1D2DA

Hamster eprs second repeated element. nmr, 5 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
molecule keywords TRNA SYNTHETASE
total genus 18
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1999-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1d2dA00
4JI8O 1IBLO 4GKJO 1NS1A 4DV7O 1FKAO 1KUQA 3T1YO 2UXBO 1YZBA 2UUAO 5IWAO 2DJVA 4LFCO 1N36O 4LF7O 5LMUO 1XMOO 4JI5O 4A5UB 4DR3O 4JI6O 4OPAA 4B3SO 1HR0O 1IBKO 3T1HO 2UXDO 4DR7O 4B3TO 4X66O 4LF5O 2DOSA 3JAMN 3O65A 4JI0O 1AILA 2N74A 4DV4O 5LMNO 4DV1O 2ZKOA 1HNZO 1IBMO 2JRIA 4JI2O 5FLXN 4KHPO 2VQFO 4JI7O 4DV3O 2AGAA 3J81N 4DV0O 4DR5O 1N34O 4JI1O 3F5TA 1N33O 5BR8O 4LF8O 4JI4O 4LFBO 2F4VO 1G1XB 2VQEO 4JI3O 4DV2O 1HNWO 4OX9O 2UXCO 1F7YA 3M8AA 4JYAO 1DK1A 4DR1O 5BXZA 3J7AU 4DV6O 4LFAO 2LW7A 4X64O 3RT3C 1A32A 1FYJA 5BY1A 5A2QN 4B3RO 4GKKO 2ZM6O 2Z0AA 1I94O 2HHHO 3J80N 1AB3A 1X59A 4B3MO 1D2DA 2UUCO 1J5EO 1XMQO 5LL6Y 1XEQA 5H5NA 2E5LO 4YY3O 1N32O 3OTOO 4NXMO 4X65O 2UU9O 4LF9O 2UUBO 4NXNO 4X62O 4LF6O 4LF4O 5IT9N 4OPHA 4AQYO 1R1BA 3R66A 4JV5O 4DUYO 4DV5O 4YHHO 4DR6O 3SDLA 2FKXA 1FJGO 1R6TA 1HNXO 4DUZO 1XNRO 4DR4O 4DR2O 4K0KO 1XNQO
chains in the Genus database with same CATH superfamily
2E5LB 2EIKB 2ETNA 1M56C 1QNMA 1CPYA 3JARB 3CMAV 3OMNB 4LF7O 3X2QB 5LA6B 5HFLA 4DR3O 1NZ6A 1V54B 1M57B 2H3OA 1VIBA 2JS3A 3JATA 1OV9A 2XAFA 4G27B 4B3SB 3T4DA 1IBMO 3VQVA 4B3RB 5B1BC 4FK5C 1KECA 5B1NA 3CCLV 1UFIA 3OE7G 5K1PA 5BR8O 1OCZC 4JI4O 4K0KB 5H6RA 1VMGA 1SZTA 4KXRA 1RP3B 1PV0A 5J2TB 2HVJC 2AZ0A 2ZE5A 4X20A 3CXCU 2AHZA 2Z3YA 4NXMB 3K04A 1R6NA 3HKBB 3C90A 2RCVA 4WFAV 1I94O 1MSWD 4DR4B 2V7QG 1R3KC 1OCRB 1Q8IA 1K92A 5BZBA 1E79G 3DC5A 4X89A 4MW8A 1EN6A 5IJ0B 3APOA 4ZIBA 1MNGA 1NJIW 4R7CA 3CE2A 3SJCC 1TUBA 4J7KA 1Q90D 4YHHO 1R3IC 3UO3A 1ROPA 2V1DA 4YJ3A 1YI2V 4WBNB 5IYZA 2EX3A 1XNQO 1GRJA 4I55B 3FD9A 5CBHA 4ABMA 2WLHA 4RQEA 4GKJO 1KP2A 2HKOA 5FL7G 3IGAC 1HP8A 3ZMSA 2IH3C 1DF4A 3EFFK 3LSUA 4PJ0Z 2DJVA 3U10A 2ARHA 2YICA 4LP8A 4U3JB 5IYDO 4DR6B 1NTMH 2UXNA 2QKSA 3IAYA 4GKKB 1WB7A 1F4MA 2P7TC 3CS5A 5EIBD 5IY5C 2VQFO 1M4UA 3ZMZA 4JTCB 1MZEA 1WN7A 2HHHB 3K57A 1G1XB 1SA0B 3OR7C 2IU3A 4UXNA 2A9HA 1QVFU 2KB1A 4FMTA 5BXZA 2QTOA 1SESA 4NB5A 4DV6O 3D36A 1A32A 4BWAA 5FPOA 3B4SA 5LOVB 4D6TH 4AHCA 4J80A 2PUSA 5C8YB 1RM1C 2IJIA 4B3MO 2BTQA 2W6JG 2R9IA 4X88A 2RQ6A 2UU9B 4FFBA 4P2ZA 3BAAA 4CC6A 2IH1C 1ZX3A 1Y6XA 5B3SC 1QQCA 4LF4B 2GUZB 4JYBA 2R9RB 1RFYA 2ITDC 2Y0PA 4X65O 4YJ3B 5IWAB 4LWSA 2XUMA 5JJJB 2NN4A 1GAXA 4JI5B 2EINC 3ETEA 1XL6A 3F5WC 4IHJA 2UXDB 2YDEA 1T5EA 1VARA 4J9ZB 2RN9A 1VQLV 2ZXWB 2DWEC 2WLLB 4QPKA 3RBZA 3ZHTA 5DECA 3QF7A 3ETQA 4PDLA 4LR3A 2ZE6A 4R6ZA 2PI4A 3ZRVA 2L6LA 1XMOO 4ZHQA 4DV1B 2VWJA 2WPDG 2YSUB 1VF6A 5KA6A 2LGWA 3K0DA 1GN3A 4ZOLA 3ZJZA 5GW7A 2ZIOA 1H2LA 2ZQMA 4X64B 1D5AA 3CC4V 1YCIA 4O4IA 3LSSA 1CXZB 2XNDG 3B8MA 4K8ZA 1PL4A 2UUAB 5LMNB 1YJ9V 2PGGA 2Q9LA 1S77D 1JJ2U 3U11A 4MVMA 3HKDA 4DR1O 3E86A 3ZS8C 3J7AU 3CC2V 2RMKB 2CDYA 1WNSA 4GKKO 3CCEV 4FFKA 3I5DA 4O2BA 1O9GA 4JI4B 3J80N 4H37A 2H8PC 1SQGA 2QE7G 1PP9H 3JCZA 2PZSA 1XMQO 5AG2A 2FB5A 3ZIAG 3ZN1A 3CMEV 3E8BA 3A0BZ 1U96A 3K9AA 4YY3O 2IJHA 3BA8A 5B5EZ 1CP9A 2OCCC 1NVPB 4NXMO 3PN1A 1BHAA 3AG4B 4X1IA 4LF9O 1JFFA 4N21A 4DV6B 4LF4O 1YXBA 5KMGB 4LCUC 1QR8A 4X1KB 1IZ3A 4ZOLB 1I94B 4UVCA 1HNZB 1Y4MA 4IIJA 2OIEA 4QE9A 1AI7A 2YXLA 3RYIB 4I0XB 4U7OA 1HDJA 5HFMA 1EZVH 3LUTB 3ZRXA 3G4SV 1M93A 1VQKV 3JD2A 2BE3A 4TOIA 1AJNA 1GM8A 3G6BA 4NVPA 1L8DA 2WLKA 5FNVB 4LF5O 4JZ2A 1PM9A 4QIWF 4EKWA 1KP3A 5LP6A 3H1HH 2EILC 4JAAA 4CS2A 2CH7B 1JR9A 3DSQA 4ASUG 2CGOA 3CSXA 4JI1O 4FLWA 2DYSB 3N2KB 1J5EB 1HNWO 3ABMB 3JALA 4OX9O 5KAIZ 1SQQH 3WU2Z 3H1LH 1Y66A 1SQPH 4JI6B 4LFAO 3AG3B 4ZI7B 3ASOC 1XL4A 1V55B 3RT3C 1IBMB 1FYJA 2BSKA 4B3RO 3QG5A 2UUBB 2DYRC 2ZR3A 1S72V 3QO8A 3SPGA 3ASNB 2UUCO 2ZM6B 3E8HA 4LF8B 1RSOA 2Q0AA 2YIAA 3MHSC 1RPRA 1XUQA 4JYYA 5EYPB 3RYHB 4DK1A 4G28B 4O4LB 1XMQB 1Q6HA 4O2AB 3LNMB 5K1XA 5KUKA 2EIMC 5J9PC 3N2GB 1FXKC 4LFCB 4LBEC 1URFA 4DR2O 2BSKB 2AW9A 3JASB 5LA6A 1YJNV 3AG1B 3K5LA 3MDSA 2DMXA 4LNUA 4X65B 4HBNA 5IYZB 1N32B 4WBNA 3UT5A 3CJHB 2YEVB 1VQPV 1B06A 4I4TB 4O4JA 5EZYA 4YHHB 1Q6UA 4JPRA 1JX9A 1DLBA 4JV5B 3BFRA 1VQ4V 2CH7A 2B1IA 2EBOA 2N74A 4DV4O 4MVSA 1HNZO 1GM9A 1V55C 3RYFB 1Q3EA 