3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PmoB
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
4PHZA 3RFRA 3CHXA 3RGBA 4O65A 4PI2A 1YEWA 4PI0A
chains in the Genus database with same CATH superfamily
3H1HH 2JV6A 3MODH 5D7SH 5ICZB 2E75C 5IMLB 4GYCB 2R27A 1FATA 4HANA 3VDDB 3S5LA 4F7EA 4QXTA 5IAXA 3LH2H 2WNVA 4X8JA 5CSBA 2VQFB 1JJ2U 1SN0A 2XX0A 5HDOA 5DVPA 3KSCA 4CJ1A 1WG3A 3ZGIA 4IHOA 3AMKA 4KTEL 4PLJC 1NCBL 3L5HA 2YPVL 2Y26A 3GC3A 1RUNA 3MV7B 5EU5A 4GXUM 2RMU3 2MW2B 3VA2C 3FB6B 4G9FE 2IW5A 3F7RA 1IC0A 5DMGC 3WHUA 1Q8OA 4AVVA 1ZGLP 5ABJC 4HUUA 4N8MA 1OPMA 5EJ3A 4TQ8A 1VMGA 3EXJA 2CK0L 3HI5H 3KE0A 4PUBH 1Z1WA 3GBFA 4W65A 2V8LA 1IPJA 1USQA 4K9EH 3IN2A 4D9LL 1ND2A 1T80A 3EJZD 1PX3A 4GQRA 4KXZI 5DO2D 3ABMB 4P0DA 4L2LA 4OI1A 5D5PA 4DP8X 5AEAA 5AL8A 2ZYIA 2ADQB 5C3IA 2I2SA 1RZ8B 4PJIE 1HWHB 3UO2A 3MRLA 3SPHA 2K1EA 1CGUA 3ARUA 5FDWB 3NJYA 4MHRA 2XBO1 4NM8H 2YUZA 3OW2U 3VZLA 3K08A 3CWBH 4ADGA 1QBML 1I5YA 4JDZB 4HG4K 3DK2A 1WAAE 4HK3N 4QGTA 5FGBC 1A9VA 3SY0A 1MQTC 1P7QB 5IQ9B 4MGIE 3U4EA 2I32A 3U7YL 5FWJA 1EPFA 4GAGH 4NJ9L 1N36O 2ZJSH 2MCMA 1KG0B 5IK5A 4L4TE 2E27H 4JB9L 3TCLB 2JGUA 5E8PB 3FZ3A 2WXNA 4HK9A 3ZN0A 5HGBB 4LO4B 4YNIA 4JRLA 4R9CA 4R26L 5D6CA 4N8CL 1CT8B 2E7LA 3R05A 2OL3L 4UV4L 3CLFH 1YSCA 4R3SB 2D93A 3H8OA 4L3CB 4L1HA 4G72B 5HHQA 1G6RB 3TFKC 3BKZA 2AQ1A 3B2DC 2OMYA 1DQTA 5T33H 4HX1B 1CS6A 3M86A 4NLAA 4TNFA 4Y9EA 1SBDA 4ZUUA 3SDAC 1KACB 2XU9A 3SD2A 3CFIC 2V9QA 3QYCA 3MF9A 1GMEA 2G4GA 4J8RB 4POZD 4AGLA 1WZKA 1N4XH 3P40A 3USUA 3NV3A 3MLJA 5FHAL 3CK0H 5BV6A 3FAVB 3RZJA 2G3NA 4PJ9B 4YSDA 3TZVC 4NQXA 3RJQB 2NXZD 5BMFL 2PHDA 1YYCA 4KKCC 4PLJD 1N36B 1DZQA 5IROA 1S0FA 1LTXA 3J81N 1NCQC 4GRWE 3RY4A 4C8DA 1F58H 4WO4B 3H2WA 4W6XB 4NS0A 4LLDB 2OL3B 4QOKA 3SMHA 3KF5A 3H3PH 4W93A 1RINA 1ZLSH 3UBGA 3WUWA 4FTEA 2BBVA 3H9YA 2OW6A 1OXCA 3J4UH 1NPJA 3NJXA 5DD0H 3TEYA 4IGGA 4HS3A 4YDLC 4X6CE 5I1LB 4H55A 1JK8B 4HUUB 3ULUF 2BSRA 1H0DB 3CN0A 3ZYBA 4NHUB 2ADDA 1A6ZB 3X2QB 2BVVA 3NQKA 3NNLA 4N0UE 2VGDA 1W80A 1WCUA 1UOGA 4TSFG 1JGUH 2YD0A 4HC1L 3F2ZA 2AK1L 5C4WC 1XEQA 3A22A 3T71A 3W37A 1OSPH 2AJZB 5DAVA 3PJLA 2B14A 4M56A 1PD6A 2PY5A 2JJSA 1JRHH 3HAEH 4IGBB 2NM1A 1EZVX 1ZBE3 1E7VA 2PYLA 1IKFH 3Q5TA 5FYLD 3CO2A 3LIHA 1MREH 1YHPA 2YN5A 3FULA 4OT1L 2VDNH 1CTMA 5B3SC 1NH2B 2QEXV 1R3KB 1K42A 2OTUA 4Q4IA 2NYYA 2FATH 1ROCA 5JQHC 1S0EA 2X4UB 3BVTA 1BQHG 2UXDB 4OZGB 5AVYB 2XBZA 4A4AA 1GP4A 2BOJA 1UUNA 3UTSE 4MSWB 5A32B 1VBD1 3MRPB 2ADGA 2ZG3A 4NQDA 1HRV1 4PH8A 4R9BA 2CJ3A 1NCAH 1N67A 4OZHA 1L0YA 5JXAL 2CL2A 3LDEA 4HF5H 3QRBA 4OX9O 4AW7A 1CE1H 4PM1A 2BOCC 2GHYA 4JFFE 1WFTA 1WYJA 4KHPB 5KG9B 1C8QA 2B1HH 5CAYB 4YG6A 4DOHB 2V0AA 2PCFB 3LA2A 3DRQA 4K71B 2F5AH 3TN93 4LF7B 3CRAA 3CG8A 1QQDB 3OHXC 4TUOA 4AHXA 2K3HA 4ZPTA 4S2GA 3CIHA 2WUCH 3VG9C 4C4BA 1B04A 4OJYA 1G86A 5H2BB 1N8OE 1PVHA 3O4OB 1C5BH 2JJ2G 1JN6B 1XXNA 3PQYD 5DZPA 5IHZA 1KTBA 1QJFA 3MBWA 5IWLC 5AUMB 3CSTA 4F9LA 2P3KA 5J3UA 3RYFA 2VAJA 2ZINA 1B2WL 5DT1L 1W59A 5IHZB 2W88A 3C12A 4DK6A 1CXFA 4AMXA 3IAYA 3TBDA 2QPFA 3QUGA 4KKLD 4OCXL 1AC6A 1AO7E 2C9UA 3LKSA 3WFZA 1N1SA 3CHOA 4A6OA 3UEQA 2KBGA 4JJOA 4OMCA 3ETDA 2JELH 5JHDE 3UO1L 1LEDA 4QX3A 3BZEB 3TN91 1VACA 4RIRA 3IMUA 2NOYA 3E2HB 1KTJA 5AAMC 3QAQA 1NTKH 3O0LA 3QFDA 1XIWC 3OPZH 3UTZB 2R2EA 2WCGA 3UBXI 2WSUA 4E4EA 4ZI7B 3ARQA 1D4VB 5GRUH 4B3MO 3F65A 3ZMTA 2B39A 2HFGL 1IM9D 2WKGA 4X6DF 5BZWB 3VXNA 3EYOA 2JKTM 4O2BA 3B40A 1NCDL 2XWJA 1JAEA 2NY2C 3KYOA 4MS8D 1KNOA 1BMZA 3BN3B 5MEND 1CWPA 1UCBH 2MQCA 5LRRA 3P77B 2HG5B 4PW9A 4KWLA 4ZY9A 1FE8L 5L8LB 1GOFA 5F3BA 2NPIA 3F7QA 1RUJ3 2RJLA 3NP3A 4XBNA 1CAVB 5FW6A 1R3JB 1HZHH 1QWNA 2FNWA 3UPRB 3CQFA 3DURA 4QX5A 4KDWA 5CBFA 3NFNB 4UCFA 1WWYA 5E4AA 4UTBA 4CPBD 3FLRA 4Y22B 1PZSA 2YFZA 2H47C 4A2HA 3CJHB 2CLRA 5BNPA 4TSAH 2CDGA 3ECBA 5FY4A 5CKQA 2Y1YA 2C7UA 3JTTA 3QZNA 3FQWB 5JQGA 1A1OA 4XXDA 3MCLL 2BY3A 4TVPL 5JDJA 4KTEH 4BMEA 2IWGA 1UWEH 3OGCA 3CSFA 4IKKA 4IE7A 5EWIH 4ZNEA 2FB4L 3IXAB 4IT5A 2GDFA 1VSCA 1DLFL 3OKNB 1SJEB 4NXSA 5IVCA 1OLME 3TBYB 3KWUA 3KPOA 5IQNA 3JAWA 3RTQB 1L3NA 3LD8C 3R4DB 5D70L 2IXHA 3ZXGA 4YGVB 4KJQC 4TLGA 1A9BA 4GG6A 2FWUA 1KN4L 5LRSA 1MVEA 2GT9A 4H8HA 1AZDA 2FJGB 3N85L 2SLIA 5TE6L 2WA3A 3Q48A 2R9HC 4UW4A 3SO3B 4KPHL 4DVRH 1J59A 3HNTL 4DHLA 1RJZA 4YH6A 3I3QA 3S7EA 3MD0A 4L1BA 5GGSY 5I8KL 5TDNA 1NYWA 1JG9A 1W0VA 3N3EA 5C0AA 2J8UE 1E4KA 4B08A 4A3ZA 3ESUF 4QQPA 4L8BB 5D72L 3DHJA 4I9QA 4NBZB 3L72H 5DZFA 4JDTH 3I84A 1GYUA 3FUDA 4XUNA 5KXCA 5HHPA 3US9A 1MACA 2OMZB 5CB4A 4QRRE 5E6RB 2WLPA 2EZ0D 2HWZL 3RZWA 3RJ2X 4FPGA 4B60A 5FM5O 1S5IL 4Z7NB 1JGDB 1HKLL 5D7JD 5JQGB 3D33A 4A38A 3T1FA 3RWCB 3OCPA 2QDRA 4ODSL 1DLLA 1UZZA 1ZS2A 4UM9D 2YGNA 3ARFD 1QBMH 2AMUA 3EUUA 2ZD0A 3WD5A 5IV2A 3ZMRA 1GNYA 2WLLB 2G9HA 2ZWNA 3KYNB 2NYZA 2VN5A 2BSED 1AJ7H 3LKNB 1L6PA 2D7TL 2VGLM 2PTTB 3KPSD 3KPRE 4AKOA 1JXGA 4H7VA 4HGMA 4B5EA 3JD73 3EGSA 3SJVA 2WSSG 1GYVA 1ZLEA 1S7WB 3HZ3A 2OK0H 2P52A 2VDNB 4CDGC 4QHOA 3GI8H 3PL6D 2AVGA 1I9IL 2ZJCA 4N8CH 3N2JA 5T5JA 3VGAB 1MJUL 