1RSOA

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
total genus 18
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1rsoA01
5JJJB 3WB2A 2F1MA 4L8JA 1RSOA 5JJNB 3WB0A 2F93B 5JJEB 3WB1A 2V4DA 5D5QA 2F95B 5D5PA 3BRCA 1T5EA 3LNNA 1H2SB 4DK1A 1VF7A 4GYCB 4DK0A
chains in the Genus database with same CATH superfamily
3L72H 2F66C 4NKGB 4TV9B 2XASA 5LXTA 1BMFG 1M57B 2N04A 2Y69B 5JJEB 4LNUA 1YVWA 1M5IA 4JI6B 4GX2A 3RVZA 3RYIA 3K58A 4NXNB 4MVMA 3A0HZ 1I94B 3PN1A 2JGDB 4BW9A 1O9GA 1QLEB 2QWQB 4A5UB 4QPKA 2HVKC 1Q6UA 1D2DA 4ABMA 3ZHRA 1XBLA 2DYRB 3L9DA 4FFBA 4Z1VA 1N8RW 3JATA 4LFAO 3RYFB 3MD0A 4HZ3A 2Q69A 3FB6C 1OCOC 4B3MB 2L6LA 3ML0A 5EYPA 1FPOA 1WB7A 1NR1A 5EK0A 2WLKA 2Y0IA 4U7NA 3QO7A 2DYSC 1K8AW 1RPOA 2FTKA 4LF7B 3FYIB 4PI0A 4PJ0Z 3ICXA 2DWDC 2EINB 4D7TA 2IBZH 1HR0O 2YXLA 4BIUA 3B8NA 3ABLB 2FMLA 1M4UA 4O4IA 3OGIB 2A7WA 3Q4HA 3H1JH 4TOIA 5KX5B 2EIJC 5KA5A 5IE9A 4QGPA 1URFA 1JA8A 1IVSA 3ZHSA 5BZBA 5C8YB 1TA8A 5LGTA 3E35A 2HJFC 1YI2V 1YJNV 2OCHA 1KP3A 3AG3B 5CBGA 1NR7A 4FVMA 1VMGA 3K06A 4X20A 1XEQA 3ZEDA 4UCTA 3RWRD 2CH7B 2ZE7A 3AEIA 3JARB 5J2UA 1ZTEA 4DUZO 1K92A 4Q6GA 3U0ZA 4DV1B 4X65O 4EB6A 3ABMC 4Q20A 4I9QA 1AP5A 1FYJA 1IBKO 3ZRWA 3JCUZ 1Q8IA 3ZHQA 1BE3H 1Y74A 1OHHG 2WPDG 3FB5C 2N74A 5GTHZ 2K1EA 5KHGA 1U96A 2HFEC 1T5EA 4IHJA 4R6ZA 4O4HB 4X64O 2UXDB 1K33A 2E76B 1GAXA 5CB4A 1QU7A 2QA4V 1WAZA 3CCRV 4ZIBA 3UCSC 4OX9O 2HKOA 4UVBA 1GMGA 3HKEA 3JALB 4WFBV 1XNRO 2A06H 3I55V 1XREA 2P67A 1VQNV 4I55A 4CZZA 4DV0O 3ABKC 4I50A 1TUEB 1J5EO 1M90W 1HWYA 1Y76B 5JCOC 3RYCB 4DR1O 5DN6G 5L3CA 1AROP 4JF3A 4CBCA 1GM8A 1I5YA 3JAKA 5KA6A 3D36C 2KB1A 1NZ6A 4Z1MG 5IJ9A 5BXZA 3FAVA 4FPPA 3B40A 1MZEA 4MTXA 1A32A 3HKBB 4DRXB 3N27A 2KG7A 2EIMC 4GKKO 1OCCC 3G71V 2WLMA 4PDMA 1SERA 1DLBA 1SQGA 1W59A 4MS2A 1S76D 5CMUA 4DUYB 3AK1A 4CS2A 2QM7A 2UUAO 5F2VO 2CUGA 4O2BB 5LP6A 1V55C 4JI5O 3CHXA 4BIZA 4WBNA 1PNMA 2WSSG 1NQTA 2ITDC 1S5LZ 5EBWC 1B3QA 2B1IA 2LFSA 2Y4UA 3A2FA 1K4CC 4JI2O 4JTCB 3VQXA 3QNEA 5JCOA 2ARHA 1IZ3A 5LMNB 3TXSA 4DR2O 4DR5B 3CSXA 3OE7G 4NTYA 1UJWB 4H13B 4JV5B 2ZXWB 3D36A 3ZN0A 1BSMA 4HBNA 2PY5A 3S3WA 4I7ZB 3B77A 4LR3A 4DR6O 1VQ4V 1FAFA 2OIGA 1R3KC 3G67A 4LF8B 2X6BA 1ZUQA 2LO1A 2YXHA 1E79G 1MNGA 1XQ8A 1N0NA 2LGQA 4QE9A 5EIBC 3UT5B 2WA3A 1IBMO 1HW7A 2HEPA 1H38A 4J7ZA 5E1AC 2A9HA 3FD9A 3ASOB 3RVYA 4AILC 3JAMN 1H2MA 5EBLC 3K79A 5IYCO 4ICGA 4UV9A 2PGGA 1TVKA 1NU1H 4OPHA 2IM9A 3WG7B 2F4VB 1BQZA 3K3WA 2WLNA 1R6TA 4DV6B 1YF2A 2A3QA 1VIBA 3K5MA 2YDEA 4JI1B 1G8MA 2AHZA 1WA8B 2QKCA 4P9OA 3HB3B 5JJNB 2GUZB 1NVPD 3K04A 3THOA 4ZI7A 1THZA 4LF5B 3CWBH 4PI2A 1JR9A 5CBFA 1PL4A 4GKJO 3TXQA 4GX5A 1VF5B 3AG2B 1GH6A 2WWWA 3G4SV 5B1AB 1JOYA 1SETA 2QTSA 3K5LA 4UB8Z 1BS3A 1KYOF 5LHIA 2ATKC 1WPXA 5J2TA 1PKXA 2KQXA 4H44B 2K9PA 1Q43A 3ETQA 1KD1W 2JGUA 3LDCA 2E3CA 3AG4C 1JQ0A 3W7SA 2P4VA 3HPLC 4U3FH 4LFAB 1EZVH 1Y4MA 5LMUO 1NKDA 4DXWA 5KLVH 4X1IA 1N0JA 4LNUB 1BGYH 1Q6HA 2ETNA 5IT9N 3PJSK 3ASNC 1YITV 5IYBO 2EBOA 3DGEA 4JTDB 1BQ0A 1PPJH 5B66Z 2V7QG 4CH4A 2IW5A 1US6A 5GW7A 4RAIA 4K8XA 1HR0B 4FFBB 3JATB 3JASA 1MMMA 5GTIZ 4EFEA 4ZBMA 4MSWC 1DF4A 2YXYA 4TSFG 5EYPB 4J41A 3P30A 4E2LA 4LC1A 1SQPH 1JFFB 1K34A 1P7GA 5B3SC 1NT2B 1XNQO 4X88A 4DV4O 2QWRB 4TWKA 3CCMV 4JI4O 1GN4A 2VQFO 3F5TA 2ADQB 5IYZA 2Z5UA 5KHJA 2OTLV 3AK2A 3JD0A 1JVMA 1O9HA 3H01A 3SYPA 3RFRA 1YEWA 2MK3A 5JWPA 3RYHA 2HG5C 1YHQV 1BHAA 1BCCH 1VEWA 4O4IB 3BAAA 3Q4HB 3RBZA 3K57A 1FS0G 4X65B 1H8HG 1SQXH 1EN4A 4B3SO 3G6EV 3B8MA 1V54C 4J11A 5KUKA 2LFRA 4PD4F 1IBKB 4X89A 2IH3C 3F7VC 1R6NA 4U3JB 3IJ4A 1AR1B 4X20B 4JI8O 2HHHO 3CMAV 2ZNIA 2CK3G 2QWNB 1AB3A 4LF9O 1OCOB 4X62O 2QEXV 5J2UB 2IJKA 5B1BC 1WP8A 2JJ1G 4TQDA 4QPJA 5E79Z 4RUFA 2D2CB 5LYJA 1L0NH 1N4CA 4QJFB 4OX9B 3BY6A 1YTFB 1Y67A 1K7DA 1XNRB 4EB6B 2DYSB 2UUBO 4KL1A 4B3TO 1RFYA 4TV8A 2W6IG 4DV0B 2AZ2A 1J5EB 1Y74B 4LFCO 1Z5WA 4FLWA 2DE0X 4K0KO 3C90A 1HNXO 2ZM6O 2HLDG 3CCVV 1OV9A 4IHJB 1F23A 2R9RB 4UUJC 1XILA 4AQYO 5IWAB 1YDXA 2EIJB 2CAZC 4JYYA 1IXMA 1OCRC 1QVFU 1PL0A 1Y6XA 4I55B 1KMIZ 1QCEA 1EM1A 4GKKB 5FPRA 4I50B 2R70A 4P30A 3ZMTA 4EFBA 4JI0B 4O4LA 2VWJA 1AJNA 1P4RA 3SPIA 3L75H 2YIBA 4AHCA 3JAKB 3VQYA 3BA9A 2UXBO 4X66O 1FJGO 5H9CA 1G6UA 3R65A 1ORQC 4JI5B 1W0KG 1S5JA 4E4EA 2NR5A 2OWOA 3LUTB 2JRIA 5ITZA 5LHHA 2P4KA 3ABMB 2XAQA 2KG7B 3ZCCA 4DR3O 4Z2WA 3P32A 2FB5A 2UU9O 4JI2B 4NB5A 3CCUV 4IIJA 5DEDA 1B04A 2WLLB 3ABUA 2ZCEA 2DMXA 4IL6Z 3ZN1A 2JVDA 2X6CA 3JAWA 2R72A 3E83A 3T2MA 1M56C 4WBNB 2EIKC 2RDCA 1XMQO 3LDEA 4UCVA 1VQOV 1HNWO 1QHTA 3U11A 3OFNG 4O4JA 4XBFA 2DQ0A 5DM6V 4NTWA 3FB8C 3DXRA 3ABKB 1MABG 2XAFA 3NXSA 3T1YO 2P6JA 3ZRXA 2PF4E 1GTOA 5LGUA 3LDDA 1AJQA 4J7JA 5JVDA 4EKWA 1KKCA 1YIJV 1XL6A 1SQQH 1RM1C 3ETEA 2DW4A 2JS5A 4D6TH 