1D2DA

Hamster eprs second repeated element. nmr, 5 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
molecule keywords TRNA SYNTHETASE
total genus 18
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1999-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1d2dA00
4OPHA 4LF4O 3R66A 4NXNO 1J5EO 2UU9O 2ZM6O 4DR5O 4JI3O 4DV1O 1XNRO 4B3RO 1HNXO 4LF7O 1FYJA 3RT3C 3J7AU 4YHHO 4JI5O 1AB3A 4JYAO 3O65A 4YY3O 4DV3O 5BY1A 2UUAO 4LF9O 4DUYO 1KUQA 1N34O 5LMUO 4KHPO 2JRIA 5BR8O 1HNZO 1IBLO 4DV2O 4X66O 3SDLA 3T1YO 2UUCO 1FJGO 3F5TA 2DJVA 4A5UB 4JI7O 4DUZO 1XMOO 1N36O 3M8AA 4B3SO 1R6TA 3J81N 4DR4O 2UXCO 5IT9N 4DV5O 4JI4O 1YZBA 4X64O 4LFBO 5A2QN 3T1HO 4JI1O 2FKXA 5LL6Y 4LFCO 1A32A 4X65O 2F4VO 4DV0O 1IBMO 4JI0O 2Z0AA 4K0KO 3J80N 2VQFO 4DR7O 5FLXN 4NXMO 5LMNO 3OTOO 1XNQO 2LW7A 1HNWO 1R1BA 4LF6O 4DR1O 4B3MO 5BXZA 1HR0O 2UUBO 4LFAO 1D2DA 4OPAA 4DV4O 1G1XB 1DK1A 4DR6O 1I94O 1FKAO 1IBKO 2E5LO 4OX9O 1AILA 2DOSA 1XEQA 4GKJO 4JI6O 1N33O 1NS1A 1F7YA 5H5NA 4DR2O 4LF8O 4AQYO 3JAMN 4LF5O 1X59A 4DR3O 4B3TO 4X62O 1N32O 4JI8O 2HHHO 4JV5O 4DV6O 2VQEO 2ZKOA 4JI2O 2UXBO 4GKKO 2AGAA 5IWAO 4DV7O 2N74A 1XMQO 2UXDO
chains in the Genus database with same CATH superfamily
2DWEC 3OMAB 3OUFA 1HP8A 4DW0A 2QWRB 3CP1A 1VQNV 1OCRC 3MHHC 3ABKB 2IM9A 4PHZA 1FYJA 3J7AU 4NTYA 1N0JA 2EIKB 3X2QB 2EINC 2VRZA 3ZIAG 1NI8A 3GWKC 3SPHA 1FXKB 1ZX3A 3IFXA 1SS3A 2JRIA 3SYAA 1FFXB 5JVDA 1NQTA 3QVNA 3LSQA 4JI7O 3E83A 4JI5B 1YTFD 3CC4V 4IIJB 2EJ7A 3E22A 3ZRWA 2R72A 3VQVA 3W7WA 4UB6Z 3ETGA 3OTFA 2Q9LA 1ZSPA 3SJAC 4MVRA 5JCOC 5LP6C 4DV0B 5FPRA 3ZN0A 2IJKA 3P3NA 3HPLC 3STZC 1RM1C 3ABTA 1P4RA 1RPRA 4MS2A 3SJBC 5B66Z 2W0FC 4NYKA 4PA9A 1VQMV 2OT5A 5JH7A 3D8CA 3FFQA 4YJ3B 4W4KA 5IJ0B 1XREA 1M1KW 1AR1B 3CS5A 1FJGB 1Q81W 2XASA 4WFFA 3OD4A 5GONB 1M56C 3K0GA 1L0LH 1QLEB 4ZOLA 1M9NA 4DW1A 2HP8A 4PA4A 5IYZA 2Y0IA 5CMUA 5C8YA 2ETNA 1AI4A 1KMIZ 3I55V 1SKVA 2IH3C 3FB5C 4JAAA 3I56V 5KMGB 4PI2A 2HLDG 4OPHA 1EN4A 3AK3A 5IYBO 4JASA 4FMTA 3OM3B 4TSFG 4FLVA 5B1OA 2VQEB 4I0XA 4JI6B 2D2CB 4I55A 1B6QA 5L3EA 2ILMA 1GM9A 2RJZA 1RM1B 4DR4B 3OGCC 2R9AA 2QR4A 4JGSA 1QQCA 4U7NA 4X89A 3IC9A 5K1XA 2GTAA 5CB4B 3K3WA 4LC1A 1I94B 1HW7A 2Q5ZA 4N23A 4WFHA 3S3WA 4DUZO 4BAYA 1XNQB 3K04A 3K5LA 3EHBB 3ABMB 3G4SV 4FLTA 2DYRB 5IT9N 3K06A 1GM8A 1SQFA 2YIBA 2YICA 1OJHA 2EIMC 4LFCO 5LGTA 4X65B 1KB9F 4H37A 1IBMO 5IJ0A 4NXMO 3CCEV 3FB6C 4N21A 2XNDG 1Y4MA 1ZAUA 1NTKH 4ZIBA 4H13B 1HWYA 2HJFC 2DWDC 4EB6A 1H8EG 5EBMC 4CH4A 2QKSA 1PD3A 2XAHA 2PY5A 2HKOA 3SPGA 1SERA 1Y76A 1SA0B 3O9OA 3AG1B 2QWOB 2VWKA 2JEUA 4PA6A 4MVUA 2XAGA 1XQ8A 2P67A 4PDLA 2YXYA 3JYCA 3JATB 2CGNA 1PL0A 3G6EV 1VF6A 3CXHF 3C90A 1K92A 3CC7V 1FXHA 4XBFA 3NR7A 3K03A 3E8BA 1GK9A 1NBMG 3RYCB 4YY3O 2WLJA 2GUZA 2CK3G 2YEVB 3JALA 3DC6A 4I4TB 1BQZA 2YIDA 1FXVA 4KHPB 2BSKB 2EIMB 4Z2WA 1O9HA 3OMIB 3AK1A 3ZHQA 4YY3B 4KFMA 5CBGA 4JPRA 3FYIB 5IWAB 2H3OA 1N34B 2P06A 5EYPB 1I08A 1FAFA 1L8DA 1FPOA 1SF9A 1F4NA 5LL6Y 4DV0O 3IC7A 4JI0O 2ZDIA 2JIZG 2LP7A 2ZDIC 3CMEV 2YS8A 3DSQA 3MDSA 3ZMUA 4B3MO 4LNUA 4X20B 3FX7A 3FYEB 3E2EA 3H1KH 1I94O 2M6YA 4B3RB 1I5YA 2ZE6A 2YI8A 2A9HA 3N2KA 1KYOF 4AQYO 3ML0A 5JJJB 4O2AB 1F23A 4LFCB 1YEWA 3RYCA 3AG4C 4EFEA 1KBHA 1DGSA 3UO3A 3ZMVA 2EILB 5EBWC 2Z3YA 5CBFA 4QIWF 5J9PC 1YJ9V 3L73H 1Q6HA 4CH3A 2JJ1G 4J7ZA 2JS3A 1QCEA 3TETA 2X7RB 1ZL8A 2WLNA 4YHHO 1AB3A 4WBNA 3O65A 3BA9A 3ZRWB 1SESA 1K3EA 4DR2B 1JPXA 1SC5B 5DM6V 1J5EB 2UU9B 2YSUB 3TJTA 2PF4E 2WLMA 4G2KA 4UCRA 4ZKIA 3CRAA 1QVGU 3FAVB 3T1YO 4J10A 2DYSC 3QO5A 3F5TA 1VQ9V 3ETDA 5LMNB 1AI7A 4NTXA 1KQSU 2XAQA 5FL7G 2OTJV 3JD0A 2Q8VA 2ZXWC 1JFFA 4J11A 4TV8B 3U10A 3VQXA 4UCVA 4UV8A 3SJCC 2OTLV 4FLZA 4R6ZA 4DV6B 5H2FZ 3J80N 2DW4A 2AZ2A 1RP3B 1GO3F 1B06A 2JK5C 3JARB 5GTHZ 1K97A 5JVDB 1FFXA 2WWWA 4O4JA 1SQPH 3OGIB 3JAKB 1PP9H 5CA0B 2E76B 1F7YA 1UPGA 2A3QA 2QTSA 3VQYA 2KQXA 3CJHB 5CBHA 1HNXB 4JV5B 1BL8A 3H01A 1GRJA 3APOA 1Y66A 2YI9A 3CX5F 3N2KB 5JCOA 4B3MB 5KLVH 3LDEA 4X1KA 4MTOA 1XNRO 3MAQA 5BMVB 2O57A 2Z5UA 4HYOA 3H1IH 4FM0A 4I9WA 4MVZA 3TGUH 2PI4A 1PNMA 4FJCC 4QE7A 4KHPO 2EILC 2WLIA 2V7QG 3E8GA 3AK2A 1I7FA 2IU3A 2F1MA 3C3TA 5B1NA 3F5WC 4TQDA 3PN1A 1GN4A 5JH7B 1H2SB 1YZBA 1AJQA 4LF4B 2UXCB 1GTOA 2V1DA 3D36C 3CCVV 3T1HB 1A32A 1BS3A 2PYLA 2DE0X 4GUNA 3P30A 