1XH3B 3RPIB 3Q7JA 4LSSH 4P46A 1VKXB 1SLLA 2YAHA 4NPRA 1N59A 1QA9B 2JK5A 3QISA 1YXBA 5B38A 1RZGB 2WIIA 1D2DA 1MVQA 3WG7B 2MHAA 1NCQB 2OXGA 2PHWA 4LLUB 5GHWH 2Z4QA 2X4TA 3EAKA 2CMRL 2E7HA 2DI8A 3WNOA 2HRPL 5DHDA 3PPSA 4CP9A 1G0DA 1NGXA 1YEEL 3D2TA 4EBQH 2XX1A 2WXLA 5DUML 4YS4A 1WS8A 5IHHA 2EILC 1BFVH 4JAMB 4KKAC 4GT1A 5DWPA 1KECA 5GGUB 2P4EA 4KUZH 4DEUA 2Q2LA 2CHDA 4XO3A 3I9AA 3SITA 1KELL 2WLNA 4WUKL 3BUPA 3RWIA 4FZEH 1OAZL 3DJSA 2ZNIA 3CSYB 4E2OA 4LBKA 4LULA 2AXWA 2CQVA 4BXFA 5A40E 3QULB 4BM8A 5C71A 2R30A 2J4WL 4EUPB 1U21A 4PJFA 5I9QC 1GR3A 5F8PA 3RY5A 1D3CA 2YPKA 5HHMB 4XP5H 1Y7BA 3G5ZA 4J3OD 3HPJA 2EXIA 3R7RA 1EEZB 2BVUA 4J10A 4JHBA 4LCYA 1A4BA 1J0HA 5C7XL 3LKRB 1IG3A 2DW4A 2K9PA 4UTCA 5LBSH 3RB7A 1X9TA 3MJ7A 4DAGH 4FAHA 4YBQD 4ITCA 2FJUB 1P2CA 4A7SA 2CGNA 2F58L 1P1ZB 2IU0A 2AITA 1UB5A 3WB1A 3FT3B 2WS93 1PM4A 2EXHA 3VFUA 4UTBL 2DQEH 4NZUL 1R3IC 2PMZA 1C08A 1ED3A 2F54E 1VKXA 1J1PL 4HUMB 3B7UX 4A6YA 4GKJO 3P9WB 2XWTA 4JRXE 5ECJE 5F93C 4HCRA 1GQPA 2O14A 2ZGRA 4GQ9L 2EE9A 1BX2A 2O4EA 2VERN 2UYLA 4O9EA 3O4LA 4XE0A 1YXWA 3IAQA 1SLBA 4NN5B 3V0HA 5LOVA 4PRID 3D25B 4W9CC 1GNZA 4AEDB 3GJEA 5CLZA 4PIYA 1CDJA 2HT3C 1NJ9B 1XSQA 5C0BB 3VH8B 1KC5H 1MOEA 4GH7B 1NAKL 4RGND 2ZWKA 3LDBC 2XDVA 3ABMC 5I0UA 5AB9A 4LF8B 3WN5A 1EUUA 3AG3B 1BM3H 1YC61 4KTGA 3L2HA 4HAGA 1PX8A 3L9DA 3CCVV 2CR3A 3ZHLA 5FZCA 1Z0HA 1E5UI 5CLYA 3FTGA 2F6BA 4XDPA 1MRFL 3ASWA 3R65A 2KQNA 3POBA 3SH4A 1YPZE 1DUZB 2X4RB 3V7AE 4HG4J 5FZ3A 1AB3A 1RSYA 3G5ZB 4HP5A 4XCEA 3T1YB 2LABA 3H9SB 4NFBA 3WS3A 5J6GB 3SKVA 4H33A 3RG0A 3ALWA 2QWPB 3G5XA 1EIBA 4L8BA 3PY9A 1Q9LA 4G9FD 2WO2A 4OLXH 4OQTL 1JGVL 3B9CA 4OI2A 5DT1H 4CDWC 2EDEA 3U1XA 3H2QA 5JJNB 5ICYB 1AHWB 4AI9A 4ZOEA 4PREA 3W1ZA 3KM5A 1NLBH 1LRHA 4X7TB 4I4WB 4Y8DC 2N56A 3QT2A 4IJTA 1AR92 2E7DA 4MCZB 1BZ9A 1TVHB 4ZK8A 3ZDYE 1OFNA 4M8QB 4QUOA 3LA3A 1F42A 2W60B 2CRZA 2GTWB 1BGYH 1FORL 3BJLA 5E4EB 2OQJA 4CXYA 1RUD1 1JZDC 3NRUA 1YMHA 4CZSA 2ODIA 2DD8H 2NY2B 1JF6A 4N8UA 1B4JH 1CF8L 5CSZA 4JF3A 4L8CA 3L7EA 3T4AC 1WGPA 4J4PD 3TTSA 4UF0B 4OUMA 1KYOF 2DWSA 3IKCB 4B7KA 5KA5A 4AQOA 1VEPA 4S10A 1RL3A 5C8YB 1N19A 3DXAD 3PLQA 5I8YA 4F2FA 2DH3A 5F3HB 5AW8B 5BVJB 2XUEA 4QHZA 2W5FA 4P49A 4CKVX 3CSXA 2ZGQA 4U7SA 4LVOC 3Q05A 4P9JA 5DEJA 3V4PH 4GMP0 1R3IH 1OCRC 1O6SB 4XMPL 3SE9L 4KXAA 1LOFC 4F8PA 2I26N 4HMEA 3CIAA 3V4LA 3ZFEC 4D7YA 2CLRB 5J1SC 1NVPD 3SKNB 1QXRA 4XFFA 3SBQA 1W2AX 1XGRB 3D85A 4ORZC 4MTGA 3SE8H 1B35B 2Y69B 4CAGA 2WZR2 1UXSB 4JM2F 3C09B 1W9FA 4Y1YA 2A6XA 2J6EL 2CHNA 4DIXA 3TK1A 4U7OA 1L7IL 1V3KA 3V64A 4U1HA 4AX3A 1XGZA 2OXHA 2L6LA 1SQGA 1IBLB 3D50A 4H5SB 3B7YA 3K2MC 3URFA 4NQUA 5E9NA 1EFQA 2J2ZB 3OHXB 4P57B 4BZ2L 5JXEC 1KNOB 4PS4H 2DWXA 1ZA6A 2EEAA 1HSBB 3N1QC 2LU3A 5F89B 3RIFF 1T1WA 4U1KB 3VXNB 5FY5A 2W91A 4E4SA 1VBB1 3EYFB 1KFGA 1OGAD 1QNMA 3PWPD 1UXLA 5FA3B 3GXUA 3T3YA 4PJGE 2MEJB 1RJZB 3VZNA 2IAMD 2FECL 4ODHH 1W6OA 2QZ3A 1F86A 2BOBA 3V6FA 4U1LA 3RWGA 3QQDA 5ITBL 5IATA 5JCOC 1NS1A 4MAYB 3QUYC 4M6ML 1QHDA 5CD3A 3PNAA 2CO6A 2DMKA 3IYLW 4Q0XL 5DTFB 5ENWA 3VYPA 4TKWA 1WBZA 2BSEA 2ZHNA 5GZEA 3VM7A 1OARH 43CAB 2B59A 4BZ4A 3QG6B 3MICA 2CDFB 3PWPB 3K80A 3IM0A 4LO5B 2AZ5A 2RCSH 4JPVL 1BXXA 1UB6A 5EN2B 3QFJD 4H26A 3V4UL 5BNOA 3DC6A 1IGTB 3IXTB 3QW9A 3VDCA 4D0BA 1V8HA 5DFWH 4L18A 1BKZA 4JDVA 3OBZA 2KMWA 1OZUA 1POV3 4FXLA 1JGLH 4MZRA 3VBBA 2RHEA 4DH2A 2XVLA 2TEPA 1WUNT 3NIDE 3KPQB 1QPPA 4P5TD 4WWNA 5FYTA 1DQMH 3EFFA 2IWFA 2D31A 5IB4A 3MA9L 3UL4A 4BA8A 4GQZA 3IK2A 3TBVA 4JANB 5ICZA 1MW1A 4GSUA 1J1XL 1MZYA 3HPLA 5E9DE 2VW7A 5LGHH 1UYPA 3IGAC 3RRDA 1AJ7L 2VRZA 1H5BA 1KGIA 4WY7L 1MQTB 1IPSA 3CDYA 1ASQA 2Y6SC 2DQHH 3N1PC 3VFSB 2EE3A 5AAWA 1UT2A 5E2TL 1TCRB 2Y3NA 3GZPA 4DO2A 4JFPA 1SEBA 4K3UA 3MGUA 5L2JB 4MLIA 5E6UB 2YDEA 5JLZA 1YNTB 4RS5B 3QUXB 3SDYH 1NDGB 2BW5A 1CCZA 2OYZA 2IXQB 1I75A 4GG8B 5JHDB 1R092 1EN4A 3JD3A 1PJWA 2ZOTA 4MQ7B 1GAFL 2B15A 2WYFA 5KXEA 1O3QA 4LDOB 2FEEL 2NNFA 3FFCE 4NCDA 5DHEA 3P02A 4ONFH 4GZ9A 3C6SA 4TLTA 3GSOB 4FXKA 4ZMXA 4XETA 3M45A 5B1BC 1G4RA 2XJPA 4LLAA 1ORSB 1RZ7L 3II1A 4C56D 2CA4A 2PHXA 3TT3H 4AQZA 2UXGA 5CEXB 3SDXF 5F2FA 3DUUA 2YJLA 3N6YA 5FYHA 1JYTA 1R73A 2EUVA 5EU6A 1EBOA 2E4FA 1KTDB 5D7IE 4G7RB 2ZJSL 1CDHA 4LL9A 2AHIA 3NV2A 4M1CD 3K3QA 2VB5A 3ZHNA 3T4ZA 4ACTA 2X4RA 2J44A 4DZBB 1Y9MA 4EBQL 4XO4A 1QFWH 4L3FA 3ZL4L 3C5JB 3T4HB 4A5UB 2B9ZA 2OM5A 3RUGB 1POV1 1FIGL 4X4KA 2X89D 2V7HA 2YY1A 4XP6L 4BSWB 1RZGA 2WIIB 4WWKD 2ZXGA 2F54B 3E8HA 1AR1D 3QUXA 4KUCD 3M4FA 4RMSA 5B22A 3D25A 1I9EA 4YXLL 4NOFA 5AD0A 1WA8B 1YIPA 4WWKC 2DTMH 2BP3A 1OV9A 4UCOA 4UAOC 3B5LB 2QADD 5HYEA 5KR7A 3DSQA 4KGLA 1BAFL 3FFOA 3DARA 1GGUA 3EFDL 3K5SA 1AGEB 4Y4HD 5GGTL 4HU2A 2EDBA 3MJGX 3NACH 2RR3A 4U31A 1WD3A 1SUHA 3J7MA 2JKRM 4QHUB 2APXA 5FO9B 1TZGH 5DEGB 2ZOEB 3MNVB 4HDIB 2FB5A 1PZ2A 3KPQA 2CNYA 4MXWL 5HCFA 2YAQA 3ZN5A 4FLXA 3QACA 3MRFA 3LDCA 2X70B 4ZUTA 5KSUB 5GZFA 3PUIA 1QNZH 3L75H 1PD1A 3QYNA 1QJX2 3UAEA 2QQJA 1IAKB 3OXSA 4KJYA 3VV1A 2VULA 3SDDD 5EF0A 1MJ8L 4JI4B 1OE3A 3RWDB 2IIJA 1MWAH 4AGNA 4BAYA 