3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PmoB
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
1YEWA 4PHZA 4PI2A 3CHXA 3RGBA 3RFRA 4PI0A 4O65A
chains in the Genus database with same CATH superfamily
3CVIH 3DDFA 2A38A 3Q2VA 1NC2D 1WAAE 3BDBA 4Y1SA 3LZQA 3MBWA 1AKPA 3NN8A 2VE1A 5EF0A 1TYJA 1JUFA 2FIKB 4J7JA 3DBSA 3HG5A 4AENA 5KS9A 3M70A 2X2HA 1WZXA 3PTRB 1DLBA 3MQIA 5A7PA 3WIHA 4XZPA 2AXGA 3BX7C 5DJ6A 3N7JA 3W9AA 4AG4A 3H8RA 3C6LD 2AXJA 4CYDA 3JWDC 1YAIA 4UB0L 5DO2D 2WN3A 4Z3JA 3FHEA 4IV3A 2B16A 3SNMA 3PCYA 4A2MA 2Z5UA 1SEFA 4M1DH 2VDPB 1L6ZA 3FFOA 4JG9A 3BABA 4OJEH 5D1ZI 4WU5B 3ELAT 2FO8A 5E2WL 3FU8A 2RHPA 3ILEA 1NCIA 1UURA 4KX9A 1G9NL 4WI8A 4QKFA 2JB6A 4G28B 3BVDB 4WFED 3HD8B 1FE8H 1VADA 3LDKA 3RYCA 4YH6A 5DD1L 4NNYA 3MV8B 1NT2B 1CU4H 4P9WA 4I50B 2F19L 3MBWB 1C7TA 1S7QA 4KDTC 1VBE1 3NVCA 3BKMH 1MVFA 1M9WA 3ZY7A 2CO6B 1GLHA 5C7GA 1NCJA 2X4PA 1U8HB 3KT4A 4EN7B 5FYLL 2UZPA 3WF2A 4QRPB 2XJUA 2EH8L 1AR73 5HYIA 5EZIL 4H14A 5TDPB 1ZANL 3LB6C 2VW0A 2PWGA 3ATFA 1KMIZ 4N9IA 3WEMA 3LKQA 1J59A 4YBQD 3N9LA 4PCSA 2TNFA 2YEQA 4UAOB 3QC5X 3VXMA 2BK8A 2JKIS 3BPCB 2HBTA 2Y33A 3SE9L 1I9JL 1KQSU 2F74A 4MB1A 2P2KA 4XBPA 1WW7A 2EE6A 4MJIE 2WQZC 4AI3A 4YBHA 5H5NA 1NC2A 1PAZA 3L81A 3V0FA 3I6LD 3WP5A 3U82B 2GFBB 1CDGA 3B6SB 3KYOA 4FPOB 4L37A 3MJ8A 4U05A 4MYEA 3QUZA 5F7BA 1BVP1 5K59F 3UAFA 3HE7C 1BFTA 3ZKXC 2R7EB 2WD0A 3Q1EA 3ZHLA 3D50A 1W39A 3FCGA 4I09A 4Q6GA 1MUJB 4NI6A 5FZAA 2CIIB 2XQBL 4YXWG 3C3TA 1L0NH 4HCFA 1JU4A 2X4QB 1CK0H 2DJVA 4MSWB 1G6RA 2H6UA 1Y07A 4NHKA 1WMFA 2RM21 1DQJA 2Y4TA 4M29A 3LN5B 4YAQB 4GUQA 1N34B 2XKNB 2QDNA 1AACA 1KN4L 1NAMH 1WHPA 1FNAA 3NSJA 4DV7B 2XV6B 4DVRH 1YUHA 2HWD2 4EJRA 3WUZA 4XDJA 3PHSA 3O2WH 3U4XA 3MV9D 1P4IH 3ARGC 1WLHA 1KT2A 4GW1A 5C0BA 5FV3A 2SODB 5DR5H 2IBGA 4XFAA 4PRHB 3LOIA 1OSGA 2IEPA 2YG0A 3OMZA 4FK5C 2XNAA 1UUNA 1L6XA 2VM4A 2EUVA 2PPEA 2E7HA 3G6DH 3LKNB 4WFEE 5KYWA 4L5FE 1KS4A 4HS6B 5C9JA 3QBQA 5EPAA 3HR6A 1KEXA 2R043 2X29A 1P6WA 2D3LA 3ZE1F 3VNYA 4LUMA 1HEZA 3VBSB 2NLJA 4P04A 3WUWG 4A55A 4W8JA 4JMXA 2ZTNA 3TXQA 3BRGC 4Z7VA 1F2XK 1KBBA 3O4LB 4GIQA 3QJVB 1VENA 4DEPB 3TCUA 1GWKA 3ECBB 1HW7A 3LEYH 4FG0A 1XZ0B 5ABDE 3F95A 1VF5C 4AL9A 1YUHB 3UEQA 4C0BA 1S2EA 2CO7B 4PY8J 5IMOA 3EF7A 2WNUA 4LA3A 4OGXL 1EA9C 5CG9A 3NUKA 1RVFL 4PRHA 4XPBH 2J4WH 4M7KL 4OFDA 1RMFH 4H40A 2K1MA 2XNAB 2E26A 3ZVXA 3GSVA 1DL7H 5I8KH 3J07A 1PHMA 1WCDJ 2G38A 3MLSL 3IDEA 1WUZA 1TJGH 1KG0B 2CLRB 2P3YA 3BWUF 4LCCC 4UTBA 1ZRFA 2DURA 1BV8A 1ORSA 1W59A 4YJ3B 1ACYH 5H2FZ 2EDXA 2ZA9A 3TN91 3QWRA 1QCEA 1JWUB 4KPHH 4EUPA 5C09D 4HX1B 3D12B 5EC1C 4Z2WA 3MDSA 3HE6C 3ILPB 3PHAA 4OZFH 4B9KC 4E42A 2DBNA 3O3UN 3M3IA 4KK8C 5AUMB 4CVUA 2AH2A 1NCQA 3HC0A 1U8JA 5C7XH 2LTNA 3BP4A 3GNEA 4UT9L 2Y26A 4TPRL 2DCYA 3DMMA 3ARYA 5FA4B 3U79A 3ZFEC 1MHCB 4KU8A 3VZLA 1FMD2 1YC8A 1BQKA 2HUEA 4OX9O 2VQFB 1CGWA 1IFRA 2FHBA 4N1HB 1N26A 2XYCA 4KWLA 2JWYA 4MGKE 1PG7X 4AQTA 2F5AH 3EFFB 2ZKNA 1DJYA 4ZI8A 3VM7A 3GD1C 4UQ3A 1EGJL 5J1AB 1F58H 3LAGA 5FBZA 1N64L 5TISZ 2BIPA 5KW9H 1RD6A 2GJ6A 1DSFL 3AMLA 3D6GA 2OP4L 5A6MA 4JM2A 3O4OB 5IJCC 3ZYGA 4OFYD 3CLEL 1FFPB 5CNHA 1A6UL 1HL9A 4TUYB 1Q0EA 4K3JH 5HSFA 4AVHA 3OPZA 4GH4C 1AS8A 3ZYPA 4EN6B 1KELH 2VXTL 3AQZA 3VMOA 1NMBH 1VB4A 2WZ5A 4WCEV 2CL2A 5LB6A 3I85A 2NXZC 3T8VA 3P9LB 4DR5O 4B3TB 1N6VA 1SXAA 4YZ2A 1NR1A 1DGWX 3CZFB 5D2LF 2HHHB 1T7YA 4RDQF 2C9QA 4XNXH 1IPKA 2JJSC 3HT1A 1FBIL 5HYJA 4TLSA 4YM3A 1Q43A 3RYHB 1C16B 3D69B 1E9PA 4MXWH 5I30L 4CDXC 2BDRA 5L3DA 2MRYA 1WCBB 2EIEA 1HT6A 3WW3A 5EOTB 2YLHA 3CFMA 3TH2T 5HPMB 1KWKA 4YLZA 4BSVB 1RUG2 4DEQA 5C07A 4Z1VA 4MQ7B 4O9HL 3N7KA 4R5XA 5LW9A 3OAUH 5AW0B 5EEVA 3MHHC 5EBLA 3IE9A 1AR81 5E1HB 4DN4L 4L2YA 4GMSH 4XHQA 1UPGA 3JBG7 1FNZA 1N3NB 2OI9B 1CQKA 4QXKA 5JIAA 3O6ML 4P2OD 4UANA 5L7XH 2YAQA 3PU3A 2VNVA 3QXWA 4M3JA 1XOUA 3CZFA 2A9ML 1PK6C 2X4TB 2ADJA 1ZLSH 5HGHB 1K2DA 5I9QC 1J1PH 4JC1A 4DV3O 3O11A 5D8JH 5FF6A 4RO2A 4PS4L 3QXAB 1JDDA 2NMOA 3QG7L 4MAYA 5GZNC 4KK6D 2R0FA 5BMVA 2BIHA 5HHVH 1IGJB 2WJ7A 4M43H 4EDXB 1WLWA 1KLFA 3I6GA 3PNRB 3QWOB 3POWA 5L19A 1RLWA 3MOBL 1WPCA 2JB5H 1JMUB 1BYHA 4OGYH 3MRBB 4YHNA 1SUHA 2R073 3RTQB 1NIAA 1PD3A 5DRZA 1IKPA 2VC9A 4FLXA 3FB8B 4RWUA 1BQLH 3MOQA 3VD9A 3HNYM 3U2IA 2HJFA 4OV5A 2HZHA 3NR7A 1QSFE 5HJBA 5I1KH 3K03A 3RWGB 1MLCB 2VQTA 1N4CA 4BZ2A 2IGFH 4LHKA 2BFUS 4F92B 1FC1A 4GKSB 3BOWA 1UH4A 1B4JL 2UXVA 1NQTA 4FFYA 1GGBH 1GIGH 4X8XA 2MTAA 5HGHA 1JF6A 1LOFA 2UXBB 3AKPA 2ZGUA 2HKXA 4CCOA 3DGGB 5DEJA 5BNPC 2HLFC 1H2MA 4IKLA 4JFDD 2E31A 3MOAL 3VYOA 1DZQA 3CAFA 5J2UA 1WMEA 2VAAB 4MOAA 4CNIB 4MTMA 3G80A 4YSRA 1MVUA 4XUOA 3EMRA 1HXS1 1OSZB 1G1YA 2ZOWA 5LBSA 2JGDA 1PYWA 3FFCB 1FNYA 5IK4A 4KVCL 5EO0A 2OMYB 4BSWB 1K5MC 1CFSA 4FADA 3MV8E 4LFBO 1JZGA 2VXSL 3T3PF 3U4EB 3SR2C 2MOQA 1N3PA 4AMKH 1BMGA 4LCCA 2K4AA 4FQLH 4NNPL 3H53A 2EYSA 5FUPA 1SEBA 3U9WA 2HWB1 1FXKC 4CADB 4XBMA 3S96A 1JNHB 1AS6A 1VRSA 2PR4L 4NO0A 1VBA1 5DJXA 2R59A 1NFDA 1RLBA 2BVOA 1N1YA 3RWJB 1XIWA 3KYOB 1FXKA 3L3DB 1UYPA 5ACA2 2OSYA 4U6TA 4X8NA 