2QTSA

Structure of an acid-sensing ion channel 1 at 1.9 a resolution and low ph
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
417
structure length
417
Chain Sequence
b'LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel
publication title Structure of acid-sensing ion channel 1 at 1.9A resolution and low pH
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 110
structure length 417
sequence length 417
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 2qtsA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 2qtsA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 2qtsA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 2qtsA02
4NTXA 3IJ4A 4NTYA 3S3XA 4NYKA 4NTWA 3S3WA 2L35A 1WP7A 4FZ1A 1WP8A 2FB5A 4FZ0A 3N27A 2QTSA
chains in the Genus database with same CATH superfamily
3QO7A 3CJHB 1YTFD 1KMIZ 4YY3O 4R50A 5DM6V 1PPJH 2EIKC 3B8NA 3CYOA 5L3FA 1BQ0A 4DUZO 1M56B 3HB3B 3ZHTA 1Y74A 3FYIB 4PDMA 1R1BA 2EX3A 1SZXA 2JEUA 3ZIAG 3ZHUA 2DWDC 2P90A 4HZ3A 4RAIA 3LDDA 1DGSA 1KQSU 2AZ0A 1P84F 4BIZA 3OMAB 3ASNB 2Y69C 3N2KA 1TGOA 2UUAO 1XL4A 1KP3A 4YHHO 3AG1C 5BZBA 4CZZA 4LF9O 2EZPA 1JVMA 4ICGA 4KUMA 5KX5A 4I4TB 1CP9A 4O2BB 4FLTA 1K97A 1N4CA 5KHKA 2WAMA 2BSKA 2W0FC 4O4HA 4GCZA 1Q81W 4DW1A 3K5LA 5BXZA 5LP6A 2P06A 4LF4B 3K5OA 1AJPA 5BY1A 4RO2A 5FPOA 2UU9B 2Q7HA 3OTOB 4R8CA 3SGIA 2DE0X 4JTDB 3QF7A 1E79G 4DW0A 1FXVA 3ABLB 4ZIBA 4DR2O 2ZINA 2OCHA 1N33B 3HKCA 2KB1A 4U3JA 1COWG 1JR9A 1NTKH 3CRMA 1VEWA 2Y4TA 4X62B 5IWAO 2PUSA 3W7TA 1EBOA 2XAHA 3CWBH 3MHHC 4X65O 2M6YA 4DR3B 4B3RB 3G71V 3ZMUA 2HP8A 4TSFG 3CPWU 2DYSC 1KU9A 4LCUC 5LA6B 4ZI7B 2VQFO 3HKDB 1JJ2U 2ZQMA 3CSXA 3K0DA 5JH7A 4GUNA 1GMGA 1ZL8A 2E74B 1M4UA 1OCRB 4NVPA 2WLHA 3ABKC 1IDSA 3TXQA 1FYJA 4BAYA 1QQCA 3L70H 1H2SB 1K34A 1N34O 5JWPA 2HJFC 1EZJA 2QDOA 4KHPO 1FXKA 4DV6O 5JQGB 5LYJB 2G38A 2VS0A 4TUYB 2XASA 1PD3A 4FM1A 2ZE6A 2N05A 1PNLA 5IE9A 1YSCA 4ZBMA 2QE7G 4X66B 1KKCA 4MW8A 4J7ZA 5CBHA 4B7KA 4TQDA 4JYYA 1Y66A 3IC7A 1SQBH 1P7GA 5B5EZ 2R9IA 2ARHA 3AG2C 1AR5A 2R9RB 3FB8C 3JD2A 5L3BA 1OCZB 2HVKC 2OCCB 1J5EO 3H1JH 1XHXA 5B1AC 5KAIZ 3ZMVA 4JI8O 3M7MX 1FJGO 1N36O 4E4EA 1XUQA 4WFFA 5FNVB 3B2EE 3JSLA 3MHSC 4H37A 3JAMN 2CK3G 1R3JC 4UV9A 4QE9A 2WSSG 3K08A 4UCOA 2CH7B 4I4TA 1EM1A 4DRXB 5IJ9B 5CA0B 3F7VC 1YEWA 1UFIA 4BR6A 1XREA 1GN2A 3APQA 1R6TA 2XUMA 2QM4A 1XI1A 2QTSA 2CUGA 2WLIB 3THOA 1DF4A 1O9GA 2UXDO 1CEZA 2AHZA 3BRCA 4RWUA 3OD4A 4P2ZA 2YIAA 3HKEB 2QSAA 4CS4A 4JAAA 4MVUA 4DV1O 4X64B 2B5UA 5B3SB 1AILA 5JCOA 1VQ4V 1HP8A 3CX5F 4J80A 4WFHA 4W4KA 2KKWA 2WLMA 3P3PA 2B1IA 2V7QG 1MMMA 2RJZA 4X1YB 5LGTA 2XNDG 4PA7A 1M1KW 4LFCB 5LA6A 4ZI7A 3RBZA 3HKDA 1V55C 3JAWB 5EK0A 3FAVB 2M7WA 3ZRXA 4AI8A 4DV2B 2QWNB 3IJ4A 4JYAB 3IAYA 1XILA 3SPIA 2JEXA 4LNUA 1H2LA 3G6BA 2C2AA 3ZRVA 5LHHA 3DC6A 3E8GA 5HFLA 4R6ZA 3GB7C 5L3EA 3EHBB 3CC7V 4DR5B 3ZEDA 3K06A 2OWOA 3CMAV 4CBCA 4DK0A 1K8AW 5LYJA 2IH1C 4TUYA 5LBQA 4GYCB 2Q5ZA 4NXMO 5EBLC 4FJCC 1KUQA 3CCLV 1GO3F 2A9HA 3B4SA 3P30A 3E8FA 4MTOA 3LSQA 3JASB 2QM8A 2EULA 3LUTB 1IXBA 5LMNB 3H01A 3ETGA 4DR7B 3B40A 4JI4O 5GONB 3ABMC 1TUEB 2ATKC 1W2BU 4O4LB 2VQEO 1KB9F 4F6RB 4IIJB 2LP7A 1FPOA 2H3OA 1MZEA 2R9AA 3K3WA 1Y4MA 2JRIA 4KL1A 3OGCC 3OGIB 2OT5A 2QJ1A 3OR6C 2CTPA 1QR8A 4LF5O 1S77D 5KHHA 3P32A 5FNVA 4G28B 4DUYB 1OZ0A 1YHQV 5EBMC 5H2FZ 3KCYA 3JD4A 4JF3A 1PL0A 4KFMA 4EB6B 1DLBA 3SJAC 4J42A 4PI2A 4K0KB 4WFAV 3BCCH 5EZYB 1SQVH 2CH7A 1GN6A 2A06H 2KSDA 4RUFA 4DRXA 5IJ9A 5CA0A 1XNQB 3RYCB 5K1PA 1P7BA 5CBGA 3OE7G 3JATB 2XAQA 3SJCC 3NR7A 2Q7GA 3PN1A 1WB7A 3W7SA 1BZKA 2YIBD 3DXRB 3K9AA 2WLIA 1ENVA 3BAAA 3HKEA 3UO3A 4B08A 4FIPC 3LNNA 4X1KB 4JI3O 1XMQB 1HW7A 1QLNA 1PL4A 1UPGA 2EJ7A 1AR1B 4TQFA 2ILMA 1Q82W 1FFXB 1ROPA 3M8AA 4FZ0A 4JI5B 3K5MA 4X1YA 3ASOB 2IJHA 2QWPB 1CPYA 5IY5C 3ZMSA 3L74H 5B1BB 1IBLO 2H8PC 3IGAC 