3IGAC

Potassium channel kcsa-fab complex in li+ and k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transport protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3igaC00
4GX1A 4CBCA 4MVOA 3STZC 4G28B 4XDKA 1R3LC 3SYPA 4PA7A 3ABLC 4I9WA 2HFEC 2JK5C 2HG5C 3ABKC 3E8FA 2ZXWC 1G4YB 1R3IC 3K04A 4UUJC 4DXWA 3E89A 3OGCC 4RUFA 2WLMA 4WFGA 3SYOA 1ORQC 3E8BA 2HVJC 3FB5C 4PA4A 2Y69C 4KFMA 4MW3A 3F7YC 2A79B 2EINC 4XDJA 3SYQA 3T2MA 4RUEA 4PDLA 4PDVA 4J9ZB 2WLJA 2X6AA 4HYOA 2Q68A 4R6ZA 3IFXA 2AHYA 3SYAA 2DWEC 4GX2A 2ATKC 4G27B 3OUFA 4XDLA 4F4LA 2WLLB 2EIKC 3AG4C 2IH3C 3TETA 2BOCC 3K03A 1M56C 1V55C 1JVMA 2A0LA 4OXSA 3SJQC 4MW8A 1K4DC 2WLLA 4MVMA 3T1CA 2WLNA 4PA6A 4TWKA 5EC1C 3T4DA 3LDCA 1QLEC 4LCUC 3FB7C 4RAIA 2HVKC 3RVYA 5CBFA 1ZWIC 4JTCB 5EC2C 3F5WC 4X88A 5EBLC 1K4CC 3ABMC 3E8HA 3EFFK 3F7VC 1LNQA 3VOUA 4EKWA 2OCCC 2A9HA 5B3SC 3E86A 3ZJZA 2X6BA 5CBGA 2ITCC 2W0FC 3OR6C 3RVZA 4BW5A 3OUSA 4GX5A 5EBMC 2QTOA 3FB8C 4H37A 1J95A 3IGAC 3LUTB 2P7TC 3AG1C 5IY5C 3HPLC 1V54C 3SYCA 3RW0A 2WLIB 3SPGA 2IH1C 3ASNC 3SPIA 5KUKA 3K0DA 3PJSK 4R8CA 4MVUA 2K1EA 4MS2A 2BOBC 4RO2A 3SPJA 3UM7A 1OCOC 3AG2C 4MVQA 4P2ZA 3E8GA 4H33A 4PDMA 2EIMC 2HJFC 2WLIA 4P9OA 4MVZA 5B1AC 5BZBA 3T4ZA 3LDEA 3K0GA 4MVSA 4PA9A 5EK0A 3STLC 4J9YB 1XL6A 3FB6C 3SPCA 2Q67A 4P9PA 5E1AC 4QNHB 2AHZA 5CBHA 3RBZA 4MVRA 4WFFA 2DWDC 2Q6AA 2Q69A 2X6CA 1R3KC 2NLJC 3GB7C 3K06A 2DYSC 3K08A 4MTOA 1KKDA 2EILC 5KUMA 2H8PC 4JTDB 4WFEA 3R65A 1OCCC 3ASOC 1OCRC 4GX0A 5EBWC 3TCUA 1R3JC 3ZRSA 5J9PC 4QE9A 4X8AA 4MTGA 2WLHA 1XL4A 3OR7C 3UKMA 3JYCA 4R50A 1M57C 3LNMB 4MTFA 1P7BA 2QKSA 1OCZC 3KG2A 4MSWC 3E83A 3WG7C 2KB1A 1S5HC 4QE7A 2WLKA 4LBEC 4ZBMA 4X89A 3BEHA 1BL8A 4PA3A 2ITDC 2EIJC 4JTAB 4HZ3A 4PDRA 4WFHA 3X2QC 2R9RB 2YEVA 3SPHA 2ZD9A 4R7CA 3LDDA 4P30A 5B1BC 4LP8A 2DYRC 3AG3C
chains in the Genus database with same CATH superfamily
4J41A 4CBCA 4MVOA 3Q4HB 3D8CA 4DUYB 4PHZA 5LL6Y 2HFEC 3Q4HA 4F6EA 1PL0A 3BABA 1N34B 5LHIA 1Y74B 5LGUA 2V7QG 2AZ0A 1Y74A 3ZHUA 5JQGB 2LW7A 3TXQA 1JJOA 2AHYA 2QE7G 3VQVA 3CRQA 3CX5F 4I7ZB 4CH3A 1L8DA 2XASA 5JCOC 1W0KG 2KKWA 1P84F 3E2EA 5BR8O 1QCEA 2B1IA 4I5SA 4FLZA 3EFFK 3OEEG 4EKWA 2OCCC 2ITCC 2QTOA 1NR7A 2H94A 4H37A 2QKAA 5IE9A 1WPXA 2P4KA 1FD9A 5KUKA 4LFCO 2ILMA 3LSUA 2K1EA 2LGWA 1MNGA 4JI0B 2IJJA 4J11A 5EK0A 2Z5UA 2JGDB 2QJ1A 2EJ7A 1ZLZA 1MABG 2DWDC 2Q6AA 4JASA 3DTUB 3TJTA 1MG1A 1RSOB 1TAEA 5LGNA 2Q0AA 2JGDA 1GM7A 1MMMA 1FJGO 1RSOA 3N2GB 4JAUA 1GM9A 1AI6A 3CC2V 3UKMA 1RP3B 3CWBH 1Y76A 2ZNJA 5KMGB 1HNZO 4N21A 4DR6O 3MAQA 1ZX3A 4GT1A 2GDSA 4A5UB 5KMGA 1Y67A 4DR1O 3J81N 1CXZB 3X2QC 4DUZO 1HR0O 2QM7A 4OX9B 1VQ7V 3RN4A 1SZXA 2ZE8A 2CTRA 3B09A 2JK5C 1BQ0A 1WP8A 3AK2A 3E89A 1M1KW 4AHCA 3BHPA 2Z0AA 3C3TA 2UUBB 4O4LB 3QF7A 4GKJO 4CH4A 3ML0A 2JDIG 3CC7V 5JJNB 2BOCC 4GUNA 1XOUA 4JGSA 4GYCB 2DQ3A 3ZMSA 2OCCB 3ZMVA 4JI1B 3ZEDA 4MVMA 4JI8B 1COWG 2VS0A 1Y66A 4ICGA 1XNRO 3TXSA 3VOUA 3CS5A 1UPGA 1DGSA 1IBMB 1A32A 1NTZH 2PYJA 1Q8IA 4DUYO 4FFBB 1V54C 3GWOA 2IH1C 2A3QA 4L8JA 4JZGA 3CRRA 4MS2A 3OE7G 4O4HA 4IL6Z 4FFBA 1N34O 4IHJB 4PJ0Z 3BPZA 2YI8A 5EZYA 5L3CA 1FXHA 2UUCB 3LDEA 2VQEB 4IHJA 4AQYB 2RN9A 3TGUH 4WFFA 4LF8B 3K9SA 1YCIA 4K8ZA 3BVOA 1KKDA 2QWPB 2ZKOA 1GN2A 2V1DA 1Y6XA 1KD1W 2UU9B 1F51A 3X2QB 3JD0A 2AXTZ 1TA8A 4MTXA 3E83A 5EYPB 3WG7C 3JCZA 2ITDC 4JTAB 5EYPA 5KA6A 3WU2Z 3WB1A 4X64B 4PA7A 4WFAV 2QKCA 2Q73A 4RQEA 1NKDA 4JI0O 2UXCB 1ZL8B 3W7UA 3ABKC 2ZXWC 1R3IC 1HNXB 4UCRA 3OGCC 5LP6C 2EJRA 3BCCH 3ZRVA 1ZL8A 2CTPA 2Y4TA 3FAVB 1GN4A 1KC8W 1VQKV 2X6AA 2BSKB 4GX2A 3FAVA 4UFZA 1H8EG 4DR2B 2BSKA 1KQSU 5H2FZ 1EM1A 3JD4A 4NR1A 4YJ2B 2WLNA 3A2FA 4TWKA 1YI2V 3JALB 3J7AU 1Q6IA 3RVYA 1H8HG 5EC2C 1FXKC 1V54B 3OTFA 1HWYA 2HP8A 4ASUG 4YJ2A 4NXNB 3JALA 3QO8A 2QDOA 1F7YA 3RVZA 1SQBH 1QVGU 1T5EA 4OX9O 3IGAC 4J42A 1XQ8A 1XBLA 3ASNC 2GTSA 2ZE5A 4HNAB 1VARA 3FD9A 1U96A 1V9PA 5A2QN 2CK3G 2UUBO 4I55B 1VQPV 5DN6G 4Q20A 3SPCA 3OT7A 4I55A 1EFRG 1FXVA 4GCZA 4UCSA 5KUMA 3MHHC 3WG7B 4B3TB 4JI1O 3CRMA 4JI8O 5KHGA 3KCYA 1SERA 4MTFA 1SQPH 2IU3A 1MZFA 1QR8A 1IXBA 1MSWD 1IBMO 3P3NA 2UUAB 2ZXWB 4LWSB 1L1FA 2F66C 1I5XA 2PI5A 2DYRC 2YIBD 1OJHA 4LWSA 2R9IA 1RPOA 2FTKA 4FM2A 2FL4A 1FKAO 4DXWA 2CH7A 3HKCA 3K04A 1NVPB 4UXNA 2N04A 3RYFB 2UUCO 4JYAO 5KLVH 1XMOB 1FPOA 4PA4A 2CUGA 1BE3H 3ZBHA 4AQYO 1BHAA 2EINC 1EZJA 3ZMZA 4DK0A 3RYFA 4PDLA 4LF8O 4YHHB 1FXKB 1VMGA 2QWOB 4YJ3B 4XDLA 1G1XB 2NR5A 3ETGA 3TETA 2UU9O 3SGIA 1V55C 1JCHA 2WA3A 1JVMA 1PV0A 1TUEB 4YJ3A 4LNUA 4LCUC 4JTCB 1HW7A 1ZTEA 3ASNB 2YIBA 1PL4A 4B7EA 1GMGA 4JI5B 5JJEB 3E86A 4DV2B 4GKKB 1VF6C 2X6BA 1AB3A 3OUSA 4B3SB 4FLWA 4IIJB 3D36C 4U3JB 2UXCO 1HNXO 2ZNIA 5DECA 4X65B 4IIJA 5KHIA 1H2NA 2HJFC 5AG2A 1Q6HA 2EZPA 4P9OA 3MD0A 1NQTA 4LH6A 3FB6C 2DQ0A 2AHZA 3N2KA 2H3OA 4F6RA 4DR2O 1K73W 4LFBB 2F1MA 4DRXB 2LJ2A 4ZOLB 2K9PA 2DYRB 1ZUQA 3KG2A 4NXNO 1MZEA 1S5HC 1P49A 2KG7B 1THZA 1HNWB 2QWQB 2YXYA 2EIJC 3T1HB 2KG7A 2ZE6A 2CTWA 3G71V 2EINB 3VQXA 4OPHA 4K3AA 3SYPA 4X62B 1Z5VA 4BWAA 4UB6Z 3APQA 1G4YB 1N8RW 2YC0A 2GHYA 3JATA 1VQ4V 1V55B 1JA8A 4AI8A 4Z2WA 4YIPA 3WB0A 2W6JG 4HYOA 2N05A 4B3TO 2DWEC 2UXDO 4DV3O 4JPRA 3OEHG 3S3XA 4DYLA 3I55V 4LF5B 1NR1A 1ZWIC 1VQ8V 4G2KA 2RDCA 3IC7A 3G4SV 2UUAO 4JI6B 1GRJA 5IYBO 4KP4A 3BA9A 1GM8A 4OGQB 5H5NA 1P4RA 3H1JH 1WB8A 3FB8C 1G8MA 1YZBA 5IY5C 3ETEA 2IJHA 4EFBA 1SA0B 2FB5A 2VWKA 2JS3A 1VQ6V 2Y4UA 4MVQA 3E8GA 5L3BA 2VRZA 3JCUZ 3JSNA 1XMOO 1SA0A 1SQQH 1GKFA 3CCJV 2P4VA 1KP2A 1R3KC 4LF9O 3GB7C 1IBLO 3HKEA 2PYLA 5EBWC 1YSCA 3JD1A 5IJ9B 1Q82W 2RMKB 1AP5A 1URFA 3BA8A 2WLKA 1NT2B 3B2EE 4ZBMA 4JI5O 4PA3A 4DV2O 4HZ3A 5E79Z 2R9RB 4B3SO 4LP8A 4WFGA 3ZRXA 4G28B 2HJDA 4B08A 5LA6B 3I5DA 4RUFA 3E8BA 5LA6A 3FX7A 1VQMV 3JASA 