1D2DA

Hamster eprs second repeated element. nmr, 5 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
b'MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA SYNTHETASE
molecule tags Ligase
source organism Cricetulus griseus
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
total genus 18
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1999-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1d2dA00
2LW7A 4X66O 4DR6O 4NXMO 4KHPO 4LF7O 1FJGO 5FLXN 1XMQO 4DUYO 4X64O 4X62O 3M8AA 2UUCO 1I94O 4DUZO 4GKJO 1X59A 2F4VO 5A2QN 5BY1A 4JI4O 5LL6Y 4LFAO 1FYJA 2ZM6O 4B3TO 4DV6O 2DJVA 2AGAA 3O65A 4JYAO 2UU9O 4LF4O 1G1XB 1HNZO 4LF9O 4A5UB 2ZKOA 3F5TA 1R6TA 4YHHO 2UXDO 4DV4O 4LF6O 4JI1O 1IBMO 2E5LO 2UUBO 4JI8O 4B3SO 4K0KO 4OX9O 4LF8O 2VQEO 4NXNO 1R1BA 4JI2O 4JV5O 4OPHA 2JRIA 2N74A 4JI6O 4X65O 4DR5O 2DOSA 3T1HO 4DV5O 4DR4O 1N34O 4DV2O 3R66A 5IWAO 2UXCO 1N36O 4GKKO 4B3MO 4DV3O 5IT9N 1D2DA 1HR0O 1FKAO 4B3RO 2FKXA 1N32O 1HNWO 4LFCO 4JI0O 1XNQO 4JI7O 4DR1O 3J7AU 4DR7O 4DV0O 4DV7O 3T1YO 1A32A 2Z0AA 4AQYO 3OTOO 4JI5O 3SDLA 5H5NA 1IBLO 4LF5O 1XMOO 1AB3A 4YY3O 5LMUO 5BR8O 4OPAA 3J80N 2HHHO 4DR2O 1KUQA 1XNRO 1XEQA 3RT3C 3JAMN 2UXBO 3J81N 5LMNO 1HNXO 1N33O 4DV1O 4JI3O 1YZBA 1NS1A 1IBKO 2VQFO 4DR3O 2UUAO 1J5EO 4LFBO 1AILA 1DK1A 1F7YA 5BXZA
chains in the Genus database with same CATH superfamily
1Q6IA 4DR6O 4ZI7B 4J7KA 2QE7G 2ZDIC 2ZD9A 5IYDO 1EN5A 1KECA 4YIOA 1K4CC 4JYBA 3LDCA 4OXSA 1KC8W 4X1IB 2DWDC 3E89A 5B1AC 3N27A 1M56C 3C90A 4O4HB 3WB1A 1K8AW 4E4EA 3ZMTA 3UO3A 3K58A 2R9AA 4B3SB 4PHZA 1Z5VA 3ASOB 2ZKOA 5CA1B 3AG4C 3IAYA 1ZL8A 2DN9A 4FLXA 4QNHB 2UUBO 1MG1A 3K0DA 2JRIA 5J9PC 2P7TC 1K34A 5J2UB 1VQ7V 1ZLZA 4JI4B 3GWKC 2LP7A 4GLXA 1QBZA 4FM0A 3R66A 2KKWA 1VP7A 3UQ8A 2IU0A 4GCZA 3LDDA 3ZRWA 4FJCC 5JJNB 2ZR3A 2PYLA 5IWAB 5IT9N 1RFYA 1O9GA 4DR1B 4GKKB 3K0GA 2KQXA 3E8GA 4B08A 1N32O 4JPRA 4F6EA 4FFKA 4MVSA 1IX9A 1SQPH 1KU9A 5EYPA 4UFZA 3RYCB 2AZ0A 1WP8A 3FB6C 5LHIA 1H8HG 5EIBD 5LMUO 4OPAA 4H0LB 2ZIOA 1N8RW 3APQA 3BFRA 2P67A 4JZ2A 2PY5A 4IL6Z 1P4RA 1H2MA 3J81N 4PDLA 1HNXO 1QVGU 4UXNA 4G2KA 4DYLA 4QE7A 1J95A 1O9HA 2YIDA 5LGNA 1S72V 1OHHG 3L75H 3K79A 2LW1A 2E5LB 4FM2A 2BE3A 2AZ2A 3G67A 4MT8A 1GM8A 1M4UA 5HFMA 3S3XA 3B8MA 3K9AA 4IIJA 1MA1A 3ZN1A 4LFAO 1WA8B 4I9QA 2DJVA 2B5UA 2UU9O 2OT5A 4Z1VA 3ZHSA 2GDSA 3ABKB 1LR1A 1FAFA 1SA0B 1Y4MA 1NR1A 4NTXA 3ZMZA 2JIZG 4BR6A 1SZXA 3ASOC 3FB5C 1V54B 4CS4A 1GMGA 3FYEB 2VQEB 4PJ0Z 2QEXV 4B3MB 4DR4O 1N34O 2HVKC 4AILC 1NU1H 2QKCA 3WU2Z 1PL0A 3WB2A 1PNKA 1K4DC 2A0LA 4RAIA 3ICXA 2IBZH 2QA4V 2B1IA 2WAMA 3P32A 3IC7A 1MNGA 2H94A 3FKSG 4BIOA 3G80A 3GVMA 2HLDG 1VF5B 1R3LC 2XAQA 2RMKB 4C7UA 4CBCA 2Q4PA 4LF7B 2QGNA 3K5MA 1SKVA 1H2SB 1V55C 3SYCA 1SESA 1GKFA 4YY3O 4DXWA 4U3JA 1NZ6A 1K5SA 2F66C 1US6A 3CRQA 1CP9A 3H1HH 1QNMA 4IHJB 4DR3O 3CX5F 5JVDA 4X66O 4ABMA 5CBGA 3QVNA 3A0BZ 3NXSA 4DR7B 5CB4A 2A06H 3BA8A 4LWSA 3ZHVA 2R72A 3VBBA 4DW0A 1UJWB 2N04A 2IM9A 1VQ4V 1GM7A 3X2QB 4CH3A 2LGQA 4DUYB 4O4IB 2ZXWC 4J80A 2FTKA 2K9PA 4D6TH 5IJ9A 3QO5A 3ZHQA 3HKCA 3D36A 4CS3A 1R6TA 1NJIW 4AI8A 4LF6O 3JCZA 2E5LO 2LGWA 3HKEA 3JALA 1IXMA 4YHHB 5TISZ 4MVZA 1I94B 1TAEA 2PTMA 2XT9A 1H2NA 5CMUA 5KMGB 2DOSA 3AG1C 2Q5ZA 1VQKV 4JYYA 4EKWA 1TUEB 1UFIA 5F2VO 3FAVA 1AR1B 3UO2A 4I55A 1M1KW 2Q7HA 1OCOB 3C3TA 1IVSA 1HR0O 1IBMB 4I9WA 1N36B 2QWOB 3CRRA 3UT5A 3R65A 4GT1A 4TOIA 2IJJA 3FYIB 4GYCB 2F93B 3E83A 1SQVH 3W7SA 2PGGA 1ZTEA 1HW7A 3L73H 4DV7O 1A32A 4H33A 2Q69A 1QR9A 1HP8A 1R3KC 1YHQV 1HNXB 2A9HA 3JATB 1FXKB 1XNRO 1V55B 3OAAG 1VQMV 1OCCB 3DGEA 3U0ZA 4LNUB 1S3JA 1OCRB 5LXTA 2YC0A 4UUJC 3CCJV 2X7RB 5H2FZ 1XHZA 4P30A 3VQVA 4NXMO 4LF8B 3B8NA 3ETGA 1QLEC 1W59A 4ZI7A 3CCUV 4FFBB 5IYZA 4JYCA 3HKCB 4JI6B 3M8AA 2ODMA 4LFAB 4HYOA 2Q6AA 3K59A 2CTQA 3H1IH 1BE3H 1U96A 3OT7A 4YJ3A 2WLHA 2BTQA 1M5IA 3ZHUA 2WWWA 1Z2GA 1LUVA 1D5NA 5EBMC 4PI0A 3BHPA 2V4DA 2YXYA 1HNZO 1RSOA 2EIKB 4PDRA 3ZBHA 3IGAC 1YITV 4TQFA 4DR6B 4WBNB 3SPIA 5EZYB 3RWRD 1R1BA 4JI2O 2UXXA 2A7WA 5E79Z 1F4MA 4NYKA 4BIUA 2OWOA 2CTRA 1JCHA 3HR0A 3OUSA 2ADQB 2H3OA 5DM6V 4J10A 2P6JA 4I7ZB 2GV9A 3ABMC 1TVKA 4JAUA 4GX1A 4O2BB 3DSQA 1OJHA 3ZRWB 1TA8A 4L87A 3ZJZA 4ICGA 3EVKA 1I5YA 3N2GB 1L1FA 4LFBB 2Z5UA 5CA3A 4BWAA 2O57A 1XMOB 3WB0A 1T5EA 3DTUB 2E3CA 4R6ZA 3OD4A 1GN6A 2E74B 