3SGDH 5HTSA 2PR4H 5EA0H 4UM9B 1NQJA 5EIYB 4PGJA 3QUKA 2DJVA 5HGAA 3GRGA 4RA3A 5GGUA 4BKLA 4O2AA 1R5VA 5HPMB 4BQYA 1CD8A 1XB8A 4FFBB 5GZNA 1XF3A 4YBQC 3MI6A 1QVOB 3OSKA 3OSVA 3QHTC 4XMLH 4AI0A 1SOKA 4YEEA 3K3NA 1OM3H 1JUFA 5F6IC 3H1YA 2GB2A 4JPWH 4J3OC 6CGTA 4GAFB 4OT1H 1UZ8A 1FXKB 1ZLWK 4M0NA 1PAMA 1Z5VA 1NE6A 3CDCA 3CB2A 4HOMA 4BIZA 1Q9WB 2LW7A 1KT2B 4RAHA 2ORXA 4EJ1C 1XCXA 3MFFB 1ZXQA 4X5XB 2DCJA 3F6IA 4BYHA 1Y18A 3GSRB 5I5RA 3VKNA 3ARBD 2WJSA 1SXZA 2G1MA 3RZGA 3ZE1F 2H1PL 3ECWA 2BERA 1PKQB 1TZIA 2J8UB 3A6CH 5IQLA 4RWYL 1W3XA 2HP4A 1QF3A 3PL0A 3ULSA 2P6HA 1IKOP 2UXCO 4L87A 3JD4A 1ACYL 2VXQA 3QAZC 1HJFA 4CILA 2JWYA 4QYOB 4I7ZB 4GKKB 4LE3A 3EO0A 4DUZO 2OPCA 1OQEA 3D08A 5KYYB 5HJGA 1PU0A 1J1OH 4Y7OC 4UU9B 5KVFE 3MXVH 4B7IA 2XLAA 1LULA 3I2IA 4N9GA 5I18L 2P8PB 4BCXA 2P48B 1ZIAA 3QEHB 1EAPB 3UACA 2QMKA 1SXCA 1EAOA 2BSTA 1V6NA 2DLEA 3F12B 1VBB3 1VPHA 4PV8B 3RLSA 1LYQA 4ANUA 5BRZB 2ZYRA 1Q9OB 2R9RB 5C9JA 4B4RA 1MFAH 2KZ1B 3O1RA 3C5JA 3L9YA 5JXED 4F57H 4WFAV 3H6JA 2EKSB 4O4LA 3ETBJ 2HJIA 4NRPA 4MGZE 5C9KA 2BX5A 5H2FZ 2FX7H 3O45A 1P4LA 1X59A 1AR73 1WIUA 3W5NA 2LLNA 2HFEC 1JHLL 4R96B 1KJ2H 4NSKB 3RTQD 2FNBA 3DX3A 4LSVL 4FXGC 1DQLL 1SJEA 2C3HA 3ECVA 4LZKA 2E74C 3RWDA 3LSDA 1S77D 4YC2C 2ZAHA 4UTAH 1IKNC 4Z3EA 3QORC 1YEFL 4OHXA 1DBAL 1UM5L 4QY8B 3ZDZF 1P6FA 1G7HA 4ZI8A 5A3IC 1S76D 2GG1A 4GA9A 4LF4B 5GONB 1O7SA 1W0JG 1T7WA 4P4KA 4DUZB 4ZS2A 3BVDB 1ZXKA 4AR2A 3AFLA 1EJOH 3CSBA 5IFJB 2X28A 1ZREA 2ZOKA 4MA8L 3QCUH 2PCFA 3HMWL 5FCSH 2VJXA 2N59A 2QELA 5SV5A 2CIKB 2VDMB 3EXAA 2YWYA 4Y4KD 2W8CA 3V4UH 4LEOA 5JOPE 1QPXA 3N7KA 2DYCA 4BDVA 4GW1B 1X9UA 1FVDB 2V5TA 1H15B 5D4JA 1VRH1 3D3QA 5D7IA 2HH9A 1YEJL 1DQDL 1NA1C 1ZV2A 1S4IA 4P46C 4UILH 2OCCB 1PPJH 2TUNA 3T0EA 3G67A 3HZMB 5IB1A 3ZE2E 5F3EA 3B7RL 4WSJA 5CLTA 4QWWD 2BDNH 4JY4B 3TNPB 3W9AA 4L4TA 2NY1D 5T5NG 4AIZA 1VEMA 4IRJA 3GUFA 2YGMA 3WSQH 1FVEA 3K59A 5HHME 2DWEA 3W39A 4XRCB 4BFGA 5IUQA 2G4IA 5J9PB 3FQNA 1RKRA 3QDMD 1INEH 2K2SA 3O14A 4A7VA 1WZAA 4A55A 3NJLA 2BNMA 4O4JB 1MFDL 3PP3K 1L9MA 5E2TH 3ZO0A 3MW3A 4DVRL 3HPJB 2BRRL 4HXAH 3Q2CA 1K9MW 5EU6D 3ULUD 2B45X 3QUXC 2VR9A 2BU9A 4YDKL 5FOBA 3TT3L 4CN6A 2TAAA 3QFGA 1KBBA 1CL7L 2ZUSA 2EAAA 2JXAA 3CC5A 1SYSA 4QT6A 3ZYJB 2VLJB 1S0GA 5FBJA 2CGPA 2PWDA 4RRPA 3KS0J 1I1FA 1EV13 5C0GB 3CLEL 2MTPA 3AY2A 4K94L 3LDRA 4XDOA 2PYEB 1MS3A 1DO5A 4F6RA 3O2VH 1T66D 1MCJA 2ZXDA 4R8CA 1ODAA 2FYYA 1FYUA 1T21A 4QNPF 4PIXA 3O1TA 3MLZL 3ARED 3INAA 5DN2A 1NLRA 4QWNA 2GJZA 2ZOLB 1PMYA 3G08B 5JHDA 5C3LD 2R0LH 4XJAA 3P5BA 3ZFGA 4AM0B 1HV1A 1VQMV 1LO0L 4PD4J 3LSUA 3LUTB 2VO5A 4NB5A 3F7YA 5K39B 3X14A 4CBPA 3KCWA 4Q4V2 4FXKC 4XVOA 5GS1B 6FABH 1WA4A 1XGQB 4XNQA 1QFWL 4OCRH 2ICWA 5IHRA 3KDMA 3V6ZA 3ULUH 1CZVA 3LN4A 5A6QA 1KB9K 5LK5A 1YDPB 4HX1A 5EULV 1YIFA 2PQQA 3RQ0A 2EXYD 1SQBH 4HS6A 4MDJB 2XNAA 2C1PB 2JNZA 1XBFA 1G7PB 1LNUA 3QSKB 1KS4A 5CBAA 2OUHA 4XFBA 1YN7A 3QPKA 4G1MB 4QRRB 4JI7B 2H32B 2HLFD 4ZXBC 5J12C 2ZX6A 4LU5H 3U30C 5CBAB 1NLQA 2WVSA 2YGLA 4HYTB 5FYBA 2K9UA 1POQA 4RHV3 2EIMC 1D5NA 1O6TA 4FLZA 3FYIB 2AV7A 4ZMTA 1OA3A 1UM6H 3IGAA 2FR4B 2WB7A 1ZRDA 2BWIA 7FABL 3TCLA 1KQSU 1M6OA 4EXPX 2JDZA 1C7TA 4KI5F 3AZVA 1IGTA 1Q90D 3OD3A 3GS4A 2HLAB 5EZOH 5F9JA 2VLKA 4TULH 3TJEL 2EVFA 2Q1ZB 2W5PA 3VA6A 4X8AA 3D2UB 3PF2A 2AC0A 1JXNA 3G08A 3KYKH 1QLFB 1QSZA 1F41A 3K6SB 1NEZG 2IALB 1UH4A 4R8WL 4DW0A 3RA7H 4B9JA 2IPUG 4APQD 4C55A 5M95B 1T1YB 1I85A 3Q9PA 4S1SH 1ZRUA 4JYAB 2MK3A 4TV9B 3GMRB 4Q9CA 1MZFA 4LC1A 4WGVB 1EAQA 3OZ9L 2JD4A 1VBB2 2PW2A 2BVOA 3BH4A 1MHCA 2FJHA 3MOAL 4LSUL 4UTBH 3HC0A 1HNXO 3Q01A 3GUTA 3USUB 4OD3H 1NKRA 1JHKH 3HN5A 3QUYA 4JO5A 4HPOH 5ILTH 4P5KA 3G6AB 4YZ4A 5DUUA 1DQJA 3BEVA 2JJTA 4FYTA 3BI9X 3TO2A 2IWGB 1ZOXA 5F5CA 3OXSB 3MV7A 1Q38A 3DPDA 3IFNH 1UD3A 2VQ1B 4YHPA 1NIEA 5AKVA 5EU5B 3TA3C 3L5XH 1CZTA 4UOW0 3QJSB 4CNIB 3MV8D 1G84A 3QEUB 4OD1L 4YDMA 5F9WB 1KEGL 1B35A 4JHAH 1H6EA 3W2DL 2XJTA 2HWE3 3IJSA 4AT6A 2WCSA 1BZOA 3A6OA 4AI7A 4ZQTA 1MW0A 1WDAA 4R90H 3ARFA 2BPA2 4URTB 3TVMB 2ZT9C 2GK0B 3D52A 5ID0A 2V4LA 2B5UA 3TPUB 2Z3YA 3AZYA 3HWJA 1H19A 3CWGA 1FFXA 4YIOA 4ZMZA 2IGLA 4MA3B 4N8PA 2AUYA 2DQ6A 1NOLA 5C0BD 2CDPA 3QORA 5E9DD 2R042 4CE8A 1O91A 1N70A 2B7YA 1DFBL 2W9DH 5GS1A 4MGQA 5CU5A 3VFMB 4LHUD 4PRIB 3GIVB 1PNCA 2PWHA 5JIAA 5DI8A 2VTXJ 1BEYL 5DU7A 3H4HA 4GW4A 4Y4KB 2KC0A 1A4CA 4UCRA 3EUDA 5F21B 3K4ZA 1FAKT 5I19H 1GCYA 1PZUB 1ITBB 3FF8A 1LVEA 4K0KB 5GGRA 1AO7B 1KBVA 2RDQA 2FHBA 2FJFA 4AI8A 1ACCA 1UD4A 5F0MB 1GCFA 2FH6A 2FLRT 1E42A 4PW4A 5EUOB 5EZIH 1E5SA 1Q8SA 1IAOA 2AK4B 2HB0A 5EB9A 2VUKA 3FS9A 3ZSEA 5DJ0B 4Q4W3 1SLCA 4QKDA 2VWKA 4JPKH 4MVMA 4V1DE 5G55A 4OM0L 1M7DB 3MV9A 4CSZA 3VG0H 4AGPA 1IIKA 1PD0A 3UGGA 4GINA 4F7PA 2NZ1A 4WKZB 1DQ5A 3C8XA 2ICEC 1HHHB 3IAPA 4JQIA 2E5LO 3PUHA 3CCHB 1Q7YW 2OQ6A 4HFWA 1EJOL 5CWSA 4XUTA 1I5XA 2QDVA 3IRZA 2VZQA 2C1OA 3OX8A 1NCQA 5IMLA 3E2HC 3W59A 1WZ1L 1FMD3 3VRIB 1GJWA 2WXOA 3TXAA 4LBEB 2WD0A 4DR5O 4OIFA 1UM5H 1ZT7A 1I8KA 2Q87A 3TZVA 2BNQA 2VD7A 2MOVA 5KYXA 1NMBH 4AYGA 3WI9A 5DMJB 5BS0D 5EUOF 