5MENB 1QVGU 1F42A 3C08H 4OJCA 3SQBA 1W72H 4OUEA 2ITDB 5IR1B 1VIWB 5CILH 3WDYA 5DFTA 3FFCA 2BJMH 2DYPB 2VH5L 3BP5A 3HPJB 2WINA 4OJFH 2YYOA 4FOQA 4CS3A 1A7NL 3SDDB 1FN4A 5AWNH 3WKYA 4DKFH 4Q4X2 2J2ZA 1NYWA 4Y4HC 1CFMA 5JPMC 1CJYA 4WK2B 3N55A 3GZUC 2XASA 3P30H 5E0FA 2FWOB 1JOYA 1YEDA 1BX2A 2FUTA 2O5ZL 3QJSB 2VR9A 2K0GA 3WUCA 1TQTA 4YW1A 3ZMUA 1OARL 4FPLA 2GSMB 1IGIH 4PV1C 4UU9A 5I8OL 4ZPVB 3IAPA 5DN6G 4JDZA 3IVKA 1RUE2 3SQBB 1X5MA 4XP5L 1ZY9A 2CO4A 3OXSB 3V4VB 3OGCC 3KLHC 5IAXA 1I1FB 1K8IB 4OVVA 5EORL 1OTUC 2O6PA 4OIIL 3TN93 1TUBA 3KLAA 4PRBB 4Y9BA 2FJHB 4L3AA 2ZXWC 3CSBA 4JRYD 5C0CE 1U8PA 2NW3A 1PCSA 4Z7UF 1QZNA 1BEV1 3JD71 1TJHL 3LRKA 4TQEL 1CYXA 4NSKB 1T4WA 5D1ZB 1P8JA 1CDBA 3L4YA 3FBMA 1M5IA 2ILMA 5ERWA 3QH6A 1E50A 1ZPLA 2VLRE 2KS0A 1E57A 2H3NA 3LQCA 3TA3C 4JNXA 4H0LB 2E8ZA 4TTDC 3RVWD 3I55V 4QGPA 2Q7YA 1W6QB 3J9SA 2JD9A 2ZCHH 1LO2L 3DJZA 1T0NB 2ESVD 4H8WL 2YUAA 4TUJA 1NZ6A 4YBLB 5K39B 3RWDB 5T1JA 1XU1A 3RKPA 5EOCJ 5JVVA 3REVA 2K9UA 3WY4A 3AITA 3T0ED 4YXKH 4K3EL 3X3FL 4E9TA 3GXUA 1SA0B 1I8AA 3QORA 4WEBL 3Q0HA 3S35X 3FHQA 1H3UA 3FTVA 3UZVA 4CEWC 2RQ8A 4K07A 4B4RA 1AZVA 2I85A 2VDRH 1XNQO 1XNTA 4KO5A 4L1SA 1PK6A 2D0GA 2N04A 4BIZA 1AH1A 3ZKYA 2X1XR 4ZMVA 4HKWA 1GICA 3AK0A 2YIBA 3JAWA 3SJBC 4OFKA 4UNUA 3HMWH 1N5YL 3AC0A 3HRPA 4JI4O 1H8OA 1QBAA 2NY2D 3RW0A 1NWPA 3F7QA 3P4MB 1B4TA 4WQOA 1MSDA 3RWCA 2XL7A 4DKEH 3USUB 2OQ6A 3IDGA 4ZMPA 1F5JA 1UW8A 4JPRA 5LP6A 3KR3L 1H8TB 3RZWA 3KYAA 4JCLA 3KMHA 4DINB 2D31B 2FLRT 3AMKA 5ABZA 1XDCA 1MF2L 4MGXA 5MHSD 4HKBB 2ZKMX 4BFBD 2D9QB 2F54A 4YOKA 5KWYC 1FG2B 2DMHA 2ZQMA 3SYAA 2VOTA 3GI9H 4UILH 1BREA 1IC4L 1QYGH 1IM9B 4QT5B 2JG9B 3WJJA 4O9GA 1CLVA 2OYLA 5LL6Y 2FBJH 5LMUO 1K73W 4I3SL 3ZL4H 5BPXA 3JVFC 5K0UC 4XPAH 3TXAA 2OCFD 3G6JF 2ET7A 2CHDA 4EF3A 2O61A 3JATB 3MRQB 4KVCH 4X5PA 3IDNA 1AYN1 3BUDA 2CO1A 3C5ZD 4PYHA 5IYZB 1RERA 4LSDA 5FAAA 3USUA 2R1WA 3X1EA 1O3QA 3V7MA 3MRHA 3PDOB 4FQIL 2G2PA 2HT4C 3VD3A 3HAEG 4NZUH 4NIGA 2D31A 3W20A 4IBTA 5IFJA 2DYSB 3A6CL 3I49A 4CXXA 2OP4H 1ZTXH 1QGLA 1M57B 3A0HZ 3EAKA 3V5DA 5IROC 1NCBH 1I3UA 5DI8A 1K5WA 5L7OA 1U12A 2Z0AA 2F58L 4PRPD 3T8MA 4LKXA 4PQXA 2IQAB 1DJIA 3MD0A 3SKNB 3QT2A 1J1XH 1COV1 3L3IB 3QDGD 4NN5B 4O61A 1JMXA 4LP4A 3R0RA 3BJLA 4Z6AT 3S3PA 4GB33 4G6FD 1Q7YW 1P4BH 4LO4B 1EFXD 3WXPA 3NSFA 4P08A 1M9SA 2DWDB 2KKQA 4FQ2L 2IAMA 1UWYA 3HZYB 3HKDA 3K5RA 1LEIB 2QJVA 1UN1A 2VM3A 4R4XA 5HVWA 3NJYA 3CCJV 4PIXA 4FPKA 3WL9A 4L8SB 3FC0A 1O75A 1EHNA 5INDB 4Q29A 4F3FB 3NPSB 4GMTH 5L6YL 1ZA3A 3H7LA 3VG9C 4AFCA 1LO0H 1WAAF 2XPGB 1TEFA 3MSPA 4HZAA 4UVAA 3BPZA 2N1KA 4PSRA 2A74C 1I3VA 3CDZB 4RX4A 2YB7A 2Y5TA 3JASB 3M99B 1EGJH 4QRQB 5DC4B 3FHIB 1EPZA 4FO9A 1EM1A 4IIQB 5JOWA 3N43F 4OBSA 1RJYA 1MFMA 4J8QA 3FT0A 1GWMA 1TXKA 2D97A 1MN4A 5GGQH 2BSRB 4ONHB 2DLIA 3GRWH 3K3WA 1HNZO 1NL0H 1OSEA 3L4ZA 4XAEA 3QIBB 2G3XA 5TPWH 3WNLA 2XWZA 2JDPA 3CG8A 2H1PH 3D30A 4AVCA 4JZ2A 1KB9K 1V9PA 1KTKE 4ORFA 4D3CL 3ZXKA 5HDLA 3D0JA 2DI8A 4L8SA 3Q3GB 3HE7D 4PJ7B 2ATFA 1DQIA 1BZ9B 1HAWA 1S0VA 1WC7B 2XT1B 4B3MB 1YMHB 1HWGB 1A5FL 1HYSC 1OAZH 4CJ0A 3EO0B 3HZVA 4MWFB 1CONA 1D4M1 4GRMB 5LBBA 2JDYA 3VFSB 2VVEA 4AG4L 2VR8A 3N91A 5C7ZA 4ABMA 4NXMO 3C60B 1TJGL 1JD9A 2WM0A 2MQGA 3ICXA 2R23B 4UOW0 5MP6H 2HT2C 4ODVH 1JDCA 5LGTA 3GZPA 3KJ4B 4HYOA 1Q8MA 4FEIA 4L9LC 3RPKA 4DW1A 2GBTA 1J9CT 1RJZA 3CZEA 3QIBA 3L4UA 4DK5A 1B0GB 5J12B 3T6QC 1US2A 3BTYA 2JSFA 3ARGD 3E8BA 1IBYA 1X8EA 1AGCA 4V33A 3VZJA 5CU9A 4R4ND 3EYSH 2BFGA 2QE7G 3UTZB 5CBHA 5TSWA 1RSOB 4G83A 4XUNA 4U2ZA 2I60H 1ZS2A 3IETA 4R5TA 4YS4A 5DA4A 1WLCA 3GSXA 1IUZA 2GTQA 3QG6B 5CJQL 4XN1A 4XNAA 5A7EA 4XBQA 1RUMH 4RX4D 5FPZA 3P0YH 2MQ3A 5DLMH 2VBPA 2UWEB 5EJ3A 4QKDA 1M7XA 2LHAA 3I5DA 5A3TA 4GI6A 3VRLE 2G9GA 1N33O 4LEOA 1C5DB 5F3BB 4PJ6A 3DX2A 1H9PA 3O1SA 1WEJH 2CKBB 4BJLA 4G5ZH 1HRV1 1OMIA 4FTDA 4YZ1A 1W28A 5JLZB 2Y23A 1GGUA 4LEBA 4P5TD 2EINC 2R0LL 5CCKH 5LY1A 3F12B 3NK3A 3MZTA 1GNHA 4L9LB 2QZ5A 1JGIA 3O8XB 4XAWL 1IEBB 2XTAA 1GZTA 3FRPG 3NNGA 5FNVB 2HH0L 3LKSA 4XZUA 2HEYF 3AB0B 4WO4A 5IVXB 2R1DA 2CH8A 1KFXL 1DFXA 2K78A 1I5ZA 1OUXA 4X8AA 1U8MB 2VOWA 3HQXA 1BZ8A 1QLEC 4N5UA 3SDLA 3ILNA 5KBMA 1JZ8A 4PR5A 4PJBA 4RHV1 4K3AA 3PDDA 4L1TA 4NO3B 3VBOB 4QTHA 2N0KA 4JDEB 4NWVA 1ZK9A 4AFAA 3M7MX 3T0EC 3MV11 3P77B 3IFOB 1KJVB 5DHVA 2WXFA 4P2OA 2NQCA 1NC4A 3RP1A 3O1TA 4LSTL 2B4CL 4NYLA 2YN5A 2PXYC 3CQFA 2VECA 2YN3A 2NQ3A 4N0CC 4BYHA 4OZOA 2Q5BA 3L3HA 3ZO0A 2G2RB 3BUQA 3M3EA 1QBML 2ZCKL 3MUGA 3S37H 2P3JA 3BGFC 4Y0GA 1PD6A 1IBFA 3A4DA 5B38G 4P46B 5HY9B 3BA8A 1HL5A 3HNVH 1A14L 3NJGA 4KXRA 4U7NA 4R4FL 3G6EV 1NTKH 4U7MA 4E0RA 2QTWB 4AITA 4PQQA 2C9AA 4NQCA 5F6KA 4QO1B 1DVFB 1MAJA 3FQWB 2YPDA 3C8HA 3B7YA 4DK3A 1WE5A 2N74A 1CPYA 2YKLH 4AIZB 1T0NA 3S4SB 3RJOA 3B7TA 1CFTA 4L3ED 1J05B 4FN0A 1HCVA 1QOTA 3LF7A 2Q0AA 3BW9B 1U92A 4Y16B 2ZGLA 1PIFA 1LHOA 2A3TA 4XWGL 1DQKA 5H4YA 4BQ8A 4WHTA 5DHMC 1JGLL 3L3HB 4DO5A 1CL7L 4O02L 5CSBA 2ED9A 4Y4KA 2IDCA 4QXGH 5EOQL 5I15L 5HCBA 1T4KA 1QOKA 4FLZA 1F4WL 1QZ1A 1UJ3C 1AHSA 4HCIA 2N05A 2EH7H 2WTOA 