3HKEB 1H2GA 4QGPA 3JCUZ 1YSCA 2DQ3A 1XUQA 4FK5C 3D36C 1HR0B 1Z5WA 3LDEA 1HDJA 2CTWA 5LGTA 1Y74A 3JARA 4KHPO 2L35A 4AQYB 3EHBB 3H9VA 2AW9A 2OCHA 4DUYO 1N0JA 1KP2A 5BMVA 1RSOB 1WN7A 4UCTA 5LMUB 2P5OA 1ZX3A 5FL7G 1FJGB 4U7NA 2W6IG 2LO1A 5LA6B 4UB8Z 4B7KA 4U3JB 1N34B 2ITDC 1Q6UA 1M57C 4JYAO 4I55B 1CXZB 1SA0A 4JV5B 1BHAA 2Y69B 4X20B 3RFRA 3CWBH 1P7BA 1JMKC 2Q9LA 4LF8O 1BT8A 4LFCB 3AEIA 2JEXA 2YICA 4JI1B 1FXKC 1GK9A 4KL1A 4JI6O 2E75B 3OR7C 2EILB 2Q7EA 4JAAA 2CGOA 3KCYA 5CBHA 1GO3F 2X6AA 1VEWA 1B6QA 2G38A 4OGQB 3LNMB 2UU9B 1N36O 1NI8A 2YEVA 1EZVH 4UCSA 1GAXA 4YJ3B 2VQFB 2QWRB 1HNWO 4K8XA 4Z2WA 1PV0A 4JI2B 4MVQA 2ZE7A 4JI0O 1XNQO 1JFFB 3NR7A 5C8YB 1SS3A 4DR7O 2PUSA 3JD3A 4TT3G 3OTOO 1OCOC 2ARHA 2R9IA 1V9PA 2RQ6A 4IHJA 4PD4F 1FFTB 1N33B 2JK5C 3H1LH 1ZAUA 2EJ7A 5L3EA 4LR3A 5CBFA 3EFFK 5ITZB 3FB8C 5BR8B 4DO2A 3G71V 4TV8A 4MTOA 4QJFB 4ZOLB 4KP4A 3JAKA 2ZNIA 4LFBO 3QF7A 1S5LZ 5LP6B 3VOUA 4RQEA 2KG7A 2D2CB 4LC1A 2QWPB 2AXTZ 4DUZO 3DXRB 1PM9A 2WLLA 3PN1A 2Q0AA 5IJ9B 4XBFA 1GN2A 1JR9A 1S77D 1FXKA 4MW3A 3CHXA 4HZ3A 1SQQH 5JH7A 2YIAA 3A0RA 2EX3A 3SYQA 4W4LA 3WFVA 3CS5A 1FS0G 4ZIBA 4OX9O 2RN9A 5FNVB 1BS3A 4FVMA 1FXVA 3I5DA 1VQNV 5LBQA 5KUKA 4NXNB 1WB7A 3LUTB 5B5EZ 3THOA 3RYHB 1YCIA 3KZIZ 2YXLA 2R70A 2CH7B 2JGUA 2EIJB 1YDXA 5LGUA 2YSUB 4DR2B 5C93A 5H9CA 3MHSC 2UXBB 4U7OA 2BTOA 1WNSA 3FD9A 1RP3B 4B3RO 4E2LA 4WBNA 3CP1A 2BCCH 3J7AU 4EB6A 3AG3B 4HNAB 4R8CA 4FLUA 5KUMA 1B3QA 4NTWA 5B1AB 2GBOA 2Q8VA 1BHBA 4P9OA 1BCCH 2KG7B 4YY3B 1Y67A 5LMNO 1Q3EA 4FM1A 5AG2A 2XAHA 3OMAB 4DV1O 5IYZB 2E76B 3DXRA 3FX7A 1XNQB 2UUCB 2ZCEA 1BMFG 2XNDG 4N23A 3K08A 4DR3B 4NVPA 2KSDA 4H13B 5E1AC 1WJZA 1X59A 2F4VO 3QO8A 3BEHA 3SYAA 3WG7C 1GN3A 4DW1A 5J2TA 4B7EA 1KKDA 5FNVA 1N4CA 3K03A 3O65A 3E8HA 1G1XB 1I08A 5H6RA 3AG1B 1EFRG 4JGSA 5EC1C 3ZHTA 3ASNB 2JGDB 4JI1O 1WP7A 3ABLC 3RYFB 3JAWA 2DYRB 2P4KA 1NVPD 4GUNA 3K5NA 4JI8B 4QIWF 4X65O 2WLIB 2QSAA 4DR5O 1G4YB 2EULA 4PDVA 3B2EE 3DC5A 3CD6V 4UVBA 2NN4A 1JJ2U 1QLNA 3OTFA 4GKKO 3ETQA 2DYSC 3ZEDA 1QCEA 1XHXA 2FKXA 1AR5A 2W6JG 5HFLA 3OTOB 3RVYA 2Q67A 2QKSA 3CXCU 2B9ZA 4K3AA 2DMXA 1E1RG 1OCCC 1OCZC 4GX0A 4KHPB 4AQYO 1YJNV 1VF7A 2VS0A 1Y66A 3JD1A 3ABUA 3N2GA 1NT2B 5IJ0A 3LSUA 1K9MW 1EZJA 3CCMV 4DR2O 1LUWA 1AR4A 2EZPA 3OGCC 2MW2B 4Z1MG 1WB8A 4PI2A 5GW7A 1AILA 3ZRSA 1VQ8V 2LW7A 4DK0A 5L3CA 4O4HA 4X88A 4X64O 2QJ1A 2JS5A 4X62O 2A79B 1LNQA 1XILA 2DWEC 4I5SA 5IY5B 5LL6Y 3W7XA 4JTAB 2ZM6O 5KHJA 2AGAA 2Y4UA 3K9SA 1DTOA 3OR6C 3A8TA 2R9RB 4DV6B 2V7QG 3QNEA 4DV4O 1VF6A 4LF4B 3QG5A 3AK1A 2F23A 1HNZB 2VQEO 2YUAA 3F5WC 3SYOA 4DR4B 4RO2A 3T4ZA 3SPCA 4WFAV 2ZE6A 1JPXA 4H44B 4LNUA 3OMIB 2YS8A 2CE4A 2W0FC 4WFGA 3A2FA 5DECA 2GTSA 4JYAB 5FPOA 3MHHC 1AJQA 4J42A 5CN0A 3UKMA 3W7UA 2LFSA 3D3QA 3Q4HA 1KYOF 2DYRC 1JFFA 4NR1A 1NTMH 3AK2A 1RM1B 3FB7C 4BAYA 4UCUA 2Z0AA 5D5QA 4PDMA 4NKGB 2YIBA 3JD4A 2RNBA 4DK1A 2XHBA 2HJDA 2Q68A 2IJKA 3IFXA 4FMTA 4BW9A 2V1DA 5K1XA 2EIKC 4ZHQA 2PF4E 1E79G 3JSNA 2VQFO 2ZDIA 2ITCC 5B3SB 1P84F 5JQGB 5BXZA 2GSMB 4WF9V 4Q20A 4PA6A 1AJNA 4RUEA 2NR5A 2ZT9B 3P30A 3X2QC 2OYQA 2XAFA 3CCSV 4YXWG 4DRXA 4H37A 2HEPA 2FB5A 4GKJB 3ETEA 3MDSA 4B3TO 3ZMVA 5A9GA 2WA3A 2BSKB 3HKDA 2M7WA 4CS2A 3RN4A 4TSFG 4PA7A 2L6LA 1SERA 3K3WA 2HVJC 4JI8O 1Q90D 4ZKIA 2FYUH 1F23A 4EEQA 4G28B 1U97A 4OPHA 1EBOA 5D5PA 4UCOA 3CCLV 1Q5OA 4RUFA 5IJ0B 3TCUA 1JQ0A 3TJTA 4IIJB 5IE9A 4P2ZA 3C3SA 3RYHA 1D2DA 1FKAO 2OCCB 3SJBC 1Y76A 5FPRA 4OX9B 3IC9A 1FFXB 3BCCH 3OEHG 2ZQMA 1J5EB 1XL6A 2DQ0A 1XREA 4X8AA 2P22C 2DW4A 5B1OA 2OTJV 3E8FA 3IJ4A 1S76D 2GUZA 3K5OA 1S5JA 1ZL8B 2QM8A 4YJ2B 1I5XA 4O2AB 4ASUG 5CB4B 4UV9A 1NBMG 1NTKH 1VQ5V 3CSXA 4CC5A 3G6BA 1WAZA 1NS1A 3ABKC 2IJHA 1IBKO 1VMGA 3N2KA 4YIPA 5EYPB 5JVDB 4LF7O 2XAJA 3O9OA 1BQZA 1XI1A 4X1IA 4MVMA 1Q81W 1H8EG 3L9DA 3CMAV 2AHZA 2C2AA 2JGDA 1WPXA 4RQFA 1THZA 3OE7G 2EINC 1SETA 4IGGA 1MZEA 2WSSG 1AP5A 4DV1B 4LF4O 1BSMA 2UXDO 2RDCA 3JASB 1OZ0A 3DC6A 1VQLV 4K0KO 2IW5A 3D8CA 2CUGA 2Y4TA 1SQGA 4JI7B 3ZIAG 3MD0A 1OCRC 5CA1A 5KLVH 1Y6XA 3AG3C 4KXRA 2MK3A 4DV5O 3KG2A 4WFBV 3OFNG 5LYJA 4J41A 4J7ZA 1NR7A 3VQWA 4IT5A 4TQDA 3B40A 4XDLA 4DV3O 1B04A 4RWUA 3BVOA 4MS2A 3FAVB 4O4JB 1BGYH 3T2MA 2OIEA 2JEUA 2QWQB 1FXHA 4LBEC 1JA8A 1PP9H 3CCQV 2KB1A 3F7VC 4FLVA 3VQYA 1W0KG 2QDOA 4X65B 3T1YO 2CK3G 4P9PA 4JI5O 1VQOV 