1FS0G

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
219
Chain Sequence
KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
total genus 81
structure length 219
sequence length 230
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fs0G02
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 1fs0G01
2HLDG 4UV9A 3OAAG 2WPDG 2H94A 2Z5UA 2JIZG 5LBQA 4YXWG 2IW5A 3FKSG 1W0JG 2X0LA 4CZZA 2XAGA 1E79G 4ASUG 1MABG 2V1DA 1OHHG 3ZMSA 4KUMA 4UXNA 1BMFG 4XBFA 2WSSG 2R9IA 5LGTA 2W6JG 3ABTA 3OFNG 3ZMZA 2XAHA 5LHHA 1E1QG 1COWG 3OEEG 5L3BA 2QE7G 2XOKG 4BAYA 3OE7G 1W0KG 4Z1MG 4UVCA 1H8EG 3ZN0A 2JJ2G 2JDIG 5LHIA 3ZN1A 3OEHG 5LHGA 2HKOA 2Y48A 2Z3YA 5H6QA 4UVBA 2DW4A 3ABUA 4UVAA 5L3CA 5DN6G 1E1RG 2V7QG 3ZMUA 2CK3G 4UV8A 5L3DA 4TT3G 2EJRA 5FL7G 1FS0G 5LGNA 2UXXA 1EFRG 2W6IG 3ZMTA 5L3EA 5L3GA 4TSFG 5LGUA 2XNDG 2JJ1G 2F43G 2XAFA 2UXNA 2XASA 2XAJA 5H6RA 3ZIAG 5L3FA 3ZMVA 1NBMG 1H8HG 2XAQA
chains in the Genus database with same CATH superfamily
1KECA 4QGCA 4DUZO 1PKNA 3W7WA 2B9ZA 2OTLV 3T4ZA 3W7TA 2IM9A 3GVMA 4DR3O 2CDYA 4J7JA 3LDEA 3BVOA 1EN6A 5IJ0B 1YJ9V 4QG8A 2EJ7A 4HZ3A 3RVZA 1AP6A 5CBHA 1PNKA 4GX0A 5CA3A 5IYDO 4JF3A 2K1EA 1SA0A 2IU3A 2WSSG 1WB7A 4O4JA 1BZKA 1H2KA 4I50A 1Q6HA 3ZMZA 3W7SA 3ZRSA 4B3SO 1W0KG 1Y67A 3T1HO 2L35A 3AG3C 3T07A 3T2MA 4PJ0Z 4JI4O 1IBMB 2EIJC 5CA1A 1Q90D 1PD3A 5H6QA 3R66A 1D5AA 2D2CB 3CCRV 3I5DA 3UT5A 1Y74B 1PKYA 4WFGA 2UXCB 3CRRA 2QDOA 1BQZA 5IE9A 4LF7B 2Q68A 3TGUH 1EN4A 3QV7A 5CBFA 4DV1B 1NQTA 1FPOA 4DR3B 4TT3G 2KSDA 4QJFB 2LO1A 1WJZA 1URFA 1YCIA 4X64B 4TQFA 4LF9B 2W6IG 3H1HH 4DV4B 2UUCB 2JJ1G 4JI7B 4MTXA 1AR1B 3MAQA 2CH7B 2W0FC 3M99B 4ZHQB 4X65O 2QEXV 3ZIAG 4OPHA 4I4TB 1ZX3A 3JASA 4JTDB 3CMEV 4AILC 1FKAO 1IBLO 4JAAA 4ABMA 2HVJC 1MG1A 4B7KA 5B1OA 2A9HA 1HNXB 3ABMC 1N34B 4B2DD 5JH7B 4LC1A 4N23A 3N2KA 4TV9B 4JASA 5KAFZ 2VQEO 4LWSB 3E22A 3WFVA 2P67A 1W0JG 1GO3F 3RGBA 4WCEV 2D3OW 3K9AA 3CP1A 4PA3A 3AK1A 4RAIA 1M5IA 3Q4HA 4UXNA 1V55C 3SYCA 1US6A 2QTOA 1P4RA 3EVKA 5E1AC 4B08A 4XDJA 4DUZB 4BAYA 4HNAB 4Z1MG 3ZN0A 2ZIOA 3L9DA 5LHIA 1NTKH 4X65B 4LF6O 4ICGA 4J11A 5EC2C 4EFEA 4DV3O 2YIDA 4DUYB 3AG1C 1SQQH 1QCEA 1M4UA 5IY5B 1FJGB 2L6LA 1N36O 3P32A 5BZBA 2GBOA 1VQLV 5FPRA 3QF7A 1Y6XA 4LBEC 4GKJO 3LSQA 3JARA 4JI5O 1K9MW 2GDSA 3D3IA 4CC6A 4DV2B 5FL7G 4LF8B 3K3WA 4UCVA 2OCHA 2W0XA 2JRIA 4HNAA 4TV8A 4JI3O 4JI8B 4X1IA 5CA0B 1H38A 3SGIA 2F43G 2WLIA 2AXTZ 2ATKC 3T1CA 3K79A 4UCTA 1QQCA 5BR8B 5D5QA 5KMGB 3ETDA 2LW7A 4FFBB 4YJ3B 1R3JC 1IBLB 3ZX6A 3SPCA 1PPJH 3W7XA 1HNWO 5A9GA 1D2DA 2XT9A 3CB2A 3K08A 2UUAO 2ZM6B 2ZR2A 3DSQA 3LDDA 1ZL8A 2Y4UA 2HVKC 2ZNJA 3FB5C 5EC1C 4X8AA 4R50A 2OIGA 3GQYA 1EM1A 1J5EB 4KRZA 3B09A 3ETEA 4FLYA 4GKJB 1WN7A 3EOEA 3LSSA 3D8CA 2JEUA 2W6JG 5B1NA 3CJHA 4IL6Z 2F4VO 1G4YB 3JD2A 3ZJZA 3ABKC 2Q8VA 2PGGA 4I9WA 1JOYA 3G6EV 4O2AB 3D36C 3EHBB 1U96A 4E4EA 4DR5B 2QKAA 1XQ8A 1YXBA 4MTOA 1K8AW 1S77D 2E3CA 4LF4B 4QPKA 5EYPA 1EZJA 3VQXA 2OTJV 3UKMA 4EB6B 4KHPB 1H2NA 2HHHB 2ITDC 5L3CA 4XDLA 1J5EO 1PNLA 5IYZA 3RYCA 1QHTA 2V7QG 3CC7V 1NJIW 3DTUB 3CWBH 4YJ3A 1Z2GA 2A3QA 2Y4TA 3A0BZ 2JS3A 3K9SA 3OGCC 1R73A 3ZMTA 3X2QB 1I94B 5L3EA 5JWPA 2XNDG 5JQGB 3LDCA 4JV5O 2DMXA 3CC2V 2N05A 2YI8A 1P49A 2Q67A 2R9RB 1RM1C 5B1BB 1HWYA 3SPJA 2LJ2A 1BGYH 5K1PA 4N21A 4JI7O 4JPRA 4DR1B 2UUCO 3K58A 1Q6UA 3T4DA 3CCEV 4MVQA 4J7KA 4O2AA 4U7OA 4NTXA 2X0LA 2Q73A 1IBKO 4MTFA 1WP7A 3H1JH 2HR3A 5KX5B 1AR5A 4LFAB 4CS2A 2E28A 5KUMA 3LNNA 3ZS8C 4LF7O 3BY6A 4IIJA 1IXMA 5J2TB 1R1BA 3GG8A 3ABKB 5EZYA 4DV3B 1K3EA 4OX9O 4KCUA 1V9PA 2BOBC 4FM1A 5LYJB 1S5HC 1PKMA 3OE7G 5D5PA 4IHJA 1H8EG 2XHBA 2P90A 4RQEA 4FLVA 3OEHG 2R72A 3SPGA 5C8YB 3JASB 4WFHA 5IDJA 1AI4A 5LXTA 2QWNB 3STZC 4UVBA 1M56C 4JI2B 1AI5A 4MTGA 3U11A 5LOVB 4K8XA 4UCUA 3APQA 1N0NA 3A0RA 3CCVV 3CJHB 1ORQC 1NVPD 1FXVA 2CK3G 2QKSA 1QLEC 2ZDIC 1O9GA 2EJRA 4ZOLA 3HPLC 5EZYB 3KHDA 2PI4A 1FFXB 3H6OA 2AZ0A 3KCXA 2R70A 1FAFA 1IDSA 5BMVB 4FLWA 4DR7O 1WB8A 2VGBA 4YNGA 4R7CA 4JI1O 4X9QA 2JGDB 2HJFC 4PHZA 3HKBB 3KTXA 1VP8A 3CCQV 1SQVH 2RN9A 2DN9A 1K7DA 3ZEDA 4TWKA 3HB3B 1KU9A 3E83A 5LMNO 2Z5UA 4LF5B 4YXWG 1R3LC 4DV0B 3CYOA 2ADPA 2X7RB 4I55A 1W59A 3KCYA 4DRXB 2M7WA 2XAGA 1F23A 3JAWB 5CBGA 2OYQA 4WF9V 1AB3A 4DR4B 3C90A 1KKCA 4DYLA 2XUMA 4JYCA 4G1NA 2LFRA 1RPRA 3ABTA 1Q3EA 3ZBHA 1NH2D 1E1QG 1RP3B 1FXKA 4GKKB 2WLLA 3WU2Z 5BR8O 3T1YO 4RO2A 2HHHO 4J9ZB 2VQFO 2KQXA 1VQ8V 5JVDB 1SS3A 4WFFA 2DWEC 1T57A 2PF4E 4UB6Z 2NR5A 2A06H 4X20B 5B1AC 4BW5A 3J7AU 3Q4HB 4NVPA 4KCVA 4PDLA 1KKDA 4LH6A 2JVDA 1DF5A 3UO3A 3P3NA 3CD6V 2KKWA 1JCHA 4D7SA 4L87A 4KS0A 3KG2A 1FD9A 5IJ9B 4AHCA 3SYAA 1XMQO 4DR6O 5DEDA 1OCCC 1QLNA 3WB1A 1QNMA 5L3GA 2P4VA 1YEWA 3F5TA 1WLEA 2YSUB 2EIKB 4U7NA 4LWSA 4PA6A 2Q6AA 4ZHQA 1LR1A 1OCCB 3L74H 1WPXA 2IJIA 2F4VB 2WLJA 4MVSA 1NU1H 4FLZA 1KC8W 2WLLB 3SPIA 1SQGA 5HFMA 4YHHO 1A5UA 3ZHQA 4HYWA 2DYSC 1W2BU 2YEVB 1B3QA 3E2EA 2LGQA 1GM7A 5LMUB 1IXBA 1WNSA 1VQ5V 4JAVA 1Y74A 2DWDC 1YIJV 4DR4O 5IWAB 2A7WA 1M56B 4TOIA 1F7YA 3FB7C 3G80A 3OTOO 1QU7A 5LGTA 2E76B 2VWKA 3JCUZ 4DV0O 3MA8A 2GTSA 1HP8A 2DYRC 3OEEG 1VP7A 3UT5B 3JARB 3K06A 2OT5A 1BS3A 1SZTA 1THZA 4YIPA 3JSLA 4UVCA 4YIOA 3C3TA 2Q0AA 4KP4A 1MSDA 1R6NA 3FYIB 1VQ4V 1K5QA 4FLUA 2DW4A 4I0XA 4IYHA 3T1HB 4QE9A 1GN6A 4AQYB 3JD4A 4NXNB 4X89A 2RQ6A 1N33O 3CE2A 1BHBA 4FXJA 4JI6O 2DE0X 3CS5A 4QE7A 4UFZA 5JJJB 5GONA 3ZHUA 4O4LB 4K3AA 2CUGA 1SETA 1YSCA 4GLXA 1GN3A 1Q5OA 4J42A 5H9CA 1JR9A 4Z1VA 3OTFA 4JYBA 2OWOA 1K33A 5JCOA 4JI0O 2CTPA 2WLKA 3ZHTA 2B5UA 3ETGA 3HKDB 3ZCCA 1A3XA 2NN4A 2BSKA 3CRAA 1WPBA 4PA4A 3OAAG 1BQ0A 