3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
3RGBA 4PI0A 4PI2A 3RFRA 3CHXA 1YEWA 4PHZA 4O65A
chains in the Genus database with same CATH superfamily
2ILLA 4YDZA 3RVVD 2PTTA 1E1QG 3JWOH 2NLRA 1I4FA 2BSTA 3K4AA 3CIAA 4LPCA 1LOGA 3ZSLA 3H1WA 1R5VA 3ILNA 5DA0B 3R4SA 5E9DB 3OPZH 4ZU4A 3V0HA 2L7QA 5EU5B 4KTDH 1E9QA 1RVFL 4J6RH 3DCQA 1Z66A 1ZTXL 2BNQB 4PRIA 4Q2ZB 4ATWA 4Z0XB 4HD5A 4AT6B 5AYTA 5I76B 2R59A 1UZ8A 2CGZA 2XXCB 4MBOA 4PQQA 3RYKA 1QBAA 2AABH 1JS9A 2J7MA 4A45A 1EUUA 4BLIA 2YXMA 4YX2L 3ULVD 3IMBA 4HUNB 2NZIA 5JW4Q 3GXDA 4UTCA 2A6WA 2W8CA 4M62L 4OZFA 4NZTH 4WF7A 2CM6A 1OVSA 5KYUA 1GTOA 4M29A 3NIGB 4HK8A 1RCYA 2XKNB 2XTSA 4FP8H 5C7XH 2UUBO 2UZXB 4H1LA 2ZDIA 5DFTA 4ODTH 5LVEA 3QQDA 2CBMA 1BJMA 3PYCA 5CIPH 1TKWA 1K12A 3FU0A 4B7EA 3M45A 1ORQB 5JR2A 2V3FA 1RM1C 3HC3L 2NTSP 2VZUA 5AVYB 3NCBB 2WZEA 4OZHA 4L1LA 3CL1A 2EYTB 3HEIA 5T1KA 3NSXA 5D2NA 3NV2A 4DN4L 4XJAA 4I1PA 3JATB 1RINA 4FLRA 3I2DA 3ZYIA 1QJX1 3POSA 5GALA 4QIWF 3ISRA 3P4OB 4QRAA 4XNQA 1MRCH 5JOXA 1RERA 2XWXA 3BD4A 3HE6C 4FEMA 4KNQA 4QHOA 4HHWA 4AOCA 2ADPA 3T1YB 1UACH 1Z9PA 4HETA 1ZPUA 3AMKA 5MERB 4IDLA 3U0PA 1UY4A 2FYYA 3SE9L 3DX9A 2CLVA 2Y5EA 4CJ0A 2G1MA 2DB8A 1ZRDA 3E5QA 3BZFA 1MS9A 3PHOB 4WW2F 3ZKMD 2AZAA 4QD2E 4AIOA 2RVAA 3E8FA 4AVIA 1XU2A 2D6LX 1ZV2A 2E47A 5FYKH 1XNRB 1JH5A 4F15B 2PQQA 1B35B 1M6OB 4KI5D 1FNFA 4PB0L 5ERWA 2EE9A 1BCIA 1GMEA 1CAUB 2FT7A 4AE0A 4LHUA 5FZAA 2OKXA 1PSKH 4KJYA 5KJRL 1XMWA 4COZA 3S97C 1DBMH 1XGUA 4W4OC 3S0PA 2BGPA 3T4VA 3RGVA 1RUMH 3N27A 3HAEA 3M17B 1KUMA 4AG4H 1QLEC 4PJAE 1QRND 1U58A 5F9OH 5LXTA 4HDIB 5D1QC 3VXQA 3RVWC 3UGFA 3KCWA 5CWSB 3TCLA 3LSQA 3S9DB 3OQRA 1OLQA 4GIQA 1TJIL 1U8LB 1M1XB 4UM8A 2UZIH 2FCBA 2VSKB 3MFFA 1DBKL 4PRHE 1T7YA 4WDIA 4QXUH 3LQMA 2I26N 2FZ2A 3VVVA 3TESA 1RH8A 1D5NA 2F54D 1UCBH 1HYSC 4XP1L 3ZFEB 4AI3A 1E7VA 3KPMA 3D3VB 1BV8A 4ZAKC 2PGGA 2ZR2A 4Z3EA 3ZO0B 1JF6A 1NGZB 1PEZA 2HTKD 1HIXA 1O8SA 5HV0A 1C5IA 4TVPH 4XN7A 4NHCL 4JZ2A 3LEGA 5CBHA 1AX1A 5B8CC 3BVTA 1VZGA 5E9DE 1A8DA 4N8CL 2E3VA 4PJDF 1WG3A 1DZRA 3SPCA 5EF0A 3X1EA 3WY2A 5CEZD 2OL3H 4BD4A 4NHMA 3OTOB 4QNPF 4MAYC 4OZGF 5GQBA 1OP3K 4YC2C 4HULB 4Q0PA 4AQ2A 1A02N 1U8KB 2QQKH 1PVXA 5HGGS 4U6VL 2CK0L 1XBFA 1ZBA3 1S8DB 2RDNA 1RK1B 3CPLB 4BFBD 1U12A 4OSUH 3V4VL 4X99A 5L3DA 3NIGE 2EZPA 4N1CA 5M95B 3F5TA 2JVUA 3ZX7A 3FFCA 3OF6D 5F7KC 1CT8A 4UVBA 1RU9L 4AGOA 3OG6B 1H3WM 4R3SB 1VF7A 3TCXA 3CCJV 3GWJA 3INUH 4Z5RA 5IGXL 2ARCA 3GBML 5E1RA 5LBBA 4QRPA 3C7EA 1A7OH 4P9IA 1ODAA 4R4FL 5M0TA 1U4EA 3WENA 4B3EA 2XQBH 3QSKB 4DPNA 3M3QA 1NMCC 2X89D 3HFMH 1ND2A 4RIRA 2VTXJ 2VGLM 4JFXB 5EPMA 3EF7A 2VDPB 4AW7A 1ULOA 3LDBB 43C9B 2ZGMA 1O9HA 2NUPA 1JCVA 3FCUB 3GXTA 3B9VA 3M86A 5FC9A 2W38A 4YHKL 1IAIM 4P3DB 3GJAA 3ASOB 2VIRA 3EOAB 5JW5B 4D7PA 3QEQB 1O5DT 4XFBA 4UT9H 3BUPA 4F1SA 3LSDA 3NK3A 4WGKA 3EXUA 4LIQL 1N9PA 2Y69C 1W99A 1QLEL 3GMQA 4N20A 2C9KA 2RQ6A 3MXVL 4Y4FA 4N86A 4MD5A 3USUA 3I9IA 3C3SA 3L6FA 2I32A 2OJ1A 4BZYA 4MW3A 1XE7A 4YVWC 5KSBF 4MCYB 3HKEA 5C2BL 2XQYG 4LSSL 4R4ND 3DGTA 5EYXA 4YZWA 4CBZA 3BH4A 3I6LD 4Z78B 5C0CA 3IIAA 5K59E 4P5SA 4LO6B 3NCYS 3ILQC 1ENRA 2BVOA 5KC5A 1GN3A 5AG9A 4PS4H 3CZUA 1MF2L 3QDMB 3P3TA 1QEWB 1R3LA 3KZ8A 3G6BA 1AZBA 1BEXA 1V7ML 3SOTA 4IBSA 3TWCL 5D1QA 4K8RB 4CZSA 2WQXA 3C5ZD 3DO3A 4HKLA 1FS0G 3BPOC 4Z1VA 1CGWA 3MRKB 3QUYD 3EOTL 2OZJA 3VZJA 1IC5L 2I5YL 4LCIL 5C0BB 4DOHB 5ICZB 2IZWA 5DFVC 1CAWB 2BOBB 1NQJA 4BJLA 5JHBA 3WE6B 3OWRA 3PMEA 3RVZA 2A6JA 4K55A 3NQHA 3O6FC 1XF5B 2ZYHA 1L9SA 3SD2A 4U3SB 1SZTA 2BHFA 2VQ1B 5SWQB 3WS3A 5ISZA 1P2CB 2Y4SA 2G9HB 3SDDD 3ZHSA 3PIGA 2VQEB 4JN1H 3VBRA 4OF6A 1EY2A 4OGYH 1HXMA 4Q0UA 4Q6IB 2IH3C 1KD7A 5A2QN 1CGXA 1IFHH 3KLLA 1YEHH 4GFXA 3M3CA 4MAYA 4NN7B 4LHQB 1Q4NX 4YXHL 5K69A 1HAWA 4DO6A 3WDYA 2B9ZA 4E9TA 5EA0H 2ZX0A 5FWJA 2VZPA 5GS0D 2GFBA 2I45A 3AS3A 4B27A 5I8EB 1QI3A 2ITFA 4KMTL 1BQPA 3L4UA 3VFUB 3MNWB 2R29A 4YYOA 2XZQL 2DIAA 5IBUG 1VAKA 5A40E 2VCCA 1ODNA 1PO22 1MFNA 3U0TB 5IFJA 1JXKA 3KYMA 4TSCH 3BZDA 1IGFH 2BY0A 4EKWA 1SESA 4TUOB 2DICA 5GZDA 5IMLB 1U30A 3AQXA 3MBWB 4NDMB 2XOTA 3I2OA 2YIHA 4HX1B 1H5BB 1XTLA 1ZHBA 2EDEA 5CP3H 1KV3A 4JM2C 3TT1H 4FA6A 1OD9A 2NTFA 1YQ5A 3AXHA 3ATGA 1MACA 2FNWA 2R49A 3QAZB 4LF9O 1AFVL 3QRBA 4M48H 4U0RB 2KG7B 5IMMA 4GRMA 2UUAB 3WY4A 3FX3A 3WUWG 4FSJA 1C5DA 3S4SB 1S46A 4XNYH 2XA8L 4N24A 4Y7MA 4JVAA 1NWOA 3FQNA 1O5LA 1S6NA 2R23A 2YWZA 1EVUA 3VXPA 1JZ5A 1KB5L 5FXZA 4DB5A 4LF6O 3VUOA 5BMVB 1C8QA 1VFOA 3WLBB 3O2VH 4XF3A 1UWWA 5LUMA 3IE9A 2HH9A 4Q56A 4ZTPH 2ZG3A 3LKPA 3AFGA 1Z7S2 4L3ED 1KEGL 1J3QA 3V6OE 1U92B 2WXJA 1NS1A 4NTWA 2VNCA 3HKDB 3KH3A 4HJSA 3AG4C 1T83A 1K2DB 3A6CH 2JKTM 2ZWSA 2XAQA 2R51A 2NSXA 3LS5H 2EDJA 1LO0L 4K21A 5ACA3 4HC1A 5EU6B 4EF3A 1R6NA 3OCPA 1NCCL 2GABA 2VUYA 4ZUWA 4LHKA 1KB5A 2FRGP 3QDME 4BE5A 1M1SA 3INOA 2L6LA 2DQIH 4JRYA 4W9HC 3FUNA 3QIBB 3WHXA 4FNRA 4IGOA 1WBXB 1JHTB 1U95A 1BOGB 1EGJL 4I5BA 3WMQA 1ND3A 1T04A 3N4MA 1NBYA 4ZS6C 5E5UB 5B7EA 1I1YA 1UASA 1S77D 4EEQA 4KHPB 2PR4H 4WUUA 5CKNA 1H19A 5C0BE 3DMMD 2C9AA 1D5MA 