1VF6A 3FAVA 2IU3A 1NH2B 4QPJA 3T1HO 3D8CA 3HR0A 3FB7C 1KC8W 4AQYB 3CC4V 1QR9A 3I5DA 3T1YO 4W4LA 1OCCC 1XHZA 1G6UA 5KMGB 3AG4B 4XDJA 3RVYA 1QLEB 4PDLA 4DR4B 1XBLA 3CRQA 3JAKB 3OTFA 4WF9V 3CXCU 4XDLA 3CXHF 4WFEA 1UJWB 2A3QA 1S5JA 4UCRA 2OTLV 4DV4O 2RDCA 1WN7A 3JASA 3TGUH 2HR3A 4I0XB 1G8MA 5LMUB 4JI7O 1YJWV 1P4RA 5GONA 4QJFB 4IYIA 1HNZB 1V54C 2EBOA 4X20B 4U3FH 3EXAA 3E83A 2ZR3A 4O4LA 5GW7A 4F6RA 3N27A 4UB6Z 1XMOB 4IIJA 2UXCO 4OX9B 2UUCB 5J2TB 2Z3YA 1HNXO 1WJZA 5DECA 4J10A 4J9ZB 4LFBO 2QKCA 1NBMG 3K0GA 2JS3A 4ASUG 3J80N 2PY5A 4EB6A 1JQ0A 2F4VO 3OUSA 2ODMA 3AG1B 2DMXA 5EC1C 2P4KA 5EZYA 2PF4E 3U10A 5LL6Y 3UO2A 2N74A 5J2UB 1B6QA 2X0LA 4UVBA 1LUWA 3ZJZA 2YC0A 2NN4A 4CC5A 2VRZA 4GX5A 2YIDA 4P9PA 3JATA 2ZDIC 2W6IG 1I0HA 5H9CA 1N32O 1I7FA 2QWQB 2ADPA 1DTOA 3DXRA 3APOA 4CH3A 5LGUA 4NTXA 4LFAO 3ZHRA 1GM8A 1R6KA 1YTFB 2NLJC 1K5QA 2AW9A 4LH7A 5IYBO 1L0NH 1OCOB 2XT9A 5LP6C 2CAZC 5KA6A 3OMNB 3UT5B 1G1XB 4JASA 4MVOA 1AP5A 1M57B 4X9QA 4X89A 4B3TO 3OW2U 1K4DC 2DN9A 4NTYA 2ZE5A 3ETQA 4D7SA 4BW5A 2EINC 4I9WA 4B3SO 3WU2Z 2LGQA 4U7OA 2HKOA 4H44B 3ABKB 1HNWB 4OGQB 4JZGA 4DV5B 1GM7A 5H6RA 2F1MA 3TETA 5CMUA 3CE2A 4LH6A 2P7TC 2PYJA 5JJNB 4LF8O 2Q8VA 3Q4HB 1YI2V 4JI0O 1NKDA 4BWAA 1IBMO 5KMGA 4GKJB 4WFGA 2UXBB 4BW9A 3QNEA 2HHHO 4CC6A 2ZT9B 4DR1B 4MTXA 3JAKA 5JVDB 3RYFB 2K1EA 3HKBB 3VQVA 1SERA 1RPOA 4JI1O 1FXKC 4JI6O 2OIEA 4RQFA 3A8TA 1RP3B 2FYUH 1G4YB 1KD1W 4I0XA 4ZHQB 1VMGA 1SC5B 1NR1A 4NB5A 1SQXH 3QG5A 4I50B 2VWKA 4X20A 1IVSA 2F66C 1V9PA 2RN9A 1EN5A 2HEPA 1Q8IA 4LF6B 1NQTA 3CD6V 2OYQA 3AG2B 3B77A 3E35A 3K79A 5IT9N 1M56C 1OHHG 5BR8O 1QCEA 4NYKA 5GTIZ 5J2TA 3H1HH 5L3GA 1X4TA 1D2DA 5L3DA 4O2AB 3DC5A 3CCEV 4DV0O 1LR1A 4UVAA 1I5YA 1N0JA 4G2KA 4UFZA 1Z5WA 3BA9A 3JARA 2ADQB 5IJ0B 5ITZB 3ASNC 1VQPV 5J2UA 2FB5A 3R66A 3TXSA 1AI7A 1M9NA 1RSOB 2YXLA 1YZBA 3VOUA 2CTQA 4TWKA 3CJHA 3RN4A 3J7AU 3K04A 3FYEB 3SPJA 2D2CB 2IH3C 3L72H 3RFRA 4I7ZB 4D6TH 1ZTEA 1QNMA 4B3MO 4GKKB 1TA8A 4ZKIA 1WAZA 2L35A 3U0ZA 4HYOA 3F7YC 3UT5A 4K3AA 3OMIB 3EFFK 1NT2B 3OEHG 1VQ9V 1K33A 2QM7A 4JGSA 4FLUA 2P67A 4HAMA 1GRJA 5EBWC 1VQOV 3G80A 3SDLA 4XDKA 4JYCA 4UUJC 5JCOC 2EIMB 2XAFA 1MG1A 2JIZG 4UXNA 1YDXA 5C93A 4AHCA 1FXHA 1FFTB 1OV9A 2YICA 1JPXA 3SPGA 3CHXA 5EIBC 4AQYO 4NXNB 1GN4A 2E5LB 1BE3H 1JFFB 2IU0A 5IYZB 2DYRC 3PJSK 4OPAA 4LF7O 2CTRA 3FB5C 4HBNA 1SESA 2AHYA 1BT8A 1U96A 4QNHB 4DV3O 4O2BA 3RW0A 3E22B 1H2NA 2X6CA 2HJDA 3Q4HA 1I94O 1OCRC 4LWSB 3ZBHA 1VQ5V 3SPCA 3T1CA 3IFXA 2ZNIA 3OT7A 4WFBV 2BTOA 5JVDA 3WG7B 1EFRG 1F4MA 3RYFA 3E2EA 3I55V 2GDSA 2YEVB 1SQFA 1K3EA 1K92A 1W59A 3STZC 4JZ2A 4ZHQA 1RM1B 2BOCC 4I50A 1N8RW 3CC2V 1K7DA 3KCXA 3ABMB 4WBNB 1K9MW 1HDJA 1VF7A 2Z0AA 2F95B 3BVOA 5LGNA 2XHBA 3ML0A 4DV7B 2WPDG 2Q73A 4MS2A 3WB0A 5HFMA 4DUZB 2L6LA 4GX0A 4O2AA 1DK1A 2QGNA 1S3JA 3R65A 1OCZC 2LW1A 2OCCC 2DQ0A 3IC9A 5FL7G 3C3TA 1R3LC 5IJ0A 2W6JG 3LSSA 5ITZA 1W0JG 1NS1A 5DEDA 1L0LH 2YSUB 4X8AA 3CCSV 1J95A 4JV5O 4FLXA 1A32A 1ZWIC 3BFRA 3BHPA 5JQGA 1RSOA 3BEHA 2UUAB 1Z2GA 4YHHB 1F7YA 2EILB 2D3OW 2PI5A 1SQGA 3FKSG 1PV0A 4LF9B 2Q9LA 1SQPH 5KUMA 3U11A 2BOBC 2LO1A 3OM3B 4UCUA 2IM9A 4FZ1A 1I5XA 3VBBA 4MTFA 3UQ8A 3ZS8C 4FM2A 2PZSA 1SETA 3OEEG 2IJIA 1KKDA 1B04A 3JCZA 5B3SC 1D5AA 2IBZH 3GWKC 4J9YB 2OIGA 1JMKC 4MSWC 4AILC 4LC1A 5IY5B 4DR2B 5E79Z 1VIBA 1W0KG 5L3CA 1EN4A 1Q7YW 1AROP 5IWAB 3JALB 1VQ8V 1JFFA 5IYZA 2CE4A 3SYOA 4X65B 2YXHA 5KAFZ 1NVPD 4JAUA 4Z2WA 1JCHA 3D3IA 4JAVA 1ZAUA 1PNMA 4HNAB 3L9DA 1VF6C 1Q3EA 3P3NA 1AI6A 2R72A 1WLEA 2Q0OC 3DSQA 3UCSC 2VQFB 4LWSA 2EIJB 1XNRB 1OCCB 5CA1B 3H1KH 4LF4O 1M90W 3L75H 2UU9O 3OTOO 3SYAA 1S5HC 1BGYH 2YEVA 4UB8Z 5JJEB 4RUEA 1N33O 2JDIG 2ZIMA 3AK1A 2V1DA 1AJNA 1GKFA 4X62O 4KHPB 1PM9A 3BABA 4F6EA 4DV6B 4GT1A 4OPHA 4DR3O 4B3RO 2PGGA 1K4CC 4H13B 4J7KA 4YIOA 1AR4A 2JGDB 4C7UA 5BMVB 2MW2B 2Q68A 1MOFA 4I55B 2HG5C 