2ZT9B 4UCVA 1JFFB 1X4TA 3CRCA 4U7OA 3K79A 4LFBO 1JFFA 3OUFA 1K9MW 5L3DA 3K03A 1KU9A 4MW8A 1K4DC 3T1CA 1JR9A 3E22A 3T4DA 2HVKC 2PY5A 5IY5B 2BE3A 1HNWO 5H9CA 2YIAA 4AILC 1LNQA 4I4TB 3T1HO 2XAQA 5IT9N 1M4UA 2W0FC 3CD6V 1EZVH 3QNEA 1N0NA 2P7TC 4U3FH 4X62O 3OTOB 3LSQA 2YDEA 3SPIA 3ZN0A 5JQGA 5D5QA 1IVSA 1Q6UA 3ABUA 1EN6A 4P2ZA 1B3QA 3CYOA 1MA1A 1YXBA 2R9AA 4X1IB 1IZ3A 4DR4B 2PZSA 2XTAA 4P9PA 2LO1A 5CA3A 3FYIB 1WAZA 5IWAB 1SKVA 4D7TA 2QM8A 3DSQA 1RPRA 2R70A 3W7SA 4D6TH 2ZR2A 3LNMB 2B9ZA 5L3EA 3EXAA 2QKSA 4JI6O 1DTOA 2MW2B 3BY6A 1M9NA 3QO5A 4WFHA 2HEPA 2HLDG 4MVSA 4UV9A 5CA1B 4PELA 3NR7A 4PD4F 4I50B 5HFLA 3ABLC 1NTKH 3N2GA 3AG3B 2ARHA 4I50A 3CCSV 2XOKG 1XNQB 3IC9A 4J9ZB 3IFXA 4B3MB 3CEIA 2Y0IA 2WLLB 1M56C 3I56V 3G6EV 3T1YB 1FFTB 1XEQA 2WLLA 5EC1C 2AW9A 1L0NH 1QQCA 3L74H 1HP8A 1SQFA 1WPBA 2Y0PA 2OTJV 3ETDA 2IJKA 2Q7EA 2EZOA 4UVBA 1ZSPA 1FS0G 1JX9A 2XAJA 4O4LA 5C8YB 5IYDO 5JCOA 3RFRA 4TV9B 4FLVA 5C8YA 3FKSG 3FFQA 2F23A 2EIMC 4MVZA 4FM0A 2YEVB 3H1LH 3RT3C 5LXTB 1FFXB 2QM4A 3OFNG 1AJNA 1FFXA 4WFEA 3R65A 3L75H 3SJBC 4CS3A 3OAAG 4UCTA 1TVKB 1AI5A 1OCZC 5L3FA 1TVKA 1K34A 2UXBB 3ABLB 3FYEB 3WB2A 4N23A 4DR5B 2EULA 3BAAA 3OTOO 2Q5ZA 2ZM6B 4NTYA 5GONB 4PI2A 3BFRA 4BAYA 2HG5C 1GH6A 5GONA 4UUJC 2E76B 4DR4O 5FNVB 1VIBA 1M56B 5IWAO 2ZINA 1BMFG 1PNKA 1R1BA 3JD3A 5FNVA 4UV8A 1GTOA 3SYAA 3QO7A 4LF4B 4FM1A 2ZR3A 2PF4E 4FZ0A 4D7SA 4OXSA 5A9GA 2ZCEA 4RAIA 1U97A 1IURA 1SESA 1EN4A 1XI1A 1NJIW 1K4CC 1Q86W 1K33A 1TUBB 3HB3B 3TK1A 3AG7A 3KCXA 2EIMB 5KAIZ 3OR6C 4H13B 1TUBA 1H38A 3SYCA 2WLIB 5KA5A 5KHHA 2WLIA 4UB8Z 1I5YA 1XNQO 3CC4V 2LGQA 1M93A 5E1AC 3B77A 5EIBC 2E75B 3K08A 2P6JA 4B3MO 1OCZB 3H01A 4JZ2A 3SJCC 2H8PC 3CSXA 1S76D 3T1YO 4QE9A 5KAFZ 2YS8A 1XL4A 4DK1A 3JAMN 4FLYA 3W7TA 3CMAV 4I9QA 4HNAA 1RFYA 2IBZH 4LBEC 4X89A 1VP7A 3BEHA 5CB4B 2X7RB 4CS4A 1QNMA 2EX3A 1AVMA 2ADPA 2NNUA 5CB4A 3CPWU 3M8AA 1GO3F 1Q43A 1NVPD 1XREA 2YXHA 1NBMG 5IYCO 1QBZA 1SRYA 1QVFU 1GK9A 2Y69C 3F7YC 1JJ2U 3IAYA 1DK1A 4NXMB 5IJ0B 4NTWA 3ABKB 1D2DA 2M6YA 4R6ZA 3O9OA 2F43G 1BSMA 2XT9A 5LP6B 4G27B 5J2TB 4J80A 1WP7A 5IJ0A 3L73H 5LP6A 5J2TA 3LDCA 4QJFB 3OMNB 4WFBV 4QGPA 5CBFA 1OV9A 4BIUA 2UXBO 2VQEO 1GN3A 3VBBA 3UT5B 3F7VC 5LGTA 1Q90D 3CXCU 4O2BB 2QWRB 3U0ZA 4DR5O 5B3SC 1WLEA 2VWJA 4BW5A 2OT5A 2ZM6O 1J95A 1GN6A 2FMLA 3VQWA 1F23A 3ZRWB 1CEZA 1FXKA 4YY3B 2D3OW 5F2VO 4PDMA 2X0LA 3ZRWA 2Y48A 3P30A 3K5LA 5BZBA 4NKGB 4PA9A 1I0HA 4Z1VA 2LP7A 1EBOA 2X6CA 1L0LH 1PPJH 4X64O 4LF4O 5FLXN 1S77D 4IYIA 4LC1A 5BY1A 3AK1A 1OCRC 4DR3B 3ZRSA 3A0RA 2FYUH 2WLHA 3OR7C 4PI0A 2OIEA 5KX5B 4MSWC 4U3JA 1Z5WA 2YI9A 1BT8A 5KX5A 2KSDA 2E5LB 1M5IA 1KYOF 3THOA 5JH7B 3SPHA 4WF9V 2QTSA 2Y69B 5JH7A 1R6NA 2DW4A 1FYJA 1IBKB 4LF6B 1Z2GA 1K92A 1S5LZ 5J2UB 4DRXA 2LQTA 4ZOLA 2PUSA 3MHSC 3CP1A 5J2UA 3JAKB 4ZIBA 2C2AA 1Q5OA 3SDLA 4CS2A 1X59A 5CMUA 1KP3A 3SJAC 1KBHA 4KHPB 4JAAA 4DV1B 4IYHA 4X20B 5B3SB 4PA6A 1YTFB 1JQ0A 2JIZG 4JI4B 4K0KB 5B1NA 3P3PA 1VQ9V 2L6LA 2A9HA 1Q7YW 1B6QA 2WAMA 4RQFA 5EBMC 3LUTB 3AG1C 3KKYA 4CH5A 1YJNV 1K5QA 1SETA 3CCMV 4EB6B 2F4VB 4NB5A 2VQFB 1AR5A 2W0XA 3T4ZA 1OCRB 4NXMO 1VF6A 4EB6A 1DLBA 3A8TA 1BCCH 4QNHB 4J7ZA 4DV4B 2Q69A 3D36A 2DYSC 2EILC 2PI4A 2P90A 3ASOC 4GX0A 2O57A 3WFVA 4I0XB 1F4MA 3AEIA 2G38A 4I0XA 3G67A 3G6BA 4IT5A 1YVWA 4YHHO 1OHHG 2JJ1G 2ADQB 4NVPA 1F4NA 5J9PC 3E35A 5K1XA 4YY3O 1XILA 2EIJB 3B8MA 1BHBA 1W2BU 1WB7A 2YICA 1KKCA 3CCRV 3E8FA 2RQ6A 1W59A 1NU1H 1CP9A 2HVJC 2RNBA 3FB5C 3CJHB 2AGAA 4KFMA 5IJ9A 3T2MA 4YXWG 1NI8A 2QEXV 4GKKO 3CHXA 2CAZC 2QGNA 5HFMA 3L71H 1HR0B 3JAWB 5D5PA 1QHTA 1YDXA 3HKDB 4W4KA 4X65O 1HDJA 2W6IG 1N4CA 2Z3YA 3AG1B 2Q7HA 2E5LO 5B66Z 3LSSA 1I08A 4JI3B 1IX9A 1NH2B 5L3GA 3ETQA 1WJZA 1JPXA 4FPPA 1IBKO 4LF6O 4R8CA 2CDYA 3UM7A 2DYSB 5KHJA 1OCOC 2EILB 1VF5B 2F95B 5B5EZ 2Q4PA 2OIGA 4C7UA 2ZQMA 1J5EB 3ASOB 1PD3A 2LFRA 3GWKC 4DR7B 3BRCA 2ZDIC 3S3WA 2A06H 2HR3A 4KHPO 4I4TA 1D5NA 1CPYA 4DV1O 3TCUA 4X8AA 3DGEA 1TGOA 3JYCA 1R6KA 5DEDA 4JI4O 4K0KO 3ZMUA 3R66A 1AJPA 1XDCA 1LUWA 1Q81W 3K5MA 1LUVA 3H1HH 4QPJA 3EVKA 2DMXA 4K8XA 5LOVB 2Q9LA 2IW5A 2YUAA 4X1IA 2ZD9A 4TQFA 5IYZB 4WCEV 1NZ6A 5FPRA 3CCLV 3JD2A 5JVDB 5LOVA 1SF9A 4FLTA 3D3QA 5IYZA 3CXHF 3OGIB 4LF5O 2F4VO 2VQFO 1D5AA 5JVDA 3ZHVA 1I94B 5FL7G 1ORQC 4O4JB 1H2LA 4XDJA 2A79B 4RUEA 3CMEV 1I7FA 4DV4O 3OD4A 1M90W 1BGYH 4O4JA 4X66B 2NN4A 4FLUA 2ODMA 3VQYA 2IH3C 1ROPA 3N27A 4DV6B 4DW0A 1QLEC 1IXMA 5CA1A 4BR6A 1G6UA 5LMNB 1US6A 1N36B 3E8HA 5TISZ 1OCOB 1PNMA 1EN5A 3RYCB 4TUYB 4GX5A 3A0HZ 3IJ4A 3RYIB 3RYCA 1Y76B 4TUYA 4FJCC 2Q0OC 1LR1A 4MVUA 3SPJA 5IDJA 3RYIA 4DO2A 1JMKC 2WPDG 1R6TA 2ZDIA 4TOIA 2JS5A 3K0GA 1RM1C 4J9YB 4X9QA 2WSSG 2GSMB 1QLNA 3U10A 2GV9A 4MTOA 4QIWF 2AZ2A 3B4SA 3H9VA 1K3EA 1XHZA 3J80N 1OCCC 2ZIOA 3OW2U 4JI7B 3CB2A 2CGNA 4XBFA 4UVAA 4TV9A 1P7BA 2OTLV 4JI3O 5LYJB 4QE7A 5CA0B 4TSFG 3ZHRA 5LYJA 3LNNA 2YEVA 5CA0A 1AR4A 5LXTA 4R50A 4X1KB 4KXRA 3STZC 3ABTA 4OPAA 3G80A 5DM6V 4X1KA 2N74A 4I9WA 2KQXA 4GLXA 1J5EO 2LFSA 2WLMA 3SYOA 1ENVA 1AJQA 4JYBA 3K3WA 4DR7O 1QLEB 3DC6A 2Q68A 2ZE7A 3B8NA 4PV1B 3M7MX 4O4HB 4F4LA 1H2MA 2EIKC 2IM9A 1UFIA 1GAXA 2A0LA 2WWWA 5EZYB 4ZHQB 3P32A 1AI4A 2P5OA 1DF5A 4ZHQA 4JYAB 1K97A 3ABMC 2R72A 4L87A 4BW9A 1E1QG 4JYCA 4LFAB 3K58A 2QWNB 3C90A 1RM1B 3UCSC 3HPLC 3W7WA 3QG5A 4J7KA 3M99B 3AG2C 1I94O 1P7GA 2FKXA 2QA4V 3OM3B 2RCVA 1OCCB 2OWOA 1VQNV 5BMVB 5ITZB 2P06A 4X66O 2M7WA 3ZCCA 5BMVA 5ITZA 1AI7A 4TV8B 1SS3A 2DE0X 4BIOA 3A0BZ 2WA4A 4TV8A 2F93B 4DV6O 1R3JC 5GW7A 3CCVV 4MTGA 4JF3A 4J10A 2D2CB 2CE4A 5LMNO 1M57C 1O9HA 3K59A 4ZI7B 4DV7B 4CH6A 3CCQV 1N36O 2PGGA 2JGUA 4ZI7A 4LF7B 3MDSA 1KUQA 3LDDA 5GTHZ 5B1BC 4GX1A 5H6RA 5KHKA 3JARB 4IGGA 3CRAA 3ZIAG 1N0JA 4QPKA 2EIKB 3JARA 4MW3A 3SYQA 