3RFRA

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
386
structure length
386
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMILSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLENYGISRIYAWHLPWLAVGAAWILFWFIRKGIIASYVRVAEGRPDDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKEQVTTELNGGVYKVPGRELTINVKVKNGTSQPVRLGEYTAAGLRFLNPTVFTQKPDFPDYLLADRGLSNDDVIAPGESKEIVVKIQDARWDIERLSDLAYDTDSQVGGLLFFFTPDGKRFAAEIGGPVIPKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
total genus 93
structure length 386
sequence length 386
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rfrA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rfrA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rfrA01
4PI0A 4PI2A 4PHZA 3CHXA 1YEWA 3RFRA 3RGBA 4O65A
chains in the Genus database with same CATH superfamily
4GKOA 2ZKOA 4JGSA 5IQNA 1M1KW 1IL1B 4YZWA 1XPWA 4DP6X 2OTUA 3T0WA 3MV8A 3E8UL 1MVUB 3PDQA 2BWCA 1G7PB 3HG1D 4AK3A 3BWAB 2NNFA 1AZCA 2AI0L 4KQ4H 4ODUB 5D2LE 5DG1A 3QHTC 3V6OE 1A7BA 3WEZA 3O9OA 4W4KA 3C5XA 2HX8A 3HE6D 4PA6A 3MV9E 5EIQA 4RS5B 3CDYA 5IOPA 4N2MA 1DZQA 2XG4B 1G1CA 4FYQA 2VXTL 1JH5A 3VNYA 3VFNA 4KXRA 3J7NA 4J6RH 4PRIB 3WFEL 2FDHA 1NFIA 1UEMA 3I56V 2C1PB 2J21A 1TSHA 3B7UX 4MCYA 4BFOA 1K2DA 2DTYA 1R1CA 5A32B 1RJ7A 5CIPH 2KB1A 4G7YH 5CKMA 2GSMB 1ZIBA 3V0VA 3BRGC 4PCRA 1THAA 4XOGA 4KKBD 3CQOA 4I89A 3IDAA 4XMTA 2AGAA 1DQQA 5HBAA 5CGYC 1RIUH 3VB9A 3CFMA 5LBEA 3GRWA 5HHNB 1HI6B 5KSBE 4O4HA 4HUVB 4BQCA 3GB7C 2AVFA 2VH5H 3O9WB 3KR3H 1O4YA 3ROOA 3GI9H 1AI6A 4MD5A 1WAZA 1VF7A 2AMGA 2WBWB 4K2UL 1RFYA 4ZUWB 5GS0D 1NVPD 3J9SA 3GM8A 5BS0B 2UYBA 1NBVL 3ARBD 3SE4A 5E9AA 3TJHC 4KMLB 4DVRL 1COV3 1EAH1 4KK9C 1KKCA 1TU2B 5I8CB 1BIHA 1MHHB 3D52A 4XMXA 1VA9A 5ANMB 2LS6A 4YVWB 1V3MA 3G6AA 4LCYB 4NBYB 1ZWIB 4QOKB 4NXNO 1S5HA 4LK6A 2WZ0A 1RQ5A 4Y9CA 4B3MB 4HXBL 5IT9N 3I9GL 4Z78B 4EQVA 5GRXG 4MJJA 5AB2A 3RZLA 4JHAL 4JHWH 4M6ML 4PJ7A 2JXAA 5DAPA 1UD6A 4XRCA 2B1IA 5DRWB 4IU2B 4ZFOB 4Q56A 3GSUB 3OJMB 4H25A 4I88A 5IB5B 4K9EC 2VLJB 3MZHA 2DPKA 4PF1A 2R0WL 2VZSA 5CVRA 1TQBC 2M83A 1TMF3 3BFRA 1GN6A 2ORZA 3KLAA 4ZS3A 1MVQA 4PY7B 4YM1A 3PVEA 5JCOC 2Y06L 5D6CB 3RDTC 5IFAH 2FCBA 5MEOA 3RZCD 3RWHB 5B1BB 3B37A 3D4GA 3V0HA 2HB0A 3OGCB 4PBDA 4JDTL 5LCVA 2G60L 3BOPA 1LK3L 3ZHFA 2XTSA 1ZX5A 3SMHA 4YR6B 3MOQA 4LVHB 4FVVA 4Q8KA 4DVBB 3EBAA 1KN4L 1OLLA 1XAUA 3HI1B 3J27A 3BN9C 4AGRA 3QI9C 4U6VL 3SGKC 3VFGL 3WNNA 4PS8A 2BIPA 4Z3FA 3MUGB 1LHNA 1AI7A 3N7JA 4WFGD 3VD7A 2A0LA 1L7IL 4N43A 4E4DX 2HT2C 4LEOB 3K3WA 1RZIA 4BGDA 2CR6A 1F8TL 4J4PA 3QC6X 4JK0D 4M03A 3H6JA 2W87A 1AGEA 3OFNG 4FJCC 4M02A 1BQHG 1LGCA 1RZ7H 2F15A 4L2YA 1II4E 2TRHA 4M4RB 1LJ7A 2COQA 3BZFB 4POZD 1R1A2 1M3IA 5FYJH 2UWEF 1JERA 3VD4A 2WWOA 1TMF1 1KCVH 4PS4L 4KHPB 2YLHA 1JWSB 3FTYA 3HBPA 2Y0PA 3JV6B 4MGQA 1MS1A 3VXOA 1UM6H 1G6RA 3AP7A 2ETEA 4KY1L 1JJ2U 1MFMA 5IQLA 1OJHA 1NLDL 1YEEH 2DBLL 3CCRV 3VWJB 1AGFB 1YEGL 4AEDA 1E28A 3BPNB 3EYQD 4HP5A 4XP4H 3SO3C 5JDJA 3QJUB 4E2QA 3JAMN 2Y3NA 4JKLA 5JUVA 2OMVA 1EEYA 4PW4A 5IJBC 4OH2A 1FWXA 3E89A 2A99A 3P73B 4WEEA 3AY2A 1VAMA 1KBWA 2XHKA 3NV3A 4GJYA 1HHHB 2AV7B 5IBUG 3SH4A 2VDKL 2ZCHH 2KPWA 5GSRA 4S0TD 1YCIA 2HCZX 2QR0A 3GFUA 4LSRL 4Q0XL 2K3TA 4APQC 4XDLA 4BGLA 1LTEA 4LBEC 4YHIA 1OKOA 4YDZA 2WO4A 2XKPA 5LXTA 1FNSH 3VXME 5IF0A 1BJ1H 3NVQA 1JBJA 2VS0A 3J7AU 3AWFA 4NRMA 1KB9K 1NZIA 4CXYA 2N7AA 3PV7A 4GAAA 1GIGH 1NCDH 1G4RA 1WAAE 1XNRO 2PP8A 3B1TA 1VBE2 4JGZB 5B39G 2YGPA 3L3IB 4COUA 2FJGB 4AQ1C 4UFIA 3BVVA 4MXWB 1DDHB 1U93B 4UXNA 4AMKH 2WYIA 2XWDA 2ZCWA 3KPNA 3MACL 5E16A 4OPAA 2E5LO 1AQKL 2XT1B 4JHUA 2D3JA 4HS8H 4PGEA 5A6IA 3OGVA 3UJQA 4K55A 2JDPA 2A74B 2GHWB 4JFEA 4NN5C 4YHOH 5A3TA 4P59H 1AQHA 1N5AA 5KS9A 4CUCA 3CHRA 4X6QB 4A67A 2UUAB 1WA1X 1YNLL 3TV3L 4PJ6A 1RVF2 1HCVA 4O4YL 3KYMA 1FL3B 2XBZA 2P48B 3NFNB 3IFPA 5JORB 1U8MA 1ZLSH 3K2MC 4J12A 4CYDA 1K9TA 2OZ4A 3JSLA 1QHOA 3N2JA 1CQYA 5JW5A 1U8OA 2KMWA 2FIKA 5IK3A 1M93A 3Q7JA 4Y1YA 1AXIB 2NR6A 5A2JH 2H8PC 4QRFA 3G08A 4KKCC 4BIZA 3GMLA 4ORGB 1T0NA 4R7NA 5AW1B 5F0JB 4PLMA 4CGUB 2WBKA 4JPKH 1T1WB 2PF4E 2X4OB 4G83A 2D7QA 1J0KA 3BW9A 3TX4A 4KZEH 2WO7A 4LF5O 1BQLH 3HHSA 3VD1A 2DEXX 3HS9A 1WIUA 3JV0A 4LHUB 2A3XA 4JN1H 1KGYA 3I50H 1WCSA 3PGFL 2Z3YA 5K9QI 1FMD3 4Q4X1 1SHMA 4PA9A 1CFVH 3KBPA 3LH9A 2XUEA 5L7OC 4BAYA 3BSZA 3CLEH 1B88A 3L8QA 1G1OA 4OU3A 4Y5VC 3THDA 4M56A 4B8EA 5I82A 3QJQB 1SA0A 4NJ4A 1FNLA 3ZJAA 1I7TB 5EO9B 5DJXA 3DJTA 2Y69B 1G7LB 3JU9A 1EBPA 5E5MA 1VB2A 2IQAB 2GJZB 3WXWL 4U3JB 1JRHI 2KI6A 1QTYT 3PGCA 3RTQB 1E1QG 2YUVA 4HUMB 4QXBA 4E27A 1AO7E 4LLAA 1J5EB 4WVMA 3IDYB 3X1BA 1JGEA 4N8UA 4JZ2A 1P49A 1KJRA 1MELA 4I77H 4OKVB 3T8XB 3WGVB 1ACCA 5GRJH 5CBAA 1U0QA 3O6FA 4NJAL 3AZXA 2O6PA 5ABJC 3I2IA 4O7XA 1QGLA 2VDLL 3EH2A 2ZOEB 4JFZL 5T3XE 4BINA 5F3BB 4ISVB 1T1ZA 5IHHA 2CO6A 43C9B 4F2EA 4RN5A 1PX4A 3IDJA 4PH8A 5C4WA 2EF6A 5I5RA 5JOFB 1YEFL 1FN4A 3VFUB 3PWVB 4A7TA 1UVQA 4DP1X 4NQTA 3D7PA 4AVHA 5KMGB 2WSVA 1OH4A 2X7LA 1CL7I 1CAVA 3E5QA 2DW4A 1A2YA 4TZDA 5H2BA 1DUZA 4XABA 2EULA 3VGHA 3Q9PA 1ZE3C 2ZTNA 1TJIH 1H3XA 4WUUA 3RWFB 1IS5A 1S0CA 3IC7A 4QE9A 