2QWPB 2ODMA 3SYQA 4LF6B 3AEIA 4LFAO 4X9QA 1S76D 2RMKB 2IJJA 5B1BB 5LHGA 3T1YB 1IBKO 2E5LO 2K1EA 3AG3B 4RUFA 2ZE7A 1FS0G 3KG2A 4UV9A 4NXMB 2QWNB 2ZXWB 1X59A 3FB7C 3OAAG 2Y4TA 1WPBA 5BR8B 2ZIOA 4DV4B 1AJNA 2F43G 4KP4A 3OEHG 4DV6O 1EBOA 4JTDB 2UXBO 4LH6A 5B3SB 3EXAA 3N2GB 4I55B 1I5XA 4DR3B 2QJ1A 2RN9A 4YJ3A 3KCXA 2YXHA 5IYDO 1F51A 2D3OW 4JI5O 2GSMB 4ZI7B 1R3LC 1EN5A 1P49A 2ADQB 4CS3A 5CA3A 3ABLC 1JVMA 1KKDA 1OCCC 1GMGA 1SA0A 2Q4PA 4WFEA 3IGAC 3JD1A 1OCZB 5KHKA 4UCUA 3CXCU 3MD0A 2FB5A 5L3GA 5ITZA 4DV3B 1RSOB 1N36B 1Q90D 4IHJA 3CCMV 1M57C 4K8XA 1K4CC 3ASNB 4CZZA 1HNWB 1Z5WA 1KKCA 4O4IA 5BMVA 4NR1A 5GW7A 5KX5B 1ZL8B 2FMLA 4JTAB 1YF2A 1NTMH 3QO7A 4KUMA 1AROP 1Z2GA 3FKSG 4U3FH 3DXRB 5KHJA 1NR1A 1HR0O 2UUBO 3OMNB 1V54C 1VQ5V 1OZ0A 4MTXA 1VQLV 4FLYA 4R50A 1R3IC 3LDCA 4JZ2A 5ITZB 1T5EA 3K0DA 5IY5C 1NS1A 2EBOA 4J7KA 1NVPB 4K8ZA 2OCCC 1EFRG 1W2BU 1MA1A 1CEZA 5L3FA 2QSAA 4X62O 5HFMA 2LJ2A 5K1PA 4DV1B 3G6BA 1JX9A 4HBNA 5J2TA 4UFZA 1E1RG 4I4TA 3CPWU 3SPCA 1R3JC 3ZHRA 3ABLB 1XMQO 4AQYB 5LYJA 3QNEA 2OWOA 5LOVB 2P4VA 4I5SA 5IY5B 2LO1A 4JI8B 2CTWA 4XDJA 1SQBH 2GHYA 4WFBV 2NR5A 3ZRSA 4DR7B 4GX2A 4O2BB 1WP7A 3RYHB 3RYFA 1M5IA 3JSLA 5EIBD 5B3SC 1KUQA 2CGOA 3K9AA 1JOYA 3OR6C 4JZGA 3W7TA 1WJZA 5C8YB 1EM1A 1J95A 5BR8O 1YIJV 4LCUC 1SQXH 3CMAV 3A0RA 1MSDA 5B1AB 1GM7A 2YXLA 1WN7A 2IU0A 4YHHB 5CA1B 4MTGA 4QE9A 3S3XA 2OYQA 3ZRVA 1VQOV 2Y69B 2UXCO 2ZR2A 3CRRA 1V54B 4J9ZB 5A2QN 2XAJA 3CB2A 2F4VO 1K4DC 4U7OA 3A2FA 3E8FA 3TK1A 1OCCB 2E75B 4DK0A 4OGQB 2JVDA 4LFAB 1QHTA 3LNMB 3JD3A 3W7UA 1W0JG 2ZE8A 3BVOA 3HKEA 2YC0A 2PUSA 2QGNA 4JAVA 1PNLA 2WA4A 4B08A 5L3BA 5JQGA 4J41A 4TV9A 5KX5A 2Y69C 2EX3A 3C3SA 3DTUB 1XHZA 2WSSG 1WLEA 1GN6A 5B1AC 1GN3A 1BT8A 1XMOB 2OCHA 1VP7A 4JF3A 1AI5A 4GX5A 2N74A 4DUYB 3HKDB 4BW5A 1N4CA 4NVPA 5J2UB 1Q6UA 1XI1A 1Q82W 1VQ7V 2IJIA 3STLC 5EZYB 1KU9A 4I50B 1MOFA 2CUGA 2AXTZ 3AG1C 3KKYA 3LSSA 3T1CA 2WLIB 4FPPA 2DN9A 4MW3A 2W6IG 4BWAA 3G71V 3JASB 1KECA 2B9ZA 4O4HA 4PV1B 4YJ2A 1G8MA 4BW9A 1TUEB 4DV5O 2QKAA 5B1BC 1LUVA 2P5OA 4LFBO 3GWOA 5LGUA 1Y74A 2Q0OC 5CA0A 5D5QA 1WPXA 1XL6A 3B8MA 3RYHA 3JALB 3ZHVA 3RGBA 4X1IA 1R1BA 1XDCA 4JYCA 2B1IA 5KHIA 2F95B 3Q4HA 3ASOB 1JR9A 5TISZ 4D7TA 1YVWA 4FLWA 2ITDC 5KUMA 1IZ3A 3E22B 1D5NA 3HKDA 5EYPA 1SQQH 1YTFB 5FNVA 2P7TC 2CAZC 4LF5O 2ZD9A 1JFFB 2Q7HA 4TV8A 2CDYA 2DMXA 4NTWA 3L72H 1O9GA 4X62B 4B3TO 2RDCA 2DYSB 3K5NA 2EZPA 3RYIB 3SYPA 2UUCB 4OX9B 3RFRA 4IL6Z 4LWSA 1UFIA 4X1YA 2ZKOA 3HKEB 4JI2O 1WB8A 1S5HC 1N0NA 4CS4A 2ZE5A 4IIJA 4EEQA 1YI2V 1AR4A 3RBZA 1EZJA 4LBEC 1K9MW 4RWUA 5LA6B 4DV2B 3TXSA 3BY6A 4JI2B 4JAUA 2QKCA 1IXMA 1BQ0A 4PI0A 4LF9O 4DUYO 2YEVA 1VQKV 3LUTB 2YIAA 3U0ZA 5LMUB 4GX1A 1WA8A 1DF5A 4ABMA 2WAMA 4DV2O 4X1KB 4IYIA 4PJ0Z 2CTPA 2LFRA 5L3CA 3SYOA 4FK5C 3WB2A 1NVPD 2IW5A 1XMOO 4LF9B 3ZX6A 4GKKB 1R6TA 3J81N 4XDKA 2XHBA 1RFYA 4JI4O 1TUBB 1B3QA 4QPJA 3WFVA 4UVBA 1XILA 1H2NA 5BZBA 2YDEA 3A0HZ 2Z0AA 3LNNA 4X88A 2HVJC 3F7VC 5F2VO 3UCSC 2GBOA 1FXKA 2W0XA 3CWBH 1ZUQA 3BAAA 1M4UA 4LNUB 1BGYH 3BPZA 4AI8A 2NLJC 1PL4A 3P3PA 1ZTEA 1DK1A 2EZOA 2F23A 3CRMA 4O4IB 3GB7C 1N32B 2PI5A 1IXBA 1WP8A 4QJFB 4FVMA 1XEQA 5DN6G 2ARHA 3OFNG 5CA1A 1H8HG 1FFTB 1BSMA 4LF8B 1TUBA 1BCCH 1N8RW 3CC2V 2JEXA 4FLXA 4JYBA 4D7SA 1N32O 4MSWC 3ZHSA 2QTOA 1MABG 1IX9A 3H9VA 3RYFB 2CE4A 1TAEA 4B7KA 3JAWA 2W6JG 3THOA 5IWAO 2LGQA 4G27B 2MK3A 3OR7C 4LP8A 3WU2Z 4X8AA 2IH1C 1URFA 4CC6A 3M7MX 3JAKA 5KA5A 3RT3C 2KKWA 5LP6B 3QTCA 3VBBA 2QE7G 4RO2A 4W4LA 4TUYA 4X1YB 3D3QA 3RW0A 1XL4A 3M99B 4J9YB 4MVOA 2CH7A 3RN4A 1AVMA 4X64B 1L0NH 1OHHG 5GTIZ 1HNZB 1BHAA 2UUCO 2BE3A 1Y67A 2XAFA 3SPIA 3VQWA 4A5UB 4DXWA 1IBMB 2HJDA 5A9GA 4B3SO 3R65A 2WA3A 3FB8C 4MTFA 4TOIA 2Q6AA 4GT1A 2Q0AA 3ABMC 4X64O 4DR1B 1NH2D 4J7JA 2WLKA 4RQEA 4ZI7A 1KD1W 1W59A 1JCHA 4WFAV 2VQFO 2Q7GA 1TA8A 1DLBA 4ICGA 3CRQA 4DR1O 1SQGA 2BOBC 5BXZA 2LGWA 4DV4O 1US6A 3W7XA 1ZWIC 3T2MA 3RVZA 4O4LA 1EN6A 2KB1A 3TCUA 1OCOB 1S5JA 1NTZH 3B4SA 2GDSA 4LF5B 3K79A 4DR2O 4ZOLB 4GLXA 3CRCA 4DR3O 2F66C 1HDJA 3CJHA 2QM4A 3P32A 1IURA 2E74B 5LGNA 3D3IA 3KZIZ 3E35A 2HEPA 4DV7O 3IAYA 1KP2A 4UVCA 2AHYA 1VF6C 1FXKC 1GH6A 5J2UA 1YDXA 1IBLB 2P90A 4D6TH 4J80A 2F93B 3IJ4A 1PKXA 4PD4F 1VQPV 2EJRA 4YJ2B 2WPDG 3ABKC 4WCEV 4LH7A 4R8CA 1N34O 1R6KA 2BTOA 3FD9A 3G80A 3L9DA 