2NLJC

Potassium channel kcsa(m96v)-fab complex in kcl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVVVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment light chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nljC00
3X2QC 1R3IC 2WLKA 3E8GA 3F7VC 3F7YC 2HG5C 3OGCC 3T2MA 1OCZC 5EBWC 5EK0A 2NLJC 4J9YB 3OR7C 3TCUA 3F5WC 4RUEA 4G27B 3SPGA 2X6AA 4P2ZA 2QKSA 1XL6A 2ITCC 4P9OA 4PA4A 3AG1C 4R8CA 4WFHA 3RVYA 2IH3C 1M56C 3FB5C 4MW3A 4MTGA 4WFFA 1OCRC 2ITDC 4MTOA 4RO2A 2X6BA 3ABKC 4GX1A 3T4DA 3LDDA 3AG2C 3AG3C 1V54C 3ZRSA 2HJFC 3E8HA 3TETA 2A9HA 1G4YB 2WLIA 1K4CC 3BEHA 2BOCC 4ZBMA 3IGAC 2Q68A 4PA9A 3SJQC 3E89A 3E86A 3LUTB 4R7CA 5E1AC 2DYRC 3SYQA 2HFEC 1ZWIC 2K1EA 3ASNC 3VOUA 1OCOC 3K0DA 3LDCA 3SYOA 5CBFA 2H8PC 3IFXA 3LDEA 4XDLA 3SYCA 1XL4A 3OR6C 4HZ3A 3OUFA 2WLLA 4DXWA 4GX2A 3OUSA 3GB7C 3E8BA 5CBGA 4MVQA 4PA7A 3ASOC 4QNHB 2WLMA 1R3JC 4KFMA 2DWDC 3K03A 4X89A 4X88A 2BOBC 4HYOA 4UUJC 3WG7C 2Q67A 2EILC 1P7BA 4R6ZA 2W0FC 4JTDB 3E8FA 2HVJC 4LP8A 2Q6AA 3SYAA 4BW5A 4EKWA 4P30A 3FB6C 4H33A 4MVZA 5KUKA 2YEVA 1V55C 3ABMC 1M57C 1OCCC 2Q69A 2A0LA 4JTCB 4WFEA 4I9WA 4G28B 2WLLB 2AHYA 2R9RB 4MVSA 4QE7A 3RVZA 2DYSC 2A79B 3SPJA 4MSWC 5CBHA 4PDVA 4MVUA 1LNQA 2X6CA 4LCUC 2WLNA 3EFFK 5B1BC 5BZBA 3K08A 2DWEC 1BL8A 1JVMA 2AHZA 3AG4C 1R3KC 3FB8C 5KUMA 5J9PC 3K04A 4TWKA 1R3LC 4JTAB 2WLHA 1S5HC 2EIJC 4MS2A 3E83A 2WLIB 3K06A 2WLJA 3FB7C 3SPIA 4RUFA 4RAIA 4MTFA 4P9PA 4PDMA 4QE9A 3T1CA 3RBZA 3RW0A 4H37A 4J9ZB 5EBMC 1KKDA 4MVOA 5B1AC 2ZD9A 3ZJZA 3LNMB 2EINC 1ORQC 4MVRA 4WFGA 4XDJA 3SYPA 4PA6A 3T4ZA 2EIMC 1J95A 4MVMA 3SPCA 5IY5C 4PDLA 3PJSK 4PA3A 2P7TC 3R65A 4PDRA 3STLC 4GX0A 3UKMA 2ATKC 2JK5C 3SPHA 4MW8A 4X8AA 2HVKC 4LBEC 2IH1C 3K0GA 4F4LA 4R50A 3JYCA 3KG2A 3ABLC 5EC1C 1QLEC 4OXSA 4CBCA 2QTOA 2KB1A 2Y69C 4XDKA 5EC2C 3STZC 3UM7A 2EIKC 4GX5A 5EBLC 1K4DC 2ZXWC 3HPLC 5B3SC 2OCCC
chains in the Genus database with same CATH superfamily
4OGQB 2JGUA 1NU1H 3EXAA 2N05A 1XREA 3WB2A 2F4VB 1H8HG 1K5SA 2UUBB 4YJ2B 2XAFA 1V54B 1D2DA 5J2UB 3C90A 4E2LA 2QWNB 1HNZB 4LWSB 3HKCA 1A32A 4YXWG 3ZRXA 4LF9O 4YHHO 3EHBB 1KYOF 5JH7A 1OCOB 3CJHB 3E89A 2G38A 3L75H 3OT7A 3N27A 4XDLA 3L71H 3CC4V 4Z2WA 3GB7C 3E8BA 1FYJA 2ZCEA 5CBGA 1KECA 2JJ1G 3H1HH 3HKBB 1JQ0A 2EILC 5EZYB 1SQBH 1EN6A 4N21A 1RM1B 2RNBA 1MZEA 1SC5B 3E22B 1U96A 5CBHA 3U10A 1F23A 2WLNA 4LF6O 1LUWA 1I5XA 5L3FA 2P4VA 3E83A 2WLJA 3M99B 3T1CA 2QWQB 1NTMH 1PNKA 3ZJZA 1DTOA 3LNMB 2WA3A 3ZRWB 4LF8B 1XI1A 4DRXA 1SQGA 3CHXA 3RGBA 2MK3A 2CGNA 4PDLA 1PP9H 4PDRA 3L74H 3FFQA 2ATKC 4LH6A 4AHCA 3DC6A 3P3PA 1TUBA 1Y76B 1HNZO 1AP5A 2WLKA 3ICXA 2OT5A 3W7WA 3C3SA 2CTQA 1AP6A 4GZRB 5FPOA 5LYJB 2AZ2A 3BAAA 1BE3H 1AI6A 3RVYA 1NQTA 2YC0A 2KKWA 3RWRD 5BR8B 3CCMV 3G67A 4MTXA 3LDDA 1EFRG 1FFTB 4DV0B 2R72A 3CXCU 4AQYB 2RCVA 4AI8A 3IGAC 4PA9A 4DR1O 2DYRC 4DV7B 5LMNB 2DW4A 1Y74A 1SS3A 1U97A 3OR6C 3H1KH 5BY1A 3I5DA 3DGEA 1P84F 2V7QG 2PYJA 4UUJC 4I4TA 3VQXA 2PTMA 1XQ8A 1BQ0A 3WB0A 4B7EA 2IM9A 1HW7A 4LF8O 4K3AA 3UT5A 2WLLB 1RPRA 4LNUA 3AG4B 2DYSC 4J7JA 