1RSOA

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
total genus 18
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1rsoA01
1VF7A 5D5QA 2V4DA 3WB1A 4DK0A 1H2SB 1RSOA 4GYCB 1T5EA 5JJJB 5JJNB 3WB0A 3BRCA 2F93B 2F1MA 3WB2A 5D5PA 4DK1A 2F95B 4L8JA 5JJEB 3LNNA
chains in the Genus database with same CATH superfamily
4IGGA 4O2BB 1OCRB 4D7SA 3WB1A 4BIZA 3ZMSA 4R7CA 4I50A 5JJJB 2A7WA 3ZBHA 4BIUA 1AI5A 3T1YB 4YJ2B 3CS5A 3CX5F 4Z1MG 2BE3A 1GTOA 3CE2A 2EBOA 4O2AB 4LF4O 1Q3EA 3ZN0A 4X66B 4LF5B 1N0NA 2RQ6A 2KG7B 3OAAG 1DF4A 3BABA 1JOYA 4HNAA 2KQXA 3OUSA 4JI6O 4FLVA 4YXWG 4YIPA 3UT5B 1ROPA 3ZCCA 4FLXA 4MTOA 3VQVA 2BSKB 1PNLA 4JZGA 2GUZA 1H2NA 2OT5A 1XBLA 4DV3O 3SJBC 3ABLB 1Z5VA 3K3WA 4I50B 2VS0A 1ZUQA 2R9IA 4FJCC 2M7WA 1JJOA 2F95B 3HKCB 3AG4C 5DECA 4J42A 3WU2Z 4X20B 3FB5C 2VQFB 4DR4B 4DUZB 4I5SA 4YHHO 5ITZB 5CA3A 2EIKB 1AVMA 2RCVA 3E89A 5LMUO 1XMQO 3K58A 3ZRXA 2QWOB 2ZE6A 3F7VC 1OCZB 1H2LA 4R8CA 4LNUB 1AI7A 1JFFA 2PYLA 2Y48A 4NVPA 2ITDC 5D5QA 4JI8B 2Q9LA 1D5NA 5KX5A 3E8GA 4W4LA 4JTCB 1TUEB 3APOA 4DRXB 1H2KA 3P30A 2HKOA 2BTQA 2YIBA 1AROP 5C8YB 2OTLV 3ZN1A 2OYQA 4WFBV 4QGPA 1OHHG 4DV6B 1K4DC 3X2QB 2LW7A 3FAVA 5IJ0A 1WPBA 4TV9B 3O9OA 3ASNB 2PZSA 3OTFA 1XNQB 3LSUA 1O9HA 3B09A 4DR1O 3T4ZA 4CH3A 4CC5A 1NR1A 1WA8B 5EZYB 2A06H 3KCYA 2ZXWB 2R72A 2HG5C 1B6QA 2JEXA 1XMQB 2KB1A 1QLEC 1YZBA 3P32A 1TAEA 3K0GA 1K97A 2R9AA 1GK9A 2CK3G 5IYBO 1HR0O 2EZPA 1VMGA 3BAAA 1VQPV 4KXRA 2JS3A 1L0LH 4WFHA 1K5SA 3STLC 1QBZA 1R3JC 3DC5A 3FX7A 5CMUA 4PDMA 1Y74B 1YJ9V 4NYKA 4X20A 5JVDB 1HDJA 1ZAUA 3B4SA 1BSMA 5LHGA 5B1OA 2M6YA 5LMNB 3UKMA 4O4HA 1G6UA 2XAFA 1AB3A 2CGNA 4DK1A 2QTOA 4NXMB 1IX9A 3SPCA 4DR7B 3A8TA 1THZA 4LFAO 2Y0PA 4H33A 1WB7A 2YS8A 1X4TA 1FAFA 3KG2A 3JAMN 4H44B 4LF9O 2WA3A 2PI5A 1COWG 4U7NA 5FPOA 1JVMA 3E86A 4J7ZA 4LFBB 2XNDG 1R73A 2VWKA 5GTIZ 4G2KA 4UXNA 4MS2A 3H1KH 1VF6C 4X62B 1FFXB 1NTZH 5B66Z 2CTWA 1PD3A 4YHHB 1PNMA 3ZEDA 2V7QG 2Z5UA 5IYCO 2ZR2A 4JYBA 5EBLC 5IJ0B 3SGIA 2W0FC 4KFMA 5LL6Y 1ZL8A 2ZM6O 3AG3C 1R1BA 2QWNB 3OD4A 3LNNA 2WLJA 3ASOC 4ICGA 3OTOB 1MZEA 1NU1H 1SQPH 2OCCC 5EK0A 3SYAA 4GUNA 4UUJC 3ABMC 1MMMA 5E1AC 3ZHTA 2UU9B 1KD1W 3QO8A 1M5IA 2H3OA 2UXCO 4X65O 5BY1A 3JD4A 4MTGA 1I5YA 1HNZB 5IJ9B 1NKDA 4X9QA 3H01A 1RM1B 3HR0A 4PA7A 4H0LB 1V54C 4LF4B 2DWDC 4Q20A 4MVMA 1IZ3A 1W0KG 1VP7A 4I9QA 1KMIZ 3SYPA 1HR0B 3FB8C 4PA3A 3AG1C 1K4CC 1UPGA 2KG7A 3MHSC 4AI8A 5IYDO 1W59A 4JTDB 1FD9A 2P90A 3VQXA 1Q6IA 5H6QA 4TOIA 4LF7B 5IYZA 1FFTB 1D5AA 1SQBH 1UFIA 2JIZG 4DR1B 2UUCO 1QLNA 5EBMC 4LFCO 5CA0B 3OEEG 3Q4HA 1R3LC 2OTJV 4IHJB 3D36A 5L3EA 3M99B 1CP9A 4RQFA 2UUBO 4NXNO 2X0LA 1AR4A 1AR5A 1H2SB 4LH6A 2EJRA 1XMOO 5LGTA 1MZFA 1QR8A 4TUYA 4B7EA 3N2KA 5KUKA 3K5MA 2IJIA 4PDRA 3E83A 2ADPA 2AGAA 3ZIAG 2IBZH 2V1DA 2ILMA 4DV1B 4FZ1A 2Q0OC 1XOUA 2WLMA 2RMKB 2E74B 5B1BC 3OMIB 2WLNA 2PGGA 3M8AA 2ZE5A 1CPYA 5LOVA 4WF9V 5CB4B 4DV4B 4LF6B 4O4HB 5LA6B 5EIBC 3RT3C 3CMAV 3N27A 3CCSV 1YXBA 1YITV 4X1YB 4FLWA 2UXBO 4JI0B 4DV5O 2F1MA 5IJ9A 3JSLA 5L3CA 3BFRA 1IBMO 3T1CA 1V55C 4AHCA 4X64B 1EZVH 2O57A 3SPGA 4XDLA 4DK0A 1VQLV 1K7DA 2CH7A 1F4MA 2ODMA 4Z1VA 1GAXA 5AG2A 4JYAO 3CC7V 2VQEB 4PA4A 4DR2B 3CMEV 3OGCC 4DV0B 1JR9A 3LSSA 1VQ7V 2QKAA 2EILB 1GH6A 2W0XA 2IW5A 5JVDA 3OMNB 1G8MA 3OE7G 3QVNA 5BR8O 3QO5A 2JGDB 4CBCA 3EHBB 4R6ZA 2ETNA 2AZ0A 2F66C 3CB2A 2UU9O 3CRRA 3VQWA 1L0NH 1TUBA 4FLYA 4GKKO 3BCCH 1CEZA 1LNQA 1HW7A 4K0KO 2YC0A 3RN4A 2XHBA 1BHAA 3N2KB 3CHXA 1P7BA 2ZXWC 1G1XB 2WLIA 1KB9F 5IDJA 4LFCB 5FNVB 3T1HO 4B3RB 1J95A 3CXCU 2AHYA 3RYHB 1W0JG 1PL4A 3JD3A 1GO3F 4U7OA 2Q6AA 2QE7G 5CBHA 5LBQA 5CA0A 2IJHA 2HJFC 2JK5C 5CA1A 1XL6A 4GZRB 3IFXA 1K5QA 2CDYA 3K5LA 4TQDA 2L35A 3R66A 1SA0A 4EKWA 2DYRB 5A9GA 4WBNA 1AR1B 3ABTA 1JQ0A 3A0BZ 1MSDA 1PV0A 4RO2A 5LP6A 2XAHA 3ZHVA 2QA4V 2EIJC 2E76B 3X2QC 4HAMA 4ZOLA 1EFRG 2QEXV 2LGQA 2JEUA 1WAZA 4LFAB 4LP8A 2JJ2G 1PPJH 4JZ2A 4JYAB 4JI3O 1XNRB 4X1KA 3CRCA 1NJIW 3RW0A 3QO7A 5CBGA 2JRIA 3MHHC 5KAIZ 4IYHA 3C3TA 1H8HG 4UVCA 1ZTEA 3JATB 3ZMVA 2EINB 2EIJB 5EC2C 3JSNA 4PDVA 4O2AA 1RFYA 2E5LO 2DWEC 3I55V 3IJ4A 1IXBA 1WB8A 3KCXA 3L73H 3TCUA 1FYJA 3CJHB 4MVSA 4JI5B 4EEQA 4JI1B 1S72V 5GW7A 3BY6A 2EJ7A 4LH7A 1OCZC 1B3QA 2BOCC 1WN7A 1RSOA 2RNBA 3MDSA 3JAKA 3S3XA 5L3GA 1XNQO 5JWPA 4DV1O 2IH1C 2IJKA 2RJZA 3M7MX 3TGUH 3K04A 4P9OA 3BHPA 5EC1C 1FXKB 3OR7C 3ZHQA 4GX1A 1SETA 4Q6GA 2WLLA 3ZMZA 2QKSA 1MG1A 1XMOB 1XL4A 4JI1O 5B3SC 1IBMB 1I94B 1WPXA 3E8FA 1BMFG 3CYOA 4IYIA 1S5JA 4DUYB 2G38A 4LWSB 4GYCB 3LSQA 3STZC 3E8HA 1M56C 4RUEA 4LNUA 1VQ5V 4YJ3B 4NB5A 5CBFA 1QLEB 1YDXA 4JI7O 5DEDA 3L75H 5GTHZ 2F23A 4DV2O 3JCUZ 3JASA 5KA6A 2ZCEA 5CA1B 4ZI7B 3CCLV 1MNGA 4DUZO 2EINC 3OUFA 5K1XA 1Q43A 3VOUA 3ML0A 4JV5B 4JI2B 1Z2GA 3RWRD 4PHZA 