2LGWA

Solution structure of the j domain of hsj1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
71
structure length
71
Chain Sequence
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily B member 2
publication title The C-terminal helices of HSP70 are essential for HSJ1a J-domain binding and ATPase activation
doi rcsb
source organism Homo sapiens
total genus 25
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lgwA00
2Y4UA 1HDJA 1GH6A 2YS8A 1XBLA 4IT5A 3UCSC 2GUZA 2Y4TA 2CUGA 2CTWA 4J80A 2QWRB 3APOA 3UO3A 1BQZA 2DN9A 2GUZB 3BVOA 1BQ0A 3AG7A 1IURA 2QWOB 2LGWA 2M6YA 2L6LA 2DMXA 2OCHA 2CTQA 1WJZA 2QWNB 3UO2A 1NZ6A 2QSAA 1N4CA 2CTRA 2LO1A 2QWPB 2PF4E 2YUAA 2QWQB 3APQA 4RWUA 2CTPA 2EJ7A 4J7ZA 1FAFA 1FPOA 2N05A 2N04A 2KQXA
chains in the Genus database with same CATH superfamily
2BTQA 2A0LA 4X1IA 1MNGA 3JYCA 4LBEC 4ABMA 1EN4A 1NVPB 4JI2O 1N34B 2ZE6A 1K92A 4IIJA 4DRXA 4HYOA 1XMQB 3S3WA 1J5EB 3E89A 5GTIZ 2UXXA 4J9YB 2JRIA 4MVMA 3OTOB 3ZRWA 1URFA 4NTWA 1GH6A 3OFNG 4L87A 4IHJA 1I94O 4UV9A 2PY5A 3O9OA 4LF5O 2D2CB 2IJKA 2OT5A 2Q5ZA 3N2KA 4HBNA 1RM1C 4FM2A 3W7SA 1JJ2U 1Y6XA 4I9WA 5H2FZ 5EBWC 2HHHO 2E5LO 2Q0OC 4X1YA 5CA1B 4BR6A 3QG5A 2CTPA 4R7CA 2F66C 1F7YA 2X0LA 3C3SA 3AK1A 3SYOA 1ZX3A 1HP8A 2GV9A 2ZT9B 2KKWA 2OWOA 4NR1A 1PM9A 4I55A 3ASOB 3L9DA 1KKCA 5KX5A 4I4TB 1NJIW 1F23A 4AQYO 3DC6A 3ZRSA 5D5PA 5LOVA 1VQMV 1GN2A 1ZL8A 4GKJB 3U0ZA 1PL0A 2P4VA 5J2TA 2R72A 1GN6A 3ETQA 4EFBA 1SQXH 1XMOO 2YI9A 3K5OA 5EC2C 2B1GA 4X20B 1B3QA 1Q82W 4O4HA 3CCVV 5FPRA 1YCIA 2A9HA 2XUMA 3CRAA 3EXAA 2UXBO 5JCOC 4B7EA 3X2QC 3N2GB 5BR8B 1VF7A 1NU1H 1US6A 4B3MO 2YXYA 4H44B 1BZKA 5DEDA 4J9ZB 2DQ3A 3RYIB 4PDMA 1YITV 4I0XA 4U7OA 4DR4O 2QDOA 3HB3B 4HZ3A 1XILA 2DOSA 3A0HZ 3VQWA 3CPWU 1H2GA 3BAAA 2WLHA 4K0KO 1Q6UA 1N36O 3ML0A 4TQFA 3OR6C 4JI0B 4QPJA 1SQGA 1IXBA 2BTQB 2ARHA 2PTMA 4BIOA 5EZYA 3E8BA 1MSDA 4DR1B 4IIJB 1Q8IA 5CA0A 4DRXB 5KMGA 3BPZA 3FAVA 4XDKA 1XEQA 3CX5F 4YJ3A 2DQ0A 4P9PA 1SESA 2PYJA 3ZMZA 3ZRWB 2JS5A 5KA5A 2W6IG 4IHJB 1VF6A 5JWPA 4JI4O 1BMFG 4JYCA 3RYFA 3N2KB 4J10A 3OAAG 1GN3A 3D36A 3QO8A 1JA8A 2Q69A 5EIBC 4X1YB 2NN4A 2EZOA 2Y4TA 4TV8A 3IGAC 1X4TA 2HLDG 3ZMTA 4LNUA 5J9PC 4QNHB 4I55B 2QKSA 5KX5B 2ZR3A 4RUFA 2DW4A 5EK0A 2R9RB 3AK2A 5A2QN 4YY3O 5LOVB 1ZL8B 2NR5A 4UCSA 4WFEA 5LYJA 1JCHA 2QKAA 5J2TB 4J80A 5B1NA 5FLXN 1KB9F 2Q67A 4DR3O 1JQ0A 1OCCB 5B1BB 2JVDA 2JDIG 5KUKA 4X66O 4TQDA 1D5NA 3ZN0A 2BCCH 2YSUB 3CB2A 3G6BA 4ZI7A 4O4HB 2XAJA 4JZGA 1EFRG 5EBMC 4JI3B 5CBHA 3TXSA 1XNQB 3RVYA 3K0GA 4DV3O 3ZS8C 4I0XB 1QNMA 5L3EA 1NTMH 4UUJC 2QM8A 5FNVA 4X66B 3H9VA 4U3JA 1UFIA 1N0JA 1AJPA 3OTFA 2BTOA 4FLWA 1I7FA 4KXRA 5JJEB 1VQ8V 1FKAO 4CH6A 1WP7A 1R3KC 2P6JA 1IDSA 1OCRB 4DV0B 4LFAB 3UKMA 4NB5A 2RN9A 5EZYB 4WCEV 1WNSA 5CA0B 2XNDG 5KMGB 3FAVB 4FPPA 4PA3A 4F6RA 4OXSA 1K4CC 1H38A 3K9SA 4YJ3B 4W4KA 3JCZA 2LJ2A 2DYSB 2VQFO 1GK9A 4TOIA 1IX9A 2ZDIA 5LMNB 5CMUA 1ROPA 4ASUG 4U3FH 4ZBMA 2P67A 4MTGA 3O65A 1IVSA 3ZHVA 4J11A 3ZCCA 4CS4A 4TUYA 3RYFB 2UUCO 1K8AW 3I55V 4B3RO 1M1KW 4GX0A 1HDJA 1R3LC 2AXTZ 1Q6IA 1OCOB 3CCSV 1K4DC 1SA0A 4DW0A 2QE7G 3W7TA 1NR7A 2JIZG 1VQPV 4DV7O 2EIJC 1MMMA 4LNUB 1VMGA 1HWYA 2Z3YA 2E76B 4J7KA 3J81N 1XHZA 2AHYA 1GRJA 2UUCB 3C3TA 1HR0B 4DV2O 2W0XA 1SS3A 1PKXA 3FFQA 5LYJB 2PYLA 2OTLV 1V9PA 3H1JH 1QVGU 4OX9B 1QCEA 4KHPO 1N32B 4ZI7B 1ORQC 3SPCA 3E35A 1NBMG 1X59A 1F51A 2IU3A 2RQ6A 3CHXA 1QVFU 4PA6A 1I08A 3ABTA 3CCLV 4DUZO 5HFMA 1K5SA 3SR2C 3CP1A 4C7UA 3OMIB 5LMUB 3HKBA 5IE9A 2EZPA 3CC4V 4YXWG 3SJBC 1FXKC 2DE0X 1YTFD 3FB5C 3JASA 4J7ZA 2WLMA 1M56C 5FNVB 2YC0A 3WB0A 1KD1W 1WPBA 4U3JB 4IYIA 3ASNB 4FLYA 3K5LA 4X65B 1T5EA 2PGGA 4N21A 3K5NA 5KUMA 4JAAA 4WFGA 2FMLA 3AG4C 3EVKA 2G38A 2ZINA 2QM4A 3AG1C 1AVMA 2GUZA 5B66Z 4F6RB 2EX3A 4GZRB 5FPOA 2IJJA 2YDEA 1IBKB 4FJCC 3NXSA 1NH2D 2EIKC 2UXDO 2P06A 3B8MA 3OGIB 2CGOA 3OR7C 3PN1A 2HVJC 2JEXA 1YJ9V 1KC8W 1MABG 4GT1A 1AROP 2YS8A 4DV4O 2OIEA 4TUYB 1GM7A 4CH5A 