1FS0G

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
219
Chain Sequence
KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
total genus 81
structure length 219
sequence length 230
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fs0G02
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 1fs0G01
5LHIA 2XAGA 1MABG 2HLDG 4XBFA 2WPDG 2XNDG 3OEHG 2JJ2G 2UXXA 2EJRA 5L3EA 5LHHA 2HKOA 2R9IA 4TSFG 2JJ1G 2Y48A 3ABUA 4BAYA 3ZIAG 2DW4A 1OHHG 3OE7G 5L3FA 1W0JG 1EFRG 2XAQA 3ZMTA 2X0LA 4CZZA 3FKSG 2W6JG 5L3CA 5LGNA 4ASUG 4UV9A 3ZN1A 4UVAA 1E1RG 1BMFG 2IW5A 4UV8A 2H94A 3ZMVA 4UVBA 5L3DA 5H6RA 2V1DA 3OEEG 5LGUA 4Z1MG 2F43G 4UVCA 2QE7G 2JDIG 1H8HG 2W6IG 1COWG 3ZN0A 3OFNG 2XAFA 5FL7G 1H8EG 4KUMA 4YXWG 3ZMZA 5DN6G 1FS0G 1W0KG 1NBMG 2JIZG 2WSSG 2XAHA 2XOKG 2XASA 1E1QG 5LBQA 5H6QA 3ZMUA 2Z5UA 5LHGA 2V7QG 4TT3G 5L3BA 2XAJA 1E79G 3OAAG 3ZMSA 5L3GA 2UXNA 5LGTA 2CK3G 2Z3YA 3ABTA 4UXNA
chains in the Genus database with same CATH superfamily
3UCSC 1NQTA 3SJQC 2ZQMA 1F7YA 1W59A 1YIJV 3MDSA 5EBWC 2AGAA 3OEHG 3WFVA 2OIGA 3QV9A 1AP5A 4E2LA 3B4SA 5LHHA 4X65B 2LFSA 3ABUA 5J2TA 1XILA 3G71V 3CP1A 1F4NA 4YY3O 3A0HZ 4CH3A 5IYCO 3RYIA 1CXZB 1D2DA 1YZBA 3RFRA 1DTOA 3ZMTA 3JATB 3N2KB 4DW1A 4CZZA 3GG8A 1SQXH 3IC7A 1AP6A 1XBLA 4RWUA 3ZN1A 1FPOA 3ZHRA 2Y4TA 2BE3A 1QVFU 2K9PA 1VEWA 3OT7A 4HYOA 4X64O 2UXBO 3B09A 2FKXA 2WLJA 1Z5WA 1PKXA 3PN1A 2WAMA 2YDEA 4UVBA 5JH7A 2BTQB 4LF9O 4FMTA 5LGUA 1PKYA 4Z1MG 2GTSA 4I9QA 3OTFA 1JFFB 3JD0A 2DYSB 1H2SB 2QE7G 5LMUB 4P2ZA 2ZT9B 3CCSV 1OCCC 4YJ5A 1ROPA 5C8YB 1Q6IA 4ZBMA 1F51A 2NLJC 3B40A 1BQ0A 3CRQA 4TUYB 3IFXA 1JR9A 2QDOA 1F4MA 1K34A 1S77D 2AW9A 3ZRSA 1AI4A 4O2AB 1AJPA 4H13B 1Q5OA 3TETA 2MW2B 4ZOLB 2ITDC 3QV7A 3T2MA 3CC2V 2BTQA 4X1IB 4QGCA 2JS3A 2LFRA 4PDLA 2Z3YA 4DUYB 1R6NA 2Q4PA 2E3CA 4NXMB 2A0LA 3K9AA 4GZRB 2B1IA 3OMAB 1THZA 4X1YA 1GN2A 2DN9A 2QM7A 2Q5ZA 4WBNA 1YJWV 4UUJC 2YXLA 1HDJA 3SPHA 3AG4B 5J2UA 3JSLA 4PD4F 4JI2B 3QTCA 4BAYA 2VWKA 4JTDB 4BIOA 4FM1A 4WFEA 2B5UA 3OE7G 1W0JG 2KKWA 4R8CA 3SJBC 3AG3B 5K1XA 4JI6B 2X0LA 3U10A 2VWJA 3SYOA 4TV8B 2D2CB 2UU9B 4DR6B 5LMNB 3ABMC 4LC1A 2O57A 2DYRC 1DK1A 1HW7A 3D3IA 4R7CA 5KUKA 1K4CC 4LH6A 4LCUC 3K5NA 2XT9A 1Q82W 2DYSC 3K57A 3HQNA 1WB7A 2CTQA 5B1NA 3K0GA 1S5LZ 3JD3A 2VQEB 4K0KB 2YI9A 2OIEA 3CCRV 5FLXN 4F6EA 1V55C 3B77A 5KHHA 4CH5A 3HKCA 3E8BA 4K8XA 1VF7A 5HFMA 1G6UA 3QV6A 1B06A 3DC5A 3MHHC 2Q7GA 2QA4V 2HEPA 3AG7A 1BCCH 3E86A 3SRDA 3OM3B 3FB8C 2ADQB 1DF5A 1OJHA 1R73A 3B8MA 3N2GB 3E8HA 3CHXA 2EULA 3FAVA 1NU1H 3ABMB 5KA5A 1MOFA 3LSUA 4F6RA 3ZJZA 1Y76A 2F4VB 4DV5O 2CH7A 1K5SA 3G6EV 4K3AA 4JI4O 4IGGA 2ZINA 4KCUA 1FYJA 2QJ1A 4KHPO 1VQ4V 4DR4O 1S5HC 1MABG 2ZXWB 3HKCB 2BSKB 5CB4B 2ZM6B 1ZL8A 3FX7A 1CPYA 1RFYA 3STZC 2UXCB 2LP7A 4DR2O 1URFA 1TUEB 2NNUA 1BHAA 2ZDIA 4ZHQA 4LBEC 4G1NA 1Y66A 4LFCB 4FFBA 5K1PA 2BOBC 1RPOA 3BY6A 3L72H 4L87A 2JGDA 4NKGB 3CRMA 3FAVB 2AXTZ 1IBLB 3N2GA 3KKYA 1UFIA 2LGQA 4PA3A 2XAQA 1NKDA 3DXRB 1V54B 2QGNA 2LQTA 4LF6B 2CH7B 2XTAA 4YJ3A 5KA6A 4QJFB 2HJFC 3E0WA 3UT5A 4FLXA 2CUGA 1RM1C 4JI8O 4WFFA 4LP8A 4J11A 1UPGA 3ZHSA 3RT3C 1SETA 4RUFA 4LF9B 4WJ8A 4B2DA 4B3RB 1AILA 3ZHQA 3ML0A 4JYYA 4O4HA 2DE0X 1OCCB 4D7TA 1TVKA 1SQBH 4GX1A 2UXBB 4XDKA 5H9CA 5IYZB 5LOVB 1BSMA 1BS3A 1XOUA 2JK5C 3DTUB 2HP8A 1A32A 4IYHA 3PJSK 4EFBA 2YIDA 1VF6C 1V54C 1E0UA 3G67A 3SJAC 2L35A 4YY3B 2QEXV 3N25A 1TGOA 1V9PA 4X20A 2A79B 1S76D 4RO2A 1N8RW 3I5DA 2YI8A 1YXBA 1IBKB 4LF5B 4KCWA 2CTPA 3SYAA 1PKMA 4I0XB 3LDCA 2XAGA 3FD9A 3AG1B 2QKCA 2WLHA 4JAAA 2WLLA 5IYZA 2Q7HA 4MVMA 1XNRO 2JGUA 4FFBB 4PJ0Z 4X62B 4DXWA 5CBHA 3K08A 2K1EA 4DR3B 1ORQC 1ZSPA 4H37A 3W7XA 3N2KA 4TSFG 2A06H 4FLUA 1J5EB 1N34O 1L0NH 2GDSA 3M7MX 5BY1A 2P90A 2YUAA 2F66C 4PI2A 4EKWA 1YITV 2RNBA 1HNWO 1WB8A 2N04A 4AQYB 3CX5F 2PI5A 1I5XA 5LGNA 4Q6GA 4MVQA 4B7EA 5JWPA 2B1GA 3SRKA 1WP8A 1S72V 3CE2A 4I4TA 1J5EO 1U96A 4DV1B 1S0VA 4O4HB 4TQFA 5KAFZ 5BR8O 1I94O 3LDDA 3H1HH 2VRZA 1HNXO 3EHBB 2VGIA 5C8YA 4X62O 5CMUA 4JYBA 4IYIA 5EK0A 1P84F 1B6QA 2Q0AA 4UVCA 1SF9A 3BJFA 2W6IG 1COWG 3T4ZA 4NXNO 3A0RA 4O2BA 3PP7A 3CCJV 1J95A 4NB5A 4LFAB 1VQNV 1WNSA 3BHPA 4OGQB 2Y4UA 1Y4MA 2EIMB 3C3SA 1K5QA 1R3LC 2XAHA 1XREA 2DWEC 2CDYA 2QKAA 3AEIA 3AG3C 2F95B 3P3PA 5GONB 1WLEA 5LHGA 4BIZA 2V7QG 3BPZA 1NZ6A 4QNHB 5C93A 1N0JA 1QVGU 2GBOA 4JTAB 1QLEC 1KU9A 5JH7B 4LF7B 3KZIZ 3FB6C 2BSKA 5CB4A 2WLLB 4FFKA 1SERA 1M9NA 2HLDG 4WCEV 4PELA 1NVPB 4PHZA 4BW9A 3G80A 3GR4A 1K7DA 2QWRB 2ZD9A 2QWQB 1K33A 3H01A 3BABA 4FLTA 1RSOA 1JJ2U 1VQ6V 3AG1C 1QHTA 4JZGA 2FL4A 5JJEB 3AK3A 3WU2Z 1QLNA 4B3TO 1K97A 5IWAO 4LF6O 3OMIB 5FNVB 1WPBA 1TA8A 4U3FH 1TUBB 1EBOA 1XNQO 3CSXA 1GKFA 2WA4A 3K06A 2R9AA 4MVRA 4J9YB 3UQ8A 3C3TA 3T1HO 2V1DA 3H1IH 2N05A 4GX5A 3T1YB 3GWKC 3CJHB 1VMGA 3HKDA 4FM2A 4LF8O 2V4DA 2ZNJA 4RQEA 2EIJC 4DV3B 1H8HG 4JYCA 4B2DD 1IBKO 4LF5O 3ZRVA 1KKDA 4WBNB 2LGWA 1D5NA 1U97A 1H2KA 2OCCB 4MVUA 2FYUH 3AK2A 3J81N 4OPHA 3QG5A 2G38A 2WSSG 4OXSA 4GKJO 5IJ0B 3BA9A 1SQPH 3BA8A 3UKMA 1F23A 3LSQA 4GKJB 2X6BA 1VP7A 3STLC 3CC7V 1OCRC 4I55A 1HR0B 4JV5B 1T5AA 3L70H 2UXCO 3P32A 2UUAO 2ZE5A 4MVZA 2HVKC 2JS5A 4LNUB 5LYJB 2PYJA 4KHPB 4LF8B 3JAWA 4JV5O 3E89A 4HZ3A 4PDRA 4ICGA 3BEHA 4F4LA 2HKOA 3CRAA 5BMVA 2JJ1G 1YVWA 3RVYA 4BIUA 1BQZA 4EB6B 1N33B 5L3FA 5KAIZ 4I9WA 1AJQA 2BOCC 4DYLA 2KG7A 1VIBA 3ABKC 2HVJC 4UCTA 1JA8A 2Q68A 3JAKB 1EZVH 4TV9B 3OR7C 1N33O 4F6RB 2IJKA 1SQFA 2YIBD 2X6AA 2KB1A 4Z1VA 4QG9A 3GQYA 4I55B 5DECA 3W7TA 3HKEB 4X66B 4NTXA 3THOA 1EN6A 3A0BZ 1FXHA 1DLBA 4GUNA 2IBZH 2GUZB 2UUAB 5KX5A 1KUQA 1LUWA 4QPJA 3DC6A 