3UTTA 2QEJA 2NR6A 5DD5L 4CJ0A 1Y43B 4RMWA 5JW5A 2CSPA 3REVB 4PDWA 1VP7A 4Z3HA 1ZSDA 2H0VA 5BRZE 1BV8A 2CUHA 4X4XB 4WV8A 1DN0B 1ZK5A 3QVNA 4ICGA 1DL7H 1V10A 2EDRA 4K5LA 1JTZX 1XR8B 1NEZB 4QLRA 1OSEA 1PL0A 4AE1A 2C9XA 1Q3EA 4JRYE 3KH4A 3LS5L 4FP8H 4HGWB 2E74B 1Q1JL 2VTFA 3B5TA 4NKOB 5DFAA 4GD4A 5BY1A 3HKFA 4NP4L 3T65A 1XF2B 2UUBO 4WI5A 5DZNA 1UGNA 2ZUUA 2X2JA 1JN2P 3NQIA 4RDQG 1OQDA 3EADA 5A6XA 3RUGE 2VW4A 2O72A 1UY3A 4WUUD 3RPKA 5T5FL 2AXFB 3HT2A 4Z3FA 5FUOH 3N7LA 1R75A 3E6FA 1GLHA 4NQVB 2H3NA 4YXKH 3GS7A 3V0WH 3D69A 1DG6A 1S7RA 1W0VB 3O6KH 2QGBA 5C0AB 1XH1A 5EEVA 5D2LF 1N6QH 1JODA 4O4LB 4D69A 4NERA 3P4NA 4K94H 4BE5A 3C5ZA 1FJ1A 4DXTA 4W6XA 4WGWB 4NAMA 4X8CA 3D7PA 5E4IA 5H37H 3UDWC 3ML0A 3JWNE 3RURA 4R26H 3LDKA 4AVSA 1QU7A 1WC7A 3JWNC 3U2IA 4O2AB 1R5VB 2QWNB 2BZDA 3FZUD 5FYJU 5C0EB 5HPMA 3OR6A 4BWOA 4N21A 5FOJA 3EB7A 1FQ9C 3JAWB 4YXHL 3B2PA 4NC2B 1NFDB 3NNMA 1F90L 2HKOA 3HE7A 1OF2A 5D2NC 1Q0XH 4H8WH 4ZO7A 5DUBA 4AQAA 5FQ0A 4TUYA 1W9XA 5J9PC 3ABZA 4MMZA 3U1PA 3D4ZA 1TCMA 2VITB 1M93A 3GWKC 4WBNB 4V33A 2PTTA 1MY7A 4UV7L 2DQJH 1N1VA 4YXWG 3KJ4C 4P2RB 2X70A 4XQWA 4PRHE 1CDIA 2KERA 4JFZL 4PYGA 4YSOA 3P0GB 3H7JA 4FT8A 1MG2C 3CJHA 2JCWA 5BNPB 1T5EA 5CZXC 2HTLD 2JSFA 1L9PA 2X6CA 3IKKA 3WE1A 1KXGA 2DUQA 2RJZA 4IIQB 4I0PD 1T4WA 2A4CA 1TUBA 2VXQH 1AI5A 1JR9A 4MXWB 5FZ8A 3VQYA 4JVWA 4KX7A 4KG8A 3ULUL 3KHCA 3O9WB 2P80A 3NIDB 3CXHJ 2OMZA 2YD7A 3R7QA 1PIV1 5FTTC 4CUGA 2XN1A 4NN7B 2EZPA 4IEVA 2ITDA 3BTXA 2AQSA 3J80N 1ES0A 1C1LA 2WR9A 1QYGL 3RU8L 4JHUA 2P47B 2V4AA 1AGCA 1MXGA 1GC1H 4OZHF 4QKXB 2E31A 2HWB1 5TF1H 1JS9A 2AEQH 2EIBA 1T22B 1NAMH 2AJ3A 4N68A 2YI8A 1HT6A 3VBOC 1Q9KA 4FLVA 5FYKH 4M5ZH 3TEZA 3TOPA 4UQ2A 1QJEA 4CCLA 1EHKB 2HA1A 3OB8A 3QIUD 2GT9B 3ZE0F 1XSJA 3PGCB 3QJOA 3E9UA 5DQJB 5EC1B 5HVFB 1QJU3 3TPKA 5CNAA 1IAII 1KIQB 1W6PA 3G7TA 3VD9A 4LKCA 1HJBC 1AYM1 3LFMA 5KWRA 2XPZA 4JM0A 4IOFD 3NZUA 1JZ2A 3W58A 4AEIH 1JK9B 2Y5EA 1JZJA 2OLDA 2Q8BH 4YXLH 1M1KW 5FMCA 2DS4A 1HC1A 5CN2A 5DD6A 5F44A 1Z32X 2JB5H 2FR4A 1RUE3 3N06B 5F1RA 1SMDA 1E43A 2NY2D 1Q1PA 2WK2A 4MS8C 4QI3A 5AG2A 2P9RA 5I76B 3LD8A 2XQXA 2YJQA 2G3XA 4LLQB 2WKOA 4WJ5A 2DYPD 1GYKA 1HNWB 2KD7A 4YARA 2GJ6B 3POYA 2WZEA 1WMFA 1FNEA 5ETUA 3AXIA 2UZIL 2VXUH 5JHDD 2FVNA 4H20H 4COVA 5FYKE 1UL9A 1I1YA 3MBEB 2DF3A 4CP1A 4JGJA 4MA7H 4NWTL 4Z0XA 3EOBA 5SV4A 4CVZA 5F3BB 3CZFB 3IU3A 4HWBL 4Y2DC 2C9VA 2C3VB 2DMGA 3N1GC 5D7LB 4MJ5A 5E6ID 5AW0B 4ZUWB 1F15A 3B3IB 3KG2A 4I3RL 4DTGH 4LBQA 4Y5YA 3HS0C 1GZWA 3DHMA 3RIAF 2PYTA 1PNKA 3RJDA 3RW0A 4M3CB 5FYUA 3UJOA 3O6ML 1S3RA 3AT0A 1GA2A 3BXNB 3FB8A 3M1BB 3M7AA 2NY1B 2JVDA 2MIZA 3TX4A 3FB7B 2PR4L 1LO4L 5EA0L 1SZTA 5AVWB 1TQSA 3N04A 2ZDIA 2KQMA 4I48A 2H6UA 2DQIL 3GBGA 1D5IH 1J5OH 3LQCA 3NAAL 4KU8A 3WIHA 4FG0A 4XMAA 3REWA 4KK5C 1IGMH 4HD5A 4J7RA 4RIRB 1ULGA 4GEIA 4L0ZA 3HFMH 4N1HB 3T77A 2CGYA 1P8JA 4LLMA 4PD4K 2NXYC 4J3TA 2ADJB 4QY8A 1J12A 4FLRA 5IWFA 3UAJD 5FPRA 3ZXDA 2IANE 2RA1A 2GH2A 1NICA 4HN1A 4MNQB 4C7UA 4HJGA 1HX6A 1G9DA 1F4XH 4B27A 5ANMA 4W9ZA 5F7NC 1Y4WA 5H2BA 3HKCA 2A7AA 5KA6A 5JOWA 5LK7B 5I66A 2YFOA 2W81C 3IU4H 1UCBL 2FZ3A 4U6HB 3K0WA 1WW6A 3VFVB 3OD0A 1JVLA 4QPGB 1WCBA 5FXZA 3UV9A 3ZSJA 4MJID 1DSYA 5EF2A 1E2ZA 4GQQA 1Q9KB 4OTXH 2NW2A 4TYUA 3WE6B 4Z7OB 1D4M3 1FOD2 2AH2A 1KCKA 2APVA 1N9PA 3MLTB 4PJDB 3A6CL 4UT9L 4F9LC 3BQUC 4MQ7A 2B8MA 4NROA 1QI4A 3MJ8A 4GXUN 4DUWA 1R3LC 1L9QA 4EIZC 2H0PA 2J88H 5E7FA 1AVBA 4PLMA 4IDZA 2AJYH 3QBTB 3JCIA 1XD0A 2A7BA 3KWXA 1HL5A 1ZA4A 1U8IB 2CDOA 4Y4RA 4BH9A 4F33B 4LPTA 1WW4A 1JXKA 4NQSB 3P1IA 4U1SB 1RK0B 3EO0B 1AJPA 4LCUC 1MELA 3NABH 5AB1A 3P6BA 4BPZA 2XQBH 4GMSL 1VCBC 4JFYB 1V55B 1LJMA 1LD9A 3GBNH 4U1IA 5AW9B 4Z2AA 1IBFA 3Q43A 1XGYL 2KDGA 1EV12 4D6QA 4FOQA 5EO0B 1AS7A 3HZKA 3MROA 3JBG1 4L3CA 1KPVB 3TO4A 4XQ4A 2X8KA 2EIGA 1FNEB 5ETUB 3LNGA 4MJ6A 3WNJA 3IETB 5BRQA 3AVRA 1II4E 1RFYA 5M0TA 1A1MA 1OT5A 4PRPB 2P45B 4LF3B 2HWF2 4WBNA 3E22B 3BVNA 2E9IA 1A9EA 2P8MA 3M88A 3J8F2 4XPTH 4CDWA 1FC1A 4RAIA 1UD2A 4P2RD 4NQCB 3G6AA 1CF1A 1Y6XA 1S46A 3TEUA 4IXLA 3B09A 1D6VH 4UMSA 5E6YA 1I5PA 4WEBH 2TBVA 1IG0A 5L7OC 4TSBH 4KNSA 4JRYD 2EXYC 4DV7B 3P30H 4HC1A 43CAA 2J12B 2CXKA 1JNHB 1R5IB 4Z1MG 4KZCA 5HYSA 3U14A 3RVXC 1CFSB 3R0RA 4AHZA 4FQQB 1ZSHA 4ZKTB 2MKLC 4QRRD 4L3EA 3M2MA 1LDPH 3LDBA 4M6NL 1SM3L 1K85A 3K6SA 4YGVA 3VWKA 4YGBA 1G9CA 5FPLA 1W8ZA 4PF1A 1AQDA 3GBML 2WCPA 4NPYB 2XZAL 3MQIA 2WYHA 4JQVC 1NC4B 1HWYA 1HSBA 4PJEE 2G9GA 4ZX5A 4DGYL 3SDCB 2AXFA 5C0AD 3DBXA 2WNUA 5FZ0A 3GZTB 2VDRB 4KJYB 1UX7A 1BYOA 1RIUH 1TEYA 2VLRB 1ZZCA 4Z8BA 4E9LA 1NT0A 1F4AA 2AV7B 4KMTH 3DPBB 2E51A 1RUAL 1A3QA 2VLMD 3OBAA 3WDUA 3P32A 4E41A 2F6AA 2EDTA 3C75A 5CD5C 2BP5M 2C7UB 4XPGH 5T3XE 1VHPA 1R3HB 4X8JB 2OYMA 3BOPA 4Q8BA 2EEXA 3L45A 3MRGA 3WO4B 2YB7A 4U05A 5SWSB 2P8LB 4C1WA 5EC2A 3B94A 3C6LB 3X11B 2FO4B 2YOCA 4N6RB 4F91B 2GDSA 3VD2A 4LP4A 1HEZA 4QRQB 3L3IA 4G8FA 3JWOC 3SDAA 3GHMA 3QIWD 1OOAA 2A3QA 2WBJA 4GKLA 3C7EA 3AP7A 5FO8A 5JNYB 2X05A 3UJJH 3MJ9L 4L97A 3UNPA 1Y66A 5DABA 5J56B 1BFVL 5C0BE 1YTFB 1YQVL 