1H2GA 4PDVA 2B1GA 2UXCB 2HKOA 2BTQA 1FXHA 4B3TO 4OX9B 1EZVH 1HDJA 4DV5B 1D5NA 2OCCB 5J2TA 5B5EZ 4PDMA 3JSNA 3AEIA 5GONB 1Q7YW 3APQA 3ZEDA 4FLYA 1ROPA 1NS1A 3H9VA 1B3QA 4ZHQA 3CMAV 3T4ZA 4IT5A 1EZJA 1KKCA 3UKMA 3J80N 1N8RW 2OTLV 1WNSA 5LXTA 4UB8Z 2KG7A 5LOVA 2Y69B 3AG7A 2ZNJA 1XHXA 4DV0O 5LGNA 4DUYB 1KU9A 5LP6A 5IYZB 3IC7A 2YSUB 4FLWA 4O2AA 5L3GA 2HG5C 4DV7O 5LMNO 1BZKA 4P2ZA 2ITCC 1H2NA 3KCXA 5C8YB 4K8XA 2YI9A 1OCRC 3K9SA 3RYHB 3N2GA 1YI2V 3E8HA 3RYIB 2AXTZ 2QSAA 3TETA 4X65B 4LFCO 2HR3A 4X1YA 3T1YB 5KHHA 1S3JA 3QO5A 1VARA 3SYQA 4O2BB 3SYOA 1MSDA 2JS3A 4GX2A 1JA8A 4OX9O 1GMGA 1XUQA 1CPYA 2YIBA 4X89A 3CXHF 1NKDA 1HWYA 3E8FA 4JTDB 3SDLA 4BW5A 1VQPV 3FB6C 1YTFB 4MVZA 3CCQV 2UXXA 5EIBD 4I9WA 1BHBA 2Q7EA 3EFFK 5IYCO 1IX9A 3Q4HA 5EIBC 4DV1O 4YY3B 1I94O 2YUAA 1G6UA 4JTAB 4GKKB 5LA6B 3CCEV 3N2KB 4DUYO 4MTFA 3C3TA 3ETDA 2LO1A 3LSQA 3MHSC 2Q9LA 5B1AC 3CC7V 4U3FH 2ZIMA 1Q6UA 2O57A 5BMVA 5IY5C 4CC5A 3MD0A 4PA3A 4O4IB 5IYBO 1FKAO 1D5AA 2JGDA 1OHHG 1M1KW 2JS5A 4YIPA 1DLBA 1G8MA 5IJ0B 5EYPA 2ZT9B 1NVPB 2RQ6A 2YEVB 1SQXH 3CCRV 3B77A 3JASA 4X65O 4DR7B 4TV8A 3DSQA 3T1YO 4HNAB 4DYLA 2CUGA 2QKSA 2XAJA 4JI2O 3K5OA 3ZMVA 1K73W 3AG3B 3SJCC 4RO2A 1E79G 4DV6B 2XOKG 5L3EA 3RYCB 2GV9A 4R7CA 2B1IA 1VQ6V 1YCIA 4QPJA 1ZX3A 4X1IB 3JALB 3CC2V 3BPZA 3SYCA 2Q0AA 4GKKO 3LNNA 5LP6C 1XNQB 3ABMB 4ZOLB 4U3JA 3RYFB 1FD9A 3CMEV 2E5LB 1EN4A 4BR6A 2Q6AA 3JARB 1FAFA 1R6NA 3VBBA 3DTUB 3FAVA 2C2AA 4MVSA 5JVDB 3O65A 1RP3B 1PPJH 1L8DA 1BL8A 3S3WA 1R3KC 4UCOA 3FB8C 1LR1A 4FFBB 4DV2O 5D5QA 3TXQA 1BCCH 2PF4E 1XMQO 1HR0O 2X7RB 1E1RG 2RDCA 2EINB 3JAWA 4DR7O 2W6IG 1AI7A 2UXNA 2DQ3A 3DXRA 4KXRA 3SPCA 4ABMA 3R65A 2YIBD 2HJDA 4EB6A 4GX0A 4IIJB 3ZHQA 4X8AA 5IE9A 3BABA 3OTOO 1W59A 4JI3O 2Q5ZA 1YDXA 3ZCCA 3H1LH 4IHJB 3E8GA 1XMOB 3OGCC 5EK0A 2X6AA 2ZKOA 1Q3EA 3VQYA 2OIEA 1ZSPA 4JYCA 1WP8A 4KHPB 1WA8A 1ENVA 3ZRSA 2E5LO 2N74A 4FK5C 1DGSA 3ASNB 4GYCB 4W4LA 4LF7B 4I50A 1TAEA 1B06A 2N04A 1ZWIC 3IFXA 4QPKA 5CB4A 3MDSA 2DN9A 4LF4B 2VQEB 1F51A 1R73A 1JMKC 3VQWA 1AILA 1V55B 4O4HB 4J80A 2YDEA 4TSFG 1N33B 1IXMA 3FYIB 4B3MB 1GRJA 1IDSA 1M57C 1FXVA 3RVZA 1BSMA 1IBLB 1VQOV 2X6CA 4FVMA 3W7SA 3JATB 3WB1A 1L0LH 5J9PC 4TWKA 1GO3F 1GK9A 4NYKA 3FB7C 5EBMC 5J2UA 2EIMB 5L3BA 1XMOO 3SR2C 1PNLA 4YHHB 1GH6A 3OFNG 3K5LA 1I0HA 3ZHVA 2BSKA 1S0VA 5JCOA 2ZE6A 1J5EO 2CTWA 3CJHA 2QJ1A 2VWKA 1QLEB 5TISZ 1SKVA 4JYAO 2GSMB 2IH1C 2CK3G 2EIKB 3JYCA 4KHPO 5AG2A 1N0NA 2QTOA 1H2MA 2EZOA 1PV0A 3SJAC 2JEXA 1Q82W 1P4RA 2V4DA 4AILC 1DF5A 1OCZC 4LF7O 1AROP 4IYIA 1Q81W 4P9OA 3ABKB 2EX3A 3ZRVA 3E22A 1M56C 3P3NA 4MTGA 1WB7A 4X1KB 2EILB 1RSOB 3BCCH 2CH7B 4LH7A 1BS3A 1N34B 3D36A 3BEHA 4B3MO 2E75B 1KD1W 1CP9A 1IBLO 1TGOA 2QM8A 3ZRWA 1AJPA 3QO8A 4D7SA 2FMLA 1O9GA 5IWAB 3ASOB 5CA1B 3QO7A 4DXWA 2LFRA 2P90A 4JI0B 4DV4O 1R6TA 1VEWA 2EZPA 2W0FC 4JI8O 1IURA 5HFMA 1Y76A 1YITV 3MHHC 2NR5A 3L73H 4WFEA 1NZ6A 1L1FA 2GUZB 5CMUA 4MSWC 5KA5A 3A8TA 1Q6IA 2IJKA 3WFVA 1DF4A 1H8EG 5LYJA 4JI1O 1PKXA 4DK1A 1VQ5V 4RAIA 2ZE8A 5LGUA 3CCSV 2OWOA 4CS2A 2ZD9A 1VQKV 3IAYA 