1D2DA

Hamster eprs second repeated element. nmr, 5 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA SYNTHETASE
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
total genus 18
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1999-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1d2dA00
1A32A 4NXMO 4DV7O 1N32O 5LMUO 4OX9O 4JI8O 4B3RO 3T1HO 1XEQA 4DUZO 1AB3A 4DR7O 4A5UB 1F7YA 2DOSA 4DR1O 2UUCO 4LF4O 3R66A 1XNQO 1R1BA 5LL6Y 4LFCO 2ZKOA 1N36O 2UUAO 5H5NA 1NS1A 2VQFO 3J7AU 4DR2O 4JYAO 4YY3O 4DR6O 4JI0O 4JI3O 5BXZA 3F5TA 1R6TA 4DR3O 4LF5O 4JI1O 4DUYO 2HHHO 1X59A 4NXNO 4LF6O 4LFBO 1XMOO 2UUBO 4DR4O 2F4VO 4X64O 2UXBO 2VQEO 1DK1A 1HNZO 4B3SO 4LF8O 4GKJO 1G1XB 4DV3O 2UXDO 2N74A 1FKAO 2UU9O 1KUQA 3SDLA 3OTOO 4JI4O 1AILA 1IBLO 4X62O 2AGAA 4KHPO 4GKKO 2LW7A 4DV5O 4LF7O 4DV0O 5IWAO 3JAMN 5BY1A 1IBMO 4DV2O 4AQYO 5BR8O 4OPHA 4B3MO 4YHHO 1YZBA 4DR5O 4JI2O 1N34O 4JV5O 3O65A 1HNWO 5A2QN 1HNXO 3RT3C 1J5EO 1D2DA 3J80N 2ZM6O 3M8AA 4DV1O 2Z0AA 4JI5O 5FLXN 4OPAA 2E5LO 1IBKO 5IT9N 3J81N 1I94O 1XNRO 4LFAO 1N33O 4K0KO 4X65O 4JI7O 4DV6O 1HR0O 1FJGO 4JI6O 4LF9O 2FKXA 2UXCO 1FYJA 4B3TO 2JRIA 4X66O 4DV4O 2DJVA 3T1YO 5LMNO 1XMQO
chains in the Genus database with same CATH superfamily
3K59A 2DE0X 2WWWA 1H2KA 4N21A 4UB6Z 1E1RG 3SPJA 4LFBB 2HJDA 1Q3EA 5B5EZ 5LYJB 3WG7C 2BOBC 4YJ3A 1XOUA 1I08A 1NS1A 5JJNB 1V55B 3JARA 3N27A 5EK0A 2IM9A 5BXZA 2HKOA 4TQDA 1WA8B 3RYFB 5FL7G 2AHZA 4O4LB 2ETNA 4JI1B 4IYIA 3OR7C 4LF6B 2YI8A 1FAFA 4JZGA 4I4TA 2K9PA 3BRCA 4PDLA 1ZSPA 4LF8O 2QJ1A 2Q0AA 4GKJO 3CJHA 4E4EA 1Q8IA 1AP5A 1M56B 1QR8A 3ABKB 2ZR2A 2PZSA 1HNWB 2FTKA 4U3JA 3I55V 3B8NA 1URFA 1ZLZA 2OT5A 5IWAB 3H1LH 3B2EE 5EBLC 2OTJV 5H6RA 1GK9A 2BSKA 2WLLA 4H0LB 2F43G 3UM7A 4CS4A 1IZ3A 3APOA 2JJ1G 2RJZA 1Q82W 1EM1A 2IJKA 1SQXH 2ITCC 4OX9B 4G27B 1JVMA 3K58A 4UVBA 4ZBMA 1PNLA 3DTUB 1NTKH 3IC9A 5H6QA 3FYEB 5LXTA 2X6AA 5IJ9B 3JAKA 1K33A 4KL1A 4DR6B 3OAAG 1S5JA 5LP6C 3BA9A 3UQ8A 5CA1B 4CZZA 4DK1A 4J7KA 1QCEA 2W6JG 4LF5B 4PA9A 3S3XA 3RYCA 3F7YC 4DUZO 4EKWA 3K03A 3ZRSA 1NU1H 1O9HA 1QVFU 1NVPD 4MW3A 2YIBA 1GKFA 3LNMB 4AILC 1N36B 4XDJA 1ORQC 5EIBD 1HDJA 3MHSC 5EYPB 1NJIW 1XUQA 1L1FA 2HHHO 1RM1C 1Y76B 4LC1A 3DGEA 2Y4UA 1Z5WA 1H38A 3SR2C 1T5EA 1GM7A 2EILC 2RQ6A 3BPZA 4JF3A 4L87A 1NBMG 1HNZO 1IDSA 4DV3O 3CCEV 4LBEC 4DYLA 4UB8Z 3ASOB 1SQVH 1IBLO 2YEVA 4BIOA 1KD1W 4GKKO 2WLMA 4AI8A 3W7WA 1RSOA 2ZIOA 1IBMO 1Y74A 2Q68A 4FFBB 1N33B 4MVRA 4X65B 3M99B 3K9AA 4R50A 5LA6B 3VQVA 2BTOA 3JCUZ 2ZXWC 4LNUA 2DQ3A 1Q5OA 2C2AA 4EB6B 1BHAA 1KB9F 2ZM6O 2DYSB 1OZ0A 3BHPA 4JAVA 1B06A 4P2ZA 1YI2V 1XBLA 3JCZA 1YSCA 2PGGA 2V7QG 2VS0A 5D5QA 1VQ5V 4LP8A 3TXSA 1I94B 4DV6O 4PA7A 2CK3G 2X6BA 4DV4O 3JATB 3DXRB 4JI0B 4JYCA 4JI3B 4BAYA 3NR7A 5KA5A 4X20A 2P4VA 1IVSA 4O4JA 3R65A 5EZYB 3ZRWB 2OTLV 3TETA 1HWYA 1I5YA 1W0KG 1YVWA 1QBZA 4GUNA 3R66A 2AZ2A 2Q67A 4CS3A 1CXZB 1CPYA 1H8HG 5KMGB 5GW7A 2CTQA 1WP8A 4O2BA 1ZL8B 3AG1C 4QPJA 1OCRC 2ZE7A 1F4MA 2P90A 4FFKA 1BMFG 2PI5A 2A79B 3I56V 2RCVA 3SPIA 1VQ9V 4XDLA 2F4VO 1H2LA 5DN6G 1VQ8V 3CC7V 3LSSA 3LUTB 4NTYA 4O4HB 2UXDO 3HKBA 4JI4O 3HKEA 4LWSB 1H8EG 2GUZB 1K9MW 3WU2Z 3K5LA 4JI5B 2HEPA 4IIJA 4TV8A 1RPOA 4G2KA 5BR8O 5KHKA 1R6KA 5F2VO 3FAVA 1I0HA 4FLUA 1Z2GA 3C90A 3N2KB 1U97A 3RYIB 2MK3A 2P22C 1QLEC 4TUYA 3JASB 2M7WA 3U0ZA 3P30A 3ZRXA 4X9QA 1GN3A 1YCIA 5FLXN 3D36A 3OFNG 4X88A 3WG7B 2E75B 2LGWA 2PYLA 4LFAB 1FJGO 2YDEA 5KAIZ 1NTMH 4BW9A 2PUSA 3ZHSA 1Q43A 3ABKC 5JCOC 3H01A 3T2MA 1SQPH 2WLJA 3ZX6A 2UXNA 2HP8A 3WB2A 5LMUB 3IFXA 1DF4A 3T1HB 4F6EA 1NQTA 5LL6Y 1M9NA 1AJQA 1BS3A 3EVKA 1MOFA 2EZPA 2PTMA 3FB7C 1FXKC 4I9WA 3MD0A 4Q20A 4DV5B 1PV0A 1GN2A 3ABLB 1YJ9V 3L73H 1K34A 1SZTA 2AHYA 3UCSC 1JCHA 1TVKB 1VQOV 1GN6A 1P84F 1H2NA 4B3SB 3ZIAG 2N05A 2QM8A 2R9RB 4UFZA 2NLJC 1F23A 1S77D 1MMMA 5C8YB 2JIZG 1IXBA 4D7TA 2XTAA 2ARHA 2IU0A 2VRZA 3OMNB 5K1XA 5KX5B 1EN6A 1YJWV 3RVZA 2O57A 3E22A 5A2QN 4NB5A 2QSAA 2YIDA 2YXYA 4W4KA 1N4CA 1PNMA 3H9VA 1K8AW 3LDCA 5IE9A 3M8AA 2EJ7A 4UCSA 2LFSA 4DV1B 4TV9A 1B04A 3JALA 2WLIA 1DLBA 3H1HH 1SKVA 1AR4A 2WPDG 2ZD9A 1R3IC 4BIUA 4IT5A 2VQFB 4K35A 3WB0A 3OMAB 3H1KH 1QNMA 3ABMC 5B1BC 3ASOC 4MVOA 3OT7A 3RWRD 3T1YO 1NH2D 1LR1A 4I9QA 4B3RO 4DXWA 1XEQA 3AEIA 4DR7O 3CX5F 1H2SB 2EILB 4LF4O 5J2UA 1XNQO 4WBNB 