2QKSA 3TK1A 2W0XA 4PELA 5EC2C 4FLZA 2LFSA 2QKAA 3ZMTA 1L1FA 3S3WA 1MA1A 3QO8A 4R7CA 4JI2B 3JAWA 2Q69A 3BY6A 3M99B 1M5IA 4P30A 4DO2A 3AG3B 3E89A 2Q67A 4H0LB 4NR1A 5DN6G 2LFRA 5FPRA 3A2FA 5KA5A 4TV8B 3MAQA 1AI4A 1YIJV 3LDEA 4JI8B 2WWWA 1R6NA 3CRRA 1FJGB 2UUBB 2YDEA 1N36B 5E1AC 4GZRB 2ZXWB 2QWOB 4X66O 1BMFG 1ZLZA 3D36A 1B3QA 3WB1A 4UV8A 1H8EG 4PDVA 2IJJA 5B1OA 2EIKB 4PI0A 2QEXV 2O57A 1YJ9V 4NTWA 3CCUV 2Q0AA 1BQZA 1VP7A 5CN0A 2PI4A 1Q6UA 4YXWG 1F4NA 5A2QN 4DR6B 3SYPA 1IBKB 3FB6C 2WA4A 3B8MA 1U97A 3G4SV 4J7JA 4NXNO 1Q6IA 2GTAA 2VWJA 4DV1B 1PNKA 4FMTA 4A5UB 4L87A 2Y69B 1F51A 1O9HA 2ITDC 3CCRV 3ASOC 3JALA 3VQXA 1H2KA 1R3KC 5CB4B 2FTKA 3ZRWB 5B1BC 4TV9B 1VQLV 3OUFA 1AP6A 1SZTA 3AG7A 1AJQA 1SQQH 3X2QC 2E3CA 1S0VA 2ZR2A 3RYCA 3OAAG 1YVWA 1WB8A 3JCUZ 1MABG 1VQ6V 3RYHB 1NTZH 1DF5A 1QHTA 4CH5A 5C8YB 3AG4C 2ZCEA 2X7RB 4X64O 2JVDA 1QLEC 3JD3A 1WPBA 4CH4A 1US6A 4N21A 2F23A 2YIBA 4X1KA 2ETNA 1FKAO 2F93B 4O4IB 4IL6Z 1S72V 4NXMB 2WLJA 1FFXA 4LFCO 4DV7O 2JGDA 2ITCC 5BMVA 1KP2A 4GLXA 4QPKA 4I55A 1WP8A 5KLVH 4FLYA 4X1IB 2LW7A 1FAFA 2DYSB 4DV2O 5J9PC 4JYAO 4JI4B 2JJ1G 2GSMB 3AK3A 4EFEA 4PA6A 2P22C 1H8HG 2VQEB 2ZIOA 2GUZB 3CB2A 2P4VA 2XAJA 4DR5O 1THZA 5LOVB 4UVCA 4TV8A 2DW4A 2Y48A 3CMEV 4LF5B 5FLXN 1YF2A 4F4LA 1VQ7V 1VQMV 1JX9A 5TISZ 3D3QA 1Y76B 1QBZA 1URFA 3OFNG 3ETEA 3ZN0A 3STLC 2FL4A 4CS2A 2ZDIA 4MTGA 5LMNO 3CCMV 3L71H 1TAEA 1KECA 4DR7O 2UXXA 1TVKB 1SS3A 1L8DA 2CGOA 3CEIA 2PYLA 1YCIA 1YITV 4OXSA 1BHAA 2AGAA 5H5NA 1NJIW 2DWEC 4I9QA 4PV1B 1NU1H 4WCEV 1BS3A 2Y0PA 3BA8A 1WA8B 1OCOC 3FX7A 4YJ2B 2QR4A 2RQ6A 1IZ3A 1Y6XA 4DUYO 5EIBD 1M57C 5B1AB 3AEIA 4X88A 2JK5C 4JI3B 4Q6GA 2ZE7A 2BE3A 1HR0B 2ZM6B 4K0KO 4K8XA 3FD9A 1GK9A 5KUKA 4FM0A 1R73A 1Y67A 5CB4A 2DYRB 1AB3A 3W7UA 3ZRWA 4JYBA 3DTUB 1Z5VA 3SJBC 1Q5OA 4MVRA 5GTHZ 1XNQO 4TV9A 2Z5UA 1XNRO 1KBHA 4UCTA 3FFQA 1MZFA 5H6QA 1GN3A 3UM7A 4ABMA 4MT8A 1NZ6A 2FKXA 4LNUB 1IBLB 1OJHA 4LBEC 2AXTZ 1MSDA 3T1HB 5AG2A 3RYHA 2V4DA 5C8YA 1XMQO 3E8BA 3T1YB 4TT3G 4YJ3B 3L73H 4FFKA 3JD1A 2AZ2A 3O65A 4ZOLB 2H94A 4O4JB 4PA3A 5IDJA 4JI5O 1K73W 4O4IA 1XL6A 2GBOA 1WP7A 2PTMA 3CCVV 5D5QA 3SYQA 3ABLC 2RMKB 3G67A 4MVZA 1S76D 1PKXA 2CTWA 4DV4B 4JI2O 4X1IA 4NKGB 3LSUA 1ZSPA 3H1IH 3JYCA 4U7NA 4FFBB 4JI7B 3WFVA 3QO5A 1V55B 4QGPA 1JA8A 4Z1MG 2LJ2A 4RQEA 2GUZA 3ZCCA 1N0NA 3LNMB 2UXCB 5LOVA 2UUBO 4DR4O 1HNXB 2RCVA 1YJNV 2Y0IA 2JS5A 4LFBB 4PA9A 1YXBA 2N04A 5IYCO 2EJRA 4H33A 4CH6A 4LP8A 1Y76A 5B66Z 1GH6A 3E86A 4Q20A 3HKBA 2F4VB 3G6EV 3SR2C 4N23A 5LMUO 4EKWA 3VQYA 2OTJV 2CDYA 1E1RG 1TVKA 1TUBB 3LDCA 3EVKA 1HNZO 1NTMH 3VQWA 1XMOO 1P49A 3ZMZA 5KHIA 2QA4V 3C90A 4OX9O 2UUCO 4MW3A 2E75B 4YY3B 1N32B 2B9ZA 4DR6O 1IBKO 4J11A 2YI9A 1WA8A 2YS8A 3K9SA 3A0RA 4YJ2A 4LFAB 2HFEC 3E8HA 2P6JA 4BIUA 1IXMA 3CRAA 2WLNA 5LHGA 2EIMC 1H38A 2CGNA 4B3TB 2IJKA 3J81N 3RYIB 2B1GA 2KG7B 5CBFA 2GV9A 3BPZA 4MVMA 1RPRA 1QU7A 3C3SA 3T4ZA 4GX2A 2P5OA 1BCCH 4IGGA 1MSWD 4QE7A 1FS0G 3KG2A 4B3SB 2A0LA 2JGUA 3A0HZ 1BL8A 2Y4UA 3AK2A 5LXTB 1E1QG 1EN6A 5EYPB 2F43G 4LF8B 1EZVH 4MVQA 4YJ3A 3WG7C 3K57A 4FLVA 4JI0B 1IBMB 4ZOLA 4O4JA 3JSNA 2HHHB 4IT5A 2A79B 2Q7EA 1XEQA 5JJJB 3N2GB 4IHJB 1I08A 2DQ3A 4FLWA 3RT3C 2WLLB 3TJTA 1Q90D 1RM1C 4JI1B 4JI6B 3RVZA 3CCJV 2WLKA 1JOYA 2DJVA 1WNSA 1Q6HA 1QVGU 4FFBA 1R3IC 1NI8A 1SA0B 2IW5A 2X6BA 2XTAA 4FPPA 4KXRA 1HNWO 2NR5A 4DV5O 2GHYA 1WPXA 4XBFA 5KHJA 2GTSA 4P9OA 5BR8B 3ZN1A 4GKJO 2UXBO 2BTQB 1VF5B 2K9PA 3E22A 1NVPB 3A0BZ 4PHZA 4DR1O 4K8ZA 5CA3A 4DK1A 3QTCA 4PDRA 1QVFU 5KHGA 3K59A 4DV0B 3ZRSA 4EEQA 4I5SA 3ZHQA 2FMLA 2ZKOA 1SKVA 2RNBA 4DYLA 2YXYA 3NXSA 1LNQA 3OR7C 1N34B 5D5PA 3K5NA 3JD0A 3GWOA 3S3XA 1PP9H 1TUBA 2EILC 2YUAA 3D36C 2NNUA 2JJ2G 4BIOA 4LF6O 1T5EA 1IURA 2UXNA 3MDSA 3O9OA 4WBNA 2XOKG 1GAXA 1XDCA 1V54B 1LUVA 1AI5A 4PD4F 3H1LH 1ORQC 1ZX3A 4YIPA 2YI8A 4QIWF 4JPRA 1HWYA 1B06A 3SYCA 