYIB 1IBLO 4X62B 1Q3EA 4MSWC 2IJKA 1VIBA 1NR7A 3JD1A 1ZLZA 1YTFD 4NXNO 4UCUA 1Y74B 4DV2O 2EX3A 3THOA 3QG5A 3K3WA 4MW3A 1NS1A 3R65A 3H1LH 3IJ4A 1AR4A 2OIGA 4U3FH 4AQYB 2P4VA 4FFBB 4LF6O 2NN4A 3STZC 2KSDA 5GTIZ 1V55B 1Z5VA 2E5LO 1Y66A 2EINC 4UVBA 1AI7A 3CSXA 1I94B 3DXRB 4JTCB 3QTCA 2OYQA 4PD4F 2B9ZA 4R7CA 2Z3YA 4ZHQB 4GKKB 5FL7G 4PI2A 4ZI7B 1IBMB 1N32B 4YY3O 3CCUV 1JR9A 1VQNV 3C3TA 2DN9A 3RFRA 1XDCA 1M93A 2YI9A 4H0LB 3RYIA 3K9SA 1TUEB 3OGIB 5JH7B 4JI2B 5KA6A 3BRCA 3B77A 4TV8B 3VQXA 5E1AC 4MTFA 1GN6A 1VQKV 1Y74A 4P2ZA 1L0NH 3ML0A 5L3CA 3OW2U 1TVKB 1YCIA 2CAZC 1LUWA 4JI1O 4FFBA 4JPRA 4J41A 3A2FA 4B3SB 1KP2A 1NKDA 1R3JC 4LWSB 1FYJA 1UPGA 3DXRA 3CRMA 4IYHA 3E89A 5EC1C 1MA1A 5LOVB 1HNZO 2LGWA 3OD4A 3ETGA 3P3PA 2X0LA 3B2EE 2YS8A 4JYAO 1HW7A 1H2LA 1AP5A 2QGNA 5F2VO 1MG1A 1OCZB 1T5EA 1DK1A 1IBKB 1S76D 1I5XA 2BOBC 4TV8A 4U7OA 4FM2A 3JCUZ 3UT5B 1K34A 5BZBA 3CD6V 1Q82W 4LF5B 1MABG 1OJHA 1FPOA 1N33O 5GONA 3ZEDA 1H8EG 3ZHQA 4R6ZA 1TVKA 4X1KB 2R72A 2F1MA 4JI3O 4DR6O 4KUMA 1WB8A 1Q86W 4WFBV 4B3TO 4WFHA 1GM7A 5LHIA 3RVZA 3JATA 4O4IB 1QLEB 5LOVA 4LFBO 1VQ9V 2UUAB 2ZT9B 1V54C 2ADPA 2PY5A 1M9NA 2M6YA 1GM9A 1W0KG 3ZMZA 5CN0A 4X65O 4PDLA 3I55V 4DV0O 3HB3B 4WCEV 3JD2A 1MOFA 3LUTB 4X89A 4TT3G 4J80A 1N0JA 3AG2C 2P67A 3UT5A 4WFGA 2MW2B 3L73H 1EZJA 2GDSA 4X1KA 2XAFA 4FM1A 2ZINA 5LHHA 2Q69A 5EBMC 1SQGA 5K1PA 2EIKC 3U10A 4LFCB 3M8AA 4O4IA 4FPPA 4F6RB 3D36C 5EZYA 2BSKB 1V54B 2H3OA 2QM7A 3JAWA 1XHXA 3CWBH 1JQ0A 2IH1C 3BFRA 2NLJC 2IJJA 2OTLV 1DGSA 4IL6Z 2CTPA 3CCQV 1E79G 1OV9A 2XAGA 5IE9A 1XNRO 4ZBMA 4ABMA 4LFAB 3AG2B 4R50A 3ZIAG 4FMTA 1WNSA 4MVMA 1DF5A 4DW1A 2VQEO 4LF8O 4GX1A 3ETDA 2LW7A 1SESA 1SRYA 2UXNA 3AK2A 3LSUA 3GWOA 1N34O 2R70A 4CS3A 5EIBD 3ABUA 4CH5A 1D5NA 3L71H 4JI4O 2E75B 1YJ9V 4F6RA 2WLLB 4EFEA 2K9PA 4UCRA 3TK1A 2BSKA 2KB1A 2BTQB 4NB5A 5JJNB 3AG4C 4QE7A 3TXSA 4MTOA 2JDIG 2GBOA 4FIPC 1M90W 1NVPD 3SPJA 4IIJB 4NKGB 1Q7YW 1QHTA 1G8MA 1JCHA 3M99B 4DV5B 3CCRV 4FK5C 3D3IA 1K9MW 4JAAA 2WA3A 2DJVA 1G6UA 3H1IH 1VQMV 3FB7C 3CMEV 5KHGA 2QWOB 3RW0A 1NH2D 1TGOA 1XNQB 4CS2A 1AP6A 4RO2A 4QE9A 5B1OA 3CC2V 3FB8C 5IYBO 5LGNA 5CB4B 2HFEC 1JX9A 4J7ZA 5TISZ 2MK3A 2Q7EA 2L35A 4TQDA 2PYLA 4D6TH 4J9YB 3UKMA 3W7UA 5KHIA 3ZRWB 1XI1A 2CGOA 3ABLC 2LFRA 3F7YC 1F4MA 2HVKC 1EN5A 1SQVH 4MVUA 4BIUA 1G4YB 3D36A 4DXWA 3JALB 2RDCA 4FLZA 2JJ1G 4IIJA 2HR3A 3AG4B 4TUYA 3ZJZA 3ASNC 4CZZA 2FYUH 3CCEV 3T4DA 3KG2A 1XL4A 2Q68A 4RQEA 4XDJA 4K8ZA 4UV9A 2DYSB 2CGNA 4NR1A 3OM3B 4LF5O 1GMGA 3EXAA 3BCCH 4WBNB 2RN9A 2ITDC 4PDVA 2UXXA 5CB4A 2OCCC 2GSMB 1MSDA 3BEHA 1PV0A 5L3BA 2D2CB 1IXBA 2IU3A 2LGQA 5B1BC 3ZRWA 1BSMA 1RP3B 4DUZB 2E74B 2YIBA 3BA8A 3WFVA 1H38A 4DV7B 2Y69C 3JAKB 1MZFA 1M57C 4PDMA 1FXVA 1BCCH 1YHQV 3K06A 1WP8A 1WAZA 1PL0A 4X8AA 3ASNB 4HBNA 5B66Z 1K7DA 2ZE6A 4PJ0Z 4MVZA 