2WWWA 4GKJB 2CUGA 1MABG 3OD4A 4JF3A 1JA8A 4MVUA 3CD6V 4I50A 4O4HB 5A9GA 1OCOC 1Z5WA 4XDKA 3RFRA 1K4CC 5KAFZ 5L3FA 1BMFG 1BSMA 1TVKB 1SKVA 3JSNA 3ZMVA 1BT8A 4RWUA 3IJ4A 1NTKH 4TT3G 3S3WA 3AEIA 4X64O 2PYJA 4R8CA 3UKMA 1WJZA 1SRYA 4W4KA 2ZDIA 4WF9V 1GK9A 1S3JA 2GTSA 4Z2WA 2D2CB 5BMVA 2X6BA 2ZNIA 1PD3A 4PI0A 1P84F 2WLJA 1GN2A 2LO1A 1L0NH 1R6KA 1IDSA 3E89A 2KSDA 5H5NA 5JVDB 4DR1B 2LQTA 5KUMA 3HKCA 4BW9A 3C3SA 4J42A 3H1JH 4YJ2A 3BCCH 2WSSG 4KUMA 4OPHA 3K5MA 4DR3B 1QCEA 5KLVH 2WA3A 1S76D 3SDLA 3IFXA 5FPRA 2R70A 2IJKA 3KG2A 2OWOA 1BGYH 5GONA 1NT2B 2X7RB 4RUFA 4MTXA 2EIJC 1QLEC 3ZRWA 4I7ZB 4FVMA 2VWKA 4CBCA 2OTLV 4DW1A 1R3LC 1FFXB 5LXTA 1COWG 1Q6IA 4DV7O 3ZMTA 1H38A 4CH4A 4ZKIA 1QLNA 3ZHVA 4LFCO 2CTWA 5LYJB 1AJPA 4JI5O 4LF6B 3AK2A 4FLVA 4PHZA 3FB5C 3BABA 4O2AA 5KHGA 3QO7A 3SYCA 2XASA 3D36C 3E8FA 1FXKB 4L8JA 2M7WA 4UCSA 3CPWU 1IBLB 4DV3O 1GH6A 2YIBD 1AR5A 4WFEA 2EZPA 1K9MW 2WLIB 1L1FA 2VQEO 4FM0A 4J41A 3CC7V 2YS8A 5CMUA 4TWKA 5J2UB 3CCSV 3ABLC 3ZRSA 2BOBC 1DGSA 4J9YB 4JI2B 3TXSA 1MMMA 2LJ2A 2A3QA 4TV9B 1IVSA 3K08A 4J7JA 1X59A 2RJZA 1J5EO 5JQGA 3OMIB 4LH6A 4PA9A 4XDLA 3NR7A 3ICXA 5JWPA 4LWSB 4X1YA 3RYFA 3BY6A 2B5UA 4CS3A 4YIOA 1SF9A 2KKWA 4MTFA 3BHPA 4TV8A 2UUBO 2Y4UA 4O4JB 5EZYB 2YEVA 2G38A 3FKSG 1WA8B 5FNVA 4DV5O 2H94A 4NYKA 5C8YA 2IBZH 3KCXA 3SYPA 1M9NA 4H44B 1WP8A 4WFFA 1R73A 5CBGA 4MVZA 2VQFB 4X9QA 3GWOA 1XILA 4MTOA 1H8HG 3JAKB 3T1YO 3A0RA 5DM6V 3TJTA 4O4LA 4UCUA 4JYAB 2ZR2A 1SA0A 3LSQA 3I56V 5ITZB 3RVZA 4HYOA 1KU9A 3WFVA 3E22B 1VQOV 1RSOB 3ABMC 4DXWA 2Q68A 3H1IH 5LMUB 3H9VA 5EYPA 3B77A 3WB0A 4KHPO 1AROP 2Q69A 1K4DC 2B1GA 2ZE7A 3F5TA 5LXTB 2D3OW 2F4VO 4JI8B 1K33A 1NQTA 3K06A 1LUWA 4BR6A 1OHHG 3P30A 4JAUA 3BEHA 2UXCO 1AR1B 2CTPA 1WB8A 3EVKA 1MOFA 1KD1W 5KHJA 2P06A 4YJ2B 1V9PA 2A79B 3HKCB 4LFBB 1XBLA 4U3FH 2R72A 4DV2B 4OX9B 1NI8A 1TUBB 3WG7C 1AP6A 2WA4A 3CCJV 3AG7A 1XOUA 1O9HA 5BMVB 1N36B 2Q7HA 3KZIZ 4G2KA 1YIJV 3G6EV 1PL0A 1AP5A 1US6A 4QJFB 1NU1H 1YTFD 1N0NA 5CB4A 1R1BA 3R66A 4PDVA 3L74H 1Q7YW 5IY5B 4DR6O 2X6AA 3SPJA 1TGOA 2Q5ZA 2RNBA 5LHGA 4AQYB 1Q5OA 2GSMB 4K0KO 2ZD9A 2KG7A 2W0XA 1ZLZA 4NTYA 3E8GA 1IXBA 3F7YC 3E35A 2A7WA 2Q0OC 2YXYA 3CX5F 2IU0A 4B3SO 3B09A 4P9PA 4DR7O 4B3TO 4X66O 4J10A 3H1KH 2AXTZ 4MVQA 2AZ2A 1QBZA 3CRRA 4I4TA 1AI6A 4UFZA 4PA6A 3UT5B 3UQ8A 1Q82W 4UCRA 3RWRD 2Q8VA 4WFHA 4CH5A 3ETGA 1YJWV 4WFGA 1IXMA 1FXVA 2UXBB 5GONB 1I7FA 2LGQA 3T2MA 3N2GA 4JYAO 3NXSA 3ZHUA 1FS0G 5B1BB 1S5LZ 2ZE8A 5LGTA 2QWRB 3HKDB 4LF9B 1VF5B 5JVDA 4O4IB 1OCCB 3RYHA 2P90A 1F4NA 1BZKA 1PNKA 4FLYA 3ZBHA 1MZFA 3VOUA 3FB6C 2OIGA 1P4RA 5CA1A 3JCUZ 3P3PA 3UO2A 3OT7A 1PPJH 1QVGU 3CYOA 2LW1A 2P4VA 2Y4TA 4NXNO 4L87A 5E79Z 2DQ3A 2WLLA 3MD0A 2MK3A 4PD4F 1I0HA 4BAYA 4H0LB 2ITCC 3JSLA 2OYQA 1FJGO 1HNXO 5KHHA 5CB4B 3CEIA 4DW0A 3BPZA 4DUZO 1RM1B 4O4HA 2XT9A 1N0JA 2CE4A 2F1MA 3KCYA 1ENVA 5KX5B 2F93B 4E4EA 1N36O 2CTQA 2GDSA 1NKDA 3AG1C 4DV5B 3CRAA 5JQGB 2K9PA 4FFBB 5JH7B 3CJHA 4JI0O 1FFTB 4MTGA 5EBWC 3SPCA 1NBMG 1YEWA 5LOVA 2GHYA 4Q20A 1VF6C 4IYHA 4QGPA 1K3EA 4FIPC 4JAVA 4GZRB 2XAHA 1P7BA 5EK0A 2JGUA 2VRZA 5LP6C 1K73W 2UUCB 3D8CA 2FTKA 2FMLA 2QR4A 4B08A 1Y74B 2DYSC 1EN4A 2QWNB 1XI1A 1DTOA 1VF7A 2EILB 1VQMV 1VQ8V 1KYOF 3AG4C 1K97A 5EIBC 5L3EA 3JD4A 2QM8A 2XAQA 5ITZA 4KP4A 4D7SA 4X1IB 1YTFB 1BCCH 5LL6Y 3BRCA 2A0LA 4FLXA 2F43G 2Q6AA 5LHHA 1IURA 4P30A 3ETDA 3JD3A 2CK3G 4NTWA 4ZI7A 3ZRWB 2VS0A 2QM7A 3OGCC 2Y48A 4I55A 4X8AA 2W0FC 1HWYA 3JALB 3ZN0A 2XTAA 4EFBA 4TV8B 2QWQB 2YC0A 3JARA 4DV0B 1N33B 1N34B 3RW0A 3N27A 4N23A 1AVMA 4EB6A 3G80A 1AI5A 3RYCA 3CCRV 3SJBC 1M57C 5CBFA 2CAZC 4DUZB 2BTOA 1MA1A 1YVWA 4NKGB 3X2QC 3CRQA 1X4TA 4DUYB 1XREA 3T1HO 2NNUA 5KX5A 5B66Z 1YHQV 3JAMN 3TGUH 4LF7B 5IJ9A 5LHIA 4TSFG 3SYQA 4E2LA 1ORQC 5LMNO 1OCZB 3DGEA 4ZHQB 1HNXB 1QR9A 3G67A 3C3TA 3UM7A 3K03A 3SR2C 1BHBA 1VQ7V 4IGGA 3QVNA 2GBOA 1GO3F 2XOKG 3K3WA 3ZX6A 4B3TB 2KQXA 3VBBA 1AI4A 4GX1A 5LBQA 3TETA 3W7UA 3GB7C 5BY1A 1FXKA 4F6EA 1NH2D 4MT8A 4UCTA 2JEXA 2ZT9B 5JCOC 4JI0B 3F7VC 4PA7A 3SPIA 4J11A 1GMGA 1D2DA 3EXAA 2QJ1A 3TCUA 3WB2A 5B3SB 3JATB 2E3CA 4C7UA 2JIZG 4EB6B 3QNEA 2BTQB 4FLUA 4P9OA 3DTUB 2ADQB 5D5PA 4LH7A 4GCZA 4GT1A 1ZWIC 5C93A 1D5NA 1Y67A 1PNMA 1YITV 5TISZ 1TUEB 2GV9A 4KFMA 1XNRO 1OCOB 2YUAA 4DR4O 4JYCA 2JDIG 2C2AA 4OGQB 