3IGAC

Potassium channel kcsa-fab complex in li+ and k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Antibody Fab Fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3igaC00
4R7CA 3SPCA 3E89A 4GX0A 1R3LC 2R9RB 3LDCA 3FB5C 3RW0A 4KFMA 3F7VC 4QNHB 4EKWA 5KUMA 1KKDA 3AG1C 2JK5C 1M57C 3ASNC 2ITDC 2ZXWC 4JTDB 4DXWA 4PDMA 3F7YC 4OXSA 2WLHA 3ABKC 3K0DA 2A9HA 1R3JC 4LCUC 4MVOA 2NLJC 2HVKC 3SPGA 3BEHA 4LBEC 4TWKA 4PA9A 4GX5A 1S5HC 3TETA 4HYOA 5EC2C 2KB1A 3VOUA 3OGCC 2H8PC 3WG7C 2OCCC 4X88A 5J9PC 3E8BA 1LNQA 2WLNA 4PDVA 2DYRC 3SYOA 5B3SC 4BW5A 2HVJC 3T2MA 2ZD9A 2ITCC 3R65A 2HG5C 3AG4C 5CBFA 4XDLA 3X2QC 2X6BA 3IFXA 2A0LA 3ABLC 4MTFA 4PDLA 3UKMA 1K4CC 4X89A 5KUKA 1V55C 3E8HA 4G27B 3K0GA 4ZBMA 2AHZA 1M56C 3OR6C 4MVUA 4MVZA 2K1EA 3KG2A 3AG2C 4MW8A 2EIKC 1XL4A 2Q69A 2AHYA 2DWEC 3OR7C 1OCCC 3SJQC 4MTGA 1BL8A 1OCZC 4P30A 4PDRA 3F5WC 2EIJC 2QKSA 3LDDA 5EBWC 5EC1C 4P2ZA 4RUEA 2IH3C 4I9WA 4XDKA 3OUFA 3LNMB 3K06A 4MVMA 3EFFK 4RAIA 2WLKA 4XDJA 4CBCA 3UM7A 2BOCC 4RUFA 5CBHA 4MS2A 2EINC 5EBMC 3ZRSA 3K03A 5E1AC 4MVQA 3E8FA 4MVSA 4MTOA 1OCRC 2HJFC 2P7TC 3E8GA 3E83A 4P9PA 4JTAB 3STLC 1K4DC 4RO2A 5IY5C 2X6AA 2W0FC 4PA6A 3OUSA 3ABMC 3SYAA 3SYPA 2X6CA 4J9YB 3ASOC 2BOBC 1P7BA 3K04A 3TCUA 1R3IC 3K08A 2Q6AA 3RBZA 2QTOA 2Y69C 3RVYA 4J9ZB 4QE9A 3GB7C 3FB6C 2Q68A 4MVRA 4QE7A 3SPJA 4WFGA 4WFHA 4GX2A 3SYQA 4PA4A 3PJSK 2EIMC 3T1CA 3SYCA 3LDEA 4UUJC 3ZJZA 4F4LA 2WLIA 4P9OA 2DWDC 5B1BC 5BZBA 3FB8C 3T4ZA 3E86A 2WLLB 4MW3A 2HFEC 4PA7A 4WFFA 2WLMA 1R3KC 4R8CA 4GX1A 5B1AC 2WLJA 1ZWIC 3FB7C 2EILC 4PA3A 4HZ3A 3STZC 2WLIB 1QLEC 3IGAC 1XL6A 5CBGA 1G4YB 3HPLC 1JVMA 4JTCB 5EK0A 3SPHA 2ATKC 1OCOC 1V54C 3LUTB 4WFEA 3JYCA 2A79B 3SPIA 4H33A 2Q67A 4G28B 4H37A 4MSWC 4R50A 5EBLC 3RVZA 1J95A 1ORQC 2WLLA 3T4DA 3AG3C 2YEVA 2DYSC 4R6ZA 4X8AA 2IH1C 4LP8A
chains in the Genus database with same CATH superfamily
3SJBC 4X1KA 4R7CA 2CH7A 1R3LC 2R9RB 3K3WA 1N32O 4DV3B 3BHPA 1M5IA 1B6QA 2EX3A 3TJTA 4PDMA 1SS3A 2WWWA 3N2KA 4KP4A 2YIBD 3WB0A 1Q81W 3C3SA 3JSLA 1AR1B 3OGCC 4C7UA 5L3BA 1NR7A 3RWRD 2D2CB 3T2MA 5JJNB 4F6RA 4YHHB 4JZGA 1W0KG 1V55C 2ZDIC 1Q7YW 3I55V 4MVUA 1EM1A 2GSMB 2ZKOA 4JAUA 3K5MA 4DV0O 1CXZB 3OR7C 5JQGB 1D2DA 3F5WC 4WBNB 2NN4A 3RYIB 2E75B 1G1XB 1LR1A 1YZBA 1GRJA 1A32A 3MAQA 4UVBA 3UO2A 1Y66A 5IY5C 5IYCO 1RM1C 2WPDG 3TCUA 4O4JA 5H6QA 1ZSPA 2ZINA 4W4LA 1XNRO 2E5LO 4FK5C 2PI4A 3M99B 4DR4O 4UUJC 3UO3A 1D5NA 5LYJB 1HDJA 2UUAO 2OTLV 4H0LB 4L87A 3B09A 1N34B 1M90W 1SETA 2F4VO 1N36O 1YXBA 2PI5A 4LF9O 4EEQA 2XASA 1E1QG 4ZHQA 1FXVA 5LGTA 2ZE6A 1BE3H 1I5XA 3ZMZA 3ABLB 4X8AA 3ZRXA 1MNGA 1BHAA 2UUBB 2ITDC 5HFLA 1SQVH 3QF7A 2NLJC 3BEHA 4Z1VA 2V4DA 3VOUA 3CRCA 4DYLA 5C8YA 5J9PC 1LNQA 3SYOA 1HNZB 2ZNIA 2HG5C 3F5TA 5D5PA 5H9CA 4JI4O 4KL1A 1M1KW 3E8HA 2CTRA 3MDSA 4AQYO 2WA4A 2AHZA 4TUYA 2V7QG 4BIUA 4DV7O 2A06H 1Z5VA 5ITZB 4IYIA 2N04A 5LGUA 2EIJC 3LDDA 3H1JH 1QVFU 5EC1C 1EFRG 3OUFA 2VQEO 3OMIB 3CP1A 3UM7A 1VMGA 2LFRA 1EN6A 4TV9B 4YJ2B 3M7MX 3RYHB 4LR3A 1F4MA 1NKDA 4IHJB 4NTXA 1QLEB 2HJFC 2C2AA 4P9PA 4DUYB 3Q4HB 2X6AA 1SESA 5KHKA 4DR7B 1ZAUA 1NTZH 1FD9A 3D3IA 2PYJA 3GB7C 1K5SA 4QE7A 1WNSA 5EZYB 3PJSK 1H2LA 1AP6A 3IC9A 3KKYA 4DR6B 1AI7A 2XAQA 2ZE7A 3KZIZ 4J7JA 4PA7A 2WLMA 4PA3A 1MG1A 2QWNB 3S3XA 1RPRA 2RMKB 5IE9A 2IJKA 4AI8A 4UCOA 1VF6C 4G2KA 1NU1H 4I0XB 3IAYA 1KUQA 3SPIA 3ABTA 3JALB 2ZIMA 4H37A 1T5EA 3WFVA 4IT5A 1VP7A 1DF4A 1SERA 4UCRA 4DK0A 3ZMSA 2BTQB 3ASOB 1OCCB 2WLHA 2Y69B 2A9HA 2JDIG 1M4UA 4FM2A 1B3QA 2GUZA 1WPXA 4PHZA 2H8PC 1VF7A 4LFAO 2YSUB 2LO1A 5CBFA 1SZXA 3BFRA 2CK3G 3DTUB 3ML0A 1H2GA 1GN6A 1WN7A 2WA3A 1NTMH 1M56C 3HKCB 1GH6A 1BHBA 4JI8B 1H8HG 4JI6B 1GO3F 1R6KA 4I9WA 5LMNB 5EIBC 4MVMA 4CBCA 5LBQA 2D3OW 1BT8A 5KHJA 4OX9B 2BTOA 3K5LA 4ASUG 1SRYA 2ZE5A 4N23A 4ZKIA 4HBNA 1OCRC 4FLZA 2P7TC 3HKBA 3W7WA 5FLXN 4KUMA 1HW7A 4X1YB 1SQPH 5IJ9A 1P7BA 2YXLA 4BR6A 3CB2A 4DV2B 2QKAA 1MSDA 5CA3A 4LF5O 2KSDA 5KX5A 4CC5A 4J11A 2RNBA 4X66O 1E79G 3T1HB 2P67A 4R8CA 1VQ7V 2W6IG 4UVCA 3D8CA 3CEIA 1WA8A 3I56V 1SQXH 1SQFA 2F93B 1VEWA 4H33A 2R72A 1YSCA 4UCTA 1FXKC 2HEPA 2R9AA 1PNLA 1HNWO 4LP8A 2UXDO 2E76B 1YCIA 1XBLA 5DN6G 1JA8A 1KKDA 3AG1C 1Q3EA 4OXSA 3ABKC 5LMUO 4MVOA 3BA8A 3C90A 4HYOA 2EJRA 3ZMVA 5IWAO 4B3TO 5LXTA 4PDVA 2IJJA 2ITCC 3R65A 3DSQA 5J2TB 1US6A 4MTFA 1GTOA 2CGNA 4ZIBA 2LGWA 5ITZA 3UT5B 2UXBB 2IJIA 3OR6C 1IBLB 2OCHA 1WLEA 4RWUA 4QPKA 1UJWB 3B40A 1XMOB 1XUQA 3SJQC 3L74H 4YJ2A 4I55A 4IHJA 4U7NA 2ZCEA 4JYBA 5CB4B 4RQEA 1J5EB 4YY3O 5FNVA 4DV5B 4GKJO 2BSKB 3T1YO 1Q86W 2R70A 4DV1B 2QSAA 4JTAB 5B1OA 3SJAC 5EZYA 1W2BU 1KC8W 1GN3A 3WG7B 4I5SA 1YIJV 1Q43A 1PV0A 2ZNJA 5LP6A 5JCOA 2Q68A 1K7DA 4CH4A 4J41A 2UUCO 4DV4O 1FFXB 5J2UB 2A7WA 1P84F 3KCXA 3FB8C 2QE7G 2GV9A 4I0XA 2YS8A 1OHHG 3S3WA 3JALA 4B3MO 3JD0A 5B66Z 1G4YB 1KECA 3JD2A 4D7TA 1GM7A 4LH6A 1H8EG 2W6JG 5CA1A 4TV8B 2BTQA 4R6ZA 4FIPC 1GM8A 3RW0A 3G67A 2H3OA 1TA8A 3ASNC 4BIZA 4DR5B 4UV8A 1JFFA 2AZ2A 5CA0B 4UB8Z 1IXBA 4U7OA 4GKKB 2OCCC 3SDLA 3OM3B 1JX9A 1HNXO 4IIJA 5GONB 5HFMA 2N74A 3IFXA 2A0LA 3HKEB 3ZRVA 1KQSU 4K8XA 3OE7G 1VQ4V 4JI2O 3MHSC 3VQVA 1NVPD 4MW8A 4QGPA 2DOSA 1WB7A 3PN1A 2QKSA 3LNMB 1G8MA 4X64B 1N8RW 4JAVA 3ZRSA 2YICA 4JZ2A 1XMQO 2Y4UA 3LSQA 3H1KH 5K1PA 1NI8A 1THZA 1KD1W 2VQFO 3SYPA 5KHGA 2ZE8A 2XT9A 1EZJA 4HAMA 5IJ0A 2F95B 1N32B 1VQMV 5L3FA 1SQBH 1AROP 3K58A 3ZJZA 2FYUH 1KP2A 2P4KA 4LWSA 4PELA 3N2GA 2LGQA 1XL6A 2XAJA 4B3RO 2JJ2G 1Q6HA 3LUTB 2ADPA 3RYCB 2XTAA 3AG4B 2QWQB 1O9HA 3CC4V 4DV0B 3K57A 1Q5OA 1EN5A 5H2FZ 5KHHA 4LFCO 1K73W 1XOUA 2P5OA 5J2TA 1CPYA 3HKDB 3QO5A 4PD4F 1VQ8V 5GTIZ 3UT5A 4BW5A 4Z1MG 2CTQA 3KCYA 3ZMTA 3ZMUA 2G38A 3ABLC 4X20A 1P49A 2JIZG 4I7ZB 1MA1A 1XNRB 3OFNG 1XL4A 5JWPA 2DWEC 2E5LB 