1FS0G

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
219
Chain Sequence
b'KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 81
structure length 219
sequence length 230
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fs0G02
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 1fs0G01
2JJ2G 5H6QA 3ZMVA 1H8EG 2HLDG 2XASA 3ZIAG 4UV8A 5LHIA 1W0KG 2V1DA 2UXXA 5LGUA 3OE7G 3OFNG 3OAAG 4KUMA 4TSFG 4CZZA 2IW5A 2X0LA 2V7QG 5LBQA 2XAQA 3OEHG 2CK3G 2Z5UA 1H8HG 2XAHA 1NBMG 4BAYA 5LGTA 1FS0G 4ASUG 4UVCA 3ABUA 1MABG 2JIZG 4UVBA 5L3FA 2W6IG 4Z1MG 1E1RG 2Y48A 4TT3G 5H6RA 4XBFA 5FL7G 2EJRA 1COWG 2XAJA 2XNDG 2JDIG 1EFRG 3ZMTA 2XAGA 2Z3YA 5L3DA 2XAFA 3FKSG 2H94A 2HKOA 5L3BA 5LHGA 1OHHG 1W0JG 3ZMSA 3ZMUA 5LHHA 2F43G 2WSSG 4UV9A 2DW4A 5DN6G 2R9IA 5LGNA 2QE7G 3ZMZA 3OEEG 5L3CA 1BMFG 2UXNA 3ABTA 5L3EA 2WPDG 2JJ1G 4YXWG 1E1QG 2W6JG 1E79G 3ZN0A 3ZN1A 4UXNA 4UVAA 2XOKG 5L3GA
chains in the Genus database with same CATH superfamily
2GBOA 3GWKC 1OCZB 5KX5A 5J9PC 4DR2O 1SQGA 5IYCO 2EJ7A 1ZLZA 3JALA 4H0LB 4KS0A 1O9HA 3MHSC 1TA8A 2ILMA 5LGUA 4FLZA 2CDYA 3JD3A 3K0GA 4JI5B 1R3IC 4MSWC 4KP4A 1P84F 1VQ8V 1URFA 4J9ZB 3RYHB 4FVMA 1XOUA 2E76B 2LGQA 2XAHA 4YHHB 3AAGA 1H2SB 1PV0A 4TQFA 1QR9A 5LGTA 5LOVA 1K4CC 1L8DA 4J11A 3SYCA 4JYAO 1AR5A 2E3CA 4TT3G 2AXTZ 1LR1A 1H38A 4FPPA 3SRDA 1YJNV 1I94B 1EFRG 4LC1A 3AEIA 1B6QA 5KAFZ 3ZMTA 4KRZA 3K3WA 4IL6Z 2Z3YA 5LHGA 2YDEA 1KBHA 5C93A 2PGGA 5KUMA 2LP7A 4K0KO 2ZR2A 2AW9A 4IT5A 3X2QB 1HWYA 3CEIA 4LF7O 2HEPA 2DYSC 4X64B 5L3EA 4EB6A 3ML0A 1XHZA 4OX9O 1VQ5V 1H2NA 5J2UA 4F6RA 5C8YA 4GX1A 2YEVB 3DGEA 4DUYB 2QEXV 1KKDA 3FX7A 4I0XA 3SYOA 1WB8A 3E22B 3DC6A 4O4HB 1JR9A 3OTFA 4G27B 1NVPB 4YNGA 3C3TA 3CCEV 4JI7O 3RYIA 4UCSA 2EIJC 4MTGA 1VP7A 2WLHA 1PKMA 3G6EV 4JI0O 2CH7B 4KUMA 4PDRA 1BE3H 3HQOA 1HDJA 3ZJZA 1ZAUA 3CJHB 1AI5A 4DRSA 1RPRA 1Q86W 1FXKB 1SKVA 2ADQB 5LP6A 4O2AB 1T5AA 2Q73A 4NR1A 3SJCC 4WJ8A 4X1IA 1NBMG 4PDLA 3EFFK 3ASNB 1WA8A 4QPJA 2N04A 4FLTA 3WB0A 3LDEA 4EFEA 4QPKA 2LW7A 4UCUA 5B3SC 3E2EA 3K5OA 4RO2A 4B7KA 1Q6HA 4DW1A 4XDLA 1XDCA 4YY3O 2Y48A 4MTOA 4XBFA 5FPRA 4PELA 1TVKA 4JTAB 1AR1B 5CA1A 2IJHA 2ZE8A 5K1XA 1GTOA 3B4SA 4AQYO 1G6UA 3CYOA 3T07A 1K92A 1M56B 3B77A 5KMGB 4JI6O 3JD2A 5L3BA 4LF6B 1W0JG 3RWRD 1XMQB 5B1AB 3HPLC 3CC4V 5E79Z 4L8JA 5DN6G 2PYJA 3ZHTA 2R9IA 4X62B 3AG1B 5EIBC 2IH1C 2RJZA 4J7KA 4MVQA 2PY5A 3APOA 2YIBD 4CH3A 4B3MO 1ZL8B 2N74A 5A9GA 1XNRO 1JFFA 4IYIA 4HYWA 3E86A 2CTPA 3KG2A 4QJFB 1YHQV 1NTMH 3K57A 5KA6A 3CRAA 1S72V 3N2GA 3FB8C 2N05A 1ZTEA 1H2LA 4LWSB 3LNNA 2EIKB 3CC2V 1GK9A 4DR2B 2WLIB 3F7YC 3UT5A 5CB4A 3K59A 3STLC 4E2LA 2QA4V 4JAAA 1IVSA 5LBQA 2Q69A 4JZGA 2ZD9A 5KHKA 5LP6C 4TQDA 5KLVH 4DR7O 2UUBB 3RYFB 1XREA 4DR5O 1YTFD 1K34A 2WWWA 1RSOB 2JEXA 2D2CB 2X6CA 4RAIA 3ABUA 1XUQA 2E28A 1DTOA 2IJIA 5L3FA 2ZDIA 3K06A 5LYJA 3QTCA 5H6RA 4FM0A 3K58A 4NXNB 2Y69B 2R9RB 2JGDA 5EC2C 5JJJB 1PKLA 3QTGA 4JPGA 4KL1A 4KXRA 3MA8A 1ENVA 2HKOA 2F4VB 1OHHG 2KG7A 4O2BA 2OTLV 1PKNA 1MG1A 4PA3A 4DR4O 5BR8B 4C7UA 1NQTA 1M9NA 4ZBMA 5LMNO 3H01A 4X1YA 2EILC 3IC9A 4BIZA 1I5XA 4ZOLA 4K0KB 1JMKC 1NI8A 1M4UA 1YDXA 2Q67A 3GQYA 4CS3A 3QO8A 4JI8O 1U96A 4LF7B 3U0ZA 4JYBA 3FB6C 1SQPH 3GG8A 5F2VO 2QDOA 1K7DA 4MW3A 5E1AC 5IWAO 3SYAA 3PN1A 5GONA 3T4ZA 5IT9N 4K35A 5JWPA 3T1CA 4FMTA 1Y67A 3ZRWA 4O4LA 1GM8A 2HJDA 1M57B 4IIJA 1TUBA 2JGUA 3STZC 1WPXA 4UCOA 2ZINA 2RQ6A 2F1MA 4TUYA 4JI0B 1NTKH 2BSKA 1Q90D 2YICA 4E4EA 2WLKA 4TWKA 1M93A 2UXBO 2YUAA 4O4JA 1IBLB 1SQFA 4PA7A 3R66A 3CP1A 1M57C 3HKEA 1W2BU 4JI5O 4LFCO 1KP2A 1T5EA 2QTOA 1Q8IA 2BOBC 4UVCA 1BHBA 4I9QA 1FFXB 3ETDA 3N25A 5FNVB 2ZDIC 4Z1MG 5B1BB 3EXAA 5CBFA 1NVPD 4YHHO 4YIPA 4UFZA 3U10A 4WFGA 3HQNA 4KCWA 4AQYB 3OR7C 1TGOA 2FTKA 2ZIOA 3H1LH 3CSXA 3HKBA 1DF5A 1K9MW 1PNKA 2DJVA 1OCOC 5LGNA 2DW4A 5KAIZ 2JVDA 1THZA 2EINB 2K9PA 4K3AA 2OCHA 4MVRA 1I94O 5L3CA 5DECA 5B1BC 3UKMA 5LXTB 2WPDG 2CAZC 2CUGA 2WLLA 4DV7B 5K1PA 2IU3A 3ETGA 1XNRB 1R1BA 4ZKIA 2VQFB 4I50B 3SPHA 1XNQB 5L3GA 3ZRXA 4I4TB 1VQPV 3DTUB 4X64O 2X7RB 2BCCH 5KUKA 4GX5A 1Q5OA 4QE9A 2DYRC 3JAKB 2DWEC 4U7NA 3CCLV 1BQZA 4FK5C 4BWAA 3AG2B 1Z2GA 4FXFA 2F23A 4H13B 3IAYA 2M6YA 3EOEA 4D7SA 3G71V 3NXSA 2RN9A 4B2DA 4ZHQA 3K0DA 2HFEC 4DR7B 3U11A 2ETNA 4YJ3B 2KQXA 2QJ1A 4CH6A 4NTWA 1V54B 4MVUA 4JF3A 1YIJV 4CC6A 3MAQA 5CMUA 4X89A 1D5AA 3AG2C 3DXRB 2BTQB 4FXJA 1KMIZ 1Y4MA 4I9WA 2JDIG 1N0NA 4OPHA 4WBNB 2QWOB 1GN3A 4QG8A 2W0FC 1Y6XA 4JPRA 4QIWF 3SPIA 3QV7A 2EZOA 1V54C 2WSSG 2QWPB 4DR4B 3K79A 4IHJB 3QV9A 5IYZB 2ARHA 3ZHRA 4JAUA 4X9QA 3AG7A 1SA0B 3A0HZ 1SESA 3I5DA 2UXCB 2PZSA 2AZ2A 2GHYA 3APQA 4EKWA 3RYHA 3T05A 3CRQA 4LF6O 1E0UA 5B66Z 1S0VA 3H6OA 1QLEB 3SGIA 4JI8B 4A5UB 5IDJA 1KC8W 5H5NA 4WFEA 2A06H 1E0TA 4X62O 1ZJHA 4HAMA 3P32A 3E8GA 1L1FA 1SQQH 5IWAB 2Q68A 1B06A 5IJ0B 1FPOA 3P3PA 1AP6A 3BFRA 5JQGB 1MNGA 1YTFB 1AILA 4HYOA 2V1DA 4WFFA 4KCVA 1Q3EA 3F5TA 2XT9A 4BIOA 1QQCA 3NR7A 2FMLA 3CWBH 1NTZH 4X8AA 4PA6A 1RP3B 1FXVA 1VP8A 1SF9A 2UXBB 5H2FZ 2DQ3A 3E0WA 1A3XA 3P3NA 2Y4UA 4BAYA 4K8ZA 4NXMB 1AR4A 1VQLV 4J7JA 4LFCB 4LF8B 3QO7A 1F3WA 4JZ2A 2YEVA 4KCTA 1QVGU 1OCZC 4LP8A 2UUBO 5EBWC 3SPJA 3TETA 2DMXA 1XEQA 3FYIB 3WFVA 3E22A 1A5UA 4O4HA 1Z5VA 4JI1B 1GRJA 2QR4A 4MW8A 5JJEB 1DLBA 2XAFA 3E89A 1QCEA 3TXQA 4HYVA 3GB7C 4FZ0A 3JSNA 4OGQB 1K5QA 2CH7A 1OCCB 2ATKC 5IJ9A 4NXNO 1RFYA 4LF5B 1JVMA 2CGNA 2WLJA 1FXKA 1YEWA 4X20B 4OPAA 2B1IA 2YC0A 1XMOO 1Q82W 5BMVB 2F4VO 1EN5A 3FAVB 4G1NA 3CCMV 3WU2Z 4TV8B 1E79G 2Q4PA 5BR8O 1BS3A 1PNMA 2AZ0A 4KFMA 2VGGA 2XOKG 3ASOB 2QM8A 3VQXA 3CMAV 5EYPB 1HW7A 4X65B 3JARB 