1FS0G

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
219
Chain Sequence
KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 81
structure length 219
sequence length 230
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fs0G02
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 1fs0G01
2XAQA 3ZMZA 3ABUA 2XOKG 3ZMTA 1MABG 1W0JG 4UV8A 2EJRA 2WSSG 2X0LA 4KUMA 2XAFA 2Z3YA 5H6RA 1E1RG 2HLDG 2V1DA 2IW5A 1NBMG 4UV9A 4UVAA 2DW4A 4CZZA 5LHGA 5DN6G 1COWG 1E79G 3ZIAG 3ZMUA 2UXNA 1E1QG 2XAGA 5L3CA 2R9IA 2CK3G 3ZN1A 2JIZG 3OFNG 5L3FA 2QE7G 5LHIA 3ABTA 1W0KG 3OEHG 5LGNA 2Z5UA 2V7QG 1H8HG 5LHHA 4UVCA 2Y48A 4BAYA 4UVBA 2JJ2G 3OE7G 5H6QA 5FL7G 2WPDG 2XAHA 1H8EG 2XASA 4Z1MG 1FS0G 3ZMSA 4YXWG 2W6IG 5L3BA 4UXNA 3ZN0A 5L3EA 5LGUA 1EFRG 2H94A 2XNDG 4TSFG 5L3GA 3FKSG 4XBFA 2JDIG 5LBQA 2HKOA 1OHHG 2JJ1G 3OEEG 1BMFG 2F43G 5LGTA 2W6JG 2UXXA 3OAAG 5L3DA 2XAJA 4TT3G 4ASUG 3ZMVA
chains in the Genus database with same CATH superfamily
3LNMB 3ZMZA 3KKYA 2WLNA 3FX7A 3F7VC 3NR7A 3T4DA 3KG2A 4UV8A 3CJHB 3GG8A 1CPYA 1QR8A 2QR4A 2BTQB 4FLVA 1IBKO 4EB6B 4DV7B 2ZE6A 3RGBA 1MSDA 3UO3A 2EULA 4DV1B 3LUTB 1SC5B 2CTWA 2WLIA 1KYOF 4GKKB 5LOVA 1NTKH 4HYOA 1NKDA 4ZOLB 1R3JC 5JQGA 1F4MA 4B2DA 5IJ9A 3WB2A 4AHCA 4DW1A 4GT1A 3SPGA 4TV8A 2F4VO 2A7WA 3U10A 3CCSV 4EFEA 1Q7YW 4X1IB 4NTWA 4N23A 1THZA 2P4VA 4FM1A 1W0KG 1AI4A 3CCMV 3ZRSA 4LF7B 3CCRV 2V7QG 4JASA 2P5OA 2X7RB 4Q20A 3E35A 2EILB 5H6QA 3T05A 2IJKA 3W7SA 2JS5A 3HKBA 4RQEA 2VGGA 2RMKB 4JTDB 1Z5WA 3JCZA 5TISZ 1JJ2U 4J80A 5A9GA 2XASA 4X65O 1ZSPA 1FS0G 2ZD9A 4DR7B 3ZMSA 4U7NA 3SDLA 2RJZA 3CCUV 4JV5O 2ETNA 3BVOA 3TETA 1Y76A 4YJ2A 1E0TA 4CH6A 1BL8A 5C93A 5DM6V 3E8BA 4FZ0A 3BA9A 1WNSA 2N74A 4XBFA 4DV2O 1TVKB 3OD4A 4GKJO 3S3WA 4NXMB 3K5MA 3RYCA 2Q9LA 5B5EZ 4U3JA 4EEQA 2HJDA 2DMXA 2EIKC 3OAAG 3JARA 1GM7A 1PKNA 4NVPA 4YIPA 2DYSB 4J11A 3QV9A 1XILA 5KHHA 2DWDC 4JI5B 3ABLC 2WSSG 3CE2A 5KX5B 2X0LA 4FLZA 2R9RB 4UCTA 3G67A 5LXTB 2YDEA 1N4CA 3K03A 3O9OA 2M7WA 4FLTA 1I7FA 4JYCA 1V54B 5H2FZ 1K34A 1SQBH 4CZZA 4DR2O 5J9PC 4P9OA 3BEHA 1GKFA 2UXNA 1K97A 2EX3A 1XREA 3X2QB 4DR3B 3JALB 1S5LZ 5B1AB 1OCOB 4YJ5A 1GMGA 1GM8A 3D36A 4OPHA 4JI7O 2BSKA 1IBLB 1VF7A 2P67A 1M93A 3AG3B 1YI2V 3FYIB 4R7CA 3DC6A 2VWJA 5E79Z 1K73W 4TOIA 1JCHA 3ETQA 4QE9A 1AJPA 2JGDA 3QO7A 5B1NA 1BE3H 1SQQH 2Q73A 1NTMH 3CCQV 3AG4C 1BCCH 2HVJC 2CAZC 3L70H 3OW2U 2HEPA 4IHJA 1ENVA 1JMKC 4X62O 2OCCC 2Y69B 3GR4A 1YHQV 4PDRA 1K5SA 4KHPO 5KA6A 4H37A 1PP9H 4LNUA 4ASUG 1I08A 3OTFA 1PD3A 1UJWB 3ETDA 3ZMTA 4DUYO 5B1BB 1OCRB 3TCUA 4BIZA 4J9ZB 3JSNA 2LFRA 5IY5B 3G80A 4H0LB 2E3CA 2UUAB 1Q82W 1VARA 3R65A 4B3SB 4KS0A 3VBBA 1VQKV 4Z2WA 3JD0A 2D3OW 2QM7A 2E5LO 3SJBC 3CRRA 4MVZA 3DC5A 3N25A 1E1RG 2G50A 3FYEB 1PNKA 1FAFA 1CEZA 2ZNJA 5KHIA 2M6YA 4I50A 4OX9B 1YDXA 3RYIB 2AGAA 1RP3B 4JPRA 4KCUA 3M8AA 3HKDA 2DYRC 4LF5B 5DECA 2UXCB 3ML0A 1V55B 2JIZG 3ZN1A 4EFBA 3SJAC 1ZUQA 3CXHF 1F3WA 4P30A 2QE7G 2YEVA 2GDSA 2WLIB 4BW9A 4DUZB 2PI4A 4WJ8A 5LOVB 4LF9O 4KL1A 3RFRA 5IJ9B 3CCLV 2X6BA 4P2ZA 4HBNA 2QEXV 2AW9A 5FNVA 3T4ZA 1XQ8A 4O4IA 1K92A 4K3AA 3K9AA 4UCVA 1H2SB 1S0VA 3LDEA 1Q43A 3ETEA 1M90W 2VGBA 3B2EE 1QLEC 1XEQA 4TQFA 2L6LA 3QF7A 2YXLA 4X1KA 3HB3B 3ZHQA 1X59A 2VWKA 4I9QA 1SA0B 2LJ2A 4NKGB 3CPWU 1YZBA 2CTQA 1K3EA 2XAJA 1R6NA 1K9MW 3ZMVA 2UUCB 5KLVH 2ODMA 2AHYA 4U7OA 4IT5A 1Y76B 4TV9B 4E2LA 4DV4B 2Q4PA 2VQEB 2JGUA 1N32O 5A2QN 3ABKB 4ABMA 2XAFA 4UB8Z 4DV1O 2EIJC 4JI4O 4GKKO 4KCTA 3RYCB 4U3JB 1OCZC 1QR9A 3AK3A 3JARB 4LF8B 2MW2B 4MW3A 5F2VO 3IJ4A 2N05A 1AI6A 2ZIOA 2XAGA 4FJCC 4YHHB 1N33B 4JYAB 3H1HH 5AG2A 3WB0A 1XMOB 2Q69A 4HZ3A 3K0DA 3JD1A 4X1YB 4JI3O 2NLJC 2VS0A 4XDJA 3STLC 2F66C 1XBLA 3WG7C 2ZDIC 1VQOV 5KA5A 1Y66A 2OCHA 2BCCH 5FL7G 3CD6V 3APQA 1G8MA 2ZKOA 4ZIBA 1F3XA 3SRDA 2PYJA 3JD4A 5GW7A 1FXKC 2W6IG 2IU0A 5C8YA 2ZM6B 4J7KA 2BSKB 1PNMA 3CX5F 2EJ7A 1MG1A 3T1HO 5L3EA 1AI5A 2WLJA 3RW0A 3DSQA 4QIWF 4X88A 3AG7A 1U97A 2F95B 1DF5A 4DR1B 2E28A 3JAWB 1JJOA 4NXMO 5D5PA 1PL4A 4KCWA 1H2KA 3G4SV 4LFAB 4HAMA 4HYWA 1BGYH 5K1PA 3QNEA 3KZIZ 4GX2A 3C3TA 5CA3A 2QKSA 3JD3A 3I56V 4DR6B 2FKXA 4JI5O 2WLLA 1DTOA 3CRMA 1H2LA 1N0JA 1OCCB 2X6AA 4QGCA 5H6RA 4DV3O 4FLXA 3F5WC 4I7ZB 2ITCC 2JRIA 1D5NA 3I5DA 3B4SA 1WP8A 1SQXH 3ASOB 4NB5A 3I55V 5JVDB 3LDDA 3PP7A 2UXBB 4YY3B 1Y74A 2EILC 1Q6UA 1N0NA 2Q7GA 4R50A 1I5XA 3MDSA 1YTFB 2W0XA 2RNBA 1P84F 4LF6O 3BHPA 1PKMA 4UCRA 5KMGA 4GX1A 3E8FA 3ZS8C 3IGAC 3JCUZ 4B2DD 1DF4A 1KECA 1YF2A 2IH1C 3ZHVA 1RM1B 1ZJHA 1L0LH 4I50B 3HKDB 2DOSA 3JD2A 1PKXA 3J7AU 3QV7A 3SYQA 2KB1A 3JASA 3B40A 1VQ7V 4YXWG 2P7TC 1R6KA 2YEVB 1L0NH 1N36O 4O4LA 2VQFB 1S76D 3L73H 1N8RW 2DYSC 2UXDO 1JQ0A 4IP7A 4MW8A 1AR4A 2NR5A 2ZR3A 2EINB 3SPCA 1AJQA 3L71H 5FNVB 3OEEG 1GN2A 1V54C 1M56B 1MMMA 4DR4B 1NZ6A 4JI0O 4GLXA 1NTZH 4IIJB 3VQYA 2YXHA 2Y4TA 3N27A 4CH3A 2Q6AA 4LCUC 1QQCA 3QTGA 4DR5B 3HKEA 5BZBA 3X2QC 1B04A 4QG8A 3SPHA 4X1KB 5B1AC 2FTKA 5LMUB 4FLUA 4B3MO 2GHYA 3CP1A 1OCOC 1A49A 1KP3A 1DK1A 4HNAA 1T57A 3FAVA 4PA7A 3AG3C 1FJGB 2EIMB 2PF4E 2DW4A 1IVSA 1ZAUA 4FPPA 5DN6G 5LYJA 1RSOA 4QG6A 1E1QG 3LSSA 1K4CC 2LGWA 3MHSC 1M57B 2R9IA 2UXCO 4KCVA 2FB5A 4J7ZA 4ICGA 5B3SB 2B5UA 2RDCA 2CDYA 4LFBO 2FL4A 1IBMB 1Y6XA 1HNWB 1K8AW 2OYQA 1HNXO 4FM0A 3OMNB 5ITZB 1AILA 1AVMA 3KHDA 3SJCC 4I0XA 2ZXWB 4FK5C 4U3FH 2Y69C 4DO2A 3CXCU 1VP7A 3M7MX 1QCEA 1V9PA 2FYUH 4X66B 4MVOA 5GTHZ 5B1BC 1OCRC 1PL0A 5IY5C 1F7YA 2XNDG 4WBNA 4KXRA 2ADQB 1VF6C 5IWAO 3K79A 1I94B 3RN4A 2W6JG 1B06A 1BHAA 1OZ0A 5DEDA 3W7UA 1WPBA 2ZQMA 3DXRA 4E4EA 5EK0A 2UUCO 5C8YB 3ABUA 3SJQC 2R9AA 3H9VA 4L8JA 