5JVDB 1FS0G 4BW9A 4DR4B 2UUAB 3EFFK 1W0JG 4NB5A 3A2FA 1N36B 2F4VB 3GVMA 2EZPA 4LF9B 5E1AC 1I0HA 4GUNA 3B2EE 1FJGO 4K0KO 1GN2A 4DR2O 1OCOB 2OYQA 1JOYA 3QTCA 2JGDB 3K08A 1K3EA 4I50A 4H44B 2Q8VA 4WFGA 4U3JB 3LDEA 3JAWA 2DWDC 3DC6A 1YVWA 3ZHSA 1GAXA 2E74B 5C93A 1BS3A 1IBKO 1AJNA 1E1RG 2DJVA 1QLEC 3K5OA 2AXTZ 1EZVH 1PL4A 3SPHA 3CSXA 4FZ0A 1XQ8A 1NJIW 4FVMA 3RVZA 4JI4B 3T4DA 4AQYB 2O57A 2Y48A 4DV7B 2F66C 4OPHA 1SKVA 3LDCA 3FB5C 5LP6C 3U0ZA 3FKSG 5JCOC 2EBOA 2VQEB 2Q7HA 1NT2B 2KB1A 5JH7A 4A5UB 1XILA 1RP3B 2AZ0A 1ROPA 2EINB 2WLNA 4J7ZA 1GK9A 3JASB 2E3CA 5AG2A 4FFBA 2OTJV 1H2KA 2LW1A 5B1AB 4EFEA 1IX9A 3H9VA 4LF8O 1CP9A 3QNEA 2YIBA 3ZHTA 3KG2A 2LFSA 2Y4TA 1U97A 3OMAB 1OCCC 3BABA 3H1IH 2DYSB 1Q82W 2IW5A 2XNDG 4P2ZA 4XDKA 4B08A 2YXYA 5LHHA 3K06A 4K8ZA 4MS2A 3EXAA 1I7FA 3EVKA 3BY6A 4I4TB 3FAVB 1K9MW 3WB2A 3JARB 4YIPA 3CCRV 2DW4A 3OTFA 2XAFA 5LA6A 2QR4A 3STLC 4LFBO 2QJ1A 4JAAA 4O2AA 3B8MA 4DUZO 4LH7A 4ZOLB 4OGQB 1XREA 4DR3O 4DK1A 4O4HA 1H2SB 2MK3A 1V55B 1X4TA 5BY1A 1TGOA 1VF5B 3CWBH 3T4ZA 1IXMA 3EHBB 3QVNA 3JATB 3RYCA 2DQ3A 1DLBA 4NXNO 1S0VA 2GDSA 4IGGA 3IGAC 4LFAB 2KG7B 3HPLC 1ENVA 2YC0A 2CGOA 4TQDA 2IH1C 1NR1A 2PTMA 4QIWF 4BAYA 2M6YA 3HB3B 4KFMA 5IY5B 2AGAA 3J81N 2K9PA 4OPAA 3HKDA 3ZRWB 1AI6A 4FLTA 1JR9A 3OAAG 1S5HC 2X7RB 3CCUV 1QR9A 4O4LB 1VQ6V 4X88A 2Y0IA 2L35A 5CMUA 1U96A 3RYFB 2GBOA 3GWKC 1KU9A 1R6NA 1KBHA 1UFIA 3ZHRA 4LF5B 1S76D 1L8DA 4FLVA 4DRXB 2Q9LA 2CAZC 4X66B 2HHHO 2FB5A 3TGUH 3LSUA 2B1IA 3CRRA 3CRMA 1S72V 1SQGA 1TUEB 5CBHA 3RN4A 1VQPV 2L6LA 2ZR2A 5IYZB 2JGDA 5GW7A 5JQGA 5FPRA 5FPOA 4NYKA 1Q6IA 4WBNA 3RYIA 1B04A 2JEUA 3ABMC 4U3JA 5EYPB 3CC7V 1ZL8B 4HNAB 3RBZA 1HNWB 2UXDB 3NXSA 3RVYA 2BE3A 4LNUB 4TOIA 3G6BA 5JJJB 1OZ0A 4PA4A 4WCEV 3ETDA 5LMUB 2WLLB 1I94O 4JI3O 4DO2A 4CS4A 3SGIA 3MD0A 5IWAB 1BQ0A 4B3TB 3OMNB 4JTCB 4GLXA 3JYCA 2A79B 1S5LZ 4LC1A 5LYJA 4PV1B 1F51A 1KMIZ 5A2QN 3OD4A 2LQTA 2IU0A 1UPGA 1M57C 2YEVB 3P32A 4FM1A 1CEZA 4TWKA 2N05A 3JASA 4YY3B 4JGSA 4GKJB 4W4KA 3T1YB 3JSNA 1HWYA 1ZX3A 5KUKA 2M7WA 5LOVB 3DXRB 3OTOO 1QR8A 4ZBMA 3K0GA 2UXCO 3JCUZ 3RT3C 3RGBA 1Y67A 2UUCB 3B8NA 4FLYA 1YTFB 4L8JA 1BL8A 4MTGA 3FAVA 3OGIB 3JARA 2JVDA 4XDJA 5B1BB 4EFBA 2NNUA 3L73H 1BGYH 2XHBA 4UCUA 4B3MB 3E8FA 4TT3G 3A0RA 1TUBB 4ZOLA 2VRZA 3B4SA 1V54B 4PI0A 4NKGB 1AJQA 3OUSA 1NVPB 2PYLA 1HR0O 4JI7O 2Q6AA 2P4VA 3E22B 3JD1A 5KAIZ 4TV9A 3RYHA 3JATA 3SPJA 1VQLV 2JEXA 5KA5A 1YJNV 1M56B 5BR8O 3Q4HA 1WP8A 1R3KC 4X1KB 4J7KA 3STZC 1WAZA 1HNXB 1Z2GA 1K97A 3W7UA 1Y74B 4DW0A 3N2KB 1QBZA 4Q6GA 1VARA 4YJ3B 3QO8A 3AG3C 3ZRWA 3ZCCA 1OCRB 3H01A 4JI2B 1EBOA 4MTXA 3N27A 4TQFA 3E35A 2JGUA 2HJDA 2ILMA 2ZXWC 4JTDB 3DGEA 3K0DA 4DR1O 4UCSA 1GMGA 4LBEC 4PA9A 1I5YA 3RYFA 4Q20A 3SR2C 2WSSG 4QJFB 2VWKA 4KHPB 1XMQB 2F23A 3E2EA 2Q5ZA 1QCEA 2ADQB 3AG4C 2RCVA 3BAAA 3L72H 4JI1O 3X2QC 3UKMA 2HLDG 4PDLA 2VQFB 4X89A 4DRXA 3JAKB 1NS1A 2JJ1G 3A0HZ 1YTFD 4B3SO 1Q90D 2QA4V 1IBMO 1DK1A 1FXKB 1YJ9V 5L3CA 1OCZC 1N33O 2JRIA 1F23A 4JI5O 2IH3C 5IYZA 1NTKH 3P30A 4O2BB 1XNQO 3CPWU 4H13B 4BWAA 1K34A 3AG1B 3HKCA 2FTKA 3K03A 1DF5A 3ABKB 1ZL8A 2IU3A 4B3RB 3NR7A 1WP7A 4HNAA 3E83A 4B7EA 3U10A 4TSFG 1K4DC 2XUMA 3TXSA 1S5JA 1L0NH 3DC5A 4DV1O 4J9YB 4X62O 3AEIA 4DV6O 4NXMO 3W7XA 4J9ZB 4AHCA 3JD4A 4O4IB 3T1CA 3CCJV 4FZ1A 1AJPA 4LFCB 5BZBA 2FL4A 4X1YA 4XBFA 2YI9A 1VQ9V 2CTPA 4JI0O 4LF4O 5EIBD 5CN0A 1OCOC 1QU7A 5H6RA 1IVSA 1R1BA 3ETQA 4X65O 2YEVA 3K59A 1TVKB 3APOA 5C8YB 1BCCH 2EIKB 4DW1A 1MOFA 2RJZA 2CE4A 3F7YC 2P6JA 4IL6Z 4GX5A 2PGGA 4TUYB 3J7AU 1PL0A 2QM8A 1Y6XA 3DXRA 5LHIA 1LUVA 2HR3A 1FAFA 1FPOA 1PNMA 1FJGB 2ZD9A 4K0KB 4DR2B 2ETNA 1VF6A 2X6BA 3WU2Z 3IC7A 3L75H 2P22C 3JAMN 4N21A 5B5EZ 2LJ2A 4Z2WA 2ZM6O 4G27B 3ZHUA 1SQQH 4MVZA 5H5NA 3H1LH 4J80A 3D3QA 3FX7A 5EBWC 3K5NA 3CCLV 3SJCC 3CS5A 1MMMA 2Z5UA 2YIAA 3VQXA 3ZN1A 1TUBA 5LGNA 4FLXA 3ASNB 2EINC 1IBKB 1PKXA 2EILB 2RN9A 2Q7EA 3CE2A 4RO2A 3W7TA 2OCCB 2BOBC 2V1DA 5CB4A 1R3IC 3ETGA 3BPZA 4MVRA 2BSKA 2IBZH 2UU9O 1VQNV 4LF7O 2Q4PA 3E86A 4GT1A 3ZHQA 5LL6Y 1AP5A 1Y74A 3IJ4A 3CCQV 4YJ3A 3M8AA 3AK1A 2ATKC 3ZBHA 1FFXA 5J2UA 2DYRB 5B3SB 1MZEA 1H2MA 4JV5O 1XEQA 3BA9A 4LF8B 5A9GA 2GUZB 4JYAO 3GWOA 1OJHA 2YUAA 4EB6B 3CC2V 3AG2B 4EKWA 4D7SA 1FKAO 3OEHG 2YI8A 4DXWA 4TV8A 4LCUC 1WJZA 1AVMA 3L70H 5L3EA 1D5AA 1AB3A 2R9IA 3E8BA 2Q7GA 3JAKA 3TK1A 2HVJC 2PUSA 1RFYA 4UXNA 2QM4A 3U11A 1Y4MA 1V9PA 4LF6O 4LFBB 1H2NA 5BMVB 3D36A 1K4CC 1FXKA 2GHYA 1VIBA 3H1HH 1S3JA 4DUZB 4JF3A 4UV9A 5CA0A 1KB9F 4DR3B 4DV3O 1G6UA 2YDEA 1B06A 3JCZA 4O2BA 4JASA 2OIEA 1JCHA 3HKBB 4J10A 5GONA 5KMGB 1X59A 1L1FA 1W59A 1KKCA 2BCCH 2EIMB 3HKEA 5GTHZ 2WLKA 5IJ9B 1GM9A 3CX5F 1R73A 4NXNB 1SC5B 1XHZA 1JPXA 5KX5B 3CD6V 1SF9A 1KYOF 4O4IA 4YHHO 5IT9N 4X9QA 1VQ5V 3LSSA 5LHGA 1JMKC 1K5QA 1N4CA 3ASOC 2FKXA 3VQWA 1GKFA 3UCSC 3AK2A 2QTOA 2Y69C 4QE9A 3FFQA 3CCEV 2B9ZA 2QEXV 3BRCA 1WA8B 4GX2A 2MW2B 3C3TA 1YEWA 5IYDO 2DE0X 1LUWA 1Y76B 3WB1A 1YITV 3G4SV 4GX1A 2DQ0A 2WLIB 1ZLZA 5CBGA 3THOA 3G80A 4J42A 3CXCU 1MSWD 3AK3A 4GCZA 3FYEB 1TVKA 3G6EV 4MSWC 2UXNA 1ORQC 1AILA 4YXWG 3ZHVA 1XI1A 3ICXA 1H38A 5LXTB 1AR5A 3LNNA 4KXRA 1NQTA 1K92A 4YIOA 2HHHB 3CHXA 4U3FH 3TETA 1N34O 1QNMA 1OV9A 5EC2C 4FJCC 3G71V 2H94A 2A3QA 2DN9A 4XDLA 4I55B 2Z0AA 1VQKV 3P3PA 1RM1B 1S77D 3K9AA 5FNVB 3O65A 1P4RA 4UCVA 2ARHA 2UUBO 2Q69A 2XOKG 5DECA 4PDRA 2PF4E 3JD3A 1I94B 1BMFG 4JI3B 5LP6B 4ABMA 4ZI7B 4RUFA 4X1IB 1YDXA 5EBMC 3A8TA 2RDCA 4K35A 2F1MA 2PY5A 5JVDA 3ZN0A 5B1NA 1HNZO 5KLVH 4UVAA 2QWOB 3MHHC 4JPRA 4JYYA 1K33A 3QO7A 3APQA 1KP3A 2QWPB 4K3AA 1PD3A 3SYQA 2GTSA 5CA1B 4PJ0Z 1DGSA 5B1BC 4AILC 2Q0OC 4MW3A 2WLJA 3OW2U 4FM0A 1RPOA 1PPJH 2LW7A 4CS3A 1V54C 4CH6A 4WFEA 1NH2B 4DUYO 4FMTA 2UXXA 4EB6A 2YIDA 4WFAV 3OTOB 1JFFB 