1PKLA 1BCCH 1CEZA 1S5JA 1Q43A 5C93A 3WB2A 1VQPV 5GONB 3W7UA 3GB7C 4B3TO 3B40A 1OHHG 4AQYO 4H33A 5CA0A 3ABMB 4XBFA 1HNZB 4PV1B 4KFMA 4DV5B 5DM6V 1VQNV 2DYRB 1TUBA 3SJCC 3FFQA 2XAHA 3ZHSA 5LHHA 1SKVA 3K57A 2DJVA 3THOA 3ML0A 5F2VO 4MVMA 3BPZA 1L8DA 1R3IC 2XTAA 3RYIA 3QVNA 2ZD9A 1P7BA 1XHXA 3ZN1A 1E0TA 2FTKA 2FYUH 4PDVA 2Y48A 2ZXWC 2EZPA 3E0VA 1AJPA 1Y76B 5GTHZ 1IURA 1PP9H 2P4KA 5DN6G 3K0DA 2QM4A 2YEVA 2BOCC 1SZXA 3ZRXA 1QLEB 4R6ZA 1OCOB 1M9NA 2QWQB 4D6TH 3SRHA 4F6RA 3JD1A 5LMUO 1YJWV 3N27A 3HQOA 3MHHC 2EINC 3ABLB 3OMAB 4I9QA 3U2ZA 1SRYA 4WBNA 4TSFG 4JI5B 1M57B 1M57C 3OGIB 4J9YB 2B1GA 5J2UB 1KMIZ 4MVUA 4WJ8A 2XAJA 5H6RA 1F3XA 2PYLA 4LF4O 1TUBB 1AP5A 1MNGA 1HW7A 1K5SA 3HQNA 1S5LZ 5JH7A 5KA6A 3K5MA 1H2MA 2ZT9B 4MT8A 4FM2A 4FMTA 1RM1B 1GMGA 4JTCB 4DR7B 5LBQA 1EZVH 3IJ4A 3QTGA 4JZGA 4PD4F 4Z2WA 2B1IA 4B3MO 3OMNB 5C8YA 1JFFB 4UCSA 3DXRA 4KCTA 2VS0A 4ZI7B 5IYBO 2BSKB 4O4IB 4QGPA 3FAVA 2Q7HA 2F1MA 2Z0AA 1PM9A 3J80N 2CTWA 3QTCA 3OTOB 1VF6A 2YI9A 4DK0A 2ZM6O 2Q0OC 3B8MA 1Q86W 3STLC 4LNUA 4FLXA 1JPXA 2QE7G 2ZR3A 4JGSA 1VEWA 4X20A 2WWWA 1T5EA 2OCCB 4UB8Z 1EN5A 4F6RB 4FLTA 5BY1A 3NXSA 2EILB 1D5NA 3E8BA 4JYAB 3D36A 4I0XB 1N32B 4K0KB 1N33B 4PI2A 3IS4A 2NNUA 4FPPA 4YY3O 2UU9B 3VQWA 4FIPC 2VRZA 1XOUA 4HAMA 2ZCEA 1ZWIC 1FXKB 4DRXA 3CCJV 2E75B 1ZAUA 1K34A 3LUTB 3S3XA 4B3RO 2KB1A 5H2FZ 4X66O 4EEQA 3K03A 2UXNA 1JMKC 3SR2C 1K73W 1FFXA 4DV4O 2XAQA 2R9AA 4HBNA 5FPOA 2P7TC 5IYZB 2YDEA 2ARHA 3IGAC 4DV6O 2WLHA 3UM7A 2F66C 3A0HZ 3ICXA 1WA8B 4JAUA 4TUYB 5LOVA 1LUVA 3L70H 3H1KH 1I5XA 2ODMA 4GZRB 5BXZA 3DGEA 3OM3B 3FYEB 1H2SB 3EXAA 1PV0A 1XI1A 1IBMO 4NTWA 1S72V 2F93B 2EBOA 3BJFA 1T5AA 4G2KA 1K4DC 4B3SB 1IX9A 2BCCH 4X1KA 1H2GA 2YIBA 4JTAB 4ZOLB 4X1KB 4PA7A 2JJ2G 4FFKA 1NTZH 3L75H 3TJTA 2HG5C 4IIJB 5JJNB 1SQFA 2CH7A 4DV7B 1BL8A 2ZKOA 3QG5A 4OX9B 3N2GA 5CMUA 1S76D 4G28B 1V54B 3K5OA 4J41A 3ZHRA 3G2GA 3AG2C 1JFFA 5ITZB 1GM9A 2GHYA 2QWRB 2ZDIA 1I5YA 3ZMUA 3AG7A 3K5NA 2G50A 5L3DA 5B1BC 5CB4B 4FXFA 4X64O 1ZL8B 1OCRB 2PY5A 4RQFA 4W4LA 2Y0PA 5K1XA 1Q6IA 3E0WA 3OW2U 1Z5VA 1PL0A 2YICA 3WG7B 4PI0A 3E35A 2EINB 4LR3A 2VGIA 3I55V 5JQGA 4X62O 3BHPA 1CPYA 1K97A 2PI5A 1NBMG 4JI2O 4NKGB 1WAZA 3T1YB 1F51A 3H01A 3B8NA 4UV9A 1NI8A 4YHHB 1GTOA 5AG2A 2YIBD 4YY3B 1J95A 4OXSA 2ZXWB 1M90W 3CX5F 4YJ2A 4U3JB 1VIBA 4CH6A 1G6UA 2ZIMA 5GTIZ 1P7GA 2NLJC 1MABG 4WFEA 1YZBA 1XNQB 1VARA 4H13B 1VF5B 1QR9A 4JI6B 4E2LA 3HKBA 1IZ3A 3JYCA 4FZ0A 2JEXA 3E8FA 3N25A 2YIAA 3U0ZA 3TXQA 4MSWC 4IMAA 1AI6A 3CHXA 5KHGA 4KXRA 1KQSU 4X62B 5LA6B 2A79B 2HKOA 1XL4A 2QGNA 2CGNA 3LNMB 4MVRA 3BA9A 1A49A 1AQFA 4R8CA 2WAMA 2P6JA 3BFRA 4O4LA 4FVMA 1H2LA 2OIEA 3QO7A 3VQVA 2ZE6A 2UUBO 4B3RB 4JV5B 1DLBA 3ETQA 1B6QA 1F4NA 4PELA 3AG4B 4GT1A 1LNQA 5LGNA 1VMGA 1BSMA 4GX1A 3TCUA 2F95B 4FFBA 2H3OA 3BJTA 4JYAO 2UXBO 2ZQMA 5LGUA 1XMOO 4ZI7A 4FJCC 5IYCO 2XASA 1N34O 3IAYA 4DR2O 2Y69B 4RUEA 4TUYA 2QA4V 2AZ2A 4H44B 1AILA 3JD0A 1G8MA 2BTQA 3PP7A 1I94O 4ZKIA 1DGSA 1SQXH 1I0HA 3G67A 3UO2A 4G27B 3LSUA 1VF6C 4LH7A 4RWUA 4Q20A 5LP6B 1KYOF 1XEQA 1BE3H 2IW5A 1KBHA 4X1IB 3PJSK 1Z5WA 2GUZA 4CZZA 5KA5A 4LF9O 4QG6A 1N8RW 4K35A 2PTMA 4WBNB 2DYSB 3OD4A 1SQPH 2ITCC 2EIJB 3HR0A 3IC7A 2YUAA 3PN1A 4MVZA 2ADQB 5E79Z 1R3KC 5B66Z 1COWG 4MW8A 2DQ0A 3CCMV 1GN2A 3CSXA 5L3BA 3RWRD 1BHAA 3MDSA 4IT5A 2K9PA 2ZE7A 1MZEA 4UCOA 2ETNA 5IY5C 1VQKV 2Y69C 3ZRVA 1SESA 1HNZO 1PL4A 5J9PC 4X1YA 5LL6Y 1JJOA 1OCZB 1FFTB 2QSAA 3SYOA 5KHJA 2LGWA 3DC5A 3TXSA 4U3FH 2PZSA 1O9HA 3HKEB 4JZ2A 1FXHA 2HJDA 4CH5A 2UUAB 1XNRO 4QIWF 4NTYA 1YITV 3CRQA 4LFAO 5A2QN 3WB0A 3RVYA 1L1FA 4CH3A 4J10A 3WG7C 1A32A 2QTSA 4OGQB 4JI0B 4GX5A 3JSNA 1DK1A 1AR4A 5CN0A 4DR2B 1FYJA 4HYOA 3DXRB 1FJGO 3G4SV 1RPOA 2UXBB 2MW2B 3JATB 5KHIA 4H0LB 3FX7A 2QWOB 2WLNA 2WPDG 1RFYA 4EFBA 3RYHA 4MVOA 1NVPB 4X66B 4O4HA 1NR7A 5JVDA 4NXNO 4DV5O 1GRJA 2Q7GA 3RW0A 1VQMV 1IBKB 1MA1A 3JAWA 3OR7C 3L73H 4O2BB 1S0VA 1MMMA 1NT2B 1E79G 2QJ1A 3ASOB 4DXWA 1GAXA 3ZMSA 3BAAA 4LP8A 3S3WA 4WFAV 5J2UA 2GV9A 1OCRC 1XNRB 2RNBA 4U3JA 2IJJA 2ZINA 5HFLA 4XDKA 2RDCA 2Q7EA 3AK3A 1NTMH 4I55B 1QVFU 1X59A 4IP7A 2DQ3A 1AVMA 1TVKB 4EB6A 4FK5C 4GKKO 1YTFB 3CPWU 5JJEB 1KP3A 3K5LA 1YJNV 5EBLC 2UXDB 1TGOA 3JALB 4CS4A 1K4CC 4L8JA 3RYCB 5LP6A 1XUQA 4CBCA 5IT9N 4AI8A 4UV8A 4B2DA 1HR0O 2PYJA 3N2GB 1VQ9V 2IH3C 3SPHA 4B7EA 1XREA 2YXHA 3RN4A 3SJAC 3E8HA 4LNUB 4B3MB 1Y4MA 3UQ8A 2LW1A 3GWKC 2IJKA 1GK9A 4P2ZA 3A2FA 4DV1O 4DR5O 3E89A 5EBWC 4QG9A 3H9VA 2Y0IA 1YDXA 1QVGU 2CGOA 2N74A 5B5EZ 2EZOA 1CXZB 1L0LH 2ZNIA 4PA9A 3ZMVA 3AG3B 4O4IA 2X6AA 2RMKB 2O57A 5FLXN 2Q5ZA 4J80A 1YVWA 2DOSA 5KUKA 3VOUA 4DV7O 2AHYA 2JIZG 2EIKC 3RFRA 3CMAV 5DECA 1B06A 1X4TA 3N2KB 1WA8A 4IHJB 3HKDA 4HYVA 3CCUV 3ASNC 1ROPA 2ZE8A 4K0KO 3GWOA 1HR0B 1S3JA 4LFCO 3FB8C 3C3SA 3JAKB 5LA6A 3AG4C 5B1AB 4DK1A 4PDMA 4TV8B 3TK1A 2FKXA 3OFNG 4GYCB 4MS2A 5IJ9A 1MOFA 5LYJA 2P5OA 3B77A 5KHHA 2F23A 3JAMN 1KB9F 1UFIA 1ZJHA 4GX2A 3QO8A 2YXLA 2JDIG 2CAZC 5J2TA 2Z3YA 1PNMA 1G1XB 4C7UA 3BA8A 2C2AA 4UVAA 1EBOA 4NYKA 4NXMB 2P06A 4NR1A 3NR7A 1XL6A 1AJQA 3RYFB 1P84F 2JGUA 3R65A 4LFBO 3L72H 2PUSA 2UXXA 3CRCA 1ZUQA 3EFFK 1Q82W 1UJWB 2EILC 3CRMA 4OPAA 2UXCO 1SF9A 3QNEA 1YF2A 3P3PA 5TISZ 3BCCH 1R6KA 4W4KA 4DO2A 5B3SB 3AG1B 4IYIA 4UUJC 3H1IH 4I50B 5L3FA 2HP8A 5ITZA 3OT7A 3B2EE 2AGAA 5EIBC 1XHZA 2A0LA 5BMVA 5CB4A 2QWPB 1I08A 2H94A 1JA8A 1A3WA 3ZRWA 2VWJA 3SYQA 1RSOA 3J81N 2JGDA 3FKSG 5H5NA 4FM0A 4BIUA 2Q69A 2WA4A 4JI8O 1ENVA 1MSWD 4ZBMA 4ASUG 3E86A 4A5UB 4P9OA 3F7VC 1E0UA 4DV6B 1B04A 4LF5O 3QV8A 5LXTB 3AEIA 4BR6A 4KHPO 3MHSC 1WP8A 2UUBB 3B4SA 4UCRA 1N4CA 