2LGWA

Solution structure of the j domain of hsj1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
71
structure length
71
Chain Sequence
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily B member 2
publication title The C-terminal helices of HSP70 are essential for HSJ1a J-domain binding and ATPase activation
doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 25
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lgwA00
2QWOB 2QWQB 3AG7A 4IT5A 2CTRA 1N4CA 4J7ZA 3UCSC 2CUGA 2QWRB 1FPOA 2Y4UA 4RWUA 1XBLA 2N04A 2M6YA 2YUAA 2PF4E 2N05A 3APQA 3UO2A 2LGWA 2DMXA 2DN9A 2QWPB 2YS8A 1BQZA 1HDJA 1WJZA 3UO3A 2CTWA 2EJ7A 4J80A 1BQ0A 2KQXA 1FAFA 2QSAA 1NZ6A 2Y4TA 2GUZB 3BVOA 2OCHA 1IURA 1GH6A 2CTPA 2QWNB 2GUZA 2L6LA 3APOA 2CTQA 2LO1A
chains in the Genus database with same CATH superfamily
1JA8A 1IX9A 3M8AA 1I5XA 2QDOA 3ZS8C 3FB6C 1FYJA 1KKCA 1HNWO 3AG1B 1VF6C 4I7ZB 5FPRA 4DV4B 4JI6O 4BIUA 4WFGA 1NQTA 2W6IG 1VF5B 2WSSG 5IYBO 4DW1A 4JV5O 2WLIA 1AB3A 4J7ZA 3UCSC 4RAIA 3AG4C 4NR1A 2QJ1A 3ASNC 5E1AC 4FK5C 1L1FA 1XHXA 4B3RO 1N36O 4PI2A 3HR0A 2PYJA 2AHYA 5IWAO 2QWPB 4H33A 4X62O 4MVSA 5IJ0B 4TQDA 1K97A 2ATKC 1K92A 4X65B 1T5EA 4ZIBA 3A0RA 3HKEA 4QJFB 1XREA 2CTQA 3N27A 1QR8A 1NTKH 3J7AU 2AGAA 1IBMO 5GW7A 4B7KA 4FM2A 1XILA 1VQPV 2WA4A 2CE4A 3UKMA 5EZYB 3ABTA 5LGUA 4ZI7B 5CA3A 1I0HA 1QLEC 5JH7B 4GKKB 4JASA 4UB8Z 3OUFA 3OFNG 3ZRSA 2ADPA 3DGEA 2XAGA 5BY1A 4FVMA 4DR4B 2VS0A 1B6QA 1JFFA 1FXHA 2UXDO 4JI2O 1BQZA 1FJGB 1OCZB 2FB5A 4WBNA 3VBBA 2ZKOA 2UXCB 2WAMA 5LYJB 3JAMN 4O4LA 5IE9A 3SPJA 3ZHVA 1FXKA 2JJ2G 4CH4A 3ZHTA 1GMGA 3CWBH 1PP9H 1R6NA 4JYCA 1QQCA 5JQGA 3CRMA 5LA6A 1OV9A 1XMOO 3RVZA 2ZDIA 2R70A 3K0GA 3CSXA 5GONA 3WFVA 1YTFB 4O4HA 5CB4B 1IDSA 2QKCA 4CC6A 1XNRB 1P49A 4KXRA 1KP3A 3GB7C 1EZJA 1MNGA 4WCEV 4CZZA 5KHHA 1YZBA 4O2BA 3AEIA 4UCVA 3B8NA 3ZRXA 1RM1C 1WPBA 3UT5A 5KHKA 2P22C 1FFTB 2IU3A 4FFBA 2XHBA 2VRZA 5J9PC 5LMUO 1O9GA 2WLMA 1H8EG 1XBLA 2ZR3A 4AILC 1VF6A 1F4NA 5ITZB 2X6AA 1RSOA 4L87A 2Q7HA 4DV1O 4LFAB 4UCUA 3CEIA 5KHGA 1VQ8V 2WPDG 3OGCC 5L3EA 4DUYO 2HFEC 4QPJA 3LNNA 4H13B 4JTAB 1QNMA 4TV9A 2R9RB 3OT7A 1AJNA 3T2MA 2CGOA 2Q68A 1N33O 3T1HB 1CP9A 5LGTA 4DW0A 2R9IA 4WFAV 4DR2O 4PA6A 1TVKB 2KSDA 4J7KA 2LJ2A 1YITV 1SF9A 2CH7B 4FM0A 3SGIA 1MSWD 5A2QN 1SQXH 4DV4O 3B40A 1JJOA 4X1IA 3SYOA 5LHIA 1WPXA 3IJ4A 1KECA 4A5UB 2ZE5A 2PY5A 2XTAA 2Z5UA 2LFSA 1TA8A 4E2LA 4J10A 5D5PA 4DR3B 3H1LH 3BY6A 2HVKC 4CH5A 4H44B 3HKBB 1S5HC 4KHPO 1M56C 4P9OA 3B4SA 3ZCCA 5EYPA 2YDEA 3G6BA 3APOA 3B8MA 1WLEA 3ETEA 1KD1W 2GTAA 1TUBA 1WB8A 4JI4B 4PDMA 1FD9A 3ABMC 4PD4F 1SERA 1Z5VA 4CBCA 1G4YB 3HKDB 2LGQA 3D3IA 1JVMA 2ZM6O 3JALB 1GK9A 3P3NA 4DR6B 4LF4B 4GZRB 3LDEA 2L6LA 3AG2B 2ZXWC 3BRCA 3G4SV 2EJRA 3KCYA 3OEHG 3VQYA 5BXZA 1W59A 1BGYH 2KKWA 3LSQA 2IJKA 1VQ5V 2WLLA 1US6A 2M6YA 1FJGO 4CH6A 2JEXA 3G67A 4Q6GA 4JI7B 3F7VC 3RFRA 4FLTA 1VIBA 2ADQB 2EIMB 2Q5ZA 1YF2A 2DYSB 1TGOA 2YI9A 3F7YC 4DXWA 1XL4A 1ZLZA 5KMGB 3FAVA 4OPAA 1KYOF 2Y69B 4EKWA 3T1YB 5CA0A 2D2CB 3SJBC 2KB1A 4YJ3B 1SC5B 3CRQA 4I55A 4X1YA 3OMAB 4CS2A 2JGDB 1XNRO 4X1KB 4FLUA 4UFZA 2WLIB 3BCCH 1SRYA 1WNSA 5JJJB 4PV1B 3SYQA 2YXLA 3TJTA 1Q81W 3VQWA 4MTXA 1ZL8A 2BOCC 3HKCA 1VQLV 1VQ6V 4X66B 4DV2B 1Q8IA 1LUVA 3ZBHA 4P2ZA 4DK0A 2UXBO 5C8YB 1D5NA 2CAZC 4LH6A 5E79Z 3JD4A 4FPPA 2DOSA 3PN1A 1L0LH 2HKOA 3CRCA 4B3MB 4YJ2B 1DGSA 3TETA 2DYRC 5F2VO 2A06H 1NJIW 4LWSA 3CXCU 5B1NA 1HNXO 4ASUG 3ZMUA 1HR0O 1QCEA 4ZOLA 4JYBA 2UXNA 3T1HO 5LMNO 5K1PA 1Y6XA 5CA1B 1SKVA 3UO3A 2EJ7A 4WBNB 2UU9O 1QHTA 1VF7A 1G1XB 4OGQB 4JTDB 1VQNV 3L72H 4MVMA 3X2QB 4Z1VA 1MG1A 1EN5A 4IYHA 4O2AA 3FYEB 4QIWF 1K5QA 1WA8B 1OHHG 3E89A 4IHJA 4MW3A 1P4RA 4WFBV 1R3LC 5LA6B 2ZNJA 3BAAA 3ZHUA 4QE9A 1VQMV 4FJCC 1YVWA 1R3IC 3P3PA 1PNKA 2DQ0A 4JI8B 2JDIG 5EBMC 2IJHA 2WWWA 1OZ0A 1BZKA 3E22A 4FLVA 5CBGA 1Y74A 3L75H 3AK2A 2OCCC 5H6QA 4XDLA 2VQEB 1XI1A 3KKYA 1F23A 1FXVA 3RYFA 2OWOA 4OX9B 3UT5B 4J80A 3CX5F 4DYLA 