4O2AA 4FLYA 4W4LA 4DV4O 5CBHA 1V55C 2PYLA 4I4TA 1TUEB 3K04A 4RUFA 1MZEA 2WA4A 2XTAA 1HR0O 2V1DA 2L35A 3TXQA 4DV5B 5BR8B 1AJNA 2R72A 3O65A 4RUEA 4MSWC 5GONA 3VOUA 3K06A 1B6QA 2ADPA 1YTFD 2YXYA 4LF8O 1COWG 5KHKA 1PPJH 1N33O 4CC6A 1VQ4V 5EZYA 1XMOO 2WLLB 4KFMA 5EIBC 2QWNB 5LMNO 1XL6A 4BWAA 3A0HZ 2KG7A 3CRCA 4F4LA 3JATA 2GSMB 3QTCA 3CYOA 3U2ZA 5BXZA 5LGNA 1NT2B 2QKCA 2UUBO 1ZL8A 3SRFA 3OUFA 2Y0IA 4LFCB 5LP6B 3OE7G 2RCVA 4B3TB 4CC5A 1XI1A 1H8EG 4MVSA 2YC0A 4JI8B 2YIDA 1Q90D 4PI0A 1A3WA 1R3IC 2ZM6O 2NNUA 1ZX3A 5KMGB 1H2NA 1TAEA 4B08A 1EM1A 5IE9A 4G2KA 3S3XA 4RO2A 5J2UA 1EN6A 2KKWA 1NI8A 5L3GA 1A5UA 3ABKC 4W4KA 4JI1B 3OR7C 4DR1O 2IJIA 4LWSB 1VQ6V 2RN9A 3DTUB 3IC7A 4LFAO 4NR1A 4CH4A 3T0TA 4GX5A 1L8DA 4BIUA 4I55A 2XAQA 1NH2B 4LH7A 1ZLZA 3BFRA 1M1KW 3ZBHA 4DR6O 2Q7HA 3TGUH 2GTSA 3QV6A 4IYIA 2UU9B 3F5TA 4A5UB 1TGOA 3K5OA 3ABMB 4BR6A 4C7UA 3AK1A 5IT9N 4K35A 2RQ6A 5IJ0A 2JVDA 2E75B 4MVUA 1IXBA 2LFSA 1ROPA 3WU2Z 3SGIA 1YXBA 2CK3G 3APOA 3HKEB 4NXNB 4X64B 1S72V 3B77A 5CB4A 3WFVA 1G6UA 3D36C 3A8TA 3RYFB 4HNAB 2Z5UA 3BCCH 5IDJA 1Q6IA 4UB6Z 4MVQA 2OTLV 3E22A 3MHHC 5LYJB 1IX9A 2WPDG 2XHBA 4QG9A 1D5AA 4PDLA 4H33A 5CBFA 4YJ3A 2PGGA 5KHGA 4KRZA 3QVNA 1P7GA 4PDMA 4X20A 4LC1A 3CMAV 2K9PA 1N34B 1R3LC 4CH5A 3E0WA 1K5QA 4GYCB 3RBZA 2WLHA 5JQGB 4O4HA 1IBKB 4DV0O 2O57A 4TV8B 5H9CA 3JAKA 4PHZA 3HQNA 1FFTB 4IL6Z 1P4RA 2PUSA 1MOFA 4MTOA 4DR4O 1ORQC 1W2BU 3ASOC 2CTPA 3MAQA 3THOA 4LF4O 2XT9A 3AEIA 1J5EO 4CBCA 4WBNB 3AG2B 4I5SA 1CP9A 3BY6A 2DQ3A 4HYVA 2IM9A 5BY1A 1JOYA 1EZVH 3HKBB 2DN9A 4JZGA 3EFFK 4UCSA 3KCXA 4LH6A 4DV6B 3K08A 4UV9A 1P49A 3LSQA 1FJGO 4J10A 4UVAA 3DXRB 1QBZA 1RM1C 5LHGA 2HHHB 3ZIAG 4FFKA 4YJ2B 4JI2B 4O2AB 4K8XA 4DV7O 3FB6C 4JAUA 1VQPV 3M99B 1H2MA 1FXKA 1MSWD 4JV5B 4DRXA 2Q7EA 2LQTA 5EBMC 3OEHG 2VGIA 1A32A 3ICXA 1IBMO 1HNWO 1H8HG 2PY5A 3FFQA 2JJ2G 4QNHB 2F23A 3VQXA 3EVKA 2B9ZA 5HFMA 2OTJV 3B8MA 5LA6A 3W7TA 3H6OA 1FKAO 5EZYB 4IGGA 3FB5C 1T5AA 4WFHA 2KG7B 3K58A 3SR2C 3L75H 3JATB 5L3BA 3SYOA 4X66O 3OTOB 1W59A 3PN1A 1VP8A 5EC2C 4LF7O 1EFRG 3ZRWA 4WFEA 1KB9F 3CB2A 2ZR2A 5IYBO 4AQYB 3FKSG 5FLXN 1S77D 1WB7A 1I94O 2AXTZ 4JTAB 1L1FA 5LGTA 1XHXA 4DR7O 1NH2D 3TK1A 2CH7A 2EIMC 2KSDA 3ZCCA 2P90A 3EOEA 1FYJA 1SQVH 5JCOC 3OGCC 4DRSA 1W0JG 1DGSA 3JAMN 1M57C 4WFAV 4RWUA 3CS5A 5J2UB 2GTAA 3TJTA 1EZJA 4GCZA 5CA1A 4KUMA 4PD4F 1AQFA 3QO8A 3RT3C 5B3SC 3ZRVA 4JI7B 2JGDB 3CWBH 2DWEC 4DYLA 5BR8O 4QGPA 1I5YA 1M4UA 2IW5A 4G28B 3CC2V 1IZ3A 3SRHA 1NU1H 1GN6A 3R66A 1BQ0A 2KQXA 4I55B 3IFXA 2QDOA 2ZXWC 4IHJB 4BIOA 2Q5ZA 2R70A 4PA4A 2PTMA 4DW0A 1GRJA 1FD9A 3HQPA 3J81N 3STZC 3L72H 3U0ZA 2YIAA 2H8PC 1KU9A 2F1MA 2YUAA 2QTSA 3UQ8A 3ZHRA 3RVZA 4MTXA 4LNUB 1Q3EA 4PDVA 4LFCO 2N04A 3E86A 2OWOA 4TUYA 5IJ0B 1E0UA 4DR3O 2WLMA 1WN7A 4TWKA 2Q8VA 4X62B 4JI8O 3SYCA 4KHPB 3CRAA 3JYCA 2QM8A 1IBLO 4JAVA 4F6RA 5CB4B 3ZN0A 4DUYB 3BAAA 4WF9V 2ATKC 3C90A 2ZCEA 3OMAB 4P9PA 4MS2A 1GK9A 3ASNB 3E22B 1AR1B 2LP7A 5J2TA 3FD9A 3ETGA 4YJ3B 1BMFG 2WA3A 3E83A 3BJFA 4TT3G 2GV9A 1SZTA 3ZX6A 1WP7A 1VQNV 1VEWA 1SETA 1LR1A 2XOKG 4FIPC 1XUQA 4RPPA 2EZPA 2UU9O 4Z1VA 3E8GA 5CMUA 3JAKB 4ZI7A 3CC7V 1OJHA 3B09A 1K33A 4O4IB 1Q8IA 2HLDG 4PJ0Z 2D2CB 1KQSU 3HR0A 3GQYA 5CA0A 1OCZB 1YJ9V 2BOBC 4B7EA 1QNMA 3W7XA 1XMQB 3LNNA 4LF9B 1VQMV 1JFFA 3P30A 5LP6C 4D7TA 5D5QA 1HP8A 5BMVA 4H44B 2UUAO 4B3SO 1R1BA 3OFNG 2CGOA 2JEXA 2MK3A 4X64O 2AZ0A 3G71V 1SS3A 3ABTA 3N2KA 5FPRA 1SQGA 4LR3A 4J41A 3AK2A 3H1LH 5LHHA 3T1YB 3OGIB 4R8CA 5EBLC 4QPKA 2YS8A 4OX9O 2QWRB 1VQ9V 1K7DA 4JF3A 1VF5B 1EN5A 4LF5O 1R6TA 2FMLA 4B7KA 1SESA 2XAHA 3K59A 1US6A 3KCYA 4O2BA 2OT5A 3FB8C 1URFA 3E89A 4DUZO 2IU3A 1FFXA 4FXJA 3RYIA 4DRXB 3K0GA 3OMIB 1QHTA 4X89A 3UO2A 2G38A 4OGQB 1N32B 4WFBV 3QV8A 1SZXA 5JJEB 2ZINA 3B8NA 4OXSA 2ZE8A 3D8CA 3ZHTA 1R73A 4JI4B 3ABMC 4WFGA 2JJ1G 5LA6B 3IAYA 2EZOA 3OT7A 1XL4A 5L3DA 2BOCC 5LL6Y 2VGFA 3BPZA 1YCIA 5HFLA 4ZHQA 1G1XB 4JGSA 1QVFU 2VRZA 3N2GA 4MVRA 4I9WA 2E74B 1Q5OA 3ZRWB 2HP8A 1XHZA 3MD0A 4JI3B 2X6CA 3W7WA 4NTXA 5B66Z 4DV6O 2CH7B 2QWPB 3BABA 1MA1A 2HHHO 1SA0A 4CS2A 2ZNIA 1PV0A 4JI2O 2VQEO 1D2DA 1FXHA 3ZHSA 5CA1B 5B1OA 4RAIA 2HFEC 4IMAA 1YVWA 1VQ8V 1SQPH 3T1HB 4TV9A 1KBHA 2P6JA 3P3PA 1PM9A 3OUSA 4JYBA 3P3NA 3AG1B 2P06A 3GB7C 5EYPA 2QJ1A 4YHHO 4JYAO 3K57A 2JS3A 4Z1MG 1XDCA 2WWWA 1HNZB 1TA8A 4B3RB 3LSUA 3ZJZA 3OTOO 5LGUA 4NTYA 1NQTA 2WLKA 4AILC 3AG2C 4AQYO 4H13B 4G27B 4X1YA 2HVKC 4TUYB 1Y74B 4WCEV 1KKCA 2W0FC 5JH7A 4DV3B 1KKDA 3GWOA 4MTFA 5KAFZ 1X4TA 4NYKA 5IYDO 2K1EA 3FB7C 4JAAA 4F6RB 1WAZA 1Y4MA 5E1AC 4X8AA 3TXSA 3ME3A 1XNQB 1CXZB 1F51A 2YIBD 1GO3F 1WLEA 4LF6B 3Q4HA 5J2TB 1NR7A 2HJFC 3H1IH 4JPGA 1YIJV 3BRCA 3SPIA 1YEWA 2A06H 4GZRB 3JASB 3EXAA 1WB8A 4EKWA 4R6ZA 3RVYA 3NXSA 4O4LB 5IYZA 1NJIW 1LUWA 2A3QA 1E79G 3H1JH 3CSXA 1HW7A 3JAWA 2F93B 5L3CA 4J9YB 3HKCA 1TUBA 1SKVA 2YSUB 1ZWIC 4OPAA 4O4JA 2QM4A 1N36B 4ZI7B 1RPOA 3T2MA 2YI8A 1SERA 2UXDB 1AP6A 2QWQB 4JI6B 5CA0B 2AHZA 2QTOA 4L87A 1R3KC 2Y48A 5K1XA 4UVBA 4UCOA 3RYHA 2UXBO 1JFFB 1UFIA 4YY3O 1XNRB 3AAGA 1U96A 2ZIMA 4WFFA 5BMVB 4K0KB 4PI2A 3G6EV 1P7BA 2IH3C 2Y0PA 1KUQA 4JI0B 5KHJA 1VIBA 1AI7A 4PV1B 4UXNA 5JVDA 1F23A 1IDSA 1QVGU 1Y67A 3N2KB 3FAVB 3E8HA 3K9SA 3UT5A 2HG5C 1AP5A 3SPJA 1RSOB 4B3MB 3J80N 2QA4V 1YITV 1MNGA 2F43G 1BQZA 4DK0A 2UXXA 4O2BB 4JYYA 2VQFO 4DK1A 2CTRA 2AZ2A 1FFXB 3LDCA 4PELA 5IYCO 1LNQA 4QE7A 3OR6C 2EJRA 1M5IA 5CBGA 2CUGA 4UUJC 4J7JA 2QWOB 1OCCC 3K5LA 1GN3A 4I0XB 1HWYA 1JA8A 3CCJV 2YIBA 2Y4UA 1LUVA 2PI5A 1JX9A 2QGNA 1SRYA 3CC4V 4LFBB 2EIKB 1NBMG 3WB1A 3CCEV 4IYHA 1XMQO 4FFBA 1HNXB 1BHBA 4QPJA 