1UJWB

Structure of the complex between btub and colicin e3 receptor binding domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
116
structure length
116
Chain Sequence
YERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vitamin B12 receptor
publication title The structure of BtuB with bound colicin E3 R-domain implies a translocon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/hydrolase
total genus 46
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ujwB00
1JCHA 1UJWB 2YSUB 2B5UA
chains in the Genus database with same CATH superfamily
4JYBA 3ZHSA 3R66A 1AJPA 1BZKA 3CYOA 3JSNA 4I0XB 1AR1B 1Y4MA 2CTWA 1YIJV 2DYRB 2LW1A 4LH6A 2ZDIC 1M9NA 1XL4A 1DK1A 2XAGA 2DE0X 1GM9A 1NBMG 2DWDC 1M93A 2KSDA 4MW3A 2Q7HA 1XUQA 3WB1A 2ZKOA 2WSSG 1XHZA 4L87A 4P30A 2AW9A 1P49A 3K5MA 5JQGB 2R9RB 2YUAA 4PA9A 4X1YB 3ZX6A 5LOVA 4F6RA 5LHHA 4DV2O 4JASA 5EC1C 3ABLB 3DXRA 4J7KA 1FAFA 1BL8A 3KZIZ 3APQA 2QSAA 3OMIB 4I50B 2X6CA 3FFQA 1PNKA 1Q6IA 2JS3A 5LP6A 4DK1A 2B9ZA 2ARHA 5LXTA 5JVDA 1UPGA 2IJIA 2LJ2A 4MVZA 4DK0A 1OV9A 1XQ8A 4JI5O 4R50A 3RFRA 1VP7A 1ZL8A 5IWAO 1Y74A 5EIBD 1M90W 4JI1O 4X64O 4IIJA 3A8TA 2EIKB 4MVOA 3M99B 4GYCB 1I0HA 2XT9A 1OCCB 2QEXV 4MTOA 3ASOC 4OPAA 3TXQA 4MVMA 1BS3A 1QNMA 2VQEO 1VQ8V 1WLEA 3RN4A 3CCQV 2HHHO 2VWKA 2Y0IA 4J11A 2KKWA 5JJNB 5L3EA 3K58A 2ITCC 1HWYA 3AK2A 2YDEA 3FB8C 2QA4V 1R1BA 3B4SA 1H8HG 5CMUA 4FFBB 1NQTA 3DC6A 2Q9LA 5LOVB 3HKEA 3DXRB 3JASA 1P84F 4ZOLA 3U0ZA 4B3TB 1E79G 4DV3B 1Z2GA 1ZTEA 4I5SA 1YEWA 1SQVH 1QLNA 5FLXN 3ZRVA 2A9HA 2PGGA 4LNUA 3K04A 3D3IA 2W6IG 4LWSA 4DV1O 4LFBB 4JV5O 1NTZH 1N36O 2FL4A 2WLMA 5JCOA 1MZFA 1F7YA 1NTKH 3BRCA 1K5SA 1IX9A 1ZL8B 3ASNB 4TV9A 4BIZA 1OHHG 3E86A 1Y74B 2IH3C 2BOBC 3A2FA 1K73W 4PV1B 4JTDB 1AVMA 3OD4A 4IIJB 4X66B 2IJJA 1XNRO 5H6RA 2WLIA 2OCHA 2Q8VA 1K8AW 3AG3C 2WLHA 4JF3A 4XDJA 1PP9H 1YF2A 3H1LH 4JYYA 1U97A 2XAQA 1R6KA 1VQPV 3O65A 3ZRXA 1H38A 2UUBB 1N33B 3BY6A 2YI8A 2HJFC 4DV5B 4UCSA 1LUWA 3THOA 3P3PA 3JD3A 1Q90D 2MK3A 2HVJC 3K5NA 3JD1A 3HKEB 1GH6A 1E1QG 1YZBA 4ZOLB 2GBOA 5B1BC 3ZN0A 2BE3A 4X1IA 2KG7A 5GONB 3BHPA 1ZX3A 4JI3O 3KG2A 4LNUB 1VQ6V 2B1GA 3LDCA 2PI4A 5LA6A 1Q7YW 2ZIOA 1MSWD 3JCZA 5J2TB 2EZPA 3CB2A 3E8FA 4X65B 2DMXA 4LF7B 3JD0A 5IY5B 2ZM6O 1IBLB 5FPOA 2DYRC 4UV8A 4H37A 1W59A 1YTFB 4TV9B 4UCTA 2UUAO 1K3EA 1Q3EA 4CZZA 1M57B 4WF9V 2DQ0A 4YJ2A 2W0XA 5IWAB 4JI4B 4F6EA 5E79Z 2WLIB 4JI1B 4X64B 1FXHA 3DTUB 2WAMA 3CEIA 3ABLC 1VQ4V 5CA3A 3E83A 3F7VC 1GMGA 4UVAA 3K9SA 4CH3A 3K57A 2CE4A 1M1KW 2LFRA 4EEQA 2VQEB 3CCMV 4JAAA 3PJSK 2D3OW 1WPXA 4TQDA 4JI7B 2PZSA 3CCRV 1H2LA 5K1PA 1SF9A 1KB9F 4NXMB 2EIMC 5L3DA 1HR0O 1YXBA 1SQFA 4PA6A 5EK0A 3OGCC 3I55V 5EC2C 2Q69A 1BT8A 2Q4PA 4WFAV 1SESA 3M8AA 3UM7A 2EIKC 2KG7B 2Q6AA 2YXHA 3IFXA 4LFCB 2F93B 2H3OA 1P4RA 3C3TA 5LA6B 1OCCC 5CN0A 5LHGA 4EKWA 4O4LA 4RUEA 3BFRA 2OTJV 2LP7A 4JV5B 1VQNV 3JAKA 4U3JB 4H33A 3RBZA 4DV6O 1N36B 2X7RB 3OFNG 2JJ1G 4X62O 2UXBO 3IC7A 2QDOA 4B3MO 2Y4TA 3CCEV 3JAMN 4YJ2B 2ATKC 4X1KA 4DR6O 3MD0A 2WWWA 2BTOA 1CPYA 1EZJA 3TETA 4O4IA 5L3GA 4DUYO 4JI6O 3VQYA 3QF7A 4LR3A 1JX9A 2IJHA 2DYSB 1KU9A 1MSDA 2LW7A 2NR5A 3CC7V 3E8BA 4Q6GA 2BTQA 1AB3A 4J42A 5LP6C 5BY1A 2ZQMA 5FNVA 5C93A 4K8ZA 1TUEB 1YHQV 1OZ0A 2QWPB 4X8AA 1VQOV 1YTFD 1NS1A 5IYCO 3SPJA 1NJIW 1ROPA 4UCVA 3ASNC 3H01A 1L0LH 2IBZH 4WCEV 2F1MA 2CH7A 3ZN1A 3HKCA 3JSLA 1AP6A 4X9QA 4KUMA 4JGSA 3L70H 2CAZC 4JI3B 3AG4C 4O4LB 1HNXB 4OXSA 1QLEB 1FFTB 1SQXH 2ZM6B 1N8RW 4G28B 5KAFZ 1AI6A 3VQXA 1S72V 4GKJB 4JI8B 3G80A 4CC5A 4K3AA 4ZHQA 1HW7A 3CC4V 3ZHUA 4E4EA 4DV4O 3GWOA 1THZA 2OT5A 1V9PA 3A0RA 3ETEA 1AROP 5KHKA 2WLNA 5JH7A 1N0NA 2XASA 2QR4A 4NYKA 3JYCA 5LGUA 1Q8IA 2JDIG 4FPPA 2OYQA 2HLDG 1PD3A 2BTQB 1AI7A 3K5LA 3ZS8C 3RYFA 1G6UA 1G8MA 1I94B 1VQLV 5FNVB 4JZ2A 2XOKG 2Q73A 5IY5C 1TVKA 4HBNA 5JCOC 4ZKIA 1AP5A 2PTMA 1XI1A 1SETA 3WG7B 4IT5A 5CBHA 2V1DA 1N32B 4KHPB 4ICGA 3H1JH 4DR4B 1K4DC 1M57C 1VQKV 2QJ1A 3OMAB 1QVGU 4R8CA 4GX1A 2OCCC 2QGNA 3SPHA 3H9VA 3HKCB 1I08A 3JD4A 3CCUV 4CH5A 3ETGA 1RFYA 2JEXA 2PY5A 4DV3O 3RYCA 3QO8A 1QR8A 1J95A 2QE7G 3N27A 4RAIA 1UJWB 1K97A 3JD2A 4FLYA 2YICA 4IGGA 4DV7B 3ZMZA 2YEVA 4FM1A 4FZ0A 4TV8B 3FD9A 2P4VA 4ZHQB 3A0HZ 1RSOB 1PM9A 4J80A 3FB6C 4X62B 4QPJA 1JOYA 4MW8A 1ZSPA 2QM8A 4DR6B 3SYOA 4DW0A 5JH7B 3G4SV 2GTSA 4X66O 3VQVA 2NN4A 5B1BB 1HNWB 3E35A 3RYFB 4NXNB 2LFSA 4QPKA 4B08A 1TVKB 2A3QA 2YC0A 5L3CA 4H13B 1GKFA 3ABTA 2Y48A 1HNZB 2RJZA 4AHCA 3MDSA 4FJCC 4MVSA 2UUBO 1N33O 4O4HA 3EFFK 3E2EA 1KKCA 3JATA 2ZT9B 4DV5O 3TJTA 5CBFA 4LFAB 2C2AA 3N2KA 3QVNA 1K9MW 3JAWA 1S0VA 2JEUA 1SQQH 3K08A 3J80N 2ZIMA 1Q43A 4AI8A 1SA0A 1WP7A 2G38A 4CS2A 3NR7A 4QE7A 3RYCB 4IL6Z 2DYSC 3CMAV 3AG1B 1IURA 4BAYA 1Z5VA 2YSUB 2GUZB 3E89A 2YEVB 1FPOA 4X65O 4LF7O 1XDCA 1IBLO 3E22B 4GT1A 4X20A 5LMNB 2HP8A 3EXAA 4AQYO 4PHZA 5FPRA 2LGQA 1EM1A 4YY3B 4HNAA 1Y76B 4PDLA 2CTPA 2IU3A 4DV4B 4Z1MG 4TUYA 4FM2A 1Z5WA 4IYIA 2EIMB 2QWNB 1FKAO 4JI4O 5B5EZ 3CP1A 2Q0AA 5K1XA 4QIWF 2ADQB 2XAHA 2FMLA 5EBLC 1GTOA 4L8JA 1L0NH 2CTRA 1VQ9V 4MSWC 2BOCC 1QLEC 5C8YA 3W7UA 5EZYA 5KHJA 4LBEC 2ZR3A 3RGBA 3T1CA 4O4HB 4JI7O 4UB8Z 3JATB 3FAVA 3ABUA 4GKKB 5IDJA 2QKSA 3JAWB 3QO7A 4B7EA 3CPWU 4NXMO 3ZMVA 2QWOB 4ZI7A 1SA0B 2A06H 4FM0A 4F6RB 3K3WA 3UKMA 