2RCVA 5B1AC 3ZJZA 3CJHB 3CCRV 1NKDA 4EB6A 1SA0B 1SZXA 2GV9A 4KFMA 2OIGA 2VWJA 4UV9A 4LBEC 2F95B 2YS8A 1PL0A 1FFXA 4K35A 3JAKA 4L8JA 4JI3B 4LF4O 3J81N 3CCQV 4MT8A 3SPIA 5IY5C 2P90A 3TXSA 4NXMB 2EILC 4N23A 4I9QA 2WLKA 1R3JC 3AK1A 4LF6B 1ORQC 1YEWA 3SYPA 4LF5O 1DF4A 4JI7O 3JAWA 4DV0B 4TV9B 2NR5A 1FXKC 3JD0A 3ETGA 3WB2A 1K7DA 2QM8A 2QE7G 1GRJA 3RYCA 3AK3A 2PZSA 3IC7A 2G38A 1NH2D 4F6RA 5LGNA 3RYIA 2F23A 3IFXA 4GKJO 1XEQA 4GUNA 4RWUA 1K34A 3E2EA 1SETA 1CEZA 2R72A 5IJ9A 5LOVA 2LGWA 1EM1A 5AG2A 3E8HA 4X1IB 1QLEB 2E5LB 5IYZA 1B3QA 2HHHB 3N2GA 1Q90D 3B77A 1I7FA 1ENVA 2H3OA 2ETNA 4DRXB 4NYKA 3K03A 2P06A 3L74H 2XNDG 2HEPA 4GX5A 3UO2A 4B7EA 4MVOA 2CK3G 1B04A 1QR9A 4X66O 1WB7A 4CS4A 5JVDB 3STZC 1BQ0A 3JASA 4DV2O 4UCRA 2XAJA 4GX0A 3LDDA 2RMKB 4TV8A 1AJQA 4I0XA 1H2GA 2RQ6A 2OT5A 1SQQH 3M7MX 2A3QA 4ZHQB 5BZBA 4R8CA 2UUCO 5FL7G 2DW4A 2Q4PA 4JI5O 4OPHA 4RQEA 5CBFA 4IYIA 1LR1A 4B3SB 2A0LA 5H5NA 2Q0AA 4D6TH 3CRAA 4TT3G 3AG3C 2E74B 4PDVA 3L73H 1F4MA 1NR1A 2OTLV 3TGUH 1DLBA 2EULA 3BA9A 3JD2A 3ZEDA 2OCHA 3KZIZ 1MSDA 1M93A 4U3JA 4B3TB 1VQOV 4GYCB 2O57A 1KUQA 4DV7B 2V7QG 2A9HA 5CA0B 1I94B 1AVMA 4FLZA 1JCHA 4G27B 2C2AA 2LW7A 2EIJB 4I55B 1ZUQA 3VOUA 2Q6AA 4HNAB 1K9MW 3U0ZA 2ZT9B 5H6RA 1XL6A 1VQ7V 1L0NH 4JI8O 1PNMA 4LP8A 1M90W 3L71H 2IW5A 2X6CA 4O4IA 4P30A 4FIPC 5KAIZ 2Q7EA 1HNZB 1KB9F 3FB5C 4WFEA 3JARB 1ZL8B 1SQPH 4OX9O 1XDCA 3OMNB 1HWYA 4PDRA 3P30A 2ZQMA 5TISZ 1THZA 3JYCA 1GAXA 1EFRG 4XDJA 4LNUA 1N34B 4FLWA 1KBHA 4MSWC 2ZCEA 4JZ2A 1EN6A 4LC1A 5LP6C 3ASOB 3L70H 2PUSA 4JI3O 3APQA 1BHAA 2RN9A 2BTQA 1M57B 4O4JA 3A2FA 4K8XA 1W0KG 4FLYA 2P4VA 1K73W 4LF6O 4IGGA 1IXMA 5HFLA 3CCLV 3CCJV 2YIBD 3ABKC 4DV0O 2FYUH 4RUEA 1NVPD 5FNVA 2QM7A 3EXAA 3C90A 3QF7A 1K4DC 4XBFA 4J42A 2DN9A 4JI1B 4LFBO 4WFFA 3ICXA 4MVQA 1P7BA 3GWOA 2ITDC 2XAQA 4O2AB 3BHPA 2NNUA 2AW9A 2KG7A 5BMVB 4UCOA 4FLXA 3I55V 2HJDA 3CE2A 1OCCC 2HHHO 3S3XA 1WJZA 2ZXWB 4UB6Z 2ZIOA 2ZD9A 4BR6A 1ZX3A 3RT3C 4CC5A 4BWAA 3FFQA 4JI0B 3E22B 2W0XA 3TCUA 2AHZA 2PYLA 1O9HA 1S72V 3FD9A 4IIJA 4X20A 2YIBA 4JAUA 5B66Z 5KA6A 1H2MA 4X89A 1JR9A 2YXHA 1S77D 3BA8A 2QKSA 3RYFB 1PL4A 3K04A 4UVCA 1XQ8A 5IYDO 3DXRB 1Q6UA 2BSKB 2Q73A 1NTMH 3G71V 2F4VB 2IH1C 5EIBC 1Q43A 3AG7A 2JRIA 2P67A 3WG7C 4OXSA 2YEVB 2YIDA 1EN4A 4JAVA 1BT8A 1IBKB 1FFXB 1AR4A 4X65O 1IVSA 1NS1A 1MABG 3ZMTA 5J2UB 1WP7A 1PV0A 3JD3A 4AHCA 4ABMA 4B3SO 3K06A 3RWRD 3MAQA 1KKDA 2KQXA 5B5EZ 4YHHB 3H9VA 3GVMA 3J80N 1NR7A 3ABLC 3RYHB 2QWQB 5J2TB 4F4LA 3UM7A 2UUBB 2MK3A 4QE7A 3OGIB 3ZHQA 4J7JA 4DR5B 4YIPA 4LFCB 2Q67A 1M5IA 4NVPA 1AJPA 3OAAG 4NXNB 2WLNA 4B3TO 4GKKO 1V9PA 1XNQB 4PA9A 5LXTB 4F6EA 4DV7O 1SQGA 5D5QA 1I94O 5L3BA 4K3AA 5KHJA 5LP6A 2CUGA 2M7WA 4DR4O 1JPXA 4MVUA 5IJ9B 1JX9A 2DYRB 1J5EB 3L9DA 4W4KA 3ZHSA 3F5TA 5IYZB 1H2LA 5KAFZ 3RGBA 2UXCO 1WP8A 2BTOA 1NZ6A 3CXHF 4LF8B 1HNZO 3CCUV 3M99B 1ROPA 4NTWA 5B3SB 1SQVH 1D5AA 5GTIZ 3K5MA 1AILA 4Z2WA 2EZOA 4LH7A 3F5WC 5EZYA 3JASB 1S5JA 1YSCA 2ARHA 1YCIA 3H1JH 2ZE6A 2JS5A 4KP4A 5JH7A 5B1BC 3K9AA 5BR8B 1KU9A 3B2EE 1NH2B 4K0KB 2WLJA 4DUZB 3CB2A 1AI6A 5DECA 4CH3A 3GWKC 5A9GA 1ZWIC 4RUFA 5EC1C 3UQ8A 2CDYA 4K8ZA 3A0HZ 1JMKC 1E79G 3K5LA 4YY3B 3HKEB 2YXYA 5LYJA 1K4CC 2GDSA 2OCCB 3OUSA 3QG5A 1QU7A 3ZRVA 1D2DA 2P4KA 1GM8A 1M9NA 3G6EV 3Q4HA 1MOFA 4WF9V 5DN6G 1OCOB 4LF9B 2Q0OC 3QO7A 4LFAO 4QNHB 1BMFG 4I5SA 1IZ3A 4IL6Z 5FPOA 5B1AB 1OCRC 2DWDC 4U3JB 1S76D 3ZX6A 2A7WA 5EBLC 3W7XA 3SPHA 3H01A 3R66A 1GO3F 2RNBA 1SQFA 3VQVA 1JFFB 2Y0PA 5IDJA 5C93A 5IY5B 2EILB 4BW9A 3K5OA 1N36B 3PJSK 5KX5A 3OR6C 2BOBC 1MZEA 4DV3B 2DQ3A 1W2BU 4X62B 1SESA 2GBOA 3HB3B 4JI0O 3K59A 3CHXA 2LP7A 3C3SA 4O4LB 3MHSC 3FKSG 1GM9A 2OYQA 1FXKB 5LHGA 1Y67A 2AXTZ 3OMIB 2PI5A 5JQGB 2VWKA 1KMIZ 4MVRA 1V55C 5ITZA 2Y69C 4PJ0Z 4GX1A 2XT9A 2FMLA 5GONB 2HVJC 4O4HB 4UVBA 2OTJV 4LNUB 2EIKB 2LFRA 1S0VA 2FKXA 1Q6IA 4DR3O 2JIZG 4DO2A 1GN3A 2H8PC 2WLHA 4HYOA 2PGGA 1QLNA 2FTKA 4O2BB 3CCMV 4JI2B 1K33A 4YHHO 1AI5A 3O65A 2QKAA 2EBOA 