1WN7A 5LHHA 3F5TA 1VQLV 3AG4C 3ABMB 1S72V 4BIZA 4JI7O 4H0LB 2E74B 5LMUB 5LHGA 3C3SA 4X1YB 3W7XA 3FB7C 3PN1A 4X88A 2LW1A 1O9GA 3DC5A 4X1YA 1IDSA 1XHXA 3AG2B 2XAGA 1YJWV 3ZJZA 5EIBD 3NXSA 5CN0A 1YHQV 2HKOA 4JV5B 1K8AW 1PKXA 2UXDB 4DV3B 3RW0A 3ICXA 3QTCA 3OMAB 2CTQA 1E1RG 2IJIA 3DXRB 4H33A 4TT3G 2OYQA 1AP6A 4GZRB 3UQ8A 4O2AB 2DN9A 3DXRA 2IU0A 2YSUB 1BZKA 1YEWA 4O2AA 4UCOA 1M57B 2JVDA 3CE2A 3UT5A 4JTDB 5LBQA 5FPOA 4O2BA 2CH7B 3HKCB 4DV0B 4FLXA 2XUMA 1H2SB 2MK3A 4B3RB 2BTOA 1VF7A 5B1BB 2QSAA 4YIOA 2V4DA 4RWUA 2GBOA 2B1GA 4EEQA 5B1OA 3UO3A 3K57A 4LFAO 1PM9A 1S3JA 2HHHB 4MT8A 4JI2B 4LF9B 3D3IA 1IBLB 4HBNA 1ZAUA 4LNUB 2ETNA 1N32B 1SZTA 1R3LC 3RGBA 4ABMA 1SQGA 1YITV 3H1IH 3AG4B 4W4LA 1PP9H 2CGOA 2BTQB 2GTAA 4PDVA 1K5SA 2XAFA 4EFEA 2BTQA 1B04A 3RYHB 1H2GA 1B06A 1YTFD 2OCHA 4FMTA 1BQZA 3RYHA 4UVCA 1YJ9V 4KUMA 4DV7O 1N33B 3F5WC 3CCEV 3N2KB 2YXLA 3RWRD 4F6RB 2P22C 4LF7O 3L9DA 1K7DA 4CC5A 4LH7A 5JWPA 4NTXA 3JAKA 4DV5B 4J7JA 1XMQB 4HAMA 3SPGA 1E79G 4Q6GA 3K0DA 1W0JG 1Y4MA 2Q7GA 4RO2A 4FZ1A 4UCUA 2YIDA 5B1AC 4X20A 1QR9A 2QR4A 3STLC 3UO2A 3ZS8C 2L35A 2Q67A 3ZX6A 3L72H 3RBZA 4MVRA 3AK3A 4FFKA 4FIPC 1VQ5V 3HKBB 5LMUO 3JATB 1AROP 4CC6A 2UXNA 3HKBA 3SR2C 3ZHTA 4TQDA 1VEWA 2JRIA 2KB1A 1WA8B 5BR8B 1SC5B 3QVNA 3L70H 1AILA 4KL1A 3ZHQA 1WA8A 4JV5O 1PNLA 4P30A 2XNDG 3GVMA 3KZIZ 1Q3EA 4XDKA 1H2KA 3JSLA 1FAFA 1DF4A 4LFCB 4O4IB 2ZIMA 4CZZA 3ZMTA 2Q8VA 4O4IA 2RJZA 4FVMA 3EHBB 2B5UA 2WLJA 4DW1A 4E2LA 2ATKC 4DV0O 4Z1MG 3O65A 2EBOA 1UJWB 2XAHA 4B3RO 1FJGB 2JEXA 1XUQA 3SJQC 3K5OA 1NH2D 1KB9F 4K35A 1HNZB 1SQXH 4DR6B 2E3CA 5EBLC 2HHHO 2BCCH 3HKEB 4JI2O 5K1PA 5B1AB 5CBGA 4DR1B 5BXZA 1S5JA 3CJHA 3K9AA 1N32O 1OZ0A 4DUZB 5GTIZ 3U11A 2DJVA 1R73A 4DR3O 3H1KH 3PJSK 3K5NA 3APOA 1WNSA 2BOBC 1S0VA 3ZN1A 1QU7A 3JAWA 4E4EA 1NS1A 1KECA 3HKDA 1SQVH 4NYKA 4WBNB 1YIJV 1XL6A 4U7NA 5CBHA 4H44B 4ZKIA 4GKJB 1BS3A 2NLJC 3K06A 4WBNA 4LR3A 2DOSA 3HR0A 5C93A 3CCUV 5H6QA 4FK5C 1MOFA 4JYYA 3B40A 2GUZB 4B7KA 2XHBA 1N33O 1NTMH 2UXXA 3JASB 2JJ2G 2GUZA 1JOYA 2P67A 4JAVA 1XNRB 2JEUA 1VQOV 2A7WA 3ZHSA 1AR1B 5JJJB 1BL8A 4PDRA 3OMIB 1YF2A 1KMIZ 4DV5O 4R7CA 2PTMA 1XMQO 1MSDA 3E22B 3AG3C
chains in the Genus database with same CATH topology
2EINB 4CBCA 4MVOA 1GO3F 3STZC 3ABTA 1NVPD 5DM6V 3SYPA 1NBMG 5IYCO 1QBZA 1SRYA 4I9WA 2HFEC 1G4YB 1N8RW 2LFSA 1PL0A 2GHYA 2WLMA 3SYOA 1ENVA 1AJQA 1VQ4V 4JYBA 1V55B 5LHIA 1QVFU 1GK9A 2Y69C 3K3WA 3F7YC 1JJ2U 5LGUA 2V7QG 2W6JG 1QLEB 4HYOA 3ABKB 2Q68A 4R6ZA 2AHYA 2F43G 2DWEC 2QE7G 3B8NA 4G27B 4F4LA 2EIKC 4JPRA 2A0LA 2WWWA 3OEHG 2XASA 3P32A 1W0KG 3I55V 3LDCA 1NR1A 1AI4A 4QJFB 3OMNB 4WFBV 5CBFA 1DF5A 1ZWIC 4BIUA 3E2EA 1VQ8V 1QCEA 2B1IA 4G2KA 4I5SA 1K97A 3VBBA 3ABMC 3EFFK 3IC7A 3F7VC 3G4SV 5LGTA 4L87A 3OEEG 5IYBO 4EKWA 4KP4A 2OCCC 3CXCU 1GM8A 1E1QG 4JYCA 5B3SC 1WLEA 2ITCC 1P4RA 4BW5A 2QTOA 3FB8C 2OT5A 1RM1B 1NR7A 1J95A 2H94A 4H37A 1G8MA 1WPXA 5IY5C 3HPLC 3W7WA 1F23A 3ZRWB 3ETEA 2IJHA 1CEZA 5KUKA 1FXKA 3M99B 2K1EA 2D3OW 1VQ6V 3AG2C 4MVQA 3E8GA 4PDMA 2X0LA 5L3BA 2QA4V 3OM3B 3ZRWA 2Y48A 2IJJA 3P30A 5BZBA 1OCCB 1VQNV 4PA9A 5EK0A 1GKFA 2Z5UA 3CCJV 2M7WA 3ZCCA 1MABG 1KP2A 2DWDC 2Q6AA 1AI7A 1EBOA 1R3KC 2LP7A 2X6CA 1MG1A 3DTUB 3GB7C 4JASA 5LGNA 1GM7A 1S77D 4LC1A 1OCRC 5EBWC 1YSCA 1R3JC 3A0RA 4JAUA 3ZRSA 1GM9A 5GW7A 3JD1A 4MTGA 3CCVV 2WLHA 1AI6A 4JF3A 3CC2V 3OR7C 3UKMA 1Q82W 1M57C 4N21A 4MSWC 3CCQV 4GT1A 2WLKA 4ZBMA 4PA3A 4HZ3A 3X2QC 2R9RB 3SPHA 3LDDA 4WF9V 5B1BC 2QM7A 4LP8A 2Y69B 4WFGA 3ZRXA 4GX1A 5H6RA 1R6NA 2DW4A 4G28B 1VQ7V 3ZIAG 1K92A 4QPKA 2JK5C 2EIKB 3E89A 4RUFA 1M1KW 3E8BA 3MHSC 1VQMV 4MW3A 3SYQA 3CP1A 2C2AA 4U7OA 5LHHA 3ML0A 1VQLV 2JDIG 5CMUA 3CC7V 1KP3A 3K79A 3OUFA 1K9MW 3AG4C 3ABMB 5L3DA 1S72V 4BIZA 2BOCC 4JGSA 3K03A 2DQ3A 3ZMSA 2OCCB 3ZMVA 5B3SB 4MW8A 1K4DC 5LHGA 4MVMA 3T1CA 4PA6A 1COWG 3T4DA 1JQ0A 1YTFB 2JIZG 3W7XA 1Y66A 3FB7C 2HVKC 5B1NA 1VQ9V 5IY5B 4X88A 5H9CA 1LNQA 3VOUA 3AG2B 2XAGA 2XAQA 1YJWV 2A9HA 1Q7YW 1B6QA 2WAMA 4RQFA 3ZJZA 2W0FC 3CD6V 3NXSA 5CN0A 5EBMC 3QNEA 1YHQV 2HKOA 1K8AW 1PKXA 2P7TC 3LUTB 3AG1C 1V54C 3RW0A 3GWOA 2IH1C 3LSQA 3SPIA 3OMAB 3ZN0A 1E1RG 4MS2A 2IJIA 3OE7G 1YJNV 3ABUA 1K5QA 4P2ZA 1SETA 4H33A 4TT3G 3CCMV 3CYOA 3T4ZA 1OCRB 5L3CA 1FXHA 3LDEA 2IU0A 1DLBA 4P9PA 5CA3A 2YSUB 4QNHB 3FYIB 2QM8A 1M57B 4WFFA 2Q69A 3D36A 2DYSC 1KKDA 2EILC 4JTDB 2PI4A 5LBQA 1RPRA 2V1DA 2P90A 3ASOC 4GX0A 3WFVA 1KD1W 3W7SA 1F51A 1F4MA 2MK3A 3JD0A 3X2QB 2ZR2A 3AEIA 5B1BB 3LNMB 5L3EA 2QKSA 4MTXA 3E83A 3WG7C 3JCZA 2B1GA 1DTOA 5B1OA 3BY6A 1M9NA 3QO5A 2ITDC 4JTAB 1S3JA 5KA6A 1OHHG 4WFHA 2JJ1G 4MT8A 3D3IA 2HLDG 1F4NA 4MVSA 5J9PC 3E35A 4PA7A 4UV9A 4WFAV 1SZTA 2EIJB 3B8MA 1R3LC 1NKDA 4PELA 4RQEA 1BHBA 5HFLA 1W2BU 3ABLC 1YITV 3W7UA 3ABKC 3CCRV 3E8FA 2ZXWC 1R3IC 3AG4B 3OGCC 3AG3B 2EJRA 3ZRVA 1CP9A 2HVJC 3FB5C 4KFMA 3CCSV 2XOKG 3T2MA 1KC8W 4PDVA 4YXWG 1K5SA 4J9ZB 2QEXV 2XAFA 1VQKV 2X6AA 3IFXA 4GX2A 5HFMA 1H2GA 2WLLB 1H8EG 1YTFD 1M56C 3I56V 1KQSU 3G6EV 4FMTA 3JD4A 1FFTB 4UVCA 1YJ9V 2WLLA 2WLNA 4KUMA 4TWKA 5EC1C 1YI2V 3RVYA 2W6IG 1H8HG 1FXKC 2Z3YA 5EC2C 3AG1B 3F5WC 1V54B 1HWYA 3CCEV 4ASUG 3LSSA 1NH2B 5L3GA 3QO8A 2OTJV 3ETDA 2IJKA 1K7DA 2EZOA 4UVBA 1FS0G 1JX9A 3RVZA 2XAJA 5IYDO 1JPXA 1QVGU 3IGAC 4FPPA 4HAMA 3SPGA 1E79G 3ASNC 3FKSG 3K0DA 4R8CA 1W0JG 1Y4MA 4RO2A 3UM7A 2DYSB 1OCOC 2EILB 2EIMC 4MVZA 5B1AC 2CK3G 2ZQMA 1VQPV 3ASOB 2YEVB 1QR9A 1PD3A 2LFRA 3STLC 5DN6G 4Q20A 2Q67A 3SPCA 3RBZA 1EFRG 2ZDIC 4MVRA 1FXVA 4GCZA 3OFNG 1AJNA 2HR3A 3MHHC 5KUMA 3WG7B 4FIPC 4WFEA 3R65A 1VQ5V 1CPYA 3TCUA 4X8AA 3DGEA 1AROP 2UXNA 3OAAG 3JYCA 1R6KA 1SERA 3ZMUA 1AI5A 4MTFA 1OCZC 1AJPA 2IU3A 5L3FA 1Q81W 1QR8A 2KB1A 1MSWD 1K34A 3ABLB 3FYEB 4QPJA 2ZXWB 4N23A 1L1FA 2IW5A 