1RSOA

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
total genus 18
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1rsoA01
1VF7A 1T5EA 2F95B 5D5PA 4L8JA 3WB2A 3LNNA 3WB1A 2F1MA 1RSOA 3WB0A 5JJEB 5D5QA 5JJNB 4GYCB 2V4DA 1H2SB 2F93B 5JJJB 4DK0A 3BRCA 4DK1A
chains in the Genus database with same CATH superfamily
4CS2A 3LSUA 3BEHA 1K8AW 2VWJA 2L6LA 3K5LA 1EN4A 2FMLA 2QGNA 3TXQA 5LOVB 4AHCA 3T4DA 3D36C 1OHHG 4FM0A 2WLIA 1SF9A 2QTSA 2Q9LA 3OR6C 4DR1B 4L87A 2FL4A 1XI1A 1PL4A 1IXBA 1YTFD 1GN3A 1MNGA 1MZEA 1SQPH 2R72A 4N23A 3ZMZA 1QQCA 4PDLA 2KSDA 3UCSC 3LNNA 1BQ0A 5IJ9B 4DV3O 1NKDA 3ZS8C 3N2KA 1NTKH 1JVMA 4DR4O 4GX5A 3SJCC 1IBMB 3VQWA 4JI6O 4DK1A 4MVRA 3ABKB 4DUZB 2OYQA 2P4KA 3FB5C 4FMTA 2ZKOA 5EBLC 1M57C 5BMVB 3IC7A 4X62O 1YI2V 1M90W 5BR8B 4X9QA 3MDSA 3DGEA 1OCOC 3JASB 5ITZA 5IWAO 2EINB 5EBWC 4JI8B 2WPDG 4CC6A 3GWKC 1IBKO 4IYHA 3ZMSA 3B2EE 4J9YB 5LA6A 4LFAB 2ZT9B 3BABA 4LF8B 2OT5A 4I9WA 4JI4B 1SKVA 2PI5A 2P06A 2PGGA 1VP7A 4O2BB 5JQGB 5LGUA 4CBCA 1YZBA 4ZI7B 4ZHQB 3CCSV 1DLBA 5A2QN 1Q7YW 2N05A 4U7OA 2FYUH 4RWUA 3A2FA 3A0HZ 1JPXA 3DTUB 3BVOA 5IYBO 1XL4A 5KMGB 3O65A 1KYOF 4PELA 3JATB 5IDJA 4LFBO 2X6CA 3D8CA 4X1KA 4JI3O 4YHHO 4LF9O 3N27A 4DV6O 1M57B 5IYCO 4I9QA 5IYZB 3AK1A 2GSMB 4KHPO 2AHZA 5IE9A 3SYOA 3O9OA 1N0JA 3B77A 1AJNA 4GCZA 4YXWG 2QEXV 5LP6B 4K0KB 2QR4A 4JI6B 3BA9A 1US6A 3SGIA 4DO2A 3B8MA 3K3WA 1DF5A 4DR2B 4U3JB 3CCMV 2A9HA 3JAKA 3CCRV 1GAXA 1KMIZ 5KLVH 4YY3B 4PD4F 2RN9A 2OWOA 1JR9A 2ZR3A 2F66C 2YC0A 3IJ4A 4JI5B 3DXRA 1IURA 1B3QA 2DOSA 3K9SA 2F4VO 3T1YO 1SRYA 3L72H 4FLWA 3AG3C 3CRAA 4DUYO 3WG7C 1MABG 2Q4PA 1T5EA 2WAMA 1IBLO 1YJNV 3R66A 3C3SA 1TUBB 4H0LB 1R6KA 4CH5A 2PYLA 1FJGB 3RYHA 3CEIA 3UT5A 1Q8IA 2XOKG 2QWPB 1N33B 1GM8A 3UQ8A 4O4IA 3U10A 3OE7G 1SZXA 1J5EO 1H8EG 2GBOA 1SQQH 3APOA 2XAGA 2A06H 4YIOA 2UXDB 5L3FA 4DXWA 4EFEA 4B3MB 2FB5A 4K8XA 5EIBD 1EZVH 5E1AC 2JGDB 3KKYA 4LNUB 2IH1C 5B1OA 3STZC 4NR1A 1HNXB 2JS5A 2E75B 2HHHO 3CD6V 3ZJZA 1NVPD 4DV7O 3VQXA 1VF5B 1E79G 1U97A 2AW9A 3QVNA 4WFEA 2HJDA 4KFMA 1R73A 1ZWIC 1PD3A 1WLEA 2CH7B 4GUNA 2XNDG 3P3NA 1CEZA 3CCEV 4O4LB 2OIEA 3OAAG 2DMXA 2EZPA 3BHPA 2ZE8A 4WBNB 4JI7O 2Y69C 1QNMA 5K1XA 3H1JH 3CCQV 1R1BA 3K57A 3Q4HB 3QNEA 1K5QA 3SJAC 5GONB 2CAZC 1PM9A 2WLHA 1GM7A 2UXXA 3CRMA 1QCEA 2GUZA 1SQFA 2LGQA 1FD9A 3BFRA 1NH2B 4BAYA 2VQEB 3FFQA 4MVQA 4LWSB 1P4RA 4W4KA 3D36A 3SYPA 4B3SB 4IHJA 1MZFA 2CE4A 4X20B 1URFA 2W0XA 1GMGA 4H33A 5EC2C 3ETEA 1H2LA 3QO5A 5CA1B 3S3WA 1FFTB 1ROPA 3ABMB 1RFYA 3BAAA 1EBOA 3AG4B 2V4DA 4DR6O 1M93A 2X6BA 1VQOV 4J7ZA 1Q5OA 4FFBA 3QO7A 4ZOLB 1XNQO 1AJPA 4LBEC 5L3DA 2CK3G 5IY5B 3J80N 4R7CA 3ABLC 1GN4A 5IJ0A 3RYCB 3B09A 1E1RG 1XBLA 2EINC 5CB4B 3LSQA 2ETNA 4G2KA 5AG2A 2B1IA 5IYDO 3LDDA 3CC2V 5EIBC 3E89A 2NN4A 4QE9A 1YIJV 2ZIOA 4JV5B 4TUYA 5LMNB 1JMKC 1BS3A 3J81N 3B40A 4UV8A 4K35A 3BCCH 1OCZC 2EIKC 1U96A 1Y74A 2VRZA 1S72V 2CUGA 4X1IA 3GVMA 4EB6B 1P84F 4FLZA 4MTXA 2Y0PA 3KZIZ 4KXRA 3E8FA 5KUMA 3ZHUA 4LF7O 1IXMA 3E22B 4CC5A 3OMAB 3E8HA 4XDKA 4EKWA 2KG7A 3L9DA 2EBOA 2Z3YA 3C90A 2Q7EA 4RQFA 4DV1B 3C3TA 3G71V 2KB1A 4U3JA 2UUCO 3RYFB 4NTYA 3ZMTA 2BCCH 3UO3A 5FL7G 1PNMA 1ZL8A 1CP9A 4ABMA 5JJJB 4TUYB 4LF6B 2EIJB 4WCEV 2GUZB 2BTOA 4PA6A 4LH6A 2QWQB 4IIJB 2UXBB 3ETQA 2ZINA 4JI1B 5EK0A 3B8NA 4KP4A 3JD2A 3OGCC 5KUKA 1I5XA 1PPJH 2WSSG 1KECA 5JVDA 2DWDC 4WFGA 4PV1B 1XREA 3ZRWA 4NXMB 2AZ0A 3CJHA 4XDLA 2EIMC 1VQ5V 1CXZB 3TJTA 4DR2O 3K04A 3TCUA 1ZX3A 3MHHC 3LNMB 3OD4A 4DV6B 4X65B 4I5SA 3WB2A 1QHTA 1R3IC 4WFBV 1LUVA 4Z1VA 3E35A 2DE0X 5ITZB 3K08A 3ZMVA 4MVUA 1F4NA 1F7YA 2B5UA 4UCUA 4WFAV 1YF2A 2A3QA 3HR0A 1Q6IA 3I56V 2ZQMA 1XHZA 4X89A 4B08A 2P67A 1FXHA 3AG3B 4PA4A 4DV0B 4O4JA 4I50A 1BGYH 5BR8O 1YSCA 2NNUA 1XNRB 4JI3B 2UXCO 4YJ2B 3RT3C 3AK3A 3VOUA 3OFNG 5JVDB 1XMQO 2YIDA 1O9GA 4DV5O 1NQTA 4ZKIA 3MAQA 1H38A 4UFZA 3H1HH 2CH7A 2W6IG 1W59A 5LXTB 1FAFA 3E8BA 2ZE7A 4DK0A 1QVGU 1AILA 3H9VA 5LXTA 3E86A 2FKXA 4JAVA 4MSWC 1THZA 1VMGA 1RPRA 3FD9A 1RM1B 2HKOA 1J5EB 3ZCCA 2IU0A 4ZIBA 1YHQV 2JRIA 1CPYA 3RYFA 1GO3F 3CMAV 4NXNO 5EYPA 4J7KA 3K59A 1ZSPA 3ETDA 1COWG 3RGBA 1FFXB 1NS1A 2IBZH 3ABTA 3RYIB 1F4MA 2RNBA 3CPWU 4X1IB 4JYAB 2ZCEA 2V7QG 4H13B 2F1MA 2BSKB 2EILC 2LFRA 2IJIA 5EZYB 3TGUH 5LMUB 2X6AA 5J2TB 3UT5B 2RCVA 1TGOA 5CB4A 4G28B 3AG7A 1SERA 1VQ7V 3AG2C 3ASNC 3G4SV 4HAMA 2ILMA 4UUJC 3G6EV 4I4TB 5L3BA 1H2SB 3APQA 1FXKB 3DC5A 3OMNB 2DWEC 4PA7A 2QJ1A 5A9GA 3ZEDA 2PUSA 4JYYA 4JI2B 1Z2GA 1H2KA 5B1AB 3W7TA 4OGQB 4DR6B 2ADPA 2P4VA 4X66B 2HP8A 3EVKA 4OX9B 1DTOA 3CWBH 2OCCC 3KG2A 3R65A 4LF5O 2XUMA 5KHJA 4MVSA 4RO2A 4CS4A 4PDRA 2IU3A 3T4ZA 4LFBB 3STLC 1JX9A 3JALA 3L71H 1HR0B 2EIJC 4CS3A 4FM1A 4MW3A 3H1IH 5LYJA 3OW2U 3ASOB 1GRJA 4Z2WA 4KUMA 4O4JB 1FKAO 