4DOHE 3EH1A 5I71C 1XSQA 3F01A 2YGVA 2E27L 4GO8A 5T3ZE 5J5EA 1E79G 1HSAA 2JF1A 1PMJX 1RZQA 4NKMA 2BW4A 3KJ6L 3ZSJA 1P84K 1U91A 3PIQB 2EUXA 4MDIB 1ZHLA 5L6YH 3BX7C 4HIPA 1ERNA 3V0EA 3NJZA 1AZZC 5J13B 2EAAA 2AK4E 1V3LA 4L5FH 4GSRA 3THOA 5BRZB 1EVTC 4WW1A 3BH9B 1V0AA 5CB7A 5BY1A 2OLDA 3CU7A 3U10A 4PJ9C 4AGPA 4G9SB 4N43B 4HKWA 1USQA 4OF8A 5F0LB 3E80A 1W2AX 3KS7A 4TYUA 2E86A 1U8HA 3FQUB 3SCMD 5GZOA 4W68A 5EO0B 1KBGL 3MV9B 3SJQC 4L8JA 4A2HA 3RZHA 2GALA 4NQCB 3EJZD 1O4TA 3AL6A 1DANT 2DQMA 5F7YC 4E8CA 1MLCA 3PL6B 2IAAC 1KJ3H 4OAWA 3H9SA 4BUQA 1QQP3 4JPIB 3VGAC 2MHAA 3GLAA 4JFDB 2FX8L 4G6AD 3SBRA 1JBJA 5J37A 5DM6V 2Q6AA 4CH6A 3RPBA 4NWTH 3QIUB 1NBMG 1WBFA 3T2TA 4ONGH 5FYLL 3HQXA 1AZVA 5DO8A 2HXAA 1JK8B 3ILPA 1UD5A 2LFRA 3FTUA 3OMIB 2HN7B 3RHWK 1ZTEA 1NCGA 1BFSA 3F00A 2VDQH 3PJNA 2Z1PA 2BIMA 4MJ6A 4NJ9L 1RP8A 1SCSA 1OB1B 2A1WH 4DUZB 3BAEH 4N90A 1NH2B 1QBMH 4TV9A 2IAMC 2UX7A 3L3JB 1AOHA 1NR1A 1KT2B 2WNGA 4L9LC 4ZMTA 4BFOA 2WS92 5IVEA 3JTSA 1YVLA 1T2QH 4MDJB 1VEPA 1D2DA 1EJOH 3O6KL 2B9BA 4FFYA 4BFRA 5B1JC 3ZRSA 1ULPA 1O3RA 1R24B 2F1AA 3IFPB 1M90W 5C6TL 5JW4N 2NLJB 3HMWL 3HNSL 4K71B 3TO4B 2YG0A 4Q9RH 2MHFA 1IXBA 2DN9A 1L9MA 3REWA 1DGRN 1RUC2 4RA0A 4AFAA 3VSQA 4LORA 2A1XA 1FH5H 2QSAA 1YI2V 1W0VB 2NXYB 4XC9A 3E9TA 3K58A 3RVHA 4F6RB 2G3MA 1ZA4A 2AQQA 3BSGA 1NTKH 2VJ8A 4LMFA 3PU3A 4ELMA 4X6BA 4PEEA 1YJLA 1CLZH 1TZOA 4NT6B 5DS8B 4FLVA 1CDCA 1NCTA 5EU6E 5EZJA 4RMUA 1S9YB 4D0CA 3HOBA 1KDJA 1DQLH 1ESOA 1D5AA 1CN1A 4JF3A 2IFWA 2TRHA 1Y1DA 4H44B 5F3CA 3LEVL 2J56A 2XETA 2IWEA 4JPKH 3IETB 3MAWA 2Q8CA 2B39A 3ZN6B 1WZKA 4JQXC 4CL7A 3OUHA 4J3SA 4AY0A 2LLLA 2WGXA 1R6TA 2VUAA 1XGTB 4GQQA 1YO8A 1OAYL 2DWYA 2JD4A 4FP8L 4BH8A 4GX1A 1SLUA 4ZOCA 1A4AA 2XN9B 4ZUSB 5EXOA 4LO9A 3W57A 4XE0A 5D1ZC 5GS1B 2YN3A 3DC6A 3UO1H 2H7WA 2J21A 3OPZA 4UW6A 5CKGA 2ZIOA 3B8MA 2ZNIA 5D7SL 1DBJH 5BRZE 3EGDB 5FFLA 2GMEA 1F18A 4I3RH 4EV0A 3SGIA 4QRBA 3T1HO 4WHYG 3EDEA 4ZBMA 1HNZO 4O02L 2FLBT 3L5HA 4GG8B 2RBLA 3CKHA 1YEKH 1E8YA 1S3KH 3CFDA 3MV9E 3E97A 1PV0A 2H6CA 4NQCE 1U8JB 4U1HA 4O65A 2PTTB 1I4FB 5EU7C 2WAQA 3WFCL 3ML9A 4AYSA 4OZ4A 4XP9H 2EIJC 4GMSL 3PJLA 4J1UB 5CIPA 2Q3ZA 2H2SC 2QEXV 3AP4A 3VD0A 1ZVFA 3GD1C 4LCUB 2IIJA 1BVLA 1QSFB 1XO8A 4LWSB 2FJGA 4JFDE 5A3PA 2WJ5A 1DQ6A 4RMTA 2FBRA 2YZ8A 3BTZA 3WNJA 3HNMA 4G3YH 4KK6D 3F3HA 1MEC1 4CJ1A 5JXJA 3KCPB 1FORH 3FPXA 5AB1A 1F6LL 1OA3A 1KYOK 3FN0L 4Z3GA 1D5XB 3J27A 2XTJC 5C71A 1I5ZA 1B0RB 2K6WA 3PUCA 2IAMA 4LF4O 2OCJA 2W60B 5ID0A 3BLBA 5B22A 3SDCD 3FJTA 2KQMA 1UIKA 2DJMA 4LKCA 3F7YC 1HH6A 4NQDD 4I48B 5EOQH 5B1JA 1J05A 5IJ9B 2R2EB 3ON7A 3U30B 3CVCA 1PIFA 4OZHB 2XGXA 2VM9A 2GV9A 1D9KC 2UZIL 1XPWA 2E4FA 3HEIB 1TVKB 3ETGA 2OI9C 3QYNA 5GZFA 4I0KA 2DM2A 4R9BA 2FWLB 4MS2A 1OD3A 2O14A 2VTFA 3HBZA 1BZEA 2BCKA 4XNQB 1WHOA 5F21B 4XVUC 5FXVA 3CNKA 5C8JA 1HKDA 4WFAV 2M83A 4H88L 3TFKC 3EO6A 2HTLD 2RCSL 4JY4B 3O1PA 2APXA 2Z91A 1GSKA 4LBOA 4AG4A 2NY4B 3PWUB 3DX9B 4S2SA 2CLVB 3MROA 4FAAB 1YA5A 5TDOB 1HQ4B 4M7LL 2ADGB 2FT6A 2X10A 1UZYA 2DMKA 3QI9A 1WA8A 1TG8A 4NO2B 1J0YA 3MLLA 1GWKA 1OAXH 1B04A 32C2B 1N5YH 3SH4A 4GKYA 4EN7B 4MBRA 3L3HA 4XP6H 4OBRA 5JWPA 4U33A 5K59F 1GOFA 1AR81 1CZTA 1A8MA 2FJSA 4PJ8B 4YSDA 3VXOB 1KFUL 3L1EA 1J0IA 5H6RA 1S7UB 1DF4A 2IJHA 2WBJC 1E4KC 3ARFC 1THAA 3HKZA 4LCVA 1H8TC 5T5OA 3FK3A 4LHUB 3WNNA 1JZ8A 4KJYB 1ZLWK 3QQ3A 5DRWB 5DR5H 4GY4A 1ACXA 2ZUSA 5ITBH 4BMBA 1VBA1 4XQ4A 1F58L 2ZINA 3IJHA 1BEV2 3ESUF 3MODH 1NZCA 4LBJA 3MRQA 2KI6A 3DPDA 5KANI 1LGNA 1VRH2 2UY6A 1OAZH 2OL3A 2P80D 1QXPA 3RG0A 1MMMA 4D7YA 3U1PA 3VZNA 3BGAA 1RITA 1FGVL 2FH6A 1KENH 2QQKA 5CB4A 2WLMA 1JWMB 3KJ4C 2ORBL 2DQTL 1MCPH 4X4MA 2W0FA 1TO4A 2PO6B 4H2CA 4XP4L 2JE7A 2Q7NA 2P5PA 4Y4KD 5D9SA 4MGYE 3NT0A 3CLFH 1AR71 1H3UA 1IBZA 2BFVL 4XX5A 1DGSA 4AEJA 4F8OA 1P69B 3JD72 3OUIA 2OMXB 2J2ZA 5I0WA 1PK6C 2QKDA 1L3WA 4DR3O 1KCVL 2BNRE 3WG4A 3X29B 4CCCA 4TNVK 3FD9A 5T1LA 1CIDA 5EO9A 2PTMA 5I8CB 3F12A 4JI7O 1YSOA 3HG1B 1QSFE 1BWWA 1LL1A 5IQ7H 3OGIB 2YV8A 2XJPA 3LA3A 4G4FA 4A41A 2DMGA 5IVJA 4MD0B 5J3HC 2G4EA 5E24E 3W38A 1V00A 2NNCA 3CJIA 1NC2A 4BGDA 5F5QA 1UWEL 2W07A 4ZZKA 2GCYA 4CDWA 3ARGD 4IIJA 1ZE3H 2Y6GA 4ORFA 5FDBA 3OXSA 2EDKA 4UT9A 1CFMA 2HFTA 3VFWB 1FCCA 1X5GA 2Z65C 2V2XA 1JZ2A 4MT8A 2UXCB 1P7QD 4NUGH 3S5ZA 4CW1B 2IPTH 4P5MA 5BXXA 2AAVA 1BHGA 4UZGA 3WJLC 3NKTA 2ZJSH 4JFWA 3DOHA 4G42A 1ZTXE 3FCSA 2KHAA 3ZVXA 1CAVA 1WP8A 4RIRB 3O6ML 4YXKH 1IARB 1S7XB 4OZHE 5DJ0A 3QBTB 1CICC 4AJYV 2XH6A 1HNXO 4XPHL 1ZUQA 3EUDA 3FO0H 5I17A 4HJTA 4D0BB 2ZD0A 2WKKA 4NXKA 3V0JA 4DIQA 3WT3A 1S7VB 2NUPB 4Q4X1 2IAND 1DGWX 3OB0K 1Q8MA 2FDGA 3NP4A 3VFMA 4QQPA 3HE6B 1ULCA 3EFDH 4UYBA 2FAUA 2R9HD 1JNLL 5D6CA 5CEXA 2XB6C 2ADIA 1I7UA 1F3DJ 1ORSB 1QFUH 4Y88A 4IHBA 2H4EA 3IU4L 1DUYA 2XBTA 5K0UC 2ZKXA 5AB2A 4Y4FB 3VMNA 1CXEA 5FLXN 4FTSA 3AYAA 4KP4A 2UZYA 3RIFF 3I2JA 3RTQA 4ISRA 2DCYA 1NAKH 3QUXD 4PGDA 1A7BA 4CRPA 1QFPA 2BVVA 4P9WA 3I6SA 4U6HA 1YJNV 2ZXEB 4YGAB 2WNOA 1N36B 1G4MA 1KGXA 5GGQL 5C0CB 2Y6HA 1JAEA 2M8XA 3PVEA 1S7TA 5EUOA 1PGL1 5J1AA 4R7CA 