1ZSPA 3JD3A 3FAVB 1XMOB 3O9OA 2QKCA 3IC9A 1SERA 3VBBA 3JALA 3E8GA 3ABUA 4BW9A 1ZTEA 3ZHVA 3X2QC 1XMQB 2AW9A 3SRKA 3RBZA 1KUQA 3BABA 2CTQA 5KX5A 3K59A 2IH1C 3L71H 2GSMB 3ASOC 2YS8A 2FL4A 2Q9LA 5EIBD 1AI7A 3KKYA 3CEIA 1KP2A 2AHZA 4WFBV 3MD0A 1Q8IA 2WA3A 3ASNB 4F4LA 2VGFA 1UPGA 2UXDO 1GM8A 1HDJA 1VQ7V 3U10A 2RCVA 4JI4B 3CXHF 2VQEB 1K92A 3IFXA 1XILA 3HKCB 4I7ZB 5GW7A 5IJ0A 4DW0A 1H8HG 2KG7B 4O2BA 5EK0A 4BIOA 1NS1A 2HLDG 4QPJA 3CC4V 1U97A 1M93A 4BWAA 1AROP 4YJ5A 1OCOC 3HQPA 1GN4A 4CS3A 3RT3C 3SRDA 2LQTA 4NB5A 3SYPA 3FD9A 3SRFA 2KG7A 2EIMB 2OCCC 3TETA 1JQ0A 3HKCA 1V54C 3M8AA 2E74B 2E5LB 2V1DA 3RYIB 1Y66A 4ZIBA 4P9PA 3F7YC 4KUMA 1XBLA 3D3QA 2MK3A 1TAEA 1Q81W 2R9IA 3GR4A 1DTOA 1DF4A 4CH4A 1N36B 2HFEC 4TQDA 2YXYA 3OR6C 1OZ0A 3CXCU 4DR1O 3M7MX 1OV9A 2EX3A 1JJ2U 1IVSA 4P30A 3F5WC 1GH6A 1Q7YW 4JI1B 5LHGA 4GCZA 3G71V 4QNHB 1YI2V 1YTFD 4K8ZA 5EYPB 3APOA 2GTAA 2JK5C 3I56V 3T0TA 1R6TA 1VQ6V 2N04A 2LFSA 4B3TB 1E1RG 1NR1A 1KD1W 4KL1A 3K0GA 1SC5B 4FZ1A 4TV9A 4BIZA 4LCUC 4LFCB 5KMGA 3A8TA 1XNQO 2FB5A 2JS5A 5LP6C 1VQOV 2V4DA 5KAIZ 2HEPA 1TUEB 2EIMC 1OJHA 1M1KW 1AJNA 4RPPA 3OUFA 1OCZC 3H1LH 2M6YA 2XAFA 4X1YB 3DC6A 4I5SA 2EULA 3OUSA 5LMNB 3ZRWB 1SQBH 2IJHA 1NZ6A 3BRCA 3SJBC 3G6BA 5KHKA 3HKEA 2ILMA 4YJ2B 4D7TA 1Y76A 1XDCA 2GUZB 1YHQV 1NH2B 3KZIZ 3CCLV 2WLMA 2Q4PA 1QBZA 2CE4A 2VGGA 1RSOB 2IBZH 5CA1B 4JYYA 2LP7A 4F6EA 4LF8O 4DRSA 4CC5A 2RJZA 3QV6A 4IGGA 1FXKC 2ZE5A 3K04A 4GUNA 2CTRA 2QM7A 1TVKA 3JCZA 4LFBB 2WLIB 1MZFA 4NXMO 3RYFA 1BMFG 2UU9O 4DUYO 3SJQC 2X6CA 1SA0B 1QR8A 5KLVH 3QV9A 2BTQB 4O4HB 3UCSC 1F4MA 1HNWB 2XOKG 2H8PC 1I7FA 1TA8A 1ZLZA 1NKDA 4X88A 5JCOC 1HNXO 2VQFB 3JAKA 2QR4A 3OMIB 4O4JB 1JX9A 3VQYA 5FNVA 3AK2A 2BE3A 1VF7A 3SDLA 4H37A 1BT8A 3QO5A 3CCSV 2QM8A 3FB6C 4KCWA 4RUFA 5IWAO 4JI3B 1N32O 5B3SC 1V55B 3P30A 4MW3A 3O65A 4I4TA 4DV2O 1L0NH 2YC0A 3ABLC 1FS0G 3BEHA 1GKFA 4DR6B 1EFRG 2G38A 3RYHB 3ME3A 2E5LO 4EKWA 1LUWA 2FMLA 3T05A 2X6BA 1PKXA 2P22C 3JATA 1CP9A 3AAGA 5FNVB 1N0JA 4JPGA 1JVMA 4J7ZA 2IU0A 4DW1A 1F3WA 4PDRA 3E22B 4Q6GA 2BTOA 4LF6B 3AG2B 5EBMC
chains in the Genus database with same CATH topology
1KECA 1K7DA 4TWKA 3W7WA 5KUKA 2OTLV 3VOUA 2P7TC 3HB3B 3T4ZA 3W7TA 3E83A 2AHYA 2Z5UA 2JIZG 2EIKC 3IGAC 3CMAV 2WLHA 3UM7A 4YXWG 1R3LC 3CYOA 3LDEA 2X7RB 4JAUA 1YJ9V 4HZ3A 3RVZA 2XAGA 2M7WA 1F23A 5CBGA 3CCUV 1I5XA 3ASNC 1ROPA 5CBHA 1PNKA 4GX0A 3DGEA 4WF9V 5CA3A 3GWOA 5IYDO 1S3JA 4JF3A 3OM3B 2K1EA 3FYEB 3FB8C 4JYCA 3AG4C 2IU3A 2WSSG 5B1AB 2LFRA 1S72V 4PDMA 1RPRA 3TK1A 2EBOA 3ABTA 3OFNG 3ZMZA 4MS2A 3W7SA 1NH2D 1MOFA 1E1QG 1FXKA 4G2KA 1K4DC 3B77A 2WLLA 3ZRSA 4RO2A 1H2GA 1W0KG 4J9ZB 4JTAB 1VQ8V 4PA7A 2JJ2G 4WFFA 3AG3C 2DWEC 3QO8A 4GX2A 3T2MA 2JDIG 2HG5C 2EIJC 5B1AC 4BW5A 1BL8A 2Z3YA 1PD3A 1PNMA 5H6QA 5CMUA 1S77D 3CCRV 4PDLA 1S76D 1KKDA 2C2AA 1V54B 4G28B 4UVAA 4WFGA 1EBOA 3AG2C 1DF5A 1GM9A 2Q68A 3CD6V 1JCHA 2GHYA 2ZDIA 1I5YA 3ZMUA 5CBFA 1NQTA 1XL6A 1AJQA 4L87A 5L3DA 3KG2A 5B1BC 4TT3G 4QJFB 3R65A 1OCRB 4RQFA 2UXXA 3SYAA 3EFFK 3OW2U 1OCCC 2W6IG 1Q82W 1PL0A 1QLNA 1UJWB 2EILC 5L3GA 3WG7B 1WLEA 2YSUB 3E35A 2EIKB 4U7NA 2EINB 2JJ1G 3QNEA 4PA6A 2Q6AA 4MTXA 3I55V 1AR1B 2W0FC 4DO2A 1R6KA 3M99B 3AG1B 1OCCB 4UUJC 5B3SB 2QEXV 3ZIAG 5L3FA 1CPYA 1K97A 1WPXA 2PI5A 2IJIA 3CMEV 4JTDB 1NBMG 2WLJA 4MVSA 1KC8W 2WLLB 3SPIA 2HVJC 5HFMA 1F51A 1MG1A 3H01A 2A0LA 3B8NA 4UV9A 5B1OA 1GTOA 2A9HA 2DYSC 2H94A 3ABMC 4LC1A 3ZRWA 4N23A 1W2BU 2YEVB 3SYQA 1J95A 4OXSA 2ZXWB 1M90W 4JASA 3E2EA 3WFVA 1GM7A 2P67A 1W0JG 3FKSG 1GO3F 4BIUA 1VQ5V 4JAVA 4WCEV 2DWDC 1YIJV 2Q69A 3K9AA 2D3OW 3CP1A 1ENVA 4PA3A 4RAIA 1MSWD 4ZBMA 2NLJC 4ASUG 1MABG 4WFEA 1M56B 3FB7C 4UXNA 1V55C 3E86A 1QR9A 4E2LA 4P9OA 3SYCA 5LGTA 3JYCA 3F7VC 2QTOA 2JEXA 3E8FA 1P4RA 3AEIA 3MHSC 2DYRC 3OEEG 4MSWC 3K06A 5E1AC 1AI6A 2OT5A 1SZTA 1THZA 4XDJA 4BAYA 3JD3A 4Z1MG 4UVCA 3ZN0A 1KQSU 5LHIA 4KP4A 1R6NA 5EC2C 2A79B 2HKOA 1XL4A 1SERA 3AG1C 3FYIB 3VBBA 1VQ4V 1QCEA 1K5QA 3LNMB 5IY5B 4MVRA 2DW4A 1K8AW 4R8CA 2WAMA 2P6JA 3ABUA 3E8GA 3P32A 3X2QC 4QE9A 3QO7A 5BZBA 3RBZA 1VQLV 4LBEC 3JD4A 3LSQA 4X89A 1DLBA 2IH1C 1K9MW 2GSMB 3ASOC 1B6QA 3D3IA 1BHBA 5FL7G 1F4NA 4PELA 4QE7A 3AG4B 4GT1A 1LNQA 3K3WA 1AI7A 5LGNA 1KP2A 2AHZA 4GX1A 3TCUA 4WFBV 3MD0A 3ASNB 4F4LA 2ZQMA 1SETA 1GM8A 1YSCA 5LGUA 1VQ7V 1H38A 5H9CA 2F43G 2WLIA 4FJCC 5IYCO 4JYBA 2ATKC 2XASA 3T1CA 3K79A 1K92A 1K33A 3IFXA 2Y69B 2WLKA 5GW7A 4RUEA 3ETDA 2B5UA 1H8HG 3ETGA 1R3JC 2QA4V 5EK0A 3JD0A 3ZCCA 2HLDG 1G8MA 4QPJA 3SPCA 3CC4V 1AROP 4ZKIA 3W7XA 4PA4A 3OAAG 4G27B 3K08A 1OCOC 4Q20A 1CEZA 2ZR2A 3LDDA 5C93A 3SYPA 2IW5A 2HVKC 3FB5C 5EC1C 1VQPV 3PJSK 4X8AA 4CZZA 2EIMB 4R50A 5KA5A 3GB7C 3W7UA 2OCCC 3TETA 1JQ0A 1N8RW 1V54C 2V1DA 1OHHG 3ETEA 1Y66A 4H33A 4P9PA 3F7YC 2DYSB 3ABMB 4KUMA 2ITCC 4XBFA 2MK3A 3LSSA 1Q81W 2R9IA 4KFMA 2EIJB 2JEUA 2W6JG 3IC7A 1DTOA 5B1NA 5DM6V 1VQNV 1DF4A 2DYRB 4MVZA 1G4YB 2XAHA 5LHHA 1R3KC 2HFEC 3JD2A 3ZJZA 3ABKC 1COWG 3ML0A 3OR6C 4MW8A 2DQ0A 3CCMV 5L3BA 1OZ0A 4I9WA 3CXCU 1JOYA 3G6EV 4MVMA 1BHAA 3EHBB 1R3IC 1JJ2U 4P30A 3F5WC 2ZD9A 5IY5C 1VQKV 1Q7YW 2Y69C 4MTOA 1P7BA 3ZRVA 3ZN1A 1SESA 4GCZA 2FTKA 4QNHB 5LHGA 4PDVA 3G71V 2Y48A 5J9PC 1YI2V 1YTFD 4QPKA 1OCZB 2ZXWC 1FFTB 1EZJA 2EZPA 3SYOA 2JK5C 1AJPA 3UKMA 3I56V 2OTJV 2ITDC 1VQ6V 5L3CA 4XDLA 1PNLA 2LFSA 5DN6G 1E1RG 2V7QG 3K0DA 1NR1A 1KD1W 2YEVA 3K0GA 2BOCC 3CC7V 4BIZA 1NJIW 1FXHA 4LCUC 3DTUB 1VQOV 3ZRXA 1QLEB 4R6ZA 1OCOB 1M9NA 1TUEB 2EIMC 3JD1A 1AJNA 1YJWV 1M1KW 3OGCC 4QIWF 1R73A 3MHHC 3OUFA 1OCZC 1YITV 2EINC 3ZMTA 3ABLB 3OMAB 3X2QB 1SRYA 5L3EA 4TSFG 3RVYA 