3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
3CHXA 4O65A 3RFRA 3RGBA 1YEWA 4PI0A 4PI2A 4PHZA
chains in the Genus database with same CATH superfamily
4PGEB 4CNIA 2IXQB 2R59A 4N8CL 4PYGA 1HIXA 3HE7A 1HB4A 1LWJA 4XPFL 1RFDH 5HHPB 3E89A 1T21B 3DOSA 3QG7L 1H0DA 1MJ8H 1Y18B 2FECL 2VUOA 5JCOC 4F8NA 4XOBA 3HAEB 1J1PL 3G5YA 3V2AR 2GYSA 1YECH 3VFNA 2F8XC 5JUVA 2YPVL 4KOCA 2BNRB 1P7HL 5FLJA 1KZQA 3I75A 3L4WA 3CFCL 5GONB 3IMRA 4YHOH 3C2SA 5F44A 5BVJB 4LBQA 4PIXA 3EZJB 4UILH 2LVCA 2KPWA 5A3ID 1IKPA 4QPWA 3EFOB 3G67A 4O2CB 3QO0B 1DGSA 4XPHL 2UXTA 2EKJA 4PJHE 3SCMC 3POYA 5ID1A 3VQ1C 1TME1 3A0HZ 2KC0A 3IJEA 2B9VA 2KR2A 5CP3A 1FO0A 1HEZA 5JOPE 4RQPA 3HKBB 1YXBA 2YD0A 1BYOA 4HETA 3QJFA 4XO8A 3B93A 2G3MA 2BXYA 2H3XC 1A65A 2ZMKA 3LDRA 3UL4A 2E9QA 5BZXA 4XVTH 1AYRA 5KLVH 4HIHA 4NUQA 1WFJA 3AY4A 1P9MC 3C7GA 3GCWA 3K71B 3MHZA 3I59B 2XJUA 4JGYA 3OR6C 4OB5L 1FZJA 1AP5A 2BDRA 1U95B 1VF5C 3WEBA 5ITFA 3KMDA 2A3QA 1U93B 4J3OH 1DBJH 3EFFB 1OK8A 1ETJA 5D8JL 4MZ3A 4LVNB 5E6ZA 4QTHB 5KBFA 1VQOV 2F5BL 4X66B 5IB5A 2DURA 2ZINA 1SZXA 3K74B 2HJDA 2IALA 2GC2A 2X41A 4Q6IC 1ZVHA 3LDBC 4U1GB 4N22A 4DZ8B 3Q05A 1FN4A 4YHIB 1DQDL 3I2KA 1NT2B 2Y5EA 3MLWL 2R063 1DEEA 1C5HA 1CAWA 1RJYA 1ZT7A 3THML 3T2PA 4XN5A 3WLBA 2VOXA 4MWFB 4TWTA 4IEOA 4KKZA 1F97A 2WJSA 2NNAB 1B35A 1LKNA 1TTGA 2ZUVA 1UD4A 4GZRB 4X5XA 5AOMA 3T1FB 2OTUA 2VABB 4F20A 4XNDA 4H5SA 5J48A 4M9OA 3CEIA 1DVQA 1S55A 2OJEB 4K5PA 2ATPA 3FTZA 1HQ4B 5KYNA 1URLA 4O7XA 3MXWH 2C5DA 5E2WH 1BD2A 1CJYA 1DL7L 4RAVB 5F2FA 3ZDSA 3QUMA 4AEIH 3QCUL 5D1ZI 2BS71 2A1XA 3Q6GH 4FXKB 3MYJA 5AUMA 2QQKH 3QXAA 1J8KA 1PNMA 3WB1A 2BH0A 1ZOXA 2VXSH 3QI9C 1G5AA 3MACH 4CMHC 4KMQA 4XF9A 1NOVA 1QBZA 4OD3L 1MPAL 2J8UE 2FUTA 1NDGB 5KZCD 1CF8L 4OM0H 3IXTA 1ES0B 1VQPV 1ETB1 1MFEL 3T6VA 3V0AC 3ULUH 3UROR 3RFZB 2PWGA 4RA0A 4HT1T 1VBB2 4Y24A 3EHBB 3HPJA 5I76B 3D6EA 4PLOA 1YY9C 4PN6A 3TZVA 1MABG 2OIIA 5D7LA 4AQ2A 2ZIMA 1FE8L 1OAYL 1YO4A 2M2DA 1JDDA 2RV9A 3HR6A 4OI4A 5IW0A 1CLYH 2AQ3A 2DYRC 1JI6A 3NAPB 5DAVA 4JJHA 1LECA 4NUGL 5FA4B 5IJVB 2ZONA 3D82A 4DINB 1QSFE 2CRZA 2DTSA 3IMWA 2FKXA 4JI5O 3KNBA 4PJBF 3WINE 4NHUA 4X7EC 4HSJA 4XEZA 1GYUA 1TZGH 3CBRA 5DZGA 2DMBA 1G7MA 3HN1A 4ELME 3ASOB 3GMOA 4FNUA 1P4LB 4PCSA 1EHLL 1TME3 4HG6B 4XXAA 2A9ML 3QQ4A 4P2RD 5I8EB 3S5LB 1H30A 1JGVH 4Z82A 1X3DA 1YNTB 1WZMA 3VB8A 1QPKA 4FLVA 3MJWA 5MENA 2HUEA 3JV0A 1T5EA 1QHOA 3HHSB 4JFFB 2Q7YA 1WMXA 1WWWX 2CE4A 5F5QA 3D7PA 3BWAA 5DN2A 4N86A 3ZSKA 3V5HA 1IGFH 4QRPA 4J3BA 4C0HA 1MEC2 3TJTA 2RIKA 3LXUX 4JKLA 4DW2L 5FR3A 1Q9KA 3TURA 1ILSA 2IUWA 4FTVA 3HZVB 4KUCF 1L6PA 1C28A 3EVKA 5EA0H 5FXVA 1B0GB 4LF9O 2R1WA 4U6YB 4WFBV 1LE9A 4FEIA 1R083 2WM0A 3TO4A 4A7KA 1AR91 1XHXA 4NAQA 2P8PB 1PKXA 2DQMA 3FT1A 3KZ4C 5F9TA 2ZOLA 4LF7B 2JIXD 3LZQA 3SGDH 2QSVA 3B9EA 4OFKA 5E0FA 1WBXB 6FABH 3C6SA 1ZD6A 5FLHA 2OL3A 1OWWA 3MRMA 2ZS6B 1JGEA 3VE0A 2WO1A 4IIQA 4OFQA 3T8XB 1XL6A 4IMLA 1CAUA 3KLHC 1JXNA 3LSQA 4OD2A 4R3SA 5J1XA 2HKAA 1NU1H 2JKRM 3KXFE 4NQDD 4F7KA 3BOPA 3I2HA 2Y6HA 5D9SA 3K91A 3TCLA 2JEMA 3B2VL 4ZOEA 3POJA 3HKEB 5JW5B 2F23A 4GUPA 4FCHA 1LOBA 3WP3A 4UCVA 3D18B 2GT9A 3HC3H 4GQZA 4TUOB 5GISL 1FA4A 4Q4Y1 1I8IA 5B2GB 5ICYB 1UYZA 4NWTL 4PV9A 5T1KD 2V1DA 4YIQB 1HK6A 5HYSG 3FFZA 4HXAL 3HCVA 4P9HL 2AABH 4UCFA 3GSOB 1SHWB 3V4UH 3QW9A 1F9KA 1XSJA 2MCPH 1Z78A 4DV6B 1A47A 1DHKA 1KXHA 4UF0A 5J6HA 2R9RB 4FDWA 4IE5A 1V9PA 3APQA 4NNXB 2AJ3B 4NIYE 4RMTA 1P7QD 1JZ6A 4EI5B 1OSEA 4Z7WE 2DIBA 1RHFA 2DL9A 3R4SA 2OMVB 1C5IA 4LFCO 4XBEL 3E6HB 1SCSA 1WW5A 3IETA 5MHSE 1QYGH 2P7TA 3IS1X 5EDXA 3VMPA 7PAZA 1SQ4A 1M2VA 1QEWB 4W9ZA 5JMOC 4J6RH 5DEGB 4B29A 2FSEB 1TDQA 3O4LD 4DV1B 1GGUA 2DQJL 1NBZA 2RR12 1YXWA 4DR6O 1XGTA 4G6JH 4BZ2A 3F7VB 1K42A 5EIVA 4LF8B 4F3FB 1T1WA 1ZK9A 1NEZG 1VERA 3IGUA 3P2DA 5D55A 4F7PA 1L7TL 3GHEH 1P1ZA 3M45A 5ESVA 3BFRA 4GRLB 4ORGA 2JRIA 5FPVA 5CLZA 1FSKC 4A45A 3U1QA 4DZGA 1TZAA 4DS0A 2NY0D 4JFSA 2ERFA 1BYNA 3T4ZA 4YIPA 4JI0O 5DM6V 5IY5B 2NT0A 4P4KA 5GZFA 1TVKB 1RZ7L 2PUQT 4PIBA 4OCYL 2R8SL 3ULVL 3TNPB 4GCZA 1KULA 2QDVA 2J1WA 1XGZA 2LTQB 4U1HA 2ZIDA 3BX7C 5CXPA 1CN1A 1W8TA 2VH5L 2D6MA 1RXFA 3ARPA 4DUXA 3KPPA 1W3XA 4Q6KA 3K48A 1JYTA 4NQCB 2OYPA 2HEPA 1MRFH 1YPZB 4JFED 3H1JH 1MUJB 3GB7C 1OGTB 5LGTA 1IGYB 1Y6NR 3CVIL 5CM1A 4Q4W1 4CEWB 5IJ0A 1I82A 1K4CC 2JIZG 3GF6A 4N2NA 4Q56A 4KHXL 1K8DA 4LC1A 5B38G 3DO7A 2WNOA 1REEA 5FYMA 4NFDA 2YAOA 3PFUA 4U7KA 1YUDA 5FNVA 3LZPA 5T5NF 1W15A 4P05A 2GC1A 3QDMA 4QYOB 1JYWA 2B9UA 2X4PB 4IESA 4E36A 5J11C 4MS6A 3MRLB 2ZGNA 4D69A 4FKKA 1MSPA 3BPLB 2ZPKL 3CG8A 2DU1A 1DCEA 4ZTPH 2RFXA 1N5YL 4FZEL 1A7QL 1VQNV 4R90L 4BWUA 3MUZ1 2HWC1 5E2TH 1SA0B 1T89C 4HJJL 4E41E 1QH6A 5A7WB 3F01A 3OV6A 4N5ED 5B7FA 3PL6A 4AWJC 5CFCA 4HMCA 1XSOA 4ZW8A 3N91A 3W7XA 2DD8L 4JVUA 4Q4Y3 5E79Z 3N5AA 1FCCA 1OIOA 4JRYE 4OZFA 2H2PD 4GQ9L 3A67L 5HYIA 5IEKB 5I8YA 2XHNA 2YBGA 3ARVA 5EFIB 5A7QA 1V6NA 3O1SA 5BR8O 1NMAH 2YSSA 1QFWI 3G7TA 5I1DA 4PUBL 1OCRC 4DETA 2D93A 1B2WL 3H3BC 5CINH 5IEHB 1F4MA 4CBZA 4HKLA 5AZEL 1DJZA 5I5IA 2EIZA 4BE5A 4CC4C 