2EIJB 3CCUV 5LMUO 4DRXA 2LFSA 4MW8A 3ZCCA 3SDLA 3BHPA 2OIEA 4JI7B 4RUEA 1AJPA 4JI0B 4JYYA 5C93A 2JS5A 4FFKA 3JASA 4HZ3A 4PA7A 2MW2B 4JI4B 1HR0B 1YCIA 4H33A 4XDLA 2UUBB 3G67A 2PZSA 4JI1O 2EIKC 3X2QC 1ENVA 2KG7B 1YSCA 4HNAA 2JJ2G 5D5PA 4F6RB 1Q86W 3EFFK 1VF7A 2V4DA 1NZ6A 3CEIA 2ZNJA 2K9PA 4C7UA 1P84F 4OPAA 2OIGA 5KHHA 2HHHB 1IBKB 1AILA 1LR1A 3ASNC 3JSNA 4KL1A 1K7DA 4I0XB 2NN4A 3B77A 4HNAB 1R3KC 2WLLA 5GONA 5FPOA 4LF8O 1G6UA 3K5OA 3BFRA 1OV9A 3WB0A 1PNKA 5IYZB 3E89A 4UCSA 1QBZA 3H1LH 2H8PC 1GAXA 4O4LB 2ZR3A 5KAFZ 3PJSK 1MZEA 1TVKB 3LSUA 1JMKC 1BHBA 3APQA 4LF4O 3R66A 1J5EO 2UU9O 1THZA 4MVQA 1P7GA 4PDVA 3ZN1A 1ROPA 4B3TB 1H38A 1CP9A 4ZBMA 4LF7O 2N05A 4NB5A 3N27A 1AP6A 4BR6A 5BY1A 2AZ0A 2BCCH 3JCUZ 4O4HB 2Y0PA 3BEHA 2QEXV 5E1AC 4H0LB 2IBZH 5LXTA 1HNZO 3ZMTA 5H6RA 5H9CA 1AP5A 1M57B 1Y74B 4B3SB 1NT2B 2CTRA 1N36O 2ADPA 3CCSV 3QF7A 1MG1A 1VF5B 3N2GA 3CCRV 4DV7B 3ZEDA 4DO2A 3NXSA 1BE3H 3HKBA 4DRXB 5EK0A 2LW1A 3SJQC 4UUJC 4X65O 1L1FA 3ABUA 1NR7A 2EIJC 5DEDA 4WBNB 3CE2A 3ZBHA 1H2GA 2QM8A 2NNUA 3K08A 1K33A 4G28B 3L74H 5CN0A 4I9QA 2BTQA 1WA8B 4O4JB 4FFBB 2DQ0A 1TGOA 5KA6A 4FM1A 5IJ9A 2RCVA 4DK1A 4P9OA 4J42A 4F6RA 2UUAB 1U96A 4BIOA 4O2AA 3B09A 1Y76B 3CSXA 3SPJA 4JI3B 2GV9A 4Z1VA 4U3JB 1R6NA 3OEEG 1V9PA 4ZHQA 3L70H 4JYAB 1MMMA 4CS2A 1NH2B 1OCZC 1V55C 3T4DA 3H1HH 5KHGA 1K5SA 3GVMA 1VIBA 4JI3O 4UB8Z 4B3RO 4K0KB 4JYAO 1YITV 4FM2A 1M93A 2IJHA 1B04A 4DV5B 2ITCC 1XNRB 3QO8A 1E79G 1WNSA 4Q6GA 3WB1A 2HFEC 1M56B 2DJVA 1U97A 2Q7EA 3UM7A 3ZMZA 1H2KA 1S72V 4PDRA 1YHQV 3CYOA 2AW9A 5EC2C 1JQ0A 4DR4O 1VQ4V 4YXWG 5EC1C 5L3DA 1QVFU 4WFGA 2DQ3A 2QM7A 2CH7B 5LHIA 3ETQA 3D36A 5LHHA 5KAIZ 1AI6A 5JJEB 1SETA 1D5AA 2Q69A 2VWJA 1XNQO 2JGDA 2X0LA 1QNMA 1XMQB 3ETEA 5IYCO 3UT5B 5EIBC 2AHZA 1FD9A 3WG7B 1XHXA 1BMFG 4X20A 2RNBA 2XT9A 1G1XB 2ZNIA 3RWRD 4OX9O 3HKBB 4QPKA 3CCLV 1ORQC 2L35A 1GKFA 4CH5A 4L8JA 3SGIA 1N33O 4E2LA 3U11A 3AG4B 3KCYA 2GTSA 1NU1H 2UXDB 3K57A 5JQGB 3ZHUA 2YUAA 2UXXA 5CB4A 2X6AA 4PELA 1H2MA 3JD2A 4HAMA 4LWSB 1XBLA 2QDOA 5LA6A 1M90W 3ZJZA 3DGEA 4K35A 4GZRB 2P4KA 3L71H 4BIUA 2UXDO 1NKDA 3SYCA 3OE7G 4NXNB 2ZM6O 5JWPA 4Z1MG 3MHSC 2XTAA 2N04A 4LF7B 1AR5A 2UXBB 1QR9A 4DV3O 4TUYB 3T4ZA 4FZ1A 5EZYA 4CH6A 2Q67A 2UUAO 3JAWB 1WAZA 3E8HA 5B5EZ 1CPYA 1UJWB 1QR8A 3K59A 1IBLO 2Q68A 2WLHA 5J2TB 3BCCH 4CC5A 2QA4V 2FYUH 1V55B 5EBLC 3B2EE 2PGGA 3DC5A 4DYLA 3OUSA 2L6LA 1VMGA 3AG2C 4NKGB 1QLEC 2HVKC 2ZCEA 4MT8A 1RSOA 2R9IA 4DR6B 1G4YB 1VQ6V 1Z5VA 4K0KO 4H44B 1NJIW 4B7EA 1Q3EA 4TWKA 2ZQMA 4YIPA 1HNWO 1GN2A 1X4TA 3DXRA 1JJOA 2PTMA 3JARA 2JGUA 4DR6O 2XOKG 1MNGA 1P7BA 2DOSA 2Y48A 3JATA 4GX0A 4P30A 1S5LZ 3ICXA 4L87A 4E4EA 1Q5OA 4QNHB 1SZXA 2FL4A 4GYCB 2B5UA 4EFBA 2Y4UA 5LYJB 1MSWD 2KG7A 4JI8O 2HHHO 1YJNV 4JV5O 2R70A 2VQEO 3E86A 4PA3A 1SQVH 4AILC 1LNQA 2C2AA 3ZS8C 2ZT9B 2E3CA 5LP6A 3UT5A 2R9RB 1W0KG 2LQTA 3H1JH 2A79B 4QGPA 5DECA 4DR5O 4DV1O 2RQ6A 2KSDA 1Q6IA 1KP3A 1N33B 3A0BZ 2P6JA 4I7ZB 4CBCA 3WG7C 1ZLZA 4RQFA 3CD6V 3ZHTA 4UCTA 1QLNA 4DR5B 4OXSA 1VARA 2FTKA 3FAVA 4X66O 3BABA 2DYRC 2VQFB 3UQ8A 4K3AA 3RVYA 5E79Z 1VEWA 2YIBD 1PPJH 3HKCA 3LDDA 1S77D 4EB6B 2ZM6B 3T1HO 4BIZA 1IDSA 4F4LA 1K8AW 5IJ9B 2HR3A 2M7WA 3HB3B 3K9SA 1EZVH 5IDJA 5LMNO 1COWG 3F7YC 3OTOO 1R73A 2LW7A 2ZIMA 4LF6O 3BRCA 4UVAA 4WF9V 3ZMSA 5AG2A 3Q4HB 3UO2A 3I5DA 1E1QG 1LUWA 1JA8A 4JTCB 2JDIG 4GKJO 3OTOB 1SRYA 1Q43A 1WB7A 4IGGA 2G38A 3JCZA 5H5NA 2WLLB 1I0HA 2ZINA 5LBQA 4P9PA 4FLUA 2X6BA 4MVSA 3CHXA 1DTOA 1K34A 4TV9B 2BSKA 2VS0A 5JJNB 1IVSA 3RYIA 4GKJB 2H94A 3JD4A 3AG7A 2GUZB 2BOCC 4KXRA 1BZKA 3ASOC 1Q7YW 1XUQA 1S3JA 4GKKO 4IHJB 2AGAA 2JGDB 3SR2C 3AG3C 4GCZA 4UXNA 1F4MA 2A0LA 4FZ0A 4NXNO 2UXNA 3K5MA 5IE9A 2B1GA 2X6CA 4EKWA 3TXQA 3BA8A 3CCQV 1HNXO 1SZTA 3QG5A 3UKMA 4YIOA 5LXTB 3CCJV 4O2BA 2Q73A 1VQ8V 3VOUA 4I50A 4X1IB 1TVKA 4IYHA 5HFLA 4JI1B 4LR3A 4LFBB 3HKCB 3AG2B 2XUMA 1FJGO 3B8NA 4TT3G 2P22C 2A7WA 4DUZB 3M8AA 3EVKA 4PDMA 4FFBA 3OT7A 5KUKA 1PM9A 2FKXA 5H6QA 1CXZB 2CTQA 4F6EA 3L75H 2HG5C 1H2LA 4DR7O 5FLXN 1XOUA 2A06H 4FIPC 3K58A 1Q8IA 5KMGA 2BTQB 3HR0A 3ZRXA 3A8TA 1D2DA 1K5QA 4TQFA 5LOVA 3B40A 4AHCA 4X66B 1FKAO 4Q20A 2PYJA 1MZFA 3OW2U 1KC8W 3W7SA 4JI6O 1YJWV 1JJ2U 4R7CA 4U3JA 2ATKC 4MVMA 3JAMN 1S0VA 2EULA 1YXBA 1DF4A 4UCOA 1OCOC 2F4VB 1Y6XA 2EINB 1K73W 4RAIA 2E5LB 2QWQB 2OCCB 1QU7A 5FNVB 4ZHQB 4P2ZA 1PV0A 1RPOA 4IT5A 4ASUG 1OCRB