1M57B 1M57C 2XNDG 2XAFA 4J9YB 1L1FA 2B1GA 4I5SA 3OUSA 4MVUA 3WG7C 3LDCA 4GX5A 2XAJA 3ZRWB 3CC2V 5H6RA 2IJHA 5CN0A 2Q67A 2R9RB 1RM1C 5B1BB 1HWYA 4HYOA 3SPJA 1K5SA 1YHQV 4N21A 3G4SV 1NH2B 1RPOA 3CCLV 2WLMA 5KA6A 4JPRA 4MT8A 1QBZA 2WLNA 2WPDG 2LP7A 1RM1B 4FMTA 3T4DA 1GMGA 4MVOA 4JTCB 3CCEV 4MVQA 5LBQA 1NVPB 1NR7A 1FXKC 3K04A 3RW0A 2B1IA 4U7OA 2QM7A 1VQMV 3OMNB 2X0LA 3JCZA 3OR7C 4MTFA 1S0VA 2WLIB 2HR3A 1E79G 5IYBO 3ASOB 4DXWA 5KUMA 4LP8A 3ZMSA 1BMFG 3BY6A 1IXMA 4WFAV 1OCRC 3SJQC 2X6CA 1QR8A 3ABKB 2IJJA 1K3EA 3B8MA 5HFLA 4XDKA 1Q86W 1F4MA 3STLC 1JPXA 2QE7G 2BOBC 2XOKG 2H8PC 2ZR3A 1S5HC 3OE7G 4JGSA 1NKDA 4X88A 1H8EG 3OMIB 2P90A 1QVFU 2WWWA 4RQEA 3OEHG 1JX9A 2DQ3A 2OCCB 3SPGA 4WFHA 5IDJA 1AI4A 4H37A 4FK5C 4UVBA 3STZC 1M56C 1YTFB 3QO5A 3CPWU 1AI5A 4MTGA 3CCSV 1KP3A 2QM8A 3FB6C 3NXSA 1YJNV 5EBLC 2EILB 4RUFA 3E8BA 3A0RA 1K4CC 3D36A 5B3SC 3CCVV 1ORQC 1V55B 1NVPD 1FXVA 4CBCA 2CK3G 4UV8A 3P30A 4MW3A 2QKSA 1QLEC 2ZDIC 2EJRA 2NNUA 4FPPA 1VQ9V 3HPLC 3ABLC 4FIPC 1FS0G 2IH3C 3BEHA 4HAMA 1GKFA 3SPHA 2PI4A 1ZWIC 1EFRG 1FXKB 3CCJV 1K34A 3E8HA 1Y4MA 4EKWA 3LUTB 2KB1A 2X6BA 1PKXA 2IJKA 1CP9A 1GK9A 4P2ZA 3AAGA 1JVMA 3K03A 2UXNA 2IU0A 3E89A 5EBWC 4R7CA 1QVGU 4PDRA 2EZOA 2HJFC 4PA9A 3ZMVA 3AG2B 3AG3B 2X6AA 5EBMC 1K73W 3CCQV 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLD G;  4UV9 A;  3OAA G;  2WPD G;  2H94 A;  2Z5U A;  2JIZ G;  5LBQ A;  4YXW G;  2IW5 A;  3FKS G;  1W0J G;  2X0L A;  4CZZ A;  2XAG A;  1E79 G;  4ASU G;  1MAB G;  2V1D A;  1OHH G;  3ZMS A;  4KUM A;  4UXN A;  1BMF G;  4XBF A;  2WSS G;  2R9I A;  5LGT A;  2W6J G;  3ABT A;  3OFN G;  3ZMZ A;  2XAH A;  5LHH A;  1E1Q G;  1COW G;  3OEE G;  5L3B A;  2QE7 G;  2XOK G;  4BAY A;  3OE7 G;  1W0K G;  4Z1M G;  4UVC A;  1H8E G;  3ZN0 A;  2JJ2 G;  2JDI G;  5LHI A;  3ZN1 A;  3OEH G;  5LHG A;  2HKO A;  2Y48 A;  2Z3Y A;  5H6Q A;  4UVB A;  2DW4 A;  3ABU A;  4UVA A;  5L3C A;  5DN6 G;  1E1R G;  2V7Q G;  3ZMU A;  2CK3 G;  4UV8 A;  5L3D A;  4TT3 G;  2EJR A;  5FL7 G;  1FS0 G;  5LGN A;  2UXX A;  1EFR G;  2W6I G;  3ZMT A;  5L3E A;  5L3G A;  4TSF G;  5LGU A;  2XND G;  2JJ1 G;  2F43 G;  2XAF A;  2UXN A;  2XAS A;  2XAJ A;  5H6R A;  3ZIA G;  5L3F A;  3ZMV A;  1NBM G;  1H8H G;  2XAQ A; 
#chains in the Genus database with same CATH topology
 1KEC A;  4QGC A;  4DUZ O;  1PKN A;  3W7W A;  2B9Z A;  2OTL V;  3T4Z A;  3W7T A;  2IM9 A;  3GVM A;  4DR3 O;  2CDY A;  4J7J A;  3LDE A;  3BVO A;  1EN6 A;  5IJ0 B;  1YJ9 V;  4QG8 A;  2EJ7 A;  4HZ3 A;  3RVZ A;  1AP6 A;  5CBH A;  1PNK A;  4GX0 A;  5CA3 A;  5IYD O;  4JF3 A;  2K1E A;  1SA0 A;  2IU3 A;  2WSS G;  1WB7 A;  4O4J A;  1BZK A;  1H2K A;  4I50 A;  1Q6H A;  3ZMZ A;  3W7S A;  3ZRS A;  4B3S O;  1W0K G;  1Y67 A;  3T1H O;  2L35 A;  3AG3 C;  3T07 A;  3T2M A;  4PJ0 Z;  4JI4 O;  1IBM B;  2EIJ C;  5CA1 A;  1Q90 D;  1PD3 A;  5H6Q A;  3R66 A;  1D5A A;  2D2C B;  3CCR V;  3I5D A;  3UT5 A;  1Y74 B;  1PKY A;  4WFG A;  2UXC B;  3CRR A;  2QDO A;  1BQZ A;  5IE9 A;  4LF7 B;  2Q68 A;  3TGU H;  1EN4 A;  3QV7 A;  5CBF A;  4DV1 B;  1NQT A;  1FPO A;  4DR3 B;  4TT3 G;  2KSD A;  4QJF B;  2LO1 A;  1WJZ A;  1URF A;  1YCI A;  4X64 B;  4TQF A;  4LF9 B;  2W6I G;  3H1H H;  4DV4 B;  2UUC B;  2JJ1 G;  4JI7 B;  4MTX A;  1AR1 B;  3MAQ A;  2CH7 B;  2W0F C;  3M99 B;  4ZHQ B;  4X65 O;  2QEX V;  3ZIA G;  4OPH A;  4I4T B;  1ZX3 A;  3JAS A;  4JTD B;  3CME V;  4AIL C;  1FKA O;  1IBL O;  4JAA A;  4ABM A;  2HVJ C;  1MG1 A;  4B7K A;  5B1O A;  2A9H A;  1HNX B;  3ABM C;  1N34 B;  4B2D D;  5JH7 B;  4LC1 A;  4N23 A;  3N2K A;  4TV9 B;  4JAS A;  5KAF Z;  2VQE O;  4LWS B;  3E22 A;  3WFV A;  2P67 A;  1W0J G;  1GO3 F;  3RGB A;  4WCE V;  2D3O W;  3K9A A;  3CP1 A;  4PA3 A;  3AK1 A;  4RAI A;  1M5I A;  3Q4H A;  4UXN A;  1V55 C;  3SYC A;  1US6 A;  2QTO A;  1P4R A;  3EVK A;  5E1A C;  4B08 A;  4XDJ A;  4DUZ B;  4BAY A;  4HNA B;  4Z1M G;  3ZN0 A;  2ZIO A;  3L9D A;  5LHI A;  1NTK H;  4X65 B;  4LF6 O;  4ICG A;  4J11 A;  5EC2 C;  4EFE A;  4DV3 O;  2YID A;  4DUY B;  3AG1 C;  1SQQ H;  1QCE A;  1M4U A;  5IY5 B;  1FJG B;  2L6L A;  1N36 O;  3P32 A;  5BZB A;  2GBO A;  1VQL V;  5FPR A;  3QF7 A;  1Y6X A;  4LBE C;  4GKJ O;  3LSQ A;  3JAR A;  4JI5 O;  1K9M W;  2GDS A;  3D3I A;  4CC6 A;  4DV2 B;  5FL7 G;  4LF8 B;  3K3W A;  4UCV A;  2OCH A;  2W0X A;  2JRI A;  4HNA A;  4TV8 A;  4JI3 O;  4JI8 B;  4X1I A;  5CA0 B;  1H38 A;  3SGI A;  2F43 G;  2WLI A;  2AXT Z;  2ATK C;  3T1C A;  3K79 A;  4UCT A;  1QQC A;  5BR8 B;  5D5Q A;  5KMG B;  3ETD A;  2LW7 A;  4FFB B;  4YJ3 B;  1R3J C;  1IBL B;  3ZX6 A;  3SPC A;  1PPJ H;  3W7X A;  1HNW O;  5A9G A;  1D2D A;  2XT9 A;  3CB2 A;  3K08 A;  2UUA O;  2ZM6 B;  2ZR2 A;  3DSQ A;  3LDD A;  1ZL8 A;  2Y4U A;  2HVK C;  2ZNJ A;  3FB5 C;  5EC1 C;  4X8A A;  4R50 A;  2OIG A;  3GQY A;  1EM1 A;  1J5E B;  4KRZ A;  3B09 A;  3ETE A;  4FLY A;  4GKJ B;  1WN7 A;  3EOE A;  3LSS A;  3D8C A;  2JEU A;  2W6J G;  5B1N A;  3CJH A;  4IL6 Z;  2F4V O;  1G4Y B;  3JD2 A;  3ZJZ A;  3ABK C;  2Q8V A;  2PGG A;  4I9W A;  1JOY A;  3G6E V;  4O2A B;  3D36 C;  3EHB B;  1U96 A;  4E4E A;  4DR5 B;  2QKA A;  1XQ8 A;  1YXB A;  4MTO A;  1K8A W;  1S77 D;  2E3C A;  4LF4 B;  4QPK A;  5EYP A;  1EZJ A;  3VQX A;  2OTJ V;  3UKM A;  4EB6 B;  4KHP B;  1H2N A;  2HHH B;  2ITD C;  5L3C A;  4XDL A;  1J5E O;  1PNL A;  5IYZ A;  3RYC A;  1QHT A;  2V7Q G;  3CC7 V;  1NJI W;  3DTU B;  3CWB H;  4YJ3 A;  1Z2G A;  2A3Q A;  2Y4T A;  3A0B Z;  2JS3 A;  3K9S A;  3OGC C;  1R73 A;  3ZMT A;  3X2Q B;  1I94 B;  5L3E A;  5JWP A;  