3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PmoB
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
4O65A 1YEWA 3RGBA 4PHZA 3CHXA 4PI2A 4PI0A 3RFRA
chains in the Genus database with same CATH superfamily
5FFGA 4AITA 3AY2A 1MNGA 1NFIB 1KPUA 5E95B 3L70H 4MTOA 1TQCB 3LSOA 4HH9A 1XIWC 3L45A 3MX0A 1W0WA 4UF7C 1YZZA 5E2TH 4WI8A 3D6EA 1M06G 2TUNA 2GH2A 1BECA 2DQDL 3MR9A 4MDJA 1MS8A 2JJ2G 1G86A 3JD4A 3RU8L 3NL1A 1ULCA 2BDRA 4JFZL 1CGSL 1GLHA 1KWGA 1BYHA 1O9GA 5F89B 2NUPB 2BGOA 3HWJA 1K33A 4XFFA 1N0NA 4MB3A 4MQXD 3ULUL 3RVTC 3BRFA 4IV3A 2F5BL 4YG6A 1U36A 4Q9QH 3NGBC 2QKDA 4XX1G 1T7YA 1UOWA 1NCHA 1UYWL 3V4LA 5E1IA 2HH9A 3LWCA 2EIJC 3SR2C 1QR9A 4KXRA 3UL4A 4Y20B 2P5WD 5J2TB 3GEWB 3CJXA 3STLC 1I4FB 5K9JH 4NJAH 1G84A 3SKMA 1G7QB 4LLWA 3R65A 1PZAA 2WWKT 2RCSH 1N33B 2WYHA 1AKJA 1YY9C 2CNZA 1FL3A 5INDB 1AR1B 2K9PA 4X7EC 3BP5A 5C1MB 1RTVA 4WI0B 4XACA 1P6FA 2Y69B 1SF5A 4JM0A 4UINH 4PQXA 4LRNH 4XABA 4N9OB 3WY4A 4R0LA 4F9PA 2VVDA 4FADA 1R24A 3ILEA 2ZYHA 1XNDA 2HWE2 5F7WC 2GI7A 4HBCH 5FLJA 1IC5L 3ZIXA 3M3OA 4GO9A 4AW4A 5B39A 4P5TA 1XL6A 1OAQL 2JDPA 3V7AG 5D5MA 5CCHE 4DV5B 2K2SA 2X4NA 1BBDL 4PGBB 1UEYA 3EO1A 3N42B 4UM8A 4KI5D 5AB1A 5BV7H 2CHXA 4HDIB 4JO8A 2YHJA 4AZ8A 3QDGD 2V1DA 3S3DB 4JTNA 4Y3OA 5DZOA 3SO5A 1S5HC 4R97C 1ULDA 4JCWA 4YM3A 2XN9D 3T4DA 3AS3A 1O9ZA 1YY9D 4JAVA 3WNNA 2ZMKA 4NM8H 2YA0A 4GSDH 1T5XB 2AEPH 3OLEA 4DAGL 2W9EL 1UKTA 4K7PH 5IW1B 4HJTA 4K9EH 1UACL 1H6XA 1JUHA 3ZE1B 5DUBB 3ZYPA 2NZ9A 2H3NA 5BV7L 1AI7A 4L8CB 1VEWA 2AFNA 1NCCH 3GHEL 5K1VA 1KUQA 3TBSA 3UKVA 4DUZB 1NFDB 3VG9B 5AVWB 2OMTB 4X9IA 1FNLA 1P7QB 1R3HB 2WXHA 1H15B 2IUWA 2F66C 3AACA 2QQKA 1Q90A 1SXAA 4C55A 3A4UA 4GSDL 3RDTA 4PSRA 3X3FL 5FXCH 4HXBL 2RHPA 1AILA 3L2NA 3VXRA 4EN0A 3VH8A 1NMCC 3CSBA 35C8L 5KX5B 1L6PA 4UXNA 5E6ZA 3AK3A 2XKNB 4PJ7A 3JD0A 1C5BL 2X40A 1EFXA 5IMMB 2B4CL 2X3BA 3OWEA 3VFOB 4Q74A 5FP8A 3V6ZA 4M5ZL 1LB2A 3GSXB 5TDNA 4OH2A 1Q9KA 2A4EA 4K94H 2XPJA 1J18A 4LBMA 4RAUA 3EYFB 5LVEA 2AJUH 1PM9A 4MW3A 4YNIA 1EFRG 5DN2A 4TQ8A 5DM6V 3MJ8B 4OMCA 3RNQB 3P2TA 2HFFA 1QSFE 1KWKA 3J8F3 1QQP1 4MAYC 2P8LA 4WFED 4XPFL 1S7RA 5CIPA 1S7QA 3PGDB 5FHAL 4FOMA 4CSWA 1SGKA 4I4TA 1MFBL 3Q5TA 2UYAA 2VTXA 3HPLC 5I73B 1DDLA 2EYSA 3VX1A 5CSZB 1QWUA 3STZC 1XGPA 1XGUA 3MLWL 5E7FA 5LHIA 5FYJD 4ONGH 1E42A 2VDPB 1B9KA 4DGYH 4BEIA 1HV1A 4FLHA 4JCLA 5CSBA 1ZTMA 1VQ8V 3CFNA 4JDZA 5FY9A 1JPFA 1H8TB 4E4HA 3OKOA 5SWZB 1WBZB 5T5FA 1CU4L 5IGXH 1I8IB 1ZY9A 4WI9A 4AJYV 4WIQA 2ENYA 2VL4A 3GHEH 5FHAH 5FO2A 1S3JA 3UX9B 3VD2A 5K1XA 3TJTA 1F1DA 4O4JA 2QSTA 3GDCA 4YVUA 3ICXA 1SZBA 1NGYB 2FO4B 2RJKA 2V4AA 2H9GB 1WBXB 1JZGA 5JCTA 1MAMH 2DI7A 4UT7H 4BW9A 3Q6GL 3V7MA 2P5ED 4Q0PA 4Y5Z0 2VTXJ 3M3QA 4GINA 4K2UH 4ZOEA 2W5FA 3K71A 1VQKV 1FA4A 4Y5VC 1G9CA 1VAHA 1N10A 5HSFA 1S0DA 4G9FA 3L6FB 4JJOA 2DOSA 1QG3A 3N9PA 4DGIL 4NQXB 5BVJA 4CEWA 4UQIM 3SQOH 3LRHA 3S0PA 2YAFA 1ID2A 3DC0A 4ABVA 4XBPB 4LTAA 5C9AA 4X83A 2O1QA 1NCIA 4QRRD 1MAML 5KLVH 1CZ8L 2EJ1A 5EUOE 1VP6A 4I9WE 3U75A 2GN7A 1NCUA 1WLCA 4Q58C 4I09A 3LKOA 1CLVA 4XDOA 3A5VA 4ONFH 2AZ5A 4OX9B 1SDWA 2DUOA 5GTHZ 3FTGB 4JFFA 2WINA 5A3IC 2UURA 2B1AL 1AQMA 1JF1A 4FXLA 3P4MB 4NIKB 3KG2A 4ZS7L 2MOQA 4A68A 4K23H 3P11L 4LVEA 3ELAT 4Z0XA 1VFAB 4HMCA 5FPZA 4CZSA 2P8PA 4PJIE 4G43B 4LNVA 3BEWB 1W0YT 5DZJA 1HRI1 1QOOA 4F6EA 3DV4B 1WAAA 1RUE1 2P49B 3L3HB 5DFTA 1KGUA 4F2MB 3FTSA 3ZMEA 2NTFB 1T6WA 2HWB1 2BRRH 3S5YA 3RYFB 4KGQA 2CHHA 2YBKA 3OGCC 1RUH1 3BPLB 1DTOA 5SWZE 3VTAA 4CP1A 4IE5A 2HLFD 3OQRA 4LBQA 1ZLVK 2XNDG 1HQRB 4ZQKA 1AL21 4D8PB 2OMUA 5GJSH 2OV0A 4UT7L 1I7ZA 4WCYH 5CEHA 3C5JB 5I5IA 1I1FB 2QADD 4OGQC 1FZJB 5JQIB 4P9PA 4A7TA 4AJWA 1YI2V 1SM3L 4JQVA 5FQ0A 4YSPA 4DV3O 5E0QA 1KCWA 5DDJ2 4TVPL 1Y6NR 1Q0XL 3EJRA 5KW9L 4E41A 4BDVA 4I0CC 2BOIA 5C0BD 2AI0H 2VXQA 4Y9FA 4QXBA 1KTDB 2VMEA 2EE2A 3QUKA 5AVPA 3H1KH 3W7XA 4PBVC 2PELA 4MJ5B 4BK4A 5ID0A 2Y36H 1DBMH 3CV5A 4HGKC 1AR1C 1NCBL 4F7KA 4HW6A 4IBWA 3N1FC 5IOPB 4JDMA 5FCSH 5FYLL 5D8AC 1R3IL 1A2YB 4IIQB 2ZGKA 4B5EA 1ENVA 1I5XA 4NYKA 3ZX1A 3JD72 4HVRA 4XHQA 3J26N 4UCRA 1LO5B 3FSOA 3RWCA 1X7QA 5B39G 2OW6A 4XBGA 1L7IL 2C9UA 3ZYJB 1MOFA 1TSHA 3N91A 1ID5I 3FCSA 2LTNA 2ZZQA 4RR3A 5LK7B 3VWJA 1FJ1B 3B5GA 2PTVA 1RFYA 3L16A 3V9FA 5D8JH 2DJUA 4F9LC 1FYTA 4NN7C 5HVHC 1D5ZB 1QFWM 4FQ4A 2XXGA 2ZJSH 2B7DT 4AGRA 5K8SA 5B3JE 4H0LB 4NSKA 5LP6B 1XUQA 2BS71 2DIAA 4XDLA 1LK2A 3D39D 3ETTA 1DGSA 4JY6A 3RUGF 5IV2B 1GBGA 2ZGNA 2HRPH 4XTMA 4AYFA 1BEV2 4TM9A 1T1WB 3BZEA 5FV3A 5H4ZA 3L9BA 1B2YA 3RPIB 4Z3FA 2AH2A 2XIDA 1UCBL 1XR8B 2FD6H 2GJ6E 1REFA 2YPLD 2IALA 3MJ7B 3QUYC 4NZDA 4UMGA 5EC1A 2JDUA 2LHAA 4WI0A 1LKNA 5J06A 4AUUA 2E51A 2WO1A 1FE8L 3TCLA 4PJ8B 1MSWD 1W39A 2Q7HA 1UJ3A 1CG9A 4HP5A 1OHQA 1U95A 5DUMH 4CJ0A 3CLFH 1IGFH 4K7JA 4ASLA 4PWEA 5E0FA 2CLRB 2DE0X 1AXTL 3RYMA 2FD6L 5J3HC 1TJIH 4WU7A 3NSTA 3CVDA 2ZF9A 2Z1PA 1TYRA 2YBGA 4UCOA 2E0PA 4GZRB 1A6ZB 1OOPA 2PQSA 32C2A 1DZBA 1E5ZA 4RFT0 3MRRA 4YOKA 2OKXA 2J12B 5C3QA 3ENRA 4A41A 2FYYB 1A9BB 2WC2A 1JPGA 1HCVA 1QVGU 1K5NA 4HUUB 1ZVSA 5D7KD 5IBLC 