2ZD9A 4WCEV 1PNLA 4P30A 1I5XA 2PI5A 2DYRC 2XNDG 3CCLV 3JD2A 4XDKA 2R9IA 1RPOA 2FTKA 1DF4A 4BAYA 2HG5C 4DXWA 3K04A 4CZZA 1NVPB 4UUJC 3ZMTA 4UXNA 5FL7G 1ORQC 1M56B 4PA4A 1BHAA 4XDJA 2A79B 1EZJA 1BMFG 2EINC 3ZMZA 4RUEA 3CMEV 4PDLA 1M90W 1PNKA 3EHBB 3JD3A 2B5UA 2WLJA 4E2LA 4UV8A 1FXKB 1GTOA 3SYAA 3QO7A 2ATKC 4XDLA 4Z1MG 2ZR3A 3ETGA 2IH3C 3TETA 2EBOA 1UJWB 1V55C 1JCHA 2XAHA 1JVMA 1TUEB 2JEXA 1ROPA 4OXSA 3SJQC 1NH2D 1QLEC 4LCUC 1IXMA 4RAIA 1SESA 4JTCB 3ASNB 5EBLC 1K4CC 3E8HA 1Q86W 1NJIW 1K33A 3HB3B 3TK1A 1OCOB 1GMGA 1PNMA 2EIMB 3E86A 5B1AB 2X6BA 5CBGA 3OR6C 3K9AA 3OUSA 4GX5A 1H38A 1OZ0A 1R73A 3SYCA 2WLIB 5KA5A 4FJCC 3PJSK 4MVUA 3SPJA 2BOBC 5IDJA 4DO2A 1S0VA 3ZN1A 2WLIA 2HJFC 2WPDG 2EZPA 4P9OA 3MD0A 2ZDIA 1I5YA 1KECA 1NQTA 3K0GA 1RM1C 3CC4V 1YIJV 4J9YB 1XL6A 3FB6C 2WSSG 2DQ0A 2GSMB 3B77A 4U7NA 5E1AC 1QLNA 2AHZA 5CBHA 4ZKIA 3K08A 2P6JA 2NLJC 3K06A 1OCZB 3H01A 4MTOA 5C93A 3CCUV 5H6QA 4QIWF 2H8PC 4FK5C 1K73W 1MOFA 1K3EA 1OCCC 1S76D 4QE9A 3OW2U 2UXXA 1XL4A 4XBFA 2JJ2G 2DYRB 4UVAA 1JOYA 1P7BA 3KG2A 3W7TA 3CMAV 2OTLV 2P67A 4JAVA 2JEUA 1VQOV 1S5HC 4QE7A 1AR1B 4LBEC 1THZA 4X89A 3BEHA 1BL8A 4TSFG 4PDRA 2EIJC 3OMIB 2X7RB 2YEVA 4R7CA 2NNUA 3G71V 4R50A 3CPWU 3AG3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX1 A;  4CBC A;  4MVO A;  3STZ C;  4G28 B;  4XDK A;  1R3L C;  3SYP A;  4PA7 A;  3ABL C;  4I9W A;  2HFE C;  2JK5 C;  2HG5 C;  3ABK C;  3E8F A;  2ZXW C;  1G4Y B;  1R3I C;  3K04 A;  4UUJ C;  4DXW A;  3E89 A;  3OGC C;  4RUF A;  2WLM A;  4WFG A;  3SYO A;  1ORQ C;  3E8B A;  2HVJ C;  3FB5 C;  4PA4 A;  2Y69 C;  4KFM A;  4MW3 A;  3F7Y C;  2A79 B;  2EIN C;  4XDJ A;  3SYQ A;  3T2M A;  4RUE A;  4PDL A;  4PDV A;  4J9Z B;  2WLJ A;  2X6A A;  4HYO A;  2Q68 A;  4R6Z A;  3IFX A;  2AHY A;  3SYA A;  2DWE C;  4GX2 A;  2ATK C;  4G27 B;  3OUF A;  4XDL A;  4F4L A;  2WLL B;  2EIK C;  3AG4 C;  2IH3 C;  3TET A;  2BOC C;  3K03 A;  1M56 C;  1V55 C;  1JVM A;  2A0L A;  4OXS A;  3SJQ C;  4MW8 A;  1K4D C;  2WLL A;  4MVM A;  3T1C A;  2WLN A;  4PA6 A;  4TWK A;  5EC1 C;  3T4D A;  3LDC A;  1QLE C;  4LCU C;  3FB7 C;  4RAI A;  2HVK C;  3RVY A;  5CBF A;  1ZWI C;  4JTC B;  5EC2 C;  3F5W C;  4X88 A;  5EBL C;  1K4C C;  3ABM C;  3E8H A;  3EFF K;  3F7V C;  1LNQ A;  3VOU A;  4EKW A;  2OCC C;  2A9H A;  5B3S C;  3E86 A;  3ZJZ A;  2X6B A;  5CBG A;  2ITC C;  2W0F C;  3OR6 C;  3RVZ A;  4BW5 A;  3OUS A;  4GX5 A;  5EBM C;  2QTO A;  3FB8 C;  4H37 A;  1J95 A;  3IGA C;  3LUT B;  2P7T C;  3AG1 C;  5IY5 C;  3HPL C;  1V54 C;  3SYC A;  3RW0 A;  2WLI B;  3SPG A;  2IH1 C;  3ASN C;  3SPI A;  5KUK A;  3K0D A;  3PJS K;  4R8C A;  4MVU A;  2K1E A;  4MS2 A;  2BOB C;  4RO2 A;  3SPJ A;  3UM7 A;  1OCO C;  3AG2 C;  4MVQ A;  4P2Z A;  3E8G A;  4H33 A;  4PDM A;  2EIM C;  2HJF C;  2WLI A;  4P9O A;  4MVZ A;  5B1A C;  5BZB A;  3T4Z A;  3LDE A;  3K0G A;  4MVS A;  4PA9 A;  5EK0 A;  3STL C;  4J9Y B;  1XL6 A;  3FB6 C;  3SPC A;  2Q67 A;  4P9P A;  5E1A C;  4QNH B;  2AHZ A;  5CBH A;  3RBZ A;  4MVR A;  4WFF A;  2DWD C;  2Q6A A;  2Q69 A;  2X6C A;  1R3K C;  2NLJ C;  3GB7 C;  3K06 A;  2DYS C;  3K08 A;  4MTO A;  1KKD A;  2EIL C;  5KUM A;  2H8P C;  4JTD B;  4WFE A;  3R65 A;  1OCC C;  3ASO C;  1OCR C;  4GX0 A;  5EBW C;  3TCU A;  1R3J C;  3ZRS A;  5J9P C;  4QE9 A;  4X8A A;  4MTG A;  2WLH A;  1XL4 A;  3OR7 C;  3UKM A;  3JYC A;  4R50 A;  1M57 C;  3LNM B;  4MTF A;  1P7B A;  2QKS A;  1OCZ C;  3KG2 A;  4MSW C;  3E83 A;  3WG7 C;  2KB1 A;  1S5H C;  4QE7 A;  2WLK A;  4LBE C;  4ZBM A;  4X89 A;  3BEH A;  1BL8 A;  4PA3 A;  2ITD C;  2EIJ C;  4JTA B;  4HZ3 A;  4PDR A;  4WFH A;  3X2Q C;  2R9R B;  2YEV A;  3SPH A;  2ZD9 A;  4R7C A;  3LDD A;  4P30 A;  5B1B C;  4LP8 A;  2DYR C;  3AG3 C; 
#chains in the Genus database with same CATH topology
 4J41 A;  4CBC A;  4MVO A;  3Q4H B;  3D8C A;  4DUY B;  4PHZ A;  5LL6 Y;  2HFE C;  3Q4H A;  4F6E A;  1PL0 A;  3BAB A;  1N34 B;  5LHI A;  1Y74 B;  5LGU A;  2V7Q G;  2AZ0 A;  1Y74 A;  3ZHU A;  5JQG B;  2LW7 A;  3TXQ A;  1JJO A;  2AHY A;  2QE7 G;  3VQV A;  3CRQ A;  3CX5 F;  4I7Z B;  4CH3 A;  1L8D A;  2XAS A;  5JCO C;  1W0K G;  2KKW A;  1P84 F;  3E2E A;  5BR8 O;  1QCE A;  2B1I A;  4I5S A;  4FLZ A;  3EFF K;  3OEE G;  4EKW A;  2OCC C;  2ITC C;  2QTO A;  1NR7 A;  2H94 A;  4H37 A;  2QKA A;  5IE9 A;  1WPX A;  2P4K A;  1FD9 A;  5KUK A;  4LFC O;  2ILM A;  3LSU A;  2K1E A;  2LGW A;  1MNG A;  4JI0 B;  2IJJ A;  4J11 A;  5EK0 A;  2Z5U A;  2JGD B;  2QJ1 A;  2EJ7 A;  1ZLZ A;  1MAB G;  2DWD C;  2Q6A A;  4JAS A;  3DTU B;  3TJT A;  1MG1 A;  1RSO B;  1TAE A;  5LGN A;  2Q0A A;  2JGD A;  1GM7 A;  1MMM A;  1FJG O;  1RSO A;  3N2G B;  4JAU A;  1GM9 A;  1AI6 A;  3CC2 V;  3UKM A;  1RP3 B;  3CWB H;  1Y76 A;  2ZNJ A;  5KMG B;  1HNZ O;  4N21 A;  4DR6 O;  3MAQ A;  1ZX3 A;  4GT1 A;  2GDS A;  4A5U B;  5KMG A;  1Y67 A;  4DR1 O;  3J81 N;  1CXZ B;  3X2Q C;  4DUZ O;  1HR0 O;  2QM7 A;  4OX9 B;  1VQ7 V;  3RN4 A;  1SZX A;  2ZE8 A;  2CTR A;  3B09 A;  2JK5 C;  1BQ0 A;  1WP8 A;  3AK2 A;  3E89 A;  1M1K W;  4AHC A;  3BHP A;  2Z0A A;  3C3T A;  2UUB B;  4O4L B;  3QF7 A;  4GKJ O;  4CH4 A;  3ML0 A;  2JDI G;  3CC7 V;  5JJN B;  2BOC C;  4GUN A;  1XOU A;  4JGS A;  4GYC B;  2DQ3 A;  3ZMS A;  2OCC B;  3ZMV A;  4JI1 B;  3ZED A;  4MVM A;  4JI8 B;  1COW G;  2VS0 A;  1Y66 A;  4ICG A;  1XNR O;  3TXS A;  3VOU A;  3CS5 A;  1UPG A;  1DGS A;  1IBM B;  1A32 A;  1NTZ H;  2PYJ A;  1Q8I A;  4DUY O;  4FFB B;  1V54 C;  3GWO A;  2IH1 C;  2A3Q A;  4L8J A;  4JZG A;  3CRR A;  4MS2 A;  3OE7 G;  4O4H A;  4IL6 Z;  4FFB A;  1N34 O;  4IHJ B;  4PJ0 Z;  3BPZ A;  2YI8 A;  5EZY A;  5L3C A;  1FXH A;  2UUC B;  3LDE A;  2VQE B;  4IHJ A;  4AQY