3PWVA 2QR4A 1W0WB 3FH8A 4F92B 2DQUL 3NSYA 4GB9A 3L7EB 2FDJA 3OAAG 1KPUA 4PB9L 3HD8B 4LPLA 3IDGB 2QQUA 2P7TB 5K9QG 1XBLA 1UVQB 1L7QA 4RAVA 1MHPH 1QKZH 5GHWL 3EXLA 1H2NA 4MXVE 5K93A 3ZRFC 1ASJ2 5F88A 4WM8A 5CWSB 3FB7C 3SC7X 3QDMB 3D4YA 3OKMB 5C07E 3AKRA 5IFTA 2XSKA 2EX3A 2VQ4A 4IMLA 5LY2A 3ZN4A 4CCEA 4ZFFB 3BRFA 4HWUA 3DOIA 4H7LA 2OZ4L 1DDHB 4Q0QA 1U0QA 3U48A 1LOEA 3U2SB 3QJTB 1SCRA 3J07A 4Q4Y1 4V2WA 1J8SA 2HKHH 3CLFL 5LP6C 1ZWIB 4GP5B 3RQ3A 1CR9H 4XOCA 4RGNB 4O9HH 3HBZA 4UMGA 4B6ZA 2DQEL 2CBTA 4CMHB 2Q8AL 1X7QA 3M70A 3ZXFA 1U8JB 4GQPH 5DS8A 1J1PH 4JI8O 3FB6A 4YGCA 4PRAA 3C60D 2FHFA 4NOTA 3MFGB 3NKTA 3T77B 4M01A 4ALAL 3B2UC 2GYSA 5FK9A 5KYWB 2GSIB 5IB5A 1WFNA 3FRUB 4XPFL 2K9ZA 4TS6A 3TNNA 3T8XB 4FAGA 4S1DD 1M4WA 3SH3A 5MERB 2DBLL 2YA2A 5CEYA 1IOAA 4WWKA 4YMPA 4Q6GA 1BOGA 3WXPA 3VQXA 4K3EL 5ALCH 5JSRA 1DBMH 5KTEH 3EH4B 4FX5A 2R1WA 4K8RC 3ZE1B 1JBCA 5C09B 3WY6A 3UTTE 5FIXA 4BZ1H 3LRGA 2YBPA 4WV1C 4HSAC 1XH3A 1CAXB 3PQYA 3GPEA 5BUGA 5IBLC 1UM4L 1TCRA 3K0DA 3M7OA 5E5MA 4M7ZB 4W4ZA 4WI2A 4DV5O 2ZGLA 2QDOA 5EIIG 4J2QA 2CWSA 3FRPG 4BDVB 2XGXA 1W0NA 5JOZA 5LBVA 4NYLA 4LOFA 4FJYA 1F18A 1FRGH 4JM2B 3VSTA 1BIIA 2F1AA 2WQVA 1V3JA 1MWOA 4CEYB 2FIKA 2YQ3A 1KGWA 2E75B 5BRZD 3ZDWA 3AK2A 4PTUB 1FMD2 1U33A 3QC5X 3K6DA 1ETA1 1TLKA 2JG9B 2ZX3A 4HIIB 1I8MA 2AK1H 3AKPA 3HN8A 1SFYA 3ZT7A 4X66B 3Q5OA 3QUML 5DYOB 1KB5H 1UYWL 4M5YL 4AV0A 1V6IA 1KDMA 4XC3H 3K51A 4H3WA 1NMCB 2VERA 3ZW3A 2CHZA 1AZUA 3CD6V 1RUD3 5E4EC 5J7CC 2FMLA 4P4KD 4RD7A 1RP3B 3OTOB 2VCOA 2P22C 3N2GB 4DV2O 3CH1A 1VFAB 3L48A 3OGCC 1YN6A 2R1XB 1MHCB 2FJHB 3ZE2B 3L3OA 3QO0B 5D1ZC 3D3VB 5CEXA 3HZVB 5LGKA 1N5AA 3A6BL 3P2DA 3ZDXE 5LHDA 4UBGA 3CCLV 4XYXA 5F37A 4ZAKD 1CN1A 3W3BA 1K5NB 4N2MA 3S5AA 2PUSA 1WW7A 2YMTA 4E8CA 1QZ1A 3IU4L 3X1EA 1IO4C 2DM3A 4DR4B 3KD4A 4IK7A 3ZPYA 4I0XA 5FPIA 2KHAA 3VRJA 3MU3A 3BLKA 3KMDA 5DHVB 4G9DB 4PGCB 1GKEA 3L2YA 3RMYA 5FNVB 5EEYA 4Z7UA 5AWNH 3O0XA 3BW9B 1B4JL 4WFFA 1CF8H 4FZ1A 2BC4B 4GG8A 4P2OA 3LRMA 2VMEA 3N40F 4MQSB 4PJGA 4WJG3 4UBDC 3OLIA 1OGTA 2E5EA 4OLWH 4W9DC 2AJYL 5GGVY 3BUTA 4U36A 1W8EA 2OMWA 4ZOLA 1KFAL 1FG2B 1U8NB 5BZBA 5CGYD 3MBEC 4MJIE 3B5HA 1YECL 1I3GH 2R1YA 3I4IA 3QO1A 2VDML 3EBRA 4HKXB 1FSKC 1L9SA 2KDYA 3E86A 2CWMA 4AKPA 3INOA 1WCDJ 1FC2D 5BXFA 2EC9T 3ROOA 5E94B 1J5EO 3VRLF 2RS32 3ELNA 1CJDA 2A99A 4OLZL 1TVBA 5IW1A 3WTSA 5JW4Q 4L0PA 3QDAA 3I2FA 3P4MB 3WD5H 2NY0C 5EUKB 4WI0B 3O65A 1T66C 3S30A 4IV3C 3LEYH 4P2RA 4R9HA 4DERA 5GLVA 1CU4H 4A63A 1U8QA 4XVTH 3HUJB 3OKEA 3SGKA 1PKOA 2Y7OA 2F5BH 2YQBA 3FTZA 4LCIH 4Y5VB 4X4YB 4NXNB 2OJZH 2N7AA 1D4M1 2PW1A 1MLBA 1U6AH 4XCCH 5F7KC 4AHYA 1JGEB 3EYQC 2IM9A 1N32B 3OPZL 1IC7H 3VNZA 4DP5X 3H53A 4KQ7A 5ACMA 4GAYB 1XYNA 1CB4A 3IFPB 1UUSA 2L7UA 3LRSA 4PWGA 3SODB 3VXSA 5D2LB 3DJ9A 1U9KA 3CS5A 4JPVH 5KVDH 4KNUA 1Q43A 4C57C 3ULUC 1LOAA 2OQJB 4RFNC 2JENA 1W8HA 2N7BA 4NWWA 1A7RH 3CD4A 4JFSA 4TNWK 1GRJA 5DMKA 5F6HI 1DYOA 1AR1C 2A4EA 4Q0XH 1TG7A 4HVRA 3PWNB 4Q6IA 3AREB 2DDQH 4BCUA 4Y19B 4FPJA 4B4PA 4MW3A 3CFKB 4E42A 1CZSA 1SDYA 1IGJB 3MCYA 1TNNA 1HYRC 4HCRL 3RPQA 1JSYA 2XQRA 1ASJ3 1NGPL 5KS9F 4NQVA 5IAVA 5KW9H 2WUHA 5EU4B 2FX8L 1A34A 4M61B 4FE9A 4XNMB 4QTFA 1BD2E 1Y9GA 4CUAA 4NQCA 1AZNA 3EJCA 1OP3H 4ZW5A 4JTAB 5IW3A 4CDWB 1IAKA 4HK3J 4TVPH 4F7KA 2QGEA 4LCWB 1OTSD 5TE7H 1CPUA 4BA6A 3FUIA 3DX8A 3PIGA 4EYUA 1ULCA 3DO4A 4NNPL 3F85A 5FYKU 4Y1AE 2VW1A 3D39D 2NY4B 3OG4B 3TA3D 5KVDE 2CDGB 5FZHA 4BJ0A 4EOWH 1KIRB 2FQEA 3BT0A 2ZE8A 1TU2A 5MEPA 2P5BA 3ZYOA 1YQ8A 4QX8A 1IBDA 4GSDL 1E7UA 1DN0A 5HYJD 2WZ0A 5L6YH 3PP4L 1BVOA 4UF7C 5HI4D 3IT8A 4IE4A 4U1IB 1KD1W 3AMNA 4GG6F 4NQDB 1ZA3B 4M7JL 1QSFE 3FFCD 1ULEA 4HHGA 2GNMA 2GW5A 2IU3A 3ON7A 4LF5O 1NCRC 1OCZC 1W6WA 4KTDL 1VQ8V 2JKIS 3QORD 4G70B 4N2NA 4O51A 4XPGL 1P7KA 4EB6A 3UADA 2JGDB 4L8QA 4KVNL 4GT0A 5GGSB 4UM8B 4O2BB 4AEEA 4QX0A 4F93B 2HVJB 5B7EA 5BR8B 3C5XA 1OEZW 4LEOB 5C09A 1HESA 2ZXEB 3LMJH 4NKQB 5EZJA 4AUUA 4QLWA 2QQLH 3I8TA 2V5YA 4Y5YC 2DYPB 1JH5A 2A6KA 1CDUA 3EBHA 3NPSC 2P4AB 3BKYH 3P54A 1HAWA 2FH8A 3LHAA 2R041 2FD6L 2FQPA 1YEKH 2H9GA 1FNAA 3SO5A 2F7RA 2HKFL 3PIQB 4HD9A 3VFOB 4ENEC 4GKOA 5E88A 5C8CB 5C0NC 1SLXA 2XWBA 3QNFA 3DYMA 1AHWA 1VBA1 4O58L 4DGVH 1JNLL 1AMYA 1RZIB 4UOZA 5FWEA 4HALA 3AG1B 1R091 3LQZB 4UFHA 5J09A 1N33O 1KJ2A 2ESVB 1T2QL 2Y0OA 3ATEA 1RIVL 4PJ8A 1VF6A 4U0QB 4L29A 4A7KA 2DLFH 1HSAA 5I6OA 5GW7A 3HBPA 4DO6A 1MDAA 2A77H 2WNXA 3G6JE 1NCJA 1WA0X 2ADJA 3SPCA 1AIZA 3SDLA 3EYSH 5DJCB 2JB4A 1QJU2 2BCKA 4IIJB 1EZJA 1SJVA 4QHNA 2HHHB 3D0LA 1L7LA 3SXWA 3MHHC 2GJJA 2QR0B 2VUOA 1MJUH 4E9WA 1MEC3 4QXHA 2MQ0A 3BAXA 3N27A 1US6A 1S0IA 3BSZA 4LF8O 5FYLH 1CTNA 2ZSWB 1E3FA 1UVQA 3F12A 1TZGL 3HG5A 4JFTA 5I8SA 2HEWF 4F1SA 1GS6X 2D43A 4NWUL 5L0QC 3FO9B 2MRYA 3BVCA 2KYIA 4CDUA 4NHMA 4ALAH 2LGWA 1OAJA 2WQWA 4YOKA 3I59A 5IK7A 1HB3A 5L9DL 3V0BA 4LFAO 1X8EA 1NBZB 2GP3A 5D7IB 4CBZA 3M3IA 1U3NA 4XNBA 3DRTB 3ZN1A 3N91A 3QPQD 5IUCA 4DUYB 1W3VA 4NYKA 3G6DL 3MLXL 4HJ1A 1AYN2 1SEFA 4W9KC 1Y07A 2Z7YA 4FI6A 3QK0A 3OY8B 1G7LA 5SWSA 1G6RA 1MWAL 3ETQA 