3KLQA 3ZFGC 2DBJA 3WIFB 3FQNA 3FT4A 4PJDB 3PURA 2W9DH 5CIRA 4O4JB 3MI8A 3NW4A 4UIMB 3UEQA 1DFBH 4AQ1C 3HZYB 4B0MM 3NIGE 1CAXA 2R071 3WFHB 3F95A 4LE8A 4QPJA 1U58B 2AKRA 3O8XD 1K3IA 3R18A 2W6IG 1OXYA 3EH4B 3IBEA 1XXDC 4N5EC 3OVUB 2IJJA 4PJIB 3TM6A 5EOCJ 1EH9A 1OCWH 3GXNA 1W6MA 2XWZA 4CH5A 3AZYA 1URXA 1M06G 4WF7A 1EPWA 2H2PC 1DGWX 4Z77A 3F7YC 4Z2AA 1OAZH 1XH2A 3K75B 1G9NL 3DGGB 4JCMA 5D96C 2XR4A 2CE6A 3QAZB 3IM0A 1YN6A 5CLYA 4YNYA 1NFAA 3OKNA 1RUKL 3FO0L 4H26A 4MLOA 1UU6A 5I6XB 2XL7A 2I9LA 2BFUL 1ZHNB 5D4QA 4FQJH 4RFOL 2K70A 5IT2H 2DQ0A 4OTXL 5AQ0A 5A33A 1TJGL 4XNQA 1D0GA 1GZQA 3BVUA 3NGBB 4WFEE 3M6DA 5CEXB 4LPCA 4F92B 4LEEA 2IDFA 2ZGPA 5I18H 3WVJA 1X5LA 2X89A 5EU6B 1UJ3A 5D4JA 5IDJA 4UNTA 2JDAA 3V5DA 4YVWC 2HT4D 3V4PL 5JJEB 4Q4W3 5A2FA 3MTXA 4M7JH 4YR6B 1RUAH 2QTEA 5LHHA 3QXWA 1TJMA 3OJDB 4ONGL 4M4RB 4O00A 1FUNA 2C4FU 4TQDA 4MNQE 2D3SA 4XB8A 2DUPA 3ZRXA 3H9SD 4RWHA 1FGNL 3P0YL 2AEYA 4IT5A 4OPAA 3HUJA 3RL2A 3B94A 5FZ0A 3EBHA 5D7IA 3PGCA 2Z31B 3TOJA 5FF6B 3DPRB 1ORQA 2W38A 15C8H 4DPAX 3VZKA 1RZKH 7FABL 3S57A 5J1AB 1FI2A 2CLRA 3QJRB 4Y2DB 3UPRA 4KZEL 3S7GA 1SRDA 4PV8A 5GS2D 3QRGH 3S2CA 1SLXA 2EDOA 3CHPA 4NN6B 1UM4H 3WIHH 4D9QD 1ET5A 4XMWA 5BPPA 4RWYL 4YZFE 3X2QC 2BNQE 2FBRA 1NIEA 1KB5H 1DSWA 5DVPA 1OGAD 2VTXA 4XXDB 5D70L 4Z8FH 1Q6HA 1UOBA 2NQYA 4JI3B 1M05B 4IRZL 4MD5A 4LFHG 4MDJA 4F15C 3HG2A 3MN8A 1XMEB 2YD4A 1NLQA 1R3KB 2AAVA 2V5MA 3TBCA 4KBPA 5A1FA 1XQNA 2DEYX 3B34A 4K7PY 5I6PA 5H9SA 4CSSA 2MTPA 3U6RA 1VBD2 3H42H 1YIJV 4UIKH 4F5CE 3FF7A 5L19A 1ORSB 1TJIH 2A4CA 3GSWA 4QB2A 1MQTA 3ZO0B 2VQEO 4PJEF 4N87A 5GGSB 4ACPA 3ILRA 4H25A 1NVPB 1KB9K 1ZANH 2RALA 5AC91 3HNVH 2NX5D 4U1MB 4L4VB 1KBVA 1UN1A 5JPMA 3E9TA 3BSGA 4QRSB 4QPIC 5TQ2H 2XTJE 2QELA 3K72A 1UA6H 3VXRB 1LXMA 1HRI2 2Q8AH 3RWCB 1YQCA 1K33A 3GZAA 5IQ7L 2H32H 3ISYA 3LNNA 1KY6A 2D8KA 5IG7B 1N33O 3FN3A 5JYMA 1TZIB 4I0BA 4C4UA 1I1AA 5IVOA 4X6DE 3W0WE 4LEOB 1BP3B 1CJPA 1HT6A 4ZO7A 2DRUA 1CO1A 1MSWD 3JZYA 4NO0A 2VZRA 1JP5A 3B9KA 1D4VB 2QQLA 4X50A 2ZEXA 3BABA 2P8MA 5EZOL 4PJHA 5CYYA 1CLOH 3HC2A 2WNVC 1H4HA 2WWUA 5A2AA 4PGDA 1NGPH 4QTFA 4FQXA 5TISZ 1H9VA 3WOGA 3K2UL 4QKTA 3RVWD 3CPWU 1E8WA 3LKRA 4X4YA 1JFFA 3OD3A 5EBMC 4PQ9A 2R0LH 1U3JA 4MJIB 5E8DL 2QQKA 2R30A 2OR9L 3QYNA 2VDML 5EBWC 3OT7A 2F19L 2Y7QA 4EIGB 3DI2B 1IHMA 2ICCA 2MW2B 1ACYH 2O6CA 2XBDA 3O2DA 3MRCB 3VUAA 3U4SA 4I0XB 2YAPA 4BYHA 1HV0A 4I18B 2VLME 2RHPA 1RULH 4JMNA 2FL5A 5DHVB 1W2NA 1DO6A 1HKLL 1D5ZB 3MRRA 1YEGH 5C0CE 1IFHL 4C55A 5FZIA 2YRPA 1DTOA 3C3TA 3NSYA 1FGVH 1NGXA 4UNVA 5I1GL 5C6WH 1QO3A 5F88A 5AZUA 4QRQB 4L4JA 5BJTA 3K57A 4UOW1 2FE0A 5F6IC 5AFAA 1LGBA 1U30A 3GXTA 4JO2L 3FKSG 2HTKD 5I17A 2VD7A 1JNLH 1HAUA 3MREA 5DJYB 6TAAA 5IFPA 4DR4O 5EWIL 2IDSA 3A0BZ 2Q3ZA 5AKSA 3L4VA 1OAUH 1OOPA 3GKZA 2B42B 2GDSA 3SKUD 1F42A 4I5BA 5CAYB 1FX5A 4RL7A 5L2JA 2D0HA 5IJ9A 4ZTOL 1OP3H 1E5SA 1ZHLA 2Q5ZA 5EZWA 1RSOA 2LS6A 5A6YA 2NY5C 3FHIB 3O3UN 5L4JA 1UXXX 4GKOA 1NFIB 5I1LB 3OC5A 4PRIE 1VDGA 4H8WL 1HHIA 2XVBA 3V9EA 2AZ5A 2VXVH 4XBPB 3TBWB 1PTZA 5DJ6A 3I6KA 4K94C 1W28A 4KNQA 1V3KA 5D7EA 4E2GA 5DTFA 3CFDA 2Z6FA 1MAJA 5CJOH 1CICD 2WAMA 2C26A 2J8UA 1IKNA 4XWGH 4TSFG 4RGOH 3EMRA 4OF7A 4MMZA 2GJRA 1E5RA 2DWSA 4F27A 4JPRA 8PAZA 4J4PD 3BAJA 2I9TB 3HG1E 4Z5RA 2CAKA 4I7ZC 4LSUL 1SYVB 1TNFA 2ZHNA 5GZND 2Q8DA 3C7OA 2NQCA 2YLKA 3IMTA 2QVFB 3B2MA 4JV5O 4H0HB 4OJEH 4DK0A 2BPA2 4JK0D 3I2IA 4XJWA 1W0KG 1C5BL 1P6AB 4JHZA 4OFVA 4XPGH 3IU3B 3MBED 1QSFA 1XF5A 4LHUB 2A77H 4C1XA 2COVD 3VBHB 1IEBB 1P84J 1CZVA 2XJPA 4PDVA 3HJRA 5EJ1B 4OHWA 1JFQL 4XJZA 1Y4MA 3G71V 4FLHA 3MW4A 3QBTB 4ELMA 2L0DA 4I9WE 2WBJD 4WV1C 5BV7L 1KTRL 2B2XH 1E2ZA 1AYN2 5H9PA 4M29A 1TYEB 1P5UA 5F97E 2Q6WB 1DGRN 5JWPA 2B1HH 4FLUA 4TVPD 1JTTA 3QUYC 4L92A 2ERJC 3U4AA 3HI6L 4BW9A 3TNQA 1QQDB 4YHPA 4MW8A 2GTQA 2Z69A 1GH6A 4LSQL 1P8JA 4AQEA 3LWCA 5F3GA 1OM9A 3MGTA 1JI2A 4M6OL 2G30A 2Y64A 5AEAA 3FB8B 2ITCC 3HVNA 3HIZA 3MI6A 4UFMA 5GZNC 3WEZA 3PN1A 3M1BB 4NM4L 4ICWA 3GO1H 2WLIB 1H8NA 2H6BA 3VWJA 4Y1YA 3O3BA 2XT9A 3TL5A 4CN1A 2JG8C 2GQHA 2QFEA 1Z7S2 1WPBA 3OR7C 4O58H 2ZXAA 3ETDA 1JWSB 2EIBA 1F11B 4F33B 3GBWA 3H50A 2QDNA 4K6BA 1IJ9A 5LP6A 4AYUA 4JN1H 4LASH 3H2PA 4KNCA 2DQHL 2WBJC 2PO6D 4XCBA 1T1ZB 1H8TC 4BIFA 1G9BA 2CGZA 4MJ6B 4AYFB 3CLFH 4RRPG 4JRXB 3TIDB 3OGVA 4KWJA 3V0BA 5C0IB 3UP1A 5FZCA 1LO3H 2RR3A 3KXFA 3IJYA 2YHGA 3QO5A 3VSVA 1FL3B 2F17A 3UZVA 3BRFA 3ON7A 5D8AC 5IB2B 4XZUG 4TL4A 4CN4A 4I88A 3P3YA 1QLEL 2JKTM 5K9KA 1NE6A 4ATEA 4ONHB 4I77H 5F7FA 3ZDWA 1IAIH 2WNEA 3IDNA 2NW3A 5DYOA 2Y9RT 5D6DC 5E6RB 4FFGA 1UZ6F 5GSRA 4PJ6A 1JYIA 3LKNB 4RFRB 4G6ML 3QDGD 2ADYA 3B43A 2W0KA 3N35A 3NJMA 4N2BA 4Z7WA 5CKGA 3CDFA 2LAGB 1SN5A 1UZGA 2YD6A 4JFDE 2ZABA 2GP5A 2PO6C 1KLGA 4KK9D 3QEHA 4OCNC 4XNUH 3CC7V 1INDH 4NWUH 2FAUA 4JGUA 3BEWB 4N9HA 2RGSA 4GAYA 4KUCD 1SY6H 3GSVA 3QZWB 5ETUA 3SCGA 1A4AA 3F05A 1YFUA 2YY1A 2W07B 5GJSH 1W0WA 1LGVA 3MFFB 1BZ9A 1KLFA 3BODA 4I3SL 1IBDA 4OZGE 3MGUA 4ZT1A 2X53S 3IGAA 2ZOOA 4N24A 2FEDC 3DOIA 4NCC2 4CA4A 3WUDA 2PABA 2HYKA 4IE4A 