1GN4A 4OX9O 3FB6C 4KXRA 4G28B 3STLC 5IYZB 3OGCC 3CEIA 2P7TC 3LDCA 1VQ5V 2PTMA 2Y4TA 2UUBB 3JD0A 1VQ7V 2OCCB 3AK3A 5KX5B 3G67A 5CA1B 5LYJB 4HNAB 5JQGB 5FPOA 3ABKB 1SERA 2JVDA 5B1BB 3E8HA 3PJSK 1WPBA 3IFXA 3J81N 1KQSU 4X64O 3CB2A 2Y69B 2F4VB 1Q6UA 3C90A 4WFAV 1HNXB 4H44B 4X1YA 2ZR2A 2Q0AA 3CC4V 1EM1A 5B1AB 3OMNB 4DV1O 4FLTA 1SC5B 4O2AB 2EJ7A 4GKJO 3MDSA 2PI5A 5IYZA 4OPAA 5B1NA 1Q90D 3FYIB 3ZMSA 3VBBA 2E76B 4NTWA 4PHZA 5KAFZ 2KQXA 2YEVA 5KMGB 4PV1B 5CA1A 4LF7O 2CH7B 2UXCO 5LYJA 3DTUB 2YIAA 5JQGA 1VP7A 3RGBA 2RJZA 1KP3A 5D5PA 1NTMH 5IT9N 1GK9A 2ZM6O 4KP4A 1XOUA 3D3QA 1F23A 1VQOV 1L8DA 4A5UB 3ABTA 4JI5B 3RYFB 5DN6G 4DR2O 3WB1A 4DR3O 2HP8A 2HG5C 4LCUC 4O2AA 4I50B 4GX0A 1SA0B 5JVDB 2UU9B 4DV6B 1M56C 4DV4O 2Z0AA 2P06A 4J7KA 1HNWB 3H01A 4GCZA 4JYBA 1NU1H 4PA4A 4GT1A 2CH7A 2XUMA 5IWAB 4OXSA 3WB0A 1FFXB 2R9AA 2FB5A 2YICA 3BAAA 1VF7A 5A9GA 3E8BA 4MS2A 4CC6A 1X4TA 2IBZH 1YTFB 3RYFA 5LMNB 1VQLV 3RVYA 5JWPA 1VQPV 1PNKA 1SA0A 1WP7A 5JVDA 2D3OW 4DR4O 4PA3A 1FXKB 1SQFA 1YF2A 2LFSA 4DV3O 1P49A 2ARHA 1I0HA 4FLWA 1PP9H 5IY5B 3G80A 2EIJC 2NR5A 3ZS8C 1N36O 1W2BU 4C7UA 2N04A 2QDOA 1GAXA 1QR8A 5BR8O 3AG1B 4WFFA 4FLUA 1HR0O 4JI8O 4JZGA 3FKSG 1J5EB 3JASB 4J9ZB 2F95B 3JSLA 2CE4A 2ZR3A 3FAVB 3N27A 3RT3C 2HHHB 1Z5WA 1L1FA 5L3FA 4JI0B 2VS0A 4E2LA 1BMFG 4EEQA 2IJIA 2VQFB 3N2KA 3R66A 1AVMA 1PM9A 2WSSG 5EC2C 4ASUG 3RYHB 5KUKA 5DM6V 4W4LA 1P4RA 5GW7A 3ZX6A 3Q4HB 1FJGO 2EIJB 1IX9A 2LP7A 3SPGA 2O57A 1OCZC 4CH6A 3CHXA 4ZOLB 5LMUB 3KCYA 4X66O 2A06H 3AG3C 3JASA
chains in the Genus database with same CATH topology
2L35A 4NTYA 4FZ1A 1WP8A 4NTXA 3S3WA 4NTWA 3N27A 3S3XA 1WP7A 3IJ4A 2QTSA 4FZ0A 2FB5A 4NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L35 A;  4NTY A;  4FZ1 A;  1WP8 A;  4NTX A;  3S3W A;  4NTW A;  3N27 A;  3S3X A;  1WP7 A;  3IJ4 A;  2QTS A;  4FZ0 A;  2FB5 A;  4NYK A; 
#chains in the Genus database with same CATH topology
 4AHC A;  4B3M O;  5FLX N;  3QO7 A;  3SPH A;  3SYQ A;  2WLJ A;  2ZNJ A;  3FAV A;  3A0H Z;  1XMQ B;  5H2F Z;  1GN3 A;  1H2M A;  2RMK B;  3E35 A;  5B3S B;  4DRX B;  1BQ0 A;  3F5W C;  4O4J B;  3H9V A;  3APO A;  4OPH A;  2WLK A;  3CS5 A;  4FLY A;  1U97 A;  1K4D C;  2YXL A;  4B3R O;  1FXH A;  1P7G A;  1KMI Z;  1K5S A;  2FL4 A;  2JK5 C;  3W7S A;  2QEX V;  4YHH O;  3RYH A;  1QLE C;  2AXT Z;  1H2K A;  3F7V C;  3M7M X;  2AHZ A;  3E8F A;  2QR4 A;  3UM7 A;  3OTO B;  3Q4H A;  4KHP O;  4ZHQ A;  4BW9 A;  2PZS A;  2EBO A;  1BZK A;  4N23 A;  4ZI7 A;  1TUB B;  1GO3 F;  5AG2 A;  2R9I A;  2F43 G;  5CMU A;  4ZOL A;  5H6Q A;  3T1H O;  2JIZ G;  2DQ0 A;  2X6C A;  5JH7 A;  3AG3 B;  5ITZ B;  2ADQ B;  2ZXW B;  4DRX A;  1NR1 A;  2XOK G;  3SYO A;  1YSC A;  4JGS A;  4O4J A;  4CBC A;  3WB2 A;  1OCO B;  2XHB A;  1US6 A;  4OGQ B;  4RUE A;  3ZMV A;  1TAE