1L0LH 1G8MA 2Q7GA 3JALB 1VARA 1SZTA 2X6BA 1Q8IA 3OUFA 4GX2A 3BAAA 1XL4A 2YI8A 4UCVA 2FMLA 4PA4A 1OCZB 4LCUC 2F95B 5KHKA 3JSLA 3BABA 2ZR2A 3CRCA 1FJGO 5FLXN 4W4KA 5L3BA 4GKJO 2UUCO 3E2EA 3CCRV 1JJOA 4MTGA 4QPJA 4MTFA 1COWG 1FYJA 1K7DA 2BTQB 5L3GA 4EFEA 3ZN0A 3D3IA 2IU3A 2LJ2A 2LFRA 1YF2A 1ZWIC 1XQ8A 1ZUQA 3OEEG 2EBOA 4MVOA 2IH1C 4B3SO 1G6UA 1M9NA 3ZS8C 2Q73A 2HP8A 2EIMC 4CH4A 3OM3B 4DV0B 2Y48A 4CZZA 3AK3A 1VF6C 2CGNA 3E8BA 3CCVV 3UM7A 2RJZA 3JATA 3HKBA 5J2TB 3ZRXA 4DR5B 1EM1A 2PYJA 3A0HZ 2ZE5A 2EINB 1AI5A 1TVKB 4I50B 1Q43A 3QTCA 3CE2A 4DV7B 1K73W 3B77A 3CJHB 4O4IA 3AG7A 3U11A 1ENVA 2WLKA 5JH7B 4X66B 4JI7O 4DR1O 4D7SA 3W7TA 1HWYA 3SGIA 3SYPA 2BOBC 3ETDA 4NTYA 1IDSA 1Q7YW 3RYFA 3BY6A 3JAMN 4MVRA 4X1YB 4N21A 3TXSA 4JI3O 1L8DA 4NXMB 3L71H 1F4NA 1DK1A 4DRXB 1IZ3A 1UPGA 2VWJA 2JS3A 2OTLV 1ZSPA 2W0XA 1R6KA 4WFFA 5EK0A 5JQGA 3CMEV 1KP3A 1ROPA 3G4SV 5CA0A 1IXBA 4EFBA 1EN6A 4PV1B 4KFMA 3ZMSA 3JD0A 4MSWC 1Q82W 4JAVA 2PZSA 1CEZA 1L0NH 1M57B 3RVZA 1R3JC 1SRYA 4FIPC 3CRAA 4NXNO 5KHGA 3H1JH 3OMNB 2IJIA 5L3FA 4FLYA 5KAFZ 1YVWA 2GHYA 3K06A 4UB6Z 5IDJA 4R7CA 5EIBC 4BW5A 1Y74B 2QKAA 2FL4A 4TV9B 1FFXA 2QR4A 1VIBA 4B3MO 1NH2D 2NLJC 2HG5C 1GN4A 3CC2V 1SQFA 5LA6A 1F51A 4J11A 3I55V 3T1YB 1IBKB 3ZRVA 4LFCO 1Y76B 3B09A 5DN6G 2ZIMA 4PELA 5BMVB 4X20A 4LF5O 5B1BB 4AHCA 3ABMB 1Q6HA 3GWOA 3W7WA 2HHHO 1RPRA 3RW0A 2UUAB 1R73A 1B06A 4IYIA 3N2KB 3E22B 3RYIA 2P90A 3PJSK 1Q86W 1URFA 2B1GA 5LOVA 3STLC 5K1PA 4I4TA 2YEVB 4O2AA 4K0KB 4XDKA 2F4VB 4U3FH 1NQTA 3P3PA 2F43G 2WLLB 3FFQA 4UVCA 1GH6A 1KQSU 3RYCA 3T1HB 3L74H 2PI5A 3CEIA 1YXBA 3BA9A 1SF9A 2UXCB 4HBNA 2ZE8A 4LF9O 4JTDB 4A5UB 3JASA 4UV8A 2HKOA 2M6YA 2CAZC 5GTIZ 1TUBB 2CH7A 4J9YB 1MSWD 5C8YA 2RCVA 2XASA 4JV5O 3CXHF 2HR3A 1JOYA 1PL4A 1M93A 3T1CA 1YJ9V 1AI6A 5B1NA 4NB5A 5KHHA 2Y69C 1M56B 4ZBMA 4JI5B 4PA9A 1IBLB 1V54C 2ADPA 2ZINA 1NVPB 4DV2O 1MOFA 1R6NA 2VWKA 1VQ9V 4LH7A 5IWAO 1YTFD 3HKDB 3RGBA 4LWSB 2GTAA 2UXDB 3VQXA 4JI0B 2BOCC 3HPLC 2XTAA 4HNAA 3CC7V 2HFEC 1CPYA 4CC6A 1AROP 4GZRB 5BZBA 2CTPA 1HNWB 1W2BU 5JJEB 1YIJV 3LNNA 2P4VA 1DGSA 3ABLB 5KX5A 4TUYB 1DLBA 5BR8O 2ZNJA 4JASA 5CA0B 4DV3B 3CB2A 2UXBO 1K97A 4FLTA 3JD2A 1XNRB 2QWNB 5JCOA 5GONB 2A3QA 5B66Z 4X64B 4X1KB 4I0XA 2UUBB 2QM7A 3TK1A 1XMQO 1QVFU 2XOKG 2XAGA 1GRJA 1X4TA 4WFEA 3SR2C 2JJ2G 2UXNA 2EIMB 2GUZB 1NTZH 1M90W 3K04A 1RPOA 3RBZA 4L8JA 2QM4A 4UVAA 4DV6O 4EB6B 1KKCA 1VQ6V 1YEWA 4X89A 5LP6C 2QTSA 4Q6GA 2WLIA 3APOA 3ZCCA 3SJQC 1QR8A 2AHYA 3AG2C 2EIJC 2JDIG 2ZXWB 3H1KH 3M99B 4QE9A 5EC2C 3CPWU 1K5QA 4MTXA 5ITZA 1MMMA 2YDEA 4FZ1A 1JX9A 4TV8B 3T1HO 5IY5C 2ATKC 1PPJH 2Y0PA 4ZOLA 3JAKB 4O4LA 4J9ZB 1SQBH 1KB9F 3SPGA 2X6CA 3ZMUA 1PKXA 4FFBA 1D5AA 5JCOC 5GTHZ 1BQ0A 3QO7A 1FPOA 4B3RB 5EBLC 4DV0O 1I7FA 2EZOA 2WLJA 2YIBD 4X1YA 1P49A 1IBLO 1XMOO 4DUZB 1AB3A 1WPBA 5IYBO 3G6EV 3JAWB 3AG4B 2JVDA 3CRMA 1PD3A 3TXQA 5LYJB 1XEQA 5EZYA 4WCEV 3ABTA 2WLNA 3E86A 1K92A 4BIZA 1YZBA 1KD1W 1VQPV 3LSQA 5LP6A 4LP8A 3K57A 1QLEB 4JTCB 5LMNB 1K33A 4F6RB 2YXHA 1GTOA 1QU7A 3S3WA 3SPJA 5KHIA 1S5HC 3CYOA 2ILMA 4LH6A 1FD9A 1BZKA 4B3TB 2Q0OC 4O2BA 3JYCA 2F1MA 1K3EA 5A2QN 4MVUA 5BY1A 2N05A 1MABG 4O4JA 1SC5B 1AI4A 3HB3B 3K5LA 3P3NA 4J7JA 1XDCA 2YI9A 3L72H 3L70H 1NKDA 5KX5B 3F5TA 4YHHO 3LSSA 1NH2B 1WLEA 4FPPA 5KAIZ 1DF4A 3TETA 1PNMA 5KA5A 4PA3A 2N74A 3AG2B 4DV2B 1KMIZ 3EXAA 3ML0A 4TV9A 3OW2U 1H38A 5LHHA 2D3OW 3Q4HB 4FZ0A 3SJCC 3H01A 3WG7B 2LQTA 1EN4A 1YJWV 4FLZA 4K8ZA 1H2LA 2EJRA 1AI7A 1R3IC 4DV4B 5GONA 1AVMA 2OCCC 3MAQA 4I0XB 1TUBA 4KUMA 1IURA 1KBHA 4QPKA 5JWPA 1P7GA 3BRCA 2EILC 2OIGA 1N32B 1BL8A 3B4SA 5H5NA 2K1EA 1DF5A 1XBLA 1YI2V 1H2KA 1WA8A 3TGUH 1KUQA 3RT3C 5EBWC 1AP6A 1N33O 1QQCA 2WA4A 4ZHQB 5LOVB 5J2UA 4LF9B 1ORQC 1TGOA 4I4TB 4X9QA 3RYIB 3SPHA 4HAMA 4LF6B 3KCXA 4X62B 4JI3B 2X0LA 2ETNA 3ZHRA 5JJJB 3U10A 3E22A 1I94O 3KKYA 5LHGA 1PNLA 3I56V 4D7TA 4JI4O 4I50A 3CCEV 3E35A 2HHHB 4O4LB 1GM9A 3CJHA 5L3DA 4FLWA 2BSKA 4XDJA 2XUMA 2DYSB 1IBMO 1OV9A 2VRZA 1I0HA 5B1BC 4X1KA 1MZFA 5KMGA 4CH6A 4DV5B 2WPDG 3STZC 1MSDA 1JVMA 2H8PC 4F6RA 2CDYA 4TWKA 2Y0IA 1QHTA 1W0JG 1YTFB 5B3SC 2UXCO 1RM1C 2NNUA 4JF3A 3T4DA 3M7MX 1XOUA 3GB7C 4MW8A 3CC4V 2Z3YA 2QTOA 3JARB 3UT5B 4GX5A 4CH5A 2DE0X 2JJ1G 2P06A 2HJFC 4F4LA 4JZGA 5IYCO 3OGIB 3UCSC 1XMQB 4IYHA 3SDLA 5DEDA 2WLMA 4YJ2A 1N0NA 3J80N 3ASNC 4WFHA 3BPZA 1S0VA 4K35A 4LF5B 4R50A 1SQXH 2ZM6B 2PI4A 1AJPA 1E1QG 3ZX6A 5H6QA 3F7YC 2IH3C 4UCRA 3HKBB 3SJAC 4TUYA 2UUAO 1J5EO 4G27B 5LXTB 1F7YA 5KA6A