5HYJA 4IKKA 4W70A 1AS8A 2J88L 4JV5B 3OJ2C 3MRHA 3MRPB 4XCNB 5ADOH 5KVDE 2YI8A 1J5OL 1XX9C 2HJFA 5C0IA 1D7CA 4OV5A 3AXDA 1RXFA 1JRHH 3MZGB 4PCKA 2KLTA 3NMEA 2R2BA 3FU8A 1V54B 1XTLA 4HSLA 4G9DA 1J12A 4ANKA 1TUEB 3JWOH 1F6LL 2VDOL 3GC3A 3MO1A 4G27B 1W16A 3HPJB 1XGZA 4HK0B 4HKZB 5LGHH 5A6YA 3P9MA 2WLLB 3VGGA 4IXLA 5IJKA 3SEEA 1JJ2U 2FX7H 5T5LA 3OSKA 4N8PA 4YQXH 1LGBA 3BT2L 3SO3C 1VIWB 1QPPA 5AD0A 4Z7NE 1YYMH 1PLAA 1PZ9A 3FS9A 4ZUTB 5F5CA 2XMLA 3ROOB 4WF7A 1SFDA 4AVSA 1UCTA 5L73A 5TDNB 4M7ZC 4Z8FL 4I8DA 2XG5B 3ARGB 1AJQA 5LA1A 4DF9A 4PW3A 4Z77A 3SJBC 3A2FA 2LW3A 1C8NA 2P8MA 2AJXL 3CMOH 2FVNA 2LAAA 3EJSA 2E7CA 3WXWL 1NGWB 2CDFA 1Q9WB 1N8ZA 2PFWA 3OSVA 1YYML 1ZVYA 4FXTA 5DWUH 4DH2A 1WW5A 1XQ8A 3LPPA 4UQDA 1PNCA 2HWE3 5F6HJ 4H13B 4P46A 4QF1A 5I6KA 4D3CL 2CZNA 4BELD 3CXDL 1V54C 1LE5A 4XWGL 3FB7C 4JY5H 1UWEL 5AL8A 3KPNB 5LW9A 4N2MA 3FQUA 3QAZB 5D6CB 2MOVA 1ZBE3 3AG3C 4I2XB 4ZNCD 4B53A 3LKSA 3QG5A 3HAEG 4AV4A 5CBEB 4G6JL 5LHDA 4BIUA 2A9BA 5EBWA 3EIFA 1PO22 3PDOB 2N7SA 4QRPA 2R6QA 5F2SA 4XP9H 1RZQA 2ESVE 3WL9A 3T1HO 2E5LO 2NP0A 4RYDA 1HH6B 3IMRA 3MNZA 4MSWA 4QRTB 4YVNA 5FIXA 5ACA1 5JJEB 4GKXA 1KBHA 1JD9A 1S5HB 3DX4A 4JL2A 4ODXA 4R97B 3T3ME 5ANNA 4BIZA 1NCWL 2LVEA 2UZYA 3G5VA 2Y48A 4WK4B 2DLIA 4X2UA 5A33A 2BSEA 1JRHI 1Y18A 3MIGA 4JTDB 4F37F 1BBJA 4NYLA 1U8JB 3MBEC 1Z5LB 4QB1A 4AEKA 3N0AA 2OSYA 1W05A 4K9EC 4Z2WA 2IPTL 2VZ3A 3WDIA 4A63A 1RJZB 1TPXB 3VQ2C 2J5WA 4XF4A 4WFFE 3I3QA 2E7HA 2P44B 3UC2A 3HKDB 4JI3O 2VWEE 5KWYC 1BVLA 4P2QB 5FYKD 1FD9A 4YZ4A 5IATA 4L37B 5ALBL 5HHNB 3T0EC 5HHXH 5DAPA 3HNSH 6CGTA 5EPMB 3IRCA 5F8RC 3WF2A 1OHFA 2IOOA 4JRAA 2QPFA 2ENQA 2C3VA 2E6QA 3N43B 4YC2C 5D2NE 5KJ4A 3TVMB 3WCYA 3APMA 4JFFB 1XE7A 4EN2A 1EFQA 2PO6B 1IXBA 2C1OA 3DIVA 2ZZJA 2NTSP 4NROA 3EO9L 4XAWL 2FX8L 3MLXL 5KS9E 1MVQA 2Q10A 1RUI3 2COVD 2ILMA 4A2HA 2QQIA 5LDSA 3LNDA 3LIHA 1WD9A 2UZPA 1XCTA 3A67H 1G7YA 1L4IA 5TF1L 4WTQA 3BQUB 4UFLA 5KSAD 3WHTA 1R1BA 4X80L 3QEGL 3SCFA 5L4IA 1OT5A 2WKKA 3GIZH 3QUGA 4RZKA 4IGBB 4OGXH 4XODA 4YDVA 2QEXV 1X5LA 1W0NA 1QFPA 3L3OC 4JYBA 4YBLC 2WLYA 4AZ8B 1K9MW 4X5RA 3H1WA 4LSQH 3MZTA 3QJFA 4LEXH 5IHLB 3VOUA 2FL5A 1NVPD 2Q5BA 2X42A 4Y1SA 5T1DH 1HYSD 1K34A 5KS9F 3C5JA 4FQ2L 3GJAA 2DBLH 2EXKA 4GBXC 1A6VH 4YY3B 3SJCC 3ZIWA 1WFUA 1MWAA 2P24A 1DYPA 3V55A 5HVWA 4LCUB 2G4GA 5DFVD 2BIPA 3FQRB 1G7PA 3GSWB 5DRNB 1AX1A 2D6MA 5F6IB 2Y64A 2M2DA 5IHZB 4LSTH 1ESOA 4JVWA 2CK3G 3LS5H 3FH7A 4LLUA 3RAJH 5DZNA 1N4XH 1KGJA 3BFQG 4OCWL 5CJOH 5LBFA 3BPNB 3CHPA 3VBBA 4YHPA 2SLIA 3CC4V 5CN0A 4GKNB 5BRZB 4NI6A 5LK5A 5D1QB 5DMIH 5H4YA 2HMIC 2W6IG 1BK0A 4LVOB 1VAVA 2WT0A 2C7FA 4D3WA 3B9EA 3K81A 5AOJA 3DDFA 3HTLX 1L7TL 2QT6A 3HKEA 5ICUA 2QSCH 1F5JA 5LOVB 2FATH 2GYSA 3CVHB 4AQOA 4J3XA 3H8RA 2FUTA 1VBE1 1ULEA 2CH7A 2DICA 1FFXB 3CJHB 1LM8V 2QGDA 4N87A 5EO0B 1MCHA 4J3OH 5F3BB 1UMIA 2WZR3 4NZ8A 3OY8B 4JQRA 1GRJA 4OZFA 1NLSA 3IAYA 1BHAA 1QSEB 1B2WH 1BM3L 4DNYA 3FMGL 1RUD2 2ITCC 5DS8B 1JZ2A 4I50B 1G7IB 2OZ4A 4AYMC 4PJ0Z 1IBGL 3EOBB 3HMYA 1ZZ8A 4JYCA 2C1PB 3ME0B 2XJSA 2BNNA 1OTTC 4HLZH 4R7DA 5ISZB 4YHYB 1RK1A 2CHWA 2Z31B 4BLJA 1HU8A 3FOMB 2QQLL 4HEME 4Z7QB 5IVXF 1MMMA 4PLKC 5F72S 1LEDA 2DCKA 4OYUA 4E36A 3LH8A 3ZFFA 3FMGH 2WQ4A 4J25A 1OD3A 1KGCE 2PYEE 3IDIA 1ULGA 4APQC 1UJ3B 4G8GE 1RPOA 1VGKA 2DB8A 2YPVH 4EO5A 3AYCA 2LRPA 4Y5SA 5DURD 2X9YA 5ANQA 2LV4A 1TTRA 4BRVA 3F85A 2ZPKL 3RTQC 1S5LZ 4UUJC 5GLZA 1VB9A 1WMXA 4PRDA 2X7LA 5E6ID 1F7YA 1IBMB 4GLXA 1PD0A 2ZGSA 4NRXB 3NRPA 2NY6B 1RUPL 4OZFH 5D4HA 4FP2A 2ZNXA 4GIOA 2P2KA 2ZT9C 5HFLA 2ZAHA 4BUQA 3SPGA 3R4DB 2WL1A 1F4WL 2EE3A 1TETL 5MERA 4YN3A 3AKRA 5J7CC 2IVIB 5DI8B 2RMU2 1K4DA 1NIDA 3FSWA 3K1KC 4GS7B 1OF3A 2AR6A 3HRZC 5FXWA 2F1EA 3VDDC 5EN2A 4FFGA 1SA0B 2DQHL 1F1GA 2Y4UA 2NY3B 4ZZFA 1DYZA 3O4OC 2BK8A 4ZUWB 3GHNA 1CXEA 4X7TB 3EZJB 4KQ3H 4ABWA 5FF6B 3SDCB 2JIJA 4PTUB 4TV9A 3FBMA 3QUMA 2XL7A 2B46X 3JYCA 1F4WH 4WI3A 3QDMA 2YFZA 1OQOA 4MGTA 5EOCL 3FUMA 3QFJA 2GNTA 2FJFA 4PGJA 5FZDA 3D0LA 3PABB 1LGNA 2ZDIC 2XNAB 1EHAA 2G2RA 4L3ED 1LHWA 3WY1A 1T0MA 1H5BB 4ORGA 3AMMA 1VB2A 1QNIA 4JDVA 3T1FA 3RILA 3N40P 5L9BA 3RVHA 5I74C 5I1HL 3WIHA 1XYPA 2QBXA 2PW2A 3WE1A 4BQ2A 2WKOA 2YPVL 5F1NB 2DIBA 2H26B 2W9DL 1YLLA 3FTYA 5IWLA 5C7GA 5EOCH 3RI5K 1W2OA 2I9LB 4Y26A 2DY2A 4WZCA 3OHMB 5E8NA 4G82A 3FUQA 3ELNA 4FLXA 2O5XL 1HDJA 1BEYH 3TTSA 5FOBB 1IKFL 3N40F 4LHSA 2DZEA 4HVOA 4CA4A 1HSAB 1W72H 3MMEB 5JOFA 1AC0A 3W7TA 4EJRA 5C0AD 5IBLD 4LVNC 1S46A 1JOIA 4MDIA 4R90L 5D2AA 3G6DL 5L7XL 3AQZA 4N24A 1IGOA 2XBDA 3WXVH 4CDWB 2CDYA 3RFZB 3II3A 5KYYA 2PHTA 6FABL 4YSAA 1RUH2 4IEVA 2BOCB 4X6BB 4YVWC 2APWA 1LODA 4B9ZA 4JFVA 3QS2A 3PTRB 2GJRA 1V3KA 2XYBA 5CMAA 5ICYB 3TWCH 1CXHA 1WA8A 1ASPA 2V3DA 2XTJC 2YD8A 3T2NH 5C0GA 3NFNA 2KPWA 5GZGA 4C1XA 3HKBA 1XF5A 2BIMA 5CEZH 1L3JA 5J2TA 1QNZL 1GCFA 4NPMA 2Y1ZA 3ZFGC 1TDQA 2A3TA 3IN2A 4WNQB 4Y0GA 1PK6B 5BPXA 3MIEA 3GI8H 2X4TA 3ARUA 4JFWA 4ZDHA 1KUMA 3VGBA 2JQAA 3F58L 3WSQL 4O4HA 1KBBA 1K8IA 3FCSB 4YHMH 4CU9A 3AKTA 1POV1 3N1QC 5DJ2B 3OKKB 1A02N 3KCYA 2GIXA 4PJCB 3BHBB 