2OIEA 2UUBO 4JI4O 3KCXA 1TVKA 4FFBB 3LSSA 2QWRB 4PDLA 4DR5O 1NT2B 4MS2A 4LFCO 2RJZA 2CH7A 4AI8A 1RSOB 3T4ZA 4DR6O 1XNQO 1Q5OA 3C3TA 1R73A 2V4DA 2CTPA 2Q7GA 3CC7V 3AG4B 3OTOB 1W0JG 3ASNB 4E4EA 1AI7A 1TUEB 4J9YB 3K58A 2QGNA 5KHIA 2KG7B 1TAEA 4HAMA 5KLVH 1R1BA 2ZE7A 3HKBA 2QM4A 2B9ZA 3E8FA 2HG5C 4LF8O 4I4TA 3ABUA 1Q86W 1Y4MA 3TXQA 4WFHA 4ZBMA 2IM9A 3T1YO 1URFA 1MZFA 2DJVA 3CYOA 1EZVH 3ZN1A 1NVPB 1GTOA 3HKDA 4KL1A 3DC5A 2R9AA 3P32A 3R65A 3ZRWA 4HZ3A 2E3CA 4DV1B 3SJQC 1IURA 4K0KO 1Q6HA 4BW5A 2F66C 4EFBA 3SJCC 4DUYB 5H9CA 4J11A 2F93B 3S3WA 1RPRA 3D3QA 1BL8A 4X64B 3QTCA 1Y66A 2GHYA 4DV5B 5EYPB 2XAHA 3OEEG 1NBMG 3LUTB 2Y4TA 3RVYA 1N33B 2ZE8A 4DR7B 3W7SA 1TUBB 4DR2B 4NKGB 1N4CA 5KMGA 1Q7YW 3ETQA 4TOIA 2NN4A 4LF9O 4DR1B 3K0DA 4B3MO 4XDKA 4MTFA 1VQ9V 4YJ3A 4PA3A 4JYAB 3BEHA 2B1IA 1KQSU 2UUAB 3E8BA 2JGDA 3BFRA 1WN7A 3ZN0A 4X1KA 5LBQA 5LP6B 2EINC 1V54C 3W7UA 2WLLB 4DV6B 4I50A 1VQ4V 4HBNA 3N2KA 1F51A 4JZGA 4DV3O 1RM1B 5KUMA 1HDJA 4TSFG 2N74A 3ZMSA 4KHPB 1VP7A 2L35A 3ABKB 2QSAA 2E75B 1GH6A 4N21A 2GUZA 2LO1A 1YJ9V 3EVKA 3FAVB 4TQFA 3E8GA 2V1DA 1P84F 3DTUB 3IAYA 4DK1A 3K57A 4J41A 4BAYA 5C8YA 1FS0G 4X1YB 2NLJC 2X7RB 4I9WA 1S5LZ 4YJ2A 3B09A 1G8MA 2GTSA 2ZM6B 1YJWV 1SS3A 4PA4A 1QVGU 2ILMA 3JCZA 2YSUB 1OCCB 4JF3A 2E76B 1BS3A 2VQEO 4RQFA 1RFYA 1J95A 1IBLB 1NTZH 1XMQB 2Y48A 3HKCB 4TUYA 4D7TA 2B1GA 5CA1A 1Z5WA 2ZR2A 1UJWB 5L3CA 3AG1C 5K1XA 2IU0A 3OTFA 3G80A 1I5YA 2ODMA 1H2NA 4Z1MG 4QGPA 1YXBA 3Q4HB 1WA8A 3H1HH 1YIJV 2DMXA 2H94A 3WU2Z 1UPGA 2Y0IA 3BABA 3QO5A 4NXMO 1DF5A 2XASA 3CCEV 2LQTA 3OTOO 3WG7B 1H2KA 3JSLA 2YC0A 4LWSB 3CCVV 3CCSV 1NI8A 2JEUA 3FYIB 1Y76A 3O9OA 4UXNA 3JSNA 1YHQV 4ZOLB 3MHHC 1M56B 1A32A 3K79A 4H37A 3ZMVA 2WA3A 1YDXA 5KX5B 3D36C 3JATA 1YI2V 5H2FZ 2X0LA 3ABLB 5LHHA 1ZSPA 4BIZA 1PPJH 4D7SA 3D8CA 3LSUA 3ABMB 3SPCA 1PKXA 3CJHA 2D3OW 1VARA 4IHJB 4GX2A 1SA0A 3ZIAG 1SQBH 1SZTA 2UXBB 2E5LO 2F1MA 3CRRA 2CTWA 2EIJC 3H1KH 1XUQA 4GCZA 4ICGA 5EBWC 2PTMA 1DTOA 1P7GA 1YJNV 5KUKA 2VQFB 1OCZC 2B5UA 3THOA 1Y74B 1B06A 3E86A 4YIOA 1HNXB 2F43G 4X64O 1BE3H 1HR0B 3OE7G 4G28B 2DE0X 4DV5O 1ZTEA 5LMNB 4DR7O 3FB8C 4Q20A 4PHZA 2UU9B 4X88A 5CN0A 2HP8A 2HJFC 2N05A 1H2SB 4DR1O 4EB6B 3CMAV 2Q9LA 4JTCB 5CMUA 2X6BA 2Q8VA 4JYAO 3H1IH 1OJHA 2QA4V 2UUAO 3ZHRA 4CS3A 3JAKB 2BE3A 3IC9A 5CBHA 1K5SA 1N8RW 3ASOC 4PA7A 4R7CA 5B1BB 4R6ZA 3ML0A 1AP5A 3BVOA 1M57C 1G6UA 1E1QG 4DV6O 4DRXA 3FX7A 1PNLA 2GSMB 3FB7C 4MTGA 1JJ2U 1NU1H 3JAWB 1I08A 2K9PA 1HW7A 3RYCB 4I4TB 1E1RG 3T1CA 5JVDA 2P7TC 5JWPA 5IT9N 2QWNB 4F6RB 3RYIB 1QBZA 3CPWU 4B08A 1VQKV 2AZ2A 5EK0A 3TK1A 1K3EA 1Z2GA 3QO8A 5LOVB 1R3KC 1N32B 1OCRB 1L8DA 2JGUA 1GN2A 2UXXA 4ZHQA 3MDSA 1UFIA 5L3GA 3ZRWB 3N2GB 5IJ0A 3SPGA 1VMGA 4JYYA 4UCTA 1BHBA 5JCOC 1BSMA 3NR7A 4X9QA 3E83A 1AROP 1IBLO 3D36A 1XMQO 4FZ1A 3K08A 1PD3A 4LF5B 4LF7B 1QVFU 5EIBD 3OD4A 4UV8A 3KG2A 4TWKA 1YTFD 4ZKIA 2RDCA 2YIAA 2AZ0A 1HP8A 4ZI7A 1N34O 4QPKA 2QTOA 4TV8B 2IJJA 4FFKA 3LNMB 1V55B 4I0XB 1FPOA 1COWG 2P6JA 1IXBA 4GKJB 4AQYB 2QEXV 5DEDA 4U7OA 4HNAA 1AP6A 4RO2A 2K1EA 2W6JG 2ZNIA 4EFEA 5GTHZ 1Q3EA 4FM1A 2EZPA 5EC2C 1ZAUA 3NXSA 3CD6V 4UVAA 3OM3B 4I50B 3A0BZ 2Y4UA 3N2KB 3RN4A 2QR4A 3JARA 1H8HG 2EX3A 4JI1O 3CMEV 3QNEA 3CC4V 2JK5C 2PI4A 4PI0A 1HNWB 2FL4A 1RPOA 3EFFK 2GUZB 1PM9A 4JI6B 2A79B 3W7TA 3HPLC 5CB4A 3SYAA 2QWOB 3QVNA 5JJEB 1N0NA 4JV5B 1AI4A 3OR7C 2IBZH 3AG2C 3I56V 1LNQA 2PF4E 4FMTA 1JQ0A 4H0LB 2ITCC 4MW8A 4B3RB 1M1KW 1F7YA 2UUCB 1U96A 1EBOA 2XAFA 4JI5B 5IWAB 1CPYA 4O4IB 1CXZB 2VQFO 3EHBB 4YXWG 5FLXN 2EIMC 2HR3A 1FKAO 4U7NA 4R50A 5LL6Y 3K5NA 2DYSC 5JJNB 1DK1A 1IBMB 3T4DA 2BCCH 4J9ZB 2JJ1G 1Q82W 4TUYB 2QTSA 3WB1A 2JVDA 5B3SC 1GKFA 3U10A 5DM6V 1AR1B 2YI8A 3SYCA 3RBZA 2F4VO 3I5DA 4C7UA 3DSQA 1R6TA 5L3DA 4X8AA 4UUJC 4JGSA 1GM7A 2YICA 4G2KA 4MVZA 4W4LA 3ZMZA 1VEWA 1LUWA 1IBKO 5BMVA 1XOUA 4UCSA 1X59A 2BTQB 4O4JB 2UXDB 3SDLA 4MTOA 3LDCA 4JPRA 3WB0A 3BPZA 5JCOA 1M4UA 5HFMA 2XUMA 4KUMA 3RW0A 1MA1A 1Y76B 4PELA 