1VQOV 4DR5O 4UCOA 2WLIB 4JF3A 3O65A 1SA0B 3GVMA 4PELA 2HLDG 3THOA 3CSXA 2BCCH 3K03A 4NXNB 4PA6A 1EN6A 3ZMTA 4JI3B 2YI8A 1KQSU 2WAMA 1B04A 4BAYA 3AG1B 4DW0A 3NR7A 2LFSA 4JI8O 2UXXA 2L6LA 3HKDB 5KHJA 5J2TB 1Y76A 2ZM6B 1N32B 1JMKC 4BIOA 1IXMA 1AJNA 2QWRB 4LF5O 2ZE8A 2HP8A 4NTYA 4KHPO 3OEHG 3JATA 2Q5ZA 2WLKA 1N33O 3N2GB 2QKCA 4Z2WA 3WB0A 1U96A 1W2BU 2LJ2A 2E75B 2UXDB 5B3SB 2WLHA 1F4NA 4U3JB 4PDLA 3J7AU 2FB5A 2PUSA 4P9PA 1YVWA 1NT2B 1XREA 4W4KA 1M93A 1EZJA 2FTKA 2HVKC 3KKYA 1SERA 2Y69B 1XDCA 1NI8A 1BE3H 4X65B 4LF9B 2X7RB 4GX2A 4LCUC 2CTQA 3G4SV 1EM1A 4G28B 4UCRA 2A3QA 1YI2V 3HKCA 2GHYA 2OIEA 1XNRO 4I0XB 3W7TA 5H2FZ 2OIGA 5CB4A 1IDSA 2DQ0A 3ETQA 3L71H 1NR7A 3OGIB 3RVZA 1KYOF 2YI9A 2LQTA 3CJHA 1GMGA 1Y67A 3DTUB 4DR5B 1HNWB 4CZZA 1FPOA 1TVKB 2ZE7A 1ZSPA 3B2EE 1YIJV 1SQXH 3K59A 3A0HZ 2WSSG 4DV2B 1MOFA 2FL4A 4J11A 4AILC 1Q8IA 4N21A 3FYIB 1S5HC 3G67A 2PYJA 1VARA 3CRMA 4MT8A 5IWAB 1SESA 2OWOA 4GLXA 1BGYH 5LHHA 1PL0A 5DN6G 2YDEA 2ZIOA 4OPAA 4JI0O 4YY3B 1E79G 1K3EA 1K73W 3BEHA 3BPZA 1FXKA 2P06A 4AQYB 1QQCA 4J9YB 4PV1B 4TUYB 5GONA 1OCOC 5JCOA 2W6JG 1NTKH 4I7ZB 2K1EA 5C93A 4TWKA 1YCIA 4JGSA 1NH2D 1N36O 4UVBA 3K08A 1M9NA 2FYUH 1AI4A 1JPXA 2QSAA 3GWKC 4FLTA 3ZHSA 4WCEV 3EVKA 4PJ0Z 1KKCA 4UB8Z 2YICA 4JI2O 2AXTZ 4ZHQA 1KP2A 3VBBA 1N0JA 2HEPA 4DXWA 4FZ0A 3UT5A 4EB6B 4C7UA 4X64O 3AG7A 1OCOB 2ZINA 3A0RA 1GM8A 5FL7G 1VQ4V 4NR1A 3RVYA 4MVQA 2ARHA 1VQMV 4LF8B 3CCVV 1NTMH 4DV5B 3SPIA 3DGEA 2CTPA 5JH7B 3AK3A 2JGDA 1V9PA 3FB7C 5IY5B 1KC8W 4UV9A 4B3MB 4GX0A 3AG2B 4LF8O 4XDKA 4B7KA 1DLBA 4B3SO 5LP6C 1UJWB 1YTFD 4DV4O 4LF6O 1R6NA 2ATKC 4PI0A 4RUFA 3B8NA 2Y0IA 4YJ3A 4EFBA 3B77A 4L8JA 1VQ8V 3D3QA 4I9WA 1HP8A 3LDEA 2H8PC 2QGNA 2Q7HA 1FXKC 3K57A 3BA9A 1OCRC 5TISZ 3C3SA 2X6CA 1NQTA 3BA8A 3I5DA 3MD0A 5LGUA 1I5XA 4WFFA 2ZNJA 2Q73A 4D6TH 4O2BA 1N36B 1M1KW 1HNZO 4K8XA 2X6BA 4CH5A 2DMXA 4NKGB 2UUBB 4X1YA 3MAQA 5EZYA 1WA8A 1LR1A 2CUGA 3RFRA 3T1YO 1IVSA 1IBLB 1K33A 2QM8A 2VWJA 5JJNB 2HFEC 3FYEB 2P67A 2WPDG 4R50A 4OPHA 5DM6V 1R6TA 5JQGB 2DW4A 2UUCB 3W7UA 5J2TA 5LP6B 2A79B 1BQZA 3J81N 3H9VA 3OW2U 1H2MA 3PN1A 2YXLA 4JYYA 3T1HB 2GTAA 2WA4A 1S0VA 1E1RG 2ZDIA 3F5TA 1OJHA 3A2FA 1VIBA 3BRCA 3JAWB 4BR6A 4YIOA 4CC6A 1SQQH 2DYRC 3SYCA 4IIJA 4UV8A 2DE0X 3RYHA 3VQYA 3TXSA 4F6RA 4WFEA 5BXZA 1IBKO 4MVUA 4FFKA 1GKFA 1PNKA 4CS4A 1XHXA 1GRJA 4X66O 1T5EA 1I0HA 2XT9A 4DV0O 3U10A 3HB3B 3LDDA 3QF7A 4L87A 1D2DA 4JTAB 2XOKG 4CS2A 3IC7A 4QPKA 2F4VB 2D2CB 4KP4A 3W7XA 3QNEA 1VQ6V 4FLUA 5LMNO 2NLJC 3JD0A 3KZIZ 4DR6O 4DW1A 3FD9A 3GB7C 4FFBB 2ADQB 1BCCH 4OGQB 1EBOA 1WLEA 1M57B 2AW9A 4ASUG 4X88A 1IBLO 2PI4A 3OT7A 2X6AA 3CCUV 3ZRSA 4TV8A 4DYLA 2GBOA 4O4IA 1I94O 1XILA 1SQVH 2BTQB 4GKKB 4X1IA 4MSWC 4J41A 5B1AB 2D3OW 1YJNV 5B1AC 1M56B 3CP1A 1BQ0A 3K5NA 1US6A 1WJZA 2F93B 2XAQA 4KHPB 5FLXN 5BR8B 4XBFA 2EIKC 3UO3A 1NZ6A 4QPJA 2QJ1A 2Q7GA 4IT5A 3CCQV 1N32O 3B40A 3U0ZA 1KKDA 4A5UB 4RAIA 2IU0A 1F23A 1PM9A 4ZHQB 3C90A 5LGNA 2YXYA 3K5OA 4GX5A 1J5EB 3HKEB 3RBZA 5H6RA 2VRZA 3LNMB 2EX3A 3CCJV 3E22A 1DTOA 3SR2C 3FKSG 2DYSB 1GN4A 1V54B 4FM1A 1Q6UA 1AJQA 4B3SB 2MW2B 5KMGB 4I55B 1FFXA 5KHIA 4EFEA 4FK5C 4FMTA 4B3MO 1XHZA 3DXRA 3UQ8A 1FXVA 3E2EA 4NTWA 2VQFO 4LWSA 1NS1A 3OR6C 2JVDA 3ZHUA 5IE9A 4O4JB 3K79A 5L3DA 1KECA 2XUMA 4LF7O 1AI6A 2ZQMA 3JARA 4DR3B 2QM7A 3W7WA 3SJAC 4UVAA 1SZXA 2ZIMA 4X1KB 2MK3A 2UUAB 3JD2A 3AEIA 2DYSC 4QNHB 3H1JH 1I7FA 4CH4A 1BT8A 4DUYO 5B1BB 1YHQV 1XUQA 2B1GA 4DR4O 1SRYA 4HNAB 5IT9N 3E35A 4ZOLB 3RYFA 5B1NA 2B9ZA 4JI6B 2DQ3A 4K8ZA 4BW9A 2NR5A 4DV6O 4JAVA 2GTSA 1RM1C 4LC1A 1YTFB 1E1QG 1H38A 2R70A 1BS3A 1QU7A 3GWOA 2Q68A 4E4EA 2A0LA 3TK1A 1RPRA 4DV3B 1GN2A 3CD6V 3UM7A 1ENVA 1PP9H 5IYZB 2P6JA 3T4DA 4H13B 3ABUA 4PA9A 1ORQC 2LGWA 4QJFB 4G27B 2ZD9A 5L3FA 2AHZA 2IM9A 4OX9O 2Q0AA 4MVRA 4K3AA 4DO2A 1NH2B 3SYQA 5J9PC 1TGOA 1QVFU 2Q67A 4J9ZB 2KKWA 1HNXO 2Q4PA 5LMUB 2LFRA 1R3KC 1OCCB 3JAWA 1XI1A 4P30A 1S3JA 1A32A 4TV9A 1SQGA 2C2AA 3HKDA 2CTRA 5J2UA 3D36C 2QM4A 1SQFA 4HBNA 4FM0A 1AJPA 4U3JA 5L3BA 5A2QN 1V55B 1YJWV 2WLLB 4DRXA 5K1PA 5E79Z 1F51A 3OM3B 1Q90D 2JS5A 3L70H 2CE4A 1VQ9V 1JX9A 3HPLC 4D7TA 3NXSA 2GDSA 1SKVA 2EIMB 2CH7B 4H37A 4CH6A 4DR2O 4I55A 3SDLA 4YJ2A 2IH3C 3OTOO 1YSCA 2RDCA 1OZ0A 3APQA 5KLVH 3E22B 3CWBH 3DC6A 1DK1A 4X1IB 3G71V 3CEIA 1H2GA 5EBWC 2Y4UA 3ZRWA 3G6EV 2PF4E 4UCSA 3K0DA 1R3IC 2BTOA 4BWAA 3RYCB 1RPOA 4JYCA 3ZRVA 3RGBA 1Y6XA 4KL1A 3W7SA 4GKJB 1K34A 1GN6A 1DF5A 5KHHA 2ZT9B 2DN9A 1SC5B 1H8EG 1N33B 1ZWIC 3R65A 2QTSA 3SJQC 2B5UA 1YEWA 4I4TB 4TQFA 2BOBC 1MSWD 4P2ZA 4TSFG 1P7GA 2IJJA 3UCSC 4HZ3A 3OFNG 3K9AA 4JAUA 2BSKA 5BZBA 3FB6C 4OXSA 3JARB 2W6IG 2GSMB 3P3PA 3E8BA 3ICXA 4B3TB 3EXAA 3IGAC 1Q7YW 4B08A 4NXMO 1TUBB 2UXNA 2LW1A 1Z5WA 4UCUA 3RYIA 4FPPA 