4K55A 1XNCA 5T5JA 1PGL2 2SEBA 3G04A 1I8LA 3WBDA 4FFWC 2CO3A 1PLGH 2FGWL 5C0CB 4ETQA 4U3JB 4GWNA 1W6WA 2HH0L 3GKWH 3N41F 4ISVB 3SKOB 4QE7A 3ZT7A 1OKOA 3ZVXA 1WBYA 4IIJA 1AHWB 3F00A 2WAAA 4QB6A 3WAKA 3O45A 3EO6A 1W8TA 1ZRRA 1NH2B 2XQXA 4ZUUB 1YPZA 3HG3A 2Y0SA 1N0XL 2YQ2A 2YSUB 3MREB 2BFGA 4NPYA 1JXGA 5AL0A 5J2UB 3VGAB 4MLOA 4I0XB 4I85A 5AYQA 2Y6SC 1LULA 1OGPA 5K9JL 1OA3A 1XBLA 2WNVC 3PPSA 4U2ZA 4AQ8A 1GZHC 2VDNB 5GGTH 1C9SA 1O6UA 3BVVA 4JPKL 3V5DA 3K4ZA 4UWQB 1GMEA 2F8VA 3QO1A 4RMBA 2J1AA 3VWKD 5A9GA 2X4PA 5AVVB 4ZUSA 4FHJA 4P05A 4K3EL 3O6LH 4GLRH 5F7MC 3AAZA 5FUCC 1FYTE 4C56A 4DR2B 5BZWB 3X14B 1RK7A 1IV8A 1N26A 3BP6B 3JWNH 3QI9C 2E75C 2QVTA 9CGTA 3TESA 1VZHA 3AREC 4JI7B 1DLBA 4H8HA 1HDKA 2X6MA 4PD4F 3FTWA 5GSVB 1JNHB 3E22B 4KJYB 2EXHA 2CRMA 2GC4C 3PJQA 3O8XB 4L0PB 4Y9GA 1CP9A 4Q9QL 4U6VL 3BMVA 5G2NA 5CBGA 4JI0B 1CLZH 3HS0C 5GZOA 2DDUA 3G67A 2ZX9A 3AB0A 1WLEA 3UJOA 5T5PA 3VBOA 3BTXA 3H9SE 4JGYB 4FKEA 2VIRA 1W8ZA 5JMRA 2ZOKB 1US2A 4AFBA 2R2CA 4UFZA 3VAEA 1E6JH 4FLZA 1ZA4A 3H85A 4Y7OC 5EIIG 4E4SA 1KN2H 1NAMB 4B29A 3EH4B 1GKBA 1MABG 1AMYA 2PPAA 1YFUA 1L9QA 5GZFA 5IVEA 2O57A 3ESVF 3L48A 3PN1A 5FOJB 1S9YA 2B0SL 1DJGA 2ADJB 2E6JA 2ZSVA 1CICC 1OZ0A 5J3UA 5DAVA 5IJ9A 4XO8A 5IB5A 4DFSA 3IETA 3UTOA 1OUXA 1OH3A 4LL4A 1SLVA 4FQLL 2XR4A 1BIIA 3CFJA 1U3YA 3VBHC 1MW3A 4LOUD 3RVVD 2RM23 1AP2B 1BFOA 5BZXA 3VTTA 1F4NA 2JG9C 5KC5A 2H6UA 1UM4H 4W9LC 3VI3B 1TZIB 3AK2A 2UU9B 1U33A 1EHXA 2QZ5A 4D0CA 1PLCA 5ISZA 3DK2A 4ERSL 4LKCB 2AC0A 4M6MH 4F33A 3I2GA 4G1MB 5AWNH 3DUUA 3H1IH 4Y1AD 1UZ8A 3SDAD 2VLKD 2HT2D 2W80C 2EP6A 4G9FB 4CEWB 1GM7A 3IDIB 3H3KA 1W9YA 4ODVH 5E6IB 4AH2B 5L9DL 5C6WH 1U5XA 1CEZA 1BQRA 4NDMB 1WLTA 4IEOA 4UW6A 4MNGA 3KVDD 1POQA 3MBED 1S7UB 1K3ZA 4LDCA 3AS1A 2Y7OA 1L8DA 3R0MA 2VR7A 4H0LC 3GIVB 1TLMA 2UY7B 3JTTA 2PF4E 1N7ML 4KK6D 1AR91 5JVVA 2PHUA 2NMOA 3NCWA 4N28A 1KC8W 3D18A 3ZE1F 3VSTA 4XVHA 1P84K 5AVYB 4OZIE 3ARBD 1D5NA 1UD1A 2CDPA 2EUVA 1CE6B 4E9WA 2FHRA 1MFUA 1U4FA 2JDHA 2XHKA 2YGPA 4QYAA 2XWCA 5FR3A 2X4UA 3QUML 1UOGA 3INUL 3PV7A 2ZOEB 2DV6A 2VM4A 1SDYA 2X4SA 1BZEA 1JZEA 3J7LA 1UD2A 1UZZA 4X5WB 4K94L 3WR0A 4WFEA 1ADQA 3D05A 5DD3H 2B9ZA 2H45A 1YUDA 4PJGB 1GYWA 5TPWH 2R49A 4FPYA 4QQPA 2JSFA 3WTUA 3MLRH 3L7FA 1WPCA 3DPBA 2E33A 2YIDA 5FY7A 4UQEA 4LBQB 5KHIA 3D85B 2KQMA 2WXPA 1YIFA 3ULAB 1NEZG 2JKWA 4WQOA 4CDGC 4IOFD 3JBG7 3S5ZA 5DC2A 1NG0A 1XMWA 1R091 3IDEA 3MLWH 5B1KA 4ERSH 2DEWX 3C5XA 3TM6A 3SDXF 3M46A 1GZHA 1JZ8A 3USUA 2JCCE 2GTAA 3V5KB 1L0XA 1T4KB 4Y1AA 2QNKA 4AC2A 5FYZA 3F04A 3TEYA 1NC2D 3P0YH 3ZJZA 4LKSA 5I8OH 3L1OH 1YEGH 5DZLA 3GHBH 1SERA 1X6NA 1W9XA 3IJYB 4YC2B 1DE4B 1LCLA 3CMAV 5F3IA 1NUKA 3W9DA 1QBMH 2OR9L 1B4JH 2WOYA 3V4VA 2VN4A 3FLPA 2UU9O 4KNUA 3I74A 3QJFB 3A8TA 4HLZG 1P1VA 4KKAC 2IW5A 4XCYA 1MEC3 1RKRA 2WYFA 1U8IB 3FFCA 5IE9A 4RFOH 4NNXB 1AZDA 4FZ8L 2Y38A 1DR9A 3O6MH 2L35A 1LTXA 5AZUA 2P6CA 1QSFD 1F4MA 1VARA 2I07A 1I3GL 2NYKA 3A4FA 4OQTL 1XO8A 4OSUL 4X9HA 2CBOA 5BV6A 3MUUA 1XSOA 5EIYB 1SFHA 4HBNA 1F4HA 3GXTA 4IGPA 4GT0A 4OLLA 4QPYA 1Y6XA 4BWUA 4D94A 2XVKA 5I1EH 4XNXL 2DYRC 4W8JA 1LNQA 3GSVA 3NFNB 5IP4A 5LBSH 2NNAA 4ILDA 3CHSA 5IEKA 3ARPA 5A1FA 3QDGE 1HINH 4B9CA 3QISA 1SJVA 2MCPH 2DVAA 2MNGA 5ES4B 2IAMC 3KH4A 4G59C 4ISRA 2ED8A 5CISA 5HYSA 4EKWA 1A7OL 3L72H 4LQFH 3P4OB 5DK2B 2MH4A 5IOKA 3GMLB 4H7LA 5IJVA 3F2LA 3MXWH 3PWVB 4BQYA 3FAXA 3HJ0A 2ERFA 3ZRSA 2R9RB 3DX9B 2J57A 2IH3A 2P34A 3JUUA 5F5QA 1J8RA 2RJ2A 1K3IA 1KB9J 3GQFA 1F3JB 2NR6A 1CG9B 3FB7B 3WUWB 5C08E 1HINL 1J11A 4OZ4A 3GHBL 2KZBA 4NQQA 1B04A 4Z18A 1MWAL 4LESA 4GMP0 1WCKA 4JHUA 1R5VA 4P5MA 4QOKA 5E5MB 4J1XA 1J1PH 4PY8J 2FYYA 1RUC3 2E7TA 4IBLT 1P4UA 1Q6IA 1QSED 2Y1VA 3EDDA 5GGRB 1MFEH 3J8F7 4OQTH 4L1TA 3T2LA 3IT8A 1M4UA 4I0XA 3H3PH 1QFWL 5A7BA 2V2WB 4QTHB 5BNNA 1GW0A 4IM8A 3RZCA 1I8AA 1UJ3C 4JM4H 5I6PA 2RR13 5BVPH 1QTSA 1MG1A 2IAMB 3O3DA 3KT1A 1XF4A 3MRKA 1NCBH 3U1QA 4CP2A 2XKUA 1G9NH 2IH1A 4QXUL 3GSNH 2CGZA 4KXBA 4N9GA 2BSSB 4YDIL 3ASNB 2APVA 4GH7B 4RGOL 3MNVA 3RKDC 3GB7A 5HJGA 4EZJA 4X6CF 4GXLA 5LEKA 2WXFA 5E9NA 4LF4O 2MRYA 2XG4A 2XX0A 4WI7A 3FRPG 1UD6A 3PLYA 1OKQA 1EEZA 2IFRA 1WP6A 5F8QC 4MRBA 2XPYA 4UIMB 3UBXB 1LEIA 4N7IA 5EEWA 3BZFA 2VR6A 3JXSA 3LNEA 2MHFA 2J22A 5CFDB 1JNHA 4GW1B 1JBCA 3LB6D 4YEFA 2ICCA 4EUPA 4D0DB 1TVHB 1E4HA 3WFBL 3BUDA 1YWKA 3ZYIA 2P8MB 5H35A 5HGHA 4ZFZB 3RIAK 2JVDA 1Z9SA 5AOMA 3IMVA 1IGJB 1DDHA 2VXJA 4L1BA 4PWFA 5F97E 3O7OA 2P28B 3BRCA 4HIIA 4FOVA 3TXAA 4U6HB 3SD2A 2UVEA 3MKKA 2WN2A 3WDJA 5DXWA 3VB9A 2AEZA 2EZPA 3NIFF 3I6KB 4M5TA 1VR3A 2OCCC 4FFYL 4DUVA 5E2VL 3I5DA 1NT0A 1CK0H 2P6JA 1MJ8L 5F3FA 1AXKA 1GZ9A 3O3UN 3M7OA 2EDHA 1G6NA 1GYVA 3P3RA 4B6ZA 1FG2A 1YIJV 2NYYC 2AQ1A 2RDRA 4ALAH 4TYSA 4FS0A 4Q9BA 3AK1A 3U7YL 4INDA 2ATKC 1BAWA 2IXIA 2XTJD 1L0NH 5KC6A 4ELMF 1YQ2A 3G5VB 2ZGRA 1N64L 3CC2V 4J1UB 1U96A 3KG5A 2LE9A 3SBWA 3PUCA 3W56A 4AGOA 1J3PA 1W90A 3U82B 2FDFA 1UZ8B 4YM0A 2IBZX 4OM1L 1KB5L 3TZVA 4A6YH 4V1DA 4NQVA 1I7TB 5D9SA 2IJKA 1QOSA 2BP0B 2OYKA 3J80N 2V5YA 3VFWA 3CLEH 1MEC2 5C93A 2X4TB 2XZQL 