4PDRA 4R50A 1SETA 4JGSA 5IE9A 4FM2A 4EFEA 2WLNA 4UV9A 1GKFA 1EBOA 3ABKC 1H2SB 4HAMA 4JI6O 2Z5UA 2QDOA 1UJWB 2QWOB 2ZXWC 4PDMA 2OT5A 3CB2A 2F66C 4JI1B 4UCOA 2EULA 4U3JA 1JMKC 3HKEB 1ZL8B 1SQXH 3A8TA 4JI7O 2ILMA 4NR1A 3SYOA 2EJRA 2E76B 2R9AA 4DV0O 4QPJA 1Q81W 1N34O 1N33O 4QE7A 4LF8O 3ML0A 4YIPA 4BIOA 2JGDA 1P49A 1U97A 2HEPA 3BA9A 3VQXA 1W59A 2HR3A 1HW7A 2DN9A 3N2KA 3DXRB 3T4ZA 3M99B 2PY5A 4H33A 1ZSPA 1E1RG 2ZM6O 2DW4A 2P67A 1WPBA 4CZZA 2DWDC 3QO5A 4H13B 5IJ0A 1FAFA 2ODMA 4TV9A 3LNNA 1M90W 1K34A 3JD0A 1BS3A 2WAMA 1NVPD 1N32O 5L3DA 2Q67A 5B1OA 5L3CA 2UU9O 5GTIZ 2OCCB 4LF6O 2PI5A 2AHYA 3FX7A 3HKBA 4JV5O 1SC5B 4K3AA 4DR2B 3K0GA 4FLZA 3S3XA 4UB8Z 1Y76A 1Q43A 1LUVA 2FL4A 4X1KA 2L35A 4DR5B 2LFSA 1KBHA 4NTXA 1YF2A 1IBLO 4TUYA 3T1CA 3L75H 3OAAG 2QA4V 1VEWA 2ZIMA 1FKAO 5CN0A 1KUQA 3CRCA 3E22A 1XNRB 1H8EG 5J2TA 2VQEB 3RYCB 2EJ7A 4A5UB 3GWKC 1IBKO 2UXCB 2DOSA 3CCMV 5H6QA 1JPXA 1XMOB 4UUJC 3G71V 4DV1O 2JJ2G 4JI2O 1F23A 3B2EE 1XHZA 3SJAC 2JJ1G 4DV2O 4F4LA 1NH2B 3ZMUA 4RQFA 3M8AA 4PA3A 2YIBA 2E74B 3STLC 1WLEA 3OFNG 4TQDA 2IW5A 1ZAUA 5B1AC 3ABUA 4TUYB 5KHIA 4CS4A 5CA3A 5CA0A 1WP7A 3OGIB 2YXHA 2P5OA 3W7WA 3A0HZ 1LR1A 5IYCO 3ZHSA 1Y74A 2PF4E 3GVMA 4DO2A 1NTZH 4OXSA 1F51A 3T1YB 5J2UA 3FYIB 2B9ZA 3W7XA 1VQ6V 1BQZA 2EIMB 2WLIA 3CXHF 1L0LH 1QHTA 2HVKC 2Q4PA 1BE3H 3R65A 4DV7B 1BL8A 1JFFB 3EHBB 4I9QA 4B7EA 1K5SA 4PI2A 3CCVV 4BIZA 2HP8A 3ABTA 3FAVA 3OEEG 4YY3B 3Q4HB 3SGIA 1SS3A 3H01A 1KKDA 4PA4A 1HR0O 2Y69B 4GUNA 5E1AC 3AG2C 3SPHA 3BVOA 3O65A 2F23A 1B6QA 2EIJB 3TK1A 4LF5B 5JJEB 2AGAA 5JJNB 5JCOA 3WG7B 4DR5O 1JQ0A 5D5QA 1KB9F 3HKEA 4LFBO 2ZINA 3OMAB 5H2FZ 3LDEA 4HNAA 1Z5VA 5CA1B 1AJQA 2ADPA 1JVMA 3ZCCA 1QU7A 5H9CA 3ZHRA 2LW7A 5DN6G 4FM1A 3O9OA 3CCQV 3ASNC 2O57A 3JYCA 1OCCC 1OCRC 4NXNB 3JAKA 1GM7A 1H2KA 3ZHQA 5KHKA 2XAGA 2HHHO 1Y76B 1W0KG 1AB3A 3AG3C 2HG5C 1OZ0A 3UCSC 2QKAA 5EBLC 1KQSU 2X6CA 4X62B 1PKXA 1S0VA 2M6YA 1WA8A 3OTFA 4FZ0A 2K1EA 2QM4A 2Q73A 3K58A 3APQA 3M7MX 4HZ3A 4LFAB 4XBFA 2YI9A 5IT9N 1FXHA 2HJDA 2LP7A 1EZJA 3HPLC 4F6RB 5JH7A 3MHHC 2FKXA 4B3MB 1WPXA 4PELA 3RVYA 3FAVB 2HFEC 1JOYA 4F6RA 1M5IA 2XAJA 4IT5A 4JI8O 3THOA 2GUZA 3A2FA 4QNHB 2QWPB 4IYIA 3SYAA 1IX9A 1YZBA 5IWAO 3I55V 4RAIA 5LMUO 3P32A 4K8XA 1FPOA 4UCVA 4I5SA 4OPAA 3L70H 4LC1A 2UXDO 3JAWB 4CC5A 1PNLA 3WB1A 2ZKOA 2HJFC 2BOCC 2RDCA 3FYEB 4I0XA 2CGNA 4FJCC 4JZGA 5EC1C 2PYLA 3VQYA 3E2EA 2NLJC 4BW5A 4DV4B 2QKCA 4TQFA 2V4DA 1I5XA 4JTDB 3E83A 1SQFA 4JI3O 1N4CA 5DEDA 1F7YA 1IBKB 2Y69C 3K5OA 1BQ0A 1DK1A 1GN6A 4WCEV 3TXQA 1HR0B 3FB8C 4Z1VA 2F95B 1M56B 2E75B 2QGNA 2Z0AA 3L9DA 3QTCA 2DYRB 4MVOA 2WLMA 4O2BB 3CP1A 4DRXB 1FFXA 4U7NA 2ZNJA 1G8MA 1GTOA 2E5LO 1XHXA 1W0JG 5EBMC 1G6UA 3K9SA 4DRXA 2MW2B 2IJJA 5L3BA 4DR7B 4XDJA 5LGUA 3KKYA 4X62O 4WFBV 3CHXA 4AQYO 2BCCH 4Q6GA 2ZDIC 4FLTA 3FFQA 1R6TA 2GTAA 4UV8A 1ZUQA 3LDDA 4CH3A 2Q7GA 1KC8W 3HB3B 4W4LA 2IM9A 3HR0A 5BR8B 2UXBO 4X66B 3STZC 3LDCA 2X0LA 1KMIZ 1SZXA 2FYUH 1JJOA 3MAQA 3OUSA 4Z1MG 1TVKA 4JASA 3B8NA 4BIUA 5L3GA 1W2BU 1THZA 1EFRG 5IYBO 1AILA 2LFRA 1CEZA 4MW3A 1K5QA 4KL1A 4D7TA 5FLXN 4FPPA 3JAWA 2EIKC 5IJ9B 3J81N 4MVRA 4X20B 2JK5C 1MG1A 2NR5A 2QSAA 2YI8A 3OW2U 1SQVH 5IDJA 3OUFA 5KMGA 1WAZA 3D3IA 4JTAB 4GYCB 4X1YB 4GX0A 4IHJB 2N05A 4I50B 1QLEB 5B1AB 3PJSK 3ASOB 2P4KA 1H2GA 3DC6A 2UXXA 3OM3B 1YDXA 1B3QA 2DE0X 2PTMA 4LNUB 1S5JA 3DXRA 4RO2A 1H2NA 2YIDA 1NR7A 1MSDA 4EEQA 3VQWA 2OTJV 4PV1B 3ABLB 1HNWB 2JGDB 4I9WA 3OTOB 1EM1A 3CRMA 4AILC 5EC2C 1XEQA 1FD9A 2HLDG 4UVBA 3JASA 4JI3B 3L71H 3RN4A 1UPGA 4IL6Z 1ZL8A 2JEUA 3W7SA 1TAEA 1NR1A 1ZTEA 1SQBH 1FJGB 2DQ0A 4UB6Z 3FB7C 3K59A 1YSCA 4MSWC 4DUYO 3T1HB 2OCHA 4DK0A 1Q86W 4CH6A 3CCUV 1XQ8A 2EZOA 1DF5A 1K7DA 3K5NA 1RPOA 3P3NA 1VP7A 2CTRA 5LYJA 4JI7B 1NS1A 2JS5A 5GTHZ 4AI8A 2UUAO 1LNQA 1B04A 4HNAB 3K79A 4GLXA 1K8AW 1G4YB 4K35A 2P6JA 3RGBA 3OEHG 2JRIA 2JVDA 1VQNV 2XHBA 1Z2GA 3L73H 5KA5A 4MS2A 2W6IG 2N04A 2EINB 1H2MA 2A06H 5LP6B 3Q4HA 1N8RW 1SERA 1EN5A 2QTSA 3D3QA 3ABKB 4B7KA 1I08A 1VQ9V 1OJHA 5A2QN 1KKCA 3W7TA 2KG7B 2ZCEA 1J95A 4GX5A 1M1KW 3AK3A 4DV3B 1JCHA 2QEXV 1I5YA 4YXWG 4RUEA 3AG2B 4J7ZA 1VQ5V 4UVAA 4KHPB 1V54C 2ATKC 3RYIA 3U0ZA 3ZEDA 3B40A 1TA8A 2F4VB 1P7GA 2Y0IA 4DYLA 1XDCA 3L72H 4ZBMA 4GX2A 3AK1A 5CA0B 2Q7EA 2P22C 1AR4A 3OTOO 5LGNA 3JD1A 4IIJB 4FZ1A 4ICGA 5F2VO 1GN4A 3OR6C 3IC7A 1XNQB 3CWBH 3IC9A 1R3JC 3SJQC 1S5HC 1E1QG
