1FS0G

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
219
Chain Sequence
KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 81
structure length 219
sequence length 230
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fs0G02
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 1fs0G01
5L3DA 1W0KG 2UXXA 3OE7G 4UV9A 2Z3YA 5LHIA 3ZMUA 1W0JG 1BMFG 2JJ2G 5LHGA 1OHHG 1E1RG 3ZMSA 5LHHA 2UXNA 3OFNG 2EJRA 2HLDG 2R9IA 2XOKG 1MABG 3ZMTA 5L3GA 5LBQA 4UV8A 5L3CA 3ZMZA 2IW5A 2WPDG 4UVAA 5L3FA 2HKOA 3OEHG 4UVBA 2XAHA 2JJ1G 4YXWG 2XASA 2XAFA 5L3BA 5DN6G 2QE7G 3ZMVA 2V7QG 3ABTA 2JDIG 3ZN1A 2W6IG 4XBFA 4UVCA 4Z1MG 2XAGA 4ASUG 3FKSG 4TT3G 2XAQA 2CK3G 5FL7G 5H6QA 5LGUA 1E79G 2Z5UA 4TSFG 4UXNA 3OAAG 2XAJA 1EFRG 3ZN0A 1E1QG 3ABUA 2DW4A 1NBMG 3OEEG 2V1DA 5LGNA 1H8EG 2JIZG 2F43G 1FS0G 2H94A 2WSSG 1COWG 2X0LA 2W6JG 2Y48A 3ZIAG 5LGTA 4BAYA 5L3EA 1H8HG 2XNDG 4CZZA 4KUMA 5H6RA
chains in the Genus database with same CATH superfamily
1P84F 4I4TA 5L3DA 4DV5B 3OE7G 3HKBA 2UUBO 2B9ZA 3CJHB 1DTOA 2EINC 2Z3YA 5EYPA 4QGCA 4WFEA 4LFBO 3ZHTA 4O2AA 1YJ9V 2IU0A 1I94B 3P3PA 4F6EA 3U2ZA 4DR1O 1I5YA 2WAMA 4TV8B 4HYWA 4B3TO 1YXBA 1K34A 4H33A 5IT9N 1Q6IA 2ZE7A 2ADPA 4DV3B 1PPJH 2JVDA 4YJ3B 4DR2O 1IXMA 1R6KA 1YSCA 2XT9A 1YITV 3B8NA 4JZ2A 2AZ0A 4X1YA 1GN3A 3ZX6A 4DR7O 3JAWB 4PJ0Z 3RW0A 1G1XB 1N34B 1NKDA 1WA8A 4QE7A 3JASA 5CB4B 1VF5B 1Q81W 2XASA 1K4DC 1CP9A 3ASOB 4DUYB 3JAKA 4O4LA 2V7QG 2ZDIA 2A79B 5IYDO 3UM7A 1HWYA 3K5OA 3UQ8A 4MT8A 4TT3G 1KMIZ 5LMUO 4JI3B 4X65O 3UCSC 2YEVA 2E75B 1P7BA 2BTOA 3ZN0A 4UCSA 4I9WA 4WFBV 1H8EG 3T4DA 2QSAA 3F5TA 2YS8A 1VQ4V 3HR0A 4N23A 2EIKC 4DXWA 2IJJA 1F3WA 5DECA 1H2LA 4O4JB 2RCVA 4GKKO 3PP7A 2UUCO 1U97A 3FB7C 3EXAA 4O4HA 3K08A 4LWSA 4CH6A 1ZUQA 5JH7B 1W59A 4UCTA 2EINB 1S77D 5FPOA 4QG8A 2C2AA 1XL4A 2UU9O 2UXXA 3HB3B 3J7AU 1MSDA 4DV1B 1IBMB 4LF5B 1PD3A 2NNUA 2E5LO 3OMIB 3SYAA 4EFEA 4NXNB 3JSLA 4KRZA 3L72H 1ENVA 1FFXB 1S72V 1KB9F 4FM0A 3QV8A 1FFTB 1KD1W 4X62B 2HFEC 4DK1A 5L3CA 3K57A 2OYQA 1VIBA 2LGQA 4J11A 2JJ1G 5LMNB 1Q90D 2E74B 3CS5A 4L8JA 4UCUA 4JGSA 4J41A 1GN6A 3NR7A 4D6TH 2KB1A 1EN6A 2ZIMA 1EZVH 1QHTA 2LW1A 1R1BA 1M57C 2OCCC 3JARB 2ZXWB 3ZRWB 2XAGA 3RGBA 2Y4UA 5KX5A 3HQOA 2LFRA 1HNWO 5IYCO 4HYVA 4JAVA 1MOFA 1FJGO 4JI6O 1FXKC 2DW4A 1RSOB 3G67A 4J10A 1VQ6V 2ZM6B 4JZGA 2ZINA 2ZIOA 1OCZC 3WFVA 1Q86W 2Q68A 1R73A 1Y6XA 2UXBO 4W4KA 2QTSA 1M4UA 3FB5C 1K8AW 4KL1A 2EIJC 5LOVA 3GVMA 2E76B 3RYIA 5KA5A 4KS0A 3CX5F 4B3RB 1XNRB 1BQZA 1YJWV 3BA9A 2P5OA 2P06A 1H2MA 4BIZA 2AHYA 3CXCU 1T57A 5H6RA 1O9HA 1QU7A 4LH6A 5KHJA 3SR2C 2JS5A 2WLKA 2KSDA 3JYCA 1G4YB 3W7TA 4U7OA 1BMFG 3CRRA 2DOSA 4LFAB 4ZI7A 2UXCB 3RYFA 1QVFU 4MVOA 2Y4TA 3ZMTA 5LBQA 4WBNA 4AI8A 1RFYA 2UXDO 3CCLV 5CBHA 3JD1A 3PN1A 3H6OA 4EFBA 4GUNA 1ZSPA 4J9YB 2IBZH 4FFKA 4RQFA 5KUKA 1YZBA 1SQPH 2R9RB 3CRAA 3WB2A 2ADQB 3MA8A 1M57B 2PYJA 3ZMVA 1PNKA 4QG9A 1PKXA 5KAIZ 5TISZ 1V55C 3BA8A 2QGNA 3CWBH 1ORQC 5F2VO 1DF4A 4B08A 5H6QA 2PI4A 5A9GA 1VQMV 4DV2O 3ZHSA 3N27A 4XDLA 3BPZA 5LL6Y 5CA1B 3H1JH 4DV6B 1A5UA 1OCZB 3K5LA 2GSMB 3JATA 3H1LH 3VQWA 5CA0B 4NR1A 4LH7A 3M7MX 1TA8A 2Q0AA 3AK1A 2L35A 4DRSA 3JD2A 1IBKO 3DC6A 1KKDA 1MG1A 2EIJB 1UJWB 1NQTA 4I55B 2Z0AA 3HKDB 1QR9A 4DR5O 2YDEA 5B3SC 3T1YB 2UUAB 1F3XA 3ETDA 1LNQA 3DXRA 4X1IA 4TUYB 1VARA 5L3EA 2BOBC 1OCCC 1K5SA 2EULA 4DV4O 2QWOB 1E0TA 2B5UA 1IVSA 3DC5A 2QKCA 4BW9A 1PNLA 1ZL8B 1FAFA 3OTOO 2QWQB 3ZMSA 2Y69C 1Q43A 2EILC 5LXTB 3NXSA 4H13B 2GUZA 1AJNA 1R3IC 4FLWA 4IGGA 4X20A 3M8AA 4NYKA 2Q9LA 4I7ZB 3OGCC 5KMGA 4LF6B 4BWAA 1JA8A 4X88A 4DV0B 4BIOA 3CMEV 1Z5VA 2JEXA 1V55B 3ABTA 2EZPA 3OTFA 2W6IG 3OW2U 5BMVA 1TVKA 4JI8B 1ZLZA 2WLIB 2OT5A 4J80A 4ZOLA 4JI7B 3QVNA 3ABMC 5LP6B 3VQVA 1F51A 3CD6V 4EEQA 1SC5B 2ZDIC 4JV5O 5ITZA 4DRXB 3CC7V 3H9VA 2AXTZ 4UFZA 1Q8IA 1WP7A 3IFXA 1PP9H 3TETA 4YHHO 1K7DA 3K58A 2AHZA 5EK0A 1E0UA 1XOUA 3ZIAG 2FYUH 2Q69A 3ABLB 2L6LA 1OCCB 2NN4A 4LF8B 3DSQA 5C93A 1H38A 1KECA 3JD0A 2V4DA 3SJBC 2DYSC 1EN5A 1XBLA 4K8XA 5KHIA 3AAGA 1VQ5V 1D5NA 3LUTB 4QNHB 3STZC 4KFMA 4I9QA 1GAXA 4ZHQB 1K5QA 4YY3B 2QM8A 4X8AA 3LNMB 1SKVA 2ZR3A 2WLMA 2FTKA 3RVYA 4I4TB 3HKBB 4YJ2B 2R9IA 5EYPB 3HQPA 4I0XA 4GX2A 3T1HO 3RT3C 5LA6B 1OJHA 3CCVV 4UVAA 5L3FA 1HR0O 2PGGA 3H1HH 4L87A 4DV5O 4DR3B 2LQTA 4P2ZA 3B2EE 2XTAA 2VGIA 1I94O 1GO3F 2XAFA 3D36A 5L3BA 2HP8A 4JI2B 1RPRA 5E1AC 1GN4A 3ZN1A 2F93B 1HNXB 2ZD9A 5FNVA 4HBNA 2DQ3A 2Q0OC 2WA3A 1HNZB 4D7SA 3A0HZ 3OM3B 3JAKB 4QIWF 3OAAG 4X1KA 4JYCA 2BTQA 1ZTEA 1JJOA 2QDOA 5B1OA 4U7NA 2GV9A 2HVJC 3CCUV 2XHBA 3MAQA 1I08A 1N34O 3ME3A 1GMGA 3QF7A 1XILA 4PDRA 1SERA 1H2GA 4GZRB 1VQPV 4H0LB 2PY5A 2Q67A 4MVUA 2ODMA 3N2KA 4DUYO 1SQBH 1AR4A 5D5PA 2QM4A 3ZBHA 1XNQO 3ZS8C 1Y4MA 4PDLA 3KZIZ 4PHZA 4JI1O 4FXFA 4JI3O 3HPLC 2ZR2A 3THOA 3APQA 1WAZA 1RM1B 4O4IA 2HHHB 1JX9A 2EIMB 2ZE5A 4FZ1A 3ML0A 3F7YC 2JK5C 3UKMA 1QQCA 4MVQA 1FYJA 1YDXA 3PJSK 4IIJB 3CCMV 3SPHA 4O4HB 5AG2A 3ZHUA 5FLXN 1W2BU 4NVPA 4P30A 4MS2A 5CBFA 2NR5A 2XOKG 1NR7A 3CC2V 1MABG 1SZTA 3LDDA 2N74A 3T05A 4KCUA 2DJVA 5EZYB 1BQ0A 4YIOA 3J81N 5A2QN 3H01A 1F4NA 3U0ZA 5KA6A 1AJPA 3LSUA 3GB7C 3OUFA 4JYBA 1IZ3A 4FLUA 2CUGA 5JVDB 4DV1O 3AG1B 1IBMO 4LF5O 3L70H 3WU2Z 5C8YB 3U11A 4PDVA 4NXNO 1QLEC 4R8CA 2Q73A 4CS3A 4BW5A 5CA3A 4LNUB 2CE4A 3E22A 2FMLA 4EB6A 4X62O 1XL6A 5LYJB 2Z5UA 4PA3A 5BR8B 5IJ0B 1EFRG 5E79Z 4ZIBA 4GT1A 1NBMG 3DTUB 1VQ7V 2D2CB 5LMNO 3SYCA 1BCCH 3A0RA 2YUAA 1XI1A 5HFMA 1K4CC 1J5EB 4K35A 1BT8A 1B04A 5B1BC 1OCRC 4X66B 4O2BB 3JCUZ 1PKNA 1ZX3A 2ZT9B 4JI5O 3GWOA 1HW7A 2XNDG 3TK1A 1J95A 4KUMA 5B1NA 5B66Z 3K79A 