1VARA 1Y74B 2MK3A 1AVMA 1HR0O 2BCCH 2ZM6O 4B3MB 2WA3A 3F5WC 2ZD9A 3W7WA 1IX9A 3ICXA 3CP1A 4UCSA 5B1NA 3K03A 3CRCA 4FK5C 5F2VO 3WB2A 1MNGA 4JTCB 4TOIA 3KZIZ 4K35A 1NH2D 3SPHA 1NR7A 1Q43A 4IYHA 4PJ0Z 1J5EB 3ABTA 4B7EA 3RYIA 4CS3A 1GM9A 3N2KB 3GVMA 2KG7A 1XOUA 1D5NA 1KYOF 2QTOA 3H9VA 3CCQV 3X2QB 3HPLC 3TCUA 1BHBA 2R70A 5KX5B 2X6AA 3SJQC 4LF7B 2E76B 4MVSA 4GKKO 2EIJC 4LR3A 2BSKB 4O4HB 5LXTA 1M93A 1SRYA 3QVNA 4DV3B 5EYPA 1VQKV 2EZOA 1I94B 2QWRB 1S5LZ 1CXZB 1XQ8A 3T2MA 5LP6B 3ZHSA 1VQNV 4FVMA 1RFYA 3W7XA 4DXWA 3ABUA 2LQTA 4GX1A 1FD9A 1ZUQA 3N2GA 3KKYA 4IHJA 4KP4A 3RWRD 3F5TA 2KQXA 5LHIA 2WLLA 2DOSA 4JTAB 1X59A 2UXDB 1K5SA 3HKCB 1H2GA 4L8JA 4U3JB 2ZE8A 3UKMA 2E5LO 4D7TA 1SA0A 2EINB 2HVJC 1F23A 4UCVA 1GTOA 2ZNJA 3B09A 4HNAA 2Q6AA 1H2MA 2XAGA 4PA4A 2A7WA 2BTQA 5JH7B 2HLDG 4EFBA 1ZL8B 3AG3C 3ZX6A 5CA1A 3K58A 3ETDA 1BSMA 3T4DA 3JARB 5IYDO 1JJOA 1SF9A 2LGWA 2Q4PA 4G27B 3ZHVA 4E2LA 5K1XA 5A9GA 1FXKB 3MD0A 3DGEA 2ZXWC 1Q86W 3CS5A 4J41A 4JV5B 4Z1VA 3I56V 3RGBA
chains in the Genus database with same CATH topology
4NTXA 3IJ4A 4NTYA 3S3XA 4NYKA 4NTWA 3S3WA 2L35A 1WP7A 4FZ1A 1WP8A 2FB5A 4FZ0A 3N27A 2QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTX A;  3IJ4 A;  4NTY A;  3S3X A;  4NYK A;  4NTW A;  3S3W A;  2L35 A;  1WP7 A;  4FZ1 A;  1WP8 A;  2FB5 A;  4FZ0 A;  3N27 A;  2QTS A; 
#chains in the Genus database with same CATH topology
 3QO7 A;  3CJH B;  1YTF D;  1KMI Z;  4YY3 O;  4R50 A;  5DM6 V;  1PPJ H;  2EIK C;  3B8N A;  3CYO A;  5L3F A;  1BQ0 A;  4DUZ O;  1M56 B;  3HB3 B;  3ZHT A;  1Y74 A;  3FYI B;  4PDM A;  1R1B A;  2EX3 A;  1SZX A;  2JEU A;  3ZIA G;  3ZHU A;  2DWD C;  2P90 A;  4HZ3 A;  4RAI A;  3LDD A;  1DGS A;  1KQS U;  2AZ0 A;  1P84 F;  4BIZ A;  3OMA B;  3ASN B;  2Y69 C;  3N2K A;  1TGO A;  2UUA O;  1XL4 A;  1KP3 A;  4YHH O;  3AG1 C;  5BZB A;  4CZZ A;  4LF9 O;  2EZP A;  1JVM A;  4ICG A;  4KUM A;  5KX5 A;  4I4T B;  1CP9 A;  4O2B B;  4FLT A;  1K97 A;  1N4C A;  5KHK A;  2WAM A;  2BSK A;  2W0F C;  4O4H A;  4GCZ A;  1Q81 W;  4DW1 A;  3K5L A;  5BXZ A;  5LP6 A;  2P06 A;  4LF4 B;  3K5O A;  1AJP A;  5BY1 A;  4RO2 A;  5FPO A;  2UU9 B;  2Q7H A;  3OTO B;  4R8C A;  3SGI A;  2DE0 X;  4JTD B;  3QF7 A;  1E79 G;  4DW0 A;  1FXV A;  3ABL B;  4ZIB A;  4DR2 O;  2ZIN A;  2OCH A;  1N33 B;  3HKC A;  2KB1 A;  4U3J A;  1COW G;  1JR9 A;  1NTK H;  3CRM A;  1VEW A;  2Y4T A;  4X62 B;  5IWA O;  2PUS A;  3W7T A;  1EBO A;  2XAH A;  3CWB H;  3MHH C;  4X65 O;  2M6Y A;  4DR3 B;  4B3R B;  3G71 V;  3ZMU A;  2HP8 A;  4TSF G;  3CPW U;  2DYS C;  1KU9 A;  4LCU C;  5LA6 B;  4ZI7 B;  2VQF O;  3HKD B;  1JJ2 U;  2ZQM A;  3CSX A;  3K0D A;  5JH7 A;  4GUN A;  1GMG A;  1ZL8 A;  2E74 B;  1M4U A;  1OCR B;  4NVP A;  2WLH A;  3ABK C;  1IDS A;  3TXQ A;  1FYJ A;  4BAY A;  1QQC A;  3L70 H;  1H2S B;  1K34 A;  1N34 O;  5JWP A;  2HJF C;  1EZJ A;  2QDO A;  4KHP O;  1FXK A;  4DV6 O;  5JQG B;  5LYJ B;  2G38 A;  2VS0 A;  4TUY B;  2XAS A;  1PD3 A;  4FM1 A;  2ZE6 A;  2N05 A;  1PNL A;  5IE9 A;  1YSC A;  4ZBM A;  2QE7 G;  4X66 B;  1KKC A;  4MW8 A;  4J7Z A;  5CBH A;  4B7K A;  4TQD A;  4JYY A;  1Y66 A;  3IC7 A;  1SQB H;  1P7G A;  5B5E Z;  2R9I A;  2ARH A;  3AG2 C;  1AR5 A;  2R9R B;  3FB8 C;  3JD2 A;  5L3B A;  1OCZ B;  2HVK C;  2OCC B;  1J5E O;  3H1J H;  1XHX A;  5B1A C;  5KAI Z;  3ZMV A;  4JI8 O;  3M7M X;  1FJG O;  1N36 O;  4E4E A;  1XUQ A;  4WFF A;  5FNV B;  3B2E E;  3JSL A;  3MHS C;  4H37 A;  3JAM N;  2CK3 G;  1R3J C;  4UV9 A;  4QE9 A;  2WSS G;  3K08 A;  4UCO A;  2CH7 B;  4I4T A;  1EM1 A;  4DRX B;  5IJ9 B;  5CA0 B;  3F7V C;  1YEW A;  1UFI A;  4BR6 A;  1XRE A;  1GN2 A;  3APQ A;  1R6T A;  2XUM A;  2QM4 A;  1XI1 A;  2QTS A;  2CUG A;  2WLI B;  3THO A;  1DF4 A;  1O9G A;  2UXD O;  1CEZ A;  2AHZ A;  3BRC A;  4RWU A;  3OD4 A;  4P2Z A;  2YIA