4WF9V 2DJVA 3W7UA 2OT5A 3ZJZA 3LSUA 2UUCO 1L0LH 4J9YB 4D7SA 3M7MX 4UVAA 2EIMB 3O65A 1OCCB 3MHHC 4X1YA 3X2QC 4UV8A 4FLZA 4OPAA 2XHBA 2ZE8A 2Q7GA 1R3JC 4P2ZA 4FZ0A 5LBQA 4LF4B 4QNHB 3AG7A 2H8PC 4JYAO 1V55B 2V1DA 2DQ3A 4GKJB 1M93A 4YXWG 1TVKB 3K59A 3E2EA 5IDJA 3ZBHA 4RWUA 2H94A 1Y66A 4KUMA 1EBOA 1SC5B 3CYOA 3UM7A 4L8JA 1KB9F 5KAFZ 4DV3O 2YI8A 2BTQB 3UKMA 2ZT9B 3CCJV 4WFFA 4ZI7B 3BRCA 4J80A 1QR8A 4DYLA 1XDCA 5LP6C 3CS5A 2YC0A 3JCZA 1QQCA 1I08A 4WFEA 1CP9A 2FKXA 3TK1A 2QTOA 4DR4O 3K03A 4CS3A 5JH7A 2BOCC 5LMUB 4NXMO 5K1XA 1BT8A 5CA1B 1GRJA 3BEHA 4I0XA 4JPRA 2JEUA 4CS4A 4FIPC 4HYOA 5J2TB 4LCUC 1AR4A 4NTXA 1K97A 4YIOA 4LF6O 2HJDA 4YJ3A 1XMOO 1PM9A 5EIBD 2LW7A 3OEEG 4GCZA 1KC8W 2X0LA 2XUMA 2YIDA 3TETA 3F5WC 4FMTA 1HDJA 2M6YA 4X1IB 1PD3A 3E89A 2WLJA 2UXCB 3I56V 5BMVB 3FKSG 1F51A 2YS8A 3IAYA 4DV4B 1N34O 2M7WA 4PA6A 4JI4B 4PA9A 2VQFB 4LH7A 5FLXN 5H6RA 3F7YC 3FFQA 3DSQA 1WP7A 3CEIA 2BSKA 5LOVA 3JASB 5EC2C 1FFXB 1GM7A 3EXAA 3SYAA 1K9MW 4IYHA 2OYQA 2QE7G 1XUQA 3E86A 3NR7A 4JAVA 4F4LA 1SQFA 1SQVH 1TGOA 5GONA 2B9ZA 3JYCA 2Q68A 5J9PC 5C93A 4B3SB 2OCCC 1N33O 4DV5O 3HKDA 1K5QA 2P90A 3AG4B 3SPGA 2IJJA 4NXNO 1S5HC 5FPOA 1LR1A 1I94O 1JX9A 4JI8B 5IYZB 3ZRVA 2HHHB 1DF5A 1N36O 2ZR3A 4ZHQA 2EZOA 2RMKB 5LGNA 4LF9B 2IU3A 4B08A 3RYHB 4FLUA 2Q9LA 2UXXA 1S0VA 1ZLZA 3AG1C 4FK5C 3ASNB 5CA0A 4ASUG 1F7YA 4I9WA 2UUBB 4RO2A 3CXHF 2ZD9A 4YIPA 4GZRB 3CXCU 1IBLO 4LFCB 4MVOA 1RSOA 2F23A 5C8YA 1PV0A 4K0KB 3ETDA 3EFFK 1B06A 1HNXB 5L3EA 2ZM6B 2YI9A 5L3FA 2VQEO 4TT3G 1JJOA 1EN6A 2OIEA 3L74H 1E1RG 5FNVB 4AQYB 4FJCC 3GWOA 2KSDA 1VQ6V 5B3SB 3ZHUA 2LGWA 1COWG 1FXVA 2BOBC 5EC1C 5JQGA 3SYOA 3EHBB 4TV8B 1PNLA 2W0XA 4UCOA 1NS1A 3H1KH 4F6RA 1UPGA 4BR6A 3U10A 3CCSV 5DECA 4N21A 3A0RA 1M1KW 3QTCA 3SJQC 4FM1A 4LFBB 4JYCA 4YHHO 2UXBB 3BFRA 4X66B 1FJGB 1Q82W 2AZ0A 3M99B 1HP8A 2P5OA 2AHYA 2C2AA 3E8FA 1L1FA 1AI4A 4BAYA 1GKFA 3T4DA 1TAEA 1IX9A 3D8CA 3ZX6A 4PA4A 1X4TA 2A0LA 1V54B 2XAGA 1WNSA 4DR3B 3QG5A 3CCEV 3G80A 2EJ7A 4O4LB 4DV1O 4JTAB 3K9AA 3QO5A 3KZIZ 1GK9A 2XNDG 4J9ZB 2NNUA 4FFKA 3DC5A 1JMKC 5LXTB 5B1BB 2QR4A 1N32O 2RCVA 1Z5VA 4PDLA 3RYIB 4FLYA 5ITZB 5BY1A 2YIBD 1UFIA 5KAIZ 3OUSA 4EEQA 2GHYA 2EULA 4G27B 1S3JA 4KHPO 3T1YB 2PI5A 1VQLV 3JSNA 3GVMA 3OD4A 4IIJB 5KMGA 4MVRA 1P49A 2AW9A 1Z2GA 3L71H 3T1HO 3K5OA 3FX7A 3SPCA 4MTFA 1H2NA 1XOUA 4P9PA 1OCRB 4FZ1A 3BABA 1WLEA 1ZAUA 3DXRB 3L70H 4H37A 2RNBA 4I4TA 3R66A 2A79B 4G2KA 2Q0OC 3TJTA 4CH5A 4JZ2A 4DR7O 5JVDB 5IY5C 4NVPA 2EJRA 3CX5F 4JYAB 4JI3O 4JASA 4DUYO 4BW5A 4DUZB 5H6QA 3CRMA 1I0HA 2Z3YA 5L3GA 2YSUB 1YJWV 2ZDIA 4X1YB 4X1KA 2WLHA 1GM9A 3B09A 3OTOO 1YJ9V 4HAMA 4DV3B 2D3OW 3UT5A 1VARA 2B5UA 2QSAA 4CC5A 1MSWD 3D3QA 1KECA 4DR5O 2YEVA 4DW1A 1BL8A 4X64B 1M56B 1L8DA 2Z0AA 2EIKB 1B6QA 3W7TA 4DR4B 2GDSA 2XAHA 1VF7A 3IC9A 2JJ2G 1ROPA 4JYBA 3T4ZA 5LA6A 4NXMB 4CH3A 2QKAA 2ZNJA 1R3LC 3ZRWB 5CN0A 1W0JG 1PP9H 4HNAA 4DR1B 3OT7A 1P7BA 3OTFA 1YTFD 4O2AA 4XDKA 4LF6B 2ILMA 1P84F 3CP1A 3K9SA 1XMOB 1H2SB 1WA8A 3HKCA 2GTSA 1GN6A 3OR6C 1RM1B 4N23A 5CB4B 2E75B 2LQTA 1SZTA 2GTAA 5JH7B 3HKEB 4WFGA 4YY3O 1AVMA 3J81N 1LNQA 1VF6C 1WJZA 2R9IA 2WLIA 3K0GA 1BHBA 2X7RB 3OR7C 4B7EA 3X2QB 5A9GA 3ABTA 3P3NA 1SF9A 5LHGA 1N34B 4UXNA 1KUQA 1H2KA 4C7UA 4WFAV 3N2GA 1Q81W 2PTMA 2UUAB 1KP2A 1XL4A 4YJ3B 5IJ9B 1XHXA 1FXKC 5EZYA 3FAVB 3CC7V 4LP8A 3OEHG 4GUNA 1WPBA 4I5SA 5KHHA 5D5PA 3J7AU 1FKAO 4H0LB 1EFRG 3E22A 3MDSA 3RT3C 4G28B 2ZINA 2JIZG 2DWEC 5JJJB 1VQMV 4DR2B 1N33B 3RGBA 4DV5B 1Q86W 3SJAC 3WB1A 4R8CA 5LP6B 4DR6B 3ZHVA 1G1XB 4DV7O 2BSKB 1N36B 1V9PA 1AI6A 2BCCH 2GV9A 1CEZA 5LOVB 2QWPB 4OXSA 2QJ1A 1K73W 3SDLA 1VF6A 3OW2U 2IJIA 3MHSC 3IGAC 2YUAA 2F93B 4LWSA 5IJ0A 3D3IA 4J10A 4YJ2A 5GONB 4GX1A 1IBMB 1DK1A 3CJHA 1H2LA 5B1NA 4IGGA 4MW8A 2QDOA 3HKDB 3CRCA 4MTGA 4PDVA 1JFFA 1NH2B 3CRQA 1VQPV 1IBLB 5BR8O 1FXKA 4JI7O 2R9AA 4PHZA 4AI8A 1HNZO 3QF7A 2QM8A 5B1OA 3OM3B 3K5NA 4ZHQB 2EILC 1VQKV 4NR1A 2VQEB 1AJPA 2WA4A 5KHIA 1VQ8V 2OTJV 3DC6A 1KQSU 4X9QA 1NH2D 1H8EG 1RPRA 3H1LH 1GN2A 5CA0B 4XDJA 4B3RO 1QNMA 3GB7C 2IH1C 2ZR2A 1TUBA 1ZSPA 1MZFA 3RN4A 5TISZ 5K1PA 1W2BU 3KCYA 2GSMB 2P22C 3FB7C 2XOKG 2BE3A 5CBHA 4PV1B 1PNKA 1RSOB 2V4DA 2FL4A 3SPJA 1OCZC 1S77D 3AK3A 1NTKH 3ZIAG 4YHHB 4LBEC 1X59A 4U3JA 4FM0A 4W4LA 1QBZA 2VS0A 4B7KA 1R1BA 3P3PA 4PELA 5JQGB 2OCCB 1M57C 5KUMA 1JJ2U 3G6BA 2Y69C 1K5SA 3WFVA 4TUYA 4F6RB 1CPYA 1XHZA 3SYCA 3OMIB 4CH6A 3E8BA 2PYLA 4GLXA 3UQ8A 3WU2Z 1QLEC 1I5XA 1RP3B 1SA0A 2XAJA 1YSCA 1N32B 3HR0A 3N2KA 4MVSA 3AG1B 1XI1A 3B4SA 2DYRC 3RW0A 3TCUA 2Q67A 2EX3A 2FYUH 4FM2A 3ZRSA 2B1GA 2QWOB 1QVGU 1VQ7V 2XT9A 1AILA 4KHPB 3GWKC 4K3AA 4KXRA 2NLJC 3OUFA 4OGQB 2DOSA 3WB2A 1K4DC 1MA1A 2AXTZ 5KHKA 4L87A 4MT8A 4ZOLA 1ZL8A 1MOFA 3T1HB 4JAAA 4IT5A 