3AADB 4XC1L 3MLYH 4TOYL 2V3FA 3VFGH 2VDNH 4Q0SA 4BQ1A 1ZSDA 2WWWA 3QDMB 3EFFK 2OXBA 4F91B 3WR0A 4S1DD 1CZTA 4G8GA 2F9BT 3N5AA 3Q5OA 3SDAB 3TN0D 3NOIA 4LGRB 1QD0A 2VNRA 5A3PA 3RWCB 5ANNA 1E2ZA 2BSDA 4NROA 1ZT1A 2DQUH 1AR61 3LZRA 5ILTL 5ICYB 1JZHA 3VI4A 4XCNB 4HT1T 5AW3B 2HSIA 1P84J 1FGNH 4JUSA 4BXFA 2V09A 5KHIA 2Y07H 3QISA 3RURA 4F27A 4TQFA 5IB5A 5ALBH 3WTTA 4Q6YA 1PX3A 5IW6A 5CGTA 3VQ2C 3U36A 5EN2A 3LIZH 3TO4B 1E4WH 4APXB 2XG3A 1NMCB 1SDYA 4Z7VB 1U3NA 2WNVC 2BW4A 1NJ9A 3A8TA 2Q7AA 3HRZA 4IRZL 2IPUG 3LPGA 4D8PA 1AX0A 1YNAA 4DR7B 1HOCB 3UT0A 3WTSA 5JH7A 3VXOA 4EI5A 1QU0A 2X28A 4ONUA 4Z7OF 1LE9A 3FT2B 4G8GB 3SDAA 1JK9A 2O8QA 3T0VA 2MCPH 1W8UA 3C2AH 5C08E 5I17B 2VNOA 1YQ2A 1UWFA 1NCNA 5FKPB 5C0EB 3W58A 1U4FA 4HG4J 1K33A 2G2NA 1RUE3 2WO1A 5I16A 3WOVA 3D3IA 3EYPA 5FZHA 1ND2C 1N0NA 5BRZE 1PZ5B 4NB7A 5CEZD 3MRJA 1DLLA 3WKML 1OF4A 4JFHE 3NQHA 4P9ML 3THCA 2A79B 3RZHA 3FRUB 4IKJA 3RQ3A 4EZKA 4MSWC 3TO4C 1XBRA 4H7LA 3WVJA 3F7YA 3WGUB 5L7OB 4UM9D 4RMTA 4HX1A 3F7KA 1QNYA 1XGPA 1W06A 2OV0A 1JMZA 1FYTB 2DKSA 1WZAA 4Y2OA 2BWQA 1MCHA 3WG4A 4ONGH 3T3ME 5JIKA 1H4HA 3K6NA 2H26A 4YUEL 1TME1 4HEPA 3QIUD 4C83B 3B7RL 3SY0B 1BQHG 1YMMD 4Y5VB 3MAWA 1Q0XH 3NEOA 3BU7A 1C1EH 4JAMB 4RGAA 2DBLH 4MS6A 4FS0A 4GSUA 4WWPA 1RXFA 3GXMA 4LT7A 5F88A 4J3VA 2V5RA 3IFXA 4LPUA 5TE7L 5J56B 1ND2B 3MRJB 2XETA 1PG7W 1S46A 4B96A 2Y6SC 3QAZB 2H0PA 2CD0A 1GK9A 1TVHB 1C57A 5L3FA 1SM3H 4OIBA 1IQDC 3STZB 2H6PA 4N3TA 5JW4M 2ENSA 5ALBL 1GW0A 2GBOA 1RL1A 3UKVA 5AYTA 3IPBA 4QMEA 5FYUA 1GRWA 3HJRA 1YNTB 2RJ2A 3B37A 4EWAA 1CT8B 1XGPB 4DKAA 3NA4A 5TDPA 1ZGLP 1YO8A 1RZ8A 5CFDA 4IRZH 1VRH1 3K6DA 5HFMA 3OKOB 4GXVH 2ZACA 1A9EB 2UZXA 4DAGH 4A6YA 4MVMA 1JCKA 3VXMB 1FJ1A 2BWDA 2HLDG 2I24N 1HJGA 3L7EA 4IOFD 1OF3A 4JAMA 3ZXFA 1JZJA 1YY9C 4KTDH 1ADQH 2WCPA 3FCBA 3MRFB 4PLNA 2V2XA 1UJ3A 1JYTA 2XLLA 4LASH 1OAKL 2CG9X 1BZOA 4F20A 5KVFL 3DTUB 1ZD6A 5FYBA 3D36A 1DZBA 3MLTA 2VH9A 5DUML 1NFIA 1BZ9A 3KM2A 5C4WB 1E9PB 1J1PL 2Z64C 1EQWA 4G1MB 2ZKYA 4LCYB 5JOEA 1CR7A 1QXJA 1OSPH 2GTZB 1BBJB 4OVUA 3URFA 3O45B 4LP5A 1NQBA 4GRMA 3H9HB 1ML0A 2X4QA 2EULA 4UQEA 1OHFA 2XQ0A 2WP3O 4IBSA 4LXFA 4DGYL 4YSAA 4HUVA 2ZGMA 4EQ3A 4WM8C 1KRIA 1SQQH 3DSNA 2OIEA 4N2IA 2VQ1A 4W9IC 2X10A 5GGSY 1ET7A 4G2KA 2OSXA 2PO6C 3VJ6A 1G9EA 1UIKA 4QR7A 1OK0A 1F31A 2AC1A 3JBG1 4RGGA 1AGDA 2KZKA 1ACXA 1E8XA 3DETD 4RFRB 1A8MA 3JQOB 4TOYH 4H1LG 1E4XL 2BNQE 4KJYB 2VQEB 4Y7MA 2Z8VC 2ADGA 4X4XB 3GBNH 2Q2LA 1F86A 2VUYA 4FFTA 4ODSH 1H3WM 3L9RA 4WU7A 3ZTJH 5C4WC 4JY6B 4LO7A 2FZ2A 2Z8WC 3UZEA 3CEWA 2D43A 3JWNE 2UXDO 1M6OA 3WFEH 5D7EA 3VXSE 3KPRD 5C93A 2YJLA 5FKAA 2TSAA 3BPLC 4UQ2B 3E35A 2UWEF 4A6YL 3NCMA 1XBDA 5CEHA 1UH2A 3IXAB 1F3RB 4XPGL 4HJTA 5FV1L 4L8BB 1W6OA 1VR3A 4X8JA 1SBSH 4LF5B 1LAJA 3ZDZF 3WG7C 4A5UB 3RVWC 2WBXA 2C9RA 4GG6E 1OGPA 5DJ2A 5D4IA 1X5XA 2R9IA 3KH3A 4GS7C 1J48A 1XE0A 2CTWA 4LF4O 3PHOA 4U1HB 4H25A 1OALA 4DV4O 1DBMH 2X40A 5E70A 3EFDL 4H13C 2Q8EA 1K92A 3WJLC 2YC1A 2NNRA 1SF9A 1AXTH 3RGVB 3ZKND 2PR4H 4UV4L 1M3JA 5J57B 1ORSB 1TJMA 3INUH 3KE0A 1RZJC 3P77A 2WFF3 4PIYA 5FK7A 1PGRB 2DQGL 2CLVA 3BPLB 3D85D 4ETYA 4WJ5A 5HHOE 3VCLA 1OCWH 1Z0NA 2OMZB 4KXBA 3X12B 3OTOB 4P5MB 4YFDB 5JQ6L 5A2LH 4XO9A 1R64A 4WBBA 4NZDA 3AT9A 1OD3A 4AAXA 4LR4A 3VQXA 4URTB 4X6CA 5HPOA 2B4CC 4LORA 4U1NA 4M5SA 5C1MB 3UX9B 1GYWA 4OZHF 2ZHLA 5DRXB 4GS7B 1COBA 4S1DC 1SACA 1Z9SB 4GI9A 5ESAA 3PHOB 3WDIA 1GQGA 3S5LB 5G5DA 1QQCA 2YK1H 4CN4A 4EOWL 2NT1A 3CVHB 3OV6A 3FC8A 4Q1PA 4Y5SA 5DN2A 1OF0A 5JMOC 2WXMA 5EXOA 4KI5F 1G9CA 1RUPL 2RS32 3CJIC 5SWZE 1TKWB 3HMXL 3FO0H 3GJFH 4JHWH 5AB0A 2HYMA 2JFCA 3Q5YA 4PRNB 3O0RL 2NY5C 4M4RA 4APQB 3KWVA 3ZHTA 1JGVH 1WBYA 2WW8A 4LEXL 4ODVL 1Z5LA 2V5MA 3W0WA 3BZEA 4KKQA 1OAUL 5E2UL 3KT7A 3UV9A 4MS2A 1NCUA 1J86A 2WQ8A 3CXCU 3WXVL 1UB5A 1NCAL 2PAEA 1L0PA 3Q01A 2JIGA 4A2FA 4CS2A 1FFNA 5IHBA 2GTSA 5AVVB 5A3OA 1O59A 3A6CH 3JTTA 1N8ZB 1VBD1 3MLRL 2CGZA 1SXZA 1T2QH 2FX9L 4NLHA 4HLTA 4PS4H 4AEJA 4A2UA 3I2HA 2IANE 4Z7AA 4L37B 3S6PA 3UNPA 2Y8KA 1RJLA 2ZXDA 3BH4A 5FJHA 3CFBB 4UZGA 1BAWA 2XWCA 4ENED 1WLEA 4EI6B 2EXYD 3B7SA 3CPLA 5GGVY 3DGTA 1K4CC 1VBA3 1ZRIA 1V54C 5I1CL 4FQHA 4B3VA 4UCTA 2JEUA 4LF9B 1MSPA 4MMYB 3GMLB 3QHFH 4R8CA 4OZ4A 3ZMTA 4PRBA 5FIEA 3RBZA 5T1KD 1FV1A 3KW8A 3RPIB 1JWSA 4BDVA 1K4CA 5B8CA 1LEKA 4DV2B 1UB5B 2FD6H 4OD1H 3ASWA 5I0RA 3FQRB 1CLOH 1UOWA 1JXKA 3EH1A 4G6KH 1A7PH 1I8KB 1FH2A 5E9DA 3EJKA 4XI5D 4XMKH 1JK9B 4LSQH 3DSQA 2ADJB 4N68A 1RUQH 4IS6B 4ZMLA 1BXVA 2IV8A 4WO0A 4PJAF 2NTFA 3ULVE 1VLNA 3NPZB 2ZNJA 3CFBA 1TNNA 3KPLA 3M1OA 1EV12 3OL2A 4EB6B 3MIGA 4OTXL 2LU5A 4OUOA 4XFIA 5A70A 2D7TL 1V55B 1YMME 3UBXB 4K8XA 1J1OL 2BM3A 1XV8A 3OUIA 4G8FA 1U2HA 4X5WA 5C3IA 4WGKA 4JV5O 2RM22 3U7YL 3ZLQC 2FSEB 1Z7S3 2NY6B 1GC1C 5JYLA 1UD5A 5T3ZD 1OAJA 2LFGA 5A43C 1IKFL 2I25N 4HEPG 4XMPH 4HUWA 2VLKA 2WBJA 1FFOB 4QX7A 4PV1B 1E9OA 1QWNA 4CTEA 4WHYG 2GITA 3QDJD 2GPZA 2GKIA 3FTUA 4Z0BH 1UD8A 4KI5C 2QQVA 1A6TB 4FPCA 3U30B 4M62L 1EVUA 2QVTA 3CRRA 2WIIA 5EPMA 2BNRD 5E8DL 3UYPB 1DGRN 2PETA 3BT2H 3DJSA 3FE5A 5CBEA 