4QGPA 4QG6A 3ZHVA 4PI0A 1EN5A 1Q90D 1QQCA 1VQMV 1Y74A 2FTKA 2YS8A 4AI8A 4O4LB 2EX3A 3ETGA 3CC4V 1OCOB 1N36B 1IURA 4GX0A 1IXBA 4FLVA 1GMGA 4FVMA 3RVZA 4JI2O 2XAJA 3CCVV 2ITCC 4FK5C 3RYHA 1PPJH 1G1XB 4JYAO 4XDLA 4X9QA 4UXNA 4D6TH 1YJ9V 2IM9A 3H1JH 2XNDG 2L6LA 3K5LA 2HJDA 2WLKA 3VBBA 1PD3A 2YEVB 3T05A 3JARA 1SA0B 1HNXB 2R9IA 1XHZA 2X6CA 2E5LB 1M4UA 5EZYA 1TVKB 2XUMA 2DJVA 3JASB 4YHHB 3FFQA 2AZ2A 2UXDO 3CRRA 4X20B 1ZJHA 1CP9A 2KQXA 5LYJA 2WLNA 2ZR3A 2YXHA 2X7RB 3VOUA 5ITZB 3CPWU 2Q8VA 3TJTA 3U2ZA 3ICXA 5J2UB 2UUCB 3BCCH 4UV8A 3RYHB 4MT8A 3O9OA 3IJ4A 4O4JA 2PTMA 3SJCC 4DV1O 4GKKO 4OPAA 1FXVA 1SRYA 4X64B 5JJJB 1JVMA 4DUYO 3M99B 3T1CA 1YF2A 3KTXA 4YJ3B 4J80A 1SKVA 1W0KG 5CBGA 3CCLV 4B3MO 3ABLB 1ENVA 1M57B 4FM0A 1AVMA 3SPJA 5KMGA 4X8AA 4LH7A 2OT5A 3JCZA 4P30A 3OAAG 1ZWIC 4HNAB 4O4JB 3OTOB 3QF7A 4QG8A 4X1YB 2Q6AA 3JSNA 1FXKB 3K9SA 2M6YA 3JATA 2QTOA 1KB9F 3RWRD 3WG7C 1IBMB 1SESA 2ZIOA 4KXRA 1N32O 2EZOA 1HNZO 2RQ6A 5LA6B 3RW0A 2HFEC 4I4TB 1I94B 3D3QA 2OWOA 4LR3A 1NT2B 1OHHG 1SZTA 3VQVA 1QNMA 1R1BA 4MTOA 1RP3B 1CEZA 4DR7O 4XDJA 1M5IA 5CA1A 4JI0O 3MHSC 2WLIA 1I0HA 1K8AW 2IW5A 1F3WA 5J9PC 4B3MB 3ZMVA 3CCMV 3H6OA 4MTGA 5LXTB 5IYDO 2Q0OC 3L73H 4JTCB 5D5QA 1G8MA 4DRXA 3WB0A 4UCRA 4NXNB 3F5TA 1FXKC 5EBMC 1QR8A 3GWOA 2B9ZA 4BR6A 5EC2C 2R72A 4O4LA 4WFHA 1H8EG 4KUMA 2AZ0A 3OTOO 1XHXA 1WN7A 1NBMG 4MSWC 5BR8B 4IIJA 5H6QA 3VQWA 4PDVA 2YC0A 5LOVA 2P4VA 5E79Z 3K79A 1T57A 4DR7B 1YCIA 2ATKC 3H1KH 4N23A 1NTMH 3TCUA 5LXTA 3TXQA 2A3QA 4FLWA 1Y6XA 5CN0A 4DR2B 4U3JA 1WAZA 5B5EZ 5HFLA 4I50B 4W4KA 3SPCA 5DEDA 2JVDA 2Q73A 3APOA 3LNMB 4DR4B 3S3WA 2OYQA 2E5LO 1T5EA 3DGEA 4N21A 5BXZA 2WPDG 2Y69C 2E75B 5IDJA 1I5YA 1NJIW 3X2QC 3QO7A 1FKAO 1BT8A 3X2QB 4B3RO 4TOIA 3HQOA 2CE4A 1RPRA 1EZJA 3ZIAG 1A3WA 2DW4A 4CBCA 3ZX6A 3ASOB 3TGUH 4KCVA 4ZI7B 5IT9N 3CMEV 1JFFA 5GTIZ 4FXJA 3E22A 4D7SA 2UXDB 3NR7A 5B66Z 1AI7A 4YJ2B 1R3IC 2Y0PA 2ZE7A 4Z2WA 3SYQA 3JD2A 2RJZA 3SR2C 1VQ5V 3ZHTA 4FZ0A 4LNUA 3VQXA 3T07A 3K0DA 3CXHF 3RYCA 2M7WA 4FPPA 1E1RG 2H8PC 3HQPA 4ZKIA 1XMQO 1K3EA 5H6RA 4MVSA 3G2GA 3T0TA 2FMLA 2OCHA 4PV1B 3JD4A 4RAIA 2PUSA 1X59A 5LMNO 1Q3EA 5B3SC 5H5NA 2PZSA 3CXCU 1A3XA 3GVMA 1SQGA 2QSAA 4X88A 4AILC 4GKKB 4JI4B 4KS0A 1MMMA 2P67A 2F4VO 4DV5B 1AR4A 3HKBB 2DQ0A 1VQOV 1FD9A 3ETEA 4MW8A 4DV4O 4QE7A 1P7GA 3BFRA 4DV2O 2ZDIC 3H9VA 3JYCA 3K04A 1KBHA 2GTAA 2ILMA 2Y69B 3K5MA 1NVPD 5LL6Y 3IGAC 2ZE6A 4QIWF 1XEQA 3KCYA 1Q6UA 1D5AA 3OUSA 1FFXB 3K59A 1A49A 4DUZB 1KD1W 2Q67A 4DUZO 1KMIZ 4O4IB 3LSSA 1HP8A 3RYFB 5JQGA 1NTKH 2VGGA 3OR6C 4ZI7A 2VS0A 1M93A 5CA3A 1GAXA 3UO3A 4EEQA 2NN4A 3UT5B 2RDCA 3S3XA 3E2EA 2UU9O 1EFRG 4YJ2A 1GN4A 3QTGA 4KP4A 2XHBA 1KYOF 2PGGA 2OTLV 2EINC 4UV9A 5EBLC 4JPRA 2IJIA 1M57C 1MSDA 2YICA 1YTFD 1BMFG 2QKSA 5KHIA 1RSOB 1FFXA 1JMKC 2Q9LA 3OEEG 1QBZA 1OCZB 4PA4A 1Z5VA 2ZXWC 1VQ9V 2JEXA 3E83A 4G27B 4NXMO 1S5JA 1R3JC 4KRZA 3RGBA 1OCZC 2XAFA 1MG1A 1S3JA 5IY5C 3Q4HB 3T1HB 2ODMA 1VQLV 2P6JA 2G50A 1BL8A 4MVOA 2JGDB 1QR9A 1MA1A 2EILB 4WFGA 4DR1B 4TT3G 1QCEA 1FXKA 2A7WA 3ZHUA 4JAVA 1AROP 2RN9A 4P9PA 1GTOA 2XOKG 1GM9A 1V55B 3M8AA 1JJOA 5B3SB 4XBFA 3ZRWA 3J80N 4JI5B 1VQKV 5B1AB 4UCVA 3CCUV 3K03A 3ASNB 4YNGA 3DXRA 2JJ2G 4GCZA 4DV2B 5EYPA 2EJRA 4X1KA 4H33A 1I7FA 4GX2A 1MSWD 4P9OA 3CEIA 1XQ8A 2LJ2A 2ZCEA 5DM6V 4DR6O 2QR4A 2GHYA 3RYFA 1K4DC 4PDMA 3FKSG 3ZS8C 3SYPA 1Y67A 4CS2A 5L3CA 1HNWB 3EVKA 1QU7A 4TWKA 1ZL8B 4B3TB 3RYCB 3W7SA 1SZXA 1Q43A 1W2BU 1YHQV 5LP6B 1BGYH 2YEVA 4TV8A 3F7VC 5L3DA 2IH1C 1AB3A 4X1KB 1ZX3A 1PNKA 1H2LA 1OV9A 4J42A 2CGOA 4UB6Z 4LWSB 2BTOA 4DV3O 4IIJB 4TUYA 5FPRA 3HR0A 3A2FA 1LR1A 1WP7A 5CA0B 1IXMA 2A9HA 2WWWA 4IP7A 3T1YO 1FS0G 4DK1A 3SGIA 3AG2C 3MD0A 1ZAUA 1F3XA 2CTWA 3K3WA 4JI0B 3BVOA 3HKBA 2IJHA 1K73W 3F5WC 3QVNA 5A2QN 4LFAO 1TAEA 5B1BB 4JF3A 2CK3G 3A8TA 3ASNC 2GUZA 2HR3A 4NYKA 1ZUQA 4IT5A 1Z2GA 4RQFA 5JQGB 4X1IA 4O4IA 2IH3C 4X65O 3UM7A 4JI1B 5CA0A 4LF4B 3CMAV 1WPXA 1XNRB 1XMOO 3FYEB 4JI7B 4HYVA 2HHHB 1BE3H 2NR5A 1NS1A 4JI8B 3OGIB 4UB8Z 1Q81W 4LFBB 1I08A 3P3NA 2LW1A 4WF9V 1DF4A 1IX9A 1SQQH 2F93B 4J10A 2LO1A 1PL4A 1JQ0A 1R6KA 3JAMN 1VQ8V 3L9DA 5BZBA 4DO2A 1LUVA 3FYIB 4B7KA 3O65A 2P06A 3RBZA 1NH2B 3IS4A 2EBOA 1IBLO 4JAUA 4JGSA 5EIBC 2VQFO 1XMOB 2PY5A 3W7UA 1SA0A 5E1AC 2H94A 1PL0A 4J9ZB 4NVPA 4MW3A 2VQFB 2ETNA 4DW0A 5B1AC 1H2NA 2JDIG 1RM1B 1R3KC 5KLVH 3WG7B 3D8CA 5FL7G 3SRHA 4I50A 4DRSA 3E8GA 1UJWB 1PNMA 3P30A 1FAFA 3TK1A 1Q86W 4HBNA 5KX5B 5KHKA 3ABLC 4JI7O 4DV7B 4LF4O 1JCHA 3W7WA 3AAGA 3AG2B 1HNZB 4QPKA 5IE9A 5L3GA 1NI8A 4GLXA 1XI1A 2VGFA 4YHHO 3ZEDA 4O2BB 4IMAA 3TXSA 3SPIA 3ZRWB 2EJ7A 4B3SO 2GSMB 4KFMA 2N74A 2QM4A 5CBFA 1NR7A 2E28A 2P7TC 4PA6A 1FFTB 4J7ZA 1VF6A 2UXXA 4MS2A 4LFCO 4KL1A 3JASA 3B2EE 2MK3A 1P4RA 4FIPC 5KHJA 1TUBA 5LP6C 4DR5O 1KECA 1PKLA 1G4YB 1HWYA 1B3QA 4I5SA 1WA8A 4JASA 5LA6A 1Q8IA 3VQYA 2P5OA 2H3OA 4EFEA 3CS5A 4LFBO 3CB2A 2WLIB 3T4DA 3FB7C 3K58A 4FLZA 3LNNA 2HHHO 3FB5C 5J2TB 1FJGO 2Q7EA 2QWNB 5FNVA 2R70A 3AK1A 3ETQA 2ZKOA 4CC5A 2OTJV 1H2GA 1BHBA 2JRIA 2DOSA 2C2AA 5JJNB 2ZM6O 2IU3A 3ETDA 3LDEA 3CCQV 1Q7YW 3DSQA 4B08A 1VF5B 2P4KA 4R50A 3IC9A 5JCOA 3ZMZA 5DN6G 1A5UA 4ABMA 4UFZA 4DV0O 1E0TA 4DR1O 3ABKB 3JCUZ 1O9GA 2YIBA 4H44B 3OMNB 2AHZA 3BJTA 3IAYA 5GTHZ 3KCXA 1OCOC 2WA3A 5TISZ 3HKDB 4DV0B 1KP2A 3EFFK 1B04A 3AG4C 3HKEA 3SRFA 2BCCH 2E76B 5LGTA 2QWPB 3UO2A 1ZTEA 1L0LH 5KMGB 4C7UA 4J7JA 2GV9A 3OW2U 1NR1A 3E0VA 4MTFA 5LMUO 3ZRXA 4FXFA 1KKCA 4TV9A 2KSDA 4JYAB 1BZKA 1AQFA 4PA7A 2UUBB 2WLMA 2VQEO 4K0KO 5EC1C 4J41A 1FJGB 5L3EA 1K9MW 1GN6A 4O2AA 4RUEA 2Y48A 4ZHQB 4UCUA 4DV6B 1IDSA 2R9RB 