3SGIA 2EINC 3SR2C 1BZKA 3L73H 1VQ9V 1AR5A 2LJ2A 3K0DA 4TV9A 1XNQB 1AI5A 3ABLC 1H2GA 5FL7G 2N05A 2Y0PA 4RUEA 5IWAO 2EZPA 5KMGB 1Q5OA 2ZIMA 4X8AA 5H2FZ 2JGDA 4DV2O 4DR7B 2Q73A 2H3OA 4JI0O 1Q90D 3AG3C 4NYKA 4BIOA 3ZMZA 1AP6A 1SZXA 1FFTB 2ODMA 2WLLA 4QE7A 2E5LO 4JI3B 2E74B 1KKDA 1DTOA 3RYFA 3M8AA 1NJIW 1D5NA 4JAUA 4RQFA 3OMAB 1U97A 2ZE6A 1NTMH 3QVNA 4JI6O 4I4TB 3OTOB 1LUVA 3A8TA 3LNNA 5L3DA 2HP8A 2W0FC 2MW2B 4MVZA 3LSQA 1GO3F 3CRAA 3JD1A 3VOUA 1YZBA 3IC7A 3C3SA 2ZQMA 2Q0AA 4X62B 5H5NA 3MAQA 2L35A 1R6KA 1CXZB 2WAMA 2IU0A 2CGOA 1IXBA 5D5QA 3BPZA 4MW3A 4B3MO 1YXBA 5HFLA 4B3TB 4X1KB 1OJHA 1Q6IA 2F1MA 3OAAG 3T1CA 3TGUH 4W4KA 5KX5A 5A2QN 4R7CA 3BHPA 2BTOA 4LF7O 2QKSA 4R50A 2F43G 2YEVB 3SYQA 1G4YB 4KFMA 1ZWIC 2Q4PA 5LYJB 1R3IC 2Y4TA 2CH7A 2ZKOA 4YY3B 4LH6A 2CTRA 5HFMA 1GN3A 5LA6B 4PA7A 3JARA 2ITCC 4TQFA 2GBOA 1QR9A 4DW0A 1NVPB 3DTUB 4HNAB 2CGNA 3ETGA 2RN9A 3ZMVA 3FYEB 4O2AB 2JDIG 3SJBC 5IY5B 1JCHA 2JK5C 3KCXA 4K35A 3HKCB 3CD6V 3CC4V 2Q8VA 2BTQA 3WB0A 3SPHA 4LF4O 1AI7A 2JS3A 2ZIOA 3APQA 2WLIB 4O4HA 3APOA 4FLVA 4UCRA 3LNMB 2UU9B 1JPXA 4UVCA 4DO2A 1R73A 3JALA 4BWAA 5CA1A 4PA3A 1MSDA 4JGSA 3N2GB 1LUWA 2CTPA 3VQVA 4XDLA 1FXHA 1Y76A 1IDSA 3RYCA 5EZYB 4DV7B 1SRYA 2KKWA 2PZSA 1XMQB 3W7XA 2ZXWC 3CRRA 3OMNB 1F4MA 3H9VA 3KG2A 3C3TA 1HNWB 3E22B 2LP7A 4QIWF 2UXDO 2HR3A 2ADPA 2CDYA 2ZDIC 1E1QG 3LSSA 1SESA 1ENVA 2ZE5A 3CB2A 3HKBA 3UO3A 4DRXA 2CTQA 4CC6A 4UFZA 3JD3A 4J7KA 1S72V 5BMVA 3BA8A 2NN4A 4ZKIA 1SS3A 4FLTA 3JAWB 5BR8B 4JI7B 3CE2A 1HNZB 4GX0A 1D5AA 4UB6Z 3ASOC 1WN7A 3BVOA 2DN9A 4O2BA 2JEXA 2UUCB 3VQWA 4O4JB 1F4NA 3ZHTA 4LWSB 5EBMC 5IJ0B 1EZJA 1VQ5V 1QLNA 4B3RB 2CE4A 1FFXA 4YJ2B 3WG7C 2RJZA 2P7TC 3CJHB 2Y48A 2UXNA 3J80N 3B2EE 4UCSA 4DK1A 4JZGA 2UXCO 5AG2A 1FD9A 1FXKB 2Q5ZA 2QGNA 2Q6AA 3ZS8C 1KU9A 1NI8A 3E8HA 1SQBH 3KKYA 4FLXA 4U7OA 2G38A 2LW1A 4PDRA 4J42A 3ZMUA 3O9OA 2YICA 4GYCB 4MVQA 4GT1A 1EN5A 1TUBB 3AG2C 4MTOA 3OGCC 5B1AC 4UCUA 4H33A 5IYDO 1KBHA 2W6JG 5LMNO 4WCEV 2QM4A 1WB8A 2IJHA 1IURA 1VP7A 4JV5O 1ZX3A 3JD2A 3K08A 3STLC 3W7WA 2XTAA 4DK0A 1M9NA 3CC2V 2PUSA 3VBBA 3H1IH 5LL6Y 3CCQV 4MVUA 4LF8O 5CA3A 1NBMG 5B5EZ 3CCLV 3H1HH 3E8GA 2PYJA 5FNVA 1SKVA 4TUYB 2P06A 1NTZH 1Q3EA 2Q7HA 2AGAA 2GUZA 2EILB 4KP4A 3I5DA 2Q7EA 1SA0B 2RQ6A 3IFXA 4WFHA 1I7FA 2YIAA 3N2KB 1DGSA 4I0XB 3QO8A 3CMEV 4IYIA 1J95A 2F4VO 1OZ0A 2VRZA 2CTWA 3SJCC 1K3EA 4DV6O 3STZC 2PI4A 1Q7YW 3BCCH 4K8ZA 5L3BA 1YCIA 4JI1O 4F6EA 2O57A 1OCZB 3UO2A 4DV2B 3EVKA 1MG1A 4ZOLB 2F95B 1ZL8B 4RQEA 2X6AA 3ZMSA 4LF5O 3JD4A 2E5LB 3JSLA 4LFBO 3CPWU 2HVJC 3A0BZ 3S3XA 2VWKA
chains in the Genus database with same CATH topology
1JFFB 2F66C 4TV9B 1NT2B 5LXTA 1SA0A 4LFCB 1RSOA 5C8YA 1N32B 3N2KA 5JJEB 4LNUA 4K0KB 1XI1A 1HNXB 1M5IA 4JI6B 2ZM6B 2YI9A 3RYIA 3K58A 4NXNB 2EX3A 1JJOA 1I94B 3PN1A 4BW9A 4FM2A 5IYZA 5KHJA 1O9GA 5FNVB 4AQYB 1O9HA 4KHPB 3RFRA 1YEWA 3WB2A 5JQGA 3RYHA 5KHKA 4TV8B 4O4IB 4FFBA 3BAAA 3JATA 4UCOA 4ZOLA 3RYFB 3T1HB 3K57A 4F6RA 4X65B 3U10A 4B3MB 3QTCA 4FM1A 4LFBB 3SGIA 5EYPA 1IBKB 3SR2C 2UXBB 4X66B 1FJGB 4U3JB 4TV9A 1XNQB 2P5OA 4X20B 2ZNIA 4LF7B 1TAEA 4PI0A 5KMGB 1Q5OA 2ZIMA 3ICXA 1X4TA 5J2UB 1WNSA 4TQDA 4DR3B 4D7TA 4DR7B 5LYJA 3QG5A 4OX9B 4O4LB 2YXLA 1XNRB 4EB6B 4JI3B 4KL1A 1M4UA 4TV8A 4O4IA 4DV0B 1J5EB 3RYFA 4TOIA 5KX5B 1JMKC 5LXTB 1Z5WA 5C8YB 4FLWA 1TA8A 1Z5VA 3RYIB 4I4TB 3OTOB 4FLYA 5ITZB 3LNNA 4FVMA 4IHJB 2YIBD 4X20A 4EEQA 3ZEDA 4UCTA 3RWRD 5IWAB 3T1YB 2CAZC 3JSNA 5KMGA 4IIJB 2Q0AA 4X62B 3MAQA 1P49A 3JARB 5J2UA 4I55B 1KMIZ 4GKKB 5FPRA 5D5QA 3BPZA 4I50B 2R70A 4EFBA 4JI0B 4Q6GA 3U0ZA 4O4LA 2VWJA 4DV1B 3K5OA 4EB6A 4I9QA 4B3TB 2YIBA 4AHCA 3JAKB 4X1KB 3VQYA 3BA9A 1Q8IA 2F1MA 5KX5A 1G6UA 3BABA 3BHPA 4JI5B 1S5JA 2BTOA 1ZAUA 2OWOA 4I4TA 5ITZA 5KHGA 4IHJA 1T5EA 4O4HB 2UXDB 4CH5A 5CB4A 5LYJB 4JI2B 5JVDB 4ZIBA 3HKEA 3JALB 4NVPA 4YY3B 4LH6A 4IIJA 1B04A 5LA6B 4JYAB 3JARA 4I55A 4TQFA 2ZCEA 4DUZB 4I50A 2JVDA 4HNAB 3JAWA 2R72A 5JCOC 3RYCB 4WBNB 4O2AB 3SJBC 3JAKA 4X1YB 4UCVA 4X1KA 5IJ9A 3HKCB 1QHTA 3U11A 4DV3B 4O4JA 3UT5A 2BTQA 3WB0A 2ZIOA 4CC5A 3HKBB 4O4HA 4X64B 4DRXB 1L8DA 4FLVA 4UCRA 2UU9B 4DR4B 5JVDA 1VF7A 3JALA 4BWAA 1SQGA 5LA6A 4NXMB 4CH3A 5CA1A 2ZNJA 2JS5A 4DUYB 3N2GB 4CS2A 3VQVA 4O2BB 4HNAA 5LP6A 4DR1B 3RYCA 5EZYB 4DV7B 4D7SA 3M7MX 2KKWA 3CHXA 3OTFA 4WBNA 2PZSA 1XMQB 4O2AA 4LF6B 4X1YA 4FLZA 1XMOB 2XHBA 1H2SB 1HNWB 3E22B 3HKCA 2Q7GA 5CB4B 4LF4B 3A2FA 3VQXA 5JH7B 3HKEB 5JCOA 5LMNB 4DR5B 3CSXA 3CB2A 3HKBA 4DRXA 4CC6A 4UFZA 4GKJB 4JV5B 1M93A 5BMVA 1TVKB 3BA8A 3K59A 4FLTA 3JAWB 4HBNA 2PY5A 5BR8B 1N34B 4LR3A 4JI7B 1HNZB 1D5AA 3N2GA 2PTMA 2UUAB 1WN7A 4LF8B 4YJ3B 4O2BA 5IJ9B 4L8JA 1XHXA 2UUCB 5EZYA 1XQ8A 3VQWA 4O4JB 2YI8A 5EIBC 3UT5B 2BTQB 1WPBA 5IJ0B 4B3RB 4YJ2B 