5H6QA 3E8BA 2GV9A 2DN9A 2JS5A 4LR3A 4AI8A 4Q20A 1AB3A 3JYCA 2P6JA 4FZ1A 1N0JA 2KSDA 2FYUH 2QTSA 1P4RA 3RVZA 1BHAA 1N4CA 3BCCH 4P9PA 3CRCA 4U3JB 2JS3A 4BW5A 5KMGA 2EIMB 3ZRVA 4W4LA 3K03A 3J80N 2WLMA 2P06A 5DM6V 3L71H 1AP5A 2GUZB 1EBOA 4N21A 1PKYA 1R73A 1LNQA 1QBZA 3X2QC 3DC5A 4LNUB 4TV9A 4UB6Z 1JPXA 4LH6A 4BR6A 3JATB 3N2KB 1ZL8A 4QG9A 4DK0A 3OTOO 4YJ2B 5IYBO 3FB7C 1Q6IA 4XDKA 1J95A 1I5YA 2YI9A 2P4KA 2EIMC 2BE3A 4TOIA 5BZBA 3OGIB 4AHCA 1IBLO 1GAXA 4AILC 4ZI7B 3BEHA 3M7MX 5FL7G 1DK1A 3D3QA 1XL6A 2YXLA 3ABMB 4PHZA 1NR1A 1QU7A 3M99B 1NH2B 2E5LB 2H94A 3OMIB 2B5UA 2WLIA 3HKCB 3GR4A 1WNSA 5A2QN 4H44B 4B3RB 3CS5A 2NN4A 4UV9A 3JD1A 1KP3A 3M8AA 1F4NA 1FXKC 3DSQA 4JAVA 1KB9F 3CXCU 3WB2A 3OD4A 4WFHA 3ABMC 4IP7A 2V4DA 3RYFA 2VGBA 3ASNC 4UVAA 1L0LH 3CCSV 3BA9A 1RSOA 3CCQV 3G80A 4EB6B 5CA0B 1VQKV 3G2GA 4GKKO 5J2UB 1A32A 2WLNA 4B3TO 2EX3A 4F6RB 2XASA 4DV7O 4WFBV 3FD9A 1SS3A 4IGGA 2UUAO 4MT8A 3K9SA 2VQFO 5KHHA 1M56C 1XNQO 3H9VA 3CD6V 1IX9A 4DW0A 5B1AC 4LFBO 3C3SA 3ICXA 1SZXA 5GW7A 1F51A 1H2MA 3W7UA 3AG1C 4MVMA 4FM1A 1NT2B 3GVMA 1VF7A 3W7WA 2VS0A 4GCZA 1AVMA 1HNWB 1VEWA 2K1EA 2Q7EA 3UCSC 3FYEB 5CBHA 3F7VC 2PUSA 3UO3A 1SRYA 2ZXWB 4JV5B 1AI7A 4UCTA 2M7WA 4JI2B 1ZSPA 3RYCB 1F4MA 2ZE6A 2EIKC 5L3DA 1I08A 1KECA 2QM7A 3FKSG 4EEQA 2XUMA 1VF6C 5KHGA 4NTXA 3OUFA 1GM7A 1D2DA 3FB5C 2VWKA 5HFMA 5ITZB 4ICGA 1M1KW 2UUCO 1VQOV 1OCRB 1AJNA 1X59A 3OW2U 3HB3B 2KB1A 3EHBB 5JVDB 3LSSA 3RGBA 1XMOB 1Z5WA 4UXNA 1FXHA 4RUEA 3IFXA 1EN6A 1PL4A 1KYOF 4I5SA 3ABKB 5EK0A 4JI4B 1FYJA 2UXCO 1FFXA 1WPBA 1P7BA 5FNVA 3SJQC 1MZFA 4DV2O 2Y69C 1R3KC 2P4VA 3L74H 3T1YO 1Y76B 3N2GB 3B8NA 4HNAB 4NB5A 2MK3A 1A49A 3ETQA 4J9YB 3JCUZ 3R65A 1YITV 1JQ0A 2VQEO 1PM9A 3G67A 3BABA 2P22C 4P2ZA 1X4TA 3U2ZA 2R70A 2YSUB 4FJCC 3G6BA 4BW9A 3Q4HB 3ZX6A 5LXTA 1FKAO 2RCVA 3LNMB 4G28B 5LL6Y 4XDJA 3VBBA 4FFBB 3SRKA 2JIZG 1D5NA 2XHBA 4I50A 3OTOB 3QF7A 4PJ0Z 2P7TC 4J7ZA 3JASA 1VQMV 2JRIA 2EJRA 1QNMA 3W7XA 4I4TA 2A79B 3K5LA 2YIDA 4NXMO 5IE9A 1K5SA 2OCCB 2ZE5A 4D7TA 4LF8O 2VRZA 1JJ2U 2ADPA 1N8RW 2B1GA 1ZX3A 1QVFU 1Y74B 2F43G 2IJJA 2ZIMA 5FPOA 5JH7B 3H1IH 5D5QA 2A0LA 1AI4A 2E75B 4BIUA 4JI1O 4DV4O 3BRCA 1R3LC 4O2BB 4DR3B 4FLYA 1JX9A 1G4YB 4CC5A 5EZYB 3A0BZ 4YXWG 4RWUA 1R6NA 1WN7A 4P9OA 2HJFC 4X1YB 2IH3C 4YJ3A 1SERA 3BHPA 1Q81W 3E0VA 1S77D 2L6LA 3LDCA 1SC5B 1BQ0A 4PI2A 4LF5O 1AJPA 3ZMVA 1BT8A 1I7FA 2QWQB 2LGWA 1OV9A 2WA4A 4O4IB 3B09A 3VQWA 3CC7V 4GKKB 4B3TB 4KCUA 2BTQA 3E8FA 1NH2D 2UXXA 3L70H 2YIBA 4L87A 4WBNA 2UUAB 1NR7A 1JOYA 2HVKC 4X65O 1HNXB 2UXDO 1NU1H 3AG4B 2V7QG 3ZRWB 2XAQA 4O4LB 4F6EA 4IIJB 4B3SO 4GKJO 2DWDC 2CK3G 1P7GA 1I0HA 4J80A 4DV6B 4LFBB 1P49A 4IHJA 4DV5B 2HHHB 2EINC 4ABMA 1YI2V 1GN2A 1MMMA 3AK1A 1SA0A 3SRFA 4FLXA 2BSKB 1QR8A 4DK1A 3BJFA 2Q9LA 2HVJC 3QG5A 4W4KA 1K8AW 3AG3B 3H1KH 1IDSA 2O57A 4UVBA 2QWRB 5D5PA 3TJTA 4X1KA 4UCRA 1DGSA 2JEUA 2A3QA 5AG2A 2XAJA 2XNDG 1AI6A 3AK2A 3W7SA 1HR0O 3LDDA 1WAZA 3OMAB 4DRXA 2Q5ZA 4PV1B 4R8CA 5IJ0A 3KHDA 5JJNB 3CPWU 5JQGA 4LF9O 2GSMB 3O65A 2QGNA 4DR6B 1PP9H 2H8PC 4ZIBA 5BY1A 3WG7B 1F7YA 2EZPA 1O9GA 3HKDB 3I56V 1IBMO 2E5LO 2UU9O 3HKBB 2UUCB 3CB2A 4PD4F 1PL0A 2W6JG 4U3FH 4B3RO 3D3IA 2EBOA 2B9ZA 5IY5B 1SQXH 1IBKO 3ZHVA 3OM3B 1VQ9V 4RPPA 4UV8A 1YF2A 4LF4O 5KHIA 3VQYA 3J7AU 4DV2B 3ETEA 2X6BA 3SJBC 4X66O 3RBZA 3T1YB 3IS4A 1K4DC 5IY5C 2W0XA 2Y0PA 4D6TH 3SPCA 3JAWB 2Q7HA 2Z5UA 4I7ZB 2VQEB 2OWOA 3L9DA 5B5EZ 3K5NA 2NLJC 1S3JA 3OT7A 4H37A 4JASA 4X20A 3QV8A 2QM4A 1XHXA 5BMVA 1MA1A 1QLEC 1S5HC 4WF9V 2NNUA 3JCZA 4TV8A 1VF5B 4DV0O 1LUWA 5EYPA 2ZNJA 3JARA 4N23A 2YXHA 4PDMA 2QKSA 2E74B 3KZIZ 4UB8Z 2PF4E 1HNWO 1XI1A 4I55B 4MTFA 1QHTA 2PTMA 2VWJA 1G8MA 4JTCB 4JV5O 2AGAA 1LUVA 4FLVA 1HNZO 4U3JA 5J2TB 4JI2O 1V9PA 4JGSA 4H33A 3F5WC 1CP9A 2JK5C 2OIGA 2LO1A 2QKAA 2R9AA 3L75H 2GUZA 4DV4B 4LFAO 1N32O 5EBLC 3S3XA 4RQEA 3ZN1A 2RNBA 5EBMC 3CRMA 4LNUA 4PA4A 4R50A 1KD1W 4MVSA 3BAAA 2ZCEA 3SRHA 1RPOA 3JATA 3N2KA 3I55V 3SJAC 4YJ5A 3UQ8A 4YJ2A 1BL8A 3A2FA 4MS2A 3ZHSA 1T57A 1N34O 3RW0A 2HLDG 3CJHA 1AQFA 3ZIAG 4ZI7A 2CTQA 1FJGO 4B08A 4EFBA 4FFKA 1N36B 2VGIA 4JI3B 4DUZB 2DE0X 1XILA 3K9AA 1Q6UA 2KKWA 4O2AA 4LH7A 1F23A 5LA6B 1SQVH 2HR3A 3CX5F 4CZZA 1KKCA 5JCOC 3HKCA 1YJ9V 4JI4O 2UXDB 4FIPC 1OCCC 1R3JC 2DYSB 3ZS8C 2BTOA 2XTAA 4QE7A 4B3SB 4GKJB 4GT1A 3C90A 3SYPA 1ORQC 3B2EE 1FS0G 4ASUG 4PA9A 1W59A 5KX5B 1MABG 1YJWV 1A3WA 3ASOC 3GWOA 3JALB 2D3OW 1N33B 4NKGB 4MVOA 3ABLB 5KA5A 1F3XA 2EIJB 2CE4A 3CXHF 5CA0A 4Q6GA 2CGOA 1H2KA 4YIOA 4DV3O 2C2AA 5CN0A 1JJOA 1HR0B 3OR6C 1NZ6A 1BGYH 2ZQMA 1US6A 3ZHUA 4K8XA 4LF9B 3SR2C 2RMKB 3A0RA 1XL4A 3T1HB 3ABLC 2ODMA 1S5JA 4J41A 3CE2A 4HZ3A 5LOVB 4LWSA 1IBMB 1Q43A 3IC7A 1MZEA 2UU9B 4CS2A 5IJ9B 4PI0A 1GMGA 5B3SB 4DR1B 1UFIA 2ZM6O 3L72H 1VF6A 3S3WA 1K3EA 2Q7GA 2P67A 1SQBH 2Q8VA 1IBKB 1YXBA 4DR3O 2X6AA 3MD0A 5TISZ 3MDSA 3RT3C 4Z1VA 5GTIZ 1W0KG 1K73W 2FKXA 3RYCA 4LF4B 1G1XB 3HQPA 2YXYA 4F4LA 1JA8A 4B7EA 4DXWA 3IGAC 1R6TA 1KU9A 3JD0A 4X66B 1V55B 2BOCC 4IMAA 2FB5A 4RQFA 4GX0A 5C8YB 1ZWIC 2CTWA 5ITZA 1DF4A 4FLUA 1R6KA 1BSMA 1HNXO 2P5OA 4NTYA 2YS8A 2DQ0A 5LMUO 4I0XB 5JVDA 4CBCA 1WLEA 1AJQA 3P30A 3BA8A 1GN6A 4DV6O 1QLNA 2VGFA 4DV5O 3RYIB 2HHHO 1XBLA 1V55C 4TV9B 4DV0B 2QKCA 4KHPO 3PP7A 2PI5A 1EM1A 2Y0IA 2DOSA 3UM7A 3AK3A 3QNEA 3CCUV 2OYQA 1MSDA 1HP8A 1FD9A 3KCXA 1PD3A 1Y76A 2GDSA 5IYDO 4HNAA 4X88A 5LP6B 3G4SV 2CTRA 1K97A 1HNZB 2QE7G 2F95B 4X1IB 3ZMZA 3JD4A 1OJHA 2ITCC 1WA8B 3ZBHA 2P90A 1B3QA 1WB7A 3TCUA 3RFRA 1WP7A 4DYLA 3SPGA 3LSUA 4GX2A 4QG6A 4DR6O 3E83A 4LFAB 1N32B 1NS1A 2Z0AA 3ZRSA 2Q6AA 4PDVA 3K5MA 5KHJA 