1OSZB 3DX6B 4YW4A 3HE7B 2WN3A 2AQQA 2QMJA 5SWSA 2ISDA 3T4YA 2IUWA 3DC5A 1VP7A 2BFUL 2J8UF 3WG4A 2IOOA 2CDPA 1U5XA 2A6XA 1Z3GH 3BVTA 3VI4B 2FBEA 4QHKJ 4HDIB 3KS0H 2H3XC 2FHCA 1GA2A 1R0AL 1GKFA 2FJSA 3T2NL 1VF6C 3ULVL 2DUPA 1JZ4A 4DRXB 2OP4L 5EJ1B 4ABQA 3GKZA 5I6XC 1UB5B 2X4SA 3BD4A 2B7DT 2ZGTA 1FAIH 2ZE0A 4P02B 4LLUB 1F35A 4N2BA 1W28A 4Q4W3 5F9OL 1NGQH 4WU5B 3VV1A 4TXVB 2TSBA 4LU5L 4HCRH 4OB5H 4NQDE 4Y9EA 4GSUA 1ZTMA 1KGUA 2BVEA 5T1KB 5DVNA 4LC1A 2XR4A 4HKLA 4Q20A 5IQMA 1XD1A 2N74A 4NNYA 5E1AB 4GRLC 1WD3A 3DKQA 1H6FA 1DF0A 4GCZA 3C09C 1AXSA 4LGPB 5C0ND 4NWUH 4X88A 2RQ6A 1UZ8A 3REWA 4HLJA 4AVCA 1NT2B 2LU4A 1IIIA 3DV6A 1CAXA 2Y25A 3STLC 5HHPB 3DBXA 1BX2B 1MWAB 1RZKL 1RK1B 2IF7A 2K6WA 4QF1A 1IAOA 4FI7A 5E6ID 4QY8A 3EJZC 1UXWB 2PQQA 4AIXA 4PRID 1KFAL 1N1TA 3LOIA 3AWGA 4ZBMA 5EEYA 4MDIA 2JE9A 4FJYA 1WBYA 4AI9A 4OZIA 4GFXA 2QVMA 3E86A 2F54B 4IJTA 1INQB 3GIVB 5FS5A 3AJYA 1WCUA 4X20B 4BFIB 1P53A 1CVNA 3FCGA 5J98B 4Q4W1 4BBWA 1T66D 3DVNB 3KYAA 3BHPA 4QIWF 1KYFA 2A6JA 2XKSA 3HPJA 4U1NB 3OGGA 2WNXA 3VMPA 3DROA 5T1MB 3WDJA 4FCAA 4CDQA 5FXCH 3CMGA 4O2BA 3CZKA 3NUKA 2HEWF 1BQHB 3VXRA 1NPJA 3IJ7A 2A6IB 4YO0B 5LCWL 1OD9A 2YGNA 2CO2A 2LV4A 3OE7G 2PPCA 3FFDA 2DTMH 4PJXF 4BZ1A 5IK5A 3H8OA 3C8XA 3MO1B 4CADA 3MYZA 3H3PH 1ZM1A 4EIBA 3WG3A 1YYLH 2DQDL 3U46A 2ZAIA 1MDAA 2HN7B 2CM6A 4KK6D 5J6HB 1T5WB 5E9DE 3VWKA 3MRLA 5C08A 1YI2V 3IS1X 1LOCA 3EXUA 3AQZA 4DXTA 1NR1A 4PRPB 1X6LA 4TLUA 3HB3D 3VN4A 1U95A 3EFFB 4HOZA 4FLXA 1ZHKB 2K78A 4W9DC 4PWIA 4HYOA 2ERJC 4MNHB 5A80A 4O9HH 4HUNB 2LJ2A 5DYFA 2P3YA 4G43A 2VLJD 4S1RH 5IBUB 1MCBA 1AXZA 2NT1A 2W95A 1GP4A 3WQ0A 3ZFEB 5KVGL 2YQ3A 4HIHB 3T1CA 5AQ0A 5HHXL 1EXHA 4FOWA 2G9FA 3SPCA 3OD4A 1PGW2 2QQJA 2LTQB 4YL4A 4LBJA 3MCYA 3X3GH 4XP9H 2QKIB 4YHZH 5L6YL 1BBT2 3LQZA 3B2XA 1D5IH 5C5UA 5EF1A 1S7VA 3ZRFC 5B39B 2R0ZL 2ZKHL 4X9QA 4WWKC 5A7WA 2FT6A 3U1SH 1F7YA 4JI4B 5EZOL 3LF7A 4XHXA 4G2AA 1SHWA 2GCYA 5IQ7H 1MCEA 4L8CA 3PYCA 4ZHQB 4HSQA 1AZDA 3WFZA 1OF2B 1OSEA 1PD1A 4N0UB 2WIIA 4X6BA 2NSMA 3MRDA 3BGAA 3MW2A 1WT5C 2R063 1XWVA 1UM5H 1TVKA 1HU8A 3ZDYF 4COWA 1NWPA 1H3PH 2R1DA 1ZAGA 2EBOA 2IPTL 4GEJA 5DAXA 2CKBL 2FEEI 1UW8A 1NLQA 1SLBA 1DBJH 2ZIMA 3RYRA 5C5TA 1IGJA 3IGAA 1I7ZA 2UZIH 1A6WL 4YDNA 1UKSA 2XDVA 5CBLA 2Y7MA 3PU3A 3S34L 4PWEA 1YTFB 5I8EB 1I5XA 1JOIA 1PFOA 4KO6A 4Y5SA 3FHAA 4YY3B 4HPOH 3PIQB 3WGUB 1OH3A 4TQ8A 1CFTB 5FQ0B 3CHXA 4MZIA 2NZIA 5GALA 2YAMA 1Q94A 3BZ4B 4HGWB 4AIZB 1IBMB 4PJ5B 1RAMA 4BFRA 5AC92 2BHZA 4I55B 2UWEB 1PO22 3FO1B 3HVDA 1TXKA 3MVSA 4GBXA 1CFQB 1FIGH 1SXBA 4KZCA 2X6VA 1ACZA 5T5JA 1K33A 2X2HA 1T5XB 1OD5A 4L2NA 3C6LD 3IN0A 3MV7B 3T8MA 1MHCB 5LDSA 1DBMH 2MQ0A 2W07A 1RUG3 2R061 3WTVA 4XH2B 1IS4A 4DR6B 3GGWB 3HRZC 3N1QC 1R6KA 4KK8C 2APWA 5AVVB 2W65B 4AV4A 1ULCA 2F43G 2APXA 2JCCF 2RTTA 3Q5TA 2Z34A 1G7HB 1RSOB 4NQSB 3VD3A 2VR8A 4R96A 4E9TA 5LAXB 4QB2A 3DBSA 3V95A 5KSVB 3EB7A 5KBPA 3O81A 3NFSH 5EZLA 4UF0B 4BWUA 4MDJA 1D7CA 1E4HA 3JYBA 1CGYA 4XBPB 3FSZA 1W91A 4K07A 5DFTA 3B9CA 4D3CL 1KMIZ 5AVUB 2IADB 3DUUA 1E2VA 1SNRA 1MJUH 3NT0A 4NRYA 4PWHA 1UAIA 3N40P 1NC2B 3BCDA 4L3FA 1DQLH 4MA8H 5DZOA 2Z42A 1N0XL 2VISB 2R4SH 2GMMA 1A4CA 4JI7B 3QDMD 3MLZL 5E8OA 1E4WH 1ULOA 4HF5L 4CDHA 4OLXL 3N9QA 1MIMH 1IQWH 1HP8A 3MRHA 1ORQC 1NGPH 1EUTA 4QGPA 2N04A 1S4IA 1U8QA 3PG2A 3U0PA 2FMYA 4J7RA 4ES8A 2IJJA 3VFOA 4ACTA 4W4NA 4OCSL 4RH4A 5KYNA 3JCUZ 3K5LA 3PCYA 1KECA 2FTKA 1WBZA 3ZVVA 3WI9A 2JDIG 4LLYB 3UYRL 2YROA 3HKDA 1SQXH 3CU1A 5GGTL 3S36L 1X5XA 2CUGA 2UWBA 1IBDA 5IHLB 4YSOA 1LO5A 3JCIA 4O4JA 2ZCKL 4L3EA 1TQBB 3LTVA 1DDTA 5FHAH 3QEHA 4XP1L 2X4RA 1PL3A 1VFUA 2HZHA 2UZYA 2YAEA 3RB7A 4P9LA 5GRZA 4MAYA 4XN4A 4RFEB 2JK5A 2XZAL 3B40A 5GHWL 3RDTB 4YX2H 3BP4B 1XHZA 1SLTA 4CC5A 2WO2B 4PJ8C 3JD4A 2ROXA 1S1AA 1VP6A 2YGMA 3DECA 3QJSB 4LRNL 2DMCA 4OCWH 1YLLA 5IQ9A 3ZOAA 2HMIC 1URLA 3QI9B 2XL9A 4U3FH 1EDQA 3MIHA 4JV5O 3NV1A 4GXVH 4CU8A 5EHFA 3QW9A 5GZFA 5JHDA 3KVPA 3RMYA 5E2UH 3B2VL 4DN3L 1BMV2 2YXWA 1FFPB 1D5ZB 1R5IB 1W6MA 3LQCA 3VCLA 4HHAA 4RGOH 3ROLA 3DXAB 1PVC3 4QT5B 1SHXA 1JZ5A 2GC0A 4XHQA 1VADB 5IWLA 3VD5A 1W2BU 4LFHG 4JDMA 1VBB1 4DUZO 2WBXA 2CU9A 3DHMA 2OMXA 4Y1AA 3SKUD 5BMFL 3TFBA 1G7YA 3NL1A 4NUJA 1P7GA 4KBPA 3BWUC 3ZJZA 3GLAA 4PR5B 5DK0B 3ZGHA 4GKJB 2VKXA 4GAJL 5C0RL 2VZ1A 2ERFA 3UTSA 1ACYH 2NY1D 1EHNA 3GCXA 4ZMTA 2ATAA 1AL23 4J3BA 4N25A 1TCMA 3SO3B 1WW4A 2EXKA 1ZA6A 1XQNA 4KGGA 3B77A 5ABJB 2NYKA 1P1ZB 1M71A 5FO2A 1VMJA 1TA8A 1SJVA 1E9QA 4N1HB 4HWBA 4LCWA 1PLGL 1Q82W 1T2XA 1URIA 1ZV5A 4APQB 4P23D 2MTPA 5E8DH 5EWIL 2CBPA 1OARH 4LBEB 1DQDL 3CCLV 4K5PA 1JHTB 3MLRH 1JYWA 1G6UA 5JAXA 1FAFA 2RALA 4E42B 3L7EB 7TAAA 2GSIA 1U3HC 3N9MA 3G6DL 2CNYA 3MSPA 2AQ1A 3JTTB 3D33A 3QJZA 4PTUB 1JF1B 4NQEA 4XBGB 3KKYA 4Z7OF 4Z77A 1S78C 1DN0B 2YBPA 1I1EA 3HPLC 1OGAB 4O02A 1K8IA 2XSKA 3II1A 4R9DA 1OB1B 1TLMA 2CQVA 2CGPA 1AL21 1PNKA 5C0IB 1UY2A 1ZA4A 3NV4A 3GRWH 3B5TA 1NBYB 1QPXA 5JNYB 3GYRA 2A6VA 2GHZA 5DJ6B 4F7MA 1PIV3 2KC0A 2NY3C 5JHLH 4NN5B 3ZXGA 5HI3C 2X5PA 3HZMB 5E6UB 4UM8A 4TUUA 1AD9A 1HWWA 4CJ0A 4ODTH 2XL7A 2QQQA 2P67A 4LCCC 1HB3A 2CBMA 5IT2L 1MFBH 3U1XA 1KIUA 2LR4A 