1RPRA 1MHHB 1XCQA 4HCRL 4LLVA 2XNAB 1SN2A 4NAJA 4QGTA 2ADFH 3CZUB 3UGXA 3VRJB 5C0GB 1NEPA 1RUPH 4W6XA 4LLUA 1RMU1 3AVSA 2WRAA 2EE0A 4R96B 3OTFA 3B4SA 1HIMH 1QYGL 1IGFL 5JYMA 1QLEB 5FFGA 5JXEA 5D1QB 4ZQKA 1ZLDA 2YXLA 3QFJD 4FLSA 3ABTA 4NFCA 4TXVB 2Q6WB 4WFGE 3SDYL 5C9AC 4CH5A 1V3KA 2E63A 4DV1B 4C4UA 3ABMC 2JIGA 1F7YA 1EHAA 2IGLA 43CAA 2UYLA 3LHPH 2L7EA 3MGOA 3MVSA 4PJEA 4WK4B 1BQRA 3MA7B 5DZLA 3V4UL 2YK1L 2ZP8A 5T5FH 5L4MA 1KGYA 3PUSA 1B2WL 1O75A 2N7SA 5L9DL 1V6NA 4PVLA 4ZAKB 4Z7UF 2H94A 5GJSH 1HHHB 1BE3H 2MKWA 5E8DL 3BWSA 2HWF3 5HI3D 2AZ0A 4OLYL 1A34A 2LALA 4M5ZL 2LU7A 4KO9A 1M4KA 5B8CB 5HY9A 1TQTA 3VWKD 2OCHA 3MRMB 3O2VL 4PJXF 4G8GB 1HXMB 2VXVH 1I7TB 3SKNB 2AJZA 5I1IL 1F4NA 1MCNA 3HG1E 3UZEA 4QHMB 4MAYB 5CP3A 3GIZH 2GH2A 1CPYA 4YC2B 3NNMA 5F3HA 3S36L 3ZDZF 3VFTB 2NXZD 4TVUA 3L4ZA 3LS5L 4I3SL 1FP5A 4M02A 4PLKD 1FATA 3D34A 1C16B 2H0PA 2DUPA 2QELA 1QO3B 3G5VA 4XCNB 1FZKA 2J1TA 4YLQT 4AC4A 5FB8A 3C7OA 5IFJB 4XDOA 4PA4A 2QKIA 3FO9B 3JYBA 4WU7B 3BY6A 1N3NA 2WIIA 3LB6D 3WJLA 3LYRA 5CKAA 1NGQH 3OFNG 2QZQA 3LXUX 1MWAL 1NMCB 1PMYA 3DIDA 4QGYA 1ZHBB 5DMKB 5EF2A 1BD2B 3IJYA 2BH0A 2NTFB 1JIBA 5C6WH 3M46A 2XIIA 3B2DC 4NAQA 2QVFB 5DTFB 1IEAB 2BIIA 4XNUH 4QX2A 4GRMB 1IT9H 2ZSWB 3IAPA 3MRNB 2NMOA 2DUOA 3QCUH 2EO1A 3T4AA 3OAZK 2LGQA 1DEEA 4S1QH 5CBEA 3FQNB 1LDPL 2YQ2A 4MZUA 2AACA 1KTRL 1DQQA 3J26N 3IDCB 2WUBH 4YR6B 1JRHL 4PQXA 3VQMA 1VPOH 4C57C 4L5FL 4A7VA 2Y69B 5DQJA 3ZW3A 1L3NA 4TUJA 2J22A 3LKPB 1E40A 2OXHA 5I66A 4FABH 1DN0A 1OV8A 2GI0A 4A2GA 4G9FB 3RYIB 1W72L 3ELQA 1PO11 2VQUA 1J12A 2E6JA 1OSZB 1N8ZA 2EIEA 4KJQD 5CJBA 2WQSA 5GGRB 5E1GA 2NN8A 2SBAA 4YVWB 2XWZA 4JAAA 1YNTB 2H2PD 5CJ5A 2BPBA 1S55A 4I0PC 3WUCA 3AP5A 1T2JA 4JW3A 3S37H 2Q0ZX 2Y1ZA 2Z0BA 3UDWC 3RL1A 5JQ6H 2SLIA 5IWLA 4NO3B 4X88A 1AQMA 1NEUA 2Q73A 1KB5B 3VU1A 3H1YA 1IG3A 4Z23A 3AREA 1AMXA 4P2CG 1A1OA 4LIQE 2FBOJ 4JRYB 3WHXB 2QNKA 2VECA 5D1QE 1U3JA 1U95B 2BZCA 4S1DD 4MJIA 4KY1L 3AK0A 4W6WA 5C9AA 3BPOB 3J80N 4N5UA 5F8RC 1T04B 1NKRA 3C12A 1NBYB 4DR1B 4JCMA 2D97A 3EIFA 3PQYA 4K7PH 1MA1A 3TBWB 1W2BU 4LL1A 2DWDC 1YFXA 4QQOA 2IDFA 2RJKA 1AGCA 1JFQH 5BXZA 3CFEA 4H0IA 2HWC2 3U2IA 1HEHC 1RL1A 2IXIA 2YMOA 2RS31 4WV8A 4MWFB 4NKMB 3LXBA 2QVMA 4N9GA 1JV2A 2GQHA 1G7JA 1ZHLB 3O6FB 4GMP1 3HS9A 3IMMA 3C7HA 4DPCX 2F7RA 4YL4A 1Z32X 4WW1B 4LFHD 2GVYA 2UY8A 5AL8A 2HH0H 4G8GE 2DBLL 4LOUD 1OA2A 2IH3B 4L8QA 3T0EA 3PUUA 4JYAO 3NP3A 4IERA 1HESA 4J5VA 1U8HB 3A8TA 3AXLA 2FJFA 3D0VA 4G3YC 1U3HA 2Q7HA 1TITA 2ATKC 1EPWA 4KKNA 5BMFH 4NXNO 5B1NA 2B9AA 4OIBA 1CDJA 1T1ZA 2X0VA 3PWNA 5C6CA 1WSST 2AGAA 3WY3A 4PBOA 4J3XA 3DUUB 3QWQB 3TB0A 4OAWB 1E5SA 4M7JH 1CLZL 2ATPB 1RSYA 1MG1A 3O6LH 4YDIH 1ULEA 3RVXD 4IYKA 1DQLL 2OMYB 2IVIB 1W16A 1HRI3 4I2XB 5DMGC 3PLQA 4AR2A 4P9XA 1FYTD 2CGYA 5FPRA 3DX3A 1AYRA 3H42H 4MGZE 2IPUK 4GFTB 5PAZA 4PBPA 4U36A 3ACGA 1A3ZA 1QOOA 4JM2B 1BD2E 1SRDA 4WIQA 4YIQA 4N28A 5IJ0B 1H1IA 4GKJO 1C5HA 3OHXC 5FY1A 3G5ZB 2ZUYA 2IJJA 1ONQA 3MYJA 5DI8A 1NDMB 5GRUL 1WA6X 2CIKB 3IWVA 1ZX3A 5IMOA 4OI8A 4TV9B 1EBAA 4BQYA 5E2WH 4NKQB 2VQFB 3RIAK 3D33A 5JQIB 2PCYA 3ETBJ 1IZKA 3JTSB 1WBZA 3FUOA 5BZDB 3OAWA 3BYTA 3QJQB 3OJBA 4B5EA 5DEFB 5FXWA 3NKGA 2ED9A 1GNHA 3HLAB 4DV2O 5GGUB 1AR5A 4JGYC 2EJ1A 3AG3C 4ZO6A 2W2IA 3J7AU 1Z9SB 4U1MB 2Z35A 2A77H 4FNTA 5C08D 2EC9U 4G9FE 5IB4A 2HT2D 2OTWA 3AG4B 2VZ1A 1BF8A 3DX7A 1HINH 2XUWA 3B6SB 4OU3A 2O61A 2ESVA 3MJ9L 3HI1A 1DVXA 3FONA 3MRHA 5KYYB 3GK8L 1G6NA 3M2MA 1CF8H 4XCEB 1FAKT 4X6BB 4ELMB 8CGTA 3RI5K 1CXFA 1E9OB 1PLAA 1ZLZA 1VERA 2HJDA 1U8QB 2AKRB 1REIA 1M2VA 1CQYA 1Z9OA 2CG9X 4GYBA 2VXQH 4D0CB 4JI2B 3UXFA 1EV11 1NFDF 4G8IA 4MX7B 5EQUA 5DD0H 4ZI8A 5IWAB 4JRYE 3CFUA 1RULL 5H9SA 3V2AR 4PRPE 2BP0B 2A3TA 2CJUH 2BP8A 2F1EA 3CFCH 3H3PH 3NRPA 3QARA 3NWKA 5FYMA 1EFRG 1E9PB 4ZD3L 2HWE2 1I1FB 5T5JA 1NCBL 2F9BT 3C9NA 4Q14A 3ZSSA 1ZZCA 2AANA 3LRSA 2AJ3B 4NUQA 4HFWB 5JI7A 2PHUA 3VNYA 2OYLA 1U3YA 3ZXAC 3P3NA 1K4DC 2A6IB 2GEEA 2PXYC 3E6FA 4AV4A 3NQKA 2QADD 4YL9A 5I30H 1YC61 3FUFA 4HKZB 4M6MH 1VB4A 4X4XA 2XIBA 1I7RA 1S7WA 5KSAC 4ZO8A 3CXDL 4DGWC 2NR6C 3W0WB 1P5UC 3ASNC 2FT8A 5FZBA 5A9GA 3GSVA 2NMNA 2G3NA 3MLSL 5IK7A 4YNIA 4CAGA 5E8NA 3KMDA 2EADA 3N9OA 1VEMA 3CFDB 3FAVB 3MLXL 3HBQA 3Q44A 4X6DA 4RHV1 2CGOA 4I4WA 5J36A 4U4BA 4PG9A 1C8M2 2JG9C 2FEEI 5F2SA 4WFEA 4DR7O 2VH5H 3JALA 4NPYA 4OZ4B 3WN5C 3B3BA 1DF0A 1UY0A 2GNBA 1HEZA 5D71L 5IFHH 4ABWA 1UWYA 4K3DH 3VGAB 3HNVH 3FT4A 1U97A 1BVLB 2BS9A 2EXSA 4I2XE 3FYEB 5F8PA 2YIBA 4CEYA 3KH4A 5FPUA 1O7VA 3GXUB 3T1FA 1M71B 2OZ4L 3MCG1 4O02B 1T4KB 5DJZA 2FQGA 3QW9A 4E9XA 1NYWA 1QQP1 4E4HA 3HMXL 4PP2A 4ZXBC 2BNQD 4XVTH 1CK0L 4ONFH 2W3JA 3LA2A 5DF0A 3QK0A 3QRLA 5JOPD 1FPN1 2YSSA 2BTQB 4X65B 5CFAA 1U96A 3WUDA 4A7ZA 4G28B 3APBA 2IAMB 4HUVA 4PU2A 5HVGB 5C1MB 5ID0B 1CFTB 2CO4A 2F8IA 5EZLA 2QQWA 4JFQA 4XVJH 1RKRA 1JSYA 4OZHF 1BFVH 4NVPA 1J05B 1XOYA 5KAIZ 3K2UH 4NP9A 2WQAA 5FYLE 3SN6N 1P7HL 5LYJA 4KZ0A 2DQDH 1KIRA 2G4GA 3SGKA 2GC7C 4NC0B 2BWCA 2DWRA 2ID4A 5JPMC 2QTSA 3AKRA 3CGTA 3S36X 2BNOA 4O2EA 5F3EA 1PG7W 