3AG1B 4CH4A 4ZIBA 3ABMB 1KU9A 1M93A 3T1YB 4BIUA 4B3SB 1RP3B 1SA0B 4DUYB 1OCZB 4DR2B 4LC1A 2OCCC 5C8YA 4W4LA 1F4MA 3SYQA 3PJSK 2DWDC 3A2FA 1FPOA 4G2KA 1F4NA 2R9AA 2X6BA 3IC9A 1MZFA 2Q68A 1PV0A 4MSWC 1VQ5V 1LUWA 4H37A 4IYHA 2Q7EA 2OIGA 4J41A 1EBOA 4LF8O 4DR5B 2H8PC 1K33A 4LWSA 1QLEC 2ZIMA 3GWOA 3U10A 4LFBO 3G71V 4PHZA 1BCCH 2WPDG 3T4DA 2CAZC 2PUSA 5EBLC 4QE9A 3ABKC 4R6ZA 4FLUA 3HPLC 2B9ZA 2UXCB 3K9AA 3AG3B 4FM1A 3E86A 5GTHZ 3HKBB 1S3JA 2V4DA 1VF5B 1DGSA 3G67A 3H1IH 4LFBB 3FB6C 5GW7A 2QGNA 3JASB 4HNAA 3FKSG 4OPAA 1K34A 3SJCC 2RNBA 1RFYA 1TVKA 4FFBA 4RAIA 3LDEA 1N8RW 2LW7A 1HNWB 1M57B 1PNMA 3MHHC 5BY1A 2UUAO 4UVAA 4R50A 2B5UA 2H94A 1JR9A 2YXHA 4JI8O 2GUZB 3J80N 1KP2A 2EULA 3STZC 3TETA 1E1RG 3DXRA 1VQKV 3F7VC 3BFRA 1Y66A 2N05A 2N04A 2F95B 2E74B 2YICA 1AP6A 1SF9A 3LUTB 3A0RA 1Q90D 4IGGA 2DYRB 4K35A 3ASOC 2ITCC 4FZ0A 4JI2B 1BE3H 1VQLV 4F4LA 1NH2B 1BHBA 3D8CA 4CC5A 4CS2A 1AI6A 1XDCA 2F23A 1QR9A 5C8YB 3AK3A 1S5HC 4JI1O 3SDLA 2UU9O 1ENVA 3VQVA 1BQZA 4MVUA 1I94B 1DF5A 3UM7A 2V1DA 1FFTB 1NTZH 3CXCU 4LF5B 3BRCA 3ZHTA 2ATKC 2HHHB 2E5LB 3CCEV 4UCVA 3Q4HA 3B77A 3ZMUA 2PI5A 1TUBB 4X64O 4WFFA 2EJRA 3I5DA 3CXHF 1Q7YW 2W0FC 2UU9B 1XOUA 2QA4V 3LNNA 2LP7A 1THZA 3UO2A 1M5IA 1EZJA 1S77D 2VWKA 4GYCB 4ICGA 3FB8C 1RPRA 4AQYB 1B06A 4CBCA 1QU7A 3BA9A 3MHSC 1PNLA 2XTAA 4DO2A 4HNAB 1XMOB 4RQFA 5CA3A 4EKWA 4X9QA 2L6LA 4X64B 4UXNA 4HAMA 1TVKB 4FFBB 4JYYA 3LDCA 3APQA 1CXZB 5JH7A 2JJ2G 2UXBB 4B3MB 1KECA 4JI5O 5H5NA 2IU0A 4X1IB 1KMIZ 5H6QA 3W7WA 1SKVA 3RYCA 3SPIA 4DR4B 4I50A 2WA3A 1YXBA 4ZHQA 4BAYA 3DXRB 4D7SA 4K0KB 1GTOA 4DYLA 4B3TO 4GX2A 3TGUH 1XNRO 2CTWA 3K03A 5IYBO 3CRMA 3ZHQA 1N36B 2ETNA 5L3FA 2QJ1A 4BWAA 1YEWA 4DV6O 1DK1A 2HKOA 3RWRD 3ABLB 3QF7A 1FYJA 4JAVA 3B2EE 4YIOA 1GKFA 2UXNA 4F6EA 3G4SV 1N0NA 1NS1A 1YI2V 3ZMVA 2FL4A 1OCCC 1ZSPA 5B1BC 2WAMA 1SZTA 2F43G 3M8AA 4XDLA 3M99B 5KAFZ 4B08A 2C2AA 3RGBA 1E1QG 1ZAUA 4JI4B 3TK1A 1FS0G 1R6NA 2JGUA 2IW5A 4P30A 5J2UA 5IDJA 5BZBA 4YHHO 2GDSA 4X89A 3Q4HB 1YHQV 3E22A 2F4VO 1KP3A 1L0LH 2ZKOA 4UCUA 4NTYA 4LP8A 1PP9H 2AZ2A 1LNQA 3CRQA 3CRRA 5IY5B 4K8XA 1QQCA 1JOYA 3CS5A 5KHGA 3RT3C 2A79B 2BE3A 2WA4A 3ETEA 4QJFB 3CMAV 4YY3B 2BSKA 1W2BU 1BQ0A 2K9PA 4PI2A 5B1AB 4YHHB 1OCRC 4O4IA 5LXTA 2CTQA 4DR3B 1JPXA 3CCJV 4MT8A 1WAZA 3CE2A 5JH7B 1B6QA 2DYSC 3RFRA 4PA4A 1BL8A 1AR4A 1G6UA 1V55B 1VF6C 1Z2GA 2HFEC 4FLVA 1Q81W 2QTOA 2WLKA 1SETA 4BIZA 4DV3B 4JYAO 3UT5A 4WBNA 4JASA 3J7AU 4I50B 2QTSA 3D36C 3WB2A 3UQ8A 3G6EV 1W59A 1YSCA 4ZHQB 4X62O 1OCOC 2AW9A 4QGPA 1GAXA 1TUEB 4JTDB 2NNUA 4PDLA 3F7YC 3ZRVA 2WSSG 3BY6A 2D3OW 2V7QG 3AG2B 4FK5C 1KYOF 1U96A 2CDYA 3KCYA 3SPGA 4MVQA 2YIDA 3QNEA 2CUGA 3RW0A 5ITZA 4U7NA 1VQNV 2ODMA 3JSNA 4FLTA 4LCUC 1H2NA 4TV8B 1GO3F 2X6CA 4YJ2A 2VQFB 4UB8Z 2ZE5A 5B5EZ 4O4JA 5LL6Y 4K3AA 3KCXA 3QTCA 2GHYA 2HEPA 3KG2A 4ZKIA 1FXHA 1Y74A 5IWAO 3H01A 3SYCA 4X1KA 1HNXO 1H2LA 4B3RB 5J2UB 3OEHG 4Z1VA 3ZBHA 3VBBA 5JJNB 4FLZA 1BHAA 2GTAA 3SYAA 3E22B 4I5SA 3THOA 1IBLO 5LGNA 3JARA 2Q7HA 1R6TA 2ZR2A 4DV7B 3QVNA 4WFHA 4NYKA 2MW2B 2EINB 1AJQA 5BXZA 3IFXA 5LP6A 3ASNC 4LF6O 2ADPA 3RN4A 1G1XB 3ZN1A 2ZD9A 3BVOA 2BOCC 2ITDC 1G8MA 1WN7A 3F5TA 5L3DA 3CCUV 4DV2B 2JJ1G 2BSKB 1GM9A 1DTOA 4LH6A 1SQFA 1CP9A 1JMKC 4O4IB 3ZRXA 1V54B 5LXTB 4LFCO 2IJHA 2FTKA 1VQOV 4DR6O 4DV5O 1IBLB 3K04A 1Z5VA 3MAQA 3JD4A 4KHPB 2LGQA 3E2EA 4J42A 3TJTA 1R3JC 5B1OA 3NR7A 2ZDIC 2IBZH 3JSLA 3CSXA 4JV5O 1SQPH 4DUZB 1LR1A 1VQ7V 2QWPB 4NXNO 5JVDA 2JGDA 3QO5A 2WLLA 4FM0A 3UT5B 3WFVA 4WBNB 1AB3A 3DTUB 2VS0A 1AP5A 4IT5A 5IT9N 4DR6B 3ABMC 1XI1A 2XAGA 3BABA 2HJDA 3JD0A 3ZJZA 5LA6A 3G80A 3IJ4A 1OCZC 4MVSA 4MVZA 1OJHA 5KHJA 4NXMO 2P4KA 3SPJA 5DM6V 1AI5A 4PA7A 3L73H 5LHIA 3OM3B 2PZSA 1VP7A 3WG7B 4DR7O 1FJGO 2FKXA 3E8HA 1VEWA 5ITZB 3A8TA 2CH7A 2KB1A 2JS3A 2H3OA 4RO2A 1KBHA 1I5XA 5KLVH 2QSAA 4YJ2B 4X8AA 3JCUZ 2UXDB 3P32A 2F1MA 1H8HG 2GBOA 3ZHUA 2ZCEA 1AILA 3UCSC 1NI8A 4O4JB 1E79G 3HKDA 1S76D 1KUQA 4MW3A 1O9HA 1P84F 