4DR7O 3CRAA 2UXCB 1FXHA 3OEEG 3SPCA 3E89A 1RSOB 4GX0A 4E4EA 4IYHA 4D6TH 3F7VC 2B1GA 4JYCA 4QNHB 3CCVV 4IIJB 2JK5C 4NVPA 4DR6O 4UB6Z 2EIJB 3RFRA 3SPGA 3VQYA 3L9DA 2ZIOA 3O9OA 5D5QA 1FFTB 5BMVA 3WG7C 4UFZA 1BQZA 4CH5A 4NR1A 2LP7A 3CJHB 1M93A 1QQCA 1HR0B 5KA6A 4FFKA 5KMGA 4JI7B 3A0BZ 3B77A 3BCCH 2AHYA 2W0XA 2QM7A 3UQ8A 2ZR3A 1WB8A 5BR8B 4RUEA 2ZQMA 4FPPA 4RAIA 5JJEB 2BOCC 5IJ0B 4MVQA 3R66A 1MZFA 4MTOA 3E8GA 2YXHA 3ZS8C 2CTWA 1SA0B 4PI2A 2W0FC 2P06A 4E2LA 4PA6A 3SYAA 1IZ3A 2X6CA 3K04A 4DV4B 1K8AW 2JS3A 4LWSB 3D36C 2OWOA 2Q73A 3N2GB 3FB6C 4I4TA 1Y76A 4JI8O 4CH3A 4JI6O 4WFHA 2WLIA 4DR1B 1VQOV 2B5UA 2VWJA 5LMNO 2OIGA 4WFFA 5DEDA 2X0LA 4OX9O 4HZ3A 1COWG 5KAFZ 1NH2D 5EK0A 3K9SA 4BIOA 2ZDIA 4JI1B 2DMXA 2EJ7A 1J95A 1PM9A 4DV2O 5TISZ 4QPJA 1N0NA 4B3SB 1IBMB 2KG7A 3CMEV 5KUMA 3ABMB 2EULA 1AR4A 2XAGA 1N33B 1MABG 2EZOA 4JI5B 2CH7B 4WF9V 1R3JC 3J80N 3T1HO 1XNQB 4X20B 3CCSV 2RQ6A 3I5DA 1QHTA 1HP8A 2CUGA 1ZUQA 2OT5A 3AG7A 2Y0PA 4X62B 4DV6B 1URFA 4NXMB 3TXQA 4RQFA 2FMLA 3ZX6A 4F6RB 4CZZA 2EIKC 4O4LA 1WPBA 4ZI7A 4X1IA 3CRQA 3ETEA 4P30A 5K1XA 3K79A 1M57B 1YHQV 4I50B 4JI0B 1BSMA 2WAMA 4LF4B 4MVSA 4MT8A 4I9QA 5E79Z 3JAWB 4NTYA 5F2VO 1F7YA 4X65B 2QKCA 2UXBO 1IBLO 5L3GA 4ICGA 2CDYA 1XDCA 1XMOO 2QDOA 2AW9A 1AI4A 4GYCB 4O4JB 4F4LA 3CYOA 5EYPA 4FLUA 1J5EO 3HR0A 3FB7C 2EILC 4DV5O 1YJWV 2JS5A 4LNUA 1JVMA 1QLNA 1XHXA 1RSOA 2GTAA 4R50A 5EBLC 4NTWA 2WLLA 2ZM6B 1YI2V 3QG5A 5JH7B 1I08A 2IM9A 2QGNA 4ZHQB 2ZT9B 5DM6V 3FD9A 4FFBB 2VS0A 2NR5A 4CC6A 1EN4A 1Q8IA 2HVKC 1GN4A 1TAEA 5L3DA 1Z5WA 3CJHA 2XAHA 2DYRC 5B3SC 1QVGU 1Q6UA 2Z3YA 4GZRB 2QTSA 1JQ0A 2IJHA 4KHPO 2Q0AA 1AI5A 1JJOA 3P3NA 1YF2A 2K1EA 1SZTA 4B7KA 1N0JA 3AG2C 2PZSA 1PNKA 1L0LH 1NZ6A 2UU9B 5LA6B 3AG3B 4DR5O 4LF7B 5LOVA 5IDJA 1BZKA 4O2AB 1SA0A 2ZXWB 4GKKO 4O4HB 2ODMA 1M9NA 3FYIB 4CS2A 3CCMV 2HKOA 3L71H 1O9GA 4FLWA 2P90A 1JJ2U 1PP9H 3CXHF 4JV5B 4WFBV 3ZIAG 4JYAB 1FYJA 2KKWA 2QWRB 2KQXA 3ZEDA 2F43G 3X2QB 3BVOA 4F6EA 3W7SA 1R6TA 3OT7A 1IDSA 2EIMC 3SYCA 4P9OA 1F4NA 3ABUA 1NBMG 2HFEC 1DTOA 3E22A 5B1AC 1ZWIC 4X64O 1OCZB 5IYBO 5BXZA 5KHIA 1ZTEA 5FL7G 4LF6B 1IURA 2Q67A 4G28B 1P7GA 2HP8A 3CMAV 2DYSC 3VBBA
chains in the Genus database with same CATH topology
4R7CA 4YXWG 1H38A 1R3LC 2R9RB 3K3WA 3RW0A 2IU0A 1NQTA 1B6QA 1M57C 3ASNC 4BIZA 2YEVB 1K92A 4PDMA 3P32A 2WWWA 4KP4A 4UV8A 1CEZA 4TWKA 1Q81W 3TETA 5EC2C 1AR1B 4JGSA 3OGCC 4FJCC 4U7OA 5L3BA 3G71V 2OCCC 1NR7A 2H94A 3OM3B 1JX9A 5HFMA 3T2MA 1HWYA 4XDLA 3IFXA 2A0LA 5KUKA 2M7WA 3ZRVA 1W0KG 1KQSU 1V55C 1VQKV 1QR8A 2ZDIC 3OE7G 1RM1B 1VQ4V 4ZBMA 3K0GA 3I55V 3K9AA 4MVUA 1Q7YW 1S77D 3MHSC 2GSMB 4JAUA 1NVPD 4MW8A 1P4RA 2Q69A 3B8NA 3OR7C 1YTFB 2XOKG 4MTGA 1BL8A 4PDRA 3F5WC 2QKSA 3JD3A 3LNMB 1BMFG 4XDJA 5B1BB 1G8MA 2NNUA 4RUFA 1N8RW 4JAVA 5EBMC 3ZRSA 3E8FA 4TT3G 3LSQA 3ZN0A 3A0RA 5B1NA 1THZA 4UVAA 4UVBA 1KD1W 3MHHC 1Y66A 1V54B 5IY5C 4JPRA 5IYCO 1RM1C 3SYPA 1AJQA 3OUSA 2WPDG 3TCUA 1NVPB 1K33A 2Q6AA 3JD1A 1EZJA 4HAMA 5H6QA 3QO7A 1KP3A 1VQMV 3SPJA 1VQLV 5L3FA 4FK5C 2PI4A 1PD3A 3SYQA 2JEXA 3M99B 1AROP 5KA5A 4UUJC 3ZJZA 1YJNV 1M56B 5B1BC 2OTLV 1KP2A 4MW3A 4L87A 1M90W 1R3KC 2WLJA 1SETA 4PELA 3OW2U 3STZC 1RPOA 2PI5A 1XL6A 2XAJA 2JJ2G 2XASA 1V54C 3LUTB 1K97A 4WFEA 1NH2B 1E1QG 5LGTA 1FXVA 4FMTA 2UXXA 3W7UA 1I5XA 3AG4B 1QBZA 4WFAV 3ZMZA 3QO8A 3ABLB 3AG3C 4X8AA 3ZRWA 3ZCCA 3ZRXA 1OCRB 3H01A 3CC4V 1FXHA 3OEEG 3SPCA 3E89A 1BHAA 4GX0A 1EBOA 4MTXA 3F7VC 2B1GA 4JYCA 4QNHB 3CCVV 3E35A 2JK5C 2ITDC 2ZXWC 4JTDB 3DGEA 5HFLA 3K0DA 1GMGA 2EIJB 2NLJC 3SPGA 3BEHA 4LBEC 1K73W 4PA9A 1I5YA 1CPYA 4Q20A 1FFTB 3QO5A 3VOUA 4QJFB 2WSSG 3WG7C 1VQ8V 5J9PC 1LNQA 3SYOA 3E2EA 4BW5A 4Z1MG 2HG5C 3AG4C 1QCEA 3ZMTA 3ZMUA 3X2QC 5H9CA 2LP7A 3UKMA 2HLDG 3ABLC 4PDLA 4X89A 1M1KW 3E8HA 5KA6A 2AHZA 4BIUA 2V7QG 3B77A 2JIZG 2JJ1G 1YTFD 3OFNG 1XL4A 2QA4V 2AHYA 2DWEC 2QM7A 1FXKB 1YJ9V 1FS0G 5LGUA 5L3CA 1OCZC 2EIJC 3LDDA 2ZR3A 1QVFU 1F23A 4RUEA 5EC1C 2IH3C 1EFRG 3OUFA 3OMIB 2ZQMA 3CP1A 4FPPA 3EFFK 4RAIA 1W0JG 3P30A 3CPWU 3UM7A 2LFRA 1K34A 2BOCC 3AG1B 2FTKA 2EZPA 3K03A 5E1AC 4MVQA 1DF5A 1F4MA 3ABKB 1NKDA 2IU3A 4MTOA 1QLEB 2HJFC 2C2AA 3E8GA 3E83A 4P9PA 1K4DC 1OCOB 4TSFG 2X6AA 2W0FC 4E2LA 4PA6A 1SESA 3SYAA 1JOYA 2X6CA 4J9YB 3K04A 3AEIA 1K8AW 3K08A 3W7XA 1K3EA 3D3IA 4J9ZB 3JD4A 3GB7C 3FB6C 1K5SA 4QE7A 4WFGA 4WFHA 3PJSK 3T1CA 3LDEA 1AI7A 2WLIA 3CCJV 2DWDC 1AJPA 2XAQA 2B5UA 1VQOV 5BZBA 4XBFA 4PA7A 4WFFA 2WLMA 1VQ9V 2X0LA 4PA3A 1MG1A 5C93A 4HZ3A 1COWG 1AJNA 1E1RG 1QLEC 1RPRA 2IJKA 5CN0A 3SPHA 5EK0A 1NH2D 1OCOC 2ZDIA 4G2KA 1NJIW 3SPIA 5H6RA 3ABTA 4H37A 3RVZA 1J95A 3T4DA 3WFVA 2YEVA 2Y48A 4QPJA 3LDCA 3FB5C 3CMEV 1DF4A 2EIKB 5KUMA 3ABMB 1SERA 3FKSG 3ZMSA 2XAGA 1MOFA 3ASOB 1MABG 2EBOA 1OCCB 3F7YC 2EZOA 2WLHA 2Y69B 4WF9V 2A9HA 2JDIG 2P6JA 1R3JC 4GX5A 2KB1A 1WPXA 3CCSV 2H8PC 1PL0A 2QM8A 1ROPA 2EINB 5LHIA 2WLNA 2HR3A 1GK9A 2YSUB 1PNMA 2ZD9A 2OTJV 5CBFA 2CK3G 3DTUB 2X6BA 5B1AB 3IC7A 2OT5A 3ML0A 1H2GA 4N21A 4G27B 1CP9A 4RQFA 4MVZA 1M56C 3QNEA 1BHBA 4CZZA 3KG2A 2EIKC 2LFSA 1H8HG 3OMAB 1OCCC 1GO3F 5EBWC 3ETEA 4P30A 2DYSB 3CCLV 1Q82W 2IW5A 2XNDG 4P2ZA 1R6KA 4XDKA 4I9WA 3K79A 5LHHA 2Z5UA 3K06A 4MVMA 3ZN1A 4CBCA 5LBQA 5LGNA 2D3OW 1M57B 3ASNB 2EINC 4MS2A 1YHQV 2WAMA 3BY6A 4ASUG 1PKXA 1SRYA 1K9MW 2EILB 4MT8A 4MVSA 4N23A 4ZKIA 3CCRV 2DW4A 1OCRC 2XAFA 2P7TC 3STLC 3W7WA 4RO2A 4KUMA 3W7TA 2OCCB 2BOBC 1P7BA 2V1DA 1R3IC 3B8MA 3ETGA 5L3GA 5CA3A 4MVRA 2MK3A 1V55B 1VQNV 1AI4A 4F4LA 3CYOA 3T4ZA 1IXMA 3EHBB 1E79G 3E86A 4GT1A 2P67A 2DQ3A 4R8CA 1DLBA 1VQ7V 1S0VA 2W6IG 2EILC 3FB7C 4UVCA 1YJWV 3IGAC 3CCQV 3HPLC 1JVMA 2ATKC 1QLNA 1ENVA 2DYRB 3I56V 5B3SB 4H33A 4R50A 1YSCA 5EBLC 1FXKC 2WLLA 1YI2V 1PNLA 2IH1C 4LP8A 1NR1A 