B;  2RN9 A;  3TGU H;  4WFF A;  4LF8 B;  3K9S A;  1YCI A;  4K8Z A;  3BVO A;  1KKD A;  2QWP B;  2ZKO A;  1GN2 A;  2V1D A;  1Y6X A;  1KD1 W;  2UU9 B;  1F51 A;  3X2Q B;  3JD0 A;  2AXT Z;  1TA8 A;  4MTX A;  3E83 A;  5EYP B;  3WG7 C;  3JCZ A;  2ITD C;  4JTA B;  5EYP A;  5KA6 A;  3WU2 Z;  3WB1 A;  4X64 B;  4PA7 A;  4WFA V;  2QKC A;  2Q73 A;  4RQE A;  1NKD A;  4JI0 O;  2UXC B;  1ZL8 B;  3W7U A;  3ABK C;  2ZXW C;  1R3I C;  1HNX B;  4UCR A;  3OGC C;  5LP6 C;  2EJR A;  3BCC H;  3ZRV A;  1ZL8 A;  2CTP A;  2Y4T A;  3FAV B;  1GN4 A;  1KC8 W;  1VQK V;  2X6A A;  2BSK B;  4GX2 A;  3FAV A;  4UFZ A;  1H8E G;  4DR2 B;  2BSK A;  1KQS U;  5H2F Z;  1EM1 A;  3JD4 A;  4NR1 A;  4YJ2 B;  2WLN A;  3A2F A;  4TWK A;  1YI2 V;  3JAL B;  3J7A U;  1Q6I A;  3RVY A;  1H8H G;  5EC2 C;  1FXK C;  1V54 B;  3OTF A;  1HWY A;  2HP8 A;  4ASU G;  4YJ2 A;  4NXN B;  3JAL A;  3QO8 A;  2QDO A;  1F7Y A;  3RVZ A;  1SQB H;  1QVG U;  1T5E A;  4OX9 O;  3IGA C;  4J42 A;  1XQ8 A;  1XBL A;  3ASN C;  2GTS A;  2ZE5 A;  4HNA B;  1VAR A;  3FD9 A;  1U96 A;  1V9P A;  5A2Q N;  2CK3 G;  2UUB O;  4I55 B;  1VQP V;  5DN6 G;  4Q20 A;  3SPC A;  3OT7 A;  4I55 A;  1EFR G;  1FXV A;  4GCZ A;  4UCS A;  5KUM A;  3MHH C;  3WG7 B;  4B3T B;  4JI1 O;  3CRM A;  4JI8 O;  5KHG A;  3KCY A;  1SER A;  4MTF A;  1SQP H;  2IU3 A;  1MZF A;  1QR8 A;  1IXB A;  1MSW D;  1IBM O;  3P3N A;  2UUA B;  2ZXW B;  4LWS B;  1L1F A;  2F66 C;  1I5X A;  2PI5 A;  2DYR C;  2YIB D;  1OJH A;  4LWS A;  2R9I A;  1RPO A;  2FTK A;  4FM2 A;  2FL4 A;  1FKA O;  4DXW A;  2CH7 A;  3HKC A;  3K04 A;  1NVP B;  4UXN A;  2N04 A;  3RYF B;  2UUC O;  4JYA O;  5KLV H;  1XMO B;  1FPO A;  4PA4 A;  2CUG A;  1BE3 H;  3ZBH A;  4AQY O;  1BHA A;  2EIN C;  1EZJ A;  3ZMZ A;  4DK0 A;  3RYF A;  4PDL A;  4LF8 O;  4YHH B;  1FXK B;  1VMG A;  2QWO B;  4YJ3 B;  4XDL A;  1G1X B;  2NR5 A;  3ETG A;  3TET A;  2UU9 O;  3SGI A;  1V55 C;  1JCH A;  2WA3 A;  1JVM A;  1PV0 A;  1TUE B;  4YJ3 A;  4LNU A;  4LCU C;  4JTC B;  1HW7 A;  1ZTE A;  3ASN B;  2YIB A;  1PL4 A;  4B7E A;  1GMG A;  4JI5 B;  5JJE B;  3E86 A;  4DV2 B;  4GKK B;  1VF6 C;  2X6B A;  1AB3 A;  3OUS A;  4B3S B;  4FLW A;  4IIJ B;  3D36 C;  4U3J B;  2UXC O;  1HNX O;  2ZNI A;  5DEC A;  4X65 B;  4IIJ A;  5KHI A;  1H2N A;  2HJF C;  5AG2 A;  1Q6H A;  2EZP A;  4P9O A;  3MD0 A;  1NQT A;  4LH6 A;  3FB6 C;  2DQ0 A;  2AHZ A;  3N2K A;  2H3O A;  4F6R A;  4DR2 O;  1K73 W;  4LFB B;  2F1M A;  4DRX B;  2LJ2 A;  4ZOL B;  2K9P A;  2DYR B;  1ZUQ A;  3KG2 A;  4NXN O;  1MZE A;  1S5H C;  1P49 A;  2KG7 B;  1THZ A;  1HNW B;  2QWQ B;  2YXY A;  2EIJ C;  3T1H B;  2KG7 A;  2ZE6 A;  2CTW A;  3G71 V;  2EIN B;  3VQX A;  4OPH A;  4K3A A;  3SYP A;  4X62 B;  1Z5V A;  4BWA A;  4UB6 Z;  3APQ A;  1G4Y B;  1N8R W;  2YC0 A;  2GHY A;  3JAT A;  1VQ4 V;  1V55 B;  1JA8 A;  4AI8 A;  4Z2W A;  4YIP A;  3WB0 A;  2W6J G;  4HYO A;  2N05 A;  4B3T O;  2DWE C;  2UXD O;  4DV3 O;  4JPR A;  3OEH G;  3S3X A;  4DYL A;  3I55 V;  4LF5 B;  1NR1 A;  1ZWI C;  1VQ8 V;  4G2K A;  2RDC A;  3IC7 A;  3G4S V;  2UUA O;  4JI6 B;  1GRJ A;  5IYB O;  4KP4 A;  3BA9 A;  1GM8 A;  4OGQ B;  5H5N A;  1P4R A;  3H1J H;  1WB8 A;  3FB8 C;  1G8M A;  1YZB A;  5IY5 C;  3ETE A;  2IJH A;  4EFB A;  1SA0 B;  2FB5 A;  2VWK A;  2JS3 A;  1VQ6 V;  2Y4U A;  4MVQ A;  3E8G A;  5L3B A;  2VRZ A;  3JCU Z;  3JSN A;  1XMO O;  1SA0 A;  1SQQ H;  1GKF A;  3CCJ V;  2P4V A;  1KP2 A;  1R3K C;  4LF9 O;  3GB7 C;  1IBL O;  3HKE A;  2PYL A;  5EBW C;  1YSC A;  3JD1 A;  5IJ9 B;  1Q82 W;  2RMK B;  1AP5 A;  1URF A;  3BA8 A;  2WLK A;  1NT2 B;  3B2E E;  4ZBM A;  4JI5 O;  4PA3 A;  4DV2 O;  4HZ3 A;  5E79 Z;  2R9R B;  4B3S O;  4LP8 A;  4WFG A;  3ZRX A;  4G28 B;  2HJD A;  4B08 A;  5LA6 B;  3I5D A;  4RUF A;  3E8B A;  5LA6 A;  3FX7 A;  1VQM V;  3JAS A;  2ZT9 B;  4UCV A;  1JFF B;  1X4T A;  3CRC A;  4U7O A;  3K79 A;  4LFB O;  1JFF A;  3OUF A;  1K9M W;  5L3D A;  3K03 A;  1KU9 A;  4MW8 A;  1K4D C;  3T1C A;  1JR9 A;  3E22 A;  3T4D A;  2HVK C;  2PY5 A;  5IY5 B;  2BE3 A;  1HNW O;  5H9C A;  2YIA A;  4AIL C;  1LNQ A;  4I4T B;  3T1H O;  2XAQ A;  5IT9 N;  1M4U A;  2W0F C;  3CD6 V;  1EZV H;  3QNE A;  1N0N A;  2P7T C;  4U3F H;  4X62 O;  3OTO B;  3LSQ A;  2YDE A;  3SPI A;  3ZN0 A;  5JQG A;  5D5Q A;  1IVS A;  1Q6U A;  3ABU A;  1EN6 A;  4P2Z A;  1B3Q A;  3CYO A;  1MA1 A;  1YXB A;  2R9A A;  4X1I B;  1IZ3 A;  4DR4 B;  2PZS A;  2XTA A;  4P9P A;  2LO1 A;  5CA3 A;  3FYI B;  1WAZ A;  5IWA B;  1SKV A;  4D7T A;  2QM8 A;  3DSQ A;  1RPR A;  2R70 A;  3W7S A;  4D6T H;  2ZR2 A;  3LNM B;  2B9Z A;  5L3E A;  3EXA A;  2QKS A;  4JI6 O;  1DTO A;  2MW2 B;  3BY6 A;  1M9N A;  3QO5 A;  4WFH A;  2HEP A;  2HLD G;  4MVS A;  4UV9 A;  5CA1 B;  4PEL A;  3NR7 A;  4PD4 F;  4I50 B;  5HFL A;  3ABL C;  1NTK H;  3N2G A;  3AG3 B;  2ARH A;  4I50 A;  3CCS V;  2XOK G;  1XNQ B;  3IC9 A;  4J9Z B;  3IFX A;  4B3M B;  3CEI A;  2Y0I A;  2WLL B;  1M56 C;  3I56 V;  3G6E V;  3T1Y B;  1FFT B;  1XEQ A;  2WLL A;  5EC1 C;  2AW9 A;  1L0N H;  1QQC A;  3L74 H;  1HP8 A;  1SQF A;  1WPB A;  2Y0P A;  2OTJ V;  3ETD A;  2IJK A;  2Q7E A;  2EZO A;  4UVB A;  1ZSP A;  1FS0 G;  1JX9 A;  2XAJ A;  4O4L A;  5C8Y B;  5IYD O;  5JCO A;  3RFR A;  4TV9 B;  4FLV A;  5C8Y A;  3FKS G;  3FFQ A;  2F23 A;  2EIM C;  4MVZ A;  4FM0 A;  2YEV B;  3H1L H;  3RT3 C;  5LXT B;  1FFX B;  2QM4 A;  3OFN G;  1AJN A;  1FFX A;  4WFE A;  3R65 A;  3L75 H;  3SJB C;  4CS3 A;  3OAA G;  4UCT A;  1TVK B;  1AI5 A;  1OCZ C;  5L3F A;  1TVK A;  1K34 A;  2UXB B;  3ABL B;  3FYE B;  3WB2 A;  4N23 A;  4DR5 B;  2EUL A;  3BAA A;  3OTO O;  2Q5Z A;  2ZM6 B;  4NTY A;  5GON B;  4PI2 A;  3BFR A;  4BAY A;  2HG5 C;  1GH6 A;  5GON