2EIKB 1WN7A 2HVKC 2ZDIC 4DRXB 2P22C 4X62B 1AI4A 3CRCA 1RSOB 4JI2O 2E74B 4JTDB 2UXBO 4D7SA 1S5HC 2YXYA 5DM6V 2DW4A 4D7TA 3WB1A 2YEVB 3HB3B 4UVCA 5KA6A 3N2GA 3P30A 1NR7A 4N21A 5CA3A 3I55V 1IDSA 4Q6GA 4JGSA 3S3XA 1VQ4V 1SA0A 4DUZO 4JI0B 4GKKB 5KHGA 2XT9A 4GX0A 1ZLZA 3K0GA 1N32O 3CXHF 2PI4A 2OCCB 1R3JC 4I0XB 1Y66A 1UFIA 3NXSA 3K03A 1FYJA 3LDEA 4FLTA 3AG4C 3CC7V 3AEIA 1MG1A 2IM9A 3K9AA 1N32B 3F7VC 1E1QG 2ADQB 5GTHZ 2NR5A 4HYOA 2MK3A 4F6RB 2Y4TA 2JJ1G 1A32A 4XBFA 5LMNO 4EEQA 1K4DC 1VQ8V 2EJRA 5CA1A 3L70H 2LW7A 3CCUV 1F23A 3EHBB 2ODMA 3OEHG 4O4IB 4WFHA 4O2AA 4QJFB 4PJ0Z 1WJZA 1VQLV 4O4HA 4NYKA 1KP2A 1Y76A 5EC1C 3JD4A 1I08A 3SPGA 1ENVA 3L75H 1YEWA 2WLNA 5H9CA 2CTWA 1B6QA 1I5YA 4DRXA 3JD0A 1JFFA 1M4UA 1Q6HA 5JH7A 1ORQC 1K7DA 2UXCB 4K3AA 5EBMC 5TISZ 1JJOA 2XTAA 4P30A 1Y74B 4PHZA 4JYBA 1L0LH 3VQVA 2CDYA 1Y4MA 1MOFA 3HKCB 2BTQB 1K33A 2VQFB 1FXVA 2BE3A 3RN4A 2JK5C 4FVMA 4UB6Z 1H8HG 1EZJA 4J9ZB 4K8ZA 3E8GA 1L1FA 1NU1H 5LGTA 1HP8A 3OR7C 4UXNA 1XEQA 4FK5C 5IJ0B 3W7SA 2JIZG 3HKCA 4DV2B 3QF7A 1R6NA 1Y6XA 4UCTA 4QNHB 2Q67A 4FFBB 1S76D 2K9PA 1OZ0A 1AR5A 1S0VA 4QPJA 3CRRA 5H6RA 4X65O 4I4TA 2JDIG 1DGSA 2YI9A 4B3RB 1OCRC 3E22A 4MVMA 1JQ0A 1KC8W 1K3EA 1VQPV 2F23A 2CGOA 2QA4V 2LFSA 4TV8A 1BT8A 2Q8VA 3SPIA 4TOIA 3HKEA 4X20A 4B3RO 4WF9V 2YUAA 2O57A 2Q0OC 2UXNA 1Y67A 4DW1A 1KU9A 4MVOA 4FPPA 3J7AU 4A5UB 4DV2O 1R6TA 2W0FC 3T2MA 2BOCC 4DV4B 1YVWA 3M99B 2HEPA 5LHIA 3SJQC 1I94O 4X88A 3DC6A 2ITCC 3A0BZ 3P3PA 5EYPB 2BTQA 2EX3A 2RJZA 2UUBB 4D6TH 4GYCB 1XQ8A 2D2CB 2QWRB 2R9RB 3JSLA 4AI8A 2IJKA 2P5OA 2AZ2A 4QGPA 4OPHA 2DQ3A 2QTOA 2UUAO 2UUCB 1BHBA 5KAFZ 1OCCB 3N2KB 2DQ0A 2WLLB 4W4LA 2YI8A 1SA0B 1MA1A 3CX5F 4TQFA 4X64B 2H94A 4HNAB 2XAHA 3F7YC 2PYJA 2WLMA 2UUBO 2CTPA 2YIAA 3F5TA 1W0KG 2F43G 1QR8A 4JAAA 4LNUA 2JJ2G 2WLIB 4MTGA 4YJ2A 3FKSG 5B1AC 2FTKA 5HFLA 3CMEV 1EN6A 3ZBHA 4DR1O 4I50B 1DF4A 1XNQB 2YXLA 2WLKA 1S5JA 4LR3A 4QIWF 1WB8A 4UCRA 2ZE5A 3X2QC 1KB9F 2E5LO 3CS5A 2QE7G 3JALB 2GV9A 3DSQA 2ZDIA 4MTOA 3K5MA 2Y4UA 3RFRA 3ZRXA 4P9PA 3UO2A 1AVMA 3JAMN 1WA8B 1P49A 4U7NA 2ZE6A 1K97A 5CMUA 2ZXWB 4BIOA 3ABLB 2E76B 3ZHRA 3A0RA 1SQXH 1V55C 2QKSA 4B3TO 1TVKB 5HFMA 2PZSA 1OCOB 4X8AA 3FYIB 2ITDC 1Q86W 3JAWB 2ZNIA 2UU9O 5BXZA 4K0KO 1D5NA 5K1PA 1G4YB 3ZRWB 1V9PA 2DYRB 4LF9B 4PDVA 3RWRD 1QLEC 2Q6AA 4LF8O 1D2DA 2M6YA 1GK9A 1N34O 3ZHVA 4UCVA 1K4CC 1UPGA 3TETA 2QM8A 3QG5A 1R3KC 1WNSA 3EXAA 3ABKC 1J95A 3ZHQA 3K0DA 3CHXA 2HHHB 3W7UA 1ZAUA 1TA8A 1MSDA 4NTXA 3E2EA 5H2FZ 3PN1A 3ZN0A 2HLDG 5KA5A 3BPZA 1Q3EA 1HDJA 5LP6A 3RVYA 3RVZA 2DYSB 1N36O 1HNXO 1AR4A 5LHHA 2HVJC 3W7WA 4JI4O 5LHGA 1PV0A 5GONA 1BQZA 4QPKA 4RAIA 2Q69A 4YJ3A 5B66Z 2WA3A 4BW5A 1VQ9V 3OTFA 4BIZA 1GH6A 4PA9A 1GM9A 5DN6G 4DV4O 4QE7A 2XASA 4ZHQA 2CTQA 1LNQA 2ATKC 4J80A 2UUAB 4RQEA 1NBMG 4NVPA 2W6JG 1VARA 3UKMA 1H2MA 5F2VO 3K79A 3ZIAG 4IT5A 4OPAA 2B1GA 2QM7A 4O4HB 1XHXA 1K34A 1L0NH 1AJQA 3HKEB 5CN0A 4WFFA 3U11A 2Z5UA 2Y48A 2RQ6A 5KX5A 4CH4A 1Q90D 3OMIB 2ZM6B 5JCOC 1K73W 2CGNA 1DK1A 2QDOA 4DV5B 4JYAO 4F6RA 4YY3O 4X1KB 2JEUA 3ASNB 4JTCB 1PNLA 5KAIZ 1KKDA 3IGAC 5IT9N 1N0NA 1YJWV 4H37A 1G6UA 4Z1MG 3ZMUA 1VQKV 4L8JA 3CRQA 1VF6C 3ICXA 4ZI7A 1XL6A 1AB3A 3ZHSA 1N4CA 3ML0A 4P9OA 5DEDA 1BE3H 1GN6A 1PNKA 4R8CA 4YHHB 5FPOA 1VF7A 4UVAA 1NVPB 2WLLA 3OEEG 3A8TA 4B7KA 1P7BA 4JI0O 4GKKO 4DYLA 1P7GA 3JYCA 1S3JA 1QBZA 2YEVA 4X1YB 3K5NA 4X1YA 3ETGA 3BA8A 3IFXA 2LQTA 4O4LA 4YJ3B 2IH3C 1XOUA 2YIBA 4ICGA 3SYAA 4I7ZB 5JH7B 4MT8A 2Q68A 2OTJV 3JAKB 4DW0A 4NB5A 2YS8A 5GTIZ 2G38A 5BY1A 1M5IA 1AI7A 1Y76B 1YDXA 2KKWA 3SYCA 1F51A 4GLXA 2QM4A 5FPRA 1HR0O 2CTRA 2LP7A 1XILA 1PKXA 1Q43A 4TV8B 4PA3A 1X4TA 2H8PC 4HBNA 2R9AA 1AP5A 1QLNA 4LF6O 3FB6C 2GTAA 4CZZA 2P6JA 2A0LA 3WB0A 3VBBA 1W0JG 1G8MA 3OGIB 3JATA 4JZGA 5KMGA 3ABUA 5KX5B 3CCLV 1KD1W 2YSUB 3W7XA 4J42A 4R6ZA 2X7RB 5JQGA 3JAWA 4IL6Z 4FLVA 3FYEB 3JCZA 5LA6B 1VF6A 3RYHB 4TV9A 1X59A 2E5LB 5B5EZ 3UM7A 1QVFU 1HWYA 1IBLB 4NXNB 5B1BB 1R3LC 4JI1O 3JASA 2DN9A 3N2GB 1VIBA 1SQVH 2QKAA 4FZ1A 1GN2A 2QWOB 1KBHA 2Z0AA 4KL1A 4UVBA 5CA0B 2BSKA 2GDSA 4RUFA 4J10A 4TT3G 4F4LA 1RP3B 1M1KW 1HNWO 4BW9A 4DR5B 3WU2Z 2YDEA 4RUEA 3D3QA 3SJBC 1RPOA 3WFVA 1AP6A 4H44B 2RMKB 3ZX6A 4GT1A 5LYJB 1XNRO 3CCJV 4UCSA 2AXTZ 4JAUA 5KHKA 1OCCC 5LL6Y 1YTFB 3H1LH 1SQGA 3CB2A 1OJHA 1YITV 2Q0AA 4I55B 5LP6C 4E2LA 5C8YB 1FXKC 1AI5A 3ZN1A 1BZKA 3JD1A 2WWWA 3JSNA 2N74A 2VQEO 4TWKA 1XDCA 3HPLC 1N36B 1GKFA 1NH2D 1K92A 3OUSA 2OCHA 4UCOA 4BIUA 3TK1A 2ZR2A 4F6EA 2VS0A 4I0XA 1OCZB 5LMUO 1TUEB 3MHSC 4AQYB 1N34B 1B06A 2LGWA 5IWAB 2IJJA 1WB7A 1OV9A 3FAVA 3AG2B 1S77D 4DR3B 2JS3A 1PP9H 3I5DA 4MS2A 2WA4A 1BCCH 1Z5VA 5BMVA 4JASA 3FB7C 5IY5C 1WPBA 2ZXWC 3LSSA 4NXMO 1WPXA 5J2UA 1YJ9V 3NR7A 3H1KH 5B1NA 2VWKA 3GB7C 1HW7A 