3GWOA 4QIWF 4BAYA 3CC2V 3HB3B 4KFMA 5IY5B 5DM6V 5DN6G 3AG2B 4EKWA 1KKDA 3AG1C 3OEHG 3ZRWB 4DXWA 1AI6A 4OXSA 3ABKC 4LCUC 4MVOA 2HVKC 3OAAG 1S5HC 2X7RB 5L3DA 4HYOA 2EJRA 3CCUV 1QR9A 3ZMVA 5L3EA 1VQ6V 4X88A 2R9IA 3E8BA 2XAHA 4PDVA 5CMUA 2DYRC 5B3SC 3TK1A 2HVJC 2IJJA 1QVGU 4UXNA 2Z3YA 2ITCC 3R65A 1Y4MA 4MTFA 1JQ0A 2IJHA 3D36A 1K4CC 1GTOA 1FXKA 2GHYA 1AI5A 1S3JA 1R6NA 2IJIA 3OR6C 4JF3A 4UV9A 2K1EA 1SZTA 1WLEA 3AG2C 1S76D 1PNKA 4QPKA 1UJWB 3JCZA 4JASA 3SJQC 1JCHA 3AG3B 1L1FA 2EIMB 4U7NA 5IDJA 2WLKA 2B1IA 4JYBA 4RQEA 1GM9A 1S72V 1R73A 1TUEB 5CBHA 1VQPV 2ZXWB 1Q86W 1JPXA 2ZR2A 5GW7A 1M9NA 4JTAB 3FYIB 5B1OA 3CCMV 2HKOA 3CD6V 2P90A 1JJ2U 2JEUA 1VQ5V 1W2BU 3ABMC 3LSSA 3WG7B 5LHGA 4I5SA 1YIJV 1KC8W 1K5QA 4WFBV 3ASOC 3CC7V 3ZIAG 1GKFA 3RBZA 2QTOA 2Y69C 3NXSA 3RVYA 4QE9A 2Q68A 1K7DA 2F43G 3X2QB 3CCEV 2QEXV 3W7SA 4GX2A 1OZ0A 4PA4A 2EIMC 3SYCA 4WCEV 5IYDO 4P9OA 1F4NA 3ETDA 3FB8C 3ABUA 2WLLB 1NBMG 2HFEC 4DO2A 2QE7G 1YITV 3G4SV 1DTOA 4GX1A 5B1AC 1OHHG 1ZWIC 2DQ0A 1OCZB 5IYBO 3MD0A 2WLIB 5CBGA 3JD0A 1G4YB 3OMNB 1KECA 4JTCB 5FL7G 3JD2A 3CXCU 1MSWD 1GM7A 4GCZA 3FYEB 3JYCA 1H8EG 2A79B 2W6JG 4LC1A 3G6EV 2Q67A 4G28B 4MSWC 2UXNA 1ORQC 1F51A 3CMAV 4R6ZA 2DYSC 4FIPC 1GM8A 3VBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7C A;  3SPC A;  3E89 A;  4GX0 A;  1R3L C;  2R9R B;  3LDC A;  3FB5 C;  3RW0 A;  4KFM A;  3F7V C;  4QNH B;  4EKW A;  5KUM A;  1KKD A;  3AG1 C;  2JK5 C;  1M57 C;  3ASN C;  2ITD C;  2ZXW C;  4JTD B;  4DXW A;  4PDM A;  3F7Y C;  4OXS A;  2WLH A;  3ABK C;  3K0D A;  2A9H A;  1R3J C;  4LCU C;  4MVO A;  2NLJ C;  2HVK C;  3SPG A;  3BEH A;  4LBE C;  4TWK A;  4PA9 A;  4GX5 A;  1S5H C;  3TET A;  4HYO A;  5EC2 C;  2KB1 A;  3VOU A;  3OGC C;  2H8P C;  3WG7 C;  2OCC C;  4X88 A;  5J9P C;  3E8B A;  1LNQ A;  2WLN A;  4PDV A;  2DYR C;  3SYO A;  5B3S C;  4BW5 A;  2HVJ C;  3T2M A;  2ZD9 A;  2ITC C;  3R65 A;  2HG5 C;  3AG4 C;  5CBF A;  4XDL A;  3X2Q C;  2X6B A;  3IFX A;  2A0L A;  3ABL C;  4MTF A;  4PDL A;  3UKM A;  1K4C C;  4X89 A;  5KUK A;  1V55 C;  3E8H A;  4G27 B;  3K0G A;  4ZBM A;  2AHZ A;  1M56 C;  3OR6 C;  4MVU A;  4MVZ A;  2K1E A;  3KG2 A;  3AG2 C;  4MW8 A;  2EIK C;  1XL4 A;  2Q69 A;  2AHY A;  2DWE C;  3OR7 C;  1OCC C;  3SJQ C;  4MTG A;  1BL8 A;  1OCZ C;  4P30 A;  4PDR A;  3F5W C;  2EIJ C;  2QKS A;  3LDD A;  5EBW C;  5EC1 C;  4P2Z A;  4RUE A;  2IH3 C;  4I9W A;  4XDK A;  3OUF A;  3LNM B;  3K06 A;  4MVM A;  3EFF K;  4RAI A;  2WLK A;  4XDJ A;  4CBC A;  3UM7 A;  2BOC C;  4RUF A;  5CBH A;  4MS2 A;  2EIN C;  5EBM C;  3ZRS A;  3K03 A;  5E1A C;  4MVQ A;  3E8F A;  4MVS A;  4MTO A;  1OCR C;  2HJF C;  2P7T C;  3E8G A;  3E83 A;  4P9P A;  4JTA B;  3STL C;  1K4D C;  4RO2 A;  5IY5 C;  2X6A A;  2W0F C;  4PA6 A;  3OUS A;  3ABM C;  3SYA A;  3SYP A;  2X6C A;  4J9Y B;  3ASO C;  2BOB C;  1P7B A;  3K04 A;  3TCU A;  1R3I C;  3K08 A;  2Q6A A;  3RBZ A;  2QTO A;  2Y69 C;  3RVY A;  4J9Z B;  4QE9 A;  3GB7 C;  3FB6 C;  2Q68 A;  4MVR A;  4QE7 A;  3SPJ A;  4WFG A;  4WFH A;  4GX2 A;  3SYQ A;  4PA4 A;  3PJS K;  2EIM C;  3T1C A;  3SYC A;  3LDE A;  4UUJ C;  3ZJZ A;  4F4L A;  2WLI A;  4P9O A;  2DWD C;  5B1B C;  5BZB A;  3FB8 C;  3T4Z A;  3E86 A;  2WLL B;  4MW3 A;  2HFE C;  4PA7 A;  4WFF A;  2WLM A;  1R3K C;  4R8C A;  4GX1 A;  5B1A C;  2WLJ A;  1ZWI C;  3FB7 C;  2EIL C;  4PA3 A;  4HZ3 A;  3STZ C;  2WLI B;  1QLE C;  3IGA C;  1XL6 A;  5CBG A;  1G4Y B;  3HPL C;  1JVM A;  4JTC B;  5EK0 A;  3SPH A;  2ATK C;  1OCO C;  1V54 C;  3LUT B;  4WFE A;  3JYC A;  2A79 B;  3SPI A;  4H33 A;  2Q67 A;  4G28 B;  4H37 A;  4MSW C;  4R50 A;  5EBL C;  3RVZ A;  1J95 A;  1ORQ C;  2WLL A;  3T4D A;  3AG3 C;  2YEV A;  2DYS C;  4R6Z A;  4X8A A;  2IH1 C;  4LP8 A; 
#chains in the Genus database with same CATH topology
 3SJB C;  4X1K A;  4R7C A;  2CH7 A;  1R3L C;  2R9R B;  3K3W A;  1N32 O;  4DV3 B;  3BHP A;  1M5I A;  1B6Q A;  2EX3 A;  3TJT A;  4PDM A;  1SS3 A;  2WWW A;  3N2K A;  4KP4 A;  2YIB D;  3WB0 A;  1Q81 W;  3C3S A;  3JSL A;  1AR1 B;  3OGC C;  4C7U A;  5L3B A;  1NR7 A;  3RWR D;  2D2C B;  3T2M A;  5JJN B;  4F6R A;  4YHH B;  4JZG A;  1W0K G;  1V55 C;  2ZDI C;  1Q7Y W;  3I55 V;  4MVU A;  1EM1 A;  2GSM B;  2ZKO A;  4JAU A;  3K5M A;  4DV0 O;  1CXZ B;  3OR7 C;  5JQG B;  1D2D A;  3F5W C;  4WBN B;  2NN4 A;  3RYI B;  2E75 B;  1G1X B;  1LR1 A;  1YZB A;  1GRJ A;  1A32 A;  3MAQ A;  4UVB A;  3UO2 A;  1Y66 A;  5IY5 C;  5IYC O;  1RM1 C;  2WPD G;  3TCU A;  4O4J A;  5H6Q A;  1ZSP A;  2ZIN A;  4W4L A;  1XNR O;  2E5L O;  4FK5 C;  2PI4 A;  3M99 B;  4DR4 O;  4UUJ C;  3UO3 A;  1D5N A;  5LYJ B;  1HDJ A;  2UUA O;  2OTL V;  4H0L B;  4L87 A;  3B09 A;  1N34 B;  1M90 W;  1SET A;  2F4V O;  1N36 O;  1YXB A;  2PI5 A;  4LF9 O;  4EEQ A;  2XAS A;  1E1Q G;  4ZHQ A;  1FXV A;  5LGT A;  2ZE6 A;  1BE3 H;  1I5X A;  3ZMZ A;  3ABL B;  4X8A A;  3ZRX A;  1MNG A;  1BHA A;  2UUB B;  2ITD C;  5HFL A;  1SQV H;  3QF7 A;  2NLJ C;  3BEH A;  4Z1V A;  2V4D A;  3VOU A;  3CRC A;  4DYL A;  5C8Y A;  5J9P C;  1LNQ A;  3SYO A;  1HNZ B;  2ZNI A;  2HG5 C;  3F5T A;  5D5P A;  5H9C A;  4JI4 O;  4KL1 A;  1M1K W;  3E8H A;  2CTR A;  3MDS A;  4AQY O;  2WA4 A;  2AHZ A;  4TUY A;  2V7Q G;  4BIU A;  4DV7 O;  2A06 H;  1Z5V A;  5ITZ B;  4IYI A;  2N04 A;  5LGU A;  2EIJ C;  3LDD A;  3H1J H;  1QVF U;  5EC1 C;  1EFR G;  3OUF A;  2VQE O;  3OMI B;  3CP1 A;  3UM7 A;  1VMG A;  2LFR A;  1EN6 A;  4TV9 B;  4YJ2 B;  3M7M X;  3RYH B;  4LR3 A;  1F4M A;  1NKD A;  4IHJ B;  4NTX A;  1QLE B;  2HJF C;  2C2A A;  4P9P A;  4DUY B;  3Q4H B;  2X6A A;  1SES A;  5KHK A;  4DR7 B;  1ZAU A;  1NTZ H;  1FD9 A;  3D3I A;  2PYJ A;  3GB7 C;  1K5S A;  4QE7 A;  1WNS A;  5EZY