chains in the Genus database with same CATH topology
4OPHA 4LF4O 3R66A 4NXNO 1J5EO 2UU9O 2ZM6O 4DR5O 4JI3O 4DV1O 1XNRO 4B3RO 1HNXO 4LF7O 1FYJA 3RT3C 3J7AU 4YHHO 4JI5O 1AB3A 4JYAO 3O65A 4YY3O 4DV3O 5BY1A 2UUAO 4LF9O 4DUYO 1KUQA 1N34O 5LMUO 4KHPO 2JRIA 5BR8O 1HNZO 1IBLO 4DV2O 4X66O 3SDLA 3T1YO 2UUCO 1FJGO 3F5TA 2DJVA 4A5UB 4JI7O 4DUZO 1XMOO 1N36O 3M8AA 4B3SO 1R6TA 3J81N 4DR4O 2UXCO 5IT9N 4DV5O 4JI4O 1YZBA 4X64O 4LFBO 5A2QN 3T1HO 4JI1O 2FKXA 5LL6Y 4LFCO 1A32A 4X65O 2F4VO 4DV0O 1IBMO 4JI0O 2Z0AA 4K0KO 3J80N 2VQFO 4DR7O 5FLXN 4NXMO 5LMNO 3OTOO 1XNQO 2LW7A 1HNWO 1R1BA 4LF6O 4DR1O 4B3MO 5BXZA 1HR0O 2UUBO 4LFAO 1D2DA 4OPAA 4DV4O 1G1XB 1DK1A 4DR6O 1I94O 1FKAO 1IBKO 2E5LO 4OX9O 1AILA 2DOSA 1XEQA 4GKJO 4JI6O 1N33O 1NS1A 1F7YA 5H5NA 4DR2O 4LF8O 4AQYO 3JAMN 4LF5O 1X59A 4DR3O 4B3TO 4X62O 1N32O 4JI8O 2HHHO 4JV5O 4DV6O 2VQEO 2ZKOA 4JI2O 2UXBO 4GKKO 2AGAA 5IWAO 4DV7O 2N74A 1XMQO 2UXDO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  4LF4 O;  3R66 A;  4NXN O;  1J5E O;  2UU9 O;  2ZM6 O;  4DR5 O;  4JI3 O;  4DV1 O;  1XNR O;  4B3R O;  1HNX O;  4LF7 O;  1FYJ A;  3RT3 C;  3J7A U;  4YHH O;  4JI5 O;  1AB3 A;  4JYA O;  3O65 A;  4YY3 O;  4DV3 O;  5BY1 A;  2UUA O;  4LF9 O;  4DUY O;  1KUQ A;  1N34 O;  5LMU O;  4KHP O;  2JRI A;  5BR8 O;  1HNZ O;  1IBL O;  4DV2 O;  4X66 O;  3SDL A;  3T1Y O;  2UUC O;  1FJG O;  3F5T A;  2DJV A;  4A5U B;  4JI7 O;  4DUZ O;  1XMO O;  1N36 O;  3M8A A;  4B3S O;  1R6T A;  3J81 N;  4DR4 O;  2UXC O;  5IT9 N;  4DV5 O;  4JI4 O;  1YZB A;  4X64 O;  4LFB O;  5A2Q N;  3T1H O;  4JI1 O;  2FKX A;  5LL6 Y;  4LFC O;  1A32 A;  4X65 O;  2F4V O;  4DV0 O;  1IBM O;  4JI0 O;  2Z0A A;  4K0K O;  3J80 N;  2VQF O;  4DR7 O;  5FLX N;  4NXM O;  5LMN O;  3OTO O;  1XNQ O;  2LW7 A;  1HNW O;  1R1B A;  4LF6 O;  4DR1 O;  4B3M O;  5BXZ A;  1HR0 O;  2UUB O;  4LFA O;  1D2D A;  4OPA A;  4DV4 O;  1G1X B;  1DK1 A;  4DR6 O;  1I94 O;  1FKA O;  1IBK O;  2E5L O;  4OX9 O;  1AIL A;  2DOS A;  1XEQ A;  4GKJ O;  4JI6 O;  1N33 O;  1NS1 A;  1F7Y A;  5H5N A;  4DR2 O;  4LF8 O;  4AQY O;  3JAM N;  4LF5 O;  1X59 A;  4DR3 O;  4B3T O;  4X62 O;  1N32 O;  4JI8 O;  2HHH O;  4JV5 O;  4DV6 O;  2VQE O;  2ZKO A;  4JI2 O;  2UXB O;  4GKK O;  2AGA A;  5IWA O;  4DV7 O;  2N74 A;  1XMQ O;  2UXD O; 
#chains in the Genus database with same CATH topology
 2DWE C;  3OMA B;  3OUF A;  1HP8 A;  4DW0 A;  2QWR B;  3CP1 A;  1VQN V;  1OCR C;  3MHH C;  3ABK B;  2IM9 A;  4PHZ A;  1FYJ A;  3J7A U;  4NTY A;  1N0J A;  2EIK B;  3X2Q B;  2EIN C;  2VRZ A;  3ZIA G;  1NI8 A;  3GWK C;  3SPH A;  1FXK B;  1ZX3 A;  3IFX A;  1SS3 A;  2JRI A;  3SYA A;  1FFX B;  5JVD A;  1NQT A;  3QVN A;  3LSQ A;  4JI7 O;  3E83 A;  4JI5 B;  1YTF D;  3CC4 V;  4IIJ B;  2EJ7 A;  3E22 A;  3ZRW A;  2R72 A;  3VQV A;  3W7W A;  4UB6 Z;  3ETG A;  3OTF A;  2Q9L A;  1ZSP A;  3SJA C;  4MVR A;  5JCO C;  5LP6 C;  4DV0 B;  5FPR A;  3ZN0 A;  2IJK A;  3P3N A;  3HPL C;  3STZ C;  1RM1 C;  3ABT A;  1P4R A;  1RPR A;  4MS2 A;  3SJB C;  5B66 Z;  2W0F C;  4NYK A;  4PA9 A;  1VQM V;  2OT5 A;  5JH7 A;  3D8C A;  3FFQ A;  4YJ3 B;  4W4K A;  5IJ0 B;  1XRE A;  1M1K W;  1AR1 B;  3CS5 A;  1FJG B;  1Q81 W;  2XAS A;  4WFF A;  3OD4 A;  5GON B;  1M56 C;  3K0G A;  1L0L H;  1QLE B;  4ZOL A;  1M9N A;  4DW1 A;  2HP8 A;  4PA4 A;  5IYZ A;  2Y0I A;  5CMU A;  5C8Y A;  2ETN A;  1AI4 A;  1KMI Z;  3I55 V;  1SKV A;  2IH3 C;  3FB5 C;  4JAA A;  3I56 V;  5KMG B;  4PI2 A;  2HLD G;  4OPH A;  1EN4 A;  3AK3 A;  5IYB O;  4JAS A;  4FMT A;  3OM3 B;  4TSF G;  4FLV A;  5B1O A;  2VQE B;  4I0X A;  4JI6 B;  2D2C B;  4I55 A;  1B6Q A;  5L3E A;  2ILM A;  1GM9 A;  2RJZ A;  1RM1 B;  4DR4 B;  3OGC C;  2R9A A;  2QR4 A;  4JGS A;  1QQC A;  4U7N A;  4X89 A;  3IC9 A;  5K1X A;  2GTA A;  5CB4 B;  3K3W A;  4LC1 A;  1I94 B;  1HW7 A;  2Q5Z A;  4N23 A;  4WFH A;  3S3W A;  4DUZ O;  4BAY A;  1XNQ B;  3K04 A;  3K5L A;  3EHB B;  3ABM B;  3G4S V;  4FLT A;  2DYR B;  5IT9 N;  3K06 A;  1GM8 A;  1SQF A;  2YIB A;  2YIC A;  1OJH A;  2EIM C;  4LFC O;  5LGT A;  4X65 B;  1KB9 F;  4H37 A;  1IBM O;  5IJ0 A;  4NXM O;  3CCE V;  3FB6 C;  4N21 A;  2XND G;  1Y4M A;  1ZAU A;  1NTK H;  4ZIB A;  4H13 B;  1HWY