1RSOA

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
RKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Presynaptic protein SAP97
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
total genus 18
structure length 60
sequence length 60
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1rsoA01
4GYCB 2F95B 2F1MA 5D5PA 5JJEB 4DK0A 1H2SB 1VF7A 5JJJB 3WB2A 4DK1A 5JJNB 3LNNA 1T5EA 5D5QA 2F93B 2V4DA 3BRCA 3WB1A 1RSOA 4L8JA 3WB0A
chains in the Genus database with same CATH superfamily
5L3FA 3DXRA 2NR5A 3OGIB 3X2QC 4I9QA 3QO7A 1XMQO 1KB9F 1YHQV 2OIEA 3AK1A 4DK1A 4UCUA 2LFRA 3FB7C 4DR7O 2Y4TA 3TGUH 3E8FA 1AP5A 1I08A 4F6RA 2FL4A 3JAKA 2P67A 3JD1A 3T2MA 2XT9A 3CCQV 1Q8IA 2DYSB 2PGGA 5JVDA 3RFRA 1PNLA 1IDSA 3IFXA 4BAYA 1GTOA 1YJNV 3VOUA 1JR9A 1Q7YW 4I55A 3BAAA 3ZMSA 4LF6B 2CDYA 1SA0B 2QKCA 5LBQA 4YY3O 2P90A 1S5JA 3GWOA 1Y76A 4EB6A 5C8YA 4NVPA 1PPJH 2Q7EA 5B1NA 1JJOA 1WP7A 3ZMUA 1RM1C 5K1PA 4DV0O 1VEWA 4BIOA 4J7JA 1PNKA 3D36A 3ZMZA 1N32B 1BHAA 2V4DA 1AJQA 1M93A 1YI2V 3UCSC 1W0JG 1SZXA 2F1MA 1H2LA 4MVSA 5KAIZ 4X1KB 5EYPA 4U3FH 1K8AW 1YTFD 3LSSA 3LDDA 1M9NA 3FAVB 5BMVB 2ZKOA 2DWEC 3UT5A 1HNZB 2XTAA 1BL8A 1AJPA 1AROP 3JD3A 4AI8A 5JCOC 5J2UA 2VS0A 3CCVV 4OXSA 1VQPV 4L8JA 3HKDA 3L74H 5B1OA 4DR3B 2XUMA 3JD4A 4IHJA 1QLEC 2LP7A 3ABMB 3SYOA 4ZKIA 1WLEA 3APOA 5LP6C 3ASOB 1SQQH 4K8ZA 1ZAUA 1V54C 4W4LA 4PV1B 2DQ0A 1S3JA 4UUJC 2KB1A 4DR4O 4CH6A 4FVMA 4ZIBA 1LUVA 5ITZB 4QPKA 4LH6A 2O57A 2EIMB 3LNNA 5KX5A 5DEDA 1IURA 2X6CA 5LA6A 1B6QA 3AK2A 4TWKA 4FM0A 1XQ8A 4B3MB 1KKCA 3ZRSA 3SPIA 5JH7B 3OE7G 3OW2U 2BSKA 1N0NA 4DYLA 4I4TB 5IY5B 4OX9B 1K5SA 1UJWB 4WFAV 4G2KA 1TVKA 1P7BA 2QJ1A 4B3TB 1ZLZA 4DV6B 2QWOB 2Q68A 1VQNV 5IWAO 2C2AA 3H01A 1ORQC 1BGYH 1XNQO 1K33A 4X66B 1J95A 2ARHA 1IBMB 2PF4E 3HKBA 5GTIZ 1WA8A 1HWYA 2OIGA 3OR7C 4DV1O 1Q43A 2FB5A 4NXNB 4HNAA 1K34A 3ZRVA 1HDJA 1MG1A 4JI7B 2W6JG 2FKXA 4D6TH 2BOBC 4NTXA 4TV9A 4DR1B 2QDOA 3ASNB 5CA1B 2VQFO 1H2NA 2YEVB 1XHZA 3EHBB 1G4YB 2Y69C 3L75H 4YHHO 4KP4A 1VP7A 3I56V 2CGOA 2IJIA 5KHGA 2XAHA 1AR4A 2EZPA 3E22B 2EIJC 4OPAA 4LFCB 3P3NA 3BHPA 2HG5C 1Q6IA 3TCUA 5LOVA 1FJGO 3NXSA 1S77D 1OV9A 3B8NA 2GDSA 2UXDB 2QM7A 3OAAG 5KMGB 1EN5A 4J7ZA 4CH3A 2UXCB 1JX9A 4CC6A 3HKEA 3OTOO 1D5NA 1H2KA 2UXBO 1N33B 4O4IA 1HW7A 3W7UA 1GH6A 1VF6A 5B1BB 3CYOA 3SJAC 1XDCA 2JVDA 3FYIB 4MW3A 1KUQA 3QO5A 1AJNA 1GMGA 4DR3O 2DYSC 1H2GA 4X65B 4JYYA 3ZEDA 1MMMA 2BCCH 3K59A 2GBOA 3OFNG 3JCUZ 2V1DA 1AI7A 4I50A 1JFFB 3ZRWA 3CRAA 3D8CA 3SYAA 4DV3B 3N2GA 3OMAB 1S0VA 3K03A 3H1JH 4O4HA 2AZ2A 3AG3B 4JI2B 3F7YC 2ZE8A 1UFIA 2ITCC 1JA8A 1XNRB 1FYJA 2R9RB 4J10A 3E2EA 4LFAO 4BW5A 1BQZA 3K5OA 1KU9A 4PA9A 4FZ1A 2RNBA 2ZR2A 4O4LA 4MVUA 1NU1H 3A2FA 1VQ8V 3CRQA 4F6RB 3JAKB 4AQYB 3TXSA 4JI4O 3SYPA 5J2TA 4GX1A 4MVMA 5LYJB 4MTXA 4DR1O 3G67A 4RWUA 2UUBB 3A8TA 1AR5A 3JD0A 2WLNA 4X1IB 2YI8A 2JGUA 1NZ6A 3OR6C 4I55B 1LNQA 3L72H 4JAAA 5EK0A 4P2ZA 4PDMA 1L8DA 4I0XB 5B3SB 1OCOB 1QCEA 3K5MA 3A0BZ 1KBHA 3ASOC 3G4SV 4LFBO 1Y76B 4WFFA 5C8YB 2LFSA 1R6TA 2EIMC 1V55B 1PM9A 1SA0A 5EC1C 2A9HA 2WPDG 1AB3A 2A06H 2GV9A 4LP8A 1S72V 1E79G 1YXBA 1XEQA 3FB6C 3SDLA 2XHBA 1K4CC 5IY5C 4NKGB 3HKCB 1FXKA 3TK1A 3ZCCA 3DGEA 3RYFB 4DK0A 1H8HG 1AI5A 5FLXN 2JEUA 1SQVH 1K5QA 4LF9B 2ODMA 1MSWD 2RJZA 3QO8A 4IYIA 3VQYA 4FLWA 2X7RB 4DV7O 3U11A 2PI5A 5J2UB 4MTFA 1VQ7V 4RO2A 3MHHC 2W0FC 3SGIA 2HFEC 2ATKC 4GLXA 2Q5ZA 4IHJB 5BMVA 5JQGA 1GAXA 1KC8W 2QM8A 3S3XA 2XOKG 2YXYA 3ASNC 3SPGA 4B3SO 1PNMA 1IBLB 5LMUO 3VBBA 4JI2O 5B1AC 5KX5B 1FFXB 5LA6B 3CCSV 4P9PA 3RYHA 2UU9B 2AXTZ 1TUEB 1WB7A 4R50A 2ADQB 3OUSA 1K73W 2WA4A 4K3AA 1KP3A 2IJKA 5ITZA 1NBMG 4HAMA 1Q81W 5L3GA 2DYRB 4LWSB 3RVYA 4AQYO 1MNGA 1R3JC 3JSNA 5EZYB 5IDJA 2Q8VA 4ZBMA 5LGUA 4QJFB 4KHPB 2E5LB 4I4TA 5B5EZ 1WA8B 3E35A 4FLVA 1YVWA 2UUBO 4UXNA 1ZUQA 4FLTA 3I55V 5B1BC 2WSSG 4FLUA 4K35A 1L0NH 3LDCA 3T4ZA 2HHHO 3RW0A 4UB6Z 4O2AB 2PYLA 3JARA 1F4NA 4TV9B 5FPRA 2ZXWC 2PI4A 1U96A 2OCCB 4PJ0Z 1SF9A 1WJZA 3SPHA 1HR0B 1SS3A 1SQPH 2IU3A 2WLLB 3A0RA 2JRIA 2ZINA 1BS3A 1XREA 2E75B 2FYUH 1PL4A 2CH7A 1I5XA 3ML0A 5JJJB 5LOVB 3JSLA 4X62O 4LF4O 3FKSG 1HNWB 2YEVA 3AG3C 4CH4A 1M1KW 2DMXA 2F4VB 2Q6AA 3OUFA 4KFMA 1QBZA 3E22A 2PTMA 2LGWA 3HKEB 1ZWIC 4QE9A 4EKWA 1MABG 4R8CA 2B9ZA 3TXQA 1N34B 1I94O 4N23A 4UFZA 5KMGA 3IAYA 1SQFA 1Q90D 2A79B 3RVZA 5IYZA 4FJCC 3T1YB 4LCUC 1Y66A 1XILA 1HP8A 3K79A 4NR1A 1Y6XA 2Q7GA 5IJ0A 3KCXA 2KQXA 1WB8A 2CGNA 1YDXA 4LC1A 4K0KB 1QU7A 3ZRWB 1VQOV 4KXRA 1QLNA 4D7TA 2E74B 3N2GB 3CXHF 1Z2GA 1KMIZ 5B3SC 1OCOC 2CTRA 5IJ9B 2DQ3A 3WB1A 1IXBA 1YIJV 2BOCC 1I5YA 1NS1A 4O4HB 2K9PA 5GONA 2EULA 1URFA 3HB3B 1SQXH 2AHZA 4JAUA 1L1FA 5BZBA 3F5WC 1JFFA 4PD4F 3FB8C 3T1CA 3K0DA 2JS3A 1V55C 3K5LA 1GN3A 2QKSA 3SJQC 1WPXA 1QVGU 3I5DA 1F23A 