3Q4HA 4CH5A 1TVKB 5CA1B 4B2DD 4FFBA 3VQVA 1IURA 2ZXWC 3ZCCA 1J5EO 4JTDB 1N34B 1M90W 1U97A 5LHIA 3H1JH 1FJGB 4QNHB 2AHZA 1UPGA 4QGPA 2EILB 4DV1O 1YZBA 1Y74A 2IBZH 4JYAB 5DEDA 1JFFB 5JH7A 1NKDA 3JAMN 1SETA 1OCRC 2EULA 2ITDC 1CEZA 3T0TA 5CA3A 3SDLA 5B1NA 5EZYA 1PNLA 2AHYA 2IJKA 1H2GA 5FLXN 2QWNB 1ROPA 3ABKC 1VMGA 3UT5B 3RN4A 5CB4B 3OMNB 3TGUH 3ZHQA 2LFRA 2LJ2A 4IYHA 2FL4A 4J10A 1VARA 4O4IA 4UCVA 4LCUC 4OX9B 4DV3B 3PJSK 2IM9A 1M5IA 3K08A 2OIEA 2G38A 4NYKA 3QV6A 3D36A 1Y66A 1IXMA 2NR5A 3ZEDA 4MTXA 1BMFG 1VQNV 3ABTA 4P30A 3JSLA 1WJZA 2JJ1G 4JI7B 3VOUA 2LFSA 1ZUQA 4CH4A 3ZN0A 4U7OA 1EN4A 1CXZB 5LYJB 2OT5A 1AROP 5HFLA 2ZT9B 3CMEV 3MHHC 2JGDB 2ZM6B 3HR0A 3JAKA 3B40A 2KG7B 1KQSU 3B8MA 5BXZA 3QO5A 2A7WA 4DO2A 2WAMA 3OE7G 2OCCC 3BJTA 1OCOB 1RM1B 3CHXA 2ZR3A 2IW5A 4ZOLB 3OUSA 3OEHG 4RUFA 2LW1A 4GZRB 1GM9A 1UJWB 4YY3B 4GYCB 1N36O 1BCCH 4QGCA 2A9HA 1H8HG 4JI3O 3UO2A 4DUZO 1MOFA 1WP8A 3DXRA 3HKDA 4UUJC 1L0NH 1EZVH 4JI6B 2ZKOA 5GONB 1RM1C 1JCHA 1GN4A 4WCEV 5LMUB 5H9CA 1TUBB 4R7CA 4G2KA 1COWG 5IYZA 2IU0A 1S76D 4B3MB 2PI4A 4TUYB 3N27A 4KHPB 3OGCC 3KCYA 2DYRB 1B04A 3ZMSA 3ZMUA 1KUQA 2WA3A 3JASB 3D36C 3E35A 1N33O 4O4JB 5EIBD 3RVYA 4R6ZA 3J81N 3AG4C 1NJIW 4NVPA 3CCVV 2HG5C 3OEEG 5GTHZ 3HKEB 1TUEB 4GUNA 1VIBA 3E8HA 3JAWA 1GO3F 3TXSA 2F93B 4FLWA 4FM2A 4DUYO 3O9OA 2JJ2G 3FFQA 3AG3C 3T1HO 1Q7YW 3T4DA 3TK1A 2HP8A 1H8EG 1K33A 3L73H 1MSWD 5B1OA 3BVOA 1J5EB 4J42A 2H3OA 4DR5B 2F66C 4DR1O 1GKFA 1BZKA 4GLXA 1FFTB 3OFNG 1YVWA 3OAAG 3THOA 2Q0OC 5EC1C 4TSFG 1VQ6V 4I55A 4JYCA 2X0LA 4OXSA 1IZ3A 3CCRV 2RDCA 1VQ7V 1IXBA 2WLLB 3IJ4A 3WG7C 4DV1B 2Q0AA 5J2TA 2GTSA 1EZJA 4WFAV 3A8TA 3KTXA 3CRRA 3T2MA 3D8CA 3K04A 2OTJV 2W6IG 5JCOA 1E1RG 3BY6A 3SYQA 5LMNB 3EVKA 2R72A 2YI8A 2ZNIA 2ZE7A 1PPJH 1OZ0A 4CS4A 4LBEC 2XAGA 1XMQO 4MVZA 4X1KB 1FAFA 2LQTA 3FAVA 1YCIA 3BPZA 5LHHA 4HBNA 2G50A 3CCJV 4JYYA 1YSCA 5LA6A 3LSQA 4ZHQB 2YIAA 1GH6A 3H1HH 3WB1A 2PYLA 2QSAA 4DRXB 4Z2WA 2MW2B 2UXNA 3KKYA 1SZTA 2L35A 1E1QG 1XQ8A 1TAEA 1PKXA 1CPYA 3QVNA 3W7TA 1S5LZ 3LUTB 3ME3A 2GTAA 5CBGA 1VQ4V 2Y4TA
chains in the Genus database with same CATH topology
1K3EA 4I5SA 1OCZB 3ABKB 3ZRXA 2P67A 5J9PC 1VQPV 3DTUB 5EK0A 5IYCO 2X6AA 2X7RB 1P7BA 3MD0A 3SJQC 5KUKA 2Y69C 1R3KC 3MHSC 1W0KG 1K73W 4GX5A 5LGUA 3JD3A 3B8NA 3K0GA 4F4LA 4QE9A 2MK3A 4DXWA 3IGAC 1R3IC 4J9YB 2DYRC 4MSWC 4KP4A 2DWEC 4U7NA 3CCLV 3JD0A 3R65A 4FK5C 1V55B 3AG2B 2BOCC 1VQ8V 1YITV 4J9ZB 1JQ0A 4P2ZA 4RQFA 3G71V 3NXSA 4GX0A 3K0DA 2HFEC 2YSUB 2XAHA 4FJCC 3AAGA 1ZWIC 1DF4A 1R6KA 1QR9A 5LGTA 1V54B 3LNMB 1K4CC 4MVUA 2DQ0A 4G28B 4JF3A 4XDJA 3VBBA 4CBCA 1YIJV 1WLEA 2JIZG 5CMUA 3SYCA 1AJQA 3P30A 1QLNA 4X89A 2P7TC 4TT3G 1V55C 3AG2C 1VQMV 1H38A 2EJRA 3W7XA 4FPPA 1Y4MA 4I9WA 2A79B 2JDIG 1YJNV 2PI5A 1EFRG 4LC1A 3AEIA 1B6QA 3UM7A 3ZMTA 3K3WA 1K5SA 3CCUV 2OCCB 3QNEA 2W0FC 2Z3YA 1JJ2U 5LHGA 4JPRA 4QIWF 3SPIA 1N8RW 2EZOA 2B1GA 1V54C 1PD3A 5C93A 1QVFU 5IYDO 2F43G 2WSSG 2IJJA 5KUMA 4X88A 2LP7A 3K79A 2ZR2A 3G4SV 1K97A 4JAUA 2QE7G 2A0LA 3ZMZA 3X2QB 1AI4A 3JD4A 4BIUA 1HWYA 1SESA 2ITCC 2DYSC 1R3LC 5L3EA 1JX9A 1G4YB 2GHYA 2P90A 3ML0A 4EKWA 4YXWG 1VQ5V 1R6NA 1S0VA 4P9OA 3TCUA 1QLEB 3SPGA 4GX2A 5IDJA 4GX1A 2YEVB 2HJFC 1KC8W 3E83A 3DGEA 4WFEA 2IH3C 1SERA 3ZRSA 2Q6AA 4PDVA 1Q81W 2QEXV 1S77D 3LDCA 4HAMA 3P32A 1KKDA 3E8GA 1L1FA 1AJPA 3ZMVA 3SYOA 2ZXWC 2Q68A 3ZCCA 4G27B 1NVPB 4JTDB 3CCEV 1M90W 3CC7V 2EIJC 4MTGA 5LHIA 1YTFB 4HYOA 3E8FA 1NH2D 2V1DA 2UXXA 4WFFA 2WLHA 4L87A 4QNHB 3G6EV 1NR7A 1JOYA 2HVKC 4KUMA 4PDRA 2AHZA 3ZJZA 3AG4B 2EILB 2V7QG 1AI5A 3ZRWB 2XAQA 4X8AA 4PA6A 1RPRA 1Q86W 1FXKB 2DWDC 2CK3G 1FXVA 1NKDA 2EINC 2DQ3A 1SETA 1YI2V 1NBMG 4BAYA 4PDLA 3EFFK 1OCRC 1CEZA 2ITDC 3ASNB 5CA3A 1VQLV 1QR8A 5B1NA 4QPJA 2HVJC 3QO7A 1PNLA 2AHYA 3LDEA 1K8AW 3AG3B 2IJKA 1H2GA 4QPKA 5B3SC 3E2EA 2YEVA 4UVBA 4RO2A 4XDLA 2JEUA 2Y48A 1ROPA 4MTOA 1QVGU 1OCZC 3ABKC 4LP8A 4XBFA 4PELA 5EBWC 3SPJA 3TETA 4JTAB 1AR1B 2XAJA 2XNDG 3OMNB 3FYIB 2IJHA 3WFVA 1GTOA 2LFRA 1AI6A 3W7SA 3CYOA 4MW8A 1K92A 3LDDA 1M56B 3B77A 3OMAB 4LCUC 1DLBA 4R8CA 2XAFA 3E89A 3JD2A 3PJSK 1QCEA 5L3BA 3CPWU 1W0JG 3GB7C 3K08A 5B1AB 3HPLC 3CC4V 2GSMB 1K5QA 3D36A 1Y66A 1OCCB 2H8PC 5DN6G 2R9IA 1IXMA 2ATKC 3AG1B 3WG7B 2EZPA 2IH1C 4MVQA 1JVMA 3I56V 4MTXA 2WLJA 1BMFG 1VQNV 3ABTA 1FXKA 4P30A 2JJ1G 2B1IA 1Q82W 3VOUA 3E86A 3KG2A 4QJFB 3CCMV 2LFSA 1YHQV 1PL0A 2W6JG 1E79G 3D3IA 3ZN0A 2EBOA 1PNMA 4U7OA 5KA6A 4KFMA 5IY5B 2XOKG 3ASOB 2QM8A 3CMAV 2OT5A 1S72V 1AROP 5HFLA 3CMEV 3MHHC 3FB8C 5H6QA 3OM3B 3E8BA 4Q20A 3JYCA 1VQ9V 2EIKB 3CC2V 4UV8A 2P6JA 1GK9A 2WLIB 3F7YC 1KQSU 3B8MA 3ETEA 3QO5A 3RVZA 1P4RA 1BHAA 4DO2A 3STLC 4E2LA 2WAMA 2QA4V 3OE7G 2X6BA 4P9PA 2OCCC 1OCOB 3RBZA 4BW5A 1RM1B 2EIMB 3ZRVA 1K4DC 5IY5C 2ZR3A 2IW5A 3OUSA 3K03A 5LBQA 2WLMA 2Q69A 2ZD9A 3OEHG 5DM6V 4RUFA 3SPCA 1GM9A 1UJWB 1EBOA 2Z5UA 4N21A 1R73A 1LNQA 1QBZA 2A9HA 3X2QC 1H8HG 1MOFA 1YTFD 1K34A 2NLJC 4UUJC 1S3JA 2WWWA 1JPXA 4H37A 4JASA 2JEXA 5IYBO 3FB7C 1QLEC 2X6CA 1S5HC 4WF9V 2NNUA 4RAIA 4XDKA 1J95A 1I5YA 3ABUA 3JCZA 1RM1C 1JCHA 2EIMC 1DTOA 4WCEV 5BZBA 5H9CA 2IJIA 5L3FA 2ZDIA 3K06A 3BEHA 5H6RA 4R7CA 2Y69B 4N23A 5FL7G 2R9RB 4G2KA 1XL6A 4PDMA 2QKSA 1COWG 5EC2C 3ABMB 2IU0A 1NR1A 1S76D 3M99B 2PI4A 1NH2B 1ENVA 3OGCC 2H94A 2HKOA 2B5UA 3OMIB 4MTFA 1OHHG 2DYRB 2WLIA 2OTLV 1MG1A 4PA3A 1G8MA 4JTCB 3ZMSA 3ZMUA 1NQTA 3E35A 1M9NA 4ZBMA 4UV9A 3RVYA 3H01A 3JD1A 4R6ZA 1KP3A 3AG4C 2EILC 4BIZA 1NJIW 4JGSA 3CCVV 1I5XA 2HG5C 1F4NA 3OEEG 1FXKC 4H33A 1TUEB 3F5WC 4JAVA 2Q67A 1CP9A 2JK5C 3CXCU 3E8HA 3QO8A 4WFHA 1GO3F 3ABMC 5EBLC 