3APOA 4E2LA 4DV4B 1Y74B 4XBFA 4X1KB 3ZHSA 3AG3C 4PA9A 5F2VO 4LF9O 2RDCA 1WB8A 4UVBA 1K3EA 1FD9A 3SYPA 4DV1O 5D5QA 4JTAB 2HG5C 2NLJC 1P49A 3JARB 1RPOA 1PD3A 1IBMO 1KQSU 1WP8A 4UVCA 5CB4A 5LP6B 4R8CA 2Q4PA 4KP4A 5KHIA 4X88A 4EEQA 5LBQA 2QWOB 3ETGA 1J95A 2ZNIA 2DMXA 2MK3A 2QWNB 2VQEO 1M57C 1NTKH 2EILB 4LF8B 1N4CA 1P7BA 3B8NA 3S3XA 2Y69B 1H2SB 4NTXA 4LF9B 1EN5A 3CJHA 3E8GA 2YEVA 4DV1B 2X7RB 4CH3A 3RYHA 1AR5A 3K57A 5GONA 4ZOLA 5CBGA 1QLNA 2Q73A 1S5JA 4KUMA 1WLEA 5E79Z 2ADQB 4FIPC 4O4LA 1NZ6A 1K9MW 2EIMB 4DW1A 5K1XA 3CCQV 2JK5C 3JAMN 4RUEA 4JAUA 4AHCA 5IYZA 4XDJA 5JVDB 2JGDB 1XBLA 2WLLB 1H2MA 3GB7C 4NKGB 3I56V 1L0NH 4GX5A 1XMQO 3EHBB 4QE7A 2XT9A 2DYRC 1J5EO 3AG7A 1B04A 1W0JG 3OTOO 5JCOA 3L74H 5IJ0A 5LA6B 3W7UA 1SERA 1K97A 1NT2B 3CC7V 4GKKO 3H1KH 5CN0A 4UV8A 3A0BZ 1WB7A 3E83A 3H1LH 4BW5A 5B3SB 4FLXA 1IURA 1W0KG 2UUAB 1K5QA 3MD0A 1SC5B 4JI8B 1R6KA 3OUSA 2RJZA 2YXLA 2CH7B 4JTCB 3OEEG 2IM9A 2VWJA 2Q6AA 2XOKG 2OTJV 1Y76A 1FXVA 4UB6Z 4AI8A 2ZXWB 1VQ9V 3ZHRA 4GKKB 3BCCH 1S0VA 1A32A 3GVMA 1M90W 3K3WA 1IXMA 3HKDB 4H0LB 2X6AA 3OW2U 4GKJO 2ZM6O 4WFAV 5EIBD 1MG1A 3LDDA 4LWSB 1Y67A 2K1EA 4DK1A 4QPKA 1SRYA 4O2BA 4AILC 4GUNA 1I0HA 5L3CA 4JYBA 1HW7A 1P7GA 1QHTA 5CB4B 4JI1B 3E8FA 4EB6A 5BR8O 3K59A 1RM1B 1NQTA 2QWQB 1YDXA 3R66A 2CGNA 2ZM6B 3R65A 1VQ4V 1Q43A 4LF4O 1BSMA 4CC6A 3CJHB 4UFZA 2YEVB 1M9NA 1QBZA 3RYHB 2ZE7A 5GONB 2RMKB 2ZIOA 4ZOLB 5H9CA 4PDRA 4GCZA 3JALA 1EM1A 1S5LZ 4TT3G 3CCMV 3DSQA 4JI0O 4JI6O 4O4LB 2Q9LA 3HKEA 1YVWA 3WU2Z 3HKCA 4UCTA 1PNKA 5IYZB 3ZEDA 4LF4B 4DR1O 3UO3A 2WLNA 3N27A 3ABLC 1Z5WA 3P3NA 3HR0A 2YIAA 3TXQA 2Q8VA 5KAIZ 5IJ0B 3X2QB 2XAQA 3K79A 4JI6B 3T2MA 1L8DA 2BOBC 2HJFC 1AJNA 1GM8A 4JI5B 4B7KA 2P90A 4GX1A 1D2DA 3BEHA 2YIBD 3F5WC 2PF4E 1TA8A 5BMVA 3CYOA 1PL4A 2FB5A 3DC5A 3RBZA 3SPHA 1Y76B 3OMAB 1ZWIC 1JVMA 2WLIA 5C93A 1ZUQA 4PELA 4B3TB 1R3IC 2Q0AA 1XNRB 1P4RA 2O57A 5IY5C 4OPHA 1TGOA 2YIBA 4I7ZB 4E4EA 4DV6B 2P7TC 4LF7O 2CK3G 4MVOA 3FYEB 5K1PA 5IYDO 1FFXA 3JD3A 3P30A 2DN9A 5B1AC 5DN6G 5TISZ 4O2BB 2FYUH 3QO7A 1Y4MA 2P5OA 4JI3O 4EB6B 1XNQO 2DWEC 3FYIB 3RVZA 3SJQC 2LQTA 4JF3A 4QIWF 2Y4UA 1MSWD 2VRZA 4MTXA 2GTSA 1BT8A 4BW9A 1L1FA 4LF7B 3OT7A 1XQ8A 1V55C 3CC2V 2XAFA 4A5UB 3AEIA 1R73A 3JD1A 5KA6A 3JALB 4JZ2A 2F4VB 3CWBH 5A9GA 3OGCC 2XAHA 4KFMA 3FB7C 2AHZA 3HKEB 2KG7A 3HKCB 3CD6V 4JI7O 1MZEA 5H6RA 4DV0O 4LFAO 1NKDA 3P3PA 4DK0A 2OYQA 1WA8A 2QKCA 2Y0PA 4PV1B 2M6YA 4TV9A 2UUBO 4IL6Z 4MVRA 5L3GA 3AG2C 3B40A 1GMGA 4NVPA 1G4YB 2Y0IA 3RYCB 5KHKA 4PJ0Z 1BGYH 1N33O 3TCUA 5LMNO 1K7DA 2DJVA 2ZE8A 2XHBA 4YIPA 5L3BA 3B4SA 1YJNV 4H33A 1FXKA 1HNZO 4JI7B 2UUBB 4RWUA 5JJJB 2N74A 3ZX6A 3BA8A 3CMEV 1XL6A 3JAKA 4JYAB 1H2KA 5BMVB 4P2ZA 1N33B 4MW8A 4WF9V 2Z5UA 1VQ6V 4X62B 2WLIB 2W6JG 5JQGA 3MDSA 1YZBA 4Q20A 1HNZB 1OHHG 4K8ZA 1HR0O 2EINC 2M7WA 5E1AC 1DF4A 3KKYA 5AG2A 3LSSA 3JD2A 3D3IA 4OX9O 1FFXB 1N32O 1V54C 1IZ3A 2CE4A 5EYPA 3JATA 1OV9A 2A06H 2GSMB 2WLJA 4J7JA 4Q6GA 2ZNJA 2QEXV 5LMUO 2R70A 3T1HO 4DXWA 2HVKC 2ILMA 2QM7A 4GLXA 4FZ1A 1YIJV 1AR1B 3K5MA 5IWAB 1HNXB 2OCHA 2A3QA 2JEUA 2EIJB 3L72H 1JX9A 1XREA 3KZIZ 1XL4A 4Z2WA 1SQBH 4PDVA 4X65O 1AI7A 1VIBA 2R9IA 4O2AA 5IJ9A 2L35A 3K08A 1BS3A 4N23A 1Q3EA 2KG7B 3H1HH 3T1HB 4LF6B 4Z1MG 3K06A 1WA8B 1PPJH 2QR4A 4H13B 4MS2A 4TV9B 2LFSA 2LO1A 3CRCA 3L75H 4JGSA 1COWG 5DECA 1U97A 4CZZA 1NVPD 1Q5OA 3JAWA 3WG7C 4LFCB 1JFFA 1IBKO 1TAEA 4DV5B 2QWRB 3FD9A 4LH7A 1XUQA 4RQEA 4PI0A 5CBFA 2Y48A 2LGWA 1UJWB 4FVMA 1Q86W 3STLC 1WJZA 3K58A 3K0DA 3ETDA 1FXKB 1SQQH 1RSOA 1ZTEA 2IH3C 2YUAA 1EN6A 2E75B 4JV5B 3ZMSA 1YJWV 4LR3A 4I9QA 1M56B 4NXNB 3T1YO 1NR1A 3LSUA 3JAKB 3B09A 4B3SO 1QR8A 3IC7A 4DUYO 4FMTA 3W7XA 4DR2O 1S72V 5LGTA 4TWKA 3SJAC 1KKDA 1OZ0A 4WFBV 1VARA 3AG4B 3IAYA 5JQGB 5IYCO 1XHXA 4NXMB 3OUFA 5FL7G 4KL1A 5LHHA 2PI4A 2Q7GA 4DR5O 2YI8A 5LP6C 5KHHA 1DLBA 3D3QA 4DR7B 1FJGB 5CA1A 2EILC 1H8EG 2EIKB 3OMNB 1CEZA 2Y69C 4L8JA 3M7MX 2XASA 1AI4A 5EYPB 3JATB 1EZVH 1WPXA 3OE7G 