B;  3PJS K;  1H2L A;  1AP6 A;  3IC9 A;  3KKY A;  4DR6 B;  1AI7 A;  2XAQ A;  2ZE7 A;  3KZI Z;  4J7J A;  4PA7 A;  2WLM A;  4PA3 A;  1MG1 A;  2QWN B;  3S3X A;  1RPR A;  2RMK B;  5IE9 A;  2IJK A;  4AI8 A;  4UCO A;  1VF6 C;  4G2K A;  1NU1 H;  4I0X B;  3IAY A;  1KUQ A;  3SPI A;  3ABT A;  3JAL B;  2ZIM A;  4H37 A;  1T5E A;  3WFV A;  4IT5 A;  1VP7 A;  1DF4 A;  1SER A;  4UCR A;  4DK0 A;  3ZMS A;  2BTQ B;  3ASO B;  1OCC B;  2WLH A;  2Y69 B;  2A9H A;  2JDI G;  1M4U A;  4FM2 A;  1B3Q A;  2GUZ A;  1WPX A;  4PHZ A;  2H8P C;  1VF7 A;  4LFA O;  2YSU B;  2LO1 A;  5CBF A;  1SZX A;  3BFR A;  2CK3 G;  3DTU B;  3ML0 A;  1H2G A;  1GN6 A;  1WN7 A;  2WA3 A;  1NTM H;  1M56 C;  3HKC B;  1GH6 A;  1BHB A;  4JI8 B;  1H8H G;  4JI6 B;  1GO3 F;  1R6K A;  4I9W A;  5LMN B;  5EIB C;  4MVM A;  4CBC A;  5LBQ A;  2D3O W;  1BT8 A;  5KHJ A;  4OX9 B;  2BTO A;  3K5L A;  4ASU G;  1SRY A;  2ZE5 A;  4N23 A;  4ZKI A;  4HBN A;  1OCR C;  4FLZ A;  2P7T C;  3HKB A;  3W7W A;  5FLX N;  4KUM A;  1HW7 A;  4X1Y B;  1SQP H;  5IJ9 A;  1P7B A;  2YXL A;  4BR6 A;  3CB2 A;  4DV2 B;  2QKA A;  1MSD A;  5CA3 A;  4LF5 O;  2KSD A;  5KX5 A;  4CC5 A;  4J11 A;  2RNB A;  4X66 O;  1E79 G;  3T1H B;  2P67 A;  4R8C A;  1VQ7 V;  2W6I G;  4UVC A;  3D8C A;  3CEI A;  1WA8 A;  3I56 V;  1SQX H;  1SQF A;  2F93 B;  1VEW A;  4H33 A;  2R72 A;  1YSC A;  4UCT A;  1FXK C;  2HEP A;  2R9A A;  1PNL A;  1HNW O;  4LP8 A;  2UXD O;  2E76 B;  1YCI A;  1XBL A;  5DN6 G;  1JA8 A;  1KKD A;  3AG1 C;  1Q3E A;  4OXS A;  3ABK C;  5LMU O;  4MVO A;  3BA8 A;  3C90 A;  4HYO A;  2EJR A;  3ZMV A;  5IWA O;  4B3T O;  5LXT A;  4PDV A;  2IJJ A;  2ITC C;  3R65 A;  3DSQ A;  5J2T B;  1US6 A;  4MTF A;  1GTO A;  2CGN A;  4ZIB A;  2LGW A;  5ITZ A;  3UT5 B;  2UXB B;  2IJI A;  3OR6 C;  1IBL B;  2OCH A;  1WLE A;  4RWU A;  4QPK A;  1UJW B;  3B40 A;  1XMO B;  1XUQ A;  3SJQ C;  3L74 H;  4YJ2 A;  4I55 A;  4IHJ A;  4U7N A;  2ZCE A;  4JYB A;  5CB4 B;  4RQE A;  1J5E B;  4YY3 O;  5FNV A;  4DV5 B;  4GKJ O;  2BSK B;  3T1Y O;  1Q86 W;  2R70 A;  4DV1 B;  2QSA A;  4JTA B;  5B1O A;  3SJA C;  5EZY A;  1W2B U;  1KC8 W;  1GN3 A;  3WG7 B;  4I5S A;  1YIJ V;  1Q43 A;  1PV0 A;  2ZNJ A;  5LP6 A;  5JCO A;  2Q68 A;  1K7D A;  4CH4 A;  4J41 A;  2UUC O;  4DV4 O;  1FFX B;  5J2U B;  2A7W A;  1P84 F;  3KCX A;  3FB8 C;  2QE7 G;  2GV9 A;  4I0X A;  2YS8 A;  1OHH G;  3S3W A;  3JAL A;  4B3M O;  3JD0 A;  5B66 Z;  1G4Y B;  1KEC A;  3JD2 A;  4D7T A;  1GM7 A;  4LH6 A;  1H8E G;  2W6J G;  5CA1 A;  4TV8 B;  2BTQ A;  4R6Z A;  4FIP C;  1GM8 A;  3RW0 A;  3G67 A;  2H3O A;  1TA8 A;  3ASN C;  4BIZ A;  4DR5 B;  4UV8 A;  1JFF A;  2AZ2 A;  5CA0 B;  4UB8 Z;  1IXB A;  4U7O A;  4GKK B;  2OCC C;  3SDL A;  3OM3 B;  1JX9 A;  1HNX O;  4IIJ A;  5GON B;  5HFM A;  2N74 A;  3IFX A;  2A0L A;  3HKE B;  3ZRV A;  1KQS U;  4K8X A;  3OE7 G;  1VQ4 V;  4JI2 O;  3MHS C;  3VQV A;  1NVP D;  4MW8 A;  4QGP A;  2DOS A;  1WB7 A;  3PN1 A;  2QKS A;  3LNM B;  1G8M A;  4X64 B;  1N8R W;  4JAV A;  3ZRS A;  2YIC A;  4JZ2 A;  1XMQ O;  2Y4U A;  3LSQ A;  3H1K H;  5K1P A;  1NI8 A;  1THZ A;  1KD1 W;  2VQF O;  3SYP A;  5KHG A;  2ZE8 A;  2XT9 A;  1EZJ A;  4HAM A;  5IJ0 A;  2F95 B;  1N32 B;  1VQM V;  5L3F A;  1SQB H;  1ARO P;  3K58 A;  3ZJZ A;  2FYU H;  1KP2 A;  2P4K A;  4LWS A;  4PEL A;  3N2G A;  2LGQ A;  1XL6 A;  2XAJ A;  4B3R O;  2JJ2 G;  1Q6H A;  3LUT B;  2ADP A;  3RYC B;  2XTA A;  3AG4 B;  2QWQ B;  1O9H A;  3CC4 V;  4DV0 B;  3K57 A;  1Q5O A;  1EN5 A;  5H2F Z;  5KHH A;  4LFC O;  1K73 W;  1XOU A;  2P5O A;  5J2T A;  1CPY A;  3HKD B;  3QO5 A;  4PD4 F;  1VQ8 V;  5GTI Z;  3UT5 A;  4BW5 A;  4Z1M G;  2CTQ A;  3KCY A;  3ZMT A;  3ZMU A;  2G38 A;  3ABL C;  4X20 A;  1P49 A;  2JIZ G;  4I7Z B;  1MA1 A;  1XNR B;  3OFN G;  1XL4 A;  5JWP A;  2DWE C;  2E5L B;  5JVD B;  1FS0 G;  4BW9 A;  4DR4 B;  2UUA B;  3EFF K;  1W0J G;  4NB5 A;  3A2F A;  1N36 B;  2F4V B;  3GVM A;  2EZP A;  4LF9 B;  5E1A C;  1I0H A;  4GUN A;  3B2E E;  1FJG O;  4K0K O;  1GN2 A;  4DR2 O;  1OCO B;  2OYQ A;  1JOY A;  3QTC A;  2JGD B;  3K08 A;  1K3E A;  4I50 A;  4H44 B;  2Q8V A;  4WFG A;  4U3J B;  3LDE A;  3JAW A;  2DWD C;  3DC6 A;  1YVW A;  3ZHS A;  1GAX A;  2E74 B;  5C93 A;  1BS3 A;  1IBK O;  1AJN A;  1E1R G;  2DJV A;  1QLE C;  3K5O A;  2AXT Z;  1EZV H;  1PL4 A;  3SPH A;  3CSX A;  4FZ0 A;  1XQ8 A;  1NJI W;  4FVM A;  3RVZ A;  4JI4 B;  3T4D A;  4AQY B;  2O57 A;  2Y48 A;  4DV7 B;  2F66 C;  4OPH A;  1SKV A;  3LDC A;  3FB5 C;  5LP6 C;  3U0Z A;  3FKS G;  5JCO C;  2EBO A;  2VQE B;  2Q7H A;  1NT2 B;  2KB1 A;  5JH7 A;  4A5U B;  1XIL A;  1RP3 B;  2AZ0 A;  1ROP A;  2EIN B;  2WLN A;  4J7Z A;  1GK9 A;  3JAS B;  2E3C A;  5AG2 A;  4FFB A;  2OTJ V;  1H2K A;  2LW1 A;  5B1A B;  4EFE A;  1IX9 A;  3H9V A;  4LF8 O;  1CP9 A;  3QNE A;  2YIB A;  3ZHT A;  3KG2 A;  2LFS A;  2Y4T A;  1U97 A;  3OMA B;  1OCC C;  3BAB A;  3H1I H;  2DYS B;  1Q82 W;  2IW5 A;  2XND G;  4P2Z A;  4XDK A;  4B08 A;  2YXY A;  5LHH A;  3K06 A;  4K8Z A;  4MS2 A;  3EXA A;  1I7F A;  3EVK A;  3BY6 A;  4I4T B;  3FAV B;  1K9M W;  3WB2 A;  3JAR B;  4YIP A;  3CCR V;  2DW4 A;  3OTF A;  2XAF A;  5LA6 A;  2QR4 A;  3STL C;  4LFB O;  2QJ1 A;  4JAA A;  4O2A A;  3B8M A;  4DUZ O;  4LH7 A;  4ZOL B;  4OGQ B;  1XRE A;  4DR3 O;  4DK1 A;  4O4H A;  1H2S B;  2MK3 A;  1V55 B;  1X4T A;  5BY1 A;  1TGO A;  1VF5 B;  3CWB H;  3T4Z A;  1IXM A;  3EHB B;  3QVN A;  3JAT B;  3RYC A;  2DQ3 A;  1DLB A;  4NXN O;  1S0V A;  2GDS A;  4IGG A;  3IGA C;  4LFA B;  2KG7 B;  3HPL C;  1ENV A;  2YC0 A;  2CGO A;  4TQD A;  2IH1 C;  1NR1 A;  2PTM A;  4QIW F;  4BAY A;  2M6Y A;  3HB3 B;  4KFM A;  5IY5 B;  2AGA A;  3J81 N;  2K9P A;  4OPA A;  3HKD