3CP1A 1XHZA 3E35A 3IGAC 5FNVB 2N04A 2Z0AA 1K8AW 4NTXA 2ZINA 3JATB 2ZIMA 4NXNO 3SR2C 1WAZA 3W7WA 1XMOB 1OCOC 2DWEC 3DXRA 2BSKA 1AR5A 3DC6A 1N32O 5IYCO 4BIOA 2YEVA 1J5EO 2MW2B 3U11A 1H38A 2XOKG 2HLDG 2YUAA 3OW2U 3JD1A 4EEQA 3A8TA 3VQXA 3CS5A 4LR3A 5J2UA 2CGNA 2EINB 2LW1A 1V54B 4JAAA 4P9PA 4GT1A 1N0JA 3AG3B 4IT5A 2CTRA 3RYHA 5J2TA 1X4TA 2IJIA 4LF7O 4LCUC 1R6KA 4IIJB 3K3WA 4X20B 3X2QC 1RP3B 5LMUB 1GN4A 4FZ0A 4U3FH 3ETDA 3STLC 4LFBB 1FAFA 1KP2A 3JALA 2ZDIC 5LXTA 5BR8O 1BCCH 4GLXA 4DUZO 2P5OA 3K9SA 2IH3C 1S3JA 4AQYO 2Q69A 3SJAC 2EIKC 1GN6A 3CC2V 4NTYA 3MD0A 2Z3YA 5L3FA 4YY3O 1KC8W 2JS3A 5B1OA 2W0FC 1MMMA 5KA5A 3JCUZ 1JOYA 4NB5A 1U97A
chains in the Genus database with same CATH topology
2QWOB 2QWQB 3AG7A 4IT5A 2CTRA 1N4CA 4J7ZA 3UCSC 2CUGA 2QWRB 1FPOA 2Y4UA 4RWUA 1XBLA 2N04A 2M6YA 2YUAA 2PF4E 2N05A 3APQA 3UO2A 2LGWA 2DMXA 2DN9A 2QWPB 2YS8A 1BQZA 1HDJA 1WJZA 3UO3A 2CTWA 2EJ7A 4J80A 1BQ0A 2KQXA 1FAFA 2QSAA 1NZ6A 2Y4TA 2GUZB 3BVOA 2OCHA 1IURA 1GH6A 2CTPA 2QWNB 2GUZA 2L6LA 3APOA 2CTQA 2LO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  2QWQ B;  3AG7 A;  4IT5 A;  2CTR A;  1N4C A;  4J7Z A;  3UCS C;  2CUG A;  2QWR B;  1FPO A;  2Y4U A;  4RWU A;  1XBL A;  2N04 A;  2M6Y A;  2YUA A;  2PF4 E;  2N05 A;  3APQ A;  3UO2 A;  2LGW A;  2DMX A;  2DN9 A;  2QWP B;  2YS8 A;  1BQZ A;  1HDJ A;  1WJZ A;  3UO3 A;  2CTW A;  2EJ7 A;  4J80 A;  1BQ0 A;  2KQX A;  1FAF A;  2QSA A;  1NZ6 A;  2Y4T A;  2GUZ B;  3BVO A;  2OCH A;  1IUR A;  1GH6 A;  2CTP A;  2QWN B;  2GUZ A;  2L6L A;  3APO A;  2CTQ A;  2LO1 A; 
#chains in the Genus database with same CATH topology
 1JA8 A;  1IX9 A;  3M8A A;  1I5X A;  2QDO A;  3ZS8 C;  3FB6 C;  1FYJ A;  1KKC A;  1HNW O;  3AG1 B;  1VF6 C;  4I7Z B;  5FPR A;  4DV4 B;  4JI6 O;  4BIU A;  4WFG A;  1NQT A;  2W6I G;  1VF5 B;  2WSS G;  5IYB O;  4DW1 A;  4JV5 O;  2WLI A;  1AB3 A;  4J7Z A;  3UCS C;  4RAI A;  3AG4 C;  4NR1 A;  2QJ1 A;  3ASN C;  5E1A C;  4FK5 C;  1L1F A;  1XHX A;  4B3R O;  1N36 O;  4PI2 A;  3HR0 A;  2PYJ A;  2AHY A;  5IWA O;  2QWP B;  4H33 A;  4X62 O;  4MVS A;  5IJ0 B;  4TQD A;  1K97 A;  2ATK C;  1K92 A;  4X65 B;  1T5E A;  4ZIB A;  3A0R A;  3HKE A;  4QJF B;  1XRE A;  2CTQ A;  3N27 A;  1QR8 A;  1NTK H;  3J7A U;  2AGA A;  1IBM O;  5GW7 A;  4B7K A;  4FM2 A;  1XIL A;  1VQP V;  2WA4 A;  2CE4 A;  3UKM A;  5EZY B;  3ABT A;  5LGU A;  4ZI7 B;  5CA3 A;  1I0H A;  1QLE C;  5JH7 B;  4GKK B;  4JAS A;  4UB8 Z;  3OUF A;  3OFN G;  3ZRS A;  2ADP A;  3DGE A;  2XAG A;  5BY1 A;  4FVM A;  4DR4 B;  2VS0 A;  1B6Q A;  1JFF A;  1FXH A;  2UXD O;  4JI2 O;  1BQZ A;  1FJG B;  1OCZ B;  2FB5 A;  4WBN A;  3VBB A;  2ZKO A;  2UXC B;  2WAM A;  5LYJ B;  3JAM N;  4O4L A;  5IE9 A;  3SPJ A;  3ZHV A;  1FXK A;  2JJ2 G;  4CH4 A;  3ZHT A;  1GMG A;  3CWB H;  1PP9 H;  1R6N A;  4JYC A;  1QQC A;  5JQG A;  3CRM A;  5LA6 A;  1OV9 A;  1XMO O;  3RVZ A;  2ZDI A;  2R70 A;  3K0G A;  3CSX A;  5GON A;  3WFV A;  1YTF B;  4O4H A;  5CB4 B;  1IDS A;  2QKC A;  4CC6 A;  1XNR B;  1P49 A;  4KXR A;  1KP3 A;  3GB7 C;  1EZJ A;  1MNG A;  4WCE V;  4CZZ A;  5KHH A;  1YZB A;  4O2B A;  3AEI A;  4UCV A;  3B8N A;  3ZRX A;  1RM1 C;  1WPB A;  3UT5 A;  5KHK A;  2P22 C;  1FFT B;  2IU3 A;  4FFB A;  2XHB A;  2VRZ A;  5J9P C;  5LMU O;  1O9G A;  2WLM A;  1H8E G;  1XBL A;  2ZR3 A;  4AIL C;  1VF6 A;  1F4N A;  5ITZ B;  2X6A A;  1RSO A;  4L87 A;  2Q7H A;  4DV1 O;  4LFA B;  4UCU A;  3CEI A;  5KHG A;  1VQ8 V;  2WPD G;  3OGC C;  5L3E A;  4DUY O;  2HFE C;  4QPJ A;  3LNN A;  4H13 B;  4JTA B;  1QNM A;  4TV9 A;  2R9R B;  3OT7 A;  1AJN A;  3T2M A;  2CGO A;  2Q68 A;  1N33 O;  3T1H B;  1CP9 A;  5LGT A;  4DW0 A;  2R9I A;  4WFA V;  4DR2 O;  4PA6 A;  1TVK B;  2KSD A;  4J7K A;  2LJ2 A;  1YIT V;  1SF9 A;  2CH7 B;  4FM0 A;  3SGI A;  1MSW D;  5A2Q N;  1SQX H;  4DV4 O;  3B40 A;  1JJO A;  4X1I A;  3SYO A;  5LHI A;  1WPX A;  3IJ4 A;  1KEC A;  4A5U B;  2ZE5 A;  2PY5 A;  