A;  5EIB C;  4MT8 A;  4UCO A;  1HNW O;  4G27 B;  3T1Y O;  4I9W A;  2RNB A;  5C93 A;  4LWS A;  3T1C A;  5KHJ A;  3FX7 A;  3QNE A;  2UUC O;  1W59 A;  4DUY O;  3OR7 C;  3QO8 A;  1R3L C;  4LF4 B;  2QWN B;  3UO2 A;  2FKX A;  3BAB A;  3H1J H;  1TUB A;  1D2D A;  4H33 A;  1EN4 A;  1AR5 A;  4BR6 A;  2YI8 A;  1SZX A;  4I7Z B;  3U11 A;  4JAS A;  5ITZ A;  3E83 A;  4CH3 A;  2RQ6 A;  3SYP A;  1EZV H;  4FZ1 A;  4I4T B;  2Q8V A;  2HJF C;  2F93 B;  4X9Q A;  2EIL B;  1VQ6 V;  4MTX A;  2ZIM A;  1ROP A;  2YDE A;  5E79 Z;  4DR7 B;  1MZE A;  3B09 A;  3K0D A;  3AG7 A;  1JMK C;  3CC7 V;  5BMV B;  1S77 D;  3CRR A;  3OE7 G;  4JV5 B;  3K5M A;  1NVP B;  3JD4 A;  4TQF A;  2JS5 A;  2IH3 C;  1Z2G A;  4X62 O;  2UXD B;  2BCC H;  1YI2 V;  1K4C C;  3P30 A;  1THZ A;  1I7F A;  2C2A A;  4I4T A;  4DR1 B;  1K92 A;  1NH2 B;  4I0X B;  4QPJ A;  4E4E A;  2A79 B;  3BA9 A;  3CRA A;  4XBF A;  1VF5 B;  5K1X A;  4AQY O;  3IGA C;  3HKB B;  4K8X A;  1I94 O;  4FFK A;  4YIO A;  1AI6 A;  2FTK A;  4Z1V A;  4IYI A;  4GKK O;  4IGG A;  1IBM O;  1N32 O;  2QA4 V;  2HEP A;  3K59 A;  3CX5 F;  5LMU O;  4B7E A;  4JI6 B;  3F5T A;  2DE0 X;  4DW0 A;  3I5D A;  4JI2 O;  3ASO C;  1CP9 A;  2DYS C;  5CBH A;  1XBL A;  4FLV A;  1XMO B;  5J9P C;  3ZN0 A;  4J11 A;  2ZE8 A;  2DW4 A;  2LJ2 A;  5L3G A;  1YZB A;  2AZ2 A;  2BE3 A;  4JTD B;  4DR5 B;  5L3D A;  5LGU A;  2JEU A;  4QGP A;  3SR2 C;  3LNM B;  1SET A;  4B3S O;  5HFM A;  2YSU B;  3HKB A;  4JI7 B;  3MD0 A;  3K03 A;  3GVM A;  1IVS A;  2WLI B;  2WLL A;  1JVM A;  3T4Z A;  1RPO A;  2JS3 A;  2XAS A;  2Y4U A;  5C8Y B;  2PI4 A;  4NYK A;  2Z5U A;  3BY6 A;  3JCZ A;  1Q5O A;  2BTQ A;  2QKA A;  2RCV A;  3NR7 A;  1UFI A;  3ZMT A;  3L75 H;  4LF9 B;  2V4D A;  3I56 V;  3EFF K;  5KHH A;  1IBK O;  1R1B A;  2B1I A;  1SQX H;  3ABM B;  4UCS A;  3ASO B;  3RYC B;  5LA6 B;  3RBZ A;  4RUF A;  1SS3 A;  2QM8 A;  5CBG A;  2ZNI A;  1BQZ A;  4NTX A;  3E22 B;  2YC0 A;  2ATK C;  3APQ A;  2UXB B;  2PYJ A;  4XDL A;  3WU2 Z;  3VQV A;  2GHY A;  5FPR A;  3RN4 A;  3ABK C;  1S5L Z;  2CUG A;  2UUA O;  4LH7 A;  3HKE B;  3WG7 C;  1F51 A;  2DWE C;  1WB7 A;  3JAL A;  3CCM V;  4KL1 A;  4NXM B;  2EUL A;  4X20 B;  3T2M A;  4K0K B;  1PD3 A;  4GUN A;  5B1A C;  1AJP A;  1PL4 A;  5LHG A;  3KZI Z;  4Q6G A;  1XEQ A;  2X6B A;  5LA6 A;  2H8P C;  2N05 A;  4U3J B;  1R6T A;  4WBN A;  3E22 A;  1X59 A;  1VQ8 V;  4W4K A;  1IBL B;  3A0R A;  2AW9 A;  4TV9 B;  1XUQ A;  4GYC B;  3VQW A;  4NXN B;  4LFC O;  1BHA A;  4DV2 B;  1FFT B;  1I08 A;  1HDJ A;  4P9P A;  5KUM A;  1VQ4 V;  4KFM A;  3JYC A;  1WJZ A;  1K8A W;  3JAK A;  3WG7 B;  4LF6 B;  1JJO A;  3CXH F;  4X20 A;  4UXN A;  1ZSP A;  2E5L B;  1BE3 H;  4EB6 B;  3K5L A;  2KKW A;  4LNU B;  3OT7 A;  3G4S V;  3SYC A;  4CH4 A;  4LFA O;  4YY3 B;  4U3J A;  