chains in the Genus database with same CATH topology
4JI8O 1IBLO 4GKJO 1NS1A 4DV7O 1FKAO 1KUQA 3T1YO 2UXBO 1YZBA 2UUAO 5IWAO 2DJVA 4LFCO 1N36O 4LF7O 5LMUO 1XMOO 4JI5O 4A5UB 4DR3O 4JI6O 4OPAA 4B3SO 1HR0O 1IBKO 3T1HO 2UXDO 4DR7O 4B3TO 4X66O 4LF5O 2DOSA 3JAMN 3O65A 4JI0O 1AILA 2N74A 4DV4O 5LMNO 4DV1O 2ZKOA 1HNZO 1IBMO 2JRIA 4JI2O 5FLXN 4KHPO 2VQFO 4JI7O 4DV3O 2AGAA 3J81N 4DV0O 4DR5O 1N34O 4JI1O 3F5TA 1N33O 5BR8O 4LF8O 4JI4O 4LFBO 2F4VO 1G1XB 2VQEO 4JI3O 4DV2O 1HNWO 4OX9O 2UXCO 1F7YA 3M8AA 4JYAO 1DK1A 4DR1O 5BXZA 3J7AU 4DV6O 4LFAO 2LW7A 4X64O 3RT3C 1A32A 1FYJA 5BY1A 5A2QN 4B3RO 4GKKO 2ZM6O 2Z0AA 1I94O 2HHHO 3J80N 1AB3A 1X59A 4B3MO 1D2DA 2UUCO 1J5EO 1XMQO 5LL6Y 1XEQA 5H5NA 2E5LO 4YY3O 1N32O 3OTOO 4NXMO 4X65O 2UU9O 4LF9O 2UUBO 4NXNO 4X62O 4LF6O 4LF4O 5IT9N 4OPHA 4AQYO 1R1BA 3R66A 4JV5O 4DUYO 4DV5O 4YHHO 4DR6O 3SDLA 2FKXA 1FJGO 1R6TA 1HNXO 4DUZO 1XNRO 4DR4O 4DR2O 4K0KO 1XNQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 O;  1IBL O;  4GKJ O;  1NS1 A;  4DV7 O;  1FKA O;  1KUQ A;  3T1Y O;  2UXB O;  1YZB A;  2UUA O;  5IWA O;  2DJV A;  4LFC O;  1N36 O;  4LF7 O;  5LMU O;  1XMO O;  4JI5 O;  4A5U B;  4DR3 O;  4JI6 O;  4OPA A;  4B3S O;  1HR0 O;  1IBK O;  3T1H O;  2UXD O;  4DR7 O;  4B3T O;  4X66 O;  4LF5 O;  2DOS A;  3JAM N;  3O65 A;  4JI0 O;  1AIL A;  2N74 A;  4DV4 O;  5LMN O;  4DV1 O;  2ZKO A;  1HNZ O;  1IBM O;  2JRI A;  4JI2 O;  5FLX N;  4KHP O;  2VQF O;  4JI7 O;  4DV3 O;  2AGA A;  3J81 N;  4DV0 O;  4DR5 O;  1N34 O;  4JI1 O;  3F5T A;  1N33 O;  5BR8 O;  4LF8 O;  4JI4 O;  4LFB O;  2F4V O;  1G1X B;  2VQE O;  4JI3 O;  4DV2 O;  1HNW O;  4OX9 O;  2UXC O;  1F7Y A;  3M8A A;  4JYA O;  1DK1 A;  4DR1 O;  5BXZ A;  3J7A U;  4DV6 O;  4LFA O;  2LW7 A;  4X64 O;  3RT3 C;  1A32 A;  1FYJ A;  5BY1 A;  5A2Q N;  4B3R O;  4GKK O;  2ZM6 O;  2Z0A A;  1I94 O;  2HHH O;  3J80 N;  1AB3 A;  1X59 A;  4B3M O;  1D2D A;  2UUC O;  1J5E O;  1XMQ O;  5LL6 Y;  1XEQ A;  5H5N A;  2E5L O;  4YY3 O;  1N32 O;  3OTO O;  4NXM O;  4X65 O;  2UU9 O;  4LF9 O;  2UUB O;  4NXN O;  4X62 O;  4LF6 O;  4LF4 O;  5IT9 N;  4OPH A;  4AQY O;  1R1B A;  3R66 A;  4JV5 O;  4DUY O;  4DV5 O;  4YHH O;  4DR6 O;  3SDL A;  2FKX A;  1FJG O;  1R6T A;  1HNX O;  4DUZ O;  1XNR O;  4DR4 O;  4DR2 O;  4K0K O;  1XNQ O; 
#chains in the Genus database with same CATH topology
 2E5L B;  2EIK B;  2ETN A;  1M56 C;  1QNM A;  1CPY A;  3JAR B;  3CMA V;  3OMN B;  4LF7 O;  3X2Q B;  5LA6 B;  5HFL A;  4DR3 O;  1NZ6 A;  1V54 B;  1M57 B;  2H3O A;  1VIB A;  2JS3 A;  3JAT A;  1OV9 A;  2XAF A;  4G27 B;  4B3S B;  3T4D A;  1IBM O;  3VQV A;  4B3R B;  5B1B C;  4FK5 C;  1KEC A;  5B1N A;  3CCL V;  1UFI A;  3OE7 G;  5K1P A;  5BR8 O;  1OCZ C;  4JI4 O;  4K0K B;  5H6R A;  1VMG A;  1SZT A;  4KXR A;  1RP3 B;  1PV0 A;  5J2T B;  2HVJ C;  2AZ0 A;  2ZE5 A;  4X20 A;  3CXC U;  2AHZ A;  2Z3Y A;  4NXM B;  3K04 A;  1R6N A;  3HKB B;  3C90 A;  2RCV A;  4WFA V;  1I94 O;  1MSW D;  4DR4 B;  2V7Q G;  1R3K C;  1OCR B;  1Q8I A;  1K92 A;  5BZB A;  1E79 G;  3DC5 A;  4X89 A;  4MW8 A;  1EN6 A;  5IJ0 B;  3APO A;  4ZIB A;  1MNG A;  1NJI W;  4R7C A;  3CE2 A;  3SJC C;  1TUB A;  4J7K A;  1Q90 D;  4YHH O;  1R3I C;  3UO3 A;  1ROP A;  2V1D A;  4YJ3 A;  1YI2 V;  4WBN B;  5IYZ A;  2EX3 A;  1XNQ O;  1GRJ A;  4I55 B;  3FD9 A;  5CBH A;  4ABM A;  2WLH A;  4RQE A;  4GKJ O;  1KP2 A;  2HKO A;  5FL7 G;  3IGA C;  1HP8 A;  3ZMS A;  2IH3 C;  1DF4 A;  3EFF K;  3LSU A;  4PJ0 Z;  2DJV A;  3U10 A;  2ARH A;  2YIC A;  4LP8 A;  4U3J B;  5IYD O;  4DR6 B;  1NTM H;  2UXN A;  2QKS A;  3IAY A;  4GKK B;  1WB7 A;  1F4M A;  2P7T C;  3CS5 A;  5EIB D;  5IY5 C;  2VQF O;  1M4U A;  3ZMZ A;  4JTC B;  1MZE A;  1WN7 A;  2HHH B;  3K57 A;  1G1X B;  1SA0 B;  3OR7 C;  2IU3 A;  4UXN A;  2A9H A;  1QVF U;  2KB1 A;  4FMT A;  5BXZ A;  2QTO A;  1SES A;  4NB5 A;  4DV6 O;  3D36 A;  1A32 A;  4BWA A;  5FPO A;  3B4S A;  5LOV B;  4D6T H;  4AHC A;  4J80 A;  2PUS A;  5C8Y B;  1RM1 C;  2IJI A;  4B3M O;  2BTQ A;  2W6J G;  2R9I A;  4X88 A;  2RQ6 A;  2UU9 B;  4FFB A;  4P2Z A;  3BAA A;  4CC6 A;  2IH1 C;  1ZX3 A;  1Y6X A;  5B3S C;  1QQC A;  4LF4 B;  2GUZ B;  4JYB A;  2R9R B;  1RFY A;  2ITD C;  