4CS3A 4MVOA 4EB6A 1BHBA 5KMGA 2EULA 2DJVA 5EYPB 4LBEC 5J2UB 1GN3A 3ASNC 4JASA 3J80N 5KA5A 1Y66A 3SJCC 4JV5O 1CXZB 2N05A 2LO1A 2DOSA 3JD1A 4MTFA 5LXTA 1Q86W 1QR9A 2P22C 3CCRV 2YIBD 3EFFK 1WNSA 4E2LA 4J80A 5LYJA 4J7JA 4JI7B 5D5PA 1AP5A 1P4RA 1LUVA 4QE9A 1N34B 4DR3O 4JI5O 4J7KA 1K9MW 1YF2A 1QCEA 5JCOC 3CCEV 2ZDIC 5KUMA 4WFGA 2V4DA 3AG4B 1M90W 5BMVB 2E5LB 1N4CA 1SZTA 5IY5C 4K35A 2YIDA 4DR6B 1VF6A 3WG7B 3WB2A 5FPRA 4MTXA 1N34O 3K06A 1FJGO 2PTMA 1G4YB 2Q69A 2ZR3A 5JQGA 5KAFZ 2UXCB 1Q5OA 2N04A 3AG2C 1VF5B 3LDCA 3CCMV 3U11A 5LYJB 3RYCA 2K9PA 4ZKIA 5F2VO 1ZL8B 2GV9A 3HKBB 2XAGA 2PY5A 4UB6Z 2HHHO 1BZKA 3TJTA 3IAYA 1IBKB 2IU3A 1BL8A 1EN5A 1AP6A 3B8MA 1MABG 4ZIBA 4TT3G 1Q6HA 1Q82W 3LUTB 5GONB 2JDIG 3CC4V 1GM9A 1Y74A 2FKXA 2YEVB 3RYIB 1KUQA 2EZOA 2P4VA 3JAKB 4WBNB 1AILA 4GKJO 2QR4A 3JALB 3ZMUA 4X62O 3AG3B 2ZKOA 2CGOA 3QTCA 4ZI7A 1S5LZ 5H5NA 4WFAV 2F43G 5IWAO 2RN9A 4OX9B 1NVPD 1Y76B 4RWUA 1S76D 2P4KA 5KHGA 2HHHB 4UCTA 1URFA 4ABMA 1QVGU 1X59A 1QNMA 5JH7A 3T2MA 4ZBMA 2QWPB 4K0KB 4DV7B 3CC2V 1FXHA 2F4VO 1SF9A 3S3WA 4DR7O 3F5WC 5LA6A 3CXHF 1Q81W 3DSQA 1OCCC 1B06A 3L72H 4O4IB 4MW8A 1TA8A 3WG7C 1FJGB 3WFVA 1K92A 3JCZA 3D3IA 2NN4A 2OCHA 2P7TC 2NNUA 1JJ2U 1XEQA 3CRAA 4PI2A 2QWQB 2VQEO 2A9HA 1VEWA 4PD4F 2N74A 4BW5A 2B1IA 5ITZA 1ZLZA 4O4LA 1PKXA 4J10A 4XDJA 4X8AA 2Y4TA 2UUAO 2WWWA 1FKAO 2EIMC 2H94A 4F4LA 2CAZC 1KBHA 1RSOB 3SYOA 1F7YA 3PJSK 3G6BA 5LXTB 2ITCC 3ZRWB 1K8AW 5H9CA 3BVOA 4IIJB 4B3RO 4MVZA 2FMLA 1L8DA 4UFZA 3JASB 2UXBB 1U97A 1R6KA 4GT1A 4HYOA 3HKBA 3FFQA 3IC9A 2P5OA 3FAVB 4N23A 2XTAA 2GUZB 4QE7A 3ABMB 2UXDO 5EIBD 3P3NA 5EYPA 4LR3A 2Y69C 2YSUB 4KUMA 5JJEB 1XQ8A 1M57C 4NTXA 1HNXB 2Z0AA 4FM2A 4GCZA 1EN4A 4FFBA 4LFBO 1JA8A 4QIWF 4U3FH 5HFMA 3UO2A 4JAAA 2HVJC 4UCVA 3L9DA 4FLZA 4B3TO 3DXRB 4TV8B 3SPJA 3CRQA 2LP7A 3AK1A 2JJ1G 1VQKV 2Q7EA 3ASOB 2YEVA 3ETGA 4IHJA 2JGUA 2OCCB 4I4TA 1JCHA 4JI4B 4X89A 5B5EZ 1S77D 2Z3YA 3F7YC 3Q4HB 1NVPB 2YIAA 1N8RW 1IURA 2E3CA 5KHKA 3ETDA 5KX5B 1I08A 1MA1A 3ZX6A 4I0XA 3H1HH 1JFFB 1KP3A 4AQYO 3ETEA 1SS3A 5HFLA 4FVMA 2AZ2A 1TVKA 4YY3O 1P84F 2XAJA 1VF7A 1WP8A 3K9SA 3OMAB 1GM7A 4JPRA 3H1LH 3CPWU 2ZNIA 2YXHA 3H1IH 4JI4O 1J5EO 1DGSA 1HWYA 2Q8VA 1VQNV 1OV9A 3N2GA 3SPHA 1WP7A 3JYCA 5LHIA 4IL6Z 1P49A 5LOVB 3I56V 4O4JA 3D8CA 4MW3A 4RQEA 3L74H 1HNWO 2R9RB 4FIPC 2HR3A 1Y4MA 1LUWA 5C8YA 2XASA 3G80A 2QDOA 5BMVA 2YUAA 2KSDA 3ABKB 3JALA 3ABKC 4F6EA 1FS0G 3ZHRA 4DV7O 1M4UA 3HKEA 3ZJZA 2HJDA 1KU9A 1NBMG 3ABLC 1QHTA 1O9GA 1RP3B 3AK2A 5CN0A 3TXQA 3QG5A 2EILC 1ZX3A 4F6RB 3ZS8C 5FNVA 3TETA 3RYFB 4O4LB 1L1FA
chains in the Genus database with same CATH topology
4UCSA 4O2BB 4D7SA 3WB1A 4DK0A 2BTOA 4FLTA 4BWAA 3RYCB 4I50A 5JJJB 3RGBA 4KL1A 4GKJB 2VQEB 4DR2B 3T1YB 4YJ2B 5KHHA 4DV0B 4ZHQA 4O2AB 1N33B 2HEPA 1Q3EA 4X66B 5JVDA 4LF5B 3UT5A 4EB6B 4I4TB 1YEWA 2RQ6A 4TQFA 2ZINA 3BABA 2F66C 3CB2A 3VQWA 4HNAA 1TUBA 4FLYA 4LF8B 4FLVA 4DV5B 3JARB 3UT5B 1HW7A 4FLXA 3VQVA 5JH7B 2XHBA 1V9PA 3N2KB 3ICXA 4B3TB 3CHXA 4B3MB 4B08A 3SJBC 1TUBB 4LFCB 5FNVB 1Z5WA 4UCUA 4B3RB 5LP6C 3RYIA 1Z5VA 4CS3A 4EB6A 4PI0A 5KMGA 5EYPB 3RYHB 4I50B 5J2UB 4YJ3A 4EFBA 1JJOA 2F95B 3HKCB 4L8JA 5CA0A 4X20B 5CA1A 3SJCC 2Q7HA 3K57A 2VQFB 4DR4B 4DUZB 3BA9A 3K5LA 4TQDA 5LXTA 2P22C 1SA0A 5ITZB 2YIBD 3BA8A 1WNSA 4WBNA 5LYJA 2ZNJA 3K58A 5LP6A 4O2BA 1N36B 4JI7B 4K8XA 5D5PA 4CH5A 1N34B 4ZOLA 4LNUB 2UUBB 4X1YA 5JCOC 1JFFA 3MAQA 2PYLA 5EZYA 3RFRA 4NVPA 5D5QA 4JI8B 4LFAB 2V4DA 5KX5A 1IBLB 4JYAB 5BMVB 1XNRB 4X1KA 2E5LB 2VWJA 5JJNB 4DRXB 4DR6B 3WB2A 5FPRA 5JQGB 2UUCB 5J2TA 5LP6B 2PTMA 2BTQA 2YIBA 5C8YB 5JQGA 3PN1A 2YXLA 2UXCB 1Q5OA 3T1HB 3JATB 2OYQA 3JSNA 4DV6B 4O2AA 5IJ0A 1WPBA 4TV9B 3U11A 3A2FA 5LYJB 3RYCA 3BRCA 2PZSA 3JAWB 3OTFA 1XNQB 4CC6A 2GV9A 1O9HA 4IIJA 3HKBB 4JI5B 2PY5A 3RYHA 3VQYA 4CH3A 4JI1B 4EEQA 4F6RA 4CC5A 5EZYB 2R72A 4CS4A 3IAYA 1IBKB 1XMQB 1XHXA 4LH7A 1WN7A 1RSOA 4ZIBA 1T5EA 1TAEA 2R9AA 3JAKA 3U10A 5GONB 3QF7A 3BAAA 3RYIB 4CS2A 3JAKB 4WBNB 2RJZA 2F4VB 3M7MX 3BHPA 3JALB 3QTCA 4ZI7A 4Q6GA 4X20A 5JVDB 4FLUA 1ZAUA 5LMNB 1XMOB 4OX9B 4O4HA 1G6UA 5KHGA 2HHHB 4UCTA 1IBMB 4DK1A 1I94B 5JH7A 4FFBB 4NXMB 4DR7B 4K0KB 4DV7B 5LA6A 1X4TA 4TV8A 3DSQA 4O4IA 1S5JA 2BTQB 4GKKB 4X1IA 4DUYB 4GYCB 5FPOA 4LFBB 4O4IB 3K5NA 1TA8A 4LNUA 2F93B 1FJGB 4KHPB 2VWKA 5BR8B 4YJ3B 2QJ1A 2Q7GA 3U0ZA 4X62B 1FFXB 3JASA 2ZCEA 5CA1B 4ZI7B 4PI2A 5K1XA 4ZHQB 4YHHB 1Q43A 3ZEDA 5ITZA 4O4LA 3K5OA 4JV5B 4JI2B 1J5EB 3RWRD 3HKEB 4PHZA 5IJ0B 2EX3A 3E22A 3SR2C 2CAZC 3SGIA 4UCOA 4FM1A 5LXTB 1SA0B 4IIJB 4B3SB 5KMGB 3THOA 3CSXA 3LNNA 1L8DA 4I55B 4UFZA 1FFXA 3JASB 4EFEA 5KHIA 4NXNB 2UXBB 4JI3B 3OTOB 2YI8A 1XHZA 3UQ8A 1B04A 3HKBA 3FFQA 2P5OA 2JVDA 4O4JB 5EIBD 2UU9B 5EYPA 3HKDB 1M5IA 4LR3A 5KHJA 