1RSOA

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
b'RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Presynaptic protein SAP97
molecule tags Neuropeptide/membrane protein
source organism Rattus norvegicus
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
total genus 18
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1rsoA01
1H2SB 3WB1A 3BRCA 1T5EA 4DK1A 3WB2A 5JJNB 2V4DA 1VF7A 3LNNA 5D5QA 5JJEB 5D5PA 2F1MA 4L8JA 3WB0A 2F93B 5JJJB 1RSOA 4GYCB 2F95B 4DK0A
chains in the Genus database with same CATH superfamily
2QE7G 2R70A 2YS8A 4K35A 2GSMB 3OGCC 1S5JA 3OE7G 2XUMA 4PA6A 3K9AA 4MT8A 4X66B 1NVPB 1XI1A 4B3TB 4TV9A 2XAQA 4OPHA 2KKWA 2HG5C 4GKJB 4I4TA 5B5EZ 1K33A 4GLXA 1I0HA 3OD4A 2YUAA 4TT3G 2G38A 3ZMZA 2QKCA 1H2KA 1V9PA 5LP6A 3RYIB 1JR9A 4JAVA 1RM1C 4CBCA 4TWKA 3TGUH 3HKCB 3OTOB 4GX2A 1GMGA 3QG5A 3L70H 2IW5A 3KKYA 5DEDA 4JI0B 3B09A 3DSQA 3GWOA 2R72A 1WPBA 2HJFC 2H94A 1E1RG 1K8AW 1YZBA 1Q8IA 2NLJC 2IBZH 1YJ9V 4KP4A 3U11A 1HNWB 1G8MA 4P9PA 3I55V 1I5YA 1WA8B 1E1QG 2BTQB 3SPGA 1VQMV 3DC5A 3BPZA 5KX5A 1NT2B 2HEPA 4YHHB 2ZKOA 3JAWB 2KSDA 5CB4A 2Q5ZA 3T1HO 1URFA 2ZE7A 3QNEA 1MNGA 3D36A 4DV2O 2UUCO 4TQFA 3PJSK 3W7TA 3CYOA 4LNUB 4O4IA 2XOKG 3DXRA 4JI0O 1BGYH 4FK5C 1WP8A 2ZQMA 4ABMA 4Z1MG 4NXNO 3ZMSA 1KD1W 1J5EO 1FXKB 4R7CA 1WA8A 3ML0A 1JFFA 1DK1A 2DN9A 3DXRB 4AHCA 1U96A 4DYLA 4DO2A 5GONA 1YCIA 1X59A 3MD0A 4I0XA 2XHBA 4MVQA 4B3RB 4GKJO 1Q43A 3P30A 4P30A 2M6YA 3L9DA 4FIPC 4FFBA 4LH6A 3RT3C 5LA6B 1K92A 2WLMA 2VQEB 5DM6V 4X66O 2BOBC 3DTUB 2JJ2G 3WG7C 4UCOA 3H9VA 4IYIA 3TJTA 3OM3B 1NZ6A 4PDMA 4JI1B 1OV9A 5KAIZ 4AI8A 3OMNB 4PI0A 3AG1B 4FLXA 1JA8A 3LUTB 2QWPB 1F51A 2Q9LA 2UXCO 2HVJC 3D36C 4WBNA 5K1XA 1AR1B 3IFXA 4LFAB 5LGNA 4WFBV 2ZXWC 2GHYA 1LNQA 1Y4MA 2ARHA 2EULA 1PPJH 1D2DA 3ZHRA 2XT9A 1IDSA 1S5HC 3CP1A 5FLXN 4JTAB 3G6BA 4NXMB 3AK1A 3RBZA 4WFGA 4LF7B 2EINB 2ZE6A 2UUAB 4JYYA 5J2TB 1I7FA 5DN6G 1HR0B 3HR0A 4DV5B 3T2MA 4B08A 5EBLC 1I94B 1NTZH 3ZN1A 3UO3A 1L0LH 1ROPA 1JFFB 2WA3A 3FAVB 3WU2Z 2FB5A 1QU7A 1IBMO 3E8GA 2E75B 1TUEB 3LSUA 4P2ZA 4I5SA 4LCUC 2ZE5A 3AG2B 2ITDC 2PYLA 1RSOB 5LMUO 3K06A 3O9OA 1EZVH 1NTKH 3AG1C 4JF3A 1RPOA 3K3WA 5LP6B 3R65A 3X2QB 1QVFU 3C90A 3HKDA 5EBWC 1H2NA 1MOFA 3ZIAG 4JV5O 2HLDG 1R3IC 4JGSA 5IYBO 1PM9A 3FYEB 3CCSV 5JWPA 4H0LB 2FKXA 1AILA 3JAMN 5LXTA 3JARB 3BHPA 1BT8A 2P4KA 1CPYA 4JI4O 4JI5B 3AK3A 4GKKB 1HP8A 4MW3A 1DLBA 3TETA 4FLUA 1SQFA 1H2LA 3MDSA 1SA0B 1G6UA 5E1AC 1ZL8A 2CUGA 4WF9V 4OPAA 3B2EE 3I5DA 4J9ZB 3K9SA 2PY5A 3AG4B 4JYAO 4QNHB 1PV0A 1N33O 2UXCB 3K08A 4JZ2A 4DV3B 2DE0X 3ETQA 4JAAA 1ZTEA 2OTJV 4ZOLA 1ZSPA 1S72V 4DK0A 1VQNV 1MSWD 5BXZA 4LWSB 1S0VA 3SPIA 4DRXB 5IWAB 4I50A 1BE3H 4JYBA 2IJIA 2YIBA 2QKAA 2KQXA 4U7OA 1R73A 3A0RA 1Y74B 1XBLA 2DJVA 5JQGA 5JVDA 1R3JC 2GTAA 5L3EA 4DR5O 1PKXA 2DYRC 2EIKC 1J5EB 2OTLV 3CRRA 4JI3B 1MABG 2W0XA 1YTFD 3WG7B 3IJ4A 5LMNB 1TAEA 3CJHB 1OCZC 1AP5A 4UB6Z 3DC6A 4PA3A 3ZRWB 4EB6B 2VRZA 3CCVV 1P49A 3KG2A 5EBMC 4LNUA 4O4IB 5CA3A 2BSKA 3CSXA 3HB3B 2Q67A 4TV9B 5GONB 2QWQB 4FMTA 4B7KA 4FLZA 5FNVB 1R6KA 1WB8A 3ZRVA 3ZS8C 4LF9O 2ZD9A 1VARA 3AK2A 4JYAB 3J80N 4I55B 5EIBD 2YI9A 2GTSA 2ZNIA 4I0XB 4ICGA 1T5EA 2DWDC 4LF6B 3FB7C 3ZMVA 1H38A 1COWG 4XDLA 2NR5A 4MTOA 3OTOO 3JCUZ 1GM9A 2WA4A 3JAWA 4B7EA 2JGUA 2JIZG 4X1KB 4RQEA 2V7QG 4TUYA 1OCCB 3L74H 1QLEC 3RYIA 4F6RA 1ZAUA 1Q82W 1RFYA 2QEXV 4PDVA 2DMXA 2R9AA 3SYCA 1P7GA 2O57A 4LF4O 3QO7A 4FM1A 4K0KB 3CCMV 1M93A 2IM9A 2EJ7A 4ZBMA 2YICA 2DWEC 3L75H 2YIBD 4AQYB 3FFQA 4CC5A 3OT7A 3QVNA 1GM7A 2OWOA 4LF9B 1Q86W 4PD4F 2UXBO 4UUJC 4L87A 4GT1A 3BABA 1VIBA 1R6NA 1Q90D 3M8AA 4N21A 3RYCB 1OCRB 3U0ZA 4DR1B 2GUZB 1Q7YW 1IX9A 4PDRA 5EC1C 4DV5O 1WPXA 1DF5A 2A7WA 3ZRWA 4EB6A 2D2CB 5EC2C 3RYCA 1KP2A 4J80A 1AI7A 3APQA 4MVMA 2DQ3A 2JJ1G 3VQVA 2A0LA 2P5OA 3JCZA 1WN7A 3HKDB 1ZLZA 1B06A 2ZIOA 2DYSB 4DR5B 3S3WA 4PV1B 4O4LA 3WB0A 1FYJA 1VMGA 1JOYA 5LL6Y 2ITCC 4LF5O 4DR2O 4NR1A 2IU0A 3RGBA 2Y69B 3HPLC 1RM1B 1ORQC 2Y48A 4XBFA 1S3JA 4X8AA 3ZMUA 1IURA 4UCSA 4LWSA 2E5LB 5KA6A 2AW9A 1SS3A 4GX0A 1G1XB 2HR3A 3C3TA 2A79B 1GK9A 4TOIA 5H2FZ 3B4SA 1FXHA 2E5LO 4UVCA 2QSAA 5L3FA 2VQEO 4YY3O 5E79Z 3BVOA 2Y4TA 4B3RO 4LFBO 5K1PA 2EZPA 3GVMA 3SPHA 4LF8B 1FAFA 4B3MB 3UT5B 3CC2V 4RUFA 4YJ3B 1AJPA 4ZI7A 5FPRA 4NYKA 2RCVA 3ABUA 3FB5C 5JH7B 2KB1A 2DYRB 4JI4B 4HYOA 2BCCH 2EIKB 1NKDA 4DR4B 3ZX6A 2NNUA 5H6RA 3FB6C 2HVKC 1KYOF 3TXSA 2ZM6B 4EFBA 3U10A 1SZXA 4MVOA 2R9IA 2WLKA 1VQ5V 1I08A 2LP7A 1DF4A 4PA9A 5KA5A 1N32O 5TISZ 3CJHA 1TGOA 2Q68A 1V55B 2ZNJA 4RO2A 1NI8A 3BA9A 5LA6A 4RAIA 4FFBB 3CEIA 2UXDB 4DV6B 1D5AA 1AROP 5JQGB 2ZE8A 3QO5A 1N0NA 5EZYB 1Z2GA 4AQYO 2QR4A 4ZIBA 3E22A 3T1YO 3CC4V 2YXLA 1NR1A 1Y76A 4K0KO 3APOA 4FZ0A 4D7SA 1EZJA 4R8CA 4I55A 1YTFB 2WLLA 2CTWA 