chains in the Genus database with same CATH topology
2LW7A 4X66O 4DR6O 4NXMO 4KHPO 4LF7O 1FJGO 5FLXN 1XMQO 4DUYO 4X64O 4X62O 3M8AA 2UUCO 1I94O 4DUZO 4GKJO 1X59A 2F4VO 5A2QN 5BY1A 4JI4O 5LL6Y 4LFAO 1FYJA 2ZM6O 4B3TO 4DV6O 2DJVA 2AGAA 3O65A 4JYAO 2UU9O 4LF4O 1G1XB 1HNZO 4LF9O 4A5UB 2ZKOA 3F5TA 1R6TA 4YHHO 2UXDO 4DV4O 4LF6O 4JI1O 1IBMO 2E5LO 2UUBO 4JI8O 4B3SO 4K0KO 4OX9O 4LF8O 2VQEO 4NXNO 1R1BA 4JI2O 4JV5O 4OPHA 2JRIA 2N74A 4JI6O 4X65O 4DR5O 2DOSA 3T1HO 4DV5O 4DR4O 1N34O 4DV2O 3R66A 5IWAO 2UXCO 1N36O 4GKKO 4B3MO 4DV3O 5IT9N 1D2DA 1HR0O 1FKAO 4B3RO 2FKXA 1N32O 1HNWO 4LFCO 4JI0O 1XNQO 4JI7O 4DR1O 3J7AU 4DR7O 4DV0O 4DV7O 3T1YO 1A32A 2Z0AA 4AQYO 3OTOO 4JI5O 3SDLA 5H5NA 1IBLO 4LF5O 1XMOO 1AB3A 4YY3O 5LMUO 5BR8O 4OPAA 3J80N 2HHHO 4DR2O 1KUQA 1XNRO 1XEQA 3RT3C 3JAMN 2UXBO 3J81N 5LMNO 1HNXO 1N33O 4DV1O 4JI3O 1YZBA 1NS1A 1IBKO 2VQFO 4DR3O 2UUAO 1J5EO 4LFBO 1AILA 1DK1A 1F7YA 5BXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW7 A;  4X66 O;  4DR6 O;  4NXM O;  4KHP O;  4LF7 O;  1FJG O;  5FLX N;  1XMQ O;  4DUY O;  4X64 O;  4X62 O;  3M8A A;  2UUC O;  1I94 O;  4DUZ O;  4GKJ O;  1X59 A;  2F4V O;  5A2Q N;  5BY1 A;  4JI4 O;  5LL6 Y;  4LFA O;  1FYJ A;  2ZM6 O;  4B3T O;  4DV6 O;  2DJV A;  2AGA A;  3O65 A;  4JYA O;  2UU9 O;  4LF4 O;  1G1X B;  1HNZ O;  4LF9 O;  4A5U B;  2ZKO A;  3F5T A;  1R6T A;  4YHH O;  2UXD O;  4DV4 O;  4LF6 O;  4JI1 O;  1IBM O;  2E5L O;  2UUB O;  4JI8 O;  4B3S O;  4K0K O;  4OX9 O;  4LF8 O;  2VQE O;  4NXN O;  1R1B A;  4JI2 O;  4JV5 O;  4OPH A;  2JRI A;  2N74 A;  4JI6 O;  4X65 O;  4DR5 O;  2DOS A;  3T1H O;  4DV5 O;  4DR4 O;  1N34 O;  4DV2 O;  3R66 A;  5IWA O;  2UXC O;  1N36 O;  4GKK O;  4B3M O;  4DV3 O;  5IT9 N;  1D2D A;  1HR0 O;  1FKA O;  4B3R O;  2FKX A;  1N32 O;  1HNW O;  4LFC O;  4JI0 O;  1XNQ O;  4JI7 O;  4DR1 O;  3J7A U;  4DR7 O;  4DV0 O;  4DV7 O;  3T1Y O;  1A32 A;  2Z0A A;  4AQY O;  3OTO O;  4JI5 O;  3SDL A;  5H5N A;  1IBL O;  4LF5 O;  1XMO O;  1AB3 A;  4YY3 O;  5LMU O;  5BR8 O;  4OPA A;  3J80 N;  2HHH O;  4DR2 O;  1KUQ A;  1XNR O;  1XEQ A;  3RT3 C;  3JAM N;  2UXB O;  3J81 N;  5LMN O;  1HNX O;  1N33 O;  4DV1 O;  4JI3 O;  1YZB A;  1NS1 A;  1IBK O;  2VQF O;  4DR3 O;  2UUA O;  1J5E O;  4LFB O;  1AIL A;  1DK1 A;  1F7Y A;  5BXZ A; 
#chains in the Genus database with same CATH topology
 1Q6I A;  4DR6 O;  4ZI7 B;  4J7K A;  2QE7 G;  2ZDI C;  2ZD9 A;  5IYD O;  1EN5 A;  1KEC A;  4YIO A;  1K4C C;  4JYB A;  3LDC A;  4OXS A;  1KC8 W;  4X1I B;  2DWD C;  3E89 A;  5B1A C;  3N27 A;  1M56 C;  3C90 A;  4O4H B;  3WB1 A;  1K8A W;  4E4E A;  3ZMT A;  3UO3 A;  3K58 A;  2R9A A;  4B3S B;  4PHZ A;  1Z5V A;  3ASO B;  2ZKO A;  5CA1 B;  3AG4 C;  3IAY A;  1ZL8 A;  2DN9 A;  4FLX A;  4QNH B;  2UUB O;  1MG1 A;  3K0D A;  2JRI A;  5J9P C;  2P7T C;  1K34 A;  5J2U B;  1VQ7 V;  1ZLZ A;  4JI4 B;  3GWK C;  2LP7 A;  4GLX A;  1QBZ A;  4FM0 A;  3R66 A;  2KKW A;  1VP7 A;  3UQ8 A;  2IU0 A;  4GCZ A;  3LDD A;  3ZRW A;  4FJC C;  5JJN B;  2ZR3 A;  2PYL A;  5IWA B;  5IT9 N;  1RFY A;  1O9G A;  4DR1 B;  4GKK B;  3K0G A;  2KQX A;  3E8G A;  4B08 A;  1N32 O;  4JPR A;  4F6E A;  4FFK A;  4MVS A;  1IX9 A;  1SQP H;  1KU9 A;  5EYP A;  4UFZ A;  3RYC B;  2AZ0 A;  1WP8 A;  3FB6 C;  5LHI A;  1H8H G;  5EIB D;  5LMU O;  4OPA A;  4H0L B;  2ZIO A;  1N8R W;  3APQ A;  3BFR A;  2P67 A;  4JZ2 A;  2PY5 A;  4IL6 Z;  1P4R A;  1H2M A;  3J81 N;  4PDL A;  1HNX O;  1QVG U;  4UXN A;  4G2K A;  4DYL A;  4QE7 A;  1J95 A;  1O9H A;  2YID A;  5LGN A;  1S72 V;  1OHH G;  3L75 H;  3K79 A;  2LW1 A;  2E5L B;  4FM2 A;  2BE3 A;  2AZ2 A;  3G67 A;  4MT8 A;  1GM8 A;  1M4U A;  5HFM A;  3S3X A;  3B8M A;  3K9A A;  4IIJ A;  1MA1 A;  3ZN1 A;  4LFA O;  1WA8 B;  4I9Q A;  2DJV A;  2B5U A;  2UU9 O;  2OT5 A;  4Z1V A;  3ZHS A;  2GDS A;  3ABK B;  1LR1 A;  1FAF A;  1SA0 B;  1Y4M A;  1NR1 A;  4NTX A;  3ZMZ A;  2JIZ G;  4BR6 A;  1SZX A;  3ASO C;  3FB5 C;  1V54 B;  4CS4 A;  1GMG A;  3FYE B;  2VQE B;  4PJ0 Z;  2QEX V;  4B3M B;  4DR4 O;  1N34 O;  2HVK C;  4AIL C;  1NU1 H;  2QKC A;  3WU2 Z;  1PL0 A;  3WB2 A;  1PNK A;  1K4D C;  