5J2TB 2ZM6B 5JJEB 3JARA 1N32B 1XQ8A 1JMKC 4DR3B 1HNXB 1HNZB 4FM2A 5IJ9B 3SJAC 4FFBA 3JATA 2ZIMA 4X1KB 2UUAB 1I7FA 4CH4A 3N2GB 4LF4B 4UCVA 3WB0A 4FLZA 2UXDB 4TV8B 4HNAB 4U3JB 2Q7EA 4I9QA 1KMIZ 4ZOLB 4IHJA 3RYFA 1HR0B 2PUSA 4JI6B 2JGUA 4K8ZA 4I4TA 4BW9A 4JI4B 1NT2B 1M93A 2YIAA 2R70A 2E3CA 3VQXA 5KHKA 4TOIA 4LF7B 5IYZA 4LF9B 4X65B 1D5AA 5KX5B 4DV3B 4DR1B 1JFFB 4UCRA 5CA0B 3HKCA 4FVMA 5CB4A 4IHJB 5IYZB 1TVKA 3ETQA 1VF7A 2YI9A 4LH6A 1H2SB 2IM9A 2Q0AA 1TGOA 4TUYA 4DR5B 1HNWB 3N2KA 2KKWA 2ZNIA 1TVKB 3K5MA 5LMUB 3B2EE 3JAWA 1XI1A 3K59A 1DGSA 4TV9A 1SQGA 4DV1B 3N2GA 3HKDA 5J2UA 2QM4A 4DV2B 1SQFA 1P49A 5LOVB 4O4JA 4HBNA 4FM0A 4U3JA 4AILC 1Q8IA 4DRXA 5K1PA 2PYJA 2PGGA 5IWAB 2OWOA 5C8YA 2JS5A 4GLXA 5LOVA 4DV4B 5CB4B 4LF6B 4O4HB 5LA6B 5EIBC 4D7TA 2ZIOA 4YY3B 1SKVA 5BMVA 4CH6A 3BPZA 3JALA 1M4UA 3HKEA 4I55A 4AQYB 4X1YB 4FLWA 1QQCA 4YJ2A 1KU9A 4JI0B 2F1MA 4TUYB 5IJ9A 3JSLA 5GONA 1QHTA 5JCOA 3E22B 1O9GA 3QG5A 4F6RB 4X1IB 4AHCA 4X64B 3ZS8C 5FNVA 3RYFB 4O4LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF7 A;  5D5Q A;  2V4D A;  3WB1 A;  4DK0 A;  1H2S B;  1RSO A;  4GYC B;  1T5E A;  5JJJ B;  5JJN B;  3WB0 A;  3BRC A;  2F93 B;  2F1M A;  3WB2 A;  5D5P A;  4DK1 A;  2F95 B;  4L8J A;  5JJE B;  3LNN A; 
#chains in the Genus database with same CATH topology
 4IGG A;  4O2B B;  1OCR B;  4D7S A;  3WB1 A;  4BIZ A;  3ZMS A;  4R7C A;  4I50 A;  5JJJ B;  2A7W A;  3ZBH A;  4BIU A;  1AI5 A;  3T1Y B;  4YJ2 B;  3CS5 A;  3CX5 F;  4Z1M G;  2BE3 A;  1GTO A;  3CE2 A;  2EBO A;  4O2A B;  4LF4 O;  1Q3E A;  3ZN0 A;  4X66 B;  4LF5 B;  1N0N A;  2RQ6 A;  2KG7 B;  3OAA G;  1DF4 A;  3BAB A;  1JOY A;  4HNA A;  2KQX A;  3OUS A;  4JI6 O;  4FLV A;  4YXW G;  4YIP A;  3UT5 B;  1ROP A;  3ZCC A;  4FLX A;  4MTO A;  3VQV A;  2BSK B;  1PNL A;  4JZG A;  2GUZ A;  1H2N A;  2OT5 A;  1XBL A;  4DV3 O;  3SJB C;  3ABL B;  1Z5V A;  3K3W A;  4I50 B;  2VS0 A;  1ZUQ A;  2R9I A;  4FJC C;  2M7W A;  1JJO A;  2F95 B;  3HKC B;  3AG4 C;  5DEC A;  4J42 A;  3WU2 Z;  4X20 B;  3FB5 C;  2VQF B;  4DR4 B;  4DUZ B;  4I5S A;  4YHH O;  5ITZ B;  5CA3 A;  2EIK B;  1AVM A;  2RCV A;  3E89 A;  5LMU O;  1XMQ O;  3K58 A;  3ZRX A;  2QWO B;  2ZE6 A;  3F7V C;  1OCZ B;  1H2L A;  4R8C A;  4LNU B;  1AI7 A;  1JFF A;  2PYL A;  2Y48 A;  4NVP A;  2ITD C;  5D5Q A;  4JI8 B;  2Q9L A;  1D5N A;  5KX5 A;  3E8G A;  4W4L A;  4JTC B;  1TUE B;  3APO A;  4DRX B;  1H2K A;  3P30 A;  2HKO A;  2BTQ A;  2YIB A;  1ARO P;  5C8Y B;  2OTL V;  3ZN1 A;  2OYQ A;  4WFB V;  4QGP A;  1OHH G;  4DV6 B;  1K4D C;  3X2Q B;  2LW7 A;  3FAV A;  5IJ0 A;  1WPB A;  4TV9 B;  3O9O A;  3ASN B;  2PZS A;  3OTF A;  1XNQ B;  3LSU A;  1O9H A;  3B09 A;  4DR1 O;  3T4Z A;  4CH3 A;  4CC5 A;  1NR1 A;  1WA8 B;  5EZY B;  2A06 H;  3KCY A;  2ZXW B;  2R72 A;  2HG5 C;  1B6Q A;  2JEX A;  1XMQ B;  2KB1 A;  1QLE C;  1YZB A;  3P32 A;  1TAE A;  3K0G A;  1K97 A;  2R9A A;  1GK9 A;  2CK3 G;  5IYB O;  1HR0 O;  2EZP A;  1VMG A;  3BAA A;  1VQP V;  4KXR A;  2JS3 A;  1L0L H;  4WFH A;  1K5S A;  3STL C;  1QBZ A;  1R3J C;  3DC5 A;  3FX7 A;  5CMU A;  4PDM A;  1Y74 B;  1YJ9 V;  4NYK A;  4X20 A;  5JVD B;  1HDJ A;  1ZAU A;  3B4S A;  1BSM A;  5LHG A;  5B1O A;  2M6Y A;  5LMN B;  3UKM A;  4O4H A;  1G6U A;  2XAF A;  1AB3 A;  2CGN A;  4DK1 A;  2QTO A;  4NXM B;  1IX9 A;  3SPC A;  4DR7 B;  3A8T A;  1THZ A;  4LFA O;  2Y0P A;  4H33 A;  1WB7 A;  2YS8 A;  1X4T A;  1FAF A;  3KG2 A;  3JAM N;  4H44 B;  4LF9 O;  2WA3 A;  2PI5 A;  1COW G;  4U7N A;  5FPO A;  1JVM A;  3E86 A;  4J7Z A;  4LFB B;  2XND G;  1R73 A;  2VWK A;  5GTI Z;  4G2K A;  4UXN A;  4MS2 A;  3H1K H;  1VF6 C;  4X62 B;  1FFX B;  1NTZ H;  5B66 Z;  2CTW A;  1PD3 A;  4YHH B;  1PNM A;  3ZED A;  2V7Q G;  2Z5U A;  5IYC O;  2ZR2 A;  4JYB A;  5EBL C;  5IJ0 B;  3SGI A;  2W0F C;  4KFM A;  5LL6 Y;  1ZL8 A;  2ZM6 O;  3AG3 C;  1R1B A;  2QWN B;  3OD4 A;  3LNN A;  2WLJ A;  3ASO C;  4ICG A;  3OTO B;  1MZE A;  1NU1 H;  1SQP H;  2OCC C;  5EK0 A;  3SYA A;  4GUN A;  4UUJ C;  3ABM C;  1MMM A;  5E1A C;  3ZHT A;  2UU9 B;  1KD1 W;  3QO8 A;  1M5I A;  2H3O A;  2UXC O;  4X65 O;  5BY1 A;  3JD4 A;  4MTG A;  1I5Y A;  1HNZ B;  5IJ9 B;  1NKD A;  4X9Q A;  3H01 A;  1RM1 B;  3HR0 A;  4PA7 A;  4H0L B;  1V54 C;  4LF4 B;  2DWD C;  4Q20 A;  4MVM A;  1IZ3 A;  1W0K G;  1VP7 A;  4I9Q A;  1KMI Z;  3SYP A;  1HR0 B;  3FB8 C;  4PA3 A;  3AG1 C;  1K4C C;  1UPG A;  2KG7 A;  3MHS C;  4AI8 A;  5IYD O;  1W59 A;  4JTD B;  1FD9 A;  2P90 A;  3VQX A;  1Q6I A;  5H6Q A;  4TOI A;  4LF7 B;  5IYZ A;  1FFT B;  1D5A A;  1SQB H;  1UFI A;  2JIZ G;  4DR1 B;  2UUC O;  1QLN A;  5EBM C;  4LFC O;  5CA0 B;  3OEE G;  3Q4H A;  1R3L C;  2OTJ V;  4IHJ B;  3D36 A;  5L3E A;  3M99 