2PXYA 2R2HB 2Y7MA 3LSOA 4M3KB 3HB3B 2D7MA 3LKPB 4IBUA 5A2CA 3TJHD 2IAMB 1JHNA 1LE9B 2R16A 5EYYA 3ZRWB 2AXGB 2IQ9L 3RWCA 2D3SA 2LW3A 2WL1A 4P9YA 2ERFA 1GZPB 2UURA 4QQOA 1KCBA 3L4WA 2F53B 1Z9NA 2G9FA 3AJYA 5JDSB 1QEXA 3C8KB 5C6PB 1PGW2 3T5WA 1ZMYA 2IDUA 4KK8D 5K9OB 3WELA 3OTOO 2FEJA 4ZAKA 5KSVA 3N9OA 3HLKA 2NXZB 4R4NC 3BRCA 1Q9WA 2W39A 2DCKA 3WTXA 2X09A 2P67A 4FFYH 1K8AW 2OJEB 3ACHA 4AE2A 2C9SA 2ZWLT 2B5IB 5B1OA 1Z5YD 3P9MB 5ESVB 5ENWB 15C8L 5JZGB 5HHOD 1P9MC 1T0MA 4KZ0A 1OD9A 1XOUA 3Q6GH 2XKUA 4TSVA 4HOOA 3GWJA 4IBTA 3BPZA 4FG6C 3GDBA 1NE4A 2P17A 1XL6A 2C3WA 4HHAA 1R5IA 1WFOA 4W4OA 1ZLWH 4BKLB 5GRWA 3QYMA 3JZVA 3PJYA 4BUQA 5KANG 5D2LA 4UM9A 4OQTA 5CJXC 2X4PB 4XMVA 2FUQA 4LPVA 4FJZA 4TQHA 5IHWA 3BU7A 3ILNA 4JO1L 1WV7T 1N8ZA 4Y4HC 2OSLA 1NCCH 3L3KB 3VU1A 3T1MA 1GGCL 1HHJB 1VFOA 4YEFA 1YEGH 2K4WA 4X0KB 5FKBA 3C60C 4KFMA 4JFEB 4X6CF 1MFCL 5E79Z 5BOJA 1KGYA 3LQMA 1AP6A 2W2IA 4EI0A 2G9HB 4YHML 3FO0L 3IDYC 4AITA 3A0OA 3GIZL 4DVBB 4DZGA 4NHKA 4QGLA 3ZIWA 3EZ8A 1RUD2 3FBYA 1IIIA 1N0LB 3R8QA 1OT2A 4HKZA 1NSNL 2IBBA 5HI4C 2M2DA 4ZZFA 4OCYL 2IFWA 1AJKA 5HGBA 4NQCE 5JOPD 3ZYGA 4NXNO 1RHHA 1U30A 3ZT5A 1AIFB 2UZYB 4BINA 2PHLA 2I25N 4F33A 2Y06H 5CA3A 3PAYA 3P0YL 1B3IA 4HSJA 1UJ3B 1ZA7A 4OUSA 3D3AA 4E27A 2Q9LA 3WFHB 1VQPV 1EJ6A 1VLNA 4FYSA 1AD9B 2BVQA 4GO6B 1HH6B 1AQDB 2NLJA 3SCMD 4LBQD 4PDWC 4XDJA 5H9QA 5CP7A 4B96A 2PAMA 2KB1A 1SJMA 2PR9A 2Y36H 1YMMA 4NI6A 3DX9B 2ZX7A 4G7YL 1OQ1A 5D4HA 1LHUA 1YEWA 1W05A 4A42A 4LLWA 2JCCF 2RQ8A 3D0LB 4PHXA 5EBLB 1HDMB 2VWEE 2Z34A 5B3JF 4BD4A 4D8PA 1L3WA 1HVXA 4GMP1 2JB6B 4XMPH 5F72S 4YFZA 1WITA 2XPYA 2ZUTA 4XC9A 2ATFA 4YAQB 3KVBA 4FFGA 1KGJA 2XTJB 4WCEV 1RU9L 1YN6B 2R1XA 4JFFD 3VYNA 3HNBM 5I0VA 3VO0A 1ZHNB 2ARCA 5FZFA 4LHQB 1SA0A 4CGTA 4XCEB 3S9DB 1PLGH 2WLQA 1YF2A 2RCVA 3WNLA 4YPGA 1JZEA 1X5AA 4BK5C 1BBT2 1D7PM 4CDQB 4OVUA 3TBTA 2J1AA 3FQWA 1HNZO 2CBMA 1NCRA 4R52A 2Y1VA 3CN2A 2VR3A 3MRDA 1M90W 2R1DA 1NXMA 1X7TA 2B4CC 4ES9A 4YDJA 1SLAA 2GC4C 5A43C 4OKVA 4HAMA 3D6GA 4N0UA 1B6DA 2ZG2A 5LL6Y 1F1DA 1K4CA 4BJLA 2Y34A 4ODWA 2ZM6O 2AXHA 3PDGA 5CMAB 4YDVA 1U95A 2X0VA 2HTKD 3FB5B 2E3CA 1ASPA 3CVDA 2VQ0A 3CL1A 2LTQB 3WLWC 5FA4A 4NIDA 2MPVA 4JRWA 4JZNB 1ACXA 4AVHA 4B9GA 5D1QA 3RE0A 3HNSL 4GW5B 4ZFOA 4F7TA 4XZUA 4NI3A 3T3PF 1F23A 3GRWH 1AH1A 4P9OA 3H50A 2UZPA 5IVZB 3VXOA 4M4PA 4U49A 4TPRH 1MA1A 2J1UA 3BHBB 1LK2A 2BTVC 1LQBC 3FUMA 3B3QE 3HI5L 4PUBL 1FBIH 1TUEB 2WTOA 3MJ8B 3DOHA 5D1QE 5T3ZE 1ONAA 2C1OB 1W9SA 3LSEA 3I85A 2XWRA 4DQOL 1RGSA 3MRBA 3BN6A 4NE9A 4BFBD 4AK3A 2DBJA 3FQ4A 3RI5F 2NW2B 3GS0A 4X7SL 5DHMC 2WWMD 2GITB 4O02L 4S1QH 5FHBH 1VACB 5K69A 4PT6A 3DX8B 4N20A 5CJQH 3D6EA 3JB8A 2W0FB 4GRWF 1MPXA 4ASKA 4OGAC 1OCRB 1TJIL 1E4WL 3RB5A 5FR3A 5G2NA 2ZQKA 1B0GB 3BPNB 3K81A 3L3DA 4JO4L 4QKFA 3VBSC 3UJTL 4TL5A 2VLLA 4R4XA 5IK3B 3BWAA 3X3FL 4OY9A 4EJRA 4JI3O 3KH3A 4FA7B 1R0AL 1NR1A 4N0CD 3DUUB 4LF9B 3RZHA 1OY3B 3UM7A 3RWIB 5DK2B 5TD4A 2MNGA 5JAXA 4AV4A 4R7LA 4LB8A 2A77L 2BNUA 1JOBA 2LP7A 4A7GF 3GB7B 5T1LA 5KHJA 1FZMB 3K5NA 5IVXA 1IFHH 3E8BA 2XUWA 5E9AA 1J95A 2VDPH 1LGNA 4M9PA 2P5EB 4F3JA 1VZIA 4AIOA 2A6KB 2XBDA 4UV4H 3HN1A 2AC1A 3CHQA 5GZCA 1FVCB 3ETBF 5TE4L 1E5RA 2JEMA 5A33A 5EC1C 2Z7WA 2ZKWA 4UQIM 4P46B 5BS0E 4WK0B 5T3ZL 5CJ5A 5IJKA 2YZ4A 3FC8A 1FDLH 1SEBB 1VAKA 1N6UA 4P9PA 3POCA 4W70A 4WFHD 4LKFA 3EDJA 1BXHA 4ENZA 3ZDYF 2DOSA 5I9QB 3AS1A 3EG9B 4JZJA 1K4DC 4RWHA 5I1IH 2WFF1 4ONGH 1YQ5A 4LCCC 1H6TA 4QIWF 5A3WA 3ZHRA 4G7VH 4EO5A 4Z5RB 3VVVA 1M6UA 1A66A 4UZSA 1WEJH 1BREA 1IX2A 1QQP2 5CA1B 1ZEAL 5JW4M 5J8OA 4NIAA 4QKTA 1OLZA 1ZT1B 1QABA 3RVZA 1S7TA 4LXFA 1HWWA 1XQNA 1GR7A 4M3CF 1EZVY 1NQDA 1OVPA 4P2OC 2E7AA 1D9KD 3JUZA 1IFGA 2X12A 4LAJH 4MDJA 4RRPM 5CGBA 5IW6B 1IMHC 1OCOB 4JVPA 4WSKA 2B8OT 3FFZA 5CJOH 4H88L 1JP5A 2QVSB 1EFXB 7FABH 4XXCA 4XVSH 2OZ4H 1GJUA 1TIUA 4MMZB 1J8HD 5F3HA 5BVJA 5BVPL 1C8NA 1B0WA 1MS9A 1UXXX 4P5KB 4E9YA 3LCPA 3VFPA 5L4IA 3FQ1A 4PA4A 1E9QB 2IPUK 3QIWC 4I0WB 4IS6A 4K21A 2YLHA 4AHWA 1S5HB 1PMIA 5I8CA 4LSUH 4PJCF 5I71C 4YUEL 2BC4A 4JN1L 3A7QA 3MKKA 5BUVA 3ZX6A 2BSKA 4HHAB 1SPDA 2V17L 3KPRD 4NPLA 4WU7B 1E9OB 3NVQA 2FCVA 1FNLA 2YGOA 4I5SA 2KG7B 4JV5B 3NUKA 4I0CC 1H3GA 4KQ4H 2PXYD 4XE5B 4ZUVB 1G6RH 5IOPA 1XGUA 3U6XA 2KA3A 2R0KL 5A2FA 3F7YC 3NACL 5EPMB 4QT5B 1P7QD 2ZWZA 3O2DL 4PWKA 2G75B 2QJDA 3IWZA 1OVSA 5E03A 4BZ1L 2OQ7A 1P5VA 3GEFA 5FZEA 5TGBB 5D5MA 1IV8A 5AVXB 2YIBA 3MRIB 4Y1AB 1UAIA 4RHV2 2K6ZA 4KKLC 5F8RC 5GSVB 4RDQF 3BRDA 1X5HA 1U8QB 3V5DB 4Z95L 2UU9O 1BMWA 4ISQA 4NZTH 1BXUA 5KAFZ 3FTGB 5BV7C 2XNDG 1AFVL 1HB4A 3ETGA 3A5VA 3RVVC 3UAFA 1H2KA 3WYRA 5LNGA 3GYDA 3MRCB 2VNRA 4DPAX 2A79B 5CO1A 4L8SC 1SGKA 4U3XA 5IMKA 4CSTA 1UOKA 3OB0H 4PU2A 4XB7A 3RX5A 5IMOB 4FN0A 5KVGE 5JW3L 3DO7A 4MH0E 1RPKA 5IT6A 5A1AA 1H3TA 5E2VH 1K2DB 5DK3A 2MPAL 1R24A 4ZZ5A 1PNFA 4PJ7F 5E8PA 3FB5C 2ZAGA 5T1MB 4GX5A 2DVBA 4GIQA 3KJ4B 1UPIA 3ALQA 3G7DA 4QHLB 3G4SV 1DANU 4B3RO 3IPEA 1DP0A 4AQTA 2LLGA 4W68A 2YD8A 4UFZA 1EUTA 1X5ZA 4J9YB 4HN0A 4B3MB 2N74A 4BKSC 1ZKAA 2OYLA 3NCEB 3KPNB 3FT2B 