4RQEA 4JYBA 3ZN1A 5EBMC 3FB6C 3ASNC 4PA4A 4UVAA 4R50A 1KD1W 4MVSA 1RPOA 3CCSV 1K7DA 2JJ2G 4MW3A 5E1AC 3I55V 3SYAA 3AG3C 3CCQV 1BL8A 4MS2A 3T4ZA 1VQKV 1Q7YW 3T4DA 3TK1A 2WLNA 1H8EG 3RW0A 2HLDG 1K33A 3T1CA 2XASA 4FMTA 3ZIAG 1MSWD 4WFBV 3ZRWA 5B1OA 1GM8A 1M57B 4MT8A 1GKFA 3STZC 3K9AA 1WPXA 1M56C 1FFTB 3OFNG 1F23A 3OAAG 2HR3A 4TSFG 5EC1C 4CZZA 3CD6V 1VQ6V 4JYCA 2X0LA 5B1AC 4OXSA 3CCRV 1YJ9V 2WLKA 4TWKA 1VQ7V 4FIPC 5GW7A 1F51A 1OCCC 1R3JC 2DYSB 2WLLB 3W7UA 3AG1C 3WG7C 4MVMA 4QE7A 4PA7A 4GT1A 3SYPA 1ORQC 3CP1A 1M57C 1W2BU 3W7WA 1KP2A 2QTOA 1EZJA 4WFAV 4GCZA 2BOBC 1FS0G 4ASUG 2K1EA 4PA9A 3FYEB 4UVCA 1MABG 3T2MA 5CBHA 1YJWV 1BHBA 3ETDA 3F7VC 1SRYA 2ZXWB 3ASOC 3K04A 2ZDIC 1AI7A 3GWOA 2OTJV 2D3OW 2W6IG 4Z1MG 1E1RG 3ABLB 4MVOA 3BY6A 3SYQA 5KA5A 5B1BB 2EIJB 2M7WA 5CBFA 1NVPD 1F4MA 1OZ0A 4WFGA 2EIKC 4LBEC 2XAGA 2C2AA 5CN0A 5L3DA 1KECA 3FKSG 2QM7A 3OR7C 2FTKA 3OR6C 4MVZA 1DF5A 2ZQMA 5LHHA 1K9MW 1PNKA 3OUFA 1GM7A 1OCOC 3CCJV 5LGNA 1YSCA 2DW4A 3LSQA 1THZA 2EINB 3A0RA 1XL4A 4MVRA 3FB5C 3ABLC 5HFMA 5L3CA 5B1BC 1M1KW 3UKMA 2UXNA 1VQOV 1OCRB 1SZTA 2WPDG 1AJNA 4HZ3A 3OW2U 2WLLA 3HB3B 1E1QG 2KB1A 3EHBB 2IU3A 3ETGA 3IC7A 1PKXA 1CPYA 3W7TA 3LSSA 4ZKIA 3LUTB 4UXNA 3SPHA 1GMGA 5B3SB 1FXHA 5CBGA 1VQ4V 4RUEA 3IFXA 5L3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ2 G;  5H6Q A;  3ZMV A;  1H8E G;  2HLD G;  2XAS A;  3ZIA G;  4UV8 A;  5LHI A;  1W0K G;  2V1D A;  2UXX A;  5LGU A;  3OE7 G;  3OFN G;  3OAA G;  4KUM A;  4TSF G;  4CZZ A;  2IW5 A;  2X0L A;  2V7Q G;  5LBQ A;  2XAQ A;  3OEH G;  2CK3 G;  2Z5U A;  1H8H G;  2XAH A;  1NBM G;  4BAY A;  5LGT A;  1FS0 G;  4ASU G;  4UVC A;  3ABU A;  1MAB G;  2JIZ G;  4UVB A;  5L3F A;  2W6I G;  4Z1M G;  1E1R G;  2Y48 A;  4TT3 G;  5H6R A;  4XBF A;  5FL7 G;  2EJR A;  1COW G;  2XAJ A;  2XND G;  2JDI G;  1EFR G;  3ZMT A;  2XAG A;  2Z3Y A;  5L3D A;  2XAF A;  3FKS G;  2H94 A;  2HKO A;  5L3B A;  5LHG A;  1OHH G;  1W0J G;  3ZMS A;  3ZMU A;  5LHH A;  2F43 G;  2WSS G;  4UV9 A;  2DW4 A;  5DN6 G;  2R9I A;  5LGN A;  2QE7 G;  3ZMZ A;  3OEE G;  5L3C A;  1BMF G;  2UXN A;  3ABT A;  5L3E A;  2WPD G;  2JJ1 G;  4YXW G;  1E1Q G;  2W6J G;  1E79 G;  3ZN0 A;  3ZN1 A;  4UXN A;  4UVA A;  2XOK G;  5L3G A; 
#chains in the Genus database with same CATH topology
 2GBO A;  3GWK C;  1OCZ B;  5KX5 A;  5J9P C;  4DR2 O;  1SQG A;  5IYC O;  2EJ7 A;  1ZLZ A;  3JAL A;  4H0L B;  4KS0 A;  1O9H A;  3MHS C;  1TA8 A;  2ILM A;  5LGU A;  4FLZ A;  2CDY A;  3JD3 A;  3K0G A;  4JI5 B;  1R3I C;  4MSW C;  4KP4 A;  1P84 F;  1VQ8 V;  1URF A;  4J9Z B;  3RYH B;  4FVM A;  1XOU A;  2E76 B;  2LGQ A;  2XAH A;  4YHH B;  3AAG A;  1H2S B;  1PV0 A;  4TQF A;  1QR9 A;  5LGT A;  5LOV A;  1K4C C;  1L8D A;  4J11 A;  3SYC A;  4JYA O;  1AR5 A;  2E3C A;  4TT3 G;  2AXT Z;  1LR1 A;  1H38 A;  4FPP A;  3SRD A;  1YJN V;  1I94 B;  1EFR G;  4LC1 A;  3AEI A;  1B6Q A;  5KAF Z;  3ZMT A;  4KRZ A;  3K3W A;  4IL6 Z;  2Z3Y A;  5LHG A;  2YDE A;  1KBH A;  5C93 A;  2PGG A;  5KUM A;  2LP7 A;  4K0K O;  2ZR2 A;  2AW9 A;  4IT5 A;  3X2Q B;  1HWY A;  3CEI A;  4LF7 O;  2HEP A;  2DYS C;  4X64 B;  5L3E A;  4EB6 A;  3ML0 A;  1XHZ A;  4OX9 O;  1VQ5 V;  1H2N A;  5J2U A;  4F6R A;  5C8Y A;  4GX1 A;  2YEV B;  3DGE A;  4DUY B;  2QEX V;  1KKD A;  3FX7 A;  4I0X A;  3SYO A;  1WB8 A;  3E22 B;  3DC6 A;  4O4H B;  1JR9 A;  3OTF A;  4G27 B;  1NVP B;  4YNG A;  3C3T A;  3CCE V;  4JI7 O;  3RYI A;  4UCS A;  2EIJ C;  4MTG A;  1VP7 A;  2WLH A;  1PKM A;  3G6E V;  4JI0 O;  2CH7 B;  4KUM A;  4PDR A;  1BE3 H;  3HQO A;  1HDJ A;  3ZJZ A;  1ZAU A;  3CJH B;  1AI5 A;  4DRS A;  1RPR A;  1Q86 W;  1FXK B;  1SKV A;  2ADQ B;  5LP6 A;  4O2A B;  1T5A A;  2Q73 A;  4NR1 A;  3SJC C;  4WJ8 A;  4X1I A;  1NBM G;  4PDL A;  3EFF K;  3ASN B;  1WA8 A;  4QPJ A;  2N04 A;  4FLT A;  3WB0 A;  3LDE A;  4EFE A;  4QPK A;  2LW7 A;  4UCU A;  5B3S C;  3E2E A;  3K5O A;  4RO2 A;  4B7K A;  1Q6H A;  4DW1 A;  4XDL A;  1XDC A;  4YY3 O;  2Y48 A;  4MTO A;  4XBF A;  5FPR A;  4PEL A;  1TVK A;  4JTA B;  1AR1 B;  5CA1 A;  2IJH A;  2ZE8 A;  5K1X A;  1GTO A;  3B4S A;  4AQY O;  1G6U A;  3CYO A;  3T07 A;  1K92 A;  1M56 B;  3B77 A;  5KMG B;  4JI6 O;  3JD2 A;  5L3B A;  4LF6 B;  1W0J G;  3RWR D;  1XMQ B;  5B1A B;  3HPL C;  3CC4 V;  5E79 Z;  4L8J A;  5DN6 G;  2PYJ A;  3ZHT A;  2R9I A;  4X62 B;  3AG1 B;  5EIB C;  2IH1 C;  2RJZ A;  4J7K A;  4MVQ A;  2PY5 A;  3APO A;  2YIB D;  4CH3 A;  4B3M O;  1ZL8 B;  2N74 A;  5A9G A;  1XNR O;  1JFF A;  4IYI A;  4HYW A;  3E86 A;  2CTP A;  3KG2 A;  4QJF B;  1YHQ V;  1NTM H;  3K57 A;  5KA6 A;  3CRA A;  1S72 V;  3N2G A;  3FB8 C;  2N05 A;  1ZTE A;  1H2L A;  4LWS B;  3LNN A;  2EIK B;  3CC2 V;  1GK9 A;  4DR2 B;  2WLI B;  3F7Y C;  3UT5 A;  5CB4 A;  3K59 A;  3STL C;  4E2L A;  2QA4 V;  4JAA A;  1IVS A;  5LBQ A;  2Q69 A;  4JZG A;  2ZD9 A;  5KHK A;  5LP6 C;  4TQD A;  5KLV H;  4DR7 O;  2UUB B;  3RYF B;  1XRE A;  4DR5 O;  1YTF D;  1K34 A;  2WWW A;  1RSO B;  2JEX A;  2D2C B;  2X6C A;  4RAI A;  3ABU A;  1XUQ A;  2E28 A;  1DTO A;  2IJI A;  5L3F A;  2ZDI A;  3K06 A;  5LYJ A;  3QTC A;  5H6R A;  4FM0 A;  3K58 A;  4NXN B;  2Y69 B;  2R9R B;  2JGD A;  5EC2 C;  5JJJ B;  1PKL A;  3QTG A;  4JPG A;  4KL1 A;  4KXR A;  3MA8 A;  1ENV A;  2HKO A;  2F4V B;  1OHH G;  2KG7 A;  4O2B A;  2OTL V;  1PKN A;  1MG1 A;  4PA3 A;  4DR4 O;  5BR8 B;  4C7U A;  1NQT A;  1M9N A;  4ZBM A;  5LMN O;  3H01 A;  4X1Y A;  2EIL C;  3IC9 A;  4BIZ A;  1I5X A;  4ZOL A;  4K0K B;  1JMK C;  1NI8 A;  1M4U A;  1YDX A;  2Q67 A;  3GQY A;  4CS3 