4CS4 A;  2BTO A;  3DC5 A;  2ZCE A;  1RPR A;  2KG7 B;  2ZKO A;  3BHP A;  2OT5 A;  1D5A A;  5KX5 A;  3BVO A;  2QWR B;  4HNA A;  2ETN A;  5IYD O;  1SF9 A;  4P9O A;  1O9G A;  1YXB A;  1OCC C;  3OMI B;  4DO2 A;  1OHH G;  2W0X A;  2XAH A;  2P4K A;  1B3Q A;  3A8T A;  4JI1 B;  3UO3 A;  4HAM A;  4JYC A;  1FKA O;  1ZL8 B;  3H1H H;  1OZ0 A;  4EB6 A;  4DV5 O;  1R73 A;  4O2B B;  1M4U A;  1HNZ B;  1Y76 B;  4LNU A;  2YXY A;  2Q67 A;  4JYA B;  2Q73 A;  3OEE G;  1J95 A;  3U0Z A;  3L70 H;  3X2Q C;  3ZRX A;  3MAQ A;  1XNQ O;  1YIT V;  1FXK C;  2ODM A;  4J10 A;  2KG7 A;  1S5H C;  5LBQ A;  3L72 H;  5IY5 C;  1KU9 A;  4F4L A;  1ARO P;  3K0G A;  4D7T A;  5LP6 B;  1NTK H;  5KMG A;  1KUQ A;  3QVN A;  2X7R B;  1ZUQ A;  1LUV A;  2ZQM A;  1H2N A;  3B8M A;  1N33 B;  3AG1 C;  1OCC B;  1BT8 A;  2DYR B;  4JI3 B;  4DR6 B;  1B04 A;  2WAM A;  1WPX A;  4B3T B;  4PA7 A;  1I5Y A;  1NI8 A;  1GH6 A;  1RM1 B;  2JEX A;  1DF4 A;  1URF A;  1O9H A;  3ZHS A;  4LFB B;  4O2B A;  1Y76 A;  4XDK A;  3ZHR A;  1KKC A;  2HJD A;  3W7X A;  3VOU A;  2LO1 A;  4I50 A;  4X65 B;  4DV0 B;  2V7Q G;  3CYO A;  3X2Q B;  3K5O A;  2PF4 E;  3P32 A;  2K1E A;  4JF3 A;  5EK0 A;  1NT2 B;  2EJR A;  3LSS A;  3OFN G;  5LP6 A;  4TSF G;  5CBF A;  5KLV H;  1M5I A;  4UCT A;  3ZBH A;  1FFX A;  3CXC U;  2QTS A;  4RAI A;  4DUZ O;  4MVO A;  1Y6X A;  2IM9 A;  1A32 A;  4DV7 O;  4NVP A;  1N8R W;  3CCS V;  1NJI W;  2AHY A;  4EFB A;  3TET A;  1Q6H A;  4JYY A;  3DSQ A;  2LQT A;  1WA8 B;  5B3S C;  4X88 A;  4O4H B;  2AZ0 A;  2IU0 A;  3GB7 C;  4WF9 V;  3IC7 A;  4UVA A;  2B1G A;  5KAI Z;  4QJF B;  3VQY A;  3OMA B;  1R6N A;  1OCR C;  1L0L H;  1FXK A;  1AI5 A;  2UUB O;  2FML A;  4NTY A;  1K33 A;  3N2G B;  1ZTE A;  3OAA G;  3TCU A;  4I9Q A;  1XNR B;  2L6L A;  2ZDI C;  3S3X A;  4JZ2 A;  2VQE B;  3PN1 A;  3MHH C;  4LF8 B;  2Y0I A;  4PI0 A;  4K35 A;  2AGA A;  2WWW A;  1M1K W;  1N34 B;  1QVF U;  2F4V O;  4GZR B;  1Q43 A;  1HNX O;  4LR3 A;  3FD9 A;  1WA8 A;  2DOS A;  2ZXW C;  1AR1 B;  4JI4 B;  4O4H A;  2E3C A;  2PGG A;  1OCO C;  5A2Q N;  4D7S A;  2JGD B;  3FFQ A;  3TXQ A;  1Q81 W;  1SQP H;  2W0F C;  5H9C A;  3HKC B;  1KBH A;  3EHB B;  2DMX A;  1BGY H;  1OCR B;  2V1D A;  4LH6 A;  4GLX A;  2GTA A;  1Y4M A;  3N2G A;  1VMG A;  5JCO C;  3AK1 A;  5LXT B;  2NNU A;  4LC1 A;  5GON B;  1JOY A;  4PEL A;  3K04 A;  3OTF A;  5LGT A;  5LL6 Y;  4ICG A;  2Q9L A;  1YJW V;  3ZHV A;  3JAT B;  2EIN B;  5DEC A;  4RQF A;  4JI5 O;  3ZHT A;  3E8G A;  1WLE A;  2EIL C;  1QBZ A;  4MW8 A;  2JGD A;  4PA6 A;  1FS0 G;  2UU9 O;  4X1I B;  4DV6 O;  4QIW F;  4YJ2 B;  1KKD A;  5D5Q A;  3HKC A;  4H37 A;  2W6I G;  3W7T A;  1GRJ A;  4CC5 A;  4UUJ C;  3O65 A;  1R6K A;  4RWU A;  4P30 A;  2EZP A;  5IWA O;  4BAY A;  2Q4P A;  2M7W A;  1KYO F;  1XQ8 A;  