5LOVB 2ZM6O 1CEZA 3IC9A 4XDKA 3IS4A 3ETQA 3SRHA 1ZAUA 1OCOC 1OHHG 3H1KH 2UXNA 3JALA 3HKCA 2DWDC 1VQ9V 4QJFB 3OFNG 3JSNA 1JQ0A 3MHSC 2NLJC 4B3RO 1XNRO 4FLXA 2VRZA 4AQYB 3ZJZA 2RDCA 3EHBB 1YHQV 3SRDA 4ZI7B 1GRJA 3RYFB 1EN4A 4UVBA 2YSUB 4FK5C 1A32A 3ETEA 3BJFA 3WG7C 4WBNB 3IAYA 3N2GA 5DN6G 4DW0A 2KG7B 3O9OA 5H2FZ 2IU3A 4LFAO 4NTWA 2UXCO 1AR1B 4DR1B 4B7KA 1U96A 1XHXA 2VGGA 5LGUA 4WF9V 3ZRSA 4ABMA 3I56V 4NTXA 1YF2A 4JTAB 4J7JA 4DR2B 4KP4A 3T2MA 1NH2D 1PV0A 3HKEA 1F7YA 1NTMH 3I55V 1XMQB 5JJJB 1QVGU 1X59A 1WNSA 4TV8A 2A3QA 4LBEC 3VQYA 1K97A 5LGNA 1BHBA 1MA1A 4MVSA 5B1BB 4C7UA 4P9OA 4YJ3A 1OCRB 3B8MA 4HZ3A 1KQSU 2YICA 1WJZA 5IWAB 2QR4A 4I5SA 2RN9A 4JI0O 2CH7A 3F7VC 1UPGA 1GM8A 2QEXV 3IGAC 4IP7A 2G50A 3MDSA 3AG7A 4MTOA 3SPCA 4DV6O 1VP8A 3SPIA 2H3OA 1M56C 1W0KG 4UV9A 4QG6A 2JGUA 4XDJA 1OCOB 2EIKB 4DR4B 4KCTA 1SZXA 4KCWA 2E3CA 4X1IB 1PKMA 4KCVA 2DQ0A 4MVRA 4GKJB 3U10A 1S3JA 4U3JA 3BJTA 3A0BZ 4FVMA 2VGFA 2EJRA 2PYLA 3E83A 4ZBMA 1AQFA 3ICXA 1V9PA 1F23A 2P90A 3T1YO 3K9AA 2UUAO 2FL4A 2AGAA 2G38A 1PNMA 1WB8A 3WG7B 4U3FH 2XAHA 3LDEA 1URFA 1XMOB 1HDJA 2IH1C 2YIBD 3OMAB 3FAVA 1R3LC 2LFSA 4O4JA 4PI2A 1BL8A 4LF9B 4X20B 2HEPA 5KHHA 4YIPA 4B3SB 1Y74B 3SYQA 4NTYA 1VQKV 5JJEB 3RFRA 5FL7G 3RYCA 1SA0A 3AK3A 2A7WA 5J2UB 4JF3A 5J2TB 3D36C 4FXJA 4I50A 1TGOA 5BMVB 1TVKB 4LF6O 5JWPA 2K1EA 2OTLV 2ZQMA 3CRQA 1GK9A 1H2KA 2QTOA 2OCCB 3GWKC 4DV0O 3AG2C 5BZBA 1NH2B 4ZKIA 4OX9B 1MZEA 3CSXA 1MSWD 4FFBA 1FFXA 1NT2B 3STLC 5EC1C 1M93A 4GCZA 2R72A 4BIUA 2VQFB 1FS0G 2RJZA 3E2EA 3CRMA 2X7RB 5ITZB 4JI8O 1FXKB 2F1MA 2F66C 1V54C 2IH3C 4DO2A 3CHXA 4TWKA 4JI7O 4A5UB 1BE3H 1GM7A 1M56B 4DR6B 4J7KA 1RP3B 1S5LZ 5JQGA 5KHKA 1OZ0A 4MTFA 3ZEDA 1VQLV 3W7XA 3CCSV 4PELA 4DW1A 4LCUC 3TXSA 3ABKC 1NR1A 1Y76A 1THZA 3O65A 2QWPB 1IDSA 1BGYH 2RNBA 1RSOA 3QV7A 3GG8A 1QNMA 1JJ2U 4LF8O 4KXRA 1O9GA 5K1XA 1A49A 3LSQA 3SJAC 3CCRV 4HAMA 4K8ZA 4I0XB 1OV9A 1CPYA 1VP7A 5IY5C 2HR3A 3P32A 3CCEV 2BSKA 4YY3O 1NS1A 1F4MA 4W4LA 4G2KA 4LF4B 2XAQA 2M6YA 4LF7B 3G71V 2QWNB 3B09A 3ETGA 3GR4A 1N36B 5FNVB 1KBHA 4X64O 1GH6A 3AG2B 4DR3O 1R3KC 4K3AA 2EJ7A 3S3WA 3KTXA 3OR6C 3S3XA 3JCZA 1XEQA 2DE0X 2YXLA 1H2SB 1IBLB 4JASA 1AVMA 2HJDA 4JI2O 4JAAA 1FD9A 3D3IA 1HNXO 2P4KA 1DK1A 3MHHC 4Z1VA 3P3NA 1V54B 2YIDA 3FB6C 1HNZO 4B2DA 1FPOA 4E2LA 3N2KB 3QTCA 5IYZB 2CTQA 4GX1A 5BY1A 4QPJA 4Z2WA 1N0NA 4DUZO 4RPPA 3T4ZA 1B6QA 4LP8A 5LHIA 3Q4HA 4RAIA 1JOYA 4O4IB 4JPRA 5B3SB 3LNNA 1JFFB 3B4SA 5LHHA 1TUBB 1Q7YW 2HLDG 3SYPA 3FFQA 5EBMC 5J9PC 2BE3A 1WP8A 2HHHO 2X6CA 3X2QC 1WPBA 5CA0A 2HKOA 2WLLA 2Y69B 5KLVH 2EILB 1PL0A 5IY5B 1B3QA 1AILA 4I55A 1P4RA 1AROP 4DV4B 4B3MB 3QNEA 2Y0PA 4IHJA 4O2AB 4FLZA 5JJNB 1UFIA 2DN9A 2YXHA 3MD0A 3QV6A 3OT7A 1QLNA 2LGWA 4JYAB 4LFCB 3ABUA 1ZL8A 3AG3C 2JGDA 2R70A 3W7UA 2VWJA 4Q6GA 1Y67A 3E22B 3G4SV 1N33B 3GQYA 3ASNC 4X1YB 1S5JA 5IJ9A 4GLXA 1VF7A 3RYHA 2F4VB 1JVMA 2JS3A 3BVOA 4WFAV 3BAAA 1WA8B 3JASB 4N21A 1VQ8V 3QO8A 4DV3O 3B77A 2F95B 2H94A 2WLJA 3ABMB 4G28B 3F5WC 4O4LB 2QKSA 3LDCA 3K5MA 3BRCA 1N32B 2CTWA 3SJCC 5BR8O 4NXMB 4JAUA 4EKWA 4BAYA 1SETA 2YEVB 4MW3A 1K73W 1CXZB 4KHPB 3K59A 3RVZA 4UCRA 1SS3A 1KYOF 1J5EO 4IMAA 2WLIA 1AP6A 3E0WA 3BABA 1SRYA 4X66O 5L3GA 5EBWC 4DV7B 2DYSB 4JPGA 4DRXA 1IURA 2FKXA 2ILMA 1Z2GA 3CEIA 3JALB 2WPDG 1GKFA 3FYIB 1XHZA 4PA9A 3RWRD 1A3WA 4F6RA 2ZE6A 3AG4C 4YXWG 1T5AA 4LWSB 1PKYA 4PV1B 2CTRA 2IJHA 4XBFA 2BCCH 4JI4B 4MW8A 3N2GB 1QR8A 1YEWA 1XUQA 2WLNA 3ZCCA 4AQYO 5EIBC 1VMGA 2H8PC 4HNAA 4IYHA 4X9QA 1G8MA 1AJQA 2VQEB 2JEUA 4ZHQA 3HQNA 1TAEA 3SPJA 1M1KW 3CCQV 2VS0A 3ZHRA 3RBZA 1M90W 2F43G 4YJ2A 1VF6A 1AP5A 4QPKA 4NB5A 3HKEB 3E8GA 1Y66A 4JTDB 5LA6A 3QTGA 3B40A 1MMMA 3AEIA 2B1GA 2ZNIA 3D3QA 3UT5A 1NJIW 3TCUA 5KX5B 4FLTA 5LGTA 1H8HG 2FB5A 3I5DA 2ZKOA 2YI8A 4G1NA 1XMQO 3CE2A 2AW9A 2CH7B 3CPWU 4MTXA 3M99B 4TV9A 4UB6Z 2ZCEA 3K0GA 3IJ4A 1LUWA 3QO7A 1JCHA 2A9HA 1FXVA 4GYCB 5IWAO 1XNQB 1VQOV 2HJFC 4NKGB 5K1PA 1A3XA 4K0KB 1LR1A 1VEWA 4ICGA 4JI1B 3RYIB 2ZXWC 3ZMZA 2JRIA 4U3JB 3AG4B 4DYLA 1SQGA 4DR4O 1M5IA 3E86A 2KQXA 1EBOA 2ZE8A 1I0HA 2P7TC 3G80A 4CS4A 2QE7G 4FM2A 2JDIG 2W0XA 4GKJO 2DYRC 2IJKA 3E8BA 2R9AA 1D2DA 4Z1MG 1L0LH 2OIEA 4ASUG 1ROPA 1S0VA 2CK3G 2WA4A 4YJ5A 1IX9A 3FAVB 1JPXA 5D5QA 1R3JC 3H1IH 4IIJA 1R6TA 5B5EZ 3CMAV 3SYOA 2MK3A 1XDCA 5GONA 1PM9A 4MVMA 2V1DA 2UUBB 4FIPC 1AI6A 3A8TA 1XMOO 1QLEB 3RYCB 1BHAA 1SA0B 4LFBB 3BHPA 4LF9O 2CDYA 4B3SO 4I50B 2P67A 4FZ0A 4B3TB 1K33A 4LR3A 1AI5A 3OD4A 5EZYA 4YNGA 5DEDA 2A0LA 5IE9A 2PTMA 3CJHA 2PF4E 2X0LA 3KG2A 2WLHA 4FFBB 5KUMA 3CCJV 1Q6HA 2HVKC 2EX3A 5JVDA 4CBCA 4DR7B 4B2DD 5C8YA 2Q5ZA 1M9NA 2CGOA 3FB8C 3L75H 4TOIA 4OX9O 3N25A 2DMXA 4OGQB 4LNUA 3KCYA 3JATB 3AK2A 2VQFO 4J42A 2GHYA 5JQGB 1TUEB 3APOA 5LYJA 1QBZA 3JAWA 3G6BA 5IJ0A 4RQEA 1KKCA 2IM9A 5LMUB 3L71H 5CB4A 3SJQC 4X65B 1L0NH 1BSMA 1ZJHA 1Q5OA 2PUSA 4IYIA 3W7SA 3RN4A 1XQ8A 1YTFD 1Y76B 4DR6O 2ITCC 1SF9A 3OEHG 2VGBA 1SQQH 5CBGA 3JD4A 3DXRB 3K06A 1SESA 1MZFA 4JI5B 2MW2B 1KP3A 3DGEA 5CMUA 3CXHF 1YCIA 1JR9A 2DYRB 4O2BA 4FLVA 4UVCA 2ARHA 5JCOA 3FKSG 3D8CA 4GKKB 1SQVH 2UUCB 3BCCH 2Q7HA 2N04A 1E79G 3ZRXA 5B1AC 4TSFG 3FYEB 2HG5C 2BSKB 2GUZB 1D5AA 5GTHZ 1N8RW 3E89A 3JAMN 4MTGA 2LJ2A 3OEEG 4F4LA 2UU9B 4IL6Z 2JIZG 1ZWIC 5KMGB 2CTPA 2E5LB 2LP7A 3EVKA 4WFGA 5JH7A 2WSSG 1NI8A 2YXYA 3L74H 4LF4O 4G27B 5FPRA 3OGIB 1KP2A 1Z5WA 4LF7O 1L8DA 1WLEA 3J80N 1MNGA 3TXQA 5IYBO 5IDJA 3CC4V 4PA4A 4CC6A 4FLYA 4FMTA 1N36O 4UB8Z 4JYYA 1LUVA 3K03A 4ZOLB 2KG7A 4FM1A 4PA6A 2Y0IA 1W0JG 1YIJV 5DM6V 2GTSA 2YC0A 3QV9A 2Q7GA 2JJ2G 1IBLO 1K92A 1KUQA 4CS2A 4UCOA 4PA7A 