3SGIA 2UXCO 2RCVA 4JPRA 1SQVH 1JJOA 1MOFA 5LGUA 3BHPA 4I4TA 3ICXA 2EBOA 2KSDA 4D7TA 1ZLZA 2IJIA 1I5YA 4G28B 2EIMC 3C90A 4UCOA 4CS3A 1D5AA 2A7WA 1SZXA 3LNMB 3FX7A 2OCCB 3OD4A 5HFLA 3WB1A 1Q6HA 3VQYA 1TUBA 2Z0AA 1K73W 4UCRA 5EC1C 2B1IA 1R1BA 3L70H 2HP8A 2LW1A 4X20A 3ZIAG 4O2AB 4OGQB 3T1CA 5IJ9B 3ABUA 1HNWO 2AZ0A 4EFEA 2E3CA 1IBMB 3GWKC 3T4ZA 4D6TH 1GN4A 3N2GA 1MA1A 1QLEB 2CTRA 2AGAA 2IH1C 4P9OA 2VQEB 3RYIA 1O9GA 1CPYA 3DGEA 1UPGA 3CEIA 3EFFK 4MTFA 2WWWA 4MTOA 1LUVA 1N34O 3L71H 4G27B 1M4UA 2HR3A 3LSQA 2F93B 3VOUA 5B3SC 3ABKB 3JAWB 1JFFB 2ZQMA 3U11A 3VQXA 4PD4F 4FFKA 3CCRV 2P22C 4TSFG 5LHGA 2LFRA 2EJ7A 1RSOB 1FAFA 2ZXWC 1YTFB 1YF2A 2KQXA
chains in the Genus database with same CATH topology
2Y4UA 1HDJA 1GH6A 2YS8A 1XBLA 4IT5A 3UCSC 2GUZA 2Y4TA 2CUGA 2CTWA 4J80A 2QWRB 3APOA 3UO3A 1BQZA 2DN9A 2GUZB 3BVOA 1BQ0A 3AG7A 1IURA 2QWOB 2LGWA 2M6YA 2L6LA 2DMXA 2OCHA 2CTQA 1WJZA 2QWNB 3UO2A 1NZ6A 2QSAA 1N4CA 2CTRA 2LO1A 2QWPB 2PF4E 2YUAA 2QWQB 3APQA 4RWUA 2CTPA 2EJ7A 4J7ZA 1FAFA 1FPOA 2N05A 2N04A 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  1HDJ A;  1GH6 A;  2YS8 A;  1XBL A;  4IT5 A;  3UCS C;  2GUZ A;  2Y4T A;  2CUG A;  2CTW A;  4J80 A;  2QWR B;  3APO A;  3UO3 A;  1BQZ A;  2DN9 A;  2GUZ B;  3BVO A;  1BQ0 A;  3AG7 A;  1IUR A;  2QWO B;  2LGW A;  2M6Y A;  2L6L A;  2DMX A;  2OCH A;  2CTQ A;  1WJZ A;  2QWN B;  3UO2 A;  1NZ6 A;  2QSA A;  1N4C A;  2CTR A;  2LO1 A;  2QWP B;  2PF4 E;  2YUA A;  2QWQ B;  3APQ A;  4RWU A;  2CTP A;  2EJ7 A;  4J7Z A;  1FAF A;  1FPO A;  2N05 A;  2N04 A;  2KQX A; 
#chains in the Genus database with same CATH topology
 2BTQ A;  2A0L A;  4X1I A;  1MNG A;  3JYC A;  4LBE C;  4ABM A;  1EN4 A;  1NVP B;  4JI2 O;  1N34 B;  2ZE6 A;  1K92 A;  4IIJ A;  4DRX A;  4HYO A;  1XMQ B;  3S3W A;  1J5E B;  3E89 A;  5GTI Z;  2UXX A;  4J9Y B;  2JRI A;  4MVM A;  3OTO B;  3ZRW A;  1URF A;  4NTW A;  1GH6 A;  3OFN G;  4L87 A;  4IHJ A;  1I94 O;  4UV9 A;  2PY5 A;  3O9O A;  4LF5 O;  2D2C B;  2IJK A;  2OT5 A;  2Q5Z A;  3N2K A;  4HBN A;  1RM1 C;  4FM2 A;  3W7S A;  1JJ2 U;  1Y6X A;  4I9W A;  5H2F Z;  5EBW C;  2HHH O;  2E5L O;  2Q0O C;  4X1Y A;  5CA1 B;  4BR6 A;  3QG5 A;  2CTP A;  4R7C A;  2F66 C;  1F7Y A;  2X0L A;  3C3S A;  3AK1 A;  3SYO A;  1ZX3 A;  1HP8 A;  2GV9 A;  2ZT9 B;  2KKW A;  2OWO A;  4NR1 A;  1PM9 A;  4I55 A;  3ASO B;  3L9D A;  1KKC A;  5KX5 A;  4I4T B;  1NJI W;  1F23 A;  4AQY O;  3DC6 A;  3ZRS A;  5D5P A;  5LOV A;  1VQM V;  1GN2 A;  1ZL8 A;  4GKJ B;  3U0Z A;  1PL0 A;  2P4V A;  5J2T A;  2R72 A;  1GN6 A;  3ETQ A;  4EFB A;  1SQX H;  1XMO O;  2YI9 A;  3K5O A;  5EC2 C;  2B1G A;  4X20 B;  1B3Q A;  1Q82 W;  4O4H A;  3CCV V;  5FPR A;  1YCI A;  2A9H A;  2XUM A;  3CRA A;  3EXA A;  2UXB O;  5JCO C;  4B7E A;  3X2Q C;  3N2G B;  5BR8 B;  1VF7 A;  1NU1 H;  1US6 A;  4B3M O;  2YXY A;  4H44 B;  1BZK A;  5DED A;  4J9Z B;  2DQ3 A;  3RYI B;  4PDM A;  1YIT V;  4I0X A;  4U7O A;  4DR4 O;  2QDO A;  3HB3 B;  4HZ3 A;  1XIL A;  2DOS A;  3A0H Z;  3VQW A;  3CPW U;  1H2G A;  3BAA A;  2WLH A;  4K0K O;  1Q6U A;  1N36 O;  3ML0 A;  4TQF A;  3OR6 C;  4JI0 B;  4QPJ A;  1SQG A;  1IXB A;  2BTQ B;  2ARH A;  2PTM A;  4BIO A;  5EZY A;  3E8B A;  1MSD A;  4DR1 B;  4IIJ B;  1Q8I A;  5CA0 A;  4DRX B;  5KMG A;  3BPZ A;  3FAV A;  4XDK A;  1XEQ A;  3CX5 F;  4YJ3 A;  2DQ0 A;  4P9P A;  1SES A;  2PYJ A;  3ZMZ A;  3ZRW B;  2JS5 A;  5KA5 A;  2W6I G;  4IHJ B;  1VF6 A;  5JWP A;  4JI4 O;  1BMF G;  4JYC A;  3RYF A;  3N2K B;  4J10 A;  3OAA G;  1GN3 A;  3D36 A;  3QO8 A;  1JA8 A;  2Q69 A;  5EIB C;  4X1Y B;  2NN4 A;  2EZO A;  2Y4T A;  4TV8 A;  3IGA C;  1X4T A;  2HLD G;  3ZMT A;  4LNU A;  5J9P C;  4QNH B;  4I55 B;  2QKS A;  5KX5 B;  2ZR3 A;  4RUF A;  2DW4 A;  5EK0 A;  2R9R B;  3AK2 A;  5A2Q N;  4YY3 O;  5LOV B;  1ZL8 B;  2NR5 A;  4UCS A;  4WFE A;  5LYJ A;  1JCH A;  2QKA A;  5J2T B;  4J80 A;  5B1N A;  5FLX N;  1KB9 F;  2Q67 A;  4DR3 