5H5NA 1F4NA 4ZHQB 2F4VB 3ZMUA 3N2GB 3ABLB 4DR5O 3E2EA 1AR5A 4PA3A 5LMUO 4ZBMA 5L3FA 1WA8A 3HQOA 4FVMA 3F7YC 4IIJA 4N21A 1NVPB 2OIGA 2GUZA 3PJSK 3UM7A 2ZDIA 3A0BZ 1KD1W 4FXFA 1YJWV 4UVCA 3T1YO 4BAYA 4UCUA 5IWAB 3ASNC 4RQFA 1SF9A 1RPRA 4LP8A 2Q68A 2LO1A 2H3OA 4CS4A 3SRKA 3CHXA 4X65B 4I4TB 3CRQA 2NN4A 5JCOA 3CJHA 5JJNB 4FM2A 5GONB 4YNGA 2BTQA 2H94A 1Z5VA 4EB6A 2ILMA 4F6EA 2WAMA 2EINC 5KAIZ 4DV2B 2JDIG 5LBQA 4ZKIA 2HKOA 1SQFA 1B3QA 1MZFA 5EYPB 4GKJB 3L9DA 4K8ZA 1HR0B 4D6TH 1M56C 1BT8A 1WPXA 4ZOLA 2PZSA 1DLBA 3BA8A 3HPLC 3AG4B 1K4DC 2IBZH 5ITZA 1MABG 1ZL8B 2A0LA 1UPGA 2V4DA 4X1IA 5LMNB 2Z3YA 1AROP 1YJNV 3ZEDA 1PKYA 2CGNA 3E0VA 5JJJB 4QJFB 2Q67A 1JR9A 2JK5C 3QG5A 5JH7B 2OCCB 2UUBB 4GUNA 4MTGA 1Z2GA 4DR2B 1GN4A 4DXWA 4MT8A 3KTXA 3K3WA 3D3IA 2YI9A 3U11A 3ZRXA 4X9QA 1I0HA 3H1KH 3VQWA 1FPOA 1JPXA 5LHIA 3Q4HB 3MA8A 4DV5O 2Z0AA 1S5JA 2YICA 2BTOA 3C3SA 1O9HA 2ZT9B 2ITDC 1IXMA 5CN0A 5IYZB 1GAXA 3H01A 1TVKA 2EBOA 2QKAA 3IS4A 2DYRB 1WJZA 3HKCB 1TUBB 1PNLA 2DE0X 2A79B 4UFZA 1HNZO 1GTOA 4O4JB 4B3RO 1BSMA 1NS1A 4BW5A 3UKMA 5KX5A 2B1IA 3D3QA 1OV9A 4JZ2A 3QO5A 1VQLV 4TSFG 5LXTA 3BJTA 4B3TO 4D7SA 1YSCA 2GBOA 3RWRD 1Q6HA 3RYHB 1BZKA 1PKLA 2JEUA 1KP2A 2BE3A 4JTCB 5EBWC 3A2FA 4Q6GA 5FPOA 3JSLA 1VMGA 4XDLA 3SYPA 1RFYA 5LP6A 2LW7A 3DGEA 2E76B 2P22C 1S3JA 2DJVA 1QLEB 1G4YB 2DQ0A 3JALA 4LBEC 1XNQO 3UT5B 2Q0AA 4JI1O 1EN4A 2E5LB 1GM9A 1AB3A 1T5EA 3P32A 4X20B 1VQ5V 4YIOA 1J95A 1IURA 1KMIZ 1HDJA 2B1GA 3CEIA 2OIEA 3AG1C 1M9NA 5EIBD 3T07A 5EC1C 4TQDA 5JWPA 3T1CA 4LWSA 1BS3A 4O4HB 1H38A 1KC8W 1NVPD 1XOUA 3ZHUA 3L74H 4KP4A 2EIJB 2Q0OC 1EBOA 4GX0A 1A3XA 3EHBB 3IC9A 4JI6O 3G6BA 3CMEV 1FXVA 1QU7A 1H2GA 4FLWA 4FFBB 2QSAA 3GVMA 1NR1A 4FZ1A 3VQVA 1Q81W 4DV0B 4J42A 3OM3B 1JVMA 1XNRO 2A9HA 3CCVV 5KUKA 4K0KO 2LW1A 2LGQA 4PA9A 4PA6A 3GWKC 4NXNO 2ZE7A 3SYAA 1WA8B 2IJHA 4AI8A 2ARHA 4CS3A 4MVMA 4LF4B 5GTIZ 1O9GA 2GUZB 4FMTA 2CE4A 3WG7B 3G2GA 2ZE5A 1VF6A 2IJJA 1S5HC 1J5EB 4XDKA 3UCSC 2XUMA 3A0RA 2HR3A 1OHHG 1ZTEA 5KUMA 3K5NA 2P4KA 2C2AA 3RYFA 1QLNA 1N34O 1Q86W 4G1NA 1FXKB 1GH6A
chains in the Genus database with same CATH topology
3LNMB 3ZMZA 5CA3A 2QKSA 3JD3A 2WLNA 3I56V 3F7VC 3T4DA 3KG2A 1Y4MA 4UV8A 5E1AC 4X8AA 1CPYA 3AEIA 2WLLA 1QR8A 1DTOA 4CBCA 3AG2B 1F51A 4I5SA 1CP9A 1GO3F 3BY6A 1OCCB 2DQ3A 1WLEA 3LUTB 1JOYA 2X6AA 5H6RA 2WLIA 1NR7A 2HJFC 3F5WC 2ITCC 1YIJV 3SPIA 3EFFK 4HYOA 3K08A 4UV9A 4EKWA 3LSQA 1NKDA 4R6ZA 3RVYA 1R3JC 4UVAA 1F4MA 3ASOB 3NXSA 1QBZA 1RM1C 5LHGA 4GT1A 3I55V 1NJIW 3SPGA 1E79G 3ZIAG 3LDDA 2EILC 5L3CA 4R50A 4J9YB 1I5XA 1YTFB 2YSUB 3FB6C 1ZWIC 3CCSV 4JAUA 1VQPV 3M99B 1Q7YW 1FXKA 1MSWD 4N23A 1THZA 4GX1A 3E8FA 1RPOA 3IGAC 3T2MA 1SERA 1AI4A 1W0KG 3OEHG 5EBMC 1KECA 1DF4A 3ZRSA 3CCMV 3CCRV 2AHZA 2IH1C 2QTOA 2V7QG 4L87A 1R3KC 4JASA 1H8HG 1RM1B 2Y48A 4UVBA 2JJ2G 2X7RB 4QNHB 4Q20A 3E35A 2EILB 5H6QA 2IJKA 3W7SA 3AAGA 5HFMA 2OTJV 4RQEA 3B8MA 4WFFA 3JD2A 4JTDB 3W7TA 3G6EV 1PKXA 3JCZA 1P7BA 3SYQA 1JJ2U 2IH3C 2KB1A 2XASA 3FB5C 1FS0G 2ZD9A 3ZMSA 1VQ7V 4U7NA 4YXWG 2P7TC 1R6KA 2YEVB 4WFHA 3CCUV 1AI7A 1S76D 5L3BA 3SYOA 4UXNA 1N8RW 2DYSC 1F23A 3TETA 1JQ0A 1QVGU 5EC2C 1EFRG 3ZRWA 4MW8A 4WFEA 3E8HA 1BL8A 2ZR2A 5C93A 5DM6V 2ZR3A 2HG5C 3E8BA 5IYBO 3FKSG 2EINB 3SPCA 3SPJA 4XBFA 1S77D 1AJQA 4JTAB 2QA4V 1L1FA 3OEEG 1YITV 2F43G 1V54C 1M56B 5LGTA 1NH2D 3TK1A 2UXXA 2EIKC 3OAAG 1GM7A 2EIMC 3ZCCA 2P90A 2DYSB 2Q6AA 5IYCO 3LDCA 4PELA 4LCUC 3OGCC 1LNQA 1W0JG 3OR6C 4QE7A 2EJRA 2DWDC 3ABLC 2WSSG 5CBGA 5BZBA 1M57C 3X2QC 4WFAV 2X0LA 3SPHA 5B1AC 4UUJC 2R9RB 1EZJA 4GCZA 2FTKA 4KUMA 1OCCC 2GHYA 3CP1A 1OCOC 3K03A 1HWYA 3QO8A 3ZRVA 1KP3A 2M7WA 5B3SC 3CCJV 4JYCA 1V54B 1JX9A 2PI5A 1SRYA 2DWEC 1I5YA 4G28B 2IW5A 3CC2V 3CC4V 2EIKB 1NBMG 4PA7A 3AG3C 3CCEV 2EIMB 1K34A 2DW4A 1BHBA 4FPPA 4CZZA 4QPJA 5J9PC 1F4NA 5DN6G 4P9OA 3BEHA 1GKFA 3ZMUA 3IFXA 2UXNA 1K97A 1E1QG 2ZXWC 3ABLB 3LSSA 1K4CC 3E2EA 3MHSC 1M57B 3X2QB 2R9IA 4PA3A 4PA4A 5B1AB 4ZBMA 5L3FA 1OCOB 5B3SB 1GMGA 3F7YC 1GM8A 3D36A 2B5UA 4N21A 3STZC 1NVPB 3PJSK 3UM7A 2H8PC 2P67A 2ZDIA 1KD1W 3AG3B 1K8AW 1YI2V 1YJWV 3RVZA 3FYIB 4MTXA 4R7CA 4UVCA 3OMNB 4PDVA 4BAYA 3E86A 1K73W 3ASNC 4RQFA 1JCHA 2ZXWB 4FK5C 4QE9A 1RPRA 4LP8A 2WLMA 2Q68A 4TWKA 1AJPA 3QO7A 2Y69C 4DO2A 3SYCA 5B1NA 3CXCU 1QCEA 3CCQV 3AG4C 3JYCA 2HVJC 4MVOA 2QM8A 4JAVA 3ZN0A 3OW2U 5B1BC 1OCRC 1PL0A 5IY5C 4WF9V 2ATKC 3OMAB 1ENVA 2H94A 2XNDG 3FB7C 4P9PA 4MS2A 1GK9A 2WAMA 3ASNB 3K79A 2EINC 1AR1B 2JDIG 2LP7A 5LBQA 4ZKIA 2HKOA 3ETGA 1BMFG 1M56C 2OCCC 2W6JG 3E83A 2Y69B 1BHAA 1WPXA 1OZ0A 3W7UA 1YHQV 4PDRA 1DLBA 1K5SA 2ZQMA 4TT3G 5KA6A 4H37A 3HPLC 1SZTA 3AG4B 1K4DC 4ASUG 5EK0A 1VQNV 1PD3A 1SETA 3ABUA 2XOKG 3SJQC 3ETDA 4FIPC 3ZMTA 1MABG 1OCRB 5B1BB 3TCUA 1UJWB 4BIZA 4J9ZB 2LFRA 5IY5B 2A0LA 2EZPA 5CBHA 1Q82W 3R65A 1V55C 3VBBA 1VQKV 2D3OW 3JD0A 3E8GA 2QM7A 1TUEB 2Z3YA 1AROP 5CMUA 1YJNV 3K04A 4RUFA 4MVZA 3CC7V 4QJFB 1E1RG 1K33A 2HLDG 2Q67A 2V1DA 2JK5C 1KQSU 3FYEB 2OCCB 1OCZB 1YJ9V 1AJNA 1PNKA 2BOBC 4RUEA 4MSWC 3VOUA 3K06A 3W7XA 1B6QA 1CEZA 4MTGA 1YTFD 1VQMV 3P30A 1COWG 4JPRA 4DXWA 4MT8A 2DYRC 3K3WA 1VQ4V 3D3IA 3ML0A 1V55B 2JIZG 2WLLB 3ZRXA 3ZN1A 4KFMA 3OFNG 4P30A 2JEXA 2QE7G 2MK3A 1XL6A 2YEVA 1JPXA 4F4LA 3G71V 5LHIA 2GSMB 2WLIB 3CYOA 2PI4A 3ABTA 5LGNA 2ITDC 1IXMA 5CN0A 5LHHA 3OUFA 4R8CA 5EBLC 4QPKA 3H01A 3OE7G 3CCLV 2X6BA 4P2ZA 1VQ9V 2QEXV 2EBOA 1K7DA 4JF3A 2DYRB 3T4ZA 1SESA 1K92A 2XAHA 3K9AA 1H8EG 1PNLA 4MVSA 1S0VA 2A79B 2OT5A 3FB8C 3LDEA 3E89A 1GTOA 1R3IC 3ETEA 2NNUA 4BW5A 1M90W 2IU3A 3UKMA 1QLEC 3K0GA 3OMIB 4G2KA 4RO2A 4X89A 2B1IA 3HB3B 