B;  1CP9 A;  4RQF A;  2UUB O;  4NXN O;  2X0L A;  1AR4 A;  1AR5 A;  1H2S B;  4LH6 A;  2EJR A;  1XMO O;  5LGT A;  1MZF A;  1QR8 A;  4TUY A;  4B7E A;  3N2K A;  5KUK A;  3K5M A;  2IJI A;  4PDR A;  3E83 A;  2ADP A;  2AGA A;  3ZIA G;  2IBZ H;  2V1D A;  2ILM A;  4DV1 B;  4FZ1 A;  2Q0O C;  1XOU A;  2WLM A;  2RMK B;  2E74 B;  5B1B C;  3OMI B;  2WLN A;  2PGG A;  3M8A A;  2ZE5 A;  1CPY A;  5LOV A;  4WF9 V;  5CB4 B;  4DV4 B;  4LF6 B;  4O4H B;  5LA6 B;  5EIB C;  3RT3 C;  3CMA V;  3N27 A;  3CCS V;  1YXB A;  1YIT V;  4X1Y B;  4FLW A;  2UXB O;  4JI0 B;  4DV5 O;  2F1M A;  5IJ9 A;  3JSL A;  5L3C A;  3BFR A;  1IBM O;  3T1C A;  1V55 C;  4AHC A;  4X64 B;  1EZV H;  2O57 A;  3SPG A;  4XDL A;  4DK0 A;  1VQL V;  1K7D A;  2CH7 A;  1F4M A;  2ODM A;  4Z1V A;  1GAX A;  5AG2 A;  4JYA O;  3CC7 V;  2VQE B;  4PA4 A;  4DR2 B;  3CME V;  3OGC C;  4DV0 B;  1JR9 A;  3LSS A;  1VQ7 V;  2QKA A;  2EIL B;  1GH6 A;  2W0X A;  2IW5 A;  5JVD A;  3OMN B;  1G8M A;  3OE7 G;  3QVN A;  5BR8 O;  3QO5 A;  2JGD B;  4CBC A;  3EHB B;  4R6Z A;  2ETN A;  2AZ0 A;  2F66 C;  3CB2 A;  2UU9 O;  3CRR A;  3VQW A;  1L0N H;  1TUB A;  4FLY A;  4GKK O;  3BCC H;  1CEZ A;  1LNQ A;  1HW7 A;  4K0K O;  2YC0 A;  3RN4 A;  2XHB A;  1BHA A;  3N2K B;  3CHX A;  1P7B A;  2ZXW C;  1G1X B;  2WLI A;  1KB9 F;  5IDJ A;  4LFC B;  5FNV B;  3T1H O;  4B3R B;  1J95 A;  3CXC U;  2AHY A;  3RYH B;  1W0J G;  1PL4 A;  3JD3 A;  1GO3 F;  4U7O A;  2Q6A A;  2QE7 G;  5CBH A;  5LBQ A;  5CA0 A;  2IJH A;  2HJF C;  2JK5 C;  5CA1 A;  1XL6 A;  4GZR B;  3IFX A;  1K5Q A;  2CDY A;  3K5L A;  4TQD A;  2L35 A;  3R66 A;  1SA0 A;  4EKW A;  2DYR B;  5A9G A;  4WBN A;  1AR1 B;  3ABT A;  1JQ0 A;  3A0B Z;  1MSD A;  1PV0 A;  4RO2 A;  5LP6 A;  2XAH A;  3ZHV A;  2QA4 V;  2EIJ C;  2E76 B;  3X2Q C;  4HAM A;  4ZOL A;  1EFR G;  2QEX V;  2LGQ A;  2JEU A;  1WAZ A;  4LFA B;  4LP8 A;  2JJ2 G;  1PPJ H;  4JZ2 A;  4JYA B;  4JI3 O;  1XNR B;  4X1K A;  3CRC A;  1NJI W;  3RW0 A;  3QO7 A;  5CBG A;  2JRI A;  3MHH C;  5KAI Z;  4IYH A;  3C3T A;  1H8H G;  4UVC A;  1ZTE A;  3JAT B;  3ZMV A;  2EIN B;  2EIJ B;  5EC2 C;  3JSN A;  4PDV A;  4O2A A;  1RFY A;  2E5L O;  2DWE C;  3I55 V;  3IJ4 A;  1IXB A;  1WB8 A;  3KCX A;  3L73 H;  3TCU A;  1FYJ A;  3CJH B;  4MVS A;  4JI5 B;  4EEQ A;  4JI1 B;  1S72 V;  5GW7 A;  3BY6 A;  2EJ7 A;  4LH7 A;  1OCZ C;  1B3Q A;  2BOC C;  1WN7 A;  1RSO A;  2RNB A;  3MDS A;  3JAK A;  3S3X A;  5L3G A;  1XNQ O;  5JWP A;  4DV1 O;  2IH1 C;  2IJK A;  2RJZ A;  3M7M X;  3TGU H;  3K04 A;  4P9O A;  3BHP A;  5EC1 C;  1FXK B;  3OR7 C;  3ZHQ A;  4GX1 A;  1SET A;  4Q6G A;  2WLL A;  3ZMZ A;  2QKS A;  1MG1 A;  1XMO B;  1XL4 A;  4JI1 O;  5B3S C;  1IBM B;  1I94 B;  1WPX A;  3E8F A;  1BMF G;  3CYO A;  4IYI A;  1S5J A;  4DUY B;  2G38 A;  4LWS B;  4GYC B;  3LSQ A;  3STZ C;  3E8H A;  1M56 C;  4RUE A;  4LNU A;  1VQ5 V;  4YJ3 B;  4NB5 A;  5CBF A;  1QLE B;  1YDX A;  4JI7 O;  5DED A;  3L75 H;  5GTH Z;  2F23 A;  4DV2 O;  3JCU Z;  3JAS A;  5KA6 A;  2ZCE A;  5CA1 B;  4ZI7 B;  3CCL V;  1MNG A;  4DUZ O;  2EIN C;  3OUF A;  5K1X A;  1Q43 A;  3VOU A;  3ML0 A;  4JV5 B;  4JI2 B;  1Z2G A;  3RWR D;  4PHZ A;  1VQO V;  4DR5 O;  4UCO A;  2WLI B;  4JF3 A;  3O65 A;  1SA0 B;  3GVM A;  4PEL A;  2HLD G;  3THO A;  3CSX A;  2BCC H;  3K03 A;  4NXN B;  4PA6 A;  1EN6 A;  3ZMT A;  4JI3 B;  2YI8 A;  1KQS U;  2WAM A;  1B04 A;  4BAY A;  3AG1 B;  4DW0 A;  3NR7 A;  2LFS A;  4JI8 O;  2UXX A;  2L6L A;  3HKD B;  5KHJ A;  5J2T B;  1Y76 A;  2ZM6 B;  1N32 B;  1JMK C;  4BIO A;  1IXM A;  1AJN A;  2QWR B;  4LF5 O;  2ZE8 A;  2HP8 A;  4NTY A;  4KHP O;  3OEH G;  3JAT A;  2Q5Z A;  2WLK A;  1N33 O;  3N2G B;  2QKC A;  4Z2W A;  3WB0 A;  1U96 A;  1W2B U;  2LJ2 A;  2E75 B;  2UXD B;  5B3S B;  2WLH A;  1F4N A;  4U3J B;  4PDL A;  3J7A U;  2FB5 A;  2PUS A;  4P9P A;  1YVW A;  1NT2 B;  1XRE A;  4W4K A;  1M93 A;  1EZJ A;  2FTK A;  2HVK C;  3KKY A;  1SER A;  2Y69 B;  1XDC A;  1NI8 A;  1BE3 H;  4X65 B;  4LF9 B;  2X7R B;  4GX2 A;  4LCU C;  2CTQ A;  3G4S V;  1EM1 A;  4G28 B;  4UCR A;  2A3Q A;  1YI2 V;  3HKC A;  2GHY A;  2OIE A;  1XNR O;  4I0X B;  3W7T A;  5H2F Z;  2OIG A;  5CB4 A;  1IDS A;  2DQ0 A;  3ETQ A;  3L71 H;  1NR7 A;  3OGI B;  3RVZ A;  1KYO F;  2YI9 A;  2LQT A;  3CJH A;  1GMG A;  1Y67 A;  3DTU B;  4DR5 B;  1HNW B;  4CZZ A;  1FPO A;  1TVK B;  2ZE7 A;  1ZSP A;  3B2E E;  1YIJ V;  1SQX H;  3K59 A;  3A0H Z;  2WSS G;  4DV2 B;  1MOF A;  2FL4 A;  4J11 A;  4AIL C;  1Q8I A;  4N21 A;  3FYI B;  1S5H C;  3G67 A;  2PYJ A;  1VAR A;  3CRM A;  4MT8 A;  5IWA B;  1SES A;  2OWO A;  4GLX A;  1BGY H;  5LHH A;  1PL0 A;  5DN6 G;  2YDE A;  2ZIO A;  4OPA A;  4JI0 O;  4YY3 B;  1E79 G;  1K3E A;  1K73 W;  