5LXT A;  5CA3 A;  1NTZ H;  1YIJ V;  1H2S B;  2ZDI A;  3L9D A;  1B06 A;  2QTO A;  2CTR A;  3IAY A;  1KD1 W;  2QE7 G;  3G6E V;  4YIP A;  1IDS A;  3SJC C;  3UCS C;  1S5J A;  1QLN A;  4YXW G;  1BS3 A;  5LMN O;  1AB3 A;  3GWK C;  5EZY B;  4I5S A;  1YEW A;  3SJB C;  1SZT A;  1Q8I A;  1YVW A;  3JAW B;  3LDD A;  1Q6I A;  2A0L A;  2IW5 A;  4MVS A;  4X1I A;  3EVK A;  4YJ2 A;  3G6B A;  1K5Q A;  2A7W A;  2HVJ C;  2G38 A;  3ETE A;  1B6Q A;  3HKD B;  4OX9 B;  5EBL C;  2R9R B;  2A9H A;  5JCO A;  2VWK A;  2W6J G;  5EBW C;  2QWQ B;  2ILM A;  1XHZ A;  1J5E O;  1H8H G;  3ZMU A;  4FZ0 A;  1VEW A;  1LR1 A;  1ENV A;  3SPC A;  2P5O A;  2HHH O;  2YXH A;  1GM8 A;  2Q6A A;  1JPX A;  4JI0 O;  5IJ9 B;  1P7B A;  3JAR B;  4ZKI A;  2EZO A;  4X64 B;  2VQF O;  4H13 B;  2CTW A;  2ZE7 A;  2JGU A;  2OWO A;  5DED A;  1LNQ A;  2GUZ B;  3A0B Z;  1AIL A;  2WLH A;  1Y67 A;  4FLX A;  4DV1 B;  1K97 A;  3HKD A;  4MVQ A;  1RFY A;  2PUS A;  2DQ3 A;  4J7J A;  5BMV A;  3K79 A;  4GKJ B;  4PA9 A;  3OR6 C;  2QWP B;  1R3K C;  1VF6 C;  2QKS A;  1BL8 A;  1S72 V;  1P84 F;  1TA8 A;  1F4N A;  1AI4 A;  2UXC B;  4LF7 B;  1BHB A;  3ABM C;  1U96 A;  2CTQ A;  4QPK A;  1XMQ O;  2EIK B;  3K9A A;  3JD3 A;  3SPI A;  4O4L B;  2WLN A;  2ZM6 B;  4HYO A;  2P90 A;  2ZIO A;  4I0X A;  5IJ9 A;  1K73 W;  4MTG A;  3JAR A;  4IT5 A;  3K58 A;  3CPW U;  2YID A;  3LSQ A;  4TUY B;  4I55 B;  2GTS A;  3ETQ A;  2VWJ A;  4LBE C;  1AJQ A;  2GUZ A;  2Y48 A;  5GTH Z;  4DR2 B;  1FAF A;  4FM0 A;  2YUA A;  4DR3 B;  1NQT A;  3OTO O;  4AIL C;  4R8C A;  2OTJ V;  2XAQ A;  1IUR A;  5J2T B;  4DV4 B;  2X6A A;  1MNG A;  3RWR D;  3SYA A;  1ZAU A;  5FNV B;  4N21 A;  4U7N A;  3ZN1 A;  3C3S A;  3E86 A;  2CDY A;  1YDX A;  3KKY A;  1JJ2 U;  1QCE A;  3S3W A;  4O4L A;  2N74 A;  3LNN A;  3K5N A;  5CA0 B;  3OEH G;  3CCV V;  3O9O A;  1S3J A;  1GKF A;  2GV9 A;  2F23 A;  3DC6 A;  4I55 A;  4DK1 A;  2XND G;  2QKC A;  4HZ3 A;  2Y0P A;  4ZIB A;  5JJJ B;  3J7A U;  1CEZ A;  2QJ1 A;  2ZE5 A;  2WLI A;  3K08 A;  4L87 A;  5HFL A;  3ZRS A;  4J42 A;  5C8Y A;  4BIO A;  5J2T A;  4LF4 O;  4DR4 B;  3FYE B;  3BPZ A;  3IC9 A;  3CCJ V;  4UB6 Z;  5FNV A;  1VF6 A;  1JFF B;  3ICX A;  5BY1 A;  5KA5 A;  4DV3 B;  2WPD G;  1ORQ C;  4UFZ A;  3HPL C;  1HWY A;  1PPJ H;  1N36 B;  3SJA C;  5H5N A;  1CXZ B;  3RYC A;  3ABL B;  1QQC A;  4UB8 Z;  2YIB D;  3MHS C;  1HP8 A;  5BR8 B;  2JRI A;  3K57 A;  1HR0 B;  5CA0 A;  4FJC C;  4JI8 B;  3NXS A;  3ZHU A;  4X1Y B;  2IJH A;  4DR7 O;  4B7K A;  3ZRV A;  3QF7 A;  1WN7 A;  2LW1 A;  4GX2 A;  3CRQ A;  1EFR G;  3HKE A;  1COW G;  1QR9 A;  1DLB A;  1SKV A;  3TJT A;  3L74 H;  4JV5 O;  1NBM G;  1JFF A;  1QVG U;  1SQQ H;  3B4S A;  2Q0O C;  1AJN A;  2YEV B;  4IHJ B;  2UXD O;  4FVM A;  4LP8 A;  1FD9 A;  3JAM N;  1FJG B;  4Z2W