2A0L A;  4RAI A;  3ICX A;  2IBZ H;  2QA4 V;  2B1I A;  2WAM A;  3P32 A;  3IC7 A;  1MNG A;  2H94 A;  3FKS G;  4BIO A;  3G80 A;  3GVM A;  2HLD G;  1VF5 B;  1R3L C;  2XAQ A;  2RMK B;  4C7U A;  4CBC A;  2Q4P A;  4LF7 B;  2QGN A;  3K5M A;  1SKV A;  1H2S B;  1V55 C;  3SYC A;  1SES A;  1GKF A;  4YY3 O;  4DXW A;  4U3J A;  1NZ6 A;  1K5S A;  2F66 C;  1US6 A;  3CRQ A;  1CP9 A;  3H1H H;  1QNM A;  4IHJ B;  4DR3 O;  3CX5 F;  5JVD A;  4X66 O;  4ABM A;  5CBG A;  3QVN A;  3A0B Z;  3NXS A;  4DR7 B;  5CB4 A;  2A06 H;  3BA8 A;  4LWS A;  3ZHV A;  2R72 A;  3VBB A;  4DW0 A;  1UJW B;  2N04 A;  2IM9 A;  1VQ4 V;  1GM7 A;  3X2Q B;  4CH3 A;  2LGQ A;  4DUY B;  4O4I B;  2ZXW C;  4J80 A;  2FTK A;  2K9P A;  4D6T H;  5IJ9 A;  3QO5 A;  3ZHQ A;  3HKC A;  3D36 A;  4CS3 A;  1R6T A;  1NJI W;  4AI8 A;  4LF6 O;  3JCZ A;  2E5L O;  2LGW A;  3HKE A;  3JAL A;  1IXM A;  4YHH B;  5TIS Z;  4MVZ A;  1I94 B;  1TAE A;  2PTM A;  2XT9 A;  1H2N A;  5CMU A;  5KMG B;  2DOS A;  3AG1 C;  2Q5Z A;  1VQK V;  4JYY A;  4EKW A;  1TUE B;  1UFI A;  5F2V O;  3FAV A;  1AR1 B;  3UO2 A;  4I55 A;  1M1K W;  2Q7H A;  1OCO B;  3C3T A;  1IVS A;  1HR0 O;  1IBM B;  4I9W A;  1N36 B;  2QWO B;  3CRR A;  3UT5 A;  3R65 A;  4GT1 A;  4TOI A;  2IJJ A;  3FYI B;  4GYC B;  2F93 B;  3E83 A;  1SQV H;  3W7S A;  2PGG A;  1ZTE A;  1HW7 A;  3L73 H;  4DV7 O;  1A32 A;  4H33 A;  2Q69 A;  1QR9 A;  1HP8 A;  1R3K C;  1YHQ V;  1HNX B;  2A9H A;  3JAT B;  1FXK B;  1XNR O;  1V55 B;  3OAA G;  1VQM V;  1OCC B;  3DGE A;  3U0Z A;  4LNU B;  1S3J A;  1OCR B;  5LXT A;  2YC0 A;  4UUJ C;  3CCJ V;  2X7R B;  5H2F Z;  1XHZ A;  4P30 A;  3VQV A;  4NXM O;  4LF8 B;  3B8N A;  3ETG A;  1QLE C;  1W59 A;  4ZI7 A;  3CCU V;  4FFB B;  5IYZ A;  4JYC A;  3HKC B;  4JI6 B;  3M8A A;  2ODM A;  4LFA B;  4HYO A;  2Q6A A;  3K59 A;  2CTQ A;  3H1I H;  1BE3 H;  1U96 A;  3OT7 A;  4YJ3 A;  2WLH A;  2BTQ A;  1M5I A;  3ZHU A;  2WWW A;  1Z2G A;  1LUV A;  1D5N A;  5EBM C;  4PI0 A;  3BHP A;  2V4D A;  2YXY A;  1HNZ O;  1RSO A;  2EIK B;  4PDR A;  3ZBH A;  3IGA C;  1YIT V;  4TQF A;  4DR6 B;  4WBN B;  3SPI A;  5EZY B;  3RWR D;  1R1B A;  4JI2 O;  2UXX A;  2A7W A;  5E79 Z;  1F4M A;  4NYK A;  4BIU A;  2OWO A;  2CTR A;  1JCH A;  3HR0 A;  3OUS A;  2ADQ B;  2H3O A;  5DM6 V;  4J10 A;  2P6J A;  4I7Z B;  2GV9 A;  3ABM C;  1TVK A;  4JAU A;  4GX1 A;  4O2B B;  3DSQ A;  1OJH A;  3ZRW B;  1TA8 A;  4L87 A;  3ZJZ A;  4ICG A;  3EVK A;  1I5Y A;  3N2G B;  1L1F A;  4LFB B;  2Z5U A;  5CA3 A;  4BWA A;  2O57 A;  1XMO B;  3WB0 A;  1T5E A;  3DTU B;  2E3C A;  4R6Z A;  3OD4 A;  1GN6 A;  2E74 B;  3HKE B;  1H2G A;  4QGP A;  3JCU Z;  1YSC A;  2DQ3 A;  1XUQ A;  4FK5 C;  3D36 C;  1HR0 B;  1Z5W A;  3LDE A;  1HDJ A;  2CTW A;  5LGT A;  1Y74 A;  3JAR A;  4KHP O;  2L35 A;  4AQY B;  3EHB B;  3H9V A;  2AW9 A;  2OCH A;  4DUY O;  1N0J A;  1KP2 A;  5BMV A;  1RSO B;  1WN7 A;  4UCT A;  5LMU B;  2P5O A;  1ZX3 A;  5FL7 G;  1FJG B;  4U7N A;  2W6I G;  2LO1 A;  5LA6 B;  4UB8 Z;  4B7K A;  4U3J B;  1N34 B;  2ITD C;  1Q6U A;  1M57 C;  4JYA O;  4I55 B;  1CXZ B;  1SA0 A;  4JV5 B;  1BHA A;  2Y69 B;  4X20 B;  3RFR A;  3CWB H;  1P7B A;  1JMK C;  2Q9L A;  4LF8 O;  1BT8 A;  4LFC B;  3AEI A;  2JEX A;  2YIC A;  4JI1 B;  1FXK C;  1GK9 A;  4KL1 A;  4JI6 O;  2E75 B;  3OR7 C;  2EIL B;  2Q7E A;  4JAA A;  2CGO A;  3KCY A;  5CBH A;  1GO3 F;  2X6A A;  1VEW A;  1B6Q A;  2G38 A;  4OGQ B;  3LNM B;  2UU9 B;  1N36 O;  1NI8 A;  2YEV A;  1EZV H;  4UCS A;  1GAX A;  4YJ3 B;  2VQF B;  2QWR B;  1HNW O;  4K8X A;  4Z2W A;  1PV0 A;  4JI2 B;  4MVQ A;  2ZE7 A;  4JI0 O;  1XNQ O;  1JFF B;  3NR7 A;  5C8Y B;  1SS3 A;  4DR7 O;  2PUS A;  3JD3 A;  4TT3 G;  3OTO O;  1OCO C;  2ARH A;  2R9I A;  1V9P A;  2RQ6 A;  4IHJ A;  4PD4 F;  1FFT B;  1N33 B;  2JK5 C;  3H1L H;  1ZAU A;  2EJ7 A;  5L3E A;  4LR3 A;  5CBF A;  3EFF K;  5ITZ B;  3FB8 C;  5BR8 B;  4DO2 A;  3G71 V;  4TV8 A;  4MTO A;  4QJF B;  4ZOL B;  4KP4 A;  3JAK A;  2ZNI A;  4LFB O;  3QF7 A;  1S5L Z;  5LP6 B;  3VOU A;  4RQE A;  2KG7 A;  2D2C B;  4LC1 A;  2QWP B;  2AXT Z;  4DUZ O;  3DXR B;  1PM9 A;  2WLL A;  3PN1 A;  2Q0A A;  5IJ9 B;  4XBF A;  1GN2 A;  1JR9 A;  1S77 D;  1FXK A;  4MW3 A;  3CHX A;  4HZ3 A;  1SQQ H;  5JH7 A;  2YIA A;  3A0R A;  2EX3 A;  3SYQ A;  4W4L A;  3WFV