2PUSA 4FZ1A 3KKYA 1K9MW 4FIPC 5DECA 1K34A 4DR1B 3ZN0A 2UU9B 4IGGA 4L87A 1WJZA 3SPHA 3UO2A 1B6QA 4A5UB 4LBEC 3A0HZ 3X2QB 1Q43A 3HB3B 2FB5A 1N34O 3DC5A 2AW9A 3CRCA 5KMGA 3T2MA 1UJWB 1K3EA 2FKXA 2NN4A 4K8ZA 2P4KA 4PJ0Z 3ETQA 1HNXO 4FM0A 2IJIA 5IWAO 1SERA 4H13B 4WFFA 4JI0O 4B3TB 1V54C 3K57A 2DMXA 5E1AC 5JCOC 2BE3A 3ABTA 1OCOC 2H8PC 3UCSC 2YICA 1NI8A 2PY5A 1I08A 3HKCB 1Z2GA 1VF7A 1R3JC 5JH7B 2DWDC 1NTZH 1QVGU 1KUQA 3JD2A 2IJJA 1SZTA 5H6QA 3A0RA 3CCVV 1QNMA 5IYZA 5KX5A 2Q69A 2ETNA 2UU9O 4B3SO 2EIJB 4UB6Z 1MABG 2LJ2A 1WN7A 3ZHSA 4JAAA 2CDYA 3K04A 3CCUV 4JI6O 1S5HC 2WLIB 3K06A 3H1JH 3OD4A 4F6RA 2ZM6O 3D36C 1O9HA 4JYBA 4LFCB 1ORQC 2ZE7A 2X0LA 3RYIA 4UCRA 1OCRB 3U11A 5JJEB 2ZE5A 1BMFG 4WBNA 2JK5C 2M6YA 4MW8A 4O2BA 2VQFB 2WA4A 5GTHZ 2CTRA 2HP8A 4DR4O 1G1XB 4DRXB 4GCZA 3P30A 2JEUA 2R9AA 2RJZA 2Z5UA 3QG5A 3AG1B 2F95B 3JAKA 3OR7C 3A2FA 5L3CA 3AG2B 3AK2A 1GN6A 3S3XA 4DV1B 1I94B 4MTOA 3OE7G 1Q86W 2VWJA 1KBHA 5KHIA 5LA6A 4C7UA 1YHQV 5KA6A 3OAAG 5KAFZ 1SA0B 1AR1B 3J7AU 1JJOA 5CA0B 4WFAV 3OTFA 5CBFA 4O4JA 1VIBA 2Y48A 3OW2U 3GWOA 4DUZB 2ADQB 4O4IA 5KHKA 1K97A 5H5NA 5B1AB 1OZ0A 1OCCB 5IJ0A 4J7ZA 2UXBO 3CSXA 3ZMSA 2FL4A 2RMKB 3D3QA 3FYEB 2YEVA 3KZIZ 4X9QA 1DK1A 1R6KA 1MNGA 1YVWA 3CB2A 3K08A 2YIDA 1FXKB 1HP8A 1JVMA 3AG4C 3OMIB 4JF3A 1W0JG 1ZTEA 2B5UA 2VQFO 4JI2B 2WLHA 2KQXA 1CXZB 5FL7G 4KP4A 2UUAO 3GWKC 3K9AA 1KKDA 4PHZA 4NKGB 5IDJA 3IC9A 5JQGB 1NT2B 4KL1A 3STLC 2ZIOA 3ABLB 1Q5OA 3NR7A 1QHTA 1K92A 2IJHA 2Y0PA 1ZL8B 4X1IA 5IJ9A 1V9PA 1M4UA 1N32B 1HNWO 5B3SB 1VF6A 1NR7A 3M7MX 2Y69C 2JIZG 2ZXWC 2GHYA 3QVNA 4GT1A 3E35A 3ZHUA 1XDCA 3CS5A 4ZOLA 1XBLA 3H01A 5FNVA 3F5WC 4RUEA 1X59A 4ICGA 5LOVB 4G27B 2DOSA 3JARA 3THOA 2Q8VA 3BA8A 4NXMO 4NXNO 4H0LB 5LP6B 2IH3C 1KQSU 5LMUB 5JVDA 4DUZO 4DK0A 1FS0G 4DV2B 4O2AB 3FX7A 2Y0IA 4FFBA 1XMQB 1HR0B 1KB9F 1Y66A 1MZFA 5K1XA 5E79Z 1NH2D 4ZBMA 4KUMA 5KAIZ 3B8NA 5B1NA 3E86A 4UVAA 5IYDO 2ARHA 1IBKO 3CRAA 2L35A 1FJGO 1S76D 4PI2A 1FFXB 4X1YB 1VMGA 4IIJA 2WLMA 3OTOB 4JI3B 2HHHO 1XEQA 2A3QA 1YTFD 2ODMA 1THZA 1SQFA 1F4NA 3QF7A 4IHJA 5D5PA 5KHGA 1LNQA 3L72H 1P7GA 1IVSA 4TQFA 5KUMA 1JOYA 2P6JA 2QEXV 3B4SA 2D3OW 3ZMTA 4X62B 2LFSA 1KC8W 1N32O 1OV9A 4DR3O 1ZUQA 3ZBHA 4WCEV 4LR3A 3FD9A 1IXBA 3RN4A 3Q4HB 4PA6A 3RFRA 4HAMA 5HFLA 2QTSA 2PYLA 3RT3C 3G6BA 4FLXA 4FM1A 5LMUO 2GTAA 1NVPD 4FLZA 2KSDA 5B1OA 3KG2A 5LHGA 5EC1C 3ZMZA 1N0JA 4Z1MG 4FLTA 2KB1A 3UM7A 1Y6XA 2UXDO 5BMVB 1CEZA 1NR1A 3L70H 1X4TA 4O4HA 5LL6Y 4BIZA 5EYPB 4E4EA 4R8CA 1TUEB 4I55A 2Y4UA 3JASB 5KLVH 2MW2B 4JAUA 2JVDA 3JATA 2BCCH 3AG3C 2BTOA 4RWUA 4X20B 2HJFC 2IBZH 4JZGA 3ZMUA 2D2CB 4PI0A 2XAHA 4FJCC 4D6TH 1NJIW 4JGSA 5H2FZ 2QM4A 4RQFA 3SJBC 3VOUA 1XILA 1VP7A 1J5EB 4X62O 2QKCA 4QIWF 4JYAB 1SETA 3WG7B 2GBOA 2F43G 1VF6C 5JWPA 1QR9A 1K7DA 4HYOA 1YIJV 2LW7A 4UCSA 3ZS8C 4IL6Z 3ABMC 3JD3A 3W7XA 3KCYA 2UUCO 3SPJA 2E76B 4MVUA 5B1BC 1URFA 2AHZA 3BFRA 4JI5B 1K8AW 1R3LC 4MS2A 1EBOA 4OPHA 4U7OA 4RUFA 3U0ZA 2AZ0A 4X1KA 3RBZA 1YSCA 5ITZB 1RSOA 1RFYA 4J42A 2CH7A 4ASUG 2EINC 3HKEA 1XNRO 1M56B 1YJWV 