5JJEB 3OTOB 3OM3B 5DECA 3FB8C 4FZ0A 3OT7A 5JCOA 3JD3A 4FM2A 4B3TB 4UV9A 1SC5B 3ABMC 1RM1C 2GHYA 3CJHB 2B9ZA 1OCRB 3AG1B 1EN5A 3PJSK 4DV1O 5GW7A 3LDCA 4JV5O 1HNZB 4WBNA 2HG5C 4X64O 2PY5A 4LCUC 4LF7B 1M56B 4IIJA 3HKBA 3HKBB 1XMOB 1VQMV 4LC1A 4GKJO 3T1HB 4LH7A 3FX7A 1XMQB 1L8DA 5L3CA 4PI2A 5D5PA 3U0ZA 3GWOA 2JEXA 1RSOA 4YIPA 1FXKA 1WP8A 3CP1A 3SR2C 3KCYA 2IW5A 4J7JA 5E79Z 2JGDA 3AG1C 3HKDB 2X0LA 4B7EA 1JFFB 2P90A 3THOA 2EULA 2R70A 2E3CA 1KQSU 3L74H 1HNZO 5H5NA 4LFCO 1JJ2U 1AI6A 4BWAA 1KP3A 3CXCU 2F4VB 5H6QA 5B1BC 2MW2B 4TQDA 1H2NA 5D5QA 4P2ZA 3SPCA 1V55B 2LW1A 2NLJC 2V1DA 1IX9A 3SYQA 3OTOO 3FAVB 4DUYB 1K9MW 1I0HA 3T1YB 1BMFG 4TV9B 2EIMB 2D3OW 2DJVA 3B4SA 3JARB 3F5WC 3ZRVA 1TUBA 1FPOA 3K58A 1BSMA 4GZRB 1IZ3A 3KCXA 1FJGO 4MW8A 4FLXA 1XMOO 3RBZA 5L3EA 2ARHA 1AR1B 4DR7O 4IGGA 4U3FH 2L35A 1I94B 3DXRB 4MVZA 1B04A 3EFFK 1NR1A 1TVKA 5J2TA 1MMMA 4I55A 2VQFO 1NI8A 5B3SC 4FJCC 4GX2A 1WA8A 4KHPB 4FFKA 4DR7B 1H2GA 5EZYA 4FLUA 4IHJB 5CBHA 2M7WA 5FNVA 3LUTB 1AROP 3CSXA 4PDMA 1VQ6V 5KHHA 4NTWA 3G6BA 2BOBC 4FLYA 1GTOA 2KG7B 4HZ3A 3VQYA 2A7WA 4J41A 1SETA 1PL0A 5IYZA 2UU9B 2Y69B 2OTLV 3Q4HA 4Q20A 5L3GA 2Q7HA 2F95B 2QKCA 5J2UB 5FNVB 2XHBA 4DV7B 1YXBA 5CA0A 3RW0A 1IBMO 4LF4B 2DYSC 4B3MO 2HFEC 4LFCB 4JI7B 1YCIA 1JCHA 3CYOA 4JTAB 5C93A 5LOVA 5KHIA 1K5SA 1Q82W 1NZ6A 1WAZA 2A79B 1S5LZ 5B3SB 2EZOA 1UJWB 3T1CA 4ZBMA 5J9PC 4DR4B 4G27B 3E83A 1Q81W 4MTFA 4FIPC 4ZOLA 2HJFC 5JJNB 3H01A 3JCUZ 3M7MX 3SPHA 2XAJA 2GTSA 1LUWA 2Q7GA 2RDCA 4JI5O 3T1HO 1VEWA 1Z5WA 1QLEB 3OUFA 5BZBA 1BHAA 1HNWB 2K1EA 3ZRSA 1SESA 3CE2A 5C8YA 2Y0IA 1KUQA 4LF4O 3MD0A 5IJ9A 1NTZH 1FS0G 4R50A 3CC4V 4EFBA 2C2AA 3G67A 4DV3B 2LJ2A 4GKJB 1SQBH 4IYIA 2ZM6O 1ZL8B 1JA8A 5LGNA 4ASUG 1W2BU 3ZHTA 1QU7A 2YIBD 2AGAA 5CBGA 4JPRA 1N33O 3AK2A 4HNAA 3RYIA 4OXSA 1WP7A 1FFXA 1V54B 2WLJA 2ZD9A 2JGUA 3HKDA 3X2QB 1VQNV 1I7FA 4UB8Z 4B3SO 2F93B 1NT2B 4DR3O 2JVDA 3K5OA 1XUQA 1M56C 1V54C 2Q73A 3ASOC 3SDLA 3QO8A 2AHYA 1Q6UA 1NTMH 4X66O 4OX9O 4C7UA 3P32A 1QR9A 4LFAO 2PTMA 1IVSA 3L73H 4JZ2A 2N04A 2Q5ZA 2YXHA 2IJHA 5FLXN 2QSAA 4DV0O 3BRCA 3RYCA 5CBFA 1SS3A 4JYCA 5LBQA 1D5AA 4XDJA 1BL8A 1KKCA 3M8AA 1SZTA 1EFRG 2XAQA 3TXSA 2XAFA 4GX1A 3K06A 1M9NA 2EJ7A 2P7TC 1ZUQA 2YICA 1IBKB 2ZIMA 4J11A 4AILC 3BY6A 2QWNB 2H3OA 3JARA 1O9HA 2DYRC 2OIGA 2HR3A 3SPJA 4EB6A 1JOYA 3QTCA 1EM1A 4AQYO 4NKGB 3G80A 4O2AB 4CH6A 1MSWD 3IC9A 1ZTEA 2UXDO 4LWSA 4O2BA 4LF5B 2EILB 3D3IA 4DR5O 3CCVV 3WG7B 2ZNJA 4JF3A 4CH3A 4TSFG 2KQXA 4LP8A 3IAYA 1TAEA 2LO1A 2PF4E 1N8RW 2R9IA 5JWPA 1G1XB 4JI8O 4BR6A 4E4EA 4PI0A 1NJIW 1LR1A
chains in the Genus database with same CATH topology
4CS2A 4UCOA 2P5OA 2VWJA 2UUCB 3N2KB 4DV6B 4X65B 4AQYB 3WB2A 1N34B 1QHTA 3K5LA 2YI8A 1SA0B 5LOVB 4AHCA 5IWAB 4TQFA 4X64B 4FM0A 4HNAB 4DR3B 2PYJA 4DR1B 5ITZB 1XI1A 2YIAA 1Z5VA 5BMVA 2R72A 1WPBA 4UCUA 4LNUA 1QQCA 5J2UA 4YJ2A 3LNNA 2VWKA 4I50B 5IJ9B 1XNQB 1HW7A 1XHZA 4B08A 2YXLA 3ZS8C 3N2KA 5JJEB 3OTOB 1S5JA 3SJCC 4LR3A 1IBMB 5JCOA 4DV0B 4O4JA 4UCRA 4I50A 3VQWA 4FM2A 4B3TB 4DK1A 1XNRB 4JI3B 4YJ2B 3JALB 4DUZB 2OYQA 2GV9A 3DSQA 5JVDB 5BMVB 3K5MA 3RFRA 1O9GA 5BR8B 3JASB 1HNZB 5ITZA 1P49A 4WBNA 4JI8B 3MAQA 4CC6A 4UFZA 2PY5A 3B2EE 4LF7B 5LA6A 5LXTB 4LFAB 1TVKB 4IIJA 3HKBA 2PZSA 3HKBB 4DK0A 1XMOB 5LXTA 3JAWB 3BABA 4LF8B 2ZNIA 3T1HB 4LH7A 4JI4B 1SKVA 2PGGA 1XMQB 4O2BB 5JQGB 4ZI7B 1L8DA 4ZHQB 5K1PA 1J5EB 4ZIBA 4PI2A 5D5PA 3U0ZA 1V9PA 4LF9B 3RYFA 3RWRD 1RSOA 3A2FA 3SR2C 5KMGB 5EYPA 3JATB 3K59A 4X1KA 4UCVA 3HKDB 4I9QA 3QG5A 5IYZB 1JFFB 1WNSA 3THOA 3RGBA 1FFXB 2R70A 2E3CA 3RYIB 3CHXA 2HHHB 1ZAUA 1TA8A 4X1IB 4JYAB 2ZCEA 4BWAA 2F4VB 5LP6B 2F1MA 4K0KB 4TQDA 5D5QA 4JI6B 3PN1A 5EZYB 3BPZA 1Q3EA 3BA9A 3SGIA 5LP6A 4DR2B 4U3JB 3JAKA 1KMIZ 4DUYB 4YY3B 5LMUB 5J2TB 3UT5B 3T1YB 4TV9B 2OWOA 2F66C 1TGOA 3JARB 5GONA 5CB4A 1TUBA 3K58A 4JI5B 4YJ3A 4FLXA 4I4TB 3OTFA 1H2SB 4FLWA 1T5EA 2QJ1A 3ZEDA 4ZHQA 2PUSA 1I94B 4JI2B 1B04A 2UUAB 4NVPA 1TUBB 1TVKA 4CH5A 4DR6B 2PYLA 1FJGB 5J2TA 3RYHA 4I55A 4X66B 4OX9B 3UT5A 1Q8IA 5KHJA 4KHPB 4DR7B 1N33B 4O4HB 5EZYA 1XHXA 4FLUA 4IHJB 4CS4A 3UQ8A 5FNVA 4LFBB 3JALA 4O4IA 3HKEB 3U10A 1HR0B 4CS3A 3U11A 4FM1A 5KX5A 2RQ6A 3CSXA 4CH4A 5KHHA 5LYJA 2ZM6B 4FLYA 5JCOC 4O4JB 3VQYA 4DV5B 4F6RA 2UXDB 5IYZA 2UU9B 4X1KB 1WN7A 4DRXB 4EFEA 4B3MB 2P22C 4X62B 5EIBD 4K8XA 2Q7HA 2F95B 5J2UB 4LNUB 5FNVB 1G6UA 4D7SA 2XHBA 4DV7B 4L8JA 1HNXB 4D7TA 5CA0A 3WB1A 2JS5A 3ICXA 4LF4B 4ZI7A 3N2GA 4LFCB 4JI7B 4Q6GA 3VQXA 4YHHB 1SA0A 5LOVA 5FPOA 5KHIA 4JI0B 4GKKB 1VF7A 5KHGA 4DR4B 4O4LB 4FLTA 3BHPA 4ZOLA 4WBNB 4X1YB 5JJNB 3K5NA 4X1YA 3M7MX 2IM9A 5K1XA 1N32B 3BA8A 3K57A 2Q7GA 4O4LA 4YJ3B 1Z5WA 2YIBA 4F6RB 3SJAC 1HNWB 5GONB 2CAZC 5JH7B 5C8YA 4EEQA 5IJ9A 1SQFA 5CA1A 3JAKB 4EFBA 