A;  3ZRW B;  1AI6 A;  4FLT A;  1JR9 A;  3OAA G;  1S5H C;  2X7R B;  3CCU V;  1QR9 A;  4O4L B;  1VQ6 V;  4X88 A;  2Y0I A;  2L35 A;  5CMU A;  1U96 A;  3RYF B;  2GBO A;  3GWK C;  1KU9 A;  1R6N A;  1KBH A;  1UFI A;  3ZHR A;  4LF5 B;  1S76 D;  1L8D A;  4FLV A;  4DRX B;  2Q9L A;  2CAZ C;  4X66 B;  2HHH O;  2FB5 A;  3TGU H;  3LSU A;  2B1I A;  3CRR A;  3CRM A;  1S72 V;  1SQG A;  1TUE B;  5CBH A;  3RN4 A;  1VQP V;  2L6L A;  2ZR2 A;  5IYZ B;  2JGD A;  5GW7 A;  5JQG A;  5FPR A;  5FPO A;  4NYK A;  1Q6I A;  4WBN A;  3RYI A;  1B04 A;  2JEU A;  3ABM C;  4U3J A;  5EYP B;  3CC7 V;  1ZL8 B;  4HNA B;  3RBZ A;  1HNW B;  2UXD B;  3NXS A;  3RVY A;  2BE3 A;  4LNU B;  4TOI A;  3G6B A;  5JJJ B;  1OZ0 A;  4PA4 A;  4WCE V;  3ETD A;  5LMU B;  2WLL B;  1I94 O;  4JI3 O;  4DO2 A;  4CS4 A;  3SGI A;  3MD0 A;  5IWA B;  1BQ0 A;  4B3T B;  3OMN B;  4JTC B;  4GLX A;  3JYC A;  2A79 B;  1S5L Z;  4LC1 A;  5LYJ A;  4PV1 B;  1F51 A;  1KMI Z;  5A2Q N;  3OD4 A;  2LQT A;  2IU0 A;  1UPG A;  1M57 C;  2YEV B;  3P32 A;  4FM1 A;  1CEZ A;  4TWK A;  2N05 A;  3JAS A;  4YY3 B;  4JGS A;  4GKJ B;  4W4K A;  3T1Y B;  3JSN A;  1HWY A;  1ZX3 A;  5KUK A;  2M7W A;  5LOV B;  3DXR B;  3OTO O;  1QR8 A;  4ZBM A;  3K0G A;  2UXC O;  3JCU Z;  3RT3 C;  3RGB A;  1Y67 A;  2UUC B;  3B8N A;  4FLY A;  1YTF B;  4L8J A;  1BL8 A;  4MTG A;  3FAV A;  3OGI B;  3JAR A;  2JVD A;  4XDJ A;  5B1B B;  4EFB A;  2NNU A;  3L73 H;  1BGY H;  2XHB A;  4UCU A;  4B3M B;  3E8F A;  4TT3 G;  3A0R A;  1TUB B;  4ZOL A;  2VRZ A;  3B4S A;  1V54 B;  4PI0 A;  4NKG B;  1AJQ A;  3OUS A;  1NVP B;  2PYL A;  1HR0 O;  4JI7 O;  2Q6A A;  2P4V A;  3E22 B;  3JD1 A;  5KAI Z;  4TV9 A;  3RYH A;  3JAT A;  3SPJ A;  1VQL V;  2JEX A;  5KA5 A;  1YJN V;  1M56 B;  5BR8 O;  3Q4H A;  1WP8 A;  1R3K C;  4X1K B;  4J7K A;  3STZ C;  1WAZ A;  1HNX B;  1Z2G A;  1K97 A;  3W7U A;  1Y74 B;  4DW0 A;  3N2K B;  1QBZ A;  4Q6G A;  1VAR A;  4YJ3 B;  3QO8 A;  3AG3 C;  3ZRW A;  3ZCC A;  1OCR B;  3H01 A;  4JI2 B;  1EBO A;  4MTX A;  3N27 A;  4TQF A;  3E35 A;  2JGU A;  2HJD A;  2ILM A;  2ZXW C;  4JTD B;  3DGE A;  3K0D A;  4DR1 O;  4UCS A;  1GMG A;  4LBE C;  4PA9 A;  1I5Y A;  3RYF A;  4Q20 A;  3SR2 C;  2WSS G;  4QJF B;  2VWK A;  4KHP B;  1XMQ B;  2F23 A;  3E2E A;  2Q5Z A;  1QCE A;  2ADQ B;  3AG4 C;  2RCV A;  3BAA A;  3L72 H;  4JI1 O;  3X2Q C;  3UKM A;  2HLD G;  4PDL A;  2VQF B;  4X89 A;  4DRX A;  3JAK B;  1NS1 A;  2JJ1 G;  3A0H Z;  1YTF D;  4B3S O;  1Q90 D;  2QA4 V;  1IBM O;  1DK1 A;  1FXK B;  1YJ9 V;  5L3C A;  1OCZ C;  1N33 O;  2JRI A;  1F23 A;  4JI5 O;  2IH3 C;  5IYZ A;  1NTK H;  3P30 A;  4O2B B;  1XNQ O;  3CPW U;  4H13 B;  4BWA A;  1K34 A;  3AG1 B;  3HKC A;  2FTK A;  3K03 A;  1DF5 A;  3ABK B;  1ZL8 A;  2IU3 A;  4B3R B;  3NR7 A;  1WP7 A;  4HNA A;  3E83 A;  4B7E A;  3U10 A;  4TSF G;  1K4D C;  2XUM A;  3TXS A;  1S5J A;  1L0N H;  3DC5 A;  4DV1 O;  4J9Y B;  4X62 O;  3AEI A;  4DV6 O;  4NXM O;  3W7X A;  4J9Z B;  4AHC A;  3JD4 A;  4O4I B;  3T1C A;  3CCJ V;  4FZ1 A;  1AJP A;  4LFC B;  5BZB A;  2FL4 A;  4X1Y A;  4XBF A;  2YI9 A;  1VQ9 V;  2CTP A;  4JI0 O;  4LF4 O;  5EIB D;  5CN0 A;  1OCO C;  1QU7 A;  5H6R A;  1IVS A;  1R1B A;  3ETQ A;  4X65 O;  2YEV A;  3K59 A;  1TVK B;  3APO A;  5C8Y B;  1BCC H;  2EIK B;  4DW1 A;  1MOF A;  2RJZ A;  2CE4 A;  3F7Y C;  2P6J A;  4IL6 Z;  4GX5 A;  2PGG A;  4TUY B;  3J7A U;  1PL0 A;  2QM8 A;  1Y6X A;  3DXR A;  5LHI A;  1LUV A;  2HR3 A;  1FAF A;  1FPO A;  1PNM A;  1FJG B;  2ZD9 A;  4K0K B;  4DR2 B;  2ETN A;  1VF6 A;  2X6B A;  3WU2 Z;  3IC7 A;  3L75 H;  2P22 C;  3JAM N;  4N21 A;  5B5E Z;  2LJ2 A;  4Z2W A;  2ZM6 O;  4G27 B;  3ZHU A;  1SQQ H;  4MVZ A;  5H5N A;  3H1L H;  4J80 A;  3D3Q A;  3FX7 A;  5EBW C;  3K5N A;  3CCL V;  3SJC C;  3CS5 A;  1MMM A;  2Z5U A;  2YIA A;  3VQX A;  3ZN1 A;  1TUB A;  5LGN A;  4FLX A;  3ASN B;  2EIN C;  1IBK B;  1PKX A;  2EIL B;  2RN9 A;  2Q7E A;  3CE2 A;  4RO2 A;  3W7T A;  2OCC B;  2BOB C;  2V1D A;  5CB4 A;  1R3I C;  3ETG A;  3BPZ A;  4MVR A;  2BSK A;  2IBZ H;  2UU9 O;  1VQN V;  4LF7 O;  2Q4P A;  3E86 A;  4GT1 A;  3ZHQ A;  5LL6 Y;  1AP5 A;  1Y74 A;  3IJ4 A;  3CCQ V;  4YJ3 A;  3M8A A;  3AK1 A;  2ATK C;  3ZBH A;  1FFX A;  5J2U A;  2DYR B;  5B3S B;  1MZE A;  1H2M A;  4JV5 O;  1XEQ A;  3BA9 A;  4LF8 B;  5A9G A;  2GUZ B;  4JYA O;  3GWO A;  1OJH A;  2YUA A;  4EB6 B;  3CC2 V;  3AG2 B;  4EKW A;  4D7S A;  1FKA O;  3OEH G;  2YI8 A;  4DXW A;  4TV8 A;  4LCU C;  1WJZ A;  1AVM A;  3L70 H;  5L3E A;  1D5A A;  1AB3 A;  2R9I A;  3E8B A;  2Q7G A;  3JAK A;  3TK1 A;  2HVJ C;  2PUS A;  1RFY A;  4UXN A;  2QM4 A;  3U11 A;  1Y4M A;  1V9P A;  4LF6 O;  4LFB B;  1H2N A;  5BMV B;  3D36 A;  1K4C C;  1FXK A;  2GHY A;  1VIB A;  3H1H H;  1S3J A;  4DUZ B;  4JF3 A;  4UV9 A;  5CA0 A;  1KB9 F;  4DR3 B;  4DV3 O;  1G6U A;  2YDE A;  1B06 A;  3JCZ A;  4O2B A;  4JAS A;  2OIE A;  1JCH A;  3HKB B;  4J10 A;  5GON A;  5KMG B;  1X59 A;  1L1F A;  1W59 A;  1KKC A;  2BCC H;  2EIM B;  3HKE A;  5GTH Z;  2WLK A;  5IJ9 B;  1GM9 A;  3CX5 F;  1R73 A;  4NXN B;  1SC5 B;  1XHZ A;  1JPX A;  5KX5 B;  3CD6 V;  1SF9 A;  1KYO F;  4O4I A;  4YHH O;  5IT9 N;  4X9Q A;  1VQ5 V;  3LSS A;  5LHG A;  1JMK C;  1K5Q A;  1N4C A;  3ASO C;  2FKX A;  3VQW A;  1GKF A;  3UCS C;  3AK2 A;  2QTO A;  2Y69 C;  4QE9 A;  3FFQ A;  3CCE V;  2B9Z A;  2QEX V;  3BRC A;  1WA8 B;  4GX2 A;  2MW2 B;  3C3T A;  1YEW A;  5IYD O;  2DE0 X;  1LUW A;  1Y76 B;  3WB1 A;  1YIT V;  3G4S V;  4GX1 A;  2DQ0 A;  2WLI B;  1ZLZ A;  5CBG A;  3THO A;  3G80 A;  4J42 A;  3CXC U;  1MSW D;  3AK3 A;  4GCZ A;  3FYE B;  1TVK A;  3G6E V;  4MSW C;  2UXN A;  1ORQ C;  1AIL A;  4YXW G;  3ZHV A;  1XI1 A;  