A;  3HKE B;  2QSA A;  4CS4 A;  4JAA A;  4MVU A;  4DV1 O;  4X64 B;  2B5U A;  5B3S B;  1AIL A;  5JCO A;  1VQ4 V;  1HP8 A;  3CX5 F;  4J80 A;  4WFH A;  4W4K A;  2KKW A;  2WLM A;  3P3P A;  2B1I A;  2V7Q G;  1MMM A;  2RJZ A;  4X1Y B;  5LGT A;  2XND G;  4PA7 A;  1M1K W;  4LFC B;  5LA6 A;  4ZI7 A;  3RBZ A;  3HKD A;  1V55 C;  3JAW B;  5EK0 A;  3FAV B;  2M7W A;  3ZRX A;  4AI8 A;  4DV2 B;  2QWN B;  3IJ4 A;  4JYA B;  3IAY A;  1XIL A;  3SPI A;  2JEX A;  4LNU A;  1H2L A;  3G6B A;  2C2A A;  3ZRV A;  5LHH A;  3DC6 A;  3E8G A;  5HFL A;  4R6Z A;  3GB7 C;  5L3E A;  3EHB B;  3CC7 V;  4DR5 B;  3ZED A;  3K06 A;  2OWO A;  3CMA V;  4CBC A;  4DK0 A;  1K8A W;  5LYJ A;  2IH1 C;  4TUY A;  5LBQ A;  4GYC B;  2Q5Z A;  4NXM O;  5EBL C;  4FJC C;  1KUQ A;  3CCL V;  1GO3 F;  2A9H A;  3B4S A;  3P30 A;  3E8F A;  4MTO A;  3LSQ A;  3JAS B;  2QM8 A;  2EUL A;  3LUT B;  1IXB A;  5LMN B;  3H01 A;  3ETG A;  4DR7 B;  3B40 A;  4JI4 O;  5GON B;  3ABM C;  1TUE B;  2ATK C;  1W2B U;  4O4L B;  2VQE O;  1KB9 F;  4F6R B;  4IIJ B;  2LP7 A;  1FPO A;  2H3O A;  1MZE A;  2R9A A;  3K3W A;  1Y4M A;  2JRI A;  4KL1 A;  3OGC C;  3OGI B;  2OT5 A;  2QJ1 A;  3OR6 C;  2CTP A;  1QR8 A;  4LF5 O;  1S77 D;  5KHH A;  3P32 A;  5FNV A;  4G28 B;  4DUY B;  1OZ0 A;  1YHQ V;  5EBM C;  5H2F Z;  3KCY A;  3JD4 A;  4JF3 A;  1PL0 A;  4KFM A;  4EB6 B;  1DLB A;  3SJA C;  4J42 A;  4PI2 A;  4K0K B;  4WFA V;  3BCC H;  5EZY B;  1SQV H;  2CH7 A;  1GN6 A;  2A06 H;  2KSD A;  4RUF A;  4DRX A;  5IJ9 A;  5CA0 A;  1XNQ B;  3RYC B;  5K1P A;  1P7B A;  5CBG A;  3OE7 G;  3JAT B;  2XAQ A;  3SJC C;  3NR7 A;  2Q7G A;  3PN1 A;  1WB7 A;  3W7S A;  1BZK A;  2YIB D;  3DXR B;  3K9A A;  2WLI A;  1ENV A;  3BAA A;  3HKE A;  3UO3 A;  4B08 A;  4FIP C;  3LNN A;  4X1K B;  4JI3 O;  1XMQ B;  1HW7 A;  1QLN A;  1PL4 A;  1UPG A;  2EJ7 A;  1AR1 B;  4TQF A;  2ILM A;  1Q82 W;  1FFX B;  1ROP A;  3M8A A;  4FZ0 A;  4JI5 B;  3K5M A;  4X1Y A;  3ASO B;  2IJH A;  2QWP B;  1CPY A;  5IY5 C;  3ZMS A;  3L74 H;  5B1B B;  1IBL O;  2H8P C;  3IGA C;  1VF6 A;  3FAV A;  2IU3 A;  1NH2 B;  4QPJ A;  3T1H O;  3D8C A;  3HR0 A;  3FB7 C;  1KC8 W;  4AQY B;  3CC4 V;  1QR9 A;  3I5D A;  3T1Y O;  4W4L A;  1OCC C;  1XHZ A;  1G6U A;  5KMG B;  3AG4 B;  4XDJ A;  3RVY A;  1QLE B;  4PDL A;  4DR4 B;  1XBL A;  3CRQ A;  3JAK B;  3OTF A;  4WF9 V;  3CXC U;  4XDL A;  3CXH F;  4WFE A;  1UJW B;  2A3Q A;  1S5J A;  4UCR A;  2OTL V;  4DV4 O;  2RDC A;  1WN7 A;  3JAS A;  3TGU H;  2HR3 A;  4I0X B;  1G8M A;  5LMU B;  4JI7 O;  1YJW V;  1P4R A;  5GON A;  4QJF B;  4IYI A;  1HNZ B;  1V54 C;  2EBO A;  4X20 B;  4U3F H;  3EXA A;  3E83 A;  2ZR3 A;  4O4L A;  5GW7 A;  4F6R A;  3N27 A;  4UB6 Z;  1XMO B;  4IIJ A;  2UXC O;  4OX9 B;  2UUC B;  5J2T B;  2Z3Y A;  1HNX O;  1WJZ A;  5DEC A;  4J10 A;  4J9Z B;  4LFB O;  2QKC A;  1NBM G;  3K0G A;  2JS3 A;  4ASU G;  3J80 N;  2PY5 A;  4EB6 A;  1JQ0 A;  2F4V O;  3OUS A;  2ODM A;  3AG1 B;  2DMX A;  5EC1 C;  2P4K A;  5EZY A;  2PF4 E;  3U10 A;  5LL6 Y;  3UO2 A;  2N74 A;  5J2U B;  1B6Q A;  2X0L A;  4UVB A;  1LUW A;  3ZJZ A;  2YC0 A;  2NN4 A;  4CC5 A;  2VRZ A;  4GX5 A;  2YID A;  4P9P A;  3JAT A;  2ZDI C;  2W6I G;  1I0H A;  5H9C A;  1N32 O;  1I7F A;  2QWQ B;  2ADP A;  1DTO A;  3DXR A;  3APO A;  4CH3 A;  5LGU A;  4NTX A;  4LFA O;  3ZHR A;  1GM8 A;  1R6K A;  1YTF B;  2NLJ C;  1K5Q A;  2AW9 A;  4LH7 A;  5IYB O;  1L0N H;  1OCO B;  2XT9 A;  5LP6 C;  2CAZ C;  5KA6 A;  3OMN B;  3UT5 B;  1G1X B;  4JAS A;  4MVO A;  1AP5 A;  1M57 B;  4X9Q A;  4X89 A;  4B3T O;  3OW2 U;  1K4D C;  2DN9 A;  4NTY A;  2ZE5 A;  3ETQ A;  4D7S A;  4BW5 A;  2EIN C;  4I9W A;  4B3S O;  3WU2 Z;  2LGQ A;  4U7O A;  2HKO A;  4H44 B;  3ABK B;  1HNW B;  4OGQ B;  4JZG A;  4DV5 B;  1GM7 A;  5H6R A;  2F1M A;  3TET A;  5CMU A;  3CE2 A;  4LH6 A;  2P7T C;  2PYJ A;  5JJN B;  4LF8 O;  2Q8V A;  3Q4H B;  1YI2 V;  4JI0 O;  1NKD A;  4BWA A;  1IBM O;  5KMG A;  4GKJ B;  4WFG A;  2UXB B;  4BW9 A;  3QNE A;  2HHH O;  4CC6 A;  2ZT9 B;  4DR1 B;  4MTX A;  3JAK A;  5JVD B;  3RYF B;  2K1E A;  3HKB B;  3VQV A;  1SER A;  1RPO A;  4JI1 O;  1FXK C;  4JI6 O;  2OIE A;  4RQF A;  3A8T A;  1RP3 B;  2FYU H;  1G4Y B;  1KD1 W;  4I0X A;  4ZHQ B;  1VMG A;  1SC5 B;  1NR1 A;  4NB5 A;  1SQX H;  3QG5 A;  4I50 B;  2VWK A;  4X20 A;  1IVS A;  2F66 C;  1V9P A;  2RN9 A;  1EN5 A;  2HEP A;  1Q8I A;  4LF6 B;  1NQT A;  3CD6 V;  2OYQ A;  3AG2 B;  3B77 A;  3E35 A;  3K79 A;  5IT9 N;  1M56 C;  1OHH G;  5BR8 O;  1QCE A;  4NYK A;  5GTI Z;  5J2T A;  3H1H H;  5L3G A;  1X4T A;  1D2D A;  5L3D A;  4O2A B;  3DC5 A;  3CCE V;  4DV0 O;  1LR1 A;  4UVA A;  1I5Y A;  1N0J A;  4G2K A;  4UFZ A;  1Z5W A;  3BA9 A;  3JAR A;  2ADQ B;  5IJ0 B;  5ITZ B;  3ASN C;  1VQP V;  5J2U A;  2FB5 A;  3R66 A;  3TXS A;  1AI7 A;  1M9N A;  1RSO B;  2YXL A;  1YZB A;  3VOU A;  2CTQ A;  4TWK A;  3CJH A;  3RN4 A;  3J7A U;  3K04 A;  3FYE B;  3SPJ A;  2D2C B;  2IH3 C;  3L72 H;  3RFR A;  4I7Z B;  4D6T H;  1ZTE A;  1QNM A;  4B3M O;  4GKK B;  1TA8 A;  4ZKI A;  1WAZ A;  2L35 A;  3U0Z A;  4HYO A;  3F7Y C;  3UT5 A;  4K3A A;  3OMI B;  3EFF K;  1NT2 B;  3OEH G;  1VQ9 V;  1K33 A;  2QM7 A;  4JGS A;  4FLU A;  2P67 A;  4HAM A;  1GRJ A;  5EBW C;  1VQO V;  3G80 A;  3SDL A;  4XDK A;  4JYC A;  4UUJ C;  5JCO C;  2EIM B;  2XAF A;  1MG1 A;  2JIZ G;  4UXN A;  1YDX A;  5C93 A;  4AHC A;  1FXH A;  1FFT B;  1OV9 A;  2YIC A;  1JPX A;  3SPG A;  3CHX A;  5EIB C;  4AQY O;  4NXN B;  1GN4 A;  2E5L B;  1BE3 H;  1JFF B;  2IU0 A;  5IYZ B;  2DYR C;  3PJS K;  4OPA A;  4LF7 O;  2CTR A;  3FB5 C;  4HBN A;  1SES A;  2AHY A;  1BT8 A;  1U96 A;  4QNH B;  4DV3 O;  4O2B A;  3RW0 A;  3E22 B;  1H2N A;  2X6C A;  2HJD A;  3Q4H A;  1I94 O;  1OCR C;  4LWS B;  3ZBH A;  1VQ5 V;  3SPC A;  3T1C A;  3IFX A;  2ZNI A;  3OT7 A;  4WFB V;  2BTO A;  5JVD A;  3WG7 B;  1EFR G;  1F4M A;  3RYF A;  3E2E A;  3I55 V;  2GDS A;  2YEV B;  1SQF A;  1K3E A;  1K92 A;  1W59 A;  3STZ C;  4JZ2 A;  4ZHQ A;  1RM1 B;  2BOC C;  4I50 A;  1N8R W;  3CC2 V;  1K7D A;  3KCX A;  3ABM B;  4WBN B;  1K9M W;  1HDJ A;  1VF7 A;  2Z0A A;  2F95 B;  3BVO A;  5LGN A;  2XHB A;  3ML0 A;  4DV7 B;  2WPD G;  2Q73 A;  4MS2 A;  3WB0 A;  5HFM A;  4DUZ B;  2L6L A;  4GX0 A;  4O2A A;  1DK1 A;  2QGN A;  1S3J A;  3R65 A;  1OCZ C;  2LW1 A;  2OCC C;  2DQ0 A;  3IC9 A;  5FL7 G;  3C3T A;  1R3L C;  5IJ0 A;  2W6J G;  3LSS A;  5ITZ A;  1W0J G;  1NS1 A;  5DED A;  1L0L H;  2YSU B;  4X8A A;  3CCS V;  1J95 A;  4JV5 O;  4FLX A;  1A32 A;  1ZWI C;  3BFR A;  3BHP A;  5JQG A;  1RSO A;  3BEH A;  2UUA B;  1Z2G A;  4YHH B;  1F7Y A;  2EIL B;  2D3O W;  2PI5 A;  1SQG A;  3FKS G;  1PV0 A;  4LF9 B;  2Q9L A;  1SQP H;  5KUM A;  3U11 A;  2BOB C;  2LO1 A;  3OM3 B;  4UCU A;  2IM9 A;  4FZ1 A;  1I5X A;  3VBB A;  4MTF A;  3UQ8 A;  3ZS8 C;  4FM2 A;  2PZS A;  1SET A;  3OEE G;  2IJI A;  1KKD A;  1B04 A;  3JCZ A;  5B3S C;  1D5A A;  2IBZ H;  3GWK C;  4J9Y B;  2OIG A;  1JMK C;  4MSW C;  4AIL C;  4LC1 A;  5IY5 B;  4DR2 B;  5E79 Z;  1VIB A;  1W0K G;  5L3C A;  1EN4 A;  1Q7Y W;  1ARO P;  5IWA B;  3JAL B;  1VQ8 V;  1JFF A;  5IYZ A;  2CE4 A;  3SYO A;  4X65 B;  2YXH A;  5KAF Z;  1NVP D;  4JAU A;  4Z2W A;  1JCH A;  3D3I A;  4JAV A;  1ZAU A;  1PNM A;  4HNA B;  3L9D A;  1VF6 C;  1Q3E A;  3P3N A;  1AI6 A;  2R72 A;  1WLE A;  2Q0O C;  3DSQ A;  3UCS C;  2VQF B;  4LWS A;  2EIJ B;  1XNR B;  1OCC B;  5CA1 B;  3H1K H;  4LF4 O;  1M90 W;  3L75 H;  2UU9 O;  3OTO O;  3SYA A;  1S5H C;  1BGY H;  2YEV A;  4UB8 Z;  5JJE B;  4RUE A;  1N33 O;  2JDI G;  2ZIM A;  3AK1 A;  2V1D A;  1AJN A;  1GKF A;  4X62 O;  4KHP B;  1PM9 A;  3BAB A;  4F6E A;  4DV6 B;  4GT1 A;  4OPH A;  4DR3 O;  