1JMKC 4D7TA 2GTAA 4CC5A 3IC7A 2D3OW 2Q6AA 2YI9A 1KC8W 3Q4HB 1X4TA 3L9DA 1HNWB 3BEHA 4UV8A 3CRCA 3K0DA 3KCXA 5BXZA 1FJGB 3C3TA 1AR5A 4JI0B 4JI6B 2IW5A 5EC2C 2ATKC 3JARA 2EZOA 4X89A 3ZRWA 1YTFB 3FX7A 4CH3A 1KU9A 3SGIA 3QG5A 5LP6C 2Q8VA 4GX5A 1SQFA 3T1CA 3OR7C 4FJCC 2UXBB 1NU1H 2Q7EA 2WLLB 5B1AB 1G6UA 3SDLA 3R66A 1DGSA 4J7ZA 1L1FA 2XAJA 1K3EA 4HYOA 1E1QG 4IHJB 3T0TA 1NZ6A 3CP1A 2OIGA 4TQDA 3E35A 1S76D 4AHCA 3ABLC 1EM1A 4R50A 2A06H 1BS3A 2WWWA 3L73H 1IXBA 2DWEC 2ITDC 4B3MO 2ETNA 2EBOA 1N0JA 2JGDB 1COWG 4Q20A 4E4EA 3JD3A 4OPAA 3K9SA 5IJ9B 1P7GA 1B06A 2XUMA 5EBLC 3RYHB 1NVPD 2UXDB 1Q6UA 3LSSA 4JYAO 1I5XA 1Q82W 4J9ZB 4WFFA 4LFCO 2OTJV 1VF6C 1NTKH 2K9PA 2Q4PA 4CZZA 2RQ6A 3VQXA 2W0FC 4X1KB 1VQNV 3K04A 2BTQB 1N33O 3QO5A 3G6EV 1Y74A 1RPOA 2F4VO 3ZHQA 5LHGA 2B1IA 1DLBA 2QJ1A 5HFLA 5J2UA 2OCHA 5J2TA 3EOEA 3E8FA 3A2FA 5GTIZ 1H2NA 1AI7A 2E28A 3UO2A 1N32O 3SPGA 4DV2B 4NXMO 2GBOA 1NTZH 2ZNJA 1PKLA 3ABKB 3WB0A 3SRKA 1FKAO 2YIAA 4KHPO 3WB1A 1FXKA 4UUJC 1YVWA 3T07A 1P49A 3G2GA 1PL4A 1IBKB 1WN7A 5CA1A 4R7CA 5KAFZ 4F6RB 5GW7A 2LW7A 1GTOA 4R6ZA 4DR5B 3K5NA 4DV7O 1I7FA 3BY6A 1DF5A 4UXNA 4LC1A 2PZSA 2QWRB 2AZ2A 1YJNV 3R65A 1RM1C 3HKDA 4RUFA 2EIMC 2RMKB 3CB2A 2OWOA 1QCEA 3E0VA 3OTOB 5CN0A 3OMNB 4H37A 4TUYA 4HNAB 3TJTA 2IJIA 3CYOA 1WB7A 1K9MW 4JI4O 3KKYA 2KKWA 5KHGA 3KHDA 4QE9A 2W6JG 4AILC 1BZKA 2QA4V 1NVPB 4EB6B 5LXTA 1Q3EA 1SQXH 2VQEO 2N05A 2YIBA 3ZRVA 2X6AA 4WJ8A 3ZMUA 4X64B 2QKAA 4BR6A 4RO2A 3UT5B 4RUEA 1YI2V 4CH4A 1E1RG 4RWUA 2GDSA 4OXSA 3AG1C 2PI5A 4FPPA 2CAZC 1US6A 4TV9B 4DK0A 1N4CA 4IT5A 3VOUA 3E8HA 4JV5B 4WCEV 4UCVA 1R6NA 4DUZB 1GM9A 4GX0A 2P6JA 3OUSA 1S5HC 5LP6A 1GN2A 4H44B 3ASOC 4MVZA 3X2QB 3SRFA 4YHHB 3UO3A 5IYZA 5H5NA 4OPHA 2BOCC 3P30A 4QGPA 2M7WA 3HKCB 4K0KO 4B7EA 1XREA 4JTCB 4WFHA 3C90A 4P9PA 2F23A 2CGNA 1JFFA 2QM7A 1TUBA 3BFRA 5JCOC 1WPXA 1T5EA 1FXHA 1HP8A 3FD9A 4PD4F 5EIBD 3C3SA 3K3WA 3ZHVA 4PI0A 4TQFA 5GONB 3VBBA 2O57A 2P4VA 4MSWC 1AB3A 3AG3B 3EFFK 4PDMA 2X6BA 5H9CA 2LO1A 2VWKA 3W7WA 2P22C 2Y48A 3TGUH 3T1HB 3ASNB 1AI4A 4CH5A 1HR0B 1EZJA
chains in the Genus database with same CATH topology
5L3DA 1OZ0A 3OE7G 4MTFA 1M9NA 1VQLV 3FB8C 3W7XA 3CCSV 4PELA 3AAGA 1DTOA 2EINC 2Z3YA 1VQ5V 4WFEA 3LUTB 1YJ9V 2IU0A 4LCUC 4QNHB 3STZC 4KFMA 1I5YA 1K5QA 2WAMA 3ABKC 1NR1A 2QM8A 4X8AA 3LNMB 2GHYA 1TUEB 2WLMA 2ZR3A 1K34A 1THZA 2FTKA 4H33A 3RVYA 1QBZA 2R9IA 4RQEA 3SJQC 1IXMA 1R6KA 1YSCA 4GX2A 1YITV 3W7SA 3B8NA 1YTFD 1JJ2U 3CCVV 4UVAA 5L3FA 2ITCC 3OEHG 4L87A 3RW0A 5CBGA 1NKDA 3JD4A 3K06A 4QE7A 1SESA 3LSQA 3CCRV 4P2ZA 4HAMA 1KP3A 3DGEA 1Q81W 5CMUA 2XASA 1K4DC 1CP9A 1GO3F 2XAFA 3D36A 5L3BA 1CPYA 2DYRB 3ASOB 5IY5C 2HR3A 3P32A 3CCEV 2V7QG 1RPRA 2ZDIA 5E1AC 2A79B 3ZN1A 5IYDO 2ZD9A 3UM7A 1HWYA 2DQ3A 4UVCA 1F4MA 4G2KA 3FKSG 4MT8A 2XAQA 4TT3G 3OM3B 2YEVA 1E79G 3ZRXA 5B1AC 1P7BA 4QIWF 4TSFG 3FYEB 3OAAG 2HG5C 3G71V 4JYCA 3ZN0A 5B1OA 3E89A 1N8RW 3ETGA 4U7NA 4I9WA 2HVJC 4MTGA 3CCUV 3AG2B 3OEEG 4F4LA 1GMGA 1R3KC 4PDRA 4WFBV 1SERA 1H2GA 3OR6C 1VQPV 1H8EG 2Q67A 2JIZG 4MVUA 3T4DA 3JCZA 1ZWIC 1VQ4V 4N23A 4JASA 2LP7A 4WFGA 3D3IA 2WSSG 2EIKC 4DXWA 1Y4MA 2IJJA 3MHHC 4PDLA 1V54B 4G27B 3FB6C 3HPLC 2ZR2A 1KP2A 3FB7C 1WLEA 4E2LA 1RM1B 5IYBO 1JX9A 5IDJA 2EIMB 3K08A 3CC4V 4PA4A 3ML0A 4FMTA 3F7YC 4GX1A 2JK5C 2EINB 4QPJA 1S77D 2C2AA 3K03A 1XL4A 3UKMA 2UXXA 4MVQA 3PJSK 3CCMV 3HB3B 1B6QA 4LP8A 4PA6A 3T4ZA 5LHIA 4RAIA 1PD3A 2NNUA 1W0JG 3SPHA 1JOYA 4JPRA 1YIJV 5DM6V 2JJ2G 5B3SB 1W2BU 1K92A 3OMIB 5LHHA 4PA7A 3SYAA 4P30A 4MS2A 1Q7YW 5CBFA 1ENVA 1S72V 2HLDG 3IC7A 3SYPA 2Q6AA 2D3OW 5EBMC 2XOKG 1NR7A 1KC8W 5J9PC 1MABG 3CC2V 1SZTA 3LDDA 1FFTB 1KD1W 2HFEC 3BEHA 4UV8A 5L3CA 3K0DA 2X6CA 3X2QC 2IW5A 3H01A 1F4NA 2HKOA 5KA6A 1AJPA 2ATKC 2WLLA 2Y69B 3GB7C 5EC2C 3OUFA 2EILB 1PL0A 2EZOA 4X89A 3ZRWA 1YTFB 2JJ1G 4JYBA 3AG1B 5IY5B 4JGSA 1P4RA 4PDVA 4GX5A 3T1CA 1AROP 2KB1A 3OR7C 4FJCC 3QNEA 1M57C 1QLEC 2OCCC 2WLLB 4R8CA 2ZXWB 3ZRWB 4BW5A 5CA3A 2XAGA 3MD0A 5B1AB 2LFRA 1QLNA 5IYCO 1XL6A 4JAVA 1MOFA 2Z5UA 4PA3A 1L1FA 2XAJA 1K3EA 1EFRG 1FXKC 4HYOA 1E1QG 3ABUA 4GT1A 2DW4A 3AG3C 1VQ6V 1NBMG 3W7UA 3CP1A 3DTUB 1VQ7V 3E35A 3G4SV 1OCZC 1S76D 3WFVA 3SYCA 1Q86W 3ABLC 2Q68A 3ASNC 3A0RA 4R50A 1R73A 1JVMA 2WWWA 5HFMA 1K4CC 4WFAV 2ITDC 2DWEC 4N21A 1VQ8V 3QO8A 3B77A 3FB5C 2H94A 1K8AW 2EBOA 2WLJA 3ABMB 1COWG 4G28B 4Q20A 5B1BC 1OCRC 2EIJC 3F5WC 3JD3A 2QKSA 3LDCA 5KA5A 1YJWV 1NVPD 5EBLC 3LSSA 1I5XA 1Q82W 4JAUA 4J9ZB 4WFFA 4BIZA 4EKWA 2OTJV 2AHYA 3CXCU 4BAYA 3GWOA 2XNDG 3TK1A 1J95A 1SETA 4KUMA 4CZZA 5H6RA 2YEVB 5B1NA 3K79A 1CEZA 4MW3A 1K73W 2W0FC 4XDKA 1VQNV 3K04A 3QO5A 2WLKA 3G6EV 3JYCA 1G4YB 3W7TA 4U7OA 1BMFG 1RPOA 3RVZA 1OCOC 5LHGA 1OHHG 2B1IA 1DLBA 2WLIA 2UXNA 2DWDC 5HFLA 1VQ9V 1QVFU 4QJFB 3OFNG 4MVOA 1SRYA 1JQ0A 3MHSC 5EBWC 3ZMTA 3E8FA 5L3GA 2DYSB 2NLJC 5LBQA 1AI7A 3SPGA 3ZJZA 3CCLV 3EHBB 1YHQV 5CBHA 3JD1A 2WPDG 4J9YB 1GKFA 3FYIB 4UVBA 4PA9A 2YSUB 3ABKB 4RQFA 4FK5C 5KUKA 3ETEA 3AG4C 4YXWG 3WG7C 2R9RB 1FXKA 5DN6G 1M57B 4UUJC 3ZMVA 2IU3A 1PNKA 1PKXA 2IJHA 4XBFA 1V55C 4R7CA 1AR1B 5GW7A 1ORQC 1GTOA 4R6ZA 1DF4A 4MW8A 5H6QA 3BY6A 5LGUA 4WF9V 3ZRSA 1QR8A 2PI4A 1DF5A 4UXNA 2WLNA 4LC1A 3ZCCA 3I56V 1VQMV 4JTAB 4XDLA 2H8PC 4KP4A 3T2MA 1NH2D 1G8MA 1AJQA 1OCZB 3I55V 1YJNV 2JEUA 2GSMB 3R65A 1RM1C 1QVGU 4LBEC 3SPJA 1K97A 4RUFA 5LGNA 2EIMC 3CCQV 1M1KW 3RBZA 1M90W 1QCEA 2F43G 1BHBA 4MVSA 5CN0A 3OMNB 5B1BB 4P9OA 3JD2A 4H37A 4QPKA 1KKDA 1MG1A 1OCRB 3B8MA 2EIJB 1UJWB 1NQTA 4HZ3A 2IJIA 3CYOA 3E8GA 1KQSU 1K9MW 1Y66A 4JTDB 1QR9A 3AEIA 2B1GA 4I5SA 4QE9A 2W6JG 5B3SC 3F7VC 