2XTA A;  2Z5U A;  2LFS A;  1TA8 A;  4E2L A;  4J10 A;  5D5P A;  4DR3 B;  3H1L H;  3BY6 A;  2HVK C;  4CH5 A;  4H44 B;  3HKB B;  1S5H C;  4KHP O;  1M56 C;  4P9O A;  3B4S A;  3ZCC A;  5EYP A;  2YDE A;  3G6B A;  3APO A;  3B8M A;  1WLE A;  3ETE A;  1KD1 W;  2GTA A;  1TUB A;  1WB8 A;  4JI4 B;  4PDM A;  1FD9 A;  3ABM C;  4PD4 F;  1SER A;  1Z5V A;  4CBC A;  1G4Y B;  3HKD B;  2LGQ A;  3D3I A;  1JVM A;  2ZM6 O;  3JAL B;  1GK9 A;  3P3N A;  4DR6 B;  4LF4 B;  4GZR B;  3LDE A;  2L6L A;  3AG2 B;  2ZXW C;  3BRC A;  3G4S V;  2EJR A;  3KCY A;  3OEH G;  3VQY A;  5BXZ A;  1W59 A;  1BGY H;  2KKW A;  3LSQ A;  2IJK A;  1VQ5 V;  2WLL A;  1US6 A;  2M6Y A;  1FJG O;  4CH6 A;  2JEX A;  3G67 A;  4Q6G A;  4JI7 B;  3F7V C;  3RFR A;  4FLT A;  1VIB A;  2ADQ B;  2EIM B;  2Q5Z A;  1YF2 A;  2DYS B;  1TGO A;  2YI9 A;  3F7Y C;  4DXW A;  1XL4 A;  1ZLZ A;  5KMG B;  3FAV A;  4OPA A;  1KYO F;  2Y69 B;  4EKW A;  3T1Y B;  5CA0 A;  2D2C B;  3SJB C;  2KB1 A;  4YJ3 B;  1SC5 B;  3CRQ A;  4I55 A;  4X1Y A;  3OMA B;  4CS2 A;  2JGD B;  1XNR O;  4X1K B;  4FLU A;  4UFZ A;  2WLI B;  3BCC H;  1SRY A;  1WNS A;  5JJJ B;  4PV1 B;  3SYQ A;  2YXL A;  3TJT A;  1Q81 W;  3VQW A;  4MTX A;  1ZL8 A;  2BOC C;  3HKC A;  1VQL V;  1VQ6 V;  4X66 B;  4DV2 B;  1Q8I A;  1LUV A;  3ZBH A;  4P2Z A;  4DK0 A;  2UXB O;  5C8Y B;  1D5N A;  2CAZ C;  4LH6 A;  5E79 Z;  3JD4 A;  4FPP A;  2DOS A;  3PN1 A;  1L0L H;  2HKO A;  3CRC A;  4B3M B;  4YJ2 B;  1DGS A;  3TET A;  2DYR C;  5F2V O;  2A06 H;  1NJI W;  4LWS A;  3CXC U;  5B1N A;  1HNX O;  4ASU G;  3ZMU A;  1HR0 O;  1QCE A;  4ZOL A;  4JYB A;  2UXN A;  3T1H O;  5LMN O;  5K1P A;  1Y6X A;  5CA1 B;  1SKV A;  3UO3 A;  2EJ7 A;  4WBN B;  2UU9 O;  1QHT A;  1VF7 A;  1G1X B;  4OGQ B;  4JTD B;  1VQN V;  3L72 H;  4MVM A;  3X2Q B;  4Z1V A;  1MG1 A;  1EN5 A;  4IYH A;  4O2A A;  3FYE B;  4QIW F;  1K5Q A;  1WA8 B;  1OHH G;  3E89 A;  4IHJ A;  4MW3 A;  1P4R A;  4WFB V;  1R3L C;  5LA6 B;  2ZNJ A;  3BAA A;  3ZHU A;  4QE9 A;  1VQM V;  4FJC C;  1YVW A;  1R3I C;  3P3P A;  1PNK A;  2DQ0 A;  4JI8 B;  2JDI G;  5EBM C;  2IJH A;  2WWW A;  1OZ0 A;  1BZK A;  3E22 A;  4FLV A;  5CBG A;  1Y74 A;  3L75 H;  3AK2 A;  2OCC C;  5H6Q A;  4XDL A;  2VQE B;  1XI1 A;  3KKY A;  1F23 A;  1FXV A;  3RYF A;  2OWO A;  4OX9 B;  3UT5 B;  4J80 A;  3CX5 F;  4DYL A;  2RCV A;  5B1A C;  3ZJZ A;  3CJH B;  3CCR V;  1NKD A;  4EB6 A;  1SA0 B;  1SZX A;  2GV9 A;  4KFM A;  2OIG A;  2VWJ A;  4UV9 A;  4LBE C;  2F95 B;  2YS8 A;  1PL0 A;  1FFX A;  4K35 A;  3JAK A;  4L8J A;  4JI3 B;  4LF4 O;  3J81 N;  3CCQ V;  4MT8 A;  3SPI A;  5IY5 C;  2P90 A;  3TXS A;  4NXM B;  2EIL C;  4N23 A;  4I9Q A;  2WLK A;  1R3J C;  3AK1 A;  4LF6 B;  1ORQ C;  1YEW A;  3SYP A;  4LF5 O;  1DF4 A;  4JI7 O;  3JAW A;  4DV0 B;  4TV9 B;  2NR5 A;  1FXK C;  3JD0 A;  3ETG A;  3WB2 A;  1K7D A;  2QM8 A;  2QE7 G;  1GRJ A;  3RYC A;  3AK3 A;  2PZS A;  3IC7 A;  2G38 A;  1NH2 D;  4F6R A;  5LGN A;  3RYI A;  2F23 A;  3IFX A;  4GKJ O;  1XEQ A;  4GUN A;  4RWU A;  1K34 A;  3E2E A;  1SET A;  1CEZ A;  2R72 A;  5IJ9 A;  5LOV A;  2LGW A;  1EM1 A;  5AG2 A;  3E8H A;  4X1I B;  1QLE B;  2E5L B;  5IYZ A;  1B3Q A;  2HHH B;  3N2G A;  1Q90 D;  3B77 A;  1I7F A;  1ENV A;  2H3O A;  2ETN A;  4DRX B;  4NYK A;  3K03 A;  2P06 A;  3L74 H;  2XND G;  2HEP A;  4GX5 A;  3UO2 A;  4B7E A;  4MVO A;  2CK3 G;  1B04 A;  1QR9 A;  4X66 O;  1WB7 A;  4CS4 A;  5JVD B;  3STZ C;  1BQ0 A;  3JAS A;  4DV2 O;  4UCR A;  2XAJ A;  4GX0 A;  3LDD A;  2RMK B;  4TV8 A;  1AJQ A;  4I0X A;  1H2G A;  2RQ6 A;  2OT5 A;  1SQQ H;  3M7M X;  2A3Q A;  4ZHQ B;  5BZB A;  4R8C A;  2UUC O;  5FL7 G;  2DW4 A;  2Q4P A;  4JI5 O;  4OPH A;  4RQE A;  5CBF A;  4IYI A;  1LR1 A;  4B3S B;  2A0L A;  5H5N A;  2Q0A A;  4D6T H;  3CRA A;  4TT3 G;  3AG3 C;  2E74 B;  4PDV A;  3L73 H;  1F4M A;  1NR1 A;  2OTL V;  3TGU H;  1DLB A;  2EUL A;  3BA9 A;  3JD2 A;  3ZED A;  2OCH A;  3KZI Z;  1MSD A;  1M93 A;  