2HEWF 4XMWA 3RQ0A 1DYZA 1FL5B 2BCKB 3SPJA 1IU1A 4DRRA 4G1EB 1OARH 2YPLA 3JBG7 5T1DH 1LR1A 2BCCH 3K57A 5E2TL 1F2QA 1RUQH 3SJVA 3RNSA 3GSNH 1MQTC 2Z91B 3QR0A 1PO23 1Q1PA 4QXVA 1UZZA 3MJGX 5GSVB 2OJEB 4FLTA 3PREA 4G8EB 2WPGA 1SLIA 3GRWH 4OUSA 1O9GA 4G7YH 1DYPA 3N9PA 4KFZC 2BOCA 2E0PA 1WA8B 2FHFA 2GKIA 4ODUA 2JE9A 3AGVA 1VJ2A 3L3HB 1V6MA 1EEYB 3SE8H 4XDJA 5J4MA 2Z8WC 5FAAA 3ZFGC 2XUMA 1DJIA 3H9YA 4FL4C 2YRPA 4TLTA 2EDHA 4OKDA 3O3EA 1I8KA 1N18A 1D6VH 1E2VA 3AU1A 5AAPA 3T08A 5GGTH 4M8RA 3KPLA 4BA8A 4YWGL 4QAMB 4S2HA 4HNAA 3WDJA 1XYOA 2PXYA 4BSVA 3MRQB 2AQTA 4K3UA 1XT5A 2GNMA 3O0WA 3KVAA 1FPOA 4OLWH 5BZBA 4MTFA 1AE6H 3GMPA 4JG5A 2YBGA 2D3NA 1Z7S3 35C8L 2QJVA 1EDQA 1QASA 2GJ6A 3BUYA 3W0WE 1W2UA 1F02I 5CB4B 1A0QL 1DEDA 4GAYA 3MCLL 3UYRH 3NW4A 1BF2A 2QGDA 4XBEL 2CTWA 1SEBA 3ZHVA 3BCFA 3UTQB 4WBBA 5FZEA 3MRLA 3NCJL 1TVBA 2E53A 2WJSA 2JG9A 2H3NA 4OTXH 2EIJB 5EEXA 2WBXA 4KTGA 2VXSL 1BBJB 3NTCH 4FQQA 4IGGA 1CLCA 2JQZA 3D3VD 4IRSA 4KKCD 4M7KH 1EN5A 1KKCA 2W65B 3BIAX 3QZOA 4P3CH 1DBBH 1Y76B 1L7TL 2YHJA 5I5RA 3L3OC 4ANWA 4UOJA 3T2LA 4NX0A 3TA3C 1OAQL 3ZUNC 1AZDA 1KPRA 4JDTH 4UT6H 3DKHA 4XNZB 3QH6A 2FQPA 2WM0A 1YHFA 2WNWA 4KHXH 2O30A 1NC2B 2I9LB 1Q43A 1CLOL 4OKVB 4P07A 4UQDA 1AR92 1HNGA 3M7FB 1VGKB 3MLWL 4SLIA 2GCYB 3FQ2A 1Q8OA 2QHRL 4IIJB 4XHJC 4GZRB 3MOBH 3BDYH 2X4TA 2XTJB 3OJDA 3BUCA 4P8QA 4WFFE 4FQ2H 4DMIA 4H14A 2V2XB 3WIIL 4JG0L 2P8LA 4K3AA 2VR8A 2N3JA 5CSZA 4LSQH 4NKGB 3HE7C 4P5MB 3BCWA 1MCDA 1IGJA 2W59A 4NM4H 4TNFA 1UM4H 3F7YB 4G42B 5LG6A 1MZZA 3CPWU 1TEYA 5AOKA 4Y5XA 3ALXA 5DO2D 4OHZA 5KYNA 5I6PA 4HJIA 3DIVA 2OI9B 1FJ1B 3B00A 4NQVA 4GKXA 5JPMA 1GMIA 4OCRH 3T8VA 2OK0H 4WGWB 3H8RA 3HKCB 2ZKWA 4NO5B 2BP6A 4LQ1A 4IBTA 4XPVA 5GGSB 4GW5B 2I85A 3FB5A 1Y6KR 4FOMA 3AZWA 4U1JB 4HLEA 5AW3B 1VPHA 5IV2A 2YXYA 2FEDD 1TNMA 1UOFA 3AAZA 1WWWX 2J55A 4YDVB 4YW4A 3ZJAA 4OZOA 5CAYB 2MPAH 3QEQD 3WHTA 4R9DA 4EI5D 1T7XA 2MCAA 3JQXA 4NPKA 3WD5L 3RZCD 4RAHA 3B7UX 4RS5C 1EN4A 2CNAA 5BR8B 4X5QA 1EPZA 2YFUA 1L0QA 1MVUA 5T5FA 2WBJB 3H50A 3ARFB 3BIBX 2ZCLH 1H8TB 1WP7A 1I9EA 1KPVA 3MLPA 3QG7H 1XCQB 3ZN1A 3LDRA 2KQXA 3JUZA 3RGBA 3KWWB 1GM8A 1BVNT 3T71A 2GHYA 1CJPA 2GC2A 2NY5H 2QWPB 4BCXA 2WS93 3PJSA 1MR5A 3RUGA 4AIZB 3GMMB 2VNOA 4ZQKB 4O61A 4P5KA 2PP9A 1WC7A 3CK0H 4NSKA 1FSKC 1BZQK 2FKXA 3WDUA 3QJXA 1RUC3 3P9MB 1MREL 4PFEA 4PHXA 2B1AL 5FKPA 4MH0E 4HWEH 3WW2A 4FPLA 2DKUA 4PJEB 3MYXA 4LTAA 3EH2A 1GN2A 3CFTA 3WV0A 1WMFA 4N0YL 4Z95H 4KU1A 4CDQC 2AUYA 5CUSH 2IXQB 4F33A 2ZUUA 5CILH 4M4RB 5EU7E 4P08A 1PX3A 4B9CA 1YQ6A 1U6AH 1J1PL 1ED3A 1U33A 1PK6B 1TMCB 3C6SA 4B96A 5HY9B 5KTEH 1LM8V 3DX2A 3CCHB 3N6YA 3V0IA 4DIXA 2O4EA 4QKNA 1Q3EA 1HSBB 3HHMA 4FABL 1QA9B 4MSWA 4I77H 3LKJA 4NYKA 3KD4A 2BHYA 1I9RL 1ZT7A 4G7VH 1V9PA 1UC6A 4L3CB 2BV4A 3KT7A 2WZ6A 5F3HB 2OVUA 1J59A 1CZ8H 3TJTA 1DSYA 4HMZA 3U6RB 2YRBA 2H26A 3FF8A 1NM9A 3CMEV 4YZFF 5DSCA 5A6XA 3QR1A 4ABUA 3E6DA 2PCXA 2D0HA 4UCUA 3NFPA 4X7SH 4L0ZA 2HUHA 2XTJE 5JW4R 3RIAF 3GZKA 3WFEL 5FB8B 5DUVA 4XCCH 1NA8A 4XAKE 1T03H 1U5XA 1WD3A 4B4RA 1S0VA 3K59A 2Z4FA 1N3NB 2WIIB 2EP6A 4X42A 3SDXA 2K0RA 1HZLA 3RWJA 1TQBC 2PLV1 4INDA 1CWPA 4QGNA 2WA3A 4PSPA 1IBHA 2VPVA 3IJYB 3ZIXA 4L23A 4W9FC 1CICB 5JIDA 4Q4W1 3U11A 1F4WL 5K9JL 1E4WH 2Z8VC 3V9CA 5A2KH 3BZEB 3TO2A 2QFEA 1G6UA 1SFNA 2HPOA 1SLWA 2NY0D 3GI8H 4CSPA 2YPJA 4B0MB 2X4OA 1ZA3A 1GP6A 3WOVA 4TNWK 4DP4X 3RNQB 2Q69A 1DEEB 2LGWA 2HLEB 1WW5A 4JX0A 4MVTA 3W7TA 5I75C 1ZS8A 1YAIA 5J11C 4C8XA 2G2RB 4H8PA 4N4YB 5LGHH 5F7EH 4C56D 5GZNA 4RFOH 5DQJB 5DZJA 5FYJU 3X3FH 4AI7A 1LRHA 2WFF1 1JZFA 2XKPA 5K0UB 2OXHB 1MWAB 2CAZC 1UWGL 3GM0A 3QCVH 5CEYA 1DN0B 4Y9EA 4FYTA 4ADJA 1BJ1H 4MA8H 1JNNH 4YE4H 4AVCA 1AOZA 1H6XA 3GDCA 2QR4A 3AS1A 5LHGA 3CZEA 3ZHFA 3DXAA 2KD7A 4ZS2A 3D85B 4G6KL 4UBDC 3PGFH 2Q8DA 3RL1B 4GSXA 5D1IA 2QVKA 5KX5A 3I2FA 5EC1C 2VR3A 2DLGA 5IJVA 2OR9H 4TQ8A 3O0RH 4NR1A 4XCFH 3ZX1A 1KACB 2C1PB 1Q72H 5FUZL 3OKLB 4B1MA 4Q0QA 3AY4A 3T3PB 5F7AA 1J83A 1P4UA 1UWXK 1IGCH 4GXFA 4ZDHB 5L3FA 1OGAB 2I69A 4HA1A 4MJIB 3PUAA 5C9AB 4K0KO 1W72B 4YHMH 4JZOA 3ABMB 1MKFA 3BCDA 5EU4A 1YY9C 4PCSA 5JMOC 5FWQA 2FH8A 4YBQD 1YQCA 5KSUA 3EBGA 5SV3A 5AD0A 2C1OA 5JHLL 1RUH1 3H01A 4N9GB 2ZKYA 1JV2B 1FVEA 5DMIH 3KLHC 1JGVH 4X7TA 3DDGA 1SEFA 3L8QA 3UNPA 4NWUL 2P43B 2E6QA 3ZO9A 3KVQA 4HLJA 5GXBB 4PRBA 1Q56A 4MYPA 1UWFA 4HZLB 2QQNH 3L9JT 5T5PA 3E6CC 3SOBL 4G82A 2EKSA 4GP5B 5LKNA 2D31A 4JHVA 4OUUB 4FOQA 1G1XB 2OCCC 3M7MX 1T1ZB 3LOWA 3PWNB 4P57B 5DC9B 4D8PA 1YEJH 3Q6GL 2LUWA 5IAVA 4Y4HD 5JIKA 1N3PA 1XNCA 2Q2LA 4CXXA 4J3BA 3UADA 3DYPA 3U82B 3P4NB 3MV9D 1DQMH 5HYJD 3QBQA 1YJDH 4ZUVB 4BQ9A 1XMQO 3WU2Z 1BEV3 1TMF2 3PL6D 4HQQL 2NW3A 4AYEC 3DWTA 4LP5A 1VRH3 2B5IC 3AXEA 5CADA 4Z7AA 2JG8C 2VG9A 1AKJA 3T65A 2EH8L 3HZKB 3SB3A 1H6TA 2DFBA 4MGSA 2H1PH 1AJPA 1MELA 4GP8B 2A6YA 5JH7A 3UKTA 5ECGA 4FFWC 5KVMC 4N7UA 3IJEA 2WLYA 1T66C 1UJ3A 1WA4A 2GBUA 2E74C 1PG7L 1HILA 3KG2A 5DI8B 3WB1A 4Y9BA 4YSQA 4PLNA 1VBB2 1X5IA 2R9AA 1DQ1A 3VD5A 5IMOB 3M8OH 1L7LA 3JD73 3MRGA 4ZPVA 1LEMA 2VXQA 3O14A 1WBZB 