O;  1JQ0 A;  1OCC B;  5B1B B;  2JVD A;  2JDI G;  5KUK A;  4X66 O;  4TQD A;  1D5N A;  3ZN0 A;  2BCC H;  2YSU B;  3CB2 A;  3G6B A;  4ZI7 A;  4O4H B;  2XAJ A;  4JZG A;  1EFR G;  5EBM C;  4JI3 B;  5CBH A;  3TXS A;  1XNQ B;  3RVY A;  3K0G A;  4DV3 O;  3ZS8 C;  4I0X B;  1QNM A;  5L3E A;  1NTM H;  4UUJ C;  2QM8 A;  5FNV A;  4X66 B;  3H9V A;  4U3J A;  1UFI A;  1N0J A;  1AJP A;  3OTF A;  2BTO A;  4FLW A;  1I7F A;  4KXR A;  5JJE B;  1VQ8 V;  1FKA O;  4CH6 A;  1WP7 A;  1R3K C;  2P6J A;  1IDS A;  1OCR B;  4DV0 B;  4LFA B;  3UKM A;  4NB5 A;  2RN9 A;  5EZY B;  4WCE V;  1WNS A;  5CA0 B;  2XND G;  5KMG B;  3FAV B;  4FPP A;  4PA3 A;  4F6R A;  4OXS A;  1K4C C;  1H38 A;  3K9S A;  4YJ3 B;  4W4K A;  3JCZ A;  2LJ2 A;  2DYS B;  2VQF O;  1GK9 A;  4TOI A;  1IX9 A;  2ZDI A;  5LMN B;  5CMU A;  1ROP A;  4ASU G;  4U3F H;  4ZBM A;  2P67 A;  4MTG A;  3O65 A;  1IVS A;  3ZHV A;  4J11 A;  3ZCC A;  4CS4 A;  4TUY A;  3RYF B;  2UUC O;  1K8A W;  3I55 V;  4B3R O;  1M1K W;  4GX0 A;  1HDJ A;  1R3L C;  2AXT Z;  1Q6I A;  1OCO B;  3CCS V;  1K4D C;  1SA0 A;  4DW0 A;  2QE7 G;  3W7T A;  1NR7 A;  2JIZ G;  1VQP V;  4DV7 O;  2EIJ C;  1MMM A;  4LNU B;  1VMG A;  1HWY A;  2Z3Y A;  2E76 B;  4J7K A;  3J81 N;  1XHZ A;  2AHY A;  1GRJ A;  2UUC B;  3C3T A;  1HR0 B;  4DV2 O;  2W0X A;  1SS3 A;  1PKX A;  3FFQ A;  5LYJ B;  2PYL A;  2OTL V;  1V9P A;  3H1J H;  1QVG U;  4OX9 B;  1QCE A;  4KHP O;  1N32 B;  4ZI7 B;  1ORQ C;  3SPC A;  3E35 A;  1NBM G;  1X59 A;  1F51 A;  2IU3 A;  2RQ6 A;  3CHX A;  1QVF U;  4PA6 A;  1I08 A;  3ABT A;  3CCL V;  4DUZ O;  5HFM A;  1K5S A;  3SR2 C;  3CP1 A;  4C7U A;  3OMI B;  5LMU B;  3HKB A;  5IE9 A;  2EZP A;  3CC4 V;  4YXW G;  3SJB C;  1FXK C;  2DE0 X;  1YTF D;  3FB5 C;  3JAS A;  4J7Z A;  2WLM A;  1M56 C;  5FNV B;  2YC0 A;  3WB0 A;  1KD1 W;  1WPB A;  4U3J B;  4IYI A;  3ASN B;  4FLY A;  3K5L A;  4X65 B;  1T5E A;  2PGG A;  4N21 A;  3K5N A;  5KUM A;  4JAA A;  4WFG A;  2FML A;  3AG4 C;  3EVK A;  2G38 A;  2ZIN A;  2QM4 A;  3AG1 C;  1AVM A;  2GUZ A;  5B66 Z;  4F6R B;  2EX3 A;  4GZR B;  5FPO A;  2IJJ A;  2YDE A;  1IBK B;  4FJC C;  3NXS A;  1NH2 D;  2EIK C;  2UXD O;  2P06 A;  3B8M A;  3OGI B;  2CGO A;  3OR7 C;  3PN1 A;  2HVJ C;  2JEX A;  1YJ9 V;  1KC8 W;  1MAB G;  4GT1 A;  1ARO P;  2YS8 A;  4DV4 O;  2OIE A;  4TUY B;  1GM7 A;  4CH5 A;  3AG1 B;  4CH4 A;  4ZIB A;  3ABM B;  1KU9 A;  1M93 A;  3T1Y B;  4BIU A;  4B3S B;  1RP3 B;  1SA0 B;  4DUY B;  1OCZ B;  4DR2 B;  4LC1 A;  2OCC C;  5C8Y A;  4W4L A;  1F4M A;  3SYQ A;  3PJS K;  2DWD C;  3A2F A;  1FPO A;  4G2K A;  1F4N A;  2R9A A;  2X6B A;  3IC9 A;  1MZF A;  2Q68 A;  1PV0 A;  4MSW C;  1VQ5 V;  1LUW A;  4H37 A;  4IYH A;  2Q7E A;  2OIG A;  4J41 A;  1EBO A;  4LF8 O;  4DR5 B;  2H8P C;  1K33 A;  4LWS A;  1QLE C;  2ZIM A;  3GWO A;  3U10 A;  4LFB O;  3G71 V;  4PHZ A;  1BCC H;  2WPD G;  3T4D A;  2CAZ C;  2PUS A;  5EBL C;  4QE9 A;  3ABK C;  4R6Z A;  4FLU A;  3HPL C;  2B9Z A;  2UXC B;  3K9A A;  3AG3 B;  4FM1 A;  3E86 A;  5GTH Z;  3HKB B;  1S3J A;  2V4D A;  1VF5 B;  1DGS A;  3G67 A;  3H1I H;  4LFB B;  3FB6 C;  5GW7 A;  2QGN A;  3JAS B;  4HNA A;  3FKS G;  4OPA A;  1K34 A;  3SJC C;  2RNB A;  1RFY A;  1TVK A;  4FFB A;  4RAI A;  3LDE A;  1N8R W;  2LW7 A;  1HNW B;  1M57 B;  1PNM A;  3MHH C;  5BY1 A;  2UUA O;  4UVA A;  4R50 A;  2B5U A;  2H94 A;  1JR9 A;  2YXH A;  4JI8 O;  2GUZ B;  3J80 N;  1KP2 A;  2EUL A;  3STZ C;  3TET A;  1E1R G;  3DXR A;  1VQK V;  3F7V C;  3BFR A;  1Y66 A;  2N05 A;  2N04 A;  2F95 B;  2E74 B;  2YIC A;  1AP6 A;  1SF9 A;  3LUT B;  3A0R A;  1Q90 D;  4IGG A;  2DYR B;  4K35 A;  3ASO C;  2ITC C;  4FZ0 A;  4JI2 B;  1BE3 H;  1VQL V;  4F4L A;  1NH2 B;  1BHB A;  3D8C A;  4CC5 A;  4CS2 A;  1AI6 A;  1XDC A;  2F23 A;  1QR9 A;  5C8Y B;  3AK3 A;  1S5H C;  4JI1 O;  3SDL A;  2UU9 O;  1ENV A;  3VQV A;  1BQZ A;  4MVU A;  1I94 B;  1DF5 A;  3UM7 A;  2V1D A;  1FFT B;  1NTZ H;  3CXC U;  