1I5XA 4JFQA 2AHIA 1FOD1 5IUCA 1SDDA 5CVRA 4SBVA 5IE9A 4R7LA 5HSFA 1GP5A 2XLLA 4PRDB 1P7GA 1NCAL 4R97B 1YDPA 1QVFU 3ZL4L 3QCVL 1IUZA 4TL5A 2VW2A 1PEZA 4YXHL 3RSJA 4WEBH 5KXCA 3BVOA 4LESA 3H1KH 3WU2Z 3KZ8A 4I2OA 1GSMA 2CPUA 4P4RA 4LSPH 5AOIA 1F8TL 5C0NC 5GRVK 3RI5F 1EANA 4GH4A 2NDFA 4UFHA 1KKDA 3ECVA 3N41F 4OKVA 4A5UB 4DV7O 1FL6B 1KYFA 2ITDA 4AIZB 1ZTXL 3C6LA 1OV8A 5JQ6H 5IB4A 2A9HA 5JNYA 5BXXA 3R4DB 3IU4H 3D8CA 4ZFZB 5C3LD 2VRAA 2VVDA 3EH3B 4ZXBB 2DM7A 1G7HB 4IRJA 5HI5D 4O2BA 5KA5A 1HJGA 3ARRA 2RM22 1JUHA 3ARBD 2X2YA 3VBFB 2WYHA 1IS6A 2IANE 2KKWA 3DMMA 1XR8A 5CIPB 2X3CA 4YDZA 4MZUA 2JJSA 4P9ML 2WBWB 2FNBA 3H9HA 5EC2B 5IMKA 2BFVH 43C9B 1KJVA 1W8FA 1OVSA 3JWNE 4KBBA 2M7WA 1GGCH 4B9YA 2Q30A 2MPAH 2F53E 2XWJA 1N67A 3GPEA 4RHV1 5FGRA 4Y5YA 3EUUA 5CWSA 1KENH 1P4UA 4XN9A 1RHI3 1XDTT 3QIBC 4FFYL 4E41A 2XKPA 2ZDIA 1OLME 1D5AA 1ID5I 4JFYB 3REVB 1XNTA 3WNXA 4LPUA 3NJNA 2HPOA 4GLRI 4W6WB 5L8JB 3BGMB 1AKJD 3VFTB 2ZKNA 3PV6A 4JRYA 2F6AA 2Z92B 4I09A 4LCWB 4JGZB 1LTXA 5CKNA 3UCRA 4Q1RA 3K6IA 5FDWB 3RWDB 3S35L 5HPMA 4KTEL 3ARBC 4U1SB 4NKGB 4FEMA 4LVHB 5KUKA 1T66D 4LK7A 2R2HA 2VISA 4MA7H 2ZCKH 2R9HC 2Z4FA 1M56C 2JJTA 4TWKA 4R0LB 4K4KA 3CFKA 5DQJA 3EJYD 4EVNB 1NBYA 1RZFL 1XIWC 1BKZA 5CKAA 1UXMA 2BOBA 1EAQA 3UT5B 1TVBA 4NKOB 4XIOA 3D85D 4H14A 3SH5A 3PGDB 3OEEG 1IC5H 5CEZD 3C08L 3G3LA 4UT6H 4X0KB 1G7YA 5AYTA 1S7SB 2B4CC 2NXZB 2Y72A 1U8CA 1TQSA 4P49A 4MX3A 2I32A 4Z76A 4F2MA 3D12B 5HHVH 3VYNA 2BE3A 2JVUA 3U4KA 1UKRA 4WWKB 3WN5A 3SXWA 2DJSA 5DGRA 3WIHA 3JWNH 2XN0A 2BP8B 1IMHC 4LHKA 3UJJH 1TQBC 3E1ZA 1FRGL 4MMYB 4PJFF 1HZLA 3UO1H 5IHUH 1R3IC 3BCCH 1K5NA 3WUWG 4JQRA 3WY6A 1FVCA 1G4RA 5TPWL 1LUVA 1MI5D 1OZUA 1UW8A 1UEYA 2AJXL 1T66C 5E6IA 4QE9A 4AIXA 5BXFA 2X10A 3O4OC 1QJU3 1HQNA 2X53A 3QEQD 3AGWA 4CILA 4A7ZA 3AWFA 4IKNA 3LX9A 1Z9PA 1VIWB 1H9WA 4WFEA 4DGVL 5KYUB 1I9RA 3MJ6A 4D0DB 4NZTL 4GD4A 1BK1A 1Q8VA 2ZX0A 4KU1A 5DD5L 1T7XA 3ULAB 1NAMB 4M7LH 2WZ8A 3AYCA 3ZXJA 4GKZB 1QY4A 1CGXA 5CZVH 5E5MB 4BA0A 4ATFA 2YRZA 1RZIA 3WYRA 1GNYA 4MNQA 2YJLA 4CW1B 5LGHL 3EUDA 2IPKA 2LAAA 4B8EA 1M4WA 3S5ZA 4LLQB 5EZJA 3MLTA 2R062 5A32A 5LCVA 1Y6MR 3G04B 1GQPA 5D6CA 4CC1A 2L7QA 3JTBA 3V5KA 4MLIA 1EZUA 3CX5F 2GFBA 4YDIH 4RHV3 5LA1A 2DH2A 1Q9LA 4DIQA 4WM7A 2D3NA 4XCEA 1HRV1 4LTAA 2H32A 4WO4B 4HLEA 1GQGA 4Y1UA 4U6XA 1AOZA 4DERA 1ZX5A 4XRCB 5H94B 5KYYA 5D5QA 3WDHA 3UETA 3SE8H 4HLTA 1TZHA 2UUBO 2BNQA 4NQVA 1N4CA 4QO1A 3B7RL 1A5FH 3P3TA 1X5ZA 3ABMB 2A6JA 2OIGA 1FV1A 3MXVL 1CXKA 4FFBA 3VL8A 3AG1C 1GN2A 2OXHA 3CHXA 3HKZA 4GFTB 3I9PA 1OAXH 5DF0A 4WI4A 5E2VL 5ALBH 3GJBA 4ELDA 3NVQA 3OSVA 2BM3A 3FU7A 3QFJE 3H8RA 2AH2A 3C5JA 4JFWA 4YGAB 3ZE0B 2BOJA 4MOAA 4I3PA 4F5CA 3T3MB 3RDTA 4OCXH 3TESA 1RSYA 2IAMA 4D9LH 1IM9D 3RBZA 3R06B 3QDJD 3JASA 1FNEA 4WVRA 3D0JA 3MF9A 3P0VH 5IATA 5MI0B 3SDCB 4MXWB 2CK2A 1OO2A 3Q8BA 4X65O 1EHNA 3P77B 1TVHB 3OBAA 1XZ0A 3SY6A 3J4UH 1JTOA 2F7QA 5BS0E 2J88H 2YD8A 4P2ZA 5KX5B 3CFUA 1PIV3 5I0VA 1VESA 2XUWA 3HN5A 3QRFM 2PW2A 1IVTA 3W20A 3J26N 2V9QA 1CG9B 3DN7A 3CDCA 3U9PH 4ZU7A 2X0UA 4ADJA 1E27B 1L6ZA 2BP0A 3I6SA 3MRDB 2JJ6A 2UWBA 3EYUL 4NQUA 5C09E 1C16A 2QQJA 4UV9A 1TME2 4XTPA 3VGIA 5A1LA 3UTZB 3OKLA 3B4SA 4XXCA 5IFAL 4FFZH 1KJMB 4YW1A 1JXDA 1OK0A 3D2UB 5B3NA 1ZCRA 1JPGB 4RVBA 1XNKA 1NGYB 4GG6F 3E80A 4JDTL 3SPHA 2P24B 4X6DA 4ZBJA 3W0WA 1VQ9V 5LK7B 1HXYB 3KWWB 2BLFA 4JY4B 2A9NH 4H8HA 5C0AD 2KXLA 3Q3GA 2XLGA 4UI2A 4IS6A 1E3ZA 4Y16B 3FU6A 2W60B 4P2QB 5DUML 1UASA 4OUUA 1WD3A 4LMQE 4HZAA 2CNZA 1CTMA 3LIGA 4OI0A 2ZNWA 4IK6A 5DJXB 3C09C 2EXYD 4I2XE 1ML0A 3ZIMA 5DU7A 1BVVA 1I6XA 4I50A 4HJUA 1LP9F 4F1ZA 1YQ8A 1E40A 2AXGA 3E38A 2X4RB 4CSTA 5EJ3A 1A8JH 1KYOJ 4CDWC 2GB2A 1J18A 3BN3B 4CC6A 4HIPA 4HAGA 3J7HA 4QHUB 1R3JA 2JDKA 1LE5A 4OI1A 3KYMB 1KCVH 3EOAB 4QX1A 3VTMA 2EXKA 3RG1C 2DTWA 1ITBB 3FT3B 1ZLWH 2MNWA 4N2EA 3P30H 4JM0A 4LRIC 2F2HA 3APMA 4HV8A 3IE9A 4UAOC 5DQDH 2OI9B 2CNYA 4GI6A 4H2CA 4JG5A 4JM4H 4Q8BA 3MLZL 4CVXA 4UCOA 4ZS7L 5DS1A 1DJIA 2YIDA 3NSCA 1TVGA 5C0CA 4BQ2A 5AVPA 2ZGLA 5DABA 5GKAC 5K0UB 1EEUA 1PJWA 3P4MB 3FTWA 2GC3A 2WWJA 3BH8A 4OMDA 4I4TA 1SXZA 4Q4EA 2KERA 3MYZA 3ETSA 1URFA 1S8DA 1T1YB 1P2CB 2EXYC 4HJ1A 2DJ4A 1F1DA 3WL9A 1B4TA 1A6CA 1DVFA 2ARCA 3WR0A 5C3QA 2UV3A 2K8QA 2UZXB 2LGNA 5J1TC 1U8HA 3ZHDA 4R4NC 3GLAA 1YHFA 2A3XA 2OZJA 2WWSA 4XTMA 3UAFA 3DROB 5EUOE 3TA4D 4AUJA 2V2XB 1A6WL 4YSEA 5FMCA 2VLKE 5FO9A 1MNUH 3MRHB 1EHXA 1MCIA 2D4DA 2YAHA 3KLSA 3EQEA 3VFOB 4D8PB 2NY7H 4DESA 1LHVA 5FY4A 2BDNH 2OP4H 4LLWA 1E1QG 1FFRA 2HRGA 2QV2A 3BRCA 1N3NA 2FH6A 5MEPB 4HONA 4LLDA 4KNSA 5EORL 2XQYK 1XGYL 4AYID 4CXWA 1CT8A 4PRIA 1PDKB 3BJLA 4YL9A 4CU8A 1RUD1 3AM8C 3B2EE 5IK3A 4JAAA 2UXBB 3S35X 1R64A 3N9MA 2EUWA 1NJIW 4B4PA 4E27A 3TBYA 1GGBL 2VMDA 4X4ZA 1NCQA 2N4IA 4NROA 4UQIM 5FRAA 2XHBA 2WXHA 1CEZA 3VXUE 5BNNB 1F0LA 4X6EB 5EIIG 2QBXA 1OSZA 1QFWH 1SVBA 4HBCH 3NNGA 4JYCA 3FO9B 2OMXB 2IQAA 3C3VA 4H88H 2R4SH 5DLMH 1JWUB 3BAIA 2P9RA 1XCQA 3E86A 3JALA 1W0VB 2F61A 4O4HB 3D39D 2HVKA 3HG1A 2X6CA 4H20L 5SX5H 3T0WA 4YHKH 2IO5A 4HEPG 