3I9PA 4K5MA 3S3BB 2ZEXA 3RFZC 1HQLA 2LU3A 1PO12 4M6OL 1DQLL 4HNAB 4KWKA 4QPIB 5ACZB 3B7SA 5HDBE 2XAJA 4KDTA 1PG7X 3ZYBA 2WP3O 3MSPA 2B45X 3NCCB 2WFPA 3QWNA 4FQXB 4NCDA 5D2NB 3CXCU 1TYEB 4YBQC 4PSPA 3SJVA 5CJBA 5C3TA 2WLZA 1EERB 5F1IA 2F23A 3CWGA 5FLXN 3S34L 2BWAA 2A4ZA 3WXWH 3HIFA 3II2A 3A67L 4LFBO 3VBHB 2IV8A 4I1NB 5C3LD 1NBMG 3O45B 4UT9A 1J0IA 2EDFA 4OD1L 1QU0A 4NM4H 1PO23 1IBMO 1JS9A 1ETZA 4E9TA 2F1BA 2V5SA 2X2JA 3FRPA 3IT8D 4OZIB 5DZAA 3RG1C 1EZJA 4GI9A 1KD1W 1I1AA 3BE1L 5BOPA 2FR4B 1AJOA 4HG4J 5T1DL 5FY1A 5I93A 3SDXA 3C6SA 3UZQA 3KPRE 2YS4A 5HHXL 5IYBO 4M61B 3BDBA 3V5KA 3W11C 1G9EA 2J73A 1TJGH 3UV9A 4GIAA 1FPOA 4ABMA 5K9KA 4FA6A 3AFLA 5MHSD 2FCVA 3M8LA 5J13C 3RJRA 1YFWA 2ADDA 4JZGA 4UDUB 4A7GF 4EDXB 2XZQH 4PP2B 4LWSA 4AHZA 2VRKA 2Y1YA 1MS3A 4PV1B 2A79B 4MAYA 2OZJA 2GUZB 2B20A 4NNXA 1IVLA 1M6OB 2DL2A 4RZCB 5E8OA 5DEZA 3LJ3A 3PIQA 1RZPA 2PHLA 3W37A 4W6WB 5B2GB 4GQ9L 1UGKA 5JHDB 4UBGA 2FBJL 1MEXL 4OFKA 3VQYA 3QIUC 1U8OB 4NKOB 3E1ZA 3BUCA 3VBOB 2VC2B 4KKBD 1HZHH 1XSJA 2PXYC 4FZEL 4HA1A 4C57C 4H26B 2EIBA 5J6GB 3O5SA 4M3CB 1E43A 2F5AH 4WHYH 1PNDA 3VHNA 5LCVL 4JLRA 4LP8A 2P1YA 3HMXL 5CFCC 4IV1C 3DO4A 3CHOA 4PJEA 1KLUA 2G5BA 3G5YB 1W15A 1ZNPA 2ESVD 3QH3B 4GSXA 1V3JA 3FT1A 3TO4D 2LGWA 3QQNA 4KDTC 4R7DB 5CD3B 4YHZH 2QA4V 2GUYA 3DHUA 3LTVA 3OF1A 5EULV 3WEXB 3M7FB 4FN0A 1EPZA 1EV2E 3DX9A 1R3KA 3ASOC 4P99A 1YY8A 2QQLH 4OZGB 1AR83 5HDQH 1UH3A 4ZMQA 4MRCA 4R6UA 4XJ8A 1OTSC 2ALWA 4IHBA 5HHQA 2C8NA 3MBWB 4ZW7A 2DWRA 4AM0Q 3S8GB 3COOA 4LCYB 3E0GA 2AHYA 2FATL 2Y72A 4B50A 1PVXA 4XCCH 2Z2SB 3MEPA 2QFPA 4FL4C 4J3UA 3HMWL 3T77B 3RQ0A 4EZ4A 3KLSA 4G8FB 4XDJA 2LGNA 2NY7L 3QXDB 5GZNC 4TUOB 4EV0A 4I18C 2EUZA 3G3LA 4KVPA 3N1MC 5D2LB 4PJHE 1WD8A 3PU8A 4FKHA 2ORBL 1EGJH 3PFQA 2F7PA 2FHCA 2Q6WB 4MXWB 3QB7C 2R1XB 4DV6B 2EIKB 4GUPB 4P5TC 1UQSB 4PJDE 1MF2L 1Q3EA 3RVTD 3MV8D 3EOTH 3ZO0A 4MCZA 2AJVL 1G6RB 4WEEA 3PMEA 4FC3E 3ZBMA 1FXVA 4XPVA 2DTYA 4BXSV 4CDXB 5CGMA 2CWRA 4OZGF 2Z4QB 5IFJA 3DIDA 5KHHA 1BJ1H 4NQTA 2AW9A 1BK1A 3SQOA 2HAZA 2UXBB 3QQ3A 1GJUA 1L7TH 3S57A 2E9IA 3EFOB 3BMWA 3OBZA 2FJFB 4DY3A 1EBOA 1G9NC 3PCYA 1RB8G 3EOTL 1PF3A 4JI3B 2B7YA 2VJ8A 4YR6A 5IT2L 2VYRE 3KL0A 3S96B 3KPOA 4Y5VB 4KU8A 4D6SA 2W5PA 4RGMC 1QY4A 2FDBP 4RGNB 3DSNA 1JD7A 3C8XA 2X12A 4K3JH 2ZQMA 1JUIA 3OEAA 2ZGPA 1QFOA 3WP6A 2NSQA 4JTCB 4DKFH 2ZCHH 3D3VE 5I17B 2AQNA 1OCRB 4XC1L 4COVA 5I5JA 3ZMOA 4MS2A 4QTIH 4TSBL 3ZYIB 4PTTA 4X20A 2X38A 2ZKWA 1KCSL 3IDGA 2R0ZH 2NYZA 3OKDB 4G7YH 4PJEF 1OOPC 4MNGE 1FNHA 3WMSA 5CG8A 4DPNA 4P9GA 4M0HA 3FB8A 4YSTA 1AR5A 3AMQA 3T1HB 2O6CA 3UBFA 2XUWA 1KIPA 1EGJL 3RDTD 5C6TL 5KYWA 4CRPA 1S7WA 4QNHB 2UZXB 1BJQA 1XEDA 1IBLO 4QHKJ 1SYSB 2C7UA 4M7JH 4DEPB 3IIAA 1HZKA 5L2JA 4FD0A 3SKNA 2IH1C 1OTTD 2J6EL 5FECA 1A21A 1U30A 3GBNH 3L95B 2O93L 4IDLA 1HX0A 2I27N 4N0UA 1VQ6V 1HH9A 3NJFA 2BSRB 2HG5A 3UEQA 2CIKA 1ZGLB 1NZIA 4I0BA 3RL1A 4HUWB 4KUZH 2YQBA 4XE9A 2OX5A 3FF8A 3MBEB 1NOLA 1TXKA 4AG4L 3JARB 5A6LA 5CEZL 5HI3D 1AHKA 3QNYA 2C4FT 4FTEA 2I07B 4DP6X 4GRWH 3W59A 5D93C 4LF8O 3BPLC 4FQQB 4JZNA 4H3WA 3SDAB 4QHOA 5HGDB 4MWFA 4QAWA 3ZDWA 3OKKA 2Z7UA 3OC5A 4FEMA 4YW7A 1HIXA 2ZXCA 2VAUA 4Z7UE 1NCGA 5L4JA 3NN8B 3RWDA 2IVFC 4U3JA 3AMNA 5E89A 4TMPA 3VV1A 3BWAB 2R2EB 5C09E 3UPRB 2WQWA 3WNPA 3TTYA 4YGBA 4HGMA 4P2OD 3KM5A 1ZAGA 4F2ME 3RB5A 1ROWA 1A78A 3WHUA 3MODL 4WUKL 4A2UA 3U6RB 2QVFB 2VDMB 4QHUA 4J3OG 5B3NA 4JRYE 4IRZH 3OVUB 2XJQA 4KP4A 4AYBA 5I1HH 4UM9D 5HDBF 4EMZA 3FRUB 2PHDA 2M1KA 3KJ6H 2NW2A 3MJWA 4B9IA 4ZD3H 5JIQA 2HHHB 1Z7S2 4EZLA 3PG2A 3N9MA 2O0OA 4K0KO 2O5XH 4NT6B 3IU4H 4LO6B 4X8GA 3MJ9A 3NJIA 3DRTB 3WEBA 1IC4L 4ODWB 1BDYA 1CTMA 1OQDA 3WAJA 1QRNA 3FSAA 2VQ1B 2YD0A 4N20A 2AANA 3B2EE 3BRGC 4XJZA 3T6QC 1N1SA 1AI6A 5EOCJ 1UZ6E 4CDHA 4ZOLB 3C09B 4XHBA 2X29A 3SPHA 3E8FA 4GAZA 1RHHA 3EGXA 2RCSL 3I84A 3OV6A 3Q2LA 1LHZA 4WENB 1PKXA 1WWWX 5DRWB 1N8ZB 4L8CA 4QPGC 1A7QH 3I75B 3MLYH 4I30A 4NO0B 1FPN3 3OR6A 2VIRB 5ACA2 3PQYA 1WC7A 1CFVH 3GS0A 4Z2AA 1AO7B 2R15A 2WVUA 3E8UL 2WUCH 1OF0A 4K15A 2Y7MA 4WWKC 3CVCA 4E41D 3N9NA 3BD5A 4K71C 5DRXA 4UBDC 4AYDC 3D39A 4QM8A 4AAPA 1MIEL 3UC0L 3CC1A 3G7TA 4KUMA 4DV1B 1ECYA 3NIFE 2PWEA 4PJ7B 4C8XA 4AOFA 3TN92 3ETPA 3PVOA 3AT0A 1AFVL 3ZCCA 1WWCA 4X6FA 1U3NA 1ZT4A 1OLZA 2CBQA 1TVHA 4BCXA 4FI9A 3ABKB 3T4YB 5E4AA 2ZUVA 2LU7A 4PMEA 4L8JA 3QCWA 4P23C 1I94B 3RGVC 1KTKE 4C0BA 1RUKL 3FN9A 3DN7A 2Y1AA 1OP3K 2VBDA 4XIOA 1KDIA 1IBDA 5IMKB 1P4IL 3F2ZA 3SBPA 3MLUH 3CG8A 2LW1A 2ZSWB 2P5BA 3I55V 3B2XA 5AB0A 3VD7A 1NOVA 1ODNA 3VI3A 2P26A 1TT6A 1TZIA 4L1HA 4PWHA 4CILA 3QO7A 1ZHNB 3AFGA 4PQQA 5T5NF 4ZMTA 1HILA 5CKGA 1KLFB 2EZOA 4KRPC 4J7KA 4NTWA 3LKNB 4KHXL 4LK7A 1UM4L 3I6LD 1UHVA 3C5SB 1FORL 4XF3A 2JVUA 4A2GA 3ZX7A 5K59F 3V0AC 1RIVL 3GMOB 3WIIL 3FO0H 4DV3B 4B3VA 3MV9B 4HF5H 5E6SB 2VQ0A 2XICA 3N04A 1LGCA 4RMWA 5HYQB 2IJ0C 4HN0A 1BFTA 5EYYA 5DJ8B 4ODBD 1VBD1 2H9GA 4CADA 2O8QA 3OM3B 1Q9LB 1TME1 2QJVA 3LSSA 2MNJB 2DCJA 1MVUB 4P57B 3JD2A 4PBXA 3RVXC 3I56V 3DPDA 4O2FA 1KJLA 2H2SD 4YRDA 3K71B 3FO0L 2Y7QB 4FG2A 2RGSA 