4U3J A;  4B3T B;  1VQO V;  4GYC B;  2O57 A;  1KUQ A;  4DV7 B;  2V7Q G;  2A9H A;  5CA0 B;  1I94 B;  1AVM A;  4FLZ A;  1JCH A;  4G27 B;  2C2A A;  2LW7 A;  2EIJ B;  4I55 B;  1ZUQ A;  3VOU A;  2Q6A A;  4HNA B;  1K9M W;  3U0Z A;  2ZT9 B;  5H6R A;  1XL6 A;  1VQ7 V;  1L0N H;  4JI8 O;  1PNM A;  4LP8 A;  1M90 W;  3L71 H;  2IW5 A;  2X6C A;  4O4I A;  4P30 A;  4FIP C;  5KAI Z;  2Q7E A;  1HNZ B;  1KB9 F;  3FB5 C;  4WFE A;  3JAR B;  1ZL8 B;  1SQP H;  4OX9 O;  1XDC A;  3OMN B;  1HWY A;  4PDR A;  3P30 A;  2ZQM A;  5TIS Z;  1THZ A;  3JYC A;  1GAX A;  1EFR G;  4XDJ A;  4LNU A;  1N34 B;  4FLW A;  1KBH A;  4MSW C;  2ZCE A;  4JZ2 A;  1EN6 A;  4LC1 A;  5LP6 C;  3ASO B;  3L70 H;  2PUS A;  4JI3 O;  3APQ A;  1BHA A;  2RN9 A;  2BTQ A;  1M57 B;  4O4J A;  3A2F A;  4K8X A;  1W0K G;  4FLY A;  2P4V A;  1K73 W;  4LF6 O;  4IGG A;  1IXM A;  5HFL A;  3CCL V;  3CCJ V;  2YIB D;  3ABK C;  4DV0 O;  2FYU H;  4RUE A;  1NVP D;  5FNV A;  2QM7 A;  3EXA A;  3C90 A;  3QF7 A;  1K4D C;  4XBF A;  4J42 A;  2DN9 A;  4JI1 B;  4LFB O;  4WFF A;  3ICX A;  4MVQ A;  1P7B A;  3GWO A;  2ITD C;  2XAQ A;  4O2A B;  3BHP A;  2NNU A;  2AW9 A;  2KG7 A;  5BMV B;  4UCO A;  4FLX A;  3I55 V;  2HJD A;  3CE2 A;  1OCC C;  2HHH O;  3S3X A;  1WJZ A;  2ZXW B;  4UB6 Z;  2ZIO A;  2ZD9 A;  4BR6 A;  1ZX3 A;  3RT3 C;  4CC5 A;  4BWA A;  3FFQ A;  4JI0 B;  3E22 B;  2W0X A;  3TCU A;  2AHZ A;  2PYL A;  1O9H A;  1S72 V;  3FD9 A;  4IIJ A;  4X20 A;  2YIB A;  4JAU A;  5B66 Z;  5KA6 A;  1H2M A;  4X89 A;  1JR9 A;  2YXH A;  1S77 D;  3BA8 A;  2QKS A;  3RYF B;  1PL4 A;  3K04 A;  4UVC A;  1XQ8 A;  5IYD O;  3DXR B;  1Q6U A;  2BSK B;  2Q73 A;  1NTM H;  3G71 V;  2F4V B;  2IH1 C;  5EIB C;  1Q43 A;  3AG7 A;  2JRI A;  2P67 A;  3WG7 C;  4OXS A;  2YEV B;  2YID A;  1EN4 A;  4JAV A;  1BT8 A;  1IBK B;  1FFX B;  1AR4 A;  4X65 O;  1IVS A;  1NS1 A;  1MAB G;  3ZMT A;  5J2U B;  1WP7 A;  1PV0 A;  3JD3 A;  4AHC A;  4ABM A;  4B3S O;  3K06 A;  3RWR D;  3MAQ A;  1KKD A;  2KQX A;  5B5E Z;  4YHH B;  3H9V A;  3GVM A;  3J80 N;  1NR7 A;  3ABL C;  3RYH B;  2QWQ B;  5J2T B;  4F4L A;  3UM7 A;  2UUB B;  2MK3 A;  4QE7 A;  3OGI B;  3ZHQ A;  4J7J A;  4DR5 B;  4YIP A;  4LFC B;  2Q67 A;  1M5I A;  4NVP A;  1AJP A;  3OAA G;  4NXN B;  2WLN A;  4B3T O;  4GKK O;  1V9P A;  1XNQ B;  4PA9 A;  5LXT B;  4F6E A;  4DV7 O;  1SQG A;  5D5Q A;  1I94 O;  5L3B A;  4K3A A;  5KHJ A;  5LP6 A;  2CUG A;  2M7W A;  4DR4 O;  1JPX A;  4MVU A;  5IJ9 B;  1JX9 A;  2DYR B;  1J5E B;  3L9D A;  4W4K A;  3ZHS A;  3F5T A;  5IYZ B;  1H2L A;  5KAF Z;  3RGB A;  2UXC O;  1WP8 A;  2BTO A;  1NZ6 A;  3CXH F;  4LF8 B;  1HNZ O;  3CCU V;  3M99 B;  1ROP A;  4NTW A;  5B3S B;  1SQV H;  1D5A A;  5GTI Z;  3K5M A;  1AIL A;  4Z2W A;  2EZO A;  4LH7 A;  3F5W C;  5EZY A;  3JAS B;  1S5J A;  1YSC A;  2ARH A;  1YCI A;  3H1J H;  2ZE6 A;  2JS5 A;  4KP4 A;  5JH7 A;  5B1B C;  3K9A A;  5BR8 B;  1KU9 A;  3B2E E;  1NH2 B;  4K0K B;  2WLJ A;  4DUZ B;  3CB2 A;  1AI6 A;  5DEC A;  4CH3 A;  3GWK C;  5A9G A;  1ZWI C;  4RUF A;  5EC1 C;  3UQ8 A;  2CDY A;  4K8Z A;  3A0H Z;  1JMK C;  1E79 G;  3K5L A;  4YY3 B;  3HKE B;  2YXY A;  5LYJ A;  1K4C C;  2GDS A;  2OCC B;  3OUS A;  3QG5 A;  1QU7 A;  3ZRV A;  1D2D A;  2P4K A;  1GM8 A;  1M9N A;  3G6E V;  3Q4H A;  1MOF A;  4WF9 V;  5DN6 G;  1OCO B;  4LF9 B;  2Q0O C;  3QO7 A;  4LFA O;  4QNH B;  1BMF G;  4I5S A;  1IZ3 A;  4IL6 Z;  5FPO A;  5B1A B;  1OCR C;  2DWD C;  4U3J B;  1S76 D;  3ZX6 A;  2A7W A;  5EBL C;  3W7X A;  3SPH A;  3H01 A;  3R66 A;  1GO3 F;  2RNB A;  1SQF A;  3VQV A;  1JFF B;  2Y0P A;  5IDJ A;  5C93 A;  5IY5 B;  2EIL B;  4BW9 A;  3K5O A;  1N36 B;  3PJS K;  5KX5 A;  3OR6 C;  2BOB C;  1MZE A;  4DV3 B;  2DQ3 A;  1W2B U;  4X62 B;  1SES A;  2GBO A;  3HB3 B;  4JI0 O;  3K59 A;  3CHX A;  2LP7 A;  3C3S A;  4O4L B;  3MHS C;  3FKS G;  1GM9 A;  2OYQ A;  1FXK B;  5LHG A;  1Y67 A;  2AXT Z;  3OMI B;  2PI5 A;  5JQG B;  2VWK A;  1KMI