A;  3QO8 A;  4JI8 O;  1U96 A;  4LF7 B;  3U0Z A;  4JYB A;  3FB6 C;  1SQP H;  3GG8 A;  5F2V O;  2QDO A;  1K7D A;  4MW3 A;  5E1A C;  5IWA O;  3SYA A;  3PN1 A;  5GON A;  3T4Z A;  5IT9 N;  4K35 A;  5JWP A;  3T1C A;  4FMT A;  1Y67 A;  3ZRW A;  4O4L A;  1GM8 A;  2HJD A;  1M57 B;  4IIJ A;  1TUB A;  2JGU A;  3STZ C;  1WPX A;  4UCO A;  2ZIN A;  2RQ6 A;  2F1M A;  4TUY A;  4JI0 B;  1NTK H;  2BSK A;  1Q90 D;  2YIC A;  4E4E A;  2WLK A;  4TWK A;  1M93 A;  2UXB O;  2YUA A;  4O4J A;  1IBL B;  1SQF A;  4PA7 A;  3R66 A;  3CP1 A;  1M57 C;  3HKE A;  1W2B U;  4JI5 O;  4LFC O;  1KP2 A;  1T5E A;  2QTO A;  1Q8I A;  2BOB C;  4UVC A;  1BHB A;  4I9Q A;  1FFX B;  3ETD A;  3N25 A;  5FNV B;  2ZDI C;  4Z1M G;  5B1B B;  3EXA A;  5CBF A;  1NVP D;  4YHH O;  4YIP A;  4UFZ A;  3U10 A;  4WFG A;  3HQN A;  4KCW A;  4AQY B;  3OR7 C;  1TGO A;  2FTK A;  2ZIO A;  3H1L H;  3CSX A;  3HKB A;  1DF5 A;  1K9M W;  1PNK A;  2DJV A;  1OCO C;  5LGN A;  2DW4 A;  5KAI Z;  2JVD A;  1THZ A;  2EIN B;  2K9P A;  4K3A A;  2OCH A;  4MVR A;  1I94 O;  5L3C A;  5DEC A;  5B1B C;  3UKM A;  5LXT B;  2WPD G;  2CAZ C;  2CUG A;  2WLL A;  4DV7 B;  5K1P A;  2IU3 A;  3ETG A;  1XNR B;  1R1B A;  4ZKI A;  2VQF B;  4I50 B;  3SPH A;  1XNQ B;  5L3G A;  3ZRX A;  4I4T B;  1VQP V;  3DTU B;  4X64 O;  2X7R B;  2BCC H;  5KUK A;  4GX5 A;  1Q5O A;  4QE9 A;  2DYR C;  3JAK B;  2DWE C;  4U7N A;  3CCL V;  1BQZ A;  4FK5 C;  4BWA A;  3AG2 B;  1Z2G A;  4FXF A;  2F23 A;  4H13 B;  3IAY A;  2M6Y A;  3EOE A;  4D7S A;  3G71 V;  3NXS A;  2RN9 A;  4B2D A;  4ZHQ A;  3K0D A;  2HFE C;  4DR7 B;  3U11 A;  2ETN A;  4YJ3 B;  2KQX A;  2QJ1 A;  4CH6 A;  4NTW A;  1V54 B;  4MVU A;  4JF3 A;  1YIJ V;  4CC6 A;  3MAQ A;  5CMU A;  4X89 A;  1D5A A;  3AG2 C;  3DXR B;  2BTQ B;  4FXJ A;  1KMI Z;  1Y4M A;  4I9W A;  2JDI G;  1N0N A;  4OPH A;  4WBN B;  2QWO B;  1GN3 A;  4QG8 A;  2W0F C;  1Y6X A;  4JPR A;  4QIW F;  3SPI A;  3QV7 A;  2EZO A;  1V54 C;  2WSS G;  2QWP B;  4DR4 B;  3K79 A;  4IHJ B;  3QV9 A;  5IYZ B;  2ARH A;  3ZHR A;  4JAU A;  4X9Q A;  3AG7 A;  1SA0 B;  3A0H Z;  1SES A;  3I5D A;  2UXC B;  2PZS A;  2AZ2 A;  2GHY A;  3APQ A;  4EKW A;  3RYH A;  3T05 A;  3CRQ A;  4LF6 O;  1E0U A;  5B66 Z;  1S0V A;  3H6O A;  1QLE B;  3SGI A;  4JI8 B;  4A5U B;  5IDJ A;  1KC8 W;  5H5N A;  4WFE A;  2A06 H;  1E0T A;  4X62 O;  1ZJH A;  4HAM A;  3P32 A;  3E8G A;  1L1F A;  1SQQ H;  5IWA B;  2Q68 A;  1B06 A;  5IJ0 B;  1FPO A;  3P3P A;  1AP6 A;  3BFR A;  5JQG B;  1MNG A;  1YTF B;  1AIL A;  4HYO A;  2V1D A;  4WFF A;  4KCV A;  1Q3E A;  3F5T A;  2XT9 A;  4BIO A;  1QQC A;  3NR7 A;  2FML A;  3CWB H;  1NTZ H;  4X8A A;  4PA6 A;  1RP3 B;  1FXV A;  1VP8 A;  1SF9 A;  2UXB B;  5H2F Z;  2DQ3 A;  3E0W A;  1A3X A;  3P3N A;  2Y4U A;  4BAY A;  4K8Z A;  4NXM B;  1AR4 A;  1VQL V;  4J7J A;  4LFC B;  4LF8 B;  3QO7 A;  1F3W A;  4JZ2 A;  2YEV A;  4KCT A;  1QVG U;  1OCZ C;  4LP8 A;  2UUB O;  5EBW C;  3SPJ A;  3TET A;  2DMX A;  1XEQ A;  3FYI B;  3WFV A;  3E22 A;  1A5U A;  4O4H A;  1Z5V A;  4JI1 B;  1GRJ A;  2QR4 A;  4MW8 A;  5JJE B;  1DLB A;  2XAF A;  3E89 A;  1QCE A;  3TXQ A;  4HYV A;  3GB7 C;  4FZ0 A;  3JSN A;  4OGQ B;  1K5Q A;  2CH7 A;  1OCC B;  2ATK C;  5IJ9 A;  4NXN O;  1RFY A;  4LF5 B;  1JVM A;  2CGN A;  2WLJ A;  1FXK A;  1YEW A;  4X20 B;  4OPA A;  2B1I A;  2YC0 A;  1XMO O;  1Q82 W;  5BMV B;  2F4V O;  1EN5 A;  3FAV B;  4G1N A;  3CCM V;  3WU2 Z;  4TV8 B;  1E79 G;  2Q4P A;  5BR8 O;  1BS3 A;  1PNM A;  2AZ0 A;  4KFM A;  2VGG A;  2XOK G;  3ASO B;  2QM8 A;  3VQX A;  3CMA V;  5EYP B;  1HW7 A;  4X65 B;  3JAR B;  5H6Q A;  3E8B A;  2GV9 A;  2DN9 A;  2JS5 A;  4LR3 A;  4AI8 A;  4Q20 A;  1AB3 A;  3JYC A;  2P6J A;  4FZ1 A;  1N0J A;  2KSD A;  2FYU H;  2QTS A;  1P4R A;  3RVZ A;  1BHA A;  1N4C A;  3BCC H;  4P9P A;  3CRC A;  4U3J B;  2JS3 A;  4BW5 A;  5KMG A;  2EIM B;  3ZRV A;  4W4L A;  3K03 A;  3J80 N;  2WLM A;  2P06 A;  5DM6 V;  3L71 H;  1AP5 A;  2GUZ B;  1EBO A;  4N21 A;  1PKY A;  1R73 A;  1LNQ A;  1QBZ A;  3X2Q C;  3DC5 A;  4LNU B;  4TV9 A;  4UB6 Z;  1JPX A;  4LH6 A;  4BR6 A;  3JAT B;  3N2K B;  1ZL8 A;  4QG9 A;  4DK0 A;  3OTO O;  4YJ2 B;  5IYB O;  3FB7 C;  1Q6I A;  4XDK A;  1J95 A;  1I5Y A;  2YI9 A;  2P4K A;  2EIM C;  2BE3 A;  4TOI A;  5BZB A;  3OGI B;  4AHC A;  1IBL O;  1GAX A;  4AIL C;  4ZI7 B;  3BEH A;  3M7M X;  5FL7 G;  1DK1 A;  3D3Q A;  1XL6 A;  2YXL A;  3ABM B;  4PHZ A;  1NR1 A;  1QU7 A;  3M99 B;  1NH2 B;  2E5L B;  2H94 A;  3OMI B;  2B5U A;  2WLI A;  3HKC B;  3GR4 A;  1WNS A;  5A2Q N;  4H44 B;  4B3R B;  3CS5 A;  2NN4 A;  4UV9 A;  3JD1 A;  1KP3 A;  3M8A A;  1F4N A;  1FXK C;  3DSQ A;  4JAV A;  1KB9 F;  3CXC U;  3WB2 A;  3OD4 A;  4WFH A;  3ABM C;  4IP7 A;  2V4D A;  3RYF A;  2VGB A;  3ASN C;  4UVA A;  1L0L H;  3CCS V;  3BA9 A;  1RSO A;  3CCQ V;  3G80 A;  4EB6 B;  5CA0 B;  1VQK V;  3G2G A;  4GKK O;  5J2U B;  1A32 A;  2WLN A;  4B3T O;  2EX3 A;  4F6R B;  2XAS A;  4DV7 O;  4WFB V;  3FD9 A;  1SS3 A;  4IGG A;  2UUA O;  4MT8 A;  3K9S A;  2VQF O;  5KHH A;  1M56 C;  1XNQ O;  3H9V A;  3CD6 V;  1IX9 A;  4DW0 A;  5B1A C;  4LFB O;  3C3S A;  3ICX A;  1SZX A;  5GW7 A;  1F51 A;  1H2M A;  3W7U A;  3AG1 C;  4MVM A;  4FM1 A;  1NT2 B;  3GVM A;  1VF7 A;  3W7W A;  2VS0 A;  4GCZ A;  1AVM A;  1HNW B;  1VEW A;  2K1E A;  2Q7E A;  3UCS C;  3FYE B;  5CBH A;  3F7V C;  2PUS A;  3UO3 A;  1SRY A;  2ZXW B;  4JV5 B;  1AI7 A;  4UCT A;  2M7W A;  4JI2 B;  1ZSP A;  3RYC B;  1F4M A;  2ZE6 A;  2EIK C;  5L3D A;  1I08 A;  1KEC A;  2QM7 A;  3FKS G;  4EEQ A;  2XUM A;  1VF6 C;  5KHG A;  4NTX A;  3OUF A;  1GM7 A;  1D2D A;  3FB5 C;  2VWK A;  5HFM A;  5ITZ B;  4ICG A;  1M1K W;  2UUC O;  1VQO V;  1OCR B;  1AJN A;  1X59 A;  3OW2 U;  3HB3 B;  2KB1 A;  3EHB B;  5JVD B;  3LSS A;  3RGB A;  1XMO B;  1Z5W A;  4UXN A;  1FXH A;  4RUE A;  3IFX A;  1EN6 A;  1PL4 A;  1KYO F;  4I5S A;  3ABK B;  5EK0 A;  4JI4 B;  1FYJ A;  2UXC O;  1FFX A;  1WPB A;  1P7B A;  5FNV A;  3SJQ C;  1MZF A;  4DV2 O;  2Y69 C;  1R3K C;  2P4V A;  3L74 H;  3T1Y O;  1Y76 B;  3N2G B;  3B8N A;  4HNA B;  4NB5 A;  2MK3 A;  1A49 A;  3ETQ A;  4J9Y B;  3JCU Z;  3R65 A;  1YIT V;  1JQ0 A;  2VQE O;  1PM9 A;  3G67 A;  3BAB A;  2P22 C;  4P2Z A;  1X4T A;  3U2Z A;  2R70 A;  2YSU B;  4FJC C;  3G6B A;  4BW9 A;  3Q4H B;  3ZX6 A;  5LXT A;  1FKA O;  2RCV A;  3LNM B;  4G28 B;  5LL6 Y;  4XDJ A;  3VBB A;  4FFB B;  3SRK A;  2JIZ G;  1D5N A;  2XHB A;  4I50 A;  3OTO B;  3QF7 A;  4PJ0 Z;  2P7T C;  4J7Z A;  3JAS A;  1VQM V;  2JRI A;  2EJR A;  1QNM A;  3W7X A;  4I4T A;  2A79 B;  3K5L A;  2YID A;  4NXM O;  5IE9 A;  1K5S A;  2OCC B;  2ZE5 A;  4D7T A;  4LF8 O;  2VRZ A;  1JJ2 U;  2ADP A;  1N8R W;  2B1G A;  1ZX3 A;  1QVF U;  1Y74 B;  2F43 G;  2IJJ A;  2ZIM A;  5FPO A;  5JH7 B;  3H1I H;  5D5Q A;  2A0L A;  1AI4 A;  2E75 B;  4BIU A;  4JI1 O;  4DV4 O;  3BRC A;  1R3L C;  4O2B B;  4DR3 B;  4FLY A;  1JX9 A;  1G4Y B;  4CC5 A;  5EZY B;  3A0B Z;  4YXW G;  4RWU A;  1R6N A;  1WN7 A;  4P9O A;  2HJF C;  4X1Y B;  2IH3 C;  4YJ3 A;  1SER A;  3BHP A;  1Q81 W;  3E0V A;  1S77 D;  2L6L A;  3LDC A;  1SC5 B;  1BQ0 A;  4PI2 A;  4LF5 O;  1AJP A;  3ZMV A;  1BT8 A;  1I7F A;  2QWQ B;  2LGW A;  1OV9 A;  2WA4 A;  4O4I B;  3B09 A;  3VQW A;  3CC7 V;  4GKK B;  4B3T B;  4KCU A;  2BTQ A;  3E8F A;  1NH2 D;  2UXX A;  3L70 H;  2YIB A;  4L87 A;  4WBN A;  2UUA B;  1NR7 A;  1JOY A;  2HVK C;  4X65 O;  1HNX B;  2UXD O;  1NU1 H;  3AG4 B;  2V7Q G;  3ZRW B;  2XAQ A;  4O4L B;  4F6E A;  4IIJ B;  4B3S O;  4GKJ O;  2DWD C;  2CK3 G;  1P7G A;  1I0H A;  4J80 A;  4DV6 B;  4LFB B;  1P49 A;  4IHJ A;  4DV5 B;  2HHH B;  2EIN C;  4ABM A;  1YI2 V;  1GN2 A;  1MMM A;  3AK1 A;  1SA0 A;  3SRF A;  4FLX A;  2BSK B;  1QR8 A;  4DK1 A;  3BJF A;  2Q9L A;  2HVJ C;  3QG5 A;  4W4K A;  1K8A W;  3AG3 B;  3H1K H;  1IDS A;  2O57 A;  4UVB A;  2QWR B;  5D5P A;  3TJT A;  4X1K A;  4UCR A;  1DGS A;  2JEU A;  2A3Q A;  5AG2 A;  2XAJ A;  2XND G;  1AI6 A;  3AK2 A;  3W7S A;  1HR0 O;  3LDD A;  1WAZ A;  3OMA B;  4DRX A;  2Q5Z A;  4PV1 B;  4R8C A;  5IJ0 A;  3KHD A;  5JJN B;  3CPW U;  5JQG A;  4LF9 O;  2GSM B;  3O65 A;  2QGN A;  4DR6 B;  1PP9 H;  2H8P C;  4ZIB A;  5BY1 A;  3WG7 B;  1F7Y A;  2EZP A;  1O9G A;  3HKD B;  3I56 V;  1IBM O;  2E5L O;  2UU9 O;  3HKB B;  2UUC B;  3CB2 A;  4PD4 F;  1PL0 A;  2W6J G;  4U3F H;  4B3R O;  3D3I A;  2EBO A;  2B9Z A;  5IY5 B;  1SQX H;  1IBK O;  3ZHV A;  3OM3 B;  1VQ9 V;  4RPP A;  4UV8 A;  1YF2 A;  4LF4 O;  5KHI A;  3VQY A;  3J7A U;  4DV2 B;  3ETE A;  2X6B A;  3SJB C;  4X66 O;  3RBZ A;  3T1Y B;  3IS4 A;  1K4D C;  5IY5 C;  2W0X A;  2Y0P A;  4D6T H;  3SPC A;  3JAW B;  2Q7H A;  2Z5U A;  4I7Z B;  2VQE B;  2OWO A;  3L9D A;  5B5E Z;  3K5N A;  2NLJ C;  1S3J A;  3OT7 A;  4H37 A;  4JAS A;  4X20 A;  3QV8 A;  2QM4 A;  1XHX A;  5BMV A;  1MA1 A;  1QLE C;  1S5H C;  4WF9 V;  2NNU A;  3JCZ A;  4TV8 A;  1VF5 B;  4DV0 O;  1LUW A;  5EYP A;  2ZNJ A;  3JAR A;  4N23 A;  2YXH A;  4PDM A;  2QKS A;  2E74 B;  3KZI Z;  4UB8 Z;  2PF4 E;  1HNW O;  1XI1 A;  4I55 B;  4MTF A;  1QHT A;  2PTM A;  2VWJ A;  1G8M A;  4JTC B;  4JV5 O;  2AGA A;  1LUV A;  4FLV A;  1HNZ O;  4U3J A;  5J2T B;  4JI2 O;  1V9P A;  4JGS A;  4H33 A;  3F5W C;  1CP9 A;  2JK5 C;  2OIG A;  2LO1 A;  2QKA A;  2R9A A;  3L75 H;  2GUZ A;  4DV4 B;  4LFA O;  1N32 O;  5EBL C;  3S3X A;  4RQE A;  3ZN1 A;  2RNB A;  5EBM C;  3CRM A;  4LNU A;  4PA4 A;  4R50 A;  1KD1 W;  4MVS A;  3BAA A;  2ZCE A;  3SRH A;  1RPO A;  3JAT A;  3N2K A;  3I55 V;  3SJA C;  4YJ5 A;  3UQ8 A;  4YJ2 A;  1BL8 A;  3A2F A;  4MS2 A;  3ZHS A;  1T57 A;  1N34 O;  3RW0 A;  2HLD G;  3CJH A;  1AQF A;  3ZIA G;  4ZI7 A;  2CTQ A;  1FJG O;  4B08 A;  4EFB A;  4FFK A;  1N36 B;  2VGI A;  4JI3 B;  4DUZ B;  2DE0 X;  1XIL A;  3K9A A;  1Q6U A;  2KKW A;  4O2A A;  4LH7 A;  1F23 A;  5LA6 B;  1SQV H;  2HR3 A;  3CX5 F;  4CZZ A;  1KKC A;  5JCO C;  3HKC A;  1YJ9 V;  4JI4 O;  2UXD B;  4FIP C;  1OCC C;  1R3J C;  2DYS B;  3ZS8 C;  2BTO A;  2XTA A;  4QE7 A;  4B3S B;  4GKJ B;  4GT1 A;  3C90 A;  3SYP A;  1ORQ C;  3B2E E;  1FS0 G;  4ASU G;  4PA9 A;  1W59 A;  5KX5 B;  1MAB G;  1YJW V;  1A3W A;  3ASO C;  3GWO A;  3JAL B;  2D3O W;  1N33 B;  4NKG B;  4MVO A;  3ABL B;  5KA5 A;  1F3X A;  2EIJ B;  2CE4 A;  3CXH F;  5CA0 A;  4Q6G A;  2CGO A;  1H2K A;  4YIO A;  4DV3 O;  2C2A A;  5CN0 A;  1JJO A;  1HR0 B;  3OR6 C;  1NZ6 A;  1BGY H;  2ZQM A;  1US6 A;  3ZHU A;  4K8X A;  4LF9 B;  3SR2 C;  2RMK B;  3A0R A;  1XL4 A;  3T1H B;  3ABL C;  2ODM A;  1S5J A;  4J41 A;  3CE2 A;  4HZ3 A;  5LOV B;  4LWS A;  1IBM B;  1Q43 A;  3IC7 A;  1MZE A;  2UU9 B;  4CS2 A;  5IJ9 B;  4PI0 A;  1GMG A;  5B3S B;  4DR1 B;  1UFI A;  2ZM6 O;  3L72 H;  1VF6 A;  3S3W A;  1K3E A;  2Q7G A;  2P67 A;  1SQB H;  2Q8V A;  1IBK B;  1YXB A;  4DR3 O;  2X6A A;  3MD0 A;  5TIS Z;  3MDS A;  3RT3 C;  4Z1V A;  5GTI Z;  1W0K G;  1K73 W;  2FKX A;  3RYC A;  4LF4 B;  1G1X B;  3HQP A;  2YXY A;  4F4L A;  1JA8 A;  4B7E A;  4DXW A;  3IGA C;  1R6T A;  1KU9 A;  3JD0 A;  4X66 B;  1V55 B;  2BOC C;  4IMA A;  2FB5 A;  4RQF A;  4GX0 A;  5C8Y B;  1ZWI C;  2CTW A;  5ITZ A;  1DF4 A;  4FLU A;  1R6K A;  1BSM A;  1HNX O;  2P5O A;  4NTY A;  2YS8 A;  2DQ0 A;  5LMU O;  4I0X B;  5JVD A;  4CBC A;  1WLE A;  1AJQ A;  3P30 A;  3BA8 A;  1GN6 A;  4DV6 O;  1QLN A;  2VGF A;  4DV5 O;  3RYI B;  2HHH O;  1XBL A;  1V55 C;  4TV9 B;  4DV0 B;  2QKC A;  4KHP O;  3PP7 A;  2PI5 A;  1EM1 A;  2Y0I A;  2DOS A;  3UM7 A;  3AK3 A;  3QNE A;  3CCU V;  2OYQ A;  1MSD A;  1HP8 A;  1FD9 A;  3KCX A;  1PD3 A;  1Y76 A;  2GDS A;  5IYD O;  4HNA A;  4X88 A;  5LP6 B;  3G4S V;  2CTR A;  1K97 A;  1HNZ B;  2QE7 G;  2F95 B;  4X1I B;  3ZMZ A;  3JD4 A;  1OJH A;  2ITC C;  1WA8 B;  3ZBH A;  2P90 A;  1B3Q A;  1WB7 A;  3TCU A;  3RFR A;  1WP7 A;  4DYL A;  3SPG A;  3LSU A;  4GX2 A;  4QG6 A;  4DR6 O;  3E83 A;  4LFA B;  1N32 B;  1NS1 A;  2Z0A A;  3ZRS A;  2Q6A A;  4PDV A;  3K5M A;  5KHJ A;  3Q4H A;  4CH5 A;  1TVK B;  5CA1 B;  4B2D D;  4FFB A;  3VQV A;  1IUR A;  2ZXW C;  3ZCC A;  1J5E O;  4JTD B;  1N34 B;  1M90 W;  1U97 A;  5LHI A;  3H1J H;  1FJG B;  4QNH B;  2AHZ A;  1UPG A;  4QGP A;  2EIL B;  4DV1 O;  1YZB A;  1Y74 A;  2IBZ H;  4JYA B;  5DED A;  1JFF B;  5JH7 A;  1NKD A;  3JAM N;  1SET A;  1OCR C;  2EUL A;  2ITD C;  1CEZ A;  3T0T A;  5CA3 A;  3SDL A;  5B1N A;  5EZY A;  1PNL A;  2AHY A;  2IJK A;  1H2G A;  5FLX N;  2QWN B;  1ROP A;  3ABK C;  1VMG A;  3UT5 B;  3RN4 A;  5CB4 B;  3OMN B;  3TGU H;  3ZHQ A;  2LFR A;  2LJ2 A;  4IYH A;  2FL4 A;  4J10 A;  1VAR A;  4O4I A;  4UCV A;  4LCU C;  4OX9 B;  4DV3 B;  3PJS K;  2IM9 A;  1M5I A;  3K08 A;  2OIE A;  2G38 A;  4NYK A;  3QV6 A;  3D36 A;  1Y66 A;  1IXM A;  2NR5 A;  3ZED A;  4MTX A;  1BMF G;  1VQN V;  3ABT A;  4P30 A;  3JSL A;  1WJZ A;  2JJ1 G;  4JI7 B;  3VOU A;  2LFS A;  1ZUQ A;  4CH4 A;  3ZN0 A;  4U7O A;  1EN4 A;  1CXZ B;  5LYJ B;  2OT5 A;  1ARO P;  5HFL A;  2ZT9 B;  3CME V;  3MHH C;  2JGD B;  2ZM6 B;  3HR0 A;  3JAK A;  3B40 A;  2KG7 B;  1KQS U;  3B8M A;  5BXZ A;  3QO5 A;  2A7W A;  4DO2 A;  2WAM A;  3OE7 G;  2OCC C;  3BJT A;  1OCO B;  1RM1 B;  3CHX A;  2ZR3 A;  2IW5 A;  4ZOL B;  3OUS A;  3OEH G;  4RUF A;  2LW1 A;  4GZR B;  1GM9 A;  1UJW B;  4YY3 B;  4GYC B;  1N36 O;  1BCC H;  4QGC A;  2A9H A;  1H8H G;  4JI3 O;  3UO2 A;  4DUZ O;  1MOF A;  1WP8 A;  3DXR A;  3HKD A;  4UUJ C;  1L0N H;  1EZV H;  4JI6 B;  2ZKO A;  5GON B;  1RM1 C;  1JCH A;  1GN4 A;  4WCE V;  5LMU B;  5H9C A;  1TUB B;  4R7C A;  4G2K A;  1COW G;  5IYZ A;  2IU0 A;  1S76 D;  4B3M B;  2PI4 A;  4TUY B;  3N27 A;  4KHP B;  3OGC C;  3KCY A;  2DYR B;  1B04 A;  3ZMS A;  3ZMU A;  1KUQ A;  2WA3 A;  3JAS B;  3D36 C;  3E35 A;  1N33 O;  4O4J B;  5EIB D;  3RVY A;  4R6Z A;  3J81 N;  3AG4 C;  1NJI W;  4NVP A;  3CCV V;  2HG5 C;  3OEE G;  5GTH Z;  3HKE B;  1TUE B;  4GUN A;  1VIB A;  3E8H A;  3JAW A;  1GO3 F;  3TXS A;  2F93 B;  4FLW A;  4FM2 A;  4DUY O;  3O9O A;  2JJ2 G;  3FFQ A;  3AG3 C;  3T1H O;  1Q7Y W;  3T4D A;  3TK1 A;  2HP8 A;  1H8E G;  1K33 A;  3L73 H;  1MSW D;  5B1O A;  3BVO A;  1J5E B;  4J42 A;  2H3O A;  4DR5 B;  2F66 C;  4DR1 O;  1GKF A;  1BZK A;  4GLX A;  1FFT B;  3OFN G;  1YVW A;  3OAA G;  3THO A;  2Q0O C;  5EC1 C;  4TSF G;  1VQ6 V;  4I55 A;  4JYC A;  2X0L A;  4OXS A;  1IZ3 A;  3CCR V;  2RDC A;  1VQ7 V;  1IXB A;  2WLL B;  3IJ4 A;  3WG7 C;  4DV1 B;  2Q0A A;  5J2T A;  2GTS A;  1EZJ A;  4WFA V;  3A8T A;  3KTX A;  3CRR A;  3T2M A;  3D8C A;  3K04 A;  2OTJ V;  2W6I G;  5JCO A;  1E1R G;  3BY6 A;  3SYQ A;  5LMN B;  3EVK A;  2R72 A;  2YI8 A;  2ZNI A;  2ZE7 A;  1PPJ H;  1OZ0 A;  4CS4 A;  4LBE C;  2XAG A;  1XMQ O;  4MVZ A;  4X1K B;  1FAF A;  2LQT A;  3FAV A;  1YCI A;  3BPZ A;  5LHH A;  4HBN A;  2G50 A;  3CCJ V;  4JYY A;  1YSC A;  5LA6 A;  3LSQ A;  4ZHQ B;  2YIA A;  1GH6 A;  3H1H H;  3WB1 A;  2PYL A;  2QSA A;  4DRX B;  4Z2W A;  2MW2 B;  2UXN A;  3KKY A;  1SZT A;  2L35 A;  1E1Q G;  1XQ8 A;  1TAE A;  1PKX A;  1CPY A;  3QVN A;  3W7T A;  1S5L Z;  3LUT B;  3ME3 A;  2GTA A;  5CBG A;  1VQ4 V;  2Y4T A; 
#chains in the Genus database with same CATH homology
 1K3E A;  4I5S A;  1OCZ B;  3ABK B;  3ZRX A;  2P67 A;  5J9P C;  1VQP V;  3DTU B;  5EK0 A;  5IYC O;  2X6A A;  2X7R B;  1P7B A;  3MD0 A;  3SJQ C;  5KUK A;  2Y69 C;  1R3K C;  3MHS C;  1W0K G;  1K73 W;  4GX5 A;  5LGU A;  3JD3 A;  3B8N A;  3K0G A;  4F4L A;  4QE9 A;  2MK3 A;  4DXW A;  3IGA C;  1R3I C;  4J9Y B;  2DYR C;  4MSW C;  4KP4 A;  2DWE C;  4U7N A;  3CCL V;  3JD0 A;  3R65 A;  4FK5 C;  1V55 B;  3AG2 B;  2BOC C;  1VQ8 V;  1YIT V;  4J9Z B;  1JQ0 A;  4P2Z A;  4RQF A;  3G71 V;  3NXS A;  4GX0 A;  3K0D A;  2HFE C;  2YSU B;  2XAH A;  4FJC C;  3AAG A;  1ZWI C;  1DF4 A;  1R6K A;  1QR9 A;  5LGT A;  1V54 B;  3LNM B;  1K4C C;  4MVU A;  2DQ0 A;  4G28 B;  4JF3 A;  4XDJ A;  3VBB A;  4CBC A;  1YIJ V;  1WLE A;  2JIZ G;  5CMU A;  3SYC A;  1AJQ A;  3P30 A;  1QLN A;  4X89 A;  2P7T C;  4TT3 G;  1V55 C;  3AG2 C;  1VQM V;  1H38 A;  2EJR A;  3W7X A;  4FPP A;  1Y4M A;  4I9W A;  2A79 B;  2JDI G;  1YJN V;  2PI5 A;  1EFR G;  4LC1 A;  3AEI A;  1B6Q A;  3UM7 A;  3ZMT A;  3K3W A;  1K5S A;  3CCU V;  2OCC B;  3QNE A;  2W0F C;  2Z3Y A;  1JJ2 U;  5LHG A;  4JPR A;  4QIW F;  3SPI A;  1N8R W;  2EZO A;  2B1G A;  1V54 C;  1PD3 A;  5C93 A;  1QVF U;  5IYD O;  2F43 G;  2WSS G;  2IJJ A;  5KUM A;  4X88 A;  2LP7 A;  3K79 A;  2ZR2 A;  3G4S V;  1K97 A;  4JAU A;  2QE7 G;  2A0L A;  3ZMZ A;  3X2Q B;  1AI4 A;  3JD4 A;  4BIU A;  1HWY A;  1SES A;  2ITC C;  2DYS C;  1R3L C;  5L3E A;  1JX9 A;  1G4Y B;  2GHY A;  2P90 A;  3ML0 A;  4EKW A;  4YXW G;  1VQ5 V;  1R6N A;  1S0V A;  4P9O A;  3TCU A;  1QLE B;  3SPG