4OF6A 4XHXA 2X4SB 1DVXA 3VFMB 4A6YB 1PK6C 1TFPA 4CL7A 5FLUA 1WRFA 1WPXA 2H94A 2DL9A 2HN7B 2WTPA 2GSYA 3NIGE 1ZVFA 2CGOA 4LOVA 4KJQD 3C2AH 1DCEA 1N36O 2OJZL 3I50H 3L7FB 4PCTA 3V4UH 4PI2A 1AS6A 3CVIL 3TV3H 2DWDC 4RLDA 3AX4A 3EYPA 4PDWA 4Q4Y1 1SMAA 3DRQA 2XAFA 3UIYA 1COWG 1CAUB 1I5ZA 3U6XA 1TIUA 2PXYA 1IG3A 1NOAA 2PYED 4P4KA 5DJCB 3RX8A 4OHWA 3E9UA 3LEMA 4E2LA 2OPCA 2WBKA 2NZ9C 4DRXA 1X3DA 1UWYA 2IADB 4LSSH 5BUPA 1W3XA 5J7MA 5FO9A 2FBRA 5B38G 3QIBD 1YVWA 3IF1A 1HB1A 3UGUA 3JZYA 2UY6B 1PEWA 3CQQA 5E6YA 2VE6B 3QEQD 3LEGA 1RURH 3IDCB 4AI2A 2CMRL 1V55B 3FHEA 2QQOA 3B09A 5T50A 1UJTA 1QD0A 1CICD 3MOBL 1N5YL 2Q1ZB 3NJLA 1OP3H 4JKLA 4MX7B 4U0RB 4WUUE 3NCXA 4W65A 3ASNC 3GBDA 4F20A 4YZ2A 1CGPA 5T1LA 4KG8A 2OW7A 3ZXFA 3ZHUA 2BIQA 5E08H 1Q6UA 1UD8A 4XO3A 1S0CA 1N18A 1T2JA 3EH2A 1NPUA 2FCBA 5EBWC 1OQ1A 3LEKA 3GJFB 4H7VA 2VECA 3PUQA 3TO4B 4LFCB 1INEL 1ZWIA 3SO3B 3GBWA 2BZDA 3ZHDA 4TXWA 4WWKB 1UZ0A 2EINC 1GXEA 4M7KH 1TQUA 3TYGH 3UJJH 2RMKB 5DD5L 4UV8A 1PIV3 4J6RL 5C3RA 3FUHA 4BUGA 3ULVL 4N0UB 3GSVB 1DGWA 3N2KA 1W9WA 4PP2A 1U8QA 4M1GH 3VFRB 5A7QA 4FQIL 4ZXBD 3ST7A 3NTCL 2A6VA 2P5WE 4I2OA 1TLKA 3QFGA 5DPNA 1PPJH 3JARA 4WEUD 1INEH 3BZDA 5JO5A 4KOBA 4BQ1A 2F53D 4FNQA 1FOD2 3JZVA 2C4XA 5CINL 4AQSA 4KK6C 4KO7A 3JAKA 3AXHA 3KLHC 2OPKA 2HJFC 3ILDA 5EORH 3OF6A 4XTPA 2X7LB 4LXFA 1EHKB 2VITB 3IFNH 4Q2ZA 4GRWB 4AVHA 5JXIA 4N0UE 3D25B 5B7EA 2EDEA 4G8GD 3FULA 2RMU3 2VU9A 1UXLA 3T6ZA 4PHZA 4LL9A 2AEWA 4OGAD 4CC4C 2EEBA 2CV6A 1ONQB 4F83A 1JPTH 1X9UA 2B39A 1W2NA 1HSBA 5MEPB 5T52A 4G3YH 1KBGL 4NUGH 3U6XS 2ROXA 1TITA 4BCZA 3ZT5A 1PFOA 4K3GA 4MXQC 4U1NA 5FV1L 3O3EB 4K23L 4G7SB 1I94O 2AAAA 2MQ3A 4WW2C 5F6HI 4BH8B 2QQNL 5DA4A 5AAMA 3VJ6A 4Q26A 3OX8B 5CZXD 4F5CE 5JOZA 3L4YA 2VZUA 3ARZA 4H0HB 5L2KA 5FYLH 4R26L 1E28B 1WZ1H 2HVJC 5TTRA 3ACLA 2CLRA 2DLFL 4WI2A 3TOPA 2P43B 3VSQA 4N9IA 3OPZH 4AOCA 5BXFA 5I1AA 4J2XA 3KMHA 1QBML 3LOWA 2BNRD 3MRKB 2EC9T 3QUYA 3O2WH 4IW4C 5J56B 3RVWC 1HQNA 2P52A 3FLRA 2G2RB 5E9AA 4FHBD 2Y3AA 3IDAA 5BRZD 3ECBA 1BF2A 3CD4A 4CCJA 4QQOA 3P3PA 4LU5L 4C54A 1BWMA 1REEA 2CLVB 3T0EB 3VI3F 7CGTA 1O4YA 1DJZA 1UZWA 3FUNA 4Z7UA 2YD7A 3S3PA 1I3GH 5D93B 1OA4A 4FQCH 3MJ6A 4UB6Z 2HR3A 4FL4B 1VENA 4LQ1A 3B2VL 1QVFU 3LY6A 4HT1L 3C3TA 1ASJ2 4CDXA 3WS6C 1UZ6F 3T9WA 3IFNL 1PNLA 4IIQC 1UU5A 3K77A 3O3BB 1NGQL 1VQ7V 4KO6A 3ILNA 3GF8A 5LBSL 4HULB 5DZ9A 4GQRA 2CKNA 1Y4MA 1BYOA 2ARXA 3D69A 4YO0A 3LDBA 1FQ9C 2K9UA 1AZCA 4X5XA 4W4OA 5FKPA 4OCYH 1QJU2 4ONHB 2B5HA 4LQFL 3H3PL 1IAIL 1HCYA 3TIEB 3MGTB 2Y9RT 5DRXB 1SEBB 4I3GA 4YXKH 3WY2A 3U78A 3DSFL 4XUTA 5AD0B 4ZNEA 3NSCA 1QMUA 1G6RH 2WVVB 2X1OA 4XNZB 3JU9A 4YG0A 3IGFA 1U8PA 3NCJH 4BQ5A 3BKZA 4PUBL 5EIBC 1EV13 1I1AD 2GAZB 5KZCB 3N2GB 1FFOB 4L4VB 2XG5A 3KVAA 5FMOL 4I4WB 5F9JA 4AUYA 1QKQA 1Z7JA 2Z5UA 1PDKB 3PAVA 3PWUA 1YJDL 4U1HB 4K73A 1PKQB 5EU6A 4LQRA 1UNBA 5IUCA 3QUXB 3ZKXC 1N1VA 5ADOL 3H6AA 4L4VD 1A66A 1POV3 5F7EL 5CGBA 3QEHA 1CPMA 1HRI3 1CFNA 2DN7A 3SPCA 3SY0B 4E0RA 3NSFA 2FJGA 2AABH 2V3EA 1C12B 3C6LA 4H37A 5CILH 5HHVL 3VI4F 2P90A 3G04B 3QJTB 4QKXB 3X1GA 4UU9A 3K08A 3Q43A 3JASA 3S36L 4XBFA 2YXSA 2W9LA 5L2JB 5HI3C 4RQPB 3R6SA 3QIWD 1DQ4A 4KI1A 4IIJB 1AHWA 5E7BA 3KPRD 4U1SA 1DSFH 5IJ0B 2WZ5A 1JZ5A 2LLGA 4KK9D 4NBZB 3JTSA 3LRSA 4L5FL 4R4BA 2CSGA 3FC0A 3DX6A 4OXSA 2E7DA 4JJ5A 4BK8A 5LN8A 1OH4A 1SUJA 4FI6A 1YNLH 3HC4L 2WS92 5KYUA 1FPN2 3KPSB 3L4UA 3BW9B 5CBAB 4LOSA 2XTLA 3KD4A 5CN2A 2Y7QA 1NA8A 1TMCB 3ABGA 4WHTB 4XGZB 3O12A 4NRYB 1LEGB 1DVTA 2VDOH 4JE0A 4L3EA 4WVMB 3KV9A 4O65A 2CGPA 4AQ2A 4X6CB 1OAYL 2NM1A 3CYOA 1A6PA 3S5LA 3VZOA 5JSRA 4BFOA 5I1CL 5C6CA 1DTUA 1HXS2 3E6DA 4BHUI 2G3XA 5AAPA 2D3JA 3WO4C 2P3JA 5HTSA 3AZYA 3CNAA 4FFIA 5EOTB 3S35L 4L4TE 1MVEA 1OVZA 1CGXA 3DA0A 2JQMA 1PJ9A 3LDEA 3AB0B 1R092 5B1JA 5T1KD 2NY6C 1WYJA 4KQ7A 2OMTA 2FR4A 4I0PB 5D1QE 4KTEL 5DHMC 2QTSA 1PEZA 1YPZF 3UCQA 2FK9A 2X4RB 3BQUA 1V10A 3DK0A 1R3JA 4WSJA 5CBLA 1LYQA 3A6BL 4D7SA 1CT8A 4E42B 1REIA 4Y16A 3K3QA 3ZFEB 2JIXD 2IOIA 4PW9A 1SKVA 4W9KC 4PS8A 3KWWA 3UGEA 4LIQH 1W6LA 3CIAA 4MVBD 2GHYA 3CC7V 5GIRA 3O1UA 4MX7A 3GMQA 3QDMD 4XNYL 3EW3B 3RE0A 5ABZA 4LO4B 5IHHA 3IETB 1MLBB 5D2LF 1E79G 3S34H 4JRXD 3TU6A 2HX8A 5JLZB 4KNQA 2VE1A 3BVTA 5CG9A 5GGSB 2J1UA 1AP2A 1T89C 2QLYA 5DO2C 5KA6A 1KT2A 1HJCA 2F8OA 1NX9A 1FGNL 4JYAO 4HJUA 1HWYA 2B1GA 5LMUB 3FTZA 4KQ0A 1IQAA 4RMUA 1OM9A 4DHLA 4HKWA 1SMVA 4KFMA 4CCEA 4BGDA 4LKCA 1QLEB 5I1CH 4FP3A 4EWDA 5KS9B 2IFWA 4M6OH 4G7VL 3ALQA 1QQCA 2ZHNA 1KLUB 2YRBA 3G5YA 4JPWH 2QEJA 5I0WA 1X9TA 5EPAA 3U2JA 2AGJH 4HJGB 4Y2DD 4ZRGA 2KZWA 3TH4T 3ZMRA 4AH2A 5EH1A 2B4CC 4PU2A 1WWYA 1ZS8A 3FDWA 5EU6D 4M5YH 2Y25A 5KOMC 3RZCC 2YEZB 3VM5A 4MXVE 3BLPX 3ULUF 1ASJ3 3ZKUA 3FQNB 5DG2A 4YLQT 4Z92B 5JOPE 2GHZA 4M8QA 3U36A 1RMFL 1G1KA 1SXNA 3VL8A 4XI5D 2JG9A 2WQAA 3LCPA 1AR82 2ZD0A 3M88A 4LCYA 4AGLA 3ARED 1UXSB 4DIQA 5CB4A 1OAKL 2X4OB 2O61B 2IXHA 3BI9X 4XDKA 2ZA9A 2Q2EB 3DOSB 3MTXA 3R8QA 1DVYA 3L6FA 4MA3B 4Q52A 1KLFA 1E5UI 3MACL 1C57A 4S1QH 4BFIB 1HRI2 4YWAA 1I3UA 4PJHB 4A2MA 5AVQB 4NEHB 3MGUA 