2UUAB 1L8DA 3TCUA 2LO1A 3CWBH 1CP9A 4JYAO 4JTAB 3RW0A 4FPPA 2B9ZA 1R6TA 3RBZA 2BTQB 1TGOA 1B6QA 3G6BA 1R73A 3OGCC 1F51A 4DRXB 3E8BA 4B3MB 4WF9V 2FB5A 4J9ZB 2JJ2G 1K92A 4Z1MG 2FYUH 5FNVB 2UU9O 2QTOA 4GX2A 3SDLA 1AILA 2CGOA 2XAHA 1HNXB 4EEQA 4PJ0Z 1B3QA 1MSWD 2W6IG 4LF7O 2ZE8A 1SA0B 4JTDB 1IX9A 1VF7A 5IYZB 5KLVH 1IBKB 3KCYA 4AQYB 3PJSK 3P32A 4I55B 1M93A 1HR0B 4JI2O 4R7CA 4MSWC 5L3FA 3FFQA 2QM4A 4UVCA 3DC5A 5IJ0A 4FZ1A 4P9OA 1XHXA 2VWKA 4WFEA 4UV8A 1OCCC 4YIPA 1AROP 3JD0A 4GX0A 5J2TA 5B1OA 1PM9A 2JGUA 4ZOLA 1JFFB 3ZCCA 4K0KO 4U7NA 5FPRA 1D5NA 4JI6O 4LF9O 4PDMA 1K97A 2XASA 4X66B 2DJVA 1ZUQA 5LMNO 3SJQC 1PL4A 1EFRG 1P4RA 1DGSA 1GAXA 1J95A 1WPXA 3FD9A 1ZAUA 1OCOC 4YJ2B 3AG2C 1ROPA 4K3AA 4XDKA 4F6RA 4UV9A 4PDRA 4LF8B 3IC7A 3JD2A 4KFMA 3ETEA 3OTFA 4TT3G 1MABG 2RMKB 3CB2A 3ETQA 4NXNO 4IGGA 1KMIZ 3BEHA 3JAWA 4DR4O 4X64O 3OEHG 2JVDA 1VQPV 2VQEB 3DC6A 4HNAB 5H2FZ 1TUBA 1QLEB 2N74A 1KUQA 4JGSA 3A0RA 4FLTA 1SQFA 3L72H 3H1IH 1VQLV 5EC1C 3D3QA 3OE7G 4DV0O 2YXHA 2JGDB 2IH1C 4IIJB 4TV8B 4QE9A 1GM9A 1X4TA 2Q7EA 1KYOF 4PA6A 1N34O 3HKDB 3K0DA 2ODMA 1QVGU 1FXHA 4CH5A 4PI0A 2K1EA 3UT5B 1TAEA 3CP1A 5L3BA 1KQSU 3ABLC 4DK0A 4DUZB 1K3EA 2JEUA 2KG7A 4X1KB 4PHZA 1D5AA 2V1DA 2A0LA 1FXVA 2EBOA 1EBOA 1WJZA 3QTCA 2DYRB 3T4ZA 2W0FC 4LCUC 3AK1A 1FXKB 3UO3A 3CRAA 1SC5B 4HAMA 4X1YB 5LOVA 4JI8O 4AHCA 3E89A 2ZDIA 4MTXA 1KP2A 3M7MX 1U96A 1GH6A 2UUCB 4LFCO 1HNZB 2WLKA 2OIEA 5C93A 5LP6A 3G4SV 1UJWB 2YSUB 3F5TA 1L0LH 2H3OA 3VQYA 1IBLB 5ITZA 4RO2A 1PD3A 2QA4V 4JI1O 3Q4HA 1K7DA 2ZCEA 3F7VC 4EFBA 4GKKB 4LF6O 2ZQMA 4FIPC 3OGIB 5E79Z 1R3KC 1SQGA 3SYOA 4MTGA 1M57C 1M90W 3CMAV 1YJNV 3RVYA 4FLWA 4PV1B 5IWAO 3JAMN 1PKXA 5BY1A 1W0JG 3WFVA 1YZBA 4DV6B 4YHHB 4CH6A 2B1GA 1MZEA 2DWEC 1VQKV 1OJHA 2F93B 1XL4A 3ABMB 5B1BB 3E22B 2QKAA 4JV5B 5HFMA 5GONA 4E2LA 1M4UA 2QM7A 2YUAA 1FFXA 1YEWA 2FMLA 2QE7G 5EBWC 4DW0A 4CH4A 1XNRB 1WN7A 4J42A 3UO2A 1WNSA 2OWOA 5JH7A 3OUFA 2RN9A 3C3TA 5KUKA 3MHHC 3ZJZA 4LH7A 3U10A 4NXMO 3TK1A 4DV7B 1VEWA 5KHIA 2CE4A 2CDYA 2F4VB 4DR1B 2GTSA 1N36O 1K4DC 3K9SA 4DW1A 4DR2O 4ZI7B 4YY3O 1H2GA 1PL0A 4JI4B 5JJJB 5B3SC 2P67A 1BQZA 3ZS8C 5BMVB 4RQFA 1VQMV 4DUYO 3RGBA 4DR3B 2CGNA 4I0XB 4I50B 2UUBO 2LP7A 2UXBO 1WP7A 1DK1A 1IXMA 1BQ0A 4BIZA 3K5OA 3ZHTA 4CBCA 3B09A 1VF6A 2CH7B 4CH3A 2E3CA 1AI4A 2N04A 1MSDA 4HYOA 1OCCB 1S5LZ 5LHGA 2Y48A 2KQXA 4O2AA 3B4SA 5JVDA 4I5SA 4J80A 4QPKA 1GRJA 5EBMC 3CCLV 4DR5O 5KAFZ 3T1CA 4H37A 3BFRA 3A8TA 1YHQV 2PF4E 3STLC 3HKCB 3K5NA 2IBZH 2H94A 4ZIBA 3VOUA 3QO8A 1AR5A 1OCOB 5KHJA 2CAZC 4RQEA 3AG2B 5IT9N 1I94O 5K1PA 2NNUA 3ETDA 3FX7A 2G38A 1YDXA 3LSQA 1AI5A 2EJRA 3CHXA 3JYCA 5GTIZ 2Y69C 3RYHB 4J7ZA 1THZA 1WA8A 2P6JA 2M6YA 3RYFA 4O4LA 2B5UA 3CS5A 3KG2A 1N32B 1JJOA 1W2BU 2F66C 1OCZC 1W59A 3J7AU 2ADQB 5E1AC 3E83A 3HB3B 4IHJB 4G28B 3TGUH 2ZINA 1K5QA 4PA4A 3L71H 1AP6A 5LGUA 3CEIA 3G80A 1S72V 4YJ3B 3JARB 4PA3A 3RFRA 1JPXA 2DYRC 3K3WA 3OTOO 5DECA 2LW1A 4TSFG 1GN4A 3FB6C 3FB8C 5JQGA 3CRMA 1GO3F 3NXSA 2AGAA 5J9PC 4KHPO 2LJ2A 3STZC 2A9HA 3W7TA 2DMXA 4IL6Z 4WFAV 4J41A 5IDJA 2E74B 4I4TB 4FM2A 5IJ9A 1VQ6V 3UKMA 3CJHB 4QGPA 4WFHA 4OGQB 2JS3A 2GV9A 3K0GA 5CA1A 3RT3C 4FLVA 1J5EO 1XILA 3P3PA 4WCEV 2HVJC 5D5PA 4U3JB 4J9YB 2L6LA 4QNHB 3LDDA 1PP9H 2A06H 3SJAC 2X7RB 4LF4B 2FL4A 4LFAO 3X2QC 1XNQB 5CN0A 3CE2A 2BSKB 2WLLB 2JRIA 4JYAB 4CC5A 2UXCB 5LHIA 1WAZA 2JS5A 3ZRVA 1FPOA 5CA0A 2YXLA 1N0NA 1Q6UA 1XMQO 2WSSG 1Y76A 1VQ4V 5KHHA 2F23A 3D8CA 5LMUO 1Y67A 4R8CA 4LH6A 1TUEB 3T1HO 3A0HZ 4UVAA 3ZMUA 3EHBB 4A5UB 2V4DA 2KKWA 4ZHQA 1Q6IA 4JAAA 5LXTB 1EN4A 4NKGB 1ZX3A 3JAKB 3JD1A 1M57B 1Q81W 1QLNA 3I5DA 4PD4F 2A7WA 4JYBA 3IJ4A 3SJCC 4KXRA 4U3FH 4LF7B 2GDSA 3K04A 3RYCB 1XMOO 4MTFA 3SGIA 4FFBA 3LNNA 4JAUA 4B3SO 2WLNA 3G6EV 5LA6A 3D3IA 4D6TH 4EB6A 2QWPB 1AVMA 2CTPA 4WFGA 2RNBA 2LW7A 1E79G 1I7FA 4TQFA 1RP3B 3K08A 4B7EA 1AR1B 4DV2O 3PN1A 1NR1A 4XBFA 2YS8A 4MW8A 3CC2V 2Q73A 3CCQV 1WB7A 4GX1A 4W4LA 2ZIMA 1WLEA 1YXBA 5TISZ 4JI6B 4LF9B 1JX9A 3JATA 2X6CA 5EZYA 2KSDA 3ZRWA 5IY5B 3MAQA 5LMNB 2YEVB 2QKCA 3L74H 1NZ6A 2EINC 4DV1O 4Z2WA 2XAGA 1WPBA 5AG2A 1FFXB 3OR6C 1KP3A 1RSOB 5IYCO 4ICGA 1Y74B 2F95B 2E5LB 1BZKA 1YTFB 5KMGA 2D3OW 5JH7B 4B3TO 2ZE6A 1ZL8A 4RAIA 5B3SB 4LNUB 3ZMTA 4MTOA 1NT2B 2R9IA 2WA4A 3AG3C 3QF7A 4NXNB 4F4LA 1Z5VA 4KP4A 1LUWA 