1D2DA

Hamster eprs second repeated element. nmr, 5 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords TRNA SYNTHETASE
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
total genus 18
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1999-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1d2dA00
4B3TO 4OPAA 3SDLA 1R1BA 1FKAO 2LW7A 4JI5O 1N33O 4JI2O 4OPHA 2UU9O 5IT9N 1AB3A 4B3MO 4JI8O 1FJGO 4OX9O 5BXZA 2JRIA 4JI3O 4B3RO 4JI6O 4DV4O 4DV0O 4KHPO 1F7YA 4DUZO 1N34O 3T1YO 4DV5O 4LF7O 1J5EO 4X66O 1XNQO 4DV2O 1DK1A 2N74A 4YHHO 2UXBO 1A32A 4AQYO 4LF5O 1R6TA 1X59A 3T1HO 5IWAO 1IBKO 4JYAO 2F4VO 4GKJO 1XEQA 4DR7O 3F5TA 4DV6O 3M8AA 5BY1A 4JI1O 1XNRO 2Z0AA 4DV1O 3OTOO 4JI4O 4JI7O 1HR0O 2VQEO 3O65A 3J81N 2VQFO 4LF9O 1I94O 4X64O 2UUCO 1N36O 4DR3O 2UXDO 5LL6Y 4JI0O 2UUAO 4DR5O 4NXMO 2ZKOA 4B3SO 3RT3C 1D2DA 1IBMO 5LMNO 3JAMN 2UUBO 4DUYO 4LF8O 1HNXO 4X65O 3J80N 2E5LO 1FYJA 4YY3O 2DJVA 1KUQA 4DR6O 4DR4O 4LFBO 5BR8O 1IBLO 2UXCO 4K0KO 3R66A 4X62O 4DR2O 1AILA 4NXNO 4JV5O 1G1XB 5H5NA 1XMOO 4DV3O 1NS1A 4GKKO 4A5UB 2AGAA 4LFAO 1XMQO 3J7AU 2HHHO 2DOSA 5LMUO 4DR1O 4LF4O 5A2QN 4DV7O 2ZM6O 1N32O 4LFCO 1HNWO 1HNZO 5FLXN 4LF6O 1YZBA 2FKXA
chains in the Genus database with same CATH superfamily
3BAAA 2HKOA 2QTSA 4HYOA 4JI2B 1VF5B 4UVBA 3CJHA 4R50A 3MHHC 3ZN0A 2A06H 4B7EA 3DTUB 2Q0AA 4JF3A 2QKAA 1YI2V 1SQVH 2YUAA 2BTOA 4LP8A 3HKBB 4DV0O 3G71V 3ZS8C 3LSQA 3APOA 3JSLA 5DM6V 2Q7GA 1NU1H 1H2NA 4O4JB 1P7GA 2GTSA 4DK0A 4X20B 1WAZA 4DYLA 3QO8A 4JI1B 2DMXA 4PHZA 1SESA 2XNDG 4UV9A 4KHPB 4PDVA 1R73A 3JASA 1V55C 5LGNA 2Y4UA 4IHJA 3SYAA 4DV2B 4U3FH 2Z5UA 4GX0A 2DYRC 2JGUA 4RAIA 2UUCO 1TA8A 1YVWA 4FFKA 3RN4A 3A0HZ 5EBLC 3ZHRA 5C8YA 1D2DA 4U3JA 4Q20A 1DGSA 2CE4A 4P2ZA 4TSFG 4H33A 3C90A 2ZXWC 1KUQA 4J10A 4LFBO 2ZINA 4X88A 1OHHG 1BHAA 2DQ3A 4JTCB 3TJTA 3WG7C 1Y6XA 5LMUB 3HKDB 2WLHA 1AJNA 4I7ZB 1DF5A 3OGIB 1AJQA 3RYHA 1OCCB 1VF7A 4F6EA 3H1IH 5HFMA 4TQDA 2EIKC 1BQ0A 3CC2V 2YI8A 2ZIMA 2NN4A 1GN3A 3BFRA 1XMOB 5DEDA 3ABMB 4FJCC 5A9GA 1URFA 1Y67A 3SPCA 2Z3YA 1SQQH 2BTQB 1ZUQA 2GHYA 2V1DA 2K1EA 3EXAA 1KYOF 3CYOA 4BW5A 2Q7EA 1E1RG 4O4LA 1AR5A 1QLEB 3L73H 1VQKV 2JS5A 3M99B 5LHHA 1I7FA 4FVMA 3IFXA 4O4HA 3E35A 4CH3A 1TVKB 2ODMA 2N05A 5KA5A 4FM0A 1Q7YW 1WB8A 4FLWA 1XEQA 2VRZA 3D3IA 2QWRB 3A8TA 3RYCB 5L3CA 1QLNA 4TOIA 3HPLC 3ZHUA 2AZ2A 4D7SA 4EFBA 4I9WA 4F4LA 5EIBC 1K7DA 1SQBH 3MAQA 1N36O 2YC0A 3KCYA 5BMVB 1U97A 1NVPD 4JI0O 5J2UA 3FX7A 4X1YB 2YXHA 1OCOC 5KAIZ 3GVMA 3AK1A 1M4UA 3RW0A 1GM8A 2UXCB 5CA1B 1HNXO 2CH7A 2E5LO 5H6RA 1ENVA 1X4TA 1NKDA 4JV5O 3QO7A 1BZKA 4HBNA 4MSWC 2A0LA 1HNWB 3N2KA 1U96A 5F2VO 4DR4B 2ZM6O 2ADPA 4LBEC 1WJZA 2NR5A 4L8JA 2Y4TA 2Y0IA 4F6RA 4JASA 2JVDA 1NI8A 5KMGA 1NH2B 1VEWA 3SJAC 3T4DA 2QWNB 1SQXH 1G4YB 3FYIB 1FPOA 1GK9A 2EJ7A 5EIBD 3KG2A 1JPXA 4JAUA 3CEIA 2O57A 3CSXA 4I50A 1M1KW 1MA1A 1HWYA 1P49A 1NBMG 3K0DA 3ASOB 1ZAUA 2QM7A 3N2GA 3K5OA 4OX9B 2G38A 1MOFA 4WF9V 3UM7A 1GO3F 4JYAO 3OTOB 4QNHB 4DV6O 4J42A 2EINB 1XNRO 4WBNB 1JFFB 1E79G 4G27B 3BPZA 1SZTA 5D5PA 1JVMA 1RFYA 5JJNB 2KG7A 1GM9A 4PA9A 3T2MA 1IBKB 1ZL8B 4X64O 2BOCC 2YXLA 3TXSA 1JJ2U 1Q90D 2XOKG 2UUBB 4PV1B 3IC7A 3OR7C 3GWKC 1EZJA 3AG1B 2ITCC 1HDJA 5LMNO 2DE0X 4I5SA 2L6LA 5IY5B 1JOYA 2JEXA 4PDRA 1YHQV 1WPXA 5B1NA 2UXDB 3JD1A 4TQFA 2QR4A 1S3JA 5H5NA 5FL7G 3E89A 5GTHZ 4YJ2B 1KC8W 2OYQA 4H0LB 4X65B 3BRCA 2R9IA 4LF4O 2Q4PA 2QWOB 3ML0A 1RM1C 1R6NA 1S5HC 5B3SC 2CTRA 1IVSA 4N21A 1LR1A 1Z2GA 3D8CA 2QKCA 2P6JA 5B1AC 1S72V 2WLJA 4GKKB 1FS0G 5KAFZ 5IJ0A 2LFRA 1I08A 1MABG 2DYSC 3C3SA 5EZYB 3X2QC 5C93A 1TUBB 2BOBC 4FLUA 4FLZA 5IYZA 4W4LA 3E22A 4XBFA 5B66Z 3BABA 4WFGA 1N34O 4GX5A 4XDLA 3PJSK 2OCCB 1YDXA 4YIOA 4LF7O 1AI4A 1VMGA 4GCZA 4U3JB 4P30A 4UFZA 4QJFB 1FFXA 3CRMA 1QU7A 4AQYO 4PA3A 2PUSA 1Y76A 3ZMTA 1SA0B 3FB5C 4O4IB 4DUZB 3OMAB 1M56C 3E83A 2E75B 4JPRA 3ZRXA 4DV1O 1KKCA 4HNAB 2HVKC 2UUCB 1BCCH 1OCZB 1K92A 2KKWA 3CWBH 4DR7B 1NVPB 4DR3O 2BE3A 2GTAA 1Q81W 2UUAO 3RWRD 4W4KA 4DR5O 2ZKOA 2HG5C 2Y48A 3E8HA 3RT3C 4UVAA 3W7UA 3JAKA 2Q8VA 5JVDA 1XREA 5B1BC 1VQLV 1MSDA 3R66A 3P3NA 1AI6A 1B6QA 3B4SA 4LCUC 4EEQA 4LFAO 4LWSB 4JYBA 1P4RA 1N0JA 2ZDIA 4EB6B 4YY3B 3ABTA 4X1IA 1EN6A 4TT3G 2XAHA 2E76B 4EKWA 4UUJC 5LP6B 4LF6O 2P22C 3BHPA 4OPAA 3OUFA 4QGPA 4TUYA 1S0VA 