3BE1H 3AKPA 1T3FA 4ZZ8A 2J7LA 3CZLA 2YIBD 3SE3A 5FGSA 4AE1A 3L9JT 3D51A 4TTGA 3QEGH 3BUYB 5MEND 2O6EA 2DEXX 2X88A 1VKXA 3FFZA 4I02A 2LFSA 2APSA 2IJJA 3B43A 3KW7A 3FFCD 2WLMA 1WE5A 3KCWA 4TVPE 3MACH 4Y9CA 1PGW2 3HG1E 2ET7A 4HSAC 4CADB 3ULVD 4OZGE 4CSSA 4Q4W1 1DQTA 4FFZH 2YC4A 4WO0A 1FVCB 4WJ5A 4Z7QF 1Y1DA 3P9LA 2Q67A 2DQEH 3Q0HA 3DV4A 3QP3A 1FAIL 1TMF2 4KY2A 2X5IC 4FQJL 5G4OA 2WBXA 1N8OE 3M3IA 3THDA 3GALA 3WFHA 1BVKB 1K2DA 2HN7A 4JL1A 1J84A 2VZVA 1VBB3 1AZNA 1HHHB 4FDWA 1MCPH 3I2KA 2EVFA 5EZYB 4GUOA 1OZUA 2BNMA 5ANME 3KPTA 1EAOA 4XNZC 2I5YL 4PYGA 3V0HA 3ULUC 1VF5C 3WEZA 1N5AA 3GO1H 4GH4B 3QDMB 3JD71 4X8NA 1S7SA 3TEXA 2BIIA 1JK8B 1GS8A 1QWNA 1XIWA 4YDZA 3RPBA 4LFBB 2R062 2TRHA 5FYJU 4NO3A 4EN3C 2ZGOA 2NXZB 4Z7IA 1UH4A 2CIIA 1G8WA 1URLA 2R23B 4E8CA 4Q0QA 2AQ3A 2JB6B 5D7LB 4AAXA 1MW2A 3JVGA 2ZD9A 4UOW0 1JQ0A 3CVBA 2DWXA 2WVVA 4JC1A 2RIKA 5HVFB 4N90D 1AR81 2UYLB 5GRVL 1XCXA 5LLIC 5F1NA 1B2WL 3CIHA 4A45A 2ARJA 3E97A 4CZZA 1L9RA 1QQDB 3OKLA 1LOBA 1ZLDA 1NGPH 1XNTA 5AEAA 2J6EA 2M26A 1FXZA 4Q20A 1XD1A 4UVAA 4RHV1 3VBRA 2QM8A 3D06A 3H3BC 4OLXL 3RWRD 3BKYL 3LHAA 3PWVA 2BVVA 5BZBA 1YTFD 4HJ0D 5INCA 4LPWA 1XOUA 4I1RA 1FJ1A 4K9SA 1I0HA 1QBBA 3CQFA 1SJHA 2E5LB 5FXXA 2V0AA 4NNPL 1WF5A 2NY5H 4K8ZA 5DT1H 4HKLA 3TRSB 1LK2B 1HIMH 1T7XA 5FPLA 3US1A 5BNQA 4PRPA 3S5LG 4C91A 2LW7A 2I24N 2YD1A 4LCVA 2E9QA 1MCPL 3ZMTA 1XZ0B 3LQAH 4XWOC 1CAWB 3CL1A 4ZX6A 3CFUA 3NCMA 1DVFD 2ZWLT 2N7BA 2XKSA 2YGNA 2CTWA 1NBYB 2V33A 3CPLB 4FVMA 3FSZA 3PU7A 4QY8A 2AREA 2NY5L 1UA3A 5EUOA 4A7UA 2K46A 3WW1A 2J1SA 1MHCB 4EOWH 4WFGA 3WOGA 1UUSA 1N0JA 1JERA 5C97A 2KUTA 2GIYA 4JFED 1E1QG 1H6TA 1CLYL 4HPKB 2PTTB 4GAGH 4R6ZA 4FABH 1A7NL 4NZUL 4QIWF 2O6FA 4P9OA 3DIFA 4W9JC 5BY5A 3WENA 1AANA 1OT2A 4QRPD 3ESOA 4GW4B 5DZEA 5IK4A 4HJJL 4RRPA 4Y16D 2SEBB 2BSSA 1J1LA 1P8JA 3AB0C 1RZFH 4XUQA 4XFIA 3ZN4A 1A9BA 2ORXA 3ZDYE 2VDQB 4D0BA 2XPGA 4JKPH 1EEZB 2W92A 3BPZA 2ADPA 5IB4B 1WBYB 4N0CC 5KANI 4LUMA 2JI3A 2ZKMX 3FZUC 3GS7A 2PYEA 4OD3L 1NMAH 5KX5A 4FNUA 4UT9H 5IWLC 2ZKLA 2HJFB 4NIHA 1E9OA 5L3CA 2HBTA 1JYTA 4RWYL 2Z4TA 2VUCA 4BH8A 5I73C 1HV0A 1HNZB 4I2XE 2K3TA 3VXPB 3WG7B 4HONA 3HPJA 1MHHB 2F19H 3ZU8A 1P4BH 3INAA 2WBJA 1H30A 5D7LE 4PJ6A 4R8WH 4XX1E 4YLCA 3DXRA 4N21A 1IL1B 4OBRA 2ZXWB 5BJTA 3ZQXA 43C9A 2X2YA 5I9QC 1Z9SB 5KBKA 4RH4A 5KZCD 1D4VB 1R093 5E6IC 3MODH 4NKMA 1OCWH 2R29L 1BEYL 4P2AA 3WF1A 4HHWA 3FUEA 4IK6A 4LE3A 5GLWA 1TUBB 4ZIBA 3LGRA 3VXME 3T09A 2E32A 3ZL4H 2BSKA 3WX5A 1JCHA 3CPWU 3KEDA 3POSA 4F91B 4GLRI 4NC0B 3VSVA 3AYEA 1SJEA 4NKDB 3CXHK 1A1OA 1EA9C 1ZPUA 1D7BA 4NXNB 2Z64C 4YFDB 1VBC1 5L7OB 1GYKA 4UWDA 3HMXA 5IBTH 1NE6A 5DVOA 1KPVB 3ZL1A 1MNUH 3H9SD 5DFVC 1ZLUH 3IWUA 1FVDB 4CS4A 4S10A 4TKWA 1EWHA 3WINE 4XBQA 5J98B 1P7KB 3HG4A 4NRZA 3N43F 1GGBL 2PXJA 3KLAA 2CKBA 3FCBA 4JS7A 2A5UA 1G9HA 2EABA 1Z9LA 1RUKH 4FPKA 5D72L 3VFVA 5JPMC 3GSOA 1J0JA 1DIWA 5CKNA 3ZKND 3KLQA 1VBB1 3RI8A 4AUJA 4IRSA 1WP8A 4R50A 1HKLL 3TZVB 1JHJA 3RUGE 3CX5K 4MA7L 2QVSB 3ZFFC 4CYDA 4JPIA 4YW3A 4S1SH 3I02A 3WEOA 1I4FA 2VGDA 3N2GA 5L3EA 1FFOA 2KLRA 3B9AA 4L4VA 5MEOA 3H7JA 1QKZH 2EH8H 1G1YA 5IB5B 2R59A 5EU3B 1EX0A 3ZE2F 2LLNA 2YIHA 3N4MA 2IJHA 4JFQB 3KZIZ 5A33B 2OTLV 1YNKL 2UZYB 1IKNA 4IQHA 3G6JE 3V52H 5FYKH 5KYXB 3W38A 1QSZA 1SXBA 1TO5A 2WPDG 5E2WL 1KDMA 1K5QA 5BS0D 4MVBC 1FV1A 3SGJC 1RUG1 2UY8A 4HFWA 4ANXA 4EJ1C 3DOSA 1XVSA 5I8KL 1OV9A 1CLZL 1VPOH 3SDDD 4AVKA 5L6YH 2LFRA 2X1PA 4XMXA 4Q14A 5GJTH 2RACA 1SN2A 4XPBH 1MQTA 1QHDA 1I8LC 3PQYD 1NTKH 5SX5H 5C0NC 2XJRA 1H3XA 1WJ3A 1ZL8B 4DW0A 1O75A 2JB5L 2TAAA 2VXSL 5FYKL 3RWIB 4LSPL 4WW1A 3KQRA 4MXWL 4WK2B 3O6FD 1IX9A 1WP7A 1A3RH 4RFNC 1D4M1 1PVC1 2Q8DA 4YWGL 4CC6A 1JZIA 5JPMB 3D87B 2JS3A 4MCMA 4O2EB 3AP5A 2OZ6A 1GGBH 3OXSB 5C3OA 1S5IH 4C83B 4Z7OF 4JQIA 1V70A 1TKWA 3LXAA 5EBLB 5IW1A 4WJ5B 4LBLA 4EN6B 1JPST 5KYUB 3A6CL 4FYTA 5A7WB 1HKLH 4B3MB 3STZA 3RFRA 4QEGA 2Z1KA 2ERJC 4K9EL 1KC5H 2VUDA 3K6FA 4POUB 1IDSA 3U0TB 1C1EH 1QKZL 2WXQA 4UDUA 3BTYA 1U6AL 1F86A 2H6CA 5LA2A 1NLDH 1D2PA 4NKGB 3VBUB 1KFGA 4X64B 3LVEA 5DEGA 5HHOA 3SDXE 3IDYB 4PA6A 5FPBA 1T0PB 4S2HA 2N56A 2EDQA 2CO7B 1AGFB 1IIKA 2OPWA 2ARJQ 2NY1D 2GC7C 1WG3A 2UUAB 4TVUA 4Z3HA 1DBBL 1LXMA 2QQKH 5ALCL 3REVB 4AQ1A 4C7UA 1URZA 3VFOA 1XIWB 2JI2A 2QKSA 4LDLB 1MFAL 3GSXA 3C08L 4R7LA 3MROA 5DVPA 1MZ5A 1BVOA 2NY1B 2EECA 1SY6L 2XASA 3BY6A 1FIEA 2C3XA 2HJKB 2BHYA 1Z78A 3QEQB 3Q3GA 1DQKA 3CVIH 3UCRA 2W6JG 3ARFB 3HZ3A 2X4RA 1GNZA 3FB6C 3P40A 2XAGA 5D55A 1EAH1 2C5DC 2M83A 4MXWH 3UO2A 2DQUL 4RFEA 1J59A 4ZOAA 3PL6D 2Y2TA 4I4TB 3IC7A 3OKLB 4Z7WE 1HVXA 1YEIH 3VHPA 2D31A 3OF6D 4TNVK 5H2BA 4IOSA 4QE9A 4EBQL 3FO9B 5KEZA 4Z9KB 2PAMA 2D7OA 4W4KA 1U91B 4WI4A 1H6FA 3SKJE 5I8SA 2VDPH 1H6UA 4PREA 5J36A 3KBPA 2JJTC 2XWTA 1ZGLP 2R2HB 3OBTA 2BBVA 2QDNA 1J8HE 4UFJA 3H9SA 1YDPB 5F7NC 1E50A 2G9HB 4YZWA 2FLRT 1GS7A 4TWTA 1RULL 1G0XA 2P3IA 4AEHL 4UQAA 4ODVL 3GSUA 5J1AB 3RVYA 2NX5D 4U7MA 4V2WA 1A6AA 3QIWA 4H1LG 4G9FE 4U1GC 1ZA3A 4YDJA 4L3CA 1B4RA 2ZOOA 1VBD2 1G9BA 2WIIA 1MY5A 5BOZG 4ZY9A 1RP8A 3UMTA 