1MSDA 5KUKA 1R3LC 4O4LB 5IYBO 4XBFA 1OCCB 4MTOA 1F7YA 1KKDA 4ZOLB 1MZFA 2GUZA 4UVBA 2QTOA 3SPJA 5J2TB 2XASA 5TISZ 3L73H 1BZKA 3K5NA 4LF8B 1GN4A 3T4DA 4UCRA 4JI1O 5LL6Y 3RYIA 1T5EA 4X8AA 2KG7A 2JGDA 1Z5WA 2WLJA 1GM9A 1HNXB 4LF5B 1NH2D 2XAFA 3SJBC 5LYJA 1KECA 2Y0PA 2Q7HA 1OCZB 3BPZA 1DGSA 4X1IA 1K4DC 2PZSA 1BT8A 2Y0IA 3OMNB 4E4EA 3BEHA 2F23A 4I0XA 4X89A 1YJ9V 4TT3G 3ZX6A 2M7WA 2WLIA 3E83A 3M7MX 1RSOB 2FTKA 2LW7A 5LGTA 2JDIG 2KKWA 4GYCB 4J9ZB 2RMKB 1NQTA 1N34O 3UM7A 2GTAA 3BY6A 5LHHA 1FXKB 2ZM6B 1H2SB 5CA0B 2DYRC 1IVSA 3EXAA 3E8HA 2VWKA 2YICA 5CBFA 4N21A 4JGSA 4J41A 2Q9LA 3TJTA 4WF9V 4LF7B 3ZHUA 3HKCA 3JAMN 1B3QA 1NVPB 3RYFA 5H6QA 4YJ2A 4DR6B 1AR1B 2H8PC 4X64B 2LQTA 4FMTA 5JQGB 2AHYA 4DUZO 1JQ0A 2QR4A 4PHZA 4UV9A 4WBNA 3ETEA 5KA5A 2RCVA 1R73A 1DK1A 2OTLV 3RYHB 2GHYA 4QPJA 4FFKA 2XAGA 4DV2O 2DWDC 2B1IA 4IL6Z 2JJ1G 2EJRA 4JTAB 1FFXA 4PA7A 1CEZA 1J5EB 1VQLV 2JIZG 3U0ZA 1ENVA 2Q0AA 2Q69A 2OYQA 3ABLB 4DR5B 3JD2A 3OTFA 4WFEA 1VF6C 1S76D 3K08A 4LWSA 2QWNB 1XOUA 5EZYA 1FFTB 1Q82W 2F43G 3JARB 3T1HB 1SC5B 3P32A 1AVMA 4PA3A 1VMGA 1Y4MA 3ZMVA 4B3RB 4IGGA 2M6YA 1ZL8A 2ZIOA 2XNDG 4FZ0A 2IU0A 4ZI7A 4LF6O 3THOA 4O2AA 3SYCA 2EILB 5JJNB 4U3JB 2CH7B 4B7KA 1BMFG 1K3EA 4WCEV 4QNHB 1O9GA 2HVJC 3ZIAG 4IT5A 2WLLA 1R6KA 2RDCA 3QVNA 4ICGA 1TA8A 3ETQA 1M4UA 4MT8A 1N32O 2QSAA 4FFBB 4MS2A 2HP8A 3DC5A 3W7XA 3H1HH 2JJ2G 5IYZB 1OCCC 1VQ9V 2CE4A 3AG1B 4BWAA 2A3QA 3RWRD 3ETGA 3L71H 4HBNA 3D3QA 3N2KB 3K9AA 1QVFU 3K57A 1EFRG 3G6EV 1HNZO 2YS8A 2YXLA 5IJ0B 4TV8A 1FD9A 1S5LZ 2H3OA 4MVQA 1R3IC 2YIAA 1AP6A 3MHSC 1YTFB 2ZDIA 1BE3H 2QE7G 2KSDA 4GX5A 1X4TA 2GSMB 3W7SA 2N74A 1OCZC 4FLXA 2A0LA 5GONB 4UCSA 3K06A 2QA4V 1PL0A 2ILMA 3ICXA 5HFMA 1JPXA 5L3BA 3RBZA 1J5EO 1TUBA 4B3MO 5IJ9A 2YUAA 4NYKA 4FIPC 3IC7A 3ZN1A 2QWQB 1WNSA 4OX9O 4DUYB 4JI8B 1QR9A 1F51A 3CWBH 1N8RW 1FXKC 1XMOB 1PP9H 1I0HA 1XL6A 1OZ0A 4J11A 4XDKA 3W7WA 4B3TO 2ZQMA 4DV6O 2GUZB 5EIBC 4DO2A 3B2EE 3CD6V 1NJIW 3O65A 1BHBA 4KL1A 1FS0G 5K1XA 4X66O 1IBMO 4GKKB 5KHKA 3P30A 3TETA 4I7ZB 3E86A 4PI2A 3BRCA 3RYIB 1VARA 2F66C 4ZOLA 4NXNO 2KG7B 2JGDB 2OCHA 3JAWA 5CMUA 1ZTEA 4JI7O 4JI0B 2IJJA 4ASUG 2UUAB 4H44B 4UCOA 3BFRA 1KQSU 2Z3YA 4JV5B 1TGOA 2WWWA 4KUMA 1BQ0A 3DSQA 3G71V 4AILC 3ABMC 1S5HC 4LFCO 2CTWA 2WLIB 3S3WA 4JYBA 2ZE6A 3VQWA 4U7OA 4JI6B 2UXDO 1KYOF 2DJVA 4X9QA 2Q67A 3CCMV 1GK9A 3Q4HA 2Q73A 4GX0A 2DW4A 4LH7A 2UXCO 3OGCC 3R66A 1JVMA 2BTQB 1YF2A 5LMNB 1E1QG 1RSOA 1Q3EA 4PDLA 3QTCA 4HYOA 2L35A 3ABLC 3CPWU 5H5NA 1N33O 2A7WA 4MVOA 5CA0A 1YEWA 5L3DA 1MZEA 4YJ2B 4GCZA 3G80A 1RFYA 3WB2A 4P30A 4X65O 3P3PA 3ZMTA 4UCVA 1K9MW 5H6RA 1IBKB 3WU2Z 5FNVB 1M5IA 4DRXB 2ZNIA 4WBNB 1U97A 3B40A 2AW9A 2P7TC 3EFFK 3X2QB 5CB4B 4CS4A 4DV3O 2EILC 3HR0A 3J80N 3B4SA 4WFGA 2X0LA 1RPRA 5LHGA 1N4CA 1SESA 2BTOA 1XMOO 1Z5VA 5C93A 3CX5F 1XNRO 4PELA 3IGAC 4GUNA 3QNEA 1WN7A 4JI3B 4NTYA 1DF4A 4BIUA 3K3WA 3W7TA 3CMEV 4EEQA 2QWRB 2CTPA 3AG1C 4H0LB 1NTKH 4NB5A 4FPPA 2UUAO 4GKJB 4CS3A 3KG2A 4JV5O 1MA1A 5IT9N 3AG2B 1ZL8B 4DV5B 4ZI7B 4W4KA 3CRCA 4H37A 5BY1A 4AHCA 5LHIA 3STLC 2IH1C 2LO1A 4UV8A 4MSWC 4X88A 2Y4UA 2B1GA 2ETNA 4G28B 2F95B 2PY5A 1K97A 2HJFC 2PYJA 3AG7A 4U3JA 3B09A 1XMQB 2NLJC 4FK5C 3APQA 2YIBD 3WB0A 2W0XA 1QR8A 1VQ6V 4CZZA 2PUSA 3VQVA 3KKYA 1QLEB 3JASA 4J7KA 5BR8B 3LNMB 4G27B 4LF9O 1VQ4V 2QTSA 4FFBA 1XBLA 1Q86W 4TV8B 4PDVA 1IBKO 1B06A 2OTJV 1RPOA 1ZSPA 1DLBA 4B08A 3ZRXA 1H2MA 3N2KA 4P9OA 4YY3B 1XI1A 2HR3A 4RQEA 5KHHA 2HEPA 1IBLO 3C3TA 2R70A 3VQXA 1IZ3A 2D3OW 4JTCB 4ABMA 4U7NA 1TUBB 2N05A 1VIBA 4DV0B 3BVOA 2UU9O 2WAMA 3LSUA 1H8EG 2VRZA 2QGNA 4J42A 5GTHZ 1IXMA 4FLYA 3L70H 3L9DA 3GB7C 2UUCB 2L6LA 4DW1A 2Y48A 2P22C 3ZHRA 1UPGA 3CS5A 2YIDA 5H2FZ 4KHPO 4Z1MG 2E5LO 4B7EA 3JCZA 3K0GA 2FMLA 4RUFA 2V7QG 3RT3C 1Y67A 3D3IA 1YZBA 2LJ2A 2UXXA 3JAWB 3UO2A 5IE9A 3CC7V 3F7VC 1P4RA 3ZBHA 4J9YB 3HPLC 3CB2A 1GO3F 5E79Z 1YSCA 4DR4B 1NI8A 5IYCO 1WPBA 4L87A 1NR7A 1X59A 1HR0O 4UCTA 5JWPA 1V9PA 5LGNA 2YDEA 2OWOA 5F2VO 1EM1A 4ZHQA 1D5AA 3OM3B 2B5UA 3GWKC 1OCRB 2YXHA 1HNWO 1N36B 3ABTA 4R7CA 2XAJA 2VWJA 2QEXV 3Q4HB 2F4VO 3PN1A 2HLDG 2QKAA 5IWAB 2GTSA 1PV0A 1XNQB 5BR8O 1FAFA 2YC0A 1W59A 1R6NA 4O4JB 3H1LH 2JK5C 3K9SA 4DV1B 1FPOA 1YCIA 2W6IG 5J9PC 4E2LA 2EBOA 3G6BA 3T1YO 1VQKV 3JATA 3CCLV 2K1EA 3CEIA 1M56B 4GX2A 2BTQA 2CK3G 3BA8A 1MOFA 1CXZB 4WFHA 2VQFB 3FD9A 3LDEA 2CUGA 4YHHB 1LR1A 1I7FA 3AG2C 2VQEB 4K0KO 4MVRA 1SKVA 4YIPA 1NR1A 3ZHQA 1FJGB 2CAZC 1QHTA 4DR2B 3CHXA 5LXTB 1SETA 2OCCC 5FNVA 4DRXA 2ZCEA 3C90A 5KHIA 1EN4A 5L3CA 1PKXA 2N04A 5KUMA 2UUCO 5CB4A 3OEEG 3BCCH 3OTOB 5JJEB 2UXBB 3IJ4A 1VF7A 2WA3A 4MVZA 2X6BA 1M90W 4QE7A 3ZJZA 2HKOA 3RN4A 3WG7B 1GM8A 5EBMC 1R3KC 2RQ6A 3C3SA 5GW7A 1JMKC 3CCEV 1EN6A 1K92A 1Q6HA 2YI9A 1AI4A 1YJWV 4LF8O 1XUQA 4GT1A 1LUWA 4TQFA 4UVAA 4Q20A 2OT5A 3CP1A 4PDRA 5DECA 1Y74A 4K8XA 4DXWA 1JJ2U 2WLMA 4H33A 4YJ3B 1HNXO 4LF5O 3KCYA 1FXVA 2ZDIC 2HVKC 1DTOA 4TUYB 1N36O 1QQCA 3AEIA 4NXMB 2AZ0A 4PA4A 1FKAO 3M99B 4NTWA 4LFAB 4UB8Z 2YSUB 3B77A 2RN9A 1NH2B 2IW5A 1US6A 5BXZA 3GVMA 4JASA 4TOIA 1M57B 3FYEB 4LNUA 2P5OA 3MAQA 2ZM6O 4JI4B 2EX3A 2Z0AA 1A32A 2H94A 3JASB 4QIWF 3MD0A 4JI5B 4EFEA 3STZC 1SERA 5KLVH 5JCOA 4LF7O 2ADPA 3CC2V 4JYCA 4JZGA 1L0LH 5B1AB 4BR6A 3KZIZ 3E8BA 2VQEO 2R72A 4DR6O 2QM4A 5LP6A 3SR2C 4X64O 3CCJV 4LFBB 3M8AA 4IIJA 4DR2O 2Q4PA 4O2BB 3JALA 3LUTB 1GKFA 5FPOA 3R65A 2UXNA 5D5QA 1WAZA 1K7DA 4JZ2A 2EIKB 4X20A 4YIOA 1OCRC 2XAQA 4DV4B 2R9AA 3AG4B 3JYCA 4JTDB 2X6AA 4PA6A 5KHJA 1Q5OA 1W2BU 1P49A 4RAIA 4LR3A 4Q6GA 4MTGA 5EC2C 3SYQA 2ZXWB 4F6EA 4DV7B 4DR5O 4CC5A 1SQBH 4FM2A 5D5PA 3CJHA 2P06A 5A2QN 2DN9A 1M56C 4FM1A 3LSQA 1Q6UA 1NTMH 4X1YB 3OMIB 4HZ3A 4YXWG 3T1HO 4B3SB 5LMUB 2EINB 4B3RO 2NN4A 1AILA 3UQ8A 3ABKB 4NXMO 3CSXA 3QG5A 3DXRB 5CBGA 1BSMA 5EBWC 2P6JA 4ZHQB 2ZT9B 4JYAB 3CC4V 3RYCA 5KA6A 4JAVA 1CPYA 1KD1W 4Z1VA 5CBHA 1D2DA 3A0HZ 2DOSA 5JVDB 3B8MA 4UVCA 1G8MA 5L3EA 2Z5UA 4JI5O 2WLHA 2ZD9A 2ZE7A 1EBOA 2CTQA 1F4MA 3WG7C 3OEHG 4I5SA 3BA9A 2LW1A 3U10A 1RP3B 2HHHB 4A5UB 3JATB 4D7SA 2F93B 2EJ7A 1THZA 2MK3A 1VF5B 2ZR3A 4BIZA 4O4JA 1COWG 3CRRA 2ZNJA 3UO3A 2AGAA 4EB6B 1NTZH 2YIBA 2E3CA 3BABA 4Z2WA 4CBCA 2JS5A 2ITDC 1OJHA 3EVKA 2DE0X 1SRYA 2EZOA 3ZN0A 3RGBA 4X62B 4LF4B 2D2CB 1H38A 4DV4O 3J81N 2ZIMA 3NR7A 1DF5A 5EYPB 3ZS8C 5CN0A 1I94B 5LXTA 1GN2A 3UT5B 1BCCH 1NKDA 4DUYO 4JI8O 1M57C 1P7GA 4X1KA 2HJDA 3SPCA 4C7UA 3HKDB 3H1KH 3SJCC 4RUEA 3OD4A 5E1AC 3FAVA 2JEXA 3H1IH 4GKKO 3CCRV 1QNMA 2P4KA 1Y74B 4JI0O 4F4LA 1KP2A 4EFBA 4XDLA 1JCHA 2BSKB 3CRMA 1YITV 4JYAO 1SZTA 3ZHSA 3E89A 4I9WA 1TVKB 4IYHA 3OT7A 1RM1B 2IH3C 4YJ3A 3N27A 3O9OA 3ZHTA 3FFQA 5JH7A 3AK3A 3ETDA 3FB5C 2EIKC 2QWPB 3MDSA 4JF3A 3J7AU 3HKBB 4TUYA 4JI6O 3CMAV 3E8GA 2NNUA 4LNUB 2Q0OC 3AG4C 4HNAB 3CXCU 2IM9A 1N0JA 4OPHA 5LMNO 3CE2A 4GZRB 2G38A 4MW8A 4BW9A 4TQDA 1E1RG 2IJHA 2ZE5A 4JI1B 4DR7B 3H9VA 3CCUV 4H13B 5KAFZ 3IC9A 4PI0A 5DM6V 5H9CA 5LP6B 1V54B 1JOYA 5HFLA 5CA1A 4IIJB 1B04A 4DW0A 4J80A 2EINC 2BE3A 3JALB 3UKMA 1OHHG 1SQGA 3ABKC 4R6ZA 4CH5A 5EIBD 5B66Z 1GN6A 4WFBV 5EBLC 4FLZA 1CP9A 1VQ5V 1XHXA 3QF7A 5CA3A 5FL7G 4X20B 4O2BA 1EZVH 2P4VA 3F5TA 4O4IB 5AG2A 1NVPD 2LGQA 4CS2A 1PD3A 4QGPA 2R9IA 3WFVA 1TAEA 1G6UA 1XL4A 3DC6A 3K58A 3PJSK 3FX7A 1O9HA 4JI3O 1NT2B 1G1XB 4TSFG 4I50B 3CJHB 5A9GA 4RQFA 1ROPA 4LBEC 1P84F 1FXHA 1AI6A 4JPRA 1GM7A 4DUZB 4GKJO 2MW2B 2E76B 5IYDO 2Y69B 1R1BA 4OGQB 5DN6G 3ZHVA 1ZX3A 2EIJB 4DV5O 2WLKA 3DTUB 4DV2B 4XDJA 1EZJA 4X1YA 3K04A 2IBZH 1W0KG 1WP8A 3D36C 3RYCB 1GRJA 3ABUA 1VQMV 1IX9A
chains in the Genus database with same CATH topology
4ZOLA 2E5LB 4I4TA 3JAWA 4JI0B 4TUYB 4FLVA 4I9QA 1QQCA 2UUAB 4NXMB 4FLTA 4UCOA 4FLUA 4JV5B 4DK1A 4UCUA 4LFAB 1TGOA 4O2AB 2PYLA 3JARA 4TV9B 4F6RA 3JAKA 3DSQA 4TOIA 5FPRA 1Q8IA 4AILC 2PGGA 5JVDA 3RFRA 4LNUA 2P5OA 3MAQA 1HR0B 2EX3A 4JI4B 3VQWA 4JI6B 2ZINA 3JASB 5JJJB 4I55A 5LOVB 3BAAA 4JI5B 4EFEA 4LF6B 4LH7A 3JSLA 1HNWB 5JCOA 2BTQB 5LMNB 1SA0B 4CH4A 1RSOA 1Q3EA 2F4VB 3QTCA 3E22A 1S5JA 2PTMA 2R72A 5C8YA 4EB6A 2QM4A 4NVPA 3HKEB 5LP6A 2Q7EA 3SR2C 1JJOA 4LFBB 5CA0A 1YEWA 4YJ2B 4IIJA 1N34B 5K1PA 3WB2A 4O2BB 3IAYA 4UFZA 5KMGA 1SQFA 3JALA 5IYZA 5FPOA 3T1YB 1N32B 2V4DA 5D5QA 4UCVA 1M93A 1IBKB 5FNVB 1M5IA 4DRXB 2ZNIA 2F1MA 4WBNB 4X1KB 4X20A 5CB4B 2Q7GA 4CS4A 5IJ0A 4DV4B 5EYPA 2R9AA 5BMVB 4K0KB 3UT5A 1HNZB 4D7TA 3N2GB 5KHJA 1Q5OA 1KMIZ 5JCOC 1P49A 5J2UA 5IJ9B 4LR3A 3WB1A 4Q6GA 4L8JA 2BTOA 3HKDA 4DR3B 1Z5VA 4O4HB 4DV7B 4IHJA 5GONA 4CC5A 4FM2A 5LP6C 5D5PA 1JFFA 4K8ZA 1ZAUA 3K5LA 1WN7A 4JI3B 4CH6A 4FVMA 4ZIBA 4FM1A 4EEQA 5ITZB 4LH6A 5KX5A 3LNNA 5LA6A 4X1YB 4B3SB 4FM0A 1XQ8A 5LMUB 4O4LB 4B3MB 5JH7B 3UQ8A 3CSXA 4ZOLB 4I4TB 3QG5A 4GKJB 4OX9B 4CS3A 5J2TB 1TVKA 4ZHQB 4JYAB 2QJ1A 4DV5B 3K5NA 4B3TB 4ZI7B 4LF8B 3RYCA 4DV6B 4UCRA 3RYIA 1T5EA 4AHCA 4X66B 1IBMB 1Z5WA 3HKBA 1HNXB 2F95B 2PY5A 4LF5B 1Q43A 5JVDB 4NXNB 4HNAA 3SJBC 5LYJA 2PYJA 4JI7B 2Q7HA 3BPZA 1DGSA 4X1IA 4U3JA 1XMQB 2PZSA 4TV9A 3BA9A 3U10A 4DR1B 2HHHB 4D7SA 3JATB 5CA1B 2F93B 1XHZA 2YIBD 3WB0A 3M7MX 2KKWA 4O4JA 2PUSA 4GYCB 3VQVA 5KHGA 2ZNJA 3E22B 4LFCB 4EB6B 3JASA 5BR8B 3BHPA 2YIBA 2E3CA 5LOVA 2ZM6B 1H2SB 3BABA 5CA0B 2JS5A 4FFBA 2UXDB 2VWKA 4TV8B 5KMGB 4CH3A 3RGBA 2UXCB 4X62B 4LF4B 4LF7B 4B08A 4CC6A 3HKCA 3HKEA 3N2KA 3RYFA 4YY3B 2ZIMA 4YJ2A 1XI1A 4DR6B 1N33B 5KHHA 4O4IA 1HW7A 2HEPA 5EYPB 4X64B 3SJAC 5JQGB 2R70A 3VQXA 3ZS8C 2JVDA 1I94B 5LXTA 3UT5B 4DV0B 1TUBB 4PHZA 4X65B 3ZEDA 4WBNA 4X1KA 3HKDB 3K59A 3SJCC 3RYHB 4FLYA 4I50A 1JFFB 2UUCB 4DV3B 2P22C 3N2GA 1FFXA 1J5EB 4O4HA 4JI2B 4EFBA 3U0ZA 2Q0AA 2OYQA 