2UXNA 2ZE6A 3OTFA 2F95B 2GTAA 4LFCO 2H8PC 4UCRA 4FFKA 3WB2A 1RM1B 1S5JA 1RP3B 1AILA 4YHHB 2YIBA 4KXRA 1MMMA 4X20B 5LP6B 1LUVA 5LXTB 5JVDB 2E5LB 4YXWG 3K06A 4LF5O 1IZ3A 2OTLV 2UU9O 4H44B 3WG7C 1W2BU 4U7OA 1D2DA 1MOFA 3K0GA 4TUYB 3IC9A 1BSMA 3MHHC 5A2QN 4I55A 3FX7A 1CXZB 4JI2O 1VEWA 1Q5OA 3CS5A 3MAQA 3K5OA 4UXNA 4H0LB 4D7TA 3C3SA 2ILMA 2N04A 4GZRB 3RYHA 3LDDA 1JA8A 3AG4B 1KKDA 5C8YB 5EZYB 1X4TA 3J81N 2M7WA 3ETDA 2PYJA 3T1HO 1UFIA 3SPGA 3UCSC 3SGIA 3ZBHA 1L1FA 2UXDB 3RVZA 2CGOA 3FAVB 3OEHG 1EN5A 1ZAUA 2FYUH 5D5PA 4I9WA 4O2BA 1IBKO 2DOSA 1YVWA 4NB5A 4ZI7B 1GN3A 4N21A 2P5OA 3HKDA 3JASB 3CMEV 1B04A 2EX3A 4RO2A 3OT7A 4HAMA 3CHXA 1BE3H 1HNXO 5H2FZ 4LWSB 4NTYA 1SC5B 4WFBV 3ZHTA 2ZE5A 3B77A 1VF6A 1VF5B 4UFZA 4AQYB 5B1AB 4GKJO 4JI8O 2P6JA 1IXBA 1D5AA 4O4JA 3SPIA 1I7FA 2ZINA 3Q4HA 3R65A 3D8CA 3WU2Z 3JARA 1NR7A 4I55B 3I56V 5L3BA 3E8GA 2OCCB 4DRXA 2NLJC 2F23A 3HB3B 1G1XB 4J7ZA 3RYHB 1TUBA 2AZ0A 3G71V 3AG1C 2RQ6A 2ZXWB 4JAVA 4B3RO 1AJNA 1P7GA 1GM8A 1I94O 5L3FA 1QBZA 3ZJZA 1R73A 3KCYA 4I4TA 1YJ9V 4NKGB 2YIAA 1N4CA 3L74H 3SYQA 3W7XA 2GDSA 2IM9A 1KYOF 3NXSA 3H1HH 4QJFB 3ABKC 2FB5A 4O2BB 1N32O 1PL4A 3SPCA 4KHPO 1VARA 1B06A 4DR4O 1IBMB 1AR5A 1VQ5V 1WA8A 2CGNA 4UVCA 3HKDB 4X89A 1GAXA 5LGNA 1B3QA 1IXMA 4E2LA 3BVOA 4X1IB 4LCUC 1S5HC 4D7SA 3W7WA 2Y0PA 3U10A 3U11A 3IAYA 3J7AU 5KLVH 4B3SB 5IYZA 3CCVV 1NVPB 3E8HA 3RYIA 2NNUA 5ITZA 3FB7C 2HEPA 1S3JA 1Y6XA 4FLTA 4DV7O 4DV0B 3S3XA 4DUZB 1Y66A 3VOUA 1OCRC 1AR4A 4J9ZB 5LHIA 4LF5B 4MVUA 2UU9B 4O4JB 1RPOA 1FYJA 3UO2A 2P22C 5DM6V 2YXLA 3JARB 5B1OA 4MT8A 3TK1A 2WPDG 1FD9A 4DRXB 2JK5C 3OTOO 4JI2B 5H5NA 3L72H 1P7BA 1WP8A 1HNWO 1TUBB 1S76D 4DR3B 3EVKA 5IJ9A 5KHHA 4NXNO 1NZ6A 3RW0A 2WA4A 1OCOC 1RM1C 1S5LZ 4NTWA 2VWJA 1M56C 2W0FC 3OR6C 1VQMV 3FYEB 4WFGA 2R70A 3T1HB 1D5NA 1SQGA 4GX2A 1HNZO 2IH1C 4RQFA 5LMUO 4TQFA 3CRMA 1K92A 1AI5A 3OR7C 1DF5A 4YIPA 4Z2WA 1VF7A 3HKBA 4JYAO 1WA8B 3CRQA 1IBKB 1NH2B 1R3KC 4LFAO 4DR2B 2ZE8A 1WJZA 3AK3A 4Z1VA 3D36A 1K33A 2ITDC 3D3QA 3HPLC 5TISZ 1MA1A 1WNSA 5IYZB 3UQ8A 3B2EE 5KX5A 4LF8O 1FXKA 3B8NA 2QTSA 5ITZB 1US6A 1U96A 3BA9A 1MNGA 5BR8B 2HFEC 1M4UA 1Q6HA 2CTQA 3H1KH 1BQ0A 3ABMC 1EFRG 4KP4A 1ENVA 3CRCA 1V54B 3JAKB 1SQBH 1IDSA 5LMNO 3L71H 2UXCO 5IYBO 1CEZA 3GB7C 4PDRA 4BWAA 4LP8A 4YY3O 2F43G 1JQ0A 1FS0G 3BABA 4UCUA 4D6TH 4JYCA 5KHGA 1H2NA 4X1KB 4ZIBA 3ZRWA 2CDYA 1Q81W 4CBCA 4O4IB 3EHBB 3BEHA 3AG7A 4PDVA 4NR1A 5A9GA 1VQ7V 4U7NA 2UXXA 5DN6G 1G4YB 2QWQB 5IJ9B 1NVPD 1KMIZ 5EBWC 3OW2U 1BMFG 2DWEC 3BCCH 2E75B 1I5XA 4B3RB 2YXYA 1O9HA 2D2CB 4P2ZA 3TGUH 3ZMUA 1XMQO 4DR7O 1GK9A 5B1AC 1XNQB 4Q20A 3ZCCA 2Z5UA 3SR2C 2YI9A 3HKBB 4PDMA 3OM3B 4GKKO 3PN1A 1K4CC 2P4KA 1YITV 1GM7A 4LC1A 2Y69B 2VQFO 3VQWA 2AHZA 4YIOA 2CH7B 1SS3A 4F4LA 1PNLA 1COWG 4MTFA 3RT3C 4PA4A 2XUMA 5KX5B 2VS0A 1FXKB 2OWOA 1GRJA 3SJAC 5LYJA 2WA3A 3STZC 2ODMA 4MVRA 4G2KA 2ZXWC 3CD6V 1F23A 4YHHO 4QE9A 4OPHA 4N23A 3SYCA 2R9IA 4AILC 1Q6UA 3TXSA 4K35A 2Q68A 2BSKA 2E5LO 2FKXA 3B40A 4FVMA 3W7SA 3CRRA 1NH2D 2GHYA 3CCJV 2WLLA 4LF4O 1Q86W 4WFHA 3OTOB 4I9QA 2RDCA 3JALA 2EINB 2ETNA 3CXHF 5DECA 3L9DA 4IHJA 4FLUA 2QKCA 1YCIA 2KQXA 1WAZA 5JJJB 4PI0A 3UT5A 4R7CA 4TT3G 3A0BZ 4B7KA 4TSFG 2F66C 1NU1H 5LMUB 2UXDO 1TAEA 1F4MA 4DR1B 2W6JG 3K0DA 1R6NA 3FYIB 5GW7A 5CA1A 1M5IA 4ZBMA 1NKDA 4XDKA 4JYAB 1KECA 4FIPC 5HFLA 3LSSA 2ZNIA 3T1YB 1SQPH 5E1AC 4UB6Z 3OUFA 2E74B 5LYJB 1H2MA 1JJ2U 4LF8B 4PA7A 1XEQA 3MHSC 1JPXA 4HYOA 3ZHVA 1QCEA 3SJCC 1BQZA 4DW1A 2BSKB 4J41A 4IYHA 1OCZC 4FFBA 5CBGA 2UXCB 3F5TA 3APOA 2EIJB 5KA6A 4UVBA 5J2UA 3LNNA 1NT2B 2EZOA 1JR9A 3ABKB 1WN7A 4BW9A 1AI4A 2WLLB 5LGTA 3M7MX 3X2QB 2K9PA 3JALB 3F5WC 1PL0A 4LF6O 3P32A 3ZIAG 2ZR2A 1VIBA 4IHJB 5LL6Y 5IJ0A 1X59A 4GLXA 4DR5B 2X0LA 5B3SB 3UT5B 5CA0A 4DO2A 3OAAG 1SZTA 1XL6A 4K0KB 4GX5A 5J9PC 1V54C 3OEEG 1XMQB 2XHBA 4DR7B 5H9CA 1OCRB 2HG5C 1N34O 5CA1B 1DLBA 2OIGA 4LH7A 1YI2V 3IJ4A 1IBMO 2QM7A 3OMNB 3N2KB 1O9GA 3CSXA 2HKOA 3OE7G 2VQFB 3SYAA 2A7WA 4PI2A 4MVQA 3O9OA 4B3SO 1OCOB 3UO3A 1M56B 4J7JA 2Q67A 4UCOA 3ML0A 3ZHQA 3BPZA 2XAFA 4DV0O 3CCSV 4DUZO 1K7DA 1QQCA 5J2UB 2ZD9A 1XHXA 4HNAB 3F7YC 2DN9A 3T4DA 1V55C 2LQTA 5GONA 1J5EB 1BGYH 2PYLA 2X6AA 2JGUA 2LO1A 4OX9B 4G27B 3HR0A 1XMOB 2Y69C 4KL1A 4LF4B 4EB6A 2CUGA 3T4ZA 3KKYA 2HVKC 3D36C 2MW2B 5J2TA 4LF9O 1H8EG 1KP3A 2HR3A 5IJ0B 3LNMB 1FXKC 2PUSA 4JI0B 4DR3O 5CA0B 5BMVA 3ZEDA 3ABMB 5H6QA 3DGEA 1FJGO 1NR1A 1H2GA 3AG2B 2LGWA 5EIBC 1GN6A 3WB0A 2B1IA 1F51A 1URFA 5B1NA 2QM4A 4CH4A 1XOUA 2OIEA 3ZRSA 2UUCO 4J10A 1LR1A 2A79B 4DR2O 4FLVA 2EILB 2QWRB 5F2VO 2EINC 4QGPA 4O2AA 2H94A 3B8MA 1JJOA 2Q7GA 5BR8O 2IW5A 4CH6A 2DW4A 2KB1A 1GN4A 4JPRA 2JIZG 4UV9A 1EN4A 3CJHA 3RVYA 1EN6A 2YIDA 2JVDA 1ZUQA 1SZXA 2V7QG 1MZEA 2PI5A 3K03A 4PD4F 4DV2B 1JFFA 5JWPA 3DSQA 1WPBA 4ASUG 4QNHB 2GSMB 2N05A 4EB6B 3BAAA 5IT9N 2JJ2G 1L8DA 1XBLA 2ZNJA 4YJ3A 3N2GA 4FLZA 4LF6B 1FFXA 4CS3A 3P30A 4U3JA 1N0JA 2AHYA 1KQSU 2AXTZ 2HJDA 2L35A 5BMVB 2JGDA 5EBMC 2IJKA 2ZDIA 1DTOA 2RMKB 4HZ3A 4JI5B 3CRAA 1R3LC 4C7UA 1YDXA 1PPJH 4RQEA 2P67A 4CC6A 2EIJC 1N34B 4MTXA 1XNQO 1R3IC 2P90A 3W7TA 2JS5A 1H2SB 5EYPA 3CX5F 1W0JG 2N74A 2Z3YA 3X2QC 5KMGA 5IE9A 4J9YB 4O2AB 3IGAC 4W4LA 2B5UA 2X6BA 1QU7A 1MG1A 2HHHB 3KCXA 3BA8A 1Y67A 1ZWIC 2RCVA 3JCUZ 4XDLA 