4KHPO 1Z5WA 1VF6C 4XDKA 3KZIZ 2YI8A 2QA4V 5B1AC 1NQTA 2LW7A 1L1FA 3ZJZA 5BY1A 1LR1A 3VOUA 2PUSA 4LH7A 4J11A 4A5UB 1QLNA 1TUBA 4IIJA 1NS1A 1PNMA 5HFLA 5IYDO 1N4CA 2FTKA 4TUYB 5D5PA 3N2KA 1N34B 1BMFG 1ZWIC 1JJ2U 3JAKB 5LBQA 5B1BC 3JD2A 1XMQB 4WCEV 3Q4HB 3LSQA 4GX5A 2K9PA 1HNZB 3DGEA 4B3SB 1W59A 4B3SO 2Q6AA 2ZR3A 2AXTZ 5J9PC 4HZ3A 3ABTA 3L73H 3JALB 5LHIA 3JSNA 3K57A 4JYCA 4DR3O 4PDLA 2JEUA 1VF5B 4I50B 4DV1B 2KG7A 2VQFB 1ZUQA 1YI2V 2XAGA 2Q69A 1GN4A 5L3DA 4U7NA 5CBHA 1W0JG 1AVMA 5JJNB 1N36O 1FFTB 1SF9A 4DR7B 3A2FA 2BSKB 3B77A 4JI3O 4BW5A 2CK3G 5LOVA 3QF7A 3E83A 1RP3B 4JI8O 3ZHVA 3SJQC 4TV8B 3AG3C 3CCJV 3OEEG 1GKFA 2R9RB 4UFZA 1SQBH 5FPOA 3RWRD 4OX9B 4X1IB 1M57C 2P6JA 3JD4A 2XASA 5EZYA 2V4DA 2LW1A 3OR7C 2BE3A 2E3CA 1IBKO 2F66C 1SQPH 3E8FA 2CGOA 3K04A 3JARA 3CHXA 5LXTB 1FJGB 3SPJA 1IBLO 1QVGU 1B3QA 1Q5OA 4DUZB 4NB5A 3CXCU 4CZZA 2HP8A 4UB8Z 3QO8A 3F7YC 4FPPA 5KMGB 1Z5VA 1QLEB 5IJ0B 3K5OA 3W7SA 1BSMA 4ZHQA 2Y0IA 4HAMA 1ZL8B 3MAQA 5EYPA 1Y76B 1Q3EA 2VWJA 1PL0A 1XHZA 1K34A 2H8PC 4X1YA 1JQ0A 3ZHQA 1RSOA 4UV9A 4O4HA 4JI2B 1KQSU 3JD1A 4CS4A 1TA8A 1THZA 1OHHG 3SJBC 4ZKIA 1H2GA 2N04A 1TVKA 4GKKO 4JI2O 3STZC 3RVYA 2D3OW 4LF8O 1BQZA 2WLHA 5CA0B 1ENVA 4OXSA 4YJ2B 4L8JA 4X65B 2K1EA 3M99B 2EIMC 3J7AU 2EBOA 5FL7G 1KB9F 3ZN0A 5IYCO 5KHJA 4IGGA 3E2EA 5LYJA 1GN6A 1FJGO 1V55C 4X62O 3SJAC 4X1YB 2UU9O 1QHTA 4JZGA 4CH6A 3T4ZA 2QTSA 2WLLB 1IBMB 1F4MA 4IHJB 1AI6A 1QCEA 4ZHQB 4K8ZA 4GYCB 3S3XA 3EFFK 1Y67A 1H8HG 2QM4A 1XNRO 3SDLA 4MVRA 1KKCA 2HJDA 1YIJV 2ODMA 4J7KA 2B1GA 2ZCEA 3ASNC 2FMLA 5IJ9B 3G67A 4LFCB 3EVKA 5BMVB 1EBOA 3UQ8A 2UUAO 4FFKA 2WPDG 2UXXA 1N0JA 1NH2D 4DR7O 3HKBA 2OT5A 2Y0PA 2M7WA 4IL6Z 1US6A 3H1JH 2JS5A 2XAHA 3CRQA 1PL4A 4O4JA 1E79G 1OCOC 1XNQO 2ADPA 1GAXA 2Z3YA 3ZHSA 3K03A 2W0FC 2OIGA 4FM2A 3CXHF 2CDYA 2QM7A 2F4VB 2H3OA 3KCYA 3HKCA 2UXBB 1EN6A 1K3EA 3RFRA 2C2AA 2ETNA 1HNZO 1GTOA 2UU9B 3WFVA 2N74A 4UVBA 2JGDB 3OR6C 5CN0A 4UCRA 4J9YB 1R3LC 3RYFA 4CS3A 4JTDB 1Q6HA 4J7JA 1GM8A 3G71V 1SQGA 1W0KG 4LP8A 1J95A 4TQDA 4BIOA 4X65O 2F95B 3K0GA 1LUVA 1AP6A 3OMAB 4EFEA 1VF7A 1LUWA 4RUEA 4X88A 2F1MA 4JTCB 1QR8A 2X0LA 2LFRA 2YSUB 2YIAA 5KUKA 5CBGA 2PYJA 4KHPB 1HDJA 5KUMA 3E86A 2XAFA 1QNMA 3AEIA 3RYHB 1AI4A 1H2SB 1EFRG 4YXWG 1NBMG 4X20A 2UUCB 2QDOA 1OCOB 2EZOA 3T1HB 2B5UA 2YXHA 1WJZA 3T1CA 1WLEA 1NH2B 2OYQA 1JX9A 2PF4E 2KG7B 1KBHA 4X64B 3CB2A 5JCOC 4MTFA 3K5NA 1F4NA 4NTYA 2A3QA 3SYAA 1SQXH 2ZT9B 3H1IH 1SQVH 4X64O 3WB1A 5BR8B 1HNWO 2Z5UA 2Q0AA 1M5IA 1WNSA 3LDCA 1IBKB 3VQXA 3LDDA 5JJEB 4W4LA 1S77D 1B6QA 2IJJA 2L6LA 2LGQA 2P4VA 2WLJA 4UXNA 1JVMA 5DECA 3R66A 3PN1A 3BAAA 2E74B 5HFMA 1OZ0A 3UCSC 4C7UA 4PHZA 2RMKB 5KLVH 4E4EA 4B3MO 5L3GA 3CRCA 1N36B 2DQ0A 3JD0A 4MVSA 1FXVA 3FD9A 3UKMA 3GWKC 4KFMA 1JJOA 5LYJB 2VQFO 4LFBB 1BHAA 1VQ4V 4NKGB 4PI2A 2XAJA 3RYFB 4DRXA 5IWAO 1Q81W 3CX5F 2WLNA 4DR3B 3P3PA 2BTOA 2PTMA 1AR5A 3T4DA 5IE9A 3BY6A 1SKVA 4I4TB 4PA4A 4YJ2A 1AJNA 1XL6A 1L0NH 1HNXB 3OEHG 1K4DC 3O65A 1K5SA 4HNAA 4H44B 2MW2B 3SYPA 1K7DA 4UCVA 3VBBA 1TVKB 4QE9A 1XMQO 1XREA 2CH7A 2XTAA 1D5NA 2LGWA 3AG4C 3SJCC 2Q4PA 1K9MW 1KECA 3L71H 4DR6O 2ZXWB 1XNQB 1R6TA 4UCTA 2P67A 1K4CC 2LQTA 2QKSA 1P84F 3ABMC 1YDXA 1XILA 2W6JG 1HW7A 5FNVA 1DGSA 4NTWA 4E2LA 5LGUA 3H1HH 1BCCH 3I56V 1S5LZ 2JEXA 3G6EV 4GUNA 1FD9A 3ZBHA 4KL1A 2Z0AA 1QQCA 4KXRA 4DR1O 2OIEA 1XMOO 4PJ0Z 4CH3A 4MVUA 3LNMB 3TK1A 2RNBA 2HFEC 5IJ0A 1GN2A 1M9NA 2ILMA 2RJZA 2FL4A 3NXSA 3EHBB 4R50A 3SYQA 1XL4A 1O9HA 4FZ1A 1SRYA 2JVDA 1SZTA 1AI5A 1XMOB 1N32B 5LP6C 4O4JB 4PA7A 3X2QC 5KHHA 5L3CA 3JATB 1HR0O 2AHYA 2YDEA 1VQPV 1CEZA 1MA1A 2LFSA 4MVZA 1V54C 2EILB 1XHXA 4ZOLB 2AZ2A 4MTXA 3ABKC 4DR4O 4MS2A 1SQQH 4BIUA 1VQ9V 3ZEDA 4WFHA 4DV0O 4IYHA 1VEWA 2Q0OC 5H9CA 2AHZA 1WP7A 3L72H 1XEQA 4O2AA 4BIZA 2WLIB 4F4LA 3B8NA 1VF6A 1XUQA 1WB7A 3C3SA 3E22B 1M1KW 3LNNA 3K5LA 3CCLV 3FX7A 3A8TA 4O2BA 5J2TA 3IAYA 1HNXO 1IBLB 1KP3A 2RQ6A 5CA1B 2F43G 1U97A 3SYOA 2CTQA 2IH1C 3CRAA 2Q7HA 2YC0A 3WB2A 3K5MA 3KCXA 3FYIB 1SERA 5ITZA 2ADQB 2WLIA 4J42A 2V1DA 4Z2WA 1S76D 3UM7A 1GN3A 4LF5B 3NR7A 1NVPD 1YXBA 1K5QA 2B1IA 2EX3A 4UV8A 4PELA 2JRIA 4KUMA 4CC6A 1BQ0A 2X6AA 3BRCA 4JI8B 4IHJA 1VQKV 1OCRC 1ZX3A 1XDCA 4QGPA 2X6BA 4QPJA 3E35A 3JASA 3W7XA 1OCZB 3CMEV 2GDSA 3CS5A 4P9OA 3CD6V 1X4TA 1KU9A 4IT5A 1M4UA 3TCUA 4WFEA 2A9HA 2IJHA 1M90W 3H01A 4GZRB 3CRMA 1KUQA 3AG2C 1JPXA 4FLTA 2DYSC 1BZKA 2ZDIC 3Q4HA 2UXNA 5B1OA 3E89A 2WSSG 1SESA 3IGAC 2W6IG 3E8HA 3JASB 3VQWA 3ZCCA 2Q7EA 3CCEV 5GTIZ 1N34O 3ABLC 1PD3A 4WFAV 1GH6A 3RYHA 4JI7O 1DTOA 3ABMB 1IVSA 1UJWB 3ZRSA 1BL8A 4DUYO 2QWRB 3EXAA 1OJHA 1YF2A 3HKEB 2JDIG 1VQLV 4B3TO 4J10A 1HWYA 2DOSA 3UT5A 2YEVB 4LF6O 4YIOA 2ZINA 4R6ZA 3ZHUA 5JVDB 1Y74A 4JPRA 3GB7C 4MSWC 1MG1A 3T1YB 3SPCA 4FLWA 4J41A 2QWOB 3IC7A 4X9QA 