1CDUA 1L7IH 3GXPA 5T52A 5B4MD 4QKBA 4YGVA 3WZ1A 2YD2A 3W39A 3PMEA 3WV0A 2PHWA 1OSZA 5D1ZC 4A37A 4QT5A 1WCUA 1HILA 1JNLL 1T20B 5AOIA 4PELA 1D5ZB 4PYGA 5FB8B 3KBPA 1RZ8B 4OD2A 3U4EA 4R0LA 2BWAA 3Q8EA 5DDJ1 1UKRA 1M1XA 1J5IA 2BQPA 2NYZA 4LLYA 4Z8FL 2A3WA 1DJXA 4YHHO 3DETC 1H3GA 4HV8A 3DMMB 4YFLI 3MW4A 2W91A 5JCTA 4CADA 2AF2A 5BV7L 5SWSA 5IWLC 3W7XA 4CU6A 4UTBL 1ZJBA 2HKHH 5C07E 2QKDA 2XUEA 4DERA 1WA6X 1XCXA 3GBLA 4S2SB 1E6OH 1HX0A 1NCGA 1NEZA 2GSGA 1U58B 4XWOD 5JXJA 3LD8A 2PW1B 1RIUL 3SGIA 3QDHA 1QPXA 4UDTA 1HE8A 1ADQA 1ODMA 1X5KA 4IDJL 4LPXA 3MLLA 3OY8A 1MF2H 2H41A 4P5TC 4YLCA 4PJ9C 3RAJH 4A7QA 5CN3A 3PYCA 5GS1A 4P9OA 3CVCA 2E4FA 4OQ8A 3B3IA 2A83A 1JN6A 2AEQL 1DQ6A 2RMU1 1BGYH 3O6KH 4NCDA 1BOYA 4TSCL 2Q9LA 4ENZA 4Y4RA 2WO3A 3WG1A 3NEXA 2VUJA 2H3KA 1WZ1L 2R0WH 3UTTE 2Y25A 3FQUA 2ODIA 3K3QA 3T4YB 4JFSA 1WS7A 1PIGA 1YJDL 1A9BA 1DO6A 4KJYA 1PM9A 5GZOA 1RUJ2 4U1JB 5D93B 2PW1A 5B1BB 1VQ8V 4KKBC 4YK4C 5INDA 5DRWB 3UP1A 5DG2A 3BH9A 4BQ5A 3L9RB 4WU7B 2ES3A 1C16A 3D69A 3GQFA 4N0CD 1OAYH 2BHYA 4WI3A 5DGQA 5F7HA 1B0RA 1ND3C 2B7DT 3T71A 2GMMA 3S30A 4QOKB 2ZX3A 4U3HA 1P84K 2EE3A 2UXGA 4HJGB 3CCLV 3KPPA 1Q8QA 4HVOA 4UW6A 3HR0A 3THOA 3DDGA 5DHXB 5TJWK 3V7AE 4JJOA 5JJJB 5T33L 2ZHMA 5D1QC 1N4XL 5BO0D 2I2SA 2OX0A 4O51A 4M5ZH 2IBZH 3O9WA 4P59L 5AEAA 1Y7VA 3T6VA 1U5XA 5D8AB 5FZ3A 3ZHNA 5KZCB 4G4FA 1QTSA 3UZQA 1G84A 3V9EA 3NN8B 2Q7YB 1WAEA 1W8EA 1RUAH 4HWBL 2E4TA 2GJ6D 1KGUA 1Q72L 2F1BA 2VUKA 5IBUG 4BA6A 5KVDL 4F83A 5HDBB 3VXTA 3I4IA 1IGIL 4EJ1C 4XHXA 1K5NB 1K9MW 4ONFH 1BG1A 1GVIA 1MFCL 1YPZE 4K7JA 1SM3L 2QZQA 5GGTA 5KC6A 3PAZA 4BWUA 1REDA 3CX5K 3FO9B 5FAXA 1TSRA 2YQ2A 3L17A 3QYMA 1GN4A 4BCUA 4MZ2A 5JR1L 4CH3A 4ODUB 1SVZA 4N0UE 5KN5B 1TCRB 1WBLA 3RDJA 2BTQB 1NFDF 4ZXKA 1B6UA 1L9QA 1RHHB 2XUWA 1AFVH 2OZ4A 3AG1C 5L9BA 3LPOA 5KBPA 3WTWA 4K21A 1MLCA 4GRLB 4ZXBD 3TOPA 1YPZA 1H9VA 1ORQA 2G5RA 4JFYB 3X1FA 1BF2A 3HKZA 3L70H 2R16A 3HR5B 3VXTB 1AYM1 4XCFL 2P7TB 5CJOL 1BT8A 3P1IA 5TQ0L 2F66C 1R24B 3QNZB 4P9HL 1GY1A 1FI8C 4HKZA 4BFKA 4KGJA 3ZE0F 1TYRA 4UIMB 5FDBA 4POZD 4NM8H 4LEEA 2PWDA 1PBYA 2VDKB 5FHBH 1XF2A 3ZE2E 2R2HA 4AEDB 1W72L 2LLNA 1M90W 2HWC3 4CXWA 1ASQA 4M6OH 5JNYB 1SFPA 3AXHA 4P4RB 3UGFA 1IM9A 4RMBA 1N4XH 3BEWA 4B08A 2F7PA 2MCPL 4L23A 2VZUA 1XH3B 1JHLH 3CFKA 4C59B 1KU9A 5IYCO 1YYML 2DLEA 4PRHE 1GJIA 3PJYA 1RV6X 4ZHNA 5D7KE 3E8UH 5E5UB 3GF8A 1RUI3 2IFWA 2KHAA 2DQHH 1KTBA 1FKAO 4NAMA 5GRUH 1I7ZB 3EGDB 9CGTA 4UXAA 4CCDA 5A7NA 4A38A 5B1AB 3DECA 4OHWA 3LIZL 3QNZA 1NCHA 5L9RA 3KLSA 3EO1B 3QFDA 5D7JD 1NCWH 4XCCH 1J7VR 2PHTA 2GC0A 4R3SB 4LNUA 25C8L 5K93A 2R0WL 3BI3A 1ADQL 1FMD1 5EQUA 3QG5A 2YUEA 4YGDA 5IJVA 4PY7A 2ZX6A 2HEVF 3DPBA 4TT3G 2OQ7A 5EIBD 1F2QA 2EDDA 1PJ9A 4ZKIA 4JRYE 1CPUA 2D9CA 3E83A 4H88L 3SDYH 3OMAB 1L9MA 5D7LD 1AHMA 3TJTA 3WXWL 2QHRL 2CBOA 3HIFA 2OL3B 5EZYB 2GC4C 3RPIA 4XP6L 3ATDA 1QSFA 4XCYA 4AEHH 1DQML 1IC7L 5B8CB 4JFDA 1UD6A 5MEPB 5D71H 4XCEB 1UC6A 4U1MA 3U83A 3ROLA 4ATEA 4Y20A 4J27A 4JAAA 5JXED 3VHOA 1X4XA 2KH2B 3RPQA 2B3IA 1RK0B 1L9RA 3BQUA 3FQWA 5E6HA 4OHXA 4YIPA 5FGCB 4D94A 2CGYA 3IU4H 4IS6A 3QEQB 3EO9H 4G8IB 2XC8A 1I85A 3CXHK 4CA9A 7CGTA 2B1HL 2QADB 1LOEA 4CDUB 2H0FA 3HS9A 4W9LC 4JW3A 4JE4B 4UVBA 2GT9B 2J8UA 3IFNH 5IVVA 4OPHA 3V6FB 4YUEH 1M4WA 4WK0B 4CEYA 2EZ0C 3EOAA 1C5BL 1LGBA 1DUYB 2FJHA 4GG8A 2C34A 3MF6A 4IV3C 5IYYA 3IM0A 1VQ4V 2F53B 4QDRA 1S3JA 5D2LA 5LNEA 4PJHF 1WP7A 3IKKA 4IIJA 2D4FA 3I2IA 3OEBA 2DQIL 1CIUA 1ACYL 2GC1A 3LKRB 1EBAA 2X6AA 1KB9J 2P46B 2P5WB 1YY9D 4Q4IA 4XOAA 1AZNA 4IE4A 1FYTE 4FLRA 3O2DH 4YDJB 4RMRA 2X41A 1UAIA 1D5NA 3POJA 1KTDB 1U91B 1KC8W 2FQGA 2ENQA 4OZGE 1E9OB 3NJLA 1C5CL 4BFFA 5A7QA 2JX9A 1CD9B 3ESNA 3N0PB 3EYUL 4FTSA 4BK5A 5IB1B 5C3QA 1J12A 4GAJL 1WTGT 1AL22 5FMOL 1W2BU 2UWAA 1J3PA 1OPMA 3SO3B 2I9LA 1ND0B 5JXGA 4JFFE 5EH1A 3U36B 3CF6E 2KQXA 3TPKA 5IQ7L 1BEV2 2PABA 1TTGA 3PWLA 5BVPH 4K3JL 3MW3A 1AGBB 1MREL 2BOIA 3SCFA 3SDXB 2OULB 5FUIA 3UTTA 4HIHA 4JKPH 3LKRA 2PO6D 5L9DH 5GLVA 1XUQA 1AHWA 1UT2A 4HIIA 3KF3A 2PTVA 3O3EA 3VDAA 5CLZA 4RWHA 3BQUD 1J18A 1YUKB 2ADFL 3KLDA 5J13B 5EZJA 1LGCA 1V9U1 3LA2A 3NGBB 5I0UA 2K2SA 4K4KA 2EALA 1REIA 3IETB 1P7HL 3ULSB 3K5MA 1QR8A 4PRIB 1H1AA 1UXSB 2TSBA 2DZEA 2VRAA 4F1ZA 4P3CH 5EUOB 2Q7HA 2XI9A 1GZPB 1ZS8A 1U93A 4JM2B 4P59H 3T04D 1ND0A 3ZHKA 2JEXA 2ZM6O 3SPCA 4XC3H 4UDTB 1YSCA 4HG4K 2DMXA 1CZ8L 2F54B 5LVEA 3CK0H 3H3PH 3EGXB 3FO2B 3FCSA 4OKVB 1OP3H 3KZ4C 3SKJE 4KHTL 1CK0L 2QPEB 1JU3A 4PJIE 4HIHB 5ACZA 1TME2 3ZXEA 4K2UL 3QCUL 2LV4A 1HKLH 4QI3A 2ZGNA 4LO8A 4DV4B 5FNVA 1NKOA 1G5AA 3LKSB 3S5YA 3P3PA 2IVFC 2JXAA 5HI3D 1RUC3 4I30A 4DQOH 1RUD1 2QCSB 1A3KA 1MEC3 1AYRA 4KXZH 4JG1L 4FFZL 4GLRI 5AG9A 3NESA 2BP8A 1LESA 4MS8C 3T0AA 3WE6B 3ZIMA 2WWMD 1PGW2 2GNTA 3T4YA 2HWB2 1JXFA 1ZLUK 2XR4A 4F7CA 4N2CA 4Q4V2 4BQ2A 4C1WA 5DUXA 5C8YA 3QJHA 4N24A 2ARHA 5IMLA 4AQAB 1OA2A 2YS8A 5LATA 2J5LC 5LA2A 3FBQA 4X6DF 3RN4A 1SOXA 5ACZB 1N6QL 1QFPA 1URFA 1DUZB 4XPTH 1A3RL 1URXA 2P6HA 4H8WC 2YXHA 5H9RA 1AJNA 2B1GA 1RULL 4U7OA 1H6EA 2AQ3A 5LGKA 2WBWB 3LDDA 