4P9PA 5B3SC 3B09A 2YS8A 1B6QA 1TGOA 2P06A 4WBNA 5KUMA 2F4VO 3CJHB 1PKXA 5D5QA 4WFEA 1SRYA 2P7TC 2WLKA 1DF4A 1JFFB 1QHTA 1CP9A 3S3WA 4XBFA 2M6YA 1EZVH 2AZ2A 4P9OA 2DJVA 5KHIA 3Q4HB 1RPRA 3CE2A 2EJ7A 1PNMA 4BR6A 4YJ3B 2XNDG 3ZMSA 3N2GB 4FLXA 2WLJA 4DV1B 1FFXB 5BXZA 4LF9B 1GO3F 1K34A 4PA3A 2JGDB 3DC5A 3QNEA 1K5QA 4ABMA 3OGIB 1T5EA 4TOIA 2YIBD 1KD1W 3FKSG 3L73H 4TWKA 1YJNV 2K1EA 1KC8W 4PELA 2Y4UA 2RN9A 4I4TB 1FJGB 4NTXA 1OCZB 1LNQA 1IVSA 3CC2V 2FTKA 3K59A 4JZGA 1XNRB 3GWKC 4FMTA 1DGSA 4DR1O 4WFFA 3SJBC 1OJHA 3ZHRA 5FL7G 1PV0A 4MTGA 4PJ0Z 4BW5A 5EYPB 1W0KG 3ICXA 2UUCB 1MABG 2QKAA 4JTAB 3CCLV 4RWUA 5LBQA 1I5YA 3LDEA 4DYLA 5KMGB 3ZMTA 1R3JC 3T1YO 3QG5A 3SYPA 4NVPA 4FK5C 2XAJA 1R6TA 3K79A 1H2KA 2L6LA 4WBNB 3RYIB 5KA5A 1EBOA 4KFMA 1A32A 2CK3G 4I7ZB 2DQ3A 3SDLA 3RWRD 3H1IH 2PF4E 2IU0A 1FXVA 2JRIA 1QVFU 5CB4A 1JVMA 3AG2C 3TCUA 2BCCH 5DEDA 4GX0A 4A5UB 3CXCU 5AG2A 3ASOB 1NTMH 1WB7A 2R72A 1S77D 1KUQA 1YSCA 2EILC 2Q0OC 4BIOA 4FLWA 4DXWA 4GUNA 4MS2A 4TV8A 1RSOA 4BIUA 2E76B 4DR5O 1GN2A 4CS4A 2UUAB 2VRZA 1BHBA 3G67A 4X88A 4RUFA 4K0KO 3VBBA 3SJQC 3T2MA 1YJWV 3K9AA 3G6BA 3I5DA 5KUKA 4OGQB 3OUSA 3L75H 5GTHZ 5HFMA 1V55B 1ZLZA 2ZE7A 2EULA 4K8XA 4U3FH 1QR9A 5B66Z 5JJEB 1JMKC 2E3CA 3P3NA 4I0XA 4EFBA 2XTAA 2ZCEA 3C90A 1HDJA 3AK1A 1BCCH 4UUJC 1WB8A 2EJRA 2RNBA 2Q7EA 2ADPA 1TA8A 4R6ZA 2F4VB 3CWBH 3LSQA 3WFVA 1HR0B 5CB4B 1KP2A 5BZBA 5JQGA 4B3TO 1Q82W 4X1YA 1HP8A 4JAUA 1BHAA 2GV9A 3LUTB 3AG3B 1F4NA 1J5EO 3ZRWB 4OX9O 3QTCA 3AEIA 1XMOO 1KBHA 1AJQA 2GUZA 4I50A 4LFBO 1NI8A 2AGAA 1JCHA 3E22A 4DV6B 3ETQA 2A0LA 3GVMA 1XREA 2QTOA 2O57A 4JI0O 2EBOA 3FB5C 4FZ1A 2UXBB 1Y76A 1E1RG 2Z0AA 4W4KA 4B3MB 1ORQC 3LSUA 5KAIZ 4JTCB 2R9AA 4GCZA 3G6EV 1VF6C 3STLC 1SERA 5GTIZ 3QO5A 1XILA 4EFEA 1SKVA 4DUYB 4JI6B 1VMGA 2V4DA 5IYDO 2Q5ZA
chains in the Genus database with same CATH topology
4OXSA 1R73A 4JYBA 1YJ9V 1QLEB 3F7YC 1AJPA 1FFTB 3T4DA 3SYQA 3W7XA 1V55C 1N8RW 3NXSA 4G28B 2X6AA 4QJFB 3ABKC 1AI6A 3CYOA 1S72V 4G27B 3SPCA 2Y69C 1AR1B 3T4ZA 1Y4MA 2HVKC 3CC4V 1YIJV 2DYRB 1VQ5V 4UVCA 4X89A 3GWOA 2ZDIC 1M9NA 1THZA 1XL4A 1H8EG 1KP3A 2HR3A 2OT5A 5LGNA 3A0RA 3LNMB 1FXKC 2XAGA 1IXMA 4E2LA 1GM9A 1NBMG 1AROP 2DWDC 3ETEA 4LCUC 2WLNA 4MW3A 1S5HC 3W7WA 2WSSG 4L87A 2XASA 4P30A 3CCVV 1NVPB 3E8HA 3ABMB 5H6QA 3JYCA 2NNUA 3DGEA 2R9RB 4PA9A 5LGUA 3FB7C 5LHHA 4JASA 5EC1C 2JDIG 3ABLB 4FPPA 1NR1A 1S3JA 2HLDG 1PD3A 1AI7A 1H2GA 1BL8A 3AG2B 2B1IA 1F51A 1G8MA 1Y66A 3VOUA 1VQLV 1OCRC 5B1NA 4J9ZB 5LHIA 4MVUA 2XOKG 5IY5C 3OMIB 1RPOA 2X6CA 3ZRSA 1PNKA 5DM6V 4ZKIA 1SETA 3WG7B 2A79B 5B1OA 5CBHA 2V1DA 4MT8A 3TK1A 2EILB 2WPDG 2IJIA 4MVZA 2JK5C 2EINC 1K4DC 1M57C 2H94A 1VQKV 1P7BA 3OMAB 1QVGU 4R8CA 4R50A 4GX1A 2OCCC 3B8MA 3SPHA 1S76D 3JD4A 2IW5A 3CCUV 2DW4A 2KB1A 3ETGA 4JPRA 3RW0A 2JIZG 1M90W 1OCOC 4UV9A 1RM1C 2JEXA 3RVYA 2EIKB 1M56C 2V7QG 2W0FC 3OR6C 4MVOA 3QO8A 2PI5A 1QR8A 1VQMV 1J95A 3FYEB 3K03A 3M99B 2QE7G 4WFGA 4RAIA 1UJWB 1K97A 1OCCB 3JD2A 4GX2A 2QEXV 4MTOA 3ASOC 2IH1C 4RQFA 3ZMZA 2YEVA 4MVMA 4ASUG 4QNHB 1K92A 2GSMB 1AI5A 3OR7C 1DF5A 1VQ8V 2JJ2G 1WLEA 3CCQV 3FB6C 1NH2B 1R3KC 4QPJA 1JOYA 3P30A 5L3EA 2ITCC 4MW8A 1HWYA 3D36A 1K33A 2AHYA 2QM8A 1KQSU 3SYOA 2ITDC 3G4SV 3FB8C 3HPLC 2QA4V 5EBMC 2IJKA 2ZDIA 1DTOA 1H8HG 5CMUA 4HZ3A 1FXKA 5B1BB 1R3LC 1NQTA 3B8NA 2HFEC 3E35A 4RQEA 2P67A 1E79G 3ABMC 1EFRG 4KP4A 1ENVA 2EIJC 2LFSA 4QPKA 1V54B 4MTXA 4I5SA 1R3IC 5IYBO 1CEZA 1QLNA 3GB7C 4PDRA 3ZRVA 2A9HA 2P90A 5L3CA 3K04A 3W7TA 3D3IA 2W6IG 4LP8A 1GKFA 2F43G 3ABTA 2Y48A 1JQ0A 1FS0G 1W0JG 4FJCC 2Z3YA 4JYCA 4MVSA 3X2QC 2WLMA 3EFFK 3E2EA 3ZRWA 4J9YB 3IGAC 1Q81W 2B5UA 2X6BA 1MG1A 4CBCA 5CBFA 3EHBB 2C2AA 3BEHA 1K9MW 1S0VA 2JEUA 3K08A 4PDVA 1K5SA 1VQ7V 1ZWIC 3ASNB 4U7NA 2UXXA 4XDLA 4BIZA 4P9PA 5B3SC 5DN6G 1OHHG 1B6QA 1G4YB 3E86A 2IH3C 2BOBC 1NVPD 5EBWC 5KUMA 1K73W 3OW2U 1BMFG 2DWEC 4JTDB 1I5XA 4QE7A 2IJJA 1PKXA 2DYSC 5H6RA 2WLIA 4WFEA 3CMAV 1SRYA 3AG1B 2P7TC 2WLKA 1DF4A 4BAYA 2YSUB 4P2ZA 1CP9A 4XBFA 3ZMUA 1K8AW 3AG3C 2WLHA 2YEVB 3E89A 1GK9A 4P9OA 4JF3A 5B1AC 1RPRA 4GT1A 4Q20A 3ZCCA 4XDJA 2Z5UA 1PNMA 4PDMA 2XAQA 2XNDG 1R6KA 3OM3B 1VQPV 1K4CC 3ZMSA 2WLJA 1YITV 3ZRXA 1GM7A 4LC1A 2Y69B 4PDLA 1H38A 2IU3A 1GO3F 4Z1MG 2AHZA 3BY6A 1K34A 2HJFC 4F4LA 4PA3A 2EIMB 1PNLA 3QNEA 1K5QA 1COWG 4MTFA 4PA4A 3JD3A 1KD1W 2MK3A 3FKSG 4TWKA 1YJNV 1FXKB 3CP1A 2HVJC 3JD1A 4QIWF 2K1EA 3STZC 4MVRA 1KC8W 4G2KA 4PELA 2XAHA 1E1QG 2ZXWC 3CD6V 5EBLC 1F23A 1OCZB 1LNQA 5B1BC 3CC2V 2FTKA 4QE9A 3ZN0A 4N23A 3SYCA 2R9IA 1GTOA 4FMTA 2Q68A 1VQ9V 4MSWC 2BOCC 4WFFA 1QLEC 3KG2A 3W7UA 1VQ6V 2B1GA 3LDCA 2PI4A 5FL7G 4LBEC 4MTGA 4BW5A 1Q7YW 1MSWD 2ZR3A 1W0KG 3T1CA 3JCZA 1MABG 4JTAB 2EZPA 3E8FA 3W7SA 3CCLV 3JD0A 5IY5B 5LBQA 1I5YA 3LDEA 1NH2D 2GHYA 3ZMTA 3CCJV 1R3JC 2WLLA 3ABUA 2DYRC 3SYPA 1Q86W 4UV8A 5IDJA 2QKSA 4WFHA 4H37A 4FK5C 3QO7A 3CPWU 1YTFB 2XAJA 3K79A 3ZMVA 2EINB 1K3EA 4CZZA 1M57B 4WF9V 5KA5A 2DQ0A 3K3WA 4KFMA 3UKMA 2CK3G 2UXNA 2DQ3A 2WLIB 1FXHA 3DTUB 4R7CA 2H8PC 2WAMA 4TT3G 3ABLC 1RM1B 2IU0A 1FXVA 1QVFU 1VQ4V 5CA3A 1JVMA 3AG2C 3E83A 3TCUA 4TSFG 3F7VC 4GX0A 3CXCU 1F4MA 1GMGA 2W6JG 3K0DA 4UVAA 1R6NA 3ASOB 3FYIB 5GW7A 4YXWG 3ZJZA 2LFRA 3K06A 1M1KW 3CCMV 4ZBMA 2OTLV 1NKDA 3WG7C 1W2BU 3PJSK 4U7OA 1S77D 1YSCA 4XDKA 2D3OW 1WPXA 1KECA 2EILC 1MOFA 3K0GA 4FIPC 5HFLA 3LSSA 4DXWA 3CCRV 4MS2A 5E1AC 3MHHC 3OUFA 4BIUA 2EIMC 5L3DA 1JJ2U 5EK0A 4PA6A 1BHBA 3OGCC 3I55V 4PA7A 4UXNA 5EC2C 4X88A 2Q69A 3MHSC 4WFAV 1SESA 4RUFA 1JPXA 3UM7A 4HYOA 2EIKC 2Q6AA 1QCEA 3VBBA 3LDDA 3SJQC 3IFXA 3AG4B 1KKDA 1OCZC 3T2MA 1YJWV 1P4RA 3K9AA 5CBGA 1OCCC 5KUKA 2M7WA 3OUSA 3ETDA 5CN0A 5HFMA 2EIJB 5KA6A 4UVBA 5LHGA 1V55B 4EKWA 4RUEA 2EZOA 3SPGA 3ABKB 2LP7A 2OTJV 1QR9A 1L1FA 1AI4A 1VQNV 3RVZA 2WLLB 5LGTA 4H33A 3OEHG 3RBZA 2X7RB 3OFNG 4I9WA 3X2QB 2JJ1G 3F5WC 3IC7A 1PL0A 4N21A 3P32A 3ZIAG 3CCEV 4UUJC 2ZR2A 2EJRA 2ATKC 3MD0A 3CMEV 4R6ZA 2WWWA 2X0LA 3LSQA 3WFVA 5B3SB 1CPYA 1EZJA 3TETA 4RO2A 4DO2A 3OAAG 5L3GA 4HAMA 1JX9A 1SZTA 2IJHA 1KP2A 1XL6A 2DYSB 4GX5A 5J9PC 5BZBA 1V54C 3OEEG 1Q82W 5H9CA 4WFBV 4JAUA 3CC7V 1BHAA 1OCRB 2HG5C 3E8BA 3B77A 3LUTB 1DLBA 1F4NA 3AG3B 3ZRWB 5B1AB 3AEIA 2P6JA 2ZQMA 1YI2V 1AJQA 5C93A 2QM7A 1TUEB 3OMNB 1YHQV 1OZ0A 3SPIA 4X8AA 3R65A 1VQOV 1YTFD 2HKOA 1JCHA 3OE7G 3SYAA 2A0LA 5IYCO 1NR7A 3SPJA 1NJIW 3I56V 1ROPA 2QTOA 5L3BA 3E8GA 2EBOA 3FB5C 2OCCB 3ASNC 3H01A 1E1RG 2NLJC 1ORQC 4MVQA 3HB3B 4JTCB 1OCOB 4WCEV 4GCZA 3G6EV 3ZN1A 3STLC 1M56B 3G71V 1SERA 3AG1C 2Q67A 3ML0A 2ZXWB 4JGSA 4KUMA 3QO5A 4JAVA 2XAFA 1AJNA 3CCSV 1GM8A 1K7DA 5IYDO 3AG4C 2ZD9A 5L3FA 1QBZA 1EBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCH A;  1UJW B;  2YSU B;  2B5U A; 
#chains in the Genus database with same CATH topology
 4JYB A;  3ZHS A;  3R66 A;  1AJP A;  1BZK A;  3CYO A;  3JSN A;  4I0X B;  1AR1 B;  1Y4M A;  2CTW A;  1YIJ V;  2DYR B;  2LW1 A;  4LH6 A;  2ZDI C;  1M9N A;  1XL4 A;  1DK1 A;  2XAG A;  2DE0 X;  1GM9 A;  1NBM G;  2DWD C;  1M93 A;  2KSD A;  4MW3 A;  2Q7H A;  1XUQ A;  3WB1 A;  2ZKO A;  2WSS G;  1XHZ A;  4L87 A;  4P30 A;  2AW9 A;  1P49 A;  3K5M A;  5JQG B;  2R9R B;  2YUA A;  4PA9 A;  4X1Y B;  3ZX6 A;  5LOV A;  4F6R A;  5LHH A;  4DV2 O;  4JAS A;  5EC1 C;  3ABL B;  3DXR A;  4J7K A;  1FAF A;  1BL8 A;  3KZI Z;  3APQ A;  2QSA A;  3OMI B;  4I50 B;  2X6C A;  3FFQ A;  1PNK A;  1Q6I A;  2JS3 A;  5LP6 A;  4DK1 A;  2B9Z A;  2ARH A;  5LXT A;  5JVD A;  1UPG A;  2IJI A;  2LJ2 A;  4MVZ A;  4DK0 A;  1OV9 A;  1XQ8 A;  4JI5 O;  4R50 A;  3RFR A;  1VP7 A;  1ZL8 A;  5IWA O;  1Y74 A;  5EIB D;  1M90 W;  4JI1 O;  4X64 O;  4IIJ A;  3A8T A;  2EIK B;  4MVO A;  3M99 B;  4GYC B;  1I0H A;  2XT9 A;  1OCC B;  2QEX V;  4MTO A;  3ASO C;  4OPA A;  3TXQ A;  4MVM A;  1BS3 A;  1QNM A;  2VQE O;  1VQ8 V;  1WLE A;  3RN4 A;  3CCQ V;  2HHH O;  2VWK A;  2Y0I A;  4J11 A;  2KKW A;  5JJN B;  5L3E A;  3K58 A;  2ITC C;  1HWY A;  3AK2 A;  2YDE A;  3FB8 C;  2QA4 V;  1R1B A;  3B4S A;  1H8H G;  5CMU A;  4FFB B;  1NQT A;  3DC6 A;  2Q9L A;  5LOV B;  3HKE A;  3DXR B;  3JAS A;  1P84 F;  4ZOL A;  3U0Z A;  4B3T B;  1E79 G;  4DV3 B;  1Z2G A;  1ZTE A;  4I5S A;  1YEW A;  1SQV H;  1QLN A;  5FLX N;  3ZRV A;  2A9H A;  2PGG A;  4LNU A;  3K04 A;  3D3I A;  2W6I G;  4LWS A;  4DV1 O;  4LFB B;  4JV5 O;  1NTZ H;  1N36 O;  2FL4 A;  2WLM A;  5JCO A;  1MZF A;  1F7Y A;  1NTK H;  3BRC A;  1K5S A;  1IX9 A;  1ZL8 B;  3ASN B;  4TV9 A;  4BIZ A;  1OHH G;  3E86 A;  1Y74 B;  2IH3 C;  2BOB C;  3A2F A;  1K73 W;  4PV1 B;  4JTD B;  1AVM A;  3OD4 A;  4IIJ B;  4X66 B;  2IJJ A;  1XNR O;  5H6R A;  2WLI A;  2OCH A;  2Q8V A;  1K8A W;  3AG3 C;  2WLH A;  4JF3 A;  4XDJ A;  1PP9 H;  1YF2 A;  3H1L H;  4JYY A;  1U97 A;  2XAQ A;  1R6K A;  1VQP V;  3O65 A;  3ZRX A;  1H38 A;  2UUB B;  1N33 B;  3BY6 A;  2YI8 A;  2HJF C;  4DV5 B;  4UCS A;  1LUW A;  3THO A;  3P3P A;  3JD3 A;  1Q90 D;  2MK3 A;  2HVJ C;  3K5N A;  3JD1 A;  3HKE B;  1GH6 A;  1E1Q G;  1YZB A;  4ZOL B;  2GBO A;  5B1B C;  3ZN0 A;  2BE3 A;  4X1I A;  2KG7 A;  5GON B;  3BHP A;  1ZX3 A;  4JI3 O;  3KG2 A;  4LNU B;  1VQ6 V;  2B1G A;  3LDC A;  2PI4 A;  5LA6 A;  1Q7Y W;  2ZIO A;  1MSW D;  3JCZ A;  5J2T B;  2EZP A;  3CB2 A;  3E8F A;  4X65 B;  2DMX A;  4LF7 B;  3JD0 A;  5IY5 B;  2ZM6 O;  1IBL B;  5FPO A;  2DYR C;  4UV8 A;  4H37 A;  1W59 A;  1YTF B;  4TV9 B;  4UCT A;  2UUA O;  1K3E A;  1Q3E A;  4CZZ A;  1M57 B;  4WF9 V;  2DQ0 A;  4YJ2 A;  2W0X A;  5IWA B;  4JI4 B;  4F6E A;  5E79 Z;  2WLI B;  4JI1 B;  4X64 B;  1FXH A;  3DTU B;  2WAM A;  3CEI A;  3ABL C;  1VQ4 V;  5CA3 A;  3E83 A;  3F7V C;  1GMG A;  4UVA A;  3K9S A;  4CH3 A;  3K57 A;  2CE4 A;  1M1K W;  2LFR A;  4EEQ A;  2VQE B;  3CCM V;  4JAA A;  3PJS K;  2D3O W;  1WPX A;  4TQD A;  4JI7 B;  2PZS A;  3CCR V;  1H2L A;  5K1P A;  1SF9 A;  1KB9 F;  4NXM B;  2EIM C;  5L3D A;  1HR0 O;  1YXB A;  1SQF A;  4PA6 A;  5EK0 A;  3OGC C;  3I55 V;  5EC2 C;  2Q69 A;  1BT8 A;  2Q4P A;  4WFA V;  1SES A;  3M8A A;  3UM7 A;  2EIK C;  2KG7 B;  2Q6A A;  2YXH A;  3IFX A;  4LFC B;  2F93 B;  2H3O A;  1P4R A;  3C3T A;  5LA6 B;  1OCC C;  5CN0 A;  5LHG A;  4EKW A;  4O4L A;  4RUE A;  3BFR A;  2OTJ V;  2LP7 A;  4JV5 B;  1VQN V;  3JAK A;  4U3J B;  4H33 A;  3RBZ A;  4DV6 O;  1N36 B;  2X7R B;  3OFN G;  2JJ1 G;  4X62 O;  2UXB O;  3IC7 A;  2QDO A;  4B3M O;  2Y4T A;  3CCE V;  3JAM N;  4YJ2 B;  2ATK C;  4X1K A;  4DR6 O;  3MD0 A;  2WWW A;  2BTO A;  1CPY A;  1EZJ A;  3TET A;  4O4I A;  5L3G A;  4DUY O;  4JI6 O;  3VQY A;  3QF7 A;  4LR3 