2KUTA 3NA4A 1NGZB 3GMOB 1SUJA 2ZE6A 1T20A 2CIKB 1SZTA 4V11A 3KPPA 3Q06A 3U07A 3P4LA 2ZE5A 5C86A 2FBOJ 1RK0A 3VDBA 2N3JA 3SDYH 2QGNA 5FFLA 1JTOA 5J3HD 1YO4A 1JGDA 2H8PB 3QIBA 3CCSV 1I8LA 4KL1A 2Q2LA 3SXWA 3US1A 4XP6H 5INCB 5KTEH 1XMOO 1U21A 3GMMB 1DLFL 5GGSB 2AABL 3F6LA 3RVUC 4EN8B 1XGYH 1A7RL 1HXYB 1V9PA 2EYTB 4QEGA 3T3PF 3OUFA 1J8HB 2YD5A 4ZPVA 5C0EB 3OUSA 1OCOC 1IS6A 2ZSVB 2HWF2 5J2UB 4WFHA 1BHBA 2ZF8A 1SF9A 3G5WA 5T3ZE 1M05B 4ZFZB 4FNPA 4CMMA 1MRFL 3UC0H 2CKBA 3BIKB 4Y4HA 3UBGA 3VTAA 4P46A 2OIEA 3GD1C 1UXSA 4XJAA 5L7OB 3GXTA 1OVSA 1DFBL 4Y5VB 4EZHA 4Y4RA 1C5DB 1X8MA 1WCBB 4PDRA 3BWUF 4HEPG 1QDOA 4MJIA 3TCUA 4X65B 1AE6L 5F3HA 1FHGA 4Q1RA 1JV2A 2ZM6B 1KYOJ 1FX5A 2RCVA 4RRPG 4JM0A 5IMOB 3ZDSA 1M9SA 4NZJA 1KXGA 3GNEA 2ATPA 4WJ5A 2DVDA 2FTAA 3M1CA 1I53A 1S7WA 3V52L 1ULDA 3AZZA 1A0QH 4F8NA 4G6AD 4NFDA 3NRFA 4JJ5A 4PJ7E 1W0JG 3PF2A 2OR7A 4DPRA 3DGDA 3AAZA 2ENRA 5I74C 3VMOA 1ENQA 2VXQA 1EV13 2AR6A 1O59A 1V7NH 4PJXB 3WQBA 2KQNA 3PJSA 4D8MA 1DO6A 1JNHA 1O9GA 1CGSL 3WN5A 4META 2Y0SA 4F8AA 1N0NA 3DETD 4X4ME 5BVJB 1WS8A 1W6OB 1P4UA 4XN8A 1HNXO 5I0DA 1ND3C 3MXWL 4DZ8B 3EYUL 5L2JA 3Q3GA 3IAPA 1G6RH 1GNZA 3GBMH 4MMZC 2Z7UA 4Y1UA 3UKVA 4CPBD 3BVNA 3GTTA 4GO9A 5E70A 2X70B 1JZGA 4UT7H 4YUEL 1QH7A 1F2XK 4OV5A 3T65B 3L4UA 2RM21 3QZBA 3HLAA 4LFAO 1BEYH 5I1GH 3K91A 3F6JA 4P2AA 4HW6A 5FW8A 5MP6H 3DA0A 2JGDB 1NGXA 1U8HA 5C0AA 5JHBA 2UUCB 3H55A 1WUNT 2XAHA 4YXWG 2YEZA 2Z1KA 3IMRA 5FY5A 5DO2C 2GC7C 4X5WA 2OTJV 1X4YA 4OD3H 3CS5A 3QIWD 4FLUA 4LZKA 1QSFB 2LQTA 5CR1A 3U4SA 4TSCL 1EV11 4BZ4A 2DKMA 3HC0B 3BYTA 3EZ8A 1YMMD 5KSAA 4AK1A 1FT9A 5I6XB 4HAFA 1QNMA 2ZXDA 1MXDA 2CHXA 4YH6A 1XNQO 5D5PA 1FL6A 3ZTDC 1W9WA 3GF6A 1E8YA 1H8LA 3AXIA 4P99A 3NABL 3CWBH 4AITA 3N91A 4JB9L 4F7CA 4ZI8A 1W3VA 1OWWA 4HIJA 4H1LH 1MJ8H 3UPAA 3M1HA 1B6DA 1YN7A 2ZICA 1U4EA 3UPRB 1E3FA 1N47A 3BH8A 3IEAA 1YTFD 4CKQA 3THCA 1NKDA 4DW0A 3CBJB 1JPGB 1JVKA 1AC0A 2Z79A 3OD0A 4LBQB 4GRLB 3ZDYB 3DIDA 5DA0B 3UGEA 4PIYA 4G6FD 4AI7A 4D9RE 2XOMA 3C09B 4QPWA 5I18L 1OQDA 3ZXLA 1R75A 2QQNL 5C33A 4BMEA 2ARHA 4PJ5D 2C34A 2D3PA 5I15H 3B7YA 4S1DC 1B0IA 3L81A 4G8IB 1NFDE 3R19A 4YSSA 2E31A 2FDJA 5DRNA 5F9JB 3ATEA 5ID1B 2ZWYA 4Y5Z0 3V0AA 3STLB 2ICWB 3CZUB 1MIEH 3CSTA 3LPGA 3MRIA 5BRZE 1PIGA 3ZHVA 2OZ4H 4XDJA 4IT5A 2P80A 4PWKA 4X6DA 3ZTNH 4A7UA 4JFPA 1EY2A 3MRGB 4LF3A 3BESR 5I1EL 4QR7A 4NNXA 5DI8A 4H7MA 2WUHA 1QKZH 4PG9B 1CJYA 4LLMA 3EDEA 1LEKA 5C7GA 1I85A 2IAMD 3FT3A 3H9HB 3LKSA 1S9WB 1TJMA 2K70A 5D72H 3I6GB 3L9YA 4S2SB 5CGYD 3NEOA 5DD0L 3S35L 4ABWA 5C0CD 2XQBH 3A6BL 1W9FA 4KGLA 2J72A 3MV11 5I73C 2J1SA 4I0BA 4JI5O 4AEEA 3WOGA 1N8OE 1RVFL 2E27L 2EE0A 2Y33A 4ZD3H 2JCCB 4AAPA 3LZZA 9PCYA 5KS9E 4DQOH 4Z1VA 3MJ7A 4H8WL 3OZ9L 1IG3A 4AVKA 2F1MA 3BSZH 4OFGA 1KYUA 2R042 4BV1A 5MI0C 4X7TA 2P8LB 3BQUA 2LUWA 1LP9E 1CAUA 2GJRA 2AEPH 3BEWB 1W2KT 1Z5LB 2JQAA 4M3CA 4Q97A 3T4AA 4H5SA 4E2SA 4FNRA 3E8UH 4GQ9L 1KACB 3CDFA 1QSED 2Y6LA 1IOAA 1IV8A 1AJPA 3DTDA 3FB6A 2AI0H 4JUTA 5DVOA 2ZUTA 3VQMA 2DRUA 4ADIA 1MS5A 2ERJB 1C5BL 3GTNA 3SY0A 3WFCH 2UURA 2HWB3 4LFBB 1R3JA 2CIIA 3IJ8A 3W0WE 4K4KA 4EE2A 4P2QA 1NM4A 1NI8A 2VXTH 3ZIMA 4FNTA 2YXHA 3T4ZA 5HCAA 3WEXB 1KGYE 3SKJL 2YO3A 2ZOKA 3APBA 1AHWC 3POHA 4WI7A 3I54A 1D5MB 2DZEA 4CCNA 2P6CA 3OSVA 4ZK8A 5I1AB 3MRQA 1ZT1A 1FJGO 7PAZA 1EPWA 2A9AA 2X4NA 1PZ8A 1EAH2 5IK8A 5LA6B 2B1GA 2OA9A 3K3OA 2JJWA 1CXIA 3AKQA 2K6ZA 3HCVA 2DIBA 1FD9A 1PZ2A 3P77B 3A47A 4WWKB 3Q2CA 3DK0A 3S96A 3AT0A 4NVPA 3UAJA 1A3QA 3LIGA 5GGUB 1AYM3 4NIIA 1WP6A 2E86A 3ARDC 4KI5E 1FFXB 1PYWA 2VZUA 4EWDA 1A47A 4OGZA 2AFNA 3LN4B 5I6NA 4K2UH 4AQ8C 4XZPA 4FCHA 1S7TB 4L0ZA 1NBVH 1Y1UA 1TPXC 4DVRH 4WFEA 2HWB1 2X5IB 2VR5A 1CXHA 1TCRB 1D5RA 2FWUA 3NP3A 1I7FA 1YEJH 3P30L 1GC1L 4N6RB 5I1IL 4DFSA 2YUXA 3BIBX 4XO9A 3H1YA 4JM2C 4KRMB 5TDOB 5GS2D 4V1DD 4MCZB 5DUXA 4IEQA 3I9GH 1YVWA 4I48A 3EO0A 4NYLB 2DJMA 4JHAH 43CAB 1HILA 5F7DB 3UV9A 1IKNA 2CK3G 3ARGA 2QFRA 5DQJA 2EACA 3BB6A 3HR9A 3RWIA 4M5ZH 2R0WH 3IIIA 4XP5L 1UNBA 2NDFA 3FF8A 4WUUE 4AIEA 2OW4A 4PIZA 1ND2A 4P9HH 2QQUA 1J3RA 1JYXA 2ORBL 1NBZB 4YZ4A 2Y06H 1YNAA 2DMGA 2ZGOA 2WTPA 5SWSE 3ZSJA 5E5RB 1EO8L 5L3EA 4JDTH 4QNPE 2G60H 3RBZA 3QNZB 3HRZB 1IEAB 1LK3H 1LQSR 3HR5B 4B5EA 5I0ZA 3QA3B 4YGDA 5AOMA 4FFYA 2ZG3A 2EIDA 1KN4H 2WMPB 3LPPA 3H9SA 3LXBA 4QWNA 1CLVA 1EANA 4LCUA 4U6VH 3VFGH 2PA7A 2R2CA 4NRZA 4WU7A 1UPSA 3M7OA 4I50B 2DQFB 2P47B 1C16B 4BW9A 1OGAD 4OFYD 3FB8A 3GDBA 3L5WA 1NDGB 2IWGA 4UW5A 3BOVA 4M7KH 5BVPL 3H4FA 2N4IA 2XIDA 2BVOB 4L0PB 5ICZB 1OXCA 3GZAA 4IGPA 3FN3A 3AC0A 1GN3A 2HHHO 1B90A 5IFTA 5KBMA 1F11B 2G9ZA 1QMUA 2ODMA 2DLFL 4Z7OB 3MX0A 4BZ1H 2L7JA 2EDLA 3H7BA 1AYOA 1O7VA 3A7QA 2GK0A 4KY1H 3QDJA 3MICA 1NLDH 3KPOB 2DBLH 5F3FA 1YEGH 4B7EA 5FP4A 4CAGA 3M3IA 5DJZA 3IDIA 1ZLVK 2VZTA 4Y16D 1OPGL 4HN1A 4K0OA 3CL1A 4RL7A 4FTEA 2FZ3B 4DGUA 2P5EE 3KEDA 4C4KO 2O6CA 3PAZA 4MNGA 1IEBB 2EDHA 3DHUA 4OSUL 2AEZA 5C8CA 4AI2A 1H4HA 3DO7B 2D98A 4UV7L 4IIQC 2AVGA 5GGQL 3KCPA 4TOYL 4OHXA 1S55A 3QZPA 1BF8A 2R30A 3OY8A 4Q0XH 4HMZA 4AV0A 1KPRB 1V05A 2ZOLA 4AYGA 5B4MC 3FX3A 1CXZB 1J8HD 3KJ4C 5C6CA 3ZHNA 2H94A 4YG0A 4PJ8B 5EZIL 