3ZN0A 4DR4B 3QO7A 4X64B 3BY6A 3U11A 2Q7HA 2UUAO 2EIKC 4O4HA 4LWSA 3BCCH 2X0LA 3SYCA 4X20B 5HFLA 2IU3A 2OYQA 4O4JB 3MDSA 4QIWF 1VQNV 2QWOB 4DV0B 5IYBO 3N2GA 4DO2A 4GZRB 3G67A 4PI2A 3A0BZ 3BVOA 2AW9A 2HFEC 3N2KA 3RYIA 3TXQA 4CC6A 1N34B 4GKJB 2EIJC 3JASA 2P06A 2YC0A 4P30A 4O2BB 1OHHG 1YIJV 1ZWIC 4GX5A 4X62O 3VBBA 3SPHA 1Y6XA 1M5IA 4AQYO 3E2EA 3JSNA 4RWUA 2Z5UA 4O2AB 5JVDB 2EX3A 1WB8A 2XT9A 4HBNA 3HKBB 2Y69B 3HKEB 3GB7C 1D2DA 3T4DA 4JTCB 3HR0A 1UPGA 1MNGA 3VQWA 2Z0AA 4FK5C 2JK5C 4K8XA 4JI8B 2NR5A 3GWOA 2EIMB 1SESA 1UFIA 1OCZB 4MS2A 1IURA 3FAVB 4JI7O 4LFCB 5FPOA 4ASUG 1SF9A 1US6A 4X66O 4TUYB 2MW2B 3APQA 3L75H 2JEXA 4X1IA 1BHBA 4JPRA 3CYOA 1XDCA 2QGNA 1TVKA 4JASA 1Q6HA 2ZKOA 4K8ZA 3ML0A 5H5NA 3W7XA 2HVKC 4I7ZB 3ZEDA 3SYQA 4RUFA 2Q8VA 3K79A 2Z3YA 3GWKC 5A9GA 2HJFC 1MA1A 5LBQA 4FLYA 1MG1A 5CBHA 5C8YA 5JJEB 2HHHB 2WAMA 4LFBO 3CCJV 4FLXA 1SETA 2XUMA 2YI9A 2GTAA 3IAYA 1NVPB 2QWNB 2VQEO 5KX5A 3QG5A 1JA8A 3K57A 1NI8A 3FKSG 2IH3C 1GMGA 1R3LC 4DV3B 5JQGB 1QR9A 2OCCB 4Q6GA 1FS0G 2GHYA 2LQTA 1IBMB 5B66Z 2ZDIC 2AXTZ 1EN5A 3X2QB 1JR9A 5GTHZ 3ASNC 5CB4A 3SYPA 5IYDO 1Q90D 1N0JA 1HNWO 5B1AB 3ABTA 3ABUA 2ZM6B 3K5MA 4NXMB 3E8HA 3OW2U 3ZN1A 2ADPA 1BT8A 3OMIB 4MVUA 1HP8A 5L3DA 2Q4PA 4HZ3A 3THOA 4WBNA 2IJJA 2R9AA 4B08A 4DR2B 2R70A 2Q0OC 4YY3B 1L0NH 2XAFA 4DV4B 2IW5A 3ZHRA 2XNDG 2BTQA 4MVSA 5CA0B 2QWRB 3B40A 4DUYB 4OX9O 4IYHA 5LHHA 4DRXA 4TV9B 4UCVA 1XI1A 1SQBH 2UUBB 3JALB 1PPJH 2BE3A 2WLIB 5KUMA 2UUCO 4ZHQB 4UUJC 2UXBB 1R1BA 4X89A 3CXHF 1S0VA 5FNVA 4DR6O 4GYCB 3SPGA 1AJPA 2NN4A 3ZMZA 4LF5O 5IY5C 5CMUA 3CCUV 4MVQA 2CTWA 1SA0A 1VP7A 5IYZA 3CC4V 1G8MA 4GLXA 1BL8A 2CUGA 4NTXA 2OCHA 5J2UB 1PNKA 4I55A 4X8AA 1ZTEA 3E86A 4DR5B 1SZXA 3CD6V 2QDOA 5H9CA 4L8JA 3OM3B 2B1IA 2UXDB 4FM0A 1H2MA 3JD4A 2DQ0A 2EINB 3CCRV 3ZBHA 4O4IA 2XOKG 4J11A 4TWKA 5L3CA 2BOCC 4UCRA 5BR8B 1JFFA 5DEDA 4YHHO 3KKYA 2ZNIA 3ZHVA 4JV5O 3KZIZ 2BCCH 1S76D 1DF5A 2EULA 2R72A 1K73W 2P4KA 4MVMA 2HLDG 1BE3H 3AG3B 2DN9A 3SYAA 4RUEA 3HPLC 4OPAA 4YJ2A 4B7KA 1K5SA 4BW5A 1HW7A 5L3GA 1V9PA 1XNRO 3F5WC 1N33O 4X65O 2YIAA 4Z1VA 2EIKB 1FJGB 4FZ0A 1VF6C 5IJ0B 1ENVA 5CA3A 3CCMV 1JJ2U 3FB5C 1EZJA 4DV7O 2ILMA 3ETGA 5J2TB 5LGNA 4DR1O 3CSXA 2PI4A 4ZOLB 5LYJA 5B1NA 3G71V 1JQ0A 4HNAA 4MVZA 2EIJB 3BAAA 2ZNJA 3OTOB 4JI0O 4YXWG 4JI3O 3AG4C 1S5HC 2YICA 2WLHA 2E76B 4DR3O 4KHPB 1X59A 2JGDA 3N2GB 3AK2A 4D7SA 2EIMC 3S3WA 2QEXV 1V54B 4F6RB 1G1XB 3HKDA 1V55C 2ZT9B 1XL6A 1Y4MA 5JCOA 3JSLA 1RPRA 4P9PA 4WFFA 1J5EB 3UT5A 2CTRA 3QVNA 4NYKA 3OD4A 1FD9A 2EZOA 3AK3A 4X1KA 3QNEA 3D36C 3JAWB 2A3QA 4GCZA 3GVMA 4JZ2A 2HG5C 3E8GA 4MT8A 1TUBB 1M56C 3O65A 1VIBA 4ZKIA 1FXKA 2H8PC 3E35A 3J80N 4UCTA 4X1YA 1XMQB 4FMTA 4JI5O 4QJFB 1M1KW 1K4CC 3CCVV 1JMKC 1R3JC 2QKSA 2QTSA 2IJHA 1KU9A 1MZFA 5EIBC 1FYJA 1RFYA 1G4YB 5CBGA 1I5XA 3B77A 3T1YB 1FKAO 4X1IB 1N32O 5EC2C 2OCCC 3E8FA 2PY5A 4YIOA 4B3RB 1XMOB 2LGQA 4J10A 2DOSA 1F7YA 5L3EA 4DR7B 2KG7B 3AG7A 1E1QG 5KA6A 2XAQA 2ZE5A 2LFRA 4NR1A 2IJIA 5LGTA 4FJCC 5EYPA 1EZVH 5JWPA 4C7UA 3WB1A 5B1AC 1YF2A 1NH2B 4NVPA 1QQCA 5LOVB 1Y66A 4QE7A 4GT1A 4DV2B 1AI7A 3C3SA 3A2FA 4KUMA 4PDVA 4UXNA 3ASNB 1DTOA 1FFTB 1TA8A 4EFEA 2W0XA 4BWAA 1CEZA 5LP6B 4BR6A 1BSMA 2UU9B 3CRCA 1AJNA 2GSMB 3ZMVA 4PELA 3OUSA 5ITZB 1AI6A 1SQQH 3CCSV 3ZHUA 4FLZA 4DV5O 3Q4HB 4H13B 1KKCA 2DWDC 4OPHA 1SRYA 2XAJA 1YITV 1F4NA 5BZBA 1XQ8A 5CB4B 2VWJA 1G6UA 3KCXA 4JI2B 2Q7GA 3EXAA 4B3TB 2D2CB 4N23A 2HR3A 1JOYA 1RM1B 4J7JA 2QR4A 4U7OA 1NKDA 3QO5A 1S3JA 3CRRA 3BA8A 1R6NA 4K0KB 4ZI7A 3ZHQA 2FKXA 2UXCO 3VQXA 3CMEV 3OEEG 1LNQA 2QWQB 3DXRA 2Y4TA 5BMVA 1QU7A 2JDIG 5GONB 1A32A 2DYSC 4FM1A 4I0XA 4OXSA 4I50A 1NR7A 3SPCA 3P3NA 2ITDC 1AB3A 2ATKC 1XHZA 3LSUA 1BGYH 1GM8A 2XHBA 3ZMSA 2VQFO 2YIBD 2KB1A 2PYJA 3EFFK 1SERA 3B8MA 3W7SA 2ZXWB 2CH7A 1KECA 1P7BA 3W7UA 1NTZH 3ICXA 1VQ7V 3JD3A 4X62B 2Q69A 1BCCH 1Q86W 2UXXA 4NTWA 2WA3A 1P7GA 1OV9A 4FVMA 1VARA 2Q9LA 5CBFA 1KC8W 1COWG 3BABA 2GBOA 2OIGA 4H44B 4JYYA 1O9GA 3L70H 1GTOA 3FYIB 2Y0IA 2P5OA 3HKCA 2GUZA 5DM6V 4H33A 1VMGA 2P7TC 2Y0PA 3CPWU 1Q7YW 4O4IB 2L35A 4UCOA 3O9OA 3K06A 4B3MO 3L9DA 2Q6AA 4R6ZA 1XREA 1P49A 2AZ0A 4LR3A 2Q5ZA 1SS3A 4ABMA 4JI7B 1YTFD 3CRQA 3RN4A 3AG1B 3RYHA 3LDEA 1OCRB 1HNXO 2DW4A 2RDCA 1QHTA 1KKDA 3IGAC 2ZR3A 1KBHA 5KHGA 2E5LO 1IBKO 3J81N 3TJTA 1LUVA 1HR0O 3DSQA 4CS2A 1V54C 4TOIA 4WFBV 3H1JH 3CXCU 4IHJA 1VF5B 3SJBC 3AG4B 1N8RW 2F1MA 4UCUA