4DR5B 3JAWB 1XNRB 3OTFA 3K5OA 1KU9A 3CB2A 1TVKB 4O4LA 4DR4B 4YJ3A 5EZYA 3FFQA 1WPBA 5JH7A 3A2FA 3JARB 4F6RB 3T1HB 3JAKB 4AQYB 4UCTA 1V9PA 3HKBB 4TUYA 5J2TA 4B3RB 2OWOA 4ZHQA 2ZIOA 1D5AA 4LNUB 4HNAB 2IM9A 5LYJB 4ZI7A 2UUBB 3THOA 4O2AA 1N36B 4X1IB 5JJNB 4U3JB 2YI8A 2JGUA 2VWJA 4I55B 4BW9A 4TQDA 3PN1A 4JI1B 5IWAB 4DR7B 1L8DA 1O9GA 1XNQB 3K5MA 4O4JB 4PI0A 5C8YB 4DV1B 1TA8A 5LP6B 3ETQA 1M4UA 5CA1A 3JATA 4IIJB 4FFBB 2BTQA 3BA8A 1B04A 1SA0A 2GV9A 3JALB 5IYZB 1SQGA 4BWAA 2VQFB 2XHBA 3RWRD 4CH5A 5EIBD 3HKCB 4HBNA 4YHHB 3N2KB 1I7FA 2VQEB 4FLZA 3RYFB 4DK0A 1XHXA 3K57A 3QF7A 4X20B 4O2BA 1SKVA 2YXLA 5IJ0B 4TV8A 4O4IB 1FJGB 4LF9B 4CS2A 2CAZC 2RJZA 3VQYA 4FLWA 1QHTA 1TAEA 4DR2B 3CHXA 5LXTB 1G6UA 2YIAA 3U11A 5FNVA 4DRXA 5J2UB 3K58A 2ZCEA 5KHIA 3SGIA 5CB4A 1X4TA 3OTOB 5JJEB 4FLXA 4GLXA 1O9HA 4IHJB 5GONB 4UCSA 1NT2B 5BMVA 2UXBB 5JQGA 3ICXA 1VF7A 4I50B 1TUBA 1IBLB 5IJ9A 5KX5B 1FFXB 5LA6B 4DUZB 2RQ6A 1WNSA 3RYHA 4DUYB 4JI8B 2UU9B 1JMKC 1XMOB 2YI9A 4TQFA 5ITZA 4DV2B 5EIBC 3B2EE 4X1YA 4KL1A 5K1XA 4K8XA 4GKKB 5KHKA 3RYCB 3JSNA 4PI2A 4YJ3B 3BRCA 3RYIB 5EZYB 2F66C 4KHPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYC B;  2F95 B;  2F1M A;  5D5P A;  5JJE B;  4DK0 A;  1H2S B;  1VF7 A;  5JJJ B;  3WB2 A;  4DK1 A;  5JJN B;  3LNN A;  1T5E A;  5D5Q A;  2F93 B;  2V4D A;  3BRC A;  3WB1 A;  1RSO A;  4L8J A;  3WB0 A; 
#chains in the Genus database with same CATH topology
 5L3F A;  3DXR A;  2NR5 A;  3OGI B;  3X2Q C;  4I9Q A;  3QO7 A;  1XMQ O;  1KB9 F;  1YHQ V;  2OIE A;  3AK1 A;  4DK1 A;  4UCU A;  2LFR A;  3FB7 C;  4DR7 O;  2Y4T A;  3TGU H;  3E8F A;  1AP5 A;  1I08 A;  4F6R A;  2FL4 A;  3JAK A;  2P67 A;  3JD1 A;  3T2M A;  2XT9 A;  3CCQ V;  1Q8I A;  2DYS B;  2PGG A;  5JVD A;  3RFR A;  1PNL A;  1IDS A;  3IFX A;  4BAY A;  1GTO A;  1YJN V;  3VOU A;  1JR9 A;  1Q7Y W;  4I55 A;  3BAA A;  3ZMS A;  4LF6 B;  2CDY A;  1SA0 B;  2QKC A;  5LBQ A;  4YY3 O;  2P90 A;  1S5J A;  3GWO A;  1Y76 A;  4EB6 A;  5C8Y A;  4NVP A;  1PPJ H;  2Q7E A;  5B1N A;  1JJO A;  1WP7 A;  3ZMU A;  1RM1 C;  5K1P A;  4DV0 O;  1VEW A;  4BIO A;  4J7J A;  1PNK A;  3D36 A;  3ZMZ A;  1N32 B;  1BHA A;  2V4D A;  1AJQ A;  1M93 A;  1YI2 V;  3UCS C;  1W0J G;  1SZX A;  2F1M A;  1H2L A;  4MVS A;  5KAI Z;  4X1K B;  5EYP A;  4U3F H;  1K8A W;  1YTF D;  3LSS A;  3LDD A;  1M9N A;  3FAV B;  5BMV B;  2ZKO A;  2DWE C;  3UT5 A;  1HNZ B;  2XTA A;  1BL8 A;  1AJP A;  1ARO P;  3JD3 A;  4AI8 A;  5JCO C;  5J2U A;  2VS0 A;  3CCV V;  4OXS A;  1VQP V;  4L8J A;  3HKD A;  3L74 H;  5B1O A;  4DR3 B;  2XUM A;  3JD4 A;  4IHJ A;  1QLE C;  2LP7 A;  3ABM B;  3SYO A;  4ZKI A;  1WLE A;  3APO A;  5LP6 C;  3ASO B;  1SQQ H;  4K8Z A;  1ZAU A;  1V54 C;  4W4L A;  4PV1 B;  2DQ0 A;  1S3J A;  4UUJ C;  2KB1 A;  4DR4 O;  4CH6 A;  4FVM A;  4ZIB A;  1LUV A;  5ITZ B;  4QPK A;  4LH6 A;  2O57 A;  2EIM B;  3LNN A;  5KX5 A;  5DED A;  1IUR A;  2X6C A;  5LA6 A;  1B6Q A;  3AK2 A;  4TWK A;  4FM0 A;  1XQ8 A;  4B3M B;  1KKC A;  3ZRS A;  3SPI A;  5JH7 B;  3OE7 G;  3OW2 U;  2BSK A;  1N0N A;  4DYL A;  4I4T B;  5IY5 B;  4OX9 B;  1K5S A;  1UJW B;  4WFA V;  4G2K A;  1TVK A;  1P7B A;  2QJ1 A;  4B3T B;  1ZLZ A;  4DV6 B;  2QWO B;  2Q68 A;  1VQN V;  5IWA O;  2C2A A;  3H01 A;  1ORQ C;  1BGY H;  1XNQ O;  1K33 A;  4X66 B;  1J95 A;  2ARH A;  1IBM B;  2PF4 E;  3HKB A;  5GTI Z;  1WA8 A;  1HWY A;  2OIG A;  3OR7 C;  4DV1 O;  1Q43 A;  2FB5 A;  4NXN B;  4HNA A;  1K34 A;  3ZRV A;  1HDJ A;  1MG1 A;  4JI7 B;  2W6J G;  2FKX A;  4D6T H;  2BOB C;  4NTX A;  4TV9 A;  4DR1 B;  2QDO A;  3ASN B;  5CA1 B;  2VQF O;  1H2N A;  2YEV B;  1XHZ A;  3EHB B;  1G4Y B;  2Y69 C;  3L75 H;  4YHH O;  4KP4 A;  1VP7 A;  3I56 V;  2CGO A;  2IJI A;  5KHG A;  2XAH A;  1AR4 A;  2EZP A;  3E22 B;  2EIJ C;  4OPA A;  4LFC B;  3P3N A;  3BHP A;  2HG5 C;  1Q6I A;  3TCU A;  5LOV A;  1FJG O;  3NXS A;  1S77 D;  1OV9 A;  3B8N A;  2GDS A;  2UXD B;  2QM7 A;  3OAA G;  5KMG B;  1EN5 A;  4J7Z A;  4CH3 A;  2UXC B;  1JX9 A;  4CC6 A;  3HKE A;  3OTO O;  1D5N A;  1H2K A;  2UXB O;  1N33 B;  4O4I A;  1HW7 A;  3W7U A;  1GH6 A;  1VF6 A;  5B1B B;  3CYO A;  3SJA C;  1XDC A;  2JVD A;  3FYI B;  4MW3 A;  1KUQ A;  3QO5 A;  1AJN A;  1GMG A;  4DR3 O;  2DYS C;  1H2G A;  4X65 B;  4JYY A;  3ZED A;  1MMM A;  2BCC H;  3K59 A;  2GBO A;  3OFN G;  3JCU Z;  2V1D A;  1AI7 A;  4I50 A;  1JFF B;  3ZRW A;  3CRA A;  3D8C A;  3SYA A;  4DV3 B;  3N2G A;  3OMA B;  1S0V A;  3K03 A;  3H1J H;  4O4H A;  2AZ2 A;  3AG3 B;  4JI2 B;  3F7Y C;  2ZE8 A;  1UFI A;  2ITC C;  1JA8 A;  1XNR B;  1FYJ A;  2R9R B;  4J10 A;  3E2E A;  4LFA O;  4BW5 A;  1BQZ A;  3K5O A;  1KU9 A;  4PA9 A;  4FZ1 A;  2RNB A;  2ZR2 A;  4O4L A;  4MVU A;  1NU1 H;  3A2F A;  1VQ8 V;  