2W0XA 2IJJA 3D36A 1N36O 1YTFB 1KQSU 2P22C 4ZIBA 2QM8A 5D5PA 2EIKC 3KHDA 4YIPA 3OGCC 5AG2A 1US6A 1H2MA 4ZOLA 3SYCA 1JPXA 2EINB 3EXAA 3MAQA 2EILC 1GO3F 2W0FC 4PA9A 4EB6A 4NTYA 1R6TA 3H1LH 1PP9H 4DV6O 2RMKB 3R66A 4CC6A 1AJNA 4X89A 4X66O 3GB7C 3JALB 1AI6A 4W4LA 4BW5A 4JZ2A 1H38A 1VP8A 1MNGA 4KCTA 2Q69A 1SC5B 4GT1A 3QNEA 4R6ZA 4YXWG 2CAZC 3HPLC 4BWAA 3CD6V 1OCRB 2ZNIA 1XDCA 4CS4A 1X4TA 4WFAV 3D36C 1XNQB 3RN4A 1P7BA 3QO8A 1VARA 3R65A 3CJHA 4E4EA 4IHJA 2OCCC 4FZ1A 2DWDC 4CS3A 1GK9A 3JALA 1Y74B 3ZMSA 5EYPB 1Q6HA 4WFBV 2QWOB 2UXNA 4NTWA 5EZYB 4JI6O 5IWAB 3ZCCA 4B3SB 5LHIA 1LNQA 5KUMA 1GM8A 3N27A 4I0XA 3CCEV 3CYOA 4G2KA 1HR0O 5IJ0A 1VQ7V 1PKNA 2JEUA 1YDXA 3G6BA 2CGNA 3E8FA 2UUBO 4HYWA 1Y76B 1L8DA 2D3OW 5F2VO 1SS3A 4RPPA 3L74H 2PI4A 2YSUB 2ARHA 4J7KA 3EOEA 2EIKB 2W6JG 1SQVH 2E74B 5JCOC 1XUQA 1EM1A 4HAMA 3G4SV 4Q20A 4ASUG 1WA8B 2ZIMA 3JAWB 1JOYA 1GM7A 3APQA 3QV8A 4GYCB 4LWSA 4I7ZB 1M90W 4DRXB 3KG2A 3ASOC 3QO5A 3LUTB 2HG5C 1AR5A 1GN3A 1WJZA 3CWBH 1XMQB 4CH6A 2CTRA 2LW7A 2AHYA 2F43G 4YIOA 5GONA 5H2FZ 1MZEA 1YSCA 3JAKA 3OFNG 4FLYA 3HB3B 3B8NA 3BRCA 3L71H 1QLEB 1M56B 3BAAA 5B1BC 4JI3O 4A5UB 2ADPA 3K5OA 4DV4B 2IU0A 1E1QG 5LBQA 1XL4A 2Z5UA 4U7OA 3ZMUA 5LP6A 3WB2A 4IL6Z 4MTXA 1MZFA 5IYBO 3OUFA 4UCOA 1O9HA 1E79G 2EIMC 4G28B 1PNLA 2FB5A 2PYLA 4OX9B 4JPGA 4AQYO 2DMXA 4K35A 3ABTA 1ZLZA 3E22B 1N4CA 1M1KW 1YEWA 1L1FA 3CRCA 3C90A 3MA8A 5ITZA 3U11A 1KC8W 1K92A 5EIBD 4AHCA 1KP3A 3Q4HA 4LF7O 4HNAA 2ZR2A 3L75H 5KHGA 4CH4A 1YJNV 1AI5A 3SPGA 1NH2D 1PV0A 2PF4E 3F7YC 4U7NA 2RCVA 1AR1B 1IVSA 5BMVB 5B1OA 3ME3A 2F1MA 3JD1A 1P49A 5JVDB 3JARB 2DQ3A 2VGBA 4OX9O 4H0LB 1YI2V 1N0NA 4UVAA 2KG7B 1EN4A 4FJCC 4DR5B 3J7AU 3ZBHA 1DGSA 1GRJA 2QTSA 5IJ9B 2Y0IA 1GH6A 4NR1A 2YXYA 4JI1O 2ZE8A 3I56V 2UUCO 2Z0AA 3E35A 3I55V 1N32B 2F23A 2EIJB 1OZ0A 1IBMO 5CA1B 3WB1A 3ZN0A 1IZ3A 2DYRB 4U3JB 1PM9A 5FPOA 3U0ZA 5A9GA 2EZPA 5JVDA 1XL6A 4L8JA 3OD4A 2JIZG 4DV7O 4UCSA 2XASA 1NTZH 3RYIB 5GW7A 1N34B 5IJ9A 5L3BA 3SDLA 4JI3B 4DK0A 4QE9A 1M56C 4DR3O 4K8ZA 2YIAA 1JX9A 4IHJB 3NXSA 4JI5O 1VQPV 4TQDA 5IY5B
chains in the Genus database with same CATH topology
2WLLB 3SPCA 3SPIA 3ZRWB 1SERA 1M9NA 2HLDG 3LNMB 1NQTA 3SJQC 4WCEV 2ZQMA 2GSMB 4KFMA 4PELA 3DGEA 1NVPB 4N21A 2WPDG 2Y69C 5CBFA 5IDJA 1I5YA 1NJIW 1NR7A 3X2QC 1YIJV 2P7TC 4PA6A 5EBWC 1K7DA 2ZD9A 3OEHG 3WFVA 1FFTB 2UXXA 4MS2A 1K33A 3QO7A 4E2LA 3H01A 3X2QB 5LHHA 1JJ2U 2LFSA 1P4RA 2MK3A 1VQ6V 3ABUA 1RPRA 1EZJA 3ZIAG 3AG1C 3G71V 2DW4A 4FIPC 4CBCA 3ASOB 3CP1A 1F4NA 1KECA 1QLNA 5IYCO 1K97A 1G4YB 1HWYA 3CMEV 1DTOA 3ZMTA 4I5SA 4CZZA 4JASA 1AI7A 3OMIB 3IC7A 1R3IC 3ZN1A 3SYQA 3JD2A 1VQ5V 2WLIB 3T4DA 3FB7C 1QVFU 1EBOA 4HYOA 3K0DA 2WLJA 1PKXA 1GKFA 3FB5C 2M7WA 3K06A 2WAMA 4FPPA 1E1RG 2H8PC 4MVRA 4J9YB 4ZKIA 1K3EA 4UVBA 5H6RA 2V1DA 4MVSA 2OTJV 4FMTA 1H2GA 4GX5A 5LGUA 4Z1MG 1BHBA 3JD0A 2C2AA 3JD4A 2DYSB 4RAIA 2QE7G 2IU3A 3ETDA 3LDEA 4RQEA 2EIJC 3CCQV 1H8HG 4P2ZA 1Q7YW 3CCSV 5B3SC 1OCCC 4JYCA 4R50A 3ZRVA 3CXCU 1KKDA 1ROPA 4ZBMA 4X88A 1F51A 2NLJC 2OCCB 3ZMZA 5DN6G 4MVUA 2P67A 2WSSG 4OXSA 3ABKB 3IFXA 1F4MA 1K34A 2DQ0A 1VQOV 1S77D 3UKMA 1F23A 3ZRSA 1AI4A 3ETEA 3OMNB 2AHZA 3LSQA 1AJPA 4MW8A 1OCOC 4QE7A 1KP2A 2X6BA 3EFFK 3TETA 2ITDC 3AG4C 3STLC 3T2MA 3CC2V 3CC7V 1OCRC 2ZDIC 3JYCA 5LGTA 2LFRA 4PDLA 3K04A 2Z3YA 3P32A 1R6NA 2Y69B 1NVPD 3OW2U 1NR1A 4MVZA 4MTFA 2HVKC 2A0LA 3K9AA 3ZRXA 2B1IA 3IGAC 4QIWF 3OMAB 3E89A 4HZ3A 4PDRA 1THZA 4PA7A 2WLMA 3OUSA 3BEHA 4F4LA 5EC1C 2QM7A 1YJWV 1KD1W 2Q67A 4UUJC 5L3EA 1K9MW 2HKOA 3LSSA 3SPHA 3AG4B 2JJ1G 4RUEA 2Y48A 3RVYA 4BAYA 4BIUA 2R9RB 4JTDB 3OR6C 2IJJA 3D36A 5CA3A 1YTFB 4WFEA 2B5UA 1KQSU 3OE7G 5L3FA 4I9WA 1W0JG 1AJQA 2BOCC 3ABKC 4R8CA 3E2EA 1EFRG 3AG3B 2QM8A 2X0LA 4KP4A 2EIKC 2OTLV 2HVJC 2EINC 3OGCC 3SYOA 3SYCA 2Q68A 1JPXA 2EINB 4UV9A 2EILC 5EBLC 1GO3F 4JPRA 2W0FC 2IJIA 3ABMC 4LC1A 4PA9A 2DYRC 3OR7C 3D3IA 1M57C 4R7CA 5KUKA 1K4CC 2IJKA 4LCUC 2X6AA 1Q82W 1YTFD 2DYSC 2KB1A 1AJNA 1BMFG 2QKSA 4X89A 5B1NA 3K0GA 3W7TA 3GB7C 3JD3A 3OEEG 1QBZA 1OCZB 1AI6A 4PA4A 3CCRV 4BW5A 1H38A 2ZXWC 1VQ9V 1FXHA 1DLBA 1V55C 2JEXA 3B77A 3E83A 4G27B 2Q69A 3E8BA 1R3JC 5HFMA 4QPJA 1OCZC 2XAFA 1MG1A 3QNEA 4GT1A 4R6ZA 1S3JA 3MHHC 5IY5C 4YXWG 2QA4V 1VQMV 3HPLC 3E86A 3CD6V 1OCRB 2FTKA 3OM3B 3FB8C 1DF5A 1R73A 3B8MA 3E8HA 3ETGA 4WFAV 1VQLV 2P6JA 3CC4V 1OCOB 4GX0A 1BL8A 4MVOA 1GMGA 3ABMB 5KA5A 1MOFA 1QR9A 3RVZA 2EILB 1P7BA 3QO8A 4WFGA 4TT3G 3R65A 3ZJZA 1QCEA 1FXKA 2XAJA 2OCCC 3CCVV 2ITCC 2DWDC 4JAVA 1AROP 1GK9A 1K5SA 3G6EV 4FK5C 4P9PA 3ZMSA 4WFBV 2UXNA 1GTOA 4XDLA 2XOKG 4UXNA 3ZCCA 1VQ4V 1GM9A 1S5HC 5LHIA 1YJ9V 1MABG 1V55B 1LNQA 2ZXWB 5KUMA 5B3SB 1GM8A 4XBFA 1CPYA 3STZC 3ZRWA 3CCEV 2LP7A 1VQKV 1TUEB 2XNDG 3CYOA 4G2KA 5B1AB 2NNUA 3CCUV 1BHAA 3K03A 3ASNB 2ZDIA 1VQ7V 2JEUA 4GCZA 2JJ2G 2WLKA 3VBBA 4LBEC 1PD3A 2YEVB 1Y66A 2EJRA 4H33A 2BOBC 2R9IA 1RPOA 3BY6A 3E8FA 4GX2A 4L87A 1MSWD 4P9OA 2X6CA 2D3OW 5DM6V 4PA3A 2GHYA 2PI4A 2XAQA 2YSUB 1NKDA 1K4DC 2EIKB 4PDMA 3FKSG 2W6JG 1V54B 3SYPA 4HAMA 3G4SV 5KA6A 5L3CA 4Q20A 4ASUG 1JOYA 4TWKA 4QJFB 1CP9A 1GM7A 2HJFC 2WLNA 3W7SA 2ZR3A 2X7RB 1RM1C 3VOUA 3CPWU 1W2BU 1M90W 4WFFA 4LP8A 3KG2A 1YHQV 3ASOC 3QO5A 2YEVA 3LUTB 2HG5C 1SETA 4RUFA 4UV8A 3F7VC 4MT8A 5L3DA 2IH1C 3ML0A 1PNKA 1OCCB 1FXVA 4GX1A 2AHYA 1SRYA 2F43G 4XDKA 5H9CA 1JVMA 1YSCA 3OFNG 3M99B 3HB3B 3T1CA 2JK5C 3DTUB 3B8NA 1IXMA 2A9HA 2WWWA 1QLEB 1M56B 3PJSK 5B1BC 1FS0G 1W0KG 5CBGA 1V54C 3CCLV 3AG2C 3ABLB 3MD0A 2IU0A 1ENVA 1E1QG 1M57B 5LBQA 1XL4A 2Z5UA 4U7OA 3ZMUA 2QEXV 3K3WA 3SPJA 4MTXA 4X8AA 5IYBO 3OUFA 2IJHA 