1RL3A 1AC6A 5A9GA 1CD8A 2IXQA 2W0PA 3VXRE 1GZWA 4AEJA 1T4KB 2W08A 1P5UC 3ZFGC 2BSRB 3KGUA 2VECA 2EXYD 4WGVB 2IZWA 2QJDA 3FHQA 3E5XA 3DJZA 3VRLF 2MHAB 2YAQA 1QA9A 2JB6A 2H41A 3KXFE 4F6RB 4X1KA 4U36A 4ESKA 4TF4A 2VL4A 2PYTA 3T3PB 1AQKH 4JYAO 5C08E 1KJMA 1XAKA 5E00B 4QRRA 1TQTA 4DXSA 5D7SL 3LNDA 1CZTA 5JJEB 5EOTB 1Q43A 1LE9A 5FOBA 3U4EB 1XF4B 2GALA 5L9RA 2W94A 4B1LA 2OI9C 4LDOB 1YNLH 2FE0A 1L9PA 3EGXA 4I0PC 3TV3H 4JDNA 1KYOK 2CLZB 4JJOA 2EC9T 2E9WA 4O4YH 4Q7DA 3I7DA 5IIEA 4CDGC 2GI0A 2F7IA 3B34A 3NZ8B 1RUH3 5LBBA 4B3MO 4K3EH 4NXSA 2I69A 2VLKA 4FXTA 1KYAA 2ADDA 3CFUA 4UOZA 2VCMA 3RNQB 2EXHA 3TFKC 1N3PA 4BUQA 2YD3A 4DAGL 4Q4X2 2NY2D 1XR9A 4MZRA 3V5HB 4D9QE 1I5ZA 1QJZA 5E6SB 3WEOA 4HK9A 2Q3ZA 4RA0C 2KLSA 1WC7A 2VQ1B 2OT5A 3JBG2 2AK4E 5JPNA 1J11A 1IBYA 2G2NA 4WSGA 2JIGA 1QEWB 3DUIA 4E4HA 4UQAA 1Q8MA 1KTBA 1CYWA 1TGOA 4XC9A 4E9VA 2HJDA 3PGFH 2Q1FA 5HPMB 3DIVA 2QDOA 6FABL 5HYJD 1USQA 1RPUA 3CFBB 5FOJA 1ULVA 3RL1A 2G0KA 1NIDA 2IO5A 2H0EA 4L9LC 4NUQA 3V0GA 5D1ZD 1QSFD 1IMHC 3VB8A 2ALWA 4FZ1A 3CFJA 5ETUB 5GGVY 3HPLB 5E8NA 2X5IA 3HR6A 4JAMA 4AFCA 5K9YA 5D5MA 3WD5A 4U05A 3WXWH 4RIRA 1BQPA 1R6VA 4CL7A 2PWHA 1X3DA 4PN6A 1ZV9A 1IBHA 1RIRA 3VBUA 4X6EA 2NY3B 4PV9B 2A6KB 4NJAH 1G7IA 4A7GF 2EZ0D 1AI4A 2VDLH 4NIAA 4B9PA 1P84J 4JFZH 4QPJA 4C56A 4QHZA 1XGUB 1I0HA 1NAKL 2Q7AA 4Y5YC 3PIJA 4LCCB 5FRAA 3D25B 1JYCA 1T83C 2HUEA 3KH4A 3QUMA 4FTVB 5EUOF 4WVZA 5FB8A 3IZOA 4LA3A 1A5FL 4N53A 1YEFH 4U6HA 5JW3L 1BCCH 4WJKB 2VY0A 1XL6A 1OFNA 1IC5H 1SQ4A 4JPVL 3U6RA 5CGTA 1CPUA 2Z31C 5BXXA 4E9SA 3NCEB 1B2WH 1ZD6A 3W38A 3MKKA 1XNAA 2E6VA 5TF0A 4Q26A 1W8WA 2AXJA 4B60A 5LY2A 1HZLA 1YA5A 2YS4A 2BIOA 3F8UB 4IRJC 5AL0A 3MJ9L 1F97A 1N3OA 4ASKA 2O6DA 1G7QB 2B4CH 4B9KC 4LL1A 2DKSA 1L3NA 3D39B 5BMVA 1OCOB 3BFWA 2V5RA 3U4XA 4XCBA 5JOYA 5IB4B 2ZX9A 2IFGA 2RD0A 4CXXA 5F8QC 1CICD 4CA4A 3HQRA 1BECA 1R0AH 3VQ1C 3T2NH 3LY6A 1EBOA 3Q1SL 4Z3IA 5L2KA 3ULVH 4Z5RA 3VGGA 1IVLA 2YDEA 3PWNA 3D48R 4U1MB 4ECNA 4XYXA 4LFHD 5FCSH 3PV6A 2BOBC 3SPVB 3KLHD 1IQAA 3POJA 1W6QB 2F5BL 4JGUA 5F9OH 1S9VB 3LA2A 3AK2A 2EAKA 1CR9H 2Z1PA 1G6VK 5KYXA 3ZSEA 1QUNB 1WZMA 1B4JL 1KTRL 1MJJA 4QDQA 4HV8B 2ARJA 1WHOA 2IV9A 1PCSA 3VH8G 3FQXA 4F9LA 5I74B 2ZA9A 5KYUA 4MUVA 1F13A 2YJQA 2WWKO 5CILL 1VACB 5CIRA 2ZXWC 3KPSA 3DMMC 1BEV3 4UZUA 2DQ6A 4L3EE 1S0FA 5I6MA 1S7QA 5FPLA 5FZDA 2Y0IA 1Y0LA 2B45X 1N0JA 1RZGB 1YQ2A 2Y6FA 1PL4A 5HGDB 1RUI1 2BPBA 1RZKH 3BAYA 3QUYC 2RNBA 4MMZB 3VBFC 2HG0A 2CH7B 3IMWA 4QDSA 2BFGA 1KFAH 5FZAA 1U58B 3VGEA 1NC4D 3D4ZA 3GMRB 3K72A 3KPMA 4O51B 4ODWA 5IR1A 2ORXA 3LGRA 2WQWA 4NHUA 3K58A 3GLDA 4A68A 3DN7A 5EN2A 4SBVA 1E8WA 1JJUA 3GMQB 4XXWA 4JRXA 1GH6A 5F7KC 1REFA 3TNMA 3EHBB 3SDAD 2K0GA 1B0RB 3LRSB 4Y2DA 3TTYA 1KLUB 4QHNA 3WY4A 5FK9B 3SDLA 3FB7C 2YIHA 3VGAC 1P2CA 2DCZA 2NUTB 2FLRT 5I6KA 4AI8A 4B7LA 1BEV1 2R1BA 3T4VA 4CCJA 1HSAB 5CMUA 2P8PA 4R9HA 4Y1AE 5K8SA 3DX9A 2RIKA 2W8CA 1FATA 1A7PL 4HT1T 2XBDA 4O02H 1J5EO 1UWXH 1ZK9A 4OUMA 2BU9A 3VJ6A 2B1OA 4HK3J 4NB7A 3UTSE 1EYBA 1FG2B 5HV4A 2KQXA 2Q86A 2QE3A 2X9XA 5KHHA 2XN1A 4Q9RL 2WGXA 2ZP8A 2ZX0A 5BV7L 5JXHA 2VVDA 4U0RC 3TBBA 2EYRA 2X6AA 2VMCA 3C08L 5CINL 5TGBA 5FLJA 5I23A 1A34A 3UP6A 3O1UA 4TNFA 4WBNA 1OI6A 4NPYB 3FTGA 5KVGH 4KX8A 4I4TB 2ZKWA 2ZX6A 3TWCL 5HHXH 3BVCA 5FMBA 1TG7A 4GH4C 1G7JB 5ISZB 2VPVA 2QGBA 2IV8A 2R29A 3MBED 3VFSB 4Q8LA 5SX5H 4P5RA 3W57A 4UNVA 1HDMA 2CPCA 3N42F 3DGCR 5GS1C 1X5HA 4AUUA 2VD7A 3KPQA 1QFWL 2Q7NA 1X7SA 4BSVA 5EZOH 4PV8B 5CP7A 2DWDB 2DMKA 5FF6A 4FXLA 2KSDA 3BGFC 4JBSA 4HOMA 3TURA 4Z8FH 1AR5A 3ZRWA 2B15A 4EWEA 4ARYA 1JPFA 3KYNA 5MENB 1Y3TA 2XY1A 2VLRB 1EV2E 5B3NA 4CP9A 3G6JF 4DR3B 3SJVB 3VXMD 1VBA3 2QVIA 3ARSA 5DEJA 2X2UA 4OQTA 3A67H 5FYJD 1UD2A 4O4LB 1BDYA 1WFTA 2IPTH 1SEBA 4K3UA 4ZT1A 3JARB 2CKBH 5C71A 5JHAA 1QQP3 2Y1ZA 4IE6A 1AJKA 1X5JA 3THOA 1NKOA 2UYAA 2FDIA 5MI0B 4K94L 1A6WH 1N12A 1NY72 2JE7A 3PNRB 3RJDA 5ESQA 1T2QL 2XICA 3MDJA 5GRUL 4XCYA 4ZYKB 3S34H 3GCWA 1K3ZA 1KLGA 2EKSB 3PDOA 4ZTPL 1PP9H 4BXVA 4E9QA 3RGVA 1QIQA 1SY6L 1CS6A 2JJUA 3QFDB 4L97A 1N0LB 2R9HC 4PJHE 4FFIA 1G8MA 1ZK5A 2WZ6A 4N0CC 3H9ZA 2VXQH 1CR7A 3H3UA 3HUJA 1L9QA 4GFTB 1GJIA 3HZKA 4R4BB 2ATKC 1QHTA 2WKOF 4XB3A 5DXWA 4QX2A 4DEUA 4AENA 5H35A 1VBA1 3GXUB 2BO0A 2J4WL 5LGJB 1AHWB 1WQVT 2HVKA 3OKNA 2IVFC 2A06H 4WFHE 3GEFA 3I55V 3WIFB 3FONA 2Q8CA 4BQ9A 3FUIA 4WO4D 4XNZC 1K6QH 4E5XA 5AB9A 1QQP1 5L9DL 1IM3B 4PJ8D 3BALA 4RLDA 3TBYA 1HIML 3U0TA 2MQ3A 3WL9A 4AYDC 2BSED 4GMSL 5BY5A 2D73A 1SDDA 3O2DL 5ALBL 3CC2V 4DZBB 5LHIA 4MJIE 3OC8A 4MKTA 4DP2X 1RUE1 3ARDB 3HTLX 4OF7A 1H1MA 1I6XA 2Z2SB 4UBHA 1XL4A 4X1YA 4CC6A 3MROA 4O2AA 1QR9A 4NQCB 4BHUI 1F3JB 4F7KA 1DLCA 2R1WB 4J80A 1N0XH 3BUYB 2LLLA 2FK9A 1TPXB 4K3GA 1A4KA 4JMNA 3MLZH 2P3JA 4PJ9A 3VXSB 1ADQL 2WWMD 4HF5H 4OLXH 1TUBA 4B3RO 1NLBL 4TQEL 1ENRA 3MIEA 4H1LG 1JA8A 2EKJA 2ZNWA 1NQTA 4G8GB 3EJTA 2F2HA 5TQ2L 2AQRA 4JM2B 4NZ8A 5FLVA 5FYBA 4HNAA 1RCYA 3DDFA 5FYMA 4I5BB 4UT9L 4LHLA 4JTDB 4ICXA 2G2PA 3ZO0A 2ITEA 1AO7D 3TRSB 1NWOA 5LA1A 4L4TE 3A6OA 3SJBC 1ITBB 1HS6A 3OXSA 2LU5A 3PU7A 3QEQB 4H13C 5DUBA 3UYRH 2YKKA 4M5YL 4MS6A 3S36H 4LBLA 4UIMB 1RMU3 