3CRQ A;  4F6R B;  3JAK B;  4AQY B;  3TXS A;  4JI4 O;  3SYP A;  5J2T A;  4GX1 A;  4MVM A;  5LYJ B;  4MTX A;  4DR1 O;  3G67 A;  4RWU A;  2UUB B;  3A8T A;  1AR5 A;  3JD0 A;  2WLN A;  4X1I B;  2YI8 A;  2JGU A;  1NZ6 A;  3OR6 C;  4I55 B;  1LNQ A;  3L72 H;  4JAA A;  5EK0 A;  4P2Z A;  4PDM A;  1L8D A;  4I0X B;  5B3S B;  1OCO B;  1QCE A;  3K5M A;  3A0B Z;  1KBH A;  3ASO C;  3G4S V;  4LFB O;  1Y76 B;  4WFF A;  5C8Y B;  2LFS A;  1R6T A;  2EIM C;  1V55 B;  1PM9 A;  1SA0 A;  5EC1 C;  2A9H A;  2WPD G;  1AB3 A;  2A06 H;  2GV9 A;  4LP8 A;  1S72 V;  1E79 G;  1YXB A;  1XEQ A;  3FB6 C;  3SDL A;  2XHB A;  1K4C C;  5IY5 C;  4NKG B;  3HKC B;  1FXK A;  3TK1 A;  3ZCC A;  3DGE A;  3RYF B;  4DK0 A;  1H8H G;  1AI5 A;  5FLX N;  2JEU A;  1SQV H;  1K5Q A;  4LF9 B;  2ODM A;  1MSW D;  2RJZ A;  3QO8 A;  4IYI A;  3VQY A;  4FLW A;  2X7R B;  4DV7 O;  3U11 A;  2PI5 A;  5J2U B;  4MTF A;  1VQ7 V;  4RO2 A;  3MHH C;  2W0F C;  3SGI A;  2HFE C;  2ATK C;  4GLX A;  2Q5Z A;  4IHJ B;  5BMV A;  5JQG A;  1GAX A;  1KC8 W;  2QM8 A;  3S3X A;  2XOK G;  2YXY A;  3ASN C;  3SPG A;  4B3S O;  1PNM A;  1IBL B;  5LMU O;  3VBB A;  4JI2 O;  5B1A C;  5KX5 B;  1FFX B;  5LA6 B;  3CCS V;  4P9P A;  3RYH A;  2UU9 B;  2AXT Z;  1TUE B;  1WB7 A;  4R50 A;  2ADQ B;  3OUS A;  1K73 W;  2WA4 A;  4K3A A;  1KP3 A;  2IJK A;  5ITZ A;  1NBM G;  4HAM A;  1Q81 W;  5L3G A;  2DYR B;  4LWS B;  3RVY A;  4AQY O;  1MNG A;  1R3J C;  3JSN A;  5EZY B;  5IDJ A;  2Q8V A;  4ZBM A;  5LGU A;  4QJF B;  4KHP B;  2E5L B;  4I4T A;  5B5E Z;  1WA8 B;  3E35 A;  4FLV A;  1YVW A;  2UUB O;  4UXN A;  1ZUQ A;  4FLT A;  3I55 V;  5B1B C;  2WSS G;  4FLU A;  4K35 A;  1L0N H;  3LDC A;  3T4Z A;  2HHH O;  3RW0 A;  4UB6 Z;  4O2A B;  2PYL A;  3JAR A;  1F4N A;  4TV9 B;  5FPR A;  2ZXW C;  2PI4 A;  1U96 A;  2OCC B;  4PJ0 Z;  1SF9 A;  1WJZ A;  3SPH A;  1HR0 B;  1SS3 A;  1SQP H;  2IU3 A;  2WLL B;  3A0R A;  2JRI A;  2ZIN A;  1BS3 A;  1XRE A;  2E75 B;  2FYU H;  1PL4 A;  2CH7 A;  1I5X A;  3ML0 A;  5JJJ B;  5LOV B;  3JSL A;  4X62 O;  4LF4 O;  3FKS G;  1HNW B;  2YEV A;  3AG3 C;  4CH4 A;  1M1K W;  2DMX A;  2F4V B;  2Q6A A;  3OUF A;  4KFM A;  1QBZ A;  3E22 A;  2PTM A;  2LGW A;  3HKE B;  1ZWI C;  4QE9 A;  4EKW A;  1MAB G;  4R8C A;  2B9Z A;  3TXQ A;  1N34 B;  1I94 O;  4N23 A;  4UFZ A;  5KMG A;  3IAY A;  1SQF A;  1Q90 D;  2A79 B;  3RVZ A;  5IYZ A;  4FJC C;  3T1Y B;  4LCU C;  1Y66 A;  1XIL A;  1HP8 A;  3K79 A;  4NR1 A;  1Y6X A;  2Q7G A;  5IJ0 A;  3KCX A;  2KQX A;  1WB8 A;  2CGN A;  1YDX A;  4LC1 A;  4K0K B;  1QU7 A;  3ZRW B;  1VQO V;  4KXR A;  1QLN A;  4D7T A;  2E74 B;  3N2G B;  3CXH F;  1Z2G A;  1KMI Z;  5B3S C;  1OCO C;  2CTR A;  5IJ9 B;  2DQ3 A;  3WB1 A;  1IXB A;  1YIJ V;  2BOC C;  1I5Y A;  1NS1 A;  4O4H B;  2K9P A;  5GON A;  2EUL A;  1URF A;  3HB3 B;  1SQX H;  2AHZ A;  4JAU A;  1L1F A;  5BZB A;  3F5W C;  1JFF A;  4PD4 F;  3FB8 C;  3T1C A;  3K0D A;  2JS3 A;  1V55 C;  3K5L A;  1GN3 A;  2QKS A;  3SJQ C;  1WPX A;  1QVG U;  3I5D A;  1F23 A;  1MSD A;  5KUK A;  1R3L C;  4O4L B;  5IYB O;  4XBF A;  1OCC B;  4MTO A;  1F7Y A;  1KKD A;  4ZOL B;  1MZF A;  2GUZ A;  4UVB A;  2QTO A;  3SPJ A;  5J2T B;  2XAS A;  5TIS Z;  3L73 H;  1BZK A;  3K5N A;  4LF8 B;  1GN4 A;  3T4D A;  4UCR A;  4JI1 O;  5LL6 Y;  3RYI A;  1T5E A;  4X8A A;  2KG7 A;  2JGD A;  1Z5W A;  2WLJ A;  1GM9 A;  1HNX B;  4LF5 B;  1NH2 D;  2XAF A;  3SJB C;  5LYJ A;  1KEC A;  2Y0P A;  2Q7H A;  1OCZ B;  3BPZ A;  1DGS A;  4X1I A;  1K4D C;  2PZS A;  1BT8 A;  2Y0I A;  3OMN B;  4E4E A;  3BEH A;  2F23 A;  4I0X A;  4X89 A;  1YJ9 V;  4TT3 G;  3ZX6 A;  2M7W A;  2WLI A;  3E83 A;  3M7M X;  1RSO B;  2FTK A;  2LW7 A;  5LGT A;  2JDI G;  2KKW A;  4GYC B;  4J9Z B;  2RMK B;  1NQT A;  1N34 O;  3UM7 A;  2GTA A;  3BY6 A;  5LHH A;  1FXK B;  2ZM6 B;  1H2S B;  5CA0 B;  2DYR C;  1IVS A;  3EXA A;  3E8H A;  2VWK A;  2YIC A;  5CBF A;  4N21 A;  4JGS A;  4J41 A;  2Q9L A;  3TJT A;  4WF9 V;  4LF7 B;  3ZHU A;  3HKC A;  3JAM N;  1B3Q A;  1NVP B;  3RYF A;  5H6Q A;  4YJ2 A;  4DR6 B;  1AR1 B;  2H8P C;  4X64 B;  2LQT A;  4FMT A;  5JQG B;  2AHY A;  4DUZ O;  1JQ0 A;  2QR4 A;  4PHZ A;  4UV9 A;  4WBN A;  3ETE A;  5KA5 A;  2RCV A;  1R73 A;  1DK1 A;  2OTL V;  3RYH B;  2GHY A;  4QPJ A;  4FFK A;  2XAG A;  4DV2 O;  2DWD C;  2B1I A;  4IL6 Z;  2JJ1 G;  2EJR A;  4JTA B;  1FFX A;  4PA7 A;  1CEZ A;  1J5E B;  1VQL V;  2JIZ G;  3U0Z A;  1ENV A;  2Q0A A;  2Q69 A;  2OYQ A;  3ABL B;  4DR5 B;  3JD2 A;  3OTF A;  4WFE A;  1VF6 C;  1S76 D;  3K08 A;  4LWS A;  2QWN B;  1XOU A;  5EZY A;  1FFT B;  1Q82 W;  2F43 G;  3JAR B;  3T1H B;  1SC5 B;  3P32 A;  1AVM A;  4PA3 A;  1VMG A;  1Y4M A;  3ZMV A;  4B3R B;  4IGG A;  2M6Y A;  1ZL8 A;  2ZIO A;  2XND G;  