A;  3CS5 A;  1FS0 G;  4ZIB A;  4OX9 O;  2RN9 A;  5FNV B;  1BS3 A;  4FVM A;  1FXV A;  3I5D A;  1VQN V;  5LBQ A;  5KUK A;  4NXN B;  1WB7 A;  3LUT B;  5B5E Z;  3THO A;  3RYH B;  1YCI A;  3KZI Z;  2YXL A;  2R70 A;  2CH7 B;  2JGU A;  2EIJ B;  1YDX A;  5LGU A;  2YSU B;  4DR2 B;  5C93 A;  5H9C A;  3MHS C;  2UXB B;  4U7O A;  2BTO A;  1WNS A;  3FD9 A;  1RP3 B;  4B3R O;  4E2L A;  4WBN A;  3CP1 A;  2BCC H;  3J7A U;  4EB6 A;  3AG3 B;  4HNA B;  4R8C A;  4FLU A;  5KUM A;  1B3Q A;  4NTW A;  5B1A B;  2GBO A;  2Q8V A;  1BHB A;  4P9O A;  1BCC H;  2KG7 B;  4YY3 B;  1Y67 A;  5LMN O;  1Q3E A;  4FM1 A;  5AG2 A;  2XAH A;  3OMA B;  4DV1 O;  5IYZ B;  2E76 B;  3DXR A;  3FX7 A;  1XNQ B;  2UUC B;  2ZCE A;  1BMF G;  2XND G;  4N23 A;  3K08 A;  4DR3 B;  4NVP A;  2KSD A;  4H13 B;  5E1A C;  1WJZ A;  1X59 A;  2F4V O;  3QO8 A;  3BEH A;  3SYA A;  3WG7 C;  1GN3 A;  4DW1 A;  5J2T A;  4B7E A;  1KKD A;  5FNV A;  1N4C A;  3K03 A;  3O65 A;  3E8H A;  1G1X B;  1I08 A;  5H6R A;  3AG1 B;  1EFR G;  4JGS A;  5EC1 C;  3ZHT A;  3ASN B;  2JGD B;  4JI1 O;  1WP7 A;  3ABL C;  3RYF B;  3JAW A;  2DYR B;  2P4K A;  1NVP D;  4GUN A;  3K5N A;  4JI8 B;  4QIW F;  4X65 O;  2WLI B;  2QSA A;  4DR5 O;  1G4Y B;  2EUL A;  4PDV A;  3B2E E;  3DC5 A;  3CD6 V;  4UVB A;  2NN4 A;  1JJ2 U;  1QLN A;  3OTF A;  4GKK O;  3ETQ A;  2DYS C;  3ZED A;  1QCE A;  1XHX A;  2FKX A;  1AR5 A;  2W6J G;  5HFL A;  3OTO B;  3RVY A;  2Q67 A;  2QKS A;  3CXC U;  2B9Z A;  4K3A A;  2DMX A;  1E1R G;  1OCC C;  1OCZ C;  4GX0 A;  4KHP B;  4AQY O;  1YJN V;  1VF7 A;  2VS0 A;  1Y66 A;  3JD1 A;  3ABU A;  3N2G A;  1NT2 B;  5IJ0 A;  3LSU A;  1K9M W;  1EZJ A;  3CCM V;  4DR2 O;  1LUW A;  1AR4 A;  2EZP A;  3OGC C;  2MW2 B;  4Z1M G;  1WB8 A;  4PI2 A;  5GW7 A;  1AIL A;  3ZRS A;  1VQ8 V;  2LW7 A;  4DK0 A;  5L3C A;  4O4H A;  4X88 A;  4X64 O;  2QJ1 A;  2JS5 A;  4X62 O;  2A79 B;  1LNQ A;  1XIL A;  2DWE C;  4I5S A;  5IY5 B;  5LL6 Y;  3W7X A;  4JTA B;  2ZM6 O;  5KHJ A;  2AGA A;  2Y4U A;  3K9S A;  1DTO A;  3OR6 C;  3A8T A;  2R9R B;  4DV6 B;  2V7Q G;  3QNE A;  4DV4 O;  1VF6 A;  4LF4 B;  3QG5 A;  3AK1 A;  2F23 A;  1HNZ B;  2VQE O;  2YUA A;  3F5W C;  3SYO A;  4DR4 B;  4RO2 A;  3T4Z A;  3SPC A;  4WFA V;  2ZE6 A;  1JPX A;  4H44 B;  4LNU A;  3OMI B;  2YS8 A;  2CE4 A;  2W0F C;  4WFG A;  3A2F A;  5DEC A;  2GTS A;  4JYA B;  5FPO A;  3MHH C;  1AJQ A;  4J42 A;  5CN0 A;  3UKM A;  3W7U A;  2LFS A;  3D3Q A;  3Q4H A;  1KYO F;  2DYR C;  1JFF A;  4NR1 A;  1NTM H;  3AK2 A;  1RM1 B;  3FB7 C;  4BAY A;  4UCU A;  2Z0A A;  5D5Q A;  4PDM A;  4NKG B;  2YIB A;  3JD4 A;  2RNB A;  4DK1 A;  2XHB A;  2HJD A;  2Q68 A;  2IJK A;  3IFX A;  4FMT A;  4BW9 A;  2V1D A;  5K1X A;  2EIK C;  4ZHQ A;  2PF4 E;  1E79 G;  3JSN A;  2VQF O;  2ZDI A;  2ITC C;  5B3S B;  1P84 F;  5JQG B;  5BXZ A;  2GSM B;  4WF9 V;  4Q20 A;  4PA6 A;  1AJN A;  4RUE A;  2NR5 A;  2ZT9 B;  3P30 A;  3X2Q C;  2OYQ A;  2XAF A;  3CCS V;  4YXW G;  4DRX A;  4H37 A;  2HEP A;  2FB5 A;  4GKJ B;  3ETE A;  3MDS A;  4B3T O;  3ZMV A;  5A9G A;  2WA3 A;  2BSK B;  3HKD A;  2M7W A;  4CS2 A;  3RN4 A;  4TSF G;  4PA7 A;  2L6L A;  1SER A;  3K3W A;  2HVJ C;  4JI8 O;  1Q90 D;  4ZKI A;  2FYU H;  1F23 A;  4EEQ A;  4G28 B;  1U97 A;  4OPH A;  1EBO A;  5D5P A;  4UCO A;  3CCL V;  1Q5O A;  4RUF A;  5IJ0 B;  3TCU A;  1JQ0 A;  3TJT A;  4IIJ B;  5IE9 A;  4P2Z A;  3C3S A;  3RYH A;  1D2D A;  1FKA O;  2OCC B;  3SJB C;  1Y76 A;  5FPR A;  4OX9 B;  3IC9 A;  1FFX B;  3BCC H;  3OEH G;  2ZQM A;  1J5E B;  1XL6 A;  2DQ0 A;  1XRE A;  4X8A A;  2P22 C;  2DW4 A;  5B1O A;  2OTJ V;  3E8F A;  3IJ4 A;  1S76 D;  2GUZ A;  3K5O A;  1S5J A;  1ZL8 B;  2QM8 A;  4YJ2 B;  1I5X A;  4O2A B;  4ASU G;  5CB4 B;  4UV9 A;  1NBM G;  1NTK H;  1VQ5 V;  3CSX A;  4CC5 A;  3G6B A;  1WAZ A;  1NS1 A;  3ABK C;  2IJH A;  1IBK O;  1VMG A;  3N2K A;  4YIP A;  5EYP B;  5JVD B;  4LF7 O;  2XAJ A;  3O9O A;  1BQZ A;  1XI1 A;  4X1I A;  4MVM A;  1Q81 W;  1H8E G;  3L9D A;  3CMA V;  2AHZ A;  2C2A A;  2JGD A;  1WPX A;  4RQF A;  1THZ A;  3OE7 G;  2EIN C;  1SET A;  4IGG A;  1MZE A;  2WSS G;  1AP5 A;  4DV1 B;  4LF4 O;  1BSM A;  2UXD O;  2RDC A;  3JAS B;  1OZ0 A;  3DC6 A;  1VQL V;  4K0K O;  2IW5 A;  3D8C A;  2CUG A;  2Y4T A;  1SQG A;  4JI7 B;  3ZIA G;  3MD0 A;  1OCR