1FFXA 5KHHA 2RJZA 4ZI7B 5D5PA 3BRCA 1HW7A 5LP6C 3E22A 2HEPA 3B2EE 4UCSA 4DK1A 1QQCA 2ZINA 4AILC 4CS3A 5JH7A 5LMUB 5JJJB 4DR2B 3ZS8C 1N33B 3RGBA 4DV5B 5K1XA 1KU9A 5CA1B 3SJAC 3WB1A 2PGGA 1TVKA 2F4VB 2IM9A 4CS4A 5LP6B 4DR6B 5J2TB 4DV6B 1N36B 1V9PA 4FLXA 2GV9A 5LOVB 3K5MA 4GYCB 4JI1B 2QJ1A 4YJ3A 5EIBD 1TUBB 4UCUA 5JJNB 2F93B 5IJ0A 3THOA 4YJ2A 5GONB 4ZI7A 4LF5B 1IBMB 2QM4A 4PI2A 4X1IB 3HKDB 2UXCB 5BMVB 1JFFA 1IBLB 3IAYA 4DV4B 4DK0A 2R9AA 2PUSA 4PHZA 3QF7A 3K5NA 3K5LA 4ZHQB 2VQEB 4JI4B 5KHIA 2VQFB 4LH7A 3FFQA 5J2TA 3DSQA 1Q43A 2PYJA 5FNVA 5LOVA 1SKVA 3ETQA 3JASB 5CA0B 4TUYB 1FFXB 2JGUA 2E3CA 1TUBA 2OYQA 2Q7HA 1Q3EA 5K1PA 4LFAB 2P22C 1SQFA 1TGOA 2Q7EA 5GONA 1SA0B 2RQ6A 2V4DA 4B3SB 1I7FA 4X1IA 2YIAA 3N2KB 4LNUB 1DGSA 3HKDA 4YHHB 4U3JA 5FPOA 4FM0A 3SJCC 4JI8B 5IYZB 2HHHB 4ZHQA 4K8ZA 4CH4A 4LF9B 4B08A 5JQGB 3RYHB 4FLUA 4DV2B 4K8XA 1HR0B 4FFBB 3JATB 3JASA 5CA0A 4ZOLB 2F95B 4TUYA 4EFEA 4F6RB 1XHZA 2E5LB 2UUBB 3JSLA 4CH6A 2PYLA 5EYPB 4GLXA 3UQ8A 2VWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJJ B;  3WB2 A;  2F1M A;  4L8J A;  1RSO A;  5JJN B;  3WB0 A;  2F93 B;  5JJE B;  3WB1 A;  2V4D A;  5D5Q A;  2F95 B;  5D5P A;  3BRC A;  1T5E A;  3LNN A;  1H2S B;  4DK1 A;  1VF7 A;  4GYC B;  4DK0 A; 
#chains in the Genus database with same CATH topology
 3L72 H;  2F66 C;  4NKG B;  4TV9 B;  2XAS A;  5LXT A;  1BMF G;  1M57 B;  2N04 A;  2Y69 B;  5JJE B;  4LNU A;  1YVW A;  1M5I A;  4JI6 B;  4GX2 A;  3RVZ A;  3RYI A;  3K58 A;  4NXN B;  4MVM A;  3A0H Z;  1I94 B;  3PN1 A;  2JGD B;  4BW9 A;  1O9G A;  1QLE B;  2QWQ B;  4A5U B;  4QPK A;  2HVK C;  1Q6U A;  1D2D A;  4ABM A;  3ZHR A;  1XBL A;  2DYR B;  3L9D A;  4FFB A;  4Z1V A;  1N8R W;  3JAT A;  4LFA O;  3RYF B;  3MD0 A;  4HZ3 A;  2Q69 A;  3FB6 C;  1OCO C;  4B3M B;  2L6L A;  3ML0 A;  5EYP A;  1FPO A;  1WB7 A;  1NR1 A;  5EK0 A;  2WLK A;  2Y0I A;  4U7N A;  3QO7 A;  2DYS C;  1K8A W;  1RPO A;  2FTK A;  4LF7 B;  3FYI B;  4PI0 A;  4PJ0 Z;  3ICX A;  2DWD C;  2EIN B;  4D7T A;  2IBZ H;  1HR0 O;  2YXL A;  4BIU A;  3B8N A;  3ABL B;  2FML A;  1M4U A;  4O4I A;  3OGI B;  2A7W A;  3Q4H A;  3H1J H;  4TOI A;  5KX5 B;  2EIJ C;  5KA5 A;  5IE9 A;  4QGP A;  1URF A;  1JA8 A;  1IVS A;  3ZHS A;  5BZB A;  5C8Y B;  1TA8 A;  5LGT A;  3E35 A;  2HJF C;  1YI2 V;  1YJN V;  2OCH A;  1KP3 A;  3AG3 B;  5CBG A;  1NR7 A;  4FVM A;  1VMG A;  3K06 A;  4X20 A;  1XEQ A;  3ZED A;  4UCT A;  3RWR D;  2CH7 B;  2ZE7 A;  3AEI A;  3JAR B;  5J2U A;  1ZTE A;  4DUZ O;  1K92 A;  4Q6G A;  3U0Z A;  4DV1 B;  4X65 O;  4EB6 A;  3ABM C;  4Q20 A;  4I9Q A;  1AP5 A;  1FYJ A;  1IBK O;  3ZRW A;  3JCU Z;  1Q8I A;  3ZHQ A;  1BE3 H;  1Y74 A;  1OHH G;  2WPD G;  3FB5 C;  2N74 A;  5GTH Z;  2K1E A;  5KHG A;  1U96 A;  2HFE C;  1T5E A;  4IHJ A;  4R6Z A;  4O4H B;  4X64 O;  2UXD B;  1K33 A;  2E76 B;  1GAX A;  5CB4 A;  1QU7 A;  2QA4 V;  1WAZ A;  3CCR V;  4ZIB A;  3UCS C;  4OX9 O;  2HKO A;  4UVB A;  1GMG A;  3HKE A;  3JAL B;  4WFB V;  1XNR O;  2A06 H;  3I55 V;  1XRE A;  2P67 A;  1VQN V;  4I55 A;  4CZZ A;  4DV0 O;  3ABK C;  4I50 A;  1TUE B;  1J5E O;  1M90 W;  1HWY A;  1Y76 B;  5JCO C;  3RYC B;  4DR1 O;  5DN6 G;  5L3C A;  1ARO P;  4JF3 A;  4CBC A;  1GM8 A;  1I5Y A;  3JAK A;  5KA6 A;  3D36 C;  2KB1 A;  1NZ6 A;  4Z1M G;  5IJ9 A;  5BXZ A;  3FAV A;  4FPP A;  3B40 A;  1MZE A;  4MTX A;  1A32 A;  3HKB B;  4DRX B;  3N27 A;  2KG7 A;  2EIM C;  4GKK O;  1OCC C;  3G71 V;  2WLM A;  4PDM A;  1SER A;  1DLB A;  1SQG A;  1W59 A;  4MS2 A;  1S76 D;  5CMU A;  4DUY B;  3AK1 A;  4CS2 A;  2QM7 A;  2UUA O;  5F2V O;  2CUG A;  4O2B B;  5LP6 A;  1V55 C;  4JI5 O;  3CHX A;  4BIZ A;  4WBN A;  1PNM A;  2WSS G;  1NQT A;  2ITD C;  1S5L Z;  5EBW C;  1B3Q A;  2B1I A;  2LFS A;  2Y4U A;  3A2F A;  1K4C C;  4JI2 O;  4JTC B;  3VQX A;  3QNE A;  5JCO A;  2ARH A;  1IZ3 A;  5LMN B;  3TXS A;  4DR2 O;  4DR5 B;  3CSX A;  3OE7 G;  4NTY A;  1UJW B;  4H13 B;  4JV5 B;  2ZXW B;  3D36 A;  3ZN0 A;  1BSM A;  4HBN A;  2PY5 A;  3S3W A;  4I7Z B;  3B77 A;  4LR3 A;  4DR6 O;  1VQ4 V;  1FAF A;  2OIG A;  1R3K C;  3G67 A;  4LF8 B;  2X6B A;  1ZUQ A;  2LO1 A;  2YXH A;  1E79 G;  1MNG A;  1XQ8 A;  1N0N A;  2LGQ A;  4QE9 A;  5EIB C;  3UT5 B;  2WA3 A;  1IBM O;  1HW7 A;  2HEP A;  1H38 A;  4J7Z A;  5E1A C;  2A9H A;  3FD9 A;  3ASO B;  3RVY A;  4AIL C;  3JAM N;  1H2M A;  5EBL C;  3K79 A;  5IYC O;  4ICG A;  4UV9 A;  2PGG A;  1TVK A;  1NU1 H;  4OPH A;  2IM9 A;  3WG7 B;  2F4V B;  1BQZ A;  3K3W A;  2WLN A;  1R6T A;  4DV6 B;  1YF2 A;  2A3Q A;  1VIB A;  3K5M A;  2YDE A;  4JI1 B;  1G8M A;  2AHZ A;  1WA8 B;  2QKC A;  4P9O A;  3HB3 B;  5JJN B;  2GUZ B;  1NVP D;  3K04 A;  3THO A;  4ZI7 A;  1THZ A;  4LF5 B;  3CWB