3SGIA 4TT3G 1M71B 1W72L 4W50A 1E6JH 3NIDF 4G42B 3SBPA 5F2VO 2AQPA 2GJZA 3H7BA 4XNXH 3KBFA 1WUNT 3WHXB 4JYYA 4N9OB 4XMKH 2J1UA 3LD8C 4ODUB 4WWID 4ZY9A 2K4AA 5EZPA 4KY1H 1I7ZA 1OF2A 1ZIAA 2JS5A 3QWQB 2DWEC 1HCZA 5CGMA 4I9WA 2PPCA 3AS1A 4M00A 1EV11 4IEVA 1J11A 25C8L 1MN4A 2G9FA 3MV7E 3N9LA 4YOKA 3FCTB 3ZFFB 4CNIB 3T3PB 1AR92 5DZOA 5TGBA 3B7SA 3HE7B 2QJVA 4GXUN 5E1AB 4K20A 4X1YB 1JV5A 3DRQB 4ALAC 5GW7A 4D6SA 4FNTA 1BCXA 3PVNA 5JAXA 3NAAH 3RQ3A 3UOAB 2DY2A 3G5YB 3VFNB 4N8PA 1RU9L 5H2BB 2DFBA 2DLFH 1UZWA 1XH0A 4MRCA 2QNKA 1U3HA 3I75B 4ONFH 3U36B 2R2EA 1GHFL 2XJKA 4DV5O 1R6VA 4JQVC 4F6RA 1UACH 5G4OA 3LXCA 2BUKA 3I49A 2P3KA 1SY6A 2NTFB 1CR9L 2ICWA 5IYCO 5KJRH 1I1FA 3NACH 4NGHL 4IRSD 1TUBA 2EVXA 2KA3A 3D09A 4PDWA 5FPUA 1S0FA 2QVSB 5ID1B 2WINA 4Q4Y2 1TR7A 2WZR1 3IJEB 4GS7C 1J1XH 1HEZB 3K7UA 3VVWA 3QG6B 3PWPD 4B95C 3QJFB 1GUIA 4XP6L 4RSUA 2AV7B 4MTFA 1F35A 5E6YA 3VQVA 1SMVA 4HIHB 3WQ1A 5L3FA 4XVUD 4EKXA 4QXWA 2EXTA 3UTPE 3ELNA 1EPFA 4P5SA 4X64O 1G9MH 1QVOA 2YFNA 4PJAF 3W9AA 5C6TH 1F4WL 1QUNA 3CHSA 3S48A 4FOQA 3W39A 3WFVA 2LU7A 2O6DA 4IQHA 4TPRL 2W5FA 5L9RA 5IB5B 3SD2A 2X0LA 1AVAA 1IT9H 3EYFB 3GF8A 5FO8B 4JZNA 4Q0VA 1A7PL 2DF3A 4P5TA 5BUVA 1RM1B 1VEOA 2CDEA 3MJ8B 3HOGA 4IRSC 2MOQA 1FN4B 1RUD3 3NL1A 1IC1A 1JIBA 3FQUB 1I8AA 3IAPA 4NRMA 1CAWB 2WAHA 1YNKH 3UMNA 2R23A 4DNLA 4ANWA 1SXBA 3QP3A 4ADIA 4DEQA 2E6PA 5LGJA 4JFDA 1QBMH 2FJFA 3EJZC 3VM5A 1B35B 1QR9A 5IJDC 2DU0A 1ASPA 4N6RA 2ZHKA 4X5XB 2Z8SA 3RWHB 5FK7A 4GBXD 3VBOA 3CUPA 3RWEA 1TTBA 1ZLDA 4QHLA 4QX8A 1U97A 4LKCA 2AEQL 4NZUL 1PO21 3OQRA 2YFZA 2XQRA 4OZGA 4M61A 4LBQD 3B6SA 3IFLL 4G8GD 4OGAD 1JS9A 4XYXA 4X7TA 2ZYSA 3CLEH 1BD2B 3M70A 5ILTH 4IW3A 4OPHA 3CZGA 2R0WH 3QUMB 3IRPX 4OQ8A 4FULA 3ZGIA 1T83C 3L7FA 5AUMB 3ZS8C 3QXAB 2I2SA 2AANA 1AZVA 4L3AA 3TN0B 4ZYKA 5EDSA 4Q4W2 5CFDC 1EV13 1UIKA 2X6VA 4HCIA 4XCFH 3EO9L 5FCUH 4AVTA 2C9KA 3SGKC 5D2LE 3VCLA 1PZ2A 1HC1A 3IXTB 3HS0C 3GIZH 4B9FA 2GJ6E 2EZ0C 4CCOA 2XQYA 4K7PL 1QU7A 1JPFB 2NW2B 2FO8A 2WD0A 4FQ1H 4OIBA 4HBNA 4PLOB 3RUGF 1MS4A 2VERN 3HQUA 4UT5A 4AR2A 1MFDL 2WWOA 4HUKB 4GBXC 4JYBA 4N5UA 1HZKA 3QTCA 2X3AA 3QD6A 4BRVA 4M3CF 5I23A 4HSAC 2EXSA 3BSZH 2HWC2 4PRAB 1LODA 3SJVD 5FYUA 1NLBL 4DEVA 5KSVA 4QDRA 3CC4V 3VW3L 4XF0A 4XMAA 1VZIA 2YSTA 4EN3A 5ANHA 4E4ZA 2N74A 4NQEE 1G7MB 4UT6A 2IANA 4DP8X 5F96L 3GMOB 4AGGA 1YYMH 4X5WA 5DG2A 1PQZB 2UVFA 4HAFA 4YEFA 2Z0UA 2B3RA 1MCLA 4PIYA 5HHOD 3MR9B 1FORL 1ZLWK 3IPVB 3TIEA 4GKNB 5J7CC 1COV1 2Q7NA 4A1RA 5DJ0A 5C0RL 1N1VA 1M7DA 2F53A 4OF5A 2UWEE 3BXNA 3DO4A 4KTGA 3OYWA 5A2QN 1MVQA 1J12A 1HX6A 4AK2A 4W4OC 4AVVA 1LULA 3UPAA 4QXTA 1OLMA 3DDGA 5JOXA 3ZZLA 3ARFA 1XMWA 3QISA 4OLEA 1OQOA 2EH7H 5E8PA 4HVOA 1F13A 2E0PA 2NY6D 3LZRA 2K0GA 3BP6A 2R072 4HOOA 2R1WB 2F58L 2XWRA 4ZUSA 2MHAA 3LAFA 4WBNA 1F2NA 1R5VA 2ZWYA 1W39A 3V52H 1WIPA 4DVRH 2HYXA 1H19A 1NUDA 2ODHA 5HHQA 5MP6H 5GGQL 4KI5M 2ZE7A 3A4DA 4W6YB 4IBZA 5D7KE 2XG3A 3KM5A 1CDIA 1IGTB 2V8MA 4N9GB 4QGTA 2BHZA 1HIML 4HYOA 1XNRO 3MRMB 2L9LA 2BEOA 4ABQA 1JGEB 2OX5B 5DURD 12E8H 1VGKA 4HOMA 4CTEA 4DO0A 1D6VH 3MUGA 3TEUA 5C0DB 2HCZX 4FL4C 4K9EC 3ZE1E 1AL0G 3O11A 3F7PC 3OBZA 3EH1A 3UKMA 3TZVD 2KL6A 4K8RH 5D7LD 3D0VB 3TCLB 3B01A 1PO23 1NGZA 2L7UA 1WZ1H 2F54E 4XAWH 2GT9B 4ZNCD 5LMNB 2PWEA 1NBVH 1PD3A 1NDTA 2XXMB 5FYVA 2ZXDA 2R7EA 4PV9B 4WJ5A 2PYEB 5GLZA 3I2OA 1PPIA 2NY6C 1KBKA 3HCVB 5PCYA 2ARJA 1SBFA 4XPAL 5FCCA 2XZAH 3RWNA 4CDXB 4MB1A 3VO0A 2JKIS 2ZG2A 1BZOA 2XN1A 3PWVA 4OLYL 4NENA 1YC8A 3SE9L 1DHKB 4YK4C 2B4KA 4NIAA 1B90A 4JI6B 3BCFA 4GULA 4ODSL 3N3EA 3JV4A 5L0QB 4O4IA 1FFOA 2OWOA 2VTXJ 3Q9OA 4L4TD 2CKBH 2XRAL 4XMTA 4TVSa 3N9PA 3NP4A 5MEND 2ZR3A 2P7TB 5HDBB 3I6GA 1M2VB 2Q1EA 3GZUC 1T3FB 4AXOA 1H5BA 4FHKA 3SJCC 1RIVH 2E51A 5FZBA 1NBZB 1X4TA 4DR3O 4XQDA 4KV5E 4MVOA 4FK5C 3IJSA 5FZHA 5FA3B 3W9DB 4G9DB 3QUZD 5F21B 4FS0A 1QSEE 1BZWA 1T1WB 3BW9B 4E0RB 4FTVD 1CCZA 4P5RA 4F7PB 4MLSA 3AP7A 2DN9A 1CDYA 5E1HB 3PGFL 4PY8J 4D2NA 1DVSA 3DPBB 3TO4D 1P5VA 3P9MB 2J20A 4EUPG 2H26B 1WGVA 1QW9A 3RWFA 4XOGA 4WK0B 1FNGB 4DKDC 3MIHA 1E6OH 3KYAA 4E4DX 4J7KA 4P4KB 3US1A 4OHZA 1JVOA 2J1RA 3IDGA 1T22B 2AK4E 3HTLX 1ZVSA 1COV3 4G70B 4D9RE 3RPIB 2J12B 3T4YB 3VXTA 5JPNA 1MHCB 3MNDA 4UMSA 3L2MA 5IMLA 2X9YA 2J6EH 4P02B 3ML0A 5FK9A 1FIGH 3SCMB 1CIWA 3ABZA 4NO2B 1BYHA 1KFAH 4JQIA 3SY0A 1QG3A 4G8FA 4QCIA 5EOQL 2XKNA 4YW7A 2BX5A 1QD0A 1WWAX 3QUZC 4N53C 3BDXA 4N2FA 4NLHA 5AC92 4AEDA 4F8PA 3GSUB 3W37A 5FNVB 2EACA 3N7JA 3N2KB 5L36A 1K12A 2IOIA 2HFGH 3VYPA 1L0QA 3ULVE 3QFJA 3D2TA 2JEXA 4J28A 1K6QH 5JQGA 1OT1A 1VF5B 2EBOA 1N0LA 1WSST 1ND3C 2D9QB 3SDDA 4NWTH 1EERB 4L8SC 4UBHA 1BMV2 1YAIA 4X8JB 4M1GL 4HXAH 3RI5K 4P9HH 5AD0B 5BO1H 4JI7B 4WFFE 5TD4A 4HPKA 4QXCA 2BY1A 2EX3A 4ES8A 4Q2ZB 3VFMA 1OLRA 1NGQH 4LIQL 2GSGA 4R5VA 1S7UA 4ETQA 5CFCB 2G60H 1N0XH 5DMKA 5I26A 5BMVA 2VXQH 1ZT4A 1HTYA 5DLLA 2DDQL 5BS0A 3P30A 5D1XE 3TJPA 4F8AA 3PNRB 2FZ2A 4RQEA 2WTPA 3BKYH 4IHBA 4DN3L 3UGHA 3VA2C 4QDGA 5MEQA 3QNEA 3RFRA 2W92A 2YSSB 1MJ7H 3ZN6B 4XCCH 1REDA 5C09A 1AJNA 4Q20A 3ZDYE 