C;  5CA1 A;  5KLV H;  1Y6X A;  3AG3 C;  4KXR A;  2MK3 A;  4DV5 O;  3KG2 A;  4WFB V;  3OFN G;  5LYJ A;  4J41 A;  4J7Z A;  1NR7 A;  3VQW A;  4IT5 A;  4TQD A;  3B40 A;  4XDL A;  4DV3 O;  1B04 A;  4RWU A;  3BVO A;  4MS2 A;  3FAV B;  4O4J B;  1BGY H;  3T2M A;  2OIE A;  2JEU A;  2QWQ B;  1FXH A;  4LBE C;  1JA8 A;  1PP9 H;  3CCQ V;  2KB1 A;  3F7V C;  4FLV A;  3VQY A;  1W0K G;  2QDO A;  4X65 B;  3T1Y O;  2CK3 G;  4P9P A;  4JI5 O;  1VQO V;  1L0L H;  1G8M A;  2Q7G A;  3JAL B;  1VAR A;  1SZT A;  2X6B A;  1Q8I A;  3OUF A;  4GX2 A;  3BAA A;  1XL4 A;  2YI8 A;  4UCV A;  2FML A;  4PA4 A;  1OCZ B;  4LCU C;  2F95 B;  5KHK A;  3JSL A;  3BAB A;  2ZR2 A;  3CRC A;  1FJG O;  5FLX N;  4W4K A;  5L3B A;  4GKJ O;  2UUC O;  3E2E A;  3CCR V;  1JJO A;  4MTG A;  4QPJ A;  4MTF A;  1COW G;  1FYJ A;  1K7D A;  2BTQ B;  5L3G A;  4EFE A;  3ZN0 A;  3D3I A;  2IU3 A;  2LJ2 A;  2LFR A;  1YF2 A;  1ZWI C;  1XQ8 A;  1ZUQ A;  3OEE G;  2EBO A;  4MVO A;  2IH1 C;  4B3S O;  1G6U A;  1M9N A;  3ZS8 C;  2Q73 A;  2HP8 A;  2EIM C;  4CH4 A;  3OM3 B;  4DV0 B;  2Y48 A;  4CZZ A;  3AK3 A;  1VF6 C;  2CGN A;  3E8B A;  3CCV V;  3UM7 A;  2RJZ A;  3JAT A;  3HKB A;  5J2T B;  3ZRX A;  4DR5 B;  1EM1 A;  2PYJ A;  3A0H Z;  2ZE5 A;  2EIN B;  1AI5 A;  1TVK B;  4I50 B;  1Q43 A;  3QTC A;  3CE2 A;  4DV7 B;  1K73 W;  3B77 A;  3CJH B;  4O4I A;  3AG7 A;  3U11 A;  1ENV A;  2WLK A;  5JH7 B;  4X66 B;  4JI7 O;  4DR1 O;  4D7S A;  3W7T A;  1HWY A;  3SGI A;  3SYP A;  2BOB C;  3ETD A;  4NTY A;  1IDS A;  1Q7Y W;  3RYF A;  3BY6 A;  3JAM N;  4MVR A;  4X1Y B;  4N21 A;  3TXS A;  4JI3 O;  1L8D A;  4NXM B;  3L71 H;  1F4N A;  1DK1 A;  4DRX B;  1IZ3 A;  1UPG A;  2VWJ A;  2JS3 A;  2OTL V;  1ZSP A;  2W0X A;  1R6K A;  4WFF A;  5EK0 A;  5JQG A;  3CME V;  1KP3 A;  1ROP A;  3G4S V;  5CA0 A;  1IXB A;  4EFB A;  1EN6 A;  4PV1 B;  4KFM A;  3ZMS A;  3JD0 A;  4MSW C;  1Q82 W;  4JAV A;  2PZS A;  1CEZ A;  1L0N H;  1M57 B;  3RVZ A;  1R3J C;  1SRY A;  4FIP C;  3CRA A;  4NXN O;  5KHG A;  3H1J H;  3OMN B;  2IJI A;  5L3F A;  4FLY A;  5KAF Z;  1YVW A;  2GHY A;  3K06 A;  4UB6 Z;  5IDJ A;  4R7C A;  5EIB C;  4BW5 A;  1Y74 B;  2QKA A;  2FL4 A;  4TV9 B;  1FFX A;  2QR4 A;  1VIB A;  4B3M O;  1NH2 D;  2NLJ C;  2HG5 C;  1GN4 A;  3CC2 V;  1SQF A;  5LA6 A;  1F51 A;  4J11 A;  3I55 V;  3T1Y B;  1IBK B;  3ZRV A;  4LFC O;  1Y76 B;  3B09 A;  5DN6 G;  2ZIM A;  4PEL A;  5BMV B;  4X20 A;  4LF5 O;  5B1B B;  4AHC A;  3ABM B;  1Q6H A;  3GWO A;  3W7W A;  2HHH O;  1RPR A;  3RW0 A;  2UUA B;  1R73 A;  1B06 A;  4IYI A;  3N2K B;  3E22 B;  3RYI A;  2P90 A;  3PJS K;  1Q86 W;  1URF A;  2B1G A;  5LOV A;  3STL C;  5K1P A;  4I4T A;  2YEV B;  4O2A A;  4K0K B;  4XDK A;  2F4V B;  4U3F H;  1NQT A;  3P3P A;  2F43 G;  2WLL B;  3FFQ A;  4UVC A;  1GH6 A;  1KQS U;  3RYC A;  3T1H B;  3L74 H;  2PI5 A;  3CEI A;  1YXB A;  3BA9 A;  1SF9 A;  2UXC B;  4HBN A;  2ZE8 A;  4LF9 O;  4JTD B;  4A5U B;  3JAS A;  4UV8 A;  2HKO A;  2M6Y A;  2CAZ C;  5GTI Z;  1TUB B;  2CH7 A;  4J9Y B;  1MSW D;  5C8Y A;  2RCV A;  2XAS A;  4JV5 O;  3CXH F;  2HR3 A;  1JOY A;  1PL4 A;  1M93 A;  3T1C A;  1YJ9 V;  1AI6 A;  5B1N A;  4NB5 A;  5KHH A;  2Y69 C;  1M56 B;  4ZBM A;  4JI5 B;  4PA9 A;  1IBL B;  1V54 C;  2ADP A;  2ZIN A;  1NVP B;  4DV2 O;  1MOF A;  1R6N A;  2VWK A;  1VQ9 V;  4LH7 A;  5IWA O;  1YTF D;  3HKD B;  3RGB A;  4LWS B;  2GTA A;  2UXD B;  3VQX A;  4JI0 B;  2BOC C;  3HPL C;  2XTA A;  4HNA A;  3CC7 V;  2HFE C;  1CPY A;  4CC6 A;  1ARO P;  4GZR B;  5BZB A;  2CTP A;  1HNW B;  1W2B U;  5JJE B;  1YIJ V;  3LNN A;  2P4V A;  1DGS A;  3ABL B;  5KX5 A;  4TUY B;  1DLB A;  5BR8 O;  2ZNJ A;  4JAS A;  5CA0 B;  4DV3 B;  3CB2 A;  2UXB O;  1K97 A;  4FLT A;  3JD2 A;  1XNR B;  2QWN B;  5JCO A;  5GON B;  2A3Q A;  5B66 Z;  4X64 B;  4X1K B;  4I0X A;  2UUB B;  2QM7 A;  3TK1 A;  1XMQ O;  1QVF U;  2XOK G;  2XAG A;  1GRJ A;  1X4T A;  4WFE A;  3SR2 C;  2JJ2 G;  2UXN A;  2EIM B;  2GUZ B;  1NTZ H;  1M90 W;  3K04 A;  1RPO A;  3RBZ A;  4L8J A;  2QM4 A;  4UVA A;  4DV6 O;  4EB6 B;  1KKC A;  1VQ6 V;  1YEW A;  4X89 A;  5LP6 C;  2QTS A;  4Q6G A;  2WLI A;  3APO A;  3ZCC A;  3SJQ C;  1QR8 A;  2AHY A;  3AG2 C;  2EIJ C;  2JDI G;  2ZXW B;  3H1K H;  3M99 B;  4QE9 A;  5EC2 C;  3CPW U;  1K5Q A;  4MTX A;  