5LMUB 4D6TH 3N27A 4CH4A 4LR3A 4H37A 2UXDO 4DK1A 4XDJA 3OUSA 1FXKA 3HKBB 4ZI7B 4TV8A 1YJWV 5JCOA 3MHSC 1B04A 4O2AB 3ZHTA 3E8BA 2PZSA 1PNLA 5IY5C 3ABKB 2ZR2A 4FLVA 3TXQA 4QE7A 1XOUA 4JI6O 2ZM6O 1FPOA 5GTHZ 5J2UB 2GBOA 4EEQA 2EIJB 1F7YA 5IDJA 4QJFB 4NTXA 4FVMA 2Q8VA 1V54B 2EILC 4LC1A 4D7TA 4JASA 5KX5B 1BS3A 4LFCO 4X20B 1QR9A 1VQ8V 1YEWA 2CTRA 1EN5A 4O2BB 2EJRA 2A06H 1KC8W 5IJ9A 2IH3C 2QJ1A 5KHIA 3FKSG 3OGIB 3AG7A 2P7TC 4MW8A 5B1AB 3ZRXA 2UUBB 5EK0A 3CCQV 3B40A 2IU3A 2CGNA 2OCCB 5A2QN 2CAZC 4TSFG 4G28B 1Q6UA 5B1BB 1P7BA 2N05A 3CE2A 1EM1A 3G80A 3OMIB 5C93A 4I9WA 1I5XA 2E76B 4J7ZA 1YITV 4DV3O 2GV9A 1N33B 4O4HB 1NJIW 2UUBO 3BA8A 2PI4A 4UCUA 4DV7B 1FS0G 2LO1A 4DR2B 5B3SC 2JK5C 1G4YB 3ETEA 1OCCC 1MMMA 3JAKA 1N8RW 2AZ0A 1F23A 4JI5O 1YHQV 4DV0B 1GO3F 3RVZA 2QWNB 2CH7B 4X1KA 4NXNB 1MZEA 4AILC 2VS0A 3AG3B 4CS2A 1NR7A 1XQ8A 4DV2B 1IXBA 2X7RB 4JV5B 4JI6B 3STLC 5KAFZ 5CMUA 4I7ZB 1IZ3A 2L35A 3CPWU 5BR8O 1M57B 5CA0A 5EIBC 2PGGA 5BMVA 4YHHO 3UO2A 1AB3A 1Y6XA 1FFXA 4YIPA 3IC9A 2Y4UA 2Q7GA 4I9QA 4DW0A 1RPRA 1PNKA 5IT9N 3SR2C 2RN9A 1NTMH 5EYPB 4OX9O 4DW1A 3D3IA 3BFRA 4DV4B 3QTCA 4FLYA 4YJ3A 1AR4A 2YXYA 5KHGA 4LF4B 3FAVA 1A32A 1K97A 3HKEA 1TUBB 4DUYB 2QTOA 4G2KA 3BEHA 3ASOC 1QBZA 4JI7B 2QGNA 1NU1H 1EN4A 3ETGA 5AG2A 4GCZA 2Y69C 2IJKA 1H8EG 2CE4A 4U3FH 3N2GB 4DR6B 1YSCA 2JGDA 5LHHA 4F6RB 5A9GA 4LFAO 2VWKA 2Q73A 2EIMB 5JH7A 3OAAG 5H5NA 4IIJB 2YIDA 3JALA 4HBNA 3K0DA 1JCHA 2P22C 3N2GA 4W4KA 1FKAO 5LOVB 2F4VO 2EIJC 4O4LB 1P4RA 4MTGA 4JI1O 1UFIA 3LSSA 5GW7A 1W2BU 5IY5B 5KHKA 2JS3A 1JMKC 2XNDG 5IYZB 5H6QA 5JJJB 2CTPA 3ICXA 4GX1A 1VQ7V 3CWBH 4DXWA 3MHHC 3K58A 3W7WA 1SC5B 4QPKA 5LMNO 1K73W 3OTFA 3A0BZ 3JYCA 1CP9A 2NN4A 1H2MA 4RWUA 3K79A 4UVAA 2HKOA 3LDEA 4G27B 1BHBA 4U3JB 4BR6A 1VQ6V 5C8YA 1IXMA 1MSDA 4FJCC 3CCRV 4DV4O 4H13B 2F23A 4ASUG 3OFNG 1VP7A 2BOCC 4K3AA 4JAUA 3OW2U 4U3JA 4BWAA 4K8XA 1R3KC 2OCCC 2EINC 4DV6O 1YJNV 2HHHB 1Q6IA 4X62B 4QIWF 5CBFA 5ITZB 3G4SV 1UPGA 3RW0A 4BAYA 3RN4A 2GUZA 3N2KB 3VQYA 3JATA 1SA0A 5D5QA 2BTQA 4EKWA 5CA1A 5B1NA 1PP9H 2WAMA 1GRJA 4NVPA 2DW4A 3ZMTA 2B9ZA 4WFFA 2ZDIA 3D3QA 2LJ2A 2MK3A 3CCUV 3D8CA 5KMGA 1SETA 2RDCA 3P3NA 1FXKC 4DV7O 1M56B 1R1BA 3P32A 4YY3B 3M7MX 5LGTA 4OGQB 2ATKC 1YVWA 4DUZO 5L3BA 1MZFA 3W7UA 4RQFA 4LBEC 5BZBA 2HHHO 2X6CA 3F7VC 1AJQA 3F5TA 3A0HZ 3CMAV 4X1IA 1Y66A 3B8MA 2OCHA 4X89A 3F5WC 3CC7V 3THOA 3JSLA 4H33A 2WWWA 4CH5A 3OUFA 5F2VO 3K59A 1KMIZ 1I94O 2P90A 2ZIMA 3H1KH 5C8YB 3ASNB 4WBNB 3ASOB 3BCCH 1L8DA 3FB8C 4Q6GA 1KKDA 5B66Z 2AGAA 5LHGA 4FM0A 5CB4B 4LF7O 1FFXB 2F93B 3ABLB 1VQOV 4NXMO 2PI5A 2QM8A 2FYUH 5J2UA 4DV1O 4Q20A 1WAZA 5IYZA 1CXZB 4F6EA 1XNRB 3JD3A 4BW9A 2P06A 3H1LH 1M56C 1O9GA 4N23A 3ETDA 3SGIA 4Z1VA 5B3SB 3J81N 2YEVA 4HNAB
chains in the Genus database with same CATH topology
2UU9B 4DK1A 2R70A 3BABA 3HKBB 4ZI7B 4TV8A 4UCRA 5JCOA 1B04A 4O2AB 3RYFA 2PZSA 4CS3A 1S5JA 3RYCB 3U0ZA 4DR1B 4FLVA 4X66B 1SQGA 1XI1A 4B3TB 4TV9A 4TQDA 5J2UB 2KKWA 4EEQA 4GKJB 2F95B 4I4TA 4EB6A 4GLXA 3RYCA 4FVMA 4EFEA 1VF7A 1V9PA 3VQVA 5LP6A 2P5OA 4D7TA 5KX5B 3RYIB 1WN7A 3HKDB 2F1MA 2ZIOA 4X20B 3HKCB 4DR5B 3OTOB 2YIAA 2PYJA 4KHPB 1YEWA 4O4LA 3WB0A 3QG5A 4O2BB 3RYHB 5IJ9A 2QJ1A 5KHIA 3RGBA 4JI0B 1H2SB 3DSQA 2R72A 1WPBA 4X20A 2UUCB 2UUBB 3T1HB 2OYQA 1Q8IA 4UCSA 3U11A 1HNWB 2E5LB 2CAZC 4X64B 2BTQB 3CB2A 5JCOC 3BPZA 5KX5A 1NT2B 2HEPA 4YHHB 3K5NA 3JAWB 4TOIA 3WB1A 5BR8B 2GV9A 2Q0AA 5CB4A 1M5IA 1WNSA 1N33B 4O4HB 1IBKB 3BA8A 3VQXA 5JJEB 4UCUA 5K1PA 4TQFA 4DV7B 4LNUB 4O4IA 4LF8B 4DR2B 4B3MB 3UT5B 4YJ3B 4ZI7A 5FPRA 3PN1A 3BAAA 5JH7B 3JAKA 1JFFA 4PHZA 4DV0B 4JI4B 4AHCA 4X1KA 4NXNB 4DR4B 1N36B 5GONA 4AILC 2XHBA 4CS2A 1JJOA 1XQ8A 5LYJB 4LFBB 4DV2B 4B3RB 1Q43A 4JV5B 4FFBA 4LH6A 4PI2A 5LA6B 2ZM6B 4EFBA 4JI6B 3RYFB 3U10A 4DRXA 2VQEB 4DR3B 2BTOA 2PTMA 4UCOA 5CA0A 5EIBC 1TGOA 4JI1B 2PGGA 5BMVA 1SKVA 4I4TB 4YJ2A 2ZNJA 1FFXA 4PI0A 1HNXB 3BA9A 5LA6A 4FFBB 4FLXA 2UXDB 4DV6B 2Q7GA 1D5AA 4I9QA 5JQGB 4HNAA 4UCVA 4WBNA 1TVKB 5EZYB 5K1XA 3SR2C 4ZIBA 3E22A 4LFAB 2YXLA 5EYPB 3SJCC 4DV4B 3QTCA 4D7SA 4FLYA 4YJ3A 5KHGA 4LF4B 1XNQB 4UCTA 4I55A 1Z5WA 3HKEA 2YI8A 1TUBB 1HW7A 4DUYB 4NXMB 5FNVA 1DGSA 4LF7B 2PUSA 4LH7A 2UUAB 5J2TB 4JI7B 1I7FA 1HR0B 1TUBA 4IIJA 4KL1A 4DV5B 4B08A 1QQCA 4TUYB 1I94B 3N2GB 5D5PA 4DR6B 3N2KA 1N34B 4F6RB 2VWKA 4CH3A 1JFFB 3JAKB 5JH7A 5IJ0A 1XMQB 4IIJB 3JALA 2RJZA 4HBNA 2P22C 1HNZB 3N2GA 4B3SB 5LOVB 2PYLA 4O4LB 1O9HA 2JVDA 1XMOB 3JALB 1N32B 3JSNA 5LP6C 3K57A 4O4JB 5KHKA 5LP6B 1JMKC 5IYZB 5KHHA 3HKDA 3JATB 4I50B 5JJJB 4DV1B 2VQFB 3ICXA 3K58A 5JJNB 1XHXA 4ZOLB 4DR7B 3A2FA 5LXTA 3OTFA 3JARB 3BHPA 3ZEDA 5LOVA 3QF7A 4JI5B 4GKKB 4TV8B 4U3JB 4FLUA 1SQFA 4O2AA 5C8YA 4UFZA 5FPOA 3RWRD 1SA0B 1G6UA 4OX9B 4X1IB 3B2EE 5EZYA 2V4DA 