3OEEG 1G0XA 4P46A 2B0SH 1N70A 3ZZLA 3NTCL 2RR12 3OR6A 2DJSA 4LBQA 4JFDE 4PJGA 4XMLH 1FRGL 2VSMB 4UBGA 3DVGA 3QZWA 1SJXA 4RGND 4XIOA 4HIJA 4RMQA 4I4TB 5FGBA 1KCVH 2H2SC 4MD4B 4DEUA 5CA6A 4K8RH 5JW5A 4XEZA 3QD6A 2R49A 3HKDB 3H0OA 4JTAB 4RESB 4PBDA 4B1LA 1G43A 1CZ8H 4ALAL 2UUAB 4J7RA 1KCWA 2DU1A 4MO3M 4OI4A 2F95B 1U3HD 3MLTB 4JL2A 2WLKA 5I75B 2YMZA 3O1RA 4H55A 3I6SA 3DO7A 1IDSA 1JP5A 3HG0A 4U1IB 3LDBA 3D3AA 3L48A 2VQ4A 4WNQB 1BBJA 1OM9A 3LFIA 5T54A 3CBRA 4OQTL 5AVTB 4AQ1B 3AZYA 1NAML 1ZV2A 4DW2H 3GBMH 1E2WA 4FIPC 1N8RW 1DQLL 2E74C 5C0FB 3UO1L 2WNOA 3VBFA 4AJVA 3TP4A 4PGBB 5LA6B 4WFFA 4GKSA 3LCYA 5CMAA 5HHPA 4LEJA 1KGCD 2O1AA 3ZVVA 1BSMA 1CESA 3NAAL 2P8LA 1CMOA 1WA4A 2WXOA 4AV5A 1U3ZA 2AZ2A 1HNXO 1YPZB 3ZDVA 3HWJA 4LBLA 4DOUA 5I1AB 1VP7A 5FOJA 1Y0LA 3MRKB 1K3IA 1J3QA 2CBQA 4MBRA 5EDSA 3B9KB 1N2RA 2QFEA 2WSUA 4RDBA 2WXNA 3OBTA 1TO4A 5EULV 4HQQL 4R4ZA 3UK9A 5A3WA 3IS1X 5JZ7D 1QKQA 3EO0A 1B0IA 2FK9A 3MJ9A 1ZTEA 1VBA2 4Q2FA 5EN2B 2D7QA 2AJ3A 4HXAH 3TO4A 4APXA 5C2BH 4Q9BA 1GCFA 5IT9N 1AGEB 1I4FB 3MJ7A 1KEMH 2WNUC 4ITCA 4YWGL 2OW6A 3KXFA 5T3ZL 2I7OA 4KKNA 1HB4A 4NHMA 4GP8B 5FZ1A 3ZYBA 2P8LB 3PWVA 2J57A 2CDEA 5DQDL 3TONA 3WG3A 4Y1TA 4FQXA 3U0TB 3HE6B 1X9LA 4GW1B 3WFEL 3JWNC 2C2AA 1A5FH 4MNQD 3OPWA 1HJBC 1W9TA 1ET5A 4K5LA 1HIMH 1U3HA 1ODAA 4HD9A 3BAIA 3D5OF 2ICEA 2XTJB 4OM1L 4XUQA 2E7CA 1NCBL 3IC7A 3VGGA 3AGVA 3SOTA 3J8F1 2FSDA 3ECQA 1BXAA 3L2MA 3NCXA 4GQRA 5HYJD 1RHI3 1X44A 5FDYA 4BH7A 2BOJA 3P9MB 1K5JA 1IJ9A 4I18C 5A1FA 3F7YB 2IANB 1FSKC 4P5MA 1YQVH 4WDIA 2XICA 1MRCH 2Z4QB 5E2WH 5BS0D 4NKDB 1W0KG 2QPDB 3UTPE 1TVBA 3L3KA 3FRPA 1TNMA 3MDPA 4AIXA 5EBMB 3IDMA 2C26A 4CBCA 4FXTA 4WFGE 2PYED 3OD3A 1ZBA2 2E53A 2P5PA 2EUXA 1KYOK 2PCFB 1CXLA 3QUGA 5CJXA 5K7PA 2DQFA 2DQEH 3OKLA 2EX3A 1EMTL 1A1MA 2OJZL 3LS5L 3G6BA 4NTYA 3E2EA 1BLNA 2X5IB 4P07A 1HS6A 3SCMB 4E9SA 2NY0B 4EVNB 1S0IA 1NKDA 2WMPA 3OJDA 3MLRH 5KLVH 3E6BA 1K4DA 4QPGC 4LBNA 3C5XA 2BRRL 1ZA4A 1AX2A 2FDKA 1CZVA 1ZRDA 3GIVA 1NC4B 4N4YB 1KJMA 3C7GA 3L9JT 1RZIB 1I8UA 2VDOL 1PVC2 4IRJD 4OFVA 3NSTA 1G9MH 2WNKA 3V6FA 5CWSA 4NUBA 4AWDA 2J25A 3W0WB 5C08B 2CIKB 1THZA 2UXBO 4YX2L 1XPWA 4W4ZA 4LBKA 2X7LB 5JIDA 4TZDA 2DVBA 3VBHA 2V5DA 7PCYA 1UZVA 1CEZA 1MFDL 4IEXA 3AQYA 4FP3A 2P5WA 4JZJC 1QWHA 4RHV2 3FX7A 3JT2A 1LTXA 2FO4A 1J8RA 3RGVC 3BAWA 1AE6L 4HPOH 1P84F 5CEZE 2P37A 1K4DB 3E5UA 2KBGA 4IEFA 4C4KO 12E8L 3EFFA 4K94L 4U6XB 3S4SA 2DJMA 2Z1PA 4F7TB 3H9AA 2UUDH 4FNQA 3GMOA 1HHHB 4JI2B 1ZHLB 1E7VA 4UV7H 5A7BA 1PK6B 2PP7A 1OP5K 5I9QB 1T2XA 3KNBB 1EJ6A 3T0DA 4Z95L 2X4RB 5I66A 1Z78A 4HMCA 3MIBA 2EO9A 2P5WE 2WLJA 3G9VA 1GZWB 3C6LA 5A6YA 2FQPA 5GRJL 5AVPA 3ZJAA 1FQ9C 3FD9A 2DRUA 1UZ0A 4CZSA 4MX7A 4N8MA 4CCEA 1HSBB 1QLRA 4BD4A 1F11B 1OP9A 3EJYC 4LF6B 1S2BA 5JQGB 2JDNA 4U6VH 4YM1A 3CHSA 2YFNA 4R97C 3FB8C 2WO4A 4NKQB 2AV1A 1R0AH 1OLRA 2CUHA 3EFDH 1QJY3 3M46A 3QI9D 4GW5B 1LJ7A 2ORBL 4GX0A 4NXNB 4OIIH 4AMWA 3KWWB 3QDGE 4NC1C 3MF9A 2RB8A 3D09A 2YMOA 5M94B 4BQ4A 1FG2A 4RUEA 4TNVK 3KZ8A 1X7NA 3V4PB 5EUOA 1XCWA 4Q7DA 2ORBH 5FP7A 3UBXA 2VLJD 5C07B 4ZOLA 4HGMA 5D6CB 1W72B 1IEHA 1CFQA 2F43G 3JV4A 1IG0A 3N4MA 2FSEA 3G9AB 4LOUD 5IK5A 1E5YA 5JOPE 3KGZA 1GM8A 3Q2LA 4NUJA 4KOCA 4JKMA 2H2PD 2J7LA 3VYPA 1MFBL 1V8HA 1KC5H 2AW9A 2QMKA 2UVEA 1A47A 1KY7A 2NY3B 4ODSL 5LAPA 1FZKA 3PUHA 4UNIA 2ZD0A 4NVPA 1SFHA 3VFNA 1Q8PA 3EJTA 4N2GA 1TF4A 4AFDA 4PP1D 1ZAUA 4RCAA 3CBNA 4RIRA 1A6ZA 2XAQA 1JF1A 2Q68A 1QKZL 4O02A 4NPMA 4N25A 2FJSA 1V54B 4HOMA 4I48B 5FIXA 4AK3A 1IGMH 1WSST 4KP4A 5CBEB 2UVFA 5JDSA 3APQA 1WS8A 1R47A 1RTVA 1GM7A 2M2DA 2F7IA 5J1SC 2L9LA 4G3YC 4IW3A 4V2VA 5IB3A 1U8NA 3IKCB 1PS3A 4JO8A 4U6VL 3AP6A 5KA6A 1NUDA 4ACPA 1T7XA 4ZXBC 2ZDIA 1L9TA 4JO4H 3WAKA 2JJ2G 2RG4A 4M62H 4YPGA 3TX4A 1NIEA 4EXKA 4J5VA 1L7QA 3KMDA 1UOLA 3NACL 1QVFU 5AW6B 1IV8A 3N7LA 3RWHB 4HBCH 1ZCRA 4G8EA 2H6CA 3IKWA 5CJQH 4KUMA 1TVDA 2WNXA 4OF5A 1PMJX 1VSCA 4KZ0A 1ECYA 5DGRA 3R4SA 3ABKB 1BHAA 4S2HA 4FI9A 4RIRB 4DETA 3I3EA 3B77A 1G7JA 3FTZA 3N41B 2JB5L 3N85L 5AVQB 4ZMTA 4JCWA 4Q9QL 3VW3H 1ZE3C 1IVSA 2Z3YA 2R0KH 1JS4A 4B0MB 4I0WB 1FZOB 3MACL 1LK2B 4XX1E 2CNZA 3LV3A 4C7UA 2WLZA 1OP3K 2WFF1 1A32A 1A4KA 4PRNA 1FVEB 4Z3EA 3RWIB 1W2TA 1TTUA 1UIJA 2BMKA 5FC9A 1Z5LB 2IBZY 1B4JH 2YXLA 2HKOA 2ZQKA 4EAEA 3H42B 1CVRA 2IGFL 1WAAA 2D73A 1SEBB 5KYYA 3LQAC 1FYHB 2O5NA 4LSUH 5DD6A 2OZJA 4LSQL 4LITA 4NO0B 4DN4H 5DTFA 2F8XC 1X59A 4AGNA 1HP8A 4XGZB 1CE1L 4ZBMA 3P0VL 5DQJB 3WINE 1T66D 3MKGA 2NOYA 1E8YA 4LOEA 4OF3A 3WFDH 5I1AA 2AJVL 4X9FA 3IAYA 3DX7A 3SHSA 3VI3F 2I74A 4RR3C 2WLLB 2RCSL 1BW8A 1SPDA 3KVPA 1TQVA 5CZXC 5FYVA 5FYZA 5LRSA 1Y1UA 1FPTL 5IR1A 5L36A 4JG0H 3B2XA 1EEQA 3EH4B 1B0RB 4Y2NA 3DI2B 1JZ3A 2NY7H 4IEPA 1KXHA 2V2WA 1PNKA 2IDFA 3HN8A 3C5ZA 4Y5XC 2X05A 5JVDB 2BVPB 1A6VH 4ZNCD 4UCRA 1XGYL 3AM2A 5IVJA 1F4MA 2UY6A 1YTFD 4Z95H 2ODHA 1SOQA 1VPOL 4U3SA 1WWBX 5I0XA 4D7PA 4HU2A 4CUAA 4TLGA 3FONA 4L4VA 2MQ0A 2ETNA 4XO3A 2O72A 3JWOL 3LMJL 4DFIA 2RDSA 2WWSA 3KPSB 4PGDA 2F4PA 1OE3A 1QNZL 3REWA 1TUEB 1DANT 3K0WA 1XHHA 2KC0A 2YAMA 1Z1WA 