1K73W 2OT5A 1E79G 2EIMC 4G28B 3F5WC 1PNLA 3JCZA 4P30A 3OAAG 1ZWIC 2A79B 1S76D 4RO2A 1N8RW 5B1BB 4JF3A 2CK3G 2Q6AA 3ASNC 3ABTA 1FXKB 3SYAA 2HR3A 2QTOA 3LDCA 2XAGA 1M1KW 1L1FA 3WG7C 3AG1B 2WLHA 2WLLA 4RQFA 1KC8W 1K92A 4MVMA 1SESA 4DXWA 1KP3A 2IH3C 2EZOA 3UM7A 5CBHA 3K08A 2K1EA 1ORQC 2ZR2A 4H37A 3W7XA 3RW0A 2HFEC 3CMAV 4TSFG 1WPXA 1YJNV 3FYEB 1AI5A 3SPGA 1NH2D 1OHHG 3F7YC 4U7NA 1AR1B 1SZTA 2P90A 1Q81W 4WF9V 5B1OA 1DF4A 4EKWA 1YITV 3JD1A 1JQ0A 1R6KA 2PI5A 2DQ3A 1I5XA 1VQ8V 5LGNA 4MTOA 5BZBA 4MVQA 4DO2A 3FYIB 1YI2V 1CEZA 2B1GA 4UVAA 4XDJA 3RBZA 1NH2B 4FJCC 2EBOA 1S72V 3MHSC 4JAUA 2WLIA 4JGSA 1S0VA 1K8AW 3W7UA 2IW5A 3LDDA 5E1AC 2H94A 1PL0A 3ZMVA 5J9PC 4J9ZB 3CCMV 3EHBB 4MTGA 4MW3A 5IYDO 3I56V 4JTCB 3E35A 5CMUA 4JYBA 3I55V 5EK0A 1B6QA 1G8MA 2EIJB 1OZ0A 5B1AC 4UVCA 2JDIG 1FXKC 2W6IG 1QR8A 5EBMC 1COWG 1R3KC 3T4ZA 1RM1B 3WG7B 3ZN0A 2DYRB 3A0RA 3GWOA 5FL7G 3CCJV 5EC2C 1J95A 4WFHA 1H8EG 4KUMA 3E8GA 1UJWB 1VQNV 2EZPA 1PNMA 3P30A 1XL6A 1Y4MA 2EIMB 3TK1A 1Q86W 1NBMG 1K5QA 1R3LC 2JIZG 2XAHA 2DWEC 2XASA 3AEIA 4MSWC 3AG3C 5H6QA 5GW7A 4PDVA 1WLEA 5LHGA 4BIZA 2V7QG 3ABLC 3K79A 4QNHB 5C93A 5L3BA 2ATKC 1QVGU 4N23A 3AAGA 1JCHA 1M56C 4JTAB 1QLEC 3AG2B 4QE9A 3W7WA 3TCUA 4QPKA 5L3GA 1JX9A 3NXSA 3FB6C 5CN0A 1VQPV 5HFLA 5IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHI A;  2XAG A;  1MAB G;  2HLD G;  4XBF A;  2WPD G;  2XND G;  3OEH G;  2JJ2 G;  2UXX A;  2EJR A;  5L3E A;  5LHH A;  2HKO A;  2R9I A;  4TSF G;  2JJ1 G;  2Y48 A;  3ABU A;  4BAY A;  3ZIA G;  2DW4 A;  1OHH G;  3OE7 G;  5L3F A;  1W0J G;  1EFR G;  2XAQ A;  3ZMT A;  2X0L A;  4CZZ A;  3FKS G;  2W6J G;  5L3C A;  5LGN A;  4ASU G;  4UV9 A;  3ZN1 A;  4UVA A;  1E1R G;  1BMF G;  2IW5 A;  4UV8 A;  2H94 A;  3ZMV A;  4UVB A;  5L3D A;  5H6R A;  2V1D A;  3OEE G;  5LGU A;  4Z1M G;  2F43 G;  4UVC A;  2QE7 G;  2JDI G;  1H8H G;  2W6I G;  1COW G;  3ZN0 A;  3OFN G;  2XAF A;  5FL7 G;  1H8E G;  4KUM A;  4YXW G;  3ZMZ A;  5DN6 G;  1FS0 G;  1W0K G;  1NBM G;  2JIZ G;  2WSS G;  2XAH A;  2XOK G;  2XAS A;  1E1Q G;  5LBQ A;  5H6Q A;  3ZMU A;  2Z5U A;  5LHG A;  2V7Q G;  4TT3 G;  5L3B A;  2XAJ A;  1E79 G;  3OAA G;  3ZMS A;  5L3G A;  2UXN A;  5LGT A;  2CK3 G;  2Z3Y A;  3ABT A;  4UXN A; 
#chains in the Genus database with same CATH topology
 3UCS C;  1NQT A;  3SJQ C;  2ZQM A;  1F7Y A;  1W59 A;  1YIJ V;  3MDS A;  5EBW C;  2AGA A;  3OEH G;  3WFV A;  2OIG A;  3QV9 A;  1AP5 A;  4E2L A;  3B4S A;  5LHH A;  4X65 B;  2LFS A;  3ABU A;  5J2T A;  1XIL A;  3G71 V;  3CP1 A;  1F4N A;  4YY3 O;  3A0H Z;  4CH3 A;  5IYC O;  3RYI A;  1CXZ B;  1D2D A;  1YZB A;  3RFR A;  1DTO A;  3ZMT A;  3JAT B;  3N2K B;  4DW1 A;  4CZZ A;  3GG8 A;  1SQX H;  3IC7 A;  1AP6 A;  1XBL A;  4RWU A;  3ZN1 A;  1FPO A;  3ZHR A;  2Y4T A;  2BE3 A;  1QVF U;  2K9P A;  1VEW A;  3OT7 A;  4HYO A;  4X64 O;  2UXB O;  3B09 A;  2FKX A;  2WLJ A;  1Z5W A;  1PKX A;  3PN1 A;  2WAM A;  2YDE A;  4UVB A;  5JH7 A;  2BTQ B;  4LF9 O;  4FMT A;  5LGU A;  1PKY A;  4Z1M G;  2GTS A;  4I9Q A;  3OTF A;  1JFF B;  3JD0 A;  2DYS B;  1H2S B;  2QE7 G;  5LMU B;  4P2Z A;  2ZT9 B;  3CCS V;  1OCC C;  4YJ5 A;  1ROP A;  5C8Y B;  1Q6I A;  4ZBM A;  1F51 A;  2NLJ C;  3B40 A;  1BQ0 A;  3CRQ A;  4TUY B;  3IFX A;  1JR9 A;  2QDO A;  1F4M A;  1K34 A;  1S77 D;  2AW9 A;  3ZRS A;  1AI4 A;  4O2A B;  1AJP A;  4H13 B;  1Q5O A;  3TET A;  2MW2 B;  4ZOL B;  2ITD C;  3QV7 A;  3T2M A;  3CC2 V;  2BTQ A;  4X1I B;  4QGC A;  2JS3 A;  2LFR A;  4PDL A;  2Z3Y A;  4DUY B;  1R6N A;  2Q4P A;  2E3C A;  4NXM B;  2A0L A;  3K9A A;  4GZR B;  2B1I A;  3OMA B;  1THZ A;  4X1Y A;  1GN2 A;  2DN9 A;  2QM7 A;  2Q5Z A;  4WBN A;  1YJW V;  4UUJ C;  2YXL A;  1HDJ A;  3SPH A;  3AG4 B;  5J2U A;  3JSL A;  4PD4 F;  4JI2 B;  3QTC A;  4BAY A;  2VWK A;  4JTD B;  4BIO A;  4FM1 A;  4WFE A;  2B5U A;  3OE7 G;  1W0J G;  2KKW A;  4R8C A;  3SJB C;  3AG3 B;  5K1X A;  4JI6 B;  2X0L A;  3U10 A;  2VWJ A;  3SYO A;  4TV8 B;  2D2C B;  2UU9 B;  4DR6 B;  5LMN B;  3ABM C;  4LC1 A;  2O57 A;  2DYR C;  1DK1 A;  1HW7 A;  3D3I A;  4R7C A;  5KUK A;  1K4C C;  4LH6 A;  4LCU C;  3K5N A;  2XT9 A;  1Q82 W;  2DYS C;  3K57 A;  3HQN A;  1WB7 A;  2CTQ A;  5B1N A;  3K0G A;  1S5L Z;  3JD3 A;  2VQE B;  4K0K B;  2YI9 A;  2OIE A;  3CCR V;  5FLX N;  4F6E A;  1V55 C;  3B77 A;  5KHH A;  4CH5 A;  3HKC A;  3E8B A;  4K8X A;  1VF7 A;  5HFM A;  1G6U A;  3QV6 A;  1B06 A;  3DC5 A;  3MHH C;  2Q7G A;  2QA4 V;  2HEP A;  3AG7 A;  1BCC H;  3E86 A;  3SRD A;  3OM3 B;  3FB8 C;  2ADQ B;  1DF5 A;  1OJH A;  1R73 A;  3B8M A;  3N2G B;  3E8H A;  3CHX A;  2EUL A;  3FAV A;  1NU1 H;  3ABM B;  5KA5 A;  1MOF A;  3LSU A;  4F6R A;  3ZJZ A;  1Y76 A;  2F4V B;  4DV5 O;  2CH7 A;  1K5S A;  3G6E V;  4K3A A;  4JI4 O;  4IGG A;  2ZIN A;  4KCU A;  1FYJ A;  2QJ1 A;  4KHP O;  1VQ4 V;  4DR4 O;  1S5H C;  1MAB G;  2ZXW B;  3HKC B;  2BSK B;  5CB4 B;  2ZM6 B;  1ZL8 A;  3FX7 A;  1CPY A;  1RFY A;  3STZ C;  2UXC B;  2LP7 A;  4DR2 O;  1URF A;  1TUE B;  2NNU A;  1BHA A;  2ZDI A;  4ZHQ A;  4LBE C;  4G1N A;  1Y66 A;  4LFC B;  4FFB A;  5K1P A;  2BOB C;  1RPO A;  3BY6 A;  3L72 H;  4L87 A;  2JGD A;  4NKG B;  3CRM A;  3FAV B;  2AXT Z;  1IBL B;  3N2G A;  3KKY A;  1UFI A;  2LGQ A;  4PA3 A;  2XAQ A;  1NKD A;  3DXR B;  1V54 B;  2QGN A;  2LQT A;  4LF6 B;  2CH7 B;  2XTA A;  4YJ3 A;  5KA6 A;  4QJF B;  2HJF C;  3E0W A;  3UT5 A;  4FLX A;  2CUG A;  1RM1 C;  4JI8 O;  4WFF A;  4LP8 A;  4J11 A;  1UPG A;  3ZHS A;  3RT3 C;  1SET A;  4RUF A;  4LF9 B;  4WJ8 A;  4B2D A;  4B3R B;  1AIL A;  