2XND G;  5JQG B;  3LDC A;  4JV5 O;  2DMX A;  3CC2 V;  2N05 A;  2YI8 A;  1P49 A;  2Q67 A;  2R9R B;  1RM1 C;  5B1B B;  1HWY A;  3SPJ A;  2LJ2 A;  1BGY H;  5K1P A;  4N21 A;  4JI7 O;  4JPR A;  4DR1 B;  2UUC O;  3K58 A;  1Q6U A;  3T4D A;  3CCE V;  4MVQ A;  4J7K A;  4O2A A;  4U7O A;  4NTX A;  2X0L A;  2Q73 A;  1IBK O;  4MTF A;  1WP7 A;  3H1J H;  2HR3 A;  5KX5 B;  1AR5 A;  4LFA B;  4CS2 A;  2E28 A;  5KUM A;  3LNN A;  3ZS8 C;  4LF7 O;  3BY6 A;  4IIJ A;  1IXM A;  5J2T B;  1R1B A;  3GG8 A;  3ABK B;  5EZY A;  4DV3 B;  1K3E A;  4OX9 O;  4KCU A;  1V9P A;  2BOB C;  4FM1 A;  5LYJ B;  1S5H C;  1PKM A;  3OE7 G;  5D5P A;  4IHJ A;  1H8E G;  2XHB A;  2P90 A;  4RQE A;  4FLV A;  3OEH G;  2R72 A;  3SPG A;  5C8Y B;  3JAS B;  4WFH A;  5IDJ A;  1AI4 A;  5LXT A;  2QWN B;  3STZ C;  4UVB A;  1M56 C;  4JI2 B;  1AI5 A;  4MTG A;  3U11 A;  5LOV B;  4K8X A;  4UCU A;  3APQ A;  1N0N A;  3A0R A;  3CCV V;  3CJH B;  1ORQ C;  1NVP D;  1FXV A;  2CK3 G;  2QKS A;  1QLE C;  2ZDI C;  1O9G A;  2EJR A;  4ZOL A;  3HPL C;  5EZY B;  3KHD A;  2PI4 A;  1FFX B;  3H6O A;  2AZ0 A;  3KCX A;  2R70 A;  1FAF A;  1IDS A;  5BMV B;  4FLW A;  4DR7 O;  1WB8 A;  2VGB A;  4YNG A;  4R7C A;  4JI1 O;  4X9Q A;  2JGD B;  2HJF C;  4PHZ A;  3HKB B;  3KTX A;  1VP8 A;  3CCQ V;  1SQV H;  2RN9 A;  2DN9 A;  1K7D A;  3ZED A;  4TWK A;  3HB3 B;  1KU9 A;  3E83 A;  5LMN O;  2Z5U A;  4LF5 B;  4YXW G;  1R3L C;  4DV0 B;  3CYO A;  2ADP A;  2X7R B;  4I55 A;  1W59 A;  3KCY A;  4DRX B;  2M7W A;  2XAG A;  1F23 A;  3JAW B;  5CBG A;  2OYQ A;  4WF9 V;  1AB3 A;  4DR4 B;  3C90 A;  1KKC A;  4DYL A;  2XUM A;  4JYC A;  4G1N A;  2LFR A;  1RPR A;  3ABT A;  1Q3E A;  3ZBH A;  1NH2 D;  1E1Q G;  1RP3 B;  1FXK A;  4GKK B;  2WLL A;  3WU2 Z;  5BR8 O;  3T1Y O;  4RO2 A;  2HHH O;  4J9Z B;  2VQF O;  2KQX A;  1VQ8 V;  5JVD B;  1SS3 A;  4WFF A;  2DWE C;  1T57 A;  2PF4 E;  4UB6 Z;  2NR5 A;  2A06 H;  4X20 B;  5B1A C;  4BW5 A;  3J7A U;  3Q4H B;  4NVP A;  4KCV A;  4PDL A;  1KKD A;  4LH6 A;  2JVD A;  1DF5 A;  3UO3 A;  3P3N A;  3CD6 V;  2KKW A;  1JCH A;  4D7S A;  4L87 A;  4KS0 A;  3KG2 A;  1FD9 A;  5IJ9 B;  4AHC A;  3SYA A;  1XMQ O;  4DR6 O;  5DED A;  1OCC C;  1QLN A;  3WB1 A;  1QNM A;  5L3G A;  2P4V A;  1YEW A;  3F5T A;  1WLE A;  2YSU B;  2EIK B;  4U7N A;  4LWS A;  4PA6 A;  2Q6A A;  4ZHQ A;  1LR1 A;  1OCC B;  3L74 H;  1WPX A;  2IJI A;  2F4V B;  2WLJ A;  4MVS A;  1NU1 H;  4FLZ A;  1KC8 W;  2WLL B;  3SPI A;  1SQG A;  5HFM A;  4YHH O;  1A5U A;  3ZHQ A;  4HYW A;  2DYS C;  1W2B U;  2YEV B;  1B3Q A;  3E2E A;  2LGQ A;  1GM7 A;  5LMU B;  1IXB A;  1WNS A;  1VQ5 V;  4JAV A;  1Y74 A;  2DWD C;  1YIJ V;  4DR4 O;  5IWA B;  2A7W A;  1M56 B;  4TOI A;  1F7Y A;  3FB7 C;  3G80 A;  3OTO O;  1QU7 A;  5LGT A;  2E76 B;  2VWK A;  3JCU Z;  4DV0 O;  3MA8 A;  2GTS A;  1HP8 A;  2DYR C;  3OEE G;  1VP7 A;  3UT5 B;  3JAR B;  3K06 A;  2OT5 A;  1BS3 A;  1SZT A;  1THZ A;  4YIP A;  3JSL A;  4UVC A;  4YIO A;  3C3T A;  2Q0A A;  4KP4 A;  1MSD A;  1R6N A;  3FYI B;  1VQ4 V;  1K5Q A;  4FLU A;  2DW4 A;  4I0X A;  4IYH A;  3T1H B;  4QE9 A;  1GN6 A;  4AQY B;  3JD4 A;  4NXN B;  4X89 A;  2RQ6 A;  1N33 O;  3CE2 A;  1BHB A;  4FXJ A;  4JI6 O;  2DE0 X;  3CS5 A;  4QE7 A;  4UFZ A;  5JJJ B;  5GON A;  3ZHU A;  4O4L B;  4K3A A;  2CUG A;  1SET A;  1YSC A;  4GLX A;  1GN3 A;  1Q5O A;  4J42 A;  5H9C A;  1JR9 A;  4Z1V A;  3OTF A;  4JYB A;  2OWO A;  1K33 A;  5JCO A;  4JI0 O;  2CTP A;  2WLK A;  3ZHT A;  2B5U A;  3ETG A;  3HKD B;  3ZCC A;  1A3X A;  2NN4 A;  2BSK A;  3CRA A;  1WPB A;  4PA4 A;  3OAA G;  1BQ0 A;  1PKL A;  1BCC H;  1CEZ A;  1S5J A;  1Q43 A;  5C93 A;  3WB2 A;  1VQP V;  5GON B;  3W7U A;  3GB7 C;  4B3T O;  3B40 A;  1OHH G;  4AQY O;  4H33 A;  5CA0 A;  3ABM B;  4XBF A;  1HNZ B;  4PV1 B;  4KFM A;  4DV5 B;  5DM6 V;  1VQN V;  2DYR B;  1TUB A;  3SJC C;  3FFQ A;  2XAH A;  3ZHS A;  5LHH A;  1SKV A;  3K57 A;  2DJV A;  3THO A;  3ML0 A;  5F2V O;  4MVM A;  3BPZ A;  1L8D A;  1R3I C;  2XTA A;  3RYI A;  3QVN A;  2ZD9 A;  1P7B A;  1XHX A;  3ZN1 A;  1E0T A;  2FTK A;  2FYU H;  4PDV A;  2Y48 A;  2ZXW C;  2EZP A;  3E0V A;  1AJP A;  1Y76 B;  5GTH Z;  1IUR A;  1PP9 H;  2P4K A;  5DN6 G;  3K0D A;  2QM4 A;  2YEV A;  2BOC C;  1SZX A;  3ZRX A;  1QLE B;  4R6Z A;  1OCO B;  1M9N A;  2QWQ B;  4D6T H;  3SRH A;  4F6R A;  3JD1 A;  5LMU O;  1YJW V;  3N27 A;  3HQO A;  3MHH C;  2EIN C;  3ABL B;  3OMA B;  4I9Q A;  3U2Z A;  1SRY A;  4WBN A;  4TSF G;  4JI5 B;  1M57 B;  1M57 C;  3OGI B;  4J9Y B;  2B1G A;  5J2U B;  1KMI Z;  4MVU A;  4WJ8 A;  2XAJ A;  5H6R A;  1F3X A;  2PYL A;  4LF4 O;  1TUB B;  1AP5 A;  1MNG A;  1HW7 A;  1K5S A;  3HQN A;  1S5L Z;  5JH7 A;  5KA6 A;  3K5M A;  1H2M A;  2ZT9 B;  4MT8 A;  4FM2 A;  4FMT A;  1RM1 B;  1GMG A;  4JTC B;  4DR7 B;  5LBQ A;  1EZV H;  3IJ4 A;  3QTG A;  4JZG A;  4PD4 F;  4Z2W A;  2B1I A;  4B3M O;  3OMN B;  5C8Y A;  1JFF B;  4UCS A;  3DXR A;  4KCT A;  2VS0 A;  4ZI7 B;  5IYB O;  2BSK B;  4O4I B;  4QGP A;  3FAV A;  2Q7H A;  2F1M A;  2Z0A A;  1PM9 A;  3J80 N;  2CTW A;  3QTC A;  3OTO B;  1VF6 A;  2YI9 A;  4DK0 A;  2ZM6 O;  2Q0O C;  3B8M A;  1Q86 W;  3STL C;  4LNU A;  4FLX A;  1JPX A;  2QE7 G;  2ZR3 A;  4JGS A;  1VEW A;  4X20 A;  2WWW A;  1T5E A;  2OCC B;  4UB8 Z;  1EN5 A;  4F6R B;  4FLT A;  5BY1 A;  3NXS A;  2EIL B;  1D5N A;  3E8B A;  4JYA B;  3D36 A;  4I0X B;  1N32 B;  4K0K B;  1N33 B;  4PI2 A;  3IS4 A;  2NNU A;  4FPP A;  4YY3 O;  2UU9 B;  3VQW A;  4FIP C;  2VRZ A;  1XOU A;  4HAM A;  2ZCE A;  1ZWI C;  1FXK B;  4DRX A;  3CCJ V;  