2QEXV 1GM8A 3IGAC 3ETDA 1LNQA 1NJIW 3TCUA 4MTOA 5LGTA 5L3EA 1H8HG 3SPCA 2QA4V 1NVPB 2BOBC 3SPIA 1OCCC 1M56C 1K5SA 1W0KG 4UV9A 3ZRVA 2X6AA 4XDJA 1OCOB 2EIKB 2B5UA 3CPWU 3ZMUA 4MTXA 1PNLA 3M99B 4RO2A 4RUEA 3K0GA 1YI2V 1E1RG 2DQ0A 2Y69C 4MVRA 3ZMSA 3QO7A 2EILC 1JCHA 1S3JA 4OXSA 2A9HA 3AG1C 3NXSA 2EJRA 1FXVA 3E83A 2PI5A 4ZBMA 4FPPA 1VQOV 1F23A 2HJFC 2P90A 3K9AA 1AJNA 1R3IC 1PNMA 2ZXWC 3ZMZA 3AG4B 3OGCC 3VOUA 3E8HA 3WG7B 2XAHA 3LDEA 4X88A 2IH1C 4WCEV 3E86A 3OMAB 3CMEV 1R3LC 2LFSA 1EBOA 1R6NA 2P7TC 2JEXA 1GM9A 1BL8A 2QE7G 1V55B 2P6JA 4GX0A 3OUSA 1S5HC 3ABTA 2JDIG 2DYRC 3ASOC 4MVZA 2EZPA 3SYQA 2W6IG 2IJKA 3E8BA 3OW2U 3X2QB 1VQKV 4Z1MG 4ASUG 1ROPA 2BOCC 3P30A 1S0VA 5FL7G 2CK3G 2M7WA 2OT5A 2WLIB 1JPXA 1R3JC 4JTCB 4JF3A 3ABMC 4WFHA 1F51A 3CMAV 3SYOA 4P9PA 3CD6V 2MK3A 2ZDIC 2OTLV 2K1EA 2ZQMA 3CC7V 4MVMA 2V1DA 1AI6A 1GK9A 4FIPC 2QM7A 2QTOA 1QLEB 2OCCB 1NH2B 3AG2C 5BZBA 1MSWD 4ZKIA 1BHAA 1WPXA 3IFXA 1FXHA 3STLC 5EC1C 4GCZA 4BIUA 3K3WA 1FS0G 3E2EA 2P67A 2X7RB 1K33A 3VBBA 3TETA 1K7DA 1AI5A 1FXKB 4MSWC 2AHZA 5EK0A 3AG3B 3EFFK 2A0LA 4PDMA 2X6BA 5H9CA 2X0LA 3KG2A 3W7WA 2WLHA 5KUMA 1V54C 3CCJV 2Y48A 2IH3C 3ZIAG 4DO2A 4TWKA 2Q69A 2HVKC 3ABLB 3ASNB 1AI4A 1OCCB 1GM7A 1M56B 4CBCA 5C93A 1H38A 1KECA 3JD0A 1EZJA 2DYSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3D A;  1W0K G;  2UXX A;  3OE7 G;  4UV9 A;  2Z3Y A;  5LHI A;  3ZMU A;  1W0J G;  1BMF G;  2JJ2 G;  5LHG A;  1OHH G;  1E1R G;  3ZMS A;  5LHH A;  2UXN A;  3OFN G;  2EJR A;  2HLD G;  2R9I A;  2XOK G;  1MAB G;  3ZMT A;  5L3G A;  5LBQ A;  4UV8 A;  5L3C A;  3ZMZ A;  2IW5 A;  2WPD G;  4UVA A;  5L3F A;  2HKO A;  3OEH G;  4UVB A;  2XAH A;  2JJ1 G;  4YXW G;  2XAS A;  2XAF A;  5L3B A;  5DN6 G;  2QE7 G;  3ZMV A;  2V7Q G;  3ABT A;  2JDI G;  3ZN1 A;  2W6I G;  4XBF A;  4UVC A;  4Z1M G;  2XAG A;  4ASU G;  3FKS G;  4TT3 G;  2XAQ A;  2CK3 G;  5FL7 G;  5H6Q A;  5LGU A;  1E79 G;  2Z5U A;  4TSF G;  4UXN A;  3OAA G;  2XAJ A;  1EFR G;  3ZN0 A;  1E1Q G;  3ABU A;  2DW4 A;  1NBM G;  3OEE G;  2V1D A;  5LGN A;  1H8E G;  2JIZ G;  2F43 G;  1FS0 G;  2H94 A;  2WSS G;  1COW G;  2X0L A;  2W6J G;  2Y48 A;  3ZIA G;  5LGT A;  4BAY A;  5L3E A;  1H8H G;  2XND G;  4CZZ A;  4KUM A;  5H6R A; 
#chains in the Genus database with same CATH topology
 1P84 F;  4I4T A;  5L3D A;  4DV5 B;  3OE7 G;  3HKB A;  2UUB O;  2B9Z A;  3CJH B;  1DTO A;  2EIN C;  2Z3Y A;  5EYP A;  4QGC A;  4WFE A;  4LFB O;  3ZHT A;  4O2A A;  1YJ9 V;  2IU0 A;  1I94 B;  3P3P A;  4F6E A;  3U2Z A;  4DR1 O;  1I5Y A;  2WAM A;  4TV8 B;  4HYW A;  4B3T O;  1YXB A;  1K34 A;  4H33 A;  5IT9 N;  1Q6I A;  2ZE7 A;  2ADP A;  4DV3 B;  1PPJ H;  2JVD A;  4YJ3 B;  4DR2 O;  1IXM A;  1R6K A;  1YSC A;  2XT9 A;  1YIT V;  3B8N A;  4JZ2 A;  2AZ0 A;  4X1Y A;  1GN3 A;  3ZX6 A;  4DR7 O;  3JAW B;  4PJ0 Z;  3RW0 A;  1G1X B;  1N34 B;  1NKD A;  1WA8 A;  4QE7 A;  3JAS A;  5CB4 B;  1VF5 B;  1Q81 W;  2XAS A;  1K4D C;  1CP9 A;  3ASO B;  4DUY B;  3JAK A;  4O4L A;  2V7Q G;  2ZDI A;  2A79 B;  5IYD O;  3UM7 A;  1HWY A;  3K5O A;  3UQ8 A;  4MT8 A;  4TT3 G;  1KMI Z;  5LMU O;  4JI3 B;  4X65 O;  3UCS C;  2YEV A;  2E75 B;  1P7B A;  2BTO A;  3ZN0 A;  4UCS A;  4I9W A;  4WFB V;  1H8E G;  3T4D A;  2QSA A;  3F5T A;  2YS8 A;  1VQ4 V;  3HR0 A;  4N23 A;  2EIK C;  4DXW A;  2IJJ A;  1F3W A;  5DEC A;  1H2L A;  4O4J B;  2RCV A;  4GKK O;  3PP7 A;  2UUC O;  1U97 A;  3FB7 C;  3EXA A;  4O4H A;  3K08 A;  4LWS A;  4CH6 A;  1ZUQ A;  5JH7 B;  1W59 A;  4UCT A;  2EIN B;  1S77 D;  5FPO A;  4QG8 A;  2C2A A;  1XL4 A;  2UU9 O;  2UXX A;  3HB3 B;  3J7A U;  1MSD A;  4DV1 B;  1IBM B;  4LF5 B;  1PD3 A;  2NNU A;  2E5L O;  3OMI B;  3SYA A;  4EFE A;  4NXN B;  3JSL A;  4KRZ A;  3L72 H;  1ENV A;  1FFX B;  1S72 V;  1KB9 F;  4FM0 A;  3QV8 A;  1FFT B;  1KD1 W;  4X62 B;  2HFE C;  4DK1 A;  5L3C A;  3K57 A;  2OYQ A;  1VIB A;  2LGQ A;  4J11 A;  2JJ1 G;  5LMN B;  1Q90 D;  2E74 B;  3CS5 A;  4L8J A;  4UCU A;  4JGS A;  4J41 A;  1GN6 A;  3NR7 A;  4D6T H;  2KB1 A;  1EN6 A;  2ZIM A;  1EZV H;  1QHT A;  2LW1 A;  1R1B A;  1M57 C;  2OCC C;  3JAR B;  2ZXW B;  3ZRW B;  2XAG A;  3RGB A;  2Y4U A;  5KX5 A;  3HQO A;  2LFR A;  1HNW O;  5IYC O;  4HYV A;  4JAV A;  1MOF A;  1FJG O;  4JI6 O;  1FXK C;  2DW4 A;  1RSO B;  3G67 A;  4J10 A;  1VQ6 V;  2ZM6 B;  4JZG A;  2ZIN A;  2ZIO A;  1OCZ C;  3WFV A;  1Q86 W;  2Q68 A;  1R73 A;  1Y6X A;  2UXB O;  4W4K A;  2QTS A;  1M4U A;  3FB5 C;  1K8A W;  4KL1 A;  2EIJ C;  5LOV A;  3GVM A;  2E76 B;  3RYI A;  5KA5 A;  4KS0 A;  3CX5 F;  4B3R B;  1XNR B;  1BQZ A;  1YJW V;  3BA9 A;  2P5O A;  2P06 A;  1H2M A;  4BIZ A;  2AHY A;  3CXC U;  1T57 A;  5H6R A;  1O9H A;  1QU7 A;  4LH6 A;  5KHJ A;  3SR2 C;  2JS5 A;  2WLK A;  2KSD A;  3JYC A;  1G4Y B;  3W7T A;  4U7O A;  1BMF G;  3CRR A;  2DOS A;  4LFA B;  4ZI7 A;  2UXC B;  3RYF A;  1QVF U;  4MVO A;  2Y4T A;  3ZMT A;  5LBQ A;  4WBN A;  4AI8 A;  1RFY A;  2UXD O;  3CCL V;  5CBH A;  3JD1 A;  3PN1 A;  3H6O A;  4EFB A;  4GUN A;  1ZSP A;  4J9Y B;  2IBZ H;  4FFK A;  4RQF A;  5KUK A;  1YZB A;  1SQP H;  2R9R B;  3CRA A;  3WB2 A;  2ADQ B;  3MA8 A;  1M57 B;  2PYJ A;  3ZMV A;  1PNK A;  4QG9 A;  1PKX A;  5KAI Z;  5TIS Z;  1V55 C;  3BA8 A;  2QGN A;  3CWB H;  1ORQ C;  5F2V O;  1DF4 A;  4B08 A;  5H6Q A;  2PI4 A;  5A9G A;  1VQM V;  4DV2 O;  3ZHS A;  3N27 A;  4XDL A;  3BPZ A;  5LL6 Y;  5CA1 B;  3H1J H;  4DV6 B;  1A5U A;  1OCZ B;  3K5L A;  2GSM B;  3JAT A;  3H1L H;  3VQW A;  5CA0 B;  4NR1 A;  4LH7 A;  3M7M X;  1TA8 A;  2Q0A A;  3AK1 A;  2L35 A;  4DRS A;  