3E22B 2E3CA 3LNNA 3K5LA 4U3JA 2F66C 2PY5A 4BWAA 4K8XA 2UXCB 4O2BA 4DV3B 5J2TA 2HHHB 3IAYA 4X62B 3JARA 3CHXA 1IBLB 3ETQA 2RQ6A 5LXTB 5CA1B 5ITZB 1FJGB 4ZOLA 1Q5OA 4DUZB 4DK0A 3N2KB 2Q7HA 3WB2A 4DRXB 5KMGB 3VQYA 5IWAB 3JATA 4I50A 1Z5VA 1SA0A 5D5QA 2BTQA 5IJ0B 3K5MA 2YIBA 3K5OA 4ZHQA 5CA1A 5ITZA 3MAQA 5EYPA 1Q3EA 2VWJA 1XHZA 4LF5B 4X1YA 4NVPA 1RSOA 4O4HA 4JI2B 5JQGA 5JVDA 2EX3A 4CS4A 1TA8A 4CC6A 3SJBC 3BRCA 4JI8B 1TVKA 4IHJA 1J5EB 4JI3B 5LMNB 1TAEA 3JASA 5CA0B 5KMGA 4YJ2B 4EB6B 4L8JA 4X65B 1X4TA 1KU9A 1P49A 4YY3B 3M7MX 1M4UA 4LNUA 4O4IB 3CSXA 5KHJA 4TV9B 5GONB 4FLTA 4FLZA 5LYJA 5FNVB 3SJAC 4X1YB 3ZS8C 1QHTA 4CH6A 4X1IA 4JYAB 4I55B 3JASB 1IBMB 3VQWA 3THOA 4IHJB 5EIBD 3JSLA 4ZHQB 4K8ZA 2YI9A 4GYCB 2Q7EA 2ZNIA 4CH5A 2QM4A 3K59A 1T5EA 1KMIZ 4LF6B 2ZIMA 5C8YB 2ZCEA 4WBNB 3RYHA 1L8DA 5IJ9B 4Q6GA 4LFCB 5BMVB 3UQ8A 3JAWA 4FM0A 2JGUA 5CB4B 4X1KB 1FFXB 2F93B 4TUYA 3HKBA 3RYIA 4F6RA 1ZAUA 2JS5A 3HKEB 4O4JA 5J2UA 2R9AA 3UT5A 5IYZA 4FM1A 2ZINA 5JVDB 4K0KB 1M93A 1XNRB 4BW9A 2IM9A 3T1YB 4FLWA 1O9GA 4FM2A 2YIBD 3SGIA 4AQYB 3FFQA 5LMUB 2F4VB 4CC5A 4CH4A 3HKCA 2UXBB 4LR3A 3RFRA 4HNAB 2OWOA 4LF9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2S B;  3WB1 A;  3BRC A;  1T5E A;  4DK1 A;  3WB2 A;  5JJN B;  2V4D A;  1VF7 A;  3LNN A;  5D5Q A;  5JJE B;  5D5P A;  2F1M A;  4L8J A;  3WB0 A;  2F93 B;  5JJJ B;  1RSO A;  4GYC B;  2F95 B;  4DK0 A; 
#chains in the Genus database with same CATH topology
 2QE7 G;  2R70 A;  2YS8 A;  4K35 A;  2GSM B;  3OGC C;  1S5J A;  3OE7 G;  2XUM A;  4PA6 A;  3K9A A;  4MT8 A;  4X66 B;  1NVP B;  1XI1 A;  4B3T B;  4TV9 A;  2XAQ A;  4OPH A;  2KKW A;  2HG5 C;  4GKJ B;  4I4T A;  5B5E Z;  1K33 A;  4GLX A;  1I0H A;  3OD4 A;  2YUA A;  4TT3 G;  2G38 A;  3ZMZ A;  2QKC A;  1H2K A;  1V9P A;  5LP6 A;  3RYI B;  1JR9 A;  4JAV A;  1RM1 C;  4CBC A;  4TWK A;  3TGU H;  3HKC B;  3OTO B;  4GX2 A;  1GMG A;  3QG5 A;  3L70 H;  2IW5 A;  3KKY A;  5DED A;  4JI0 B;  3B09 A;  3DSQ A;  3GWO A;  2R72 A;  1WPB A;  2HJF C;  2H94 A;  1E1R G;  1K8A W;  1YZB A;  1Q8I A;  2NLJ C;  2IBZ H;  1YJ9 V;  4KP4 A;  3U11 A;  1HNW B;  1G8M A;  4P9P A;  3I55 V;  1I5Y A;  1WA8 B;  1E1Q G;  2BTQ B;  3SPG A;  1VQM V;  3DC5 A;  3BPZ A;  5KX5 A;  1NT2 B;  2HEP A;  4YHH B;  2ZKO A;  3JAW B;  2KSD A;  5CB4 A;  2Q5Z A;  3T1H O;  1URF A;  2ZE7 A;  3QNE A;  1MNG A;  3D36 A;  4DV2 O;  2UUC O;  4TQF A;  3PJS K;  3W7T A;  3CYO A;  4LNU B;  4O4I A;  2XOK G;  3DXR A;  4JI0 O;  1BGY H;  4FK5 C;  1WP8 A;  2ZQM A;  4ABM A;  4Z1M G;  4NXN O;  3ZMS A;  1KD1 W;  1J5E O;  1FXK B;  4R7C A;  1WA8 A;  3ML0 A;  1JFF A;  1DK1 A;  2DN9 A;  3DXR B;  4AHC A;  1U96 A;  4DYL A;  4DO2 A;  5GON A;  1YCI A;  1X59 A;  3MD0 A;  4I0X A;  2XHB A;  4MVQ A;  4B3R B;  4GKJ O;  1Q43 A;  3P30 A;  4P30 A;  2M6Y A;  3L9D A;  4FIP C;  4FFB A;  4LH6 A;  3RT3 C;  5LA6 B;  1K92 A;  2WLM A;  2VQE B;  5DM6 V;  4X66 O;  2BOB C;  3DTU B;  2JJ2 G;  3WG7 C;  4UCO A;  3H9V A;  4IYI A;  3TJT A;  3OM3 B;  1NZ6 A;  4PDM A;  4JI1 B;  1OV9 A;  5KAI Z;  4AI8 A;  3OMN B;  4PI0 A;  3AG1 B;  4FLX A;  1JA8 A;  3LUT B;  2QWP B;  1F51 A;  2Q9L A;  2UXC O;  2HVJ C;  3D36 C;  4WBN A;  5K1X A;  1AR1 B;  3IFX A;  4LFA B;  5LGN A;  4WFB V;  2ZXW C;  2GHY A;  1LNQ A;  1Y4M A;  2ARH A;  2EUL A;  1PPJ H;  1D2D A;  3ZHR A;  2XT9 A;  1IDS A;  1S5H C;  3CP1 A;  5FLX N;  4JTA B;  3G6B A;  4NXM B;  3AK1 A;  3RBZ A;  4WFG A;  4LF7 B;  2EIN B;  2ZE6 A;  2UUA B;  4JYY A;  5J2T B;  1I7F A;  5DN6 G;  1HR0 B;  3HR0 A;  4DV5 B;  3T2M A;  4B08 A;  5EBL C;  1I94 B;  1NTZ H;  3ZN1 A;  3UO3 A;  1L0L H;  1ROP A;  1JFF B;  2WA3 A;  3FAV B;  3WU2 Z;  2FB5 A;  1QU7 A;  1IBM O;  3E8G A;  2E75 B;  1TUE B;  3LSU A;  4P2Z A;  4I5S A;  4LCU C;  2ZE5 A;  3AG2 B;  2ITD C;  2PYL A;  1RSO B;  5LMU O;  3K06 A;  3O9O A;  1EZV H;  1NTK H;  3AG1 C;  4JF3 A;  1RPO A;  3K3W A;  5LP6 B;  3R65 A;  3X2Q B;  1QVF U;  3C90 A;  3HKD A;  5EBW C;  1H2N A;  1MOF A;  3ZIA G;  4JV5 O;  2HLD G;  1R3I C;  4JGS A;  5IYB O;  1PM9 A;  3FYE B;  3CCS V;  5JWP A;  4H0L B;  2FKX A;  1AIL A;  3JAM N;  5LXT A;  3JAR B;  3BHP A;  1BT8 A;  2P4K A;  1CPY A;  4JI4 O;  4JI5 B;  3AK3 A;  4GKK B;  1HP8 A;  4MW3 A;  1DLB A;  3TET A;  4FLU A;  1SQF A;  1H2L A;  3MDS A;  1SA0 B;  1G6U A;  5E1A C;  1ZL8 A;  2CUG A;  4WF9 V;  4OPA A;  3B2E E;  3I5D A;  4J9Z B;  3K9S A;  2PY5 A;  3AG4 B;  4JYA O;  4QNH B;  1PV0 A;  1N33 O;  2UXC B;  3K08 A;  4JZ2 A;  4DV3 B;  2DE0 X;  3ETQ A;  4JAA A;  1ZTE A;  2OTJ V;  4ZOL A;  1ZSP A;  1S72 V;  4DK0 A;  1VQN V;  1MSW D;  5BXZ A;  4LWS B;  1S0V A;  3SPI A;  4DRX B;  5IWA B;  4I50 A;  1BE3 H;  4JYB A;  2IJI A;  2YIB A;  2QKA A;  2KQX A;  4U7O A;  1R73 A;  3A0R A;  