5IJ9A 3RVYA 4LNUB 3FB7C 1PP9H 1Y74A 2RDCA 3JARB 3ICXA 3ZMVA 1G8MA 5H2FZ 2L35A 1M90W 1S76D 3K06A 2WLKA 1A32A 2A79B 2QTOA 4J9ZB 2A9HA 4UV8A 2UXXA 1ZSPA 3LDCA 2YEVA 4JZ2A 2RCVA 4DO2A 2AW9A 3OW2U 3JSNA 3ABKB 1HR0O 1GM7A 4JI0B 1YIJV 2V4DA 3RBZA 5LOVB 1L8DA 4CS2A 3CHXA 5CA0B 1N8RW 4J7ZA 4CBCA 4NYKA 3AK3A 2GDSA 2Q9LA 3FD9A 4F6RB 3CXHF 4FM2A 2WLIB 5LXTA 2E5LB 2PY5A 4CH5A 1ZWIC 2IH1C 4LF8O 2W0FC 3PN1A 1I0HA 2RNBA 3K5NA 2F66C 1VQ9V 4I55A 1R3KC 3JALA 4HAMA 1R6KA 1R3IC 1AP6A 2PYLA 4UVCA 4IIJB 5BZBA 1P84F 3SPJA 2ZM6B 2CAZC 4JAAA 1FXKA 2B1GA 5JH7B 1KU9A 4DV7O 3SYQA 4FZ1A 2PZSA 3N2GB 5DECA 4GX1A 3SYPA 2FKXA 4B3TO 1EZVH 3TXQA 1NT2B 3H9VA 5JQGA 3DXRA 4I0XA 2EJRA 3ETDA 5ITZA 1KD1W 2OTJV 1YJWV 1THZA 2K9PA 4ZHQB 1BSMA 4B3MO 3GWOA 2DQ0A 2R9RB 2FB5A 4JI6O 4DV4O 2BSKB 4PA6A 2IJJA 1O9GA 3RFRA 4GYCB 3WB2A 1XOUA 1NZ6A 1EN4A 1J5EO 1ORQC 4X66O 3B09A 4JYAB 3H1LH 1XL6A 4MS2A 1FAFA 5L3GA 3OEHG 1OZ0A 1XNRB 5J2TA 3T1HO 1OCRC 2XTAA 2H3OA 5FNVA 3M8AA 1AR4A 3ZHVA 1XHXA 4WFFA 2UXBB 5FPOA 1XUQA 2LJ2A 5B3SB 3K3WA 4YJ3B 3RYIB 1YTFD 1S77D 4R7CA 3ZRSA 3K59A 1I94O 1JJOA 3FB8C 3R65A 4B7KA 5JWPA 3QO5A 3KZIZ 3ZRWA 3CCJV 2DW4A 2IW5A 3G67A 1Q5OA 3X2QB 3LUTB 1I5XA 1GTOA 1WP8A 2WWWA 1COWG 4PI2A 5GONA 1AILA 3AEIA 4LF4B 4OXSA 2QA4V 1VQ8V 1M93A 3CCUV 3CMAV 5KHIA 5CA3A 2KSDA 1V54C 4TV8B 2EIMB 3K5MA 4ZOLA 4H13B 2IU0A 5EYPB 3EHBB 2Y69C 1G6UA 1JCHA 4FLYA 4CC5A 3K5LA 1VQOV 1IXMA 1YITV 3Q4HA 1M9NA 2EIJC 2XAQA 4DRXB 4JTAB 4CS4A 3NXSA 5JCOA 2WLLB 2QM4A 4FFBB 3ZJZA 5KX5A 1AB3A 2OT5A 1CXZB 1YF2A 3OMNB 3LSUA 1PL0A 1RSOA 2LGQA 2LGWA 5JCOC 1N34B 1JQ0A 1NQTA 4ZKIA 2JRIA 2Q68A 3KKYA 4LF7B 4FPPA 4O2AB 2LO1A 1WPBA 2IBZH 2P06A 5E79Z 3VQWA 3E86A 1K34A 2HJDA 2OWOA 1KP3A 5DN6G 2ZNIA 3RGBA 5KHJA 4AQYB 4YHHO 2KB1A 2EZPA 1FJGB 3DGEA 3L72H 4LF5O 3FAVB 3FB6C 2GUZA 5TISZ 4GKJO 1D5AA 2X0LA 3ZN1A 2E74B 5LYJA 4DV5B 4J80A 3CE2A 3W7WA 3ZIAG 1XNQB 5LA6B 3H1JH 4MVOA 4ASUG 1GN6A 3VQXA 2NNUA 1XILA 3U0ZA 4QE9A 5LL6Y 4U7OA 3CPWU 1E1QG 4ZBMA 3D36A 5KLVH 3BCCH 2PGGA 5H9CA 3D36C 1SKVA 3CRRA 2CGOA 1IURA 3I56V 2JGDB 4I9QA 3OEEG 1JMKC 3CP1A 1QQCA 3RYFA 1G1XB 4KUMA 2R72A 4AILC 1BHBA 1S5LZ 3AG3C 2D3OW 1EFRG 5BR8B 2F95B 1WN7A 3I5DA 4U7NA 3HKCB 2Y0PA 1CP9A 4DXWA 1IBMO 3UT5A 3M7MX 3JYCA 4WFEA 4FK5C 3AG4C 2JK5C 4MVUA 2HHHB 4GZRB 4K35A 1MG1A 3ZBHA 5IT9N 4DK1A 4MTXA 4JYYA 3K9AA 2F93B 3ASNC 4UXNA 5KHGA 1ROPA 4O2BA 4H44B 1EN5A 3EFFK 1BT8A 2RN9A 2B5UA 4JI5B 2LP7A 1PKXA 2UU9B 3F7YC 1GN2A 3BEHA 2XAFA 4WFHA 1F4MA 2C2AA 1TAEA 4UCSA 3SPIA 1X59A 4MVMA 4KL1A 4RWUA 1HR0B 1QCEA 1K5SA 1VQ4V 4I4TA 2Z0AA 4J7JA 1ZTEA 4IL6Z 2VQFO 4MTGA 1YTFB 4EFEA 3OMIB 2DN9A 2W0XA 2F23A 3HKEB 4Q6GA 1P7BA 2AZ0A 4LF8B 3ABLC 1WNSA 4JI7B 2HVJC 2Q0OC 5CB4B 1FD9A 4ZI7A 4NXMB 1NJIW 3JAWA 2QWQB 2EILC 4TV9B 2AHZA 2P4VA 4DUYB 3J7AU 2CTWA 3JD4A 1W2BU 3CJHB 3IC9A 2HFEC 2VWKA 3DSQA 5EC1C 4DR2B 3JATA 5L3DA 1YZBA 1Q3EA 3UQ8A 1L1FA 1L0NH 5FNVB 4PD4F 1MZEA 5IYDO 4JI6B 4DV4B 2A3QA 2WLMA 1AR1B 1NTKH 2Q67A 4X9QA 2ZT9B 1J5EB 4X66B 2IJHA 4KHPO 3AK2A 3T1YO 3CC4V 1UJWB 3ZHTA 3CCQV 1VQ6V 1V55B 3T1HB 3JASB 4DV2O 1K4DC 1VARA 3UCSC 1AROP 1SQFA 1LNQA 4JAVA 3HKBA 4IHJB 1LUWA 3QG5A 3U11A 2HR3A 2PF4E 4KXRA 3SPGA 5IE9A 2DYRB 3VOUA 5AG2A 3VQVA 1EM1A 4DV0B 4O4JA 3S3XA 2N04A 3H1HH 4X20A 4JTDB 1V54B 3G6EV 1I94B 1H8EG 2GBOA 4BAYA 5C8YB 1DLBA 1MNGA 3JD0A 2ZXWB 1VQMV 2Y69B 3P32A 5KUKA 3E8FA 2EIJB 3WG7B 3WU2Z 2PTMA 1UPGA 3ETEA 2ETNA 3ZRVA 1ZX3A 3L75H 3K58A 5J9PC 3HR0A 4DR6O 2P4KA 3IAYA 2ZCEA 3B2EE 1K9MW 4NKGB 4D6TH 2EIKB 3RYHB 3OE7G 1XMOO 3VBBA 3MHSC 4MVZA 4WCEV 2ZR2A 5B5EZ 4MTFA 4LFBB 4LFCO 3HKDA 1PV0A 4NR1A 3SDLA 3OR6C 3CC7V 3CCEV 5KHKA 1JA8A 1RP3B 4O4LB 2HJFC 1OCCC 4MTOA 3K0GA 3ZEDA 4OPHA 2ADQB 3MDSA 2XHBA 2YIDA 1QHTA 3C3TA 4O4HB 5BXZA 4FLTA 1PNMA 4B3RO 2BTQA 1WA8A 2ZDIC 4HZ3A 5JJJB 3DC6A 2LW1A 2XAGA 5H6QA 4LF5B 1QR9A 4R6ZA 4P9PA 4RQFA 2EX3A 1QLEC 5IWAO 3KCXA 5JJEB 3CRQA 4K8ZA 3CCMV 1TVKA 3A0RA 3K04A 1T5EA 1HP8A 3OAAG 1OCOB 4JI4O 5J2UB 3CD6V 5LHIA 1Q6HA 1XQ8A 5GW7A 4Z1MG 3RYCA 2QE7G 2QSAA 2CH7B 4LR3A 4PA4A 3AG4B 1Q82W 1SERA 2QM8A 3AG2C 4BIOA 3A2FA 1US6A 5BMVA 1DF4A 3IGAC 1PNKA 2DJVA 1TUEB 1IZ3A 3I55V 2YIBA 4X1YA 3STZC 5LGUA 1N36B 4DR4O 3N2KB 2WLNA 4X1KA 5CA1A 1XDCA 4QPKA 1NS1A 3BVOA 2AGAA 1Y4MA 3CCVV 1KECA 3RVZA 1XMQO 1H2GA 4DW1A 1HNXB 1QNMA 