A;  4GX2 A;  5IDJ A;  4GX1 A;  2YEV B;  2HJF C;  1KC8 W;  3E83 A;  3DGE A;  4WFE A;  2IH3 C;  1SER A;  3ZRS A;  2Q6A A;  4PDV A;  1Q81 W;  2QEX V;  1S77 D;  3LDC A;  4HAM A;  3P32 A;  1KKD A;  3E8G A;  1L1F A;  1AJP A;  3ZMV A;  3SYO A;  2ZXW C;  2Q68 A;  3ZCC A;  4G27 B;  1NVP B;  4JTD B;  3CCE V;  1M90 W;  3CC7 V;  2EIJ C;  4MTG A;  5LHI A;  1YTF B;  4HYO A;  3E8F A;  1NH2 D;  2V1D A;  2UXX A;  4WFF A;  2WLH A;  4L87 A;  4QNH B;  3G6E V;  1NR7 A;  1JOY A;  2HVK C;  4KUM A;  4PDR A;  2AHZ A;  3ZJZ A;  3AG4 B;  2EIL B;  2V7Q G;  1AI5 A;  3ZRW B;  2XAQ A;  4X8A A;  4PA6 A;  1RPR A;  1Q86 W;  1FXK B;  2DWD C;  2CK3 G;  1FXV A;  1NKD A;  2EIN C;  2DQ3 A;  1SET A;  1YI2 V;  1NBM G;  4BAY A;  4PDL A;  3EFF K;  1OCR C;  1CEZ A;  2ITD C;  3ASN B;  5CA3 A;  1VQL V;  1QR8 A;  5B1N A;  4QPJ A;  2HVJ C;  3QO7 A;  1PNL A;  2AHY A;  3LDE A;  1K8A W;  3AG3 B;  2IJK A;  1H2G A;  4QPK A;  5B3S C;  3E2E A;  2YEV A;  4UVB A;  4RO2 A;  4XDL A;  2JEU A;  2Y48 A;  1ROP A;  4MTO A;  1QVG U;  1OCZ C;  3ABK C;  4LP8 A;  4XBF A;  4PEL A;  5EBW C;  3SPJ A;  3TET A;  4JTA B;  1AR1 B;  2XAJ A;  2XND G;  3OMN B;  3FYI B;  2IJH A;  3WFV A;  1GTO A;  2LFR A;  1AI6 A;  3W7S A;  3CYO A;  4MW8 A;  1K92 A;  3LDD A;  1M56 B;  3B77 A;  3OMA B;  4LCU C;  1DLB A;  4R8C A;  2XAF A;  3E89 A;  3JD2 A;  3PJS K;  1QCE A;  5L3B A;  3CPW U;  1W0J G;  3GB7 C;  3K08 A;  5B1A B;  3HPL C;  3CC4 V;  2GSM B;  1K5Q A;  3D36 A;  1Y66 A;  1OCC B;  2H8P C;  5DN6 G;  2R9I A;  1IXM A;  2ATK C;  3AG1 B;  3WG7 B;  2EZP A;  2IH1 C;  4MVQ A;  1JVM A;  3I56 V;  4MTX A;  2WLJ A;  1BMF G;  1VQN V;  3ABT A;  1FXK A;  4P30 A;  2JJ1 G;  2B1I A;  1Q82 W;  3VOU A;  3E86 A;  3KG2 A;  4QJF B;  3CCM V;  2LFS A;  1YHQ V;  1PL0 A;  2W6J G;  1E79 G;  3D3I A;  3ZN0 A;  2EBO A;  1PNM A;  4U7O A;  5KA6 A;  4KFM A;  5IY5 B;  2XOK G;  3ASO B;  2QM8 A;  3CMA V;  2OT5 A;  1S72 V;  1ARO P;  5HFL A;  3CME V;  3MHH C;  3FB8 C;  5H6Q A;  3OM3 B;  3E8B A;  4Q20 A;  3JYC A;  1VQ9 V;  2EIK B;  3CC2 V;  4UV8 A;  2P6J A;  1GK9 A;  2WLI B;  3F7Y C;  1KQS U;  3B8M A;  3ETE A;  3QO5 A;  3RVZ A;  1P4R A;  1BHA A;  4DO2 A;  3STL C;  4E2L A;  2WAM A;  2QA4 V;  3OE7 G;  2X6B A;  4P9P A;  2OCC C;  1OCO B;  3RBZ A;  4BW5 A;  1RM1 B;  2EIM B;  3ZRV A;  1K4D C;  5IY5 C;  2ZR3 A;  2IW5 A;  3OUS A;  3K03 A;  5LBQ A;  2WLM A;  2Q69 A;  2ZD9 A;  3OEH G;  5DM6 V;  4RUF A;  3SPC A;  1GM9 A;  1UJW B;  1EBO A;  2Z5U A;  4N21 A;  1R73 A;  1LNQ A;  1QBZ A;  2A9H A;  3X2Q C;  1H8H G;  1MOF A;  1YTF D;  1K34 A;  2NLJ C;  4UUJ C;  1S3J A;  2WWW A;  1JPX A;  4H37 A;  4JAS A;  2JEX A;  5IYB O;  3FB7 C;  1QLE C;  2X6C A;  1S5H C;  4WF9 V;  2NNU A;  4RAI A;  4XDK A;  1J95 A;  1I5Y A;  3ABU A;  3JCZ A;  1RM1 C;  1JCH A;  2EIM C;  1DTO A;  4WCE V;  5BZB A;  5H9C A;  2IJI A;  5L3F A;  2ZDI A;  3K06 A;  3BEH A;  5H6R A;  4R7C A;  2Y69 B;  4N23 A;  5FL7 G;  2R9R B;  4G2K A;  1XL6 A;  4PDM A;  2QKS A;  1COW G;  5EC2 C;  3ABM B;  2IU0 A;  1NR1 A;  1S76 D;  3M99 B;  2PI4 A;  1NH2 B;  1ENV A;  3OGC C;  2H94 A;  2HKO A;  2B5U A;  3OMI B;  4MTF A;  1OHH G;  2DYR B;  2WLI A;  2OTL V;  1MG1 A;  4PA3 A;  1G8M A;  4JTC B;  3ZMS A;  3ZMU A;  1NQT A;  3E35 A;  1M9N A;  4ZBM A;  4UV9 A;  3RVY A;  3H01 A;  3JD1 A;  4R6Z A;  1KP3 A;  3AG4 C;  2EIL C;  4BIZ A;  1NJI W;  4JGS A;  3CCV V;  1I5X A;  2HG5 C;  1F4N A;  3OEE G;  1FXK C;  4H33 A;  1TUE B;  3F5W C;  4JAV A;  2Q67 A;  1CP9 A;  2JK5 C;  3CXC U;  3E8H A;  3QO8 A;  4WFH A;  1GO3 F;  3ABM C;  5EBL C;  4RQE A;  4JYB A;  3ZN1 A;  5EBM C;  3FB6 C;  3ASN C;  4PA4 A;  4UVA A;  4R50 A;  1KD1 W;  4MVS A;  1RPO A;  3CCS V;  1K7D A;  2JJ2 G;  4MW3 A;  5E1A C;  3I55 V;  3SYA A;  3AG3 C;  3CCQ V;  1BL8 A;  4MS2 A;  3T4Z A;  1VQK V;  1Q7Y W;  3T4D A;  3TK1 A;  2WLN A;  1H8E G;  3RW0 A;  2HLD G;  1K33 A;  3T1C A;  2XAS A;  4FMT A;  3ZIA G;  1MSW D;  4WFB V;  3ZRW A;  5B1O A;  1GM8 A;  1M57 B;  4MT8 A;  1GKF A;  3STZ C;  3K9A A;  1WPX A;  1M56 C;  1FFT B;  3OFN G;  1F23 A;  3OAA G;  2HR3 A;  4TSF G;  5EC1 C;  4CZZ A;  3CD6 V;  1VQ6 V;  4JYC A;  2X0L A;  5B1A C;  4OXS A;  3CCR V;  1YJ9 V;  2WLK A;  4TWK A;  1VQ7 V;  4FIP C;  5GW7 A;  1F51 A;  1OCC C;  1R3J C;  2DYS B;  2WLL B;  3W7U A;  3AG1 C;  3WG7 C;  4MVM A;  4QE7 A;  4PA7 A;  4GT1 A;  3SYP A;  1ORQ C;  3CP1 A;  1M57 C;  1W2B U;  3W7W A;  1KP2 A;  2QTO A;  1EZJ A;  4WFA V;  4GCZ A;  2BOB C;  1FS0 G;  4ASU G;  2K1E A;  4PA9 A;  3FYE B;  4UVC A;  1MAB G;  3T2M A;  5CBH A;  1YJW V;  1BHB A;  3ETD A;  3F7V C;  1SRY A;  2ZXW B;  3ASO C;  3K04 A;  2ZDI C;  1AI7 A;  3GWO A;  2OTJ V;  2D3O W;  2W6I G;  4Z1M G;  1E1R G;  3ABL B;  4MVO A;  3BY6 A;  3SYQ A;  5KA5 A;  5B1B B;  2EIJ B;  2M7W A;  5CBF A;  1NVP D;  1F4M A;  1OZ0 A;  4WFG A;  2EIK C;  4LBE C;  2XAG A;  2C2A A;  5CN0 A;  5L3D A;  1KEC A;  3FKS G;  2QM7 A;  3OR7 C;  2FTK A;  3OR6 C;  4MVZ A;  1DF5 A;  2ZQM A;  5LHH A;  1K9M W;  1PNK A;  3OUF A;  1GM7 A;  1OCO C;  3CCJ V;  5LGN A;  1YSC A;  2DW4 A;  3LSQ A;  1THZ A;  2EIN B;  3A0R A;  1XL4 A;  4MVR A;  3FB5 C;  3ABL C;  5HFM A;  5L3C A;  5B1B C;  1M1K W;  3UKM A;  2UXN A;  1VQO V;  1OCR B;  1SZT A;  2WPD G;  1AJN A;  4HZ3 A;  3OW2 U;  2WLL A;  3HB3 B;  1E1Q G;  2KB1 A;  3EHB B;  2IU3 A;  3ETG A;  3IC7 A;  1PKX A;  1CPY A;  3W7T A;  3LSS A;  4ZKI A;  3LUT B;  4UXN A;  3SPH A;  1GMG A;  5B3S B;  1FXH A;  5CBG A;  1VQ4 V;  4RUE A;  3IFX A;  5L3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...