4WFBV 3QO5A 1VQLV 4TSFG 5L3GA 1YSCA 3ABKC 3B8NA 4OXSA 2JEUA 3OR7C 1KP2A 2IJIA 3CPWU 1R73A 4JTCB 3ABMC 1VQ6V 4WFGA 2JJ1G 5EBWC 3DTUB 3IC7A 2EZOA 1XL4A 5L3DA 1K3EA 2BOCC 2XAJA 1R6NA 4XDLA 3SYPA 4GX5A 5HFLA 1K9MW 3ZMVA 4BIUA 4JGSA 1QVFU 2XAQA 3DGEA 1NH2B 1S3JA 2AHYA 4U7OA 1M1KW 1QLEB 1G4YB 2DQ0A 4I9WA 4MVRA 4E2LA 4LBEC 3ZRWB 3ABKB 2XAFA 3MD0A 1GM9A 2EIJC 2X6CA 3ABMB 3W7WA 3P32A 1OCZC 1VQ5V 1J95A 1QR9A 2B1GA 4MW3A 3AG1C 1AI6A 1M9NA 5EC1C 2XAGA 4MVUA 4FJCC 3T1CA 2LFSA 1ROPA 2CK3G 1FXHA 1H38A 1KC8W 1NVPD 2Q69A 4HZ3A 3K0DA 4KP4A 2EIJB 3JD1A 1S72V 5B1OA 2NLJC 4RAIA 1EBOA 2HFEC 3B77A 4GX0A 3WFVA 3EHBB 4XDJA 3STLC 1VQ8V 2Z5UA 3WG7C 2ZDIC 5IDJA 2P6JA 3CMEV 1FXVA 1VQOV 3OUSA 4JYBA 1Y66A 4MVQA 5KA5A 1H2GA 2OTLV 1NR1A 3AG1B 1Q81W 3MHHC 3GB7C 3OM3B 5FL7G 2WPDG 3CD6V 1JVMA 1G8MA 4PDLA 4H33A 5CBFA 2A9HA 3CCVV 5KUKA 4PA9A 4PA6A 4PDMA 4Z1MG 4LC1A 3CMAV 3JD4A 5GW7A 2WWWA 3SYAA 1R3LC 1FXKC 2IJHA 2W6IG 2IU0A 3ZJZA 1PNMA 1MG1A 4MVMA 5L3EA 4FMTA 5LGUA 1AI5A 2WLJA 3RW0A 3WG7B 1K5QA 1NQTA 2IJJA 2WLKA 1S5HC 2WLHA 4QIWF 3RBZA 4XDKA 3AG2C 4X88A 5H9CA 4G27B 1DF5A 2HVKC 2HR3A 1OHHG 3A0RA 1FFTB 5KUMA 4WCEV 2W0FC 1KKDA 1P4RA 1MOFA 2C2AA 4MTOA 3GWOA 3G4SV 1QLNA 4HAMA 4MTFA 1Q86W 1ORQC 2K1EA 3QNEA 1FXKB 5IYDO 1W2BU 3ASOC 4GX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAQ A;  3ZMZ A;  3ABU A;  2XOK G;  3ZMT A;  1MAB G;  1W0J G;  4UV8 A;  2EJR A;  2WSS G;  2X0L A;  4KUM A;  2XAF A;  2Z3Y A;  5H6R A;  1E1R G;  2HLD G;  2V1D A;  2IW5 A;  1NBM G;  4UV9 A;  4UVA A;  2DW4 A;  4CZZ A;  5LHG A;  5DN6 G;  1COW G;  1E79 G;  3ZIA G;  3ZMU A;  2UXN A;  1E1Q G;  2XAG A;  5L3C A;  2R9I A;  2CK3 G;  3ZN1 A;  2JIZ G;  3OFN G;  5L3F A;  2QE7 G;  5LHI A;  3ABT A;  1W0K G;  3OEH G;  5LGN A;  2Z5U A;  2V7Q G;  1H8H G;  5LHH A;  4UVC A;  2Y48 A;  4BAY A;  4UVB A;  2JJ2 G;  3OE7 G;  5H6Q A;  5FL7 G;  2WPD G;  2XAH A;  1H8E G;  2XAS A;  4Z1M G;  1FS0 G;  3ZMS A;  4YXW G;  2W6I G;  5L3B A;  4UXN A;  3ZN0 A;  5L3E A;  5LGU A;  1EFR G;  2H94 A;  2XND G;  4TSF G;  5L3G A;  3FKS G;  4XBF A;  2JDI G;  5LBQ A;  2HKO A;  1OHH G;  2JJ1 G;  3OEE G;  1BMF G;  2F43 G;  5LGT A;  2W6J G;  2UXX A;  3OAA G;  5L3D A;  2XAJ A;  4TT3 G;  4ASU G;  3ZMV A; 
#chains in the Genus database with same CATH topology
 3LNM B;  3ZMZ A;  3KKY A;  2WLN A;  3FX7 A;  3F7V C;  3NR7 A;  3T4D A;  3KG2 A;  4UV8 A;  3CJH B;  3GG8 A;  1CPY A;  1QR8 A;  2QR4 A;  2BTQ B;  4FLV A;  1IBK O;  4EB6 B;  4DV7 B;  2ZE6 A;  3RGB A;  1MSD A;  3UO3 A;  2EUL A;  4DV1 B;  3LUT B;  1SC5 B;  2CTW A;  2WLI A;  1KYO F;  4GKK B;  5LOV A;  1NTK H;  4HYO A;  1NKD A;  4ZOL B;  1R3J C;  5JQG A;  1F4M A;  4B2D A;  5IJ9 A;  3WB2 A;  4AHC A;  4DW1 A;  4GT1 A;  3SPG A;  4TV8 A;  2F4V O;  2A7W A;  3U10 A;  3CCS V;  4EFE A;  1Q7Y W;  4X1I B;  4NTW A;  4N23 A;  1THZ A;  2P4V A;  4FM1 A;  1W0K G;  1AI4 A;  3CCM V;  3ZRS A;  4LF7 B;  3CCR V;  2V7Q G;  4JAS A;  2P5O A;  2X7R B;  4Q20 A;  3E35 A;  2EIL B;  5H6Q A;  3T05 A;  2IJK A;  3W7S A;  2JS5 A;  3HKB A;  4RQE A;  2VGG A;  2RMK B;  4JTD B;  1Z5W A;  3JCZ A;  5TIS Z;  1JJ2 U;  4J80 A;  5A9G A;  2XAS A;  4X65 O;  1ZSP A;  1FS0 G;  2ZD9 A;  4DR7 B;  3ZMS A;  4U7N A;  3SDL A;  2RJZ A;  3CCU V;  4JV5 O;  2ETN A;  3BVO A;  3TET A;  1Y76 A;  4YJ2 A;  1E0T A;  4CH6 A;  1BL8 A;  5C93 A;  5DM6 V;  3E8B A;  4FZ0 A;  3BA9 A;  1WNS A;  2N74 A;  4XBF A;  4DV2 O;  1TVK B;  3OD4 A;  4GKJ O;  3S3W A;  4NXM B;  3K5M A;  3RYC A;  2Q9L A;  5B5E Z;  4U3J A;  4EEQ A;  2HJD A;  2DMX A;  2EIK C;  3OAA G;  3JAR A;  1GM7 A;  1PKN A;  4NVP A;  4YIP A;  2DYS B;  4J11 A;  3QV9 A;  1XIL A;  5KHH A;  2DWD C;  4JI5 B;  3ABL C;  2WSS G;  3CE2 A;  5KX5 B;  2X0L A;  4FLZ A;  2R9R B;  4UCT A;  3G67 A;  5LXT B;  2YDE A;  1N4C A;  3K03 A;  3O9O A;  2M7W A;  4FLT A;  1I7F A;  4JYC A;  1V54 B;  5H2F Z;  1K34 A;  1SQB H;  4CZZ A;  4DR2 O;  5J9P C;  4P9O A;  3BEH A;  1GKF A;  2UXN A;  1K97 A;  2EX3 A;  1XRE A;  3X2Q B;  4DR3 B;  3JAL B;  1S5L Z;  5B1A B;  1OCO B;  4YJ5 A;  1GMG A;  1GM8 A;  3D36 A;  4OPH A;  4JI7 O;  2BSK A;  1IBL B;  1VF7 A;  2P67 A;  1M93 A;  3AG3 B;  1YI2 V;  3FYI B;  4R7C A;  3DC6 A;  2VWJ A;  5E79 Z;  1K73 W;  4TOI A;  1JCH A;  3ETQ A;  4QE9 A;  1AJP A;  2JGD A;  3QO7 A;  5B1N A;  1BE3 H;  1SQQ H;  2Q73 A;  1NTM H;  3CCQ V;  3AG4 C;  1BCC H;  2HVJ C;  2CAZ C;  3L70 H;  3OW2 U;  2HEP A;  4IHJ A;  1ENV A;  1JMK C;  4X62 O;  2OCC C;  2Y69 B;  3GR4 A;  1YHQ V;  4PDR A;  1K5S A;  4KHP O;  5KA6 A;  4H37 A;  1PP9 H;  4LNU A;  4ASU G;  1I08 A;  3OTF A;  1PD3 A;  1UJW B;  3ETD A;  3ZMT A;  4DUY O;  5B1B B;  1OCR B;  3TCU A;  4BIZ A;  4J9Z B;  3JSN A;  2LFR A;  5IY5 B;  3G80 A;  4H0L B;  2E3C A;  2UUA B;  1Q82 W;  1VAR A;  3R65 A;  4B3S B;  4KS0 A;  3VBB A;  1VQK V;  4Z2W A;  3JD0 A;  2D3O W;  2QM7 A;  2E5L O;  3SJB C;  3CRR A;  4MVZ A;  3DC5 A;  3N25 A;  1E1R G;  2G50 A;  3FYE B;  1PNK A;  1FAF A;  1CEZ A;  2ZNJ A;  5KHI A;  2M6Y A;  4I50 A;  4OX9 B;  1YDX A;  3RYI B;  2AGA A;  1RP3 B;  4JPR A;  4KCU A;  3M8A A;  3HKD A;  2DYR C;  4LF5 B;  5DEC A;  2UXC B;  3ML0 A;  1V55 B;  2JIZ G;  3ZN1 A;  4EFB A;  3SJA C;  1ZUQ A;  3CXH F;  1F3W A;  4P30 A;  2QE7 G;  2YEV A;  2GDS A;  2WLI B;  4BW9 A;  4DUZ B;  2PI4 A;  4WJ8 A;  5LOV B;  4LF9 O;  4KL1 A;  3RFR A;  5IJ9 B;  3CCL V;  2X6B A;  4P2Z A;  4HBN A;  2QEX V;  2AW9 A;  5FNV A;  3T4Z A;  1XQ8 A;  4O4I A;  1K92 A;  4K3A A;  3K9A A;  4UCV A;  1H2S B;  1S0V A;  3LDE A;  1Q43 A;  3ETE A;  1M90 W;  2VGB A;  