3JD2 A;  1IBK O;  3DC6 A;  1KKD A;  1MG1 A;  2EIJ B;  1UJW B;  1NQT A;  4I55 B;  2Z0A A;  3HKD B;  1QR9 A;  4DR5 O;  2YDE A;  5B3S C;  3T1Y B;  2UUA B;  1F3X A;  3ETD A;  1LNQ A;  3DXR A;  4X1I A;  4TUY B;  1VAR A;  5L3E A;  2BOB C;  1OCC C;  1K5S A;  2EUL A;  4DV4 O;  2QWO B;  1E0T A;  2B5U A;  1IVS A;  3DC5 A;  2QKC A;  4BW9 A;  1PNL A;  1ZL8 B;  1FAF A;  3OTO O;  2QWQ B;  3ZMS A;  2Y69 C;  1Q43 A;  2EIL C;  5LXT B;  3NXS A;  4H13 B;  2GUZ A;  1AJN A;  1R3I C;  4FLW A;  4IGG A;  4X20 A;  3M8A A;  4NYK A;  2Q9L A;  4I7Z B;  3OGC C;  5KMG A;  4LF6 B;  4BWA A;  1JA8 A;  4X88 A;  4DV0 B;  4BIO A;  3CME V;  1Z5V A;  2JEX A;  1V55 B;  3ABT A;  2EZP A;  3OTF A;  2W6I G;  3OW2 U;  5BMV A;  1TVK A;  4JI8 B;  1ZLZ A;  2WLI B;  2OT5 A;  4J80 A;  4ZOL A;  4JI7 B;  3QVN A;  3ABM C;  5LP6 B;  3VQV A;  1F51 A;  3CD6 V;  4EEQ A;  1SC5 B;  2ZDI C;  4JV5 O;  5ITZ A;  4DRX B;  3CC7 V;  3H9V A;  2AXT Z;  4UFZ A;  1Q8I A;  1WP7 A;  3IFX A;  1PP9 H;  3TET A;  4YHH O;  1K7D A;  3K58 A;  2AHZ A;  5EK0 A;  1E0U A;  1XOU A;  3ZIA G;  2FYU H;  2Q69 A;  3ABL B;  2L6L A;  1OCC B;  2NN4 A;  4LF8 B;  3DSQ A;  5C93 A;  1H38 A;  1KEC A;  3JD0 A;  2V4D A;  3SJB C;  2DYS C;  1EN5 A;  1XBL A;  4K8X A;  5KHI A;  3AAG A;  1VQ5 V;  1D5N A;  3LUT B;  4QNH B;  3STZ C;  4KFM A;  4I9Q A;  1GAX A;  4ZHQ B;  1K5Q A;  4YY3 B;  2QM8 A;  4X8A A;  3LNM B;  1SKV A;  2ZR3 A;  2WLM A;  2FTK A;  3RVY A;  4I4T B;  3HKB B;  4YJ2 B;  2R9I A;  5EYP B;  3HQP A;  4I0X A;  4GX2 A;  3T1H O;  3RT3 C;  5LA6 B;  1OJH A;  3CCV V;  4UVA A;  5L3F A;  1HR0 O;  2PGG A;  3H1H H;  4L87 A;  4DV5 O;  4DR3 B;  2LQT A;  4P2Z A;  3B2E E;  2XTA A;  2VGI A;  1I94 O;  1GO3 F;  2XAF A;  3D36 A;  5L3B A;  2HP8 A;  4JI2 B;  1RPR A;  5E1A C;  1GN4 A;  3ZN1 A;  2F93 B;  1HNX B;  2ZD9 A;  5FNV A;  4HBN A;  2DQ3 A;  2Q0O C;  2WA3 A;  1HNZ B;  4D7S A;  3A0H Z;  3OM3 B;  3JAK B;  4QIW F;  3OAA G;  4X1K A;  4JYC A;  2BTQ A;  1ZTE A;  1JJO A;  2QDO A;  5B1O A;  4U7N A;  2GV9 A;  2HVJ C;  3CCU V;  2XHB A;  3MAQ A;  1I08 A;  1N34 O;  3ME3 A;  1GMG A;  3QF7 A;  1XIL A;  4PDR A;  1SER A;  1H2G A;  4GZR B;  1VQP V;  4H0L B;  2PY5 A;  2Q67 A;  4MVU A;  2ODM A;  3N2K A;  4DUY O;  1SQB H;  1AR4 A;  5D5P A;  2QM4 A;  3ZBH A;  1XNQ O;  3ZS8 C;  1Y4M A;  4PDL A;  3KZI Z;  4PHZ A;  4JI1 O;  4FXF A;  4JI3 O;  3HPL C;  2ZR2 A;  3THO A;  3APQ A;  1WAZ A;  1RM1 B;  4O4I A;  2HHH B;  1JX9 A;  2EIM B;  2ZE5 A;  4FZ1 A;  3ML0 A;  3F7Y C;  2JK5 C;  3UKM A;  1QQC A;  4MVQ A;  1FYJ A;  1YDX A;  3PJS K;  4IIJ B;  3CCM V;  3SPH A;  4O4H B;  5AG2 A;  3ZHU A;  5FLX N;  1W2B U;  4NVP A;  4P30 A;  4MS2 A;  5CBF A;  2NR5 A;  2XOK G;  1NR7 A;  3CC2 V;  1MAB G;  1SZT A;  3LDD A;  2N74 A;  3T05 A;  4KCU A;  2DJV A;  5EZY B;  1BQ0 A;  4YIO A;  3J81 N;  5A2Q N;  3H01 A;  1F4N A;  3U0Z A;  5KA6 A;  1AJP A;  3LSU A;  3GB7 C;  3OUF A;  4JYB A;  1IZ3 A;  4FLU A;  2CUG A;  5JVD B;  4DV1 O;  3AG1 B;  1IBM O;  4LF5 O;  3L70 H;  3WU2 Z;  5C8Y B;  3U11 A;  4PDV A;  4NXN O;  1QLE C;  4R8C A;  2Q73 A;  4CS3 A;  4BW5 A;  5CA3 A;  4LNU B;  2CE4 A;  3E22 A;  2FML A;  4EB6 A;  4X62 O;  1XL6 A;  5LYJ B;  2Z5U A;  4PA3 A;  5BR8 B;  5IJ0 B;  1EFR G;  5E79 Z;  4ZIB A;  4GT1 A;  1NBM G;  3DTU B;  1VQ7 V;  2D2C B;  5LMN O;  3SYC A;  1BCC H;  3A0R A;  2YUA A;  1XI1 A;  5HFM A;  1K4C C;  1J5E B;  4K35 A;  1BT8 A;  1B04 A;  5B1B C;  1OCR C;  4X66 B;  4O2B B;  3JCU Z;  1PKN A;  1ZX3 A;  2ZT9 B;  4JI5 O;  3GWO A;  1HW7 A;  2XND G;  3TK1 A;  1J95 A;  4KUM A;  5B1N A;  5B66 Z;  3K79 A;  5LOV B;  2ZM6 O;  1CEZ A;  3IC9 A;  4XDK A;  3IS4 A;  3ETQ A;  3SRH A;  1ZAU A;  1OCO C;  1OHH G;  3H1K H;  2UXN A;  3JAL A;  3HKC A;  2DWD C;  1VQ9 V;  4QJF B;  3OFN G;  3JSN A;  1JQ0 A;  3MHS C;  2NLJ C;  4B3R O;  1XNR O;  4FLX A;  2VRZ A;  4AQY B;  3ZJZ A;  2RDC A;  3EHB B;  1YHQ V;  3SRD A;  4ZI7 B;  1GRJ A;  3RYF B;  1EN4 A;  4UVB A;  2YSU B;  4FK5 C;  1A32 A;  3ETE A;  3BJF A;  3WG7 C;  4WBN B;  3IAY A;  3N2G A;  5DN6 G;  4DW0 A;  2KG7 B;  3O9O A;  5H2F Z;  2IU3 A;  4LFA O;  4NTW A;  2UXC O;  1AR1 B;  4DR1 B;  4B7K A;  1U96 A;  1XHX A;  2VGG A;  5LGU A;  4WF9 V;  3ZRS A;  4ABM A;  3I56 V;  4NTX A;  1YF2 A;  4JTA B;  4J7J A;  4DR2 B;  4KP4 A;  3T2M A;  1NH2 D;  1PV0 A;  3HKE A;  1F7Y A;  1NTM H;  3I55 V;  1XMQ B;  5JJJ B;  1QVG U;  1X59 A;  1WNS A;  4TV8 A;  2A3Q A;  4LBE C;  3VQY A;  1K97 A;  5LGN A;  1BHB A;  1MA1 A;  4MVS A;  5B1B B;  4C7U A;  4P9O A;  4YJ3 A;  1OCR B;  3B8M A;  4HZ3 A;  1KQS U;  2YIC A;  1WJZ A;  5IWA B;  2QR4 A;  4I5S A;  2RN9 A;  4JI0 O;  2CH7 A;  3F7V C;  1UPG A;  1GM8 A;  2QEX V;  3IGA C;  4IP7 A;  2G50 A;  3MDS A;  3AG7 A;  4MTO A;  3SPC A;  4DV6 O;  1VP8 A;  3SPI A;  2H3O A;  1M56 C;  1W0K G;  4UV9 A;  4QG6 A;  2JGU A;  4XDJ A;  1OCO B;  2EIK B;  4DR4 B;  4KCT A;  1SZX A;  4KCW A;  2E3C A;  4X1I B;  1PKM A;  4KCV A;  2DQ0 A;  4MVR A;  4GKJ B;  3U10 A;  1S3J A;  4U3J A;  3BJT A;  3A0B Z;  4FVM A;  2VGF A;  2EJR A;  2PYL A;  3E83 A;  4ZBM A;  1AQF A;  3ICX A;  1V9P A;  1F23 A;  2P90 A;  3T1Y O;  3K9A A;  2UUA O;  2FL4 A;  2AGA A;  2G38 A;  1PNM A;  1WB8 A;  3WG7 B;  4U3F H;  2XAH A;  3LDE A;  1URF A;  1XMO B;  1HDJ A;  2IH1 C;  2YIB D;  3OMA B;  3FAV A;  1R3L C;  2LFS A;  4O4J A;  4PI2 A;  1BL8 A;  4LF9 B;  4X20 B;  2HEP A;  5KHH A;  4YIP A;  4B3S B;  1Y74 B;  3SYQ A;  4NTY A;  1VQK V;  5JJE B;  3RFR A;  5FL7 G;  3RYC A;  1SA0 A;  3AK3 A;  2A7W A;  5J2U B;  4JF3 A;  5J2T B;  3D36 C;  