2Y0P A;  4X65 O;  4YJ3 B;  5IWA B;  4LWS A;  2XUM A;  5JJJ B;  2NN4 A;  1GAX A;  4JI5 B;  2EIN C;  3ETE A;  1XL6 A;  3F5W C;  4IHJ A;  2UXD B;  2YDE A;  1T5E A;  1VAR A;  4J9Z B;  2RN9 A;  1VQL V;  2ZXW B;  2DWE C;  2WLL B;  4QPK A;  3RBZ A;  3ZHT A;  5DEC A;  3QF7 A;  3ETQ A;  4PDL A;  4LR3 A;  2ZE6 A;  4R6Z A;  2PI4 A;  3ZRV A;  2L6L A;  1XMO O;  4ZHQ A;  4DV1 B;  2VWJ A;  2WPD G;  2YSU B;  1VF6 A;  5KA6 A;  2LGW A;  3K0D A;  1GN3 A;  4ZOL A;  3ZJZ A;  5GW7 A;  2ZIO A;  1H2L A;  2ZQM A;  4X64 B;  1D5A A;  3CC4 V;  1YCI A;  4O4I A;  3LSS A;  1CXZ B;  2XND G;  3B8M A;  4K8Z A;  1PL4 A;  2UUA B;  5LMN B;  1YJ9 V;  2PGG A;  2Q9L A;  1S77 D;  1JJ2 U;  3U11 A;  4MVM A;  3HKD A;  4DR1 O;  3E86 A;  3ZS8 C;  3J7A U;  3CC2 V;  2RMK B;  2CDY A;  1WNS A;  4GKK O;  3CCE V;  4FFK A;  3I5D A;  4O2B A;  1O9G A;  4JI4 B;  3J80 N;  4H37 A;  2H8P C;  1SQG A;  2QE7 G;  1PP9 H;  3JCZ A;  2PZS A;  1XMQ O;  5AG2 A;  2FB5 A;  3ZIA G;  3ZN1 A;  3CME V;  3E8B A;  3A0B Z;  1U96 A;  3K9A A;  4YY3 O;  2IJH A;  3BA8 A;  5B5E Z;  1CP9 A;  2OCC C;  1NVP B;  4NXM O;  3PN1 A;  1BHA A;  3AG4 B;  4X1I A;  4LF9 O;  1JFF A;  4N21 A;  4DV6 B;  4LF4 O;  1YXB A;  5KMG B;  4LCU C;  1QR8 A;  4X1K B;  1IZ3 A;  4ZOL B;  1I94 B;  4UVC A;  1HNZ B;  1Y4M A;  4IIJ A;  2OIE A;  4QE9 A;  1AI7 A;  2YXL A;  3RYI B;  4I0X B;  4U7O A;  1HDJ A;  5HFM A;  1EZV H;  3LUT B;  3ZRX A;  3G4S V;  1M93 A;  1VQK V;  3JD2 A;  2BE3 A;  4TOI A;  1AJN A;  1GM8 A;  3G6B A;  4NVP A;  1L8D A;  2WLK A;  5FNV B;  4LF5 O;  4JZ2 A;  1PM9 A;  4QIW F;  4EKW A;  1KP3 A;  5LP6 A;  3H1H H;  2EIL C;  4JAA A;  4CS2 A;  2CH7 B;  1JR9 A;  3DSQ A;  4ASU G;  2CGO A;  3CSX A;  4JI1 O;  4FLW A;  2DYS B;  3N2K B;  1J5E B;  1HNW O;  3ABM B;  3JAL A;  4OX9 O;  5KAI Z;  1SQQ H;  3WU2 Z;  3H1L H;  1Y66 A;  1SQP H;  4JI6 B;  4LFA O;  3AG3 B;  4ZI7 B;  3ASO C;  1XL4 A;  1V55 B;  3RT3 C;  1IBM B;  1FYJ A;  2BSK A;  4B3R O;  3QG5 A;  2UUB B;  2DYR C;  2ZR3 A;  1S72 V;  3QO8 A;  3SPG A;  3ASN B;  2UUC O;  2ZM6 B;  3E8H A;  4LF8 B;  1RSO A;  2Q0A A;  2YIA A;  3MHS C;  1RPR A;  1XUQ A;  4JYY A;  5EYP B;  3RYH B;  4DK1 A;  4G28 B;  4O4L B;  1XMQ B;  1Q6H A;  4O2A B;  3LNM B;  5K1X A;  5KUK A;  2EIM C;  5J9P C;  3N2G B;  1FXK C;  4LFC B;  4LBE C;  1URF A;  4DR2 O;  2BSK B;  2AW9 A;  3JAS B;  5LA6 A;  1YJN V;  3AG1 B;  3K5L A;  3MDS A;  2DMX A;  4LNU A;  4X65 B;  4HBN A;  5IYZ B;  1N32 B;  4WBN A;  3UT5 A;  3CJH B;  2YEV B;  1VQP V;  1B06 A;  4I4T B;  4O4J A;  5EZY A;  4YHH B;  1Q6U A;  4JPR A;  1JX9 A;  1DLB A;  4JV5 B;  3BFR A;  1VQ4 V;  2CH7 A;  2B1I A;  2EBO A;  2N74 A;  4DV4 O;  4MVS A;  1HNZ O;  1GM9 A;  1V55 C;  3RYF B;  1Q3E A;  2WWW A;  4GKJ B;  2CUG A;  1MAB G;  3OD4 A;  4JF3 A;  1JA8 A;  4MVU A;  3CD6 V;  4I50 A;  4O4H B;  5A9G A;  1OCO C;  1Z5W A;  4XDK A;  3RFR A;  1K4C C;  5KAF Z;  5L3F A;  1BMF G;  1BSM A;  1TVK B;  1SKV A;  3JSN A;  3ZMV A;  1BT8 A;  4RWU A;  3IJ4 A;  1NTK H;  4TT3 G;  3S3W A;  3AEI A;  4X64 O;  2PYJ A;  4R8C A;  3UKM A;  1WJZ A;  1SRY A;  4W4K A;  2ZDI A;  4WF9 V;  1GK9 A;  1S3J A;  2GTS A;  4Z2W A;  2D2C B;  5BMV A;  2X6B A;  2ZNI A;  1PD3 A;  4PI0 A;  1P84 F;  2WLJ A;  1GN2 A;  2LO1 A;  1L0N H;  1R6K A;  1IDS A;  3E89 A;  2KSD A;  5H5N A;  5JVD B;  4DR1 B;  2LQT A;  5KUM A;  3HKC A;  4BW9 A;  3C3S A;  4J42 A;  3H1J H;  4YJ2 A;  3BCC H;  2WSS G;  4KUM A;  4OPH A;  3K5M A;  4DR3 B;  1QCE A;  5KLV H;  2WA3 A;  1S76 D;  3SDL A;  3IFX A;  5FPR A;  2R70 A;  2IJK A;  3KG2 A;  2OWO A;  1BGY H;  5GON A;  1NT2 B;  2X7R B;  4RUF A;  4MTX A;  2EIJ C;  1QLE C;  3ZRW A;  4I7Z B;  4FVM A;  2VWK A;  4CBC A;  2OTL V;  4DW1 A;  1R3L C;  1FFX B;  5LXT A;  1COW G;  1Q6I A;  4DV7 O;  3ZMT A;  1H38 A;  4CH4 A;  4ZKI A;  1QLN A;  3ZHV A;  4LFC O;  2CTW A;  5LYJ B;  1AJP A;  4JI5 O;  4LF6 B;  3AK2 A;  4FLV A;  4PHZ A;  3FB5 C;  3BAB A;  4O2A A;  5KHG A;  3QO7 A;  3SYC A;  2XAS A;  3D36 C;  3E8F A;  1FXK B;  4L8J A;  2M7W A;  4UCS A;  3CPW U;  1IBL B;  4DV3 O;  1GH6 A;  2YIB D;  1AR5 A;  4WFE A;  2EZP A;  1K9M W;  2WLI B;  1L1F A;  2VQE O;  4FM0 A;  4J41 A;  3CC7 V;  2YS8 A;  5CMU A;  4TWK A;  5J2U B;  3CCS V;  3ABL C;  3ZRS A;  2BOB C;  1DGS A;  4J9Y B;  