A;  1JX9 A;  2IJH A;  2DYS B;  1KU9 A;  1MSD A;  2LW7 A;  2NR5 A;  3CC7 V;  3E8B A;  4Q6G A;  2BTQ A;  1AB3 A;  4J42 A;  5LP6 C;  5BY1 A;  2ZQM A;  5FNV A;  5C93 A;  4K8Z A;  1TUE B;  1YHQ V;  1OZ0 A;  2QWP B;  4X8A A;  1VQO V;  1YTF D;  1NS1 A;  5IYC O;  3SPJ A;  1NJI W;  1ROP A;  4UCV A;  3ASN C;  3H01 A;  1L0L H;  2IBZ H;  4WCE V;  2F1M A;  2CH7 A;  3ZN1 A;  3HKC A;  3JSL A;  1AP6 A;  4X9Q A;  4KUM A;  4JGS A;  3L70 H;  2CAZ C;  4JI3 B;  3AG4 C;  4O4L B;  1HNX B;  4OXS A;  1QLE B;  1FFT B;  1SQX H;  2ZM6 B;  1N8R W;  4G28 B;  5KAF Z;  1AI6 A;  3VQX A;  1S72 V;  4GKJ B;  4JI8 B;  3G80 A;  4CC5 A;  4K3A A;  4ZHQ A;  1HW7 A;  3CC4 V;  3ZHU A;  4E4E A;  4DV4 O;  3GWO A;  1THZ A;  2OT5 A;  1V9P A;  3A0R A;  3ETE A;  1ARO P;  5KHK A;  2WLN A;  5JH7 A;  1N0N A;  2XAS A;  2QR4 A;  4NYK A;  3JYC A;  5LGU A;  1Q8I A;  2JDI G;  4FPP A;  2OYQ A;  2HLD G;  1PD3 A;  2BTQ B;  1AI7 A;  3K5L A;  3ZS8 C;  3RYF A;  1G6U A;  1G8M A;  1I94 B;  1VQL V;  5FNV B;  4JZ2 A;  2XOK G;  2Q73 A;  5IY5 C;  1TVK A;  4HBN A;  5JCO C;  4ZKI A;  1AP5 A;  2PTM A;  1XI1 A;  1SET A;  3WG7 B;  4IT5 A;  5CBH A;  2V1D A;  1N32 B;  4KHP B;  4ICG A;  3H1J H;  4DR4 B;  1K4D C;  1M57 C;  1VQK V;  2QJ1 A;  3OMA B;  1QVG U;  4R8C A;  4GX1 A;  2OCC C;  2QGN A;  3SPH A;  3H9V A;  3HKC B;  1I08 A;  3JD4 A;  3CCU V;  4CH5 A;  3ETG A;  1RFY A;  2JEX A;  2PY5 A;  4DV3 O;  3RYC A;  3QO8 A;  1QR8 A;  1J95 A;  2QE7 G;  3N27 A;  4RAI A;  1UJW B;  1K97 A;  3JD2 A;  4FLY A;  2YIC A;  4IGG A;  4DV7 B;  3ZMZ A;  2YEV A;  4FM1 A;  4FZ0 A;  4TV8 B;  3FD9 A;  2P4V A;  4ZHQ B;  3A0H Z;  1RSO B;  1PM9 A;  4J80 A;  3FB6 C;  4X62 B;  4QPJ A;  1JOY A;  4MW8 A;  1ZSP A;  2QM8 A;  4DR6 B;  3SYO A;  4DW0 A;  5JH7 B;  3G4S V;  2GTS A;  4X66 O;  3VQV A;  2NN4 A;  5B1B B;  1HNW B;  3E35 A;  3RYF B;  4NXN B;  2LFS A;  4QPK A;  4B08 A;  1TVK B;  2A3Q A;  2YC0 A;  5L3C A;  4H13 B;  1GKF A;  3ABT A;  2Y48 A;  1HNZ B;  2RJZ A;  4AHC A;  3MDS A;  4FJC C;  4MVS A;  2UUB O;  1N33 O;  4O4H A;  3EFF K;  3E2E A;  1KKC A;  3JAT A;  2ZT9 B;  4DV5 O;  3TJT A;  5CBF A;  4LFA B;  2C2A A;  3N2K A;  3QVN A;  1K9M W;  3JAW A;  1S0V A;  2JEU A;  1SQQ H;  3K08 A;  3J80 N;  2ZIM A;  1Q43 A;  4AI8 A;  1SA0 A;  1WP7 A;  2G38 A;  4CS2 A;  3NR7 A;  4QE7 A;  3RYC B;  4IL6 Z;  2DYS C;  3CMA V;  3AG1 B;  1IUR A;  4BAY A;  1Z5V A;  2YSU B;  2GUZ B;  3E89 A;  2YEV B;  1FPO A;  4X65 O;  4LF7 O;  1XDC A;  1IBL O;  3E22 B;  4GT1 A;  4X20 A;  5LMN B;  2HP8 A;  3EXA A;  4AQY O;  4PHZ A;  5FPR A;  2LGQ A;  1EM1 A;  4YY3 B;  4HNA A;  1Y76 B;  4PDL A;  2CTP A;  2IU3 A;  4DV4 B;  4Z1M G;  4TUY A;  4FM2 A;  1Z5W A;  4IYI A;  2EIM B;  2QWN B;  1FKA O;  4JI4 O;  5B5E Z;  3CP1 A;  2Q0A A;  5K1X A;  4QIW F;  2ADQ B;  2XAH A;  2FML A;  5EBL C;  1GTO A;  4L8J A;  1L0N H;  2CTR A;  1VQ9 V;  4MSW C;  2BOC C;  1QLE C;  5C8Y A;  3W7U A;  5EZY A;  5KHJ A;  4LBE C;  2ZR3 A;  3RGB A;  3T1C A;  4O4H B;  4JI7 O;  4UB8 Z;  3JAT B;  3FAV A;  3ABU A;  4GKK B;  5IDJ A;  2QKS A;  3JAW B;  3QO7 A;  4B7E A;  3CPW U;  4NXM O;  3ZMV A;  2QWO B;  4ZI7 A;  1SA0 B;  2A06 H;  4FM0 A;  4F6R B;  3K3W A;  3UKM A;  2UXN A;  2ZE6 A;  3OTF A;  2F95 B;  2GTA A;  4LFC O;  2H8P C;  4UCR A;  4FFK A;  3WB2 A;  1RM1 B;  1S5J A;  1RP3 B;  1AIL A;  4YHH B;  2YIB A;  4KXR A;  1MMM A;  4X20 B;  5LP6 B;  1LUV A;  5LXT B;  5JVD B;  2E5L B;  4YXW G;  3K06 A;  4LF5 O;  1IZ3 A;  2OTL V;  2UU9 O;  4H44 B;  3WG7 C;  1W2B U;  4U7O A;  1D2D A;  1MOF A;  3K0G A;  4TUY B;  3IC9 A;  1BSM A;  3MHH C;  5A2Q N;  4I55 A;  3FX7 A;  1CXZ B;  4JI2 O;  1VEW A;  1Q5O A;  3CS5 A;  3MAQ A;  3K5O A;  4UXN A;  4H0L B;  4D7T A;  3C3S A;  2ILM A;  2N04 A;  4GZR B;  3RYH A;  3LDD A;  1JA8 A;  3AG4 B;  1KKD A;  5C8Y B;  5EZY B;  1X4T A;  3J81 N;  2M7W A;  3ETD A;  2PYJ A;  3T1H O;  1UFI A;  3SPG A;  3UCS C;  3SGI A;  3ZBH A;  1L1F A;  2UXD B;  3RVZ A;  2CGO A;  3FAV B;  3OEH G;  1EN5 A;  1ZAU A;  2FYU H;  5D5P A;  4I9W A;  4O2B A;  1IBK O;  2DOS A;  1YVW A;  4NB5 A;  4ZI7 B;  1GN3 A;  4N21 A;  2P5O A;  3HKD A;  3JAS B;  3CME V;  1B04 A;  2EX3 A;  4RO2 A;  3OT7 A;  4HAM A;  3CHX A;  1BE3 H;  1HNX O;  5H2F Z;  4LWS B;  4NTY A;  1SC5 B;  4WFB V;  3ZHT A;  2ZE5 A;  3B77 A;  1VF6 A;  1VF5 B;  4UFZ A;  4AQY B;  5B1A B;  4GKJ O;  4JI8 O;  2P6J A;  1IXB A;  1D5A A;  4O4J A;  3SPI A;  1I7F A;  2ZIN A;  3Q4H A;  3R65 A;  3D8C A;  3WU2 Z;  3JAR A;  1NR7 A;  4I55 B;  3I56 V;  5L3B A;  3E8G A;  2OCC B;  4DRX A;  2NLJ C;  2F23 A;  3HB3 B;  1G1X B;  4J7Z A;  3RYH B;  1TUB A;  2AZ0 A;  3G71 V;  3AG1 C;  2RQ6 A;  2ZXW B;  4JAV A;  4B3R O;  1AJN A;  1P7G A;  1GM8 A;  1I94 O;  5L3F A;  1QBZ A;  3ZJZ A;  1R73 A;  3KCY A;  4I4T A;  1YJ9 V;  4NKG B;  2YIA A;  1N4C A;  3L74 H;  3SYQ A;  3W7X A;  2GDS A;  2IM9 A;  1KYO F;  3NXS A;  3H1H H;  4QJF B;  3ABK C;  2FB5 A;  4O2B B;  1N32 O;  1PL4 A;  3SPC A;  4KHP O;  1VAR A;  1B06 A;  4DR4 O;  1IBM B;  1AR5 A;  1VQ5 V;  1WA8 A;  2CGN A;  4UVC A;  3HKD B;  4X89 A;  1GAX A;  5LGN A;  1B3Q A;  1IXM A;  4E2L A;  3BVO A;  4X1I B;  4LCU C;  1S5H C;  4D7S A;  3W7W A;  2Y0P A;  3U10 A;  3U11 A;  3IAY A;  3J7A U;  5KLV