3ZHQ A;  3ML0 A;  4JYY A;  4O4H A;  2DE0 X;  1OCC B;  4D7T A;  1TVK A;  1SQB H;  4GX1 A;  2UXB B;  4XDK A;  5H9C A;  5IYZ B;  5LOV B;  1BSM A;  1BS3 A;  1XOU A;  2JK5 C;  3DTU B;  2HP8 A;  1A32 A;  4IYH A;  3PJS K;  4EFB A;  2YID A;  1VF6 C;  1V54 C;  1E0U A;  3G67 A;  3SJA C;  2L35 A;  4YY3 B;  2QEX V;  3N25 A;  1TGO A;  1V9P A;  4X20 A;  2A79 B;  1S76 D;  4RO2 A;  1N8R W;  3I5D A;  2YI8 A;  1YXB A;  1IBK B;  4LF5 B;  4KCW A;  2CTP A;  3SYA A;  1PKM A;  4I0X B;  3LDC A;  2XAG A;  3FD9 A;  3AG1 B;  2QKC A;  2WLH A;  4JAA A;  2WLL A;  5IYZ A;  2Q7H A;  4MVM A;  1XNR O;  2JGU A;  4FFB B;  4PJ0 Z;  4X62 B;  4DXW A;  5CBH A;  3K08 A;  2K1E A;  4DR3 B;  1ORQ C;  1ZSP A;  4H37 A;  3W7X A;  3N2K A;  4TSF G;  2A06 H;  4FLU A;  1J5E B;  1N34 O;  1L0N H;  2GDS A;  3M7M X;  5BY1 A;  2P90 A;  2YUA A;  2F66 C;  4PI2 A;  4EKW A;  1YIT V;  2RNB A;  1HNW O;  1WB8 A;  2N04 A;  4AQY B;  3CX5 F;  2PI5 A;  1I5X A;  5LGN A;  4Q6G A;  4MVQ A;  4B7E A;  5JWP A;  2B1G A;  3SRK A;  1WP8 A;  1S72 V;  3CE2 A;  4I4T A;  1J5E O;  1U96 A;  4DV1 B;  1S0V A;  4O4H B;  4TQF A;  5KAF Z;  5BR8 O;  1I94 O;  3LDD A;  3H1H H;  2VRZ A;  1HNX O;  3EHB B;  2VGI A;  5C8Y A;  4X62 O;  5CMU A;  4JYB A;  4IYI A;  5EK0 A;  1P84 F;  1B6Q A;  2Q0A A;  4UVC A;  1SF9 A;  3BJF A;  2W6I G;  1COW G;  3T4Z A;  4NXN O;  3A0R A;  4O2B A;  3PP7 A;  3CCJ V;  1J95 A;  4NB5 A;  4LFA B;  1VQN V;  1WNS A;  3BHP A;  4OGQ B;  2Y4U A;  1Y4M A;  2EIM B;  3C3S A;  1K5Q A;  1R3L C;  2XAH A;  1XRE A;  2DWE C;  2CDY A;  2QKA A;  3AEI A;  3AG3 C;  2F95 B;  3P3P A;  5GON B;  1WLE A;  5LHG A;  4BIZ A;  2V7Q G;  3BPZ A;  1NZ6 A;  4QNH B;  5C93 A;  1N0J A;  1QVG U;  2GBO A;  4JTA B;  1QLE C;  1KU9 A;  5JH7 B;  4LF7 B;  3KZI Z;  3FB6 C;  2BSK A;  5CB4 A;  2WLL B;  4FFK A;  1SER A;  1M9N A;  2HLD G;  4WCE V;  4PEL A;  1NVP B;  4PHZ A;  4BW9 A;  3G80 A;  3GR4 A;  1K7D A;  2QWR B;  2ZD9 A;  2QWQ B;  1K33 A;  3H01 A;  3BAB A;  4FLT A;  1RSO A;  1JJ2 U;  1VQ6 V;  3AG1 C;  1QHT A;  4JZG A;  2FL4 A;  5JJE B;  3AK3 A;  3WU2 Z;  1QLN A;  4B3T O;  1K97 A;  5IWA O;  4LF6 O;  3OMI B;  5FNV B;  1WPB A;  1TA8 A;  4U3F H;  1TUB B;  1EBO A;  1XNQ O;  3CSX A;  1GKF A;  2WA4 A;  3K06 A;  2R9A A;  4MVR A;  4J9Y B;  3UQ8 A;  3C3T A;  3T1H O;  2V1D A;  3H1I H;  2N05 A;  4GX5 A;  3T1Y B;  3GWK C;  3CJH B;  1VMG A;  3HKD A;  4FM2 A;  4LF8 O;  2V4D A;  2ZNJ A;  4RQE A;  2EIJ C;  4DV3 B;  1H8H G;  4JYC A;  4B2D D;  1IBK O;  4LF5 O;  3ZRV A;  1KKD A;  4WBN B;  2LGW A;  1D5N A;  1U97 A;  1H2K A;  2OCC B;  4MVU A;  2FYU H;  3AK2 A;  3J81 N;  4OPH A;  3QG5 A;  2G38 A;  2WSS G;  4OXS A;  4GKJ O;  5IJ0 B;  3BA9 A;  1SQP H;  3BA8 A;  3UKM A;  1F23 A;  3LSQ A;  4GKJ B;  2X6B A;  1VP7 A;  3STL C;  3CC7 V;  1OCR C;  4I55 A;  1HR0 B;  4JV5 B;  1T5A A;  3L70 H;  2UXC O;  3P32 A;  2UUA O;  2ZE5 A;  4MVZ A;  2HVK C;  2JS5 A;  4LNU B;  5LYJ B;  2PYJ A;  4KHP B;  4LF8 B;  3JAW A;  4JV5 O;  3E89 A;  4HZ3 A;  4PDR A;  4ICG A;  3BEH A;  4F4L A;  2HKO A;  3CRA A;  5BMV A;  2JJ1 G;  1YVW A;  3RVY A;  4BIU A;  1BQZ A;  4EB6 B;  1N33 B;  5L3F A;  5KAI Z;  4I9W A;  1AJQ A;  2BOC C;  4DYL A;  2KG7 A;  1VIB A;  3ABK C;  2HVJ C;  4UCT A;  1JA8 A;  2Q68 A;  3JAK B;  1EZV H;  4TV9 B;  3OR7 C;  1N33 O;  4F6R B;  2IJK A;  1SQF A;  2YIB D;  2X6A A;  2KB1 A;  4Z1V A;  4QG9 A;  3GQY A;  4I55 B;  5DEC A;  3W7T A;  3HKE B;  4X66 B;  4NTX A;  3THO A;  1EN6 A;  3A0B Z;  1FXH A;  1DLB A;  4GUN A;  2IBZ H;  2GUZ B;  2UUA B;  5KX5 A;  1KUQ A;  1LUW A;  4QPJ A;  3DC6 A;  4QGP A;  4QG6 A;  3ZHV A;  4PI0 A;  1EN5 A;  1Q90 D;  1QQC A;  1VQM V;  1Y74 A;  2FTK A;  2YS8 A;  4AI8 A;  4O4L B;  2EX3 A;  3ETG A;  3CC4 V;  1OCO B;  1N36 B;  1IUR A;  4GX0 A;  1IXB A;  4FLV A;  1GMG A;  4FVM A;  3RVZ A;  4JI2 O;  2XAJ A;  3CCV V;  2ITC C;  4FK5 C;  3RYH A;  1PPJ H;  1G1X B;  4JYA O;  4XDL A;  4X9Q A;  4UXN A;  4D6T H;  1YJ9 V;  2IM9 A;  3H1J H;  2XND G;  2L6L A;  3K5L A;  2HJD A;  2WLK A;  3VBB A;  1PD3 A;  2YEV B;  3T05 A;  3JAR A;  1SA0 B;  1HNX B;  2R9I A;  1XHZ A;  2X6C A;  2E5L B;  1M4U A;  5EZY A;  1TVK B;  2XUM A;  2DJV A;  3JAS B;  4YHH B;  3FFQ A;  2AZ2 A;  2UXD O;  3CRR A;  4X20 B;  1ZJH A;  1CP9 A;  2KQX A;  5LYJ A;  2WLN A;  2ZR3 A;  2YXH A;  2X7R B;  3VOU A;  5ITZ B;  3CPW U;  2Q8V A;  3TJT A;  3U2Z A;  3ICX A;  5J2U B;  2UUC B;  3BCC H;  4UV8 A;  3RYH B;  4MT8 A;  3O9O A;  3IJ4 A;  4O4J A;  2PTM A;  3SJC C;  4DV1 O;  4GKK O;  4OPA A;  1FXV A;  1SRY A;  4X64 B;  5JJJ B;  1JVM A;  4DUY O;  3M99 B;  3T1C A;  1YF2 A;  3KTX A;  4YJ3 B;  4J80 A;  1SKV A;  1W0K G;  5CBG A;  3CCL V;  4B3M O;  3ABL B;  1ENV A;  1M57 B;  4FM0 A;  1AVM A;  3SPJ A;  5KMG A;  4X8A A;  4LH7 A;  2OT5 A;  3JCZ A;  4P30 A;  3OAA G;  1ZWI C;  4HNA B;  4O4J B;  3OTO B;  3QF7 A;  4QG8 A;  4X1Y B;  2Q6A A;  3JSN A;  1FXK B;  3K9S A;  2M6Y A;  3JAT A;  2QTO A;  1KB9 F;  3RWR D;  3WG7 C;  1IBM B;  1SES A;  2ZIO A;  4KXR A;  1N32 O;  2EZO A;  1HNZ O;  2RQ6 A;  5LA6 B;  3RW0 A;  2HFE C;  4I4T B;  1I94 B;  3D3Q A;  2OWO A;  4LR3 A;  1NT2 B;  1OHH G;  1SZT A;  3VQV A;  1QNM A;  1R1B A;  4MTO A;  1RP3 B;  1CEZ A;  4DR7 O;  4XDJ A;  1M5I A;  5CA1 A;  4JI0 O;  3MHS C;  2WLI A;  1I0H A;  1K8A W;  2IW5 A;  1F3W A;  5J9P C;  4B3M B;  3ZMV A;  3CCM V;  3H6O A;  4MTG A;  5LXT B;  5IYD O;  2Q0O C;  3L73 H;  4JTC B;  5D5Q A;  1G8M A;  4DRX A;  3WB0 A;  4UCR A;  4NXN B;  3F5T A;  1FXK C;  5EBM C;  1QR8 A;  3GWO A;  2B9Z A;  4BR6 A;  5EC2 C;  