4E4EA 3BY6A 1SZXA 1W0KG 4FMTA 3SR2C 5CMUA 2OIEA 4RUFA 5KMGB 4PDMA 1N32O 1SETA 3U10A 4JZGA 4CH6A 2JJ1G 2H8PC 4ZIBA 4JV5B 2CGNA 1K73W 2VWJA 1R1BA 2HLDG 4OGQB 2Q5ZA 4I50B 4UCUA 1I5YA 3K79A 4IYHA 3LDDA 3THOA 4FIPC 1NR1A 2IH3C 4JI8O 2ITDC 3B40A 4J41A 4OX9O 2F43G 3LNMB 5CBFA 1FXKC 4FLXA 5FPRA 2P90A 3CCRV 2P7TC 3ABUA 1VQ7V 3A0BZ 3D3QA 1DK1A 2WA3A 5L3FA 1VIBA 4BIUA 1IBKO 2YIBD 1H2SB 2PI5A 2F4VO 2HP8A 2KG7B 1B3QA 3OM3B 3ASOC 3F7VC 2X6AA 3B8NA 4N23A 2YI9A 4X89A 3VQYA 2X6CA 3TETA 3E8GA 3K03A 4PJ0Z 1BQZA 2E3CA 4WBNA 4IGGA 1KKDA 2EINC 4DV6B 2UXDO 1JFFA 4B3SO 3G4SV 3BA9A 3SJCC 3WB0A 1OV9A 1F4NA 1ZL8A 4X65O 2EBOA 3ZHSA 1FYJA 4NTWA 3DC5A 4PELA 2W6JG 4QPJA 2CTQA 4X64B 2XUMA 1RM1B 1R3LC 3OTFA 1IBLO 4K0KO 1NH2D 1QR8A 4NXNO 4Z1VA 2DWEC 3AG1C 5B1AB 4GKKO 2M6YA 5LMNB 3N27A 5IY5C 1ZLZA 4DR1O 2JEUA 5A2QN 2WSSG 2DYSB 4YJ2A 1PD3A 4FZ0A 5EK0A 3ZMUA 5IJ0B 4NTYA 1FXVA 1GRJA 5IYZB 3S3WA 4Z2WA 5CN0A 3QF7A 2LW7A 3B8MA 3E22B 2MW2B 1N33O 3FKSG 5K1PA 2A7WA 2BCCH 1WP7A 2IJIA 3JD3A 4PA7A 3T1YB 1YJNV 4X8AA 4XDJA 1TGOA 1LUVA 2FL4A 1FFXB 3EVKA 2HEPA 1F7YA 1V9PA 5EZYA 4DUZO 1TUBA 1Y76B 1KB9F 1M56B 1M57C 3SPHA 2QEXV 1GN4A 3FYEB 2QGNA 3L74H 4QE7A 4DR7O 3OUSA 1PPJH 2OCCC 3ZHQA 4C7UA 4G28B 5BY1A 2H94A 4NVPA 2F1MA 1K5QA 1SA0A 3CXCU 4O4IA 2PYJA 1NR7A 5B1BB 1YEWA 1AI7A 3JAKB 2LFSA 5D5QA 2ATKC 5JVDB 1Q86W 4HNAA 5IYCO 1VF6A 3L9DA 3LDEA 1GMGA 1N0NA 2JS3A 4DV1B 4DR6B 1VF6C 2KQXA 1OCZC 5LGTA 1Q6IA 5EC2C 4YY3O 2WA4A 4ABMA 3APQA 1NTZH 3CB2A 3K08A 2FTKA 2YIAA 4DR3B 2OCHA 1IX9A 1Q43A 1SQGA 2UUAB 4X62O 1UFIA 4X1IB 4DR5B 1WA8B 4DV3O 2PI4A 1WB7A 4MT8A 4A5UB 4LFCB 2FYUH 4NB5A 4MVRA 5EBWC 4TUYB 3UO2A 2GSMB 3T4ZA 4K3AA 5IJ9B 1FFTB 4LWSA 2IJKA 4RUEA 2B9ZA 4E2LA 4EB6A 3ETGA 3BA8A 2YICA 4LFAB 1Y74B 3JD2A 3ZMSA 4CS3A 3MD0A 5LP6A 4B3RB 3G80A 5LP6C 2W6IG 4LF6B 4MW3A 5KUMA 4JI3O 1RPOA 3OD4A 4AI8A 2R70A 4J11A 2FMLA 4LNUA 1R3JC 1GKFA 3SJQC 3AG2B 2ZD9A 2Q69A 2YEVB 1PL4A 3JARA 5IWAB 2XASA 4UCVA 2N74A 1OJHA 2JJ2G 2CK3G 4JI4B 3F5TA 4KFMA 2XAJA 4X1KB 4PI0A 3JCZA 4WFBV 4CC6A 1GH6A 2VQEO 5LXTB 1BE3H 4LF9O 1PM9A 2JDIG 1L0LH 4IT5A 3ZCCA 1H2LA 5B1OA 2WAMA 4I55B 4J7KA 3ABKC 3JALB 5LOVA 1SF9A 2QWPB 5CA0A 4TWKA 2OIGA 3CMEV 3JAMN 3O9OA 2WLIA 4YXWG 1FXKB 1XMQB 2ZQMA 2ZR3A 4GX2A 2JIZG 1N32B 2ZE6A 2YSUB 4G2KA 4GUNA 5HFLA 5JQGB 3DXRB 4IIJA 4I0XB 1HNZO 5EBMC 5ITZB 1XBLA 3ZMZA 5JH7A 2YS8A 2X7RB 1FKAO 3OFNG 4JI8B 1DTOA 4FLVA 4JI2O 3TCUA 4BR6A 4DV7B 2CDYA 2Q73A 2QKSA 1JR9A 4B3TB 3UKMA 1YXBA 1K4CC 1OCRB 4ZHQA 5E1AC 5J2TB 1MMMA 3WFVA 4UCRA 2F4VB 2UXBO 4B3MB 2BSKA 1AVMA 1K3EA 1R6TA 2LQTA 2IU3A 1Z5VA 1FXHA 2P67A 4RQEA 4JI1O 1HW7A 1QBZA 1S5JA 1SC5B 3P30A 1AP5A 3O65A 3J81N 1XI1A 4B3SB 2ZE5A 3ZRWB 1H38A 3SGIA 1H2MA 1BL8A 4YJ3A 5GONB 3RYIA 4QIWF 2AXTZ 3L71H 1IBLB 4K0KB 4NXNB 1Z5WA 4D7TA 4IYIA 3AG7A 3TGUH 1J95A 3K57A 4ZOLB 4DR1B 1B04A 1M57B 3E2EA 2ZE8A 2DOSA 5LMUO 1N4CA 2XT9A 1SRYA 3Q4HB 1W0JG 1IDSA 5KX5B 4LH6A 1N33B 3QVNA 2NLJC 4TV8A 4XDKA 1RSOB 5K1XA 4WFAV 2Q6AA 4P9OA 3CS5A 3W7TA 4H37A 1H2KA 2EIMC 5EYPA 3B77A 2UXNA 1FJGO 2EZOA 3G6BA 3P3PA 4LC1A 1K33A 4DRXA 3H1KH 2RJZA 5L3BA 3GB7C 2WLLA 4FFBA 2ILMA 3K9SA 5CBHA 1XHZA 2GUZB 4DV5O 5IYBO 5GTIZ 4LH7A 1XNQO 2ZNJA 5LYJB 3CRAA 4O2AA 2WPDG 1XL4A 1IXBA 3HB3B 4BWAA 1VQPV 1KP2A 4K8XA 3OT7A 2RQ6A 3QTCA 2ARHA 1VQ5V 4MW8A 3CRCA 3WB1A 2M7WA 3ABMC 2X6BA 2IM9A 3FAVA 4YHHB 1D5NA 3UO3A 1Q8IA 2DWDC 4JYCA 2VS0A 3IJ4A 3W7SA 2P5OA 1H8HG 1O9HA 4GKJB 1B06A 1AJPA 5CBGA 3JCUZ 5LA6A 1MZFA 1PNLA 3CX5F 2ZIOA 3W7XA 3RYFB 1SS3A 4RO2A 3J80N 4X62B 1CEZA 3AG3B 2OTLV 2GV9A 4DV3B 5LBQA 3CCSV 5BR8O 2UXCO 4JGSA 5LHGA 4CZZA 3CCLV 3UT5B 1GAXA 1BMFG 2JGDA 2HHHO 5IDJA 2CUGA 1NTMH 1HNWO 1AI5A 4CH4A 2R9AA 1VQNV 3ASNB 3STLC 4FM1A 2AHYA 2D2CB 1K8AW 3F5WC 1CPYA 3HKCA 4JI5O 4O2BB 4JI3B 2UU9O 4BIZA 2YDEA 5L3EA 4UCOA 3T1CA 1IBMB 4GT1A 3ZX6A 1QVGU 2QDOA 4PDLA 4MVQA 3SYCA 2YXYA 4GLXA 1BGYH 2RMKB 1KBHA 2ZE7A 4YIPA 1YSCA 4I4TB 1RPRA 4B08A 3QNEA 1KMIZ 4DW0A 3LNNA 3ETQA 2VQEB 2EULA 3FFQA 1YJ9V 1Q6UA 4LF9B 1VP7A 3ABLB 4BW9A 3OTOO 4JI7O 3LSSA 1WLEA 1F23A 4R8CA 1QVFU 2B1IA 3OGCC 2MK3A 4NTXA 1KQSU 1EBOA 1W59A 3TK1A 1BS3A 4NXMO 1M5IA 2QJ1A 2EILB 3HKEA 4ZI7B 2UUBO 3JAWB 2VQFB 4DUYO 3NR7A 3E8BA 4KP4A 4MVSA 2Q7HA 1Y66A 2V7QG 4DR2O 1F51A 4UB6Z 4UB8Z 5CB4A 4ICGA 1JX9A 1YCIA 4L87A 3JATB 3L70H 1HNZB 4UCTA 2CTPA 4J9YB 5KA6A 3SJBC 1K97A 4AHCA 1SQPH 3SYOA 1MSWD 4TV9A 3H01A 5FLXN 5KHHA