3B2E E;  1QLE C;  1XEQ A;  4TQF A;  2L6L A;  3QF7 A;  2YXL A;  4X1K A;  3HB3 B;  3ZHQ A;  1X59 A;  2VWK A;  4I9Q A;  1SA0 B;  2LJ2 A;  4NKG B;  3CPW U;  1YZB A;  2CTQ A;  1K3E A;  2XAJ A;  1R6N A;  1K9M W;  3ZMV A;  2UUC B;  5KLV H;  2ODM A;  2AHY A;  4U7O A;  4IT5 A;  1Y76 B;  4TV9 B;  4E2L A;  4DV4 B;  2Q4P A;  2VQE B;  2JGU A;  1N32 O;  5A2Q N;  3ABK B;  4ABM A;  2XAF A;  4UB8 Z;  4DV1 O;  2EIJ C;  4JI4 O;  4GKK O;  4KCT A;  3RYC B;  4U3J B;  1OCZ C;  1QR9 A;  3AK3 A;  3JAR B;  4LF8 B;  2MW2 B;  4MW3 A;  5F2V O;  3IJ4 A;  2N05 A;  1AI6 A;  2ZIO A;  2XAG A;  4FJC C;  4YHH B;  1N33 B;  4JYA B;  3H1H H;  5AG2 A;  3WB0 A;  1XMO B;  2Q69 A;  4HZ3 A;  3K0D A;  3JD1 A;  4X1Y B;  4JI3 O;  2NLJ C;  2VS0 A;  4XDJ A;  3STL C;  2F66 C;  1XBL A;  3WG7 C;  2ZDI C;  1VQO V;  5KA5 A;  1Y66 A;  2OCH A;  2BCC H;  5FL7 G;  3CD6 V;  3APQ A;  1G8M A;  2ZKO A;  4ZIB A;  1F3X A;  3SRD A;  2PYJ A;  3JD4 A;  5GW7 A;  1FXK C;  2W6I G;  2IU0 A;  5C8Y A;  2ZM6 B;  4J7K A;  2BSK B;  1PNM A;  3CX5 F;  2EJ7 A;  1MG1 A;  3T1H O;  5L3E A;  1AI5 A;  2WLJ A;  3RW0 A;  3DSQ A;  4QIW F;  4X88 A;  3AG7 A;  1U97 A;  2F95 B;  1DF5 A;  4DR1 B;  2E28 A;  3JAW B;  1JJO A;  4NXM O;  5D5P A;  1PL4 A;  4KCW A;  1H2K A;  3G4S V;  4LFA B;  4HAM A;  4HYW A;  1BGY H;  5K1P A;  3QNE A;  3KZI Z;  4GX2 A;  3C3T A;  5CA3 A;  2QKS A;  3JD3 A;  3I56 V;  4DR6 B;  2FKX A;  4JI5 O;  2WLL A;  1DTO A;  3CRM A;  1H2L A;  1N0J A;  1OCC B;  2X6A A;  4QGC A;  5H6R A;  4DV3 O;  4FLX A;  3F5W C;  4I7Z B;  2ITC C;  2JRI A;  1D5N A;  3I5D A;  3B4S A;  1WP8 A;  1SQX H;  3ASO B;  4NB5 A;  3I55 V;  5JVD B;  3LDD A;  3PP7 A;  2UXB B;  4YY3 B;  1Y74 A;  2EIL C;  1Q6U A;  1N0N A;  2Q7G A;  4R50 A;  1I5X A;  3MDS A;  1YTF B;  2W0X A;  2RNB A;  1P84 F;  4LF6 O;  3BHP A;  1PKM A;  4UCR A;  5KMG A;  4GX1 A;  3E8F A;  3ZS8 C;  3IGA C;  3JCU Z;  4B2D D;  1DF4 A;  1KEC A;  1YF2 A;  2IH1 C;  3ZHV A;  1RM1 B;  1ZJH A;  1L0L H;  4I50 B;  3HKD B;  2DOS A;  3JD2 A;  1PKX A;  3J7A U;  3QV7 A;  3SYQ A;  2KB1 A;  3JAS A;  3B40 A;  1VQ7 V;  4YXW G;  2P7T C;  1R6K A;  2YEV B;  1L0N H;  1N36 O;  4O4L A;  2VQF B;  1S76 D;  3L73 H;  1N8R W;  2DYS C;  2UXD O;  1JQ0 A;  4IP7 A;  4MW8 A;  1AR4 A;  2NR5 A;  2ZR3 A;  2EIN B;  3SPC A;  1AJQ A;  3L71 H;  5FNV B;  3OEE G;  1GN2 A;  1V54 C;  1M56 B;  1MMM A;  4DR4 B;  1NZ6 A;  4JI0 O;  4GLX A;  1NTZ H;  4IIJ B;  3VQY A;  2YXH A;  2Y4T A;  3N27 A;  4CH3 A;  2Q6A A;  4LCU C;  1QQC A;  3QTG A;  4DR5 B;  3HKE A;  5BZB A;  3X2Q C;  1B04 A;  4QG8 A;  3SPH A;  4X1K B;  5B1A C;  2FTK A;  5LMU B;  4FLU A;  4B3M O;  2GHY A;  3CP1 A;  1OCO C;  1A49 A;  1KP3 A;  1DK1 A;  4HNA A;  1T57 A;  3FAV A;  4PA7 A;  3AG3 C;  1FJG B;  2EIM B;  2PF4 E;  2DW4 A;  1IVS A;  1ZAU A;  4FPP A;  5DN6 G;  5LYJ A;  1RSO A;  4QG6 A;  1E1Q G;  3LSS A;  1K4C C;  2LGW A;  3MHS C;  1M57 B;  2R9I A;  2UXC O;  4KCV A;  2FB5 A;  4J7Z A;  4ICG A;  5B3S B;  2B5U A;  2RDC A;  2CDY A;  4LFB O;  2FL4 A;  1IBM B;  1Y6X A;  1HNW B;  1K8A W;  2OYQ A;  1HNX O;  4FM0 A;  3OMN B;  5ITZ B;  1AIL A;  1AVM A;  3KHD A;  3SJC C;  4I0X A;  2ZXW B;  4FK5 C;  4U3F H;  2Y69 C;  4DO2 A;  3CXC U;  1VP7 A;  3M7M X;  1QCE A;  1V9P A;  2FYU H;  4X66 B;  4MVO A;  5GTH Z;  5B1B C;  1OCR C;  1PL0 A;  5IY5 C;  1F7Y A;  2XND G;  4WBN A;  4KXR A;  2ADQ B;  1VF6 C;  5IWA O;  3K79 A;  1I94 B;  3RN4 A;  2W6J G;  1B06 A;  1BHA A;  1OZ0 A;  5DED A;  3W7U A;  1WPB A;  2ZQM A;  3DXR A;  4E4E A;  5EK0 A;  2UUC O;  5C8Y B;  3ABU A;  3SJQ C;  2R9A A;  3H9V A;  4L8J A;  4O2A A;  4FLY A;  4W4L A;  4DV4 O;  5CBH A;  1V55 C;  2PYL A;  4I4T A;  1TUE B;  3K04 A;  4RUF A;  1MZE A;  2WA4 A;  2XTA A;  1HR0 O;  2V1D A;  2L35 A;  3TXQ A;  4DV5 B;  5BR8 B;  1AJN A;  2R72 A;  3O65 A;  4RUE A;  4MSW C;  5GON A;  3VOU A;  3K06 A;  1B6Q A;  2ADP A;  1YTF D;  2YXY A;  4LF8 O;  1COW G;  5KHK A;  1PPJ H;  1N33 O;  4CC6 A;  1VQ4 V;  5EZY A;  1XMO O;  2WLL B;  4KFM A;  5EIB C;  2QWN B;  5LMN O;  1XL6 A;  4BWA A;  3A0H Z;  2KG7 A;  3CRC A;  4F4L A;  3JAT A;  2GSM B;  3QTC A;  3CYO A;  3U2Z A;  5BXZ A;  5LGN A;  1NT2 B;  2QKC A;  2UUB O;  1ZL8 A;  3SRF A;  3OUF A;  2Y0I A;  4LFC B;  5LP6 B;  3OE7 G;  2RCV A;  4B3T B;  4CC5 A;  1XI1 A;  1H8E G;  4MVS A;  2YC0 A;  4JI8 B;  2YID A;  1Q90 D;  4PI0 A;  1A3W A;  1R3I C;  2ZM6 O;  2NNU A;  1ZX3 A;  5KMG B;  1H2N A;  1TAE A;  4B08 A;  1EM1 A;  5IE9 A;  4G2K A;  3S3X A;  4RO2 A;  5J2U A;  1EN6 A;  2KKW A;  1NI8 A;  5L3G A;  1A5U A;  3ABK C;  4W4K A;  4JI1 B;  3OR7 C;  4DR1 O;  2IJI A;  4LWS B;  1VQ6 V;  2RN9 A;  3DTU B;  3IC7 A;  4LFA O;  4NR1 A;  4CH4 A;  3T0T A;  4GX5 A;  1L8D A;  4BIU A;  4I55 A;  2XAQ A;  1NH2 B;  4LH7 A;  1ZLZ A;  3BFR A;  1M1K W;  3ZBH A;  4DR6 O;  2Q7H A;  3TGU H;  2GTS A;  3QV6 A;  4IYI A;  2UU9 B;  3F5T A;  4A5U B;  1TGO A;  3K5O A;  3ABM B;  4BR6 A;  4C7U A;  3AK1 A;  5IT9 N;  4K35 A;  2RQ6 A;  5IJ0 A;  2JVD A;  2E75 B;  4MVU A;  1IXB A;  2LFS A;  1ROP A;  3WU2 Z;  3SGI A;  1YXB A;  2CK3 G;  3APO A;  3HKE B;  4NXN B;  4X64 B;  1S72 V;  3B77 A;  5CB4 A;  3WFV A;  1G6U A;  3D36 C;  3A8T A;  3RYF B;  4HNA B;  2Z5U A;  3BCC H;  5IDJ A;  1Q6I A;  4UB6 Z;  4MVQ A;  2OTL V;  3E22 A;  3MHH C;  5LYJ B;  1IX9 A;  2WPD G;  2XHB A;  4QG9 A;  1D5A A;  4PDL A;  4H33 A;  5CBF A;  4YJ3 A;  2PGG A;  5KHG A;  4KRZ A;  3QVN A;  1P7G A;  4PDM A;  4X20 A;  4LC1 A;  3CMA V;  2K9P A;  1N34 B;  1R3L C;  4CH5 A;  3E0W A;  1K5Q A;  4GYC B;  3RBZ A;  2WLH A;  