H;  4PI2 A;  1JR9 A;  5CBF A;  1PL4 A;  4GKJ O;  3TXQ A;  4GX5 A;  1VF5 B;  3AG2 B;  1GH6 A;  2WWW A;  3G4S V;  5B1A B;  1JOY A;  1SET A;  2QTS A;  3K5L A;  4UB8 Z;  1BS3 A;  1KYO F;  5LHI A;  2ATK C;  1WPX A;  5J2T A;  1PKX A;  2KQX A;  4H44 B;  2K9P A;  1Q43 A;  3ETQ A;  1KD1 W;  2JGU A;  3LDC A;  2E3C A;  3AG4 C;  1JQ0 A;  3W7S A;  2P4V A;  3HPL C;  4U3F H;  4LFA B;  1EZV H;  1Y4M A;  5LMU O;  1NKD A;  4DXW A;  5KLV H;  4X1I A;  1N0J A;  4LNU B;  1BGY H;  1Q6H A;  2ETN A;  5IT9 N;  3PJS K;  3ASN C;  1YIT V;  5IYB O;  2EBO A;  3DGE A;  4JTD B;  1BQ0 A;  1PPJ H;  5B66 Z;  2V7Q G;  4CH4 A;  2IW5 A;  1US6 A;  5GW7 A;  4RAI A;  4K8X A;  1HR0 B;  4FFB B;  3JAT B;  3JAS A;  1MMM A;  5GTI Z;  4EFE A;  4ZBM A;  4MSW C;  1DF4 A;  2YXY A;  4TSF G;  5EYP B;  4J41 A;  3P30 A;  4E2L A;  4LC1 A;  1SQP H;  1JFF B;  1K34 A;  1P7G A;  5B3S C;  1NT2 B;  1XNQ O;  4X88 A;  4DV4 O;  2QWR B;  4TWK A;  3CCM V;  4JI4 O;  1GN4 A;  2VQF O;  3F5T A;  2ADQ B;  5IYZ A;  2Z5U A;  5KHJ A;  2OTL V;  3AK2 A;  3JD0 A;  1JVM A;  1O9H A;  3H01 A;  3SYP A;  3RFR A;  1YEW A;  2MK3 A;  5JWP A;  3RYH A;  2HG5 C;  1YHQ V;  1BHA A;  1BCC H;  1VEW A;  4O4I B;  3BAA A;  3Q4H B;  3RBZ A;  3K57 A;  1FS0 G;  4X65 B;  1H8H G;  1SQX H;  1EN4 A;  4B3S O;  3G6E V;  3B8M A;  1V54 C;  4J11 A;  5KUK A;  2LFR A;  4PD4 F;  1IBK B;  4X89 A;  2IH3 C;  3F7V C;  1R6N A;  4U3J B;  3IJ4 A;  1AR1 B;  4X20 B;  4JI8 O;  2HHH O;  3CMA V;  2ZNI A;  2CK3 G;  2QWN B;  1AB3 A;  4LF9 O;  1OCO B;  4X62 O;  2QEX V;  5J2U B;  2IJK A;  5B1B C;  1WP8 A;  2JJ1 G;  4TQD A;  4QPJ A;  5E79 Z;  4RUF A;  2D2C B;  5LYJ A;  1L0N H;  1N4C A;  4QJF B;  4OX9 B;  3BY6 A;  1YTF B;  1Y67 A;  1K7D A;  1XNR B;  4EB6 B;  2DYS B;  2UUB O;  4KL1 A;  4B3T O;  1RFY A;  4TV8 A;  2W6I G;  4DV0 B;  2AZ2 A;  1J5E B;  1Y74 B;  4LFC O;  1Z5W A;  4FLW A;  2DE0 X;  4K0K O;  3C90 A;  1HNX O;  2ZM6 O;  2HLD G;  3CCV V;  1OV9 A;  4IHJ B;  1F23 A;  2R9R B;  4UUJ C;  1XIL A;  4AQY O;  5IWA B;  1YDX A;  2EIJ B;  2CAZ C;  4JYY A;  1IXM A;  1OCR C;  1QVF U;  1PL0 A;  1Y6X A;  4I55 B;  1KMI Z;  1QCE A;  1EM1 A;  4GKK B;  5FPR A;  4I50 B;  2R70 A;  4P30 A;  3ZMT A;  4EFB A;  4JI0 B;  4O4L A;  2VWJ A;  1AJN A;  1P4R A;  3SPI A;  3L75 H;  2YIB A;  4AHC A;  3JAK B;  3VQY A;  3BA9 A;  2UXB O;  4X66 O;  1FJG O;  5H9C A;  1G6U A;  3R65 A;  1ORQ C;  4JI5 B;  1W0K G;  1S5J A;  4E4E A;  2NR5 A;  2OWO A;  3LUT B;  2JRI A;  5ITZ A;  5LHH A;  2P4K A;  3ABM B;  2XAQ A;  2KG7 B;  3ZCC A;  4DR3 O;  4Z2W A;  3P32 A;  2FB5 A;  2UU9 O;  4JI2 B;  4NB5 A;  3CCU V;  4IIJ A;  5DED A;  1B04 A;  2WLL B;  3ABU A;  2ZCE A;  2DMX A;  4IL6 Z;  3ZN1 A;  2JVD A;  2X6C A;  3JAW A;  2R72 A;  3E83 A;  3T2M A;  1M56 C;  4WBN B;  2EIK C;  2RDC A;  1XMQ O;  3LDE A;  4UCV A;  1VQO V;  1HNW O;  1QHT A;  3U11 A;  3OFN G;  4O4J A;  4XBF A;  2DQ0 A;  5DM6 V;  4NTW A;  3FB8 C;  3DXR A;  3ABK B;  1MAB G;  2XAF A;  3NXS A;  3T1Y O;  2P6J A;  3ZRX A;  2PF4 E;  1GTO A;  5LGU A;  3LDD A;  1AJQ A;  4J7J A;  5JVD A;  4EKW A;  1KKC A;  1YIJ V;  1XL6 A;  1SQQ H;  1RM1 C;  3ETE A;  2DW4 A;  2JS5 A;  4D6T H;  4WF9 V;  2DJV A;  3W7U A;  2OT5 A;  3ZJZ A;  3LSU A;  2UUC O;  1L0L H;  4J9Y B;  4D7S A;  3M7M X;  4UVA A;  2EIM B;  3O65 A;  1OCC B;  3MHH C;  4X1Y A;  3X2Q C;  4UV8 A;  4FLZ A;  4OPA A;  2XHB A;  2ZE8 A;  2Q7G A;  1R3J C;  4P2Z A;  4FZ0 A;  5LBQ A;  4LF4 B;  4QNH B;  3AG7 A;  2H8P C;  4JYA O;  1V55 B;  2V1D A;  2DQ3 A;  4GKJ B;  1M93 A;  4YXW G;  1TVK B;  3K59 A;  3E2E A;  5IDJ A;  3ZBH A;  4RWU A;  2H94 A;  1Y66 A;  4KUM A;  1EBO A;  1SC5 B;  3CYO A;  3UM7 A;  4L8J A;  1KB9 F;  5KAF Z;  4DV3 O;  2YI8 A;  2BTQ B;  3UKM A;  2ZT9 B;  3CCJ V;  4WFF A;  4ZI7 B;  3BRC A;  4J80 A;  1QR8 A;  4DYL A;  1XDC A;  5LP6 C;  3CS5 A;  2YC0 A;  3JCZ A;  1QQC A;  1I08 A;  4WFE A;  1CP9 A;  2FKX A;  3TK1 A;  2QTO A;  4DR4 O;  3K03 A;  4CS3 A;  5JH7 A;  2BOC C;  5LMU B;  4NXM O;  5K1X A;  1BT8 A;  5CA1 B;  1GRJ A;  3BEH A;  4I0X A;  4JPR A;  2JEU A;  4CS4 A;  4FIP C;  4HYO A;  5J2T B;  4LCU C;  1AR4 A;  4NTX A;  1K97 A;  4YIO A;  4LF6 O;  2HJD A;  4YJ3 A;  1XMO O;  1PM9 A;  5EIB D;  2LW7 A;  3OEE G;  4GCZ A;  1KC8 W;  2X0L A;  2XUM A;  2YID A;  3TET A;  3F5W C;  4FMT A;  1HDJ A;  2M6Y A;  4X1I B;  1PD3 A;  3E89 A;  2WLJ A;  2UXC B;  3I56 V;  5BMV B;  3FKS G;  1F51 A;  2YS8 A;  3IAY A;  4DV4 B;  1N34 O;  2M7W A;  4PA6 A;  4JI4 B;  4PA9 A;  2VQF B;  4LH7 A;  5FLX N;  5H6R A;  3F7Y C;  3FFQ A;  3DSQ A;  1WP7 A;  3CEI A;  2BSK A;  5LOV A;  3JAS B;  5EC2 C;  1FFX B;  1GM7 A;  3EXA A;  3SYA A;  1K9M W;  4IYH A;  2OYQ A;  2QE7 G;  1XUQ A;  3E86 A;  3NR7 A;  