A;  2HJF C;  2DWD C;  4EB6 A;  1H8E G;  5EBM C;  4CH4 A;  2QKS A;  1PD3 A;  2XAH A;  2PY5 A;  2HKO A;  3SPG A;  1SER A;  1Y76 A;  1SA0 B;  3O9O A;  3AG1 B;  2QWO B;  2VWK A;  2JEU A;  4PA6 A;  4MVU A;  2XAG A;  1XQ8 A;  2P67 A;  4PDL A;  2YXY A;  3JYC A;  3JAT B;  2CGN A;  1PL0 A;  3G6E V;  1VF6 A;  3CXH F;  3C90 A;  1K92 A;  3CC7 V;  1FXH A;  4XBF A;  3NR7 A;  3K03 A;  3E8B A;  1GK9 A;  1NBM G;  3RYC B;  4YY3 O;  2WLJ A;  2GUZ A;  2CK3 G;  2YEV B;  3JAL A;  3DC6 A;  4I4T B;  1BQZ A;  2YID A;  1FXV A;  4KHP B;  2BSK B;  2EIM B;  4Z2W A;  1O9H A;  3OMI B;  3AK1 A;  3ZHQ A;  4YY3 B;  4KFM A;  5CBG A;  4JPR A;  3FYI B;  5IWA B;  2H3O A;  1N34 B;  2P06 A;  5EYP B;  1I08 A;  1FAF A;  1L8D A;  1FPO A;  1SF9 A;  1F4N A;  5LL6 Y;  4DV0 O;  3IC7 A;  4JI0 O;  2ZDI A;  2JIZ G;  2LP7 A;  2ZDI C;  3CME V;  2YS8 A;  3DSQ A;  3MDS A;  3ZMU A;  4B3M O;  4LNU A;  4X20 B;  3FX7 A;  3FYE B;  3E2E A;  3H1K H;  1I94 O;  2M6Y A;  4B3R B;  1I5Y A;  2ZE6 A;  2YI8 A;  2A9H A;  3N2K A;  1KYO F;  4AQY O;  3ML0 A;  5JJJ B;  4O2A B;  1F23 A;  4LFC B;  1YEW A;  3RYC A;  3AG4 C;  4EFE A;  1KBH A;  1DGS A;  3UO3 A;  3ZMV A;  2EIL B;  5EBW C;  2Z3Y A;  5CBF A;  4QIW F;  5J9P C;  1YJ9 V;  3L73 H;  1Q6H A;  4CH3 A;  2JJ1 G;  4J7Z A;  2JS3 A;  1QCE A;  3TET A;  2X7R B;  1ZL8 A;  2WLN A;  4YHH O;  1AB3 A;  4WBN A;  3O65 A;  3BA9 A;  3ZRW B;  1SES A;  1K3E A;  4DR2 B;  1JPX A;  1SC5 B;  5DM6 V;  1J5E B;  2UU9 B;  2YSU B;  3TJT A;  2PF4 E;  2WLM A;  4G2K A;  4UCR A;  4ZKI A;  3CRA A;  1QVG U;  3FAV B;  3T1Y O;  4J10 A;  2DYS C;  3QO5 A;  3F5T A;  1VQ9 V;  3ETD A;  5LMN B;  1AI7 A;  4NTX A;  1KQS U;  2XAQ A;  5FL7 G;  2OTJ V;  3JD0 A;  2Q8V A;  2ZXW C;  1JFF A;  4J11 A;  4TV8 B;  3U10 A;  3VQX A;  4UCV A;  4UV8 A;  3SJC C;  2OTL V;  4FLZ A;  4R6Z A;  4DV6 B;  5H2F Z;  3J80 N;  2DW4 A;  2AZ2 A;  1RP3 B;  1GO3 F;  1B06 A;  2JK5 C;  3JAR B;  5GTH Z;  1K97 A;  5JVD B;  1FFX A;  2WWW A;  4O4J A;  1SQP H;  3OGI B;  3JAK B;  1PP9 H;  5CA0 B;  2E76 B;  1F7Y A;  1UPG A;  2A3Q A;  2QTS A;  3VQY A;  2KQX A;  3CJH B;  5CBH A;  1HNX B;  4JV5 B;  1BL8 A;  3H01 A;  1GRJ A;  3APO A;  1Y66 A;  2YI9 A;  3CX5 F;  3N2K B;  5JCO A;  4B3M B;  5KLV H;  3LDE A;  4X1K A;  4MTO A;  1XNR O;  3MAQ A;  5BMV B;  2O57 A;  2Z5U A;  4HYO A;  3H1I H;  4FM0 A;  4I9W A;  4MVZ A;  3TGU H;  2PI4 A;  1PNM A;  4FJC C;  4QE7 A;  4KHP O;  2EIL C;  2WLI A;  2V7Q G;  3E8G A;  3AK2 A;  1I7F A;  2IU3 A;  2F1M A;  3C3T A;  5B1N A;  3F5W C;  4TQD A;  3PN1 A;  1GN4 A;  5JH7 B;  1H2S B;  1YZB A;  1AJQ A;  4LF4 B;  2UXC B;  1GTO A;  2V1D A;  3D36 C;  3CCV V;  3T1H B;  1A32 A;  1BS3 A;  2PYL A;  2DE0 X;  4GUN A;  3P30 A;  2QWP B;  2ODM A;  3SYQ A;  4LF6 B;  3AEI A;  4LFA O;  4X9Q A;  1S76 D;  2RMK B;  2IJJ A;  5B1B B;  5LHG A;  3T1Y B;  1IBK O;  2E5L O;  2K1E A;  3AG3 B;  4RUF A;  2ZE7 A;  1FS0 G;  3KG2 A;  4UV9 A;  4NXM B;  2QWN B;  2ZXW B;  1X59 A;  3FB7 C;  3OAA G;  2Y4T A;  1WPB A;  5BR8 B;  2ZIO A;  4DV4 B;  1AJN A;  2F43 G;  4KP4 A;  3OEH G;  4DV6 O;  1EBO A;  4JTD B;  2UXB O;  4LH6 A;  5B3S B;  3EXA A;  3N2G B;  4I55 B;  1I5X A;  4DR3 B;  2QJ1 A;  2RN9 A;  4YJ3 A;  3KCX A;  2YXH A;  5IYD O;  1F51 A;  2D3O W;  4JI5 O;  2GSM B;  4ZI7 B;  1R3L C;  1EN5 A;  1P49 A;  2ADQ B;  4CS3 A;  5CA3 A;  3ABL C;  1JVM A;  1KKD A;  1OCC C;  1GMG A;  1SA0 A;  2Q4P A;  4WFE A;  3IGA C;  3JD1 A;  1OCZ B;  5KHK A;  4UCU A;  3CXC U;  3MD0 A;  2FB5 A;  5L3G A;  5ITZ A;  4DV3 B;  1RSO B;  1N36 B;  1Q90 D;  4IHJ A;  3CCM V;  1M57 C;  4K8X A;  1K4C C;  3ASN B;  4CZZ A;  1HNW B;  1Z5W A;  1KKC A;  4O4I A;  5BMV A;  4NR1 A;  5GW7 A;  5KX5 B;  1ZL8 B;  2FML A;  4JTA B;  1YF2 A;  1NTM H;  3QO7 A;  4KUM A;  1ARO P;  1Z2G A;  3FKS G;  4U3F H;  3DXR B;  5KHJ A;  1NR1 A;  1HR0 O;  2UUB O;  3OMN B;  1V54 C;  1VQ5 V;  1OZ0 A;  4MTX A;  1VQL V;  4FLY A;  4R50 A;  1R3I C;  3LDC A;  4JZ2 A;  5ITZ B;  1T5E A;  3K0D A;  5IY5 C;  1NS1 A;  2EBO A;  4J7K A;  1NVP B;  4K8Z A;  2OCC C;  1EFR G;  1W2B U;  1MA1 A;  1CEZ A;  5L3F A;  2QSA A;  4X62 O;  5HFM A;  2LJ2 A;  5K1P A;  4DV1 B;  3G6B A;  1JX9 A;  4HBN A;  5J2T A;  4UFZ A;  1E1R G;  4I4T A;  3CPW U;  3SPC A;  1R3J C;  3ZHR A;  3ABL B;  