1WLEA 4K0KB 5CA3A 4BW9A 4TOIA 1US6A 2VRZA 4JI7O 2YXHA 1JFFB 3SGIA 4DV4B 4YJ2A 1BHAA 2YIAA 1K4DC 4UCVA 3HPLC 4L8JA 4JI8B 3F7YC 3LSUA 4ZI7B 2FYUH 5DN6G 4LWSA 1B04A 4B3RB 4DW1A 4JV5O 5IT9N 1YJNV 4WFHA 4CZZA 4TUYB 3NXSA 3AK1A 4ZKIA 2EBOA 4JI1B 1QLNA 1TVKB 3JAMN 1G4YB 3R66A 3QTCA 3CPWU 1F7YA 3HKBA 2QDOA 1M90W 3ASNC 5EZYA 3TXSA 2ZQMA 1SRYA 4YJ3B 4FPPA 1WA8B 4JI5O 2WAMA 4I0XB 3OGIB 4TV9B 2EULA 4UFZA 4QNHB 4LF5O 4UXNA 2ZDIA 2E74B 1I5YA 1L0NH 4O4LB 1E1QG 1V55C 4B08A 1N4CA 1VQ9V 4J10A 5CB4B 4K0KO 2CTPA 5H9CA 2CGOA 3UQ8A 3K79A 3JD0A 1HNXB 3ZHTA 2W6JG 2EJRA 2XT9A 4J9ZB 1QR8A 5KHJA 3E2EA 4CS3A 3CRQA 4MVRA 1JCHA 4B3RO 2EIMC 1J95A 4DR2O 1RPOA 4D7TA 2H3OA 5LHHA 2DQ0A 1SF9A 3K0GA 1VQ8V 1QLEC 3A0BZ 2ZR3A 2EIKC 2ZR2A 2BSKB 4QJFB 2XHBA 5EBWC 2NLJC 3UO3A 2HLDG 2PGGA 5F2VO 2H94A 1I7FA 4DR6B 3BY6A 3CCLV 4B3SB 4PA4A 4EFEA 3BVOA 3HKDB 4UVBA 4FZ0A 4PELA 4X66O 3ABKC 4GX1A 4JI6B 1XHZA 3P32A 1PD3A 4NVPA 3OMAB 4GLXA 3AK3A 1QVFU 1AVMA 2QR4A 4GUNA 2ZM6B 2WLIA 2A06H 2DYRB 4JI4O 3CP1A 1SESA 3PN1A 1AI5A 1QQCA 1N36O 1M5IA 1GN4A 5A9GA 2YI8A 2WLLA 3CE2A 2Z3YA 1WAZA 1M93A 2QGNA 4DR4B 4PA7A 3ASOC 3JCZA 4KFMA 3CEIA 3TK1A 4R6ZA 4J11A 4JZ2A 4X64B 1TA8A 2DYSB 5KUKA 4WFBV 4G2KA 4JTCB 1H38A 2AGAA 2IW5A 4QE7A 5GONA 2F4VO 2A79B 4CC6A 4LC1A 5BZBA 2UUBO 2DWEC 3OEHG 2QWPB 1ZAUA 3W7UA 4J41A 2LGWA 4BWAA 2XNDG 3TGUH 2R9IA 3SYPA 1Z5VA 1VQ4V 4UV8A 1SQVH 2QKAA 4MVMA 4DR6O 3PJSK 4EFBA 1RM1C 1Y4MA 1SA0A 1WB8A 4YIOA 1H2LA 5CA0A 2V1DA 3CRMA 5C8YA 1WPBA 2QA4V 4DV3B 2OIGA 5EBLC 2ZDIC 5B66Z 2UXBB 4JPRA 3OEEG 3X2QC 3CX5F 3T1HB 3RYHA 1MMMA 3OMNB 4IYHA 1Q6HA 3SPGA 1IBMB 1XL6A 4MW3A 4F6EA 2IU0A 1M9NA 3T4DA 1FXKA 2GDSA 5KMGB 2DJVA 1GN2A 3OM3B 2OYQA 1VQNV 2UUAB 4X64O 3ML0A 5BXZA 1S72V 2P5OA 4Q6GA 4FLUA 1QCEA 1GKFA 4TT3G 3QNEA 3K0DA 1TUBB 1XL4A 4GKJB 3OUFA 5JQGA 1PM9A 1MOFA 3CYOA 3LSSA 3BHPA 4X88A 1HNWB 5DEDA 1ZL8A 1P7BA 4EKWA 3SYAA 1WP7A 4H33A 3N2KA 1XOUA 2Q0OC 3ETGA 4NTYA 2A0LA 2EJ7A 4G28B 2AHYA 2LW1A 3ZIAG 5K1PA 3ZHRA 4NXNB 4NXMB 2Q7GA 5C93A 5BR8O 5H6RA 2EIJC 2ZXWB 3ETEA 1KP3A 4I5SA 1GM8A 4AQYO 1T5EA 5KX5B 4QE9A 4DV3O 2HEPA 3G6EV 5CN0A 2OCHA 1YEWA 3VQVA 1PNMA 5IY5B 1Y74B 5JJNB 3T1HO 1UPGA 3IJ4A 4WFGA 3JCUZ 3BRCA 1IBMO 1JPXA 3CRRA 4HNAA 1IBKB 4F6RB 4TQDA 4I4TB 5L3DA 1FJGB 5EC2C 3UT5B 1FFXA 4LNUB 2RN9A 4NR1A 2OCCC 4CH6A 1W2BU 1NH2B 2HHHB 2WSSG 2JRIA 2VS0A 3F7VC 4WBNB 2LGQA 4DW0A 2BTQB 3K59A 2UXCO 3AG1C 3CD6V 5J2TB 4FFKA 4GKJO 3RYCA 1YF2A 2ITDC 4DV5O 2K9PA 2X6BA 2WWWA 2JDIG 3AG2C 3JALA 2YS8A 3JAKB 4DR3B 4ZHQB 3JD4A 2A9HA 1EM1A 4CH3A 2BOCC 4BIOA 4DR5B 1MSWD 2E3CA 3LUTB 3RYFA 3MAQA 5LXTB 3B8MA 1Z5WA 4OPAA 4RQEA 1GTOA 2KG7B 2L6LA 3JD1A 2F66C 4MVQA 1QBZA 1ZLZA 2BOBC 4K35A 4Z1VA 3G4SV 1AJQA 2Q67A 2UXDB 4DO2A 3O9OA 2HVJC 3H1IH 1GM9A 2YXLA 4LP8A 4P30A 1OCCC 4JYYA 4O4JB 3ZN1A 2WPDG 5FPRA 2R9RB 3HR0A 3K5NA 4UCUA 2CE4A 3G80A 3N2GB 4NTWA 4W4KA 1FXKC 2DE0X 5GW7A 3SPIA 4BIUA 4H37A 4CS4A 4XBFA 4Q20A 3G71V 4X20A 3J81N 4XDJA 3D3IA 1EN5A 4JASA 4U7NA 3B40A 2P7TC 1YXBA 2PI5A 1SQPH 1VQ7V 1AB3A 1MA1A 2F23A 2PZSA 1VQMV 2HVKC 