2R72 A;  4O4L A;  4WFH A;  1H8E G;  4KUM A;  2AZ0 A;  3OTO O;  1XHX A;  1WN7 A;  1NBM G;  4MSW C;  5BR8 B;  4IIJ A;  5H6Q A;  3VQW A;  4PDV A;  2YC0 A;  5LOV A;  2P4V A;  5E79 Z;  3K79 A;  1T57 A;  4DR7 B;  1YCI A;  2ATK C;  3H1K H;  4N23 A;  1NTM H;  3TCU A;  5LXT A;  3TXQ A;  2A3Q A;  4FLW A;  1Y6X A;  5CN0 A;  4DR2 B;  4U3J A;  1WAZ A;  5B5E Z;  5HFL A;  4I50 B;  4W4K A;  3SPC A;  5DED A;  2JVD A;  2Q73 A;  3APO A;  3LNM B;  4DR4 B;  3S3W A;  2OYQ A;  2E5L O;  1T5E A;  3DGE A;  4N21 A;  5BXZ A;  2WPD G;  2Y69 C;  2E75 B;  5IDJ A;  1I5Y A;  1NJI W;  3X2Q C;  3QO7 A;  1FKA O;  1BT8 A;  3X2Q B;  4B3R O;  4TOI A;  3HQO A;  2CE4 A;  1RPR A;  1EZJ A;  3ZIA G;  1A3W A;  2DW4 A;  4CBC A;  3ZX6 A;  3ASO B;  3TGU H;  4KCV A;  4ZI7 B;  5IT9 N;  3CME V;  1JFF A;  5GTI Z;  4FXJ A;  3E22 A;  4D7S A;  2UXD B;  3NR7 A;  5B66 Z;  1AI7 A;  4YJ2 B;  1R3I C;  2Y0P A;  2ZE7 A;  4Z2W A;  3SYQ A;  3JD2 A;  2RJZ A;  3SR2 C;  1VQ5 V;  3ZHT A;  4FZ0 A;  4LNU A;  3VQX A;  3T07 A;  3K0D A;  3CXH F;  3RYC A;  2M7W A;  4FPP A;  1E1R G;  2H8P C;  3HQP A;  4ZKI A;  1XMQ O;  1K3E A;  5H6R A;  4MVS A;  3G2G A;  3T0T A;  2FML A;  2OCH A;  4PV1 B;  3JD4 A;  4RAI A;  2PUS A;  1X59 A;  5LMN O;  1Q3E A;  5B3S C;  5H5N A;  2PZS A;  3CXC U;  1A3X A;  3GVM A;  1SQG A;  2QSA A;  4X88 A;  4AIL C;  4GKK B;  4JI4 B;  4KS0 A;  1MMM A;  2P67 A;  2F4V O;  4DV5 B;  1AR4 A;  3HKB B;  2DQ0 A;  1VQO V;  1FD9 A;  3ETE A;  4MW8 A;  4DV4 O;  4QE7 A;  1P7G A;  3BFR A;  4DV2 O;  2ZDI C;  3H9V A;  3JYC A;  3K04 A;  1KBH A;  2GTA A;  2ILM A;  2Y69 B;  3K5M A;  1NVP D;  5LL6 Y;  3IGA C;  2ZE6 A;  4QIW F;  1XEQ A;  3KCY A;  1Q6U A;  1D5A A;  3OUS A;  1FFX B;  3K59 A;  1A49 A;  4DUZ B;  1KD1 W;  2Q67 A;  4DUZ O;  1KMI Z;  4O4I B;  3LSS A;  1HP8 A;  3RYF B;  5JQG A;  1NTK H;  2VGG A;  3OR6 C;  4ZI7 A;  2VS0 A;  1M93 A;  5CA3 A;  1GAX A;  3UO3 A;  4EEQ A;  2NN4 A;  3UT5 B;  2RDC A;  3S3X A;  3E2E A;  2UU9 O;  1EFR G;  4YJ2 A;  1GN4 A;  3QTG A;  4KP4 A;  2XHB A;  1KYO F;  2PGG A;  2OTL V;  2EIN C;  4UV9 A;  5EBL C;  4JPR A;  2IJI A;  1M57 C;  1MSD A;  2YIC A;  1YTF D;  1BMF G;  2QKS A;  5KHI A;  1RSO B;  1FFX A;  1JMK C;  2Q9L A;  3OEE G;  1QBZ A;  1OCZ B;  4PA4 A;  1Z5V A;  2ZXW C;  1VQ9 V;  2JEX A;  3E83 A;  4G27 B;  4NXM O;  1S5J A;  1R3J C;  4KRZ A;  3RGB A;  1OCZ C;  2XAF A;  1MG1 A;  1S3J A;  5IY5 C;  3Q4H B;  3T1H B;  2ODM A;  1VQL V;  2P6J A;  2G50 A;  1BL8 A;  4MVO A;  2JGD B;  1QR9 A;  1MA1 A;  2EIL B;  4WFG A;  4DR1 B;  4TT3 G;  1QCE A;  1FXK A;  2A7W A;  3ZHU A;  4JAV A;  1ARO P;  2RN9 A;  4P9P A;  1GTO A;  2XOK G;  1GM9 A;  1V55 B;  3M8A A;  1JJO A;  5B3S B;  4XBF A;  3ZRW A;  3J80 N;  4JI5 B;  1VQK V;  5B1A B;  4UCV A;  3CCU V;  3K03 A;  3ASN B;  4YNG A;  3DXR A;  2JJ2 G;  4GCZ A;  4DV2 B;  5EYP A;  2EJR A;  4X1K A;  4H33 A;  1I7F A;  4GX2 A;  1MSW D;  4P9O A;  3CEI A;  1XQ8 A;  2LJ2 A;  2ZCE A;  5DM6 V;  4DR6 O;  2QR4 A;  2GHY A;  3RYF A;  1K4D C;  4PDM A;  3FKS G;  3ZS8 C;  3SYP A;  1Y67 A;  4CS2 A;  5L3C A;  1HNW B;  3EVK A;  1QU7 A;  4TWK A;  1ZL8 B;  4B3T B;  3RYC B;  3W7S A;  1SZX A;  1Q43 A;  1W2B U;  1YHQ V;  5LP6 B;  1BGY H;  2YEV A;  4TV8 A;  3F7V C;  5L3D A;  2IH1 C;  1AB3 A;  4X1K B;  1ZX3 A;  1PNK A;  1H2L A;  1OV9 A;  4J42 A;  2CGO A;  4UB6 Z;  4LWS B;  2BTO A;  4DV3 O;  4IIJ B;  4TUY A;  5FPR A;  3HR0 A;  3A2F A;  1LR1 A;  1WP7 A;  5CA0 B;  1IXM A;  2A9H A;  2WWW A;  4IP7 A;  3T1Y O;  1FS0 G;  4DK1 A;  3SGI A;  3AG2 C;  3MD0 A;  1ZAU A;  1F3X A;  2CTW A;  3K3W A;  4JI0 B;  3BVO A;  3HKB A;  2IJH A;  1K73 W;  3F5W C;  3QVN A;  5A2Q N;  4LFA O;  1TAE A;  5B1B B;  4JF3 A;  2CK3 G;  3A8T A;  3ASN C;  2GUZ A;  2HR3 A;  4NYK A;  1ZUQ A;  4IT5 A;  1Z2G A;  4RQF A;  5JQG B;  4X1I A;  4O4I A;  2IH3 C;  4X65 O;  3UM7 A;  4JI1 B;  5CA0 A;  4LF4 B;  3CMA V;  1WPX A;  1XNR B;  1XMO O;  3FYE B;  4JI7 B;  4HYV A;  2HHH B;  1BE3 H;  2NR5 A;  1NS1 A;  4JI8 B;  3OGI B;  4UB8 Z;  1Q81 W;  4LFB B;  1I08 A;  3P3N A;  2LW1 A;  4WF9 V;  1DF4 A;  1IX9 A;  1SQQ H;  2F93 B;  4J10 A;  2LO1 A;  1PL4 A;  1JQ0 A;  1R6K A;  3JAM N;  1VQ8 V;  3L9D A;  5BZB A;  4DO2 A;  1LUV A;  3FYI B;  4B7K A;  3O65 A;  2P06 A;  3RBZ A;  1NH2 B;  3IS4 A;  2EBO A;  1IBL O;  4JAU A;  4JGS A;  5EIB C;  2VQF O;  1XMO B;  2PY5 A;  3W7U A;  1SA0 A;  5E1A C;  2H94 A;  1PL0 A;  4J9Z B;  4NVP A;  4MW3 A;  2VQF B;  2ETN A;  4DW0 A;  5B1A C;  1H2N A;  2JDI G;  1RM1 B;  1R3K C;  5KLV H;  3WG7 B;  3D8C A;  5FL7 G;  3SRH A;  4I50 A;  4DRS A;  3E8G A;  1UJW B;  1PNM A;  3P30 A;  1FAF A;  3TK1 A;  1Q86 W;  4HBN A;  5KX5 B;  5KHK A;  3ABL C;  4JI7 O;  4DV7 B;  4LF4 O;  1JCH A;  3W7W A;  3AAG A;  3AG2 B;  1HNZ B;  4QPK A;  5IE9 A;  5L3G A;  1NI8 A;  4GLX A;  1XI1 A;  2VGF A;  4YHH O;  3ZED A;  4O2B B;  4IMA A;  3TXS A;  3SPI A;  3ZRW B;  2EJ7 A;  4B3S O;  2GSM B;  4KFM A;  2N74 A;  2QM4 A;  5CBF A;  1NR7 A;  2E28 A;  2P7T C;  4PA6 A;  1FFT B;  4J7Z A;  1VF6 A;  2UXX A;  4MS2 A;  4LFC O;  4KL1 A;  3JAS A;  3B2E E;  2MK3 A;  1P4R A;  4FIP C;  5KHJ A;  1TUB A;  5LP6 C;  4DR5 O;  1KEC A;  1PKL A;  1G4Y B;  1HWY A;  1B3Q A;  4I5S A;  1WA8 A;  4JAS A;  5LA6 A;  1Q8I A;  3VQY A;  2P5O A;  2H3O A;  4EFE A;  3CS5 A;  4LFB O;  3CB2 A;  2WLI B;  3T4D A;  3FB7 C;  3K58 A;  4FLZ A;  3LNN A;  2HHH O;  3FB5 C;  5J2T B;  1FJG O;  2Q7E A;  2QWN B;  5FNV A;  2R70 A;  3AK1 A;  3ETQ A;  2ZKO A;  4CC5 A;  2OTJ V;  1H2G A;  1BHB A;  2JRI A;  2DOS A;  2C2A A;  5JJN B;  2ZM6 