1VCAA 1L7IL 2DQEL 2UV3A 3GTTA 2J1VA 4SBVA 3ES4A 3FFOA 2MQ3A 3FF7A 2VL5A 3SY0A 2VY0A 4XDKA 3VWJC 2XTAA 3V5HB 2WXQA 1P4LB 2Z35B 3KXFD 1SVBA 4HISA 2WC7A 4QX5A 1YPZB 5IB4B 2IDCA 2O61B 4ELMF 1N7ML 2ESVB 3TFBA 3TO4D 3HI1B 1YNAA 4I0BA 3MRHB 3BI9X 4I0PB 4LSPH 2V3EA 4RWHA 4Z7WA 4L4VB 2NYZA 3UJJL 4LF8O 1GYAA 3PNWB 1KTDB 5AOMA 2NXYD 2W9DL 4WHYH 1NCQA 4JDVA 1M2VB 3RZWA 1XEUA 4GRWB 2UU8A 5PCYA 3A4FA 4FQCL 4G8IB 2D7TH 4J6GA 3CTTA 1OF0A 2EXYD 1Q9LA 4CCDA 4L5FE 2ZR3A 2R2BB 4JAMA 2NNXA 4JG9A 3T3PE 3VV1A 4B8EA 4C1XA 2PKDA 1CGSH 3HLKA 2YUWA 1QLNA 1F3JA 1OGAE 2JB5L 4GAJH 3V5DB 1JBCA 2R061 5C4WC 2BP8B 1OT4A 5E1HB 4RZKA 1BG1A 2ZMNA 4J8QA 4B9KC 3LB9A 3U07A 2NMSA 1RLBA 4XF1A 1UYWL 2X1PA 4KXDA 2NYKA 2DI7A 5JMOA 2DWDB 2VLKA 2FSEB 4LB8A 3CQPA 4I9WD 2DAVA 1ASQA 5AKSA 1DUZA 2BZDA 5HYSB 1FI2A 4CXYA 3GUTA 3NA4A 4BM8A 3K6SA 3T1WA 3E6FB 3CRMA 3FZ3A 4H7MA 4CP2A 4YDLC 1AXTL 4LEOA 4W8JA 3WY6A 4LPLA 5BNPC 2HVKA 1MW1A 2XN9D 4HGMA 4HUCA 1MPAH 4NIYE 4XWOD 5SWSA 3V95A 2XFXB 4XO5A 2NDGA 2CBQA 3AZXA 2KDGA 3QZWG 2CGRH 3NSDA 4LCYA 4KO7A 1GZ9A 2ATKB 2B1IA 4NZJA 2A9AA 4RBPK 2Y06H 4F9PA 4YHNB 4LIUA 5DUWA 5ERLA 4JR9H 1LUVA 5AW5B 2X0WA 2YA1A 2ADJA 3MSPA 2WZPP 3E6BA 5F5IA 2DMXA 1IBLB 1M4UA 1IKFL 3OAYH 5D55A 1GV9A 3O7OA 3NH7H 1G9MH 5LBEA 1KGJA 3QAQA 2WWOA 3TJPA 1CWVA 2Y2WA 3V52L 3FT4B 4ETQA 5F44A 2W91A 1BVKA 1JMXA 5IBTL 4L8CA 4Z3HA 1RUE1 4JREC 4F8NA 3T6QC 3ALQA 5K9KA 5DUXA 3RVUD 3AK2A 4D6QA 3WF2A 3L5XL 5T5NG 1ODUA 5DEGA 2UY7B 1MFAH 4PRID 3ETBF 5GGVL 4XMAA 4AQYO 5HDQL 3RYHA 3LKSA 1HH9B 4NC1C 2MEJB 4DGIL 2JJVA 2XPGA 3OHXB 2VR4A 3FUQA 3QQXA 3N5AA 4OHWA 2VWEC 3SDLA 1D5ZA 4PLJD 1JCKA 5EZIH 3C7GA 1HXKA 3GSNA 3CB2A 1SEQL 1K85A 2OP4L 3QQ9D 5DWUL 4Q4Y1 2YN5A 4PRDA 2IH1A 4NRZB 1IQWH 1Q9OB 4WO4C 5ILTL 4RETB 3OEAA 2J71A 2RACA 1VKXB 1I5XA 3GRWA 1GZPB 4EN8B 1AIFB 4GAAA 1MUJA 4JPQA 4JGYB 3AG3B 1GSLA 5LYJB 4RYDA 4X1IB 1QZNA 4UIMA 3FN9A 1PIV1 1OZ0A 1LO2H 4ZT1A 1YPZE 2ICEC 1TXKA 2B7YA 5DVKA 1PD3A 3OX8B 5AVXB 2O6CA 2DDUA 2YD7A 2ESVE 3Q1SH 4RAIA 1FL6A 5T1KD 4FPYA 4O4YH 5E7BA 2FGWL 3B7YA 5AOZA 4L4VE 1QR8A 5GGTA 3WMSA 2NUTA 2NY5C 5GS2H 2B3RA 5IQNA 4X4ME 5ENWA 2VRAA 4K23H 4GRWE 1SOSA 1R17A 1T21A 4JY5H 4PP1C 4AITA 3NIFB 3O1TA 4DW2H 3HZVB 1KELL 1X7QB 5CINL 4OD1L 2VKWA 3H54A 4RGKA 4D0DA 3OHMB 4FFVC 5CFDA 4O9HL 2V8LA 4JYCA 1Q90A 5D7IA 3HS0C 1KMGA 1H3XA 2XYCA 5JUVA 3BKML 1QOKA 2LP7A 4HEMA 1HCVA 4K2UH 4J3OD 1P4BL 3IS0X 5FIXA 1J8RA 1I8KB 5FXCH 3T1YO 3HZYA 1JGUL 4GSDL 3BAAA 3ZTJG 4DO4A 1PD6A 4LF3A 1UZ0A 3BDYL 1LVEA 1XH1A 2X09A 4BRVA 2X29A 2VLJA 1FV3A 4ABQA 4OLZH 4HNAB 1K4DB 2WWMC 2ZOUA 1EMTL 5CU1A 4D9QD 1QF3A 2PXYB 3TEZA 3EO9H 3D39B 4LHUD 1BEYH 5LP6C 5L8KB 3FRPG 4JQIL 2Q7EA 1OGTB 3GMPB 1JUIA 1B4TA 4KBBA 1XNRO 5BJTB 4E27A 1P5UB 3ASNB 2GJ6B 4UT6A 2O5XL 1MXGA 2J88L 3BUYB 5H2BA 3RGVD 1K73W 5DJXA 3TBTA 2HFFB 3B69A 3IPVB 3M1HA 5DAXA 4DK0A 4GAYB 2CSPA 3W9DA 2XXGA 3VM5A 2XQXA 1UB5B 1JZDC 5C3IA 4OLXH 3GRBA 2JKBA 5AVQB 1WJZA 1KN2L 1W6WA 3CBRA 4NBYB 1I8MA 2JG9B 1YNLL 5F1NB 3J8F7 4A2DA 3ZL2A 3WN5B 1O6TA 2ALWA 1DDTA 4GKKB 3KYNB 2N1TE 5EO1A 2MMXA 3ZE0F 2DEWX 15C8L 4EDWL 4DKDC 1REFA 4CCEA 4EWDA 4J8RA 4RZCA 1N2RA 1URLA 2APVA 2XQYA 3SIKA 3POJA 4AZZA 4PV1C 2XTLA 5DJYA 25C8H 1IE5A 4FG6D 2FTKA 3KL5A 4XODA 1YJ9V 5F1IA 4IEFB 4UM9A 5EZOL 2WK2A 3VNZA 4ZXBB 5E03A 1L9NA 1AHSA 1HC1A 1IPKA 1LP9A 1HLCA 1QFOA 4HK9A 1LQSR 3RDTA 2JLPA 3RZMA 1C12B 4HS3B 3CJJA 4XF0A 2JGDB 2A0LC 4PY8J 4OCLC 4WTQA 1G7HB 4JGZC 4RWYH 4WO4A 1K72A 3JTBA 5F5AA 3UC0L 5CCKH 2BY1A 2PTUA 3QG6B 4IMLA 3AEIA 3VQLA 5BXFB 2HVBA 4Y16C 1JGDB 4A7KA 1J7VR 2ARJQ 4W9LC 3EMRA 5BYNA 1XBLA 4QRPD 3WIFA 5GJ6A 1CTNA 1GP5A 5JPMB 3C75A 3Q5TA 1U5YA 1EAQA 1FN4A 1WD9A 3UTPE 3P4LA 4ADGA 3ML0A 4RWUA 1FAFA 5GW7A 5DRZB 1R5WA 5HGHA 4X62O 1P9MC 3W39B 4A2LA 1D7PM 2VOVA 4X7EC 3LRMA 3TL5A 1XYNA 5IV2B 3L9RA 1C8PA 4WV1A 4XZ4A 1CG9B 1MQTB 1TZ8A 3MOAH 5D72H 2R7EA 3BPSA 4KAQH 1K45A 3NIFE 1P4IH 2HLAA 4TULH 1BIHA 1TUPA 1CVSC 3K2KA 1CXKA 3QIWC 5I15L 2FX9H 1P6WA 3B9CA 1W6NA 4XETA 1YY8A 2LFSA 2VDRL 4EZKA 3LEYH 2VDOH 4I4TA 3KGSA 4UOQA 1UFIA 1KFAH 4IXLA 3HS0A 4Q8LA 2VGDA 4RQPC 5EUOF 3ZFGB 4RGNC 1MVUB 4WU5B 1PG7X 4FL4B 4Y4FD 2D4DA 3TV3H 4EIBA 1CIWA 2O6EA 3HQUA 1IBMB 1FV1A 3RDJA 2A3QA 2B59A 3CXFA 4CTEA 4RUEA 1KGCE 3NABL 4RGOL 2VE6A 4RISL 2PI4A 3NJMA 3S3PA 5C0CD 3PJSB 3V56A 1UKRA 1AD9B 5HGDA 2H1LM 1HCYA 3K7UA 2NW2A 3D39E 4P5KB 4CCNA 2H8PC 3WUWA 1LHZA 4AQAA 4UTAH 4GWMA 1XZWA 4PJEF 3PWPE 4RNRB 1QKQA 4AEMA 1RLWA 3B56A 5LB6A 2OTUA 4JO3L 1CURA 3UAJA 1Z9LA 5D1QD 1VBE2 4ODHH 2XZCH 1KTJA 4PF1A 5E8EA 5LXGH 1FT9A 4FMTA 1TTBA 2H41A 3MREA 4HKBA 1JD7A 4F33B 4QKDA 4CP9B 1FA4A 3MIEA 2WZ8A 1WFMA 4CXWA 1Q6IA 4JMNA 4XPGH 2OBGA 3VXSA 1JFFB 4HONA 1ED3B 2NY2C 3N2JA 4EPSA 3C6SB 4MAUH 1UFUA 4KHTH 1REEA 3URFA 5LB1A 4IBVA 2VN7A 4AMKH 3VI4A 3L3OB 4JHWH 1WAEA 3TA3B 3LNDA 3TEYA 3HPLA 3MTRA 5ISZD 5DABA 1J8HB 3VUAA 4ARYA 4N8VB 2HWE3 1BWMA 3I7DA 4X9GA 3JSNA 4XGZB 2UXVA 1MS4A 3T4HB 5B2GB 1Q6UA 4J2QA 4MAYD 1PJWA 2DQUL 4C7UA 1DR9A 2VQEO 3FQ1A 4L0YA 2J57A 1Z78A 1F6FB 3VFGH 5HXMA 5FZ6A 