4JI2 B;  3TXS A;  1MMM A;  2LJ2 A;  2A3Q A;  4TV9 B;  1IVS A;  3K08 A;  4J7J A;  1X59 A;  2RJZ A;  1J5E O;  5JQG A;  3OMI B;  4LH6 A;  4PA9 A;  4XDL A;  3NR7 A;  3ICX A;  5JWP A;  4LWS B;  4X1Y A;  3RYF A;  3BY6 A;  2B5U A;  4CS3 A;  4YIO A;  1SF9 A;  2KKW A;  4MTF A;  3BHP A;  4TV8 A;  2UUB O;  2Y4U A;  4O4J B;  5EZY B;  2YEV A;  2G38 A;  3FKS G;  1WA8 B;  5FNV A;  4DV5 O;  2H94 A;  4NYK A;  5C8Y A;  2IBZ H;  3KCX A;  3SYP A;  1M9N A;  4H44 B;  1WP8 A;  4WFF A;  1R73 A;  5CBG A;  4MVZ A;  2VQF B;  4X9Q A;  3GWO A;  1XIL A;  4MTO A;  1H8H G;  3JAK B;  3T1Y O;  3A0R A;  5DM6 V;  3TJT A;  4O4L A;  4UCU A;  4JYA B;  2ZR2 A;  1SA0 A;  3LSQ A;  3I56 V;  5ITZ B;  3RVZ A;  4HYO A;  1KU9 A;  3WFV A;  3E22 B;  1VQO V;  1RSO B;  3ABM C;  4DXW A;  2Q68 A;  3H1I H;  5LMU B;  3H9V A;  5EYP A;  3B77 A;  3WB0 A;  4KHP O;  1ARO P;  2Q69 A;  1K4D C;  2B1G A;  2ZE7 A;  3F5T A;  5LXT B;  2D3O W;  2F4V O;  4JI8 B;  1K33 A;  1NQT A;  3K06 A;  1LUW A;  4BR6 A;  1OHH G;  3P30 A;  4JAU A;  3BEH A;  2UXC O;  1AR1 B;  2CTP A;  1WB8 A;  3EVK A;  1MOF A;  1KD1 W;  5KHJ A;  2P06 A;  4YJ2 B;  1V9P A;  2A79 B;  3HKC B;  4LFB B;  1XBL A;  4U3F H;  2R72 A;  4DV2 B;  4OX9 B;  1NI8 A;  1TUB B;  3WG7 C;  1AP6 A;  2WA4 A;  3CCJ V;  3AG7 A;  1XOU A;  1O9H A;  5BMV B;  1N36 B;  2Q7H A;  3KZI Z;  4G2K A;  1YIJ V;  3G6E V;  1PL0 A;  1AP5 A;  1US6 A;  4QJF B;  1NU1 H;  1YTF D;  1N0N A;  5CB4 A;  1R1B A;  3R66 A;  4PDV A;  3L74 H;  1Q7Y W;  5IY5 B;  4DR6 O;  2X6A A;  3SPJ A;  1TGO A;  2Q5Z A;  2RNB A;  5LHG A;  4AQY B;  1Q5O A;  2GSM B;  4K0K O;  2ZD9 A;  2KG7 A;  2W0X A;  1ZLZ A;  4NTY A;  3E8G A;  1IXB A;  3F7Y C;  3E35 A;  2A7W A;  2Q0O C;  2YXY A;  3CX5 F;  2IU0 A;  4B3S O;  3B09 A;  4P9P A;  4DR7 O;  4B3T O;  4X66 O;  4J10 A;  3H1K H;  2AXT Z;  4MVQ A;  2AZ2 A;  1QBZ A;  3CRR A;  4I4T A;  1AI6 A;  4UFZ A;  4PA6 A;  3UT5 B;  3UQ8 A;  1Q82 W;  4UCR A;  3RWR D;  2Q8V A;  4WFH A;  4CH5 A;  3ETG A;  1YJW V;  4WFG A;  1IXM A;  1FXV A;  2UXB B;  5GON B;  1I7F A;  2LGQ A;  3T2M A;  3N2G A;  4JYA O;  3NXS A;  3ZHU A;  1FS0 G;  5B1B B;  1S5L Z;  2ZE8 A;  5LGT A;  2QWR B;  3HKD B;  4LF9 B;  1VF5 B;  5JVD A;  4O4I B;  1OCC B;  3RYH A;  2P90 A;  1F4N A;  1BZK A;  1PNK A;  4FLY A;  3ZBH A;  1MZF A;  3VOU A;  3FB6 C;  2OIG A;  1P4R A;  5CA1 A;  3JCU Z;  3P3P A;  3UO2 A;  3OT7 A;  1PPJ H;  1QVG U;  3CYO A;  2LW1 A;  2P4V A;  2Y4T A;  4NXN O;  4L87 A;  5E79 Z;  2DQ3 A;  2WLL A;  3MD0 A;  2MK3 A;  4PD4 F;  1I0H A;  4BAY A;  4H0L B;  2ITC C;  3JSL A;  2OYQ A;  1FJG O;  1HNX O;  5KHH A;  5CB4 B;  3CEI A;  4DW0 A;  3BPZ A;  4DUZ O;  1RM1 B;  4O4H A;  2XT9 A;  1N0J A;  2CE4 A;  2F1M A;  3KCY A;  1ENV A;  5KX5 B;  2F93 B;  4E4E A;  1N36 O;  2CTQ A;  2GDS A;  1NKD A;  3AG1 C;  4DV5 B;  3CRA A;  5JQG B;  2K9P A;  4FFB B;  5JH7 B;  3CJH A;  4JI0 O;  1FFT B;  4MTG A;  5EBW C;  3SPC A;  1NBM G;  1YEW A;  5LOV A;  2GHY A;  4Q20 A;  1VF6 C;  4IYH A;  4QGP A;  1K3E A;  4FIP C;  4JAV A;  4GZR B;  2XAH A;  1P7B A;  5EK0 A;  2JGU A;  2VRZ A;  5LP6 C;  1K73 W;  2UUC B;  3D8C A;  2FTK A;  2FML A;  2QR4 A;  4B08 A;  1Y74 B;  2DYS C;  1EN4 A;  2QWN B;  1XI1 A;  1DTO A;  1VF7 A;  2EIL B;  1VQM V;  1VQ8 V;  1KYO F;  3AG4 C;  1K97 A;  5EIB C;  5L3E A;  3JD4 A;  2QM8 A;  2XAQ A;  5ITZ A;  4KP4 A;  4D7S A;  4X1I B;  1YTF B;  1BCC H;  5LL6 Y;  3BRC A;  2A0L A;  4FLX A;  2F43 G;  2Q6A A;  5LHH A;  1IUR A;  4P30 A;  3ETD A;  3JD3 A;  2CK3 G;  4NTW A;  4ZI7 A;  3ZRW B;  2VS0 A;  2QM7 A;  3OGC C;  2Y48 A;  4I55 A;  4X8A A;  2W0F C;  1HWY A;  3JAL B;  3ZN0 A;  2XTA A;  4EFB A;  4TV8 B;  2QWQ B;  2YC0 A;  3JAR A;  4DV0 B;  1N33 B;  1N34 B;  3RW0 A;  3N27 A;  4N23 A;  1AVM A;  4EB6 A;  3G80 A;  1AI5 A;  3RYC A;  3CCR V;  3SJB C;  1M57 C;  5CBF A;  2CAZ C;  4DUZ B;  2BTO A;  1MA1 A;  1YVW A;  4NKG B;  3X2Q C;  3CRQ A;  1X4T A;  4DUY B;  1XRE A;  3T1H O;  2NNU A;  5KX5 A;  5B66 Z;  1YHQ V;  3JAM N;  3TGU H;  4LF7 B;  5IJ9 A;  5LHI A;  4TSF G;  3SYQ A;  4E2L A;  1ORQ C;  5LMN O;  1OCZ B;  3DGE A;  4ZHQ B;  1HNX B;  1QR9 A;  3G67 A;  3C3T A;  3UM7 A;  3K03 A;  3SR2 C;  1BHB A;  1VQ7 V;  4IGG A;  3QVN A;  2GBO A;  1GO3 F;  2XOK G;  3K3W A;  3ZX6 A;  4B3T