A;  2OIE A;  2P6J A;  1E1R G;  4JAU A;  1UJW B;  1E1Q G;  3ZCC A;  4PDR A;  4DR1 O;  4YJ3 B;  4B08 A;  2EIM C;  2XTA A;  3UQ8 A;  1N4C A;  1PNL A;  3TGU H;  2OCH A;  2Q7G A;  4X66 B;  5J2U B;  2HLD G;  4B3M B;  5EYP B;  5LP6 C;  1M57 B;  1DTO A;  1RSO B;  2XAJ A;  4TV9 A;  1IXM A;  3OUF A;  1R3I C;  3D8C A;  3H1K H;  2DYR C;  1VAR A;  2P22 C;  3W7W A;  4L8J A;  4B3R B;  4UCV A;  1RM1 C;  1EN6 A;  1PNM A;  4YHH B;  4JI6 O;  2ZD9 A;  2F66 C;  4IHJ A;  4UVC A;  4GX5 A;  1JA8 A;  2B5U A;  2XT9 A;  1XMO O;  4KHP B;  4K3A A;  1NZ6 A;  1G1X B;  4AI8 A;  5JJE B;  4YJ3 A;  2HKO A;  2Q7H A;  3JSN A;  3T1H B;  5J2U A;  2EIM B;  4DR5 O;  5EYP A;  1IZ3 A;  1RSO A;  3J80 N;  3OUS A;  2WLM A;  5KHK A;  4JI7 O;  5IDJ A;  3QO5 A;  1MMM A;  2H94 A;  1K3E A;  3CJH B;  5IJ0 B;  3CRC A;  3B8N A;  3P3N A;  2QSA A;  4Q20 A;  1S0V A;  1KC8 W;  1SQB H;  1CPY A;  3T1Y B;  4BW5 A;  2QM4 A;  4LF9 O;  1ZL8 A;  1ZX3 A;  5BXZ A;  4MVR A;  1QU7 A;  4WFE A;  5IYC O;  3SGI A;  2UUC B;  2Q5Z A;  4DUY B;  3CE2 A;  1ZWI C;  4TOI A;  1XIL A;  3HR0 A;  1V9P A;  1N0N A;  2DWD C;  3LDE A;  5H6R A;  2UXB O;  2JJ2 G;  1EBO A;  5L3E A;  3AEI A;  1XL6 A;  2BOC C;  4Z1M G;  3SJQ C;  1GN2 A;  4DK0 A;  3KCX A;  2CK3 G;  4G2K A;  3CJH A;  5IJ0 A;  3G71 V;  1GTO A;  1PKX A;  4F6E A;  4DYL A;  3N2K B;  1YJN V;  2VRZ A;  3FB5 C;  4EKW A;  4NXM O;  1V55 C;  1M56 B;  2ITC C;  1KEC A;  1MSW D;  4K0K O;  4JTA B;  1KB9 F;  4UV8 A;  3CMA V;  1W0J G;  4BIZ A;  4QNH B;  5B5E Z;  1XRE A;  2WA4 A;  1F7Y A;  1QNM A;  2A3Q A;  4TWK A;  3DGE A;  3E2E A;  4BWA A;  3B40 A;  3CP1 A;  4JAV A;  3SDL A;  3CCL V;  1H2G A;  3RYI B;  1IBL O;  4X62 B;  1Q3E A;  4MSW C;  2IJK A;  1VIB A;  1NR7 A;  3JD1 A;  1ZLZ A;  1YTF D;  4NXN O;  4UCU A;  1Y74 B;  4DV2 O;  2EX3 A;  3THO A;  3QG5 A;  3K3W A;  4MW3 A;  1NS1 A;  3R65 A;  3H1L H;  3IJ4 A;  1AR4 A;  2OIG A;  4U3F H;  4AQY B;  2P4V A;  4FFB B;  4LF6 O;  2NN4 A;  3STZ C;  2KSD A;  5GTI Z;  1V55 B;  1Z5V A;  2E5L O;  1Y66 A;  2EIN C;  4UVB A;  1AI7 A;  3CSX A;  1I94 B;  3DXR B;  4JTC B;  3QTC A;  2OYQ A;  4PD4 F;  2B9Z A;  4R7C A;  2Z3Y A;  4ZHQ B;  4GKK B;  5FL7 G;  4PI2 A;  4ZI7 B;  1IBM B;  1N32 B;  4YY3 O;  3CCU V;  1JR9 A;  1VQN V;  3C3T A;  2DN9 A;  3RFR A;  1XDC A;  1M93 A;  2YI9 A;  4H0L B;  3RYI A;  3K9S A;  1TUE B;  3OGI B;  5JH7 B;  4JI2 B;  5KA6 A;  3BRC A;  3B77 A;  4TV8 B;  3VQX A;  5E1A C;  4MTF A;  1GN6 A;  1VQK V;  1Y74 A;  4P2Z A;  1L0N H;  3ML0 A;  5L3C A;  3OW2 U;  1TVK B;  1YCI A;  2CAZ C;  1LUW A;  4JI1 O;  4FFB A;  4JPR A;  4J41 A;  3A2F A;  4B3S B;  1KP2 A;  1NKD A;  1R3J C;  4LWS B;  1FYJ A;  1UPG A;  3DXR A;  3CRM A;  4IYH A;  3E89 A;  5EC1 C;  1MA1 A;  5LOV B;  1HNZ O;  2LGW A;  3OD4 A;  3ETG A;  3P3P A;  2X0L A;  