O;  2IU3 A;  3ETD A;  3LDE A;  3CCQ V;  1Q7Y W;  3DSQ A;  4B08 A;  1VF5 B;  2P4K A;  4R50 A;  3IC9 A;  5JCO A;  3ZMZ A;  5DN6 G;  1A5U A;  4ABM A;  4UFZ A;  4DV0 O;  1E0T A;  4DR1 O;  3ABK B;  3JCU Z;  1O9G A;  2YIB A;  4H44 B;  3OMN B;  2AHZ A;  3BJT A;  3IAY A;  5GTH Z;  3KCX A;  1OCO C;  2WA3 A;  5TIS Z;  3HKD B;  4DV0 B;  1KP2 A;  3EFF K;  1B04 A;  3AG4 C;  3HKE A;  3SRF A;  2BCC H;  2E76 B;  5LGT A;  2QWP B;  3UO2 A;  1ZTE A;  1L0L H;  5KMG B;  4C7U A;  4J7J A;  2GV9 A;  3OW2 U;  1NR1 A;  3E0V A;  4MTF A;  5LMU O;  3ZRX A;  4FXF A;  1KKC A;  4TV9 A;  2KSD A;  4JYA B;  1BZK A;  1AQF A;  4PA7 A;  2UUB B;  2WLM A;  2VQE O;  4K0K O;  5EC1 C;  4J41 A;  1FJG B;  5L3E A;  1K9M W;  1GN6 A;  4O2A A;  4RUE A;  2Y48 A;  4ZHQ B;  4UCU A;  4DV6 B;  1IDS A;  2R9R B;  2W0X A;  2IJJ A;  3D36 A;  1N36 O;  1YTF B;  1KQS U;  2P22 C;  4ZIB A;  2QM8 A;  5D5P A;  2EIK C;  3KHD A;  4YIP A;  3OGC C;  5AG2 A;  1US6 A;  1H2M A;  4ZOL A;  3SYC A;  1JPX A;  2EIN B;  3EXA A;  3MAQ A;  2EIL C;  1GO3 F;  2W0F C;  4PA9 A;  4EB6 A;  4NTY A;  1R6T A;  3H1L H;  1PP9 H;  4DV6 O;  2RMK B;  3R66 A;  4CC6 A;  1AJN A;  4X89 A;  4X66 O;  3GB7 C;  3JAL B;  1AI6 A;  4W4L A;  4BW5 A;  4JZ2 A;  1H38 A;  1VP8 A;  1MNG A;  4KCT A;  2Q69 A;  1SC5 B;  4GT1 A;  3QNE A;  4R6Z A;  4YXW G;  2CAZ C;  3HPL C;  4BWA A;  3CD6 V;  1OCR B;  2ZNI A;  1XDC A;  4CS4 A;  1X4T A;  4WFA V;  3D36 C;  1XNQ B;  3RN4 A;  1P7B A;  3QO8 A;  1VAR A;  3R65 A;  3CJH A;  4E4E A;  4IHJ A;  2OCC C;  4FZ1 A;  2DWD C;  4CS3 A;  1GK9 A;  3JAL A;  1Y74 B;  3ZMS A;  5EYP B;  1Q6H A;  4WFB V;  2QWO B;  2UXN A;  4NTW A;  5EZY B;  4JI6 O;  5IWA B;  3ZCC A;  4B3S B;  5LHI A;  1LNQ A;  5KUM A;  1GM8 A;  3N27 A;  4I0X A;  3CCE V;  3CYO A;  4G2K A;  1HR0 O;  5IJ0 A;  1VQ7 V;  1PKN A;  2JEU A;  1YDX A;  3G6B A;  2CGN A;  3E8F A;  2UUB O;  4HYW A;  1Y76 B;  1L8D A;  2D3O W;  5F2V O;  1SS3 A;  4RPP A;  3L74 H;  2PI4 A;  2YSU B;  2ARH A;  4J7K A;  3EOE A;  2EIK B;  2W6J G;  1SQV H;  2E74 B;  5JCO C;  1XUQ A;  1EM1 A;  4HAM A;  3G4S V;  4Q20 A;  4ASU G;  1WA8 B;  2ZIM A;  3JAW B;  1JOY A;  1GM7 A;  3APQ A;  3QV8 A;  4GYC B;  4LWS A;  4I7Z B;  1M90 W;  4DRX B;  3KG2 A;  3ASO C;  3QO5 A;  3LUT B;  2HG5 C;  1AR5 A;  1GN3 A;  1WJZ A;  3CWB H;  1XMQ B;  4CH6 A;  2CTR A;  2LW7 A;  2AHY A;  2F43 G;  4YIO A;  5GON A;  5H2F Z;  1MZE A;  1YSC A;  3JAK A;  3OFN G;  4FLY A;  3HB3 B;  3B8N A;  3BRC A;  3L71 H;  1QLE B;  1M56 B;  3BAA A;  5B1B C;  4JI3 O;  4A5U B;  2ADP A;  3K5O A;  4DV4 B;  2IU0 A;  1E1Q G;  5LBQ A;  1XL4 A;  2Z5U A;  4U7O A;  3ZMU A;  5LP6 A;  3WB2 A;  4IL6 Z;  4MTX A;  1MZF A;  5IYB O;  3OUF A;  4UCO A;  1O9H A;  1E79 G;  2EIM C;  4G28 B;  1PNL A;  2FB5 A;  2PYL A;  4OX9 B;  4JPG A;  4AQY O;  2DMX A;  4K35 A;  3ABT A;  1ZLZ A;  3E22 B;  1N4C A;  1M1K W;  1YEW A;  1L1F A;  3CRC A;  3C90 A;  3MA8 A;  5ITZ A;  3U11 A;  1KC8 W;  1K92 A;  5EIB D;  4AHC A;  1KP3 A;  3Q4H A;  4LF7 O;  4HNA A;  2ZR2 A;  3L75 H;  5KHG A;  4CH4 A;  1YJN V;  1AI5 A;  3SPG A;  1NH2 D;  1PV0 A;  2PF4 E;  3F7Y C;  4U7N A;  2RCV A;  1AR1 B;  1IVS A;  5BMV B;  5B1O A;  3ME3 A;  2F1M A;  3JD1 A;  1P49 A;  5JVD B;  3JAR B;  2DQ3 A;  2VGB A;  4OX9 O;  4H0L B;  1YI2 V;  1N0N A;  4UVA A;  2KG7 B;  1EN4 A;  4FJC C;  4DR5 B;  3J7A U;  3ZBH A;  1DGS A;  1GRJ A;  2QTS A;  5IJ9 B;  2Y0I A;  1GH6 A;  4NR1 A;  2YXY A;  4JI1 O;  2ZE8 A;  3I56 V;  2UUC O;  2Z0A A;  3E35 A;  3I55 V;  1N32 B;  2F23 A;  2EIJ B;  1OZ0 A;  1IBM O;  5CA1 B;  3WB1 A;  3ZN0 A;  1IZ3 A;  2DYR B;  4U3J B;  1PM9 A;  5FPO A;  3U0Z A;  5A9G A;  2EZP A;  5JVD A;  1XL6 A;  4L8J A;  3OD4 A;  2JIZ G;  4DV7 O;  4UCS A;  2XAS A;  1NTZ H;  3RYI B;  5GW7 A;  1N34 B;  5IJ9 A;  5L3B A;  3SDL A;  4JI3 B;  4DK0 A;  4QE9 A;  1M56 C;  4DR3 O;  4K8Z A;  2YIA A;  1JX9 A;  4IHJ B;  3NXS A;  4JI5 O;  1VQP V;  4TQD A;  5IY5 B; 
#chains in the Genus database with same CATH homology
 2WLL B;  3SPC A;  3SPI A;  3ZRW B;  1SER A;  1M9N A;  2HLD G;  3LNM B;  1NQT A;  3SJQ C;  4WCE V;  2ZQM A;  2GSM B;  4KFM A;  4PEL A;  3DGE A;  1NVP B;  4N21 A;  2WPD G;  2Y69 C;  5CBF A;  5IDJ A;  1I5Y A;  1NJI W;  1NR7 A;  3X2Q C;  1YIJ V;  2P7T C;  4PA6 A;  5EBW C;  1K7D A;  2ZD9 A;  3OEH G;  3WFV A;  1FFT B;  2UXX A;  4MS2 A;  1K33 A;  3QO7 A;  4E2L A;  3H01 A;  3X2Q B;  5LHH A;  1JJ2 U;  2LFS A;  1P4R A;  2MK3 A;  1VQ6 V;  3ABU A;  1RPR A;  1EZJ A;  3ZIA G;  3AG1 C;  3G71 V;  2DW4 A;  4FIP C;  4CBC A;  3ASO B;  3CP1 A;  1F4N A;  1KEC A;  1QLN A;  5IYC O;  1K97 A;  1G4Y B;  1HWY A;  3CME V;  1DTO A;  3ZMT A;  4I5S A;  4CZZ A;  4JAS A;  1AI7 A;  3OMI B;  3IC7 A;  1R3I C;  3ZN1 A;  3SYQ A;  3JD2 A;  1VQ5 V;  2WLI B;  3T4D A;  3FB7 C;  1QVF U;  1EBO A;  4HYO A;  3K0D A;  2WLJ A;  1PKX A;  1GKF A;  3FB5 C;  2M7W A;  3K06 A;  2WAM A;  4FPP A;  1E1R G;  2H8P C;  4MVR A;  4J9Y B;  4ZKI A;  1K3E A;  4UVB A;  5H6R A;  2V1D A;  4MVS A;  2OTJ V;  4FMT A;  1H2G A;  4GX5 A;  5LGU A;  4Z1M G;  1BHB A;  3JD0 A;  2C2A A;  3JD4 A;  2DYS B;  4RAI A;  2QE7 G;  2IU3 A;  3ETD A;  3LDE A;  4RQE A;  2EIJ C;  3CCQ V;  1H8H G;  4P2Z A;  1Q7Y W;  3CCS V;  5B3S C;  1OCC C;  4JYC A;  4R50 A;  3ZRV A;  3CXC U;  1KKD A;  1ROP A;  4ZBM A;  4X88 A;  1F51 A;  2NLJ C;  2OCC B;  3ZMZ A;  5DN6 G;  4MVU A;  2P67 A;  2WSS G;  4OXS A;  3ABK B;  3IFX A;  1F4M A;  1K34 A;  2DQ0 A;  1VQO V;  1S77 D;  3UKM A;  1F23 A;  3ZRS A;  1AI4 A;  3ETE A;  3OMN B;  2AHZ A;  3LSQ A;  1AJP A;  4MW8 