2E75 B;  1ZAU A;  1K34 A;  3LUT B;  3S3X A;  4B3R O;  2KB1 A;  5H2F Z;  4X66 O;  4EEQ A;  3K03 A;  2UXN A;  1JMK C;  3SR2 C;  1K73 W;  1FFX A;  4DV4 O;  2XAQ A;  2R9A A;  4HBN A;  5FPO A;  2P7T C;  5IYZ B;  2YDE A;  2ARH A;  3IGA C;  4DV6 O;  2WLH A;  3UM7 A;  2F66 C;  3A0H Z;  3ICX A;  1WA8 B;  4JAU A;  4TUY B;  5LOV A;  1LUV A;  3L70 H;  3H1K H;  1I5X A;  2ODM A;  4GZR B;  5BXZ A;  3DGE A;  3OM3 B;  3FYE B;  1H2S B;  3EXA A;  1PV0 A;  1XI1 A;  1IBM O;  4NTW A;  1S72 V;  2F93 B;  2EBO A;  3BJF A;  1T5A A;  4G2K A;  1K4D C;  4B3S B;  1IX9 A;  2BCC H;  4X1K A;  1H2G A;  2YIB A;  4JTA B;  4ZOL B;  4X1K B;  4PA7 A;  2JJ2 G;  4FFK A;  1NTZ H;  3L75 H;  3TJT A;  2HG5 C;  4IIJ B;  5JJN B;  1SQF A;  2CH7 A;  4DV7 B;  1BL8 A;  2ZKO A;  3QG5 A;  4OX9 B;  3N2G A;  5CMU A;  1S76 D;  4G28 B;  1V54 B;  3K5O A;  4J41 A;  3ZHR A;  3G2G A;  3AG2 C;  1JFF A;  5ITZ B;  1GM9 A;  2GHY A;  2QWR B;  2ZDI A;  1I5Y A;  3ZMU A;  3AG7 A;  3K5N A;  2G50 A;  5L3D A;  5B1B C;  5CB4 B;  4FXF A;  4X64 O;  1ZL8 B;  1OCR B;  2PY5 A;  4RQF A;  4W4L A;  2Y0P A;  5K1X A;  1Q6I A;  3E0W A;  3OW2 U;  1Z5V A;  1PL0 A;  2YIC A;  3WG7 B;  4PI0 A;  3E35 A;  2EIN B;  4LR3 A;  2VGI A;  3I55 V;  5JQG A;  4X62 O;  3BHP A;  1CPY A;  1K97 A;  2PI5 A;  1NBM G;  4JI2 O;  4NKG B;  1WAZ A;  3T1Y B;  1F51 A;  3H01 A;  3B8N A;  4UV9 A;  1NI8 A;  4YHH B;  1GTO A;  5AG2 A;  2YIB D;  4YY3 B;  1J95 A;  4OXS A;  2ZXW B;  1M90 W;  3CX5 F;  4YJ2 A;  4U3J B;  1VIB A;  4CH6 A;  1G6U A;  2ZIM A;  5GTI Z;  1P7G A;  2NLJ C;  1MAB G;  4WFE A;  1YZB A;  1XNQ B;  1VAR A;  4H13 B;  1VF5 B;  1QR9 A;  4JI6 B;  4E2L A;  3HKB A;  1IZ3 A;  3JYC A;  4FZ0 A;  2JEX A;  3E8F A;  3N25 A;  2YIA A;  3U0Z A;  3TXQ A;  4MSW C;  4IMA A;  1AI6 A;  3CHX A;  5KHG A;  4KXR A;  1KQS U;  4X62 B;  5LA6 B;  2A79 B;  2HKO A;  1XL4 A;  2QGN A;  2CGN A;  3LNM B;  4MVR A;  3BA9 A;  1A49 A;  1AQF A;  4R8C A;  2WAM A;  2P6J A;  3BFR A;  4O4L A;  4FVM A;  1H2L A;  2OIE A;  3QO7 A;  3VQV A;  2ZE6 A;  2UUB O;  4B3R B;  4JV5 B;  1DLB A;  3ETQ A;  1B6Q A;  1F4N A;  4PEL A;  3AG4 B;  4GT1 A;  1LNQ A;  5LGN A;  1VMG A;  1BSM A;  4GX1 A;  3TCU A;  2F95 B;  4FFB A;  2H3O A;  3BJT A;  4JYA O;  2UXB O;  2ZQM A;  5LGU A;  1XMO O;  4ZI7 A;  4FJC C;  5IYC O;  2XAS A;  1N34 O;  3IAY A;  4DR2 O;  2Y69 B;  4RUE A;  4TUY A;  2QA4 V;  2AZ2 A;  4H44 B;  1AIL A;  3JD0 A;  1G8M A;  2BTQ A;  3PP7 A;  1I94 O;  4ZKI A;  1DGS A;  1SQX H;  1I0H A;  3G67 A;  3UO2 A;  4G27 B;  3LSU A;  1VF6 C;  4LH7 A;  4RWU A;  4Q20 A;  5LP6 B;  1KYO F;  1XEQ A;  1BE3 H;  2IW5 A;  1KBH A;  4X1I B;  3PJS K;  1Z5W A;  2GUZ A;  4CZZ A;  5KA5 A;  4LF9 O;  4QG6 A;  1N8R W;  4K35 A;  2PTM A;  4WBN B;  2DYS B;  3OD4 A;  1SQP H;  2ITC C;  2EIJ B;  3HR0 A;  3IC7 A;  2YUA A;  3PN1 A;  4MVZ A;  2ADQ B;  5E79 Z;  1R3K C;  5B66 Z;  1COW G;  4MW8 A;  2DQ0 A;  3CCM V;  1GN2 A;  3CSX A;  5L3B A;  3RWR D;  1BHA A;  3MDS A;  4IT5 A;  2K9P A;  2ZE7 A;  1MZE A;  4UCO A;  2ETN A;  5IY5 C;  1VQK V;  2Y69 C;  3ZRV A;  1SES A;  1HNZ O;  1PL4 A;  5J9P C;  4X1Y A;  5LL6 Y;  1JJO A;  1OCZ B;  1FFT B;  2QSA A;  3SYO A;  5KHJ A;  2LGW A;  3DC5 A;  3TXS A;  4U3F H;  2PZS A;  1O9H A;  3HKE B;  4JZ2 A;  1FXH A;  2HJD A;  4CH5 A;  2UUA B;  1XNR O;  4QIW F;  4NTY A;  1YIT V;  3CRQ A;  4LFA O;  5A2Q N;  3WB0 A;  3RVY A;  1L1F A;  4CH3 A;  4J10 A;  3WG7 C;  1A32 A;  2QTS A;  4OGQ B;  4JI0 B;  4GX5 A;  3JSN A;  1DK1 A;  1AR4 A;  5CN0 A;  4DR2 B;  1FYJ A;  4HYO A;  3DXR B;  1FJG O;  3G4S V;  1RPO A;  2UXB B;  2MW2 B;  3JAT B;  5KHI A;  4H0L B;  3FX7 A;  2QWO B;  2WLN A;  2WPD G;  1RFY A;  4EFB A;  3RYH A;  4MVO A;  1NVP B;  4X66 B;  4O4H A;  1NR7 A;  5JVD A;  4NXN O;  4DV5 O;  1GRJ A;  2Q7G A;  3RW0 A;  1VQM V;  1IBK B;  1MA1 A;  3JAW A;  3OR7 C;  3L73 H;  4O2B B;  1S0V A;  1MMM A;  1NT2 B;  1E79 G;  2QJ1 A;  3ASO B;  4DXW A;  1GAX A;  3ZMS A;  3BAA A;  4LP8 A;  3S3W A;  4WFA V;  5J2U A;  2GV9 A;  1OCR C;  1XNR B;  2RNB A;  4U3J A;  2IJJ A;  2ZIN A;  5HFL A;  4XDK A;  2RDC A;  2Q7E A;  3AK3 A;  1NTM H;  4I55 B;  1QVF U;  1X59 A;  4IP7 A;  2DQ3 A;  1AVM A;  1TVK B;  4EB6 A;  4FK5 C;  4GKK O;  1YTF B;  3CPW U;  5JJE B;  1KP3 A;  3K5L A;  1YJN V;  5EBL C;  2UXD B;  1TGO A;  3JAL B;  4CS4 A;  1K4C C;  4L8J A;  3RYC B;  5LP6 A;  1XUQ A;  4CBC A;  5IT9 N;  4AI8 A;  4UV8 A;  4B2D A;  1HR0 O;  2PYJ A;  3N2G B;  1VQ9 V;  2IH3 C;  3SPH A;  4B7E A;  1XRE A;  2YXH A;  3RN4 A;  3SJA C;  3E8H A;  4LNU B;  4B3M B;  1Y4M A;  3UQ8 A;  2LW1 A;  3GWK C;  2IJK A;  1GK9 A;  4P2Z A;  3A2F A;  4DV1 O;  4DR5 O;  3E89 A;  5EBW C;  4QG9 A;  3H9V A;  2Y0I A;  1YDX A;  1QVG U;  2CGO A;  2N74 A;  5B5E Z;  2EZO A;  1CXZ B;  1L0L H;  2ZNI A;  4PA9 A;  3ZMV A;  3AG3 B;  4O4I A;  2X6A A;  2RMK B;  2O57 A;  5FLX N;  2Q5Z A;  4J80 A;  1YVW A;  2DOS A;  5KUK A;  3VOU A;  4DV7 O;  2AHY A;  2JIZ G;  2EIK C;  3RFR A;  3CMA V;  5DEC A;  1B06 A;  1X4T A;  3N2K B;  1WA8 A;  4IHJ B;  3HKD A;  4HYV A;  3CCU V;  3ASN C;  1ROP A;  2ZE8 A;  4K0K O;  3GWO A;  1HR0 B;  1S3J A;  4LFC O;  3FB8 C;  3C3S A;  3JAK B;  5LA6 A;  3AG4 C;  5B1A B;  4DK1 A;  4PDM A;  4TV8 B;  3TK1 A;  2FKX A;  3OFN G;  4GYC B;  4MS2 A;  5IJ9 A;  1MOF A;  5LYJ A;  2P5O A;  3B77 A;  5KHH A;  2F23 A;  3JAM N;  1KB9 F;  1UFI A;  1ZJH A;  4GX2 A;  3QO8 A;  2YXL A;  2JDI G;  2CAZ C;  5J2T A;  2Z3Y A;  1PNM A;  1G1X B;  4C7U A;  3BA8 A;  2C2A A;  4UVA A;  1EBO A;  4NYK A;  4NXM B;  2P06 A;  4NR1 A;  3NR7 A;  