4BCYA 3WB2A 1S3JA 1EO8H 4N9IA 1AGBB 5DZOA 1T1XB 4LBQA 1DLHB 1XGPB 3HE7B 4I85A 3SDXB 4EROA 1UA6L 1BZKA 1PZCA 2LE9A 3ULSA 1QNWA 1E43A 1FNSH 2FHRA 4LR4A 1CLYH 4QQLA 5T3NA 4C4KT 4Y16A 5BOJA 3BD5A 4OY9A 4F5CE 3V0FA 2MPFA 3TO2B 2XVKA 1I85C 1OCRC 2X38A 3NJLA 3I3EA 2EE6A 3RYCA 5AL0A 1DFBL 3WDWA 4Q97A 3F7RA 1SQVH 4MJ4A 2PAMA 1C8M3 4L0PA 1PKXA 2C7FA 4HS8L 4WI0B 1RUJ2 5D2LB 1AYM2 1KJMA 2ROYA 5IYBO 1ZS8B 4GW1B 1C1LA 3VKNA 2O5ZL 2WGNB 5EFIB 4J23A 1N0JA 1KXTB 5ANHA 4X1YB 1RZGA 4F7ZA 2AERT 3DSNA 4KH9A 3FB8A 5CEYB 4Q4V1 1ZSDB 3S30A 3OR6A 5EPAA 2UUAO 4MGXA 5LBGA 4F57H 4AH2A 2W9EH 1M3JA 4HGKC 1ULVA 4JE4B 4N0UA 4RS5B 1SHWA 3QT2A 2GI7A 2JLLA 3EQEA 4O00A 3LKOB 3DXAB 3CX5J 1X7SA 5JDSA 3T4YB 1MRFL 4E5XA 1ZA6B 4XHXA 4MHRA 4L29B 4DNYA 1DQML 1NAEA 3BEVA 4MHHG 1M6UA 3T3PF 3KF3A 4R52A 1TIUA 3OEHG 1F8TH 3F7KA 1KQSU 2C3HA 3DROB 1MCKA 3QEHB 4NO0A 1SQ2N 4WK2B 3CSGA 4Z76A 2VDNL 2QQNA 1MH5A 2H8PA 2WLQA 2WYIA 1FSKB 3I02A 4E9YA 2YEZB 4DP5X 4JZOB 5CA6A 5AEAA 5JCTA 1KOAA 4DFIA 5E5MA 4ZMQA 1A7RL 1BECA 2P8MB 3GHEH 3S3CB 4JRYD 5E1AC 4APQC 2O72A 1E5IA 1YC8A 4NC2B 4F7KA 2RHEA 4W70A 2H6OA 1QVFU 1OE1A 5IB3A 1MCHA 1Z3RA 5KSUB 1KS4A 4POZC 1SZBA 4Y1XA 4CDQB 2WWJA 2NRDA 3AL5A 2ZX1A 2N7BA 4IEUA 3IGFA 4IK7A 5ICYB 1XF2B 1UCTA 3GO1H 4WY7L 5HSFA 4WUUD 5E94B 1JUHA 3QTCA 3VXUA 1DGWA 3DV4B 1Y9MA 3WEAA 4ZBJA 2WXRA 3MIFA 5ISLA 5EBMC 1NANI 4CC5A 3W2DH 2ZCWA 2GITA 1SDDA 2W47A 4KHPO 1HWYA 3CZLA 4N2KA 2L9LA 4L48A 3CMGA 4K1ZA 1U8MA 1J8HE 3RBSA 3EYOB 1AI4A 1QWUA 3A7QA 4Y1UA 1W0WA 1V10A 3EG9B 4TSAH 1RZJC 4JO1H 3RU8L 4UB0H 4MW8A 4Q8BA 1GS6X 1CFNB 5IW6B 3WTUA 5E0FA 4JFTA 1KTKE 5FFOC 4NLAA 2OMTB 3RY6A 1ACYL 3WFVA 2NW3B 3TT3L 2GC3A 3T77A 2XXMB 5I91A 3SDXE 4UXNA 3H9SD 2QWRB 1TQBB 2DYPA 2H6UA 1IIIA 1B3JA 4FLHA 1RUD1 2GU9A 2W52A 1T5WB 4HYOA 4WEBH 3PHQA 3THCA 5DHVH 5J56B 3CHXA 4PJ7A 3LN9A 1TME1 1NIAA 4Z7QB 2R071 4NZUH 4R4XA 1HILB 3N55A 4UDUB 4A6YL 1CXIA 4KDTA 3UBXG 1XNDA 2OYMA 1MCJA 1K5NA 2B1OA 1SMAA 2IO5A 2QPEB 3OLEA 2ZHLA 1JZIA 4C0HA 1ZRFA 2QUOA 4YZ3A 2Z4QB 5D2LE 3KT4A 3ZMEA 3K81A 5I75B 1T6GC 2EUVA 5APAA 2X4RA 3C8XA 4YVSC 5J11B 1XEQA 2P7TA 2N0MA 5FO9B 3ZFFB 5IK4A 2VL5B 3EZ8A 4N90D 3VG0L 2WYZA 4A55A 5A3IC 1R9FA 3SY0B 2BVTA 3CDZA 2TEPA 3TYFB 3NJVA 5DG1A 3AFKA 1CVNA 1H0BA 4XMKL 4FPHA 2HBUA 2FHBA 3TZVA 1BLZA 1AR93 2Y06L 2DYSC 3L7EB 4AEHH 2PYJA 3R0NA 2NX5A 3PWJA 4DKEL 4ZFFB 4Z7WB 1JL8A 3DXAE 4KVPA 2ZPKL 1A6PA 4H4NA 4BKLA 4ZI7B 3NYKA 4QHZA 2PHWA 2W9XA 1I9JL 3HB3D 1B88A 5EC1B 3TASA 2HLFC 4R7DB 1IM9B 3NEXA 1GCFA 1VAVA 3WF1A 1NANH 3U6XA 3KPRA 5A3UA 2X88A 3VQ2C 2DL9A 4OI2A 1IEBA 3F95A 1ZA7A 1MN4A 2K8MA 3QDGB 5LY1A 4DXRA 1UNBA 1F3JB 3Q7JA 4P2RA 1JA8A 1XYPA 3ELNA 1YMMB 4ZZ5A 4O5LL 4Y5YA 5D1XC 3H3ZA 3X3GH 1MZ6A 1MFAL 5FCCA 5CG9A 5H2FZ 3D0LB 3WVJA 2DM3A 4RQEA 4MXWL 4OJDH 1DQ5A 3GJFH 5DGQA 3QEGL 3VH8B 4NJ4A 4G5AA 2EVGA 2WJ7A 2YD1A 1A66A 3V0DA 3GUTB 4PW9A 1RZJL 3UG4A 4WKXA 3VBSA 3K6SB 3HQRA 2CLZA 1ZRRA 1AR1D 4LEOB 2VQAA 3CCLV 1TZHB 5IK3A 3EOBB 1RVF1 5J96B 1PAMA 2DWEC 2PPFA 4F80A 3MRDA 1BPVA 4WKZA 1SN0A 5IYZB 4PWFA 4LCYB 4X6DF 2YIDA 1UENA 1S5IL 1JF1B 2JTDA 4WSKA 2OCCB 3Q8EA 3C2SA 5L9VA 2EYRA 1LO4H 4Q1RA 1IBGL 1X4ZA 2NNUA 4QKFA 4W93A 2EVFA 2ADJB 1CXHA 5HHOA 4XAEA 1TUBB 4FLUA 1S9WA 1HX0A 5FDWB 5LBSL 4YFEA 3FPYA 3ROOA 1NE6A 4AEIL 1A5FL 2AEZA 3EJJX 4NUJA 4OFDA 3U4EB 1V6KA 2CJTA 1M9SA 3MI6A 1MQ8A 4L3AA 4WSGA 1S2BA 2LRPA 4HVBA 4ETQB 2Z5WA 5GLUA 3TN91 1CGYA 2B5IB 1QVOA 2JG8B 4NCC2 4LCCA 1RQ5A 1OLRA 1OOPC 1XGQB 3I2CL 5IOKA 4GB32 2GBOA 1AI7A 2ICES 3UK9A 2VISA 1UAIA 1BQUA 4TRPL 2AGSA 4FADA 3F2LA 3ZU8A 4XO3A 1MSPA 4DEPB 4Z7QE 2E74B 5A6IA 4XJ9A 3MIDA 3ZMTA 3D4KA 1D5ZB 3X1GA 2JICA 3ROLA 2AVGA 1OD5A 5F70A 4XBFA 3BJLA 4ZS7L 1RHI2 3GXNA 1UH2A 2Z92B 5K1XA 4M1GH 4PRDB 1S0EA 2FDFA 4P3WA 1C5CH 4X98A 3I56V 4C91A 4PJCB 3ZXJA 1N26A 4DQOL 2IAMD 3S35L 4F7MA 1GMGA 3BB6A 3VWJB 4PA3A 1F6AA 2DH2A 1FFTB 3ARPA 4GUCA 5TFSH 3WIHH 4AQ1A 1DBAH 1P7KB 3U4XA 4U1KA 2QJDA 3TNNA 3IDNB 4KZDH 5C3RA 1FL6B 5IB1B 2F74B 1LGVA 4HXBH 4PJHE 5CS7A 5FYKD 1U3NA 4OT1L 3G4SV 3TGUH 5KMGB 3RVVC 3KKYA 2WT1A 2EIKC 3D7PA 4BQXA 1BHBA 2DS4A 3P2TA 1OQOA 4Y1YA 3FHEA 4CCOA 1W8OA 2VT0A 5LA2A 4X5WA 1HVXA 1U0QA 1TJHL 1TLKA 1CGVA 1KCSH 4LESA 5HTSA 3QDGE 1K4CC 2GDFA 4CCMA 2XWBB 1GXEA 3M3IA 5C4WB 3O1OA 1YMME 2GC4C 2R69L 1G1OA 3CXHJ 4XB8A 4Z07A 3NCWA 4BZ1L 1RPKA 2X4QB 3QO1B 1ANUA 1A3LH 2A9MH 2D6KA 2E7LC 3K6IA 3BA9A 3ULVC 3QI9D 4QXGL 4EI6A 3HPJA 3GHBL 2IC1A 5FM5O 4LO7A 3WHE0 5I0UA 4AI0A 1DDLA 3QUKA 4FZ1A 4PELA 3EGXB 4XAWH 3T6WA 5MHSE 1JHLL 3OLGA 5FBZA 1CN4A 4OD3H 1IVTA 1GQHA 4IMKA 2ZX6A 2P34A 1FG2B 4HBQA 4NNYA 5CSGA 2Q8BH 4GH4C 4YDLB 3FFZA 3FOMB 1F4XL 1X9QA 3EHKA 1A6UH 3TJHC 4PG2C 1J5OH 3IJ8A 4LSTH 4TVPD 5BNPB 2F53A 1KC5H 3CHPA 3LEXA 3K6FA 5DJXB 1CDYA 3U4AA 1LE9A 1KTLA 5GGVY 1UFGA 1A6TA 1GR7A 1LGBA 3CN3A 2JDHA 3U37A 3ATDA 3RZKA 4PJFB 3L4TA 4TQFA 1I8MB 1VRSA 2FWOA 1LNUA 4JB9H 2KZ1B 5C0FB 1RJ8A 5D7JA 3TBBA 5DVNA 3GINA 1R3JC 1PYWA 1J5EO 3KLQA 4PJIB 4PYGA 2VW1A 3FQXB 2F43G 2PP8A 3GUFA 3P0GB 1SN5A 3AZUA 2YGOA 4HUXA 4KAQL 4RZCB 