Z;  4MVR A;  1V55 C;  5ITZ A;  2Y69 C;  4PJ0 Z;  4GX1 A;  2XT9 A;  2FML A;  5GON B;  2HVJ C;  4O4H B;  4UVB A;  2OTJ V;  4LNU B;  2EIK B;  2LFR A;  1S0V A;  2FKX A;  1Q6I A;  4DR3 O;  2JIZ G;  4DO2 A;  1GN3 A;  2H8P C;  2WLH A;  4HYO A;  2PGG A;  1QLN A;  2FTK A;  4O2B B;  3CCM V;  4JI2 B;  1K33 A;  4YHH O;  1AI5 A;  3O65 A;  2QKA A;  2EBO A;  2OIE A;  2UUB O;  4JI4 O;  3KCX A;  1TVK A;  4FFB B;  3LSS A;  2QWR B;  4PDL A;  4DR5 O;  1NT2 B;  4MS2 A;  4LFC O;  2RJZ A;  2CH7 A;  4AI8 A;  1RSO B;  3T4Z A;  4DR6 O;  1XNQ O;  1Q5O A;  3C3T A;  1R73 A;  2V4D A;  2CTP A;  2Q7G A;  3CC7 V;  3AG4 B;  3OTO B;  1W0J G;  3ASN B;  4E4E A;  1AI7 A;  1TUE B;  4J9Y B;  3K58 A;  2QGN A;  5KHI A;  2KG7 B;  1TAE A;  4HAM A;  5KLV H;  1R1B A;  2ZE7 A;  3HKB A;  2QM4 A;  2B9Z A;  3E8F A;  2HG5 C;  4LF8 O;  4I4T A;  3ABU A;  1Q86 W;  1Y4M A;  3TXQ A;  4WFH A;  4ZBM A;  2IM9 A;  3T1Y O;  1URF A;  1MZF A;  2DJV A;  3CYO A;  1EZV H;  3ZN1 A;  1NVP B;  1GTO A;  3HKD A;  4KL1 A;  3DC5 A;  2R9A A;  3P32 A;  3R65 A;  3ZRW A;  4HZ3 A;  2E3C A;  4DV1 B;  3SJQ C;  1IUR A;  4K0K O;  1Q6H A;  4BW5 A;  2F66 C;  4EFB A;  3SJC C;  4DUY B;  5H9C A;  4J11 A;  2F93 B;  3S3W A;  1RPR A;  3D3Q A;  1BL8 A;  4X64 B;  3QTC A;  1Y66 A;  2GHY A;  4DV5 B;  5EYP B;  2XAH A;  3OEE G;  1NBM G;  3LUT B;  2Y4T A;  3RVY A;  1N33 B;  2ZE8 A;  4DR7 B;  3W7S A;  1TUB B;  4DR2 B;  4NKG B;  1N4C A;  5KMG A;  1Q7Y W;  3ETQ A;  4TOI A;  2NN4 A;  4LF9 O;  4DR1 B;  3K0D A;  4B3M O;  4XDK A;  4MTF A;  1VQ9 V;  4YJ3 A;  4PA3 A;  4JYA B;  3BEH A;  2B1I A;  1KQS U;  2UUA B;  3E8B A;  2JGD A;  3BFR A;  1WN7 A;  3ZN0 A;  4X1K A;  5LBQ A;  5LP6 B;  2EIN C;  1V54 C;  3W7U A;  2WLL B;  4DV6 B;  4I50 A;  1VQ4 V;  4HBN A;  3N2K A;  1F51 A;  4JZG A;  4DV3 O;  1RM1 B;  5KUM A;  1HDJ A;  4TSF G;  2N74 A;  3ZMS A;  4KHP B;  1VP7 A;  2L35 A;  3ABK B;  2QSA A;  2E75 B;  1GH6 A;  4N21 A;  2GUZ A;  2LO1 A;  1YJ9 V;  3EVK A;  3FAV B;  4TQF A;  3E8G A;  2V1D A;  1P84 F;  3DTU B;  3IAY A;  4DK1 A;  3K57 A;  4J41 A;  4BAY A;  5C8Y A;  1FS0 G;  4X1Y B;  2NLJ C;  2X7R B;  4I9W A;  1S5L Z;  4YJ2 A;  3B09 A;  1G8M A;  2GTS A;  2ZM6 B;  1YJW V;  1SS3 A;  4PA4 A;  1QVG U;  2ILM A;  3JCZ A;  2YSU B;  1OCC B;  4JF3 A;  2E76 B;  1BS3 A;  2VQE O;  4RQF A;  1RFY A;  1J95 A;  1IBL B;  1NTZ H;  1XMQ B;  2Y48 A;  3HKC B;  4TUY A;  4D7T A;  2B1G A;  5CA1 A;  1Z5W A;  2ZR2 A;  1UJW B;  5L3C A;  3AG1 C;  5K1X A;  2IU0 A;  3OTF A;  3G80 A;  1I5Y A;  2ODM A;  1H2N A;  4Z1M G;  4QGP A;  1YXB A;  3Q4H B;  1WA8 A;  3H1H H;  1YIJ V;  2DMX A;  2H94 A;  3WU2 Z;  1UPG A;  2Y0I A;  3BAB A;  3QO5 A;  4NXM O;  1DF5 A;  2XAS A;  3CCE V;  2LQT A;  3OTO O;  3WG7 B;  1H2K A;  3JSL A;  2YC0 A;  4LWS B;  3CCV V;  3CCS V;  1NI8 A;  2JEU A;  3FYI B;  1Y76 A;  3O9O A;  4UXN A;  3JSN A;  1YHQ V;  4ZOL B;  3MHH C;  1M56 B;  1A32 A;  3K79 A;  4H37 A;  3ZMV A;  2WA3 A;  1YDX A;  5KX5 B;  3D36 C;  3JAT A;  1YI2 V;  5H2F Z;  2X0L A;  3ABL B;  5LHH A;  1ZSP A;  4BIZ A;  1PPJ H;  4D7S A;  3D8C A;  3LSU A;  3ABM B;  3SPC A;  1PKX A;  3CJH A;  2D3O W;  1VAR A;  4IHJ B;  4GX2 A;  1SA0 A;  3ZIA G;  1SQB H;  1SZT A;  2UXB B;  2E5L O;  2F1M A;  3CRR A;  2CTW A;  2EIJ C;  3H1K H;  1XUQ A;  4GCZ A;  4ICG A;  5EBW C;  2PTM A;  1DTO A;  1P7G A;  1YJN V;  5KUK A;  2VQF B;  1OCZ C;  2B5U A;  3THO A;  1Y74 B;  1B06 A;  3E86 A;  4YIO A;  1HNX B;  2F43 G;  4X64 O;  1BE3 H;  1HR0 B;  3OE7 G;  4G28 B;  2DE0 X;  4DV5 O;  1ZTE A;  5LMN B;  4DR7 O;  3FB8 C;  4Q20 A;  4PHZ A;  2UU9 B;  4X88 A;  5CN0 A;  2HP8 A;  2HJF C;  2N05 A;  1H2S B;  4DR1 O;  4EB6 B;  3CMA V;  2Q9L A;  4JTC B;  5CMU A;  2X6B A;  2Q8V A;  4JYA O;  3H1I H;  1OJH A;  2QA4 V;  2UUA O;  3ZHR A;  4CS3 A;  3JAK B;  2BE3 A;  3IC9 A;  5CBH A;  1K5S A;  1N8R W;  3ASO C;  4PA7 A;  4R7C A;  5B1B B;  4R6Z A;  3ML0 A;  1AP5 A;  3BVO A;  1M57 C;  1G6U A;  