1XL6 A;  1AJQ A;  3RYF B;  1P84 F;  2JGU A;  3R65 A;  4LFB O;  3L72 H;  2PUS A;  2UXX A;  3CRC A;  1ZUQ A;  3EFF K;  1Q82 W;  1UJW B;  2EIL C;  3CRM A;  4OPA A;  2UXC O;  1SF9 A;  3QNE A;  1YF2 A;  3P3P A;  5TIS Z;  3BCC H;  1R6K A;  4W4K A;  4DO2 A;  5B3S B;  3AG1 B;  4IYI A;  4UUJ C;  3H1I H;  4I50 B;  5L3F A;  2HP8 A;  5ITZ A;  3OT7 A;  3B2E E;  2AGA A;  5EIB C;  1XHZ A;  2A0L A;  5BMV A;  5CB4 A;  2QWP B;  1I08 A;  2H94 A;  1JA8 A;  1A3W A;  3ZRW A;  2VWJ A;  3SYQ A;  1RSO A;  3J81 N;  2JGD A;  3FKS G;  5H5N A;  4FM0 A;  4BIU A;  2Q69 A;  2WA4 A;  4JI8 O;  1ENV A;  1MSW D;  4ZBM A;  4ASU G;  3E86 A;  4A5U B;  4P9O A;  3F7V C;  1E0U A;  4DV6 B;  1B04 A;  4LF5 O;  3QV8 A;  5LXT B;  3AEI A;  4BR6 A;  4KHP O;  3MHS C;  1WP8 A;  2UUB B;  3B4S A;  4UCR A;  1N4C A;  1ZSP A;  3JD3 A;  3FAV B;  1XMO B;  3O9O A;  2QKC A;  3IC9 A;  1SER A;  3VBB A;  3JAL A;  3E8G A;  3ABU A;  4BW9 A;  1ZTE A;  3ZHV A;  3X2Q C;  1XMQ B;  2AW9 A;  3SRK A;  3RBZ A;  1KUQ A;  3BAB A;  2CTQ A;  5KX5 A;  3K59 A;  2IH1 C;  3L71 H;  2GSM B;  3ASO C;  2YS8 A;  2FL4 A;  2Q9L A;  5EIB D;  1AI7 A;  3KKY A;  3CEI A;  1KP2 A;  2AHZ A;  4WFB V;  3MD0 A;  1Q8I A;  2WA3 A;  3ASN B;  4F4L A;  2VGF A;  1UPG A;  2UXD O;  1GM8 A;  1HDJ A;  1VQ7 V;  3U10 A;  2RCV A;  4JI4 B;  3CXH F;  2VQE B;  1K92 A;  3IFX A;  1XIL A;  3HKC B;  4I7Z B;  5GW7 A;  5IJ0 A;  4DW0 A;  1H8H G;  2KG7 B;  4O2B A;  5EK0 A;  4BIO A;  1NS1 A;  2HLD G;  4QPJ A;  3CC4 V;  1U97 A;  1M93 A;  4BWA A;  1ARO P;  4YJ5 A;  1OCO C;  3HQP A;  1GN4 A;  4CS3 A;  3RT3 C;  3SRD A;  2LQT A;  4NB5 A;  3SYP A;  3FD9 A;  3SRF A;  2KG7 A;  2EIM B;  2OCC C;  3TET A;  1JQ0 A;  3HKC A;  1V54 C;  3M8A A;  2E74 B;  2E5L B;  2V1D A;  3RYI B;  1Y66 A;  4ZIB A;  4P9P A;  3F7Y C;  4KUM A;  1XBL A;  3D3Q A;  2MK3 A;  1TAE A;  1Q81 W;  2R9I A;  3GR4 A;  1DTO A;  1DF4 A;  4CH4 A;  1N36 B;  2HFE C;  4TQD A;  2YXY A;  3OR6 C;  1OZ0 A;  3CXC U;  4DR1 O;  3M7M X;  1OV9 A;  2EX3 A;  1JJ2 U;  1IVS A;  4P30 A;  3F5W C;  1GH6 A;  1Q7Y W;  4JI1 B;  5LHG A;  4GCZ A;  3G71 V;  4QNH B;  1YI2 V;  1YTF D;  4K8Z A;  5EYP B;  3APO A;  2GTA A;  2JK5 C;  3I56 V;  3T0T A;  1R6T A;  1VQ6 V;  2N04 A;  2LFS A;  4B3T B;  1E1R G;  1NR1 A;  1KD1 W;  4KL1 A;  3K0G A;  1SC5 B;  4FZ1 A;  4TV9 A;  4BIZ A;  4LCU C;  4LFC B;  5KMG A;  3A8T A;  1XNQ O;  2FB5 A;  2JS5 A;  5LP6 C;  1VQO V;  2V4D A;  5KAI Z;  2HEP A;  1TUE B;  2EIM C;  1OJH A;  1M1K W;  1AJN A;  4RPP A;  3OUF A;  1OCZ C;  3H1L H;  2M6Y A;  2XAF A;  4X1Y B;  3DC6 A;  4I5S A;  2EUL A;  3OUS A;  5LMN B;  3ZRW B;  1SQB H;  2IJH A;  1NZ6 A;  3BRC A;  3SJB C;  3G6B A;  5KHK A;  3HKE A;  2ILM A;  4YJ2 B;  4D7T A;  1Y76 A;  1XDC A;  2GUZ B;  1YHQ V;  1NH2 B;  3KZI Z;  3CCL V;  2WLM A;  2Q4P A;  1QBZ A;  2CE4 A;  2VGG A;  1RSO B;  2IBZ H;  5CA1 B;  4JYY A;  2LP7 A;  4F6E A;  4LF8 O;  4DRS A;  4CC5 A;  2RJZ A;  3QV6 A;  4IGG A;  1FXK C;  2ZE5 A;  3K04 A;  4GUN A;  2CTR A;  2QM7 A;  1TVK A;  3JCZ A;  4LFB B;  2WLI B;  1MZF A;  4NXM O;  3RYF A;  1BMF G;  2UU9 O;  4DUY O;  3SJQ C;  2X6C A;  1SA0 B;  1QR8 A;  5KLV H;  3QV9 A;  2BTQ B;  4O4H B;  3UCS C;  1F4M A;  1HNW B;  2XOK G;  2H8P C;  1I7F A;  1TA8 A;  1ZLZ A;  1NKD A;  4X88 A;  5JCO C;  1HNX O;  2VQF B;  3JAK A;  2QR4 A;  3OMI B;  4O4J B;  1JX9 A;  3VQY A;  5FNV A;  3AK2 A;  2BE3 A;  1VF7 A;  3SDL A;  4H37 A;  1BT8 A;  3QO5 A;  3CCS V;  2QM8 A;  3FB6 C;  4KCW A;  4RUF A;  5IWA O;  4JI3 B;  1N32 O;  5B3S C;  1V55 B;  3P30 A;  4MW3 A;  3O65 A;  4I4T A;  4DV2 O;  1L0N H;  2YC0 A;  3ABL C;  1FS0 G;  3BEH A;  1GKF A;  4DR6 B;  1EFR G;  2G38 A;  3RYH B;  3ME3 A;  2E5L O;  4EKW A;  1LUW A;  2FML A;  3T05 A;  2X6B A;  1PKX A;  2P22 C;  3JAT A;  1CP9 A;  3AAG A;  5FNV B;  1N0J A;  4JPG A;  1JVM A;  4J7Z A;  2IU0 A;  4DW1 A;  1F3W A;  4PDR A;  3E22 B;  4Q6G A;  2BTO A;  4LF6 B;  3AG2 B;  5EBM C; 
#chains in the Genus database with same CATH homology
 1KEC A;  1K7D A;  4TWK A;  3W7W A;  5KUK A;  2OTL V;  3VOU A;  2P7T C;  3HB3 B;  3T4Z A;  3W7T A;  3E83 A;  2AHY A;  2Z5U A;  2JIZ G;  2EIK C;  3IGA C;  3CMA V;  2WLH A;  3UM7 A;  4YXW G;  1R3L C;  3CYO A;  3LDE A;  2X7R B;  4JAU A;  1YJ9 V;  4HZ3 A;  3RVZ A;  2XAG A;  2M7W A;  1F23 A;  5CBG A;  3CCU V;  1I5X A;  3ASN C;  1ROP A;  5CBH A;  1PNK A;  4GX0 A;  3DGE A;  4WF9 V;  5CA3 A;  3GWO A;  5IYD O;  1S3J A;  4JF3 A;  3OM3 B;  2K1E A;  3FYE B;  3FB8 C;  4JYC A;  3AG4 C;  2IU3 A;  2WSS G;  5B1A B;  2LFR A;  1S72 V;  4PDM A;  1RPR A;  3TK1 A;  2EBO A;  3ABT A;  3OFN G;  3ZMZ A;  4MS2 A;  3W7S A;  1NH2 D;  1MOF A;  1E1Q G;  1FXK A;  4G2K A;  1K4D C;  3B77 A;  2WLL A;  3ZRS A;  4RO2 A;  1H2G A;  1W0K G;  4J9Z B;  4JTA B;  1VQ8 V;  4PA7 A;  2JJ2 G;  4WFF A;  3AG3 C;  2DWE C;  3QO8 A;  4GX2 A;  3T2M A;  2JDI G;  2HG5 C;  2EIJ C;  5B1A C;  4BW5 A;  1BL8 A;  2Z3Y A;  1PD3 A;  1PNM A;  5H6Q A;  5CMU A;  1S77 D;  3CCR V;  4PDL A;  1S76 D;  1KKD A;  2C2A A;  1V54 B;  4G28 B;  4UVA A;  4WFG A;  1EBO A;  3AG2 C;  1DF5 A;  1GM9 A;  2Q68 A;  3CD6 V;  1JCH A;  2GHY A;  2ZDI A;  1I5Y A;  3ZMU A;  5CBF A;  1NQT A;  1XL6 A;  1AJQ A;  4L87 A;  5L3D A;  3KG2 A;  5B1B C;  4TT3 G;  4QJF B;  3R65 A;  1OCR B;  4RQF A;  2UXX A;  3SYA A;  3EFF K;  3OW2 U;  1OCC C;  2W6I G;  1Q82 W;  1PL0 A;  1QLN A;  1UJW B;  2EIL C;  5L3G A;  3WG7 B;  1WLE A;  2YSU B;  3E35 A;  2EIK B;  4U7N A;  2EIN B;  2JJ1 G;  3QNE A;  4PA6 A;  2Q6A A;  4MTX A;  3I55 V;  1AR1 B;  2W0F C;  4DO2 A;  