5ITZ A;  1MMM A;  2YDE A;  4FZ1 A;  1JX9 A;  4TV8 B;  3T1H O;  5IY5 C;  2ATK C;  1PPJ H;  2Y0P A;  4ZOL A;  3JAK B;  4O4L A;  4J9Z B;  1SQB H;  1KB9 F;  3SPG A;  2X6C A;  3ZMU A;  1PKX A;  4FFB A;  1D5A A;  5JCO C;  5GTH Z;  1BQ0 A;  3QO7 A;  1FPO A;  4B3R B;  5EBL C;  4DV0 O;  1I7F A;  2EZO A;  2WLJ A;  2YIB D;  4X1Y A;  1P49 A;  1IBL O;  1XMO O;  4DUZ B;  1AB3 A;  1WPB A;  5IYB O;  3G6E V;  3JAW B;  3AG4 B;  2JVD A;  3CRM A;  1PD3 A;  3TXQ A;  5LYJ B;  1XEQ A;  5EZY A;  4WCE V;  3ABT A;  2WLN A;  3E86 A;  1K92 A;  4BIZ A;  1YZB A;  1KD1 W;  1VQP V;  3LSQ A;  5LP6 A;  4LP8 A;  3K57 A;  1QLE B;  4JTC B;  5LMN B;  1K33 A;  4F6R B;  2YXH A;  1GTO A;  1QU7 A;  3S3W A;  3SPJ A;  5KHI A;  1S5H C;  3CYO A;  2ILM A;  4LH6 A;  1FD9 A;  1BZK A;  4B3T B;  2Q0O C;  4O2B A;  3JYC A;  2F1M A;  1K3E A;  5A2Q N;  4MVU A;  5BY1 A;  2N05 A;  1MAB G;  4O4J A;  1SC5 B;  1AI4 A;  3HB3 B;  3K5L A;  3P3N A;  4J7J A;  1XDC A;  2YI9 A;  3L72 H;  3L70 H;  1NKD A;  5KX5 B;  3F5T A;  4YHH O;  3LSS A;  1NH2 B;  1WLE A;  4FPP A;  5KAI Z;  1DF4 A;  3TET A;  1PNM A;  5KA5 A;  4PA3 A;  2N74 A;  3AG2 B;  4DV2 B;  1KMI Z;  3EXA A;  3ML0 A;  4TV9 A;  3OW2 U;  1H38 A;  5LHH A;  2D3O W;  3Q4H B;  4FZ0 A;  3SJC C;  3H01 A;  3WG7 B;  2LQT A;  1EN4 A;  1YJW V;  4FLZ A;  4K8Z A;  1H2L A;  2EJR A;  1AI7 A;  1R3I C;  4DV4 B;  5GON A;  1AVM A;  2OCC C;  3MAQ A;  4I0X B;  1TUB A;  4KUM A;  1IUR A;  1KBH A;  4QPK A;  5JWP A;  1P7G A;  3BRC A;  2EIL C;  2OIG A;  1N32 B;  1BL8 A;  3B4S A;  5H5N A;  2K1E A;  1DF5 A;  1XBL A;  1YI2 V;  1H2K A;  1WA8 A;  3TGU H;  1KUQ A;  3RT3 C;  5EBW C;  1AP6 A;  1N33 O;  1QQC A;  2WA4 A;  4ZHQ B;  5LOV B;  5J2U A;  4LF9 B;  1ORQ C;  1TGO A;  4I4T B;  4X9Q A;  3RYI B;  3SPH A;  4HAM A;  4LF6 B;  3KCX A;  4X62 B;  4JI3 B;  2X0L A;  2ETN A;  3ZHR A;  5JJJ B;  3U10 A;  3E22 A;  1I94 O;  3KKY A;  5LHG A;  1PNL A;  3I56 V;  4D7T A;  4JI4 O;  4I50 A;  3CCE V;  3E35 A;  2HHH B;  4O4L B;  1GM9 A;  3CJH A;  5L3D A;  4FLW A;  2BSK A;  4XDJ A;  2XUM A;  2DYS B;  1IBM O;  1OV9 A;  2VRZ A;  1I0H A;  5B1B C;  4X1K A;  1MZF A;  5KMG A;  4CH6 A;  4DV5 B;  2WPD G;  3STZ C;  1MSD A;  1JVM A;  2H8P C;  4F6R A;  2CDY A;  4TWK A;  2Y0I A;  1QHT A;  1W0J G;  1YTF B;  5B3S C;  2UXC O;  1RM1 C;  2NNU A;  4JF3 A;  3T4D A;  3M7M X;  1XOU A;  3GB7 C;  4MW8 A;  3CC4 V;  2Z3Y A;  2QTO A;  3JAR B;  3UT5 B;  4GX5 A;  4CH5 A;  2DE0 X;  2JJ1 G;  2P06 A;  2HJF C;  4F4L A;  4JZG A;  5IYC O;  3OGI B;  3UCS C;  1XMQ B;  4IYH A;  3SDL A;  5DED A;  2WLM A;  4YJ2 A;  1N0N A;  3J80 N;  3ASN C;  4WFH A;  3BPZ A;  1S0V A;  4K35 A;  4LF5 B;  4R50 A;  1SQX H;  2ZM6 B;  2PI4 A;  1AJP A;  1E1Q G;  3ZX6 A;  5H6Q A;  3F7Y C;  2IH3 C;  4UCR A;  3HKB B;  3SJA C;  4TUY A;  2UUA O;  1J5E O;  4G27 B;  5LXT B;  1F7Y A;  5KA6 A; 
#chains in the Genus database with same CATH homology
 2LW7 A;  4X66 O;  4DR6 O;  4NXM O;  4KHP O;  4LF7 O;  1FJG O;  5FLX N;  1XMQ O;  4DUY O;  4X64 O;  4X62 O;  3M8A A;  2UUC O;  1I94 O;  4DUZ O;  4GKJ O;  1X59 A;  2F4V O;  5A2Q N;  5BY1 A;  4JI4 O;  5LL6 Y;  4LFA O;  1FYJ A;  2ZM6 O;  4B3T O;  4DV6 O;  2DJV A;  2AGA A;  3O65 A;  4JYA O;  2UU9 O;  4LF4 O;  1G1X B;  1HNZ O;  4LF9 O;  4A5U B;  2ZKO A;  3F5T A;  1R6T A;  4YHH O;  2UXD O;  4DV4 O;  4LF6 O;  4JI1 O;  1IBM O;  2E5L O;  2UUB O;  4JI8 O;  4B3S O;  4K0K O;  4OX9 O;  4LF8 O;  2VQE O;  4NXN O;  1R1B A;  4JI2 O;  4JV5 O;  4OPH A;  2JRI A;  2N74 A;  4JI6 O;  4X65 O;  4DR5 O;  2DOS A;  3T1H O;  4DV5 O;  4DR4 O;  1N34 O;  4DV2 O;  3R66 A;  5IWA O;  2UXC O;  1N36 O;  4GKK O;  4B3M O;  4DV3 O;  5IT9 N;  1D2D A;  1HR0 O;  1FKA O;  4B3R O;  2FKX A;  1N32 O;  1HNW O;  4LFC O;  4JI0 O;  1XNQ O;  4JI7 O;  4DR1 O;  3J7A U;  4DR7 O;  4DV0 O;  4DV7 O;  3T1Y O;  1A32 A;  2Z0A A;  4AQY O;  3OTO O;  4JI5 O;  3SDL A;  5H5N A;  1IBL O;  4LF5 O;  1XMO O;  1AB3 A;  4YY3 O;  5LMU O;  5BR8 O;  4OPA A;  3J80 N;  2HHH O;  4DR2 O;  1KUQ A;  1XNR O;  1XEQ A;  3RT3 C;  3JAM N;  2UXB O;  3J81 N;  5LMN O;  1HNX O;  1N33 O;  4DV1 O;  4JI3 O;  1YZB A;  1NS1 A;  1IBK O;  2VQF O;  4DR3 O;  2UUA O;  1J5E O;  4LFB O;  1AIL A;  1DK1 A;  1F7Y A;  5BXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...