3B2E E;  2YS8 A;  4JYA O;  1HW7 A;  1H2L A;  1AP5 A;  2QGN A;  5F2V O;  1MG1 A;  1OCZ B;  1T5E A;  1DK1 A;  1IBK B;  1S76 D;  1I5X A;  2BOB C;  4TV8 A;  4U7O A;  4FM2 A;  3JCU Z;  3UT5 B;  1K34 A;  5BZB A;  3CD6 V;  1Q82 W;  4LF5 B;  1MAB G;  1OJH A;  1FPO A;  1N33 O;  5GON A;  3ZED A;  1H8E G;  3ZHQ A;  4R6Z A;  1TVK A;  4X1K B;  2R72 A;  2F1M A;  4JI3 O;  4DR6 O;  4KUM A;  1WB8 A;  1Q86 W;  4WFB V;  4B3T O;  4WFH A;  1GM7 A;  5LHI A;  3RVZ A;  3JAT A;  4O4I B;  1QLE B;  5LOV A;  4LFB O;  1VQ9 V;  2UUA B;  2ZT9 B;  1V54 C;  2ADP A;  2PY5 A;  1M9N A;  2M6Y A;  1GM9 A;  1W0K G;  3ZMZ A;  5CN0 A;  4X65 O;  4PDL A;  3I55 V;  4DV0 O;  3HB3 B;  4WCE V;  3JD2 A;  1MOF A;  3LUT B;  4X89 A;  4TT3 G;  4J80 A;  1N0J A;  3AG2 C;  2P67 A;  3UT5 A;  4WFG A;  2MW2 B;  3L73 H;  1EZJ A;  2GDS A;  4X1K A;  2XAF A;  4FM1 A;  2ZIN A;  5LHH A;  2Q69 A;  5EBM C;  1SQG A;  5K1P A;  2EIK C;  3U10 A;  4LFC B;  3M8A A;  4O4I A;  4FPP A;  4F6R B;  3D36 C;  5EZY A;  2BSK B;  1V54 B;  2H3O A;  2QM7 A;  3JAW A;  1XHX A;  3CWB H;  1JQ0 A;  2IH1 C;  3BFR A;  2NLJ C;  2IJJ A;  2OTL V;  1DGS A;  4IL6 Z;  2CTP A;  3CCQ V;  1E79 G;  1OV9 A;  2XAG A;  5IE9 A;  1XNR O;  4ZBM A;  4ABM A;  4LFA B;  3AG2 B;  4R50 A;  3ZIA G;  4FMT A;  1WNS A;  4MVM A;  1DF5 A;  4DW1 A;  2VQE O;  4LF8 O;  4GX1 A;  3ETD A;  2LW7 A;  1SES A;  1SRY A;  2UXN A;  3AK2 A;  3LSU A;  3GWO A;  1N34 O;  2R70 A;  4CS3 A;  5EIB D;  3ABU A;  4CH5 A;  1D5N A;  3L71 H;  4JI4 O;  2E75 B;  1YJ9 V;  4F6R A;  2WLL B;  4EFE A;  2K9P A;  4UCR A;  3TK1 A;  2BSK A;  2KB1 A;  2BTQ B;  4NB5 A;  5JJN B;  3AG4 C;  4QE7 A;  3TXS A;  4MTO A;  2JDI G;  2GBO A;  4FIP C;  1M90 W;  1NVP D;  3SPJ A;  4IIJ B;  4NKG B;  1Q7Y W;  1QHT A;  1G8M A;  1JCH A;  3M99 B;  4DV5 B;  3CCR V;  4FK5 C;  3D3I A;  1K9M W;  4JAA A;  2WA3 A;  2DJV A;  1G6U A;  3H1I H;  1VQM V;  3FB7 C;  3CME V;  5KHG A;  2QWO B;  3RW0 A;  1NH2 D;  1TGO A;  1XNQ B;  4CS2 A;  1AP6 A;  4RO2 A;  4QE9 A;  5B1O A;  3CC2 V;  3FB8 C;  5IYB O;  5LGN A;  5CB4 B;  2HFE C;  1JX9 A;  4J7Z A;  5TIS Z;  2MK3 A;  2Q7E A;  2L35 A;  4TQD A;  2PYL A;  4D6T H;  4J9Y B;  3UKM A;  3W7U A;  5KHI A;  3ZRW B;  1XI1 A;  2CGO A;  3ABL C;  2LFR A;  3F7Y C;  1F4M A;  2HVK C;  1EN5 A;  1SQV H;  4MVU A;  4BIU A;  1G4Y B;  3D36 A;  4DXW A;  3JAL B;  2RDC A;  4FLZ A;  2JJ1 G;  4IIJ A;  2HR3 A;  3AG4 B;  4TUY A;  3ZJZ A;  3ASN C;  4CZZ A;  2FYU H;  3CCE V;  3T4D A;  3KG2 A;  1XL4 A;  2Q68 A;  4RQE A;  4XDJ A;  4K8Z A;  4UV9 A;  2DYS B;  2CGN A;  4NR1 A;  3OM3 B;  4LF5 O;  1GMG A;  3EXA A;  3BCC H;  4WBN B;  2RN9 A;  2ITD C;  4PDV A;  2UXX A;  5CB4 A;  2OCC C;  2GSM B;  1MSD A;  3BEH A;  1PV0 A;  5L3B A;  2D2C B;  1IXB A;  2IU3 A;  2LGQ A;  5B1B C;  3ZRW A;  1BSM A;  