A;  1OCO C;  4QE7 A;  1KP2 A;  2X6B A;  3EFF K;  3TET A;  2ITD C;  3AG4 C;  3STL C;  3T2M A;  3CC2 V;  3CC7 V;  1OCR C;  2ZDI C;  3JYC A;  5LGT A;  2LFR A;  4PDL A;  3K04 A;  2Z3Y A;  3P32 A;  1R6N A;  2Y69 B;  1NVP D;  3OW2 U;  1NR1 A;  4MVZ A;  4MTF A;  2HVK C;  2A0L A;  3K9A A;  3ZRX A;  2B1I A;  3IGA C;  4QIW F;  3OMA B;  3E89 A;  4HZ3 A;  4PDR A;  1THZ A;  4PA7 A;  2WLM A;  3OUS A;  3BEH A;  4F4L A;  5EC1 C;  2QM7 A;  1YJW V;  1KD1 W;  2Q67 A;  4UUJ C;  5L3E A;  1K9M W;  2HKO A;  3LSS A;  3SPH A;  3AG4 B;  2JJ1 G;  4RUE A;  2Y48 A;  3RVY A;  4BAY A;  4BIU A;  2R9R B;  4JTD B;  3OR6 C;  2IJJ A;  3D36 A;  5CA3 A;  1YTF B;  4WFE A;  2B5U A;  1KQS U;  3OE7 G;  5L3F A;  4I9W A;  1W0J G;  1AJQ A;  2BOC C;  3ABK C;  4R8C A;  3E2E A;  1EFR G;  3AG3 B;  2QM8 A;  2X0L A;  4KP4 A;  2EIK C;  2OTL V;  2HVJ C;  2EIN C;  3OGC C;  3SYO A;  3SYC A;  2Q68 A;  1JPX A;  2EIN B;  4UV9 A;  2EIL C;  5EBL C;  1GO3 F;  4JPR A;  2W0F C;  2IJI A;  3ABM C;  4LC1 A;  4PA9 A;  2DYR C;  3OR7 C;  3D3I A;  1M57 C;  4R7C A;  5KUK A;  1K4C C;  2IJK A;  4LCU C;  2X6A A;  1Q82 W;  1YTF D;  2DYS C;  2KB1 A;  1AJN A;  1BMF G;  2QKS A;  4X89 A;  5B1N A;  3K0G A;  3W7T A;  3GB7 C;  3JD3 A;  3OEE G;  1QBZ A;  1OCZ B;  1AI6 A;  4PA4 A;  3CCR V;  4BW5 A;  1H38 A;  2ZXW C;  1VQ9 V;  1FXH A;  1DLB A;  1V55 C;  2JEX A;  3B77 A;  3E83 A;  4G27 B;  2Q69 A;  3E8B A;  1R3J C;  5HFM A;  4QPJ A;  1OCZ C;  2XAF A;  1MG1 A;  3QNE A;  4GT1 A;  4R6Z A;  1S3J A;  3MHH C;  5IY5 C;  4YXW G;  2QA4 V;  1VQM V;  3HPL C;  3E86 A;  3CD6 V;  1OCR B;  2FTK A;  3OM3 B;  3FB8 C;  1DF5 A;  1R73 A;  3B8M A;  3E8H A;  3ETG A;  4WFA V;  1VQL V;  2P6J A;  3CC4 V;  1OCO B;  4GX0 A;  1BL8 A;  4MVO A;  1GMG A;  3ABM B;  5KA5 A;  1MOF A;  1QR9 A;  3RVZ A;  2EIL B;  1P7B A;  3QO8 A;  4WFG A;  4TT3 G;  3R65 A;  3ZJZ A;  1QCE A;  1FXK A;  2XAJ A;  2OCC C;  3CCV V;  2ITC C;  2DWD C;  4JAV A;  1ARO P;  1GK9 A;  1K5S A;  3G6E V;  4FK5 C;  4P9P A;  3ZMS A;  4WFB V;  2UXN A;  1GTO A;  4XDL A;  2XOK G;  4UXN A;  3ZCC A;  1VQ4 V;  1GM9 A;  1S5H C;  5LHI A;  1YJ9 V;  1MAB G;  1V55 B;  1LNQ A;  2ZXW B;  5KUM A;  5B3S B;  1GM8 A;  4XBF A;  1CPY A;  3STZ C;  3ZRW A;  3CCE V;  2LP7 A;  1VQK V;  1TUE B;  2XND G;  3CYO A;  4G2K A;  5B1A B;  2NNU A;  3CCU V;  1BHA A;  3K03 A;  3ASN B;  2ZDI A;  1VQ7 V;  2JEU A;  4GCZ A;  2JJ2 G;  2WLK A;  3VBB A;  4LBE C;  1PD3 A;  2YEV B;  1Y66 A;  2EJR A;  4H33 A;  2BOB C;  2R9I A;  1RPO A;  3BY6 A;  3E8F A;  4GX2 A;  4L87 A;  1MSW D;  4P9O A;  2X6C A;  2D3O W;  5DM6 V;  4PA3 A;  2GHY A;  2PI4 A;  2XAQ A;  2YSU B;  1NKD A;  1K4D C;  2EIK B;  4PDM A;  3FKS G;  2W6J G;  1V54 B;  3SYP A;  4HAM A;  3G4S V;  5KA6 A;  5L3C A;  4Q20 A;  4ASU G;  1JOY A;  4TWK A;  4QJF B;  1CP9 A;  1GM7 A;  2HJF C;  2WLN A;  3W7S A;  2ZR3 A;  2X7R B;  1RM1 C;  3VOU A;  3CPW U;  1W2B U;  1M90 W;  4WFF A;  4LP8 A;  3KG2 A;  1YHQ V;  3ASO C;  3QO5 A;  2YEV A;  3LUT B;  2HG5 C;  1SET A;  4RUF A;  4UV8 A;  3F7V C;  4MT8 A;  5L3D A;  2IH1 C;  3ML0 A;  1PNK A;  1OCC B;  1FXV A;  4GX1 A;  2AHY A;  1SRY A;  2F43 G;  4XDK A;  5H9C A;  1JVM A;  1YSC A;  3OFN G;  3M99 B;  3HB3 B;  3T1C A;  2JK5 C;  3DTU B;  3B8N A;  1IXM A;  2A9H A;  2WWW A;  1QLE B;  1M56 B;  3PJS K;  5B1B C;  1FS0 G;  1W0K G;  5CBG A;  1V54 C;  3CCL V;  3AG2 C;  3ABL B;  3MD0 A;  2IU0 A;  1ENV A;  1E1Q G;  1M57 B;  5LBQ A;  1XL4 A;  2Z5U A;  4U7O A;  3ZMU A;  2QEX V;  3K3W A;  3SPJ A;  4MTX A;  4X8A A;  5IYB O;  3OUF A;  2IJH A;  1K73 W;  2OT5 A;  1E79 G;  2EIM C;  4G28 B;  3F5W C;  1PNL A;  3JCZ A;  4P30 A;  3OAA G;  1ZWI C;  2A79 B;  1S76 D;  4RO2 A;  1N8R W;  5B1B B;  4JF3 A;  2CK3 G;  2Q6A A;  3ASN C;  3ABT A;  1FXK B;  3SYA A;  2HR3 A;  2QTO A;  3LDC A;  2XAG A;  1M1K W;  1L1F A;  3WG7 C;  3AG1 B;  2WLH A;  2WLL A;  4RQF A;  1KC8 W;  1K92 A;  4MVM A;  1SES A;  4DXW A;  1KP3 A;  2IH3 C;  2EZO A;  3UM7 A;  5CBH A;  3K08 A;  2K1E A;  1ORQ C;  2ZR2 A;  4H37 A;  3W7X A;  3RW0 A;  2HFE C;  3CMA V;  4TSF G;  1WPX A;  1YJN V;  3FYE B;  1AI5 A;  3SPG A;  1NH2 D;  1OHH G;  3F7Y C;  4U7N A;  1AR1 B;  1SZT A;  2P90 A;  1Q81 W;  4WF9 V;  5B1O A;  1DF4 A;  4EKW A;  1YIT V;  3JD1 A;  1JQ0 A;  1R6K A;  2PI5 A;  2DQ3 A;  1I5X A;  1VQ8 V;  5LGN A;  4MTO A;  5BZB A;  4MVQ A;  4DO2 A;  3FYI B;  1YI2 V;  1CEZ A;  2B1G A;  4UVA A;  4XDJ A;  3RBZ A;  1NH2 B;  4FJC C;  2EBO A;  1S72 V;  3MHS C;  4JAU A;  2WLI A;  4JGS A;  1S0V A;  1K8A W;  3W7U A;  2IW5 A;  3LDD A;  5E1A C;  2H94 A;  1PL0 A;  3ZMV A;  5J9P C;  4J9Z B;  3CCM V;  3EHB B;  4MTG A;  4MW3 A;  5IYD O;  3I56 V;  4JTC B;  3E35 A;  5CMU A;  4JYB A;  3I55 V;  5EK0 A;  1B6Q A;  1G8M A;  2EIJ B;  1OZ0 A;  5B1A C;  4UVC A;  2JDI G;  1FXK C;  2W6I G;  1QR8 A;  5EBM C;  1COW G;  1R3K C;  3T4Z A;  1RM1 B;  3WG7 B;  3ZN0 A;  2DYR B;  3A0R A;  3GWO A;  5FL7 G;  3CCJ V;  5EC2 C;  1J95 A;  4WFH A;  1H8E G;  4KUM A;  3E8G A;  1UJW B;  1VQN V;  2EZP A;  1PNM A;  3P30 A;  1XL6 A;  1Y4M A;  2EIM B;  3TK1 A;  1Q86 W;  1NBM G;  1K5Q A;  1R3L C;  2JIZ G;  2XAH A;  2DWE C;  2XAS A;  3AEI A;  4MSW C;  3AG3 C;  5H6Q A;  5GW7 A;  4PDV A;  1WLE A;  5LHG A;  4BIZ A;  2V7Q G;  3ABL C;  3K79 A;  4QNH B;  5C93 A;  5L3B A;  2ATK C;  1QVG U;  4N23 A;  3AAG A;  1JCH A;  1M56 C;  4JTA B;  1QLE C;  3AG2 B;  4QE9 A;  3W7W A;  3TCU A;  4QPK A;  5L3G A;  1JX9 A;  3NXS A;  3FB6 C;  5CN0 A;  1VQP V;  5HFL A;  5IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...