3MJ9A 5AVRB 5DZGA 2AITA 2ZCKH 2F74A 1UT2A 2V5SA 3F64A 1KPVB 2IM9A 4XP1H 3N0AA 1PJWA 4EEQA 2WBJD 1TNRA 4BU2A 5AAMA 4WZ9A 3U0ZA 4GIQA 3K4AA 3LNFA 5LGTA 2RHEA 2XZAH 5GHWH 2CHHA 2C3XA 1TTUA 2JIJA 2ZUUA 1N18A 5FUCE 5KW9H 2OIIA 3GSRA 2CWMA 2FUQA 3NKGA 1SESA 3FT2A 4QD2A 3MRKB 2WT0A 1S9YB 4N20A 4LRNH 1S0BA 5EYYA 4YZ5A 3BXNA 5C0BA 1ZRCA 2HSIA 1KKDA 4JI4O 3IBOA 1A1OB 4NM4L 2JS5A 1P4LA 3ILDA 3F04A 3TBTA 4V2BA 4B5ZA 1JUIA 1VBB2 4EZ4A 4ETYA 1LU2A 3LSQA 3B2VH 5E4IA 4DN3H 1XF2B 3CH1B 4NCC1 2KLRA 4LIQE 4WM7C 1R9FA 2F53B 5JH7B 3FRPA 2WQ8A 3SPHA 3N9GL 4GNKB 3SOTA 3WNPA 3U9PH 1QDCA 1LXMA 4Y19A 3X1FA 4LBAA 4AYEC 2F1AA 1Q6IA 4UDTA 2EO9A 5DJ8B 5F72S 2O4EA 1IAMA 1IAIL 2VKWA 2Y7LA 3AREC 3HI6L 4B9ZA 5BMFH 3BISA 5HI4C 3SOBH 1AR63 5FPIA 4NO0B 4RX4D 4ZMVA 5CG9A 5C0RH 3ZOIA 3VQVA 1XNDA 2Q73A 4YY3O 3CC4V 1OEZW 2HUHA 2ICEA 2W46A 1PNMA 4Q0QA 1W05A 3OAAG 2NY5L 1P84K 1DZTA 2AK1L 1HQWA 3D3VA 5IEKA 1MEXL 3PWLB 4X6DE 4DEVA 3G5YB 4MTMA 1CLOL 3RE0A 4Q89A 4A2UA 3FMGL 1OTUD 5CNHA 3EXLA 4HJEA 1MRDL 1PLGH 4IIQB 1UGKA 2FO4A 4ZSOB 4PQXA 2EH7H 3DX7B 2CBQA 3D6GA 4FT8A 4RWYL 5EWIH 3EAKA 2D6PA 4JDZB 5EUOB 3U37A 1DQDH 4FLRA 1HSBB 1PIFA 1AL22 3FKUS 3GZPA 1QG3A 3KJ4B 4PYHA 5AW3B 3TGXA 1KV7A 4WEMB 2R23A 1BM3L 1N8RW 3T0EA 2FSEB 4B9CA 2ZJSH 2Q1EA 1DZRA 4HN0A 5FA3B 4FBFA 4RWUA 1P5UB 3VBRA 3CSFA 3ZFGB 4KY2A 4K5OA 1I7RB 1UD3A 4JL1A 3P9MA 1IBGL 2BWDA 4QJ4B 3VI3A 4G9DA 1O7FA 2ET1A 4O4HB 2ID4A 5CFDC 3V0JA 4P57B 2NZ9D 1XI1A 1T7XA 1DVUA 1PMIA 1FZMA 2H6UA 3QBQA 4XN7A 4MHRA 2OCCC 4M3CE 2AJUL 1KQSU 1F23A 4JI7O 2BERA 4JNXA 2IANA 1HN0A 3KYKH 4KZDH 2H9GB 4XT1C 3QJHA 3EG9B 1WJZA 2OI9B 3S3CB 5C0GA 5DQ9B 1MI5B 4I0PB 5JQ6L 3PFUA 2OS7A 5KAQG 3LB6C 4ZUSA 1M5IA 4MD0B 2FQDA 3WKML 1AZUA 2COVD 3CXCU 2CYFA 1NANI 1FC2D 3D4CA 5DTFA 2QWQB 1E8XA 4ZS6D 5C09B 1B6QA 4KITB 3U10A 5HHQA 3MFCA 3UG5A 2GAZB 4G9FA 4G71B 1J5OL 3QIUC 4TUKH 3REVB 1I5PA 2VCBA 2GJPA 1F51A 1ZLWH 4AWDA 2X4UB 2JIXB 4KHXL 2AABH 4RRPM 5CGBA 2EECA 3KLAB 4DCQA 1KLFA 1GZPB 3R7QA 3RY6A 2N0KA 1J87A 5D2NE 2ZUSA 5CEYB 3I75A 4YS4A 2Q8AH 3A23A 4Y33A 3LSUA 3CIHA 4KKNA 3PUAA 3W11C 5ANNA 2ZEYA 1JPEA 2B8OT 3EHBD 4KXAA 1MRFH 1RPQA 2Z8RA 5EO1B 5ABDE 2QQKL 4AUJA 1S9KC 1LHVA 1Z7S1 2BRRL 3QACA 4L9LB 1DFBH 4LLVA 3BO8A 3RBGA 2RJMA 2UY7A 4WFEE 4X42A 1DVYA 1SUHA 3CN1A 4A3ZA 4X83A 4MRBA 3FBMA 2WZPA 1AE6H 5FP8A 4OUUB 3CDZB 2BNRB 3EGSA 1BREA 3FXIC 4DXWA 1UKTA 1GBGA 5LWBA 4IV3C 3HKBB 4RZKA 1N19A 3V52H 3FW6A 2BW4A 3CPWU 5J9PC 1IARB 2D31B 3CZLA 4L1DA 3SE3A 4PCYA 5D96C 5J8OA 2D7PA 3BAEL 3LKPA 5I91A 3ZMVA 2RM22 5EA0L 4LKXA 5CJXA 4GKJO 2YAFA 5F1IB 3L3KA 5L73A 3DC0A 1CGSH 1DQJB 4Y5YB 1RZKC 1GW0A 2QWNB 3HKZA 3PHOB 1ONAA 4NHLA 2J5WA 3TBDA 4Y8DC 4W6YA 3EOTL 3MXWH 3EYUH 1GYVA 2W91A 3OCPA 4JHZA 5CSBA 3MMEA 1PAZA 1TEIA 1BVNP 3GS0A 2Z31B 4RSVA 4YUEH 3RIKA 1O4TA 4LXFA 5EPAA 1VQMV 1JZEA 4GW1B 1SPPB 2GQHA 4LNUA 1EV12 2Q5TA 3POEA 3H9SE 2XG5A 2XFXB 2VC2L 3B43A 3UP1A 5F21B 3ZN5A 3UQ8A 1SYVA 3X1NA 3AK0A 2ADIA 2IGTA 3PMEA 3C60A 4KHTL 1DK1A 5H4YA 4M1CD 8CGTA 2VMIA 1W9XA 4JFDE 5IROA 3AB0C 5FX3A 5BW7A 2NYYD 3RQ0A 1IGFH 1L9NA 3RWGB 3CCJV 4TSCH 1VJ2A 5AVZB 4ZMOA 3TEWA 3HG2A 2WTOA 1NINA 4JQVA 3FQTA 5FKPA 3NG5A 1BJ8A 2J88L 2YXLA 5JJNB 3GF8A 1U2HA 3N42B 4H1LB 4UT9A 1BVNT 3QTCA 3TASA 2BOBB 5FO8A 3NABH 5K59F 4LHKA 4WW2A 2AQ2A 3QDJE 4JI2B 3SGIA 2WLHA 2K1MA 5FY9A 4HS3B 2CDOA 5TK2A 5HHOB 1RKRA 4XFAA 4TQFA 2D9CA 4BMBA 4DGVL 2RDRA 2XBO3 5DD6A 1MCIA 4PJAA 3TVMA 2ZAGA 3TJPA 3UZEC 3V4UH 1H9WA 5BNPB 5I18H 2ZXWB 3DMMB 3GWKC 1MZ5A 2A3YA 2P17A 2KDGA 2MH4A 3D3QA 1VERA 2YQ2A 3MREA 3CCEV 4LASL 3IJYB 4XAKE 5FYYA 2WL1A 2TEPA 4QI3A 1CDJA 4P2CG 2X09A 1JTPA 4QHPA 3QUYB 3SJQC 4WI8A 5JW5B 2ES3A 3JWNH 4B0MB 4LPTA 5FK8A 1TMCB 3BE1H 3VBFB 5CEHA 2JRIA 2HJLB 4AKQA 1NCNA 3GMLB 5I1EH 2WAHA 3QDAA 3ULUC 1NFKA 3WTXA 4N85A 1WLTA 2XUWA 4PRNA 3WFBH 4F37F 4QKFA 4OF3A 2WP3O 2BSSB 3OKKB 3P3UA 3HI5L 5KAFZ 4L5FL 5DMGD 4P4KA 3X12A 2GP5A 4GWIA 2PW1B 2G2RB 2G5BA 4I9WE 4NZDA 2VT0A 3S35H 3GGLA 5B1NA 3A6BH 5D7LA 2JJ6A 4XDQA 2FBJL 1JGLL 4X8CA 1QOKA 4L3AA 1RVFH 1SDWA 4P46C 3HS8A 2PCPB 2W52A 2YWZA 4NQCD 2KYIA 3FB7B 3VDDC 4P05A 2OQJA 1SA0B 4H8WH 3VGAB 3OZ9H 3HJEA 4OGQC 4X65O 2FHRA 2ED8A 2H2SD 3VACA 3L9BA 3JAWB 4EUPA 2C7FA 5HFLA 1N34B 3DXRA 3S35X 3WO4B 1UZ6E 1UN1A 1ZSDB 2VLKE 2FJFB 4WVMB 4JM2D 1MQTC 4CEWA 1AKJB 4UW6A 2NX5A 1TEGA 4HHWA 5ESAA 3A0KA 1TJXA 4GQ9H 3L3HA 2X4QB 1E1RG 2X41A 3UDWA 4WV1C 2GABA 4NQVA 2F5AH 4ONUA 4LLDB 5HBBA 1UX6A 4U0RB 1C5BH 5FYJU 1F4WL 4Q4V3 2FGZA 2XQ0A 4MGZE 1EGJA 2L0DA 5BZWB 4QRQA 5AKTA 3LD8C 3CXHF 1X44A 2HVJC 2K4WA 4PWJA 4UOW1 2FWSA 3TZVD 4WHTB 2Y2WA 3SKJH 3QQDB 4S1SL 1BWWA 1PV0A 4YHPA 5CJ5A 1HCYA 4GH4B 2VGDA 1X5GA 3PWJB 1GL4B 1CAVB 1PZ3A 2X0VA 1PO13 5A3WA 4D7YA 3QUKA 3SDXA 1CD1B 3U9WA 4YHHO 2EINC 3F7YC 3LRHA 3UT5A 4HKXB 5GS1B 4E8CA 4AZUA 2HWB2 5H2FZ 3VU1A 1WW5A 4BWWA 3FQNB 1KS4A 1CQKA 5D5ME 3JAKB 2NUPB 1MNUL 3BGFB 3WLUA 2AP2A 4FFTA 3AG1C 4NNPL 5TH2A 2DM2A 4OLEA 5FYKL 2DH2A 2HTKC 1ULPA 2WCPA 1CI5A 3K0WA 2QGCA 5DMIH 3IN2A 5DS8A 1N6QL 1V6OA 2PO6D 1BA9A 3QH7A 5EU6B 2YQBA 2B3RA 1ZVSB 2P24A 2YOAA 1OK8A 3WLWD 2VMEA 1GCFA 5I1IH 3CYOA 1GC1H 5EO0A 1J10A 