4PIBA 1OD5A 3MA7A 4P2OC 3BVXA 3FXIC 3QLQA 3FMGL 1O6SA 1MW2A 1D6EB 2XN9D 4AZUA 1UM5L 3O4LE 1NQJA 1VPHA 3RZLA 4OSUL 3GSOA 2NNCA 4YDLC 4CCMA 3VMPA 3TBTA 4Z7WF 3QRGL 4XCBA 4UQ2A 2GUZA 3HBGA 3VHNA 1QA9B 4HFWA 1RJ8A 1X9UA 1SNRA 1TQCC 1SQGA 1AG6A 1A2YB 5ERWB 3UGGA 5I93A 3DUSB 1TVBB 5HD8D 3MODL 3S3DB 5F44A 5PCYA 3RVVC 5AUMA 3T0EE 1NOAA 3OUSA 1OEZW 2R0HA 4UQIM 4BUHA 1GSLA 1RHI2 1VEWA 2LW3A 3L5HA 1MAMH 3QRBA 1CGYA 1TTCA 2WXQA 4DNLA 1COV3 1EFXA 2F68X 3UL2A 4NQDA 3BUTA 5B1BC 5FZ6A 5LYJB 4NYLB 4YXLH 2R061 4LMQI 3X3GL 4KPHL 2YI8A 5IHUL 2VVFA 3U75A 2IADA 1LTEA 3ZDSA 3TBTB 2HWZL 4MD0B 1N33B 1DANU 4XPAL 3RKDD 3UJTL 5K9QI 3ZE0B 3GBDA 1KCBA 1KCLA 2DYSC 1J5EB 1V6MA 3V64A 4TVPD 1X5GA 5FB8A 3TT3L 5JPNA 5CWSB 5IDJA 4X6BB 4FFIA 5F0PB 3CFKB 3N1QC 3S5LG 1FFPA 4MYWB 4XWGH 1YN6B 1FL6A 1AXTL 2FT7A 2FRGP 3PGDA 1Z9PA 4Z7UB 3VWKA 5FEBA 5JHAA 1SVCP 1HN0A 4HKLA 1N10A 5KVGH 3K2KA 3P4MA 4V1DE 5F1OB 5L88H 1N6QH 4OJAA 3TYFB 2X4PB 1MRDL 1QPKA 4J8RA 1CFTB 5J0BA 3ULUE 4KROB 1QJY1 2Q1MA 4O4JB 3CVHA 3M8OH 3IJ8A 5C3LD 1H8TA 2CK0H 1KITA 1GTFA 3QHZL 4WFFD 4QTIL 1X9QA 5EWIH 3TNNA 3V0VA 4G9FD 1NGPH 4ERSH 3ZFGC 4YHKL 3VZKA 3SOBH 2OTUB 1FMD3 1KZQA 5MEQA 3C9NB 1VBC1 3GJEB 4TLTA 5F9OL 3BWAA 3AMNA 4K0KB 1AQKH 1P4BL 1E65A 4DRRA 3AS1A 4JFPA 4M7LT 3GKZA 4XR8C 1OY3B 4ZO8A 2VMGA 5J6GA 4WEUD 1FXHA 3K06A 2OL3A 5FYKL 5FYYA 2ARBA 1JOPA 2A74B 4FNLL 3CSXA 2H2PC 4OFQA 2OYKA 1AI1L 1J88A 3QEGH 3P32A 1FFQA 1E30A 4Y2DC 4F8OA 4ZUSB 3FBYA 5JXAH 3SO5A 1BECA 4MA7H 2YMXH 4XCEA 1EAOA 1IGYB 1E4XH 5ISZB 5JQGA 2G4EA 2WWMC 1T2JA 4PUBL 4N9GA 1BCCH 2DF7A 3KXFD 4WUUA 5HVHC 3ZX7A 3IDXH 3BCCH 4I3PA 4K7PL 1LWJA 1TLKA 1YNLH 3W59A 3WS3A 5JQHC 2VY0A 4AAPA 3O3BB 2HPOA 4NKIH 2QQNA 2J88H 4IHBA 4HHGA 1WWAX 3ZHDA 1U6AH 4F7KA 5CR1A 2R69L 3LN5A 3NZHL 3OJMB 4I13B 1IILE 1L8DA 3RZCC 1TJHH 5D7IA 5T5OA 4MMYA 3POFA 1DF4A 2Y36L 5MEND 5CIPH 1ZV5A 2EADA 2V7QG 2O6CA 4Z3IA 5BOZG 3HAEH 1SXNA 3ESOA 4OLZL 1NINA 4EI5B 3K79A 4NKIL 1EX0A 2VQUA 1PNGA 1ZZBA 3B2EE 3DGDA 3PXLA 4J7KA 3KJ6H 1BVNT 1OTUD 1IBZA 1MWAL 2DYPD 2R1XA 4N0YH 4ZUSA 4JYAO 2B1AH 4P9XA 2HEWF 1HZHH 1WWYA 2HEPA 1LO3H 4R84A 4ZD3H 2PHDA 3E6DA 2VZSA 4DCQB 3UZQB 5FXWA 2X6VA 2IAMB 3OG2A 2P8PA 1PZ5A 1B2WH 4FZ8L 4G9FA 2EH8H 1E1RG 2OKMA 3FRUA 3WFZA 1MG1A 4B50A 1PX8A 3ZYRA 2X12A 3Q6FB 4P3CL 1VIBA 3BLKA 4XABA 5IP4A 3TFBA 3JASA 1MCKA 2BW5A 5C92A 4WFHE 4KH2A 3PFQA 3ULUD 3D39E 4XOBA 4A6OA 1GZ9A 3A6OA 1A1OB 1INEL 1NBZA 2EEBA 2V5YA 3A3YB 5HI5D 4XJ9A 3U14A 3K57A 1UOJA 3UTTB 2WXHA 3O3AB 1DN0A 2FX7L 4XF0A 2DICA 1H9WA 2W46A 5D6DC 1GNZA 3IMUA 1UGNA 2W81C 5LO7A 3IRPX 3TBYA 2XBO1 4KU7A 4N6RA 4F8AA 2CDYA 3VKOA 2VYRE 3O9WD 3U1QA 3KVQA 5EO1A 3VE0B 3DX6A 3P40A 4BZ2L 3DX8B 1FLRH 4PRIA 1G9NC 1NFDB 4DR4B 2NY4B 1R3LC 3RYIB 1G7QA 1NAMB 5EFIB 4F5CE 5FGSA 1EYBA 4R9AA 4JR9L 4ODHL 1MVQA 5I8EA 3FH7A 4ZOBA 2V4DA 1WVZA 4LC1A 2UUCO 1HNWB 2JXMA 3PF2A 4R7DB 4L29A 5AAMC 4AEDA 2ZX1A 1CWPA 1KIPB 2XOTA 4MTXA 4MQTB 3BFRA 4LASL 4B9FA 2ADIA 1IAIL 5FY9A 1IT9H 4KGQA 1KGWA 4GBXD 1R19A 2VDML 4JZNA 5TDNA 2BMKB 3OF6A 5GS2D 3HAEB 4R0LB 2DMGA 3S36L 5AVUB 3BO8A 1QATA 4NQEA 4XXPA 1KZYA 4TULL 3CL1A 5GS1C 4QX3A 1XU2A 1UENA 4WTZG 3AWGA 5FUZH 3FYIB 3CX5F 4LQFH 3LY6A 5J1AA 2VISA 4LLAA 3S34L 1WT5A 1R3LB 5IEHB 2B1HH 1X4TA 1F4YH 2YD9A 2DL9A 1WNSA 4E9WA 1NCRA 2IJ0C 2AEZA 4IIZA 5D5MF 3JBG2 1KIPA 1HU8A 4DO0A 1DVFC 2HT4D 2Y38A 4ARXA 3N3EA 4XDKA 2Y4SA 4PJ8A 3OY8B 4N28A 1AJ7H 1B0WA 3VD4A 3QULA 2QGNA 1CF8H 5CB4B 3SKUD 3H0TA 3AG2B 3VJ6B 1VF6A 2QL1A 3H9SE 3DEMA 2YWYA 2ZEWA 4LO5B 5KXCA 1OE2A 4R0LC 2NXYD 4WO4B 4Q89A 3AB0A 5DDJ2 1JHLL 1PKQB 2DF3A 5GXBB 5FY4A 4QDSA 4NSKA 4QTFA 3SKJL 4ELMB 1HNWO 1IFHH 1LKNA 4ASMB 2EUZA 2ADGB 4PR5B 1JVKA 4E5XB 2YGQA 4L4VB 1YXWA 5CBFA 1KLGB 4FTVD 4L8QA 1W6QA 4QCIA 3U0WH 5L73A 1AP2A 2QLVB 4MBOA 5JCOC 1WCBA 5BZXA 2FBEA 5HHOB 4WM8A 3UAJA 3ENEA 2Y69C 1DZRA 4AI1A 3ARTA 5DHVB 1L3JA 4IERA 3L45A 2DWTA 1IAIH 3IE4A 4Y4KC 2AJSH 1PLCA 5DK0A 3AQDA 5A2AA 1ET8A 1M1SA 2NY1D 4Q6IC 5FP3A 3IN9A 4QD2E 1OCOC 4XP1H 4Q97A 2J8UB 3WQ1A 3R06B 2CM6A 4G7VH 2PY5A 4LHQB 3VNZA 1S7XA 2XAFA 1EO8H 1PEWA 2AEWA 2Q8CA 1EGJA 1QA9A 4HFWB 4FP8L 2F53A 4OCMC 1I94O 1IKNC 4PREA 4LAJH 2VBDA 4OFGA 1OAQH 3M7OA 5LGNA 5FYCA 4KQ4H 4Q14A 3ZIXA 4ODWB 4H25B 4XNQB 5E99L 5I74B 1AQHA 4X0NA 2AQ1A 2CPUA 1CCZA 1EDYA 3A6BL 1LE5B 4G3YL 1V6KA 3SGJC 3H7JA 3IU4L 2W1QA 4QD2A 4LHUB 1POV1 4B7LA 4G6FB 1EJOH 3NNFA 1IEAB 3D0LB 4LF5O 4RMSA 1VQKV 2Y69B 2XJLA 4NERA 4GMP1 2E75C 3B9KA 1SPPB 2ZJSL 3HS0A 3BUCA 3HZMA 4QRTA 1KLUA 2BVVA 4XX1G 1HSAA 1QBMH 2ZCKH 3S37L 3UFIA 2LROA 3UTQA 3HR9A 1QWRA 3Q44A 2DVFA 3FTXA 4U0QB 4WTQA 4MD0A 4U1LB 3VFUA 4LT5A 1I4FA 3A4AA 2EQDA 3NXSA 4D6TH 2P28B 3MTXA 2LJ2A 3N1FC 2VQFO 5F7UA 1W8ZA 1BPLB 2CWSA 3BFWA 4P9LA 2VNGA 3EJYD 5I74C 1NXMA 1VMHA 1PIV1 4NN7C 3VXRB 4O4LA 2CDEB 5DMYA 5FY5A 4NHLA 1GAFL 3KYNA 2KM2A 4JFYA 1NVPD 2DKUA 3QCTH 4DEPC 4XAAA 3SH5A 1O3SA 4BBWA 1UL9A 3ME0A 3RA7L 3BJ91 5IYZA 4FQPA 4HK3N 1KECA 2VN3A 4ZQKB 2A1WH 2VLME 5IQNA 4CNIA 2JEMA 3M7AA 5I73C 3LIZA 4TNEA 1ENVA 2ZUTA 3H3KA 1AQ8A 3QQ4B 3TBWA 5DO8A 