4FXJ A;  4I50 A;  1TGO A;  5BMV B;  1TVK B;  4LF6 O;  5JWP A;  2K1E A;  2OTL V;  2ZQM A;  3CRQ A;  1GK9 A;  1H2K A;  2QTO A;  2OCC B;  3GWK C;  4DV0 O;  3AG2 C;  5BZB A;  1NH2 B;  4ZKI A;  4OX9 B;  1MZE A;  3CSX A;  1MSW D;  4FFB A;  1FFX A;  1NT2 B;  3STL C;  5EC1 C;  1M93 A;  4GCZ A;  2R72 A;  4BIU A;  2VQF B;  1FS0 G;  2RJZ A;  3E2E A;  3CRM A;  2X7R B;  5ITZ B;  4JI8 O;  1FXK B;  2F1M A;  2F66 C;  1V54 C;  2IH3 C;  4DO2 A;  3CHX A;  4TWK A;  4JI7 O;  4A5U B;  1BE3 H;  1GM7 A;  1M56 B;  4DR6 B;  4J7K A;  1RP3 B;  1S5L Z;  5JQG A;  5KHK A;  1OZ0 A;  4MTF A;  3ZED A;  1VQL V;  3W7X A;  3CCS V;  4PEL A;  4DW1 A;  4LCU C;  3TXS A;  3ABK C;  1NR1 A;  1Y76 A;  1THZ A;  3O65 A;  2QWP B;  1IDS A;  1BGY H;  2RNB A;  1RSO A;  3QV7 A;  3GG8 A;  1QNM A;  1JJ2 U;  4LF8 O;  4KXR A;  1O9G A;  5K1X A;  1A49 A;  3LSQ A;  3SJA C;  3CCR V;  4HAM A;  4K8Z A;  4I0X B;  1OV9 A;  1CPY A;  1VP7 A;  5IY5 C;  2HR3 A;  3P32 A;  3CCE V;  2BSK A;  4YY3 O;  1NS1 A;  1F4M A;  4W4L A;  4G2K A;  4LF4 B;  2XAQ A;  2M6Y A;  4LF7 B;  3G71 V;  2QWN B;  3B09 A;  3ETG A;  3GR4 A;  1N36 B;  5FNV B;  1KBH A;  4X64 O;  1GH6 A;  3AG2 B;  4DR3 O;  1R3K C;  4K3A A;  2EJ7 A;  3S3W A;  3KTX A;  3OR6 C;  3S3X A;  3JCZ A;  1XEQ A;  2DE0 X;  2YXL A;  1H2S B;  1IBL B;  4JAS A;  1AVM A;  2HJD A;  4JI2 O;  4JAA A;  1FD9 A;  3D3I A;  1HNX O;  2P4K A;  1DK1 A;  3MHH C;  4Z1V A;  3P3N A;  1V54 B;  2YID A;  3FB6 C;  1HNZ O;  4B2D A;  1FPO A;  4E2L A;  3N2K B;  3QTC A;  5IYZ B;  2CTQ A;  4GX1 A;  5BY1 A;  4QPJ A;  4Z2W A;  1N0N A;  4DUZ O;  4RPP A;  3T4Z A;  1B6Q A;  4LP8 A;  5LHI A;  3Q4H A;  4RAI A;  1JOY A;  4O4I B;  4JPR A;  5B3S B;  3LNN A;  1JFF B;  3B4S A;  5LHH A;  1TUB B;  1Q7Y W;  2HLD G;  3SYP A;  3FFQ A;  5EBM C;  5J9P C;  2BE3 A;  1WP8 A;  2HHH O;  2X6C A;  3X2Q C;  1WPB A;  5CA0 A;  2HKO A;  2WLL A;  2Y69 B;  5KLV H;  2EIL B;  1PL0 A;  5IY5 B;  1B3Q A;  1AIL A;  4I55 A;  1P4R A;  1ARO P;  4DV4 B;  4B3M B;  3QNE A;  2Y0P A;  4IHJ A;  4O2A B;  4FLZ A;  5JJN B;  1UFI A;  2DN9 A;  2YXH A;  3MD0 A;  3QV6 A;  3OT7 A;  1QLN A;  2LGW A;  4JYA B;  4LFC B;  3ABU A;  1ZL8 A;  3AG3 C;  2JGD A;  2R70 A;  3W7U A;  2VWJ A;  4Q6G A;  1Y67 A;  3E22 B;  3G4S V;  1N33 B;  3GQY A;  3ASN C;  4X1Y B;  1S5J A;  5IJ9 A;  4GLX A;  1VF7 A;  3RYH A;  2F4V B;  1JVM A;  2JS3 A;  3BVO A;  4WFA V;  3BAA A;  1WA8 B;  3JAS B;  4N21 A;  1VQ8 V;  3QO8 A;  4DV3 O;  3B77 A;  2F95 B;  2H94 A;  2WLJ A;  3ABM B;  4G28 B;  3F5W C;  4O4L B;  2QKS A;  3LDC A;  3K5M A;  3BRC A;  1N32 B;  2CTW A;  3SJC C;  5BR8 O;  4NXM B;  4JAU A;  4EKW A;  4BAY A;  1SET A;  2YEV B;  4MW3 A;  1K73 W;  1CXZ B;  4KHP B;  3K59 A;  3RVZ A;  4UCR A;  1SS3 A;  1KYO F;  1J5E O;  4IMA A;  2WLI A;  1AP6 A;  3E0W A;  3BAB A;  1SRY A;  4X66 O;  5L3G A;  5EBW C;  4DV7 B;  2DYS B;  4JPG A;  4DRX A;  1IUR A;  2FKX A;  2ILM A;  1Z2G A;  3CEI A;  3JAL B;  2WPD G;  1GKF A;  3FYI B;  1XHZ A;  4PA9 A;  3RWR D;  1A3W A;  4F6R A;  2ZE6 A;  3AG4 C;  4YXW G;  1T5A A;  4LWS B;  1PKY A;  4PV1 B;  2CTR A;  2IJH A;  4XBF A;  2BCC H;  4JI4 B;  4MW8 A;  3N2G B;  1QR8 A;  1YEW A;  1XUQ A;  2WLN A;  3ZCC A;  4AQY O;  5EIB C;  1VMG A;  2H8P C;  4HNA A;  4IYH A;  4X9Q A;  1G8M A;  1AJQ A;  2VQE B;  2JEU A;  4ZHQ A;  3HQN A;  1TAE A;  3SPJ A;  1M1K W;  3CCQ V;  2VS0 A;  3ZHR A;  3RBZ A;  1M90 W;  2F43 G;  4YJ2 A;  1VF6 A;  1AP5 A;  4QPK A;  4NB5 A;  3HKE B;  3E8G A;  1Y66 A;  4JTD B;  5LA6 A;  3QTG A;  3B40 A;  1MMM A;  3AEI A;  2B1G A;  2ZNI A;  3D3Q A;  3UT5 A;  1NJI W;  3TCU A;  5KX5 B;  4FLT A;  5LGT A;  1H8H G;  2FB5 A;  3I5D A;  2ZKO A;  2YI8 A;  4G1N A;  1XMQ O;  3CE2 A;  2AW9 A;  2CH7 B;  3CPW U;  4MTX A;  3M99 B;  4TV9 A;  4UB6 Z;  2ZCE A;  3K0G A;  3IJ4 A;  1LUW A;  3QO7 A;  1JCH A;  2A9H A;  1FXV A;  4GYC B;  5IWA O;  1XNQ B;  1VQO V;  2HJF C;  4NKG B;  5K1P A;  1A3X A;  4K0K B;  1LR1 A;  1VEW A;  4ICG A;  4JI1 B;  3RYI B;  2ZXW C;  3ZMZ A;  2JRI A;  4U3J B;  3AG4 B;  4DYL A;  1SQG A;  4DR4 O;  1M5I A;  3E86 A;  2KQX A;  1EBO A;  2ZE8 A;  1I0H A;  2P7T C;  3G80 A;  4CS4 A;  2QE7 G;  4FM2 A;  2JDI G;  2W0X A;  4GKJ O;  2DYR C;  2IJK A;  3E8B A;  2R9A A;  1D2D A;  4Z1M G;  1L0L H;  2OIE A;  4ASU G;  1ROP A;  1S0V A;  2CK3 G;  2WA4 A;  4YJ5 A;  1IX9 A;  3FAV B;  1JPX A;  5D5Q A;  1R3J C;  3H1I H;  4IIJ A;  1R6T A;  5B5E Z;  3CMA V;  3SYO A;  2MK3 A;  1XDC A;  5GON A;  1PM9 A;  4MVM A;  2V1D A;  2UUB B;  4FIP C;  1AI6 A;  3A8T A;  1XMO O;  1QLE B;  3RYC B;  1BHA A;  1SA0 B;  4LFB B;  3BHP A;  4LF9 O;  2CDY A;  4B3S O;  4I50 B;  2P67 A;  4FZ0 A;  4B3T B;  1K33 A;  4LR3 A;  1AI5 A;  3OD4 A;  5EZY A;  4YNG A;  5DED A;  2A0L A;  5IE9 A;  2PTM A;  3CJH A;  2PF4 E;  2X0L A;  3KG2 A;  2WLH A;  4FFB B;  5KUM A;  3CCJ V;  1Q6H A;  2HVK C;  2EX3 A;  5JVD A;  4CBC A;  4DR7 B;  4B2D D;  5C8Y A;  2Q5Z A;  1M9N A;  2CGO A;  3FB8 C;  3L75 H;  4TOI A;  4OX9 O;  3N25 A;  2DMX A;  4OGQ B;  4LNU A;  3KCY A;  3JAT B;  3AK2 A;  2VQF O;  4J42 A;  2GHY A;  5JQG B;  1TUE B;  3APO A;  5LYJ A;  1QBZ A;  3JAW A;  3G6B A;  5IJ0 A;  4RQE A;  1KKC A;  2IM9 A;  5LMU B;  3L71 H;  5CB4 A;  3SJQ C;  4X65 B;  1L0N H;  1BSM A;  1ZJH A;  1Q5O A;  2PUS A;  4IYI A;  3W7S A;  3RN4 A;  1XQ8 A;  1YTF D;  1Y76 B;  4DR6 O;  2ITC C;  1SF9 A;  3OEH G;  2VGB A;  1SQQ H;  5CBG A;  3JD4 A;  3DXR B;  3K06 A;  1SES A;  1MZF A;  4JI5 B;  2MW2 B;  1KP3 A;  3DGE A;  5CMU A;  3CXH F;  1YCI A;  1JR9 A;  2DYR B;  4O2B A;  4FLV A;  