1M5IA 2VQEB 4DV3B 4O4IB 2KKWA 3FFQA 4O2AA 4GLXA 4GKJB 2QM4A 4B3SB 4IHJA 5FPRA 4O4HA 4X20B 2YIBD 1Q43A 4TV8B 1YEWA 1X4TA 5CA1B 4HBNA 4HNAA 3RYIA 4DRXA 2R9AA 1FFXA 1JFFA 1M4UA 2JGUA 5JH7A 3HKDA 3WB0A 3BAAA 1I7FA 3JATA 2V4DA 1M93A 5KMGA 2F93B 2UXCB 1NT2B 1JJOA 5KX5B 2JVDA 3K5OA 4PHZA 3VQVA 1Q5OA 4FFBA 4ZOLB 3HKCB 5JQGA 2BTQB 2VQFB 5IJ0A 3JAWA 3RYCB 4FLVA 4FVMA 5CB4B 2PTMA 2E5LB 5LA6B 3RYHB 4TV9A 4K8ZA 5EIBC 1IBLB 4NXNB 3BRCA 3RYCA 2ZIOA 5IJ0B 3HKCA 4DV2B 4JV5B 3QF7A 1D5AA 4TUYA 3JASA 5LMNB 3N2GB 1JMKC 4UCTA 4KL1A 4FFBB 5CA0B 4I4TA 4X1IA 4EB6B 4FLZA 1DGSA 2YI9A 4B3RB 1IBKB 2ZIMA 4BW9A 4AILC 4DR5B 3E22A 3E22B 4CC5A 3JARA 1O9HA 4DV1B 2Q7EA 3SJBC 4EB6A 3QTCA 5LYJB 4U3JA 4TV8A 3RYFB 4TOIA 3HKEA 4X20A 4O2AB 4CH6A 4UCSA 5KHKA 4O2BA 5JJJB 4TUYB 4LF6B 1KU9A 2BTOA 1SQGA 3CB2A 4LH6A 4LF5B 4IIJB 2UXBB 2Q0AA 2ZINA 3ETQA 4I55B 4JI1B 5LP6C 5C8YB 2ZNJA 4DV4B 2HEPA 4CH3A 3JSNA 3IAYA 1TAEA 5EYPB 2BTQA 2EX3A 2RJZA 2UUBB 4GYCB 1N36B 1XQ8A 5JVDA 3JSLA 4PI0A 4NXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF7 A;  1T5E A;  2F95 B;  5D5P A;  4L8J A;  3WB2 A;  3LNN A;  3WB1 A;  2F1M A;  1RSO A;  3WB0 A;  5JJE B;  5D5Q A;  5JJN B;  4GYC B;  2V4D A;  1H2S B;  2F93 B;  5JJJ B;  4DK0 A;  3BRC A;  4DK1 A; 
#chains in the Genus database with same CATH topology
 4CS2 A;  3LSU A;  3BEH A;  1K8A W;  2VWJ A;  2L6L A;  3K5L A;  1EN4 A;  2FML A;  2QGN A;  3TXQ A;  5LOV B;  4AHC A;  3T4D A;  3D36 C;  1OHH G;  4FM0 A;  2WLI A;  1SF9 A;  2QTS A;  2Q9L A;  3OR6 C;  4DR1 B;  4L87 A;  2FL4 A;  1XI1 A;  1PL4 A;  1IXB A;  1YTF D;  1GN3 A;  1MNG A;  1MZE A;  1SQP H;  2R72 A;  4N23 A;  3ZMZ A;  1QQC A;  4PDL A;  2KSD A;  3UCS C;  3LNN A;  1BQ0 A;  5IJ9 B;  4DV3 O;  1NKD A;  3ZS8 C;  3N2K A;  1NTK H;  1JVM A;  4DR4 O;  4GX5 A;  3SJC C;  1IBM B;  3VQW A;  4JI6 O;  4DK1 A;  4MVR A;  3ABK B;  4DUZ B;  2OYQ A;  2P4K A;  3FB5 C;  4FMT A;  2ZKO A;  5EBL C;  1M57 C;  5BMV B;  3IC7 A;  4X62 O;  1YI2 V;  1M90 W;  5BR8 B;  4X9Q A;  3MDS A;  3DGE A;  1OCO C;  3JAS B;  5ITZ A;  5IWA O;  2EIN B;  5EBW C;  4JI8 B;  2WPD G;  4CC6 A;  3GWK C;  1IBK O;  4IYH A;  3ZMS A;  3B2E E;  4J9Y B;  5LA6 A;  4LFA B;  2ZT9 B;  3BAB A;  4LF8 B;  2OT5 A;  4I9W A;  4JI4 B;  1SKV A;  2PI5 A;  2P06 A;  2PGG A;  1VP7 A;  4O2B B;  5JQG B;  5LGU A;  4CBC A;  1YZB A;  4ZI7 B;  4ZHQ B;  3CCS V;  1DLB A;  5A2Q N;  1Q7Y W;  2N05 A;  4U7O A;  2FYU H;  4RWU A;  3A2F A;  3A0H Z;  1JPX A;  3DTU B;  3BVO A;  5IYB O;  1XL4 A;  5KMG B;  3O65 A;  1KYO F;  4PEL A;  3JAT B;  5IDJ A;  4LFB O;  2X6C A;  3D8C A;  4X1K A;  4JI3 O;  4YHH O;  4LF9 O;  3N27 A;  4DV6 O;  1M57 B;  5IYC O;  4I9Q A;  5IYZ B;  3AK1 A;  2GSM B;  4KHP O;  2AHZ A;  5IE9 A;  3SYO A;  3O9O A;  1N0J A;  3B77 A;  1AJN A;  4GCZ A;  4YXW G;  2QEX V;  5LP6 B;  4K0K B;  2QR4 A;  4JI6 B;  3BA9 A;  1US6 A;  3SGI A;  4DO2 A;  3B8M A;  3K3W A;  1DF5 A;  4DR2 B;  4U3J B;  3CCM V;  2A9H A;  3JAK A;  3CCR V;  1GAX A;  1KMI Z;  5KLV H;  4YY3 B;  4PD4 F;  2RN9 A;  2OWO A;  1JR9 A;  2ZR3 A;  2F66 C;  2YC0 A;  3IJ4 A;  4JI5 B;  3DXR A;  1IUR A;  1B3Q A;  2DOS A;  3K9S A;  2F4V O;  3T1Y O;  1SRY A;  3L72 H;  4FLW A;  3AG3 C;  3CRA A;  4DUY O;  3WG7 C;  1MAB G;  2Q4P A;  1T5E A;  2WAM A;  1IBL O;  1YJN V;  3R66 A;  3C3S A;  1TUB B;  4H0L B;  1R6K A;  4CH5 A;  2PYL A;  1FJG B;  3RYH A;  3CEI A;  3UT5 A;  1Q8I A;  2XOK G;  2QWP B;  1N33 B;  1GM8 A;  3UQ8 A;  4O4I A;  3U10 A;  3OE7 G;  1SZX A;  1J5E O;  1H8E G;  2GBO A;  1SQQ H;  3APO A;  2XAG A;  2A06 H;  4YIO A;  2UXD B;  5L3F A;  4DXW A;  4EFE A;  4B3M B;  2FB5 A;  4K8X A;  5EIB D;  1EZV H;  5E1A C;  2JGD B;  3KKY A;  4LNU B;  2IH1 C;  5B1O A;  3STZ C;  4NR1 A;  1HNX B;  2JS5 A;  2E75 B;  2HHH O;  3CD6 V;  3ZJZ A;  1NVP D;  4DV7 O;  3VQX A;  1VF5 B;  1E79 G;  1U97 A;  2AW9 A;  3QVN A;  4WFE A;  2HJD A;  4KFM A;  1R73 A;  1ZWI C;  1PD3 A;  1WLE A;  2CH7 B;  4GUN A;  2XND G;  3P3N A;  1CEZ A;  3CCE V;  4O4L B;  2OIE A;  3OAA G;  2DMX A;  2EZP A;  3BHP A;  2ZE8 A;  4WBN B;  4JI7 O;  2Y69 C;  1QNM A;  5K1X A;  3H1J H;  3CCQ V;  1R1B A;  3K57 A;  3Q4H B;  3QNE A;  1K5Q A;  3SJA C;  5GON B;  2CAZ C;  1PM9 A;  2WLH A;  1GM7 A;  2UXX A;  3CRM A;  1QCE A;  2GUZ A;  1SQF A;  2LGQ A;  1FD9 A;  3BFR A;  1NH2 B;  4BAY A;  2VQE B;  3FFQ A;  4MVQ A;  4LWS B;  1P4R A;  4W4K A;  3D36 A;  3SYP A;  4B3S B;  4IHJ A;  1MZF A;  2CE4 A;  4X20 B;  1URF A;  2W0X A;  1GMG A;  4H33 A;  5EC2 C;  3ETE A;  1H2L A;  3QO5 A;  5CA1 B;  3S3W A;  1FFT B;  1ROP A;  3ABM B;  1RFY A;  3BAA A;  1EBO A;  3AG4 B;  2V4D A;  4DR6 O;  1M93 A;  2X6B A;  1VQO V;  4J7Z A;  1Q5O A;  4FFB A;  3QO7 A;  4ZOL B;  1XNQ O;  1AJP A;  4LBE C;  5L3D A;  2CK3 G;  5IY5 B;  3J80 N;  4R7C A;  3ABL C;  1GN4 A;  5IJ0 A;  3RYC B;  3B09 A;  1E1R G;  1XBL A;  2EIN C;  5CB4 B;  3LSQ A;  2ETN A;  4G2K A;  5AG2 A;  2B1I A;  5IYD O;  3LDD A;  3CC2 V;  5EIB C;  3E89 A;  2NN4 A;  4QE9 A;  1YIJ V;  2ZIO A;  4JV5 B;  4TUY A;  5LMN B;  1JMK C;  1BS3 A;  3J81 N;  3B40 A;  4UV8 A;  4K35 A;  3BCC H;  1OCZ C;  2EIK C;  1U96 A;  1Y74 A;  2VRZ A;  1S72 V;  2CUG A;  4X1I A;  3GVM A;  4EB6 B;  1P84 F;  4FLZ A;  4MTX A;  2Y0P A;  3KZI Z;  4KXR A;  3E8F A;  5KUM A;  3ZHU A;  4LF7 O;  1IXM A;  3E22 B;  4CC5 A;  3OMA B;  3E8H A;  4XDK A;  4EKW A;  2KG7 A;  3L9D A;  2EBO A;  2Z3Y A;  3C90 A;  2Q7E A;  4RQF A;  4DV1 B;  3C3T A;  3G71 V;  2KB1 A;  4U3J A;  2UUC O;  3RYF B;  4NTY A;  3ZMT A;  2BCC H;  3UO3 A;  5FL7 G;  1PNM A;  1ZL8 A;  1CP9 A;  4ABM A;  5JJJ B;  4TUY B;  4LF6 B;  2EIJ B;  4WCE V;  2GUZ B;  2BTO A;  4PA6 A;  4LH6 A;  2QWQ B;  4IIJ B;  2UXB B;  3ETQ A;  2ZIN A;  4JI1 B;  5EK0 A;  3B8N A;  4KP4 A;  3JD2 A;  3OGC C;  5KUK A;  1I5X A;  1PPJ H;  2WSS G;  1KEC A;  5JVD A;  2DWD C;  4WFG A;  4PV1 B;  1XRE A;  3ZRW A;  4NXM B;  2AZ0 A;  3CJH A;  4XDL A;  2EIM C;  1VQ5 V;  1CXZ B;  3TJT A;  4DR2 O;  3K04 A;  3TCU A;  1ZX3 A;  3MHH C;  3LNM B;  3OD4 A;  4DV6 B;  4X65 B;  4I5S A;  3WB2 A;  1QHT A;  1R3I C;  4WFB V;  1LUV A;  4Z1V A;  3E35 A;  2DE0 X;  5ITZ B;  3K08 A;  3ZMV A;  4MVU A;  1F4N A;  1F7Y A;  2B5U A;  4UCU A;  4WFA V;  1YF2 A;  2A3Q A;  3HR0 A;  1Q6I A;  3I56 V;  2ZQM A;  1XHZ A;  4X89 A;  4B08 A;  2P67 A;  1FXH A;  3AG3 B;  4PA4 A;  4DV0 B;  4O4J A;  4I50 A;  1BGY H;  5BR8 O;  1YSC A;  2NNU A;  1XNR B;  4JI3 B;  2UXC O;  4YJ2 B;  3RT3 C;  3AK3 A;  3VOU A;  3OFN G;  5JVD B;  1XMQ O;  2YID A;  1O9G A;  4DV5 O;  1NQT A;  4ZKI A;  3MAQ A;  1H38 A;  4UFZ A;  3H1H H;  2CH7 A;  2W6I G;  1W59 A;  5LXT B;  1FAF A;  3E8B A;  2ZE7 A;  4DK0 A;  1QVG U;  1AIL A;  3H9V A;  5LXT A;  3E86 A;  2FKX A;  4JAV A;  4MSW C;  1THZ A;  1VMG A;  1RPR A;  3FD9 A;  1RM1 B;  2HKO A;  1J5E B;  3ZCC A;  2IU0 A;  4ZIB A;  1YHQ V;  2JRI A;  1CPY A;  3RYF A;  1GO3 F;  3CMA V;  4NXN O;  5EYP A;  4J7K A;  3K59 A;  1ZSP A;  3ETD A;  1COW G;  3RGB A;  1FFX B;  1NS1 A;  2IBZ H;  3ABT A;  3RYI B;  1F4M A;  2RNB A;  3CPW U;  4X1I B;  4JYA B;  2ZCE A;  2V7Q G;  4H13 B;  2F1M A;  2BSK B;  2EIL C;  2LFR A;  2IJI A;  5EZY B;  3TGU H;  5LMU B;  2X6A A;  5J2T B;  3UT5 B;  2RCV A;  1TGO A;  5CB4 A;  4G28 B;  3AG7 A;  1SER A;  1VQ7 V;  3AG2 C;  3ASN C;  3G4S V;  4HAM A;  2ILM A;  4UUJ C;  3G6E V;  4I4T B;  5L3B A;  1H2S B;  3APQ A;  1FXK B;  3DC5 A;  3OMN B;  2DWE C;  4PA7 A;  2QJ1 A;  5A9G A;  3ZED A;  2PUS A;  4JYY A;  4JI2 B;  1Z2G A;  1H2K A;  5B1A B;  3W7T A;  4OGQ B;  4DR6 B;  2ADP A;  2P4V A;  4X66 B;  2HP8 A;  3EVK A;  4OX9 B;  1DTO A;  3CWB H;  2OCC C;  3KG2 A;  3R65 A;  4LF5 O;  2XUM A;  5KHJ A;  4MVS A;  4RO2 A;  4CS4 A;  4PDR A;  2IU3 A;  3T4Z A;  4LFB B;  3STL C;  1JX9 A;  3JAL A;  3L71 H;  1HR0 B;  2EIJ C;  4CS3 A;  4FM1 A;  4MW3 A;  3H1I H;  5LYJ A;  3OW2 U;  3ASO B;  1GRJ A;  4Z2W A;  4KUM A;  4O4J B;  1FKA O;  2EIK B;  1WN7 A;  2HVK C;  2ZDI C;  4DRX B;  2P22 C;  4X62 B;  1AI4 A;  3CRC A;  1RSO B;  4JI2 O;  2E74 B;  4JTD B;  2UXB O;  4D7S A;  1S5H C;  2YXY A;  5DM6 V;  2DW4 A;  4D7T A;  3WB1 A;  2YEV B;  3HB3 B;  4UVC A;  5KA6 A;  3N2G A;  3P30 A;  1NR7 A;  4N21 A;  5CA3 A;  3I55 V;  1IDS A;  4Q6G A;  4JGS A;  3S3X A;  1VQ4 V;  1SA0 A;  4DUZ O;  4JI0 B;  4GKK B;  5KHG A;  2XT9 A;  4GX0 A;  1ZLZ A;  3K0G A;  1N32 O;  3CXH F;  2PI4 A;  2OCC B;  1R3J C;  4I0X B;  1Y66 A;  1UFI A;  3NXS A;  3K03 A;  1FYJ A;  3LDE A;  4FLT A;  3AG4 C;  3CC7 V;  3AEI A;  1MG1 A;  2IM9 A;  3K9A A;  1N32 B;  3F7V C;  1E1Q G;  2ADQ B;  5GTH Z;  2NR5 A;  4HYO A;  2MK3 A;  4F6R B;  2Y4T A;  2JJ1 G;  1A32 A;  4XBF A;  5LMN O;  4EEQ A;  1K4D C;  1VQ8 V;  2EJR A;  5CA1 A;  3L70 H;  2LW7 A;  3CCU V;  1F23 A;  3EHB B;  2ODM A;  3OEH G;  4O4I B;  4WFH A;  4O2A A;  4QJF B;  4PJ0 Z;  1WJZ A;  1VQL V;  4O4H A;  4NYK A;  1KP2 A;  1Y76 A;  5EC1 C;  3JD4 A;  1I08 A;  3SPG A;  1ENV A;  3L75 H;  1YEW A;  2WLN A;  5H9C A;  2CTW A;  1B6Q A;  1I5Y A;  4DRX A;  3JD0 A;  1JFF A;  1M4U A;  1Q6H A;  5JH7 A;  1ORQ C;  1K7D A;  2UXC B;  4K3A A;  5EBM C;  5TIS Z;  1JJO A;  2XTA A;  4P30 A;  1Y74 B;  4PHZ A;  4JYB A;  1L0L H;  3VQV A;  2CDY A;  1Y4M A;  1MOF A;  3HKC B;  2BTQ B;  1K33 A;  2VQF B;  1FXV A;  2BE3 A;  3RN4 A;  2JK5 C;  4FVM A;  4UB6 Z;  1H8H G;  1EZJ A;  4J9Z B;  4K8Z A;  3E8G A;  1L1F A;  1NU1 H;  5LGT A;  1HP8 A;  3OR7 C;  4UXN A;  1XEQ A;  4FK5 C;  5IJ0 B;  3W7S A;  2JIZ G;  