3BEH A;  3BPZ A;  1FXK A;  2P06 A;  4AQY B;  1QQC A;  4J9Y B;  4PV1 B;  4TUY B;  5GON A;  1OCO C;  5JCO A;  2W6J G;  1NTK H;  4I7Z B;  2K1E A;  5C93 A;  4TWK A;  1YCI A;  4JGS A;  1NH2 D;  1N36 O;  4UVB A;  3K08 A;  1M9N A;  2FYU H;  1AI4 A;  1JPX A;  2QSA A;  3GWK C;  4FLT A;  3ZHS A;  4WCE V;  3EVK A;  4PJ0 Z;  1KKC A;  4UB8 Z;  2YIC A;  4JI2 O;  2AXT Z;  4ZHQ A;  1KP2 A;  3VBB A;  1N0J A;  2HEP A;  4DXW A;  4FZ0 A;  3UT5 A;  4EB6 B;  4C7U A;  4X64 O;  3AG7 A;  1OCO B;  2ZIN A;  3A0R A;  1GM8 A;  5FL7 G;  1VQ4 V;  4NR1 A;  3RVY A;  4MVQ A;  2ARH A;  1VQM V;  4LF8 B;  3CCV V;  1NTM H;  4DV5 B;  3SPI A;  3DGE A;  2CTP A;  5JH7 B;  3AK3 A;  2JGD A;  1V9P A;  3FB7 C;  5IY5 B;  1KC8 W;  4UV9 A;  4B3M B;  4GX0 A;  3AG2 B;  4LF8 O;  4XDK A;  4B7K A;  1DLB A;  4B3S O;  5LP6 C;  1UJW B;  1YTF D;  4DV4 O;  4LF6 O;  1R6N A;  2ATK C;  4PI0 A;  4RUF A;  3B8N A;  2Y0I A;  4YJ3 A;  4EFB A;  3B77 A;  4L8J A;  1VQ8 V;  3D3Q A;  4I9W A;  1HP8 A;  3LDE A;  2H8P C;  2QGN A;  2Q7H A;  1FXK C;  3K57 A;  3BA9 A;  1OCR C;  5TIS Z;  3C3S A;  2X6C A;  1NQT A;  3BA8 A;  3I5D A;  3MD0 A;  5LGU A;  1I5X A;  4WFF A;  2ZNJ A;  2Q73 A;  4D6T H;  4O2B A;  1N36 B;  1M1K W;  1HNZ O;  4K8X A;  2X6B A;  4CH5 A;  2DMX A;  4NKG B;  2UUB B;  4X1Y A;  3MAQ A;  5EZY A;  1WA8 A;  1LR1 A;  2CUG A;  3RFR A;  3T1Y O;  1IVS A;  1IBL B;  1K33 A;  2QM8 A;  2VWJ A;  5JJN B;  2HFE C;  3FYE B;  2P67 A;  2WPD G;  4R50 A;  4OPH A;  5DM6 V;  1R6T A;  5JQG B;  2DW4 A;  2UUC B;  3W7U A;  5J2T A;  5LP6 B;  2A79 B;  1BQZ A;  3J81 N;  3H9V A;  3OW2 U;  1H2M A;  3PN1 A;  2YXL A;  4JYY A;  3T1H B;  2GTA A;  2WA4 A;  1S0V A;  1E1R G;  2ZDI A;  3F5T A;  1OJH A;  3A2F A;  1VIB A;  3BRC A;  3JAW B;  4BR6 A;  4YIO A;  4CC6 A;  1SQQ H;  2DYR C;  3SYC A;  4IIJ A;  4UV8 A;  2DE0 X;  3RYH A;  3VQY A;  3TXS A;  4F6R A;  4WFE A;  5BXZ A;  1IBK O;  4MVU A;  4FFK A;  1GKF A;  1PNK A;  4CS4 A;  1XHX A;  1GRJ A;  4X66 O;  1T5E A;  1I0H A;  2XT9 A;  4DV0 O;  3U10 A;  3HB3 B;  3LDD A;  3QF7 A;  4L87 A;  1D2D A;  4JTA B;  2XOK G;  4CS2 A;  3IC7 A;  4QPK A;  2F4V B;  2D2C B;  4KP4 A;  3W7X A;  3QNE A;  1VQ6 V;  4FLU A;  5LMN O;  2NLJ C;  3JD0 A;  3KZI Z;  4DR6 O;  4DW1 A;  3FD9 A;  3GB7 C;  4FFB B;  2ADQ B;  1BCC H;  4OGQ B;  1EBO A;  1WLE A;  1M57 B;  2AW9 A;  4ASU G;  4X88 A;  1IBL O;  2PI4 A;  3OT7 A;  2X6A A;  3CCU V;  3ZRS A;  4TV8 A;  4DYL A;  2GBO A;  4O4I A;  1I94 O;  1XIL A;  1SQV H;  2BTQ B;  4GKK B;  4X1I A;  4MSW C;  4J41 A;  5B1A B;  2D3O W;  1YJN V;  5B1A C;  1M56 B;  3CP1 A;  1BQ0 A;  3K5N A;  1US6 A;  1WJZ A;  2F93 B;  2XAQ A;  4KHP B;  5FLX N;  5BR8 B;  4XBF A;  2EIK C;  3UO3 A;  1NZ6 A;  4QPJ A;  2QJ1 A;  2Q7G A;  4IT5 A;  3CCQ V;  1N32 O;  3B40 A;  3U0Z A;  1KKD A;  4A5U B;  4RAI A;  2IU0 A;  1F23 A;  1PM9 A;  4ZHQ B;  3C90 A;  5LGN A;  2YXY A;  3K5O A;  4GX5 A;  1J5E B;  3HKE B;  3RBZ A;  5H6R A;  2VRZ A;  3LNM B;  2EX3 A;  3CCJ V;  3E22 A;  1DTO A;  3SR2 C;  3FKS G;  2DYS B;  1GN4 A;  1V54 B;  4FM1 A;  1Q6U A;  1AJQ A;  4B3S B;  2MW2 B;  5KMG B;  4I55 B;  1FFX A;  5KHI A;  4EFE A;  4FK5 C;  4FMT A;  4B3M O;  1XHZ A;  3DXR A;  3UQ8 A;  1FXV A;  3E2E A;  4NTW A;  2VQF O;  4LWS A;  1NS1 A;  3OR6 C;  2JVD A;  3ZHU A;  5IE9 A;  4O4J B;  3K79 A;  5L3D A;  1KEC A;  2XUM A;  4LF7 O;  1AI6 A;  2ZQM A;  3JAR A;  4DR3 B;  2QM7 A;  3W7W A;  3SJA C;  4UVA A;  1SZX A;  2ZIM A;  4X1K B;  2MK3 A;  2UUA B;  3JD2 A;  3AEI A;  2DYS C;  4QNH B;  3H1J H;  1I7F A;  4CH4 A;  1BT8 A;  4DUY O;  5B1B B;  1YHQ V;  1XUQ A;  2B1G A;  4DR4 O;  1SRY A;  4HNA B;  5IT9 N;  3E35 A;  4ZOL B;  3RYF A;  5B1N A;  2B9Z A;  4JI6 B;  2DQ3 A;  4K8Z A;  4BW9 A;  2NR5 A;  4DV6 O;  4JAV A;  2GTS A;  1RM1 C;  4LC1 A;  1YTF B;  1E1Q G;  1H38 A;  2R70 A;  1BS3 A;  1QU7 A;  3GWO A;  2Q68 A;  4E4E A;  2A0L A;  3TK1 A;  1RPR A;  4DV3 B;  1GN2 A;  3CD6 V;  3UM7 A;  1ENV A;  1PP9 H;  5IYZ B;  2P6J A;  3T4D A;  4H13 B;  3ABU A;  4PA9 A;  1ORQ C;  2LGW A;  4QJF B;  4G27 B;  2ZD9 A;  5L3F A;  2AHZ A;  2IM9 A;  4OX9 O;  2Q0A A;  4MVR A;  4K3A A;  4DO2 A;  1NH2 B;  3SYQ A;  5J9P C;  1TGO A;  1QVF U;  2Q67 A;  4J9Z B;  2KKW A;  1HNX O;  2Q4P A;  5LMU B;  2LFR A;  1R3K C;  1OCC B;  3JAW A;  1XI1 A;  4P30 A;  1S3J A;  1A32 A;  4TV9 A;  1SQG A;  2C2A A;  3HKD A;  2CTR A;  5J2U A;  3D36 C;  2QM4 A;  1SQF A;  4HBN A;  4FM0 A;  1AJP A;  4U3J A;  5L3B A;  5A2Q N;  1V55 B;  1YJW V;  2WLL B;  4DRX A;  5K1P A;  5E79 Z;  1F51 A;  3OM3 B;  1Q90 D;  2JS5 A;  3L70 H;  2CE4 A;  1VQ9 V;  1JX9 A;  3HPL C;  4D7T A;  3NXS A;  2GDS A;  1SKV A;  2EIM B;  2CH7 B;  4H37 A;  4CH6 A;  4DR2 O;  4I55 A;  3SDL A;  4YJ2 