chains in the Genus database with same CATH topology
1A32A 4NXMO 4DV7O 1N32O 5LMUO 4OX9O 4JI8O 4B3RO 3T1HO 1XEQA 4DUZO 1AB3A 4DR7O 4A5UB 1F7YA 2DOSA 4DR1O 2UUCO 4LF4O 3R66A 1XNQO 1R1BA 5LL6Y 4LFCO 2ZKOA 1N36O 2UUAO 5H5NA 1NS1A 2VQFO 3J7AU 4DR2O 4JYAO 4YY3O 4DR6O 4JI0O 4JI3O 5BXZA 3F5TA 1R6TA 4DR3O 4LF5O 4JI1O 4DUYO 2HHHO 1X59A 4NXNO 4LF6O 4LFBO 1XMOO 2UUBO 4DR4O 2F4VO 4X64O 2UXBO 2VQEO 1DK1A 1HNZO 4B3SO 4LF8O 4GKJO 1G1XB 4DV3O 2UXDO 2N74A 1FKAO 2UU9O 1KUQA 3SDLA 3OTOO 4JI4O 1AILA 1IBLO 4X62O 2AGAA 4KHPO 4GKKO 2LW7A 4DV5O 4LF7O 4DV0O 5IWAO 3JAMN 5BY1A 1IBMO 4DV2O 4AQYO 5BR8O 4OPHA 4B3MO 4YHHO 1YZBA 4DR5O 4JI2O 1N34O 4JV5O 3O65A 1HNWO 5A2QN 1HNXO 3RT3C 1J5EO 1D2DA 3J80N 2ZM6O 3M8AA 4DV1O 2Z0AA 4JI5O 5FLXN 4OPAA 2E5LO 1IBKO 5IT9N 3J81N 1I94O 1XNRO 4LFAO 1N33O 4K0KO 4X65O 4JI7O 4DV6O 1HR0O 1FJGO 4JI6O 4LF9O 2FKXA 2UXCO 1FYJA 4B3TO 2JRIA 4X66O 4DV4O 2DJVA 3T1YO 5LMNO 1XMQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A32 A;  4NXM O;  4DV7 O;  1N32 O;  5LMU O;  4OX9 O;  4JI8 O;  4B3R O;  3T1H O;  1XEQ A;  4DUZ O;  1AB3 A;  4DR7 O;  4A5U B;  1F7Y A;  2DOS A;  4DR1 O;  2UUC O;  4LF4 O;  3R66 A;  1XNQ O;  1R1B A;  5LL6 Y;  4LFC O;  2ZKO A;  1N36 O;  2UUA O;  5H5N A;  1NS1 A;  2VQF O;  3J7A U;  4DR2 O;  4JYA O;  4YY3 O;  4DR6 O;  4JI0 O;  4JI3 O;  5BXZ A;  3F5T A;  1R6T A;  4DR3 O;  4LF5 O;  4JI1 O;  4DUY O;  2HHH O;  1X59 A;  4NXN O;  4LF6 O;  4LFB O;  1XMO O;  2UUB O;  4DR4 O;  2F4V O;  4X64 O;  2UXB O;  2VQE O;  1DK1 A;  1HNZ O;  4B3S O;  4LF8 O;  4GKJ O;  1G1X B;  4DV3 O;  2UXD O;  2N74 A;  1FKA O;  2UU9 O;  1KUQ A;  3SDL A;  3OTO O;  4JI4 O;  1AIL A;  1IBL O;  4X62 O;  2AGA A;  4KHP O;  4GKK O;  2LW7 A;  4DV5 O;  4LF7 O;  4DV0 O;  5IWA O;  3JAM N;  5BY1 A;  1IBM O;  4DV2 O;  4AQY O;  5BR8 O;  4OPH A;  4B3M O;  4YHH O;  1YZB A;  4DR5 O;  4JI2 O;  1N34 O;  4JV5 O;  3O65 A;  1HNW O;  5A2Q N;  1HNX O;  3RT3 C;  1J5E O;  1D2D A;  3J80 N;  2ZM6 O;  3M8A A;  4DV1 O;  2Z0A A;  4JI5 O;  5FLX N;  4OPA A;  2E5L O;  1IBK O;  5IT9 N;  3J81 N;  1I94 O;  1XNR O;  4LFA O;  1N33 O;  4K0K O;  4X65 O;  4JI7 O;  4DV6 O;  1HR0 O;  1FJG O;  4JI6 O;  4LF9 O;  2FKX A;  2UXC O;  1FYJ A;  4B3T O;  2JRI A;  4X66 O;  4DV4 O;  2DJV A;  3T1Y O;  5LMN O;  1XMQ O; 
#chains in the Genus database with same CATH topology
 3K59 A;  2DE0 X;  2WWW A;  1H2K A;  4N21 A;  4UB6 Z;  1E1R G;  3SPJ A;  4LFB B;  2HJD A;  1Q3E A;  5B5E Z;  5LYJ B;  3WG7 C;  2BOB C;  4YJ3 A;  1XOU A;  1I08 A;  1NS1 A;  5JJN B;  1V55 B;  3JAR A;  3N27 A;  5EK0 A;  2IM9 A;  5BXZ A;  2HKO A;  4TQD A;  1WA8 B;  3RYF B;  5FL7 G;  2AHZ A;  4O4L B;  2ETN A;  4JI1 B;  4IYI A;  3OR7 C;  4LF6 B;  2YI8 A;  1FAF A;  4JZG A;  4I4T A;  2K9P A;  3BRC A;  4PDL A;  1ZSP A;  4LF8 O;  2QJ1 A;  2Q0A A;  4GKJ O;  3CJH A;  4E4E A;  1Q8I A;  1AP5 A;  1M56 B;  1QR8 A;  3ABK B;  2ZR2 A;  2PZS A;  1HNW B;  2FTK A;  4U3J A;  3I55 V;  3B8N A;  1URF A;  1ZLZ A;  2OT5 A;  5IWA B;  3H1L H;  3B2E E;  5EBL C;  2OTJ V;  5H6R A;  1GK9 A;  2BSK A;  2WLL A;  4H0L B;  2F43 G;  3UM7 A;  4CS4 A;  1IZ3 A;  3APO A;  2JJ1 G;  2RJZ A;  1Q82 W;  1EM1 A;  2IJK A;  1SQX H;  2ITC C;  4OX9 B;  4G27 B;  1JVM A;  3K58 A;  4UVB A;  4ZBM A;  1PNL A;  3DTU B;  1NTK H;  3IC9 A;  5H6Q A;  3FYE B;  5LXT A;  2X6A A;  5IJ9 B;  3JAK A;  1K33 A;  4KL1 A;  4DR6 B;  3OAA G;  1S5J A;  5LP6 C;  3BA9 A;  3UQ8 A;  5CA1 B;  4CZZ A;  4DK1 A;  4J7K A;  1QCE A;  2W6J G;  4LF5 B;  4PA9 A;  3S3X A;  3RYC A;  3F7Y C;  4DUZ O;  4EKW A;  3K03 A;  3ZRS A;  1NU1 H;  1O9H A;  1QVF U;  1NVP D;  4MW3 A;  2YIB A;  1GKF A;  3LNM B;  4AIL C;  1N36 B;  4XDJ A;  1ORQ C;  5EIB D;  1HDJ A;  3MHS C;  5EYP B;  1NJI W;  1XUQ A;  1L1F A;  2HHH O;  1RM1 C;  1Y76 B;  4LC1 A;  3DGE A;  2Y4U A;  1Z5W A;  1H38 A;  3SR2 C;  1T5E A;  1GM7 A;  2EIL C;  2RQ6 A;  3BPZ A;  4JF3 A;  4L87 A;  1NBM G;  1HNZ O;  1IDS A;  4DV3 O;  3CCE V;  4LBE C;  4DYL A;  4UB8 Z;  3ASO B;  1SQV H;  1IBL O;  2YEV A;  4BIO A;  1KD1 W;  4GKK O;  2WLM A;  4AI8 A;  3W7W A;  1RSO A;  2ZIO A;  1IBM O;  1Y74 A;  2Q68 A;  4FFB B;  1N33 B;  4MVR A;  4X65 B;  3M99 B;  3K9A A;  4R50 A;  5LA6 B;  3VQV A;  2BTO A;  3JCU Z;  2ZXW C;  4LNU A;  2DQ3 A;  1Q5O A;  2C2A A;  4EB6 B;  1BHA A;  1KB9 F;  2ZM6 O;  2DYS B;  1OZ0 A;  3BHP A;  4JAV A;  1B06 A;  4P2Z A;  1YI2 V;  1XBL A;  3JCZ A;  1YSC A;  2PGG A;  2V7Q G;  2VS0 A;  5D5Q A;  1VQ5 V;  4LP8 A;  3TXS A;  1I94 B;  4DV6 O;  4PA7 A;  2CK3 G;  2X6B A;  4DV4 O;  3JAT B;  3DXR B;  4JI0 B;  4JYC A;  4JI3 B;  4BAY A;  3NR7 A;  5KA5 A;  4X20 A;  2P4V A;  1IVS A;  4O4J A;  3R65 A;  5EZY B;  3ZRW B;  2OTL V;  3TET A;  1HWY A;  1I5Y A;  1W0K G;  1YVW A;  1QBZ A;  4GUN A;  3R66 A;  2AZ2 A;  2Q67 A;  4CS3 A;  1CXZ B;  1CPY A;  1H8H G;  5KMG B;  5GW7 A;  2CTQ A;  1WP8 A;  4O2B A;  1ZL8 B;  3AG1 C;  4QPJ A;  1OCR C;  2ZE7 A;  1F4M A;  2P90 A;  4FFK A;  1BMF G;  2PI5 A;  2A79 B;  3I56 V;  2RCV A;  3SPI A;  1VQ9 V;  4XDL A;  2F4V O;  1H2L A;  5DN6 G;  1VQ8 V;  3CC7 V;  3LSS A;  3LUT B;  4NTY A;  4O4H B;  2UXD O;  3HKB A;  4JI4 O;  3HKE A;  4LWS B;  1H8E G;  2GUZ B;  1K9M W;  3WU2 Z;  3K5L A;  4JI5 B;  2HEP A;  4IIJ A;  4TV8 A;  1RPO A;  4G2K A;  5BR8 O;  5KHK A;  1R6K A;  5F2V O;  3FAV A;  1I0H A;  4FLU A;  1Z2G A;  3C90 A;  3N2K B;  1U97 A;  3RYI B;  2MK3 A;  2P22 C;  1QLE C;  4TUY A;  3JAS B;  2M7W A;  3U0Z A;  3P30 A;  3ZRX A;  4X9Q A;  1GN3 A;  1YCI A;  5FLX N;  3D36 A;  3OFN G;  4X88 A;  3WG7 B;  2E75 B;  2LGW A;  2PYL A;  4LFA B;  1FJG O;  2YDE A;  5KAI Z;  1NTM H;  4BW9 A;  2PUS A;  3ZHS A;  1Q43 A;  3ABK C;  5JCO C;  3H01 A;  3T2M A;  1SQP H;  2WLJ A;  3ZX6 A;  2UXN A;  2HP8 A;  3WB2 A;  5LMU B;  3IFX A;  1DF4 A;  3T1H B;  4F6E A;  1NQT A;  5LL6 Y;  1M9N A;  1AJQ A;  1BS3 A;  3EVK A;  1MOF A;  2EZP A;  2PTM A;  3FB7 C;  1FXK C;  4I9W A;  3MD0 A;  4Q20 A;  4DV5 B;  1PV0 A;  1GN2 A;  3ABL B;  1YJ9 V;  3L73 H;  1K34 A;  1SZT A;  2AHY A;  3UCS C;  1JCH A;  1TVK B;  1VQO V;  1GN6 A;  1P84 F;  1H2N A;  4B3S B;  3ZIA G;  2N05 A;  2QM8 A;  2R9R B;  4UFZ A;  2NLJ C;  1F23 A;  1S77 D;  1MMM A;  5C8Y B;  2JIZ G;  1IXB A;  4D7T A;  2XTA A;  2ARH A;  2IU0 A;  2VRZ A;  3OMN B;  5K1X A;  5KX5 B;  1EN6 A;  1YJW V;  3RVZ A;  2O57 A;  3E22 A;  5A2Q N;  4NB5 A;  2QSA A;  2YID A;  2YXY A;  4W4K A;  1N4C A;  1PNM A;  3H9V A;  1K8A W;  3LDC A;  5IE9 A;  3M8A A;  2EJ7 A;  4UCS A;  2LFS A;  4DV1 B;  4TV9 A;  1B04 A;  3JAL A;  2WLI A;  1DLB A;  3H1H H;  1SKV A;  1AR4 A;  2WPD G;  2ZD9 A;  1R3I C;  4BIU A;  4IT5 A;  2VQF B;  4K35 A;  3WB0 A;  3OMA B;  3H1K H;  1QNM A;  3ABM C;  5B1B C;  3ASO C;  4MVO A;  3OT7 A;  3RWR D;  3T1Y O;  1NH2 D;  1LR1 A;  4I9Q A;  4B3R O;  4DXW A;  1XEQ A;  3AEI A;  4DR7 O;  3CX5 F;  1H2S B;  2EIL B;  4LF4 O;  5J2U A;  1XNQ O;  4WBN B;  2UUA B;  1L8D A;  3TCU A;  2LO1 A;  3CWB H;  1CP9 A;  4JYA O;  4JTA B;  3RW0 A;  4FPP A;  2B9Z A;  1R6T A;  3RBZ A;  2BTQ B;  1TGO A;  1B6Q A;  3G6B A;  1R73 A;  3OGC C;  1F51 A;  4DRX B;  3E8B A;  4B3M B;  4WF9 V;  2FB5 A;  4J9Z B;  2JJ2 G;  1K92 A;  4Z1M G;  2FYU H;  5FNV B;  2UU9 O;  2QTO A;  4GX2 A;  3SDL A;  1AIL A;  2CGO A;  2XAH A;  1HNX B;  4EEQ A;  4PJ0 Z;  1B3Q A;  1MSW D;  2W6I G;  4LF7 O;  2ZE8 A;  1SA0 B;  4JTD B;  1IX9 A;  1VF7 A;  5IYZ B;  5KLV H;  1IBK B;  3KCY A;  4AQY B;  3PJS K;  3P32 A;  4I55 B;  1M93 A;  1HR0 B;  4JI2 O;  4R7C A;  4MSW C;  5L3F A;  3FFQ A;  2QM4 A;  4UVC A;  3DC5 A;  5IJ0 A;  4FZ1 A;  4P9O A;  1XHX A;  2VWK A;  4WFE A;  4UV8 A;  1OCC C;  4YIP A;  1ARO P;  3JD0 A;  4GX0 A;  5J2T A;  5B1O A;  1PM9 A;  2JGU A;  4ZOL A;  1JFF B;  3ZCC A;  4K0K O;  4U7N A;  5FPR A;  1D5N A;  4JI6 O;  4LF9 O;  4PDM A;  1K97 A;  2XAS A;  4X66 B;  2DJV A;  1ZUQ A;  5LMN O;  3SJQ C;  1PL4 A;  1EFR G;  1P4R A;  1DGS A;  1GAX A;  1J95 A;  1WPX A;  3FD9 A;  1ZAU A;  1OCO C;  4YJ2 B;  3AG2 C;  1ROP A;  4K3A A;  4XDK A;  4F6R A;  4UV9 A;  4PDR A;  4LF8 B;  3IC7 A;  3JD2 A;  4KFM A;  3ETE A;  3OTF A;  4TT3 G;  1MAB G;  2RMK B;  3CB2 A;  3ETQ A;  4NXN O;  4IGG A;  1KMI Z;  3BEH A;  3JAW A;  4DR4 O;  4X64 O;  3OEH G;  2JVD A;  1VQP V;  2VQE B;  3DC6 A;  4HNA B;  5H2F Z;  1TUB A;  1QLE B;  2N74 A;  1KUQ A;  4JGS A;  3A0R A;  4FLT A;  1SQF A;  3L72 H;  3H1I H;  1VQL V;  5EC1 C;  3D3Q A;  3OE7 G;  4DV0 O;  2YXH A;  2JGD B;  2IH1 C;  4IIJ B;  4TV8 B;  4QE9 A;  1GM9 