4DP1X 3S37L 5HVGB 3SE4A 4BFJA 4FPEA 4JO2L 4GUPA 4OZIA 1NSNH 3PREA 4OM0H 3WEBA 3BP4A 4R7DB 4NZRL 3K4DA 1UD8A 3ENEA 5C8JB 4MD0B 5GS0L 1OKQA 4PBDA 3LKRA 2X2IA 5J96B 3HLAB 2WV3A 3HN3A 1XMOB 5AVRB 4LEJA 4D2NA 1V9U3 5A80A 3L1FA 3X13B 1DJZA 4G5AA 4I13B 2NSQA 3P2BA 2YK1H 1TDQA 5CZXD 5DMIL 3RZLA 4MA1C 5F0JB 2WXRA 4PJBA 4OB5H 1H3PH 3I3DA 2CV6A 1QJZA 4YZ1A 1YY9D 1PL3A 3H54A 1MFEH 4NSKA 2WZR3 4JL1A 5EOQL 4PJBB 4QDQA 5BW7A 4RGOL 1HRV2 2NR6D 2ADEA 1BMV1 1VBD2 1N0NA 1JI2A 1G4YB 4WV1B 2GZWA 4KHTL 1KEXA 2J7MA 1TMQA 2WO3B 1KUMA 1K6QH 2PF6A 5ITFB 1PX4A 5LGJB 1I3UA 1LAJA 5IVNA 3C6SB 1HXKA 1HE7A 4A7UA 1KP3A 1W2BU 3K74B 3MRNB 4NKOA 2D3OW 4X6DB 2FIKB 5CCJA 1BZ8A 3LJ3A 4DWHA 3EYUH 3NKGA 2C2AA 1XR8A 2OTPA 4HVQA 3BSZH 4A2MA 1OHHG 2WNEA 3APCA 25C8H 4MS6A 5JHAA 3O4LD 1FIEA 4P5YA 3IDCB 4ZNCD 2OW4A 1JZHA 3FJTA 5GGSA 5IVZA 3VXOB 2B0SH 1CD1A 4L1SA 4LVNB 1MFNA 2YHGA 3C5ZD 5F96L 3GMPB 3VXRB 1BEV2 3CQOA 4A7YA 2VDQH 2AREA 2GSGA 4WFGA 3C5SB 5INCA 5C7ZA 1K5MA 1TLMA 4U3JA 1KBHA 3MGOA 4IDJL 1H5BB 5FW8A 1LXMA 1VF7A 5EOTB 1AZRA 5KVFH 2JS5A 4FOVA 3ZSKA 2P2KA 3LGRA 4CDQC 1E67A 5DAQA 5T1LD 4MQXC 1GSMA 2IFGA 5KSBE 4YHOL 5D7LE 4DV5B 4ABVA 3OZKA 3V5KA 5BW7C 5FUZL 1K72A 4KY2A 4XPHL 4LVNC 5KS9B 3STZB 1UIKA 1YFUA 4XNAA 3A4EA 3DXAE 3E5QA 5D8AA 5AC91 3BCFA 2WWJA 1NT2B 5C0RL 3TNNB 2QZ2A 3QPXL 2UX7A 4FPOB 3VKMA 3L9RB 1JFFB 4I1PA 1FPN2 4GWNA 2CHXA 4WV1A 1FXKC 3K06A 3ME0A 1L5GB 3WMSA 1VGKA 2B4KA 1M7DA 3C8DA 3HMWH 3VSQA 1XT5A 1Z5WA 4IRSB 4WM7A 3GTNA 4PJBF 4LTAA 2YEZA 4WF9V 4YXHH 2Y69C 2FX8H 4F8LA 5CJ8A 1R33A 1QQCA 1HDKA 4M7LT 4MHHG 1M1XB 1K8IA 3RVTC 3ZYFA 4M9OA 2IXJA 5FZLA 2DEXX 3TNMA 5IOKA 2JI2A 4I0BA 2FJFB 2Z4QB 4X4ZA 1L8DA 3V7MA 1C5IA 5FECA 3ZDSA 1OGAE 2ZX9A 4ZNEE 2ZXWB 4O5LL 4LR3A 3BE1H 3QO5A 5DLLA 2EVIA 3ZKYA 4G6JH 3ZKXC 1RUPH 3U6RB 2XTSA 4DV6O 4NHLA 3X17A 2UXTA 3FUKA 4YNYB 3PUCA 4YPJA 3H01A 3SZ6A 1LR5A 3U10A 2WYTA 2GNBA 2N01B 4JASA 3CVHL 3MZTA 2Z31C 3WP3A 1FH5L 3VXMB 2RS52 1OWRM 3QCTL 5DVKA 4P00B 3KPPB 4J3SA 3TCUA 4J9ZB 1KDIA 2Z1PA 1JX9A 4IHJA 4HZLA 3CV5A 1WEJL 1XF4A 4JHZA 4ZS7L 5AALA 3WZ1A 2WZ6A 1XIWD 2WP3T 2RV9A 2VH9A 2XBO2 3ULVE 2A70A 3TT1H 1SLIA 4PBPA 1NWOA 4JR9L 2DQDH 1DDTA 4C54A 5TF1L 2CRYA 2BOCB 4XB3A 4PFEA 3GGWB 5FYZA 3V5DA 4WI4A 4RQFA 2J1YA 3I2CH 5JMOC 2D5FA 4EV0A 5ACLA 2D3LA 2ZCHL 1VJSA 3UMNA 5L7OB 1KJVA 1WFIA 2QQMA 4Z7QB 4XXAA 3WB0A 2IV8A 1A6VH 3U4EB 4OQ8A 3MW2A 4GRLC 4X5PA 1B9ZA 1OGTB 1THCA 2P80D 5CILH 4COWA 4WDIA 1AGDA 5AW2B 3KV6A 4ZKIA 4BSWA 3GALA 2FECI 3WDWA 3S36H 2ICWJ 5FJKA 1JWMB 2P90A 3PHQA 4YR6A 3BLPX 4H88H 4NZFA 1J18A 5GSRA 4CH3A 4K4KA 4Z7AA 1BJ1H 1DYKA 3APQA 5BOZG 2CNAA 4OFPA 4KROC 3CXCU 5CNHA 2ZX0A 2CKBH 3NW4A 2H6CA 2BNUB 3IDIA 1VADA 4JQVA 3KXFB 4LPWA 3C7OA 4PJCA 3ELQA 4NNXA 4UQEA 3VXUB 1VZGA 3QXAB 2CDYA 4FLHA 4NX0A 1JPXA 2D03H 3TBYA 3UEZA 5LXGH 3WDIA 1F6AA 1KJMA 2LUWA 4UYBA 1NMAH 4Q56A 1CD3G 4ZTPL 4IOIB 3W9EB 2VM4A 3ESNA 4Q4W2 4K5OA 4PJHB 2B08A 2DW5A 5J6GA 1CK0L 3OL2A 4HHWA 4WI3A 1UWGH 3BVNB 3M1HA 3CHXA 5I1CH 4RQPB 2AKRB 5AQ0A 4HBQA 3IJ7A 4CU7A 1NCBH 3K8KA 4HUXB 4CC0A 5IMMB 1JHJA 3GCXA 5L4FA 4PJFF 4JZGA 4CA4A 1QFHA 3KQRA 4X64B 1RSOB 5CCGE 4LFHG 2WQ4A 2ZX4A 2EIMB 2HYKA 1OP4A 4UQ3A 2E7TA 2EXWD 4NYLB 4JY4A 1RURL 3BEWB 1ONQB 1I3HA 1LMIA 4RUEA 2IQ9H 1IFRA 4W6YA 1HRI2 4K9EL 1CPNA 4U1SA 1UENA 1MEC2 1KCSL 3HG1E 4HBCH 1ODMA 1PNGA 4NZTL 2HG5A 4LFCO 1IM9A 1FHNA 1P4IH 1M7IA 1G7IB 2WFF3 2YIBD 2NXYB 1RC6A 5C9AC 1J5IA 2ILLA 2HP8A 3OPUA 2ESVE 4JANA 3FK3A 4NM8L 1QDCA 2A6YA 4FFYL 3MCKA 2ZSWA 3HPNA 1BOGB 3N9LA 4FFWD 2GUOB 1CICA 4FNLH 4D0QA 3ZN6A 3K5LA 3MRMA 3OKKB 4PJGF 5TQ0H 1JPTH 5IVXF 3BDBA 4S2HA 1WCBB 4HIHA 3DXTA 1LOGA 1XAUA 2VRAA 3GSNH 5DJ2B 3VFNB 1C8M2 2IXKA 2XTJE 4DZBA 1RPOA 3SDDA 4XF4A 4JI1O 3GDCA 4I18C 4WW2C 3TH2T 1WAZA 3FTWA 1TJXA 3VXPB 3FLTA 2OMTA 2XASA 1JYXA 1RUH2 4DEPB 1U5YA 3IDEA 3EBGA 2QQQA 1WKYA 5DDJ1 1NZ6A 1GUIA 1ZWIA 5EBMC 3BKCL 3V8CA 1CFVH 3SBPA 4EN2A 4ZSOB 3QDJE 5ICYA 1CAWB 3IB3A 5A7EA 3PWJB 2Y3AA 3U11A 3ARSA 1MCHA 3FQYA 1ERNA 1EVTC 3TYGL 5F7UA 1WN7A 1L3JA 5DRZA 3CFMA 4X5LA 3AUWB 3DGCR 3H1IH 4W6WA 2WINB 3B9VA 4GYBA 3QXTA 4FQLH 4CCMA 4N43A 3ATDA 5LZ6A 4DR2B 1OT1A 4LLFA 2HPOA 2RFXA 2BPBA 5TQ2L 1KJ3L 3NEEA 3QEGL 2EE6A 3SJCC 1MH5B 1WD9A 3EGDA 3H0TB 3QEHA 4OJEH 4PJXA 3MRJA 2DDUA 4XHXA 1MSWD 3DX2A 2J6EH 1TVKA 3A0HZ 3K2KA 2GCYB 4UI9L 1VQ9V 2VDQL 3T3PB 1S7WA 4IBVA 1GKBA 3WU2Z 5DDHA 5F9OH 5GJSH 4CC6A 5MI0C 2VVFA 4AI1A 3NL1A 2XBO3 4RQQA 3NCFB 4MMZC 3APDA 3OGIB 3JYCA 1UOLA 3W0WE 1U8MB 1HX0A 4RN5A 1QLEH 4D6RA 5E16A 2GUZA 2VMFA 3FNKA 1V6KA 1E2WA 2VC2H 4JFDB 2I60H 3VBUC 4DPNA 4YIQB 3QA3A 3H1JH 4NC1C 1EERB 5AOKA 5LGTA 3S3JA 3IJHA 4GFXA 4K3GA 1HNXB 2JVUA 4MBOA 4PWEA 1WD8A 1YEDB 2H8PA 3E8VA 4JDVB 4XVJH 4I0AA 4H13C 1CVNA 4Y19E 3WGVB 5B39G 1NJIW 2JI3A 3J27A 5ACA1 3TF7C 1JF1A 4OZFB 1IKQA 5C8YA 3NCJH 3P11H 3SHSA 5HGDA 2JDNA 4LRNL 2RCSL 1Q8VA 5C33A 3NJVA 2WAOA 4DV3O 1Z9LA 2PW2B 5CSGA 1AQMA 2CPUA 1UFIA 3CFJB 2X3AA 5LN4A 3UKVA 4LSQL 3CMEV 3WG7C 4I0XB 5AYTA 1ZGLB 4TVSa 2YSSB 4OQ9A 5E70A 4PV1C 3WHE0 2I85A 1T04B 1EHAA 2I5YH 2V7NB 