1WS7A 2A74C 1I3UA 4XNZC 2VAJA 4MNHB 5AALA 4HKWA 3WIIH 4QKXB 3MLKA 4X62B 3F7KA 2DQIL 4HH9A 4L87A 1VQ8V 2ARHA 1RVFL 4RAUB 3FT4B 3OLGA 4XP5H 2HXAA 2Q1MA 4C4KO 2Y36H 1BQHA 4C54A 1KEGL 5IB1B 4J8RA 1FG2A 1CAXB 2D7TL 5FUIA 5BQDA 1A6ZA 4E5XA 1RYYA 4GSUA 4UQ2A 5C4WC 2ED6A 4Y4YA 4P04A 4IGBA 3QI9B 3Q6FA 2ATKA 4PJCE 3VSUA 1MJJA 1W6MB 1BAFL 2UUDH 1GMMA 4FADA 4AGMA 3NZSA 4G72B 4I2XA 4IBWA 3RAJH 3BWSA 2VH5H 3HBGA 3E22A 3V0AB 3AU1A 5E7FA 5JVDB 1URIA 3RNKB 5GLVA 4FQIL 2PI5A 4BSWA 3QDMD 3SISA 2AEIT 4EZHA 4A2GA 2IDCA 3OKNB 2NR5A 1OI6A 1RUE1 1KWGA 3BTAA 1G9CA 4JJOA 1IURA 3DTXA 2KH2B 4U1LA 1N9PA 5CBAA 3WDXA 5I71B 2NUTA 1FXKC 1TFHA 4U2ZA 1WT5A 5A33B 4FQLH 4H1LB 3TWCL 3ZYJA 1THAA 1K3ZA 5FYJD 2D0FA 4WHYH 4TUYA 2ZE0A 2BZDA 3PL6D 4DUZB 5CD3B 4HZLA 1VF7A 3BZFA 4J27A 3UTQB 2P28B 3NSJA 5FZ9A 4XAAA 1EX0A 1ZL8B 3FB5A 5FFOA 3LKQA 2WFF3 1OLQA 5KZCB 2QTOA 4XMPH 4QMEA 5FZMA 3SDXE 2GTZA 3RL2B 4TTDD 1XEDA 1AD0A 4FG6C 3DSNB 1WA1X 2VDLB 3PGCB 4NHKA 5EUOA 3EO0A 3D3IA 2J5WA 2VLKA 5HPOA 5T5OA 1CLVA 4B97A 3D1MC 3JB4C 2CGNA 3PP3K 5M94B 3U9UB 3KCPA 4TV9A 5AYUL 4W9IC 1A8ZA 1KB9J 2XDHA 4G8IB 4R4FH 4YPGA 3ZQXA 3V4VB 3JU9A 2LFRA 5B1BC 1OHZA 1P7KB 5FKPA 5IKCB 1Z5YD 1UD3A 3PL6C 1JZGA 3NTCL 3C9NA 2GY5A 2IVFC 2DTML 1XE7A 1IIIA 1OOWA 3JSNA 4JHBA 5F8QC 1NAKH 1CGUA 4R7DB 4TF4A 1PJ9A 1EHAA 3ZYHA 1NCDH 2EH8L 3VXUA 3G9VA 3VVVA 1U8NB 2DH3A 2IDTA 2X4TA 3B8MA 4FPJA 4OCWH 3M3EA 1E9QA 3C90A 4TTDC 1VPOH 3VHRA 1JTPA 4XN7A 5IV2A 3KLAA 2OMTA 1HR0O 3U10A 4FQPA 4OFYA 1MQTB 1LK2A 4TKWA 5FLUA 1PLGH 2WUBL 1RZJH 1N19A 3FO0H 2HN7A 2IWKA 1MLCA 4MW3A 5T3XD 4EIZC 2X4NA 1JD7A 4DEPC 4RMQA 4YDVA 3Q8FA 4KVNH 2ZHMA 1X5YA 2G0LA 4Z23A 3ZHFA 4WVVA 2F6BA 5JPMB 3KQRA 1RFYA 2QTVA 3BUIA 2VC2B 4POYA 2X40A 2AMUA 4DR7B 3K72B 3MV7A 2XOKG 4H3WA 1HS6A 2BNUB 4ODWA 2AXJA 3ET9F 2YIHA 1BOGA 2XJRA 2FZ3A 1BFVH 1LO4H 4YY3O 3N85H 5C0BE 3ZE2E 4EZ4A 2APFA 1I9IH 1RUE3 3PHOA 5ABDE 2FT7A 2HKFH 3P3SA 1AR4A 2NNFA 3MW2A 1GGTA 1BXUA 1XCXA 4UDUB 1AGDB 4R96B 4GAFB 2F4PA 1JNJA 4P2AA 4PJ8A 1SFNA 3D36C 3CZUA 3C87A 1OKOA 3F58L 1RHI2 1UM6H 4G7QB 1Y76B 1F3DH 2DB8A 1XF2B 1K97A 4LO7A 5CEHA 4F8OA 3CSFA 3B9KB 4HPHA 1ZM1A 1PFCA 5TFSL 5LBSH 2HRPL 4RRPM 1VQ7V 3EJRA 4FHJA 4HAMA 1UT2A 4IDJL 1HXS1 5FJKA 3K06A 3QE5A 4E9LA 3FQ4A 2P6HA 5DVKA 2ZP8A 1Q1PA 5KVMC 1G6NA 3WY3A 3LKRB 3GBML 3F7LA 1L0XA 1XF4A 2GBOA 3W11C 5FYTA 4L5FL 3W3BA 1MCEA 4XDQA 2CBOA 1TUPA 4HKXB 2QADD 2A3TA 1L7RA 1UZ0A 1AI1L 2OKMA 4F2EA 4Q4V1 5JUEL 3GB7B 3HA0A 1QNMA 5A3UA 4N26A 3AQYA 3VZJA 3ABTA 3LH8A 4JCLA 5E99L 5SWQB 2FL5B 4G9SB 2H9GA 4TLFA 5AL8A 5BMFH 2JB4A 2RQ8A 1EZSA 5I0YA 2NOYA 4I02A 3FRPG 4Y4HA 4ZUVB 2F68X 1EVTC 1ZZBA 1H3TA 5DJCA 4FQQA 1NH2D 1CFNA 2G5BA 2UY7A 4J3OD 4RDQG 5J11B 2XXZA 3O9WA 2MQGA 3BSZA 4Y5VC 2EEFA 2PCPA 1YQVH 4XCNB 5IM7A 1PY4A 1FOD2 5EF3A 3GWKC 4GXLA 3KYKL 5I17B 1KD1W 3S5AA 3N2GA 3MREB 3BQUC 4NXKA 1KIRA 4LA2A 1JGUL 5I0SA 3M99B 1W6NA 2H3NB 4MSWA 3VACA 5T1LD 1YA5A 4YM0A 1UM5H 1S5HC 3CC1A 5LL6Y 2ZOEB 5CMAB 4I5BB 2FCTA 4ZO6A 4Q0QA 2QADC 2GPZA 1I1AD 4LNVA 2YAQA 2WZPD 1UCBL 2ARAA 3V0DA 1UY2A 4AI1A 3AACA 1MQKH 1JCHA 1AHWA 2EXWD 3H2WA 1K34A 4HIXL 4NO0D 3BJ91 1O5DT 4GPVA 2OULB 1BA9A 2CBQA 3OLDA 4QT5B 1GYKA 4LARL 2PWHA 2P1YA 4ZIBA 4J2QA 2YPDA 3VRJA 2P8LA 2YZ8A 2CTWA 3M8OL 2GBVA 4NO5A 1EYBA 3I6KB 5IT9N 1CGVA 3MBWA 3IVKA 4FQXD 2B39A 4J3OC 3H1YA 4FQ4A 3GSNB 5DTFB 2CK0H 5JOFA 4JC1A 1F6LL 3ZFGB 3X13A 4OF0A 5FWJA 1P6FA 1QTSA 5HYJE 5D2LA 2XWTB 5LGUA 5GS0L 3L9JT 1J86A 2GJ6A 2VQUA 4MMZB 5DD0L 1AO7E 4IKJA 5EZOH 5CNAA 4WNQB 2J3SA 2IPUG 3GM8A 4HXBL 4HOXA 1QPXA 4Z5RB 2UY8A 2C9XA 2HWF1 1ND2C 3U4XA 1U3ZA 4RHV2 4FIPC 2EF6A 3ULUD 4LF4O 2CRMA 4I3RL 4QAWA 2BW4A 4WTZG 5HI3D 1MXDA 1GMEA 2J1TA 3F7YB 1XF5B 2WLHA 3TYJA 2OR9H 2PPDA 5H6RA 4H0LC 4L29A 3TA3D 2PXJA 2MH4A 2EXWC 4R9AA 2B5IB 1IVLA 4FI9A 5E9DE 5CCKL 4NQEA 3ROOB 1WHPA 2V5YA 1LOFC 1JMKC 1AG0A 4HF5H 5F8PA 4ASUG 5I74C 2IXLA 4ISRA 5H4ZA 2WT1A 5BNPA 3CJIC 3T1HB 2D3PA 4NN7C 4MSVA 1URZA 3ZYFA 1PNKA 1ZTMA 2DIJA 2PGGA 1EMTH 3OUFA 3AQZA 4UV4L 5E4OA 4CRPA 2W87A 4NP9A 5LW9A 1B3QA 4YHPB 3JD0A 2UWEA 3NESA 5EC1A 5I1GH 1LHWA 3ILDA 2V4LA 2KG7A 2WPDG 1XREA 4S1QL 2AQTA 2FHRA 5CJQH 3FC0A 3VBUC 2FK9A 2W88A 4YVWB 4P30A 1SVZA 3LGRA 4ZODA 3LQZB 5KAQG 5I9QB 3CVHB 3EBAA 3FT2A 3HG3A 4HUXB 3WQBA 4YDKH 2K6WA 4JM2F 4M7KH 1SJHB 3G9AB 1B4JH 3ULUC 3IPEA 5HI3C 4DV2O 5HGAB 3POGA 5BRPA 2A71A 3ZDXB 1WD4A 4NLAA 2XPGA 3TA3C 1RUC3 4A6YB 1T2JA 3PUIA 1NL0H 4FPHA 4LIVA 5FYCA 5CBFA 3K0WA 1UZYA 3CRMA 4YHLL 4PRBA 4Y8AA 3FQWB 1GTFA 3JCZA 4FLTA 3D05A 3D3VE 2Q8OA 3IBOA 4XZPA 5H37H 3AITA 1SQ2N 2Q68A 2VR6A 3FAVB 3VXSD 4LFAB 4P3WA 4N2HA 1D2SA 4N43A 2VMJA 3IJYB 4NPYB 4GG8A 3BDYL 3RILA 2VOWA 5IW1B 3D0AA 2W1SA 4W4KA 3LPWA 2F54A 4WCEV 5AG9A 1A3LH 1ANUA 4HVQA 3AB0C 3LS4L 5K9KB 2LJ2A 1YIPA 1VACB 1QSFD 4LDLB 5IMOA 3PUQA 5FZAA 1S7TA 2Q5TA 2J6EA 1S3JA 2NW3B 3IDNB 5DHMC 4AZ8B 4BFBD 1UD5A 4LHLA 1I9JL 2GY7B 1WAPA 3D33A 2ETNA 4E2OA 5GSRB 2AR6A 3IAQA 4WBBA 4HD5A 5C33A 2AJVH 2HLFC 3CIAA 3ZL1A 3TT3H 4M02A 5BCAA 3V0FA 1JF5A 1FG9C 1GZWB 3P3PA 2BSBA 4PJ9C 