1Y74 B;  1XBL A;  2DJV A;  5JQG A;  5JVD A;  1R3J C;  2GTA A;  5L3E A;  4DR5 O;  1PKX A;  2DYR C;  2EIK C;  1J5E B;  2OTL V;  3CRR A;  4JI3 B;  1MAB G;  2W0X A;  1YTF D;  3WG7 B;  3IJ4 A;  5LMN B;  1TAE A;  3CJH B;  1OCZ C;  1AP5 A;  4UB6 Z;  3DC6 A;  4PA3 A;  3ZRW B;  4EB6 B;  2VRZ A;  3CCV V;  1P49 A;  3KG2 A;  5EBM C;  4LNU A;  4O4I B;  5CA3 A;  2BSK A;  3CSX A;  3HB3 B;  2Q67 A;  4TV9 B;  5GON B;  2QWQ B;  4FMT A;  4B7K A;  4FLZ A;  5FNV B;  1R6K A;  1WB8 A;  3ZRV A;  3ZS8 C;  4LF9 O;  2ZD9 A;  1VAR A;  3AK2 A;  4JYA B;  3J80 N;  4I55 B;  5EIB D;  2YI9 A;  2GTS A;  2ZNI A;  4I0X B;  4ICG A;  1T5E A;  2DWD C;  4LF6 B;  3FB7 C;  3ZMV A;  1H38 A;  1COW G;  4XDL A;  2NR5 A;  4MTO A;  3OTO O;  3JCU Z;  1GM9 A;  2WA4 A;  3JAW A;  4B7E A;  2JGU A;  2JIZ G;  4X1K B;  4RQE A;  2V7Q G;  4TUY A;  1OCC B;  3L74 H;  1QLE C;  3RYI A;  4F6R A;  1ZAU A;  1Q82 W;  1RFY A;  2QEX V;  4PDV A;  2DMX A;  2R9A A;  3SYC A;  1P7G A;  2O57 A;  4LF4 O;  3QO7 A;  4FM1 A;  4K0K B;  3CCM V;  1M93 A;  2IM9 A;  2EJ7 A;  4ZBM A;  2YIC A;  2DWE C;  3L75 H;  2YIB D;  4AQY B;  3FFQ A;  4CC5 A;  3OT7 A;  3QVN A;  1GM7 A;  2OWO A;  4LF9 B;  1Q86 W;  4PD4 F;  2UXB O;  4UUJ C;  4L87 A;  4GT1 A;  3BAB A;  1VIB A;  1R6N A;  1Q90 D;  3M8A A;  4N21 A;  3RYC B;  1OCR B;  3U0Z A;  4DR1 B;  2GUZ B;  1Q7Y W;  1IX9 A;  4PDR A;  5EC1 C;  4DV5 O;  1WPX A;  1DF5 A;  2A7W A;  3ZRW A;  4EB6 A;  2D2C B;  5EC2 C;  3RYC A;  1KP2 A;  4J80 A;  1AI7 A;  3APQ A;  4MVM A;  2DQ3 A;  2JJ1 G;  3VQV A;  2A0L A;  2P5O A;  3JCZ A;  1WN7 A;  3HKD B;  1ZLZ A;  1B06 A;  2ZIO A;  2DYS B;  4DR5 B;  3S3W A;  4PV1 B;  4O4L A;  3WB0 A;  1FYJ A;  1VMG A;  1JOY A;  5LL6 Y;  2ITC C;  4LF5 O;  4DR2 O;  4NR1 A;  2IU0 A;  3RGB A;  2Y69 B;  3HPL C;  1RM1 B;  1ORQ C;  2Y48 A;  4XBF A;  1S3J A;  4X8A A;  3ZMU A;  1IUR A;  4UCS A;  4LWS A;  2E5L B;  5KA6 A;  2AW9 A;  1SS3 A;  4GX0 A;  1G1X B;  2HR3 A;  3C3T A;  2A79 B;  1GK9 A;  4TOI A;  5H2F Z;  3B4S A;  1FXH A;  2E5L O;  4UVC A;  2QSA A;  5L3F A;  2VQE O;  4YY3 O;  5E79 Z;  3BVO A;  2Y4T A;  4B3R O;  4LFB O;  5K1P A;  2EZP A;  3GVM A;  3SPH A;  4LF8 B;  1FAF A;  4B3M B;  3UT5 B;  3CC2 V;  4RUF A;  4YJ3 B;  1AJP A;  4ZI7 A;  5FPR A;  4NYK A;  2RCV A;  3ABU A;  3FB5 C;  5JH7 B;  2KB1 A;  2DYR B;  4JI4 B;  4HYO A;  2BCC H;  2EIK B;  1NKD A;  4DR4 B;  3ZX6 A;  2NNU A;  5H6R A;  3FB6 C;  2HVK C;  1KYO F;  3TXS A;  2ZM6 B;  4EFB A;  3U10 A;  1SZX A;  4MVO A;  2R9I A;  2WLK A;  1VQ5 V;  1I08 A;  2LP7 A;  1DF4 A;  4PA9 A;  5KA5 A;  1N32 O;  5TIS Z;  3CJH A;  1TGO A;  2Q68 A;  1V55 B;  2ZNJ A;  4RO2 A;  1NI8 A;  3BA9 A;  5LA6 A;  4RAI A;  4FFB B;  3CEI A;  2UXD B;  4DV6 B;  1D5A A;  1ARO P;  5JQG B;  2ZE8 A;  3QO5 A;  1N0N A;  5EZY B;  1Z2G A;  4AQY O;  2QR4 A;  4ZIB A;  3E22 A;  3T1Y O;  3CC4 V;  2YXL A;  1NR1 A;  1Y76 A;  4K0K O;  3APO A;  4FZ0 A;  4D7S A;  1EZJ A;  4R8C A;  4I55 A;  1YTF B;  2WLL A;  2CTW A;  4KHP O;  1Z5W A;  1VF6 C;  4XDK A;  3KZI Z;  2YI8 A;  2QA4 V;  5B1A C;  1NQT A;  2LW7 A;  1L1F A;  3ZJZ A;  5BY1 A;  1LR1 A;  3VOU A;  2PUS A;  4LH7 A;  4J11 A;  4A5U B;  1QLN A;  1TUB A;  4IIJ A;  1NS1 A;  1PNM A;  5HFL A;  5IYD O;  1N4C A;  2FTK A;  4TUY B;  5D5P A;  3N2K A;  1N34 B;  1BMF G;  1ZWI C;  1JJ2 U;  3JAK B;  5LBQ A;  5B1B C;  3JD2 A;  1XMQ B;  4WCE V;  3Q4H B;  3LSQ A;  4GX5 A;  2K9P A;  1HNZ B;  3DGE A;  4B3S B;  1W59 A;  4B3S O;  2Q6A A;  2ZR3 A;  2AXT Z;  5J9P C;  4HZ3 A;  3ABT A;  3L73 H;  3JAL B;  5LHI A;  3JSN A;  3K57 A;  4JYC A;  4DR3 O;  4PDL A;  2JEU A;  1VF5 B;  4I50 B;  4DV1 B;  2KG7 A;  2VQF B;  1ZUQ A;  1YI2 V;  2XAG A;  2Q69 A;  1GN4 A;  5L3D A;  4U7N A;  5CBH A;  1W0J G;  1AVM A;  5JJN B;  1N36 O;  1FFT B;  1SF9 A;  4DR7 B;  3A2F A;  2BSK B;  3B77 A;  4JI3 O;  4BW5 A;  2CK3 G;  5LOV A;  3QF7 A;  3E83 A;  1RP3 B;  4JI8 O;  3ZHV A;  3SJQ C;  4TV8 B;  3AG3 C;  3CCJ V;  3OEE G;  1GKF A;  2R9R B;  4UFZ A;  1SQB H;  5FPO A;  3RWR D;  4OX9 B;  4X1I B;  1M57 C;  2P6J A;  3JD4 A;  2XAS A;  5EZY A;  2V4D A;  2LW1 A;  3OR7 C;  2BE3 A;  2E3C A;  1IBK O;  2F66 C;  1SQP H;  3E8F A;  2CGO A;  3K04 A;  3JAR A;  3CHX A;  5LXT B;  1FJG B;  3SPJ A;  1IBL O;  1QVG U;  1B3Q A;  1Q5O A;  4DUZ B;  4NB5 A;  3CXC U;  4CZZ A;  2HP8 A;  4UB8 Z;  3QO8 A;  3F7Y C;  4FPP A;  5KMG B;  1Z5V A;  1QLE B;  5IJ0 B;  3K5O A;  3W7S A;  1BSM A;  4ZHQ A;  2Y0I A;  4HAM A;  1ZL8 B;  3MAQ A;  5EYP A;  1Y76 B;  1Q3E A;  2VWJ A;  1PL0 A;  1XHZ A;  1K34 A;  2H8P C;  4X1Y A;  1JQ0 A;  3ZHQ A;  1RSO A;  4UV9 A;  4O4H A;  4JI2 B;  1KQS U;  3JD1 A;  4CS4 A;  1TA8 A;  1THZ A;  1OHH G;  3SJB C;  4ZKI A;  1H2G A;  2N04 A;  1TVK A;  4GKK O;  4JI2 O;  3STZ C;  3RVY A;  2D3O W;  4LF8 O;  1BQZ A;  2WLH A;  5CA0 B;  1ENV A;  4OXS A;  4YJ2 B;  4L8J A;  4X65 B;  2K1E A;  3M99 B;  2EIM C;  3J7A U;  2EBO A;  5FL7 G;  1KB9 F;  3ZN0 A;  5IYC O;  5KHJ A;  4IGG A;  3E2E A;  5LYJ A;  1GN6 A;  1FJG O;  1V55 C;  4X62 O;  3SJA C;  4X1Y B;  2UU9 O;  1QHT A;  4JZG A;  4CH6 A;  3T4Z A;  2QTS A;  2WLL B;  1IBM B;  1F4M A;  4IHJ B;  1AI6 A;  1QCE A;  4ZHQ B;  4K8Z A;  4GYC B;  3S3X A;  3EFF K;  1Y67 A;  1H8H G;  2QM4 A;  1XNR O;  3SDL A;  4MVR A;  1KKC A;  2HJD A;  1YIJ V;  2ODM A;  4J7K A;  2B1G A;  2ZCE A;  3ASN C;  2FML A;  5IJ9 B;  3G67 A;  4LFC B;  3EVK A;  5BMV B;  1EBO A;  3UQ8 A;  2UUA O;  4FFK A;  2WPD G;  2UXX A;  1N0J A;  1NH2 D;  4DR7 O;  3HKB A;  2OT5 A;  2Y0P A;  2M7W A;  4IL6 Z;  1US6 A;  3H1J H;  2JS5 A;  2XAH A;  3CRQ A;  1PL4 A;  4O4J A;  1E79 G;  1OCO C;  1XNQ O;  2ADP A;  1GAX A;  2Z3Y A;  3ZHS A;  3K03 A;  2W0F C;  2OIG A;  4FM2 A;  3CXH F;  2CDY A;  2QM7 A;  2F4V B;  2H3O A;  3KCY A;  3HKC A;  2UXB B;  1EN6 A;  1K3E A;  3RFR A;  2C2A A;  2ETN A;  1HNZ O;  1GTO A;  2UU9 B;  3WFV A;  2N74 A;  4UVB A;  2JGD B;  3OR6 C;  5CN0 A;  4UCR A;  4J9Y B;  1R3L C;  3RYF A;  4CS3 A;  4JTD B;  1Q6H A;  4J7J A;  1GM8 A;  3G71 V;  1SQG A;  1W0K G;  4LP8 A;  1J95 A;  4TQD A;  4BIO A;  4X65 O;  2F95 B;  3K0G A;  1LUV A;  1AP6 A;  3OMA B;  4EFE A;  1VF7 A;  1LUW A;  4RUE A;  4X88 A;  2F1M A;  4JTC B;  1QR8 A;  2X0L A;  2LFR A;  2YSU B;  2YIA A;  5KUK A;  5CBG A;  2PYJ A;  4KHP B;  1HDJ A;  5KUM A;  3E86 A;  2XAF A;  1QNM A;  3AEI A;  3RYH B;  1AI4 A;  1H2S B;  1EFR G;  4YXW G;  1NBM G;  4X20 A;  2UUC B;  2QDO A;  1OCO B;  2EZO A;  3T1H B;  2B5U A;  2YXH A;  1WJZ A;  3T1C A;  1WLE A;  1NH2 B;  2OYQ A;  1JX9 A;  2PF4 E;  2KG7 B;  1KBH A;  4X64 B;  3CB2 A;  5JCO C;  4MTF A;  3K5N A;  1F4N A;  4NTY A;  2A3Q A;  3SYA A;  1SQX H;  2ZT9 B;  3H1I H;  1SQV H;  4X64 O;  3WB1 A;  5BR8 B;  1HNW O;  2Z5U A;  2Q0A A;  1M5I A;  1WNS A;  3LDC A;  1IBK B;  3VQX A;  3LDD A;  5JJE B;  4W4L A;  1S77 D;  1B6Q A;  2IJJ A;  2L6L A;  2LGQ A;  2P4V A;  2WLJ A;  4UXN A;  1JVM A;  5DEC A;  3R66 A;  3PN1 A;  3BAA A;  2E74 B;  5HFM A;  1OZ0 A;  3UCS C;  4C7U A;  4PHZ A;  2RMK B;  5KLV H;  4E4E A;  4B3M O;  5L3G A;  3CRC A;  1N36 B;  2DQ0 A;  3JD0 A;  4MVS A;  1FXV A;  3FD9 A;  3UKM A;  3GWK C;  4KFM A;  1JJO A;  5LYJ B;  2VQF O;  4LFB B;  1BHA A;  1VQ4 V;  4NKG B;  4PI2 A;  2XAJ A;  3RYF B;  4DRX A;  5IWA O;  1Q81 W;  3CX5 F;  2WLN A;  4DR3 B;  3P3P A;  2BTO A;  2PTM A;  1AR5 A;  3T4D A;  5IE9 A;  3BY6 A;  1SKV A;  4I4T B;  4PA4 A;  4YJ2 A;  1AJN A;  1XL6 A;  1L0N H;  1HNX B;  3OEH G;  1K4D C;  3O65 A;  1K5S A;  4HNA A;  4H44 B;  2MW2 B;  3SYP A;  1K7D A;  4UCV A;  3VBB A;  1TVK B;  4QE9 A;  1XMQ O;  1XRE A;  2CH7 A;  2XTA A;  1D5N A;  2LGW A;  3AG4 C;  3SJC C;  2Q4P A;  1K9M W;  1KEC A;  3L71 H;  4DR6 O;  2ZXW B;  1XNQ B;  1R6T A;  4UCT A;  2P67 A;  1K4C C;  2LQT A;  2QKS A;  1P84 F;  3ABM C;  1YDX A;  1XIL A;  2W6J G;  1HW7 A;  5FNV A;  1DGS A;  4NTW A;  4E2L A;  5LGU A;  3H1H H;  1BCC H;  3I56 V;  1S5L Z;  2JEX A;  3G6E V;  4GUN A;  1FD9 A;  3ZBH A;  4KL1 A;  2Z0A A;  1QQC A;  4KXR A;  4DR1 O;  2OIE A;  1XMO O;  4PJ0 Z;  4CH3 A;  4MVU A;  3LNM B;  3TK1 A;  2RNB A;  2HFE C;  5IJ0 A;  1GN2 A;  1M9N A;  2ILM A;  2RJZ A;  2FL4 A;  3NXS A;  3EHB B;  4R50 A;  3SYQ A;  1XL4 A;  1O9H A;  4FZ1 A;  1SRY A;  2JVD A;  1SZT A;  1AI5 A;  1XMO B;  1N32 B;  5LP6 C;  4O4J B;  4PA7 A;  3X2Q C;  5KHH A;  5L3C A;  3JAT B;  1HR0 O;  2AHY A;  2YDE A;  1VQP V;  1CEZ A;  1MA1 A;  2LFS A;  4MVZ A;  1V54 C;  2EIL B;  1XHX A;  4ZOL B;  2AZ2 A;  4MTX A;  3ABK C;  4DR4 O;  4MS2 A;  1SQQ H;  4BIU A;  1VQ9 V;  3ZED A;  4WFH A;  4DV0 O;  4IYH A;  1VEW A;  2Q0O C;  5H9C A;  2AHZ A;  1WP7 A;  3L72 H;  1XEQ A;  4O2A A;  4BIZ A;  2WLI B;  4F4L A;  3B8N A;  1VF6 A;  1XUQ A;  1WB7 A;  3C3S A;  3E22 B;  1M1K W;  3LNN A;  3K5L A;  3CCL V;  3FX7 A;  3A8T A;  4O2B A;  5J2T A;  3IAY A;  1HNX O;  1IBL B;  1KP3 A;  2RQ6 A;  5CA1 B;  2F43 G;  1U97 A;  3SYO A;  2CTQ A;  2IH1 C;  3CRA A;  2Q7H A;  2YC0 A;  3WB2 A;  3K5M A;  3KCX A;  3FYI B;  1SER A;  5ITZ A;  2ADQ B;  2WLI A;  4J42 A;  2V1D A;  4Z2W A;  1S76 D;  3UM7 A;  1GN3 A;  4LF5 B;  3NR7 A;  1NVP D;  1YXB A;  1K5Q A;  2B1I A;  2EX3 A;  4UV8 A;  4PEL A;  2JRI A;  4KUM A;  4CC6 A;  1BQ0 A;  2X6A A;  3BRC A;  4JI8 B;  4IHJ A;  1VQK V;  1OCR C;  1ZX3 A;  1XDC A;  4QGP A;  2X6B A;  4QPJ A;  3E35 A;  3JAS A;  3W7X A;  1OCZ B;  3CME V;  2GDS A;  3CS5 A;  4P9O A;  3CD6 V;  1X4T A;  1KU9 A;  4IT5 A;  1M4U A;  3TCU A;  4WFE A;  2A9H A;  2IJH A;  1M90 W;  3H01 A;  4GZR B;  3CRM A;  1KUQ A;  3AG2 C;  