A;  2IH3 C;  3OTO O;  1YSC A;  2RDC A;  1OZ0 A;  3APQ A;  5KLV H;  3E22 B;  3CWB H;  3DC6 A;  1DK1 A;  4X1I B;  3G71 V;  3CEI A;  1H2G A;  5EBW C;  2Y4U A;  3ZRW A;  3G6E V;  2PF4 E;  4UCS A;  3K0D A;  1R3I C;  2BTO A;  4BWA A;  3RYC B;  1RPO A;  4JYC A;  3ZRV A;  3RGB A;  1Y6X A;  4KL1 A;  3W7S A;  4GKJ B;  1K34 A;  1GN6 A;  1DF5 A;  5KHH A;  2ZT9 B;  2DN9 A;  1SC5 B;  1H8E G;  1N33 B;  1ZWI C;  3R65 A;  2QTS A;  3SJQ C;  2B5U A;  1YEW A;  4I4T B;  4TQF A;  2BOB C;  1MSW D;  4P2Z A;  4TSF G;  1P7G A;  2IJJ A;  3UCS C;  4HZ3 A;  3OFN G;  3K9A A;  4JAU A;  2BSK A;  5BZB A;  3FB6 C;  4OXS A;  3JAR B;  2W6I G;  2GSM B;  3P3P A;  3E8B A;  3ICX A;  4B3T B;  3EXA A;  3IGA C;  1Q7Y W;  4B08 A;  4NXM O;  1TUB B;  2UXN A;  2LW1 A;  1Z5W A;  4UCU A;  3RYI A;  4FPP A;  4CS3 A;  4MVO A;  4EB6 A;  1BHB A;  5KMG A;  2EUL A;  2DJV A;  5EYP B;  4LBE C;  5J2U B;  1GN3 A;  3ASN C;  4JAS A;  3J80 N;  5KA5 A;  1Y66 A;  3SJC C;  4JV5 O;  1CXZ B;  2N05 A;  2LO1 A;  2DOS A;  3JD1 A;  4MTF A;  5LXT A;  1Q86 W;  1QR9 A;  2P22 C;  3CCR V;  2YIB D;  3EFF K;  1WNS A;  4E2L A;  4J80 A;  5LYJ A;  4J7J A;  4JI7 B;  5D5P A;  1AP5 A;  1P4R A;  1LUV A;  4QE9 A;  1N34 B;  4DR3 O;  4JI5 O;  4J7K A;  1K9M W;  1YF2 A;  1QCE A;  5JCO C;  3CCE V;  2ZDI C;  5KUM A;  4WFG A;  2V4D A;  3AG4 B;  1M90 W;  5BMV B;  2E5L B;  1N4C A;  1SZT A;  5IY5 C;  4K35 A;  2YID A;  4DR6 B;  1VF6 A;  3WG7 B;  3WB2 A;  5FPR A;  4MTX A;  1N34 O;  3K06 A;  1FJG O;  2PTM A;  1G4Y B;  2Q69 A;  2ZR3 A;  5JQG A;  5KAF Z;  2UXC B;  1Q5O A;  2N04 A;  3AG2 C;  1VF5 B;  3LDC A;  3CCM V;  3U11 A;  5LYJ B;  3RYC A;  2K9P A;  4ZKI A;  5F2V O;  1ZL8 B;  2GV9 A;  3HKB B;  2XAG A;  2PY5 A;  4UB6 Z;  2HHH O;  1BZK A;  3TJT A;  3IAY A;  1IBK B;  2IU3 A;  1BL8 A;  1EN5 A;  1AP6 A;  3B8M A;  1MAB G;  4ZIB A;  4TT3 G;  1Q6H A;  1Q82 W;  3LUT B;  5GON B;  2JDI G;  3CC4 V;  1GM9 A;  1Y74 A;  2FKX A;  2YEV B;  3RYI B;  1KUQ A;  2EZO A;  2P4V A;  3JAK B;  4WBN B;  1AIL A;  4GKJ O;  2QR4 A;  3JAL B;  3ZMU A;  4X62 O;  3AG3 B;  2ZKO A;  2CGO A;  3QTC A;  4ZI7 A;  1S5L Z;  5H5N A;  4WFA V;  2F43 G;  5IWA O;  2RN9 A;  4OX9 B;  1NVP D;  1Y76 B;  4RWU A;  1S76 D;  2P4K A;  5KHG A;  2HHH B;  4UCT A;  1URF A;  4ABM A;  1QVG U;  1X59 A;  1QNM A;  5JH7 A;  3T2M A;  4ZBM A;  2QWP B;  4K0K B;  4DV7 B;  3CC2 V;  1FXH A;  2F4V O;  1SF9 A;  3S3W A;  4DR7 O;  3F5W C;  5LA6 A;  3CXH F;  1Q81 W;  3DSQ A;  1OCC C;  1B06 A;  3L72 H;  4O4I B;  4MW8 A;  1TA8 A;  3WG7 C;  1FJG B;  3WFV A;  1K92 A;  3JCZ A;  3D3I A;  2NN4 A;  2OCH A;  2P7T C;  2NNU A;  1JJ2 U;  1XEQ A;  3CRA A;  4PI2 A;  2QWQ B;  2VQE O;  2A9H A;  1VEW A;  4PD4 F;  2N74 A;  4BW5 A;  2B1I A;  5ITZ A;  1ZLZ A;  4O4L A;  1PKX A;  4J10 A;  4XDJ A;  4X8A A;  2Y4T A;  2UUA O;  2WWW A;  1FKA O;  2EIM C;  2H94 A;  4F4L A;  2CAZ C;  1KBH A;  1RSO B;  3SYO A;  1F7Y A;  3PJS K;  3G6B A;  5LXT B;  2ITC C;  3ZRW B;  1K8A W;  5H9C A;  3BVO A;  4IIJ B;  4B3R O;  4MVZ A;  2FML A;  1L8D A;  4UFZ A;  3JAS B;  2UXB B;  1U97 A;  1R6K A;  4GT1 A;  4HYO A;  3HKB A;  3FFQ A;  3IC9 A;  2P5O A;  3FAV B;  4N23 A;  2XTA A;  2GUZ B;  4QE7 A;  3ABM B;  2UXD O;  5EIB D;  3P3N A;  5EYP A;  4LR3 A;  2Y69 C;  2YSU B;  4KUM A;  5JJE B;  1XQ8 A;  1M57 C;  4NTX A;  1HNX B;  2Z0A A;  4FM2 A;  4GCZ A;  1EN4 A;  4FFB A;  4LFB O;  1JA8 A;  4QIW F;  4U3F H;  5HFM A;  3UO2 A;  4JAA A;  2HVJ C;  4UCV A;  3L9D A;  4FLZ A;  4B3T O;  3DXR B;  4TV8 B;  3SPJ A;  3CRQ A;  2LP7 A;  3AK1 A;  2JJ1 G;  1VQK V;  2Q7E A;  3ASO B;  2YEV A;  3ETG A;  4IHJ A;  2JGU A;  2OCC B;  4I4T A;  1JCH A;  4JI4 B;  4X89 A;  5B5E Z;  1S77 D;  2Z3Y A;  3F7Y C;  3Q4H B;  1NVP B;  2YIA A;  1N8R W;  1IUR A;  2E3C A;  5KHK A;  3ETD A;  5KX5 B;  1I08 A;  1MA1 A;  3ZX6 A;  4I0X A;  3H1H H;  1JFF B;  1KP3 A;  4AQY O;  3ETE A;  1SS3 A;  5HFL A;  4FVM A;  2AZ2 A;  1TVK A;  4YY3 O;  1P84 F;  2XAJ A;  1VF7 A;  1WP8 A;  3K9S A;  3OMA B;  1GM7 A;  4JPR A;  3H1L H;  3CPW U;  2ZNI A;  2YXH A;  3H1I H;  4JI4 O;  1J5E O;  1DGS A;  1HWY A;  2Q8V A;  1VQN V;  1OV9 A;  3N2G A;  3SPH A;  1WP7 A;  3JYC A;  5LHI A;  4IL6 Z;  1P49 A;  5LOV B;  3I56 V;  4O4J A;  3D8C A;  4MW3 A;  4RQE A;  3L74 H;  1HNW O;  2R9R B;  4FIP C;  2HR3 A;  1Y4M A;  1LUW A;  5C8Y A;  2XAS A;  3G80 A;  2QDO A;  5BMV A;  2YUA A;  2KSD A;  3ABK B;  3JAL A;  3ABK C;  4F6E A;  1FS0 G;  3ZHR A;  4DV7 O;  1M4U A;  3HKE A;  3ZJZ A;  2HJD A;  1KU9 A;  1NBM G;  3ABL C;  1QHT A;  1O9G A;  1RP3 B;  3AK2 A;  5CN0 A;  3TXQ A;  3QG5 A;  2EIL C;  1ZX3 A;  4F6R B;  3ZS8 C;  5FNV A;  3TET A;  3RYF B;  4O4L B;  1L1F A; 
#chains in the Genus database with same CATH homology