4FZ0 A;  2IU0 A;  4ZI7 A;  4LF6 O;  3THO A;  4O2A A;  3SYC A;  2EIL B;  5JJN B;  4U3J B;  2CH7 B;  4B7K A;  1BMF G;  1K3E A;  4WCE V;  4QNH B;  1O9G A;  2HVJ C;  3ZIA G;  4IT5 A;  2WLL A;  1R6K A;  2RDC A;  3QVN A;  4ICG A;  1TA8 A;  3ETQ A;  1M4U A;  4MT8 A;  1N32 O;  2QSA A;  4FFB B;  4MS2 A;  2HP8 A;  3DC5 A;  3W7X A;  3H1H H;  2JJ2 G;  5IYZ B;  1OCC C;  1VQ9 V;  2CE4 A;  3AG1 B;  4BWA A;  2A3Q A;  3RWR D;  3ETG A;  3L71 H;  4HBN A;  3D3Q A;  3N2K B;  3K9A A;  1QVF U;  3K57 A;  1EFR G;  3G6E V;  1HNZ O;  2YS8 A;  2YXL A;  5IJ0 B;  4TV8 A;  1FD9 A;  1S5L Z;  2H3O A;  4MVQ A;  1R3I C;  2YIA A;  1AP6 A;  3MHS C;  1YTF B;  2ZDI A;  1BE3 H;  2QE7 G;  2KSD A;  4GX5 A;  1X4T A;  2GSM B;  3W7S A;  2N74 A;  1OCZ C;  4FLX A;  2A0L A;  5GON B;  4UCS A;  3K06 A;  2QA4 V;  1PL0 A;  2ILM A;  3ICX A;  5HFM A;  1JPX A;  5L3B A;  3RBZ A;  1J5E O;  1TUB A;  4B3M O;  5IJ9 A;  2YUA A;  4NYK A;  4FIP C;  3IC7 A;  3ZN1 A;  2QWQ B;  1WNS A;  4OX9 O;  4DUY B;  4JI8 B;  1QR9 A;  1F51 A;  3CWB H;  1N8R W;  1FXK C;  1XMO B;  1PP9 H;  1I0H A;  1XL6 A;  1OZ0 A;  4J11 A;  4XDK A;  3W7W A;  4B3T O;  2ZQM A;  4DV6 O;  2GUZ B;  5EIB C;  4DO2 A;  3B2E E;  3CD6 V;  1NJI W;  3O65 A;  1BHB A;  4KL1 A;  1FS0 G;  5K1X A;  4X66 O;  1IBM O;  4GKK B;  5KHK A;  3P30 A;  3TET A;  4I7Z B;  3E86 A;  4PI2 A;  3BRC A;  3RYI B;  1VAR A;  2F66 C;  4ZOL A;  4NXN O;  2KG7 B;  2JGD B;  2OCH A;  3JAW A;  5CMU A;  1ZTE A;  4JI7 O;  4JI0 B;  2IJJ A;  4ASU G;  2UUA B;  4H44 B;  4UCO A;  3BFR A;  1KQS U;  2Z3Y A;  4JV5 B;  1TGO A;  2WWW A;  4KUM A;  1BQ0 A;  3DSQ A;  3G71 V;  4AIL C;  3ABM C;  1S5H C;  4LFC O;  2CTW A;  2WLI B;  3S3W A;  4JYB A;  2ZE6 A;  3VQW A;  4U7O A;  4JI6 B;  2UXD O;  1KYO F;  2DJV A;  4X9Q A;  2Q67 A;  3CCM V;  1GK9 A;  3Q4H A;  2Q73 A;  4GX0 A;  2DW4 A;  4LH7 A;  2UXC O;  3OGC C;  3R66 A;  1JVM A;  2BTQ B;  1YF2 A;  5LMN B;  1E1Q G;  1RSO A;  1Q3E A;  4PDL A;  3QTC A;  4HYO A;  2L35 A;  3ABL C;  3CPW U;  5H5N A;  1N33 O;  2A7W A;  4MVO A;  5CA0 A;  1YEW A;  5L3D A;  1MZE A;  4YJ2 B;  4GCZ A;  3G80 A;  1RFY A;  3WB2 A;  4P30 A;  4X65 O;  3P3P A;  3ZMT A;  4UCV A;  1K9M W;  5H6R A;  1IBK B;  3WU2 Z;  5FNV B;  1M5I A;  4DRX B;  2ZNI A;  4WBN B;  1U97 A;  3B40 A;  2AW9 A;  2P7T C;  3EFF K;  3X2Q B;  5CB4 B;  4CS4 A;  4DV3 O;  2EIL C;  3HR0 A;  3J80 N;  3B4S A;  4WFG A;  2X0L A;  1RPR A;  5LHG A;  1N4C A;  1SES A;  2BTO A;  1XMO O;  1Z5V A;  5C93 A;  3CX5 F;  1XNR O;  4PEL A;  3IGA C;  4GUN A;  3QNE A;  1WN7 A;  4JI3 B;  4NTY A;  1DF4 A;  4BIU A;  3K3W A;  3W7T A;  3CME V;  4EEQ A;  2QWR B;  2CTP A;  3AG1 C;  4H0L B;  1NTK H;  4NB5 A;  4FPP A;  2UUA O;  4GKJ B;  4CS3 A;  3KG2 A;  4JV5 O;  1MA1 A;  5IT9 N;  3AG2 B;  1ZL8 B;  4DV5 B;  4ZI7 B;  4W4K A;  3CRC A;  4H37 A;  5BY1 A;  4AHC A;  5LHI A;  3STL C;  2IH1 C;  2LO1 A;  4UV8 A;  4MSW C;  4X88 A;  2Y4U A;  2B1G A;  2ETN A;  4G28 B;  2F95 B;  2PY5 A;  1K97 A;  2HJF C;  2PYJ A;  3AG7 A;  4U3J A;  3B09 A;  1XMQ B;  2NLJ C;  4FK5 C;  3APQ A;  2YIB D;  3WB0 A;  2W0X A;  1QR8 A;  1VQ6 V;  4CZZ A;  2PUS A;  3VQV A;  3KKY A;  1QLE B;  3JAS A;  4J7K A;  5BR8 B;  3LNM B;  4G27 B;  4LF9 O;  1VQ4 V;  2QTS A;  4FFB A;  1XBL A;  1Q86 W;  4TV8 B;  4PDV A;  1IBK O;  1B06 A;  2OTJ V;  1RPO A;  1ZSP A;  1DLB A;  4B08 A;  3ZRX A;  1H2M A;  3N2K A;  4P9O A;  4YY3 B;  1XI1 A;  2HR3 A;  4RQE A;  5KHH A;  2HEP A;  1IBL O;  3C3T A;  2R70 A;  3VQX A;  1IZ3 A;  2D3O W;  4JTC B;  4ABM A;  4U7N A;  1TUB B;  2N05 A;  1VIB A;  4DV0 B;  3BVO A;  2UU9 O;  2WAM A;  3LSU A;  1H8E G;  2VRZ A;  2QGN A;  4J42 A;  5GTH Z;  1IXM A;  4FLY A;  3L70 H;  3L9D A;  3GB7 C;  2UUC B;  2L6L A;  4DW1 A;  2Y48 A;  2P22 C;  3ZHR A;  1UPG A;  3CS5 A;  2YID A;  5H2F Z;  4KHP O;  4Z1M G;  2E5L O;  4B7E A;  3JCZ A;  3K0G A;  2FML A;  4RUF A;  2V7Q G;  3RT3 C;  1Y67 A;  3D3I A;  1YZB A;  2LJ2 A;  2UXX A;  3JAW B;  3UO2 A;  5IE9 A;  3CC7 V;  3F7V C;  1P4R A;  3ZBH A;  4J9Y B;  3HPL C;  3CB2 A;  1GO3 F;  5E79 Z;  1YSC A;  4DR4 B;  1NI8 A;  5IYC O;  1WPB A;  4L87 A;  1NR7 A;  1X59 A;  1HR0 O;  4UCT A;  5JWP A;  1V9P A;  5LGN A;  2YDE A;  2OWO A;  5F2V O;  1EM1 A;  4ZHQ A;  1D5A A;  3OM3 B;  2B5U A;  3GWK C;  1OCR B;  2YXH A;  1HNW O;  1N36 B;  3ABT A;  4R7C A;  2XAJ A;  2VWJ A;  2QEX V;  3Q4H B;  2F4V O;  3PN1 A;  2HLD G;  2QKA A;  5IWA B;  2GTS A;  1PV0 A;  1XNQ B;  5BR8 O;  1FAF A;  2YC0 A;  1W59 A;  1R6N A;  4O4J B;  3H1L H;  2JK5 C;  3K9S A;  4DV1 B;  1FPO A;  1YCI A;  2W6I G;  5J9P C;  4E2L A;  2EBO A;  3G6B A;  3T1Y O;  1VQK V;  3JAT A;  3CCL V;  2K1E A;  3CEI A;  1M56 B;  4GX2 A;  2BTQ A;  2CK3 G;  3BA8 A;  1MOF A;  1CXZ B;  4WFH A;  