B;  2KQX A;  3VBB A;  1AI4 A;  4GX1 A;  5LBQ A;  3TET A;  3W7U A;  3GB7 C;  5BY1 A;  1FXK A;  4F6E A;  1NH2 D;  4MT8 A;  4UCT A;  2JEX A;  2ZT9 B;  5JCO C;  4JI0 B;  3F7V C;  4PA7 A;  3SPI A;  4J11 A;  1GMG A;  1D2D A;  3EXA A;  2QJ1 A;  3TCU A;  3WB2 A;  5B3S B;  3JAT B;  2E3C A;  4C7U A;  2JIZ G;  4EB6 B;  3QNE A;  2BTQ B;  4FLU A;  4P9O A;  3DTU B;  2ADQ B;  5D5P A;  4LH7 A;  4GCZ A;  4GT1 A;  1ZWI C;  5C93 A;  1D5N A;  1Y67 A;  1PNM A;  1YIT V;  5TIS Z;  1TUE B;  2GV9 A;  4KFM A;  1XNR O;  1OCO B;  2YUA A;  4DR4 O;  4JYC A;  2JDI G;  2C2A A;  4OGQ B;  4PDR A;  4R50 A;  1SET A;  4JGS A;  5IE9 A;  4FM2 A;  4EFE A;  2WLN A;  4UV9 A;  1GKF A;  1EBO A;  3ABK C;  1H2S B;  4HAM A;  4JI6 O;  2Z5U A;  2QDO A;  1UJW B;  2QWO B;  2ZXW C;  4PDM A;  2OT5 A;  3CB2 A;  2F66 C;  4JI1 B;  4UCO A;  2EUL A;  4U3J A;  1JMK C;  3HKE B;  1ZL8 B;  1SQX H;  3A8T A;  4JI7 O;  2ILM A;  4NR1 A;  3SYO A;  2EJR A;  2E76 B;  2R9A A;  4DV0 O;  4QPJ A;  1Q81 W;  1N34 O;  1N33 O;  4QE7 A;  4LF8 O;  3ML0 A;  4YIP A;  4BIO A;  2JGD A;  1P49 A;  1U97 A;  2HEP A;  3BA9 A;  3VQX A;  1W59 A;  2HR3 A;  1HW7 A;  2DN9 A;  3N2K A;  3DXR B;  3T4Z A;  3M99 B;  2PY5 A;  4H33 A;  1ZSP A;  1E1R G;  2ZM6 O;  2DW4 A;  2P67 A;  1WPB A;  4CZZ A;  2DWD C;  3QO5 A;  4H13 B;  5IJ0 A;  1FAF A;  2ODM A;  4TV9 A;  3LNN A;  1M90 W;  1K34 A;  3JD0 A;  1BS3 A;  2WAM A;  1NVP D;  1N32 O;  5L3D A;  2Q67 A;  5B1O A;  5L3C A;  2UU9 O;  5GTI Z;  2OCC B;  4LF6 O;  2PI5 A;  2AHY A;  3FX7 A;  3HKB A;  4JV5 O;  1SC5 B;  4K3A A;  4DR2 B;  3K0G A;  4FLZ A;  3S3X A;  4UB8 Z;  1Y76 A;  1Q43 A;  1LUV A;  2FL4 A;  4X1K A;  2L35 A;  4DR5 B;  2LFS A;  1KBH A;  4NTX A;  1YF2 A;  1IBL O;  4TUY A;  3T1C A;  3L75 H;  3OAA G;  2QA4 V;  1VEW A;  2ZIM A;  1FKA O;  5CN0 A;  1KUQ A;  3CRC A;  3E22 A;  1XNR B;  1H8E G;  5J2T A;  2VQE B;  3RYC B;  2EJ7 A;  4A5U B;  3GWK C;  1IBK O;  2UXC B;  2DOS A;  3CCM V;  5H6Q A;  1JPX A;  1XMO B;  4UUJ C;  3G71 V;  4DV1 O;  2JJ2 G;  4JI2 O;  1F23 A;  3B2E E;  1XHZ A;  3SJA C;  2JJ1 G;  4DV2 O;  4F4L A;  1NH2 B;  3ZMU A;  4RQF A;  3M8A A;  4PA3 A;  2YIB A;  2E74 B;  3STL C;  1WLE A;  3OFN G;  4TQD A;  2IW5 A;  1ZAU A;  5B1A C;  3ABU A;  4TUY B;  5KHI A;  4CS4 A;  5CA3 A;  5CA0 A;  1WP7 A;  3OGI B;  2YXH A;  2P5O A;  3W7W A;  3A0H Z;  1LR1 A;  5IYC O;  3ZHS A;  1Y74 A;  2PF4 E;  3GVM A;  4DO2 A;  1NTZ H;  4OXS A;  1F51 A;  3T1Y B;  5J2U A;  3FYI B;  2B9Z A;  3W7X A;  1VQ6 V;  1BQZ A;  2EIM B;  2WLI A;  3CXH F;  1L0L H;  1QHT A;  2HVK C;  2Q4P A;  1BE3 H;  3R65 A;  4DV7 B;  1BL8 A;  1JFF B;  3EHB B;  4I9Q A;  4B7E A;  1K5S A;  4PI2 A;  3CCV V;  4BIZ A;  2HP8 A;  3ABT A;  3FAV A;  3OEE G;  4YY3 B;  3Q4H B;  3SGI A;  1SS3 A;  3H01 A;  1KKD A;  4PA4 A;  1HR0 O;  2Y69 B;  4GUN A;  5E1A C;  3AG2 C;  3SPH A;  3BVO A;  3O65 A;  2F23 A;  1B6Q A;  2EIJ B;  3TK1 A;  4LF5 B;  5JJE B;  2AGA A;  5JJN B;  5JCO A;  3WG7 B;  4DR5 O;  1JQ0 A;  5D5Q A;  1KB9 F;  3HKE A;  4LFB O;  2ZIN A;  3OMA B;  5H2F Z;  3LDE A;  4HNA A;  1Z5V A;  5CA1 B;  1AJQ A;  2ADP A;  1JVM A;  3ZCC A;  1QU7 A;  5H9C A;  3ZHR A;  2LW7 A;  5DN6 G;  4FM1 A;  3O9O A;  3CCQ V;  3ASN C;  2O57 A;  3JYC A;  1OCC C;  1OCR C;  4NXN B;  3JAK A;  1GM7 A;  1H2K A;  3ZHQ A;  5KHK A;  2XAG A;  2HHH O;  1Y76 B;  1W0K G;  1AB3 A;  3AG3 C;  2HG5 C;  1OZ0 A;  3UCS C;  2QKA A;  5EBL C;  1KQS U;  2X6C A;  4X62 B;  1PKX A;  1S0V A;  2M6Y A;  1WA8 A;  3OTF A;  4FZ0 A;  2K1E A;  2QM4 A;  2Q73 A;  3K58 A;  3APQ A;  3M7M X;  4HZ3 A;  4LFA B;  4XBF A;  2YI9 A;  5IT9 N;  1FXH A;  2HJD A;  2LP7 A;  1EZJ A;  3HPL C;  4F6R B;  5JH7 A;  3MHH C;  2FKX A;  4B3M B;  1WPX A;  4PEL A;  3RVY A;  3FAV B;  2HFE C;  1JOY A;  4F6R A;  1M5I A;  2XAJ A;  4IT5 A;  4JI8 O;  3THO A;  2GUZ A;  3A2F A;  4QNH B;  2QWP B;  4IYI A;  3SYA A;  1IX9 A;  1YZB A;  5IWA O;  3I55 V;  4RAI A;  5LMU O;  3P32 A;  4K8X A;  1FPO A;  4UCV A;  4I5S A;  4OPA A;  3L70 H;  4LC1 A;  2UXD O;  3JAW B;  4CC5 A;  1PNL A;  3WB1 A;  2ZKO A;  2HJF C;  2BOC C;  2RDC A;  3FYE B;  4I0X A;  2CGN A;  4FJC C;  4JZG A;  5EC1 C;  2PYL A;  3VQY A;  3E2E A;  2NLJ C;  4BW5 A;  4DV4 B;  2QKC A;  4TQF A;  2V4D A;  1I5X A;  4JTD B;  3E83 A;  