1JPX A;  4FLT A;  2DYS C;  1BZK A;  2ZDI C;  3Q4H A;  2UXN A;  5B1O A;  3E89 A;  2WSS G;  1SES A;  3IGA C;  2W6I G;  3E8H A;  3JAS B;  3VQW A;  3ZCC A;  2Q7E A;  3CCE V;  5GTI Z;  1N34 O;  3ABL C;  1PD3 A;  4WFA V;  1GH6 A;  3RYH A;  4JI7 O;  1DTO A;  3ABM B;  1IVS A;  1UJW B;  3ZRS A;  1BL8 A;  4DUY O;  2QWR B;  3EXA A;  1OJH A;  1YF2 A;  3HKE B;  2JDI G;  1VQL V;  4B3T O;  4J10 A;  1HWY A;  2DOS A;  3UT5 A;  2YEV B;  4LF6 O;  4YIO A;  2ZIN A;  4R6Z A;  3ZHU A;  5JVD B;  1Y74 A;  4JPR A;  3GB7 C;  4MSW C;  1MG1 A;  3T1Y B;  3SPC A;  4FLW A;  4J41 A;  2QWO B;  3IC7 A;  4X9Q A;  5LMU B;  4D6T H;  3N27 A;  4CH4 A;  4LR3 A;  4H37 A;  2UXD O;  4DK1 A;  4XDJ A;  3OUS A;  1FXK A;  3HKB B;  4ZI7 B;  4TV8 A;  1YJW V;  5JCO A;  3MHS C;  1B04 A;  4O2A B;  3ZHT A;  3E8B A;  2PZS A;  1PNL A;  5IY5 C;  3ABK B;  2ZR2 A;  4FLV A;  3TXQ A;  4QE7 A;  1XOU A;  4JI6 O;  2ZM6 O;  1FPO A;  5GTH Z;  5J2U B;  2GBO A;  4EEQ A;  2EIJ B;  1F7Y A;  5IDJ A;  4QJF B;  4NTX A;  4FVM A;  2Q8V A;  1V54 B;  2EIL C;  4LC1 A;  4D7T A;  4JAS A;  5KX5 B;  1BS3 A;  4LFC O;  4X20 B;  1QR9 A;  1VQ8 V;  1YEW A;  2CTR A;  1EN5 A;  4O2B B;  2EJR A;  2A06 H;  1KC8 W;  5IJ9 A;  2IH3 C;  2QJ1 A;  5KHI A;  3FKS G;  3OGI B;  3AG7 A;  2P7T C;  4MW8 A;  5B1A B;  3ZRX A;  2UUB B;  5EK0 A;  3CCQ V;  3B40 A;  2IU3 A;  2CGN A;  2OCC B;  5A2Q N;  2CAZ C;  4TSF G;  4G28 B;  1Q6U A;  5B1B B;  1P7B A;  2N05 A;  3CE2 A;  1EM1 A;  3G80 A;  3OMI B;  5C93 A;  4I9W A;  1I5X A;  2E76 B;  4J7Z A;  1YIT V;  4DV3 O;  2GV9 A;  1N33 B;  4O4H B;  1NJI W;  2UUB O;  3BA8 A;  2PI4 A;  4UCU A;  4DV7 B;  1FS0 G;  2LO1 A;  4DR2 B;  5B3S C;  2JK5 C;  1G4Y B;  3ETE A;  1OCC C;  1MMM A;  3JAK A;  1N8R W;  2AZ0 A;  1F23 A;  4JI5 O;  1YHQ V;  4DV0 B;  1GO3 F;  3RVZ A;  2QWN B;  2CH7 B;  4X1K A;  4NXN B;  1MZE A;  4AIL C;  2VS0 A;  3AG3 B;  4CS2 A;  1NR7 A;  1XQ8 A;  4DV2 B;  1IXB A;  2X7R B;  4JV5 B;  4JI6 B;  3STL C;  5KAF Z;  5CMU A;  4I7Z B;  1IZ3 A;  2L35 A;  3CPW U;  5BR8 O;  1M57 B;  5CA0 A;  5EIB C;  2PGG A;  5BMV A;  4YHH O;  3UO2 A;  1AB3 A;  1Y6X A;  1FFX A;  4YIP A;  3IC9 A;  2Y4U A;  2Q7G A;  4I9Q A;  4DW0 A;  1RPR A;  1PNK A;  5IT9 N;  3SR2 C;  2RN9 A;  1NTM H;  5EYP B;  4OX9 O;  4DW1 A;  3D3I A;  3BFR A;  4DV4 B;  3QTC A;  4FLY A;  4YJ3 A;  1AR4 A;  2YXY A;  5KHG A;  4LF4 B;  3FAV A;  1A32 A;  1K97 A;  3HKE A;  1TUB B;  4DUY B;  2QTO A;  4G2K A;  3BEH A;  3ASO C;  1QBZ A;  4JI7 B;  2QGN A;  1NU1 H;  1EN4 A;  3ETG A;  5AG2 A;  4GCZ A;  2Y69 C;  2IJK A;  1H8E G;  2CE4 A;  4U3F H;  3N2G B;  4DR6 B;  1YSC A;  2JGD A;  5LHH A;  4F6R B;  5A9G A;  4LFA O;  2VWK A;  2Q73 A;  2EIM B;  5JH7 A;  3OAA G;  5H5N A;  4IIJ B;  2YID A;  3JAL A;  4HBN A;  3K0D A;  1JCH A;  2P22 C;  3N2G A;  4W4K A;  1FKA O;  5LOV B;  2F4V O;  2EIJ C;  4O4L B;  1P4R A;  4MTG A;  4JI1 O;  1UFI A;  3LSS A;  5GW7 A;  1W2B U;  5IY5 B;  5KHK A;  2JS3 A;  1JMK C;  2XND G;  5IYZ B;  5H6Q A;  5JJJ B;  2CTP A;  3ICX A;  4GX1 A;  1VQ7 V;  3CWB H;  4DXW A;  3MHH C;  3K58 A;  3W7W A;  1SC5 B;  4QPK A;  5LMN O;  1K73 W;  3OTF A;  3A0B Z;  3JYC A;  1CP9 A;  2NN4 A;  1H2M A;  4RWU A;  3K79 A;  4UVA A;  2HKO A;  3LDE A;  4G27 B;  1BHB A;  4U3J B;  4BR6 A;  1VQ6 V;  5C8Y A;  1IXM A;  1MSD A;  4FJC C;  3CCR V;  4DV4 O;  4H13 B;  2F23 A;  4ASU G;  3OFN G;  1VP7 A;  2BOC C;  4K3A A;  4JAU A;  3OW2 U;  4U3J A;  4BWA A;  4K8X A;  1R3K C;  2OCC C;  2EIN C;  4DV6 O;  1YJN V;  2HHH B;  1Q6I A;  4X62 B;  4QIW F;  5CBF A;  5ITZ B;  3G4S V;  1UPG A;  3RW0 A;  4BAY A;  3RN4 A;  2GUZ A;  3N2K B;  3VQY A;  3JAT A;  1SA0 A;  5D5Q A;  2BTQ A;  4EKW A;  5CA1 A;  5B1N A;  1PP9 H;  2WAM A;  1GRJ A;  4NVP A;  2DW4 A;  3ZMT A;  2B9Z A;  4WFF A;  2ZDI A;  3D3Q A;  2LJ2 A;  2MK3 A;  3CCU V;  3D8C A;  5KMG A;  1SET A;  2RDC A;  3P3N A;  1FXK C;  4DV7 O;  1M56 B;  1R1B A;  3P32 A;  4YY3 B;  3M7M X;  5LGT A;  4OGQ B;  2ATK C;  1YVW A;  4DUZ O;  5L3B A;  1MZF A;  3W7U A;  4RQF A;  4LBE C;  5BZB A;  2HHH O;  2X6C A;  3F7V C;  1AJQ A;  3F5T A;  3A0H Z;  3CMA V;  4X1I A;  1Y66 A;  3B8M A;  2OCH A;  4X89 A;  3F5W C;  3CC7 V;  3THO A;  3JSL A;  4H33 A;  2WWW A;  4CH5 A;  3OUF A;  5F2V O;  3K59 A;  1KMI Z;  1I94 O;  2P90 A;  2ZIM A;  3H1K H;  5C8Y B;  3ASN B;  4WBN B;  3ASO B;  3BCC H;  1L8D A;  3FB8 C;  4Q6G A;  1KKD A;  5B66 Z;  2AGA A;  5LHG A;  4FM0 A;  5CB4 B;  4LF7 O;  1FFX B;  2F93 B;  3ABL B;  1VQO V;  4NXM O;  2PI5 A;  2QM8 A;  2FYU H;  5J2U A;  4DV1 O;  4Q20 A;  1WAZ A;  5IYZ A;  1CXZ B;  4F6E A;  1XNR B;  3JD3 A;  4BW9 A;  2P06 A;  3H1L H;  1M56 C;  1O9G A;  4N23 A;  3ETD A;  3SGI A;  4Z1V A;  5B3S B;  3J81 N;  2YEV A;  4HNA B; 