5JQG B;  4O4H A;  1IBK B;  4DV0 O;  2O57 A;  4TV8 B;  5H9C A;  3JAK A;  4PHZ A;  3HQN A;  1FFT B;  4IL6 Z;  1P4R A;  2PUS A;  1MOF A;  4MTO A;  4DR4 O;  1ORQ C;  1W2B U;  3ASO C;  2CTP A;  3MAQ A;  3THO A;  4LF4 O;  2XT9 A;  3AEI A;  1J5E O;  4CBC A;  4WBN B;  3AG2 B;  4I5S A;  1CP9 A;  3BY6 A;  2DQ3 A;  4HYV A;  2IM9 A;  5BY1 A;  1JOY A;  1EZV H;  3HKB B;  2DN9 A;  4JZG A;  3EFF K;  4UCS A;  3KCX A;  4LH6 A;  4DV6 B;  3K08 A;  4UV9 A;  1P49 A;  3LSQ A;  1FJG O;  4J10 A;  4UVA A;  3DXR B;  1QBZ A;  1RM1 C;  5LHG A;  2HHH B;  3ZIA G;  4FFK A;  4YJ2 B;  4JI2 B;  4O2A B;  4K8X A;  4DV7 O;  3FB6 C;  4JAU A;  1VQP V;  3M99 B;  1H2M A;  1FXK A;  1MSW D;  4JV5 B;  4DRX A;  2Q7E A;  2LQT A;  5EBM C;  3OEH G;  2VGI A;  1A32 A;  3ICX A;  1IBM O;  1HNW O;  1H8H G;  2PY5 A;  3FFQ A;  2JJ2 G;  4QNH B;  2F23 A;  3VQX A;  3EVK A;  2B9Z A;  5HFM A;  2OTJ V;  3B8M A;  5LA6 A;  3W7T A;  3H6O A;  1FKA O;  5EZY B;  4IGG A;  3FB5 C;  1T5A A;  4WFH A;  2KG7 B;  3K58 A;  3SR2 C;  3L75 H;  3JAT B;  5L3B A;  3SYO A;  4X66 O;  3OTO B;  1W59 A;  3PN1 A;  1VP8 A;  5EC2 C;  4LF7 O;  1EFR G;  3ZRW A;  4WFE A;  1KB9 F;  3CB2 A;  2ZR2 A;  5IYB O;  4AQY B;  3FKS G;  5FLX N;  1S77 D;  1WB7 A;  1I94 O;  2AXT Z;  4JTA B;  1L1F A;  5LGT A;  1XHX A;  4DR7 O;  1NH2 D;  3TK1 A;  2CH7 A;  2EIM C;  2KSD A;  3ZCC A;  2P90 A;  3EOE A;  1FYJ A;  1SQV H;  5JCO C;  3OGC C;  4DRS A;  1W0J G;  1DGS A;  3JAM N;  1M57 C;  4WFA V;  4RWU A;  3CS5 A;  5J2U B;  2GTA A;  3TJT A;  1EZJ A;  4GCZ A;  5CA1 A;  4KUM A;  4PD4 F;  1AQF A;  3QO8 A;  3RT3 C;  5B3S C;  3ZRV A;  4JI7 B;  2JGD B;  3CWB H;  2DWE C;  4DYL A;  5BR8 O;  4QGP A;  1I5Y A;  1M4U A;  2IW5 A;  4G28 B;  3CC2 V;  1IZ3 A;  3SRH A;  1NU1 H;  1GN6 A;  3R66 A;  1BQ0 A;  2KQX A;  4I55 B;  3IFX A;  2QDO A;  2ZXW C;  4IHJ B;  4BIO A;  2Q5Z A;  2R70 A;  4PA4 A;  2PTM A;  4DW0 A;  1GRJ A;  1FD9 A;  3HQP A;  3J81 N;  3STZ C;  3L72 H;  3U0Z A;  2YIA A;  2H8P C;  1KU9 A;  2F1M A;  2YUA A;  2QTS A;  3UQ8 A;  3ZHR A;  3RVZ A;  4MTX A;  4LNU B;  1Q3E A;  4PDV A;  4LFC O;  2N04 A;  3E86 A;  2OWO A;  4TUY A;  5IJ0 B;  1E0U A;  4DR3 O;  2WLM A;  1WN7 A;  4TWK A;  2Q8V A;  4X62 B;  4JI8 O;  3SYC A;  4KHP B;  3CRA A;  3JYC A;  2QM8 A;  1IBL O;  4JAV A;  4F6R A;  5CB4 B;  3ZN0 A;  4DUY B;  3BAA A;  4WF9 V;  2ATK C;  3C90 A;  2ZCE A;  3OMA B;  4P9P A;  4MS2 A;  1GK9 A;  3ASN B;  3E22 B;  1AR1 B;  2LP7 A;  5J2T A;  3FD9 A;  3ETG A;  4YJ3 B;  1BMF G;  2WA3 A;  3E83 A;  3BJF A;  4TT3 G;  2GV9 A;  1SZT A;  3ZX6 A;  1WP7 A;  1VQN V;  1VEW A;  1SET A;  1LR1 A;  2XOK G;  4FIP C;  1XUQ A;  4RPP A;  2EZP A;  2UU9 O;  4Z1V A;  3E8G A;  5CMU A;  3JAK B;  4ZI7 A;  3CC7 V;  1OJH A;  3B09 A;  1K33 A;  4O4I B;  1Q8I A;  2HLD G;  4PJ0 Z;  2D2C B;  1KQS U;  3HR0 A;  3GQY A;  5CA0 A;  1OCZ B;  1YJ9 V;  2BOB C;  4B7E A;  1QNM A;  3W7X A;  1XMQ B;  3LNN A;  4LF9 B;  1VQM V;  1JFF A;  3P30 A;  5LP6 C;  4D7T A;  5D5Q A;  1HP8 A;  5BMV A;  4H44 B;  2UUA O;  4B3S O;  1R1B A;  3OFN G;  2CGO A;  2JEX A;  2MK3 A;  4X64 O;  2AZ0 A;  3G71 V;  1SS3 A;  3ABT A;  3N2K A;  5FPR A;  1SQG A;  4LR3 A;  4J41 A;  3AK2 A;  3H1L H;  5LHH A;  3T1Y B;  3OGI B;  4R8C A;  5EBL C;  4QPK A;  2YS8 A;  4OX9 O;  2QWR B;  1VQ9 V;  1K7D A;  4JF3 A;  1VF5 B;  1EN5 A;  4LF5 O;  1R6T A;  2FML A;  4B7K A;  1SES A;  2XAH A;  3K59 A;  1US6 A;  3KCY A;  4O2B A;  2OT5 A;  3FB8 C;  1URF A;  3E89 A;  4DUZ O;  2IU3 A;  1FFX A;  4FXJ A;  3RYI A;  4DRX B;  3K0G A;  3OMI B;  1QHT A;  4X89 A;  3UO2 A;  2G38 A;  4OGQ B;  1N32 B;  4WFB V;  3QV8 A;  1SZX A;  5JJE B;  2ZIN A;  3B8N A;  4OXS A;  2ZE8 A;  3D8C A;  3ZHT A;  1R73 A;  4JI4 B;  3ABM C;  4WFG A;  2JJ1 G;  5LA6 B;  3IAY A;  2EZO A;  3OT7 A;  1XL4 A;  5L3D A;  2BOC C;  5LL6 Y;  2VGF A;  3BPZ A;  1YCI A;  5HFL A;  4ZHQ A;  1G1X B;  4JGS A;  1QVF U;  2VRZ A;  3N2G A;  4MVR A;  4I9W A;  2E74 B;  1Q5O A;  3ZRW B;  2HP8 A;  1XHZ A;  3MD0 A;  4JI3 B;  2X6C A;  3W7W A;  4NTX A;  5B66 Z;  4DV6 O;  2CH7 B;  2QWP B;  3BAB A;  1MA1 A;  2HHH O;  1SA0 A;  4CS2 A;  2ZNI A;  1PV0 A;  4JI2 O;  2VQE O;  1D2D A;  1FXH A;  3ZHS A;  5CA1 B;  5B1O A;  4RAI A;  2HFE C;  4IMA A;  1YVW A;  1VQ8 V;  1SQP H;  3T1H B;  4TV9 A;  1KBH A;  2P6J A;  3P3P A;  1PM9 A;  3OUS A;  4JYB A;  3P3N A;  3AG1 B;  2P06 A;  3GB7 C;  5EYP A;  2QJ1 A;  4YHH O;  4JYA O;  3K57 A;  2JS3 A;  4Z1M G;  1XDC A;  2WWW A;  1HNZ B;  1TA8 A;  4B3R B;  3LSU A;  3ZJZ A;  3OTO O;  5LGU A;  4NTY A;  1NQT A;  2WLK A;  4AIL C;  3AG2 C;  4AQY O;  4H13 B;  4G27 B;  4X1Y A;  2HVK C;  4TUY B;  1Y74 B;  4WCE V;  1KKC A;  2W0F C;  5JH7 A;  4DV3 B;  1KKD A;  3GWO A;  4MTF A;  5KAF Z;  1X4T A;  4NYK A;  5IYD O;  2K1E A;  3FB7 C;  4JAA A;  4F6R B;  1WAZ A;  1Y4M A;  5E1A C;  4X8A A;  3TXS A;  3ME3 A;  1XNQ B;  1CXZ B;  1F51 A;  2YIB D;  1GO3 F;  1WLE A;  4LF6 B;  3Q4H A;  5J2T B;  1NR7 A;  2HJF C;  3H1I H;  4JPG A;  1YIJ V;  3BRC A;  3SPI A;  1YEW A;  2A06 H;  4GZR B;  3JAS B;  3EXA A;  1WB8 A;  4EKW A;  4R6Z A;  3RVY A;  3NXS A;  4O4L B;  5IYZ A;  1NJI W;  1LUW A;  2A3Q A;  1E79 G;  3H1J H;  3CSX A;  1HW7 A;  3JAW A;  2F93 B;  5L3C A;  4J9Y B;  3HKC A;  1TUB A;  1SKV A;  2YSU B;  1ZWI C;  4OPA A;  4O4J A;  2QM4 A;  1N36 B;  4ZI7 B;  1RPO A;  3T2M A;  2YI8 A;  1SER A;  2UXD B;  1AP6 A;  2QWQ B;  4JI6 B;  5CA0 B;  2AHZ A;  2QTO A;  4L87 A;  1R3K C;  2Y48 A;  5K1X A;  4UVB A;  4UCO A;  3RYH A;  2UXB O;  1JFF B;  1UFI A;  4YY3 O;  1XNR B;  3AAG