chains in the Genus database with same CATH topology
4B3TO 4OPAA 3SDLA 1R1BA 1FKAO 2LW7A 4JI5O 1N33O 4JI2O 4OPHA 2UU9O 5IT9N 1AB3A 4B3MO 4JI8O 1FJGO 4OX9O 5BXZA 2JRIA 4JI3O 4B3RO 4JI6O 4DV4O 4DV0O 4KHPO 1F7YA 4DUZO 1N34O 3T1YO 4DV5O 4LF7O 1J5EO 4X66O 1XNQO 4DV2O 1DK1A 2N74A 4YHHO 2UXBO 1A32A 4AQYO 4LF5O 1R6TA 1X59A 3T1HO 5IWAO 1IBKO 4JYAO 2F4VO 4GKJO 1XEQA 4DR7O 3F5TA 4DV6O 3M8AA 5BY1A 4JI1O 1XNRO 2Z0AA 4DV1O 3OTOO 4JI4O 4JI7O 1HR0O 2VQEO 3O65A 3J81N 2VQFO 4LF9O 1I94O 4X64O 2UUCO 1N36O 4DR3O 2UXDO 5LL6Y 4JI0O 2UUAO 4DR5O 4NXMO 2ZKOA 4B3SO 3RT3C 1D2DA 1IBMO 5LMNO 3JAMN 2UUBO 4DUYO 4LF8O 1HNXO 4X65O 3J80N 2E5LO 1FYJA 4YY3O 2DJVA 1KUQA 4DR6O 4DR4O 4LFBO 5BR8O 1IBLO 2UXCO 4K0KO 3R66A 4X62O 4DR2O 1AILA 4NXNO 4JV5O 1G1XB 5H5NA 1XMOO 4DV3O 1NS1A 4GKKO 4A5UB 2AGAA 4LFAO 1XMQO 3J7AU 2HHHO 2DOSA 5LMUO 4DR1O 4LF4O 5A2QN 4DV7O 2ZM6O 1N32O 4LFCO 1HNWO 1HNZO 5FLXN 4LF6O 1YZBA 2FKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  4OPA A;  3SDL A;  1R1B A;  1FKA O;  2LW7 A;  4JI5 O;  1N33 O;  4JI2 O;  4OPH A;  2UU9 O;  5IT9 N;  1AB3 A;  4B3M O;  4JI8 O;  1FJG O;  4OX9 O;  5BXZ A;  2JRI A;  4JI3 O;  4B3R O;  4JI6 O;  4DV4 O;  4DV0 O;  4KHP O;  1F7Y A;  4DUZ O;  1N34 O;  3T1Y O;  4DV5 O;  4LF7 O;  1J5E O;  4X66 O;  1XNQ O;  4DV2 O;  1DK1 A;  2N74 A;  4YHH O;  2UXB O;  1A32 A;  4AQY O;  4LF5 O;  1R6T A;  1X59 A;  3T1H O;  5IWA O;  1IBK O;  4JYA O;  2F4V O;  4GKJ O;  1XEQ A;  4DR7 O;  3F5T A;  4DV6 O;  3M8A A;  5BY1 A;  4JI1 O;  1XNR O;  2Z0A A;  4DV1 O;  3OTO O;  4JI4 O;  4JI7 O;  1HR0 O;  2VQE O;  3O65 A;  3J81 N;  2VQF O;  4LF9 O;  1I94 O;  4X64 O;  2UUC O;  1N36 O;  4DR3 O;  2UXD O;  5LL6 Y;  4JI0 O;  2UUA O;  4DR5 O;  4NXM O;  2ZKO A;  4B3S O;  3RT3 C;  1D2D A;  1IBM O;  5LMN O;  3JAM N;  2UUB O;  4DUY O;  4LF8 O;  1HNX O;  4X65 O;  3J80 N;  2E5L O;  1FYJ A;  4YY3 O;  2DJV A;  1KUQ A;  4DR6 O;  4DR4 O;  4LFB O;  5BR8 O;  1IBL O;  2UXC O;  4K0K O;  3R66 A;  4X62 O;  4DR2 O;  1AIL A;  4NXN O;  4JV5 O;  1G1X B;  5H5N A;  1XMO O;  4DV3 O;  1NS1 A;  4GKK O;  4A5U B;  2AGA A;  4LFA O;  1XMQ O;  3J7A U;  2HHH O;  2DOS A;  5LMU O;  4DR1 O;  4LF4 O;  5A2Q N;  4DV7 O;  2ZM6 O;  1N32 O;  4LFC O;  1HNW O;  1HNZ O;  5FLX N;  4LF6 O;  1YZB A;  2FKX A; 
#chains in the Genus database with same CATH topology
 3BAA A;  2HKO A;  2QTS A;  4HYO A;  4JI2 B;  1VF5 B;  4UVB A;  3CJH A;  4R50 A;  3MHH C;  3ZN0 A;  2A06 H;  4B7E A;  3DTU B;  2Q0A A;  4JF3 A;  2QKA A;  1YI2 V;  1SQV H;  2YUA A;  2BTO A;  4LP8 A;  3HKB B;  4DV0 O;  3G71 V;  3ZS8 C;  3LSQ A;  3APO A;  3JSL A;  5DM6 V;  2Q7G A;  1NU1 H;  1H2N A;  4O4J B;  1P7G A;  2GTS A;  4DK0 A;  4X20 B;  1WAZ A;  4DYL A;  3QO8 A;  4JI1 B;  2DMX A;  4PHZ A;  1SES A;  2XND G;  4UV9 A;  4KHP B;  4PDV A;  1R73 A;  3JAS A;  1V55 C;  5LGN A;  2Y4U A;  4IHJ A;  3SYA A;  4DV2 B;  4U3F H;  2Z5U A;  4GX0 A;  2DYR C;  2JGU A;  4RAI A;  2UUC O;  1TA8 A;  1YVW A;  4FFK A;  3RN4 A;  3A0H Z;  5EBL C;  3ZHR A;  5C8Y A;  1D2D A;  4U3J A;  4Q20 A;  1DGS A;  2CE4 A;  4P2Z A;  4TSF G;  4H33 A;  3C90 A;  2ZXW C;  1KUQ A;  4J10 A;  4LFB O;  2ZIN A;  4X88 A;  1OHH G;  1BHA A;  2DQ3 A;  4JTC B;  3TJT A;  3WG7 C;  1Y6X A;  5LMU B;  3HKD B;  2WLH A;  1AJN A;  4I7Z B;  1DF5 A;  3OGI B;  1AJQ A;  3RYH A;  1OCC B;  1VF7 A;  4F6E A;  3H1I H;  5HFM A;  4TQD A;  2EIK C;  1BQ0 A;  3CC2 V;  2YI8 A;  2ZIM A;  2NN4 A;  1GN3 A;  3BFR A;  1XMO B;  5DED A;  3ABM B;  4FJC C;  5A9G A;  1URF A;  1Y67 A;  3SPC A;  2Z3Y A;  1SQQ H;  2BTQ B;  1ZUQ A;  2GHY A;  2V1D A;  2K1E A;  3EXA A;  1KYO F;  3CYO A;  4BW5 A;  2Q7E A;  1E1R G;  4O4L A;  1AR5 A;  1QLE B;  3L73 H;  1VQK V;  2JS5 A;  3M99 B;  5LHH A;  1I7F A;  4FVM A;  3IFX A;  4O4H A;  3E35 A;  4CH3 A;  1TVK B;  2ODM A;  2N05 A;  5KA5 A;  4FM0 A;  1Q7Y W;  1WB8 A;  4FLW A;  1XEQ A;  2VRZ A;  3D3I A;  2QWR B;  3A8T A;  3RYC B;  5L3C A;  1QLN A;  4TOI A;  3HPL C;  3ZHU A;  2AZ2 A;  4D7S A;  4EFB A;  4I9W A;  4F4L A;  5EIB C;  1K7D A;  1SQB H;  3MAQ A;  1N36 O;  2YC0 A;  3KCY A;  5BMV B;  1U97 A;  1NVP D;  4JI0 O;  5J2U A;  3FX7 A;  4X1Y B;  2YXH A;  