3ICX A;  1H38 A;  5LXT B;  1AR5 A;  3LNN A;  4KXR A;  1NQT A;  1K92 A;  4YIO A;  2HHH B;  3CHX A;  4U3F H;  3TET A;  1N34 O;  1QNM A;  1OV9 A;  5EC2 C;  4FJC C;  3G71 V;  2H94 A;  2A3Q A;  2DN9 A;  4XDL A;  4I55 B;  2Z0A A;  1VQK V;  3P3P A;  1RM1 B;  1S77 D;  3K9A A;  5FNV B;  3O65 A;  1P4R A;  4UCV A;  2ARH A;  2UUB O;  2Q69 A;  2XOK G;  5DEC A;  4PDR A;  2PF4 E;  3JD3 A;  1I94 B;  1BMF G;  4JI3 B;  5LP6 B;  4ABM A;  4ZI7 B;  4RUF A;  4X1I B;  1YDX A;  5EBM C;  3A8T A;  2RDC A;  4K35 A;  2F1M A;  2PY5 A;  5JVD A;  3ZN0 A;  5B1N A;  1HNZ O;  5KLV H;  4UVA A;  2QWO B;  3MHH C;  4JPR A;  4JYY A;  1K33 A;  3QO7 A;  3APQ A;  1KP3 A;  2QWP B;  4K3A A;  1PD3 A;  3SYQ A;  2GTS A;  5CA1 B;  4PJ0 Z;  1DGS A;  5B1B C;  4AIL C;  2Q0O C;  4MW3 A;  2WLJ A;  3OW2 U;  4FM0 A;  1RPO A;  1PPJ H;  2LW7 A;  4CS3 A;  1V54 C;  4CH6 A;  4WFE A;  1NH2 B;  4DUY O;  4FMT A;  2UXX A;  4EB6 A;  2YID A;  4WFA V;  3OTO B;  1JFF B;  4DR7 O;  3CRA A;  2UXC B;  1FXH A;  3OEE G;  3SPC A;  3E89 A;  1RSO B;  4GX0 A;  4E4E A;  4IYH A;  4D6T H;  3F7V C;  2B1G A;  4JYC A;  4QNH B;  3CCV V;  4IIJ B;  2JK5 C;  4NVP A;  4DR6 O;  4UB6 Z;  2EIJ B;  3RFR A;  3SPG A;  3VQY A;  3L9D A;  2ZIO A;  3O9O A;  5D5Q A;  1FFT B;  5BMV A;  3WG7 C;  4UFZ A;  1BQZ A;  4CH5 A;  4NR1 A;  2LP7 A;  3CJH B;  1M93 A;  1QQC A;  1HR0 B;  5KA6 A;  4FFK A;  5KMG A;  4JI7 B;  3A0B Z;  3B77 A;  3BCC H;  2AHY A;  2W0X A;  2QM7 A;  3UQ8 A;  2ZR3 A;  1WB8 A;  5BR8 B;  4RUE A;  2ZQM A;  4FPP A;  4RAI A;  5JJE B;  2BOC C;  5IJ0 B;  4MVQ A;  3R66 A;  1MZF A;  4MTO A;  3E8G A;  2YXH A;  3ZS8 C;  2CTW A;  1SA0 B;  4PI2 A;  2W0F C;  2P06 A;  4E2L A;  4PA6 A;  3SYA A;  1IZ3 A;  2X6C A;  3K04 A;  4DV4 B;  1K8A W;  2JS3 A;  4LWS B;  3D36 C;  2OWO A;  2Q73 A;  3N2G B;  3FB6 C;  4I4T A;  1Y76 A;  4JI8 O;  4CH3 A;  4JI6 O;  4WFH A;  2WLI A;  4DR1 B;  1VQO V;  2B5U A;  2VWJ A;  5LMN O;  2OIG A;  4WFF A;  5DED A;  2X0L A;  4OX9 O;  4HZ3 A;  1COW G;  5KAF Z;  1NH2 D;  5EK0 A;  3K9S A;  4BIO A;  2ZDI A;  4JI1 B;  2DMX A;  2EJ7 A;  1J95 A;  1PM9 A;  4DV2 O;  5TIS Z;  4QPJ A;  1N0N A;  4B3S B;  1IBM B;  2KG7 A;  3CME V;  5KUM A;  3ABM B;  2EUL A;  1AR4 A;  2XAG A;  1N33 B;  1MAB G;  2EZO A;  4JI5 B;  2CH7 B;  4WF9 V;  1R3J C;  3J80 N;  3T1H O;  1XNQ B;  4X20 B;  3CCS V;  2RQ6 A;  3I5D A;  1QHT A;  1HP8 A;  2CUG A;  1ZUQ A;  2OT5 A;  3AG7 A;  2Y0P A;  4X62 B;  4DV6 B;  1URF A;  4NXM B;  3TXQ A;  4RQF A;  2FML A;  3ZX6 A;  4F6R B;  4CZZ A;  2EIK C;  4O4L A;  1WPB A;  4ZI7 A;  4X1I A;  3CRQ A;  3ETE A;  4P30 A;  5K1X A;  3K79 A;  1M57 B;  1YHQ V;  4I50 B;  4JI0 B;  1BSM A;  2WAM A;  4LF4 B;  4MVS A;  4MT8 A;  4I9Q A;  5E79 Z;  3JAW B;  4NTY A;  5F2V O;  1F7Y A;  4X65 B;  2QKC A;  2UXB O;  1IBL O;  5L3G A;  4ICG A;  2CDY A;  1XDC A;  1XMO O;  2QDO A;  2AW9 A;  1AI4 A;  4GYC B;  4O4J B;  4F4L A;  3CYO A;  5EYP A;  4FLU A;  1J5E O;  3HR0 A;  3FB7 C;  2EIL C;  4DV5 O;  1YJW V;  2JS5 A;  4LNU A;  1JVM A;  1QLN A;  1XHX A;  1RSO A;  2GTA A;  4R50 A;  5EBL C;  4NTW A;  2WLL A;  2ZM6 B;  1YI2 V;  3QG5 A;  5JH7 B;  1I08 A;  2IM9 A;  2QGN A;  4ZHQ B;  2ZT9 B;  5DM6 V;  3FD9 A;  4FFB B;  2VS0 A;  2NR5 A;  4CC6 A;  1EN4 A;  1Q8I A;  2HVK C;  1GN4 A;  1TAE A;  5L3D A;  1Z5W A;  3CJH A;  2XAH A;  2DYR C;  5B3S C;  1QVG U;  1Q6U A;  2Z3Y A;  4GZR B;  2QTS A;  1JQ0 A;  2IJH A;  4KHP O;  2Q0A A;  1AI5 A;  1JJO A;  3P3N A;  1YF2 A;  2K1E A;  1SZT A;  4B7K A;  1N0J A;  3AG2 C;  2PZS A;  1PNK A;  1L0L H;  1NZ6 A;  2UU9 B;  5LA6 B;  3AG3 B;  4DR5 O;  4LF7 B;  5LOV A;  5IDJ A;  1BZK A;  4O2A B;  1SA0 A;  2ZXW B;  4GKK O;  4O4H B;  2ODM A;  1M9N A;  3FYI B;  4CS2 A;  3CCM V;  2HKO A;  3L71 H;  1O9G A;  4FLW A;  2P90 A;  1JJ2 U;  1PP9 H;  3CXH F;  4JV5 B;  4WFB V;  3ZIA G;  4JYA B;  1FYJ A;  2KKW A;  2QWR B;  2KQX A;  3ZED A;  2F43 G;  3X2Q B;  3BVO A;  4F6E A;  3W7S A;  1R6T A;  3OT7 A;  1IDS A;  2EIM C;  3SYC A;  4P9O A;  1F4N A;  3ABU A;  1NBM G;  2HFE C;  1DTO A;  3E22 A;  5B1A C;  1ZWI C;  4X64 O;  1OCZ B;  5IYB O;  5BXZ A;  5KHI A;  1ZTE A;  5FL7 G;  4LF6 B;  1IUR A;  2Q67 A;  4G28 B;  1P7G A;  2HP8 A;  3CMA V;  2DYS C;  3VBB A; 
#chains in the Genus database with same CATH homology
 4R7C A;  4YXW G;  1H38 A;  1R3L C;  2R9R B;  3K3W A;  3RW0 A;  2IU0 A;  1NQT A;  1B6Q A;  1M57 C;  3ASN C;  4BIZ A;  2YEV B;  1K92 A;  4PDM A;  3P32 A;  2WWW A;  4KP4 A;  4UV8 A;  1CEZ A;  4TWK A;  1Q81 W;  3TET A;  5EC2 C;  1AR1 B;  4JGS A;  3OGC C;  4FJC C;  4U7O A;  5L3B A;  3G71 V;  2OCC C;  1NR7 A;  2H94 A;  3OM3 B;  1JX9 A;  5HFM A;  3T2M A;  1HWY A;  4XDL A;  3IFX A;  2A0L A;  5KUK A;  2M7W A;  3ZRV A;  1W0K G;  1KQS U;  1V55 C;  1VQK V;  1QR8 A;  2ZDI C;  3OE7 G;  1RM1 B;  1VQ4 V;  4ZBM A;  3K0G A;  3I55 V;  3K9A A;  4MVU A;  1Q7Y W;  1S77 D;  3MHS C;  2GSM B;  4JAU A;  1NVP D;  4MW8 A;  1P4R A;  2Q69 A;  3B8N A;  3OR7 C;  1YTF B;  2XOK G;  4MTG A;  1BL8 A;  4PDR A;  3F5W C;  2QKS A;  3JD3 A;  3LNM B;  1BMF G;  4XDJ A;  5B1B B;  1G8M A;  2NNU A;  4RUF A;  1N8R W;  4JAV A;  5EBM C;  3ZRS A;  3E8F A;  4TT3 G;  3LSQ A;  3ZN0 A;  3A0R A;  5B1N A;  1THZ A;  4UVA A;  4UVB A;  1KD1 W;  3MHH C;  1Y66 A;  1V54 B;  5IY5 C;  4JPR A;  5IYC O;  1RM1 C;  3SYP A;  1AJQ A;  3OUS A;  2WPD G;  3TCU A;  1NVP B;  1K33 A;  2Q6A A;  3JD1 A;  1EZJ A;  4HAM A;  5H6Q A;  3QO7 A;  1KP3 A;  1VQM V;  3SPJ A;  1VQL V;  5L3F A;  4FK5 C;  2PI4 A;  1PD3 A;  3SYQ A;  2JEX A;  3M99 B;  1ARO P;  5KA5 A;  4UUJ C;  3ZJZ A;  1YJN V;  1M56 B;  5B1B C;  2OTL V;  1KP2 A;  4MW3 A;  4L87 A;  1M90 W;  1R3K C;  2WLJ A;  1SET A;  4PEL A;  3OW2 U;  