4B3R O;  2PGG A;  1K4C C;  4H13 B;  4J7K A;  4YIO A;  1AR4 A;  2JGD B;  4C7U A;  5BMV B;  2MW2 B;  2Q68 A;  1MOF A;  4I55 B;  2HG5 C;  2QKS A;  3TK1 A;  2W0X A;  4PEL A;  5EC2 C;  4FLZ A;  2LFS A;  2QKA A;  3ZMT A;  1L1F A;  3S3W A;  1MA1 A;  3QO8 A;  4R7C A;  4JI2 B;  3JAW A;  2Q69 A;  3BY6 A;  3M99 B;  1M5I A;  4P30 A;  4DO2 A;  3AG3 B;  3E89 A;  2Q67 A;  4H0L B;  4NR1 A;  5DN6 G;  2LFR A;  5FPR A;  3A2F A;  5KA5 A;  4TV8 B;  3MAQ A;  1AI4 A;  1YIJ V;  3LDE A;  4JI8 B;  2WWW A;  1R6N A;  3CRR A;  1FJG B;  2UUB B;  2YDE A;  1N36 B;  5E1A C;  4GZR B;  2ZXW B;  2QWO B;  4X66 O;  1BMF G;  1ZLZ A;  3D36 A;  1B3Q A;  3WB1 A;  4UV8 A;  1H8E G;  4PDV A;  2IJJ A;  5B1O A;  2EIK B;  4PI0 A;  2QEX V;  2O57 A;  1YJ9 V;  4NTW A;  3CCU V;  2Q0A A;  1BQZ A;  1VP7 A;  5CN0 A;  2PI4 A;  1Q6U A;  4YXW G;  1F4N A;  5A2Q N;  4DR6 B;  3SYP A;  1IBK B;  3FB6 C;  2WA4 A;  3B8M A;  1U97 A;  3G4S V;  4J7J A;  4NXN O;  1Q6I A;  2GTA A;  2VWJ A;  4DV1 B;  1PNK A;  4FMT A;  4A5U B;  4L87 A;  2Y69 B;  1F51 A;  1O9H A;  2ITD C;  3CCR V;  3ASO C;  3JAL A;  3VQX A;  1H2K A;  1R3K C;  5CB4 B;  2FTK A;  3ZRW B;  5B1B C;  4TV9 B;  1VQL V;  3OUF A;  1AP6 A;  1SZT A;  3AG7 A;  1AJQ A;  1SQQ H;  3X2Q C;  2E3C A;  1S0V A;  2ZR2 A;  3RYC A;  3OAA G;  1YVW A;  1WB8 A;  3JCU Z;  1MAB G;  1VQ6 V;  3RYH B;  1NTZ H;  1DF5 A;  1QHT A;  4CH5 A;  5C8Y B;  3AG4 C;  2ZCE A;  2X7R B;  4X64 O;  2JVD A;  1QLE C;  3JD3 A;  1WPB A;  4CH4 A;  1US6 A;  4N21 A;  2F23 A;  2YIB A;  4X1K A;  2ETN A;  1FKA O;  2F93 B;  4O4I B;  4IL6 Z;  1S72 V;  4NXM B;  2WLJ A;  1FFX A;  4LFC O;  4DV7 O;  2JGD A;  2ITC C;  5BMV A;  1KP2 A;  4GLX A;  4QPK A;  4I55 A;  1WP8 A;  5KLV H;  4FLY A;  4X1I B;  2LW7 A;  1FAF A;  2DYS B;  4DV2 O;  5J9P C;  4JYA O;  4JI4 B;  2JJ1 G;  2GSM B;  3AK3 A;  4EFE A;  4PA6 A;  2P22 C;  1H8H G;  2VQE B;  2ZIO A;  2GUZ B;  3CB2 A;  2P4V A;  2XAJ A;  4DR5 O;  1THZ A;  5LOV B;  4UVC A;  4TV8 A;  2DW4 A;  2Y48 A;  3CME V;  4LF5 B;  5FLX N;  1YF2 A;  4F4L A;  1VQ7 V;  1VQM V;  1JX9 A;  5TIS Z;  3D3Q A;  1Y76 B;  1QBZ A;  1URF A;  3OFN G;  3ETE A;  3ZN0 A;  3STL C;  2FL4 A;  4CS2 A;  2ZDI A;  4MTG A;  5LMN O;  3CCM V;  3L71 H;  1TAE A;  1KEC A;  4DR7 O;  2UXX A;  1TVK B;  1SS3 A;  1L8D A;  2CGO A;  3CEI A;  2PYL A;  1YCI A;  1YIT V;  4OXS A;  1BHA A;  2AGA A;  5H5N A;  1NJI W;  2DWE C;  4I9Q A;  4PV1 B;  1NU1 H;  4WCE V;  1BS3 A;  2Y0P A;  3BA8 A;  1WA8 B;  1OCO C;  3FX7 A;  4YJ2 B;  2QR4 A;  2RQ6 A;  1IZ3 A;  1Y6X A;  4DUY O;  5EIB D;  1M57 C;  5B1A B;  3AEI A;  4X88 A;  2JK5 C;  4JI3 B;  4Q6G A;  2ZE7 A;  2BE3 A;  1HR0 B;  2ZM6 B;  4K0K O;  4K8X A;  3FD9 A;  1GK9 A;  5KUK A;  4FM0 A;  1R73 A;  1Y67 A;  5CB4 A;  2DYR B;  1AB3 A;  3W7U A;  3ZRW A;  4JYB A;  3DTU B;  1Z5V A;  3SJB C;  1Q5O A;  4MVR A;  5GTH Z;  1XNQ O;  4TV9 A;  2Z5U A;  1XNR O;  1KBH A;  4UCT A;  3FFQ A;  1MZF A;  5H6Q A;  1GN3 A;  3UM7 A;  4ABM A;  4MT8 A;  1NZ6 A;  2FKX A;  4LNU B;  1IBL B;  1OJH A;  4LBE C;  2AXT Z;  1MSD A;  3T1H B;  5AG2 A;  3RYH A;  2V4D A;  5C8Y A;  1XMQ O;  3E8B A;  3T1Y B;  4TT3 G;  4YJ3 B;  3L73 H;  4FFK A;  3JD1 A;  2AZ2 A;  3O65 A;  4ZOL B;  2H94 A;  4O4J B;  4PA3 A;  5IDJ A;  4JI5 O;  1K73 W;  4O4I A;  1XL6 A;  2GBO A;  1WP7 A;  2PTM A;  3CCV V;  5D5Q A;  3SYQ A;  3ABL C;  2RMK B;  3G67 A;  4MVZ A;  1S76 D;  1PKX A;  2CTW A;  4DV4 B;  4JI2 O;  4X1I A;  4NKG B;  3LSU A;  1ZSP A;  3H1I H;  3JYC A;  4U7N A;  4FFB B;  4JI7 B;  3WFV A;  3QO5 A;  1V55 B;  4QGP A;  1JA8 A;  4Z1M G;  2LJ2 A;  4RQE A;  2GUZ A;  3ZCC A;  1N0N A;  3LNM B;  2UXC B;  5LOV A;  2UUB O;  4DR4 O;  1HNX B;  2RCV A;  1YJN V;  2Y0I A;  2JS5 A;  4LFB B;  4PA9 A;  1YXB A;  2N04 A;  5IYC O;  2EJR A;  4H33 A;  4CH6 A;  4LP8 A;  1Y76 A;  5B66 Z;  1GH6 A;  