4LF5 B;  3BRC A;  3ZHT A;  2ATK C;  2HHH B;  2E5L B;  3CCE V;  4UCV A;  3Q4H A;  3B77 A;  3ZMU A;  2PI5 A;  1TUB B;  4X64 O;  4WFF A;  2EJR A;  3I5D A;  3CXH F;  1Q7Y W;  2W0F C;  2UU9 B;  1XOU A;  2QA4 V;  3LNN A;  2LP7 A;  1THZ A;  3UO2 A;  1M5I A;  1EZJ A;  1S77 D;  2VWK A;  4GYC B;  4ICG A;  3FB8 C;  1RPR A;  4AQY B;  1B06 A;  4CBC A;  1QU7 A;  3BA9 A;  3MHS C;  1PNL A;  2XTA A;  4DO2 A;  4HNA B;  1XMO B;  4RQF A;  5CA3 A;  4EKW A;  4X9Q A;  2L6L A;  4X64 B;  4UXN A;  4HAM A;  1TVK B;  4FFB B;  4JYY A;  3LDC A;  3APQ A;  1CXZ B;  5JH7 A;  2JJ2 G;  2UXB B;  4B3M B;  1KEC A;  4JI5 O;  5H5N A;  2IU0 A;  4X1I B;  1KMI Z;  5H6Q A;  3W7W A;  1SKV A;  3RYC A;  3SPI A;  4DR4 B;  4I50 A;  2WA3 A;  1YXB A;  4ZHQ A;  4BAY A;  3DXR B;  4D7S A;  4K0K B;  1GTO A;  4DYL A;  4B3T O;  4GX2 A;  3TGU H;  1XNR O;  2CTW A;  3K03 A;  5IYB O;  3CRM A;  3ZHQ A;  1N36 B;  2ETN A;  5L3F A;  2QJ1 A;  4BWA A;  1YEW A;  4DV6 O;  1DK1 A;  2HKO A;  3RWR D;  3ABL B;  3QF7 A;  1FYJ A;  4JAV A;  3B2E E;  4YIO A;  1GKF A;  2UXN A;  4F6E A;  3G4S V;  1N0N A;  1NS1 A;  1YI2 V;  3ZMV A;  2FL4 A;  1OCC C;  1ZSP A;  5B1B C;  2WAM A;  1SZT A;  2F43 G;  3M8A A;  4XDL A;  3M99 B;  5KAF Z;  4B08 A;  2C2A A;  3RGB A;  1E1Q G;  1ZAU A;  4JI4 B;  3TK1 A;  1FS0 G;  1R6N A;  2JGU A;  2IW5 A;  4P30 A;  5J2U A;  5IDJ A;  5BZB A;  4YHH O;  2GDS A;  4X89 A;  3Q4H B;  1YHQ V;  3E22 A;  2F4V O;  1KP3 A;  1L0L H;  2ZKO A;  4UCU A;  4NTY A;  4LP8 A;  1PP9 H;  2AZ2 A;  1LNQ A;  3CRQ A;  3CRR A;  5IY5 B;  4K8X A;  1QQC A;  1JOY A;  3CS5 A;  5KHG A;  3RT3 C;  2A79 B;  2BE3 A;  2WA4 A;  3ETE A;  4QJF B;  3CMA V;  4YY3 B;  2BSK A;  1W2B U;  1BQ0 A;  2K9P A;  4PI2 A;  5B1A B;  4YHH B;  1OCR C;  4O4I A;  5LXT A;  2CTQ A;  4DR3 B;  1JPX A;  3CCJ V;  4MT8 A;  1WAZ A;  3CE2 A;  5JH7 B;  1B6Q A;  2DYS C;  3RFR A;  4PA4 A;  1BL8 A;  1AR4 A;  1G6U A;  1V55 B;  1VF6 C;  1Z2G A;  2HFE C;  4FLV A;  1Q81 W;  2QTO A;  2WLK A;  1SET A;  4BIZ A;  4DV3 B;  4JYA O;  3UT5 A;  4WBN A;  4JAS A;  3J7A U;  4I50 B;  2QTS A;  3D36 C;  3WB2 A;  3UQ8 A;  3G6E V;  1W59 A;  1YSC A;  4ZHQ B;  4X62 O;  1OCO C;  2AW9 A;  4QGP A;  1GAX A;  1TUE B;  4JTD B;  2NNU A;  4PDL A;  3F7Y C;  3ZRV A;  2WSS G;  3BY6 A;  2D3O W;  2V7Q G;  3AG2 B;  4FK5 C;  1KYO F;  1U96 A;  2CDY A;  3KCY A;  3SPG A;  4MVQ A;  2YID A;  3QNE A;  2CUG A;  3RW0 A;  5ITZ A;  4U7N A;  1VQN V;  2ODM A;  3JSN A;  4FLT A;  4LCU C;  1H2N A;  4TV8 B;  1GO3 F;  2X6C A;  4YJ2 A;  2VQF B;  4UB8 Z;  2ZE5 A;  5B5E Z;  4O4J A;  5LL6 Y;  4K3A A;  3KCX A;  3QTC A;  2GHY A;  2HEP A;  3KG2 A;  4ZKI A;  1FXH A;  1Y74 A;  5IWA O;  3H01 A;  3SYC A;  4X1K A;  1HNX O;  1H2L A;  4B3R B;  5J2U B;  3OEH G;  4Z1V A;  3ZBH A;  3VBB A;  5JJN B;  4FLZ A;  1BHA A;  2GTA A;  3SYA A;  3E22 B;  4I5S A;  3THO A;  1IBL O;  5LGN A;  3JAR A;  2Q7H A;  1R6T A;  2ZR2 A;  4DV7 B;  3QVN A;  4WFH A;  4NYK A;  2MW2 B;  2EIN B;  1AJQ A;  5BXZ A;  3IFX A;  5LP6 A;  3ASN C;  4LF6 O;  2ADP A;  3RN4 A;  1G1X B;  3ZN1 A;  2ZD9 A;  3BVO A;  2BOC C;  2ITD C;  1G8M A;  1WN7 A;  3F5T A;  5L3D A;  3CCU V;  4DV2 B;  2JJ1 G;  2BSK B;  1GM9 A;  1DTO A;  4LH6 A;  1SQF A;  1CP9 A;  1JMK C;  4O4I B;  3ZRX A;  1V54 B;  5LXT B;  4LFC O;  2IJH A;  2FTK A;  1VQO V;  4DR6 O;  4DV5 O;  1IBL B;  3K04 A;  1Z5V A;  3MAQ A;  3JD4 A;  4KHP B;  2LGQ A;  3E2E A;  4J42 A;  3TJT A;  1R3J C;  5B1O A;  3NR7 A;  2ZDI C;  2IBZ H;  3JSL A;  3CSX A;  4JV5 O;  1SQP H;  4DUZ B;  1LR1 A;  1VQ7 V;  2QWP B;  4NXN O;  5JVD A;  2JGD A;  3QO5 A;  2WLL A;  4FM0 A;  3UT5 B;  3WFV A;  4WBN B;  1AB3 A;  3DTU B;  2VS0 A;  1AP5 A;  4IT5 A;  5IT9 N;  4DR6 B;  3ABM C;  1XI1 A;  2XAG A;  3BAB A;  2HJD A;  3JD0 A;  3ZJZ A;  5LA6 A;  3G80 A;  3IJ4 A;  1OCZ C;  4MVS A;  4MVZ A;  1OJH A;  5KHJ A;  4NXM O;  2P4K A;  3SPJ A;  5DM6 V;  1AI5 A;  4PA7 A;  3L73 H;  5LHI A;  3OM3 B;  