1MZZA 3T0XA 3U1PA 3FB7C 3OX8B 3WTTA 2WLZA 1POV0 1AZRA 1JF6A 5ADPL 1CL7L 4DV4B 4GAYB 4BA6A 2YWZA 3T8VA 5FREA 5ETUB 4TNEA 4GP5B 4ZOCA 3NCBB 4QKFA 3IC7A 3FBMA 1BZ9B 1KLFB 2JQZA 4NRYA 3ABLC 3SYCA 2ZWLT 4JYAB 1QSEA 1HRV2 1CZTA 3DYOA 2GN7A 5IVXB 4QPIB 3VWJD 2FYUH 4HIEA 1SDDB 1R1BA 2ZAAA 4HWEH 2RS51 4FPLA 4HX1B 1EO7A 1WTGT 3IDXL 4M6OH 4XOEA 5J96B 1F90H 1X5JA 2VXQA 3RMYA 3T3YA 2NUPB 1Q1JH 5JZGC 4YSQA 4NM4H 2C9RA 3GWJA 2BP5M 4LBMA 3KT1A 5TE6H 5KS9E 3L9DA 1JN6B 1P5UC 2AK4A 3L1EA 1D4M3 2EDDA 3B1TA 3AK0A 3WXWL 1BXXA 4NQXA 3H3PL 3RWGA 5ITBL 4GH4B 3BPCA 1TMF1 4JASA 1DBMH 2AJUL 4DR1O 3KXFD 3DC0A 3KYNB 4JKPL 1KG0B 2ITDB 1R6NA 4AOCA 2NY2D 4H55A 2QJ1A 4XN4A 2WNVB 4G59C 5IB4B 1J5OL 2YXHA 5HV0A 1RIHL 2P5PA 2A75A 3TCUA 3FCUB 2MFNA 4P2OD 5DMGD 2E53A 4XMZA 3VWJC 4XHXA 4G7YH 5CISA 1QTPA 5AW4B 4LVEA 4RYDA 1A3RH 1XR8B 2YAMA 2CAVA 3KCXA 4IBUA 1E5IA 2BW8A 1RHHB 4NMIA 4X1KB 1OSPL 2UY6A 4KVCL 5AL0A 1Q8IA 1HYRC 1U6AL 5IMKB 2WXOA 3N44B 4X9YA 5FKCA 1X5GA 3BKML 4Y19E 3N40P 3NG5A 4U1IB 5JXAL 2W1QA 5KSUB 4LQRA 3BD5A 4Q0XL 1ZTXE 3EFDH 5MHSD 4DY5A 4WFFA 1BEYH 4OFIA 5CWSB 4D7BA 4ZMPA 5HTSA 4F9LC 4FX5A 4ZFOB 4E41B 4WM8A 3V6OE 3L3OA 1NPJA 2VW1A 2AVGA 2VDRB 3T6XA 1YYNA 2CV6A 1BVKA 4TULH 5DMIL 5A3PA 4RO2A 1PVHA 5F6IB 1UY1A 5D1XA 4JRYB 3QK0A 4XJ9A 4V1PA 2QA4V 5DJ8B 2A3WA 4YBQD 5INDA 4H44C 5CSGA 5FFLA 5IIEA 4P2OC 1W6OA 4KJYA 5F3FA 3LH2L 2I7SA 3O3EA 4PWJA 1ZLUK 4I3SH 2WV3A 2H0FA 3TVMA 3G6EV 4K5OA 1MS5A 2A6XA 1KOAA 2C24A 4YM2A 3P02A 1F51A 2FDHA 2HWB1 3KPRE 3WTSA 4ZSOB 4LQ1A 1RIRA 1S2BA 3JARA 2QR0B 1W99A 1VQ5V 1E3FA 3ZLIA 1IPKA 2W0LA 3UTSA 2ZGMA 1EVUA 1V00A 3MV9E 1W2TA 2I45A 1TVBB 1A2YA 4GYCB 3O6FC 4BFOA 5CU9A 3HMWL 1H3PL 2W0XA 3C6LD 1ZLSH 3W7TA 4O2EB 1XR9A 4PJCA 3QUHA 3OKEA 1PSKL 1KU9A 3ROUA 5A2IH 2E7QA 4IRJD 4DW0A 2PHFA 4AX3A 4F2MB 1G4MA 5TQ0H 3P9LA 4XPTH 3MNZB 3NEOA 3B9IA 1XGRA 4TNGA 1VFBB 3SZKC 3FZUD 4YBQC 4ODVH 4Z3HA 4Q4IA 3DGEA 3DMMD 5LWYH 2JB5L 3ES6B 4P9YA 2R0ZH 3ASNB 2VDKH 5DECA 4AL8H 5FY0A 4XO3A 4JZJB 4BAYA 1A7OH 1SLUA 1FVCB 4L37A 2XBO3 4JB9L 3TEWA 2EC8A 3GMRB 2K2SA 1XNQB 4MBOA 4CDUC 5BXFB 1X7TA 2AJZA 1PVXA 2QTSA 3AMMA 3T4HB 1UADC 1RERA 1EN5A 2D2CB 2V2WB 3MPPG 1MVUA 5KHHA 4UWDA 5E0QA 3RGVD 3C5ZC 2C1OA 1CFQA 4QJFB 1NPUA 5IVFA 2NRDA 3AZXA 4F1SA 4HS8L 4JFVA 3AK2A 3L9RA 4MD4B 4WV1B 2QFPA 4AK1A 5JW3L 3FF8A 1TXKA 3NSXA 1SDWA 1OAKL 3N7KA 3FS9A 4N8VB 3CXFA 2ADJB 1JERA 2MKWA 4PD4F 3RQ0A 3N9NA 1MCFA 3F65A 3QUYB 5C08B 3JD1A 2ERJB 4COVA 4KGLA 5EQUA 4PBDA 2ZCLH 5BV7C 1H9PA 1RUD2 4N3TA 5DJZA 3FZUC 4K8ZA 4AFMA 3QCTL 1WGPA 3MLTB 4S11A 2OQ7A 5A32B 3KVAA 2HEVF 3NFNA 4LCUA 1ULDA 1U9KA 3BKJL 5B1KA 3E5UA 3V5KB 3IFPA 1KGJA 2JK5C 4FQHA 2OZ4H 2QLYA 3HI1B 1Q9LB 5GZOC 1FXZA 2QQNL 3LRMA 5FYIA 5FB8A 2DLGA 3DRTA 4WUUB 3OR7B 4Y5YC 1ZT1A 1S77D 3V4PA 4E9WA 3HZMB 4RZCA 3RGVC 2W65A 5KYYB 5FZ4A 1NR1A 1TZHB 5KTEH 1FAFA 4G7RB 4NQVB 3PWNA 4NTYA 4R26L 3V9FA 2ZEYA 3G5WA 4AEHL 1MR5A 1EIBA 3TBBA 3D25A 4EWEA 1FV1B 4K9JA 5FPOA 1KN4H 4XX1E 3UX9B 2FCVA 1NCJA 1FFPB 2OXHB 3OAZK 4IYHA 4NCDA 4BOWA 1EEYA 3CFQA 5LBSA 4ZTEA 4Q29A 1GIGL 1OAQH 5BNOC 4JY5H 1EV12 3C5JB 3AMHA 4KFMA 3DX7B 4JFPA 3WJMA 5E6ID 4X4XA 1VB4A 1Z9SA 3ILEA 1AX2A 2Y33A 3L16A 5DJDB 3JQOB 4KI5F 4Q9RL 3S7EA 4AK3A 4LAQL 2XETA 4L1DA 1FV2A 2H0BA 4UTBL 3LQAL 2BOBC 1WZAA 3ZTJG 4IRZA 1XZ0B 1QWNA 1CD8A 5CBEA 2AJXH 1RZKC 4Y88A 4BQ6A 1BFTA 2QQUA 4APQB 3SKJE 4DPCX 5CJXC 2PW2B 2YD7A 4DKAA 1EK3A 1GY1A 2A6WA 3WGVB 4NHLA 5FY9A 1KTCA 4MNQD 2XTJB 2ZXWC 3BIWE 3BC9A 2EDHA 1KMGA 1C16B 2EZOA 3ETBF 4L3ED 2WZR2 5C0BA 2IU3A 3OKLB 2G5RA 1SESA 4PJBB 1IBLO 1N34B 1BSMA 3EDJA 1S3RA 4FJ6A 3LKJA 4TM9A 4OMCA 4ET7A 2BVPB 5E6IC 5JW4M 5TE4L 4WI8A 1BBJA 5ABZA 3N27A 1VBC1 3BALA 5ESAA 4LSRL 2TEPA 3H1ZA 1IGIH 3Q3GB 2VTFA 1J8HB 3FTYA 3DXAD 2A0LD 4IS6B 3GHBH 2E7HA 5DR5H 2JCCE 5HYQB 2EUZA 1S72V 4FA7B 3UJQA 2BNQD 2ZCHL 1A1OB 1NPNA 3GMPA 4L3CA 5EZIH 4HNAB 4XAKE 1R0AL 3PDOA 2V73A 1MIMH 1OSYA 1FD9A 5TF0A 3VI3F 4MGZE 4Y9EA 3HLKA 3RURA 1UYWL 4NRXB 2JQMA 3MDSA 1EGJL 2QMJA 4HQQH 3OGRA 2AXGB 5DPNA 1ZRCA 2JG9A 1CXHA 4EZLA 5BVPL 1DBBL 4TNVK 3GZEA 4EI6B 5ALCH 3EYQD 1LE5B 3O0VA 3RDTD 3TNMB 1ZRRA 1BIIA 3DX2A 3VU1A 3QH7A 1BV8A 2IAMD 5JR1L 3CSYA 1TOXA 5E2VH 5EMYA 3SKJH 4PI0A 1LO0H 4BCYA 4CVXB 4RGNC 1UO9A 2OMWB 3O1UA 1KYAA 3Q5YA 1Q9OB 3QORA 4QDQA 1AZBA 4FBFA 1PO22 2WN3A 4D8OA 1SM3L 1X5XA 4ZMXA 5CN2A 5IROD 2A0LC 3IYLW 1KJ2L 3U6XS 1T2QH 4M43H 2HH0L 3MROB 2DQFA 2VDPH 1IX9A 4I4TB 2EQDA 4B41A 1GN4A 5LASA 3OTOO 1S8DB 2OJZH 1UWEL 3PAUA 3WL9B 5LN8A 5B1NA 4CADB 1DVFB 2P5WE 5TDOB 4IETA 5FBJA 4AHXA 1IL1B 3QIBB 1CBVL 5CNHA 1WBYA 3QIUA 2MPFA 4JPKH 3FUIA 1AQMA 2X4OA 4PBWD 4X9IA 3EYQC 1F4HA 5FO9B 1LB2A 2OAAA 2R56H 3RDTC 2P90A 4MD0A 4BJ0A 1MLBA 3W0WD 2IAMC 4UINL 1EEQA 2K3HA 3FUHA 4LLWB 1L9NA 4N2CA 4UM9D 2KT6A 4MZIA 4ZUUA 1N3NB 4RS5C 1KXTB 4LLDB 3R0MA 4ZD3L 1KP2A 4E68A 2LUWA 2BNRE 2Q7HA 4POZC 1Q90D 2D44A 1MEXH 3LV3B 5JDSA 2LE9A 5IROC 4BK5A 1XC6A 4M5SA 2QT6A 2GNDA 1KUQA 2CO1A 3S37L 1IAKA 5E08L 2FIKA 2XY2A 2ZYRA 4QRAA 1AS7A 4QIRA 3ATDA 4Y4FD 3UESA 1FZKA 3X14A 5AVQB 