3E86 A;  4Q20 A;  3HKB A;  2F4V B;  3G6E V;  3SR2 C;  4N23 A;  5LMU O;  4EKW A;  3VQY A;  2OTJ V;  2CDY A;  1E1R G;  1TVK A;  1TUB B;  3LDC A;  3EVK A;  1HNZ O;  1NTM H;  3VQW A;  1XMO O;  1P49 A;  3ZMZ A;  5KHI A;  2QA4 V;  3C90 A;  4OX9 O;  2UUC O;  4MW3 A;  2E75 B;  4YY3 B;  1N32 B;  2B9Z A;  4DR6 O;  1IBK O;  4J11 A;  2YI9 A;  1WA8 A;  2YS8 A;  3K9S A;  3A0R A;  4YJ2 A;  4LFA B;  2HFE C;  3E8H A;  2P6J A;  4BIU A;  1IXM A;  3CRA A;  2WLN A;  5LHG A;  2EIM C;  1H38 A;  2CGN A;  4B3T B;  2IJK A;  3J81 N;  3RYI B;  2B1G A;  2KG7 B;  5CBF A;  2GV9 A;  3BPZ A;  4MVM A;  1RPR A;  1QU7 A;  3C3S A;  3T4Z A;  4GX2 A;  2P5O A;  1BCC H;  4IGG A;  1MSW D;  4QE7 A;  1FS0 G;  3KG2 A;  4B3S B;  2A0L A;  2JGU A;  3A0H Z;  1BL8 A;  2Y4U A;  3AK2 A;  5LXT B;  1E1Q G;  1EN6 A;  5EYP B;  2F43 G;  4LF8 B;  1EZV H;  4MVQ A;  4YJ3 A;  3WG7 C;  3K57 A;  4FLV A;  4JI0 B;  1IBM B;  4ZOL A;  4O4J A;  3JSN A;  2HHH B;  4IT5 A;  2A79 B;  2Q7E A;  1XEQ A;  5JJJ B;  3N2G B;  4IHJ B;  1I08 A;  2DQ3 A;  4FLW A;  3RT3 C;  2WLL B;  3TJT A;  1Q90 D;  1RM1 C;  4JI1 B;  4JI6 B;  3RVZ A;  3CCJ V;  2WLK A;  1JOY A;  2DJV A;  1WNS A;  1Q6H A;  1QVG U;  4FFB A;  1R3I C;  1NI8 A;  1SA0 B;  2IW5 A;  2X6B A;  2XTA A;  4FPP A;  4KXR A;  1HNW O;  2NR5 A;  4DV5 O;  2GHY A;  1WPX A;  4XBF A;  5KHJ A;  2GTS A;  4P9O A;  5BR8 B;  3ZN1 A;  4GKJ O;  2UXB O;  2BTQ B;  1VF5 B;  2K9P A;  3E22 A;  1NVP B;  3A0B Z;  4PHZ A;  4DR1 O;  4K8Z A;  5CA3 A;  4DK1 A;  3QTC A;  4PDR A;  1QVF U;  5KHG A;  3K59 A;  4DV0 B;  3ZRS A;  4EEQ A;  4I5S A;  3ZHQ A;  2FML A;  2ZKO A;  1SKV A;  2RNB A;  4DYL A;  2YXY A;  3NXS A;  1LNQ A;  3OR7 C;  1N34 B;  5D5P A;  3K5N A;  3JD0 A;  3GWO A;  3S3X A;  1PP9 H;  1TUB A;  2EIL C;  2YUA A;  3D36 C;  2NNU A;  2JJ2 G;  4BIO A;  4LF6 O;  1T5E A;  1IUR A;  2UXN A;  3MDS A;  3O9O A;  4WBN A;  2XOK G;  1GAX A;  1XDC A;  1V54 B;  1LUV A;  1AI5 A;  4PD4 F;  3H1L H;  1ORQ C;  1ZX3 A;  4YIP A;  2YI8 A;  4QIW F;  4JPR A;  1HWY A;  1B06 A;  3SYC A;  1VAR A;  1Y74 B;  2MK3 A;  1AVM A;  1HR0 O;  2BCC H;  2ZM6 O;  4B3M B;  2WA3 A;  3F5W C;  2ZD9 A;  3W7W A;  1IX9 A;  3ICX A;  3CP1 A;  4UCS A;  5B1N A;  3K03 A;  3CRC A;  4FK5 C;  5F2V O;  3WB2 A;  1MNG A;  4JTC B;  4TOI A;  3KZI Z;  4K35 A;  1NH2 D;  3SPH A;  1NR7 A;  1Q43 A;  4IYH A;  4PJ0 Z;  1J5E B;  3ABT A;  4B7E A;  3RYI A;  4CS3 A;  1GM9 A;  3N2K B;  3GVM A;  2KG7 A;  1XOU A;  1D5N A;  1KYO F;  2QTO A;  3H9V A;  3CCQ V;  3X2Q B;  3HPL C;  3TCU A;  1BHB A;  2R70 A;  5KX5 B;  2X6A A;  3SJQ C;  4LF7 B;  2E76 B;  4MVS A;  4GKK O;  2EIJ C;  4LR3 A;  2BSK B;  4O4H B;  5LXT A;  1M93 A;  1SRY A;  3QVN A;  4DV3 B;  5EYP A;  1VQK V;  2EZO A;  1I94 B;  2QWR B;  1S5L Z;  1CXZ B;  1XQ8 A;  3T2M A;  5LP6 B;  3ZHS A;  1VQN V;  4FVM A;  1RFY A;  3W7X A;  4DXW A;  3ABU A;  2LQT A;  4GX1 A;  1FD9 A;  1ZUQ A;  3N2G A;  3KKY A;  4IHJ A;  4KP4 A;  3RWR D;  3F5T A;  2KQX A;  5LHI A;  2WLL A;  2DOS A;  4JTA B;  1X59 A;  2UXD B;  1K5S A;  3HKC B;  1H2G A;  4L8J A;  4U3J B;  2ZE8 A;  3UKM A;  2E5L O;  4D7T A;  1SA0 A;  2EIN B;  2HVJ C;  1F23 A;  4UCV A;  1GTO A;  2ZNJ A;  3B09 A;  4HNA A;  2Q6A A;  1H2M A;  2XAG A;  4PA4 A;  2A7W A;  2BTQ A;  5JH7 B;  2HLD G;  4EFB A;  1ZL8 B;  3AG3 C;  3ZX6 A;  5CA1 A;  3K58 A;  3ETD A;  1BSM A;  3T4D A;  3JAR B;  5IYD O;  1JJO A;  1SF9 A;  2LGW A;  2Q4P A;  4G27 B;  3ZHV A;  4E2L A;  5K1X A;  5A9G A;  1FXK B;  3MD0 A;  3DGE A;  2ZXW C;  1Q86 W;  3CS5 A;  4J41 A;  4JV5 B;  4Z1V A;  3I56 V;  3RGB A; 
#chains in the Genus database with same CATH homology
 4NTX A;  3IJ4 A;  4NTY A;  3S3X A;  4NYK A;  4NTW A;  3S3W A;  2L35 A;  1WP7 A;  4FZ1 A;  1WP8 A;  2FB5 A;  4FZ0 A;  3N27 A;  2QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...