1J1TA 4BFJA 3LDKA 5ECGA 5I1DB 4JN1L 2NX5B 3NV3A 1K5NB 1JW6A 4P2CG 1SQQH 2ZPXA 1YN7A 2W2IA 4LLFA 2GI0A 4R0LC 1VHPA 4F9PC 3NJNA 1HL5A 3BX7C 3GGWB 2PCPA 5ESQB 5CUSH 3QUMH 2DV9A 4FP8H 4MFHA 4DP7X 3ZO0B 2P3YA 4G3YL 2JJSC 3F7VC 2R2BB 2DMKA 2ZOWA 4NUGL 3ON7A 4M8QB 2FIKB 4X8XA 1FMD3 4NUJB 3D7PA 5IQOA 3D33A 1II4E 4ZXBB 3U9WA 2QQNH 1YMME 3ULSB 2XTAA 3B9KC 4AYUA 3FTGA 2Q8VA 4HMDA 2KL6A 5I15H 3OTOO 3GTNA 1QZNA 2F58H 4NMIA 4Z82A 2FB4L 4X65B 1Z9NA 2JDAA 2GALA 4MNQE 4ZAKA 5EOQH 1E40A 1FI2A 2XQYA 3HAGA 4PJHA 4FPCA 3NIGB 1MJ7L 2ATKB 5TF0A 1ZA6B 3CP1A 4Z7VB 2XC8A 2Q73A 1W2UA 2D6LX 3EYOA 1FI8C 5ESAB 4N53B 3ZDSA 1XIWD 2ADIB 1NAKL 3SDCA 1YVLA 9PCYA 1KF9B 2DN9A 4ZPVB 3W1ZA 4AVIA 1E9PA 4X4YA 3RZCB 1CICB 2F58L 4HVBA 4DV1O 4NO2A 1WVZA 4FFYA 5FM5M 1KBGH 5IK3A 2ZUUA 3CZSA 4K7FA 2QQVA 3SGDH 1AR73 1IU1A 3O2DL 3WD5A 1CPNA 3VWKC 3ARDA 1WD4A 4PRHE 4Q4W3 4E2OA 4P2YA 1PX8A 4MNQB 2WLIA 3T0AA 5CFHA 5LO7A 4AIZB 2FDIA 4JDVB 2ZM6O 1WGPA 3QOPA 4B60A 5FO7A 4YHYC 2VUAA 4F24A 3WFHB 3IVKA 4Z3JA 1SYSA 2A06H 1VRBA 4F7EB 5C07E 4M6NH 1B88A 3V10A 1Q0XH 1RK0A 3FT0A 1E8ZA 5CINH 4MJ5A 2UZIH 1XFPA 2CKBL 4J10A 5JR7B 3LPGA 1EH9A 4RR3C 1OW0C 3MAQA 3BESR 5EZYA 3ES6A 4M3CF 2YHGA 2KA3A 1GN3A 3PWPA 4KO5A 2BOBC 3H9ZA 3JYBA 2B08A 2CA3A 4I5BA 4B41A 1RUJ1 4XBLA 4MVQA 1XB8A 4DGVL 1XTMA 4EE2A 2ZX1A 1A4AA 1S7SB 3VXTA 3O9WD 1SLUA 5D8AA 1VADA 4GRLD 3NJVA 4FQCL 4JZ2A 4RAVB 4HSCX 4BK5C 4B3NA 3QJQB 1JMUB 2R4RH 3VWJB 1CFNB 4NWVA 3ZFEC 2V9QA 1SQVH 1EJOH 5D7LA 2VRAA 5KVEL 5BMVA 4H44B 5A3ID 4BFEA 3Q13A 1GZQB 3WJLA 3WG1A 1UXWB 1XNBA 2LFGA 2ZDIA 2VLJB 3IGKA 1U5ZA 2RG4A 2BIOA 2I7OA 4GALA 4MH0E 4E2GA 3VVWA 2GCYA 4JY6B 3BSGA 1KKCA 2KMWA 5JIKA 3UTTE 2EIEA 4QX0A 2DM7A 1NDMA 3SYAA 1AIFB 1DUZA 2ADGA 4Q0XL 3V4VL 1CUOA 5ANHA 3VQ1C 1JF6A 2ZXWC 2R4SL 1RZGA 4L37A 4OCYL 5HHNA 4DVRH 5KBLA 2X6BA 2HRPL 2IALB 3MJ7A 3B6SA 3CBRA 3WLBB 2GFBA 5IROA 3ZHNA 1PVC2 4X98B 4LCUC 3ZE2E 3DGTA 4CVXA 1WFJA 2PO6A 2FHBA 3UP6A 2BU9A 3GT6A 2Q7GA 3O4OB 1ND2A 1RUJ3 3I2IA 4FRWA 3OPWA 3HKZA 1KV7A 2X7RB 4UTBH 4Y9BA 2CAZC 4OLVL 4HAGA 1DHKA 2QGCA 1KJMA 5KG9A 4M6NL 3QXVA 1J86A 4GX5A 4QGTA 3QIBC 4XPGH 1ZLWH 3T4ZA 3IBEA 1EZUA 2FMDA 1ZT7B 2WAOA 3GRWA 4DR1B 3QEQE 4U1KB 4MOAA 1U92B 2DQFB 1QHPA 1JPGB 1RLWA 3LFMA 4QDSA 5ISLA 3OLIA 2J8UF 3QPKA 4GKZA 5FNVB 4IRZA 3TNNA 2DBNA 2VZQA 2C9AA 4FQPA 5D1QC 3RWNA 4ELMB 1FRGH 1AR63 5I30L 5TFSL 3PUAA 1NWOA 5C0IB 5JH7B 4U31A 2VXVL 4HPKA 4WVRA 1GN6A 1WPBA 2GABA 1XYOA 1HEHC 3D85D 2QQUA 1RHHB 3EGXB 3D4KA 4LKEA 1ZA7A 3TT3L 5IHZA 1SN5A 2V2XB 1AX0A 4AVVA 3TZVC 1IBFA 3NCJL 1ZGLM 4QXGH 2OUHA 4CW1B 1G7HB 3ZFFB 1KTLA 4J7ZA 1X4YA 3G6JA 2GTZB 2CE4A 2EXYC 1ZD6A 1IGCH 1NJ9B 4XXCC 3S35X 3B4NA 4ALAL 1YQ8A 4FQHB 5H37H 5L9VA 4QRQB 5ESVA 2JEUA 4UB8Z 2A74A 5AUMB 3ZR6A 4X50A 1YYNA 4YW4A 2DM2A 4H1LB 3BH9A 1WA4A 5K7PA 4P3DA 1R1A3 1H3PL 3UGGA 4I5SA 4M7LH 3W3BA 2BNQB 3B01A 4AQ1B 2KT6A 5JWPA 1RZKC 2CRYA 2D9QB 1XMOO 2F53B 2X87A 1C4RA 3LB9A 1OPGH 4KXAA 2IXQB 2DYPA 2R1WA 1CFTA 4AEIH 4OZFB 2NLJA 2H6PB 1J0KA 3HR6A 2ZOLB 3ZZLA 1IL1A 4OIIH 2OYLA 4FFYH 4GY4A 1GPOL 1KIQA 4Y4HA 5BJTB 5IMKA 2VJ0A 2OZ4H 1XD0A 4Z95L 2L9LA 1I7RA 3BD3A 1WS7A 2ATPA 2HTLC 2FT7A 1GKEA 1UXMA 3MCG1 5EQUA 2IVJA 2PMZA 3F12A 4OZHF 2ZX8A 3POGA 1DGWX 4E2QA 3DKWA 5FZCA 1KGYA 2HP4A 4LLYB 5EIQA 3PYCA 3MLLA 4FPLA 4MV2A 2RVAA 2VAAB 4WVVA 3T1MA 1E3XA 5AKSA 4IEYA 5I28A 1OSZA 1ZX3A 5D6DA 3VFNA 1UA6L 1US6A 4PG2C 4AK2A 5HHPA 4JFEB 2WTOA 4XOEA 5DQ9A 3BIWE 2DWEB 3A6BH 5HBBA 3CEIA 2DDQH 3L3GA 4JRXE 1NCQC 5B8CB 3LRKA 4DV6O 2XBO1 1ET5A 1TQBB 3CDZB 4N2LA 1FNSH 3QZWA 1GHFL 4MZRA 3HB3B 4B7IA 1U3HD 5F7LB 4PRDB 2WA3A 2MPAH 1KCBA 3N44B 1OAYH 4Q4Y2 2D7PA 4UIKL 1UA6H 3ZTCC 1COV1 4IRJC 3QNXA 4O2FB 4OF0A 2ID4A 3K0GA 1NCWH 3IXAA 1SRDA 1IBBA 2XJKA 3JWDH 2RS12 1Y6KR 3MICA 2I85A 4FQXC 5D2NC 4CXYA 4JO4L 2DIJA 3MZHA 5CD3A 4FG0A 3EJPA 3ZXKA 1CX1A 2YMXH 1JWSB 1NIBA 4H88L 2UVFA 1KS4A 2DJVA 3FN3A 4Q29A 3HNVL 2MNUA 3PP4H 1E27A 4P9XA 1HCFX 3K58A 1BQZA 2H47C 3FU3A 3U7WH 4FTSA 4X7DC 4KBZA 3QUMB 5EO9A 1Y9QA 3E1F1 4KRNA 5DVKA 2G9FA 3FCUB 5LNGA 4ZMNA 3FAWA 5FDYA 3LN4B 2AQ2A 1IAKA 1E8XA 4OLUL 4ZMPA 3H7YA 2JDZA 1GKFA 5JI7A 5LXTA 3ZEDA 3HAEB 4MLIA 2HRLA 3A21A 3GUFA 3P9LB 4RISH 4DCQB 1JOPA 3ZDXF 1JTZX 3ULVH 4G5ZH 2ZG1A 1MY7A 1UU6A 1ZBE2 3QYNA 2CBMA 3HI6H 2WUBH 4TLUA 1YZBA 3QFDA 1BVKA 3DPBB 4YDVB 1MCSA 4DZBA 5EO1A 1PMHX 3S0MA 4LOTA 1U8KA 1YMMA 4NN6C 3MV9D 4DETA 2FL5B 2YN3A 3E3QE 3NQKA 1GMIA 3EG9A 4NO2B 3UL2A 3MHHC 3JUYA 5CA0A 2A73B 3O1OA 1JZJA 2MTPA 3H4HA 2WMPA 2Z91B 4BB3A 3MRIB 2I5YH 1DQML 1JK8A 4X1KA 1L1FA 2E46A 2LLLA 2M8XA 2WVSA 2Y2WA 4MNQA 4U3SB 1TMF1 3W7SA 3AMPA 1H8OA 3QSKB 4AENA 4TNWF 4HKJB 3STZB 5A7WA 4GQZA 4RX4D 4AV5A 1IC0A 3BGFB 1PZ3A 4OULA 3ZTDC 2ZG3A 1D6EA 4GULA 3D34A 4Q97A 2BW5A 3AC0A 3W9DB 5D1QA 3WIAA 2H41A 3GXUB 2RB8A 3APDA 1TZGL 1Z9OA 4X5PA 1H0DB 5ELIA 3L4VA 4NIDA 3LH2L 1SBDA 3U11A 1HHKB 3V8CA 2NR6D 5BRZE 3HKEB 4KQ4L 1B0IA 1LNSA 1RZ7L 3QJOA 1XILA 2QMKA 3WVJA 1VQ4V 3GYDA 4X20B 1WISA 3H3LA 1T2QL 2AQQA 5E2UH 4B9GA 1N4CA 2X2IA 4QLRA 4HHGA 5FGBC 1PM4A 1RUI2 2MQGA 5AB2A 