4M6NL 1ITBB 2J8OA 4WEEA 3ZKMD 1CVNA 4J3OC 2DOSA 2A6JB 3MGAA 3PV6B 2OTUA 1VJSA 2R0LH 2CPCA 4JLRB 4LIQE 3T6WA 3RZZA 4OZIE 5GGSB 1YYLL 1U3JA 1VA9A 4Z8BA 4XF4A 4LCCB 3OCPA 2OTPA 4M3CF 1SJHB 3SZKC 5EIYB 2NMSA 5BRZB 1BFVL 2W52A 1FFNB 1ZOXA 5AOKA 3BEWB 1FT9A 2AK4B 5ID1A 2DBIA 3LB9A 5J6GB 1OTSD 4TSAL 4ZW5A 3C60D 2Y24A 1BAFH 4Q27A 2QEXV 2B15A 2YQBA 2BVOB 1YI7A 1WW4A 4JHBA 1XQ8A 3PVNA 2R2EA 2DVDA 5FZGA 3MV7B 5I0VA 1PL4A 3T0BA 4XNZB 3VYNA 4X9IA 3CFTA 4PFEA 2E7AA 4ELKB 1VF6C 5F8QC 1UU6A 3ARGB 4Z2AA 3SH3A 4IEUA 3WP6A 1J8HE 4QQPA 4OD3L 3AKTA 4LU5H 1I7RA 1RUOA 5BY1A 3UT5A 1S0GA 4OGAD 1NLDH 3AWEA 1G6RL 1WIUA 4QQLA 5A6IA 4AQAA 2X6CA 2YKLL 2OZ4L 2X9WA 2Y5TB 3ZRSA 4QRQA 1YC7A 1ES0A 4P9HC 1ILUA 3BIAX 4Z7NB 1QQP2 3UAJC 1TZHA 3SCGA 5HHME 4DV3B 2ZIOA 2WB7A 1DDHB 2AJZB 2IDTA 3DOSA 4LBOA 1O5DT 2K0RA 3O41A 1Q8SA 3D18A 4UFMA 1UOBA 5AOZA 4YFWA 5IUQA 1SHSA 5MERA 3O8XD 3SLIA 2AP2A 1OCRB 3AL6A 3IXTA 5F3HB 4GB32 4RSUA 2X0UA 3ZDWA 4M7JL 4AM0Q 1RP9A 5HGGS 1U6AL 2OXHB 1UY1A 1YVLA 4IEFB 4PJEE 3ETQA 3EYQD 1EXUA 3F6LA 3QOPA 3MFGB 1URZA 2KA3A 3VBUB 3ZSLA 3BD3A 3BXNA 3ACGA 3H1JH 1Q81W 4MDIA 3EUDA 5DLML 1NQDA 3AYCA 3GNML 2GT9A 4IKIA 2YPKB 1OHZA 5DURB 4NENB 4CEWA 1QAWA 5FO7B 3SGKC 2Z92A 2G60L 3C6LB 3FTSA 1KBGH 2O5YL 3GLZA 1UY3A 3G6JE 5I6LA 2A7AA 3VM5A 4PJCE 5HFLA 3NFNB 1H38A 1S2KA 1S9WB 1KN2H 3EOYG 3LKOB 3ZUNC 2GK0B 4B3SB 2RCVA 4P46D 1AROP 3V52H 5DF0A 4WFBV 2OXHA 4HVRA 4IT5A 3UYPA 1NGWB 2CJUH 3QORB 4N87A 3PIQB 3ZFEB 4KJWC 2VJ0A 1MCEA 5FOBB 4DKDC 4PJIA 1FL5A 1KOAA 4C91A 2YXMA 1DVFD 3W39B 2VR4A 1S5LZ 4XVUC 2WQWA 3ZRXA 1JTTA 3O45A 4G6JH 1WO2A 3KW7A 2JXMB 1KXVA 1VGEH 2D7OA 2XXMB 1CG9B 2MJWA 3FB5C 2WYIA 3EYOA 3H42L 3ZMRA 1M1XB 4CVZB 5FY0A 2IOOA 2PP8A 4Q4Y2 4WF7A 1IKFH 4P5KB 2ADIB 4IRSA 4XMPL 5HHNA 3T30A 3L13A 1E9QB 2VQ1B 3F12A 4B8EA 2EXWC 4TSBH 1I5YA 2JKSA 3WFBL 4AHCA 1U8IA 4MHHI 2OA2A 3BO8B 2IALA 4WKXA 3TBVA 2QQOA 4ZT1A 3P73A 4MNHA 1FPOA 4OCRL 4RAVA 3G6DL 3TIEA 4EDWL 3LD8B 2XPYA 4JV4A 1UXWA 2CDGB 1OK8A 2F19H 1MCBA 3H56A 4DR1B 3OC8A 3US0A 4QTHB 4N9HA 2ATAA 1KTLB 1XSIA 4FI6A 3UAAA 1UKTA 2JG9A 5FXXA 4K3HA 4EDWH 5FY1A 5FKAB 3IJ9A 1D4M3 3VI3E 3RB7A 3P2DA 4XN2A 3M8OL 3P9MA 4PWFA 4L3FA 2P4EA 3ZXLA 4CVZA 1JXGA 2HAZA 3LZZA 4H1LH 3F64A 5FYJD 2ZXEB 2A83B 3EG9B 4KG8A 1AKJB 4L2LA 3ZFFB 4CU9A 4YW4A 4X8JB 2Q76A 2WUCL 3FRPB 3TZVD 5I0ZA 2YROA 2QGEA 5CLXA 5AD0A 4MZUA 3VVWA 3OEHG 1M7UA 3N3HA 2GIMA 2UV3A 3PL6C 4RGNE 2HWF1 1JYXA 2QVSB 3SYOA 1UM6H 3PN1A 1U3YA 1BBT2 2ICEC 4EZJA 2EDKA 5KVMC 2ZWLT 4X4YA 1P7BA 2IBZX 3CNKA 4P2RA 1BLNB 1OKEA 3FO0L 4LFCO 3K2IA 4QJFB 1I8MB 3MV9B 2DCKA 2GSYA 5JI9A 4G8GD 1P53A 3TTYA 2EILB 3OKEB 4J3XA 2P3IA 4FI8A 3ATAA 2Z31A 1DE4A 2AJYL 3DV4B 3L3JA 4NKMB 5B1OA 1W91A 1FZJB 1J05A 3VMNA 1ZDQA 3NIFB 2F7OA 5CJ8A 4DV2O 2WYHA 1NGQH 4JFFA 3RDTD 2V4VA 1H0DB 2Q76B 3B5GA 1XJAA 3VZMA 3E9TA 3IGUA 4PMEA 1VF7A 3HNSL 1IAKB 4JFXB 4LQ1A 3SQOA 2DTML 1WA2X 4WW2A 5C0ND 3BAJA 2JS3A 1K85A 1C4RA 1NLRA 1WCQA 2Z0BA 4HA1A 4HDIB 1ESOA 4ODWA 3DVGB 3QZWB 2KPWA 2VR3A 3IPVA 3NACH 1LULA 2MKWA 5I6PA 5SWQB 3BKYL 4JRXD 1CB4A 3SJVD 2ICWJ 4OIFA 4DP8X 2XA8H 3QZOA 4PA3A 1IRAY 2A9DA 4ONOA 5LG6A 1IXBA 1ZBE2 5I1JH 2OPKA 5IVCA 1Q94B 4FZEH 4DH2A 1AR72 1MZFA 3JBG3 4AILC 3TVMD 4Y1XA 3TO2B 4POYA 4FBFA 2Q86A 1E5BA 1LDPH 3OG6B 4WNQA 1VFMA 4GRWF 4P06A 1MPAL 2XG5B 5T3NA 3K5SA 3D9AH 2RJKA 3VBFB 5JUEH 2O5XH 4FQJH 3P54A 3KL3A 4NM8L 5DUJA 2ZYHA 3US9A 3TFKD 1S72V 2DQ0A 1TG7A 3HR5A 2RMKB 4ALAH 1LNSA 3CQQA 5D6DA 3MUHL 1N5YH 4QU2A 2HG5C 4AVSA 1PP9H 4XPGH 3AMQA 3U4SA 2MH4A 3VGEA 1F5FA 3QEHA 4KTGA 3VRIA 1WV7T 5HDQH 4AY0A 2XLAA 2IWFA 3QW9A 4XJUA 1ZVHA 1AANA 3I74A 2FHFA 5FOJB 1HB2A 2HG5A 2FGWL 3CFEB 2CWMA 1GKEA 3F7VC 1RITA 4LSRL 2LRPA 3DHJA 2DY2A 2EYTB 3WF1A 4J9YB 4PLJD 3ULUL 2CTVA 4FQHB 4X5QA 3EJQA 4R4BA 4QXUL 3OT7A 5DVLA 1T5EA 1ZUQA 1JWSB 4BDVB 1CR9H 2XQXA 3RWRD 3IGFA 4G6JL 2X4OB 3TXSA 3N44F 3T09A 2AW2A 5CCHE 4RS5B 4ZYKB 4JFED 5H6RA 3L5IA 1LHNA 1QJX1 1GR7A 3Q6GL 3V0JA 1JJOA 2ZE8A 5T5FL 3ETPA 3U10A 3WIIL 4PJGE 3K71A 3IPEA 4OZGA 5ESQB 3P3SA 5E9DB 2JH2A 3T9WA 3LRLA 1TME3 4FMTA 1NCDH 1FZKB 3AU0A 3DPRB 1RZGB 4YVSB 2XSKA 1X9RA 3GIZH 5LYJA 2X2JA 3EQEA 2IPUK 4J4PA 2EO1A 4FL4C 1G7LB 4JI6B 2R0KL 2VN7A 1KIQA 2WY3B 3DPBB 4KKLC 5E9DE 1XGTA 4Y7OC 2FJFA 1IBBA 1MCSA 1UQSA 2R56H 2AK4E 1JPSH 2VW6A 1Z9MA 3IIIA 1U9KA 4DP0X 1H8TC 4A68A 4N6QA 2PYJA 1MABG 3A4FA 2WTRA 4AE0A 2XPZA 1OGAA 1PGL2 1N47A 2OMBA 4FTBA 2CXKA 4QPIB 2J1KA 4G1EA 1UX6A 2CNYA 1ZHNB 1MFBH 3W2DH 4CBPA 4EN3D 2HJIA 4Q4V3 5LWBA 3ZZSA 1HV0A 1JK8A 2YPLD 5IVZA 4LLDB 2XN0A 4OCYL 4BH8B 3S8FB 2P80D 1QJY2 4OZGB 3ZTEA 5L3EA 3MJ9H 5C9AC 4ODXA 5IVFA 3UG3A 2OYQA 3GSNH 1JG9A 4OJDH 4Q0XH 5IB4B 4NNXB 4NZRH 3KCYA 3VX0A 4P2OB 1RPUA 1MHCA 2XXGA 3GYDA 2X44D 4O4JA 2VDLL 4H0LC 4LGSB 2X5IA 4ASLA 3BVUA 5AENA 2JJVA 5C2UB 4BXSV 2ADQB 2EXTA 3X1GA 5CEZL 4ADIA 1JUHA 3BKZA 3J8F2 2V2TB 1CXFA 2G2RA 1REEA 4PVBA 4BKLA 4GO9A 2BVBA 4JDTH 2PLV2 2A5ZA 4DGVH 3ZXAC 3GIVB 1VBC3 1Q3EA 4LULA 3D3VE 1SXSA 4PD4K 1KKCA 1N36B 2A70A 3LEIA 2BZ7A 4AOCA 4XYXA 3AP9A 3EDJA 1NH2B 1FA4A 4Q4V1 