1XMQ O;  4AQY B;  5LYJ A;  3QNE A;  2OWO A;  5LOV B;  2P4V A;  4I5S A;  5IY5 B;  2LO1 A;  4JI8 B;  2CTW A;  4XDJ A;  1SQB H;  2GHY A;  4WFB V;  2NR5 A;  3ZRS A;  4DR7 B;  4GX2 A;  4O2B B;  1WP7 A;  3RYH B;  3RYF A;  1M5I A;  3JSL A;  5EIB D;  5B3S C;  1KUQ A;  2CGO A;  3K9A A;  1JOY A;  3OR6 C;  4JZG A;  3W7T A;  1WJZ A;  5C8Y B;  1EM1 A;  1J95 A;  5BR8 O;  1YIJ V;  4LCU C;  1SQX H;  3CMA V;  3A0R A;  1MSD A;  5B1A B;  1GM7 A;  2YXL A;  1WN7 A;  2IU0 A;  4YHH B;  5CA1 B;  4MTG A;  4QE9 A;  3S3X A;  2OYQ A;  3ZRV A;  1VQO V;  2Y69 B;  2UXC O;  2ZR2 A;  3CRR A;  1V54 B;  4J9Z B;  5A2Q N;  2XAJ A;  3CB2 A;  2F4V O;  1K4D C;  4U7O A;  3A2F A;  3E8F A;  3TK1 A;  1OCC B;  2E75 B;  4DK0 A;  4OGQ B;  2JVD A;  4LFA B;  1QHT A;  3LNM B;  3JD3 A;  3W7U A;  1W0J G;  2ZE8 A;  3BVO A;  3HKE A;  2YC0 A;  2PUS A;  2QGN A;  4JAV A;  1PNL A;  2WA4 A;  4B08 A;  5L3B A;  5JQG A;  4J41 A;  4TV9 A;  5KX5 A;  2Y69 C;  2EX3 A;  3C3S A;  3DTU B;  1XHZ A;  2WSS G;  1WLE A;  1GN6 A;  5B1A C;  1GN3 A;  1BT8 A;  1XMO B;  2OCH A;  1VP7 A;  4JF3 A;  1AI5 A;  4GX5 A;  2N74 A;  4DUY B;  3HKD B;  4BW5 A;  1N4C A;  4NVP A;  5J2U B;  1Q6U A;  1XI1 A;  1Q82 W;  1VQ7 V;  2IJI A;  3STL C;  5EZY B;  1KU9 A;  4I50 B;  1MOF A;  2CUG A;  2AXT Z;  3AG1 C;  3KKY A;  3LSS A;  3T1C A;  2WLI B;  4FPP A;  2DN9 A;  4MW3 A;  2W6I G;  4BWA A;  3G71 V;  3JAS B;  1KEC A;  2B9Z A;  4O4H A;  4PV1 B;  4YJ2 A;  1G8M A;  4BW9 A;  1TUE B;  4DV5 O;  2QKA A;  5B1B C;  1LUV A;  2P5O A;  4LFB O;  3GWO A;  5LGU A;  1Y74 A;  2Q0O C;  5CA0 A;  5D5Q A;  1WPX A;  1XL6 A;  3B8M A;  3RYH A;  3JAL B;  3ZHV A;  3RGB A;  4X1I A;  1R1B A;  1XDC A;  4JYC A;  2B1I A;  5KHI A;  2F95 B;  3Q4H A;  3ASO B;  1JR9 A;  5TIS Z;  4D7T A;  1YVW A;  4FLW A;  2ITD C;  5KUM A;  1IZ3 A;  3E22 B;  1D5N A;  3HKD A;  5EYP A;  1SQQ H;  1YTF B;  5FNV A;  2P7T C;  2CAZ C;  4LF5 O;  2ZD9 A;  1JFF B;  2Q7H A;  4TV8 A;  2CDY A;  2DMX A;  4NTW A;  3L72 H;  1O9G A;  4X62 B;  4B3T O;  2RDC A;  2DYS B;  3K5N A;  2EZP A;  3RYI B;  3SYP A;  2UUC B;  4OX9 B;  3RFR A;  4IL6 Z;  4LWS A;  1UFI A;  4X1Y A;  2ZKO A;  3HKE B;  4JI2 O;  1WB8 A;  1S5H C;  1N0N A;  4CS4 A;  2ZE5 A;  4IIJ A;  4EEQ A;  1YI2 V;  1AR4 A;  3RBZ A;  1EZJ A;  4LBE C;  1K9M W;  4RWU A;  5LA6 B;  4DV2 B;  3TXS A;  3BY6 A;  4JI2 B;  4JAU A;  2QKC A;  1IXM A;  1BQ0 A;  4PI0 A;  4LF9 O;  4DUY O;  2YEV A;  1VQK V;  3LUT B;  2YIA A;  3U0Z A;  5LMU B;  4GX1 A;  1WA8 A;  1DF5 A;  4ABM A;  2WAM A;  4DV2 O;  4X1K B;  4IYI A;  4PJ0 Z;  2CTP A;  2LFR A;  5L3C A;  3SYO A;  4FK5 C;  3WB2 A;  1NVP D;  2IW5 A;  1XMO O;  4LF9 B;  3ZX6 A;  4GKK B;  1R6T A;  3J81 N;  4XDK A;  2XHB A;  1RFY A;  4JI4 O;  1TUB B;  1B3Q A;  4QPJ A;  3WFV A;  4UVB A;  1XIL A;  1H2N A;  5BZB A;  2YDE A;  3A0H Z;  2Z0A A;  3LNN A;  4X88 A;  2HVJ C;  3F7V C;  5F2V O;  3UCS C;  2GBO A;  1FXK A;  2W0X A;  3CWB H;  1ZUQ A;  3BAA A;  1M4U A;  4LNU B;  1BGY H;  3BPZ A;  4AI8 A;  2NLJ C;  1PL4 A;  3P3P A;  1ZTE A;  1DK1 A;  2EZO A;  2F23 A;  3CRM A;  4O4I B;  3GB7 C;  1N32 B;  2PI5 A;  1IXB A;  1WP8 A;  4QJF B;  4FVM A;  1XEQ A;  5DN6 G;  2ARH A;  3OFN G;  5CA1 A;  1H8H G;  1FFT B;  1BSM A;  4LF8 B;  1TUB A;  1BCC H;  1N8R W;  3CC2 V;  2JEX A;  4FLX A;  4JYB A;  4D7S A;  1N32 O;  4MSW C;  3ZHS A;  2QTO A;  1MAB G;  1IX9 A;  3H9V A;  3RYF B;  2CE4 A;  1TAE A;  4B7K A;  3JAW A;  2W6J G;  3THO A;  5IWA O;  2LGQ A;  4G27 B;  2MK3 A;  3OR7 C;  4LP8 A;  3WU2 Z;  4X8A A;  2IH1 C;  1URF A;  4CC6 A;  3M7M X;  3JAK A;  5KA5 A;  3RT3 C;  2KKW A;  5LP6 B;  3QTC A;  3VBB A;  2QE7 G;  4RO2 A;  4W4L A;  4TUY A;  4X1Y B;  3D3Q A;  3RW0 A;  1XL4 A;  3M99 B;  4J9Y B;  4MVO A;  2CH7 A;  3RN4 A;  1AVM A;  4X64 B;  1L0N H;  1OHH G;  5GTI Z;  1HNZ B;  1BHA A;  2UUC O;  2BE3 A;  1Y67 A;  2XAF A;  3SPI A;  3VQW A;  4A5U B;  4DXW A;  1IBM B;  2HJD A;  5A9G A;  4B3S O;  3R65 A;  2WA3 A;  3FB8 C;  4MTF A;  4TOI A;  2Q6A A;  4GT1 A;  2Q0A A;  3ABM C;  4X64 O;  4DR1 B;  1NH2 D;  4J7J A;  2WLK A;  4RQE A;  4ZI7 A;  1KD1 W;  1W59 A;  1JCH A;  4WFA V;  2VQF O;  2Q7G A;  1TA8 A;  1DLB A;  4ICG A;  3CRQ A;  4DR1 O;  1SQG A;  2BOB C;  5BXZ A;  2LGW A;  4DV4 O;  1US6 A;  3W7X A;  1ZWI