A;  4UUJ C;  2E76 B;  4DR4 O;  5FNV B;  1VIB A;  1M56 B;  5IWA O;  2ZIN A;  1BMF G;  1PNK A;  1R1B A;  3JD3 A;  5FNV A;  4UV8 A;  1GTO A;  3SYA A;  3QO7 A;  4LF4 B;  4FM1 A;  2ZR3 A;  2PF4 E;  4FZ0 A;  4D7S A;  4OXS A;  5A9G A;  2ZCE A;  4RAI A;  1U97 A;  1IUR A;  1SES A;  1EN4 A;  1XI1 A;  1NJI W;  1K4C C;  1Q86 W;  1K33 A;  1TUB B;  3HB3 B;  3TK1 A;  3AG7 A;  3KCX A;  2EIM B;  5KAI Z;  3OR6 C;  4H13 B;  1TUB A;  1H38 A;  3SYC A;  2WLI B;  5KA5 A;  5KHH A;  2WLI A;  4UB8 Z;  1I5Y A;  1XNQ O;  3CC4 V;  2LGQ A;  1M93 A;  5E1A C;  3B77 A;  5EIB C;  2E75 B;  3K08 A;  2P6J A;  4B3M O;  1OCZ B;  3H01 A;  4JZ2 A;  3SJC C;  2H8P C;  3CSX A;  1S76 D;  3T1Y O;  4QE9 A;  5KAF Z;  2YS8 A;  1XL4 A;  4DK1 A;  3JAM N;  4FLY A;  3W7T A;  3CMA V;  4I9Q A;  4HNA A;  1RFY A;  2IBZ H;  4LBE C;  4X89 A;  1VP7 A;  3BEH A;  5CB4 B;  2X7R B;  4CS4 A;  1QNM A;  2EX3 A;  1AVM A;  2ADP A;  2NNU A;  5CB4 A;  3CPW U;  3M8A A;  1GO3 F;  1Q43 A;  1NVP D;  1XRE A;  2YXH A;  1NBM G;  5IYC O;  1QBZ A;  1SRY A;  1QVF U;  1GK9 A;  2Y69 C;  3F7Y C;  1JJ2 U;  3IAY A;  1DK1 A;  4NXM B;  5IJ0 B;  4NTW A;  3ABK B;  1D2D A;  2M6Y A;  4R6Z A;  3O9O A;  2F43 G;  1BSM A;  2XT9 A;  5LP6 B;  4G27 B;  5J2T B;  4J80 A;  1WP7 A;  5IJ0 A;  3L73 H;  5LP6 A;  5J2T A;  3LDC A;  4QJF B;  3OMN B;  4WFB V;  4QGP A;  5CBF A;  1OV9 A;  4BIU A;  2UXB O;  2VQE O;  1GN3 A;  3VBB A;  3UT5 B;  3F7V C;  5LGT A;  1Q90 D;  3CXC U;  4O2B B;  2QWR B;  3U0Z A;  4DR5 O;  5B3S C;  1WLE A;  2VWJ A;  4BW5 A;  2OT5 A;  2ZM6 O;  1J95 A;  1GN6 A;  2FML A;  3VQW A;  1F23 A;  3ZRW B;  1CEZ A;  1FXK A;  4YY3 B;  2D3O W;  5F2V O;  4PDM A;  2X0L A;  3ZRW A;  2Y48 A;  3P30 A;  3K5L A;  5BZB A;  4NKG B;  4PA9 A;  1I0H A;  4Z1V A;  2LP7 A;  1EBO A;  2X6C A;  1L0L H;  1PPJ H;  4X64 O;  4LF4 O;  5FLX N;  1S77 D;  4IYI A;  4LC1 A;  5BY1 A;  3AK1 A;  1OCR C;  4DR3 B;  3ZRS A;  3A0R A;  2FYU H;  2WLH A;  3OR7 C;  4PI0 A;  2OIE A;  5KX5 B;  4MSW C;  4U3J A;  1Z5W A;  2YI9 A;  1BT8 A;  5KX5 A;  2KSD A;  2E5L B;  1M5I A;  1KYO F;  3THO A;  5JH7 B;  3SPH A;  4WF9 V;  2QTS A;  2Y69 B;  5JH7 A;  1R6N A;  2DW4 A;  1FYJ A;  1IBK B;  4LF6 B;  1Z2G A;  1K92 A;  1S5L Z;  5J2U B;  4DRX A;  2LQT A;  4ZOL A;  2PUS A;  3MHS C;  3CP1 A;  5J2U A;  3JAK B;  4ZIB A;  2C2A A;  1Q5O A;  3SDL A;  4CS2 A;  1X59 A;  5CMU A;  1KP3 A;  3SJA C;  1KBH A;  4KHP B;  4JAA A;  4DV1 B;  4IYH A;  4X20 B;  5B3S B;  4PA6 A;  1YTF B;  1JQ0 A;  2JIZ G;  4JI4 B;  4K0K B;  5B1N A;  3P3P A;  1VQ9 V;  2L6L A;  2A9H A;  1Q7Y W;  1B6Q A;  2WAM A;  4RQF A;  5EBM C;  3LUT B;  3AG1 C;  3KKY A;  4CH5 A;  1YJN V;  1K5Q A;  1SET A;  3CCM V;  4EB6 B;  2F4V B;  4NB5 A;  2VQF B;  1AR5 A;  2W0X A;  3T4Z A;  1OCR B;  4NXM O;  1VF6 A;  4EB6 A;  1DLB A;  3A8T A;  1BCC H;  4QNH B;  4J7Z A;  4DV4 B;  2Q69 A;  3D36 A;  2DYS C;  2EIL C;  2PI4 A;  2P90 A;  3ASO C;  4GX0 A;  2O57 A;  3WFV A;  4I0X B;  1F4M A;  3AEI A;  2G38 A;  4I0X A;  3G67 A;  3G6B A;  4IT5 A;  1YVW A;  4YHH O;  1OHH G;  2JJ1 G;  2ADQ B;  4NVP A;  1F4N A;  5J9P C;  3E35 A;  5K1X A;  4YY3 O;  1XIL A;  2EIJ B;  3B8M A;  1BHB A;  1W2B U;  1WB7 A;  2YIC A;  1KKC A;  3CCR V;  3E8F A;  2RQ6 A;  1W59 A;  1NU1 H;  1CP9 A;  2HVJ C;  2RNB A;  3FB5 C;  3CJH B;  2AGA A;  4KFM A;  5IJ9 A;  3T2M A;  4YXW G;  1NI8 A;  2QEX V;  4GKK O;  3CHX A;  2CAZ C;  2QGN A;  5HFM A;  3L71 H;  1HR0 B;  3JAW B;  5D5P A;  1QHT A;  1YDX A;  3HKD B;  4W4K A;  4X65 O;  1HDJ A;  2W6I G;  1N4C A;  2Z3Y A;  3AG1 B;  2Q7H A;  2E5L O;  5B66 Z;  3LSS A;  1I08 A;  4JI3 B;  1IX9 A;  1NH2 B;  5L3G A;  3ETQ A;  1WJZ A;  1JPX A;  4FPP A;  1IBK O;  4LF6 O;  4R8C A;  2CDY A;  3UM7 A;  2DYS B;  5KHJ A;  1OCO C;  2EIL B;  1VF5 B;  2F95 B;  5B5E Z;  2Q4P A;  2OIG A;  4C7U A;  2ZQM A;  1J5E B;  3ASO B;  1PD3 A;  2LFR A;  3GWK C;  4DR7 B;  3BRC A;  2ZDI C;  3S3W A;  2A06 H;  2HR3 A;  4KHP O;  4I4T A;  1D5N A;  1CPY A;  4DV1 O;  3TCU A;  4X8A A;  3DGE A;  1TGO A;  3JYC A;  1R6K A;  5DED A;  4JI4 O;  4K0K O;  3ZMU A;  3R66 A;  1AJP A;  1XDC A;  1LUW A;  1Q81 W;  3K5M A;  1LUV A;  3H1H H;  4QPJ A;  3EVK A;  2DMX A;  4K8X A;  5LOV B;  2Q9L A;  2IW5 A;  2YUA A;  4X1I A;  2ZD9 A;  4TQF A;  5IYZ B;  4WCE V;  1NZ6 A;  5FPR A;  3CCL V;  3JD2 A;  5JVD B;  5LOV A;  1SF9 A;  4FLT A;  3D3Q A;  5IYZ A;  3CXH F;  3OGI B;  4LF5 O;  2F4V O;  2VQF O;  1D5A A;  5JVD A;  3ZHV A;  1I94 B;  5FL7 G;  1ORQ C;  4O4J B;  1H2L A;  4XDJ A;  2A79 B;  4RUE A;  3CME V;  1I7F A;  4DV4 O;  3OD4 A;  1M90 W;  1BGY H;  4O4J A;  4X66 B;  2NN4 A;  4FLU A;  2ODM A;  3VQY A;  2IH3 C;  1ROP A;  3N27 A;  4DV6 B;  4DW0 A;  1QLE C;  1IXM A;  5CA1 A;  4BR6 A;  1G6U A;  5LMN B;  1US6 A;  1N36 B;  3E8H A;  5TIS Z;  1OCO B;  1PNM A;  1EN5 A;  3RYC B;  4TUY B;  4GX5 A;  3A0H Z;  3IJ4 A;  3RYI B;  3RYC A;  1Y76 B;  4TUY A;  4FJC C;  2Q0O C;  1LR1 A;  4MVU A;  3SPJ A;  5IDJ A;  3RYI A;  4DO2 A;  1JMK C;  2WPD G;  1R6T A;  2ZDI A;  4TOI A;  2JS5 A;  3K0G A;  1RM1 C;  4J9Y B;  4X9Q A;  2WSS G;  2GSM B;  1QLN A;  3U10 A;  2GV9 A;  4MTO A;  4QIW F;  2AZ2 A;  3B4S A;  3H9V A;  1K3E A;  1XHZ A;  3J80 N;  1OCC C;  2ZIO A;  3OW2 U;  4JI7 B;  3CB2 A;  2CGN A;  4XBF A;  4UVA A;  4TV9 A;  1P7B A;  2OTL V;  4JI3 O;  5LYJ B;  4QE7 A;  5CA0 B;  4TSF G;  3ZHR A;  5LYJ A;  3LNN A;  2YEV A;  5CA0 A;  1AR4 A;  5LXT A;  4R50 A;  4X1K B;  4KXR A;  3STZ C;  3ABT A;  4OPA A;  3G80 A;  5DM6 V;  4X1K A;  2N74 A;  4I9W A;  2KQX A;  4GLX A;  1J5E O;  2LFS A;  2WLM A;  3SYO A;  1ENV A;  1AJQ A;  4JYB A;  3K3W A;  4DR7 O;  1QLE B;  3DC6 A;  2Q68 A;  2ZE7 A;  3B8N A;  4PV1 B;  3M7M X;  