4JAV A;  4F4L A;  1SQF A;  1SQV H;  1TGO A;  5GON A;  2B9Z A;  3JYC A;  2Q68 A;  5J9P C;  5C93 A;  4B3S B;  2OCC C;  1N33 O;  4DV5 O;  3HKD A;  1K5Q A;  2P90 A;  3AG4 B;  3SPG A;  2IJJ A;  4NXN O;  1S5H C;  5FPO A;  1LR1 A;  1I94 O;  1JX9 A;  4JI8 B;  5IYZ B;  3ZRV A;  2HHH B;  1DF5 A;  1N36 O;  2ZR3 A;  4ZHQ A;  2EZO A;  2RMK B;  5LGN A;  4LF9 B;  2IU3 A;  4B08 A;  3RYH B;  4FLU A;  2Q9L A;  2UXX A;  1S0V A;  1ZLZ A;  3AG1 C;  4FK5 C;  3ASN B;  5CA0 A;  4ASU G;  1F7Y A;  4I9W A;  2UUB B;  4RO2 A;  3CXH F;  2ZD9 A;  4YIP A;  4GZR B;  3CXC U;  1IBL O;  4LFC B;  4MVO A;  1RSO A;  2F23 A;  5C8Y A;  1PV0 A;  4K0K B;  3ETD A;  3EFF K;  1B06 A;  1HNX B;  5L3E A;  2ZM6 B;  2YI9 A;  5L3F A;  2VQE O;  4TT3 G;  1JJO A;  1EN6 A;  2OIE A;  3L74 H;  1E1R G;  5FNV B;  4AQY B;  4FJC C;  3GWO A;  2KSD A;  1VQ6 V;  5B3S B;  3ZHU A;  2LGW A;  1COW G;  1FXV A;  2BOB C;  5EC1 C;  5JQG A;  3SYO A;  3EHB B;  4TV8 B;  1PNL A;  2W0X A;  4UCO A;  1NS1 A;  3H1K H;  4F6R A;  1UPG A;  4BR6 A;  3U10 A;  3CCS V;  5DEC A;  4N21 A;  3A0R A;  1M1K W;  3QTC A;  3SJQ C;  4FM1 A;  4LFB B;  4JYC A;  4YHH O;  2UXB B;  3BFR A;  4X66 B;  1FJG B;  1Q82 W;  2AZ0 A;  3M99 B;  1HP8 A;  2P5O A;  2AHY A;  2C2A A;  3E8F A;  1L1F A;  1AI4 A;  4BAY A;  1GKF A;  3T4D A;  1TAE A;  1IX9 A;  3D8C A;  3ZX6 A;  4PA4 A;  1X4T A;  2A0L A;  1V54 B;  2XAG A;  1WNS A;  4DR3 B;  3QG5 A;  3CCE V;  3G80 A;  2EJ7 A;  4O4L B;  4DV1 O;  4JTA B;  3K9A A;  3QO5 A;  3KZI Z;  1GK9 A;  2XND G;  4J9Z B;  2NNU A;  4FFK A;  3DC5 A;  1JMK C;  5LXT B;  5B1B B;  2QR4 A;  1N32 O;  2RCV A;  1Z5V A;  4PDL A;  3RYI B;  4FLY A;  5ITZ B;  5BY1 A;  2YIB D;  1UFI A;  5KAI Z;  3OUS A;  4EEQ A;  2GHY A;  2EUL A;  4G27 B;  1S3J A;  4KHP O;  3T1Y B;  2PI5 A;  1VQL V;  3JSN A;  3GVM A;  3OD4 A;  4IIJ B;  5KMG A;  4MVR A;  1P49 A;  2AW9 A;  1Z2G A;  3L71 H;  3T1H O;  3K5O A;  3FX7 A;  3SPC A;  4MTF A;  1H2N A;  1XOU A;  4P9P A;  1OCR B;  4FZ1 A;  3BAB A;  1WLE A;  1ZAU A;  3DXR B;  3L70 H;  4H37 A;  2RNB A;  4I4T A;  3R66 A;  2A79 B;  4G2K A;  2Q0O C;  3TJT A;  4CH5 A;  4JZ2 A;  4DR7 O;  5JVD B;  5IY5 C;  4NVP A;  2EJR A;  3CX5 F;  4JYA B;  4JI3 O;  4JAS A;  4DUY O;  4BW5 A;  4DUZ B;  5H6Q A;  3CRM A;  1I0H A;  2Z3Y A;  5L3G A;  2YSU B;  1YJW V;  2ZDI A;  4X1Y B;  4X1K A;  2WLH A;  1GM9 A;  3B09 A;  3OTO O;  1YJ9 V;  4HAM A;  4DV3 B;  2D3O W;  3UT5 A;  1VAR A;  2B5U A;  2QSA A;  4CC5 A;  1MSW D;  3D3Q A;  1KEC A;  4DR5 O;  2YEV A;  4DW1 A;  1BL8 A;  4X64 B;  1M56 B;  1L8D A;  2Z0A A;  2EIK B;  1B6Q A;  3W7T A;  4DR4 B;  2GDS A;  2XAH A;  1VF7 A;  3IC9 A;  2JJ2 G;  1ROP A;  4JYB A;  3T4Z A;  5LA6 A;  4NXM B;  4CH3 A;  2QKA A;  2ZNJ A;  1R3L C;  3ZRW B;  5CN0 A;  1W0J G;  1PP9 H;  4HNA A;  4DR1 B;  3OT7 A;  1P7B A;  3OTF A;  1YTF D;  4O2A A;  4XDK A;  4LF6 B;  2ILM A;  1P84 F;  3CP1 A;  3K9S A;  1XMO B;  1H2S B;  1WA8 A;  3HKC A;  2GTS A;  1GN6 A;  3OR6 C;  1RM1 B;  4N23 A;  5CB4 B;  2E75 B;  2LQT A;  1SZT A;  2GTA A;  5JH7 B;  3HKE B;  4WFG A;  4YY3 O;  1AVM A;  3J81 N;  1LNQ A;  1VF6 C;  1WJZ A;  2R9I A;  2WLI A;  3K0G A;  1BHB A;  2X7R B;  3OR7 C;  4B7E A;  3X2Q B;  5A9G A;  3ABT A;  3P3N A;  1SF9 A;  5LHG A;  1N34 B;  4UXN A;  1KUQ A;  1H2K A;  4C7U A;  4WFA V;  3N2G A;  1Q81 W;  2PTM A;  2UUA B;  1KP2 A;  1XL4 A;  4YJ3 B;  5IJ9 B;  1XHX A;  1FXK C;  5EZY A;  3FAV B;  3CC7 V;  4LP8 A;  3OEH G;  4GUN A;  1WPB A;  4I5S A;  5KHH A;  5D5P A;  3J7A U;  1FKA O;  4H0L B;  1EFR G;  3E22 A;  3MDS A;  3RT3 C;  4G28 B;  2ZIN A;  2JIZ G;  2DWE C;  5JJJ B;  1VQM V;  4DR2 B;  1N33 B;  3RGB A;  4DV5 B;  1Q86 W;  3SJA C;  3WB1 A;  4R8C A;  5LP6 B;  4DR6 B;  3ZHV A;  1G1X B;  4DV7 O;  2BSK B;  1N36 B;  1V9P A;  1AI6 A;  2BCC H;  2GV9 A;  1CEZ A;  5LOV B;  2QWP B;  4OXS A;  2QJ1 A;  1K73 W;  3SDL A;  1VF6 A;  3OW2 U;  2IJI A;  3MHS C;  3IGA C;  2YUA A;  2F93 B;  4LWS A;  5IJ0 A;  3D3I A;  4J10 A;  4YJ2 A;  5GON B;  4GX1 A;  1IBM B;  1DK1 A;  3CJH A;  1H2L A;  5B1N A;  4IGG A;  4MW8 A;  2QDO A;  3HKD B;  3CRC A;  4MTG A;  4PDV A;  1JFF A;  1NH2 B;  3CRQ A;  1VQP V;  1IBL B;  5BR8 O;  1FXK A;  4JI7 O;  2R9A A;  4PHZ A;  4AI8 A;  1HNZ O;  3QF7 A;  2QM8 A;  5B1O A;  3OM3 B;  3K5N A;  4ZHQ B;  2EIL C;  1VQK V;  4NR1 A;  2VQE B;  1AJP A;  2WA4 A;  5KHI A;  1VQ8 V;  2OTJ V;  3DC6 A;  1KQS U;  4X9Q A;  1NH2 D;  1H8E G;  1RPR A;  3H1L H;  1GN2 A;  5CA0 B;  4XDJ A;  4B3R O;  1QNM A;  3GB7 C;  2IH1 C;  2ZR2 A;  1TUB A;  1ZSP A;  1MZF A;  3RN4 A;  5TIS Z;  5K1P A;  1W2B U;  3KCY A;  2GSM B;  2P22 C;  3FB7 C;  2XOK G;  2BE3 A;  5CBH A;  4PV1 B;  1PNK A;  1RSO B;  2V4D A;  2FL4 A;  3SPJ A;  1OCZ C;  1S77 D;  3AK3 A;  1NTK H;  3ZIA G;  4YHH B;  4LBE C;  1X59 A;  4U3J A;  4FM0 A;  4W4L A;  1QBZ A;  2VS0 A;  4B7K A;  1R1B A;  3P3P A;  4PEL A;  5JQG B;  2OCC B;  1M57 C;  5KUM A;  1JJ2 U;  3G6B A;  2Y69 C;  1K5S A;  3WFV A;  4TUY A;  4F6R B;  1CPY A;  1XHZ A;  3SYC A;  3OMI B;  4CH6 A;  3E8B A;  2PYL A;  4GLX A;  3UQ8 A;  3WU2 Z;  1QLE C;  1I5X A;  1RP3 B;  1SA0 A;  2XAJ A;  1YSC A;  1N32 B;  3HR0 A;  3N2K A;  4MVS A;  3AG1 B;  1XI1 A;  3B4S A;  2DYR C;  3RW0 A;  3TCU A;  2Q67 A;  2EX3 A;  2FYU H;  4FM2 A;  3ZRS A;  2B1G A;  2QWO B;  1QVG U;  1VQ7 V;  2XT9 A;  1AIL A;  4KHP B;  3GWK C;  4K3A A;  4KXR A;  2NLJ C;  3OUF A;  4OGQ B;  2DOS A;  3WB2 A;  1K4D C;  1MA1 A;  2AXT Z;  5KHK A;  4L87 A;  4MT8 A;  4ZOL A;  1ZL8 A;  1MOF A;  3T1H B;  4JAA A;  4IT5 A;  3SGI A;  2EIN C;  3SR2 C;  1BZK A;  3L73 H;  1VQ9 V;  1AR5 A;  2LJ2 A;  3K0D A;  4TV9 A;  1XNQ B;  1AI5 A;  3ABL C;  1H2G A;  5FL7 G;  2N05 A;  2Y0P A;  4RUE A;  5IWA O;  2EZP A;  5KMG B;  1Q5O A;  2ZIM A;  4X8A A;  5H2F Z;  2JGD A;  4DV2 O;  4DR7 B;  2Q73 A;  2H3O A;  4JI0 O;  1Q90 D;  3AG3 C;  4NYK A;  4BIO A;  3ZMZ A;  1AP6 A;  1SZX A;  1FFT B;  2ODM A;  2WLL A;  4QE7 A;  2E5L O;  4JI3 B;  2E74 B;  1KKD A;  1DTO A;  3RYF A;  3M8A A;  1NJI W;  1D5N A;  4JAU A;  4RQF A;  3OMA B;  1U97 A;  2ZE6 A;  1NTM H;  3QVN A;  4JI6 O;  4I4T B;  3OTO B;  1LUV A;  3A8T A;  3LNN A;  5L3D A;  2HP8 A;  2W0F C;  2MW2 B;  4MVZ A;  3LSQ A;  1GO3 F;  3CRA A;  3JD1 A;  3VOU A;  1YZB A;  3IC7 A;  3C3S A;  2ZQM A;  2Q0A A;  4X62 B;  5H5N A;  3MAQ A;  2L35 A;  1R6K A;  1CXZ B;  2WAM A;  2IU0 A;  2CGO A;  1IXB A;  5D5Q A;  3BPZ A;  4MW3 A;  4B3M O;  1YXB A;  5HFL A;  4B3T B;  4X1K B;  1OJH A;  1Q6I A;  2F1M A;  3OAA G;  3T1C A;  3TGU H;  4W4K A;  5KX5 A;  5A2Q N;  4R7C A;  3BHP A;  2BTO A;  4LF7 O;  2QKS A;  4R50 A;  2F43 G;  2YEV B;  3SYQ A;  1G4Y B;  4KFM A;  1ZWI C;  2Q4P A;  5LYJ B;  1R3I C;  2Y4T A;  2CH7 A;  2ZKO A;  4YY3 B;  4LH6 A;  2CTR A;  5HFM A;  1GN3 A;  5LA6 B;  4PA7 A;  3JAR A;  2ITC C;  4TQF A;  2GBO A;  1QR9 A;  4DW0 A;  1NVP B;  3DTU B;  4HNA B;  2CGN A;  3ETG A;  2RN9 A;  3ZMV A;  3FYE B;  4O2A B;  2JDI G;  3SJB C;  5IY5 B;  1JCH A;  2JK5 C;  3KCX A;  4K35 A;  3HKC B;  3CD6 V;  3CC4 V;  2Q8V A;  2BTQ A;  3WB0 A;  3SPH A;  4LF4 O;  1AI7 A;  2JS3 A;  2ZIO A;  3APQ A;  2WLI B;  4O4H A;  3APO A;  4FLV A;  4UCR A;  3LNM B;  2UU9 B;  1JPX A;  4UVC A;  4DO2 A;  1R73 A;  3JAL A;  4BWA A;  5CA1 A;  4PA3 A;  1MSD A;  4JGS A;  3N2G B;  1LUW A;  2CTP A;  3VQV A;  4XDL A;  1FXH A;  1Y76 A;  1IDS A;  3RYC A;  5EZY B;  4DV7 B;  1SRY A;  2KKW A;  2PZS A;  1XMQ B;  3W7X A;  2ZXW C;  3CRR A;  3OMN B;  1F4M A;  3H9V A;  3KG2 A;  3C3T A;  1HNW B;  3E22 B;  2LP7 A;  4QIW F;  2UXD O;  2HR3 A;  2ADP A;  2CDY A;  2ZDI C;  1E1Q G;  3LSS A;  1SES A;  1ENV A;  2ZE5 A;  3CB2 A;  3HKB A;  3UO3 A;  4DRX A;  2CTQ A;  4CC6 A;  4UFZ A;  3JD3 A;  4J7K A;  1S72 V;  5BMV A;  3BA8 A;  2NN4 A;  4ZKI A;  1SS3 A;  4FLT A;  3JAW B;  5BR8 B;  4JI7 B;  3CE2 A;  1HNZ B;  4GX0 A;  1D5A A;  4UB6 Z;  3ASO C;  1WN7 A;  3BVO A;  2DN9 A;  4O2B A;  2JEX A;  2UUC B;  3VQW A;  4O4J B;  1F4N A;  3ZHT A;  4LWS B;  5EBM C;  5IJ0 B;  1EZJ A;  1VQ5 V;  1QLN A;  4B3R B;  2CE4 A;  1FFX A;  4YJ2 B;  3WG7 C;  2RJZ A;  2P7T C;  3CJH B;  2Y48 A;  2UXN A;  3J80 N;  3B2E E;  4UCS A;  4DK1 A;  4JZG A;  2UXC O;  5AG2 A;  1FD9 A;  1FXK B;  2Q5Z A;  2QGN A;  2Q6A A;  3ZS8 C;  1KU9 A;  1NI8 A;  3E8H A;  1SQB H;  3KKY A;  4FLX A;  4U7O A;  2G38 A;  2LW1 A;  4PDR A;  4J42 A;  3ZMU A;  3O9O A;  2YIC A;  4GYC B;  4MVQ A;  4GT1 A;  1EN5 A;  1TUB B;  3AG2 C;  4MTO A;  3OGC C;  5B1A C;  4UCU A;  4H33 A;  5IYD O;  1KBH A;  2W6J G;  5LMN O;  4WCE V;  2QM4 A;  1WB8 A;  2IJH A;  1IUR A;  1VP7 A;  4JV5 O;  1ZX3 A;  3JD2 A;  3K08 A;  3STL C;  3W7W A;  2XTA A;  4DK0 A;  1M9N A;  3CC2 V;  2PUS A;  3VBB A;  3H1I H;  5LL6 Y;  3CCQ V;  4MVU A;  4LF8 O;  5CA3 A;  1NBM G;  5B5E Z;  3CCL V;  3H1H H;  3E8G A;  2PYJ A;  5FNV A;  1SKV A;  4TUY B;  2P06 A;  1NTZ H;  1Q3E A;  2Q7H A;  2AGA A;  2GUZ A;  2EIL B;  4KP4 A;  3I5D A;  2Q7E A;  1SA0 B;  2RQ6 A;  3IFX A;  4WFH A;  1I7F A;  2YIA A;  3N2K B;  1DGS A;  4I0X B;  3QO8 A;  3CME V;  4IYI A;  1J95 A;  2F4V O;  1OZ0 A;  2VRZ A;  2CTW A;  3SJC C;  1K3E A;  4DV6 O;  3STZ C;  2PI4 A;  1Q7Y W;  3BCC H;  4K8Z A;  5L3B A;  1YCI A;  4JI1 O;  4F6E A;  2O57 A;  1OCZ B;  3UO2 A;  4DV2 B;  3EVK A;  1MG1 A;  4ZOL B;  2F95 B;  1ZL8 B;  4RQE A;  2X6A A;  3ZMS A;  4LF5 O;  3JD4 A;  2E5L B;  3JSL A;  4LFB O;  3CPW U;  2HVJ C;  3A0B Z;  3S3X A;  2VWK A; 
#chains in the Genus database with same CATH homology