1LEKA 5DJYB 5HHNB 3I3DA 3TU6A 3F8UB 5F2FA 3TN0A 1GGUA 3CBJB 4U1SB 3K3QA 4EBQL 4JREB 4EKXA 2E33A 5AB0A 3DUSB 3ACIA 4DCQB 2KKQA 5T1LD 5F1IB 2WVVA 4NXMB 4RMBA 2XY1A 3OMZA 3RKDD 5DD5H 3WDIA 3FT9A 4BWUA 2W39A 4KI5C 5F7HA 3KYOB 5KBKA 4J1XA 4GUQA 1NC2D 1IKOP 1OCOC 1X7TA 1KEXA 5I8YA 3CC5A 4Y9FA 1V7NH 5B7MA 1INDH 2PCFA 3K3WA 4HFSA 4WO4B 2V9QA 3RWHA 1QXRA 1BMV1 1L6PA 4WWKA 1SXAA 2XTJD 4Y2DA 1F11A 3BPCB 4GG6A 2I24N 1MCCA 4PJCE 3TYGL 1K5MC 2ODIA 3CCUV 4MQ7B 2DU1A 2ZBJA 4XT1C 3L4YA 4W65A 3BFOA 5EDSA 1QNMA 3FUDA 3HC4H 4HU2A 1V54C 2ZE5A 4ODHL 2RS52 2ICEB 1BJ1J 5DYFA 2LOEA 4CS3A 4LFAB 2DYCA 5KA6A 4ODSL 1JXJA 3ULVL 5DJ6A 2ATAA 3NAPC 3AP9A 5HGHB 1GKEA 3OD3A 2UXCO 1NU1H 4EN3B 5IHUH 2R6QA 1RUAH 1F4HA 3OKMB 4QUOA 5D7KE 1XH3B 4WV1B 3WKMH 2DLHA 3THML 1QNZL 1MIMH 1TMF3 4QLRA 1SLTA 4TYSA 2GY7B 4QHKJ 4PJ5A 2K70A 3P4MA 3QNXA 4UTAA 3W7WA 5ANNA 3DURA 3SKVA 4DXSA 4POUB 3QFDB 4LAQL 2VL4A 3D18A 4I18C 3FQRB 1HZHL 3HS0B 4ZMPA 4M00A 3SQRA 6FABH 3IBOA 1OH3A 1TZGH 4FQ1L 3UABA 1TZIB 4EVNA 1FV1B 2E7LA 2B59B 4TLKA 1VBB3 2BVQA 4FFZL 3DGEA 4GXUN 3RTQD 2EXJA 4YGEA 2RS53 3WEZA 3HZMA 3P0YH 3RUGF 4IEYA 3DVIA 2DWXA 3TA4D 1YZZA 3BDBA 4EMZA 4XMPH 3KNBB 5FYJH 2JJTC 4X1KA 2YDEA 1BZ9A 5LP6B 1DE4B 2NW2B 4UYPA 8PAZA 5IB2A 2WVSA 3WFDL 1SCRA 3Q0HA 3X2QC 4YPGB 2VDRB 1CLYL 4YZ4A 4NNPL 1GHFL 4WVRA 1N36O 4LFBB 1V9U2 1VQ9V 2OTUB 3EBIA 3UGUA 4EOWL 5JXED 3ZPYA 4DV6O 1KBKA 3HG0A 2AJYL 5BW7A 5F3BB 1VLXA 2CK3G 2GY5A 1QU0A 3AB0C 4PJFE 4WBNA 5CA1A 4LARH 5B1AC 1RURL 4E0RA 3SJAC 1OSGA 3T2MA 5B4XA 2EVXA 4H5SA 1VJSA 3UIZA 1CXLA 3FKUS 4PJIE 5JR1L 5GLWA 3WQ0A 3MN8A 1UXWA 3OYWA 4DV1O 1L4IA 4PA7A 5C93A 4PV1B 1XR9B 3EDJA 2BJSA 5JI9A 3RKPA 3ZTCC 1S7RA 4R8WL 4BW9A 4KXCA 3MV8A 5IKCA 2TAAA 3OSVA 1IO4C 2VNVA 1LMIA 1ZANH 1CU4L 1Y07A 2WABA 4META 1NUKA 3DYOA 3H2PA 1NCAH 4DGYH 3BP4B 4FAGA 1VR3A 2VYRE 5A6YA 5AQ0A 3GMNB 4NC1E 5I6XC 4R4NC 4UT7L 4F2FA 2VWEE 4YG3A 2JJSA 4MJ5A 3DARA 3SDXF 3S5LG 1NAMH 4IOIA 3QXDB 4H8QA 5KJ7E 2CZNA 2RGSA 1EEUA 4JGZB 3WQ1A 3OGRA 4F3FB 5AAMC 4G8FA 2LTQC 2B5HA 2YMXH 3QHZH 2X42A 4WCYL 4Y16B 5EV7A 2P4KA 4K94H 5KYXB 4FFGA 1UY3A 1E65A 3C5ZC 1JHNA 1IJNA 2IADA 4XO8A 3WNPA 2RS11 1G9HA 5CEZL 3RMXA 4Q29A 3GS7A 3EDKA 5TISZ 3BAJA 2G0LA 4HVQA 3ZKXC 3QUYC 4R8HA 2A6KB 5J7CC 4PR5A 4I55B 1M7UA 1IGIH 5D2LF 1AYN1 3FB6A 4R9CA 4E2SA 3WEBA 3L3KB 1E5ZA 5IHHA 4NB5A 4N2GA 4ANVA 1QFWI 5HHVH 2W0PA 3MTXA 4X64B 2GUOA 4ES8A 5FRAA 4RAUA 4FFTA 1OGPA 4LF7B 4CC1A 3UPRA 2WNVA 4O9GA 1AL21 4R83A 1RZGB 5H37G 3DSNB 3QIWB 5IB5A 1MAJA 3AKPA 3OUJA 4QHPA 4NKIH 1CFVL 3VL8A 2ZGTA 4IBYA 2I9TB 4AH2B 3OD4A 2B4CH 2CHNA 2X53A 4QRUA 3VZMA 3P3SA 4RQPB 4RGNB 3GRGA 4DPRA 3EDDA 2V7HB 1S9XB 4GKSA 5FO8B 3MO1B 3DI3B 5J6GA 3K0GA 3CVIH 1C57A 1QJX2 2OTPA 2ZXCA 2FO4A 2XX1A 4NIKB 4E5XB 5GS0C 3US9A 3V9FA 4D9LH 4O2BA 1NL0L 4CDXB 1VADA 1DQ0A 1GVIA 5CN0A 1B0GA 2DV6A 4WI9A 4YW3A 2R1BA 1ZT1B 2YEVB 3HN3A 3R06B 4XH2A 1LEIA 2Z7ZA 3C5XA 2HWD1 5I1DA 3MF6A 2KERA 2YO3A 3ZMOA 2J72A 4IUGA 2IPKB 2H8PB 3S35X 4E36A 1KMIZ 4PGEB 4WVVA 5CISA 1KNOA 5CBAB 1JPSH 1JR9A 3ARED 5E5MB 1M9WA 4K3EH 5FX3A 4CVZA 4XZUB 5E2UH 3RWNA 2CHZA 2HA1A 5C8CC 3MRFB 1KP2A 2Q9OA 3NGBC 1UIJA 1OGAD 3EO1A 4HIHB 4MJID 5IB3B 5IHBA 1OCWH 1RFYA 2FQEA 1EWHA 5B4MD 1MSDA 1BS3A 3ZY7A 5A43C 2R32A 3NSYA 3SPHA 2AXGA 4P9MH 3FZUD 3NJHA 3PQYD 4MMZC 4XBPB 5ID1A 2HX9A 1ACZA 5EF3A 1ROCA 2G2NA 2NY2B 3FFDA 3M8LA 3IB3A 4MYEA 4D94A 4N68A 4BKTC 1TYEB 4LBMA 2VDNB 2FATH 1MEXH 2NQ3A 3EH5B 3LIHA 3PTYA 2AXTZ 3LAFA 3B5GA 3WSQH 5ITZB 5BRPA 5DHVA 1X5FA 5FF6B 1U8MB 1R1BA 3LNFA 5GJTH 3IJ4A 4DZ8A 3ME2A 5FY7A 3FTSA 3CH8A 5B1CA 3LS4L 4LASH 3O1UA 2V9RA 1UF2C 2MNUA 3T0ED 5D5QA 3VBHC 1BF5A 5GRJL 5DMJB 3E83A 1XSIA 4Y0GA 2J6WA 1QFWH 1RAMA 1U3HD 5I73C 3OGCA 1S0FA 2XWJA 4QY8B 5I0XA 2C3WA 3H4HA 2PFWA 4K20A 4B29A 4WZ9A 1NFIA 3T77B 2VMGA 3GHMA 5F1RA 2CL2A 3O0VA 3ET9F 2ZCKL 2MEV1 5GLTA 1HJBC 4LH7A 2VCOA 3B3IB 3L5WB 4R0LC 4OQTH 4BIFA 2E9GA 3FTGA 4D8MA 4PJ7B 3US1A 1R081 3N7LA 1OCRB 4NM8H 2UXBB 1OM3H 1F1AA 2BRQA 1KB9K 2K7QA 4BEIA 4UOZA 5HFMA 1YEEH 1GYVA 1TTGA 5GS0L 4GT1A 2IGTA 4AKOA 1V55C 5FUCC 1SMVA 2PABA 3CJHB 1GBGA 2Y0PA 2WNXA 4BELD 5KVFH 4B3SO 5E6ZA 3WIAA 4W4NA 2X4RB 4Q4X2 4FXTA 4R26H 4XIOA 1DGRA 1E5HA 3G08A 3KHCA 4QT5A 2HRPH 5TGBA 2YD0A 4PREA 3B9KA 2E7DA 3IJ9A 2Z5UA 1YMHB 3ZFFC 3CX5F 4PWIA 3UO8B 1SPDA 2TSBA 3KPPB 2DQJH 1BMFG 4TLSA 3ECVA 3TZVB 4Z7WF 5GZEA 2P45B 2E76B 3GJFA 2VQFO 1R19A 3EKCA 1OZUA 4RGNE 5I1LB 3DVNB 5JXAH 1K5WA 2WZR1 4AAXA 3KDMB 5D7LA 4F8AA 1CBJA 3EJZC 2WLLA 3E2HC 1S7SB 3V8OA 4BKLB 4YEFA 2ZGNA 4YHLH 3B5HA 2A9CA 2GYSA 1OUSA 5IVZA 1P8JA 2ESVD 2Y7OA 4MQTB 5DD1H 3KPRB 1MJJB 3K5NA 3HG3A 4D2NA 4WCEV 1M7IA 1ENXA 3D36A 1QNYA 1BQ5A 1I3RB 3D9AL 4MLIA 4MTMA 3WTSA 2DVFA 3WR0A 3VBOC 4BIUA 4ALAH 4G6AC 1RPQA 3CDFA 4OFPA 3GBNH 4Y5YB 1ETZB 1M1KW 5TQ0H 3OMAB 1FGNH 4MA7L 2HKFL 5L19A 4FQJH 5DVPA 2FLMA 5E1AB 4APQB 2WQ8A 3VRIA 4Y1VA 4XZPA 4J3UA 4XMZA 3KWUA 3W5MA 1ZMYA 1OF4A 4TN9A 1UZ6E 1IBKB 4E8DA 3VBSB 4EQ2A 5C0AA 4DYLA 1ONAA 5IWAO 1BM3L 4MMZA 1BGYH 4ZNEE 2YQGA 4PTTA 3TRSB 1STMA 4YDKH 