1OCO C;  5KAI Z;  3GVM A;  3AK1 A;  1M4U A;  3RW0 A;  1GM8 A;  2UXC B;  5CA1 B;  1HNX O;  2CH7 A;  2E5L O;  5H6R A;  1ENV A;  1X4T A;  1NKD A;  4JV5 O;  3QO7 A;  1BZK A;  4HBN A;  4MSW C;  2A0L A;  1HNW B;  3N2K A;  1U96 A;  5F2V O;  4DR4 B;  2ZM6 O;  2ADP A;  4LBE C;  1WJZ A;  2NR5 A;  4L8J A;  2Y4T A;  2Y0I A;  4F6R A;  4JAS A;  2JVD A;  1NI8 A;  5KMG A;  1NH2 B;  1VEW A;  3SJA C;  3T4D A;  2QWN B;  1SQX H;  1G4Y B;  3FYI B;  1FPO A;  1GK9 A;  2EJ7 A;  5EIB D;  3KG2 A;  1JPX A;  4JAU A;  3CEI A;  2O57 A;  3CSX A;  4I50 A;  1M1K W;  1MA1 A;  1HWY A;  1P49 A;  1NBM G;  3K0D A;  3ASO B;  1ZAU A;  2QM7 A;  3N2G A;  3K5O A;  4OX9 B;  2G38 A;  1MOF A;  4WF9 V;  3UM7 A;  1GO3 F;  4JYA O;  3OTO B;  4QNH B;  4DV6 O;  4J42 A;  2EIN B;  1XNR O;  4WBN B;  1JFF B;  1E79 G;  4G27 B;  3BPZ A;  1SZT A;  5D5P A;  1JVM A;  1RFY A;  5JJN B;  2KG7 A;  1GM9 A;  4PA9 A;  3T2M A;  1IBK B;  1ZL8 B;  4X64 O;  2BOC C;  2YXL A;  3TXS A;  1JJ2 U;  1Q90 D;  2XOK G;  2UUB B;  4PV1 B;  3IC7 A;  3OR7 C;  3GWK C;  1EZJ A;  3AG1 B;  2ITC C;  1HDJ A;  5LMN O;  2DE0 X;  4I5S A;  2L6L A;  5IY5 B;  1JOY A;  2JEX A;  4PDR A;  1YHQ V;  1WPX A;  5B1N A;  2UXD B;  3JD1 A;  4TQF A;  2QR4 A;  1S3J A;  5H5N A;  5FL7 G;  3E89 A;  5GTH Z;  4YJ2 B;  1KC8 W;  2OYQ A;  4H0L B;  4X65 B;  3BRC A;  2R9I A;  4LF4 O;  2Q4P A;  2QWO B;  3ML0 A;  1RM1 C;  1R6N A;  1S5H C;  5B3S C;  2CTR A;  1IVS A;  4N21 A;  1LR1 A;  1Z2G A;  3D8C A;  2QKC A;  2P6J A;  5B1A C;  1S72 V;  2WLJ A;  4GKK B;  1FS0 G;  5KAF Z;  5IJ0 A;  2LFR A;  1I08 A;  1MAB G;  2DYS C;  3C3S A;  5EZY B;  3X2Q C;  5C93 A;  1TUB B;  2BOB C;  4FLU A;  4FLZ A;  5IYZ A;  4W4L A;  3E22 A;  4XBF A;  5B66 Z;  3BAB A;  4WFG A;  1N34 O;  4GX5 A;  4XDL A;  3PJS K;  2OCC B;  1YDX A;  4YIO A;  4LF7 O;  1AI4 A;  1VMG A;  4GCZ A;  4U3J B;  4P30 A;  4UFZ A;  4QJF B;  1FFX A;  3CRM A;  1QU7 A;  4AQY O;  4PA3 A;  2PUS A;  1Y76 A;  3ZMT A;  1SA0 B;  3FB5 C;  4O4I B;  4DUZ B;  3OMA B;  1M56 C;  3E83 A;  2E75 B;  4JPR A;  3ZRX A;  4DV1 O;  1KKC A;  4HNA B;  2HVK C;  2UUC B;  1BCC H;  1OCZ B;  1K92 A;  2KKW A;  3CWB H;  4DR7 B;  1NVP B;  4DR3 O;  2BE3 A;  2GTA A;  1Q81 W;  2UUA O;  3RWR D;  4W4K A;  4DR5 O;  2ZKO A;  2HG5 C;  2Y48 A;  3E8H A;  3RT3 C;  4UVA A;  3W7U A;  3JAK A;  2Q8V A;  5JVD A;  1XRE A;  5B1B C;  1VQL V;  1MSD A;  3R66 A;  3P3N A;  1AI6 A;  1B6Q A;  3B4S A;  4LCU C;  4EEQ A;  4LFA O;  4LWS B;  4JYB A;  1P4R A;  1N0J A;  2ZDI A;  4EB6 B;  4YY3 B;  3ABT A;  4X1I A;  1EN6 A;  4TT3 G;  2XAH A;  2E76 B;  4EKW A;  4UUJ C;  5LP6 B;  4LF6 O;  2P22 C;  3BHP A;  4OPA A;  3OUF A;  4QGP A;  4TUY A;  1S0V A;  5IJ9 A;  3RVY A;  4LNU B;  3FB7 C;  1PP9 H;  1Y74 A;  2RDC A;  3JAR B;  3ICX A;  3ZMV A;  1G8M A;  5H2F Z;  2L35 A;  1M90 W;  1S76 D;  3K06 A;  2WLK A;  1A32 A;  2A79 B;  2QTO A;  4J9Z B;  2A9H A;  4UV8 A;  2UXX A;  1ZSP A;  3LDC A;  2YEV A;  4JZ2 A;  2RCV A;  4DO2 A;  2AW9 A;  3OW2 U;  3JSN A;  3ABK B;  1HR0 O;  1GM7 A;  4JI0 B;  1YIJ V;  2V4D A;  3RBZ A;  5LOV B;  1L8D A;  4CS2 A;  3CHX A;  5CA0 B;  1N8R W;  4J7Z A;  4CBC A;  4NYK A;  3AK3 A;  2GDS A;  2Q9L A;  3FD9 A;  4F6R B;  3CXH F;  4FM2 A;  2WLI B;  5LXT A;  2E5L B;  2PY5 A;  4CH5 A;  1ZWI C;  2IH1 C;  4LF8 O;  2W0F C;  3PN1 A;  1I0H A;  2RNB A;  3K5N A;  2F66 C;  1VQ9 V;  4I55 A;  1R3K C;  3JAL A;  4HAM A;  1R6K A;  1R3I C;  1AP6 A;  2PYL A;  4UVC A;  4IIJ B;  5BZB A;  1P84 F;  3SPJ A;  2ZM6 B;  2CAZ C;  4JAA A;  1FXK A;  2B1G A;  5JH7 B;  1KU9 A;  4DV7 O;  3SYQ A;  4FZ1 A;  2PZS A;  3N2G B;  5DEC A;  4GX1 A;  3SYP A;  2FKX A;  4B3T O;  1EZV H;  3TXQ A;  1NT2 B;  3H9V A;  5JQG A;  3DXR A;  4I0X A;  2EJR A;  3ETD A;  5ITZ A;  1KD1 W;  2OTJ V;  1YJW V;  1THZ A;  2K9P A;  4ZHQ B;  1BSM A;  4B3M O;  3GWO A;  2DQ0 A;  2R9R B;  2FB5 A;  4JI6 O;  4DV4 O;  2BSK B;  4PA6 A;  2IJJ A;  1O9G A;  3RFR A;  4GYC B;  3WB2 A;  1XOU A;  1NZ6 A;  1EN4 A;  1J5E O;  1ORQ C;  4X66 O;  3B09 A;  4JYA B;  3H1L H;  1XL6 A;  4MS2 A;  1FAF A;  5L3G A;  3OEH G;  1OZ0 A;  1XNR B;  5J2T A;  3T1H O;  1OCR C;  2XTA A;  2H3O A;  5FNV A;  3M8A A;  1AR4 A;  3ZHV A;  1XHX A;  4WFF A;  2UXB B;  5FPO A;  1XUQ A;  2LJ2 A;  5B3S B;  3K3W A;  4YJ3 B;  3RYI B;  1YTF D;  1S77 D;  4R7C A;  3ZRS A;  3K59 A;  1I94 O;  1JJO A;  3FB8 C;  3R65 A;  4B7K A;  5JWP A;  3QO5 A;  3KZI Z;  3ZRW A;  3CCJ V;  2DW4 A;  2IW5 A;  3G67 A;  1Q5O A;  3X2Q B;  3LUT B;  1I5X A;  1GTO A;  1WP8 A;  2WWW A;  1COW G;  4PI2 A;  5GON A;  1AIL A;  3AEI A;  4LF4 B;  4OXS A;  2QA4 V;  1VQ8 V;  1M93 A;  3CCU V;  3CMA V;  5KHI A;  5CA3 A;  2KSD A;  1V54 C;  4TV8 B;  2EIM B;  3K5M A;  4ZOL A;  4H13 B;  2IU0 A;  5EYP B;  3EHB B;  2Y69 C;  1G6U A;  1JCH A;  4FLY A;  4CC5 A;  3K5L A;  1VQO V;  1IXM A;  1YIT V;  3Q4H A;  1M9N A;  2EIJ C;  2XAQ A;  4DRX B;  4JTA B;  4CS4 A;  3NXS A;  5JCO A;  2WLL B;  2QM4 A;  4FFB B;  3ZJZ A;  5KX5 A;  1AB3 A;  2OT5 A;  1CXZ B;  1YF2 A;  3OMN B;  3LSU A;  1PL0 A;  1RSO A;  2LGQ A;  2LGW A;  5JCO C;  1N34 B;  1JQ0 A;  1NQT A;  4ZKI A;  2JRI A;  2Q68 A;  3KKY A;  4LF7 B;  4FPP A;  4O2A B;  2LO1 A;  1WPB A;  2IBZ H;  2P06 A;  5E79 Z;  3VQW A;  3E86 A;  1K34 A;  2HJD A;  2OWO A;  1KP3 A;  5DN6 G;  2ZNI A;  3RGB A;  5KHJ A;  4AQY B;  4YHH O;  2KB1 A;  2EZP A;  1FJG B;  3DGE A;  3L72 H;  4LF5 O;  3FAV B;  3FB6 C;  2GUZ A;  5TIS Z;  4GKJ O;  1D5A A;  2X0L A;  3ZN1 A;  2E74 B;  5LYJ A;  4DV5 B;  4J80 A;  3CE2 A;  3W7W A;  3ZIA G;  1XNQ B;  5LA6 B;  3H1J H;  4MVO A;  4ASU G;  1GN6 A;  3VQX A;  2NNU A;  1XIL A;  3U0Z A;  4QE9 A;  5LL6 Y;  4U7O A;  3CPW U;  1E1Q G;  4ZBM A;  3D36 A;  5KLV H;  3BCC H;  2PGG A;  5H9C A;  3D36 C;  1SKV A;  3CRR A;  2CGO A;  1IUR A;  3I56 V;  2JGD B;  4I9Q A;  3OEE G;  1JMK C;  3CP1 A;  1QQC A;  3RYF A;  1G1X B;  4KUM A;  2R72 A;  4AIL C;  1BHB A;  1S5L Z;  3AG3 C;  2D3O W;  1EFR G;  5BR8 B;  2F95 B;  1WN7 A;  3I5D A;  4U7N A;  3HKC B;  2Y0P A;  1CP9 A;  4DXW A;  1IBM O;  3UT5 A;  3M7M X;  3JYC A;  4WFE A;  4FK5 C;  3AG4 C;  2JK5 C;  4MVU A;  2HHH B;  4GZR B;  4K35 A;  1MG1 A;  3ZBH A;  5IT9 N;  4DK1 A;  4MTX A;  4JYY A;  3K9A A;  2F93 B;  3ASN C;  4UXN A;  5KHG A;  1ROP A;  4O2B A;  4H44 B;  1EN5 A;  3EFF K;  1BT8 A;  2RN9 A;  2B5U A;  4JI5 B;  2LP7 A;  1PKX A;  2UU9 B;  3F7Y C;  1GN2 A;  3BEH A;  2XAF A;  4WFH A;  1F4M A;  2C2A A;  1TAE A;  4UCS A;  3SPI A;  1X59 A;  4MVM A;  4KL1 A;  4RWU A;  1HR0 B;  1QCE A;  1K5S A;  1VQ4 V;  4I4T A;  2Z0A A;  4J7J A;  1ZTE A;  4IL6 Z;  2VQF O;  4MTG A;  1YTF B;  4EFE A;  3OMI B;  2DN9 A;  2W0X A;  2F23 A;  3HKE B;  4Q6G A;  1P7B A;  2AZ0 A;  4LF8 B;  3ABL C;  1WNS A;  4JI7 B;  2HVJ C;  2Q0O C;  5CB4 B;  1FD9 A;  4ZI7 A;  4NXM B;  1NJI W;  3JAW A;  2QWQ B;  2EIL C;  4TV9 B;  2AHZ A;  2P4V A;  4DUY B;  3J7A U;  2CTW A;  3JD4 A;  1W2B U;  3CJH B;  3IC9 A;  2HFE C;  2VWK A;  3DSQ A;  5EC1 C;  4DR2 B;  3JAT A;  5L3D A;  1YZB A;  1Q3E A;  3UQ8 A;  1L1F A;  1L0N H;  5FNV B;  4PD4 F;  1MZE A;  5IYD O;  4JI6 B;  4DV4 B;  2A3Q A;  2WLM A;  1AR1 B;  1NTK H;  2Q67 A;  4X9Q A;  2ZT9 B;  1J5E B;  4X66 B;  2IJH A;  4KHP O;  3AK2 A;  3T1Y O;  3CC4 V;  1UJW B;  3ZHT A;  3CCQ V;  1VQ6 V;  1V55 B;  3T1H B;  3JAS B;  4DV2 O;  1K4D C;  1VAR A;  3UCS C;  1ARO P;  1SQF A;  1LNQ A;  4JAV A;  3HKB A;  4IHJ B;  1LUW A;  3QG5 A;  3U11 A;  2HR3 A;  2PF4 E;  4KXR A;  3SPG A;  5IE9 A;  2DYR B;  3VOU A;  5AG2 A;  3VQV A;  1EM1 A;  4DV0 B;  4O4J A;  3S3X A;  2N04 A;  3H1H H;  4X20 A;  4JTD B;  1V54 B;  3G6E V;  1I94 B;  1H8E G;  2GBO A;  4BAY A;  5C8Y B;  1DLB A;  1MNG A;  3JD0 A;  2ZXW B;  1VQM V;  2Y69 B;  3P32 A;  5KUK A;  3E8F A;  2EIJ B;  3WG7 B;  3WU2 Z;  2PTM A;  1UPG A;  3ETE A;  2ETN A;  3ZRV A;  1ZX3 A;  3L75 H;  3K58 A;  5J9P C;  3HR0 A;  4DR6 O;  2P4K A;  3IAY A;  2ZCE A;  3B2E E;  1K9M W;  4NKG B;  4D6T H;  2EIK B;  3RYH B;  3OE7 G;  1XMO O;  3VBB A;  3MHS C;  4MVZ A;  4WCE V;  2ZR2 A;  5B5E Z;  4MTF A;  4LFB B;  4LFC O;  3HKD A;  1PV0 A;  4NR1 A;  3SDL A;  3OR6 C;  3CC7 V;  3CCE V;  5KHK A;  1JA8 A;  1RP3 B;  4O4L B;  2HJF C;  1OCC C;  4MTO A;  3K0G A;  3ZED A;  4OPH A;  2ADQ B;  3MDS A;  2XHB A;  2YID A;  1QHT A;  3C3T A;  4O4H B;  5BXZ A;  4FLT A;  1PNM A;  4B3R O;  2BTQ A;  1WA8 A;  2ZDI C;  4HZ3 A;  5JJJ B;  3DC6 A;  2LW1 A;  2XAG A;  5H6Q A;  4LF5 B;  1QR9 A;  4R6Z A;  4P9P A;  4RQF A;  2EX3 A;  1QLE C;  5IWA O;  3KCX A;  5JJE B;  3CRQ A;  4K8Z A;  3CCM V;  1TVK A;  3A0R A;  3K04 