3P6BA 4LK6A 4HIHB 2ZXAA 2NUPA 1HTYA 3QJSB 3QDJB 4Y33A 3VBUC 1JMKC 4QQHA 5FREA 5IKCB 1F23A 4H2AA 4L1LA 5T3XL 1MZ6A 3OG4B 4QGPA 4U3FH 1ACZA 4A1RA 1RZ8B 2NLJC 4RFEB 4NPKA 1TAEA 1T7WA 3B9KB 4OQ1A 1BZKA 4HZ1A 3I2JA 5DK0B 3ARDC 5FYLE 1HIML 1Z32X 3CDCA 2DFCA 3K6OA 4QJ4B 4GZ9A 5ITFA 2XL9A 3ZXEA 3RTLA 4JTAB 5I1KL 1G5GA 3S7EA 5L0QB 1HNYA 4LCIL 1QLNA 3ABMB 2IH3B 4ZMXA 1T5KA 3L9RB 5IQNA 1BAFH 4N0FA 1G7LA 2D7MA 4X66O 1R0AL 15C8L 1XR9A 4LGRB 1AYM1 3VRJB 1IBKO 4ICGA 5C0FB 1XNAA 3KPRB 4YXWG 3H8NA 3O2DA 3GWJA 5EV7A 5DF0A 1DANU 1FL5B 1U2CA 5F0JB 5FA4A 5DD0L 1RUF3 4ZBJA 3RA7H 1S7XB 1N2RB 3P3SA 3NDYE 3DPRA 2VN6A 2YKLL 3H1ZA 1US3A 2XUEA 2BP8A 3S37L 4KQ4H 1BAFL 4HQQL 5DMKB 5HY9A 7TAAA 2LS6A 3TCUA 4K0KB 2ZCKH 5C6TH 1KNOA 4I48A 1NFAA 2XVGA 4M62H 4FCHA 4H8WH 4NKQB 4A7VA 1NFDF 3RRDA 1RGSA 2VC9A 2ZE8A 1T5XA 3QDME 1LWRA 2W65A 4CH5A 3VXQB 1F4XL 1L9TA 3ULUD 4KGJA 3ULVE 1SEQH 5JR1L 5EEXA 5A2LH 2X0LA 2XWJB 1ZLVH 1HNZO 5FF6A 4FFFA 4O9EA 2Q7NA 1PY4A 4E9XA 3T3MB 4JHBA 4TQIA 3DC5A 1VF6C 3RWEA 2V3FA 2ZCHL 3STLB 1F9KA 2G9GA 5FYBA 5LQBL 4UVCA 4DQOH 2F19L 4CVWA 1J48A 3BLKA 3GXDA 4EKJA 2WC7A 1EZVY 2H32B 2R8SH 1RUI1 1BVNP 2RJMA 3CFBB 1AVAA 3HPLA 2YSSB 4Z23A 1SEBA 2R0ZL 4DUXA 3AEIA 3U9PL 1E5BA 4FXGC 3MOQA 1U8MA 5CJ5A 3P30H 1KLGB 1INDL 1EFXB 1JPSH 2GTWB 2F4LA 4RS5C 2VQ1A 15C8H 5DDHB 5EEYA 4BSJA 4ODUA 1QFUL 1V6OA 3ET9F 2I9LA 2DYPB 2VN3A 1W8OA 3MNDA 3Q9QA 5F7AA 3RJOA 3DO7A 3OBAA 4O4YH 5AC91 3WS3B 1CICA 5JQ6L 4Q8LA 2Z35A 3ILPA 3TT3H 1LP9F 2WNEA 4CC5A 1TNRA 3EQEA 3AADB 3HVNA 3QZPA 4IOSD 4IOIB 4V1DD 3S37H 1RSFA 1DLCA 2E27H 4DGYL 1AR71 1ZSDA 5JZ7D 2CUGA 5B66Z 4LLVA 3OXRA 1O5LA 5GONA 4K3HA 2FDKA 2EBOA 1NUFA 4WI6A 2OT5A 4Y9EA 5F1OB 2DWDB 1S0JA 1OD5A 3BPSA 5F7HA 3GBFA 3J8F2 4ZU4A 2VAAA 2R9IA 2XOTA 1QHTA 4HKXB 4OB5L 1U8CB 3UOAB 4M5SA 5JZGB 4ZD3L 1IBLB 1DVFC 2H8PB 4LF9O 2ZKYA 3FBQA 1A0QL 3FW6A 4PJDB 1TJMA 1SJXA 5DHDA 4FABL 2LQTA 2YAMA 1A6WL 5C0GB 4L8SC 2DWEA 3VRLE 4FMKA 1YYCA 2P1BA 3CHQA 1DJXA 2Y24A 4NC2B 3TJEL 3HC3H 2OA9A 1JZFA 3EJTA 3MX0B 5TH2B 1KULA 1U9KA 4BSVA 1XPWA 3N9QA 4YW2A 1L6XA 1T21B 2YIBA 1C5DB 3QZWB 4OT1L 1LOFC 4RN5A 3QYMA 1P0SE 3EO0B 4K2UL 4MZ2A 4WM7B 4Q4Y3 3ZXJA 4WWID 1PO11 5A3LA 4L18A 1WCUA 4D69A 1U8NB 5J12C 1CE6A 3IWZA 4ZW5A 1YEJL 1EJ6A 1MQ8A 1YNKH 3F5WB 3CCHA 1HYRC 1UXWA 2VLJA 3FU5A 3ASOB 3TN91 3RVUC 4G5AA 2UUCB 1CZ8H 1HILB 3BSHA 3EUDA 4NRYA 3VXMA 2QTWB 5FWJA 1GZWA 1NR7A 4LP4A 4A3ZA 3V0AB 4FXKC 4AHCA 4BPZA 5L3BA 4HN1A 4CEYB 2HRHA 3GMOA 3L2YA 1HC1A 1WGVA 2ENRA 4PF1A 1JTOA 25C8L 4N8CH 2D7TL 4P9WA 3L4TA 4OFYD 2GPZA 5KTEL 1RUG2 5DJ8A 3AU1B 3QCVH 4BD4A 3LDRA 5JPNA 4AC4A 4EROA 5HHOD 5EWIL 5FPAA 2BRRL 1KEGL 5DXDA 2H3XC 1CPUA 1T7VA 2DTMH 4Z5RB 3IJEB 1VJ2A 4BR6A 1K5WA 3BOPA 3TBVB 3QQ9D 1SDAB 3QDHA 4IGBD 5JHDE 1K3EA 5IR1A 1AOHA 2QQNA 1KRIA 2QPDB 3H2QA 3LD8B 3M1BA 2NY6D 3ZRWB 3O0RH 4LEOB 5KSAB 3RUGA 4HDIA 3GZAA 4N2NA 3ZFEA 1AKPA 2HLDG 4HJSA 2VCCA 5K39B 3MRGA 3WMPA 4AMKH 3KGSA 5DEGB 5HHOB 4D8PA 3D2UD 3KXFD 4ZAKC 4L4TB 4Z3EA 1AJPA 4NKIH 2IXCA 2OP4L 1Z0MA 1MACA 4JREB 5FYUA 4G72B 3E22A 1T5EA 1LVEA 3MRIA 4KJYA 2B14A 2VDRL 5CO1A 2E7LA 4BCUA 4Y4KD 1EAH3 3QORC 1AXSA 2Q0AA 3VBRC 2LOEA 4EUPH 1EHNA 3TBCA 2ZE7A 5CN3A 1HWHB 2X3AA 1O6VA 3VXMD 4LB8A 4QX5A 1CXFA 3NJKA 1WA2X 3OKEB 3UO1L 5HYEA 4PJAE 3QNZB 1AZRA 2YPDA 4F8OA 4NX0A 1AHSA 3T71A 2VZ1A 2HEVF 1U3JA 2WJSA 4AQYO 2J56A 1ILUA 2NNAB 2VOTA 4C56D 1OM3L 3TEUA 5IEKB 1W3VA 2VCMA 1EO8L 1CJDA 1FZOA 5IESH 3TO4C 4O4IB 4R7XA 4UYPA 4GFTB 1G94A 3WG7C 2XYCA 3H9HB 3P4OA 4IKLA 3GSNA 4DKEH 1H6EA 4MS8D 3BKJL 3CZUA 4B9YA 5BV7B 4RHV2 5SV8A 4CVZB 3DVGB 3U83A 1WZXA 2GMPA 2XXMB 2VMIA 2XWZA 2YC1A 3H2PA 3W58A 4LK4A 3SN6N 3FCTA 5J6HA 2N4IA 4JHWH 4JFYA 2W1NA 3JAWB 2IO5A 2AK4D 1JA8A 1BIIB 3CVHL 4X88A 4R5TA 2AYHA 1OAZL 4MCYB 2XXZA 2NUTB 4C0HA 1UXSA 2G3ZA 1GNHA 1MN4A 1RQ5A 5DHYA 1FYHB 4IMKC 2G5BB 4L3CB 5DK0A 2RNBA 1QLRB 3C08H 4LCCA 4LLYA 5A6XA 2BOBB 1H9VA 3KLLA 5DVMA 4JYAB 3MCLL 3PNAA 4MVTA 5L7OC 2FNBA 2R071 1UWWA 1LEMA 3IB3A 4CDQC 2CO6A 4ZOBA 2O5ZL 3L74H 1HI6B 4MB1A 5DQ9B 1EZLA 5JO5B 4KNSA 4FFTA 4KGLA 4R3SA 3L4WA 5AB9A 5HHQB 1X5IA 4RAIA 4HIEA 4JFXB 4CXXA 3DURB 4KMTL 3UJTL 3K2IA 2HT3C 5EIBD 4YL4A 1Q86W 3CCVV 1ZE3C 2IG2H 1IM9D 4Z3IA 4TNFA 3VXRE 2FB5A 4G9FD 2VDPL 4AM0A 1A22B 2AV1A 3TV3L 4WTXA 3X1BA 2DD8H 4FM0A 1LUWA 5E08L 2YAPA 4J39A 4AI1A 2DWEC 1H8EG 1XQNA 3HLKA 1RUF2 1YPZE 2R1XA 1UWFA 3CU7A 1CYWA 2FQGA 4GUPA 4OZFG 3AZUA 5GS0C 2DF3A 1FJGO 1BLIA 4DEWA 4XBPA 1O3SA 3CK0L 4N2HA 3V0GA 2F54A 4WTZG 2HJIA 2YMZA 3ZKYA 4JGJA 4AXOA 3O1MA 3QAQA 4OCMC 4Z7VF 2A9MH 2B15A 4Q0VA 1GCYA 2EC8A 5BPPA 4RA3A 4HMZA 3TB0A 3WO3B 3WLUA 4O5LH 2DD8L 2KDGA 3CDYA 3B8SA 3H56A 3LKOB 1ACCA 4JFTA 2XN0A 4WHYG 4ZQTA 5L2KB 3MLRL 1IAOA 4QHMB 4YXLL 1U5IA 3UKNA 3WQ7A 1BMZA 2KD7A 1EUUA 5HDLA 5L36A 4YIQB 2VLRA 3UT5A 1I8KB 1MCDA 2CMRH 5LXTB 2Q0ZX 5JPNC 4UF0A 3QUYB 3ILFA 1ZV2A 2HLFC 2OTWA 2YRLA 3KJ4B 5SWQB 5G5DA 3HQUA 3U07A 2EDRA 5CFCB 2CTVA 3IM0A 2RH0A 2OSWA 1AR72 3B9VA 5JTWA 5EORL 1D2QA 1GWKA 2O5ZH 1SPDA 1JV5A 4IDJH 4PRPD 4LP5A 3ZYGA 4EB6B 1MREH 4YFLF