4X99B 5DJYA 3OR7A 4XMUA 1TMF1 2VVEA 5DZVA 1PGSA 2EJ7A 3C2AL 1OAYH 1GYAA 1E8ZA 4HMCA 4JHWL 5H37A 3BTZA 4R7XA 1BF8A 5I6NA 4CBCA 3RIKA 3ZIMA 1M57C 4JKNA 3BO8B 4P57A 3ZMVA 1PVC3 3ZQXA 5EOCL 1PQZA 4G6ML 4J23A 4M62H 4RLDA 3GSWB 4NKIL 2XAGA 2CU9A 4RGMC 3LN5B 1QMUA 1MS0A 1ZZ8A 1UWFA 2UV3A 3B9IA 3SQOA 4FFIA 5FLVA 2VZOA 2X4QB 1FPOA 2RM21 4M7KL 3VVWA 3H4FA 1DBKH 5F7EH 5GZOA 3QDGA 1DJGA 2P5PA 1I3VA 3I5DA 1VF5C 4NTXA 1AZVA 2DQUH 3BE1L 3FCTA 3P4MA 4WHCA 3UH8A 4EDWH 4ZO8A 5FWQA 4LSRH 4X5RA 1TPXC 3ZQWA 3RYCB 2UVFA 3UMTA 3N7JA 1T20B 2B9UA 4QRPB 3U9UB 2ZKMX 3SJVD 2LT9A 5J06A 1FL6A 1W0KG 1T83C 5TDOB 3ZTNL 4KH2A 1R082 2UYLB 3WN5C 4OF7A 1LQSR 2DLGA 2F68X 3BH8B 1UH2A 3Q2LA 4OZIE 5AD0B 3DUIA 1SS3A 3AKSA 3QCWA 1I8KB 3AJ7A 3UKMA 4A6YB 4HIEA 2H2SC 4DV0O 1CDYA 2CUAA 4IEFB 4PGBB 2F54A 2OVUA 3X1FA 5DAWA 3AMHA 3FOLB 1MHPL 1QKZL 3D3VE 4E41D 2R2EB 3K4AA 3M7FB 4HAFA 4KO5A 3PU7A 1Q0XL 2D2OA 4H8WL 1PZ5B 1W6LA 3B83A 3IRPX 5TH2B 3R8BB 4XJWA 5DWUL 1GZTA 1MHEA 2TRYA 4OU3A 3SHRA 1JE6A 1JOYA 5AAPA 3Q3GA 2WLYA 2NNUA 3NH7H 2CKBL 2EIDA 3FU9A 4OLVL 4ET7A 4U0RC 1BL8A 1MJJA 3T0AA 5DZGA 1ND0B 5KSAC 3S88H 5FYJD 4J6IA 2JRIA 1WIPA 2OP4H 2NSXA 1ENXA 2AFNA 4QPIC 2YKLH 2NDFA 5HDQL 5C0DA 2HVKA 5LCVL 4KKBD 3WVJA 3VFOA 1GZCA 2MNUA 3BLBA 5KOMC 3AGVA 1WTGT 1SYVB 4WEMB 1CI3M 5KJ4A 5IFHH 3V56A 5FPXA 3LYRA 1ML0A 2FO1A 3N41F 4JX0A 4B9PA 4LHUG 4OD2A 4UDUB 2WZPD 5GKAC 4AUYA 2ICEB 1BIIB 2AMGA 1ZEAH 2HT4C 3M8OH 4JREB 1AI1L 2ZYHA 1BYPA 1FRGL 4NN6C 2Q7GA 1H8VA 3KL5A 1GO3F 5LA6A 4P5MA 4DUVA 2A9MH 3JAMN 3FUHA 3VI4F 1DEEB 4PELA 1MAML 5FYKL 5KX5B 2W94A 3BOVA 2R6QA 4E9TA 4LFCB 4O4IB 3L7FA 3RAJL 1MN4A 5C0JA 3IU3B 5D7LA 3ARBA 5EZPA 3NSDA 1MCNA 1P4IL 1UYWH 4M5YH 1RUC3 5CEHA 2OULB 2RE9A 3WY2A 1UZ6E 3L54A 3KHOA 3KYNA 5CP3H 5D9SA 4HT1T 4PRDB 3O0VA 3S57A 4WGKA 4UB6Z 3UERA 3VBSB 3JAKB 1W39A 3NNFA 3CCSV 4LF4O 1RURH 1D5XB 4KWKA 2A9AA 3SKJL 3IDUA 1RQ5A 4ZMWA 1MRCH 2V5MA 5FUCC 3MJ7B 4MV2A 5D7JB 5JDBA 3IMMA 2CGRL 2FIRT 4OJFH 5E95B 5TQ0L 3HKBB 3RNKA 1Z9SB 3O6FD 5IMMA 4LKEA 3K5OA 3MLWH 1SF5A 1KB5L 3ABLC 1EWHA 3OAZH 4IJ3B 5EYPB 4CVWA 4ELDA 4Y16C 5JHLH 2WSDA 4ZMPA 5DS8B 3PJSA 5CIPB 5FKAB 5BY5A 3LZOA 2F2HA 2ZUYA 5K9JH 3N3HA 3MODL 5D1XC 4EZKA 1U42A 4L4VB 1FZJA 2ZIOA 4X7CC 3LQZA 2XRAH 2R72A 3WUWB 1LGVA 2R9IA 3IJ4A 3VWKB 2CE4A 1DQ6A 3MO4A 4AEHL 5IJ0A 4LF6O 1Z66A 4PF5A 1T1YA 4UQ9A 5K0UB 4I0PC 3ZDZB 4EPSA 1DQVA 1Q82W 1PEZA 2RTTA 3C6EA 4X9GA 1S9VA 2E7MA 2W6IG 1BSIA 1TQCB 2BSTB 3PV7A 4TL4A 3ASNB 3KT4A 2XT1B 3VBRA 1S5HA 1NM9A 2DQIH 4ZS6C 2MEV2 1LO3L 4N2EA 4F37K 3D0VA 3HZYA 2F18A 1S9WB 1RCYA 1QUNB 1T5XA 4L5FH 4B5ZA 4I9WA 3GNML 1MRDH 3FT4B 1CYXA 5IB3A 5LY1A 7CGTA 2IQAB 1FZOA 3ATBA 4X80H 2WSPA 1WZXA 1RUF2 4LPUA 5D8JL 1XGTA 4FEMA 2VN6A 4AQ8A 4Z7VA 2HAZA 1G1XB 3CHRA 4WSGA 2DM7A 4DK3A 1I1RA 1OW0C 2XYBA 1RL1A 4FNSA 3IMTA 1R6TA 1LILA 4FZEL 4QTIH 3HZKB 3B37A 1A7PH 3I3MA 4U2ZA 4KKZA 5BXFB 5EHFA 3T6QC 1ET5A 2YMXL 1V6OA 2Q76A 4RFRB 5HBBA 2V3FA 4L2YA 3LN4B 3WFBL 3BFQG 3PWLB 3KCCA 4Y1AA 3BKMH 2XAJA 4E4HA 4G3YL 3HQUA 1QTPA 3O1OA 2NZIA 3P77A 3B34A 4WRLA 4IDLA 1IC7L 3HR5A 3W0WD 1UTDA 1LUVA 4NTWA 4XJUA 3IKCA 2ENPA 4TTDD 1F9KA 1BVKB 3VBUB 2I60L 3VQVA 4H1LH 4OAWA 2G2RA 4R2GC 1SDWA 4RGOH 3GWOA 3PMEA 2EIEA 3RT3C 4LGSB 4PTTB 2ZPXA 3OR7B 1E65A 4YHKL 5CD3B 5JIKA 4HLTA 2ZAAA 3OF6D 3OC5A 4LSPL 5JI9A 3SBWC 4HVBA 2Q10A 2R59A 3ARDB 4XDKA 4KUMA 2X7RB 4O4HB 3NABL 4FQQA 4K7FB 4PMFA 3SD5A 3VFWA 3LB6D 1DCSA 1ZHKA 3B8NA 2Z35B 3BY6A 4AG4A 4I5BB 4A2EA 2MEV3 4DR3B 3IWUA 3BYWA 1IJ9A 4N2FA 5C0CE 5DGQA 5K9YA 4WTXA 3EJSA 4GKSB 3VG9B 5DJ8A 1NCOA 2QKIB 4YZFE 3JWNH 4JYAO 5EEZA 3DPRA 1H8TA 2RJ2A 3OKNA 3VL8A 4U7NA 3QNXB 1FJGB 4OZFA 2ADIB 3BVOA 2FTKA 2D2CC 5F96H 4NBYB 1D9KB 1U0AA 3ZX7A 3JATB 2VN3A 2VCAA 4K94C 1H6UA 1RB8G 1WJ3A 1KBWA 2GQHA 3MUGA 2ZF9A 2Q0AA 2C8NA 4KTDH 3QOPA 1IT9H 4XZ4A 3WS6A 3SCHA 4CTEA 3BVVA 3MRMB 3OKKA 3IETA 2XJRA 1GPOL 2K1MA 3WN5B 1UQSA 2FLBT 3CQPA 1I8UA 1D5XA 3MV8E 5I6KA 3PP4H 2R2CA 3GMLA 3T6WA 5T1KA 3AP9A 3TWIA 5IHBA 5L8JB 3BXNA 5ACZB 1IEAB 3GNEA 4DKDC 3WLUA 1HHIA 4XUQA 2IBGA 4U2YA 3ZIYA 4N0YL 2VDKL 1WS7A 4NT6B 4PJFE 1VB2A 2VW6A 3KS7A 4MSWA 1HNGA 2F53E 3D09A 1RSFA 1F13A 1W06A 1ILSA 5BNNA 4JYBA 4W9FC 5KVEL 5ERWB 4ZXBA 4NJ4A 5K39A 2G0LA 1Q5OA 3B6SA 2D9CA 4BXSV 1RUJ1 1SFPA 2APFA 2DVGA 3DL3A 1J9SA 4PRNA 3ZKMC 1FSKB 1HNZB 3CZEA 4TQDA 2PPDA 5JHBA 2GTSA 3O1UA 3ZUNC 2DQTL 3ZS8C 4FDWA 1G0XA 5C9AA 3MIFA 1GW6A 3T2MA 3V6OE 4N0UB 1UT1A 3IDMB 2NUTB 1FJGO 4IGBD 2B42B 2ZOKB 2W60A 2WBJD 4MJ4A 1OW0A 5EBMB 2AW9A 5GRJH 1M05B 5JHMA 2UY9A 1MNUL 3Q2WA 1JPFA 3MKGA 4PJ5A 4RGNE 5FIEA 4F7PB 1AXKA 2RR13 5F9DC 3BWZA 3OHMB 3I3BA 1BZDA 4ATWA 2VMHA 3DOSB 5JYLA 4AI2A 3GINA 1MEXH 4LARH 2EINB 3PN1A 4AVKA 3A67H 1IBMO 1KKDA 3SKUD 1BEV1 3AL6A 2A0LA 3CYOA 4OLVH 1Z5LA 4U1GB 4TNVF 4A7QA 2DBIA 1NC2D 1C12A 1QLRA 2DLFL 2ATKB 4ETQB 1HKDA 2A3WA 1BOYA 4XBMA 5H4YA 5IVXE 4X20B 1TQ5A 2ZEYA 2WO1A 2MCG1 5FPUA 2IZWA 2AABH 5DD1L 4B9CA 1JPSL 4WO4D 5JR1H 4QAMB 2YG0A 4YSEA 3LV3B 2RNBA 1TJGH 1UOJA 4ATTA 1XSOA 4DKAA 3FQNB 3G5YB 1AP2B 5LWYH 5DM6V 3BYYA