2VQF B;  3FD9 A;  3LDE A;  2CUG A;  4YHH B;  1LR1 A;  1I7F A;  3AG2 C;  2VQE B;  4K0K O;  4MVR A;  1SKV A;  4YIP A;  1NR1 A;  3ZHQ A;  1FJG B;  2CAZ C;  1QHT A;  4DR2 B;  3CHX A;  5LXT B;  1SET A;  2OCC C;  5FNV A;  4DRX A;  2ZCE A;  3C90 A;  5KHI A;  1EN4 A;  5L3C A;  1PKX A;  2N04 A;  5KUM A;  2UUC O;  5CB4 A;  3OEE G;  3BCC H;  3OTO B;  5JJE B;  2UXB B;  3IJ4 A;  1VF7 A;  2WA3 A;  4MVZ A;  2X6B A;  1M90 W;  4QE7 A;  3ZJZ A;  2HKO A;  3RN4 A;  3WG7 B;  1GM8 A;  5EBM C;  1R3K C;  2RQ6 A;  3C3S A;  5GW7 A;  1JMK C;  3CCE V;  1EN6 A;  1K92 A;  1Q6H A;  2YI9 A;  1AI4 A;  1YJW V;  4LF8 O;  1XUQ A;  4GT1 A;  1LUW A;  4TQF A;  4UVA A;  4Q20 A;  2OT5 A;  3CP1 A;  4PDR A;  5DEC A;  1Y74 A;  4K8X A;  4DXW A;  1JJ2 U;  2WLM A;  4H33 A;  4YJ3 B;  1HNX O;  4LF5 O;  3KCY A;  1FXV A;  2ZDI C;  2HVK C;  1DTO A;  4TUY B;  1N36 O;  1QQC A;  3AEI A;  4NXM B;  2AZ0 A;  4PA4 A;  1FKA O;  3M99 B;  4NTW A;  4LFA B;  4UB8 Z;  2YSU B;  3B77 A;  2RN9 A;  1NH2 B;  2IW5 A;  1US6 A;  5BXZ A;  3GVM A;  4JAS A;  4TOI A;  1M57 B;  3FYE B;  4LNU A;  2P5O A;  3MAQ A;  2ZM6 O;  4JI4 B;  2EX3 A;  2Z0A A;  1A32 A;  2H94 A;  3JAS B;  4QIW F;  3MD0 A;  4JI5 B;  4EFE A;  3STZ C;  1SER A;  5KLV H;  5JCO A;  4LF7 O;  2ADP A;  3CC2 V;  4JYC A;  4JZG A;  1L0L H;  5B1A B;  4BR6 A;  3KZI Z;  3E8B A;  2VQE O;  2R72 A;  4DR6 O;  2QM4 A;  5LP6 A;  3SR2 C;  4X64 O;  3CCJ V;  4LFB B;  3M8A A;  4IIJ A;  4DR2 O;  2Q4P A;  4O2B B;  3JAL A;  3LUT B;  1GKF A;  5FPO A;  3R65 A;  2UXN A;  5D5Q A;  1WAZ A;  1K7D A;  4JZ2 A;  2EIK B;  4X20 A;  4YIO A;  1OCR C;  2XAQ A;  4DV4 B;  2R9A A;  3AG4 B;  3JYC A;  4JTD B;  2X6A A;  4PA6 A;  5KHJ A;  1Q5O A;  1W2B U;  1P49 A;  4RAI A;  4LR3 A;  4Q6G A;  4MTG A;  5EC2 C;  3SYQ A;  2ZXW B;  4F6E A;  4DV7 B;  4DR5 O;  4CC5 A;  1SQB H;  4FM2 A;  5D5P A;  3CJH A;  2P06 A;  5A2Q N;  2DN9 A;  1M56 C;  4FM1 A;  3LSQ A;  1Q6U A;  1NTM H;  4X1Y B;  3OMI B;  4HZ3 A;  4YXW G;  3T1H O;  4B3S B;  5LMU B;  2EIN B;  4B3R O;  2NN4 A;  1AIL A;  3UQ8 A;  3ABK B;  4NXM O;  3CSX A;  3QG5 A;  3DXR B;  5CBG A;  1BSM A;  5EBW C;  2P6J A;  4ZHQ B;  2ZT9 B;  4JYA B;  3CC4 V;  3RYC A;  5KA6 A;  4JAV A;  1CPY A;  1KD1 W;  4Z1V A;  5CBH A;  1D2D A;  3A0H Z;  2DOS A;  5JVD B;  3B8M A;  4UVC A;  1G8M A;  5L3E A;  2Z5U A;  4JI5 O;  2WLH A;  2ZD9 A;  2ZE7 A;  1EBO A;  2CTQ A;  1F4M A;  3WG7 C;  3OEH G;  4I5S A;  3BA9 A;  2LW1 A;  3U10 A;  1RP3 B;  2HHH B;  4A5U B;  3JAT B;  4D7S A;  2F93 B;  2EJ7 A;  1THZ A;  2MK3 A;  1VF5 B;  2ZR3 A;  4BIZ A;  4O4J A;  1COW G;  3CRR A;  2ZNJ A;  3UO3 A;  2AGA A;  4EB6 B;  1NTZ H;  2YIB A;  2E3C A;  3BAB A;  4Z2W A;  4CBC A;  2JS5 A;  2ITD C;  1OJH A;  3EVK A;  2DE0 X;  1SRY A;  2EZO A;  3ZN0 A;  3RGB A;  4X62 B;  4LF4 B;  2D2C B;  1H38 A;  4DV4 O;  3J81 N;  2ZIM A;  3NR7 A;  1DF5 A;  5EYP B;  3ZS8 C;  5CN0 A;  1I94 B;  5LXT A;  1GN2 A;  3UT5 B;  1BCC H;  1NKD A;  4DUY O;  4JI8 O;  1M57 C;  1P7G A;  4X1K A;  2HJD A;  3SPC A;  4C7U A;  3HKD B;  3H1K H;  3SJC C;  4RUE A;  3OD4 A;  5E1A C;  3FAV A;  2JEX A;  3H1I H;  4GKK O;  3CCR V;  1QNM A;  2P4K A;  1Y74 B;  4JI0 O;  4F4L A;  1KP2 A;  4EFB A;  4XDL A;  1JCH A;  2BSK B;  3CRM A;  1YIT V;  4JYA O;  1SZT A;  3ZHS A;  3E89 A;  4I9W A;  1TVK B;  4IYH A;  3OT7 A;  1RM1 B;  2IH3 C;  4YJ3 A;  3N27 A;  3O9O A;  3ZHT A;  3FFQ A;  5JH7 A;  3AK3 A;  3ETD A;  3FB5 C;  2EIK C;  2QWP B;  3MDS A;  4JF3 A;  3J7A U;  3HKB B;  4TUY A;  4JI6 O;  3CMA V;  3E8G A;  2NNU A;  4LNU B;  2Q0O C;  3AG4 C;  4HNA B;  3CXC U;  2IM9 A;  1N0J A;  4OPH A;  5LMN O;  3CE2 A;  4GZR B;  2G38 A;  4MW8 A;  4BW9 A;  4TQD A;  1E1R G;  2IJH A;  2ZE5 A;  4JI1 B;  4DR7 B;  3H9V A;  3CCU V;  4H13 B;  5KAF Z;  3IC9 A;  4PI0 A;  5DM6 V;  5H9C A;  5LP6 B;  1V54 B;  1JOY A;  5HFL A;  5CA1 A;  4IIJ B;  1B04 A;  4DW0 A;  4J80 A;  2EIN C;  2BE3 A;  3JAL B;  3UKM A;  1OHH G;  1SQG A;  3ABK C;  4R6Z A;  4CH5 A;  5EIB D;  5B66 Z;  1GN6 A;  4WFB V;  5EBL C;  4FLZ A;  1CP9 A;  1VQ5 V;  1XHX A;  3QF7 A;  5CA3 A;  5FL7 G;  4X20 B;  4O2B A;  1EZV H;  2P4V A;  3F5T A;  4O4I B;  5AG2 A;  1NVP D;  2LGQ A;  4CS2 A;  1PD3 A;  4QGP A;  2R9I A;  3WFV A;  1TAE A;  1G6U A;  1XL4 A;  3DC6 A;  3K58 A;  3PJS K;  3FX7 A;  1O9H A;  4JI3 O;  1NT2 B;  1G1X B;  4TSF G;  4I50 B;  3CJH B;  5A9G A;  4RQF A;  1ROP A;  4LBE C;  1P84 F;  1FXH A;  1AI6 A;  4JPR A;  1GM7 A;  4DUZ B;  4GKJ O;  2MW2 B;  2E76 B;  5IYD O;  2Y69 B;  1R1B A;  4OGQ B;  5DN6 G;  3ZHV A;  1ZX3 A;  2EIJ B;  4DV5 O;  2WLK A;  3DTU B;  4DV2 B;  4XDJ A;  1EZJ A;  4X1Y A;  3K04 A;  2IBZ H;  1W0K G;  1WP8 A;  3D36 C;  3RYC B;  1GRJ A;  3ABU A;  1VQM V;  1IX9 A; 