4O4H B;  4F4L A;  1H2M A;  2EIK C;  2IM9 A;  1UFI A;  1GAX A;  2A0L A;  2WWW A;  5EZY B;  4ZHQ B;  3P32 A;  1AI4 A;  2P5O A;  1DF5 A;  4ZHQ A;  4JYA B;  1K97 A;  3ABM C;  2R72 A;  4L87 A;  4BW9 A;  1E1Q G;  4JYC A;  4LFA B;  3K58 A;  2QWN B;  3C90 A;  1RM1 B;  3UCS C;  3HPL C;  3W7W A;  3QG5 A;  4J7K A;  3M99 B;  3AG2 C;  1I94 O;  1P7G A;  2FKX A;  2QA4 V;  3OM3 B;  2RCV A;  1OCC B;  2OWO A;  1VQN V;  5BMV B;  5ITZ B;  2P06 A;  4X66 O;  2M7W A;  3ZCC A;  5BMV A;  5ITZ A;  1AI7 A;  4TV8 B;  1SS3 A;  2DE0 X;  4BIO A;  3A0B Z;  2WA4 A;  4TV8 A;  2F93 B;  4DV6 O;  1R3J C;  5GW7 A;  3CCV V;  4MTG A;  4JF3 A;  4J10 A;  2D2C B;  2CE4 A;  5LMN O;  1M57 C;  1O9H A;  3K59 A;  4ZI7 B;  4DV7 B;  4CH6 A;  3CCQ V;  1N36 O;  2PGG A;  2JGU A;  4ZI7 A;  4LF7 B;  3MDS A;  1KUQ A;  3LDD A;  5GTH Z;  5B1B C;  4GX1 A;  5H6R A;  5KHK A;  3JAR B;  4IGG A;  3CRA A;  3ZIA G;  1N0J A;  4QPK A;  2EIK B;  3JAR A;  4MW3 A;  3SYQ A;  1WN7 A;  5LHH A;  3F5T A;  1VQL V;  3AG4 C;  3ABM B;  1S72 V;  4BIZ A;  4JI7 O;  4H0L B;  2E74 B;  5LMU B;  5LHG A;  3C3S A;  4X1Y B;  3W7X A;  3FB7 C;  3PN1 A;  4X88 A;  2LW1 A;  1O9G A;  3DC5 A;  4X1Y A;  1IDS A;  1XHX A;  3AG2 B;  2XAG A;  1YJW V;  3ZJZ A;  5EIB D;  3NXS A;  5CN0 A;  1YHQ V;  2HKO A;  4JV5 B;  1K8A W;  1PKX A;  2UXD B;  4DV3 B;  3RW0 A;  3ICX A;  3QTC A;  3OMA B;  2CTQ A;  1E1R G;  2IJI A;  3DXR B;  4H33 A;  4TT3 G;  2OYQ A;  1AP6 A;  4GZR B;  3UQ8 A;  4O2A B;  2DN9 A;  3DXR A;  2IU0 A;  2YSU B;  1BZK A;  1YEW A;  4O2A A;  4UCO A;  1M57 B;  2JVD A;  3CE2 A;  3UT5 A;  4JTD B;  5LBQ A;  5FPO A;  4O2B A;  2CH7 B;  3HKC B;  4DV0 B;  4FLX A;  2XUM A;  1H2S B;  2MK3 A;  4B3R B;  2BTO A;  1VF7 A;  5B1B B;  2QSA A;  4YIO A;  2V4D A;  4RWU A;  2GBO A;  2B1G A;  4EEQ A;  5B1O A;  3UO3 A;  3K57 A;  4LFA O;  1PM9 A;  1S3J A;  2HHH B;  4MT8 A;  4JI2 B;  4LF9 B;  3D3I A;  1IBL B;  4HBN A;  1ZAU A;  4LNU B;  2ETN A;  1N32 B;  1SZT A;  1R3L C;  3RGB A;  4ABM A;  1SQG A;  1YIT V;  3H1I H;  3AG4 B;  4W4L A;  1PP9 H;  2CGO A;  2BTQ B;  2GTA A;  4PDV A;  1K5S A;  2XAF A;  4EFE A;  2BTQ A;  1B04 A;  3RYH B;  1H2G A;  1B06 A;  1YTF D;  2OCH A;  4FMT A;  1BQZ A;  3RYH A;  4UVC A;  1YJ9 V;  4KUM A;  4DV7 O;  1N33 B;  3F5W C;  3CCE V;  3N2K B;  2YXL A;  3RWR D;  4F6R B;  2P22 C;  4LF7 O;  3L9D A;  1K7D A;  4CC5 A;  4LH7 A;  5JWP A;  4NTX A;  3JAK A;  4DV5 B;  4J7J A;  1XMQ B;  4HAM A;  3SPG A;  1E79 G;  4Q6G A;  3K0D A;  1W0J G;  1Y4M A;  2Q7G A;  4RO2 A;  4FZ1 A;  4UCU A;  2YID A;  5B1A C;  4X20 A;  1QR9 A;  2QR4 A;  3STL C;  3UO2 A;  3ZS8 C;  2L35 A;  2Q67 A;  3ZX6 A;  3L72 H;  3RBZ A;  4MVR A;  3AK3 A;  4FFK A;  4FIP C;  1VQ5 V;  3HKB B;  5LMU O;  3JAT B;  1ARO P;  4CC6 A;  2UXN A;  3HKB A;  3SR2 C;  3ZHT A;  4TQD A;  1VEW A;  2JRI A;  2KB1 A;  1WA8 B;  5BR8 B;  1SC5 B;  3QVN A;  3L70 H;  1AIL A;  4KL1 A;  3ZHQ A;  1WA8 A;  4JV5 O;  1PNL A;  4P30 A;  2XND G;  3GVM A;  3KZI Z;  1Q3E A;  4XDK A;  1H2K A;  3JSL A;  1FAF A;  1DF4 A;  4LFC B;  4O4I B;  2ZIM A;  4CZZ A;  3ZMT A;  2Q8V A;  4O4I A;  2RJZ A;  4FVM A;  3EHB B;  2B5U A;  2WLJ A;  4DW1 A;  4E2L A;  2ATK C;  4DV0 O;  4Z1M G;  3O65 A;  2EBO A;  1UJW B;  2XAH A;  4B3R O;  1FJG B;  2JEX A;  1XUQ A;  3SJQ C;  3K5O A;  1NH2 D;  1KB9 F;  4K35 A;  1HNZ B;  1SQX H;  4DR6 B;  2E3C A;  5EBL C;  2HHH O;  2BCC H;  3HKE B;  4JI2 O;  5K1P A;  5B1A B;  5CBG A;  4DR1 B;  5BXZ A;  1S5J A;  3CJH A;  3K9A A;  1N32 O;  1OZ0 A;  4DUZ B;  5GTI Z;  3U11 A;  2DJV A;  1R73 A;  4DR3 O;  3H1K H;  3PJS K;  3K5N A;  3APO A;  1WNS A;  2BOB C;  1S0V A;  3ZN1 A;  1QU7 A;  3JAW A;  4E4E A;  1NS1 A;  1KEC A;  3HKD A;  1SQV H;  4NYK A;  4WBN B;  1YIJ V;  1XL6 A;  4U7N A;  5CBH A;  4H44 B;  4ZKI A;  4GKJ B;  1BS3 A;  2NLJ C;  3K06 A;  4WBN A;  4LR3 A;  2DOS A;  3HR0 A;  5C93 A;  3CCU V;  5H6Q A;  4FK5 C;  1MOF A;  4JYY A;  3B40 A;  2GUZ B;  4B7K A;  2XHB A;  1N33 O;  1NTM H;  2UXX A;  3JAS B;  2JJ2 G;  2GUZ A;  1JOY A;  2P67 A;  4JAV A;  1XNR B;  2JEU A;  1VQO V;  2A7W A;  3ZHS A;  1AR1 B;  5JJJ B;  1BL8 A;  4PDR A;  3OMI B;  1YF2 A;  1KMI Z;  4DV5 O;  4R7C A;  2PTM A;  1XMQ O;  1MSD A;  3E22 B;  3AG3 C; 
#chains in the Genus database with same CATH homology
 2EIN B;  4CBC A;  4MVO A;  1GO3 F;  3STZ C;  3ABT A;  1NVP D;  5DM6 V;  3SYP A;  1NBM G;  5IYC O;  1QBZ A;  1SRY A;  4I9W A;  2HFE C;  1G4Y B;  1N8R W;  2LFS A;  1PL0 A;  2GHY A;  2WLM A;  3SYO A;  1ENV A;  1AJQ A;  1VQ4 V;  4JYB A;  1V55 B;  5LHI A;  1QVF U;  1GK9 A;  2Y69 C;  3K3W A;  3F7Y C;  1JJ2 U;  5LGU A;  2V7Q G;  2W6J G;  1QLE B;  4HYO A;  3ABK B;  2Q68 A;  4R6Z A;  2AHY A;  2F43 G;  2DWE C;  2QE7 G;  3B8N A;  4G27 B;  4F4L A;  2EIK C;  4JPR A;  2A0L A;  2WWW A;  3OEH G;  2XAS A;  3P32 A;  1W0K G;  3I55 V;  3LDC A;  1NR1 A;  1AI4 A;  4QJF B;  3OMN B;  4WFB V;  5CBF A;  1DF5 A;  1ZWI C;  4BIU A;  3E2E A;  1VQ8 V;  1QCE A;  2B1I A;  4G2K A;  4I5S A;  1K97 A;  3VBB A;  3ABM C;  3EFF K;  3IC7 A;  3F7V C;  3G4S V;  5LGT A;  4L87 A;  3OEE G;  5IYB O;  4EKW A;  4KP4 A;  2OCC C;  3CXC U;  1GM8 A;  1E1Q G;  4JYC A;  5B3S C;  1WLE A;  2ITC C;  1P4R A;  4BW5 A;  2QTO A;  3FB8 C;  2OT5 A;  1RM1 B;  1NR7 A;  1J95 A;  2H94 A;  4H37 A;  1G8M A;  1WPX A;  5IY5 C;  3HPL C;  3W7W A;  1F23 A;  3ZRW B;  3ETE A;  2IJH A;  1CEZ A;  5KUK A;  1FXK A;  3M99 B;  2K1E A;  2D3O W;  1VQ6 V;  3AG2 C;  4MVQ A;  3E8G A;  4PDM A;  2X0L A;  5L3B A;  2QA4 V;  3OM3 B;  3ZRW A;  2Y48 A;  2IJJ A;  3P30 A;  5BZB A;  1OCC B;  1VQN V;  4PA9 A;  5EK0 A;  1GKF A;  2Z5U A;  3CCJ V;  2M7W A;  3ZCC A;  1MAB G;  1KP2 A;  2DWD C;  2Q6A A;  1AI7 A;  