1R6K A;  3M99 B;  3AG1 B;  1OCC B;  4UUJ C;  5B3S B;  2QEX V;  3ZIA G;  5L3F A;  1CPY A;  1K97 A;  1WPX A;  2PI5 A;  2IJI A;  3CME V;  4JTD B;  1NBM G;  2WLJ A;  4MVS A;  1KC8 W;  2WLL B;  3SPI A;  2HVJ C;  5HFM A;  1F51 A;  1MG1 A;  3H01 A;  2A0L A;  3B8N A;  4UV9 A;  5B1O A;  1GTO A;  2A9H A;  2DYS C;  2H94 A;  3ABM C;  4LC1 A;  3ZRW A;  4N23 A;  1W2B U;  2YEV B;  3SYQ A;  1J95 A;  4OXS A;  2ZXW B;  1M90 W;  4JAS A;  3E2E A;  3WFV A;  1GM7 A;  2P67 A;  1W0J G;  3FKS G;  1GO3 F;  4BIU A;  1VQ5 V;  4JAV A;  4WCE V;  2DWD C;  1YIJ V;  2Q69 A;  3K9A A;  2D3O W;  3CP1 A;  1ENV A;  4PA3 A;  4RAI A;  1MSW D;  4ZBM A;  2NLJ C;  4ASU G;  1MAB G;  4WFE A;  1M56 B;  3FB7 C;  4UXN A;  1V55 C;  3E86 A;  1QR9 A;  4E2L A;  4P9O A;  3SYC A;  5LGT A;  3JYC A;  3F7V C;  2QTO A;  2JEX A;  3E8F A;  1P4R A;  3AEI A;  3MHS C;  2DYR C;  3OEE G;  4MSW C;  3K06 A;  5E1A C;  1AI6 A;  2OT5 A;  1SZT A;  1THZ A;  4XDJ A;  4BAY A;  3JD3 A;  4Z1M G;  4UVC A;  3ZN0 A;  1KQS U;  5LHI A;  4KP4 A;  1R6N A;  5EC2 C;  2A79 B;  2HKO A;  1XL4 A;  1SER A;  3AG1 C;  3FYI B;  3VBB A;  1VQ4 V;  1QCE A;  1K5Q A;  3LNM B;  5IY5 B;  4MVR A;  2DW4 A;  1K8A W;  4R8C A;  2WAM A;  2P6J A;  3ABU A;  3E8G A;  3P32 A;  3X2Q C;  4QE9 A;  3QO7 A;  5BZB A;  3RBZ A;  1VQL V;  4LBE C;  3JD4 A;  3LSQ A;  4X89 A;  1DLB A;  2IH1 C;  1K9M W;  2GSM B;  3ASO C;  1B6Q A;  3D3I A;  1BHB A;  5FL7 G;  1F4N A;  4PEL A;  4QE7 A;  3AG4 B;  4GT1 A;  1LNQ A;  3K3W A;  1AI7 A;  5LGN A;  1KP2 A;  2AHZ A;  4GX1 A;  3TCU A;  4WFB V;  3MD0 A;  3ASN B;  4F4L A;  2ZQM A;  1SET A;  1GM8 A;  1YSC A;  5LGU A;  1VQ7 V;  1H38 A;  5H9C A;  2F43 G;  2WLI A;  4FJC C;  5IYC O;  4JYB A;  2ATK C;  2XAS A;  3T1C A;  3K79 A;  1K92 A;  1K33 A;  3IFX A;  2Y69 B;  2WLK A;  5GW7 A;  4RUE A;  3ETD A;  2B5U A;  1H8H G;  3ETG A;  1R3J C;  2QA4 V;  5EK0 A;  3JD0 A;  3ZCC A;  2HLD G;  1G8M A;  4QPJ A;  3SPC A;  3CC4 V;  1ARO P;  4ZKI A;  3W7X A;  4PA4 A;  3OAA G;  4G27 B;  3K08 A;  1OCO C;  4Q20 A;  1CEZ A;  2ZR2 A;  3LDD A;  5C93 A;  3SYP A;  2IW5 A;  2HVK C;  3FB5 C;  5EC1 C;  1VQP V;  3PJS K;  4X8A A;  4CZZ A;  2EIM B;  4R50 A;  5KA5 A;  3GB7 C;  3W7U A;  2OCC C;  3TET A;  1JQ0 A;  1N8R W;  1V54 C;  2V1D A;  1OHH G;  3ETE A;  1Y66 A;  4H33 A;  4P9P A;  3F7Y C;  2DYS B;  3ABM B;  4KUM A;  2ITC C;  4XBF A;  2MK3 A;  3LSS A;  1Q81 W;  2R9I A;  4KFM A;  2EIJ B;  2JEU A;  2W6J G;  3IC7 A;  1DTO A;  5B1N A;  5DM6 V;  1VQN V;  1DF4 A;  2DYR B;  4MVZ A;  1G4Y B;  2XAH A;  5LHH A;  1R3K C;  2HFE C;  3JD2 A;  3ZJZ A;  3ABK C;  1COW G;  3ML0 A;  3OR6 C;  4MW8 A;  2DQ0 A;  3CCM V;  5L3B A;  1OZ0 A;  4I9W A;  3CXC U;  1JOY A;  3G6E V;  4MVM A;  1BHA A;  3EHB B;  1R3I C;  1JJ2 U;  4P30 A;  3F5W C;  2ZD9 A;  5IY5 C;  1VQK V;  1Q7Y W;  2Y69 C;  4MTO A;  1P7B A;  3ZRV A;  3ZN1 A;  1SES A;  4GCZ A;  2FTK A;  4QNH B;  5LHG A;  4PDV A;  3G71 V;  2Y48 A;  5J9P C;  1YI2 V;  1YTF D;  4QPK A;  1OCZ B;  2ZXW C;  1FFT B;  1EZJ A;  2EZP A;  3SYO A;  2JK5 C;  1AJP A;  3UKM A;  3I56 V;  2OTJ V;  2ITD C;  1VQ6 V;  5L3C A;  4XDL A;  1PNL A;  2LFS A;  5DN6 G;  1E1R G;  2V7Q G;  3K0D A;  1NR1 A;  1KD1 W;  2YEV A;  3K0G A;  2BOC C;  3CC7 V;  4BIZ A;  1NJI W;  1FXH A;  4LCU C;  3DTU B;  1VQO V;  3ZRX A;  1QLE B;  4R6Z A;  1OCO B;  1M9N A;  1TUE B;  2EIM C;  3JD1 A;  1AJN A;  1YJW V;  1M1K W;  3OGC C;  4QIW F;  1R73 A;  3MHH C;  3OUF A;  1OCZ C;  1YIT V;  2EIN C;  3ZMT A;  3ABL B;  3OMA B;  3X2Q B;  1SRY A;  5L3E A;  4TSF G;  3RVY A;  1M57 B;  1M57 C;  2XND G;  2XAF A;  4J9Y B;  1L1F A;  2B1G A;  4I5S A;  3OUS A;  4MVU A;  3WG7 C;  3LDC A;  4GX5 A;  2XAJ A;  3ZRW B;  3CC2 V;  5H6R A;  2IJH A;  5CN0 A;  2Q67 A;  2R9R B;  1RM1 C;  5B1B B;  1HWY A;  4HYO A;  3SPJ A;  1K5S A;  1YHQ V;  4N21 A;  3G4S V;  1NH2 B;  1RPO A;  3CCL V;  2WLM A;  5KA6 A;  4JPR A;  4MT8 A;  1QBZ A;  2WLN A;  2WPD G;  2LP7 A;  1RM1 B;  4FMT A;  3T4D A;  1GMG A;  4MVO A;  4JTC B;  3CCE V;  4MVQ A;  5LBQ A;  1NVP B;  1NR7 A;  1FXK C;  3K04 A;  3RW0 A;  2B1I A;  4U7O A;  2QM7 A;  1VQM V;  3OMN B;  2X0L A;  3JCZ A;  3OR7 C;  4MTF A;  1S0V A;  2WLI B;  2HR3 A;  1E79 G;  5IYB O;  3ASO B;  4DXW A;  5KUM A;  4LP8 A;  3ZMS A;  1BMF G;  3BY6 A;  1IXM A;  4WFA V;  1OCR C;  3SJQ C;  2X6C A;  1QR8 A;  3ABK B;  2IJJ A;  1K3E A;  3B8M A;  5HFL A;  4XDK A;  1Q86 W;  1F4M A;  3STL C;  1JPX A;  2QE7 G;  2BOB C;  2XOK G;  2H8P C;  2ZR3 A;  1S5H C;  3OE7 G;  4JGS A;  1NKD A;  4X88 A;  1H8E G;  3OMI B;  2P90 A;  1QVF U;  2WWW A;  4RQE A;  3OEH G;  1JX9 A;  2DQ3 A;  2OCC B;  3SPG A;  4WFH A;  5IDJ A;  1AI4 A;  4H37 A;  4FK5 C;  4UVB A;  3STZ C;  1M56 C;  1YTF B;  3QO5 A;  3CPW U;  1AI5 A;  4MTG A;  3CCS V;  1KP3 A;  2QM8 A;  3FB6 C;  3NXS A;  1YJN V;  5EBL C;  2EIL B;  4RUF A;  3E8B A;  3A0R A;  1K4C C;  3D36 A;  5B3S C;  3CCV V;  1ORQ C;  1V55 B;  1NVP D;  1FXV A;  4CBC A;  2CK3 G;  4UV8 A;  3P30 A;  4MW3 A;  2QKS A;  1QLE C;  2ZDI C;  2EJR A;  2NNU A;  4FPP A;  1VQ9 V;  3HPL C;  3ABL C;  4FIP C;  1FS0 G;  2IH3 C;  3BEH A;  4HAM A;  1GKF A;  3SPH A;  2PI4 A;  1ZWI C;  1EFR G;  1FXK B;  3CCJ V;  1K34 A;  3E8H A;  1Y4M A;  4EKW A;  3LUT B;  2KB1 A;  2X6B A;  1PKX A;  2IJK A;  1CP9 A;  1GK9 A;  4P2Z A;  3AAG A;  1JVM A;  3K03 A;  2UXN A;  2IU0 A;  3E89 A;  5EBW C;  4R7C A;  1QVG U;  4PDR A;  2EZO A;  2HJF C;  4PA9 A;  3ZMV A;  3AG2 B;  3AG3 B;  2X6A A;  5EBM C;  1K73 W;  3CCQ V;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...