3HKC A;  4DV2 B;  3QF7 A;  1R6N A;  1Y6X A;  4UCT A;  4QNH B;  2Q67 A;  4FFB B;  1S76 D;  2K9P A;  1OZ0 A;  1AR5 A;  1S0V A;  4QPJ A;  3CRR A;  5H6R A;  4X65 O;  4I4T A;  2JDI G;  1DGS A;  2YI9 A;  4B3R B;  1OCR C;  3E22 A;  4MVM A;  1JQ0 A;  1KC8 W;  1K3E A;  1VQP V;  2F23 A;  2CGO A;  2QA4 V;  2LFS A;  4TV8 A;  1BT8 A;  2Q8V A;  3SPI A;  4TOI A;  3HKE A;  4X20 A;  4B3R O;  4WF9 V;  2YUA A;  2O57 A;  2Q0O C;  2UXN A;  1Y67 A;  4DW1 A;  1KU9 A;  4MVO A;  4FPP A;  3J7A U;  4A5U B;  4DV2 O;  1R6T A;  2W0F C;  3T2M A;  2BOC C;  4DV4 B;  1YVW A;  3M99 B;  2HEP A;  5LHI A;  3SJQ C;  1I94 O;  4X88 A;  3DC6 A;  2ITC C;  3A0B Z;  3P3P A;  5EYP B;  2BTQ A;  2EX3 A;  2RJZ A;  2UUB B;  4D6T H;  4GYC B;  1XQ8 A;  2D2C B;  2QWR B;  2R9R B;  3JSL A;  4AI8 A;  2IJK A;  2P5O A;  2AZ2 A;  4QGP A;  4OPH A;  2DQ3 A;  2QTO A;  2UUA O;  2UUC B;  1BHB A;  5KAF Z;  1OCC B;  3N2K B;  2DQ0 A;  2WLL B;  4W4L A;  2YI8 A;  1SA0 B;  1MA1 A;  3CX5 F;  4TQF A;  4X64 B;  2H94 A;  4HNA B;  2XAH A;  3F7Y C;  2PYJ A;  2WLM A;  2UUB O;  2CTP A;  2YIA A;  3F5T A;  1W0K G;  2F43 G;  1QR8 A;  4JAA A;  4LNU A;  2JJ2 G;  2WLI B;  4MTG A;  4YJ2 A;  3FKS G;  5B1A C;  2FTK A;  5HFL A;  3CME V;  1EN6 A;  3ZBH A;  4DR1 O;  4I50 B;  1DF4 A;  1XNQ B;  2YXL A;  2WLK A;  1S5J A;  4LR3 A;  4QIW F;  1WB8 A;  4UCR A;  2ZE5 A;  3X2Q C;  1KB9 F;  2E5L O;  3CS5 A;  2QE7 G;  3JAL B;  2GV9 A;  3DSQ A;  2ZDI A;  4MTO A;  3K5M A;  2Y4U A;  3RFR A;  3ZRX A;  4P9P A;  3UO2 A;  1AVM A;  3JAM N;  1WA8 B;  1P49 A;  4U7N A;  2ZE6 A;  1K97 A;  5CMU A;  2ZXW B;  4BIO A;  3ABL B;  2E76 B;  3ZHR A;  3A0R A;  1SQX H;  1V55 C;  2QKS A;  4B3T O;  1TVK B;  5HFM A;  2PZS A;  1OCO B;  4X8A A;  3FYI B;  2ITD C;  1Q86 W;  3JAW B;  2ZNI A;  2UU9 O;  5BXZ A;  4K0K O;  1D5N A;  5K1P A;  1G4Y B;  3ZRW B;  1V9P A;  2DYR B;  4LF9 B;  4PDV A;  3RWR D;  1QLE C;  2Q6A A;  4LF8 O;  1D2D A;  2M6Y A;  1GK9 A;  1N34 O;  3ZHV A;  4UCV A;  1K4C C;  1UPG A;  3TET A;  2QM8 A;  3QG5 A;  1R3K C;  1WNS A;  3EXA A;  3ABK C;  1J95 A;  3ZHQ A;  3K0D A;  3CHX A;  2HHH B;  3W7U A;  1ZAU A;  1TA8 A;  1MSD A;  4NTX A;  3E2E A;  5H2F Z;  3PN1 A;  3ZN0 A;  2HLD G;  5KA5 A;  3BPZ A;  1Q3E A;  1HDJ A;  5LP6 A;  3RVY A;  3RVZ A;  2DYS B;  1N36 O;  1HNX O;  1AR4 A;  5LHH A;  2HVJ C;  3W7W A;  4JI4 O;  5LHG A;  1PV0 A;  5GON A;  1BQZ A;  4QPK A;  4RAI A;  2Q69 A;  4YJ3 A;  5B66 Z;  2WA3 A;  4BW5 A;  1VQ9 V;  3OTF A;  4BIZ A;  1GH6 A;  4PA9 A;  1GM9 A;  5DN6 G;  4DV4 O;  4QE7 A;  2XAS A;  4ZHQ A;  2CTQ A;  1LNQ A;  2ATK C;  4J80 A;  2UUA B;  4RQE A;  1NBM G;  4NVP A;  2W6J G;  1VAR A;  3UKM A;  1H2M A;  5F2V O;  3K79 A;  3ZIA G;  4IT5 A;  4OPA A;  2B1G A;  2QM7 A;  4O4H B;  1XHX A;  1K34 A;  1L0N H;  1AJQ A;  3HKE B;  5CN0 A;  4WFF A;  3U11 A;  2Z5U A;  2Y48 A;  2RQ6 A;  5KX5 A;  4CH4 A;  1Q90 D;  3OMI B;  2ZM6 B;  5JCO C;  1K73 W;  2CGN A;  1DK1 A;  2QDO A;  4DV5 B;  4JYA O;  4F6R A;  4YY3 O;  4X1K B;  2JEU A;  3ASN B;  4JTC B;  1PNL A;  5KAI Z;  1KKD A;  3IGA C;  5IT9 N;  1N0N A;  1YJW V;  4H37 A;  1G6U A;  4Z1M G;  3ZMU A;  1VQK V;  4L8J A;  3CRQ A;  1VF6 C;  3ICX A;  4ZI7 A;  1XL6 A;  1AB3 A;  3ZHS A;  1N4C A;  3ML0 A;  4P9O A;  5DED A;  1BE3 H;  1GN6 A;  1PNK A;  4R8C A;  4YHH B;  5FPO A;  1VF7 A;  4UVA A;  1NVP B;  2WLL A;  3OEE G;  3A8T A;  4B7K A;  1P7B A;  4JI0 O;  4GKK O;  4DYL A;  1P7G A;  3JYC A;  1S3J A;  1QBZ A;  2YEV A;  4X1Y B;  3K5N A;  4X1Y A;  3ETG A;  3BA8 A;  3IFX A;  2LQT A;  4O4L A;  4YJ3 B;  2IH3 C;  1XOU A;  2YIB A;  4ICG A;  3SYA A;  4I7Z B;  5JH7 B;  4MT8 A;  2Q68 A;  2OTJ V;  3JAK B;  4DW0 A;  4NB5 A;  2YS8 A;  5GTI Z;  2G38 A;  5BY1 A;  1M5I A;  1AI7 A;  1Y76 B;  1YDX A;  2KKW A;  3SYC A;  1F51 A;  4GLX A;  2QM4 A;  5FPR A;  1HR0 O;  2CTR A;  2LP7 A;  1XIL A;  1PKX A;  1Q43 A;  4TV8 B;  4PA3 A;  1X4T A;  2H8P C;  4HBN A;  2R9A A;  1AP5 A;  1QLN A;  4LF6 O;  3FB6 C;  2GTA A;  4CZZ A;  2P6J A;  2A0L A;  3WB0 A;  3VBB A;  1W0J G;  1G8M A;  3OGI B;  3JAT A;  4JZG A;  5KMG A;  3ABU A;  5KX5 B;  3CCL V;  1KD1 W;  2YSU B;  3W7X A;  4J42 A;  4R6Z A;  2X7R B;  5JQG A;  3JAW A;  4IL6 Z;  4FLV A;  3FYE B;  3JCZ A;  5LA6 B;  1VF6 A;  3RYH B;  4TV9 A;  1X59 A;  2E5L B;  5B5E Z;  3UM7 A;  1QVF U;  1HWY A;  1IBL B;  4NXN B;  5B1B B;  1R3L C;  4JI1 O;  3JAS A;  2DN9 A;  3N2G B;  1VIB A;  1SQV H;  2QKA A;  4FZ1 A;  1GN2 A;  2QWO B;  1KBH A;  2Z0A A;  4KL1 A;  4UVB A;  5CA0 B;  2BSK A;  2GDS A;  4RUF A;  4J10 A;  4TT3 G;  4F4L A;  1RP3 B;  1M1K W;  1HNW O;  4BW9 A;  4DR5 B;  3WU2 Z;  2YDE A;  4RUE A;  3D3Q A;  3SJB C;  1RPO A;  3WFV A;  1AP6 A;  4H44 B;  2RMK B;  3ZX6 A;  4GT1 