A;  1U96 A;  2ZIM A;  4WFF A;  5BMV B;  4K0K B;  4PI2 A;  3G6E V;  1P7B A;  2IH3 C;  2Y0P A;  1KUQ A;  4JI0 B;  5KHJ A;  1VIB A;  1AI7 A;  4PV1 B;  4UXN A;  5JVD A;  1F23 A;  1IDS A;  1QVG U;  1Y67 A;  3N2K B;  3FAV B;  3E8H A;  3K9S A;  3UT5 A;  2HG5 C;  1AP5 A;  3SPJ A;  1RSO B;  4B3M B;  3J80 N;  2QA4 V;  1YIT V;  1MNG A;  2F43 G;  1BQZ A;  4DK0 A;  2UXX A;  4O2B B;  4JYY A;  2VQF O;  4DK1 A;  2CTR A;  2AZ2 A;  1FFX B;  3LDC A;  4PEL A;  5IYC O;  1LNQ A;  4QE7 A;  3OR6 C;  2EJR A;  1M5I A;  5CBG A;  2CUG A;  4UUJ C;  4J7J A;  2QWO B;  1OCC C;  3K5L A;  1GN3 A;  4I0X B;  1HWY A;  1JA8 A;  3CCJ V;  2YIB A;  2Y4U A;  1LUV A;  2PI5 A;  1JX9 A;  2QGN A;  1SRY A;  3CC4 V;  4LFB B;  2EIK B;  1NBM G;  3WB1 A;  3CCE V;  4IYH A;  1XMQ O;  4FFB A;  1HNX B;  1BHB A;  4QPJ A;  5H5N A;  1F4N A;  4ZHQ B;  2F4V B;  3ZMU A;  3N2G B;  3ABL B;  4DR5 O;  3E2E A;  1AR5 A;  4PA3 A;  5LMU O;  4ZBM A;  5L3F A;  1WA8 A;  3HQO A;  4FVM A;  3F7Y C;  4IIJ A;  4N21 A;  1NVP B;  2OIG A;  2GUZ A;  3PJS K;  3UM7 A;  2ZDI A;  3A0B Z;  1KD1 W;  4FXF A;  1YJW V;  4UVC A;  3T1Y O;  4BAY A;  4UCU A;  5IWA B;  3ASN C;  4RQF A;  1SF9 A;  1RPR A;  4LP8 A;  2Q68 A;  2LO1 A;  2H3O A;  4CS4 A;  3SRK A;  3CHX A;  4X65 B;  4I4T B;  3CRQ A;  2NN4 A;  5JCO A;  3CJH A;  5JJN B;  4FM2 A;  5GON B;  4YNG A;  2BTQ A;  2H94 A;  1Z5V A;  4EB6 A;  2ILM A;  4F6E A;  2WAM A;  2EIN C;  5KAI Z;  4DV2 B;  2JDI G;  5LBQ A;  4ZKI A;  2HKO A;  1SQF A;  1B3Q A;  1MZF A;  5EYP B;  4GKJ B;  3L9D A;  4K8Z A;  1HR0 B;  4D6T H;  1M56 C;  1BT8 A;  1WPX A;  4ZOL A;  2PZS A;  1DLB A;  3BA8 A;  3HPL C;  3AG4 B;  1K4D C;  2IBZ H;  5ITZ A;  1MAB G;  1ZL8 B;  2A0L A;  1UPG A;  2V4D A;  4X1I A;  5LMN B;  2Z3Y A;  1ARO P;  1YJN V;  3ZED A;  1PKY A;  2CGN A;  3E0V A;  5JJJ B;  4QJF B;  2Q67 A;  1JR9 A;  2JK5 C;  3QG5 A;  5JH7 B;  2OCC B;  2UUB B;  4GUN A;  4MTG A;  1Z2G A;  4DR2 B;  1GN4 A;  4DXW A;  4MT8 A;  3KTX A;  3K3W A;  3D3I A;  2YI9 A;  3U11 A;  3ZRX A;  4X9Q A;  1I0H A;  3H1K H;  3VQW A;  1FPO A;  1JPX A;  5LHI A;  3Q4H B;  3MA8 A;  4DV5 O;  2Z0A A;  1S5J A;  2YIC A;  2BTO A;  3C3S A;  1O9H A;  2ZT9 B;  2ITD C;  1IXM A;  5CN0 A;  5IYZ B;  1GAX A;  3H01 A;  1TVK A;  2EBO A;  2QKA A;  3IS4 A;  2DYR B;  1WJZ A;  3HKC B;  1TUB B;  1PNL A;  2DE0 X;  2A79 B;  4UFZ A;  1HNZ O;  1GTO A;  4O4J B;  4B3R O;  1BSM A;  1NS1 A;  4BW5 A;  3UKM A;  5KX5 A;  2B1I A;  3D3Q A;  1OV9 A;  4JZ2 A;  3QO5 A;  1VQL V;  4TSF G;  5LXT A;  3BJT A;  4B3T O;  4D7S A;  1YSC A;  2GBO A;  3RWR D;  1Q6H A;  3RYH B;  1BZK A;  1PKL A;  2JEU A;  1KP2 A;  2BE3 A;  4JTC B;  5EBW C;  3A2F A;  4Q6G A;  5FPO A;  3JSL A;  1VMG A;  4XDL A;  3SYP A;  1RFY A;  5LP6 A;  2LW7 A;  3DGE A;  2E76 B;  2P22 C;  1S3J A;  2DJV A;  1QLE B;  1G4Y B;  2DQ0 A;  3JAL A;  4LBE C;  1XNQ O;  3UT5 B;  2Q0A A;  4JI1 O;  1EN4 A;  2E5L B;  1GM9 A;  1AB3 A;  1T5E A;  3P32 A;  4X20 B;  1VQ5 V;  4YIO A;  1J95 A;  1IUR A;  1KMI Z;  1HDJ A;  2B1G A;  3CEI A;  2OIE A;  3AG1 C;  1M9N A;  5EIB D;  3T07 A;  5EC1 C;  4TQD A;  5JWP A;  3T1C A;  4LWS A;  1BS3 A;  4O4H B;  1H38 A;  1KC8 W;  1NVP D;  1XOU A;  3ZHU A;  3L74 H;  4KP4 A;  2EIJ B;  2Q0O C;  1EBO A;  4GX0 A;  1A3X A;  3EHB B;  3IC9 A;  4JI6 O;  3G6B A;  3CME V;  1FXV A;  1QU7 A;  1H2G A;  4FLW A;  4FFB B;  2QSA A;  3GVM A;  1NR1 A;  4FZ1 A;  3VQV A;  1Q81 W;  4DV0 B;  4J42 A;  3OM3 B;  1JVM A;  1XNR O;  2A9H A;  3CCV V;  5KUK A;  4K0K O;  2LW1 A;  2LGQ A;  4PA9 A;  4PA6 A;  3GWK C;  4NXN O;  2ZE7 A;  3SYA A;  1WA8 B;  2IJH A;  4AI8 A;  2ARH A;  4CS3 A;  4MVM A;  4LF4 B;  5GTI Z;  1O9G A;  2GUZ B;  4FMT A;  2CE4 A;  3WG7 B;  3G2G A;  2ZE5 A;  1VF6 A;  2IJJ A;  1S5H C;  1J5E B;  4XDK A;  3UCS C;  2XUM A;  3A0R A;  2HR3 A;  1OHH G;  1ZTE A;  5KUM A;  3K5N A;  2P4K A;  2C2A A;  3RYF A;  1QLN A;  1N34 O;  1Q86 W;  4G1N A;  1FXK B;  1GH6 A; 
#chains in the Genus database with same CATH homology
 3LNM B;  3ZMZ A;  5CA3 A;  2QKS A;  3JD3 A;  2WLN A;  3I56 V;  3F7V C;  3T4D A;  3KG2 A;  1Y4M A;  4UV8 A;  5E1A C;  4X8A A;  1CPY A;  3AEI A;  2WLL A;  1QR8 A;  1DTO A;  4CBC A;  3AG2 B;  1F51 A;  4I5S A;  1CP9 A;  1GO3 F;  3BY6 A;  1OCC B;  2DQ3 A;  1WLE A;  3LUT B;  1JOY A;  2X6A A;  5H6R A;  2WLI A;  1NR7 A;  2HJF C;  3F5W C;  2ITC C;  1YIJ V;  3SPI A;  3EFF K;  4HYO A;  3K08 A;  4UV9 A;  4EKW A;  3LSQ A;  1NKD A;  4R6Z A;  3RVY A;  1R3J C;  4UVA A;  1F4M A;  3ASO B;  3NXS A;  1QBZ A;  1RM1 C;  5LHG A;  4GT1 A;  3I55 V;  1NJI W;  3SPG A;  1E79 G;  3ZIA G;  3LDD A;  2EIL C;  5L3C A;  4R50 A;  4J9Y B;  1I5X A;  1YTF B;  2YSU B;  3FB6 C;  1ZWI C;  3CCS V;  4JAU A;  1VQP V;  3M99 B;  1Q7Y W;  1FXK A;  1MSW D;  4N23 A;  1THZ A;  4GX1 A;  3E8F A;  1RPO A;  3IGA C;  3T2M A;  1SER A;  1AI4 A;  1W0K G;  3OEH G;  5EBM C;  1KEC A;  1DF4 A;  3ZRS A;  3CCM V;  3CCR V;  2AHZ A;  2IH1 C;  2QTO A;  2V7Q G;  4L87 A;  1R3K C;  4JAS A;  1H8H G;  1RM1 B;  2Y48 A;  4UVB A;  2JJ2 G;  2X7R B;  4QNH B;  4Q20 A;  3E35 A;  2EIL B;  5H6Q A;  2IJK A;  3W7S A;  3AAG A;  5HFM A;  2OTJ V;  4RQE A;  3B8M A;  4WFF A;  3JD2 A;  4JTD B;  3W7T A;  3G6E V;  1PKX A;  3JCZ A;  1P7B A;  3SYQ A;  1JJ2 U;  2IH3 C;  2KB1 A;  2XAS A;  3FB5 C;  1FS0 G;  2ZD9 A;  3ZMS A;  1VQ7 V;  4U7N A;  4YXW G;  2P7T C;  1R6K A;  2YEV B;  4WFH A;  3CCU V;  1AI7 A;  1S76 D;  5L3B A;  3SYO A;  4UXN A;  1N8R W;  2DYS C;  1F23 A;  3TET A;  1JQ0 A;  1QVG U;  5EC2 C;  1EFR G;  3ZRW A;  4MW8 A;  4WFE A;  3E8H