2PZS A;  1VP7 A;  3WG7 B;  4DR7 O;  1FJG O;  2FKX A;  3E8H A;  1VEW A;  5ITZ B;  3A8T A;  2CH7 A;  2KB1 A;  2JS3 A;  2H3O A;  4RO2 A;  1KBH A;  1I5X A;  5KLV H;  2QSA A;  4YJ2 B;  4X8A A;  3JCU Z;  2UXD B;  3P32 A;  2F1M A;  1H8H G;  2GBO A;  3ZHU A;  2ZCE A;  1AIL A;  3UCS C;  1NI8 A;  4O4J B;  1E79 G;  3HKD A;  1S76 D;  1KUQ A;  4MW3 A;  1O9H A;  1P84 F;  3APO A;  4E2L A;  4DV4 B;  1Y74 B;  4XBF A;  4X1K B;  3ZHS A;  3AG3 C;  4PA9 A;  5F2V O;  4LF9 O;  2RDC A;  1WB8 A;  4UVB A;  1K3E A;  1FD9 A;  3SYP A;  4DV1 O;  5D5Q A;  4JTA B;  2HG5 C;  2NLJ C;  1P49 A;  3JAR B;  1RPO A;  1PD3 A;  1IBM O;  1KQS U;  1WP8 A;  4UVC A;  5CB4 A;  5LP6 B;  4R8C A;  2Q4P A;  4KP4 A;  5KHI A;  4X88 A;  4EEQ A;  5LBQ A;  2QWO B;  3ETG A;  1J95 A;  2ZNI A;  2DMX A;  2MK3 A;  2QWN B;  2VQE O;  1M57 C;  1NTK H;  2EIL B;  4LF8 B;  1N4C A;  1P7B A;  3B8N A;  3S3X A;  2Y69 B;  1H2S B;  4NTX A;  4LF9 B;  1EN5 A;  3CJH A;  3E8G A;  2YEV A;  4DV1 B;  2X7R B;  4CH3 A;  3RYH A;  1AR5 A;  3K57 A;  5GON A;  4ZOL A;  5CBG A;  1QLN A;  2Q73 A;  1S5J A;  4KUM A;  1WLE A;  5E79 Z;  2ADQ B;  4FIP C;  4O4L A;  1NZ6 A;  1K9M W;  2EIM B;  4DW1 A;  5K1X A;  3CCQ V;  2JK5 C;  3JAM N;  4RUE A;  4JAU A;  4AHC A;  5IYZ A;  4XDJ A;  5JVD B;  2JGD B;  1XBL A;  2WLL B;  1H2M A;  3GB7 C;  4NKG B;  3I56 V;  1L0N H;  4GX5 A;  1XMQ O;  3EHB B;  4QE7 A;  2XT9 A;  2DYR C;  1J5E O;  3AG7 A;  1B04 A;  1W0J G;  3OTO O;  5JCO A;  3L74 H;  5IJ0 A;  5LA6 B;  3W7U A;  1SER A;  1K97 A;  1NT2 B;  3CC7 V;  4GKK O;  3H1K H;  5CN0 A;  4UV8 A;  3A0B Z;  1WB7 A;  3E83 A;  3H1L H;  4BW5 A;  5B3S B;  4FLX A;  1IUR A;  1W0K G;  2UUA B;  1K5Q A;  3MD0 A;  1SC5 B;  4JI8 B;  1R6K A;  3OUS A;  2RJZ A;  2YXL A;  2CH7 B;  4JTC B;  3OEE G;  2IM9 A;  2VWJ A;  2Q6A A;  2XOK G;  2OTJ V;  1Y76 A;  1FXV A;  4UB6 Z;  4AI8 A;  2ZXW B;  1VQ9 V;  3ZHR A;  4GKK B;  3BCC H;  1S0V A;  1A32 A;  3GVM A;  1M90 W;  3K3W A;  1IXM A;  3HKD B;  4H0L B;  2X6A A;  3OW2 U;  4GKJ O;  2ZM6 O;  4WFA V;  5EIB D;  1MG1 A;  3LDD A;  4LWS B;  1Y67 A;  2K1E A;  4DK1 A;  4QPK A;  1SRY A;  4O2B A;  4AIL C;  4GUN A;  1I0H A;  5L3C A;  4JYB A;  1HW7 A;  1P7G A;  1QHT A;  5CB4 B;  4JI1 B;  3E8F A;  4EB6 A;  5BR8 O;  3K59 A;  1RM1 B;  1NQT A;  2QWQ B;  1YDX A;  3R66 A;  2CGN A;  2ZM6 B;  3R65 A;  1VQ4 V;  1Q43 A;  4LF4 O;  1BSM A;  4CC6 A;  3CJH B;  4UFZ A;  2YEV B;  1M9N A;  1QBZ A;  3RYH B;  2ZE7 A;  5GON B;  2RMK B;  2ZIO A;  4ZOL B;  5H9C A;  4PDR A;  4GCZ A;  3JAL A;  1EM1 A;  1S5L Z;  4TT3 G;  3CCM V;  3DSQ A;  4JI0 O;  4JI6 O;  4O4L B;  2Q9L A;  3HKE A;  1YVW A;  3WU2 Z;  3HKC A;  4UCT A;  1PNK A;  5IYZ B;  3ZED A;  4LF4 B;  4DR1 O;  3UO3 A;  2WLN A;  3N27 A;  3ABL C;  1Z5W A;  3P3N A;  3HR0 A;  2YIA A;  3TXQ A;  2Q8V A;  5KAI Z;  5IJ0 B;  3X2Q B;  2XAQ A;  3K79 A;  4JI6 B;  3T2M A;  1L8D A;  2BOB C;  2HJF C;  1AJN A;  1GM8 A;  4JI5 B;  4B7K A;  2P90 A;  4GX1 A;  1D2D A;  3BEH A;  2YIB D;  3F5W C;  2PF4 E;  1TA8 A;  5BMV A;  3CYO A;  1PL4 A;  2FB5 A;  3DC5 A;  3RBZ A;  3SPH A;  1Y76 B;  3OMA B;  1ZWI C;  1JVM A;  2WLI A;  5C93 A;  1ZUQ A;  4PEL A;  4B3T B;  1R3I C;  2Q0A A;  1XNR B;  1P4R A;  2O57 A;  5IY5 C;  4OPH A;  1TGO A;  2YIB A;  4I7Z B;  4E4E A;  4DV6 B;  2P7T C;  4LF7 O;  2CK3 G;  4MVO A;  3FYE B;  5K1P A;  5IYD O;  1FFX A;  3JD3 A;  3P30 A;  2DN9 A;  5B1A C;  5DN6 G;  5TIS Z;  4O2B B;  2FYU H;  3QO7 A;  1Y4M A;  2P5O A;  4JI3 O;  4EB6 B;  1XNQ O;  2DWE C;  3FYI B;  3RVZ A;  3SJQ C;  2LQT A;  4JF3 A;  4QIW F;  2Y4U A;  1MSW D;  2VRZ A;  4MTX A;  2GTS A;  1BT8 A;  4BW9 A;  1L1F A;  4LF7 B;  3OT7 A;  1XQ8 A;  1V55 C;  3CC2 V;  2XAF A;  4A5U B;  3AEI A;  1R73 A;  3JD1 A;  5KA6 A;  3JAL B;  4JZ2 A;  2F4V B;  3CWB H;  5A9G A;  3OGC C;  2XAH A;  4KFM A;  3FB7 C;  2AHZ A;  3HKE B;  2KG7 A;  3HKC B;  3CD6 V;  4JI7 O;  1MZE A;  5H6R A;  4DV0 O;  4LFA O;  1NKD A;  3P3P A;  4DK0 A;  2OYQ A;  1WA8 A;  2QKC A;  2Y0P A;  4PV1 B;  2M6Y A;  4TV9 A;  2UUB O;  4IL6 Z;  4MVR A;  5L3G A;  3AG2 C;  3B40 A;  1GMG A;  4NVP A;  1G4Y B;  2Y0I A;  3RYC B;  5KHK A;  4PJ0 Z;  1BGY H;  1N33 O;  3TCU A;  5LMN O;  1K7D A;  2DJV A;  2ZE8 A;  2XHB A;  4YIP A;  5L3B A;  3B4S A;  1YJN V;  4H33 A;  1FXK A;  1HNZ O;  4JI7 B;  2UUB B;  4RWU A;  5JJJ B;  2N74 A;  3ZX6 A;  3BA8 A;  3CME V;  1XL6 A;  3JAK A;  4JYA B;  1H2K A;  5BMV B;  4P2Z A;  1N33 B;  4MW8 A;  4WF9 V;  2Z5U A;  1VQ6 V;  4X62 B;  2WLI B;  2W6J G;  5JQG A;  3MDS A;  1YZB A;  4Q20 A;  1HNZ B;  1OHH G;  4K8Z A;  1HR0 O;  2EIN C;  2M7W A;  5E1A C;  1DF4 A;  3KKY A;  5AG2 A;  3LSS A;  3JD2 A;  3D3I A;  4OX9 O;  1FFX B;  1N32 O;  1V54 C;  1IZ3 A;  2CE4 A;  5EYP A;  3JAT A;  1OV9 A;  2A06 H;  2GSM B;  2WLJ A;  4J7J A;  4Q6G A;  2ZNJ A;  2QEX V;  5LMU O;  2R70 A;  3T1H O;  4DXW A;  2HVK C;  2ILM A;  2QM7 A;  4GLX A;  4FZ1 A;  1YIJ V;  1AR1 B;  3K5M A;  5IWA B;  1HNX B;  2OCH A;  2A3Q A;  2JEU A;  2EIJ B;  3L72 H;  1JX9 A;  1XRE A;  3KZI Z;  1XL4 A;  4Z2W A;  1SQB H;  4PDV A;  4X65 O;  1AI7 A;  1VIB A;  2R9I A;  4O2A A;  5IJ9 A;  2L35 A;  3K08 A;  1BS3 A;  4N23 A;  1Q3E A;  2KG7 B;  3H1H H;  3T1H B;  4LF6 B;  4Z1M G;  3K06 A;  1WA8 B;  1PPJ H;  2QR4 A;  4H13 B;  4MS2 A;  4TV9 B;  2LFS A;  2LO1 A;  3CRC A;  3L75 H;  4JGS A;  1COW G;  5DEC A;  1U97 A;  4CZZ A;  1NVP D;  1Q5O A;  3JAW A;  3WG7 C;  4LFC B;  1JFF A;  1IBK O;  1TAE A;  4DV5 B;  2QWR B;  3FD9 A;  4LH7 A;  1XUQ A;  4RQE A;  4PI0 A;  5CBF A;  2Y48 A;  2LGW A;  1UJW B;  4FVM A;  1Q86 W;  3STL C;  1WJZ A;  3K58 A;  3K0D A;  3ETD A;  1FXK B;  1SQQ H;  1RSO A;  1ZTE A;  2IH3 C;  2YUA A;  1EN6 A;  2E75 B;  4JV5 B;  3ZMS A;  1YJW V;  4LR3 A;  4I9Q A;  1M56 B;  4NXN B;  3T1Y O;  1NR1 A;  3LSU A;  3JAK B;  3B09 A;  4B3S O;  1QR8 A;  3IC7 A;  4DUY O;  4FMT A;  3W7X A;  4DR2 O;  1S72 V;  5LGT A;  4TWK A;  3SJA C;  1KKD A;  1OZ0 A;  4WFB V;  1VAR A;  3AG4 B;  3IAY A;  5JQG B;  5IYC O;  1XHX A;  4NXM B;  3OUF A;  5FL7 G;  4KL1 A;  5LHH A;  2PI4 A;  2Q7G A;  4DR5 O;  2YI8 A;  5LP6 C;  5KHH A;  1DLB A;  3D3Q A;  4DR7 B;  1FJG B;  5CA1 A;  2EIL C;  1H8E G;  2EIK B;  3OMN B;  1CEZ A;  2Y69 C;  4L8J A;  3M7M X;  2XAS A;  1AI4 A;  5EYP B;  3JAT B;  1EZV H;  1WPX A;  3OE7 G;  3SGI A;  2UXC O;  2RCV A;  4JPR A;  1SQV H;  1JJO A;  1MOF A;  5LGU A;  3BHP A;  4I4T A;  3ICX A;  2EBO A;  2KSD A;  4D7T A;  1ZLZ A;  2IJI A;  1I5Y A;  4G28 B;  2EIM C;  3C90 A;  4UCO A;  4CS3 A;  1D5A A;  2A7W A;  1SZX A;  3LNM B;  3FX7 A;  2OCC B;  3OD4 A;  5HFL A;  3WB1 A;  1Q6H A;  3VQY A;  1TUB A;  2Z0A A;  1K73 W;  4UCR A;  5EC1 C;  2B1I A;  1R1B A;  3L70 H;  2HP8 A;  2LW1 A;  4X20 A;  3ZIA G;  4O2A B;  4OGQ B;  3T1C A;  5IJ9 B;  3ABU A;  1HNW O;  2AZ0 A;  4EFE A;  2E3C A;  1IBM B;  3GWK C;  3T4Z A;  4D6T H;  1GN4 A;  3N2G A;  1MA1 A;  1QLE B;  2CTR A;  2AGA A;  2IH1 C;  4P9O A;  2VQE B;  3RYI A;  1O9G A;  1CPY A;  3DGE A;  1UPG A;  3CEI A;  3EFF K;  4MTF A;  2WWW A;  4MTO A;  1LUV A;  1N34 O;  3L71 H;  4G27 B;  1M4U A;  2HR3 A;  3LSQ A;  2F93 B;  3VOU A;  5B3S C;  3ABK B;  3JAW B;  1JFF B;  2ZQM A;  3U11 A;  3VQX A;  4PD4 F;  4FFK A;  3CCR V;  2P22 C;  4TSF G;  5LHG A;  2LFR A;  2EJ7 A;  1RSO B;  1FAF A;  2ZXW C;  1YTF B;  1YF2 A;  2KQX A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  1HDJ A;  1GH6 A;  2YS8 A;  1XBL A;  4IT5 A;  3UCS C;  2GUZ A;  2Y4T A;  2CUG A;  2CTW A;  4J80 A;  2QWR B;  3APO A;  3UO3 A;  1BQZ A;  2DN9 A;  2GUZ B;  3BVO A;  1BQ0 A;  3AG7 A;  1IUR A;  2QWO B;  2LGW A;  2M6Y A;  2L6L A;  2DMX A;  2OCH A;  2CTQ A;  1WJZ A;  2QWN B;  3UO2 A;  1NZ6 A;  2QSA A;  1N4C A;  2CTR A;  2LO1 A;  2QWP B;  2PF4 E;  2YUA A;  2QWQ B;  3APQ A;  4RWU A;  2CTP A;  2EJ7 A;  4J7Z A;  1FAF A;  1FPO A;  2N05 A;  2N04 A;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...