3STZ C;  1RPO A;  2PI5 A;  1XL6 A;  2XAJ A;  2JJ2 G;  2XAS A;  1V54 C;  3LUT B;  1K97 A;  4WFE A;  1NH2 B;  1E1Q G;  5LGT A;  1FXV A;  4FMT A;  2UXX A;  3W7U A;  1I5X A;  3AG4 B;  1QBZ A;  4WFA V;  3ZMZ A;  3QO8 A;  3ABL B;  3AG3 C;  4X8A A;  3ZRW A;  3ZCC A;  3ZRX A;  1OCR B;  3H01 A;  3CC4 V;  1FXH A;  3OEE G;  3SPC A;  3E89 A;  1BHA A;  4GX0 A;  1EBO A;  4MTX A;  3F7V C;  2B1G A;  4JYC A;  4QNH B;  3CCV V;  3E35 A;  2JK5 C;  2ITD C;  2ZXW C;  4JTD B;  3DGE A;  5HFL A;  3K0D A;  1GMG A;  2EIJ B;  2NLJ C;  3SPG A;  3BEH A;  4LBE C;  1K73 W;  4PA9 A;  1I5Y A;  1CPY A;  4Q20 A;  1FFT B;  3QO5 A;  3VOU A;  4QJF B;  2WSS G;  3WG7 C;  1VQ8 V;  5J9P C;  1LNQ A;  3SYO A;  3E2E A;  4BW5 A;  4Z1M G;  2HG5 C;  3AG4 C;  1QCE A;  3ZMT A;  3ZMU A;  3X2Q C;  5H9C A;  2LP7 A;  3UKM A;  2HLD G;  3ABL C;  4PDL A;  4X89 A;  1M1K W;  3E8H A;  5KA6 A;  2AHZ A;  4BIU A;  2V7Q G;  3B77 A;  2JIZ G;  2JJ1 G;  1YTF D;  3OFN G;  1XL4 A;  2QA4 V;  2AHY A;  2DWE C;  2QM7 A;  1FXK B;  1YJ9 V;  1FS0 G;  5LGU A;  5L3C A;  1OCZ C;  2EIJ C;  3LDD A;  2ZR3 A;  1QVF U;  1F23 A;  4RUE A;  5EC1 C;  2IH3 C;  1EFR G;  3OUF A;  3OMI B;  2ZQM A;  3CP1 A;  4FPP A;  3EFF K;  4RAI A;  1W0J G;  3P30 A;  3CPW U;  3UM7 A;  2LFR A;  1K34 A;  2BOC C;  3AG1 B;  2FTK A;  2EZP A;  3K03 A;  5E1A C;  4MVQ A;  1DF5 A;  1F4M A;  3ABK B;  1NKD A;  2IU3 A;  4MTO A;  1QLE B;  2HJF C;  2C2A A;  3E8G A;  3E83 A;  4P9P A;  1K4D C;  1OCO B;  4TSF G;  2X6A A;  2W0F C;  4E2L A;  4PA6 A;  1SES A;  3SYA A;  1JOY A;  2X6C A;  4J9Y B;  3K04 A;  3AEI A;  1K8A W;  3K08 A;  3W7X A;  1K3E A;  3D3I A;  4J9Z B;  3JD4 A;  3GB7 C;  3FB6 C;  1K5S A;  4QE7 A;  4WFG A;  4WFH A;  3PJS K;  3T1C A;  3LDE A;  1AI7 A;  2WLI A;  3CCJ V;  2DWD C;  1AJP A;  2XAQ A;  2B5U A;  1VQO V;  5BZB A;  4XBF A;  4PA7 A;  4WFF A;  2WLM A;  1VQ9 V;  2X0L A;  4PA3 A;  1MG1 A;  5C93 A;  4HZ3 A;  1COW G;  1AJN A;  1E1R G;  1QLE C;  1RPR A;  2IJK A;  5CN0 A;  3SPH A;  5EK0 A;  1NH2 D;  1OCO C;  2ZDI A;  4G2K A;  1NJI W;  3SPI A;  5H6R A;  3ABT A;  4H37 A;  3RVZ A;  1J95 A;  3T4D A;  3WFV A;  2YEV A;  2Y48 A;  4QPJ A;  3LDC A;  3FB5 C;  3CME V;  1DF4 A;  2EIK B;  5KUM A;  3ABM B;  1SER A;  3FKS G;  3ZMS A;  2XAG A;  1MOF A;  3ASO B;  1MAB G;  2EBO A;  1OCC B;  3F7Y C;  2EZO A;  2WLH A;  2Y69 B;  4WF9 V;  2A9H A;  2JDI G;  2P6J A;  1R3J C;  4GX5 A;  2KB1 A;  1WPX A;  3CCS V;  2H8P C;  1PL0 A;  2QM8 A;  1ROP A;  2EIN B;  5LHI A;  2WLN A;  2HR3 A;  1GK9 A;  2YSU B;  1PNM A;  2ZD9 A;  2OTJ V;  5CBF A;  2CK3 G;  3DTU B;  2X6B A;  5B1A B;  3IC7 A;  2OT5 A;  3ML0 A;  1H2G A;  4N21 A;  4G27 B;  1CP9 A;  4RQF A;  4MVZ A;  1M56 C;  3QNE A;  1BHB A;  4CZZ A;  3KG2 A;  2EIK C;  2LFS A;  1H8H G;  3OMA B;  1OCC C;  1GO3 F;  5EBW C;  3ETE A;  4P30 A;  2DYS B;  3CCL V;  1Q82 W;  2IW5 A;  2XND G;  4P2Z A;  1R6K A;  4XDK A;  4I9W A;  3K79 A;  5LHH A;  2Z5U A;  3K06 A;  4MVM A;  3ZN1 A;  4CBC A;  5LBQ A;  5LGN A;  2D3O W;  1M57 B;  3ASN B;  2EIN C;  4MS2 A;  1YHQ V;  2WAM A;  3BY6 A;  4ASU G;  1PKX A;  1SRY A;  1K9M W;  2EIL B;  4MT8 A;  4MVS A;  4N23 A;  4ZKI A;  3CCR V;  2DW4 A;  1OCR C;  2XAF A;  2P7T C;  3STL C;  3W7W A;  4RO2 A;  4KUM A;  3W7T A;  2OCC B;  2BOB C;  1P7B A;  2V1D A;  1R3I C;  3B8M A;  3ETG A;  5L3G A;  5CA3 A;  4MVR A;  2MK3 A;  1V55 B;  1VQN V;  1AI4 A;  4F4L A;  3CYO A;  3T4Z A;  1IXM A;  3EHB B;  1E79 G;  3E86 A;  4GT1 A;  2P67 A;  2DQ3 A;  4R8C A;  1DLB A;  1VQ7 V;  1S0V A;  2W6I G;  2EIL C;  3FB7 C;  4UVC A;  1YJW V;  3IGA C;  3CCQ V;  3HPL C;  1JVM A;  2ATK C;  1QLN A;  1ENV A;  2DYR B;  3I56 V;  5B3S B;  4H33 A;  4R50 A;  1YSC A;  5EBL C;  1FXK C;  2WLL A;  1YI2 V;  1PNL A;  2IH1 C;  4LP8 A;  1NR1 A;  3GWO A;  4QIW F;  4BAY A;  3CC2 V;  3HB3 B;  4KFM A;  5IY5 B;  5DM6 V;  5DN6 G;  3AG2 B;  4EKW A;  1KKD A;  3AG1 C;  3OEH G;  3ZRW B;  4DXW A;  1AI6 A;  4OXS A;  3ABK C;  4LCU C;  4MVO A;  2HVK C;  3OAA G;  1S5H C;  2X7R B;  5L3D A;  4HYO A;  2EJR A;  3CCU V;  1QR9 A;  3ZMV A;  5L3E A;  1VQ6 V;  4X88 A;  2R9I A;  3E8B A;  2XAH A;  4PDV A;  5CMU A;  2DYR C;  5B3S C;  3TK1 A;  2HVJ C;  2IJJ A;  1QVG U;  4UXN A;  2Z3Y A;  2ITC C;  3R65 A;  1Y4M A;  4MTF A;  1JQ0 A;  2IJH A;  3D36 A;  1K4C C;  1GTO A;  1FXK A;  2GHY A;  1AI5 A;  1S3J A;  1R6N A;  2IJI A;  3OR6 C;  4JF3 A;  4UV9 A;  2K1E A;  1SZT A;  1WLE A;  3AG2 C;  1S76 D;  1PNK A;  4QPK A;  1UJW B;  3JCZ A;  4JAS A;  3SJQ C;  1JCH A;  3AG3 B;  1L1F A;  2EIM B;  4U7N A;  5IDJ A;  2WLK A;  2B1I A;  4JYB A;  4RQE A;  1GM9 A;  1S72 V;  1R73 A;  1TUE B;  5CBH A;  1VQP V;  2ZXW B;  1Q86 W;  1JPX A;  2ZR2 A;  5GW7 A;  1M9N A;  4JTA B;  3FYI B;  5B1O A;  3CCM V;  2HKO A;  3CD6 V;  2P90 A;  1JJ2 U;  2JEU A;  1VQ5 V;  1W2B U;  3ABM C;  3LSS A;  3WG7 B;  5LHG A;  4I5S A;  1YIJ V;  1KC8 W;  1K5Q A;  4WFB V;  3ASO C;  3CC7 V;  3ZIA G;  1GKF A;  3RBZ A;  2QTO A;  2Y69 C;  3NXS A;  3RVY A;  4QE9 A;  2Q68 A;  1K7D A;  2F43 G;  3X2Q B;  3CCE V;  2QEX V;  3W7S A;  4GX2 A;  1OZ0 A;  4PA4 A;  2EIM C;  3SYC A;  4WCE V;  5IYD O;  4P9O A;  1F4N A;  3ETD A;  3FB8 C;  3ABU A;  2WLL B;  1NBM G;  2HFE C;  4DO2 A;  2QE7 G;  1YIT V;  3G4S V;  1DTO A;  4GX1 A;  5B1A C;  1OHH G;  1ZWI C;  2DQ0 A;  1OCZ B;  5IYB O;  3MD0 A;  2WLI B;  5CBG A;  3JD0 A;  1G4Y B;  3OMN B;  1KEC A;  4JTC B;  5FL7 G;  3JD2 A;  3CXC U;  1MSW D;  1GM7 A;  4GCZ A;  3FYE B;  3JYC A;  1H8E G;  2A79 B;  2W6J G;  4LC1 A;  3G6E V;  2Q67 A;  4G28 B;  4MSW C;  2UXN A;  1ORQ C;  1F51 A;  3CMA V;  4R6Z A;  2DYS C;  4FIP C;  1GM8 A;  3VBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...