A;  5LYJ B;  1XNR O;  3CCJ V;  4UCS A;  2AXT Z;  4JAU A;  5KHK A;  1OCC C;  5LL6 Y;  1YTF B;  3H1L H;  1SQG A;  3CB2 A;  1OJH A;  1YIT V;  2Q0A A;  4I55 B;  5LP6 C;  4E2L A;  5C8Y B;  1FXK C;  1AI5 A;  3ZN1 A;  1BZK A;  3JD1 A;  2WWW A;  3JSN A;  2N74 A;  2VQE O;  4TWK A;  1XDC A;  3HPL C;  1N36 B;  1GKF A;  1NH2 D;  1K92 A;  3OUS A;  2OCH A;  4UCO A;  4BIU A;  3TK1 A;  2ZR2 A;  4F6E A;  2VS0 A;  4I0X A;  1OCZ B;  5LMU O;  1TUE B;  3MHS C;  4AQY B;  1N34 B;  1B06 A;  2LGW A;  5IWA B;  2IJJ A;  1WB7 A;  1OV9 A;  3FAV A;  3AG2 B;  1S77 D;  4DR3 B;  2JS3 A;  1PP9 H;  3I5D A;  4MS2 A;  2WA4 A;  1BCC H;  1Z5V A;  5BMV A;  4JAS A;  3FB7 C;  5IY5 C;  1WPB A;  2ZXW C;  3LSS A;  4NXM O;  1WPX A;  5J2U A;  1YJ9 V;  3NR7 A;  3H1K H;  5B1N A;  2VWK A;  3GB7 C;  1HW7 A;  5JJE B;  3OTO B;  3OM3 B;  5DEC A;  3FB8 C;  4FZ0 A;  3OT7 A;  5JCO A;  3JD3 A;  4FM2 A;  4B3T B;  4UV9 A;  1SC5 B;  3ABM C;  1RM1 C;  2GHY A;  3CJH B;  2B9Z A;  1OCR B;  3AG1 B;  1EN5 A;  3PJS K;  4DV1 O;  5GW7 A;  3LDC A;  4JV5 O;  1HNZ B;  4WBN A;  2HG5 C;  4X64 O;  2PY5 A;  4LCU C;  4LF7 B;  1M56 B;  4IIJ A;  3HKB A;  3HKB B;  1XMO B;  1VQM V;  4LC1 A;  4GKJ O;  3T1H B;  4LH7 A;  3FX7 A;  1XMQ B;  1L8D A;  5L3C A;  4PI2 A;  5D5P A;  3U0Z A;  3GWO A;  2JEX A;  1RSO A;  4YIP A;  1FXK A;  1WP8 A;  3CP1 A;  3SR2 C;  3KCY A;  2IW5 A;  4J7J A;  5E79 Z;  2JGD A;  3AG1 C;  3HKD B;  2X0L A;  4B7E A;  1JFF B;  2P90 A;  3THO A;  2EUL A;  2R70 A;  2E3C A;  1KQS U;  3L74 H;  1HNZ O;  5H5N A;  4LFC O;  1JJ2 U;  1AI6 A;  4BWA A;  1KP3 A;  3CXC U;  2F4V B;  5H6Q A;  5B1B C;  2MW2 B;  4TQD A;  1H2N A;  5D5Q A;  4P2Z A;  3SPC A;  1V55 B;  2LW1 A;  2NLJ C;  2V1D A;  1IX9 A;  3SYQ A;  3OTO O;  3FAV B;  4DUY B;  1K9M W;  1I0H A;  3T1Y B;  1BMF G;  4TV9 B;  2EIM B;  2D3O W;  2DJV A;  3B4S A;  3JAR B;  3F5W C;  3ZRV A;  1TUB A;  1FPO A;  3K58 A;  1BSM A;  4GZR B;  1IZ3 A;  3KCX A;  1FJG O;  4MW8 A;  4FLX A;  1XMO O;  3RBZ A;  5L3E A;  2ARH A;  1AR1 B;  4DR7 O;  4IGG A;  4U3F H;  2L35 A;  1I94 B;  3DXR B;  4MVZ A;  1B04 A;  3EFF K;  1NR1 A;  1TVK A;  5J2T A;  1MMM A;  4I55 A;  2VQF O;  1NI8 A;  5B3S C;  4FJC C;  4GX2 A;  1WA8 A;  4KHP B;  4FFK A;  4DR7 B;  1H2G A;  5EZY A;  4FLU A;  4IHJ B;  5CBH A;  2M7W A;  5FNV A;  3LUT B;  1ARO P;  3CSX A;  4PDM A;  1VQ6 V;  5KHH A;  4NTW A;  3G6B A;  2BOB C;  4FLY A;  1GTO A;  2KG7 B;  4HZ3 A;  3VQY A;  2A7W A;  4J41 A;  1SET A;  1PL0 A;  5IYZ A;  2UU9 B;  2Y69 B;  2OTL V;  3Q4H A;  4Q20 A;  5L3G A;  2Q7H A;  2F95 B;  2QKC A;  5J2U B;  5FNV B;  2XHB A;  4DV7 B;  1YXB A;  5CA0 A;  3RW0 A;  1IBM O;  4LF4 B;  2DYS C;  4B3M O;  2HFE C;  4LFC B;  4JI7 B;  1YCI A;  1JCH A;  3CYO A;  4JTA B;  5C93 A;  5LOV A;  5KHI A;  1K5S A;  1Q82 W;  1NZ6 A;  1WAZ A;  2A79 B;  1S5L Z;  5B3S B;  2EZO A;  1UJW B;  3T1C A;  4ZBM A;  5J9P C;  4DR4 B;  4G27 B;  3E83 A;  1Q81 W;  4MTF A;  4FIP C;  4ZOL A;  2HJF C;  5JJN B;  3H01 A;  3JCU Z;  3M7M X;  3SPH A;  2XAJ A;  2GTS A;  1LUW A;  2Q7G A;  2RDC A;  4JI5 O;  3T1H O;  1VEW A;  1Z5W A;  1QLE B;  3OUF A;  5BZB A;  1BHA A;  1HNW B;  2K1E A;  3ZRS A;  1SES A;  3CE2 A;  5C8Y A;  2Y0I A;  1KUQ A;  4LF4 O;  3MD0 A;  5IJ9 A;  1NTZ H;  1FS0 G;  4R50 A;  3CC4 V;  4EFB A;  2C2A A;  3G67 A;  4DV3 B;  2LJ2 A;  4GKJ B;  1SQB H;  4IYI A;  2ZM6 O;  1ZL8 B;  1JA8 A;  5LGN A;  4ASU G;  1W2B U;  3ZHT A;  1QU7 A;  2YIB D;  2AGA A;  5CBG A;  4JPR A;  1N33 O;  3AK2 A;  4HNA A;  3RYI A;  4OXS A;  1WP7 A;  1FFX A;  1V54 B;  2WLJ A;  2ZD9 A;  2JGU A;  3HKD A;  3X2Q B;  1VQN V;  1I7F A;  4UB8 Z;  4B3S O;  2F93 B;  1NT2 B;  4DR3 O;  2JVD A;  3K5O A;  1XUQ A;  1M56 C;  1V54 C;  2Q73 A;  3ASO C;  3SDL A;  3QO8 A;  2AHY A;  1Q6U A;  1NTM H;  4X66 O;  4OX9 O;  4C7U A;  3P32 A;  1QR9 A;  4LFA O;  2PTM A;  1IVS A;  3L73 H;  4JZ2 A;  2N04 A;  2Q5Z A;  2YXH A;  2IJH A;  5FLX N;  2QSA A;  4DV0 O;  3BRC A;  3RYC A;  5CBF A;  1SS3 A;  4JYC A;  5LBQ A;  1D5A A;  4XDJ A;  1BL8 A;  1KKC A;  3M8A A;  1SZT A;  1EFR G;  2XAQ A;  3TXS A;  2XAF A;  4GX1 A;  3K06 A;  1M9N A;  2EJ7 A;  2P7T C;  1ZUQ A;  2YIC A;  1IBK B;  2ZIM A;  4J11 A;  4AIL C;  3BY6 A;  2QWN B;  2H3O A;  3JAR A;  1O9H A;  2DYR C;  2OIG A;  2HR3 A;  3SPJ A;  4EB6 A;  1JOY A;  3QTC A;  1EM1 A;  4AQY O;  4NKG B;  3G80 A;  4O2A B;  4CH6 A;  1MSW D;  3IC9 A;  1ZTE A;  2UXD O;  4LWS A;  4O2B A;  4LF5 B;  2EIL B;  3D3I A;  4DR5 O;  3CCV V;  3WG7 B;  2ZNJ A;  4JF3 A;  4CH3 A;  4TSF G;  2KQX A;  4LP8 A;  3IAY A;  1TAE A;  2LO1 A;  2PF4 E;  1N8R W;  2R9I A;  5JWP A;  1G1X B;  4JI8 O;  4BR6 A;  4E4E A;  4PI0 A;  1NJI W;  1LR1 A; 
#chains in the Genus database with same CATH homology