3OKLA 5ENWA 1AGCA 1BD2E 4MJ6A 4TLTA 4C56E 1GN4A 1CLYL 3PWUB 3MIGA 5CN0A 3EUUA 2ZGMA 4FOYA 4TV8B 5B3JE 3WIHL 1DQ2A 4P2ZA 3QNYB 1CPNA 3ZQ9A 3TH4T 3RWCA 5CFAA 2OMWA 1BYPA 2RJ2A 3FQYA 1PO11 4FSJA 1CONA 3ZY7A 3MRMB 5C7ZA 2Q5BA 4UQ3A 1QLEL 1OSPL 3ULUF 2YPKB 2ZP0T 3ZZSA 1GQPA 5BNPC 2IJ0C 3PHQB 3MV8D 1AG6A 5CN1A 3L9RA 3ZTJG 2XASA 2AJSL 4XP5H 1AXSB 1UFIA 2QZ2A 1KP2A 4PGCB 5DR5L 2AHZA 3ZSMA 2ORBH 3KDMA 5FGBA 2ESVB 2OSXA 2YC1B 3SB3A 1Y76B 3MZGB 2ZT9C 2WLLA 2ATKB 3NPZB 1EO8H 1UMHA 1KCKA 3FSVA 4IE7A 1IAOB 2DTWA 3N43F 4QY8B 4MVZA 3MV01 4GG6E 1NCQA 3HWJA 3WS6A 4AYFB 4MDIB 1EAPA 2GNMA 3ELNA 4XNZB 5DGQA 4OZIB 3SH5A 4IHOA 3CFQA 4P9YA 2HT4D 5L2KE 2V2TA 3BQVA 3NACL 2NM1A 1QEXA 5PCYA 1AS8A 2DI9A 3B56A 3LEVH 3LZFL 3WHXA 5JYMA 3B7SA 4CCOA 1GNYA 5FZ7A 3F05A 4LSVL 1FNEB 3JD2A 1LEDA 4N7IA 4FG6D 3NIGF 4FQPA 1W03A 3UZVA 5B1CA 3KWTA 1YC8A 4X6CE 5T3ZD 3UESA 2G9KA 1JFFA 1R24A 4JPWL 5EULV 1K34A 5LGNA 3I02A 3SE9H 1PVHA 4XXCC 4LESA 2DLFH 1E2ZA 3FLRA 3F7LA 1KB5L 1D7PM 3ECUA 2Z7ZA 5E94A 3KPSE 3X3FL 1JRHH 3O65A 2TNFA 1AP2A 2Y6SC 2WZ8A 3MRLB 4IOIA 4BQ4A 4XVUD 4DR5O 5F96L 5FLUA 3C90A 1NKGA 4HK0A 5C6WH 1OA3A 3OYWB 4X0NA 4D9LL 2WR9A 5K4LA 5FY4A 3X2QC 2XAGA 1OPGH 5D7IF 4PJBB 1UY0A 1X8EA 4XUQA 1YAZA 4H13B 4EQ2A 4DV7O 4QQLA 4XDOA 1QFHA 3ZTCC 3ZXJA 2VDKB 3TFKD 2JEMA 2WXFA 3WKQA 1XCQB 4OSUH 3IFOA 3B4SA 1MVEA 1DJSA 4UV7H 4YSQA 1IX9A 3L2MA 4HA1A 1AQDA 4M1GL 3OTFA 2Q7EA 2B08A 5GGQH 4EVNA 4TOYH 1GPOL 2I9LA 3CZSA 2Q8OA 2WSPA 3RYFB 1ZDSA 2K0RA 2K7PA 4OAWA 3RPKA 3KQRA 4AVTA 5KG9B 1FYTB 5CB7A 4PMEA 4CC4C 1A3KA 1CL7H 3AKRA 5C07B 4N6QA 5EZIH 4CSTA 5F9TA 4YDJB 2JDMA 5GQBA 4AFDA 4HCGA 4DV6B 4ZO7A 4YQXL 1Q1JL 3MNZA 2R29H 4X4KA 2NZ1A 5I9QC 2J3SA 5MHSE 2F4LA 2IFRA 4LPLA 3GMPA 4W1TA 3R4DB 2Z35B 4E0RA 1RB8G 3WHE0 4DP5X 5JHMA 1FNGB 4L8CB 4QWWD 2WDBA 2Y6KA 2DYSC 2A0LD 2JI1A 5JZ7C 1UGNA 4HIIA 1CF8L 4NC0B 1A7QL 1BZEA 4WM7B 5FZ3A 3V0BA 2WNVA 1T6BX 1YQVH 1P7QB 4J4PD 2YD8A 2CLRB 2BSBA 4DK3A 3QYNA 1J88A 1K5JA 4OD2A 5GZNA 1C08B 1J8SA 1YPZF 4L4VB 1N2RB 3D82A 1SCRA 2R1YA 4XC3L 5GZOD 1J0IA 1QVOA 2OMUA 5IB2A 3AREB 4UQ2A 1H30A 5AOKA 4F7PA 5EZJA 1AGDB 3R06A 2I5YL 1BHGA 2A3WA 2VUJA 2R7EA 1QRNA 4IEZA 3ZLQC 4H7LA 1N7ML 2BXYA 3HG1A 5IB3A 2C4XA 1QNYA 5KEZA 3WUCA 1HYRC 3DIFA 3NDYE 3HE6A 3OX8B 4F6EA 1OW0A 5FXVA 1P69B 4XETA 5D1XE 1KBGL 1QBMH 2D6MA 1IJ9A 2BTQB 1FBIL 4P3DA 5T5FA 4MXWA 3VTMA 3O1RA 4D9RD 4GKNA 4YSEA 1A1NB 3NSYA 1QO3B 4HZ3A 5J2TB 4FQLL 3EGDB 1H6XA 3IDCB 4A7ZA 4R4XA 5LWYL 4QE7A 1MFEL 4P9XA 4HAGA 1JYTA 1JZHA 1V6KA 4JDEB 3GUTB 2V5TA 1GGYA 3C5SA 3D0VA 2FB4L 3GSXB 1VPHA 1YRZA 1W6LA 4PLOA 3AYEA 3P4OA 2HRLA 3CNKA 5E5UB 5KSBF 4F1SA 1R091 3D8MA 3QUZC 3OPZA 5IM7A 2AMUA 1WD9A 3VQLA 3WJLC 1PZBA 3PUIA 1AJ7L 4LSTL 5CFDB 2MW2B 2AW2A 2MTAA 5I1CH 2DCTA 4X8JB 4IGBC 4QRSA 3LKQA 4NRYB 4QKTA 3BVWA 4PJEE 1JOYA 4UOW0 1KU9A 2XTJC 4U3HA 2OCCB 3UJJL 2VDLB 1QJX3 4ZODA 3S7EA 3AS2A 4Y26A 3POSA 3RRDA 4OCLC 2VNCA 5DJ0A 1LOFA 3UETA 5IHRA 2OMTB 5E8OB 1MFVA 1P6FA 3F7KA 4JFED 4HD9A 1SKVA 2V9TA 1CFNB 5FZCA 1NAKH 1D4M3 2RFXA 4OLVH 2DF3A 1L9RA 5EBLA 4B97A 5BJTA 4TN7A 4R4ND 2FQGA 1JUFA 4LF4O 1PU0A 2X6UA 2J7MA 1FL5B 1LNUA 4FM0A 3C6SB 4QRPA 2UXFA 4JMXA 4S11A 4JPVH 4RVBA 1OP3H 4H55A 1WBZB 5HYQB 3MD0A 4A38A 3VG0L 1SLVA 32C2B 2DFBA 3QIUB 3ZLIA 1BZ7A 2RGSA 2NR6D 3UTZB 3VO0A 1LO5B 3BGMA 4MHHI 5ICYA 1BK0A 5FGSA 3NEXA 1F02I 3MJ9H 4UF7C 4BCXA 2YKLL 4U3XA 1B35C 4BWOA 4P2YA 3B8YA 3EOBB 4P8QA 2YSTA 3V9FA 3M7FB 3K81A 4PI0A 2NLJA 4DIXA 4M3HA 1NBMG 4P5SA 1AD0B 1SJEA 5IVYA 2VO5A 5D4JA 1U3JA 2AQSA 2ZG1A 3TEZA 3T6WA 4L18A 3DX3A 4DO2A 1BGXL 2DYCA 3ZZLA 3HN1A 3Q1SH 4OGXL 1WYJA 4C83B 1Q56A 4EBQL 4P9JA 1FPN1 3FUMA 5DQDL 4GS7C 4YPGA 4N90D 3NAPC 1V3KA 5DJYB 1ERNA 2BHYA 1IB5A 2W5PA 5H9QA 5GONA 2ZQKA 5LL6Y 5MEQA 2ZHNA 2F5BH 1AGBB 4GAGL 4PLJD 4JQRA 5CEZL 2XWBA 4KI5D 4Z7UF 4IV3B 3MA9H 1HNWO 1RUI2 2PHLA 3RZMA 1B4JH 5J9PB 1YIJV 3EO1A 4LHJB 2E9GA 5AEAA 3OBZA 1UJ3C 5ALCH 1U8CA 3LRGA 5D96B 3RHWF 3W5NA 4LKCB 4G11A 5CILH 1NAMA 1PZAA 3O6FD 5K1VA 1N32B 1BAWA 4YSPA 4M7ZC 1R083 3UGFA 3IJSB 4B3NA 3PWPE 4ASMB 3JWNC 4ZXBC 1G9NL 5FWQA 1KBHA 1ET5A 3D2UB 4R2GD 4FA6A 4HS6B 4COZA 4B6ZA 1BSMA 3ARFA 4QD2E 2X4PA 2ICWI 2CDFB 3WE1A 3QG7L 2FD8A 3D18B 5C0BE 1J7VR 2DV9A 3MJ6A 1BEV2 3KL3A 3MGOA 3NJLA 4N3TA 4WUUD 1G9HA 2GJ6A 3EJSA 4B95C 1T7VA 4GWJA 1X9RA 2EYSA 2JKTM 1WAAF 5SWSD 3AB0B 3DPRC 3AS3A 4H8WC 3ILPB 3OHXA 5EC2C 3SHSA 5JWPA 2LP7A 3OLEA 4IS6A 4Y19E 1J05B 1KB5A 4XPHL 3K71B 2H2PC 2J1UA 3KPRE 4MVMA 1OAKL 1R081 3AP4A 4OHWA 3POYA 4CP1A 1REDA 3OR6A 4KJPC 3SQOL 3WMPA 3TB0A 1Y43B 4HZLA 3G7DA 5LQBL 4BQ8A 3VRJB 5IBLD 1A7PH 4U1JA 1UY3A 4IV1A 3LFIA 3FK3A 1RJZB 5G04L 3QZMA 1HXS2 4UQCA 4BW5A 1I4FA 1R3HB 3AXLA 3NPSC 1S7RB 3S3JA 2RS32 3VBUC 3SD5A 3KCCA 4Q9RH 3WF1A 5E2JA 1ML0A 5CA0B 2K4AA 5A16A 5FUNA 3M17A 1OKEA 2HLAA 3WAKA 1ZBE2 5CINH 7PCYA 3QR0A 3MO4A 1Z5WA 2BNUA 4XNQA 3NN8B 1I8UA 1Y18B 2AKRA 1QLFA 3Q6FB 3MRJA 1UADC 1YG9A 3TWCH 1XDTT 1JK9B 1VIBA 3CFEB 4KUZH 4OZHE 2KM2A 4EIZC 1BLNA 3GJEB 4LNRA 5IVOA 4M8UA 3NXSA 3F7PC 3DOHA 1JGDB 1FV3A 2DQJL 5BNQA 3OG2A 3U48A 3QIBB 1JPST 2GTZA 3AT9A 1GAXA 3O2VL 4IHBA 4J2QA 4NT6B 4PRDB 