A;  1T5E A;  1HP8 A;  3OAA G;  1OCO B;  4JI4 O;  5J2U B;  3CD6 V;  5LHI A;  1Q6H A;  1XQ8 A;  5GW7 A;  4Z1M G;  3RYC A;  2QE7 G;  2QSA A;  2CH7 B;  4LR3 A;  4PA4 A;  3AG4 B;  1Q82 W;  1SER A;  2QM8 A;  3AG2 C;  4BIO A;  3A2F A;  1US6 A;  5BMV A;  1DF4 A;  3IGA C;  1PNK A;  2DJV A;  1TUE B;  1IZ3 A;  3I55 V;  2YIB A;  4X1Y A;  3STZ C;  5LGU A;  1N36 B;  4DR4 O;  3N2K B;  2WLN A;  4X1K A;  5CA1 A;  1XDC A;  4QPK A;  1NS1 A;  3BVO A;  2AGA A;  1Y4M A;  3CCV V;  1KEC A;  3RVZ A;  1XMQ O;  1H2G A;  4DW1 A;  1HNX B;  1QNM A;  4E4E A;  3BY6 A;  1SZX A;  1W0K G;  4FMT A;  3SR2 C;  5CMU A;  2OIE A;  4RUF A;  5KMG B;  4PDM A;  1N32 O;  1SET A;  3U10 A;  4JZG A;  4CH6 A;  2JJ1 G;  2H8P C;  4ZIB A;  4JV5 B;  2CGN A;  1K73 W;  2VWJ A;  1R1B A;  2HLD G;  4OGQ B;  2Q5Z A;  4I50 B;  4UCU A;  1I5Y A;  3K79 A;  4IYH A;  3LDD A;  3THO A;  4FIP C;  1NR1 A;  2IH3 C;  4JI8 O;  2ITD C;  3B40 A;  4J41 A;  4OX9 O;  2F43 G;  3LNM B;  5CBF A;  1FXK C;  4FLX A;  5FPR A;  2P90 A;  3CCR V;  2P7T C;  3ABU A;  1VQ7 V;  3A0B Z;  3D3Q A;  1DK1 A;  2WA3 A;  5L3F A;  1VIB A;  4BIU A;  1IBK O;  2YIB D;  1H2S B;  2PI5 A;  2F4V O;  2HP8 A;  2KG7 B;  1B3Q A;  3OM3 B;  3ASO C;  3F7V C;  2X6A A;  3B8N A;  4N23 A;  2YI9 A;  4X89 A;  3VQY A;  2X6C A;  3TET A;  3E8G A;  3K03 A;  4PJ0 Z;  1BQZ A;  2E3C A;  4WBN A;  4IGG A;  1KKD A;  2EIN C;  4DV6 B;  2UXD O;  1JFF A;  4B3S O;  3G4S V;  3BA9 A;  3SJC C;  3WB0 A;  1OV9 A;  1F4N A;  1ZL8 A;  4X65 O;  2EBO A;  3ZHS A;  1FYJ A;  4NTW A;  3DC5 A;  4PEL A;  2W6J G;  4QPJ A;  2CTQ A;  4X64 B;  2XUM A;  1RM1 B;  1R3L C;  3OTF A;  1IBL O;  4K0K O;  1NH2 D;  1QR8 A;  4NXN O;  4Z1V A;  2DWE C;  3AG1 C;  5B1A B;  4GKK O;  2M6Y A;  5LMN B;  3N27 A;  5IY5 C;  1ZLZ A;  4DR1 O;  2JEU A;  5A2Q N;  2WSS G;  2DYS B;  4YJ2 A;  1PD3 A;  4FZ0 A;  5EK0 A;  3ZMU A;  5IJ0 B;  4NTY A;  1FXV A;  1GRJ A;  5IYZ B;  3S3W A;  4Z2W A;  5CN0 A;  3QF7 A;  2LW7 A;  3B8M A;  3E22 B;  2MW2 B;  1N33 O;  3FKS G;  5K1P A;  2A7W A;  2BCC H;  1WP7 A;  2IJI A;  3JD3 A;  4PA7 A;  3T1Y B;  1YJN V;  4X8A A;  4XDJ A;  1TGO A;  1LUV A;  2FL4 A;  1FFX B;  3EVK A;  2HEP A;  1F7Y A;  1V9P A;  5EZY A;  4DUZ O;  1TUB A;  1Y76 B;  1KB9 F;  1M56 B;  1M57 C;  3SPH A;  2QEX V;  1GN4 A;  3FYE B;  2QGN A;  3L74 H;  4QE7 A;  4DR7 O;  3OUS A;  1PPJ H;  2OCC C;  3ZHQ A;  4C7U A;  4G28 B;  5BY1 A;  2H94 A;  4NVP A;  2F1M A;  1K5Q A;  1SA0 A;  3CXC U;  4O4I A;  2PYJ A;  1NR7 A;  5B1B B;  1YEW A;  1AI7 A;  3JAK B;  2LFS A;  5D5Q A;  2ATK C;  5JVD B;  1Q86 W;  4HNA A;  5IYC O;  1VF6 A;  3L9D A;  3LDE A;  1GMG A;  1N0N A;  2JS3 A;  4DV1 B;  4DR6 B;  1VF6 C;  2KQX A;  1OCZ C;  5LGT A;  1Q6I A;  5EC2 C;  4YY3 O;  2WA4 A;  4ABM A;  3APQ A;  1NTZ H;  3CB2 A;  3K08 A;  2FTK A;  2YIA A;  4DR3 B;  2OCH A;  1IX9 A;  1Q43 A;  1SQG A;  2UUA B;  4X62 O;  1UFI A;  4X1I B;  4DR5 B;  1WA8 B;  4DV3 O;  2PI4 A;  1WB7 A;  4MT8 A;  4A5U B;  4LFC B;  2FYU H;  4NB5 A;  4MVR A;  5EBW C;  4TUY B;  3UO2 A;  2GSM B;  3T4Z A;  4K3A A;  5IJ9 B;  1FFT B;  4LWS A;  2IJK A;  4RUE A;  2B9Z A;  4E2L A;  4EB6 A;  3ETG A;  3BA8 A;  2YIC A;  4LFA B;  1Y74 B;  3JD2 A;  3ZMS A;  4CS3 A;  3MD0 A;  5LP6 A;  4B3R B;  3G80 A;  5LP6 C;  2W6I G;  4LF6 B;  4MW3 A;  5KUM A;  4JI3 O;  1RPO A;  3OD4 A;  4AI8 A;  2R70 A;  4J11 A;  2FML A;  4LNU A;  1R3J C;  1GKF A;  3SJQ C;  3AG2 B;  2ZD9 A;  2Q69 A;  2YEV B;  1PL4 A;  3JAR A;  5IWA B;  2XAS A;  4UCV A;  2N74 A;  1OJH A;  2JJ2 G;  2CK3 G;  4JI4 B;  3F5T A;  4KFM A;  2XAJ A;  4X1K B;  4PI0 A;  3JCZ A;  4WFB V;  4CC6 A;  1GH6 A;  2VQE O;  5LXT B;  1BE3 H;  4LF9 O;  1PM9 A;  2JDI G;  1L0L H;  4IT5 A;  3ZCC A;  1H2L A;  5B1O A;  2WAM A;  4I55 B;  4J7K A;  3ABK C;  3JAL B;  5LOV A;  1SF9 A;  2QWP B;  5CA0 A;  4TWK A;  2OIG A;  3CME V;  3JAM N;  3O9O A;  2WLI A;  4YXW G;  1FXK B;  1XMQ B;  2ZQM A;  2ZR3 A;  4GX2 A;  2JIZ G;  1N32 B;  2ZE6 A;  2YSU B;  4G2K A;  4GUN A;  5HFL A;  5JQG B;  3DXR B;  4IIJ A;  4I0X B;  1HNZ O;  5EBM C;  5ITZ B;  1XBL A;  3ZMZ A;  5JH7 A;  2YS8 A;  2X7R B;  1FKA O;  3OFN G;  4JI8 B;  1DTO A;  4FLV A;  4JI2 O;  3TCU A;  4BR6 A;  4DV7 B;  2CDY A;  2Q73 A;  2QKS A;  1JR9 A;  4B3T B;  3UKM A;  1YXB A;  1K4C