 4CS2 A;  4UCO A;  2P5O A;  2VWJ A;  2UUC B;  3N2K B;  4DV6 B;  4X65 B;  4AQY B;  3WB2 A;  1N34 B;  1QHT A;  3K5L A;  2YI8 A;  1SA0 B;  5LOV B;  4AHC A;  5IWA B;  4TQF A;  4X64 B;  4FM0 A;  4HNA B;  4DR3 B;  2PYJ A;  4DR1 B;  5ITZ B;  1XI1 A;  2YIA A;  1Z5V A;  5BMV A;  2R72 A;  1WPB A;  4UCU A;  4LNU A;  1QQC A;  5J2U A;  4YJ2 A;  3LNN A;  2VWK A;  4I50 B;  5IJ9 B;  1XNQ B;  1HW7 A;  1XHZ A;  4B08 A;  2YXL A;  3ZS8 C;  3N2K A;  5JJE B;  3OTO B;  1S5J A;  3SJC C;  4LR3 A;  1IBM B;  5JCO A;  4DV0 B;  4O4J A;  4UCR A;  4I50 A;  3VQW A;  4FM2 A;  4B3T B;  4DK1 A;  1XNR B;  4JI3 B;  4YJ2 B;  3JAL B;  4DUZ B;  2OYQ A;  2GV9 A;  3DSQ A;  5JVD B;  5BMV B;  3K5M A;  3RFR A;  1O9G A;  5BR8 B;  3JAS B;  1HNZ B;  5ITZ A;  1P49 A;  4WBN A;  4JI8 B;  3MAQ A;  4CC6 A;  4UFZ A;  2PY5 A;  3B2E E;  4LF7 B;  5LA6 A;  5LXT B;  4LFA B;  1TVK B;  4IIJ A;  3HKB A;  2PZS A;  3HKB B;  4DK0 A;  1XMO B;  5LXT A;  3JAW B;  3BAB A;  4LF8 B;  2ZNI A;  3T1H B;  4LH7 A;  4JI4 B;  1SKV A;  2PGG A;  1XMQ B;  4O2B B;  5JQG B;  4ZI7 B;  1L8D A;  4ZHQ B;  5K1P A;  1J5E B;  4ZIB A;  4PI2 A;  5D5P A;  3U0Z A;  1V9P A;  4LF9 B;  3RYF A;  3RWR D;  1RSO A;  3A2F A;  3SR2 C;  5KMG B;  5EYP A;  3JAT B;  3K59 A;  4X1K A;  4UCV A;  3HKD B;  4I9Q A;  3QG5 A;  5IYZ B;  1JFF B;  1WNS A;  3THO A;  3RGB A;  1FFX B;  2R70 A;  2E3C A;  3RYI B;  3CHX A;  2HHH B;  1ZAU A;  1TA8 A;  4X1I B;  4JYA B;  2ZCE A;  4BWA A;  2F4V B;  5LP6 B;  2F1M A;  4K0K B;  4TQD A;  5D5Q A;  4JI6 B;  3PN1 A;  5EZY B;  3BPZ A;  1Q3E A;  3BA9 A;  3SGI A;  5LP6 A;  4DR2 B;  4U3J B;  3JAK A;  1KMI Z;  4DUY B;  4YY3 B;  5LMU B;  5J2T B;  3UT5 B;  3T1Y B;  4TV9 B;  2OWO A;  2F66 C;  1TGO A;  3JAR B;  5GON A;  5CB4 A;  1TUB A;  3K58 A;  4JI5 B;  4YJ3 A;  4FLX A;  4I4T B;  3OTF A;  1H2S B;  4FLW A;  1T5E A;  2QJ1 A;  3ZED A;  4ZHQ A;  2PUS A;  1I94 B;  4JI2 B;  1B04 A;  2UUA B;  4NVP A;  1TUB B;  1TVK A;  4CH5 A;  4DR6 B;  2PYL A;  1FJG B;  5J2T A;  3RYH A;  4I55 A;  4X66 B;  4OX9 B;  3UT5 A;  1Q8I A;  5KHJ A;  4KHP B;  4DR7 B;  1N33 B;  4O4H B;  5EZY A;  1XHX A;  4FLU A;  4IHJ B;  4CS4 A;  3UQ8 A;  5FNV A;  4LFB B;  3JAL A;  4O4I A;  3HKE B;  3U10 A;  1HR0 B;  4CS3 A;  3U11 A;  4FM1 A;  5KX5 A;  2RQ6 A;  3CSX A;  4CH4 A;  5KHH A;  5LYJ A;  2ZM6 B;  4FLY A;  5JCO C;  4O4J B;  3VQY A;  4DV5 B;  4F6R A;  2UXD B;  5IYZ A;  2UU9 B;  4X1K B;  1WN7 A;  4DRX B;  4EFE A;  4B3M B;  2P22 C;  4X62 B;  5EIB D;  4K8X A;  2Q7H A;  2F95 B;  5J2U B;  4LNU B;  5FNV B;  1G6U A;  4D7S A;  2XHB A;  4DV7 B;  4L8J A;  1HNX B;  4D7T A;  5CA0 A;  3WB1 A;  2JS5 A;  3ICX A;  4LF4 B;  4ZI7 A;  3N2G A;  4LFC B;  4JI7 B;  4Q6G A;  3VQX A;  4YHH B;  1SA0 A;  5LOV A;  5FPO A;  5KHI A;  4JI0 B;  4GKK B;  1VF7 A;  5KHG A;  4DR4 B;  4O4L B;  4FLT A;  3BHP A;  4ZOL A;  4WBN B;  4X1Y B;  5JJN B;  3K5N A;  4X1Y A;  3M7M X;  2IM9 A;  5K1X A;  1N32 B;  3BA8 A;  3K57 A;  2Q7G A;  4O4L A;  4YJ3 B;  1Z5W A;  2YIB A;  4F6R B;  3SJA C;  1HNW B;  5GON B;  2CAZ C;  5JH7 B;  5C8Y A;  4EEQ A;  5IJ9 A;  1SQF A;  5CA1 A;  3JAK B;  4EFB A;  1M5I A;  2VQE B;  4DV3 B;  4O4I B;  2KKW A;  3FFQ A;  4O2A A;  4GLX A;  4GKJ B;  2QM4 A;  4B3S B;  4IHJ A;  5FPR A;  4O4H A;  4X20 B;  2YIB D;  1Q43 A;  4TV8 B;  1YEW A;  1X4T A;  5CA1 B;  4HBN A;  4HNA A;  3RYI A;  4DRX A;  2R9A A;  1FFX A;  1JFF A;  1M4U A;  2JGU A;  5JH7 A;  3HKD A;  3WB0 A;  3BAA A;  1I7F A;  3JAT A;  2V4D A;  1M93 A;  5KMG A;  2F93 B;  2UXC B;  1NT2 B;  1JJO A;  5KX5 B;  2JVD A;  3K5O A;  4PHZ A;  3VQV A;  1Q5O A;  4FFB A;  4ZOL B;  3HKC B;  5JQG A;  2BTQ B;  2VQF B;  5IJ0 A;  3JAW A;  3RYC B;  4FLV A;  4FVM A;  5CB4 B;  2PTM A;  2E5L B;  5LA6 B;  3RYH B;  4TV9 A;  4K8Z A;  5EIB C;  1IBL B;  4NXN B;  3BRC A;  3RYC A;  2ZIO A;  5IJ0 B;  3HKC A;  4DV2 B;  4JV5 B;  3QF7 A;  1D5A A;  4TUY A;  3JAS A;  5LMN B;  3N2G B;  1JMK C;  4UCT A;  4KL1 A;  4FFB B;  5CA0 B;  4I4T A;  4X1I A;  4EB6 B;  4FLZ A;  1DGS A;  2YI9 A;  4B3R B;  1IBK B;  2ZIM A;  4BW9 A;  4AIL C;  4DR5 B;  3E22 A;  3E22 B;  4CC5 A;  3JAR A;  1O9H A;  4DV1 B;  2Q7E A;  3SJB C;  4EB6 A;  3QTC A;  5LYJ B;  4U3J A;  4TV8 A;  3RYF B;  4TOI A;  3HKE A;  4X20 A;  4O2A B;  4CH6 A;  4UCS A;  5KHK A;  4O2B A;  5JJJ B;  4TUY B;  4LF6 B;  1KU9 A;  2BTO A;  1SQG A;  3CB2 A;  4LH6 A;  4LF5 B;  4IIJ B;  2UXB B;  2Q0A A;  2ZIN A;  3ETQ A;  4I55 B;  4JI1 B;  5LP6 C;  5C8Y B;  2ZNJ A;  4DV4 B;  2HEP A;  4CH3 A;  3JSN A;  3IAY A;  1TAE A;  5EYP B;  2BTQ A;  2EX3 A;  2RJZ A;  2UUB B;  4GYC B;  1N36 B;  1XQ8 A;  5JVD A;  3JSL A;  4PI0 A;  4NXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...