5CKGA 3T0EE 3UEZA 3DSNA 2VUOA 5BRQA 5JA8B 1KJLA 3ZYIB 3JB8A 4MH0E 1V70A 2AEIT 3GSNL 3ME0B 4QXTA 3S5AA 1W6NB 3TONA 1LWJA 1KTCA 4GIOA 5I16A 5IVXA 3VI3E 1AKPA 4AUYA 3IMBA 1QJY3 1CC3A 4DTGH 4LH7A 5F7NC 4ALAH 2P4VA 1JGUL 4OGAC 2C5DA 1ZVFA 2DI7A 1HW7A 3FCTA 3IU3B 3O3EA 4PW9A 1H0DA 2CKBB 4Z3GA 2PYFA 3BVDB 3JV4B 1GC1C 4P46B 1HE8A 3N43B 3GBFA 2RDCA 5EZYA 1J0ZA 3VXRD 1OTTD 2WNUA 3ZIAG 2UXBO 3VDDB 4B1MA 1QXRA 4OGQB 1MCQA 4YGAB 4UCOA 1E7UA 2J71A 2LAAA 2LOEA 2QADC 4JFOA 4UAOC 3C7FA 3LX9A 2E6PA 1WWWX 3B5GA 4RR3C 5K0UA 1JV2B 2EDOA 2I9TA 4MXWL 5DCCA 3RJ2X 1XC6A 1MFCL 4Q6KA 4MSWC 4UYQA 1OCCC 1K3IA 1SQFA 1AOHA 1Y74B 1S7WB 2DLEA 1KG0A 2I26N 2EDFA 2IH1A 1Z5HA 3F58L 3HFML 4XMKL 3VWKD 2BP0B 3EDFA 3NIGB 4G5AA 3R18A 5C0DB 2UY9A 4WV1B 4G9FE 1Z9LA 2XQYK 1MVYA 5IW6A 1PNGA 1KIRB 3V6BR 3LKOB 1NMBL 3MNDA 1QJY1 4NQXB 1R5VA 1B4LA 1IU1A 3LD8B 4HWZA 1WA8A 2NY0D 5A7BA 1W6PA 1ZRIA 3Q3GB 4N8MA 4TUOB 3N7MA 2YPLA 3DRTB 1OM3L 4DP0X 1RUE2 3M3EA 1MF2L 3V64A 4G3YC 2WTRB 3T6QC 3UO1L 1ZGLB 3B9KA 4IRZL 5D7IB 3TN0A 4F2MB 3E1ZA 3CX5F 3LHAA 5L9DH 2NW3B 1NOFA 4XFHA 1D9KC 1HIMH 2EINB 3OMAB 3F7YB 5C0AB 2DLHA 4GMSH 3O2DH 3WY3A 5KHJA 2BGPA 1ZTXE 5LLIC 4JFFE 1SDAB 2E33A 3C7HA 1QZ1A 1HT6A 4EB6A 1DSFL 2E9QA 4Z8BA 3AG1B 1GWKA 3JUZA 1Q86W 1KGIA 4HWUA 1NIBA 4IOFC 3UT0A 2R2EA 4V2VA 4ZUUA 3CFKA 4GWMA 4URKA 3MIBA 3S8GB 2E6QA 1ADQH 1X5ZA 4AGOA 4FNLL 4WO0A 3T2PA 2VZQA 5CB4B 1WFNA 2PPFA 2VAAA 2Q8VA 1CBJA 1NLBH 3NIDE 3GWOA 2FJUB 4TQEH 4BFBD 5L3GA 1F45A 1FL6B 4UNUA 4F57H 2RAMA 5FO7A 4JKWA 4GMTL 4X0KB 1NUKA 1BZ9B 1Z5VA 3AU0A 2DY2A 1IL1A 4UT9H 4OI0A 4HPHA 2XX0A 4HULB 4FIPC 1MVUA 3QE5A 5EOQL 2ETWA 4UINL 2UY8A 3I2GA 5FAXA 2HR3A 1G7PA 2BY0A 3CSBA 1JXKA 1F3DJ 3BWAA 4A39A 4M5YH 3A4UA 2LABA 1U92B 4ODUA 4FPHA 1WITA 1Q4NX 2C2AA 1XHHA 3FTZA 1AR1D 3E9TA 4OJFL 4B50A 1UURA 3E9UA 3KW8A 1IJNA 1ZZCA 4RS5A 3ZHTA 4F8QA 4K8RB 3WDIA 2XG4A 4LPXA 5KBNC 3P9LA 5LNGA 4YGCA 2XLAA 3JWNG 4GBXD 4BQWA 3AG2C 4PRIA 1W04A 3MPBA 2ZT9B 2O14A 2H6CA 3J4UH 1CJDA 4OCXL 4NCC2 1GZHC 3AABA 4DETA 4LHQB 5IYDO 5A32A 3TEUA 4HSJA 4Y4KA 1CXLA 2VR9A 3VUAA 3CGTA 2UUDH 2UV3A 3APMA 4JQIL 3TESA 1V6MA 2HPOA 2WVSA 2CU5A 2Q1MA 3BMWA 3K79A 5CSZB 4KI5M 3MV9B 3KV9A 1MJ7L 2BSTB 1QR8A 2WXOA 5HHNA 3KV4A 4ZHNA 4HUVA 4WM8C 1COWG 5BXZA 2UZXB 3DVGB 1SFYA 2H0FA 3FTUA 3O9WA 2YPVA 1QJU3 1QD0A 3GBEA 1HWHB 1YITV 2AEOA 4ZUWA 3WNJA 5H8DA 3SBPA 4GB9A 4BRJA 2YMXH 5GRVK 4DR3O 3N9GH 4X8PA 1NE6A 4HWEL 5BS0A 5FZ4A 1YF2A 4WY7L 5FXWA 1NH6A 3GBGA 4AVBA 1DL7H 3K06A 1TU2A 5I8CA 3TPKA 1MHHA 2BOLA 2N7SA 4KJYB 3FUQA 5ANMA 3NCCB 1GSMA 1IAIH 1HNFA 3IDGB 4JREC 4PJAE 5AVXB 4LCYA 2HLDG 2X7RB 5KSBB 3OUHA 2PTUA 3L17A 2ARWA 4QOKA 4OLZL 3RWNA 2H45A 2YFOA 5KUMA 4RDQF 3EYSL 3MBWB 5C1MB 1LD9B 1QFPA 5LATA 3RZKA 4QTIL 4Z78A 4WAFA 5I0VA 1MQKL 2QDRA 4EUPH 1MPXA 3SN6N 3J07A 1POV3 2OPKA 2WXPA 2OUJA 4YWGL 3QFGA 2NY5H 5DO8A 3RI8A 4PRBB 3X2QB 4IU2A 5DRWA 3UZQB 2CE4A 3GSUA 4EN3C 4QMEA 1MEXH 4ZFOA 3EJUA 5IB5A 3TWIA 2AC1A 3WFDL 4CJ1A 1Q8VA 3OXRB 5FZ0A 1YSCA 2Y72A 3SY0B 3GS4A 3FMGH 4KJQC 1J1LA 1A6UL 3K9AA 1MRDH 4DESA 2CIIB 4PY7A 3ORJA 1GV9A 4C7UA 3KYOA 2BVUA 4P2QB 1QJU1 5D6CA 2VZRA 3WW2A 1DZBA 4FJ6A 3ZZQA 3WTWA 1UCBL 1AI1L 3OGCA 4X9YA 4RWYH 1EGJH 4QHMB 4XPFL 5T1DL 2A9ML 3U1QA 2YMZA 4WIQA 4MAYD 4PG2A 4YZ2A 3EDKA 2BSKB 4YR6A 4HK3N 4HISA 3I85A 4DVBA 5CGMA 4MAUH 3WP4A 3HI1A 4BYHA 1OWRM 5KBFA 2XRAL 1AFVL 3SIKA 2ZNXA 2FBRA 3MUGA 3ULVD 5I9QB 4KROD 5M94B 5HCFA 5AB0A 4LEOA 3QBTB 5FLHA 4XI5C 1IBGH 4BHUA 1CQ9A 2E8YA 3CXDL 4YDVB 5JHDD 2WWSA 2DYSB 1UA7A 5C9JA 2Y0OA 3MLWL 3GNMH 2EAEA 4M4RA 1J95A 2YRLA 4MNQE 2H3NB 2XJVA 1OCWL 3R0MA 2NX5E 4XGZA 1J0HA 4MB4A 3FTVA 1JWSA 1TEYA 2WLJA 2BZCA 4P5MB 4DO4A 3JV6A 4NTXA 1RUJ2 5JQ6H 5FL7G 3K75B 2NCMA 4OI2A 4YXLL 1S5JA 4AVAA 2AQ3A 3IAQA 3VWJA 2D7TL 1AGFA 2VL5B 4GRWH 3WKMH 3CF6E 2ADGB 2WCSA 3QWNA 4UW3A 1NDMB 1OOPC 2J1TA 4FLYA 3UTSD 3MRBB 4Z7UB 3DWTA 4I4WB 1EMTL 3TL5A 3QF7A 3JSSA 2HWZH 3ALWA 3P73A 1Z7S2 3RWIB 3ZQXA 1HHHA 2AV7A 1MLBB 3CVHB 4E36A 4OFQA 4DFIA 1YFUA 4KHXH 1AG0A 4GKXA 2ZYSA 3VFVB 1CO1A 4B3SB 1MABG 5EJ3A 2I60H 4LCWD 3K8KA 4EAEA 5E89A 4KFMA 2E0PA 4R5TA 5I0WA 4NIGA 3CZGA 3QPKA 3IS0X 4IRSC 2O26U 2HFEC 2YIAA 4LFCB 1AB3A 3FQUB 3K74B 3HVNA 2QQKH 2BRRH 4JGZA 4DOHE 3L3IA 2WQZC 4NZRL 2FJGA 2XFGB 1K5WA 2GPZA 4GYCB 3AM8A 3BKCL 3BLPX 1MFAL 4DP9X 1DDHA 1U93A 1VBD3 3TBCA 5K9QG 1GICA 1XU1A 4NQED 1GKOA 2OW7A 1RUD1 1FAKT 2DWSA 2VW4A 1ET8A 5FV2A 5J1SC 2SBAA 2FX7L 1TYEB 3EIFA 3HHRB 2IWGB 2WIMA 3A4AA 4IGBB 3E97A 5IYCO 2A74A 2JH2A 2ZWZA 5IK7A 2XTJB 4JI1O 1BFOB 3NH7L 2XN9E 2MNGA 3C7EA 3UC2A 2JKXA 3BAEH 3W3BA 1RUKL 4OI9A 1QLNA 5EA0H 2FCVA 1U8LB 1FL3A 1YEDB 3K46A 2YC4A 5AVPA 1SYSB 3SYQA 1OE1A 3NFNA 5HJGA 5JORA 3QXAB 1WVZA 4QXGH 4XNMB 5KOVC 3CVCA 4NYKA 1I1AC 5L3BA 4KDVA 3S3SA 2P34A 2ZX3A 3EOTH 3GXIA 3FYIB 2Z93B 4JZOA 2G38A 5SX4H 3ESPA 1G0XA 1UOWA 3SGDH 4ORGA 3KZ4C 4OJEH 3CN0A 5HVHC 1HV0A 2P5WE 3CFNA 1VBD1 2BW8A 1T1WA 4MJHA 3J80N 2X4OA 2X6BA 4XHJC 2JELH 3V0EA 4AMXA 2NY4D 1CMOA 2HYKA 4NJ9L 1O4ZA 3QIBD 1P0SE 2P8MB 3KCPB 4LHUA 3I3BA 3DHPA 4YL9A 4DV2B 3SBWC 4KHTH 5JXIA 1B35B 5DFVD 1DQ5A 1C57A 2AYHA 2E7MA 3QB7C 1RV6X 4NKDB 