1EBO A;  1R3K C;  2LP7 A;  2X6C A;  1MG1 A;  3DTU B;  3GB7 C;  4JAS A;  5LGN A;  1GM7 A;  1S77 D;  4LC1 A;  1OCR C;  5EBW C;  1YSC A;  1R3J C;  3A0R A;  4JAU A;  3ZRS A;  1GM9 A;  5GW7 A;  3JD1 A;  4MTG A;  3CCV V;  2WLH A;  1AI6 A;  4JF3 A;  3CC2 V;  3OR7 C;  3UKM A;  1Q82 W;  1M57 C;  4N21 A;  4MSW C;  3CCQ V;  4GT1 A;  2WLK A;  4ZBM A;  4PA3 A;  4HZ3 A;  3X2Q C;  2R9R B;  3SPH A;  3LDD A;  4WF9 V;  5B1B C;  2QM7 A;  4LP8 A;  2Y69 B;  4WFG A;  3ZRX A;  4GX1 A;  5H6R A;  1R6N A;  2DW4 A;  4G28 B;  1VQ7 V;  3ZIA G;  1K92 A;  4QPK A;  2JK5 C;  2EIK B;  3E89 A;  4RUF A;  1M1K W;  3E8B A;  3MHS C;  1VQM V;  4MW3 A;  3SYQ A;  3CP1 A;  2C2A A;  4U7O A;  5LHH A;  3ML0 A;  1VQL V;  2JDI G;  5CMU A;  3CC7 V;  1KP3 A;  3K79 A;  3OUF A;  1K9M W;  3AG4 C;  3ABM B;  5L3D A;  1S72 V;  4BIZ A;  2BOC C;  4JGS A;  3K03 A;  2DQ3 A;  3ZMS A;  2OCC B;  3ZMV A;  5B3S B;  4MW8 A;  1K4D C;  5LHG A;  4MVM A;  3T1C A;  4PA6 A;  1COW G;  3T4D A;  1JQ0 A;  1YTF B;  2JIZ G;  3W7X A;  1Y66 A;  3FB7 C;  2HVK C;  5B1N A;  1VQ9 V;  5IY5 B;  4X88 A;  5H9C A;  1LNQ A;  3VOU A;  3AG2 B;  2XAG A;  2XAQ A;  1YJW V;  2A9H A;  1Q7Y W;  1B6Q A;  2WAM A;  4RQF A;  3ZJZ A;  2W0F C;  3CD6 V;  3NXS A;  5CN0 A;  5EBM C;  3QNE A;  1YHQ V;  2HKO A;  1K8A W;  1PKX A;  2P7T C;  3LUT B;  3AG1 C;  1V54 C;  3RW0 A;  3GWO A;  2IH1 C;  3LSQ A;  3SPI A;  3OMA B;  3ZN0 A;  1E1R G;  4MS2 A;  2IJI A;  3OE7 G;  1YJN V;  3ABU A;  1K5Q A;  4P2Z A;  1SET A;  4H33 A;  4TT3 G;  3CCM V;  3CYO A;  3T4Z A;  1OCR B;  5L3C A;  1FXH A;  3LDE A;  2IU0 A;  1DLB A;  4P9P A;  5CA3 A;  2YSU B;  4QNH B;  3FYI B;  2QM8 A;  1M57 B;  4WFF A;  2Q69 A;  3D36 A;  2DYS C;  1KKD A;  2EIL C;  4JTD B;  2PI4 A;  5LBQ A;  1RPR A;  2V1D A;  2P90 A;  3ASO C;  4GX0 A;  3WFV A;  1KD1 W;  3W7S A;  1F51 A;  1F4M A;  2MK3 A;  3JD0 A;  3X2Q B;  2ZR2 A;  3AEI A;  5B1B B;  3LNM B;  5L3E A;  2QKS A;  4MTX A;  3E83 A;  3WG7 C;  3JCZ A;  2B1G A;  1DTO A;  5B1O A;  3BY6 A;  1M9N A;  3QO5 A;  2ITD C;  4JTA B;  1S3J A;  5KA6 A;  1OHH G;  4WFH A;  2JJ1 G;  4MT8 A;  3D3I A;  2HLD G;  1F4N A;  4MVS A;  5J9P C;  3E35 A;  4PA7 A;  4UV9 A;  4WFA V;  1SZT A;  2EIJ B;  3B8M A;  1R3L C;  1NKD A;  4PEL A;  4RQE A;  1BHB A;  5HFL A;  1W2B U;  3ABL C;  1YIT V;  3W7U A;  3ABK C;  3CCR V;  3E8F A;  2ZXW C;  1R3I C;  3AG4 B;  3OGC C;  3AG3 B;  2EJR A;  3ZRV A;  1CP9 A;  2HVJ C;  3FB5 C;  4KFM A;  3CCS V;  2XOK G;  3T2M A;  1KC8 W;  4PDV A;  4YXW G;  1K5S A;  4J9Z B;  2QEX V;  2XAF A;  1VQK V;  2X6A A;  3IFX A;  4GX2 A;  5HFM A;  1H2G A;  2WLL B;  1H8E G;  1YTF D;  1M56 C;  3I56 V;  1KQS U;  3G6E V;  4FMT A;  3JD4 A;  1FFT B;  4UVC A;  1YJ9 V;  2WLL A;  2WLN A;  4KUM A;  4TWK A;  5EC1 C;  1YI2 V;  3RVY A;  2W6I G;  1H8H G;  1FXK C;  2Z3Y A;  5EC2 C;  3AG1 B;  3F5W C;  1V54 B;  1HWY A;  3CCE V;  4ASU G;  3LSS A;  1NH2 B;  5L3G A;  3QO8 A;  2OTJ V;  3ETD A;  2IJK A;  1K7D A;  2EZO A;  4UVB A;  1FS0 G;  1JX9 A;  3RVZ A;  2XAJ A;  5IYD O;  1JPX A;  1QVG U;  3IGA C;  4FPP A;  4HAM A;  3SPG A;  1E79 G;  3ASN C;  3FKS G;  3K0D A;  4R8C A;  1W0J G;  1Y4M A;  4RO2 A;  3UM7 A;  2DYS B;  1OCO C;  2EIL B;  2EIM C;  4MVZ A;  5B1A C;  2CK3 G;  2ZQM A;  1VQP V;  3ASO B;  2YEV B;  1QR9 A;  1PD3 A;  2LFR A;  3STL C;  5DN6 G;  4Q20 A;  2Q67 A;  3SPC A;  3RBZ A;  1EFR G;  2ZDI C;  4MVR A;  1FXV A;  4GCZ A;  3OFN G;  1AJN A;  2HR3 A;  3MHH C;  5KUM A;  3WG7 B;  4FIP C;  4WFE A;  3R65 A;  1VQ5 V;  1CPY A;  3TCU A;  4X8A A;  3DGE A;  1ARO P;  2UXN A;  3OAA G;  3JYC A;  1R6K A;  1SER A;  3ZMU A;  1AI5 A;  4MTF A;  1OCZ C;  1AJP A;  2IU3 A;  5L3F A;  1Q81 W;  1QR8 A;  2KB1 A;  1MSW D;  1K34 A;  3ABL B;  3FYE B;  4QPJ A;  2ZXW B;  4N23 A;  1L1F A;  2IW5 A;  2ZD9 A;  4WCE V;  1PNL A;  4P30 A;  1I5X A;  2PI5 A;  2DYR C;  2XND G;  3CCL V;  3JD2 A;  4XDK A;  2R9I A;  1RPO A;  2FTK A;  1DF4 A;  4BAY A;  2HG5 C;  4DXW A;  3K04 A;  4CZZ A;  1NVP B;  4UUJ C;  3ZMT A;  4UXN A;  5FL7 G;  1ORQ C;  1M56 B;  4PA4 A;  1BHA A;  4XDJ A;  2A79 B;  1EZJ A;  1BMF G;  2EIN C;  3ZMZ A;  4RUE A;  3CME V;  4PDL A;  1M90 W;  1PNK A;  3EHB B;  3JD3 A;  2B5U A;  2WLJ A;  4E2L A;  4UV8 A;  1FXK B;  1GTO A;  3SYA A;  3QO7 A;  2ATK C;  4XDL A;  4Z1M G;  2ZR3 A;  3ETG A;  2IH3 C;  3TET A;  2EBO A;  1UJW B;  1V55 C;  1JCH A;  2XAH A;  1JVM A;  1TUE B;  2JEX A;  1ROP A;  4OXS A;  3SJQ C;  1NH2 D;  1QLE C;  4LCU C;  1IXM A;  4RAI A;  1SES A;  4JTC B;  3ASN B;  5EBL C;  1K4C C;  3E8H A;  1Q86 W;  1NJI W;  1K33 A;  3HB3 B;  3TK1 A;  1OCO B;  1GMG A;  1PNM A;  2EIM B;  3E86 A;  5B1A B;  2X6B A;  5CBG A;  3OR6 C;  3K9A A;  3OUS A;  4GX5 A;  1H38 A;  1OZ0 A;  1R73 A;  3SYC A;  2WLI B;  5KA5 A;  4FJC C;  3PJS K;  4MVU A;  3SPJ A;  2BOB C;  5IDJ A;  4DO2 A;  1S0V A;  3ZN1 A;  2WLI A;  2HJF C;  2WPD G;  2EZP A;  4P9O A;  3MD0 A;  2ZDI A;  1I5Y A;  1KEC A;  1NQT A;  3K0G A;  1RM1 C;  3CC4 V;  1YIJ V;  4J9Y B;  1XL6 A;  3FB6 C;  2WSS G;  2DQ0 A;  2GSM B;  3B77 A;  4U7N A;  5E1A C;  1QLN A;  2AHZ A;  5CBH A;  4ZKI A;  3K08 A;  2P6J A;  2NLJ C;  3K06 A;  1OCZ B;  3H01 A;  4MTO A;  5C93 A;  3CCU V;  5H6Q A;  4QIW F;  2H8P C;  4FK5 C;  1K73 W;  1MOF A;  1K3E A;  1OCC C;  1S76 D;  4QE9 A;  3OW2 U;  2UXX A;  1XL4 A;  4XBF A;  2JJ2 G;  2DYR B;  4UVA A;  1JOY A;  1P7B A;  3KG2 A;  3W7T A;  3CMA V;  2OTL V;  2P67 A;  4JAV A;  2JEU A;  1VQO V;  1S5H C;  4QE7 A;  1AR1 B;  4LBE C;  1THZ A;  4X89 A;  3BEH A;  1BL8 A;  4TSF G;  4PDR A;  2EIJ C;  3OMI B;  2X7R B;  2YEV A;  4R7C A;  2NNU A;  3G71 V;  4R50 A;  3CPW U;  3AG3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...