C;  1OCR B;  4ZHQ A;  5E1A C;  5J2T B;  1MMM A;  3WFV A;  4UCR A;  2F4V B;  2UXB O;  4B3M B;  2BSK A;  1AVM A;  1K3E A;  1R6T A;  2LQT A;  2IU3 A;  1Z5V A;  1FXH A;  2P67 A;  4RQE A;  4JI1 O;  1HW7 A;  1QBZ A;  1S5J A;  1SC5 B;  3P30 A;  1AP5 A;  3O65 A;  3J81 N;  1XI1 A;  4B3S B;  2ZE5 A;  3ZRW B;  1H38 A;  3SGI A;  1H2M A;  1BL8 A;  4YJ3 A;  5GON B;  3RYI A;  4QIW F;  2AXT Z;  3L71 H;  1IBL B;  4K0K B;  4NXN B;  1Z5W A;  4D7T A;  4IYI A;  3AG7 A;  3TGU H;  1J95 A;  3K57 A;  4ZOL B;  4DR1 B;  1B04 A;  1M57 B;  3E2E A;  2ZE8 A;  2DOS A;  5LMU O;  1N4C A;  2XT9 A;  1SRY A;  3Q4H B;  1W0J G;  1IDS A;  5KX5 B;  4LH6 A;  1N33 B;  3QVN A;  2NLJ C;  4TV8 A;  4XDK A;  1RSO B;  5K1X A;  4WFA V;  2Q6A A;  4P9O A;  3CS5 A;  3W7T A;  4H37 A;  1H2K A;  2EIM C;  5EYP A;  3B77 A;  2UXN A;  1FJG O;  2EZO A;  3G6B A;  3P3P A;  4LC1 A;  1K33 A;  4DRX A;  3H1K H;  2RJZ A;  5L3B A;  3GB7 C;  2WLL A;  4FFB A;  2ILM A;  3K9S A;  5CBH A;  1XHZ A;  2GUZ B;  4DV5 O;  5IYB O;  5GTI Z;  4LH7 A;  1XNQ O;  2ZNJ A;  5LYJ B;  3CRA A;  4O2A A;  2WPD G;  1XL4 A;  1IXB A;  3HB3 B;  4BWA A;  1VQP V;  1KP2 A;  4K8X A;  3OT7 A;  2RQ6 A;  3QTC A;  2ARH A;  1VQ5 V;  4MW8 A;  3CRC A;  3WB1 A;  2M7W A;  3ABM C;  2X6B A;  2IM9 A;  3FAV A;  4YHH B;  1D5N A;  3UO3 A;  1Q8I A;  2DWD C;  4JYC A;  2VS0 A;  3IJ4 A;  3W7S A;  2P5O A;  1H8H G;  1O9H A;  4GKJ B;  1B06 A;  1AJP A;  5CBG A;  3JCU Z;  5LA6 A;  1MZF A;  1PNL A;  3CX5 F;  2ZIO A;  3W7X A;  3RYF B;  1SS3 A;  4RO2 A;  3J80 N;  4X62 B;  1CEZ A;  3AG3 B;  2OTL V;  2GV9 A;  4DV3 B;  5LBQ A;  3CCS V;  5BR8 O;  2UXC O;  4JGS A;  5LHG A;  4CZZ A;  3CCL V;  3UT5 B;  1GAX A;  1BMF G;  2JGD A;  2HHH O;  5IDJ A;  2CUG A;  1NTM H;  1HNW O;  1AI5 A;  4CH4 A;  2R9A A;  1VQN V;  3ASN B;  3STL C;  4FM1 A;  2AHY A;  2D2C B;  1K8A W;  3F5W C;  1CPY A;  3HKC A;  4JI5 O;  4O2B B;  4JI3 B;  2UU9 O;  4BIZ A;  2YDE A;  5L3E A;  4UCO A;  3T1C A;  1IBM B;  4GT1 A;  3ZX6 A;  1QVG U;  2QDO A;  4PDL A;  4MVQ A;  3SYC A;  2YXY A;  4GLX A;  1BGY H;  2RMK B;  1KBH A;  2ZE7 A;  4YIP A;  1YSC A;  4I4T B;  1RPR A;  4B08 A;  3QNE A;  1KMI Z;  4DW0 A;  3LNN A;  3ETQ A;  2VQE B;  2EUL A;  3FFQ A;  1YJ9 V;  1Q6U A;  4LF9 B;  1VP7 A;  3ABL B;  4BW9 A;  3OTO O;  4JI7 O;  3LSS A;  1WLE A;  1F23 A;  4R8C A;  1QVF U;  2B1I A;  3OGC C;  2MK3 A;  4NTX A;  1KQS U;  1EBO A;  1W59 A;  3TK1 A;  1BS3 A;  4NXM O;  1M5I A;  2QJ1 A;  2EIL B;  3HKE A;  4ZI7 B;  2UUB O;  3JAW B;  2VQF B;  4DUY O;  3NR7 A;  3E8B A;  4KP4 A;  4MVS A;  2Q7H A;  1Y66 A;  2V7Q G;  4DR2 O;  1F51 A;  4UB6 Z;  4UB8 Z;  5CB4 A;  4ICG A;  1JX9 A;  1YCI A;  4L87 A;  3JAT B;  3L70 H;  1HNZ B;  4UCT A;  2CTP A;  4J9Y B;  5KA6 A;  3SJB C;  1K97 A;  4AHC A;  1SQP H;  3SYO A;  1MSW D;  4TV9 A;  3H01 A;  5FLX N;  5KHH A; 
#chains in the Genus database with same CATH homology
 4B3T O;  4OPA A;  3SDL A;  1R1B A;  1FKA O;  2LW7 A;  4JI5 O;  1N33 O;  4JI2 O;  4OPH A;  2UU9 O;  5IT9 N;  1AB3 A;  4B3M O;  4JI8 O;  1FJG O;  4OX9 O;  5BXZ A;  2JRI A;  4JI3 O;  4B3R O;  4JI6 O;  4DV4 O;  4DV0 O;  4KHP O;  1F7Y A;  4DUZ O;  1N34 O;  3T1Y O;  4DV5 O;  4LF7 O;  1J5E O;  4X66 O;  1XNQ O;  4DV2 O;  1DK1 A;  2N74 A;  4YHH O;  2UXB O;  1A32 A;  4AQY O;  4LF5 O;  1R6T A;  1X59 A;  3T1H O;  5IWA O;  1IBK O;  4JYA O;  2F4V O;  4GKJ O;  1XEQ A;  4DR7 O;  3F5T A;  4DV6 O;  3M8A A;  5BY1 A;  4JI1 O;  1XNR O;  2Z0A A;  4DV1 O;  3OTO O;  4JI4 O;  4JI7 O;  1HR0 O;  2VQE O;  3O65 A;  3J81 N;  2VQF O;  4LF9 O;  1I94 O;  4X64 O;  2UUC O;  1N36 O;  4DR3 O;  2UXD O;  5LL6 Y;  4JI0 O;  2UUA O;  4DR5 O;  4NXM O;  2ZKO A;  4B3S O;  3RT3 C;  1D2D A;  1IBM O;  5LMN O;  3JAM N;  2UUB O;  4DUY O;  4LF8 O;  1HNX O;  4X65 O;  3J80 N;  2E5L O;  1FYJ A;  4YY3 O;  2DJV A;  1KUQ A;  4DR6 O;  4DR4 O;  4LFB O;  5BR8 O;  1IBL O;  2UXC O;  4K0K O;  3R66 A;  4X62 O;  4DR2 O;  1AIL A;  4NXN O;  4JV5 O;  1G1X B;  5H5N A;  1XMO O;  4DV3 O;  1NS1 A;  4GKK O;  4A5U B;  2AGA A;  4LFA O;  1XMQ O;  3J7A U;  2HHH O;  2DOS A;  5LMU O;  4DR1 O;  4LF4 O;  5A2Q N;  4DV7 O;  2ZM6 O;  1N32 O;  4LFC O;  1HNW O;  1HNZ O;  5FLX N;  4LF6 O;  1YZB A;  2FKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...