5DM6V 5LHIA 1COWG 4R50A 3ABLC 1MG1A 3CCJV 3F5TA 4FMTA 5B3SC 1R3IC 4DR5O 1Q90D 4H44B 4J9YB 3TCUA 2Q7HA 4NTXA 4UV9A 3JSLA 2UUCB 5IJ9B 4YY3O 3CWBH 2PI4A 1UFIA 1BQZA 1S5JA 5FNVB 4ZIBA 5FLXN 5B1BB 2JGDB 3TJTA 4I7ZB 5ITZA 1XNRB 2HFEC 2K1EA 3I55V 1R1BA 5LGTA 1GN3A 2Q4PA 2NNUA 2XASA 4CH4A 4TV8B 4PV1B 1IZ3A 5A2QN 4JI7B 1M57B 3ABUA 1VQLV 2ILMA 2ADPA 1JFFA 4HBNA 4N23A 1AR4A 2LQTA 2B9ZA 1Y67A 2F93B 4LFBB 4LCUC 4ZI7A 3K3WA 4WF9V 4JV5B 3W7TA 4DV6O 1K33A 3M8AA 4TUYA 4LFAB 4CH5A 2Y4TA 3EVKA 1TVKA 1BGYH 2ZNIA 1Q8IA 1YJ9V 1PL4A 5LBQA 4EEQA 3K5MA 4PD4F 4U3JB 4F4LA 1QU7A 1KP2A 4YJ3A 1S5LZ 1F4MA 1XNQO 3B2EE 2OTJV 2Z0AA 3FAVB 3STZC 4LF5B 4I0XA 1OCZB 2ZINA 1BT8A 4TV9A 1FPOA 3OUSA 2W0XA 2P67A 1VF5B 4B7KA 2A7WA 4O4LA 3I56V 2GTSA 1NTKH 4FLVA 3FB5C 2QWOB 2JJ2G 3JAWB 1JX9A 2LP7A 2XAQA 1JR9A 5CA1A 2FTKA 1AR5A 3DXRB 1K4CC 1AJNA 2CAZC 2QE7G 1PL0A 2Q68A 4FM2A 3SJQC 4I55B 2XAGA 4EB6B 4JAVA 1H2KA 4LFBO 4MT8A 1KMIZ 4DR2B 1GM7A 3LDCA 3LDEA 4HZ3A 2GUZA 2Q73A 1S77D 1LUVA 2XUMA 1W0KG 4I9QA 4LFAO 3K03A 2P22C 1WPXA 3B09A 3WG7C 2QM7A 1GAXA 4LF9B 1OJHA 4J7KA 3ZX6A 2YXYA 3K58A 2QWRB 3BA9A 3FKSG 4X66B 3HKDA 1NBMG 4P9PA 4NB5A 3D8CA 4BAYA 2P06A 1SQQH 3RW0A 4I50B 3WU2Z 4QGPA 4MVOA 1JJ2U 1P49A 2XTAA 4JI4B 1AI4A 4UCTA 5JJJB 3GVMA 1H2SB 4LF6B 3L9DA 2F1MA 1N36B 1SZXA 4LF4O 2VQEO 4OXSA 4CBCA 4UVCA 2M7WA 3HKEB 2R70A 1K5QA 4XDKA 1YZBA 3APOA 4GX5A 2IU3A 5GTIZ 1N33O
chains in the Genus database with same CATH topology
2GHYA 3X2QC 3E8GA 4GT1A 3E35A 3OGCC 5EK0A 3H01A 3OMNB 3F5WC 4RUEA 4G27B 3SPGA 2X6AA 1H8HG 1XL6A 1K5SA 2IH3C 1KQSU 4MW3A 2XAFA 2IU0A 1V54B 4JYCA 1M9NA 1FS0G 3T4DA 1FXKA 1ENVA 3ZRSA 3OM3B 4E2LA 1VQNV 1Y66A 4FK5C 1NH2D 4YXWG 3ML0A 3ZRXA 3ASNB 3EHBB 4ZBMA 1S72V 4KUMA 1OCOB 3B8NA 3E89A 5B1NA 3E86A 4UVAA 1QCEA 1ZWIC 1GKFA 4TT3G 5IYDO 3QNEA 3K0DA 3IFXA 4XDLA 4QPKA 1XL4A 3OUFA 3CC4V 1S76D 3GB7C 3E8BA 5CBGA 1F51A 1KECA 1R73A 2JJ1G 1MOFA 2WLMA 3CYOA 3LSSA 4X88A 1JQ0A 1V55B 2EILC 1P7BA 4EKWA 4TSFG 3SYAA 1YTFD 4N21A 1IXMA 4H33A 3FYIB 1RM1B 1M57C 1THZA 3ETGA 1FXVA 2A0LA 1F4NA 4G28B 2AHYA 3RVZA 5CBHA 3ZIAG 1VQOV 1LNQA 2X6CA 3W7SA 1F23A 2WLNA 5KUMA 1JOYA 2P6JA 5J9PC 4TWKA 1I5XA 5C93A 5L3FA 2D3OW 5H6RA 3ZMTA 2QEXV 2EIJC 2LFSA 2ZXWB 1KC8W 3E83A 1GO3F 1GK9A 1KP3A 3ETEA 2WLJA 1GM8A 3FB7C 4I5SA 4QE9A 3M99B 3T1CA 5EBMC 4WCEV 3G6EV 5CN0A 2EIMB 1PNMA 5IY5B 5L3BA 1PNKA 3ZJZA 1DTOA 1PNLA 3LNMB 3ZRWB 3OFNG 4WFGA 4PA6A 4HAMA 5HFLA 1S0VA 2MK3A 4PDLA 1JPXA 4PDRA 2ATKC 1QLEB 2GSMB 1NVPD 2IH1C 2CK3G 2EIKB 5L3DA 3JYCA 3KG2A 5B1OA 5EC1C 5LHGA 3ZMZA 4Z1MG 2QTOA 2EZOA 2KB1A 5EC2C 2JEXA 3UM7A 1Q82W 1P4RA 1CEZA 2OCCC 1W2BU 1NH2B 1NR1A 2WLKA 2WSSG 3F7VC 2OT5A 1DF5A 3W7WA 1OCZC 1AROP 4BIZA 1Q81W 4P9OA 3ABKB 3AG1C 4R8CA 3CD6V 3ZRVA 1AI6A 1TUEB 3RVYA 1M56C 4MTGA 1NQTA 2ITDC 2EILB 2X6BA 2WWWA 3CCMV 3LDDA 4JAUA 4MTXA 1EFRG 1FFTB 2JDIG 3AG2C 3AG3C 3CXCU 2HJFC 3JD4A 3ZMUA 2A9HA 3D36A 3BEHA 2BOCC 1MSWD 2XAHA 3IGAC 4FJCC 4PA9A 1KD1W 1CP9A 3LUTB 1NJIW 2DYRC 3B8MA 2DW4A 4JGSA 1GTOA 2QM8A 4RQEA 4RQFA 3VOUA 3ZRWA 1AJPA 3QO8A 