#chains in the Genus database with same CATH homology
 2UU9 B;  4DK1 A;  2R70 A;  3BAB A;  3HKB B;  4ZI7 B;  4TV8 A;  4UCR A;  5JCO A;  1B04 A;  4O2A B;  3RYF A;  2PZS A;  4CS3 A;  1S5J A;  3RYC B;  3U0Z A;  4DR1 B;  4FLV A;  4X66 B;  1SQG A;  1XI1 A;  4B3T B;  4TV9 A;  4TQD A;  5J2U B;  2KKW A;  4EEQ A;  4GKJ B;  2F95 B;  4I4T A;  4EB6 A;  4GLX A;  3RYC A;  4FVM A;  4EFE A;  1VF7 A;  1V9P A;  3VQV A;  5LP6 A;  2P5O A;  4D7T A;  5KX5 B;  3RYI B;  1WN7 A;  3HKD B;  2F1M A;  2ZIO A;  4X20 B;  3HKC B;  4DR5 B;  3OTO B;  2YIA A;  2PYJ A;  4KHP B;  1YEW A;  4O4L A;  3WB0 A;  3QG5 A;  4O2B B;  3RYH B;  5IJ9 A;  2QJ1 A;  5KHI A;  3RGB A;  4JI0 B;  1H2S B;  3DSQ A;  2R72 A;  1WPB A;  4X20 A;  2UUC B;  2UUB B;  3T1H B;  2OYQ A;  1Q8I A;  4UCS A;  3U11 A;  1HNW B;  2E5L B;  2CAZ C;  4X64 B;  2BTQ B;  3CB2 A;  5JCO C;  3BPZ A;  5KX5 A;  1NT2 B;  2HEP A;  4YHH B;  3K5N A;  3JAW B;  4TOI A;  3WB1 A;  5BR8 B;  2GV9 A;  2Q0A A;  5CB4 A;  1M5I A;  1WNS A;  1N33 B;  4O4H B;  1IBK B;  3BA8 A;  3VQX A;  5JJE B;  4UCU A;  5K1P A;  4TQF A;  4DV7 B;  4LNU B;  4O4I A;  4LF8 B;  4DR2 B;  4B3M B;  3UT5 B;  4YJ3 B;  4ZI7 A;  5FPR A;  3PN1 A;  3BAA A;  5JH7 B;  3JAK A;  1JFF A;  4PHZ A;  4DV0 B;  4JI4 B;  4AHC A;  4X1K A;  4NXN B;  4DR4 B;  1N36 B;  5GON A;  4AIL C;  2XHB A;  4CS2 A;  1JJO A;  1XQ8 A;  5LYJ B;  4LFB B;  4DV2 B;  4B3R B;  1Q43 A;  4JV5 B;  4FFB A;  4LH6 A;  4PI2 A;  5LA6 B;  2ZM6 B;  4EFB A;  4JI6 B;  3RYF B;  3U10 A;  4DRX A;  2VQE B;  4DR3 B;  2BTO A;  2PTM A;  4UCO A;  5CA0 A;  5EIB C;  1TGO A;  4JI1 B;  2PGG A;  5BMV A;  1SKV A;  4I4T B;  4YJ2 A;  2ZNJ A;  1FFX A;  4PI0 A;  1HNX B;  3BA9 A;  5LA6 A;  4FFB B;  4FLX A;  2UXD B;  4DV6 B;  2Q7G A;  1D5A A;  4I9Q A;  5JQG B;  4HNA A;  4UCV A;  4WBN A;  1TVK B;  5EZY B;  5K1X A;  3SR2 C;  4ZIB A;  3E22 A;  4LFA B;  2YXL A;  5EYP B;  3SJC C;  4DV4 B;  3QTC A;  4D7S A;  4FLY A;  4YJ3 A;  5KHG A;  4LF4 B;  1XNQ B;  4UCT A;  4I55 A;  1Z5W A;  3HKE A;  2YI8 A;  1TUB B;  1HW7 A;  4DUY B;  4NXM B;  5FNV A;  1DGS A;  4LF7 B;  2PUS A;  4LH7 A;  2UUA B;  5J2T B;  4JI7 B;  1I7F A;  1HR0 B;  1TUB A;  4IIJ A;  4KL1 A;  4DV5 B;  4B08 A;  1QQC A;  4TUY B;  1I94 B;  3N2G B;  5D5P A;  4DR6 B;  3N2K A;  1N34 B;  4F6R B;  2VWK A;  4CH3 A;  1JFF B;  3JAK B;  5JH7 A;  5IJ0 A;  1XMQ B;  4IIJ B;  3JAL A;  2RJZ A;  4HBN A;  2P22 C;  1HNZ B;  3N2G A;  4B3S B;  5LOV B;  2PYL A;  4O4L B;  1O9H A;  2JVD A;  1XMO B;  3JAL B;  1N32 B;  3JSN A;  5LP6 C;  3K57 A;  4O4J B;  5KHK A;  5LP6 B;  1JMK C;  5IYZ B;  5KHH A;  3HKD A;  3JAT B;  4I50 B;  5JJJ B;  4DV1 B;  2VQF B;  3ICX A;  3K58 A;  5JJN B;  1XHX A;  4ZOL B;  4DR7 B;  3A2F A;  5LXT A;  3OTF A;  3JAR B;  3BHP A;  3ZED A;  5LOV A;  3QF7 A;  4JI5 B;  4GKK B;  4TV8 B;  4U3J B;  4FLU A;  1SQF A;  4O2A A;  5C8Y A;  4UFZ A;  5FPO A;  3RWR D;  1SA0 B;  1G6U A;  4OX9 B;  4X1I B;  3B2E E;  5EZY A;  2V4D A;  3E22 B;  2E3C A;  3LNN A;  3K5L A;  4U3J A;  2F66 C;  2PY5 A;  4BWA A;  4K8X A;  2UXC B;  4O2B A;  4DV3 B;  5J2T A;  2HHH B;  3IAY A;  4X62 B;  3JAR A;  3CHX A;  1IBL B;  3ETQ A;  2RQ6 A;  5LXT B;  5CA1 B;  5ITZ B;  1FJG B;  4ZOL A;  1Q5O A;  4DUZ B;  4DK0 A;  3N2K B;  2Q7H A;  3WB2 A;  4DRX B;  5KMG B;  3VQY A;  5IWA B;  3JAT A;  4I50 A;  1Z5V A;  1SA0 A;  5D5Q A;  2BTQ A;  5IJ0 B;  3K5M A;  2YIB A;  3K5O A;  4ZHQ A;  5CA1 A;  5ITZ A;  3MAQ A;  5EYP A;  1Q3E A;  2VWJ A;  1XHZ A;  4LF5 B;  4X1Y A;  4NVP A;  1RSO A;  4O4H A;  4JI2 B;  5JQG A;  5JVD A;  2EX3 A;  4CS4 A;  1TA8 A;  4CC6 A;  3SJB C;  3BRC A;  4JI8 B;  1TVK A;  4IHJ A;  1J5E B;  4JI3 B;  5LMN B;  1TAE A;  3JAS A;  5CA0 B;  5KMG A;  4YJ2 B;  4EB6 B;  4L8J A;  4X65 B;  1X4T A;  1KU9 A;  1P49 A;  4YY3 B;  3M7M X;  1M4U A;  4LNU A;  4O4I B;  3CSX A;  5KHJ A;  4TV9 B;  5GON B;  4FLT A;  4FLZ A;  5LYJ A;  5FNV B;  3SJA C;  4X1Y B;  3ZS8 C;  1QHT A;  4CH6 A;  4X1I A;  4JYA B;  4I55 B;  3JAS B;  1IBM B;  3VQW A;  3THO A;  4IHJ B;  5EIB D;  3JSL A;  4ZHQ B;  4K8Z A;  2YI9 A;  4GYC B;  2Q7E A;  2ZNI A;  4CH5 A;  2QM4 A;  3K59 A;  1T5E A;  1KMI Z;  4LF6 B;  2ZIM A;  5C8Y B;  2ZCE A;  4WBN B;  3RYH A;  1L8D A;  5IJ9 B;  4Q6G A;  4LFC B;  5BMV B;  3UQ8 A;  3JAW A;  4FM0 A;  2JGU A;  5CB4 B;  4X1K B;  1FFX B;  2F93 B;  4TUY A;  3HKB A;  3RYI A;  4F6R A;  1ZAU A;  2JS5 A;  3HKE B;  4O4J A;  5J2U A;  2R9A A;  3UT5 A;  5IYZ A;  4FM1 A;  2ZIN A;  5JVD B;  4K0K B;  1M93 A;  1XNR B;  4BW9 A;  2IM9 A;  3T1Y B;  4FLW A;  1O9G A;  4FM2 A;  2YIB D;  3SGI A;  4AQY B;  3FFQ A;  5LMU B;  2F4V B;  4CC5 A;  4CH4 A;  3HKC A;  2UXB B;  4LR3 A;  3RFR A;  4HNA B;  2OWO A;  4LF9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...