4UVC A;  2ARH A;  5JCO A;  3FKS G;  3D8C A;  4GKK B;  1SQV H;  2UUC B;  3BCC H;  2Q7H A;  2N04 A;  1E79 G;  3ZRX A;  5B1A C;  4TSF G;  3FYE B;  2HG5 C;  2BSK B;  2GUZ B;  1D5A A;  5GTH Z;  1N8R W;  3E89 A;  3JAM N;  4MTG A;  2LJ2 A;  3OEE G;  4F4L A;  2UU9 B;  4IL6 Z;  2JIZ G;  1ZWI C;  5KMG B;  2CTP A;  2E5L B;  2LP7 A;  3EVK A;  4WFG A;  5JH7 A;  2WSS G;  1NI8 A;  2YXY A;  3L74 H;  4LF4 O;  4G27 B;  5FPR A;  3OGI B;  1KP2 A;  1Z5W A;  4LF7 O;  1L8D A;  1WLE A;  3J80 N;  1MNG A;  3TXQ A;  5IYB O;  5IDJ A;  3CC4 V;  4PA4 A;  4CC6 A;  4FLY A;  4FMT A;  1N36 O;  4UB8 Z;  4JYY A;  1LUV A;  3K03 A;  4ZOL B;  2KG7 A;  4FM1 A;  4PA6 A;  2Y0I A;  1W0J G;  1YIJ V;  5DM6 V;  2GTS A;  2YC0 A;  3QV9 A;  2Q7G A;  2JJ2 G;  1IBL O;  1K92 A;  1KUQ A;  4CS2 A;  4UCO A;  4PA7 A;  1JMK C;  4D7T A;  2GTA A;  4CC5 A;  3IC7 A;  2D3O W;  2Q6A A;  2YI9 A;  1KC8 W;  3Q4H B;  1X4T A;  3L9D A;  1HNW B;  3BEH A;  4UV8 A;  3CRC A;  3K0D A;  3KCX A;  5BXZ A;  1FJG B;  3C3T A;  1AR5 A;  4JI0 B;  4JI6 B;  2IW5 A;  5EC2 C;  2ATK C;  3JAR A;  2EZO A;  4X89 A;  3ZRW A;  1YTF B;  3FX7 A;  4CH3 A;  1KU9 A;  3SGI A;  3QG5 A;  5LP6 C;  2Q8V A;  4GX5 A;  1SQF A;  3T1C A;  3OR7 C;  4FJC C;  2UXB B;  1NU1 H;  2Q7E A;  2WLL B;  5B1A B;  1G6U A;  3SDL A;  3R66 A;  1DGS A;  4J7Z A;  1L1F A;  2XAJ A;  1K3E A;  4HYO A;  1E1Q G;  4IHJ B;  3T0T A;  1NZ6 A;  3CP1 A;  2OIG A;  4TQD A;  3E35 A;  1S76 D;  4AHC A;  3ABL C;  1EM1 A;  4R50 A;  2A06 H;  1BS3 A;  2WWW A;  3L73 H;  1IXB A;  2DWE C;  2ITD C;  4B3M O;  2ETN A;  2EBO A;  1N0J A;  2JGD B;  1COW G;  4Q20 A;  4E4E A;  3JD3 A;  4OPA A;  3K9S A;  5IJ9 B;  1P7G A;  1B06 A;  2XUM A;  5EBL C;  3RYH B;  1NVP D;  2UXD B;  1Q6U A;  3LSS A;  4JYA O;  1I5X A;  1Q82 W;  4J9Z B;  4WFF A;  4LFC O;  2OTJ V;  1VF6 C;  1NTK H;  2K9P A;  2Q4P A;  4CZZ A;  2RQ6 A;  3VQX A;  2W0F C;  4X1K B;  1VQN V;  3K04 A;  2BTQ B;  1N33 O;  3QO5 A;  3G6E V;  1Y74 A;  1RPO A;  2F4V O;  3ZHQ A;  5LHG A;  2B1I A;  1DLB A;  2QJ1 A;  5HFL A;  5J2U A;  2OCH A;  5J2T A;  3EOE A;  3E8F A;  3A2F A;  5GTI Z;  1H2N A;  1AI7 A;  2E28 A;  3UO2 A;  1N32 O;  3SPG A;  4DV2 B;  4NXM O;  2GBO A;  1NTZ H;  2ZNJ A;  1PKL A;  3ABK B;  3WB0 A;  3SRK A;  1FKA O;  2YIA A;  4KHP O;  3WB1 A;  1FXK A;  4UUJ C;  1YVW A;  3T07 A;  1P49 A;  3G2G A;  1PL4 A;  1IBK B;  1WN7 A;  5CA1 A;  4R7C A;  5KAF Z;  4F6R B;  5GW7 A;  2LW7 A;  1GTO A;  4R6Z A;  4DR5 B;  3K5N A;  4DV7 O;  1I7F A;  3BY6 A;  1DF5 A;  4UXN A;  4LC1 A;  2PZS A;  2QWR B;  2AZ2 A;  1YJN V;  3R65 A;  1RM1 C;  3HKD A;  4RUF A;  2EIM C;  2RMK B;  3CB2 A;  2OWO A;  1QCE A;  3E0V A;  3OTO B;  5CN0 A;  3OMN B;  4H37 A;  4TUY A;  4HNA B;  3TJT A;  2IJI A;  3CYO A;  1WB7 A;  1K9M W;  4JI4 O;  3KKY A;  2KKW A;  5KHG A;  3KHD A;  4QE9 A;  2W6J G;  4AIL C;  1BZK A;  2QA4 V;  1NVP B;  4EB6 B;  5LXT A;  1Q3E A;  1SQX H;  2VQE O;  2N05 A;  2YIB A;  3ZRV A;  2X6A A;  4WJ8 A;  3ZMU A;  4X64 B;  2QKA A;  4BR6 A;  4RO2 A;  3UT5 B;  4RUE A;  1YI2 V;  4CH4 A;  1E1R G;  4RWU A;  2GDS A;  4OXS A;  3AG1 C;  2PI5 A;  4FPP A;  2CAZ C;  1US6 A;  4TV9 B;  4DK0 A;  1N4C A;  4IT5 A;  3VOU A;  3E8H A;  4JV5 B;  4WCE V;  4UCV A;  1R6N A;  4DUZ B;  1GM9 A;  4GX0 A;  2P6J A;  3OUS A;  1S5H C;  5LP6 A;  1GN2 A;  4H44 B;  3ASO C;  4MVZ A;  3X2Q B;  3SRF A;  4YHH B;  3UO3 A;  5IYZ A;  5H5N A;  4OPH A;  2BOC C;  3P30 A;  4QGP A;  2M7W A;  3HKC B;  4K0K O;  4B7E A;  1XRE A;  4JTC B;  4WFH A;  3C90 A;  4P9P A;  2F23 A;  2CGN A;  1JFF A;  2QM7 A;  1TUB A;  3BFR A;  5JCO C;  1WPX A;  1T5E A;  1FXH A;  1HP8 A;  3FD9 A;  4PD4 F;  5EIB D;  3C3S A;  3K3W A;  3ZHV A;  4PI0 A;  4TQF A;  5GON B;  3VBB A;  2O57 A;  2P4V A;  4MSW C;  1AB3 A;  3AG3 B;  3EFF K;  4PDM A;  2X6B A;  5H9C A;  2LO1 A;  2VWK A;  3W7W A;  2P22 C;  2Y48 A;  3TGU H;  3T1H B;  3ASN B;  1AI4 A;  4CH5 A;  1HR0 B;  1EZJ A; 
#chains in the Genus database with same CATH homology
 5L3D A;  1OZ0 A;  3OE7 G;  4MTF A;  1M9N A;  1VQL V;  3FB8 C;  3W7X A;  3CCS V;  4PEL A;  3AAG A;  1DTO A;  2EIN C;  2Z3Y A;  1VQ5 V;  4WFE A;  3LUT B;  1YJ9 V;  2IU0 A;  4LCU C;  4QNH B;  3STZ C;  4KFM A;  1I5Y A;  1K5Q A;  2WAM A;  3ABK C;  1NR1 A;  2QM8 A;  4X8A A;  3LNM B;  2GHY A;  1TUE B;  2WLM A;  2ZR3 A;  1K34 A;  1THZ A;  2FTK A;  4H33 A;  3RVY A;  1QBZ A;  2R9I A;  4RQE A;  3SJQ C;  1IXM A;  1R6K A;  1YSC A;  4GX2 A;  1YIT V;  3W7S A;  3B8N A;  1YTF D;  1JJ2 U;  3CCV V;  4UVA A;  5L3F A;  2ITC C;  3OEH G;  4L87 A;  3RW0 A;  5CBG A;  1NKD A;  3JD4 A;  3K06 A;  4QE7 A;  1SES A;  3LSQ A;  3CCR V;  4P2Z A;  4HAM A;  1KP3 A;  3DGE A;  1Q81 W;  5CMU A;  2XAS A;  1K4D C;  1CP9 A;  1GO3 F;  2XAF A;  3D36 A;  5L3B A;  1CPY A;  2DYR B;  3ASO B;  5IY5 C;  2HR3 A;  3P32 A;  3CCE V;  2V7Q G;  1RPR A;  2ZDI A;  5E1A C;  2A79 B;  3ZN1 A;  5IYD O;  2ZD9 A;  3UM7 A;  1HWY A;  2DQ3 A;  4UVC A;  1F4M A;  4G2K A;  3FKS G;  4MT8 A;  2XAQ A;  4TT3 G;  3OM3 B;  2YEV A;  1E79 G;  3ZRX A;  5B1A C;  1P7B A;  4QIW F;  4TSF G;  3FYE B;  3OAA G;  2HG5 C;  3G71 V;  4JYC A;  3ZN0 A;  5B1O A;  3E89 A;  1N8R W;  3ETG A;  4U7N A;  4I9W A;  2HVJ C;  4MTG A;  3CCU V;  3AG2 B;  3OEE G;  4F4L A;  1GMG A;  1R3K C;  4PDR A;  4WFB V;  1SER A;  1H2G A;  3OR6 C;  1VQP V;  1H8E G;  2Q67 A;  2JIZ G;  4MVU A;  3T4D A;  3JCZ A;  1ZWI C;  1VQ4 V;  4N23 A;  4JAS A;  2LP7 A;  4WFG A;  3D3I A;  2WSS G;  2EIK C;  4DXW A;  1Y4M A;  2IJJ A;  3MHH C;  4PDL A;  1V54 B;  4G27 B;  3FB6 C;  3HPL