3JD1A 3OR6C 3ASOB 3QO7A 4DXWA 2LFRA 4QIWF 1SETA 3WG7B 2F43G 2P90A 4MVQA 3DGEA 1QBZA 2V7QG 1QR9A 1K7DA 2BOBC 2EZPA 4HYOA 3G4SV 1AJQA 4UUJC 1YIJV 2Q67A 2W0FC 4DO2A 2HVJC 4LP8A 1GM9A 4P30A 5HFMA 1YITV 3MHHC 3ABMC 1OCCC 3JD3A 4WFEA 3ZN1A 3W7XA 2WPDG 2WLLB 1RPRA 1L1FA 2R9RB 3AG4B 3SPJA 2DYSC 5CMUA 4MSWC 1H2GA 4PDVA 4MVUA 5KA5A 5B1BC 2B1GA 2IJKA 3WFVA 1DF4A 2AHZA 2HKOA 1H8EG 1K8AW 1R3LC 1FXHA 1PKXA 4MS2A 1FXKC 1EBOA 1VQ5V 2OCCB 4U7OA 5GW7A 3SPIA 4RUFA 4RAIA 4PDMA 4BIUA 3RBZA 3AEIA 4H37A 5LGUA 3CCSV 1YSCA 4XBFA 4Q20A 1Q7YW 2ZD9A 3G71V 1VQKV 4ASUG 2EINC 1ROPA 4XDJA 3D3IA 1K9MW 3CMAV 1M56B 4FIPC 3T4ZA 1EZJA 1K34A 3ZN0A 4JASA 1WLEA 4U7NA 1YJWV 2P7TC 4L87A 5CA3A 2PI5A 3UKMA 1VQ7V 1N8RW 2OTLV 3SPHA 1VQMV 2HVKC 1B6QA 4LBEC 2Y69B 5DM6V 5LHIA 1COWG 4R50A 3ABLC 1MG1A 3CCJV 5LGNA 3X2QB 3HB3B 3IC7A 1BHAA 2YSUB 4FMTA 1K4DC 3HPLC 5B3SC 5L3GA 1R3IC 3T2MA 3F7YC 1UJWB 2HG5C 1K3EA 1VQPV 4J9YB 3TCUA 5DN6G 4UV9A 4P2ZA 2ITCC 1YJNV 4WFHA 2IJIA 4CZZA 1SERA 3NXSA 4WFFA 1OCRC 2PI4A 4ZKIA 2EBOA 1QLNA 1V54C 1YI2V 3E8HA 3TETA 1G4YB 2HR3A 3CPWU 5B1BB 1S3JA 3QO5A 5E1AC 3SYQA 1M90W 2HFEC 2K1EA 3ASNC 3ABTA 2ZQMA 1OCOC 1SRYA 4FPPA 3SYOA 2H8PC 3I55V 2WAMA 4GX2A 5LGTA 1GMGA 2NNUA 2XASA 1CPYA 4QNHB 1R3JC 4X89A 2DWDC 1QVGU 1M57B 3ABUA 3JD2A 1NKDA 1HWYA 2IJJA 2ZDIA 3E8FA 4JTDB 1I5YA 4UXNA 1SZTA 4BW5A 3FB6C 3A0RA 5H6QA 1E1QG 4MVZA 4N23A 3CCQV 2UXXA 1V55C 3CCVV 1YTFB 2Q69A 1VQ9V 4I9WA 1BHBA 5H9CA 4LCUC 3EFFK 2EIJB 5IYCO 1MABG 3K3WA 4WF9V 3K79A 3JD0A 3K04A 3CCUV 3W7TA 4JTAB 1S5HC 1K33A 3CCEV 2WLIB 2W6JG 3K06A 2EJRA 4MTFA 3ETDA 4J9ZB 1QR8A 3LSQA 3MHSC 3E2EA 4JYBA 5B1AC 3CC7V 1ORQC 1YJ9V 4MVRA 2X0LA 1JCHA 5LBQA 2EIMC 1J95A 1OCRB 5IY5C 1BMFG 3MD0A 4PA3A 1RPOA 5IYBO 1OHHG 5LHHA 2JK5C 1VQLV 4MW8A 1M1KW 2DQ0A 1DLBA 1G8MA 3K0GA 1KP2A 4F4LA 1VQ8V 1NVPB 1F4MA 1QLEC 2ZR3A 2OTJV 2YEVB 3STZC 4GCZA 1OCZB 2EIKC 3CCRV 2ZR2A 4QJFB 3P30A 3B77A 2JEUA 3OUSA 2Z5UA 2P67A 5EBWC 2NLJC 3AG1B 2HLDG 3OR7C 2H94A 3I56V 3BY6A 2QKSA 3CCLV 4PA4A 2XAJA 4UVBA 5L3CA 3AG2B 3ZMVA 1K73W 3AG3B 3FB5C 4PELA 2JJ2G 4MTOA 4RO2A 1E79G 3ABKC 4GX1A 1JX9A 2LP7A 3OE7G 3P32A 1PD3A 2XOKG 3OMAB 2XAQA 5L3EA 1Q86W 2FTKA 1QVFU 1YHQV 2WLIA 1K4CC 1AJNA 2DYRB 2QE7G 1PL0A 5KA6A 3CP1A 3OAAG 2Q68A 3SJQC 2XAGA 1SESA 1AR1B 4JAVA 4R7CA 1AI5A 2B1IA 1VQ6V 4MT8A 4QPJA 4WFAV 1GM7A 3LDCA 5CBFA 3LDEA 3CC2V 3SYCA 4HZ3A 2Y48A 2WLLA 3OW2U 1S77D 3GWOA 2Z3YA 1K97A 1W0KG 3ASOC 3JCZA 4PA7A 4KFMA 5B1AB 3K03A 1OZ0A 3ABMB 1WPXA 1OCCB 3TK1A 3WG7C 3CMEV 4R6ZA 3ZMSA 2Q6AA 2QM7A 2DYSB 3FYEB 1R6NA 3VBBA 2YEVA 3DTUB 5KUKA 4G2KA 4WFBV 4JTCB 2C2AA 1H38A 1R6KA 2IW5A 4MVSA 4QE7A 2A79B 4LC1A 5BZBA 3K08A 1FXKB 1BL8A 2DWEC 1JVMA 3AG4C 1R3KC 3FB8C 3OEHG 3OMIB 1W0JG 4JF3A 2B5UA 2WLHA 3FKSG 1NBMG 3W7UA 2X7RB 4P9PA 5FL7G 1E1RG 4KP4A 4BAYA 2EINB 3RW0A 2W6IG 3K9AA 2XNDG 1KKDA 1AI7A 4MVOA 1JJ2U 2R9IA 2UXNA 1AI4A 3SYPA 2DQ3A 5IDJA 1VQ4V 4UV8A 3SPCA 4MVMA 3PJSK 1RM1C 1Y4MA 3R65A 3STLC 3ABLB 4GX0A 4X8AA 2IJHA 1K92A 2V1DA 4OXSA 4CBCA 4UVCA 5B3SB 1NR7A 2M7WA 2QA4V 1K5QA 2Y69C 4XDKA 