A;  1X4T A;  2Q7E A;  1KYO F;  4PA6 A;  1N34 O;  3HKD B;  3K0D A;  2ODM A;  1QVG U;  1FXH A;  4CH5 A;  4PI0 A;  2K1E A;  3UT5 B;  1TAE A;  3CP1 A;  5L3B A;  1KQS U;  3ABL C;  4DK0 A;  4DUZ B;  1K3E A;  2JEU A;  2KG7 A;  4X1K B;  4PHZ A;  1D5A A;  2V1D A;  2A0L A;  1FXV A;  2EBO A;  1EBO A;  1WJZ A;  3QTC A;  2DYR B;  3T4Z A;  2W0F C;  4LCU C;  3AK1 A;  1FXK B;  3UO3 A;  3CRA A;  1SC5 B;  4HAM A;  4X1Y B;  5LOV A;  4JI8 O;  4AHC A;  3E89 A;  2ZDI A;  4MTX A;  1KP2 A;  3M7M X;  1U96 A;  1GH6 A;  2UUC B;  4LFC O;  1HNZ B;  2WLK A;  2OIE A;  5C93 A;  5LP6 A;  3G4S V;  1UJW B;  2YSU B;  3F5T A;  1L0L H;  2H3O A;  3VQY A;  1IBL B;  5ITZ A;  4RO2 A;  1PD3 A;  2QA4 V;  4JI1 O;  3Q4H A;  1K7D A;  2ZCE A;  3F7V C;  4EFB A;  4GKK B;  4LF6 O;  2ZQM A;  4FIP C;  3OGI B;  5E79 Z;  1R3K C;  1SQG A;  3SYO A;  4MTG A;  1M57 C;  1M90 W;  3CMA V;  1YJN V;  3RVY A;  4FLW A;  4PV1 B;  5IWA O;  3JAM N;  1PKX A;  5BY1 A;  1W0J G;  3WFV A;  1YZB A;  4DV6 B;  4YHH B;  4CH6 A;  2B1G A;  1MZE A;  2DWE C;  1VQK V;  1OJH A;  2F93 B;  1XL4 A;  3ABM B;  5B1B B;  3E22 B;  2QKA A;  4JV5 B;  5HFM A;  5GON A;  4E2L A;  1M4U A;  2QM7 A;  2YUA A;  1FFX A;  1YEW A;  2FML A;  2QE7 G;  5EBW C;  4DW0 A;  4CH4 A;  1XNR B;  1WN7 A;  4J42 A;  3UO2 A;  1WNS A;  2OWO A;  5JH7 A;  3OUF A;  2RN9 A;  3C3T A;  5KUK A;  3MHH C;  3ZJZ A;  4LH7 A;  3U10 A;  4NXM O;  3TK1 A;  4DV7 B;  1VEW A;  5KHI A;  2CE4 A;  2CDY A;  2F4V B;  4DR1 B;  2GTS A;  1N36 O;  1K4D C;  3K9S A;  4DW1 A;  4DR2 O;  4ZI7 B;  4YY3 O;  1H2G A;  1PL0 A;  4JI4 B;  5JJJ B;  5B3S C;  2P67 A;  1BQZ A;  3ZS8 C;  5BMV B;  4RQF A;  1VQM V;  4DUY O;  3RGB A;  4DR3 B;  2CGN A;  4I0X B;  4I50 B;  2UUB O;  2LP7 A;  2UXB O;  1WP7 A;  1DK1 A;  1IXM A;  1BQ0 A;  4BIZ A;  3K5O A;  3ZHT A;  4CBC A;  3B09 A;  1VF6 A;  2CH7 B;  4CH3 A;  2E3C A;  1AI4 A;  2N04 A;  1MSD A;  4HYO A;  1OCC B;  1S5L Z;  5LHG A;  2Y48 A;  2KQX A;  4O2A A;  3B4S A;  5JVD A;  4I5S A;  4J80 A;  4QPK A;  1GRJ A;  5EBM C;  3CCL V;  4DR5 O;  5KAF Z;  3T1C A;  4H37 A;  3BFR A;  3A8T A;  1YHQ V;  2PF4 E;  3STL C;  3HKC B;  3K5N A;  2IBZ H;  2H94 A;  4ZIB A;  3VOU A;  3QO8 A;  1AR5 A;  1OCO B;  5KHJ A;  2CAZ C;  4RQE A;  3AG2 B;  5IT9 N;  1I94 O;  5K1P A;  2NNU A;  3ETD A;  3FX7 A;  2G38 A;  1YDX A;  3LSQ A;  1AI5 A;  2EJR A;  3CHX A;  3JYC A;  5GTI Z;  2Y69 C;  3RYH B;  4J7Z A;  1THZ A;  1WA8 A;  2P6J A;  2M6Y A;  3RYF A;  4O4L A;  2B5U A;  3CS5 A;  3KG2 A;  1N32 B;  1JJO A;  1W2B U;  2F66 C;  1OCZ C;  1W59 A;  3J7A U;  2ADQ B;  5E1A C;  3E83 A;  3HB3 B;  4IHJ B;  4G28 B;  3TGU H;  2ZIN A;  1K5Q A;  4PA4 A;  3L71 H;  1AP6 A;  5LGU A;  3CEI A;  3G80 A;  1S72 V;  4YJ3 B;  3JAR B;  4PA3 A;  3RFR A;  1JPX A;  2DYR C;  3K3W A;  3OTO O;  5DEC A;  2LW1 A;  4TSF G;  1GN4 A;  3FB6 C;  3FB8 C;  5JQG A;  3CRM A;  1GO3 F;  3NXS A;  2AGA A;  5J9P C;  4KHP O;  2LJ2 A;  3STZ C;  2A9H A;  3W7T A;  2DMX A;  4IL6 Z;  4WFA V;  4J41 A;  5IDJ A;  2E74 B;  4I4T B;  4FM2 A;  5IJ9 A;  1VQ6 V;  3UKM A;  3CJH B;  4QGP A;  4WFH A;  4OGQ B;  2JS3 A;  2GV9 A;  3K0G A;  5CA1 A;  3RT3 C;  4FLV A;  1J5E O;  1XIL A;  3P3P A;  4WCE V;  2HVJ C;  5D5P A;  4U3J B;  4J9Y B;  2L6L A;  4QNH B;  3LDD A;  1PP9 H;  2A06 H;  3SJA C;  2X7R B;  4LF4 B;  2FL4 A;  4LFA O;  3X2Q C;  1XNQ B;  5CN0 A;  3CE2 A;  2BSK B;  2WLL B;  2JRI A;  4JYA B;  4CC5 A;  2UXC B;  5LHI A;  1WAZ A;  2JS5 A;  3ZRV A;  1FPO A;  5CA0 A;  2YXL A;  1N0N A;  1Q6U A;  1XMQ O;  2WSS G;  1Y76 A;  1VQ4 V;  5KHH A;  2F23 A;  3D8C A;  5LMU O;  1Y67 A;  4R8C A;  4LH6 A;  1TUE B;  3T1H O;  3A0H Z;  4UVA A;  3ZMU A;  3EHB B;  4A5U B;  2V4D A;  2KKW A;  4ZHQ A;  1Q6I A;  4JAA A;  5LXT B;  1EN4 A;  4NKG B;  1ZX3 A;  3JAK B;  3JD1 A;  1M57 B;  1Q81 W;  1QLN A;  3I5D A;  4PD4 F;  2A7W A;  4JYB A;  3IJ4 A;  3SJC C;  4KXR A;  4U3F H;  4LF7 B;  2GDS A;  3K04 A;  3RYC B;  1XMO O;  4MTF A;  3SGI A;  4FFB A;  3LNN A;  4JAU A;  4B3S O;  2WLN A;  3G6E V;  5LA6 A;  3D3I A;  4D6T H;  4EB6 A;  2QWP B;  1AVM A;  2CTP A;  4WFG A;  2RNB A;  2LW7 A;  1E79 G;  1I7F A;  4TQF A;  1RP3 B;  3K08 A;  4B7E A;  1AR1 B;  4DV2 O;  3PN1 A;  1NR1 A;  4XBF A;  2YS8 A;  4MW8 A;  3CC2 V;  2Q73 A;  3CCQ V;  1WB7 