1A9BA 1XIWB 5HYJA 1S0EA 2XZQL 3HT2A 4GOSA 3B56A 1NIDA 3BAYA 4PB0H 1AO7A 4E9YA 3GRBA 4KI1A 1X9RA 3RTQA 2Y0OA 3JALB 3N2JA 4LOSA 2HVKB 2QLVB 3JXAA 1COV2 2R69H 1U36A 4B7IA 1IGMH 4MJJA 3ZDZF 4ZI8A 4QR7A 5F9OL 1VBC3 2LRPA 3KR3L 2XOMA 4YZ4A 1IC0A 2GJZB 4F58L 2PQQA 3UL2A 2BSRA 4YFEA 5C0CD 5DRWA 1TQCC 3GGWA 3NOIA 4HU2A 4A2EA 1Q8PA 4N2GA 4WK4B 5E9DA 1MMMA 3ZU8A 1NXD1 1TUEB 5L3GA 2VCBA 4UTAH 3BESR 1QUPA 2GZWA 2VLRB 1U8QA 3O4OB 3LEIA 4JR9L 5L88L 5TGBB 3TT1L 2FR4A 4Y4FC 1TKWB 2IOMA 4MS2A 1JV5B 1R6TA 1IE4A 4LBJA 1RUMH 4J3XA 4AM0A 4GSQA 4P08A 1S9XA 5T33L 1A7NH 3H1HH 4XC3L 4OJFL 4BZ1L 1UY3A 2DBLL 3VKLA 2DZEA 3HAEH 2NLRA 4Y5SA 1R3JC 1WFTA 2A83A 1U3HB 2D7OA 1L3WA 4OCSL 4DP5X 4RBPH 4ANUA 1LEIA 4P46A 4PY7A 4DY3A 1I1FB 1RJZA 1TENA 3UBXA 4TYUA 3I4IA 2WINB 5IVJA 1I1YA 2VZQA 2OXGA 4KJWC 4CPBA 1MI5B 1KBGL 3L3GA 1N3OA 3P69A 1KKCA 3TFKD 4MAZA 1UWGH 3BMWA 3D3VA 2EDWA 4TNWK 5BPXA 5AW0B 2F4VO 4B4QA 2Q4PA 1HXMA 2EIMC 1YAZA 5AB2A 3HG1D 3P11H 2D7FA 1PZUB 4TOYH 3MLYH 5K9OA 5JXGA 3ZOIA 2MQCA 1MXGA 5GGTL 2VDOB 2YBKA 5GHWH 3MA7A 2VMGA 1KBHA 1QUNB 3U6XA 3CDZB 4TRPL 1Z0HA 3AG1B 1CESA 3P4OA 5L7OC 3QB7C 2E31A 4UANA 4Y22A 3WAJA 4AGVA 2GP3A 4JZNB 2R4RH 4LK4A 4P5TB 4BCXA 1OTUC 2DI7A 3Q2CA 1S2KA 4KK8D 3KZIZ 2FBOJ 1UWXH 3G08B 2XN9E 1H1MA 1YVLA 1KF9B 4IMKC 2ZEZA 2RS12 1O4YA 2PCXA 4MA8H 1HINH 1G6UA 2OYQA 4WEEA 2FATL 5EP9A 1CE6A 1NLDL 4JFDB 2FJFB 1OW0C 3TO2B 1V7NL 1FL5A 2VN4A 3CCHA 3EJJX 3TFKC 1QWRA 3AKQA 5KW9H 5K5YA 4KKPA 3VBOB 2ZMLA 2J72A 4JM2D 2ZD0A 1W6PA 1DVZA 2DMHA 1OJHA 1KPRB 1YEDA 3QJHA 3S3DB 4LO8A 4QHLB 1ZEAH 4LF3B 4LKCB 5HDQH 2MQ0A 2V9RA 1PZ7A 1H2NA 3H9ZA 3CJXA 1AP2A 4LHJB 1IKFH 4QNPF 5ESQA 2D6KA 4PLNC 4JFFE 2Z1KA 1V7MH 2UZIH 3GKWH 3NIFF 4UT9H 3SCHA 1P0SE 4CXXA 2PXYA 3UC0L 3F5WC 3PJSK 3L7FB 1U2CA 5K9YA 4ZONA 1WK0A 4EN0A 1N10A 3MLVH 4IHJB 4LBOA 4NAOA 2GUZA 4UBGA 5I19H 2HKHL 5LK5A 4AGQA 1XL4A 5A6XA 2WYIA 3MRNB 4DUVA 4LUMA 5L3EA 5KS9A 1CR9H 5GJTL 4CP1A 1H4GA 2GIYA 5DA4A 4WHCA 5LA6A 3CX2A 4XHJD 2KB1A 3UFIA 5IVZB 2Y26A 2EYRB 1C12A 1IBYA 3NNJA 5ABJC 3UMTA 5I5MA 4JM2C 1A4BA 1KNOA 4JI5B 1DQLH 3CJJA 5FO7B 1P6WA 3C09B 3CQFA 2OYKA 3JD3A 5EEVA 5EOTB 2FB4H 1E7VA 1UNBA 4LSVH 1W2KT 5KSVB 4YHMH 3MV8B 3PIQA 3M7OA 1SPPB 1WWYA 1NZRA 2IANB 3MZTA 5KVFL 1C5DA 2OCFD 3DX3A 3VFGH 2XYCA 1F4WH 5FGBC 1R091 4ZUTA 1K2DB 2YQ2A 1RPUA 4MXVE 1GS8A 1BZ7A 3IJ4A 1PG7L 3X3FH 1GNHA 1CGWA 4Y19A 3TIEB 2LM3A 3ILNA 4UAOB 5DJ0B 4JZOB 1G6RB 1M7DB 1HE8A 3BISA 1VADA 1CPMA 1JU3A 5EK0A 1NWPA 5GRUH 1GPOH 3RJRA 4XHJC 1Q0XH 3O41B 3V6OA 5MERA 4LF9B 1ZHBB 5C0GA 3ARFB 2AS5M 4LBNA 4U7NA 1DUZA 1KCUH 1KN2H 2X12A 4XPBL 5E8PB 2HFFA 3ARDD 1Q3EA 2WUCL 3NCJH 3PY9A 3T4AA 2LU4A 3CIHA 1ZBA3 2PLV1 4LDOB 4EE2A 4UM8A 2MHAB 4ZUSB 4X5LA 3FJTA 3QEUA 2VDQB 3GVMA 1YEJH 1ECYA 3DYPA 3HC0B 4NHCH 4NZUH 2K6YA 3J8F3 4PJEB 4HL0A 5AOLA 4EWAA 3WNOA 3BLKA 2UXFA 1GOFA 1QKQA 2HWZL 2EO9A 4FAGA 3AS0A 3KPRA 3SGJA 3CV5A 4FFYA 4O02L 3LFMA 4XXPA 3MUGB 2XASA 5DD3H 4UQ9A 5JSPA 1UUSA 1RUE2 2JKBA 3MV9A 4K21A 1CZ8L 2CJUH 2WKOA 3VHPA 1YMMD 1DU3D 9CGTA 4WHTB 1JZ8A 3VFUA 5JR7B 1V5JA 4RZKA 4C56E 3CBNA 3KPNA 2OZ4A 3EBIA 1FNLA 3UKTA 2UXXA 3B69A 4WJ5B 3HNSL 3ARDC 2X28A 3CC5A 4K1YA 3ZBHA 4GRWE 4XN1A 4ATWA 3HAGA 5D2NC 3VH8G 1H6UA 2OPCA 2GEEA 4N0UE 4NQCE 1YPZE 3JSLA 2IEPA 4QGYA 3S37X 3PWVB 4EN3D 1EP0A 2DV9A 2IIJA 2IVJA 3VMOA 4LFCB 2ZHLA 1LO2H 2J5LC 2ZX3A 1RUH1 5EIQA 4PLMA 2QPEB 3RX9A 1GQHA 4LOUD 4BM8A 3JV4B 4XP4L 1FFOB 4DPNA 2YK1H 1NLBH 1Q94B 3OPZH 4N8UA 4MVRA 4NRZB 4D3CL 5I1KL 3WDTA 3C7HA 5LOVB 4DR6B 2F53D 2GIMA 4V33A 5D1ZD 3U0PA 1U3NA 3DV6B 1CJDA 1ZBE3 2X1OA 1H8VA 2JIJA 1H5BB 5C9AC 3FO1B 3OCPA 3APOA 2D6PA 4KK5C 4K2UL 4K7JA 2DIEA 2NR6A 4ZUWA 3BHBB 3IJSB 4NO3A 5BW7C 5CF3A 3UJTH 3ISWA 1F6AA 5B4NA 5F0JB 5BO0D 4PA9A 3X12A 2SLIA 3ZFEC 4BSVA 1JK9B 3GJEB 3CMOL 4Z7VE 1STMA 2QCSB 1T04B 1P5VB 4GMSH 5FUCC 1T7VA 3R0RA 4AFAA 5FIXA 2ZEWA 4EN3C 5HCFA 3LIZL 3VXMD 5AOKA 4LO5B 1R093 4LBLA 1QQP1 2PQSA 1MIEL 5DJAA 1YC61 1PX8A 4AQ6A 2GIXA 4JO4H 3OEHG 2VM3A 3E8VA 4LOUC 3QLQA 1ZVSB 2HG5C 2E46A 3EJSA 2E5LO 3WSQL 4HCGA 3VXTB 2PMZA 4NUJB 1NI8A 3PJSA 5DD6B 3SE6A 3WFEL 4ZFFB 5JPNB 5D1ZC 3MLSH 4HHGA 2BCMA 4EQVA 4HPYL 5B1JA 1WLWA 4BQWA 1KEMH 1CDUA 5FYYA 3WFBH 1VBA1 5CG8A 4HG4K 4YMPA 4PJDE 4ZPIA 1FAKT 4UZGA 2XKNB 1MCHA 5F3BA 1JCKA 1XOUA 2YZ4A 1LDPL 3QH6A 2RDCA 3OJVC 4Q6YA 5KYXB 4AEDB 4ISQA 1PD0A 1PEWA 2XX1A 4OM1H 1R19A 2NYYC 3V0VB 1SLCA 5IUQA 3L3KA 4PJIE 2EDEA 3SYAA 4EKWA 4GLXA 5JQGB 3IKCA 3GK8L 1N0LB 3BUBA 5DVLA 5EO0B 1L9RA 4M5ZH 3LEYL 2W0FC 1JL8A 1RC6A 2ED7A 4FPFA 1V54C 4M8VA 2HLAB 3I3QA 2YXLA 4B3RO 1J1OL 3STLC 2CNAA 3MIGA 3CFMA 3N04A 1Z2GA 2YMXH 4CRQA 1MY7A 2OMZA 3IDMB 5CUSL 3SE9H 3VFMB 4CVZA 1PD6A 4X80L 1OFNA 2VL5A 4KGQA 3D0LB 1IAOB 4GB31 2OMYA 3FMGL 4MHRA 3B00A 1OF0A 5BR8B 4YGCA 5EO1A 4DN4H 2BTQA 3IE4A 4N9IA 5C0EA 1SYSA 5MEQB 4UUJA 2BTOA 4HDIA 4QRUA 1NCCH 2BO0A 5HDRA 4OI9A 3GXUA 1NA1A 4JQXC 5I82A 3HB3D 3ZDZE 4GEJA 1HXS2 3I9IA 1QJY1 1RUH3 1GZPB 2CO7A 1XCTB 5I66A 3D4CA 1U96A 3CB2A 2W9EH 1WUVA 3K77A 4HH9B 5AFEA 1AYOA 4ZXKA 4HK9A 5JJJB 