2JIZG 4GX5A 2IU3A 5EBLC 2ZDIC 3ZCCA 2ZXWC 4JPRA 3OEEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q C;  1R3I C;  2WLK A;  3E8G A;  3F7V C;  3F7Y C;  2HG5 C;  3OGC C;  3T2M A;  1OCZ C;  5EBW C;  5EK0 A;  2NLJ C;  4J9Y B;  3OR7 C;  3TCU A;  3F5W C;  4RUE A;  4G27 B;  3SPG A;  2X6A A;  4P2Z A;  2QKS A;  1XL6 A;  2ITC C;  4P9O A;  4PA4 A;  3AG1 C;  4R8C A;  4WFH A;  3RVY A;  2IH3 C;  1M56 C;  3FB5 C;  4MW3 A;  4MTG A;  4WFF A;  1OCR C;  2ITD C;  4MTO A;  4RO2 A;  2X6B A;  3ABK C;  4GX1 A;  3T4D A;  3LDD A;  3AG2 C;  3AG3 C;  1V54 C;  3ZRS A;  2HJF C;  3E8H A;  3TET A;  2A9H A;  1G4Y B;  2WLI A;  1K4C C;  3BEH A;  2BOC C;  4ZBM A;  3IGA C;  2Q68 A;  4PA9 A;  3SJQ C;  3E89 A;  3E86 A;  3LUT B;  4R7C A;  5E1A C;  2DYR C;  3SYQ A;  2HFE C;  1ZWI C;  2K1E A;  3ASN C;  3VOU A;  1OCO C;  3K0D A;  3LDC A;  3SYO A;  5CBF A;  2H8P C;  3IFX A;  3LDE A;  4XDL A;  3SYC A;  1XL4 A;  3OR6 C;  4HZ3 A;  3OUF A;  2WLL A;  4DXW A;  4GX2 A;  3OUS A;  3GB7 C;  3E8B A;  5CBG A;  4MVQ A;  4PA7 A;  3ASO C;  4QNH B;  2WLM A;  1R3J C;  4KFM A;  2DWD C;  3K03 A;  4X89 A;  4X88 A;  2BOB C;  4HYO A;  4UUJ C;  3WG7 C;  2Q67 A;  2EIL C;  1P7B A;  4R6Z A;  2W0F C;  4JTD B;  3E8F A;  2HVJ C;  4LP8 A;  2Q6A A;  3SYA A;  4BW5 A;  4EKW A;  4P30 A;  3FB6 C;  4H33 A;  4MVZ A;  5KUK A;  2YEV A;  1V55 C;  3ABM C;  1M57 C;  1OCC C;  2Q69 A;  2A0L A;  4JTC B;  4WFE A;  4I9W A;  4G28 B;  2WLL B;  2AHY A;  2R9R B;  4MVS A;  4QE7 A;  3RVZ A;  2DYS C;  2A79 B;  3SPJ A;  4MSW C;  5CBH A;  4PDV A;  4MVU A;  1LNQ A;  2X6C A;  4LCU C;  2WLN A;  3EFF K;  5B1B C;  5BZB A;  3K08 A;  2DWE C;  1BL8 A;  1JVM A;  2AHZ A;  3AG4 C;  1R3K C;  3FB8 C;  5KUM A;  5J9P C;  3K04 A;  4TWK A;  1R3L C;  4JTA B;  2WLH A;  1S5H C;  2EIJ C;  4MS2 A;  3E83 A;  2WLI B;  3K06 A;  2WLJ A;  3FB7 C;  3SPI A;  4RUF A;  4RAI A;  4MTF A;  4P9P A;  4PDM A;  4QE9 A;  3T1C A;  3RBZ A;  3RW0 A;  4H37 A;  4J9Z B;  5EBM C;  1KKD A;  4MVO A;  5B1A C;  2ZD9 A;  3ZJZ A;  3LNM B;  2EIN C;  1ORQ C;  4MVR A;  4WFG A;  4XDJ A;  3SYP A;  4PA6 A;  3T4Z A;  2EIM C;  1J95 A;  4MVM A;  3SPC A;  5IY5 C;  4PDL A;  3PJS K;  4PA3 A;  2P7T C;  3R65 A;  4PDR A;  3STL C;  4GX0 A;  3UKM A;  2ATK C;  2JK5 C;  3SPH A;  4MW8 A;  4X8A A;  2HVK C;  4LBE C;  2IH1 C;  3K0G A;  4F4L A;  4R50 A;  3JYC A;  3KG2 A;  3ABL C;  5EC1 C;  1QLE C;  4OXS A;  4CBC A;  2QTO A;  2KB1 A;  2Y69 C;  4XDK A;  5EC2 C;  3STZ C;  3UM7 A;  2EIK C;  4GX5 A;  5EBL C;  1K4D C;  2ZXW C;  3HPL C;  5B3S C;  2OCC C; 
#chains in the Genus database with same CATH topology