3DSFL 3BRCA 4YK4B 5IVYA 3B8MA 1PSKL 3VWJC 3OWRA 4OD2B 2DW4A 4NENA 4A6YH 4CEWB 1ICTA 2YA2A 5IMKA 3RTQD 5LGYA 1V70A 4U33A 3WNNA 4KJQC 3DHMA 5C97A 1OIOA 4ODXB 4HV8B 3VSQA 3MRRB 4XNYH 5CEYA 4PJCF 3WELA 1S9WA 2JJTA 1N0JA 5EUOE 3FPYA 3OGIB 4QWWC 4QYOB 3BW9A 3E6FA 5GRZA 4META 4N26A 3VXNA 2I69A 2PFWA 4CDWA 4GJYA 4ZZFA 3QWNA 3NDYE 1E5ZA 2Y60A 1O5LA 1YJ9V 1VQ6V 3MXVH 5BV7C 4L8CA 3B4SA 1R34A 1UU5A 4PJIB 1B4LA 2XLGA 1XB8A 2EDYA 4N5EC 2VW4A 4TV9A 1OGAD 1Z7S2 4LL4A 4ADJA 4IEZA 4QDGA 2A4ZA 1DJWA 2XU9A 1LILA 3LSDA 4OZXA 1ZRCA 1FG9C 1UZZA 3LS4H 4QXBA 4F15B 5D7JA 4ONGL 4Q4W3 2D3VA 3VGIA 2B20A 1V10A 3TAYA 2JLLA 4GX1A 4IKKA 1R6KA 2ZICA 3LXAA 3Q8CA 4HWEL 5DJZB 4K35A 1AF9A 3B5LB 4X8PA 1N0LA 2E27L 1U33A 2WQVA 4X4MA 4OGQC 4DUXA 1WD4A 1K8AW 3MFFB 4K8RC 1YC61 1V0AA 4KMTH 3PFUA 5DA0B 4KJPD 2A9NL 3BZ4A 4I77H 4KDVA 1NJ9B 3ALXA 5I5MA 2VDMB 2EVHA 2BNUB 3RDTC 1X33A 2GY7B 2Z31C 3V0AC 1KFGA 3VTAA 2AREA 2P7TC 1IFHL 2W47A 3SDYL 4X6CE 1FP5A 1PGW1 1INQA 2A9HA 2XAHA 2CNAA 1TTBA 4LPWA 1VEMA 1FH5H 1I75A 1CTOA 4FRWA 4NUJB 5T1MB 3WIHH 4WSKA 3LFMA 2VTFA 2N4IA 4NPKA 3I6KB 2XZCL 3QPQC 5HDOA 3RGHA 3T8XB 5J12C 4F7CB 4XC9A 2XZAL 2QDRA 4GXUN 3NNLA 4OGYL 3E8GA 1MCWW 3DGGA 4NFDA 2WAMA 3T0XA 3BZ4B 1J9QA 1AAJA 3K5LA 2BC4B 3D48R 4I9QA 2BNUA 4ZOCA 3O14A 2DKMA 4I48A 2EEAA 4FHBD 2Z31B 3C90A 3CN3A 1HIML 2XONA 3BALA 5DAQA 3I9GL 1BBT3 2C9XA 3ES6A 2HVJB 1A3ZA 1KJLA 1Q56A 5IVXE 2IIJA 5CD5C 1MH5A 3OR6B 4LRNL 2BO0A 5J11C 5EA0H 3D4KA 4LBQB 2BXYA 5F0LB 4FKEA 1AZRA 3AROA 3DTXB 1JYWA 2QWQB 1WBYB 4I4TA 1PKXA 5DJ8B 1UYWL 3V8OA 1W6MB 1FUNA 1W0WB 2GIXA 3F62A 1KYDA 3B6SA 2OQJB 3O6MH 2FTAA 3OXRB 2ZKXA 4KGLA 5E1AB 5E7FA 5A16A 2MEV2 3OOXA 1AO7E 1Z0MA 2BOLA 5EJZB 4TXWA 1L9NA 2R2CA 1Q8IA 2VU9A 1RUKL 1R24A 3HC2A 1EFQA 1MUJA 3VRJB 5E79Z 3CX5J 3K5NA 2PMWB 5A7SA 2YXYA 4HS8L 1XF2B 3P4OB 4MLSA 5MEQB 6PAZA 4MXQD 1HXYA 1G6RB 3HHSA 5DYFA 5ENWA 3QHTC 3IZOA 1BIIA 3FZUD 5JR1H 4CN6A 3T0EB 5LA6A 2BVQA 4UBHA 3VQYA 1I8LC 2P17A 3ES4A 4FTVE 3QUZC 3GMLA 4OZ4B 4JHVA 1FN4B 2W5FA 4OXSA 1EAJA 3L6FB 2DUQA 2JJ6A 4PTUA 3APCA 1J9RA 1XGUA 1H2KA 1KT2B 4XAWH 3MO1B 5CIPA 5C0BB 3ZRCC 5H4ZA 5LEJA 2QDWA 2C1OA 4E4EA 1THAA 5C8CB 4GO6B 3UDWA 3P0GB 2WYFA 4ISQA 4L4TE 2ZABA 2EUWA 1IG3A 4XODA 3U6RA 1AP2B 2QJ1A 3S9DB 3DMMD 3PXHA 5KW9L 2NP0A 5J4MA 1XHXA 1QEXA 5I8YA 4G42B 1XREA 2GEEA 3GTVA 2ZMNA 1LODA 2Y2WA 1O6TA 5GZFA 5F97E 3B93A 4EN9B 1CLZH 1HH6B 4RA0C 3WP4A 3LX9A 4EN3C 3WT3A 4FXKB 5ETUA 1BF8A 3KHCA 5BXFA 4IMLB 3H6AA 4FYQA 4LSPL 5ITZB 2UY6B 4PRAB 3MRDB 4F2MB 4D8MA 3MIDA 4LH7A 3RS6A 4YHLH 4LCIL 1QLFA 1YJWV 1JPTH 4UYPA 3ZPOA 3CHRA 3UYRH 2E6QA 3OMNB 4G5ZL 2Q5ZA 2ZX5A 3LQAH 5JHMA 1I3GH 4Z7VF 2HTLD 4IBWA 1USQA 1RZGA 3GDCA 3QEQA 3Q1SL 4G8IA 4GEIA 4ATTA 4YVSA 2VWEC 3DC6A 2HA1A 1ZVSB 5DS8A 2FGZA 5EC2A 1CR9L 4GT7A 1HAUA 3W0WE 3BVNB 3SPVA 5ES4B 1QRNE 1UQSB 4PB9H 4D7BA 2AVGA 1LHZA 1WFIA 3JUYA 2E6VA 4LVOB 4ANXA 5KSBB 2RALA 3BCWA 3O3DA 5AKRA 1P4IL 1KFAL 2E9WA 4MVRA 3T2QA 5BMFL 2RS53 4LSTH 4J1XA 2EBOA 1Q1PA 2N59A 4DY3A 1Y6XA 5ITFA 3RZGA 4HW6A 3TNMB 3U48A 5DAPA 4NTXA 1JNNH 2MFNA 4NXSA 3PABB 4N85A 4L0PA 2IC2A 4JY4A 1EFXB 4Z92B 3NV3A 5IB4A 3ARWA 3IC9A 1NKGA 1OURA 4OUSA 4A7KA 1KDKA 3I2CH 3D08A 4AE2A 2W95A 4GYBA 2OMZA 1HEHC 3IK2A 1S7WA 2XWBB 1C5BH 1J83A 4TYSA 1YITV 4W9FC 1SKVA 3TJEH 2ZSVB 5L2KA 5C3RA 5E5MB 3PHQB 5FYHA 4TQHA 2CIKA 3CWBH 2F15A 1I7TB 4DIXA 5KS9E 4NGHH 3CIAA 1ZZ9A 2DOCA 3KQ4B 4NRPA 4W81A 3CGTA 1V3LA 1IE5A 3PIJA 3S5LA 3V4VH 5T3ZE 4OCRH 1FPN1 5E6IC 4K5NA 3HAEA 1U0AA 1CICC 4XVJH 5F9WC 3G5WA 3SDCD 3BHPA 2W0FA 2L35A 5ACMA 1KN4H 3SQRA 4DVRL 2DCJA 2FCVA 2PHUA 1NUGA 3VFPA 3C5SB 4PG9A 4UAPA 1GAFH 3G5XB 2QV2A 3QH3B 3QIBD 3VB8A 4AEEA 3O0VA 3Q2NA 5CLTA 1DQVA 1ANUA 3R1GL 3GMQA 4PJCB 1X5LA 5BZBA 2DTMH 4KO7A 3FQUB 1P5UC 3KLKA 4KJPC 2OYMA 3KG2A 1EAQA 4EBQL 2EIZA 5HPMA 1OPOA 3ZQWA 4CUGA 4U1SB 1QNIA 5IVOA 4J3OG 5T5PA 3HE7B 4UUJC 2AVFA 3J7NA 5D1XC 4FVVA 4N2KA 2W07A 2ZXQA 1TDQA 5J09A 2WSDA 3SEPA 3OKDB 4EFEA 3STLA 1AZUA 2OIIA 4K6BA 4XNMA 1UT1A 1WFJA 4FPHA 4ZFZA 4NN7B 5EBWA 4FP2A 2OZNA 4L05A 5F9WB 5KSVB 4A4AA 3ML9A 4AQ1C 5FWQA 4QTIH 4AVJA 1CBVL 3IB3A 1ZSHA 2P5OA 3F5TA 5HHQB 3ABMC 4M02A 3QPQD 2ZUSA 1RUJ3 1RSFA 2AMGA 5I73B 2RJMA 2F58H 5DJZA 2VZTA 3WE6A 1ALYA 1GJWA 5A80A 1ZREA 1KLFB 2YU2A 1E4XI 2MK3A 4JFEA 3H01A 2JCCE 1JPST 4HVBA 1OPGH 5I1EL 2JDKA 4ZOLB 2XXFA 3T1CA 4CH6A 5EZLB 3CC7V 4BINA 2KERA 4UCSA 1TZGL 3BZ5A 4G7QB 2ZD9A 4ZIBA 3BH8B 4JB9H 2CHHA 2J1ZA 3FQRA 5K1NA 2W9LA 3VOUA 3HKFA 2DMBA 3I9AA 3HQRA 4I3RL 3NKTA 1JGUL 5JA9A 1KBHA 3S5QA 4NZTL 3SC7X 4NQVB 3L8QA 1R081 4UWQB 1X5HA 4XNZC 3WG2A 1GCYA 3WNJA 2IH3A 5KYUA 1S9YA 3IRCA 4DTGH 1UVQA 1YDPA 4M7ZC 4X1IB 2WWNA 1TJIH 4DO6A 2JB8A 1Z5YD 4WFHA 4HALA 4AJ0A 3H8UA 5DZFA 4PJ7A 4UUJA 3MUY1 2ENPA 4G7YH 4ES9A 1D7BA 2QUOA 1NCTA 1TMF1 5EZOH 1OAUH 5E2UH 5TDOB 4DGVL 3U0PB 1RUH3 3IBMA 2OBGA 3W5NA 2EDEA 3NH7L 5HCAA 1F02I 5CA1B 4DR7O 1Q9WB 2V37A 5DMIL 3S57A 5ECGA 2X89A 4DIQA 4ZBJA 4BRJA 3SPGA 2QADD 5E0QA 2X2IA 4DZ8A 1AR82 5JORA 1BQ0A 3UEZA 4ORGB 3JD73 2E7QA 1V3MA 2GITB 3BPNC 2E56A 3MV8A