1E1Q G;  4DV6 O;  4DRX A;  3FX7 A;  1PNL A;  2GSM B;  3FB7 C;  4MTG A;  1JJ2 U;  1NU1 H;  3JAW B;  1I08 A;  2K9P A;  1HW7 A;  3RYC B;  4I4T B;  1E1R G;  3T1C A;  5JVD A;  2P7T C;  5JWP A;  5IT9 N;  2QWN B;  4F6R B;  3RYI B;  1QBZ A;  3CPW U;  4B08 A;  1VQK V;  2AZ2 A;  5EK0 A;  3TK1 A;  1K3E A;  1Z2G A;  3QO8 A;  5LOV B;  1R3K C;  1N32 B;  1OCR B;  1L8D A;  2JGU A;  1GN2 A;  2UXX A;  4ZHQ A;  3MDS A;  1UFI A;  5L3G A;  3ZRW B;  3N2G B;  5IJ0 A;  3SPG A;  1VMG A;  4JYY A;  4UCT A;  1BHB A;  5JCO C;  1BSM A;  3NR7 A;  4X9Q A;  3E83 A;  1ARO P;  1IBL O;  3D36 A;  1XMQ O;  4FZ1 A;  3K08 A;  1PD3 A;  4LF5 B;  4LF7 B;  1QVF U;  5EIB D;  3OD4 A;  4UV8 A;  3KG2 A;  4TWK A;  1YTF D;  4ZKI A;  2RDC A;  2YIA A;  2AZ0 A;  1HP8 A;  4ZI7 A;  1N34 O;  4QPK A;  2QTO A;  4TV8 B;  2IJJ A;  4FFK A;  3LNM B;  1V55 B;  4I0X B;  1FPO A;  1COW G;  2P6J A;  1IXB A;  4GKJ B;  4AQY B;  2QEX V;  5DED A;  4U7O A;  4HNA A;  1AP6 A;  4RO2 A;  2K1E A;  2W6J G;  2ZNI A;  4EFE A;  5GTH Z;  1Q3E A;  4FM1 A;  2EZP A;  5EC2 C;  1ZAU A;  3NXS A;  3CD6 V;  4UVA A;  3OM3 B;  4I50 B;  3A0B Z;  2Y4U A;  3N2K B;  3RN4 A;  2QR4 A;  3JAR A;  1H8H G;  2EX3 A;  4JI1 O;  3CME V;  3QNE A;  3CC4 V;  2JK5 C;  2PI4 A;  4PI0 A;  1HNW B;  2FL4 A;  1RPO A;  3EFF K;  2GUZ B;  1PM9 A;  4JI6 B;  2A79 B;  3W7T A;  3HPL C;  5CB4 A;  3SYA A;  2QWO B;  3QVN A;  5JJE B;  1N0N A;  4JV5 B;  1AI4 A;  3OR7 C;  2IBZ H;  3AG2 C;  3I56 V;  1LNQ A;  2PF4 E;  4FMT A;  1JQ0 A;  4H0L B;  2ITC C;  4MW8 A;  4B3R B;  1M1K W;  1F7Y A;  2UUC B;  1U96 A;  1EBO A;  2XAF A;  4JI5 B;  5IWA B;  1CPY A;  4O4I B;  1CXZ B;  2VQF O;  3EHB B;  4YXW G;  5FLX N;  2EIM C;  2HR3 A;  1FKA O;  4U7N A;  4R50 A;  5LL6 Y;  3K5N A;  2DYS C;  5JJN B;  1DK1 A;  1IBM B;  3T4D A;  2BCC H;  4J9Z B;  2JJ1 G;  1Q82 W;  4TUY B;  2QTS A;  3WB1 A;  2JVD A;  5B3S C;  1GKF A;  3U10 A;  5DM6 V;  1AR1 B;  2YI8 A;  3SYC A;  3RBZ A;  2F4V O;  3I5D A;  4C7U A;  3DSQ A;  1R6T A;  5L3D A;  4X8A A;  4UUJ C;  4JGS A;  1GM7 A;  2YIC A;  4G2K A;  4MVZ A;  4W4L A;  3ZMZ A;  1VEW A;  1LUW A;  1IBK O;  5BMV A;  1XOU A;  4UCS A;  1X59 A;  2BTQ B;  4O4J B;  2UXD B;  3SDL A;  4MTO A;  3LDC A;  4JPR A;  3WB0 A;  3BPZ A;  5JCO A;  1M4U A;  5HFM A;  2XUM A;  4KUM A;  3RW0 A;  1MA1 A;  1Y76 B;  4PEL A;  3CP1 A;  1XHZ A;  3E35 A;  3IGA C;  5FNV B;  2N04 A;  2Z0A A;  1K8A W;  4NTX A;  2ZIN A;  3JAT B;  2ZIM A;  4NXN O;  3SR2 C;  1WAZ A;  3W7W A;  1XMO B;  1OCO C;  2DWE C;  3DXR A;  2BSK A;  1AR5 A;  3DC6 A;  1N32 O;  5IYC O;  4BIO A;  2YEV A;  1J5E O;  2MW2 B;  3U11 A;  1H38 A;  2XOK G;  2HLD G;  2YUA A;  3OW2 U;  3JD1 A;  4EEQ A;  3A8T A;  3VQX A;  3CS5 A;  4LR3 A;  5J2U A;  2CGN A;  2EIN B;  2LW1 A;  1V54 B;  4JAA A;  4P9P A;  4GT1 A;  1N0J A;  3AG3 B;  4IT5 A;  2CTR A;  3RYH A;  5J2T A;  1X4T A;  2IJI A;  4LF7 O;  4LCU C;  1R6K A;  4IIJ B;  3K3W A;  4X20 B;  3X2Q C;  1RP3 B;  5LMU B;  1GN4 A;  4FZ0 A;  4U3F H;  3ETD A;  3STL C;  4LFB B;  1FAF A;  1KP2 A;  3JAL A;  2ZDI C;  5LXT A;  5BR8 O;  1BCC H;  4GLX A;  4DUZ O;  2P5O A;  3K9S A;  2IH3 C;  1S3J A;  4AQY O;  2Q69 A;  3SJA C;  2EIK C;  1GN6 A;  3CC2 V;  4NTY A;  3MD0 A;  2Z3Y A;  5L3F A;  4YY3 O;  1KC8 W;  2JS3 A;  5B1O A;  2W0F C;  1MMM A;  5KA5 A;  3JCU Z;  1JOY A;  4NB5 A;  1U97 A; 
#chains in the Genus database with same CATH homology
 2QWO B;  2QWQ B;  3AG7 A;  4IT5 A;  2CTR A;  1N4C A;  4J7Z A;  3UCS C;  2CUG A;  2QWR B;  1FPO A;  2Y4U A;  4RWU A;  1XBL A;  2N04 A;  2M6Y A;  2YUA A;  2PF4 E;  2N05 A;  3APQ A;  3UO2 A;  2LGW A;  2DMX A;  2DN9 A;  2QWP B;  2YS8 A;  1BQZ A;  1HDJ A;  1WJZ A;  3UO3 A;  2CTW A;  2EJ7 A;  4J80 A;  1BQ0 A;  2KQX A;  1FAF A;  2QSA A;  1NZ6 A;  2Y4T A;  2GUZ B;  3BVO A;  2OCH A;  1IUR A;  1GH6 A;  2CTP A;  2QWN B;  2GUZ A;  2L6L A;  3APO A;  2CTQ A;  2LO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...