4G9DB 2CNYA 3C3TA 4UFMA 5AKRA 1RMFH 2JTYA 1G7QA 1DHKA 5EBMB 5GZGA 4MKMA 1SQXH 2BSDA 2BRTA 3V4PH 5IJBC 1L8DA 2AEPL 1DQVA 3BKJL 5IQ9B 1F31A 2MIZA 3MRDB 4WKZB 1QATA 2NNAB 3WIHL 3CC7V 3HPNA 4JTNA 5BV7H 4GXVL 3CH1B 2W0KA 4JGMA 4X0KA 1JPST 5L2KA 2GMPA 4LO4B 1SFDA 4DRXA 2APFA 4JFHD 4I0AA 2EJRA 1RXFA 2WO3B 3IK2A 2YPKA 3I9GL 4HJGB 4NZRL 5HHOB 3N2KB 4FLXA 1S9WB 1T0OA 5AVRB 4HMEA 2OMZA 2ZG2A 3ROOB 5JVVA 1R47A 1BVOA 5JA8B 3O11A 2J1XA 2P49B 3N50A 4QI3A 3WEXA 1A7QH 3MZTA 2BDNH 2EBOA 2VZRA 4WFED 1NUNB 2Y7QA 2ET7A 3IXAB 3EJTA 4QOKB 5ETUA 4BFIB 5DQDL 5HHMD 3BH8B 2VISB 4NKOB 4R0LA 5KBPA 3VG9C 3KV6A 1VBE3 4PJ7E 2IPUG 2YIBD 4YAQB 4DK5A 3L45A 3Q2CA 5I23A 2GMMA 2QSCH 1FLTX 1HKLH 5A7SA 1OPOA 4AQ8C 1C4RA 1PZ5A 1DQDH 1SERA 1MJUL 3A5VA 2EUZA 1QX1A 1Y7BA 2RDRA 4M3JA 5C70A 5AVSB 4XVOA 2PPAA 1RJZA 1LU1A 4YVSB 1YQ8A 1KIPB 2C5DC 3HKBA 2F08A 3PGDB 3I85A 3ZYHA 4NP4L 4HIIB 2VRKA 2YBRA 4LPVA 3K6NA 3JU9A 2ZGPA 2CDGB 5FCUL 3IWZA 5KW9H 2FK9A 3MCKA 4TPRH 3X1BA 2D3LA 2QSTA 4ZTEA 1S9VB 3NFSL 3S34L 3PWLA 2HWZH 2X44D 3TNNB 1OKQA 1D5BA 2YBPA 2DYSB 2XONA 1JFHA 1IIKA 4DEQA 4CMHB 1AHWA 3AZZA 3HHSB 2DCTA 3POIA 3LQAC 1H3VA 3OAUL 4WJ5B 3LIZH 3GJEA 4E41A 1XNBA 1KGWA 4NYLA 2I7OA 3ZQ9A 3EYUH 2CRIA 2YPLD 3EYVB 1T22B 3MKGA 3SJVD 3JZVA 2NNFA 5DHMC 4M3KB 4G5ZH 3II3A 1BAWA 3GNML 4BUGA 1W9YA 1MCRA 3GB7C 1OAUL 4JI3B 4EXPX 5CMAA 5D1XB 2R9IA 3ZK0A 3O45A 4AZ8B 2CWSA 2BLFA 5FIEA 4Q4IA 1ZSPA 1AI1H 5JIMA 4EI6B 2VXRA 4HBCL 4WK0B 1BGXL 2ZHNA 3LN4B 3II1A 4WTZG 3RWIB 3EH3B 1RUJ3 2AJUH 1AYM3 2BWQA 2Y7NA 1QMUA 2CPCA 5AYUL 1A7NL 1BZ7A 2D6MA 4FQXA 1KGCD 4A04A 1U8NB 1VZIA 4AJVA 3OR7A 1EJ6A 3ZTNL 3GHPA 2F53B 4Z7NE 2A74A 1NBVL 2CKBL 2VMDA 4GBXA 4QHUB 4MOAA 2DWEB 2PXYD 4XB7A 5D4QA 4AGMA 2JV6A 1BMGA 2NYYC 4BMEA 1KBBA 3OAYK 4GKOA 1MI5A 2WBKA 2GJ6D 4LSRH 2FWOB 4M1DL 4PJIF 3S3BB 5HHOE 3MMEB 1HXS1 3WF3A 4W4ZA 1PYWB 2B0SH 4S1SH 3RTLA 1LXMA 3G6AA 4J28A 3B7MA 2HTLC 4GWJA 4EWEA 4KKAC 1G7IA 3ERXA 1L6XA 3FFQA 4ES9A 4EN6B 1K34A 1BFOA 3DJTA 3MZGB 5FDYA 1IL1A 4QOKE 4IRSD 4LLYA 3ZLQC 2W0LA 5JPNA 1U8PA 3KPNB 4MGKE 4ZPIA 1LP9F 1Y0LB 4JM4H 4CCLA 3DC5A 2QQLL 3A0NA 2XDVA 1BX2A 3U1XA 2CUGA 4C4BA 1F4AA 4KVNH 1W0JG 5K1JA 4MXVA 4AQ8A 1RZIB 3QRGL 4C8DA 3UP1A 2APWA 5BNQA 4HP5A 1I94B 2XHNA 3LH2H 3LQAL 4DQAA 3FRUA 4JFFB 2X7LA 4UQ3B 3RWHB 1OC1A 4LSUH 1YG9A 4WWKB 5AW8B 2V4VA 4IRZH 3U2SA 5FKCA 5KSAA 2GTQA 4MFHA 4FZ8L 2IW5A 2WC2A 4QRSA 3D50A 3MFGB 2B4CC 4LUKA 3CEIA 3KHOA 2W0XA 4XP5H 3H9HB 3RFZC 4ZFZA 2B1HL 2C3VB 5IMKA 2X9ZA 4FI9A 3DX8A 2VMHA 3SODB 5CLXA 4F9LA 1AVMA 1WFJA 5FHAH 4NQQA 1T0PB 3FU5A 2J1AA 3RZJA 4YSFA 4Y4KC 5K33A 1VF6C 1D6EA 4HCFA 5FHBL 5CJOL 3LSSA 2FGZA 3BAKA 2EIKB 1YIJV 3WO4C 5CN1A 5FMDA 2LFEA 3B5TA 3ZRVA 1TPXC 1RZ8A 5HVFB 2P4EA 4OJEH 3F83A 1N59A 4IDJL 3IVKA 2GT9B 1JTPA 3LN5A 4PJ6A 8FABA 4Q9QH 5FY4A 1CZSA 5CG8A 5H5NA 1MFDL 4F6EA 4GQPH 5D1XE 2X9XA 3GMOA 5DAPA 4X66B 3G6JA 1R3IC 1EK3A 3LSOA 3OKOB 4H0GA 4KI5M 1AS6A 2Z3FA 2F0CA 4PBXA 2F66C 3GJBA 1IZJA 4PJGE 3BPNC 3OG4B 5T3XH 4YSEA 2DTMH 1IM3A 3BKCH 3L74H 4GPVA 4LBEC 4GH4B 1BZ9B 5FPOA 1UY1A 2PW1A 3O8XA 3X13A 1OP3H 4JQTA 4GAZA 2GIMA 5BR8O 5MENA 1TDQA 2OMUA 4AOFA 2F53E 5LJYH 1GZWA 4TV8A 4LDOB 2O26U 2QGCA 4LRIC 5CFCA 1N6VA 1HXYA 2EEFA 2PUQT 2A3XA 5G2NA 3FLTA 2MQCA 4KNCA 5E79Z 5IG7A 4FKKA 2VMEA 1NC4A 2ZUXA 3QJUB 1QH6A 1OQ1A 1RUI1 4D9RD 3CC4V 1PU0A 2Q2EB 1OL0A 2P26A 1NCWH 5AWNH 1QAWA 3ZQXA 5L2KD 2MCPL 2FBJL 4GQ9L 2EILC 4JZNA 2BC4A 3HN5A 1R3JB 1QHPA 1NAMA 4PUBL 3B7SA 4A63A 4X20A 1XOUA 2QQMA 3HC0B 1XF1A 1MQKL 4Q74A 1DZQA 2BU9A 3DF0A 4U1LA 2LAAA 4BK5A 3QP3A 3VTMA 3TIEB 2XAJA 4FERA 3SNMA 1VZHA 2VDKL 1E6OL 4AUUA 1GGCH 4PDWC 5FECA 1JGLL 5HCBA 4J3VA 2XPZA 1LTXA 2HT4D 3ZQWA 3AM8A 3O1VA 4F91B 1Q86W 5KXDA 3QUXC 5FGBA 4JZJA 4LKFA 1KB9F 3TA3D 2B8OT 2ZCHH 2YU2A 1ILSA 1DTUA 3IDUA 5CO1A 1HR0B 2EYSB 3EBHA 4OI0A 4K3JL 3DPRA 3O4OC 4BZ2L 5CCJA 3CMOH 2X5IC 3MIGA 5F9AC 1OCOB 4GEJA 3MLRH 4IOIB 5EORL 5JSOA 4YN3A 4I01A 2K9ZA 3JSSA 1QWRA 2OX5A 4JFFE 3IT8A 5TK2A 2DUQA 4UV4H 1RIUL 3K80A 1KLGA 1WTGT 2WXPA 3MUGB 5MEPA 1K5MB 1QRNB 4RDBA 4LGPB 3UBXI 1JPGA 3J7HA 1LO3L 2DWTA 3H85A 1RJLB 1UM5L 1JN6A 1UG9A 4KKLD 3PXJA 2YU1A 5E2UL 1V54B 2R4SL 3QULA 5L7XH 1MEC2 3A47A 5KC6A 3OKKA 1H2KA 3VACA 4W6YA 3D25B 3P30L 4PR5B 4NJAH 5DLMH 1I3HA 3GBWA 3NAPB 1P1VA 3BUTA 1R3IL 5BNOA 1UD4A 5CZVH 4QMAA 3AWEA 5A3LA 2NT1A 4AYGA 1VF6A 2LU4A 1IVSA 4XE5B 3E1F1 4ZO7A 5HVWA 3I59B 3I49A 4OX9B 2VRZA 3C60A 3VB8A 1YXWA 4IETA 1XE8A 5HI3C 1TAEA 1VQKV 4ZW7A 1QUPA 4KI1A 3VWKC 4I7ZC 5JXEC 3GZUC 2VSMB 3DDFA 5F9JB 1A78A 5IZ7A 3NBNA 1PGRB 4GD4A 4P5YA 5GZND 4I18B 1LJ7A 5KS9B 3UJTL 1A8JH 1W8FA 4GKSB 3VQXA 1H8OA 5KVEL 5DQ0A 5SX4I 4H20L 2FO4B 3ULVE 4YJZL 1RZ7H 1N4XH 4JVUA 1MHPH 2OMWA 3Q5OA 1VADB 4JJHA 3CEWA 1NLDH 4QO1B 4RFEA 1K8DA 1N64H 3CZGA 3DGGA 1RHI3 4GLXA 3GSUA 4IHJA 4XCAA 1JTOA 1JPTH 1Q82W 3DXAD 4M7ZC 3HA0A 3MLTB 3Q8CA 5I1DB 3QYMA 4JFPA 3JT0A 4NBZB 3ZSKA 1EFXB 3ARWA 5CD5C 2OZNA 1NZRA 3X2QB 4XHQA 1IGOA 5LY2A 4HT1L 4ODVH 2BVPB 3IMTA 5DEJA 3IU3A 1VQ4V 3DXRB 1QKZH 4YHHO 1UZ6F 1AR82 1SM3H 3H7BB