A;  4GX1 A;  4W4L A;  2ZIM A;  1WLE A;  1YXB A;  5TIS Z;  4JI6 B;  4LF9 B;  1JX9 A;  3JAT A;  2X6C A;  5EZY A;  2KSD A;  3ZRW A;  5IY5 B;  3MAQ A;  5LMN B;  2YEV B;  2QKC A;  3L74 H;  1NZ6 A;  2EIN C;  4DV1 O;  4Z2W A;  2XAG A;  1WPB A;  5AG2 A;  1FFX B;  3OR6 C;  1KP3 A;  1RSO B;  5IYC O;  4ICG A;  1Y74 B;  2F95 B;  2E5L B;  1BZK A;  1YTF B;  5KMG A;  2D3O W;  5JH7 B;  4B3T O;  2ZE6 A;  1ZL8 A;  4RAI A;  5B3S B;  4LNU B;  3ZMT A;  4MTO A;  1NT2 B;  2R9I A;  2WA4 A;  3AG3 C;  3QF7 A;  4NXN B;  4F4L A;  1Z5V A;  4KP4 A;  1LUW A;  3ZN0 A;  4DR4 B;  3QO7 A;  4X64 B;  3BY6 A;  3U11 A;  2Q7H A;  2UUA O;  2EIK C;  4O4H A;  4LWS A;  3BCC H;  2X0L A;  3SYC A;  4X20 B;  5HFL A;  2IU3 A;  2OYQ A;  4O4J B;  3MDS A;  4QIW F;  1VQN V;  2QWO B;  4DV0 B;  5IYB O;  3N2G A;  4DO2 A;  4GZR B;  3G67 A;  4PI2 A;  3A0B Z;  3BVO A;  2AW9 A;  2HFE C;  3N2K A;  3RYI A;  3TXQ A;  4CC6 A;  1N34 B;  4GKJ B;  2EIJ C;  3JAS A;  2P06 A;  2YC0 A;  4P30 A;  4O2B B;  1OHH G;  1YIJ V;  1ZWI C;  4GX5 A;  4X62 O;  3VBB A;  3SPH A;  1Y6X A;  1M5I A;  4AQY O;  3E2E A;  3JSN A;  4RWU A;  2Z5U A;  4O2A B;  5JVD B;  2EX3 A;  1WB8 A;  2XT9 A;  4HBN A;  3HKB B;  2Y69 B;  3HKE B;  3GB7 C;  1D2D A;  3T4D A;  4JTC B;  3HR0 A;  1UPG A;  1MNG A;  3VQW A;  2Z0A A;  4FK5 C;  2JK5 C;  4K8X A;  4JI8 B;  2NR5 A;  3GWO A;  2EIM B;  1SES A;  1UFI A;  1OCZ B;  4MS2 A;  1IUR A;  3FAV B;  4JI7 O;  4LFC B;  5FPO A;  4ASU G;  1SF9 A;  1US6 A;  4X66 O;  4TUY B;  2MW2 B;  3APQ A;  3L75 H;  2JEX A;  4X1I A;  1BHB A;  4JPR A;  3CYO A;  1XDC A;  2QGN A;  1TVK A;  4JAS A;  1Q6H A;  2ZKO A;  4K8Z A;  3ML0 A;  5H5N A;  3W7X A;  2HVK C;  4I7Z B;  3ZED A;  3SYQ A;  4RUF A;  2Q8V A;  3K79 A;  2Z3Y A;  3GWK C;  5A9G A;  2HJF C;  1MA1 A;  5LBQ A;  4FLY A;  1MG1 A;  5CBH A;  5C8Y A;  5JJE B;  2HHH B;  2WAM A;  4LFB O;  3CCJ V;  4FLX A;  1SET A;  2XUM A;  2YI9 A;  2GTA A;  3IAY A;  1NVP B;  2QWN B;  2VQE O;  5KX5 A;  3QG5 A;  1JA8 A;  3K57 A;  1NI8 A;  3FKS G;  2IH3 C;  1GMG A;  1R3L C;  4DV3 B;  5JQG B;  1QR9 A;  2OCC B;  4Q6G A;  1FS0 G;  2GHY A;  2LQT A;  1IBM B;  5B66 Z;  2ZDI C;  2AXT Z;  1EN5 A;  3X2Q B;  1JR9 A;  5GTH Z;  3ASN C;  5CB4 A;  3SYP A;  5IYD O;  1Q90 D;  1N0J A;  1HNW O;  5B1A B;  3ABT A;  3ABU A;  2ZM6 B;  3K5M A;  4NXM B;  3E8H A;  3OW2 U;  3ZN1 A;  2ADP A;  1BT8 A;  3OMI B;  4MVU A;  1HP8 A;  5L3D A;  2Q4P A;  4HZ3 A;  3THO A;  4WBN A;  2IJJ A;  2R9A A;  4B08 A;  4DR2 B;  2R70 A;  2Q0O C;  4YY3 B;  1L0N H;  2XAF A;  4DV4 B;  2IW5 A;  3ZHR A;  2XND G;  2BTQ A;  4MVS A;  5CA0 B;  2QWR B;  3B40 A;  4DUY B;  4OX9 O;  4IYH A;  5LHH A;  4DRX A;  4TV9 B;  4UCV A;  1XI1 A;  1SQB H;  2UUB B;  3JAL B;  1PPJ H;  2BE3 A;  2WLI B;  5KUM A;  2UUC O;  4ZHQ B;  4UUJ C;  2UXB B;  1R1B A;  4X89 A;  3CXH F;  1S0V A;  5FNV A;  4DR6 O;  4GYC B;  3SPG A;  1AJP A;  2NN4 A;  3ZMZ A;  4LF5 O;  5IY5 C;  5CMU A;  3CCU V;  4MVQ A;  2CTW A;  1SA0 A;  1VP7 A;  5IYZ A;  3CC4 V;  1G8M A;  4GLX A;  1BL8 A;  2CUG A;  4NTX A;  2OCH A;  5J2U B;  1PNK A;  4I55 A;  4X8A A;  1ZTE A;  3E86 A;  4DR5 B;  1SZX A;  3CD6 V;  2QDO A;  5H9C A;  4L8J A;  3OM3 B;  2B1I A;  2UXD B;  4FM0 A;  1H2M A;  3JD4 A;  2DQ0 A;  2EIN B;  3CCR V;  3ZBH A;  4O4I A;  2XOK G;  4J11 A;  4TWK A;  5L3C A;  2BOC C;  4UCR A;  5BR8 B;  1JFF A;  5DED A;  4YHH O;  3KKY A;  2ZNI A;  3ZHV A;  4JV5 O;  3KZI Z;  2BCC H;  1S76 D;  1DF5 A;  2EUL A;  2R72 A;  1K73 W;  2P4K A;  4MVM A;  2HLD G;  1BE3 H;  3AG3 B;  2DN9 A;  3SYA A;  4RUE A;  3HPL C;  4OPA A;  4YJ2 A;  4B7K A;  1K5S A;  4BW5 A;  1HW7 A;  5L3G A;  1V9P A;  1XNR O;  3F5W C;  1N33 O;  4X65 O;  2YIA A;  4Z1V A;  2EIK B;  1FJG B;  4FZ0 A;  1VF6 C;  5IJ0 B;  1ENV A;  5CA3 A;  3CCM V;  1JJ2 U;  3FB5 C;  1EZJ A;  4DV7 O;  2ILM A;  3ETG A;  5J2T B;  5LGN A;  4DR1 O;  3CSX A;  2PI4 A;  4ZOL B;  5LYJ A;  5B1N A;  3G71 V;  1JQ0 A;  4HNA A;  4MVZ A;  2EIJ B;  3BAA A;  2ZNJ A;  3OTO B;  4JI0 O;  4YXW G;  4JI3 O;  3AG4 C;  1S5H C;  2YIC A;  2WLH A;  2E76 B;  4DR3 O;  4KHP B;  1X59 A;  2JGD A;  3N2G B;  3AK2 A;  4D7S A;  2EIM C;  3S3W A;  2QEX V;  1V54 B;  4F6R B;  1G1X B;  3HKD A;  1V55 C;  2ZT9 B;  1XL6 A;  1Y4M A;  5JCO A;  3JSL A;  1RPR A;  4P9P