1RP3 B;  4DUZ B;  2E74 B;  2YIB A;  3BA8 A;  3WFV A;  1H38 A;  4DV7 B;  2Y69 C;  3JAK B;  1MZF A;  1M57 C;  4PDM A;  1FXV A;  1BCC H;  1YHQ V;  3K06 A;  1WP8 A;  1WAZ A;  1PL0 A;  4X8A A;  3ASN B;  4HBN A;  5B66 Z;  1K7D A;  2ZE6 A;  4PJ0 Z;  4MVZ A;  1GN4 A;  4OX9 O;  3FB6 C;  4KXR A;  4G28 B;  3STL C;  5IYZ B;  3OGC C;  3CEI A;  2P7T C;  3LDC A;  1VQ5 V;  2PTM A;  2Y4T A;  2UUB B;  3JD0 A;  1VQ7 V;  2OCC B;  3AK3 A;  5KX5 B;  3G67 A;  5CA1 B;  5LYJ B;  4HNA B;  5JQG B;  5FPO A;  3ABK B;  1SER A;  2JVD A;  5B1B B;  3E8H A;  3PJS K;  1WPB A;  3IFX A;  3J81 N;  1KQS U;  4X64 O;  3CB2 A;  2Y69 B;  2F4V B;  1Q6U A;  3C90 A;  4WFA V;  1HNX B;  4H44 B;  4X1Y A;  2ZR2 A;  2Q0A A;  3CC4 V;  1EM1 A;  5B1A B;  3OMN B;  4DV1 O;  4FLT A;  1SC5 B;  4O2A B;  2EJ7 A;  4GKJ O;  3MDS A;  2PI5 A;  5IYZ A;  4OPA A;  5B1N A;  1Q90 D;  3FYI B;  3ZMS A;  3VBB A;  2E76 B;  4NTW A;  4PHZ A;  5KAF Z;  2KQX A;  2YEV A;  5KMG B;  4PV1 B;  5CA1 A;  4LF7 O;  2CH7 B;  2UXC O;  5LYJ A;  3DTU B;  2YIA A;  5JQG A;  1VP7 A;  3RGB A;  2RJZ A;  1KP3 A;  5D5P A;  1NTM H;  5IT9 N;  1GK9 A;  2ZM6 O;  4KP4 A;  1XOU A;  3D3Q A;  1F23 A;  1VQO V;  1L8D A;  4A5U B;  3ABT A;  4JI5 B;  3RYF B;  5DN6 G;  4DR2 O;  3WB1 A;  4DR3 O;  2HP8 A;  2HG5 C;  4LCU C;  4O2A A;  4I50 B;  4GX0 A;  1SA0 B;  5JVD B;  2UU9 B;  4DV6 B;  1M56 C;  4DV4 O;  2Z0A A;  2P06 A;  4J7K A;  1HNW B;  3H01 A;  4GCZ A;  4JYB A;  1NU1 H;  4PA4 A;  4GT1 A;  2CH7 A;  2XUM A;  5IWA B;  4OXS A;  3WB0 A;  1FFX B;  2R9A A;  2FB5 A;  2YIC A;  3BAA A;  1VF7 A;  5A9G A;  3E8B A;  4MS2 A;  4CC6 A;  1X4T A;  2IBZ H;  1YTF B;  3RYF A;  5LMN B;  1VQL V;  3RVY A;  5JWP A;  1VQP V;  1PNK A;  1SA0 A;  1WP7 A;  5JVD A;  2D3O W;  4DR4 O;  4PA3 A;  1FXK B;  1SQF A;  1YF2 A;  2LFS A;  4DV3 O;  1P49 A;  2ARH A;  1I0H A;  4FLW A;  1PP9 H;  5IY5 B;  3G80 A;  2EIJ C;  2NR5 A;  3ZS8 C;  1N36 O;  1W2B U;  4C7U A;  2N04 A;  2QDO A;  1GAX A;  1QR8 A;  5BR8 O;  3AG1 B;  4WFF A;  4FLU A;  1HR0 O;  4JI8 O;  4JZG A;  3FKS G;  1J5E B;  3JAS B;  4J9Z B;  2F95 B;  3JSL A;  2CE4 A;  2ZR3 A;  3FAV B;  3N27 A;  3RT3 C;  2HHH B;  1Z5W A;  1L1F A;  5L3F A;  4JI0 B;  2VS0 A;  4E2L A;  1BMF G;  4EEQ A;  2IJI A;  2VQF B;  3N2K A;  3R66 A;  1AVM A;  1PM9 A;  2WSS G;  5EC2 C;  4ASU G;  3RYH B;  5KUK A;  5DM6 V;  4W4L A;  1P4R A;  5GW7 A;  3ZX6 A;  3Q4H B;  1FJG O;  2EIJ B;  1IX9 A;  2LP7 A;  3SPG A;  2O57 A;  1OCZ C;  4CH6 A;  3CHX A;  4ZOL B;  5LMU B;  3KCY A;  4X66 O;  2A06 H;  3AG3 C;  3JAS A; 
#chains in the Genus database with same CATH homology
 2L35 A;  4NTY A;  4FZ1 A;  1WP8 A;  4NTX A;  3S3W A;  4NTW A;  3N27 A;  3S3X A;  1WP7 A;  3IJ4 A;  2QTS A;  4FZ0 A;  2FB5 A;  4NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...