A;  1BL8 A;  2ZR2 A;  5C93 A;  5DM6 V;  2ZR3 A;  2HG5 C;  3E8B A;  5IYB O;  3FKS G;  2EIN B;  3SPC A;  3SPJ A;  4XBF A;  1S77 D;  1AJQ A;  4JTA B;  2QA4 V;  1L1F A;  3OEE G;  1YIT V;  2F43 G;  1V54 C;  1M56 B;  5LGT A;  1NH2 D;  3TK1 A;  2UXX A;  2EIK C;  3OAA G;  1GM7 A;  2EIM C;  3ZCC A;  2P90 A;  2DYS B;  2Q6A A;  5IYC O;  3LDC A;  4PEL A;  4LCU C;  3OGC C;  1LNQ A;  1W0J G;  3OR6 C;  4QE7 A;  2EJR A;  2DWD C;  3ABL C;  2WSS G;  5CBG A;  5BZB A;  1M57 C;  3X2Q C;  4WFA V;  2X0L A;  3SPH A;  5B1A C;  4UUJ C;  2R9R B;  1EZJ A;  4GCZ A;  2FTK A;  4KUM A;  1OCC C;  2GHY A;  3CP1 A;  1OCO C;  3K03 A;  1HWY A;  3QO8 A;  3ZRV A;  1KP3 A;  2M7W A;  5B3S C;  3CCJ V;  4JYC A;  1V54 B;  1JX9 A;  2PI5 A;  1SRY A;  2DWE C;  1I5Y A;  4G28 B;  2IW5 A;  3CC2 V;  3CC4 V;  2EIK B;  1NBM G;  4PA7 A;  3AG3 C;  3CCE V;  2EIM B;  1K34 A;  2DW4 A;  1BHB A;  4FPP A;  4CZZ A;  4QPJ A;  5J9P C;  1F4N A;  5DN6 G;  4P9O A;  3BEH A;  1GKF A;  3ZMU A;  3IFX A;  2UXN A;  1K97 A;  1E1Q G;  2ZXW C;  3ABL B;  3LSS A;  1K4C C;  3E2E A;  3MHS C;  1M57 B;  3X2Q B;  2R9I A;  4PA3 A;  4PA4 A;  5B1A B;  4ZBM A;  5L3F A;  1OCO B;  5B3S B;  1GMG A;  3F7Y C;  1GM8 A;  3D36 A;  2B5U A;  4N21 A;  3STZ C;  1NVP B;  3PJS K;  3UM7 A;  2H8P C;  2P67 A;  2ZDI A;  1KD1 W;  3AG3 B;  1K8A W;  1YI2 V;  1YJW V;  3RVZ A;  3FYI B;  4MTX A;  4R7C A;  4UVC A;  3OMN B;  4PDV A;  4BAY A;  3E86 A;  1K73 W;  3ASN C;  4RQF A;  1JCH A;  2ZXW B;  4FK5 C;  4QE9 A;  1RPR A;  4LP8 A;  2WLM A;  2Q68 A;  4TWK A;  1AJP A;  3QO7 A;  2Y69 C;  4DO2 A;  3SYC A;  5B1N A;  3CXC U;  1QCE A;  3CCQ V;  3AG4 C;  3JYC A;  2HVJ C;  4MVO A;  2QM8 A;  4JAV A;  3ZN0 A;  3OW2 U;  5B1B C;  1OCR C;  1PL0 A;  5IY5 C;  4WF9 V;  2ATK C;  3OMA B;  1ENV A;  2H94 A;  2XND G;  3FB7 C;  4P9P A;  4MS2 A;  1GK9 A;  2WAM A;  3ASN B;  3K79 A;  2EIN C;  1AR1 B;  2JDI G;  2LP7 A;  5LBQ A;  4ZKI A;  2HKO A;  3ETG A;  1BMF G;  1M56 C;  2OCC C;  2W6J G;  3E83 A;  2Y69 B;  1BHA A;  1WPX A;  1OZ0 A;  3W7U A;  1YHQ V;  4PDR A;  1DLB A;  1K5S A;  2ZQM A;  4TT3 G;  5KA6 A;  4H37 A;  3HPL C;  1SZT A;  3AG4 B;  1K4D C;  4ASU G;  5EK0 A;  1VQN V;  1PD3 A;  1SET A;  3ABU A;  2XOK G;  3SJQ C;  3ETD A;  4FIP C;  3ZMT A;  1MAB G;  1OCR B;  5B1B B;  3TCU A;  1UJW B;  4BIZ A;  4J9Z B;  2LFR A;  5IY5 B;  2A0L A;  2EZP A;  5CBH A;  1Q82 W;  3R65 A;  1V55 C;  3VBB A;  1VQK V;  2D3O W;  3JD0 A;  3E8G A;  2QM7 A;  1TUE B;  2Z3Y A;  1ARO P;  5CMU A;  1YJN V;  3K04 A;  4RUF A;  4MVZ A;  3CC7 V;  4QJF B;  1E1R G;  1K33 A;  2HLD G;  2Q67 A;  2V1D A;  2JK5 C;  1KQS U;  3FYE B;  2OCC B;  1OCZ B;  1YJ9 V;  1AJN A;  1PNK A;  2BOB C;  4RUE A;  4MSW C;  3VOU A;  3K06 A;  3W7X A;  1B6Q A;  1CEZ A;  4MTG A;  1YTF D;  1VQM V;  3P30 A;  1COW G;  4JPR A;  4DXW A;  4MT8 A;  2DYR C;  3K3W A;  1VQ4 V;  3D3I A;  3ML0 A;  1V55 B;  2JIZ G;  2WLL B;  3ZRX A;  3ZN1 A;  4KFM A;  3OFN G;  4P30 A;  2JEX A;  2QE7 G;  2MK3 A;  1XL6 A;  2YEV A;  1JPX A;  4F4L A;  3G71 V;  5LHI A;  2GSM B;  2WLI B;  3CYO A;  2PI4 A;  3ABT A;  5LGN A;  2ITD C;  1IXM A;  5CN0 A;  5LHH A;  3OUF A;  4R8C A;  5EBL C;  4QPK A;  3H01 A;  3OE7 G;  3CCL V;  2X6B A;  4P2Z A;  1VQ9 V;  2QEX V;  2EBO A;  1K7D A;  4JF3 A;  2DYR B;  3T4Z A;  1SES A;  1K92 A;  2XAH A;  3K9A A;  1H8E G;  1PNL A;  4MVS A;  1S0V A;  2A79 B;  2OT5 A;  3FB8 C;  3LDE A;  3E89 A;  1GTO A;  1R3I C;  3ETE A;  2NNU A;  4BW5 A;  1M90 W;  2IU3 A;  3UKM A;  1QLE C;  3K0G A;  3OMI B;  4G2K A;  4RO2 A;  4X89 A;  2B1I A;  3HB3 B;  4WFB V;  3QO5 A;  1VQL V;  4TSF G;  5L3G A;  1YSC A;  3ABK C;  3B8N A;  4OXS A;  2JEU A;  3OR7 C;  1KP2 A;  2IJI A;  3CPW U;  1R73 A;  4JTC B;  3ABM C;  1VQ6 V;  4WFG A;  2JJ1 G;  5EBW C;  3DTU B;  3IC7 A;  2EZO A;  1XL4 A;  5L3D A;  1K3E A;  2BOC C;  2XAJ A;  1R6N A;  4XDL A;  3SYP A;  4GX5 A;  5HFL A;  1K9M W;  3ZMV A;  4BIU A;  4JGS A;  1QVF U;  2XAQ A;  3DGE A;  1NH2 B;  1S3J A;  2AHY A;  4U7O A;  1M1K W;  1QLE B;  1G4Y B;  2DQ0 A;  4I9W A;  4MVR A;  4E2L A;  4LBE C;  3ZRW B;  3ABK B;  2XAF A;  3MD0 A;  1GM9 A;  2EIJ C;  2X6C A;  3ABM B;  3W7W A;  3P32 A;  1OCZ C;  1VQ5 V;  1J95 A;  1QR9 A;  2B1G A;  4MW3 A;  3AG1 C;  1AI6 A;  1M9N A;  5EC1 C;  2XAG A;  4MVU A;  4FJC C;  3T1C A;  2LFS A;  1ROP A;  2CK3 G;  1FXH A;  1H38 A;  1KC8 W;  1NVP D;  2Q69 A;  4HZ3 A;  3K0D A;  4KP4 A;  2EIJ B;  3JD1 A;  1S72 V;  5B1O A;  2NLJ C;  4RAI A;  1EBO A;  2HFE C;  3B77 A;  4GX0 A;  3WFV A;  3EHB B;  4XDJ A;  3STL C;  1VQ8 V;  2Z5U A;  3WG7 C;  2ZDI C;  5IDJ A;  2P6J A;  3CME V;  1FXV A;  1VQO V;  3OUS A;  4JYB A;  1Y66 A;  4MVQ A;  5KA5 A;  1H2G A;  2OTL V;  1NR1 A;  3AG1 B;  1Q81 W;  3MHH C;  3GB7 C;  3OM3 B;  5FL7 G;  2WPD G;  3CD6 V;  1JVM A;  1G8M A;  4PDL A;  4H33 A;  5CBF A;  2A9H A;  3CCV V;  5KUK A;  4PA9 A;  4PA6 A;  4PDM A;  4Z1M G;  4LC1 A;  3CMA V;  3JD4 A;  5GW7 A;  2WWW A;  3SYA A;  1R3L C;  1FXK C;  2IJH A;  2W6I G;  2IU0 A;  3ZJZ A;  1PNM A;  1MG1 A;  4MVM A;  5L3E A;  4FMT A;  5LGU A;  1AI5 A;  2WLJ A;  3RW0 A;  3WG7 B;  1K5Q A;  1NQT A;  2IJJ A;  2WLK A;  1S5H C;  2WLH A;  4QIW F;  3RBZ A;  4XDK A;  3AG2 C;  4X88 A;  5H9C A;  4G27 B;  1DF5 A;  2HVK C;  2HR3 A;  1OHH G;  3A0R A;  1FFT B;  5KUM A;  4WCE V;  2W0F C;  1KKD A;  1P4R A;  1MOF A;  2C2A A;  4MTO A;  3GWO A;  3G4S V;  1QLN A;  4HAM A;  4MTF A;  1Q86 W;  1ORQ C;  2K1E A;  3QNE A;  1FXK B;  5IYD O;  1W2B U;  3ASO C;  4GX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...