1SQF A;  4JI3 O;  1N4C A;  5DED A;  1F7Y A;  1IBK B;  2Y69 C;  3K5O A;  1BQ0 A;  1DK1 A;  1GN6 A;  4WCE V;  3TXQ A;  1HR0 B;  3FB8 C;  4Z1V A;  2F95 B;  1M56 B;  2E75 B;  2QGN A;  2Z0A A;  3L9D A;  3QTC A;  2DYR B;  4MVO A;  2WLM A;  4O2B B;  3CP1 A;  4DRX B;  1FFX A;  4U7N A;  2ZNJ A;  1G8M A;  1GTO A;  2E5L O;  1XHX A;  1W0J G;  5EBM C;  1G6U A;  3K9S A;  4DRX A;  2MW2 B;  2IJJ A;  5L3B A;  4DR7 B;  4XDJ A;  5LGU A;  3KKY A;  4X62 O;  4WFB V;  3CHX A;  4AQY O;  2BCC H;  4Q6G A;  2ZDI C;  4FLT A;  3FFQ A;  1R6T A;  2GTA A;  4UV8 A;  1ZUQ A;  3LDD A;  4CH3 A;  2Q7G A;  1KC8 W;  3HB3 B;  4W4L A;  2IM9 A;  3HR0 A;  5BR8 B;  2UXB O;  4X66 B;  3STZ C;  3LDC A;  2X0L A;  1KMI Z;  1SZX A;  2FYU H;  1JJO A;  3MAQ A;  3OUS A;  4Z1M G;  1TVK A;  4JAS A;  3B8N A;  4BIU A;  5L3G A;  1W2B U;  1THZ A;  1EFR G;  5IYB O;  1AIL A;  2LFR A;  1CEZ A;  4MW3 A;  1K5Q A;  4KL1 A;  4D7T A;  5FLX N;  4FPP A;  3JAW A;  2EIK C;  5IJ9 B;  3J81 N;  4MVR A;  4X20 B;  2JK5 C;  1MG1 A;  2NR5 A;  2QSA A;  2YI8 A;  3OW2 U;  1SQV H;  5IDJ A;  3OUF A;  5KMG A;  1WAZ A;  3D3I A;  4JTA B;  4GYC B;  4X1Y B;  4GX0 A;  4IHJ B;  2N05 A;  4I50 B;  1QLE B;  5B1A B;  3PJS K;  3ASO B;  2P4K A;  1H2G A;  3DC6 A;  2UXX A;  3OM3 B;  1YDX A;  1B3Q A;  2DE0 X;  2PTM A;  4LNU B;  1S5J A;  3DXR A;  4RO2 A;  1H2N A;  2YID A;  1NR7 A;  1MSD A;  4EEQ A;  3VQW A;  2OTJ V;  4PV1 B;  3ABL B;  1HNW B;  2JGD B;  4I9W A;  3OTO B;  1EM1 A;  3CRM A;  4AIL C;  5EC2 C;  1XEQ A;  1FD9 A;  2HLD G;  4UVB A;  3JAS A;  4JI3 B;  3L71 H;  3RN4 A;  1UPG A;  4IL6 Z;  1ZL8 A;  2JEU A;  3W7S A;  1TAE A;  1NR1 A;  1ZTE A;  1SQB H;  1FJG B;  2DQ0 A;  4UB6 Z;  3FB7 C;  3K59 A;  1YSC A;  4MSW C;  4DUY O;  3T1H B;  2OCH A;  4DK0 A;  1Q86 W;  4CH6 A;  3CCU V;  1XQ8 A;  2EZO A;  1DF5 A;  1K7D A;  3K5N A;  1RPO A;  3P3N A;  1VP7 A;  2CTR A;  5LYJ A;  4JI7 B;  1NS1 A;  2JS5 A;  5GTH Z;  4AI8 A;  2UUA O;  1LNQ A;  1B04 A;  4HNA B;  3K79 A;  4GLX A;  1K8A W;  1G4Y B;  4K35 A;  2P6J A;  3RGB A;  3OEH G;  2JRI A;  2JVD A;  1VQN V;  2XHB A;  1Z2G A;  3L73 H;  5KA5 A;  4MS2 A;  2W6I G;  2N04 A;  2EIN B;  1H2M A;  2A06 H;  5LP6 B;  3Q4H A;  1N8R W;  1SER A;  1EN5 A;  2QTS A;  3D3Q A;  3ABK B;  4B7K A;  1I08 A;  1VQ9 V;  1OJH A;  5A2Q N;  1KKC A;  3W7T A;  2KG7 B;  2ZCE A;  1J95 A;  4GX5 A;  1M1K W;  3AK3 A;  4DV3 B;  1JCH A;  2QEX V;  1I5Y A;  4YXW G;  4RUE A;  3AG2 B;  4J7Z A;  1VQ5 V;  4UVA A;  4KHP B;  1V54 C;  2ATK C;  3RYI A;  3U0Z A;  3ZED A;  3B40 A;  1TA8 A;  2F4V B;  1P7G A;  2Y0I A;  4DYL A;  1XDC A;  3L72 H;  4ZBM A;  4GX2 A;  3AK1 A;  5CA0 B;  2Q7E A;  2P22 C;  1AR4 A;  3OTO O;  5LGN A;  3JD1 A;  4IIJ B;  4FZ1 A;  4ICG A;  5F2V O;  1GN4 A;  3OR6 C;  3IC7 A;  1XNQ B;  3CWB H;  3IC9 A;  1R3J C;  3SJQ C;  1S5H C;  1E1Q G; 
#chains in the Genus database with same CATH homology
 4JI8 O;  1IBL O;  4GKJ O;  1NS1 A;  4DV7 O;  1FKA O;  1KUQ A;  3T1Y O;  2UXB O;  1YZB A;  2UUA O;  5IWA O;  2DJV A;  4LFC O;  1N36 O;  4LF7 O;  5LMU O;  1XMO O;  4JI5 O;  4A5U B;  4DR3 O;  4JI6 O;  4OPA A;  4B3S O;  1HR0 O;  1IBK O;  3T1H O;  2UXD O;  4DR7 O;  4B3T O;  4X66 O;  4LF5 O;  2DOS A;  3JAM N;  3O65 A;  4JI0 O;  1AIL A;  2N74 A;  4DV4 O;  5LMN O;  4DV1 O;  2ZKO A;  1HNZ O;  1IBM O;  2JRI A;  4JI2 O;  5FLX N;  4KHP O;  2VQF O;  4JI7 O;  4DV3 O;  2AGA A;  3J81 N;  4DV0 O;  4DR5 O;  1N34 O;  4JI1 O;  3F5T A;  1N33 O;  5BR8 O;  4LF8 O;  4JI4 O;  4LFB O;  2F4V O;  1G1X B;  2VQE O;  4JI3 O;  4DV2 O;  1HNW O;  4OX9 O;  2UXC O;  1F7Y A;  3M8A A;  4JYA O;  1DK1 A;  4DR1 O;  5BXZ A;  3J7A U;  4DV6 O;  4LFA O;  2LW7 A;  4X64 O;  3RT3 C;  1A32 A;  1FYJ A;  5BY1 A;  5A2Q N;  4B3R O;  4GKK O;  2ZM6 O;  2Z0A A;  1I94 O;  2HHH O;  3J80 N;  1AB3 A;  1X59 A;  4B3M O;  1D2D A;  2UUC O;  1J5E O;  1XMQ O;  5LL6 Y;  1XEQ A;  5H5N A;  2E5L O;  4YY3 O;  1N32 O;  3OTO O;  4NXM O;  4X65 O;  2UU9 O;  4LF9 O;  2UUB O;  4NXN O;  4X62 O;  4LF6 O;  4LF4 O;  5IT9 N;  4OPH A;  4AQY O;  1R1B A;  3R66 A;  4JV5 O;  4DUY O;  4DV5 O;  4YHH O;  4DR6 O;  3SDL A;  2FKX A;  1FJG O;  1R6T A;  1HNX O;  4DUZ O;  1XNR O;  4DR4 O;  4DR2 O;  4K0K O;  1XNQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...