H;  4B3S B;  5IYZ A;  3CCV V;  1NVP B;  3E8H A;  3RYI A;  2NNU A;  5ITZ A;  3FB7 C;  2HEP A;  1S3J A;  1Y6X A;  4FLT A;  4DV7 O;  4DV0 B;  3S3X A;  4DUZ B;  1Y66 A;  3VOU A;  1OCR C;  1AR4 A;  4J9Z B;  5LHI A;  4LF5 B;  4MVU A;  2UU9 B;  4O4J B;  1RPO A;  1FYJ A;  3UO2 A;  2P22 C;  5DM6 V;  2YXL A;  3JAR B;  5B1O A;  4MT8 A;  3TK1 A;  2WPD G;  1FD9 A;  4DRX B;  2JK5 C;  3OTO O;  4JI2 B;  5H5N A;  3L72 H;  1P7B A;  1WP8 A;  1HNW O;  1TUB B;  1S76 D;  4DR3 B;  3EVK A;  5IJ9 A;  5KHH A;  4NXN O;  1NZ6 A;  3RW0 A;  2WA4 A;  1OCO C;  1RM1 C;  1S5L Z;  4NTW A;  2VWJ A;  1M56 C;  2W0F C;  3OR6 C;  1VQM V;  3FYE B;  4WFG A;  2R70 A;  3T1H B;  1D5N A;  1SQG A;  4GX2 A;  1HNZ O;  2IH1 C;  4RQF A;  5LMU O;  4TQF A;  3CRM A;  1K92 A;  1AI5 A;  3OR7 C;  1DF5 A;  4YIP A;  4Z2W A;  1VF7 A;  3HKB A;  4JYA O;  1WA8 B;  3CRQ A;  1IBK B;  1NH2 B;  1R3K C;  4LFA O;  4DR2 B;  2ZE8 A;  1WJZ A;  3AK3 A;  4Z1V A;  3D36 A;  1K33 A;  2ITD C;  3D3Q A;  3HPL C;  5TIS Z;  1MA1 A;  1WNS A;  5IYZ B;  3UQ8 A;  3B2E E;  5KX5 A;  4LF8 O;  1FXK A;  3B8N A;  2QTS A;  5ITZ B;  1US6 A;  1U96 A;  3BA9 A;  1MNG A;  5BR8 B;  2HFE C;  1M4U A;  1Q6H A;  2CTQ A;  3H1K H;  1BQ0 A;  3ABM C;  1EFR G;  4KP4 A;  1ENV A;  3CRC A;  1V54 B;  3JAK B;  1SQB H;  1IDS A;  5LMN O;  3L71 H;  2UXC O;  5IYB O;  1CEZ A;  3GB7 C;  4PDR A;  4BWA A;  4LP8 A;  4YY3 O;  2F43 G;  1JQ0 A;  1FS0 G;  3BAB A;  4UCU A;  4D6T H;  4JYC A;  5KHG A;  1H2N A;  4X1K B;  4ZIB A;  3ZRW A;  2CDY A;  1Q81 W;  4CBC A;  4O4I B;  3EHB B;  3BEH A;  3AG7 A;  4PDV A;  4NR1 A;  5A9G A;  1VQ7 V;  4U7N A;  2UXX A;  5DN6 G;  1G4Y B;  2QWQ B;  5IJ9 B;  1NVP D;  1KMI Z;  5EBW C;  3OW2 U;  1BMF G;  2DWE C;  3BCC H;  2E75 B;  1I5X A;  4B3R B;  2YXY A;  1O9H A;  2D2C B;  4P2Z A;  3TGU H;  3ZMU A;  1XMQ O;  4DR7 O;  1GK9 A;  5B1A C;  1XNQ B;  4Q20 A;  3ZCC A;  2Z5U A;  3SR2 C;  2YI9 A;  3HKB B;  4PDM A;  3OM3 B;  4GKK O;  3PN1 A;  1K4C C;  2P4K A;  1YIT V;  1GM7 A;  4LC1 A;  2Y69 B;  2VQF O;  3VQW A;  2AHZ A;  4YIO A;  2CH7 B;  1SS3 A;  4F4L A;  1PNL A;  1COW G;  4MTF A;  3RT3 C;  4PA4 A;  2XUM A;  5KX5 B;  2VS0 A;  1FXK B;  2OWO A;  1GRJ A;  3SJA C;  5LYJ A;  2WA3 A;  3STZ C;  2ODM A;  4MVR A;  4G2K A;  2ZXW C;  3CD6 V;  1F23 A;  4YHH O;  4QE9 A;  4OPH A;  4N23 A;  3SYC A;  2R9I A;  4AIL C;  1Q6U A;  3TXS A;  4K35 A;  2Q68 A;  2BSK A;  2E5L O;  2FKX A;  3B40 A;  4FVM A;  3W7S A;  3CRR A;  1NH2 D;  2GHY A;  3CCJ V;  2WLL A;  4LF4 O;  1Q86 W;  4WFH A;  3OTO B;  4I9Q A;  2RDC A;  3JAL A;  2EIN B;  2ETN A;  3CXH F;  5DEC A;  3L9D A;  4IHJ A;  4FLU A;  2QKC A;  1YCI A;  2KQX A;  1WAZ A;  5JJJ B;  4PI0 A;  3UT5 A;  4R7C A;  4TT3 G;  3A0B Z;  4B7K A;  4TSF G;  2F66 C;  1NU1 H;  5LMU B;  2UXD O;  1TAE A;  1F4M A;  4DR1 B;  2W6J G;  3K0D A;  1R6N A;  3FYI B;  5GW7 A;  5CA1 A;  1M5I A;  4ZBM A;  1NKD A;  4XDK A;  4JYA B;  1KEC A;  4FIP C;  5HFL A;  3LSS A;  2ZNI A;  3T1Y B;  1SQP H;  5E1A C;  4UB6 Z;  3OUF A;  2E74 B;  5LYJ B;  1H2M A;  1JJ2 U;  4LF8 B;  4PA7 A;  1XEQ A;  3MHS C;  1JPX A;  4HYO A;  3ZHV A;  1QCE A;  3SJC C;  1BQZ A;  4DW1 A;  2BSK B;  4J41 A;  4IYH A;  1OCZ C;  4FFB A;  5CBG A;  2UXC B;  3F5T A;  3APO A;  2EIJ B;  5KA6 A;  4UVB A;  5J2U A;  3LNN A;  1NT2 B;  2EZO A;  1JR9 A;  3ABK B;  1WN7 A;  4BW9 A;  1AI4 A;  2WLL B;  5LGT A;  3M7M X;  3X2Q B;  2K9P A;  3JAL B;  3F5W C;  1PL0 A;  4LF6 O;  3P32 A;  3ZIA G;  2ZR2 A;  1VIB A;  4IHJ B;  5LL6 Y;  5IJ0 A;  1X59 A;  4GLX A;  4DR5 B;  2X0L A;  5B3S B;  3UT5 B;  5CA0 A;  4DO2 A;  3OAA G;  1SZT A;  1XL6 A;  4K0K B;  4GX5 A;  5J9P C;  1V54 C;  3OEE G;  1XMQ B;  2XHB A;  4DR7 B;  5H9C A;  1OCR B;  2HG5 C;  1N34 O;  5CA1 B;  1DLB A;  2OIG A;  4LH7 A;  1YI2 V;  3IJ4 A;  1IBM O;  2QM7 A;  3OMN B;  3N2K B;  1O9G A;  3CSX A;  2HKO A;  3OE7 G;  2VQF B;  3SYA A;  2A7W A;  4PI2 A;  4MVQ A;  3O9O A;  4B3S O;  1OCO B;  3UO3 A;  1M56 B;  4J7J A;  2Q67 A;  4UCO A;  3ML0 A;  3ZHQ A;  3BPZ A;  2XAF A;  4DV0 O;  3CCS V;  4DUZ O;  1K7D A;  1QQC A;  5J2U B;  2ZD9 A;  1XHX A;  4HNA B;  3F7Y C;  2DN9 A;  3T4D A;  1V55 C;  2LQT A;  5GON A;  1J5E B;  1BGY H;  2PYL A;  2X6A A;  2JGU A;  2LO1 A;  4OX9 B;  4G27 B;  3HR0 A;  1XMO B;  2Y69 C;  4KL1 A;  4LF4 B;  4EB6 A;  2CUG A;  3T4Z A;  3KKY A;  2HVK C;  3D36 C;  2MW2 B;  5J2T A;  4LF9 O;  1H8E G;  1KP3 A;  2HR3 A;  5IJ0 B;  3LNM B;  1FXK C;  2PUS A;  4JI0 B;  4DR3 O;  5CA0 B;  5BMV A;  3ZED A;  3ABM B;  5H6Q A;  3DGE A;  1FJG O;  1NR1 A;  1H2G A;  3AG2 B;  2LGW A;  5EIB C;  1GN6 A;  3WB0 A;  2B1I A;  1F51 A;  1URF A;  5B1N A;  2QM4 A;  4CH4 A;  1XOU A;  2OIE A;  3ZRS A;  2UUC O;  4J10 A;  1LR1 A;  2A79 B;  4DR2 O;  4FLV A;  2EIL B;  2QWR B;  5F2V O;  2EIN C;  4QGP A;  4O2A A;  2H94 A;  3B8M A;  1JJO A;  2Q7G A;  5BR8 O;  2IW5 A;  4CH6 A;  2DW4 A;  2KB1 A;  1GN4 A;  4JPR A;  2JIZ G;  4UV9 A;  1EN4 A;  3CJH A;  3RVY A;  1EN6 A;  2YID A;  2JVD A;  1ZUQ A;  1SZX A;  2V7Q G;  1MZE A;  2PI5 A;  3K03 A;  4PD4 F;  4DV2 B;  1JFF A;  5JWP A;  3DSQ A;  1WPB A;  4ASU G;  4QNH B;  2GSM B;  2N05 A;  4EB6 B;  3BAA A;  5IT9 N;  2JJ2 G;  1L8D A;  1XBL A;  2ZNJ A;  4YJ3 A;  3N2G A;  4FLZ A;  4LF6 B;  1FFX A;  4CS3 A;  3P30 A;  4U3J A;  1N0J A;  2AHY A;  1KQS U;  2AXT Z;  2HJD A;  2L35 A;  5BMV B;  2JGD A;  5EBM C;  2IJK A;  2ZDI A;  1DTO A;  2RMK B;  4HZ3 A;  4JI5 B;  3CRA A;  1R3L C;  4C7U A;  1YDX A;  1PPJ H;  4RQE A;  2P67 A;  4CC6 A;  2EIJ C;  1N34 B;  4MTX A;  1XNQ O;  1R3I C;  2P90 A;  3W7T A;  2JS5 A;  1H2S B;  5EYP A;  3CX5 F;  1W0J G;  2N74 A;  2Z3Y A;  3X2Q C;  5KMG A;  5IE9 A;  4J9Y B;  4O2A B;  3IGA C;  4W4L A;  2B5U A;  2X6B A;  1QU7 A;  1MG1 A;  2HHH B;  3KCX A;  3BA8 A;  1Y67 A;  1ZWI C;  2RCV A;  3JCU Z;  4XDL A;  4P9P A;  5B3S C;  3B09 A;  2YS8 A;  1B6Q A;  1TGO A;  2P06 A;  4WBN A;  5KUM A;  2F4V O;  3CJH B;  1PKX A;  5D5Q A;  4WFE A;  1SRY A;  2P7T C;  2WLK A;  1DF4 A;  1JFF B;  1QHT A;  1CP9 A;  3S3W A;  4XBF A;  2M6Y A;  1EZV H;  2AZ2 A;  4P9O A;  2DJV A;  5KHI A;  3Q4H B;  1RPR A;  3CE2 A;  2EJ7 A;  1PNM A;  4BR6 A;  4YJ3 B;  2XND G;  3ZMS A;  3N2G B;  4FLX A;  2WLJ A;  4DV1 B;  1FFX B;  5BXZ A;  4LF9 B;  1GO3 F;  1K34 A;  4PA3 A;  2JGD B;  3DC5 A;  3QNE A;  1K5Q A;  4ABM A;  3OGI B;  1T5E A;  4TOI A;  2YIB D;  1KD1 W;  3FKS G;  3L73 H;  4TWK A;  1YJN V;  2K1E A;  1KC8 W;  4PEL A;  2Y4U A;  2RN9 A;  4I4T B;  1FJG B;  4NTX A;  1OCZ B;  1LNQ A;  1IVS A;  3CC2 V;  2FTK A;  3K59 A;  4JZG A;  1XNR B;  3GWK C;  4FMT A;  1DGS A;  4DR1 O;  4WFF A;  3SJB C;  1OJH A;  3ZHR A;  5FL7 G;  1PV0 A;  4MTG A;  4PJ0 Z;  4BW5 A;  5EYP B;  1W0K G;  3ICX A;  2UUC B;  1MAB G;  2QKA A;  4JTA B;  3CCL V;  4RWU A;  5LBQ A;  1I5Y A;  3LDE A;  4DYL A;  5KMG B;  3ZMT A;  1R3J C;  3T1Y O;  3QG5 A;  3SYP A;  4NVP A;  4FK5 C;  2XAJ A;  1R6T A;  3K79 A;  1H2K A;  2L6L A;  4WBN B;  3RYI B;  5KA5 A;  1EBO A;  4KFM A;  1A32 A;  2CK3 G;  4I7Z B;  2DQ3 A;  3SDL A;  3RWR D;  3H1I H;  2PF4 E;  2IU0 A;  1FXV A;  2JRI A;  1QVF U;  5CB4 A;  1JVM A;  3AG2 C;  3TCU A;  2BCC H;  5DED A;  4GX0 A;  4A5U B;  3CXC U;  5AG2 A;  3ASO B;  1NTM H;  1WB7 A;  2R72 A;  1S77 D;  1KUQ A;  1YSC A;  2EIL C;  2Q0O C;  4BIO A;  4FLW A;  4DXW A;  4GUN A;  4MS2 A;  4TV8 A;  1RSO A;  4BIU A;  2E76 B;  4DR5 O;  1GN2 A;  4CS4 A;  2UUA B;  2VRZ A;  1BHB A;  3G67 A;  4X88 A;  4RUF A;  4K0K O;  3VBB A;  3SJQ C;  3T2M A;  1YJW V;  3K9A A;  3G6B A;  3I5D A;  5KUK A;  4OGQ B;  3OUS A;  3L75 H;  5GTH Z;  5HFM A;  1V55 B;  1ZLZ A;  2ZE7 A;  2EUL A;  4K8X A;  4U3F H;  1QR9 A;  5B66 Z;  5JJE B;  1JMK C;  2E3C A;  3P3N A;  4I0X A;  4EFB A;  2XTA A;  2ZCE A;  3C90 A;  1HDJ A;  3AK1 A;  1BCC H;  4UUJ C;  1WB8 A;  2EJR A;  2RNB A;  2Q7E A;  2ADP A;  1TA8 A;  4R6Z A;  2F4V B;  3CWB H;  3LSQ A;  3WFV A;  1HR0 B;  5CB4 B;  1KP2 A;  5BZB A;  5JQG A;  4B3T O;  1Q82 W;  4X1Y A;  1HP8 A;  4JAU A;  1BHA A;  2GV9 A;  3LUT B;  3AG3 B;  1F4N A;  1J5E O;  3ZRW B;  4OX9 O;  3QTC A;  3AEI A;  1XMO O;  1KBH A;  1AJQ A;  2GUZ A;  4I50 A;  4LFB O;  1NI8 A;  2AGA A;  1JCH A;  3E22 A;  4DV6 B;  3ETQ A;  2A0L A;  3GVM A;  1XRE A;  2QTO A;  2O57 A;  4JI0 O;  2EBO A;  3FB5 C;  4FZ1 A;  2UXB B;  1Y76 A;  1E1R G;  2Z0A A;  4W4K A;  4B3M B;  1ORQ C;  3LSU A;  5KAI Z;  4JTC B;  2R9A A;  4GCZ A;  3G6E V;  1VF6 C;  3STL C;  1SER A;  5GTI Z;  3QO5 A;  1XIL A;  4EFE A;  1SKV A;  4DUY B;  4JI6 B;  1VMG A;  2V4D A;  5IYD O;  2Q5Z A; 
#chains in the Genus database with same CATH homology
 4OXS A;  1R73 A;  4JYB A;  1YJ9 V;  1QLE B;  3F7Y C;  1AJP A;  1FFT B;  3T4D A;  3SYQ A;  3W7X A;  1V55 C;  1N8R W;  3NXS A;  4G28 B;  2X6A A;  4QJF B;  3ABK C;  1AI6 A;  3CYO A;  1S72 V;  4G27 B;  3SPC A;  2Y69 C;  1AR1 B;  3T4Z A;  1Y4M A;  2HVK C;  3CC4 V;  1YIJ V;  2DYR B;  1VQ5 V;  4UVC A;  4X89 A;  3GWO A;  2ZDI C;  1M9N A;  1THZ A;  1XL4 A;  1H8E G;  1KP3 A;  2HR3 A;  2OT5 A;  5LGN A;  3A0R A;  3LNM B;  1FXK C;  2XAG A;  1IXM A;  4E2L A;  1GM9 A;  1NBM G;  1ARO P;  2DWD C;  3ETE A;  4LCU C;  2WLN A;  4MW3 A;  1S5H C;  3W7W A;  2WSS G;  4L87 A;  2XAS A;  4P30 A;  3CCV V;  1NVP B;  3E8H A;  3ABM B;  5H6Q A;  3JYC A;  2NNU A;  3DGE A;  2R9R B;  4PA9 A;  5LGU A;  3FB7 C;  5LHH A;  4JAS A;  5EC1 C;  2JDI G;  3ABL B;  4FPP A;  1NR1 A;  1S3J A;  2HLD G;  1PD3 A;  1AI7 A;  1H2G A;  1BL8 A;  3AG2 B;  2B1I A;  1F51 A;  1G8M A;  1Y66 A;  3VOU A;  1VQL V;  1OCR C;  5B1N A;  4J9Z B;  5LHI A;  4MVU A;  2XOK G;  5IY5 C;  3OMI B;  1RPO A;  2X6C A;  3ZRS A;  1PNK A;  5DM6 V;  4ZKI A;  1SET A;  3WG7 B;  2A79 B;  5B1O A;  5CBH A;  2V1D A;  4MT8 A;  3TK1 A;  2EIL B;  2WPD G;  2IJI A;  4MVZ A;  2JK5 C;  2EIN C;  1K4D C;  1M57 C;  2H94 A;  1VQK V;  1P7B A;  3OMA B;  1QVG U;  4R8C A;  4R50 A;  4GX1 A;  2OCC C;  3B8M A;  3SPH A;  1S76 D;  3JD4 A;  2IW5 A;  3CCU V;  2DW4 A;  2KB1 A;  3ETG A;  4JPR A;  3RW0 A;  2JIZ G;  1M90 W;  1OCO C;  4UV9 A;  1RM1 C;  2JEX A;  3RVY A;  2EIK B;  1M56 C;  2V7Q G;  2W0F C;  3OR6 C;  4MVO A;  3QO8 A;  2PI5 A;  1QR8 A;  1VQM V;  1J95 A;  3FYE B;  3K03 A;  3M99 B;  2QE7 G;  4WFG A;  4RAI A;  1UJW B;  1K97 A;  1OCC B;  3JD2 A;  4GX2 A;  2QEX V;  4MTO A;  3ASO C;  2IH1 C;  4RQF A;  3ZMZ A;  2YEV A;  4MVM A;  4ASU G;  4QNH B;  1K92 A;  2GSM B;  1AI5 A;  3OR7 C;  1DF5 A;  1VQ8 V;  2JJ2 G;  1WLE A;  3CCQ V;  3FB6 C;  1NH2 B;  1R3K