A;  4WFF A;  1J5E B;  3UT5 A;  2CTR A;  3QVN A;  4NYK A;  3OD4 A;  1FD9 A;  2EZO A;  3AK3 A;  4X1K A;  3QNE A;  3D36 C;  3JAW B;  2A3Q A;  4GCZ A;  3GVM A;  4JZ2 A;  2HG5 C;  3E8G A;  4MT8 A;  1TUB B;  1M56 C;  3O65 A;  1VIB A;  4ZKI A;  1FXK A;  2H8P C;  3E35 A;  3J80 N;  4UCT A;  4X1Y A;  1XMQ B;  4FMT A;  4JI5 O;  4QJF B;  1M1K W;  1K4C C;  3CCV V;  1JMK C;  1R3J C;  2QKS A;  2QTS A;  2IJH A;  1KU9 A;  1MZF A;  5EIB C;  1FYJ A;  1RFY A;  1G4Y B;  5CBG A;  1I5X A;  3B77 A;  3T1Y B;  1FKA O;  4X1I B;  1N32 O;  5EC2 C;  2OCC C;  3E8F A;  2PY5 A;  4YIO A;  4B3R B;  1XMO B;  2LGQ A;  4J10 A;  2DOS A;  1F7Y A;  5L3E A;  4DR7 B;  2KG7 B;  3AG7 A;  1E1Q G;  5KA6 A;  2XAQ A;  2ZE5 A;  2LFR A;  4NR1 A;  2IJI A;  5LGT A;  4FJC C;  5EYP A;  1EZV H;  5JWP A;  4C7U A;  3WB1 A;  5B1A C;  1YF2 A;  1NH2 B;  4NVP A;  1QQC A;  5LOV B;  1Y66 A;  4QE7 A;  4GT1 A;  4DV2 B;  1AI7 A;  3C3S A;  3A2F A;  4KUM A;  4PDV A;  4UXN A;  3ASN B;  1DTO A;  1FFT B;  1TA8 A;  4EFE A;  2W0X A;  4BWA A;  1CEZ A;  5LP6 B;  4BR6 A;  1BSM A;  2UU9 B;  3CRC A;  1AJN A;  2GSM B;  3ZMV A;  4PEL A;  3OUS A;  5ITZ B;  1AI6 A;  1SQQ H;  3CCS V;  3ZHU A;  4FLZ A;  4DV5 O;  3Q4H B;  4H13 B;  1KKC A;  2DWD C;  4OPH A;  1SRY A;  2XAJ A;  1YIT V;  1F4N A;  5BZB A;  1XQ8 A;  5CB4 B;  2VWJ A;  1G6U A;  3KCX A;  4JI2 B;  2Q7G A;  3EXA A;  4B3T B;  2D2C B;  4N23 A;  2HR3 A;  1JOY A;  1RM1 B;  4J7J A;  2QR4 A;  4U7O A;  1NKD A;  3QO5 A;  1S3J A;  3CRR A;  3BA8 A;  1R6N A;  4K0K B;  4ZI7 A;  3ZHQ A;  2FKX A;  2UXC O;  3VQX A;  3CME V;  3OEE G;  1LNQ A;  2QWQ B;  3DXR A;  2Y4T A;  5BMV A;  1QU7 A;  2JDI G;  5GON B;  1A32 A;  2DYS C;  4FM1 A;  4I0X A;  4OXS A;  4I50 A;  1NR7 A;  3SPC A;  3P3N A;  2ITD C;  1AB3 A;  2ATK C;  1XHZ A;  3LSU A;  1BGY H;  1GM8 A;  2XHB A;  3ZMS A;  2VQF O;  2YIB D;  2KB1 A;  2PYJ A;  3EFF K;  1SER A;  3B8M A;  3W7S A;  2ZXW B;  2CH7 A;  1KEC A;  1P7B A;  3W7U A;  1NTZ H;  3ICX A;  1VQ7 V;  3JD3 A;  4X62 B;  2Q69 A;  1BCC H;  1Q86 W;  2UXX A;  4NTW A;  2WA3 A;  1P7G A;  1OV9 A;  4FVM A;  1VAR A;  2Q9L A;  5CBF A;  1KC8 W;  1COW G;  3BAB A;  2GBO A;  2OIG A;  4H44 B;  4JYY A;  1O9G A;  3L70 H;  1GTO A;  3FYI B;  2Y0I A;  2P5O A;  3HKC A;  2GUZ A;  5DM6 V;  4H33 A;  1VMG A;  2P7T C;  2Y0P A;  3CPW U;  1Q7Y W;  4O4I B;  2L35 A;  4UCO A;  3O9O A;  3K06 A;  4B3M O;  3L9D A;  2Q6A A;  4R6Z A;  1XRE A;  1P49 A;  2AZ0 A;  4LR3 A;  2Q5Z A;  1SS3 A;  4ABM A;  4JI7 B;  1YTF D;  3CRQ A;  3RN4 A;  3AG1 B;  3RYH A;  3LDE A;  1OCR B;  1HNX O;  2DW4 A;  2RDC A;  1QHT A;  1KKD A;  3IGA C;  2ZR3 A;  1KBH A;  5KHG A;  2E5L O;  1IBK O;  3J81 N;  3TJT A;  1LUV A;  1HR0 O;  3DSQ A;  4CS2 A;  1V54 C;  4TOI A;  4WFB V;  3H1J H;  3CXC U;  4IHJ A;  1VF5 B;  3SJB C;  3AG4 B;  1N8R W;  2F1M A;  4UCU A; 
#chains in the Genus database with same CATH homology
 1A32 A;  4NXM O;  4DV7 O;  1N32 O;  5LMU O;  4OX9 O;  4JI8 O;  4B3R O;  3T1H O;  1XEQ A;  4DUZ O;  1AB3 A;  4DR7 O;  4A5U B;  1F7Y A;  2DOS A;  4DR1 O;  2UUC O;  4LF4 O;  3R66 A;  1XNQ O;  1R1B A;  5LL6 Y;  4LFC O;  2ZKO A;  1N36 O;  2UUA O;  5H5N A;  1NS1 A;  2VQF O;  3J7A U;  4DR2 O;  4JYA O;  4YY3 O;  4DR6 O;  4JI0 O;  4JI3 O;  5BXZ A;  3F5T A;  1R6T A;  4DR3 O;  4LF5 O;  4JI1 O;  4DUY O;  2HHH O;  1X59 A;  4NXN O;  4LF6 O;  4LFB O;  1XMO O;  2UUB O;  4DR4 O;  2F4V O;  4X64 O;  2UXB O;  2VQE O;  1DK1 A;  1HNZ O;  4B3S O;  4LF8 O;  4GKJ O;  1G1X B;  4DV3 O;  2UXD O;  2N74 A;  1FKA O;  2UU9 O;  1KUQ A;  3SDL A;  3OTO O;  4JI4 O;  1AIL A;  1IBL O;  4X62 O;  2AGA A;  4KHP O;  4GKK O;  2LW7 A;  4DV5 O;  4LF7 O;  4DV0 O;  5IWA O;  3JAM N;  5BY1 A;  1IBM O;  4DV2 O;  4AQY O;  5BR8 O;  4OPH A;  4B3M O;  4YHH O;  1YZB A;  4DR5 O;  4JI2 O;  1N34 O;  4JV5 O;  3O65 A;  1HNW O;  5A2Q N;  1HNX O;  3RT3 C;  1J5E O;  1D2D A;  3J80 N;  2ZM6 O;  3M8A A;  4DV1 O;  2Z0A A;  4JI5 O;  5FLX N;  4OPA A;  2E5L O;  1IBK O;  5IT9 N;  3J81 N;  1I94 O;  1XNR O;  4LFA O;  1N33 O;  4K0K O;  4X65 O;  4JI7 O;  4DV6 O;  1HR0 O;  1FJG O;  4JI6 O;  4LF9 O;  2FKX A;  2UXC O;  1FYJ A;  4B3T O;  2JRI A;  4X66 O;  4DV4 O;  2DJV A;  3T1Y O;  5LMN O;  1XMQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...