 1JFF B;  2F66 C;  4TV9 B;  1NT2 B;  5LXT A;  1SA0 A;  4LFC B;  1RSO A;  5C8Y A;  1N32 B;  3N2K A;  5JJE B;  4LNU A;  4K0K B;  1XI1 A;  1HNX B;  1M5I A;  4JI6 B;  2ZM6 B;  2YI9 A;  3RYI A;  3K58 A;  4NXN B;  2EX3 A;  1JJO A;  1I94 B;  3PN1 A;  4BW9 A;  4FM2 A;  5IYZ A;  5KHJ A;  1O9G A;  5FNV B;  4AQY B;  1O9H A;  4KHP B;  3RFR A;  1YEW A;  3WB2 A;  5JQG A;  3RYH A;  5KHK A;  4TV8 B;  4O4I B;  4FFB A;  3BAA A;  3JAT A;  4UCO A;  4ZOL A;  3RYF B;  3T1H B;  3K57 A;  4F6R A;  4X65 B;  3U10 A;  4B3M B;  3QTC A;  4FM1 A;  4LFB B;  3SGI A;  5EYP A;  1IBK B;  3SR2 C;  2UXB B;  4X66 B;  1FJG B;  4U3J B;  4TV9 A;  1XNQ B;  2P5O A;  4X20 B;  2ZNI A;  4LF7 B;  1TAE A;  4PI0 A;  5KMG B;  1Q5O A;  2ZIM A;  3ICX A;  1X4T A;  5J2U B;  1WNS A;  4TQD A;  4DR3 B;  4D7T A;  4DR7 B;  5LYJ A;  3QG5 A;  4OX9 B;  4O4L B;  2YXL A;  1XNR B;  4EB6 B;  4JI3 B;  4KL1 A;  1M4U A;  4TV8 A;  4O4I A;  4DV0 B;  1J5E B;  3RYF A;  4TOI A;  5KX5 B;  1JMK C;  5LXT B;  1Z5W A;  5C8Y B;  4FLW A;  1TA8 A;  1Z5V A;  3RYI B;  4I4T B;  3OTO B;  4FLY A;  5ITZ B;  3LNN A;  4FVM A;  4IHJ B;  2YIB D;  4X20 A;  4EEQ A;  3ZED A;  4UCT A;  3RWR D;  5IWA B;  3T1Y B;  2CAZ C;  3JSN A;  5KMG A;  4IIJ B;  2Q0A A;  4X62 B;  3MAQ A;  1P49 A;  3JAR B;  5J2U A;  4I55 B;  1KMI Z;  4GKK B;  5FPR A;  5D5Q A;  3BPZ A;  4I50 B;  2R70 A;  4EFB A;  4JI0 B;  4Q6G A;  3U0Z A;  4O4L A;  2VWJ A;  4DV1 B;  3K5O A;  4EB6 A;  4I9Q A;  4B3T B;  2YIB A;  4AHC A;  3JAK B;  4X1K B;  3VQY A;  3BA9 A;  1Q8I A;  2F1M A;  5KX5 A;  1G6U A;  3BAB A;  3BHP A;  4JI5 B;  1S5J A;  2BTO A;  1ZAU A;  2OWO A;  4I4T A;  5ITZ A;  5KHG A;  4IHJ A;  1T5E A;  4O4H B;  2UXD B;  4CH5 A;  5CB4 A;  5LYJ B;  4JI2 B;  5JVD B;  4ZIB A;  3HKE A;  3JAL B;  4NVP A;  4YY3 B;  4LH6 A;  4IIJ A;  1B04 A;  5LA6 B;  4JYA B;  3JAR A;  4I55 A;  4TQF A;  2ZCE A;  4DUZ B;  4I50 A;  2JVD A;  4HNA B;  3JAW A;  2R72 A;  5JCO C;  3RYC B;  4WBN B;  4O2A B;  3SJB C;  3JAK A;  4X1Y B;  4UCV A;  4X1K A;  5IJ9 A;  3HKC B;  1QHT A;  3U11 A;  4DV3 B;  4O4J A;  3UT5 A;  2BTQ A;  3WB0 A;  2ZIO A;  4CC5 A;  3HKB B;  4O4H A;  4X64 B;  4DRX B;  1L8D A;  4FLV A;  4UCR A;  2UU9 B;  4DR4 B;  5JVD A;  1VF7 A;  3JAL A;  4BWA A;  1SQG A;  5LA6 A;  4NXM B;  4CH3 A;  5CA1 A;  2ZNJ A;  2JS5 A;  4DUY B;  3N2G B;  4CS2 A;  3VQV A;  4O2B B;  4HNA A;  5LP6 A;  4DR1 B;  3RYC A;  5EZY B;  4DV7 B;  4D7S A;  3M7M X;  2KKW A;  3CHX A;  3OTF A;  4WBN A;  2PZS A;  1XMQ B;  4O2A A;  4LF6 B;  4X1Y A;  4FLZ A;  1XMO B;  2XHB A;  1H2S B;  1HNW B;  3E22 B;  3HKC A;  2Q7G A;  5CB4 B;  4LF4 B;  3A2F A;  3VQX A;  5JH7 B;  3HKE B;  5JCO A;  5LMN B;  4DR5 B;  3CSX A;  3CB2 A;  3HKB A;  4DRX A;  4CC6 A;  4UFZ A;  4GKJ B;  4JV5 B;  1M93 A;  5BMV A;  1TVK B;  3BA8 A;  3K59 A;  4FLT A;  3JAW B;  4HBN A;  2PY5 A;  5BR8 B;  1N34 B;  4LR3 A;  4JI7 B;  1HNZ B;  1D5A A;  3N2G A;  2PTM A;  2UUA B;  1WN7 A;  4LF8 B;  4YJ3 B;  4O2B A;  5IJ9 B;  4L8J A;  1XHX A;  2UUC B;  5EZY A;  1XQ8 A;  3VQW A;  4O4J B;  2YI8 A;  5EIB C;  3UT5 B;  2BTQ B;  1WPB A;  5IJ0 B;  4B3R B;  4YJ2 B;  1FFX A;  5KHH A;  2RJZ A;  4ZI7 B;  5D5P A;  3BRC A;  1HW7 A;  5LP6 C;  3E22 A;  2HEP A;  3B2E E;  4UCS A;  4DK1 A;  1QQC A;  2ZIN A;  4AIL C;  4CS3 A;  5JH7 A;  5LMU B;  5JJJ B;  4DR2 B;  3ZS8 C;  1N33 B;  3RGB A;  4DV5 B;  5K1X A;  1KU9 A;  5CA1 B;  3SJA C;  3WB1 A;  2PGG A;  1TVK A;  2F4V B;  2IM9 A;  4CS4 A;  5LP6 B;  4DR6 B;  5J2T B;  4DV6 B;  1N36 B;  1V9P A;  4FLX A;  2GV9 A;  5LOV B;  3K5M A;  4GYC B;  4JI1 B;  2QJ1 A;  4YJ3 A;  5EIB D;  1TUB B;  4UCU A;  5JJN B;  2F93 B;  5IJ0 A;  3THO A;  4YJ2 A;  5GON B;  4ZI7 A;  4LF5 B;  1IBM B;  2QM4 A;  4PI2 A;  4X1I B;  3HKD B;  2UXC B;  5BMV B;  1JFF A;  1IBL B;  3IAY A;  4DV4 B;  4DK0 A;  2R9A A;  2PUS A;  4PHZ A;  3QF7 A;  3K5N A;  3K5L A;  4ZHQ B;  2VQE B;  4JI4 B;  5KHI A;  2VQF B;  4LH7 A;  3FFQ A;  5J2T A;  3DSQ A;  1Q43 A;  2PYJ A;  5FNV A;  5LOV A;  1SKV A;  3ETQ A;  3JAS B;  5CA0 B;  4TUY B;  1FFX B;  2JGU A;  2E3C A;  1TUB A;  2OYQ A;  2Q7H A;  1Q3E A;  5K1P A;  4LFA B;  2P22 C;  1SQF A;  1TGO A;  2Q7E A;  5GON A;  1SA0 B;  2RQ6 A;  2V4D A;  4B3S B;  1I7F A;  4X1I A;  2YIA A;  3N2K B;  4LNU B;  1DGS A;  3HKD A;  4YHH B;  4U3J A;  5FPO A;  4FM0 A;  3SJC C;  4JI8 B;  5IYZ B;  2HHH B;  4ZHQ A;  4K8Z A;  4CH4 A;  4LF9 B;  4B08 A;  5JQG B;  3RYH B;  4FLU A;  4DV2 B;  4K8X A;  1HR0 B;  4FFB B;  3JAT B;  3JAS A;  5CA0 A;  4ZOL B;  2F95 B;  4TUY A;  4EFE A;  4F6R B;  1XHZ A;  2E5L B;  2UUB B;  3JSL A;  4CH6 A;  2PYL A;  5EYP B;  4GLX A;  3UQ8 A;  2VWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...