C;  4QPJ A;  1JOY A;  3P30 A;  5L3E A;  2ITC C;  4MW8 A;  1HWY A;  3D36 A;  1K33 A;  2AHY A;  2QM8 A;  1KQS U;  3SYO A;  2ITD C;  3G4S V;  3FB8 C;  3HPL C;  2QA4 V;  5EBM C;  2IJK A;  2ZDI A;  1DTO A;  1H8H G;  5CMU A;  4HZ3 A;  1FXK A;  5B1B B;  1R3L C;  1NQT A;  3B8N A;  2HFE C;  3E35 A;  4RQE A;  2P67 A;  1E79 G;  3ABM C;  1EFR G;  4KP4 A;  1ENV A;  2EIJ C;  2LFS A;  4QPK A;  1V54 B;  4MTX A;  4I5S A;  1R3I C;  5IYB O;  1CEZ A;  1QLN A;  3GB7 C;  4PDR A;  3ZRV A;  2A9H A;  2P90 A;  5L3C A;  3K04 A;  3W7T A;  3D3I A;  2W6I G;  4LP8 A;  1GKF A;  2F43 G;  3ABT A;  2Y48 A;  1JQ0 A;  1FS0 G;  1W0J G;  4FJC C;  2Z3Y A;  4JYC A;  4MVS A;  3X2Q C;  2WLM A;  3EFF K;  3E2E A;  3ZRW A;  4J9Y B;  3IGA C;  1Q81 W;  2B5U A;  2X6B A;  1MG1 A;  4CBC A;  5CBF A;  3EHB B;  2C2A A;  3BEH A;  1K9M W;  1S0V A;  2JEU A;  3K08 A;  4PDV A;  1K5S A;  1VQ7 V;  1ZWI C;  3ASN B;  4U7N A;  2UXX A;  4XDL A;  4BIZ A;  4P9P A;  5B3S C;  5DN6 G;  1OHH G;  1B6Q A;  1G4Y B;  3E86 A;  2IH3 C;  2BOB C;  1NVP D;  5EBW C;  5KUM A;  1K73 W;  3OW2 U;  1BMF G;  2DWE C;  4JTD B;  1I5X A;  4QE7 A;  2IJJ A;  1PKX A;  2DYS C;  5H6R A;  2WLI A;  4WFE A;  3CMA V;  1SRY A;  3AG1 B;  2P7T C;  2WLK A;  1DF4 A;  4BAY A;  2YSU B;  4P2Z A;  1CP9 A;  4XBF A;  3ZMU A;  1K8A W;  3AG3 C;  2WLH A;  2YEV B;  3E89 A;  1GK9 A;  4P9O A;  4JF3 A;  5B1A C;  1RPR A;  4GT1 A;  4Q20 A;  3ZCC A;  4XDJ A;  2Z5U A;  1PNM A;  4PDM A;  2XAQ A;  2XND G;  1R6K A;  3OM3 B;  1VQP V;  1K4C C;  3ZMS A;  2WLJ A;  1YIT V;  3ZRX A;  1GM7 A;  4LC1 A;  2Y69 B;  4PDL A;  1H38 A;  2IU3 A;  1GO3 F;  4Z1M G;  2AHZ A;  3BY6 A;  1K34 A;  2HJF C;  4F4L A;  4PA3 A;  2EIM B;  1PNL A;  3QNE A;  1K5Q A;  1COW G;  4MTF A;  4PA4 A;  3JD3 A;  1KD1 W;  2MK3 A;  3FKS G;  4TWK A;  1YJN V;  1FXK B;  3CP1 A;  2HVJ C;  3JD1 A;  4QIW F;  2K1E A;  3STZ C;  4MVR A;  1KC8 W;  4G2K A;  4PEL A;  2XAH A;  1E1Q G;  2ZXW C;  3CD6 V;  5EBL C;  1F23 A;  1OCZ B;  1LNQ A;  5B1B C;  3CC2 V;  2FTK A;  4QE9 A;  3ZN0 A;  4N23 A;  3SYC A;  2R9I A;  1GTO A;  4FMT A;  2Q68 A;  1VQ9 V;  4MSW C;  2BOC C;  4WFF A;  1QLE C;  3KG2 A;  3W7U A;  1VQ6 V;  2B1G A;  3LDC A;  2PI4 A;  5FL7 G;  4LBE C;  4MTG A;  4BW5 A;  1Q7Y W;  1MSW D;  2ZR3 A;  1W0K G;  3T1C A;  3JCZ A;  1MAB G;  4JTA B;  2EZP A;  3E8F A;  3W7S A;  3CCL V;  3JD0 A;  5IY5 B;  5LBQ A;  1I5Y A;  3LDE A;  1NH2 D;  2GHY A;  3ZMT A;  3CCJ V;  1R3J C;  2WLL A;  3ABU A;  2DYR C;  3SYP A;  1Q86 W;  4UV8 A;  5IDJ A;  2QKS A;  4WFH A;  4H37 A;  4FK5 C;  3QO7 A;  3CPW U;  1YTF B;  2XAJ A;  3K79 A;  3ZMV A;  2EIN B;  1K3E A;  4CZZ A;  1M57 B;  4WF9 V;  5KA5 A;  2DQ0 A;  3K3W A;  4KFM A;  3UKM A;  2CK3 G;  2UXN A;  2DQ3 A;  2WLI B;  1FXH A;  3DTU B;  4R7C A;  2H8P C;  2WAM A;  4TT3 G;  3ABL C;  1RM1 B;  2IU0 A;  1FXV A;  1QVF U;  1VQ4 V;  5CA3 A;  1JVM A;  3AG2 C;  3E83 A;  3TCU A;  4TSF G;  3F7V C;  4GX0 A;  3CXC U;  1F4M A;  1GMG A;  2W6J G;  3K0D A;  4UVA A;  1R6N A;  3ASO B;  3FYI B;  5GW7 A;  4YXW G;  3ZJZ A;  2LFR A;  3K06 A;  1M1K W;  3CCM V;  4ZBM A;  2OTL V;  1NKD A;  3WG7 C;  1W2B U;  3PJS K;  4U7O A;  1S77 D;  1YSC A;  4XDK A;  2D3O W;  1WPX A;  1KEC A;  2EIL C;  1MOF A;  3K0G A;  4FIP C;  5HFL A;  3LSS A;  4DXW A;  3CCR V;  4MS2 A;  5E1A C;  3MHH C;  3OUF A;  4BIU A;  2EIM C;  5L3D A;  1JJ2 U;  5EK0 A;  4PA6 A;  1BHB A;  3OGC C;  3I55 V;  4PA7 A;  4UXN A;  5EC2 C;  4X88 A;  2Q69 A;  3MHS C;  4WFA V;  1SES A;  4RUF A;  1JPX A;  3UM7 A;  4HYO A;  2EIK C;  2Q6A A;  1QCE A;  3VBB A;  3LDD A;  3SJQ C;  3IFX A;  3AG4 B;  1KKD A;  1OCZ C;  3T2M A;  1YJW V;  1P4R A;  3K9A A;  5CBG A;  1OCC C;  5KUK A;  2M7W A;  3OUS A;  3ETD A;  5CN0 A;  5HFM A;  2EIJ B;  5KA6 A;  4UVB A;  5LHG A;  1V55 B;  4EKW A;  4RUE A;  2EZO A;  3SPG A;  3ABK B;  2LP7 A;  2OTJ V;  1QR9 A;  1L1F A;  1AI4 A;  1VQN V;  3RVZ A;  2WLL B;  5LGT A;  4H33 A;  3OEH G;  3RBZ A;  2X7R B;  3OFN G;  4I9W A;  3X2Q B;  2JJ1 G;  3F5W C;  3IC7 A;  1PL0 A;  4N21 A;  3P32 A;  3ZIA G;  3CCE V;  4UUJ C;  2ZR2 A;  2EJR A;  2ATK C;  3MD0 A;  3CME V;  4R6Z A;  2WWW A;  2X0L A;  3LSQ A;  3WFV A;  5B3S B;  1CPY A;  1EZJ A;  3TET A;  4RO2 A;  4DO2 A;  3OAA G;  5L3G A;  4HAM A;  1JX9 A;  1SZT A;  2IJH A;  1KP2 A;  1XL6 A;  2DYS B;  4GX5 A;  5J9P C;  5BZB A;  1V54 C;  3OEE G;  1Q82 W;  5H9C A;  4WFB V;  4JAU A;  3CC7 V;  1BHA A;  1OCR B;  2HG5 C;  3E8B A;  3B77 A;  3LUT B;  1DLB A;  1F4N A;  3AG3 B;  3ZRW B;  5B1A B;  3AEI A;  2P6J A;  2ZQM A;  1YI2 V;  1AJQ A;  5C93 A;  2QM7 A;  1TUE B;  3OMN B;  1YHQ V;  1OZ0 A;  3SPI A;  4X8A A;  3R65 A;  1VQO V;  1YTF D;  2HKO A;  1JCH A;  3OE7 G;  3SYA A;  2A0L A;  5IYC O;  1NR7 A;  3SPJ A;  1NJI W;  3I56 V;  1ROP A;  2QTO A;  5L3B A;  3E8G A;  2EBO A;  3FB5 C;  2OCC B;  3ASN C;  3H01 A;  1E1R G;  2NLJ C;  1ORQ C;  4MVQ A;  3HB3 B;  4JTC B;  1OCO B;  4WCE V;  4GCZ A;  3G6E V;  3ZN1 A;  3STL C;  1M56 B;  3G71 V;  1SER A;  3AG1 C;  2Q67 A;  3ML0 A;  2ZXW B;  4JGS A;  4KUM A;  3QO5 A;  4JAV A;  2XAF A;  1AJN A;  3CCS V;  1GM8 A;  1K7D A;  5IYD O;  3AG4 C;  2ZD9 A;  5L3F A;  1QBZ A;  1EBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...