C;  3T2M A;  3RVZ A;  4O4L A;  1EN6 A;  2KB1 A;  3TCU A;  1OCO B;  1S5J A;  1NTZ H;  3B4S A;  2GDS A;  4LF5 B;  3K79 A;  4DR2 O;  4ZOL B;  4GLX A;  3CRC A;  4DR3 O;  2F66 C;  1HDJ A;  3CJH A;  2QM4 A;  3P32 A;  1IUR A;  2E74 B;  5LGN A;  3D3I A;  3KZI Z;  3E35 A;  2HEP A;  4DV7 O;  3IAY A;  1KP2 A;  4UVC A;  2AHY A;  1VF6 C;  1FXK C;  1GH6 A;  5J2U A;  1YDX A;  1IBL B;  2P90 A;  4D6T H;  4J80 A;  2F93 B;  3IJ4 A;  1PKX A;  4PD4 F;  1VQP V;  2EJR A;  4YJ2 B;  2WPD G;  3ABK C;  4WCE V;  4LH7 A;  4R8C A;  1N34 O;  1R6K A;  2BTO A;  3FD9 A;  3G80 A;  3L9D A;  2EIJ B;  3CCU V;  5LMU O;  4DRX A;  2LFS A;  4MW8 A;  3ZCC A;  3SDL A;  3BHP A;  2OIE A;  4JI7 B;  4RUE A;  1AJP A;  4JI0 B;  4JYY A;  5C93 A;  2JS5 A;  4FFK A;  3JAS A;  4HZ3 A;  4PA7 A;  2MW2 B;  4JI4 B;  1HR0 B;  1YCI A;  4H33 A;  4XDL A;  2UUB B;  3G67 A;  2PZS A;  4JI1 O;  2EIK C;  3X2Q C;  1ENV A;  2KG7 B;  1YSC A;  4HNA A;  2JJ2 G;  5D5P A;  4F6R B;  1Q86 W;  3EFF K;  1VF7 A;  2V4D A;  1NZ6 A;  3CEI A;  2ZNJ A;  2K9P A;  4C7U A;  1P84 F;  4OPA A;  2OIG A;  5KHH A;  2HHH B;  1IBK B;  1AIL A;  1LR1 A;  3ASN C;  3JSN A;  4KL1 A;  1K7D A;  4I0X B;  2NN4 A;  3B77 A;  4HNA B;  1R3K C;  2WLL A;  5GON A;  5FPO A;  4LF8 O;  1G6U A;  3K5O A;  3BFR A;  1OV9 A;  3WB0 A;  1PNK A;  5IYZ B;  3E89 A;  4UCS A;  1QBZ A;  3H1L H;  2H8P C;  1GAX A;  4O4L B;  2ZR3 A;  5KAF Z;  3PJS K;  1MZE A;  1TVK B;  3LSU A;  1JMK C;  1BHB A;  3APQ A;  4LF4 O;  3R66 A;  1J5E O;  2UU9 O;  1THZ A;  4MVQ A;  1P7G A;  4PDV A;  3ZN1 A;  1ROP A;  4B3T B;  1H38 A;  1CP9 A;  4ZBM A;  4LF7 O;  2N05 A;  4NB5 A;  3N27 A;  1AP6 A;  4BR6 A;  5BY1 A;  2AZ0 A;  2BCC H;  3JCU Z;  4O4H B;  2Y0P A;  3BEH A;  2QEX V;  5E1A C;  4H0L B;  2IBZ H;  5LXT A;  1HNZ O;  3ZMT A;  5H6R A;  5H9C A;  1AP5 A;  1M57 B;  1Y74 B;  4B3S B;  1NT2 B;  2CTR A;  1N36 O;  2ADP A;  3CCS V;  3QF7 A;  1MG1 A;  1VF5 B;  3N2G A;  3CCR V;  4DV7 B;  3ZED A;  4DO2 A;  3NXS A;  1BE3 H;  3HKB A;  4DRX B;  5EK0 A;  2LW1 A;  3SJQ C;  4UUJ C;  4X65 O;  1L1F A;  3ABU A;  1NR7 A;  2EIJ C;  5DED A;  4WBN B;  3CE2 A;  3ZBH A;  1H2G A;  2QM8 A;  2NNU A;  3K08 A;  1K33 A;  4G28 B;  3L74 H;  5CN0 A;  4I9Q A;  2BTQ A;  1WA8 B;  4O4J B;  4FFB B;  2DQ0 A;  1TGO A;  5KA6 A;  4FM1 A;  5IJ9 A;  2RCV A;  4DK1 A;  4P9O A;  4J42 A;  4F6R A;  2UUA B;  1U96 A;  4BIO A;  4O2A A;  3B09 A;  1Y76 B;  3CSX A;  3SPJ A;  4JI3 B;  2GV9 A;  4Z1V A;  4U3J B;  1R6N A;  3OEE G;  1V9P A;  4ZHQ A;  3L70 H;  4JYA B;  1MMM A;  4CS2 A;  1NH2 B;  1OCZ C;  1V55 C;  3T4D A;  3H1H H;  5KHG A;  1K5S A;  3GVM A;  1VIB A;  4JI3 O;  4UB8 Z;  4B3R O;  4K0K B;  4JYA O;  1YIT V;  4FM2 A;  1M93 A;  2IJH A;  1B04 A;  4DV5 B;  2ITC C;  1XNR B;  3QO8 A;  1E79 G;  1WNS A;  4Q6G A;  3WB1 A;  2HFE C;  1M56 B;  2DJV A;  1U97 A;  2Q7E A;  3UM7 A;  3ZMZ A;  1H2K A;  1S72 V;  4PDR A;  1YHQ V;  3CYO A;  2AW9 A;  5EC2 C;  1JQ0 A;  4DR4 O;  1VQ4 V;  4YXW G;  5EC1 C;  5L3D A;  1QVF U;  4WFG A;  2DQ3 A;  2QM7 A;  2CH7 B;  5LHI A;  3ETQ A;  3D36 A;  5LHH A;  5KAI Z;  1AI6 A;  5JJE B;  1SET A;  1D5A A;  2Q69 A;  2VWJ A;  1XNQ O;  2JGD A;  2X0L A;  1QNM A;  1XMQ B;  3ETE A;  5IYC O;  3UT5 B;  5EIB C;  2AHZ A;  1FD9 A;  3WG7 B;  1XHX A;  1BMF G;  4X20 A;  2RNB A;  2XT9 A;  1G1X B;  2ZNI A;  3RWR D;  4OX9 O;  3HKB B;  4QPK A;  3CCL V;  1ORQ C;  2L35 A;  1GKF A;  4CH5 A;  4L8J A;  3SGI A;  1N33 O;  4E2L A;  3U11 A;  3AG4 B;  3KCY A;  2GTS A;  1NU1 H;  2UXD B;  3K57 A;  5JQG B;  3ZHU A;  2YUA A;  2UXX A;  5CB4 A;  2X6A A;  4PEL A;  1H2M A;  3JD2 A;  4HAM A;  4LWS B;  1XBL A;  2QDO A;  5LA6 A;  1M90 W;  3ZJZ A;  3DGE A;  4K35 A;  4GZR B;  2P4K A;  3L71 H;  4BIU A;  2UXD O;  1NKD A;  3SYC A;  3OE7 G;  4NXN B;  2ZM6 O;  5JWP A;  4Z1M G;  3MHS C;  2XTA A;  2N04 A;  4LF7 B;  1AR5 A;  2UXB B;  1QR9 A;  4DV3 O;  4TUY B;  3T4Z A;  4FZ1 A;  5EZY A;  4CH6 A;  2Q67 A;  2UUA O;  3JAW B;  1WAZ A;  3E8H A;  5B5E Z;  1CPY A;  1UJW B;  1QR8 A;  3K59 A;  1IBL O;  2Q68 A;  2WLH A;  5J2T B;  3BCC H;  4CC5 A;  2QA4 V;  2FYU H;  1V55 B;  5EBL C;  3B2E E;  2PGG A;  3DC5 A;  4DYL A;  3OUS A;  2L6L A;  1VMG A;  3AG2 C;  4NKG B;  1QLE C;  2HVK C;  2ZCE A;  4MT8 A;  1RSO A;  2R9I A;  4DR6 