2TBVA 2ZGRA 3QHZL 4B96A 2LO1A 3UROR 4LQFL 4Z23A 4EFBA 4RAUB 3HG5A 4K3AA 3RA7L 2IXQB 2YOCA 5JOPE 4WFHD 1YDPB 3BMVA 4K8RL 3U1PA 2W5FA 1NCRC 2Y7OA 4Y4HD 1I7TA 5EO9A 4P46D 1PX8A 1G7LA 2J88H 4CSPA 1W72L 4GS7B 2IQAA 4JGMA 3K3NA 3G6EV 3NAPB 2GJZA 5FUPA 4CH4A 4U3JA 1L0QA 3CD4A 3RTQA 3MUJA 5I6PA 4X1KB 4AYID 2YAOA 2DF7A 2JENA 4MJID 4XDKA 4ATEA 4UMGA 5BV7C 4COVA 4OKVA 4QRRB 4HVRA 1OF0A 4L8BB 4UVBA 2LW1A 1N26A 4J3OH 1AL0G 5IVZB 3UL2A 3UXFA 1UJ3B 5F3BA 4HC1L 43C9A 3QFJE 5F3GA 1Z1WA 3EFOB 2W88A 2XNAB 3RPBA 3SODB 4M7ZB 1QHQA 1GZQB 4FXGC 5JOFA 2R70A 2DQHL 5DFWH 3PWVA 4ZXBB 4G1MB 3VFUA 3PU8A 4XFCA 1IDSA 4AW4A 3MCLL 3MLTB 5LJYH 2DMBA 4HXCA 4M4PA 2HYMA 1LEIB 1HQLA 3EJCA 4OZXA 1VQ4V 2BNMA 4KK5D 3RWFA 2EVFA 2P3IA 1OSZA 2V3DA 5ERWB 2NY6C 3HE7A 4FPFA 5LASA 5IVFA 1WSST 1OP5H 3MLSH 2E4TA 3BC9A 2OTWB 4L5FH 1OD7A 5C0AD 3VI4A 1JZ7A 4P5KB 3GZTB 4HDIA 2FBJH 1JGLH 1RP8A 1TENA 3DPRB 2CL2A 5JTWA 4G70B 5LBVA 3SYOA 5EC2B 2WLPA 2YLKA 3ZE2E 1S76D 4DRXA 4E5XG 3ON7A 2X1XR 2ZGPA 4RSUA 1UB5A 1ZDQA 1RUQL 4K94C 4XWGL 4XZUG 3EFDL 4FFWD 3BODA 2GBOA 5E8NB 2EXIA 4H0GA 5KSAD 1GKEA 2ZKLA 5BUVA 2RQEA 3IJ9A 1E4XI 1XH0A 3LKJA 4WU5A 1HWYA 3OPZH 2GHYA 3BN6A 1QRNE 2R27A 2O6EA 5T1KA 1SOQA 1W8OA 3HG1E 4Y4FC 3NPSB 4R8CA 3ZKSD 5E1AA 4NX0A 3VBUB 5I76B 1JK8A 1JVOA 2IXLA 2ZACA 4LGRB 4A66A 5I24A 3DJRA 5IJ0B 3QO0B 3QR2A 1F4WH 5D7KD 4ENZA 5K9OB 4P2RB 3IPFA 1PGRB 3BFOA 5F6KA 5DJ2B 4K1YA 4NQDB 5HHPA 1BX2A 1MWAA 4MJ4A 5SV3A 1ZJBA 3MGAA 4S1SH 1OF4A 1UXWA 1RUPL 4IQHA 1LDPH 5ACLA 1OZ0A 3BKJH 5DPNA 3I4IA 5E79Z 2GUOB 2NY7L 5KHGA 4LP4A 1A02N 3KCYA 2P5BA 4KG8A 3VQYA 2RDSA 2F54A 2Y1VA 1INQA 1RJYB 1F5WA 3GIVA 2P80D 2QQWA 4X20A 1CD9B 2WY3B 4BFIA 2AXFB 1T3FB 2E76C 1MPAL 2Q30A 3DVNA 4XW3A 4W50A 4K71C 5JZGC 4U1NA 1ASOA 1ZSHA 2IXHA 1UH4A 5T1MA 1JPXA 1MNUH 3NK3A 5C0FB 4NNPH 4I1RA 2EIBA 3OMNB 4UTAL 4NO4A 3TC9A 1B4TA 2K9ZA 3W39A 2W6JG 1LWRA 2A6IA 2C9PA 2WGNB 2WQAA 4YO0A 4WHYG 2HA1A 4FYRA 1FNHA 4AEHH 3WE6B 5KZCD 1IXMA 1HH6A 1N6QH 4CDUC 1DVSA 1S3JA 4PDMA 2WXQA 5DVKA 3MO1A 5I26A 3WUDA 1LO2H 1P7KB 3HNSL 3OMIB 5DHVH 3MDSA 2HKOA 2HN7A 5I8OL 2QADB 1CLYH 2D7NA 3PV6B 3LNNA 4OY9A 1T5WA 4UAOB 1RXLA 4UTBA 4RR3B 2VITB 3WIHH 1CPYA 2DQUL 5F6HJ 3AFKA 3FRPG 3TIEB 4R8WL 4PJ7F 3DOIA 3OAZH 4MSWB 4Z7WE 1LUVA 1OCCB 1QY4A 3URFA 4PRPA 4JN2B 1J9CT 1QLEH 1WWAX 1OSPH 3DJSA 3EFFA 5IJCC 1ROWA 1ZHKA 4AL8L 2EUWA 1YEHL 2C9QA 4O2CB 5L7XL 1DDLA 2AJSH 1M7DB 3B9EA 1S0VA 3HIZA 2J7LA 2FEDD 3ZFEA 4RNRB 3IMTA 1I8KB 3PE9A 1NAMH 3N85H 4HIHA 2JXMB 1MS8A 1YIFA 2LGQA 4Z0BH 1TG8A 3NZSA 3NSCA 4P2QD 4JVAA 3IDEA 3DV8A 2C9SA 1W8TA 4HKJB 2QKIA 4HJUA 3O4LA 4GB32 1QATA 1XIWA 4DR1B 1BHAA 4KTDL 3LRLA 4PVBA 1Q1PA 5EDSA 3K72B 4WFGE 2ZAAA 5B39A 4CUAA 2OSLB 4GW4B 3O1VA 1D9KB 2J6EA 3L1OH 3NACH 2KR2A 4YRDA 3LZFH 4K9JA 3EYVB 5CLYA 1R33A 3CN3A 2OMZB 1OF2A 1PTZA 4N0UA 2MCG1 3TNMB 3QVAA 3BZEA 2DCKA 4FZ8L 3TCTA 3CMOH 5FK7A 1V9U3 1ZBA2 1U4FA 1U8NB 2R6QA 2L6LA 3S3WA 3C7GA 2EVXA 4JPWH 4AGMA 3LOBA 2E7AA 4OI4A 5HHMB 3BPCB 4JYYA 1KB5H 3MXVL 4WFED 1N34O 3P0GB 4N86A 3X3FH 5T3NA 2XDHA 1US3A 2IDTA 4LAQL 5I8EA 4QTFA 1JW6A 2LQRA 1XB9A 5F96H 5ABAA 1QJEA 3GDCA 1FAYA 3QZWB 1KJ2B 2IG2L 3IKWA 4UFMA 1CFTA 5H9CA 1TLKA 4WZCA 5FQ0A 3BZ4A 4HGWA 1XOYA 4AIZA 4LO4B 1Q3EA 1VQOV 1PD6A 4PREB 4I55A 1REIA 2UWEA 3FO1A 5KJ7E 2BGCA 2JD4A 1NFDF 2XWJB 1CFQA 5CADA 5FJHA 4ET7A 2UZPA 3K4ZA 3VXUA 4A41A 3MV7A 1MHCA 2VDML 4P30A 3PUQA 1GPOH 1V9U1 3AG2B 4XH2A 4NRPA 3GGWA 5G05L 4DK0A 2W65A 2QKAA 1H8SA 2XVBA 3N9OA 4NQSA 1RSOA 2V4VA 4FFVC 2B46X 1SOXA 1HHJB 3TBVB 3D85B 1GANA 5LAXA 4YQXH 1Z9OA 1F58L 2HT3C 5JQHC 2EEAA 2AXGB 4OJCA 1QLRA 3DSFH 3V8CA 3C3SA 4TWKA 2PY5A 4OF5A 3JALA 3FFCB 4WK4B 5GSVB 1OZUA 5E08L 1KFGA 3HKCA 3H9SD 4I3SL 2PCFB 3OZKA 4XBPA 2GKIA 4QX7A 2VTXA 1XB6A 2NN8A 4WM8B 3F01A 1NA8A 3GB7A 2IADA 3C9NA 4FS0A 1CF8H 5T1LB 4JI3B 1A7QH 3T1LA 3NIFE 1CGPA 1NC2A 2I27N 4R5XA 4A2FA 5KS9F 4L4JA 1DVQA 3DYMA 2VISA 2Q0ZX 5CD5C 4HANA 1KJVB 5EPMB 4AQYB 5CISA 2JSFA 2DQ0A 1A65A 2UYLB 4XC3H 1LP9F 1H9VA 3EHKA 4JREB 4TKWA 1XGTB 3SLIA 4I3GA 1CT8B 2FLMA 1E27B 4HFWB 2I5YH 3MF9A 1VB4A 5BOPA 4CDXC 5B1AC 2R59A 4MG2A 4X66O 1N7MH 1FIEA 2PWFA 4E9YA 1PNLA 4ZPTB 1XYNA 1UA6L 1YFXA 4R6ZA 3QDJD 3KWUA 4P4RB 4LLYA 1TR7A 1E2WA 1XQ8A 1BFSA 2YZ8A 4L48A 1KFUL 5DG2A 3E3QC 1W2TA 1V6LA 4EN3B 1M42A 3BPSA 4AGGA 1KBGH 4XUPA 5CLTA 3QO8A 1FBIH 5ILTH 2H0VA 3VX0A 4HPYL 3NMEA 1J8KA 4ELKB 5J1XA 3VW3H 2Y22A 4LBNA 4BXSV 5EEVA 1R092 1E6OL 4RFEA 5JCOA 1WGPA 4FQLH 3RDTA 3LIHA 5A6XA 4KO7A 3BP4A 1MFEH 2Y5TB 5B1KA 4HAMA 2QEXV 2DCJA 5FM4A 2WO2A 5GLTA 1AJOA 1OT5A 1WBFA 5FXZA 1HL8A 4BYYA 4Z7QE 4NKOA 5KN5B 4QQ2A 3QI9A 3F12B 4RO2A 3MODH 3SGKA 2E53A 4QDGA 3C75A 4OZOA 2RMNA 4XZUB 4CILA 1MS9A 2N0MA 4DT2A 3ZGIA 4XEZA 4PY8I 4JPIB 1CN4A 3ZMOA 1FFPA 1D5ZA 1R5IA 3P3YA 1KELL 1AJ7H 3TPUA 4Q2ZB 2PXYC 4IBWA 1TZOA 3NCYP 1WLDA 4P00B 1P7BA 1URXA 3DXAA 2ENJA 4XXPA 5J1TC 2WXKA 4QT5A 4UT6H 3HN5A 3UJJH 1NS1A 5FPVA 1VADA 5KHKA 4DR2B 1CB4A 3WOVA 4YSRA 1HJFA 3B8MA 4QRRD 1RPRA 4QDRA 1PLBA 4PR5A 2VWJA 2VUDA 1QU7A 5DK0A 3EBGA 4PJCF 4Z7VE 5E56A 4MADA 2P06A 1KBBA 3R8BB 2QKDA 5FREA 1F0LA 4U1IB 2DDQL 2WAOA 2ARCA 4KNSA 3K7UA