 4UCS A;  4O2B B;  4D7S A;  3WB1 A;  4DK0 A;  2BTO A;  4FLT A;  4BWA A;  3RYC B;  4I50 A;  5JJJ B;  3RGB A;  4KL1 A;  4GKJ B;  2VQE B;  4DR2 B;  3T1Y B;  4YJ2 B;  5KHH A;  4DV0 B;  4ZHQ A;  4O2A B;  1N33 B;  2HEP A;  1Q3E A;  4X66 B;  5JVD A;  4LF5 B;  3UT5 A;  4EB6 B;  4I4T B;  1YEW A;  2RQ6 A;  4TQF A;  2ZIN A;  3BAB A;  2F66 C;  3CB2 A;  3VQW A;  4HNA A;  1TUB A;  4FLY A;  4LF8 B;  4FLV A;  4DV5 B;  3JAR B;  3UT5 B;  1HW7 A;  4FLX A;  3VQV A;  5JH7 B;  2XHB A;  1V9P A;  3N2K B;  3ICX A;  4B3T B;  3CHX A;  4B3M B;  4B08 A;  3SJB C;  1TUB B;  4LFC B;  5FNV B;  1Z5W A;  4UCU A;  4B3R B;  5LP6 C;  3RYI A;  1Z5V A;  4CS3 A;  4EB6 A;  4PI0 A;  5KMG A;  5EYP B;  3RYH B;  4I50 B;  5J2U B;  4YJ3 A;  4EFB A;  1JJO A;  2F95 B;  3HKC B;  4L8J A;  5CA0 A;  4X20 B;  5CA1 A;  3SJC C;  2Q7H A;  3K57 A;  2VQF B;  4DR4 B;  4DUZ B;  3BA9 A;  3K5L A;  4TQD A;  5LXT A;  2P22 C;  1SA0 A;  5ITZ B;  2YIB D;  3BA8 A;  1WNS A;  4WBN A;  5LYJ A;  2ZNJ A;  3K58 A;  5LP6 A;  4O2B A;  1N36 B;  4JI7 B;  4K8X A;  5D5P A;  4CH5 A;  1N34 B;  4ZOL A;  4LNU B;  2UUB B;  4X1Y A;  5JCO C;  1JFF A;  3MAQ A;  2PYL A;  5EZY A;  3RFR A;  4NVP A;  5D5Q A;  4JI8 B;  4LFA B;  2V4D A;  5KX5 A;  1IBL B;  4JYA B;  5BMV B;  1XNR B;  4X1K A;  2E5L B;  2VWJ A;  5JJN B;  4DRX B;  4DR6 B;  3WB2 A;  5FPR A;  5JQG B;  2UUC B;  5J2T A;  5LP6 B;  2PTM A;  2BTQ A;  2YIB A;  5C8Y B;  5JQG A;  3PN1 A;  2YXL A;  2UXC B;  1Q5O A;  3T1H B;  3JAT B;  2OYQ A;  3JSN A;  4DV6 B;  4O2A A;  5IJ0 A;  1WPB A;  4TV9 B;  3U11 A;  3A2F A;  5LYJ B;  3RYC A;  3BRC A;  2PZS A;  3JAW B;  3OTF A;  1XNQ B;  4CC6 A;  2GV9 A;  1O9H A;  4IIJ A;  3HKB B;  4JI5 B;  2PY5 A;  3RYH A;  3VQY A;  4CH3 A;  4JI1 B;  4EEQ A;  4F6R A;  4CC5 A;  5EZY B;  2R72 A;  4CS4 A;  3IAY A;  1IBK B;  1XMQ B;  1XHX A;  4LH7 A;  1WN7 A;  1RSO A;  4ZIB A;  1T5E A;  1TAE A;  2R9A A;  3JAK A;  3U10 A;  5GON B;  3QF7 A;  3BAA A;  3RYI B;  4CS2 A;  3JAK B;  4WBN B;  2RJZ A;  2F4V B;  3M7M X;  3BHP A;  3JAL B;  3QTC A;  4ZI7 A;  4Q6G A;  4X20 A;  5JVD B;  4FLU A;  1ZAU A;  5LMN B;  1XMO B;  4OX9 B;  4O4H A;  1G6U A;  5KHG A;  2HHH B;  4UCT A;  1IBM B;  4DK1 A;  1I94 B;  5JH7 A;  4FFB B;  4NXM B;  4DR7 B;  4K0K B;  4DV7 B;  5LA6 A;  1X4T A;  4TV8 A;  3DSQ A;  4O4I A;  1S5J A;  2BTQ B;  4GKK B;  4X1I A;  4DUY B;  4GYC B;  5FPO A;  4LFB B;  4O4I B;  3K5N A;  1TA8 A;  4LNU A;  2F93 B;  1FJG B;  4KHP B;  2VWK A;  5BR8 B;  4YJ3 B;  2QJ1 A;  2Q7G A;  3U0Z A;  4X62 B;  1FFX B;  3JAS A;  2ZCE A;  5CA1 B;  4ZI7 B;  4PI2 A;  5K1X A;  4ZHQ B;  4YHH B;  1Q43 A;  3ZED A;  5ITZ A;  4O4L A;  3K5O A;  4JV5 B;  4JI2 B;  1J5E B;  3RWR D;  3HKE B;  4PHZ A;  5IJ0 B;  2EX3 A;  3E22 A;  3SR2 C;  2CAZ C;  3SGI A;  4UCO A;  4FM1 A;  5LXT B;  1SA0 B;  4IIJ B;  4B3S B;  5KMG B;  3THO A;  3CSX A;  3LNN A;  1L8D A;  4I55 B;  4UFZ A;  1FFX A;  3JAS B;  4EFE A;  5KHI A;  4NXN B;  2UXB B;  4JI3 B;  3OTO B;  2YI8 A;  1XHZ A;  3UQ8 A;  1B04 A;  3HKB A;  3FFQ A;  2P5O A;  2JVD A;  4O4J B;  5EIB D;  2UU9 B;  5EYP A;  3HKD B;  1M5I A;  4LR3 A;  5KHJ A;  5J2T B;  2ZM6 B;  5JJE B;  3JAR A;  1N32 B;  1XQ8 A;  1JMK C;  4DR3 B;  1HNX B;  1HNZ B;  4FM2 A;  5IJ9 B;  3SJA C;  4FFB A;  3JAT A;  2ZIM A;  4X1K B;  2UUA B;  1I7F A;  4CH4 A;  3N2G B;  4LF4 B;  4UCV A;  3WB0 A;  4FLZ A;  2UXD B;  4TV8 B;  4HNA B;  4U3J B;  2Q7E A;  4I9Q A;  1KMI Z;  4ZOL B;  4IHJ A;  3RYF A;  1HR0 B;  2PUS A;  4JI6 B;  2JGU A;  4K8Z A;  4I4T A;  4BW9 A;  4JI4 B;  1NT2 B;  1M93 A;  2YIA A;  2R70 A;  2E3C A;  3VQX A;  5KHK A;  4TOI A;  4LF7 B;  5IYZ A;  4LF9 B;  4X65 B;  1D5A A;  5KX5 B;  4DV3 B;  4DR1 B;  1JFF B;  4UCR A;  5CA0 B;  3HKC A;  4FVM A;  5CB4 A;  4IHJ B;  5IYZ B;  1TVK A;  3ETQ A;  1VF7 A;  2YI9 A;  4LH6 A;  1H2S B;  2IM9 A;  2Q0A A;  1TGO A;  4TUY A;  4DR5 B;  1HNW B;  3N2K A;  2KKW A;  2ZNI A;  1TVK B;  3K5M A;  5LMU B;  3B2E E;  3JAW A;  1XI1 A;  3K59 A;  1DGS A;  4TV9 A;  1SQG A;  4DV1 B;  3N2G A;  3HKD A;  5J2U A;  2QM4 A;  4DV2 B;  1SQF A;  1P49 A;  5LOV B;  4O4J A;  4HBN A;  4FM0 A;  4U3J A;  4AIL C;  1Q8I A;  4DRX A;  5K1P A;  2PYJ A;  2PGG A;  5IWA B;  2OWO A;  5C8Y A;  2JS5 A;  4GLX A;  5LOV A;  4DV4 B;  5CB4 B;  4LF6 B;  4O4H B;  5LA6 B;  5EIB C;  4D7T A;  2ZIO A;  4YY3 B;  1SKV A;  5BMV A;  4CH6 A;  3BPZ A;  3JAL A;  1M4U A;  3HKE A;  4I55 A;  4AQY B;  4X1Y B;  4FLW A;  1QQC A;  4YJ2 A;  1KU9 A;  4JI0 B;  2F1M A;  4TUY B;  5IJ9 A;  3JSL A;  5GON A;  1QHT A;  5JCO A;  3E22 B;  1O9G A;  3QG5 A;  4F6R B;  4X1I B;  4AHC A;  4X64 B;  3ZS8 C;  5FNV A;  3RYF B;  4O4L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...