#chains in the Genus database with same CATH homology
 4ZOL A;  2E5L B;  4I4T A;  3JAW A;  4JI0 B;  4TUY B;  4FLV A;  4I9Q A;  1QQC A;  2UUA B;  4NXM B;  4FLT A;  4UCO A;  4FLU A;  4JV5 B;  4DK1 A;  4UCU A;  4LFA B;  1TGO A;  4O2A B;  2PYL A;  3JAR A;  4TV9 B;  4F6R A;  3JAK A;  3DSQ A;  4TOI A;  5FPR A;  1Q8I A;  4AIL C;  2PGG A;  5JVD A;  3RFR A;  4LNU A;  2P5O A;  3MAQ A;  1HR0 B;  2EX3 A;  4JI4 B;  3VQW A;  4JI6 B;  2ZIN A;  3JAS B;  5JJJ B;  4I55 A;  5LOV B;  3BAA A;  4JI5 B;  4EFE A;  4LF6 B;  4LH7 A;  3JSL A;  1HNW B;  5JCO A;  2BTQ B;  5LMN B;  1SA0 B;  4CH4 A;  1RSO A;  1Q3E A;  2F4V B;  3QTC A;  3E22 A;  1S5J A;  2PTM A;  2R72 A;  5C8Y A;  4EB6 A;  2QM4 A;  4NVP A;  3HKE B;  5LP6 A;  2Q7E A;  3SR2 C;  1JJO A;  4LFB B;  5CA0 A;  1YEW A;  4YJ2 B;  4IIJ A;  1N34 B;  5K1P A;  3WB2 A;  4O2B B;  3IAY A;  4UFZ A;  5KMG A;  1SQF A;  3JAL A;  5IYZ A;  5FPO A;  3T1Y B;  1N32 B;  2V4D A;  5D5Q A;  4UCV A;  1M93 A;  1IBK B;  5FNV B;  1M5I A;  4DRX B;  2ZNI A;  2F1M A;  4WBN B;  4X1K B;  4X20 A;  5CB4 B;  2Q7G A;  4CS4 A;  5IJ0 A;  4DV4 B;  5EYP A;  2R9A A;  5BMV B;  4K0K B;  3UT5 A;  1HNZ B;  4D7T A;  3N2G B;  5KHJ A;  1Q5O A;  1KMI Z;  5JCO C;  1P49 A;  5J2U A;  5IJ9 B;  4LR3 A;  3WB1 A;  4Q6G A;  4L8J A;  2BTO A;  3HKD A;  4DR3 B;  1Z5V A;  4O4H B;  4DV7 B;  4IHJ A;  5GON A;  4CC5 A;  4FM2 A;  5LP6 C;  5D5P A;  1JFF A;  4K8Z A;  1ZAU A;  3K5L A;  1WN7 A;  4JI3 B;  4CH6 A;  4FVM A;  4ZIB A;  4FM1 A;  4EEQ A;  5ITZ B;  4LH6 A;  5KX5 A;  3LNN A;  5LA6 A;  4X1Y B;  4B3S B;  4FM0 A;  1XQ8 A;  5LMU B;  4O4L B;  4B3M B;  5JH7 B;  3UQ8 A;  3CSX A;  4ZOL B;  4I4T B;  3QG5 A;  4GKJ B;  4OX9 B;  4CS3 A;  5J2T B;  1TVK A;  4ZHQ B;  4JYA B;  2QJ1 A;  4DV5 B;  3K5N A;  4B3T B;  4ZI7 B;  4LF8 B;  3RYC A;  4DV6 B;  4UCR A;  3RYI A;  1T5E A;  4AHC A;  4X66 B;  1IBM B;  1Z5W A;  3HKB A;  1HNX B;  2F95 B;  2PY5 A;  4LF5 B;  1Q43 A;  5JVD B;  4NXN B;  4HNA A;  3SJB C;  5LYJ A;  2PYJ A;  4JI7 B;  2Q7H A;  3BPZ A;  1DGS A;  4X1I A;  4U3J A;  1XMQ B;  2PZS A;  4TV9 A;  3BA9 A;  3U10 A;  4DR1 B;  2HHH B;  4D7S A;  3JAT B;  5CA1 B;  2F93 B;  1XHZ A;  2YIB D;  3WB0 A;  3M7M X;  2KKW A;  4O4J A;  2PUS A;  4GYC B;  3VQV A;  5KHG A;  2ZNJ A;  3E22 B;  4LFC B;  4EB6 B;  3JAS A;  5BR8 B;  3BHP A;  2YIB A;  2E3C A;  5LOV A;  2ZM6 B;  1H2S B;  3BAB A;  5CA0 B;  2JS5 A;  4FFB A;  2UXD B;  2VWK A;  4TV8 B;  5KMG B;  4CH3 A;  3RGB A;  2UXC B;  4X62 B;  4LF4 B;  4LF7 B;  4B08 A;  4CC6 A;  3HKC A;  3HKE A;  3N2K A;  3RYF A;  4YY3 B;  2ZIM A;  4YJ2 A;  1XI1 A;  4DR6 B;  1N33 B;  5KHH A;  4O4I A;  1HW7 A;  2HEP A;  5EYP B;  4X64 B;  3SJA C;  5JQG B;  2R70 A;  3VQX A;  3ZS8 C;  2JVD A;  1I94 B;  5LXT A;  3UT5 B;  4DV0 B;  1TUB B;  4PHZ A;  4X65 B;  3ZED A;  4WBN A;  4X1K A;  3HKD B;  3K59 A;  3SJC C;  3RYH B;  4FLY A;  4I50 A;  1JFF B;  2UUC B;  4DV3 B;  2P22 C;  3N2G A;  1FFX A;  1J5E B;  4O4H A;  4JI2 B;  4EFB A;  3U0Z A;  2Q0A A;  2OYQ A;  4DR5 B;  3JAW B;  1XNR B;  3OTF A;  3K5O A;  1KU9 A;  3CB2 A;  1TVK B;  4O4L A;  4DR4 B;  4YJ3 A;  5EZY A;  3FFQ A;  1WPB A;  5JH7 A;  3A2F A;  3JAR B;  4F6R B;  3T1H B;  3JAK B;  4AQY B;  4UCT A;  1V9P A;  3HKB B;  4TUY A;  5J2T A;  4B3R B;  2OWO A;  4ZHQ A;  2ZIO A;  1D5A A;  4LNU B;  4HNA B;  2IM9 A;  5LYJ B;  4ZI7 A;  2UUB B;  3THO A;  4O2A A;  1N36 B;  4X1I B;  5JJN B;  4U3J B;  2YI8 A;  2JGU A;  2VWJ A;  4I55 B;  4BW9 A;  4TQD A;  3PN1 A;  4JI1 B;  5IWA B;  4DR7 B;  1L8D A;  1O9G A;  1XNQ B;  3K5M A;  4O4J B;  4PI0 A;  5C8Y B;  4DV1 B;  1TA8 A;  5LP6 B;  3ETQ A;  1M4U A;  5CA1 A;  3JAT A;  4IIJ B;  4FFB B;  2BTQ A;  3BA8 A;  1B04 A;  1SA0 A;  2GV9 A;  3JAL B;  5IYZ B;  1SQG A;  4BWA A;  2VQF B;  2XHB A;  3RWR D;  4CH5 A;  5EIB D;  3HKC B;  4HBN A;  4YHH B;  3N2K B;  1I7F A;  2VQE B;  4FLZ A;  3RYF B;  4DK0 A;  1XHX A;  3K57 A;  3QF7 A;  4X20 B;  4O2B A;  1SKV A;  2YXL A;  5IJ0 B;  4TV8 A;  4O4I B;  1FJG B;  4LF9 B;  4CS2 A;  2CAZ C;  2RJZ A;  3VQY A;  4FLW A;  1QHT A;  1TAE A;  4DR2 B;  3CHX A;  5LXT B;  1G6U A;  2YIA A;  3U11 A;  5FNV A;  4DRX A;  5J2U B;  3K58 A;  2ZCE A;  5KHI A;  3SGI A;  5CB4 A;  1X4T A;  3OTO B;  5JJE B;  4FLX A;  4GLX A;  1O9H A;  4IHJ B;  5GON B;  4UCS A;  1NT2 B;  5BMV A;  2UXB B;  5JQG A;  3ICX A;  1VF7 A;  4I50 B;  1TUB A;  1IBL B;  5IJ9 A;  5KX5 B;  1FFX B;  5LA6 B;  4DUZ B;  2RQ6 A;  1WNS A;  3RYH A;  4DUY B;  4JI8 B;  2UU9 B;  1JMK C;  1XMO B;  2YI9 A;  4TQF A;  5ITZ A;  4DV2 B;  5EIB C;  3B2E E;  4X1Y A;  4KL1 A;  5K1X A;  4K8X A;  4GKK B;  5KHK A;  3RYC B;  3JSN A;  4PI2 A;  4YJ3 B;  3BRC A;  3RYI B;  5EZY B;  2F66 C;  4KHP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...