3DIFA 1HXKA 4S2GA 4N3UA 2F1EA 1JHTB 4DP1X 2AGAA 4WI6A 3PAYA 1A4KB 4HXCA 1MFBL 2DMKA 1T4KA 1H3GA 1O5PA 1RLWA 1HL9A 1ZPLA 1ND0B 3BVWA 3FN9A 3GSXB 4UB0L 3H4HA 3AXDA 3UYJA 5IFTA 4J5VA 5JSOA 4UQ2B 1I7TA 2Y6GA 4JRAA 1AY1H 4KJPD 1J0YA 4APXB 4RGAA 1O3SA 2JCCA 2EE0A 2ATKB 3E2HB 3Q6FB 4NJAH 4RAHA 4GT0A 2VXTH 4A7TA 2RE9A 3IDYC 3B3BA 5IJKA 2Q7GA 3PQYB 4EXKA 3T2TA 4GAAA 4MCNA 3MRBA 2XG5B 3N6YA 4C4KT 1MFNA 4DUYO 3HS0B 2BHYA 4N1CA 3E22B 5K39A 3AU1B 1T6BX 3T0AA 1RUC2 4OAWA 2ZNIA 4OHXA 4RGMB 1JGLL 1N6QH 1H9DA 1KC5L 2QKDA 1L9PA 2X9XA 1PS3A 1FI8C 4BWOA 4GW4A 3SDDD 2BCKA 5DAPA 1GY2A 3QAQA 2NUTB 5BOZG 3Q8EA 1F2XK 3QIWD 3CBJB 2CUMA 2ZKWA 4XDJA 1HCVA 4D94A 3ZYJB 2HFEA 3HD8B 5FPAA 4A7QA 1VA9A 5K59F 4TUYB 4L9DA 4UW4A 1JGIA 1A32A 3VSQA 2GITA 4HZLB 3NSTA 3WDWA 1MHPL 4JDVA 5BS0D 1AI7A 2Q0ZX 2R69A 4PG2A 4V11A 4JPWH 1VRH1 3DJ9A 4YFDB 5CBLA 1HSBB 2DN7A 5C8YA 4LOFA 8FABA 3FB5B 1KJ3L 2WS91 4KRPC 2EXHA 2P5WA 1G84A 3LOBA 5C09D 1PMYA 1AD0B 3H54A 4L4VE 4TLUA 4Y1AB 1Q72H 2FD6L 5TDPA 1ZGLP 4KI5C 4UTAA 3F7RA 2PI4A 1G1YA 3EO0B 3ZKXC 5EBLC 4EF3A 3URFA 2VLKB 4PGEA 2IXQA 1F56A 5CHNB 4P59H 5DT1H 4L1HA 3VFVB 1OCZB 5HHPA 4JHWL 2N04A 1AXSB 1T21A 4J9ZB 3Q2NA 1DN2A 1IC4L 3QIWC 2P5EE 5JXIA 1FQ9C 5A3LA 5LGKA 3HAEA 3NRPA 1QRNB 1ASJ1 4MTOA 3BUDA 3F85A 2JVDA 2WQVA 5FKPB 4BA8A 4IGBD 4YUEH 2BNRA 5ISZB 4L48A 4R5TA 3RS6A 2APWA 1A14H 3C9NB 4PD4K 4JUTA 5BVJA 2VN3A 3ME2A 3QUXA 2X2JA 3LJ3A 4IE6A 1GOGA 3EFOA 2D7TH 1V3JA 2IH1C 1NTMH 2HJFB 3PDDA 4FL4B 4O2CA 4P5MB 5CCHE 4Y4KA 4FI8A 3WXVL 4AGOA 2X4TB 4MAUL 4UU9A 4YSOA 4QNPE 1BMGA 1J7VR 3D51A 1R5WA 1FYTD 3NIFE 2VQEB 3KHCA 1SEQL 4PCYA 5GGVY 4C59B 3FB6C 1EO5A 3HI5H 3KLAB 2OMTB 1D4M2 3PL0A 2BJML 4CYDA 4ZHQA 2ATAA 4RQFA 5IT6A 2DQUL 4MJIE 3I55V 1EJ8A 4X7DC 3I59A 3IT8D 2E3VA 1NQJA 1WWBX 2HN7B 4GJYA 1MLCB 4OGXH 5KMGB 3BIEA 2UZPA 4KC3B 2ZGTA 3IWUA 4YDVB 1U93A 2EABA 3E7JA 4KRNA 4I89A 3EFFA 5I8TA 1EM1A 1AR1B 4IGBC 5KSAD 1N68A 4QTHA 1US2A 4EEQA 4ZMWA 2GAUA 3N41B 5I0RA 4B3MO 3MV7B 5FYKU 2DIAA 3VBBA 1BXVA 4AQYO 4DP4X 1GJWA 1N33B 5IYZA 4K23L 4PJXF 1GYVA 2BHFA 2FZ3B 4DZ8A 4H13C 4Z7NF 4KJQD 1I7RB 1BZ8A 2FX8H 3UTOA 3I97A 1N6VA 1W72A 1MOEA 4PWKA 4FXGC 5FUOH 2PAKA 3OOXA 5JZ7D 4MWFA 1SXAA 2CMRL 1RUI1 3Q13A 2BIIA 4L0PB 3CZUB 1AYM1 1GKEA 4X5QA 1D7FA 3PAVA 2IFWA 2VUCA 2F18A 3NH7H 3T1FA 1IQWL 2VABA 2VXUH 3C8KB 2XG4B 1MS3A 4A44A 4WW1A 3WNKA 2KZ1B 3RKDC 2OJEA 4FZ8H 4YPJA 1QGLA 3S3PA 4EDWH 5GTHZ 1HQ4A 2HB0A 4KROD 4QWWC 1D9KC 3G80A 1L0YA 4GSRA 4K55A 5J13C 2IADB 5GLUA 2O4EA 4UT9A 4RAVA 5KSAC 4YRDA 1V55B 3NQKA 4G7VH 4RDBA 5HJ3A 4YSUA 1EFXB 4FP8L 4FXKA 3VXUD 4YW3A 3L9EA 5A6LA 5FXWA 1BVZA 1DSFL 2XZCH 4OZXA 2KBGA 1N64L 4CH6A 1T5XB 3QJSB 1ADQH 2YGOA 3V0HA 3VDAA 4L11A 1EHLH 4LKEA 4TSAL 1A22B 4B7EA 1HX0A 4OFYD 4GH7B 5JZ7C 2QKIC 3G5VA 3MLUH 2K9PA 1ES0A 1UHVA 4GNKB 1ZS8A 2X1QA 4NN5C 1BMZA 5FYLE 1Y1DA 2H9GB 2W1UA 2X5IC 5DHVH 2IDQA 1AS8A 4XNYL 4OJCA 1NCNA 3ECUA 1E5AA 1XFPA 4IBLT 3WEAA 1CFNB 2UY7B 4PP2B 4R50A 4K71B 5B3JF 1ND3B 3I7DA 1YEEL 2XN9A 1ILUA 4LSTH 3BCWA 4DR4B 2AQQA 2PCPB 3GRWL 4L8SB 5FA4A 5IM7B 3RNQB 4FG0A 1DCLA 4WENB 5DYFA 3GSRB 4L5FE 5DRNA 2RS52 2VRKA 2FGZA 3BOVA 4JG0L 4URTB 3VD7A 5A3WA 1LNQA 3K81A 3VZMA 1MCCA 3NABH 1I1EA 1UG9A 2XFXA 4NXMO 1NEZA 1P4LA 1YYCA 3R8QA 3SQOL 4COUA 4NYLB 2YMZA 2NSQA 2CQVA 4IKIA 1Y7BA 4M5TA 3S5LA 3G6JF 1YNTA 1VF6C 1CIYA 3D4KA 1OUSA 4ECNA 2PA7A 3OGOE 4PJ8D 4PJFB 4HULB 2HWE3 2QQIA 4PF1A 4XQWA 3IDIB 1TMF2 5ANQA 4AILC 4JFFA 3HHSA 4Y7MA 2AZ0A 3NPSC 1AFVH 3LQCA 1WC7B 2JKJA 3OZ9L 3WXPA 1G0DA 4U6VL 2A74B 4R4BA 1W3VA 3QQXA 4CS4A 3IFNH 4HH8A 1H3XA 2IBZH 2YV8A 3OPTA 1CGSL 3MBWB 1ZZ9A 2Q8BL 1VB2A 1C8M1 5JOFB 4U6YA 3K5SA 3IRZA 1KTLB 4XBQA 1X4YA 2WJ5A 5LXGL 1RUF1 3WEMA 1C5CL 3UAJD 3RW0A 3EYSH 4GAJL 5TFSH 3W2DH 4JV5B 4KX8A 5FYLH 1M53A 3WFDL 3RIAF 4TLSA 1PMJX 2OTJV 3RYIA 3UTPD 1XT5A 3I2CL 1J5DA 1QAWA 2J4WH 2EVHA 2MNGA 1UD8A 1RUI3 5HHXL 2CH7B 3L3HB 1HLCA 3Q8CA 4JY6B 4HJTA 1WP7A 1NEUA 1YUHB 1Q43A 3FBQA 3N0PB 4HLZH 4JRXE 5DWUL 3T8XA 1ED3A 1GZHA 3LN4B 2QFRA 3DHJA 3O2VL 1GZ9A 4L5FH 2DQCL 4X5RA 1YEFL 2Q8CA 4Y4HD 3VD3A 3HKEA 1OLZA 2DQTH 5JUEH 5JW5A 4AFCA 1PK6C 3D18A 5LGYA 4I1NB 1I7UB 3FU0A 3O9WD 4W9CC 2HMIC 4MVMA 4H7MA 1CB4A 5E99H 5ICYA 4FM1A 1DQTA 1PPJH 4KH2A 4YIQA 5E1QA 1Z66A 3FQTB 4QRBA 2V3FA 3RL1B 3LF7A 2JDIG 4MXVA 3E6CC 4ISVA 1FAYA 5IYDO 3FRUB 4DTGH 5LMNO 3S9DB 1DGRA 3R4RA 2KI6A 4LGRB 2ZKOA 3U0WH 2J1EA 3WP4A 3UAJC 4EI5A 5JQHC 2JD4A 5FS5A 2BSEA 4QRTA 2NNUA 1DLHB 1MFVA 2OMVA 1KIUB 1O9VA 3MD0A 4ZAKD 3E6HA 4AYBA 3FT2B 3RWJB 5KSBF 1QZ1A 1QEWA 2EILC 2A9DA 4OLXH 1I8LC 2FSEA 5EU5A 2DYPA 2HRLA 4BIUA 2H94A 1FZOB 2PKDA 2XPGB 4FFWD 4GAGL 1WCBB 1CFVL 3F7VA 3JATB 4JEGB 4AEKA 1B6UA 2CHXA 4OGZA 5DHXB 4ZZ8A 5I1IL 5GIRB 1HYSD 3MNVB 4UAPA 1LVEA 3X11B 5AWNL 4YDMA 4X6CF 5I1EH 3STZC 1EQWA 2QSCH 3ZUCA 1TTFA 1G9DA 3OTTA 4LLVA 2BOCB 3MMEA 5EHFA 5GALA 2YAFA 5JMCA 2GJ6D 2RDNA 1DK1A 2JI2A 4GUOA 5C7XH 5B1BB 3HRZC 5DD1L 4N43B 3RJQB 2QZ5A 4LL9A 4A39A 1TVKA 4XFGA 1OXCA 4XVOA 3QQ9C 2F54B 5C6CA 4DUWA 2V5RA 3WCSA 4C56A 3PTYA 5A9GA 1WO2A