B;  1G4Y B;  1VQ6 V;  1Z5V A;  4K0K O;  4H44 B;  1NJI W;  4B7E A;  1Q3E A;  4TWK A;  2ZQM A;  4YIP A;  1HNW O;  1GN2 A;  1X4T A;  3DXR A;  1JJO A;  2PTM A;  3JAR A;  2JGU A;  4DR6 O;  2XOK G;  1MNG A;  1P7B A;  2DOS A;  2Y48 A;  3JAT A;  4GX0 A;  4P30 A;  1S5L Z;  3ICX A;  4L87 A;  4E4E A;  1Q5O A;  4QNH B;  1SZX A;  2FL4 A;  4GYC B;  2B5U A;  4EFB A;  2Y4U A;  5LYJ B;  1MSW D;  2KG7 A;  4JI8 O;  2HHH O;  1YJN V;  4JV5 O;  2R70 A;  2VQE O;  3E86 A;  4PA3 A;  1SQV H;  4AIL C;  1LNQ A;  2C2A A;  3ZS8 C;  2ZT9 B;  2E3C A;  5LP6 A;  3UT5 A;  2R9R B;  1W0K G;  2LQT A;  3H1J H;  2A79 B;  4QGP A;  5DEC A;  4DR5 O;  4DV1 O;  2RQ6 A;  2KSD A;  1Q6I A;  1KP3 A;  1N33 B;  3A0B Z;  2P6J A;  4I7Z B;  4CBC A;  3WG7 C;  1ZLZ A;  4RQF A;  3CD6 V;  3ZHT A;  4UCT A;  1QLN A;  4DR5 B;  4OXS A;  1VAR A;  2FTK A;  3FAV A;  4X66 O;  3BAB A;  2DYR C;  2VQF B;  3UQ8 A;  4K3A A;  3RVY A;  5E79 Z;  1VEW A;  2YIB D;  1PPJ H;  3HKC A;  3LDD A;  1S77 D;  4EB6 B;  2ZM6 B;  3T1H O;  4BIZ A;  1IDS A;  4F4L A;  1K8A W;  5IJ9 B;  2HR3 A;  2M7W A;  3HB3 B;  3K9S A;  1EZV H;  5IDJ A;  5LMN O;  1COW G;  3F7Y C;  3OTO O;  1R73 A;  2LW7 A;  2ZIM A;  4LF6 O;  3BRC A;  4UVA A;  4WF9 V;  3ZMS A;  5AG2 A;  3Q4H B;  3UO2 A;  3I5D A;  1E1Q G;  1LUW A;  1JA8 A;  4JTC B;  2JDI G;  4GKJ O;  3OTO B;  1SRY A;  1Q43 A;  1WB7 A;  4IGG A;  2G38 A;  3JCZ A;  5H5N A;  2WLL B;  1I0H A;  2ZIN A;  5LBQ A;  4P9P A;  4FLU A;  2X6B A;  4MVS A;  3CHX A;  1DTO A;  1K34 A;  4TV9 B;  2BSK A;  2VS0 A;  5JJN B;  1IVS A;  3RYI A;  4GKJ B;  2H94 A;  3JD4 A;  3AG7 A;  2GUZ B;  2BOC C;  4KXR A;  1BZK A;  3ASO C;  1Q7Y W;  1XUQ A;  1S3J A;  4GKK O;  4IHJ B;  2AGA A;  2JGD B;  3SR2 C;  3AG3 C;  4GCZ A;  4UXN A;  1F4M A;  2A0L A;  4FZ0 A;  4NXN O;  2UXN A;  3K5M A;  5IE9 A;  2B1G A;  2X6C A;  4EKW A;  3TXQ A;  3BA8 A;  3CCQ V;  1HNX O;  1SZT A;  3QG5 A;  3UKM A;  4YIO A;  5LXT B;  3CCJ V;  4O2B A;  2Q73 A;  1VQ8 V;  3VOU A;  4I50 A;  4X1I B;  1TVK A;  4IYH A;  5HFL A;  4JI1 B;  4LR3 A;  4LFB B;  3HKC B;  3AG2 B;  2XUM A;  1FJG O;  3B8N A;  4TT3 G;  2P22 C;  2A7W A;  4DUZ B;  3M8A A;  3EVK A;  4PDM A;  4FFB A;  3OT7 A;  5KUK A;  1PM9 A;  2FKX A;  5H6Q A;  1CXZ B;  2CTQ A;  4F6E A;  3L75 H;  2HG5 C;  1H2L A;  4DR7 O;  5FLX N;  1XOU A;  2A06 H;  4FIP C;  3K58 A;  1Q8I A;  5KMG A;  2BTQ B;  3HR0 A;  3ZRX A;  3A8T A;  1D2D A;  1K5Q A;  4TQF A;  5LOV A;  3B40 A;  4AHC A;  4X66 B;  1FKA O;  4Q20 A;  2PYJ A;  1MZF A;  3OW2 U;  1KC8 W;  3W7S A;  4JI6 O;  1YJW V;  1JJ2 U;  4R7C A;  4U3J A;  2ATK C;  4MVM A;  3JAM N;  1S0V A;  2EUL A;  1YXB A;  1DF4 A;  4UCO A;  1OCO C;  2F4V B;  1Y6X A;  2EIN B;  1K73 W;  4RAI A;  2E5L B;  2QWQ B;  2OCC B;  1QU7 A;  5FNV B;  4ZHQ B;  4P2Z A;  1PV0 A;  1RPO A;  4IT5 A;  4ASU G;  1OCR B; 
#chains in the Genus database with same CATH homology
 4OPH A;  4LF4 O;  3R66 A;  4NXN O;  1J5E O;  2UU9 O;  2ZM6 O;  4DR5 O;  4JI3 O;  4DV1 O;  1XNR O;  4B3R O;  1HNX O;  4LF7 O;  1FYJ A;  3RT3 C;  3J7A U;  4YHH O;  4JI5 O;  1AB3 A;  4JYA O;  3O65 A;  4YY3 O;  4DV3 O;  5BY1 A;  2UUA O;  4LF9 O;  4DUY O;  1KUQ A;  1N34 O;  5LMU O;  4KHP O;  2JRI A;  5BR8 O;  1HNZ O;  1IBL O;  4DV2 O;  4X66 O;  3SDL A;  3T1Y O;  2UUC O;  1FJG O;  3F5T A;  2DJV A;  4A5U B;  4JI7 O;  4DUZ O;  1XMO O;  1N36 O;  3M8A A;  4B3S O;  1R6T A;  3J81 N;  4DR4 O;  2UXC O;  5IT9 N;  4DV5 O;  4JI4 O;  1YZB A;  4X64 O;  4LFB O;  5A2Q N;  3T1H O;  4JI1 O;  2FKX A;  5LL6 Y;  4LFC O;  1A32 A;  4X65 O;  2F4V O;  4DV0 O;  1IBM O;  4JI0 O;  2Z0A A;  4K0K O;  3J80 N;  2VQF O;  4DR7 O;  5FLX N;  4NXM O;  5LMN O;  3OTO O;  1XNQ O;  2LW7 A;  1HNW O;  1R1B A;  4LF6 O;  4DR1 O;  4B3M O;  5BXZ A;  1HR0 O;  2UUB O;  4LFA O;  1D2D A;  4OPA A;  4DV4 O;  1G1X B;  1DK1 A;  4DR6 O;  1I94 O;  1FKA O;  1IBK O;  2E5L O;  4OX9 O;  1AIL A;  2DOS A;  1XEQ A;  4GKJ O;  4JI6 O;  1N33 O;  1NS1 A;  1F7Y A;  5H5N A;  4DR2 O;  4LF8 O;  4AQY O;  3JAM N;  4LF5 O;  1X59 A;  4DR3 O;  4B3T O;  4X62 O;  1N32 O;  4JI8 O;  2HHH O;  4JV5 O;  4DV6 O;  2VQE O;  2ZKO A;  4JI2 O;  2UXB O;  4GKK O;  2AGA A;  5IWA O;  4DV7 O;  2N74 A;  1XMQ O;  2UXD O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...