C;  2ZR2 A;  1KP2 A;  3FB7 C;  1WLE A;  4E2L A;  1RM1 B;  5IYB O;  1JX9 A;  5IDJ A;  2EIM B;  3K08 A;  3CC4 V;  4PA4 A;  3ML0 A;  4FMT A;  3F7Y C;  4GX1 A;  2JK5 C;  2EIN B;  4QPJ A;  1S77 D;  2C2A A;  3K03 A;  1XL4 A;  3UKM A;  2UXX A;  4MVQ A;  3PJS K;  3CCM V;  3HB3 B;  1B6Q A;  4LP8 A;  4PA6 A;  3T4Z A;  5LHI A;  4RAI A;  1PD3 A;  2NNU A;  1W0J G;  3SPH A;  1JOY A;  4JPR A;  1YIJ V;  5DM6 V;  2JJ2 G;  5B3S B;  1W2B U;  1K92 A;  3OMI B;  5LHH A;  4PA7 A;  3SYA A;  4P30 A;  4MS2 A;  1Q7Y W;  5CBF A;  1ENV A;  1S72 V;  2HLD G;  3IC7 A;  3SYP A;  2Q6A A;  2D3O W;  5EBM C;  2XOK G;  1NR7 A;  1KC8 W;  5J9P C;  1MAB G;  3CC2 V;  1SZT A;  3LDD A;  1FFT B;  1KD1 W;  2HFE C;  3BEH A;  4UV8 A;  5L3C A;  3K0D A;  2X6C A;  3X2Q C;  2IW5 A;  3H01 A;  1F4N A;  2HKO A;  5KA6 A;  1AJP A;  2ATK C;  2WLL A;  2Y69 B;  3GB7 C;  5EC2 C;  3OUF A;  2EIL B;  1PL0 A;  2EZO A;  4X89 A;  3ZRW A;  1YTF B;  2JJ1 G;  4JYB A;  3AG1 B;  5IY5 B;  4JGS A;  1P4R A;  4PDV A;  4GX5 A;  3T1C A;  1ARO P;  2KB1 A;  3OR7 C;  4FJC C;  3QNE A;  1M57 C;  1QLE C;  2OCC C;  2WLL B;  4R8C A;  2ZXW B;  3ZRW B;  4BW5 A;  5CA3 A;  2XAG A;  3MD0 A;  5B1A B;  2LFR A;  1QLN A;  5IYC O;  1XL6 A;  4JAV A;  1MOF A;  2Z5U A;  4PA3 A;  1L1F A;  2XAJ A;  1K3E A;  1EFR G;  1FXK C;  4HYO A;  1E1Q G;  3ABU A;  4GT1 A;  2DW4 A;  3AG3 C;  1VQ6 V;  1NBM G;  3W7U A;  3CP1 A;  3DTU B;  1VQ7 V;  3E35 A;  3G4S V;  1OCZ C;  1S76 D;  3WFV A;  3SYC A;  1Q86 W;  3ABL C;  2Q68 A;  3ASN C;  3A0R A;  4R50 A;  1R73 A;  1JVM A;  2WWW A;  5HFM A;  1K4C C;  4WFA V;  2ITD C;  2DWE C;  4N21 A;  1VQ8 V;  3QO8 A;  3B77 A;  3FB5 C;  2H94 A;  1K8A W;  2EBO A;  2WLJ A;  3ABM B;  1COW G;  4G28 B;  4Q20 A;  5B1B C;  1OCR C;  2EIJ C;  3F5W C;  3JD3 A;  2QKS A;  3LDC A;  5KA5 A;  1YJW V;  1NVP D;  5EBL C;  3LSS A;  1I5X A;  1Q82 W;  4JAU A;  4J9Z B;  4WFF A;  4BIZ A;  4EKW A;  2OTJ V;  2AHY A;  3CXC U;  4BAY A;  3GWO A;  2XND G;  3TK1 A;  1J95 A;  1SET A;  4KUM A;  4CZZ A;  5H6R A;  2YEV B;  5B1N A;  3K79 A;  1CEZ A;  4MW3 A;  1K73 W;  2W0F C;  4XDK A;  1VQN V;  3K04 A;  3QO5 A;  2WLK A;  3G6E V;  3JYC A;  1G4Y B;  3W7T A;  4U7O A;  1BMF G;  1RPO A;  3RVZ A;  1OCO C;  5LHG A;  1OHH G;  2B1I A;  1DLB A;  2WLI A;  2UXN A;  2DWD C;  5HFL A;  1VQ9 V;  1QVF U;  4QJF B;  3OFN G;  4MVO A;  1SRY A;  1JQ0 A;  3MHS C;  5EBW C;  3ZMT A;  3E8F A;  5L3G A;  2DYS B;  2NLJ C;  5LBQ A;  1AI7 A;  3SPG A;  3ZJZ A;  3CCL V;  3EHB B;  1YHQ V;  5CBH A;  3JD1 A;  2WPD G;  4J9Y B;  1GKF A;  3FYI B;  4UVB A;  4PA9 A;  2YSU B;  3ABK B;  4RQF A;  4FK5 C;  5KUK A;  3ETE A;  3AG4 C;  4YXW G;  3WG7 C;  2R9R B;  1FXK A;  5DN6 G;  1M57 B;  4UUJ C;  3ZMV A;  2IU3 A;  1PNK A;  1PKX A;  2IJH A;  4XBF A;  1V55 C;  4R7C A;  1AR1 B;  5GW7 A;  1ORQ C;  1GTO A;  4R6Z A;  1DF4 A;  4MW8 A;  5H6Q A;  3BY6 A;  5LGU A;  4WF9 V;  3ZRS A;  1QR8 A;  2PI4 A;  1DF5 A;  4UXN A;  2WLN A;  4LC1 A;  3ZCC A;  3I56 V;  1VQM V;  4JTA B;  4XDL A;  2H8P C;  4KP4 A;  3T2M A;  1NH2 D;  1G8M A;  1AJQ A;  1OCZ B;  3I55 V;  1YJN V;  2JEU A;  2GSM B;  3R65 A;  1RM1 C;  1QVG U;  4LBE C;  3SPJ A;  1K97 A;  4RUF A;  5LGN A;  2EIM C;  3CCQ V;  1M1K W;  3RBZ A;  1M90 W;  1QCE A;  2F43 G;  1BHB A;  4MVS A;  5CN0 A;  3OMN B;  5B1B B;  4P9O A;  3JD2 A;  4H37 A;  4QPK A;  1KKD A;  1MG1 A;  1OCR B;  3B8M A;  2EIJ B;  1UJW B;  1NQT A;  4HZ3 A;  2IJI A;  3CYO A;  3E8G A;  1KQS U;  1K9M W;  1Y66 A;  4JTD B;  1QR9 A;  3AEI A;  2B1G A;  4I5S A;  4QE9 A;  2W6J G;  5B3S C;  3F7V C;  2QEX V;  1GM8 A;  3IGA C;  3ETD A;  1LNQ A;  1NJI W;  3TCU A;  4MTO A;  5LGT A;  5L3E A;  1H8H G;  3SPC A;  2QA4 V;  1NVP B;  2BOB C;  3SPI A;  1OCC C;  1M56 C;  1K5S A;  1W0K G;  4UV9 A;  3ZRV A;  2X6A A;  4XDJ A;  1OCO B;  2EIK B;  2B5U A;  3CPW U;  3ZMU A;  4MTX A;  1PNL A;  3M99 B;  4RO2 A;  4RUE A;  3K0G A;  1YI2 V;  1E1R G;  2DQ0 A;  2Y69 C;  4MVR A;  3ZMS A;  3QO7 A;  2EIL C;  1JCH A;  1S3J A;  4OXS A;  2A9H A;  3AG1 C;  3NXS A;  2EJR A;  1FXV A;  3E83 A;  2PI5 A;  4ZBM A;  4FPP A;  1VQO V;  1F23 A;  2HJF C;  2P90 A;  3K9A A;  1AJN A;  1R3I C;  1PNM A;  2ZXW C;  3ZMZ A;  3AG4 B;  3OGC C;  3VOU A;  3E8H A;  3WG7 B;  2XAH A;  3LDE A;  4X88 A;  2IH1 C;  4WCE V;  3E86 A;  3OMA B;  3CME V;  1R3L C;  2LFS A;  1EBO A;  1R6N A;  2P7T C;  2JEX A;  1GM9 A;  1BL8 A;  2QE7 G;  1V55 B;  2P6J A;  4GX0 A;  3OUS A;  1S5H C;  3ABT A;  2JDI G;  2DYR C;  3ASO C;  4MVZ A;  2EZP A;  3SYQ A;  2W6I G;  2IJK A;  3E8B A;  3OW2 U;  3X2Q B;  1VQK V;  4Z1M G;  4ASU G;  1ROP A;  2BOC C;  3P30 A;  1S0V A;  5FL7 G;  2CK3 G;  2M7W A;  2OT5 A;  2WLI B;  1JPX A;  1R3J C;  4JTC B;  4JF3 A;  3ABM C;  4WFH A;  1F51 A;  3CMA V;  3SYO A;  4P9P A;  3CD6 V;  2MK3 A;  2ZDI C;  2OTL V;  2K1E A;  2ZQM A;  3CC7 V;  4MVM A;  2V1D A;  1AI6 A;  1GK9 A;  4FIP C;  2QM7 A;  2QTO A;  1QLE B;  2OCC B;  1NH2 B;  3AG2 C;  5BZB A;  1MSW D;  4ZKI A;  1BHA A;  1WPX A;  3IFX A;  1FXH A;  3STL C;  5EC1 C;  4GCZ A;  4BIU A;  3K3W A;  1FS0 G;  3E2E A;  2P67 A;  2X7R B;  1K33 A;  3VBB A;  3TET A;  1K7D A;  1AI5 A;  1FXK B;  4MSW C;  2AHZ A;  5EK0 A;  3AG3 B;  3EFF K;  2A0L A;  4PDM A;  2X6B A;  5H9C A;  2X0L A;  3KG2 A;  3W7W A;  2WLH A;  5KUM A;  1V54 C;  3CCJ V;  2Y48 A;  2IH3 C;  3ZIA G;  4DO2 A;  4TWK A;  2Q69 A;  2HVK C;  3ABL B;  3ASN B;  1AI4 A;  1OCC B;  1GM7 A;  1M56 B;  4CBC A;  5C93 A;  1H38 A;  1KEC A;  3JD0 A;  1EZJ A;  2DYS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...