 4OGQ B;  2JGU A;  1NU1 H;  3EXA A;  2N05 A;  1XRE A;  3WB2 A;  2F4V B;  1H8H G;  1K5S A;  2UUB B;  4YJ2 B;  2XAF A;  1V54 B;  1D2D A;  5J2U B;  3C90 A;  4E2L A;  2QWN B;  1HNZ B;  4LWS B;  3HKC A;  1A32 A;  4YXW G;  3ZRX A;  4LF9 O;  4YHH O;  3EHB B;  1KYO F;  5JH7 A;  1OCO B;  3CJH B;  3E89 A;  2G38 A;  3L75 H;  3OT7 A;  3N27 A;  4XDL A;  3L71 H;  3CC4 V;  4Z2W A;  3GB7 C;  3E8B A;  1FYJ A;  2ZCE A;  5CBG A;  1KEC A;  2JJ1 G;  3H1H H;  3HKB B;  1JQ0 A;  2EIL C;  5EZY B;  1SQB H;  1EN6 A;  4N21 A;  1RM1 B;  2RNB A;  1MZE A;  1SC5 B;  3E22 B;  1U96 A;  5CBH A;  3U10 A;  1F23 A;  2WLN A;  4LF6 O;  1LUW A;  1I5X A;  5L3F A;  2P4V A;  3E83 A;  2WLJ A;  3M99 B;  3T1C A;  2QWQ B;  1NTM H;  1PNK A;  3ZJZ A;  1DTO A;  3LNM B;  2WA3 A;  3ZRW B;  4LF8 B;  1XI1 A;  4DRX A;  1SQG A;  3CHX A;  3RGB A;  2MK3 A;  2CGN A;  4PDL A;  1PP9 H;  4PDR A;  3L74 H;  3FFQ A;  2ATK C;  4LH6 A;  4AHC A;  3DC6 A;  3P3P A;  1TUB A;  1Y76 B;  1HNZ O;  1AP5 A;  2WLK A;  3ICX A;  2OT5 A;  3W7W A;  3C3S A;  2CTQ A;  1AP6 A;  4GZR B;  5FPO A;  5LYJ B;  2AZ2 A;  3BAA A;  1BE3 H;  1AI6 A;  3RVY A;  1NQT A;  2YC0 A;  2KKW A;  3RWR D;  5BR8 B;  3CCM V;  3G67 A;  4MTX A;  3LDD A;  1EFR G;  1FFT B;  4DV0 B;  2R72 A;  3CXC U;  4AQY B;  2RCV A;  4AI8 A;  3IGA C;  4PA9 A;  4DR1 O;  2DYR C;  4DV7 B;  5LMN B;  2DW4 A;  1Y74 A;  1SS3 A;  1U97 A;  3OR6 C;  3H1K H;  5BY1 A;  3I5D A;  3DGE A;  1P84 F;  2V7Q G;  2PYJ A;  4UUJ C;  4I4T A;  3VQX A;  2PTM A;  1XQ8 A;  1BQ0 A;  3WB0 A;  4B7E A;  2IM9 A;  1HW7 A;  4LF8 O;  4K3A A;  3UT5 A;  2WLL B;  1RPR A;  4LNU A;  3AG4 B;  2DYS C;  4J7J A;  1H2G A;  4PDV A;  2B1G A;  2UXC B;  2HKO A;  2BTQ A;  1FXH A;  4B3T O;  4OX9 B;  1EZV H;  1HDJ A;  4DV5 B;  1D5N A;  2OCC B;  5J2T A;  5B5E Z;  4PDM A;  3JSN A;  3AEI A;  5GON B;  1Q7Y W;  3APQ A;  3ZED A;  4FLY A;  1ROP A;  1NS1 A;  3H9V A;  1B3Q A;  4ZHQ A;  3CMA V;  3T4Z A;  4IT5 A;  1EZJ A;  1KKC A;  3UKM A;  3J80 N;  1N8R W;  2OTL V;  1WNS A;  5LXT A;  4UB8 Z;  2KG7 A;  5LOV A;  2Y69 B;  3AG7 A;  2ZNJ A;  1XHX A;  4DV0 O;  5LGN A;  4DUY B;  1KU9 A;  5LP6 A;  5IYZ B;  3IC7 A;  2YSU B;  4FLW A;  4O2A A;  5L3G A;  2HG5 C;  4DV7 O;  5LMN O;  1BZK A;  4P2Z A;  2ITC C;  1H2N A;  3KCX A;  5C8Y B;  4K8X A;  2YI9 A;  1OCR C;  3K9S A;  3RYH B;  3N2G A;  1YI2 V;  3E8H A;  3RYI B;  2AXT Z;  2QSA A;  3TET A;  4X65 B;  4LFC O;  2HR3 A;  4X1Y A;  3T1Y B;  5KHH A;  1S3J A;  3QO5 A;  1VAR A;  3SYQ A;  4O2B B;  3SYO A;  1MSD A;  2JS3 A;  4GX2 A;  1JA8 A;  4OX9 O;  1GMG A;  1XUQ A;  1CPY A;  2YIB A;  4X89 A;  3CXH F;  1NKD A;  1HWY A;  3E8F A;  4JTD B;  3SDL A;  4BW5 A;  1VQP V;  3FB6 C;  1YTF B;  4MVZ A;  3CCQ V;  2UXX A;  5EIB D;  4I9W A;  1BHB A;  2Q7E A;  3EFF K;  5IYC O;  1IX9 A;  3Q4H A;  5EIB C;  4DV1 O;  4YY3 B;  1I94 O;  2YUA A;  1G6U A;  4JTA B;  4GKK B;  5LA6 B;  3CCE V;  3N2K B;  4DUY O;  4MTF A;  3C3T A;  3ETD A;  2LO1 A;  3LSQ A;  3MHS C;  2Q9L A;  5B1A C;  3CC7 V;  4U3F H;  2ZIM A;  1Q6U A;  2O57 A;  5BMV A;  5IY5 C;  4CC5 A;  3MD0 A;  4PA3 A;  4O4I B;  5IYB O;  1FKA O;  1D5A A;  2JGD A;  1OHH G;  1M1K W;  2JS5 A;  4YIP A;  1DLB A;  1G8M A;  5IJ0 B;  5EYP A;  2ZT9 B;  1NVP B;  2RQ6 A;  2YEV B;  1SQX H;  3CCR V;  3B77 A;  3JAS A;  4X65 O;  4DR7 B;  4TV8 A;  3DSQ A;  3T1Y O;  4HNA B;  4DYL A;  2CUG A;  2QKS A;  2XAJ A;  4JI2 O;  3K5O A;  3ZMV A;  1K73 W;  3AG3 B;  3SJC C;  4RO2 A;  1E79 G;  4DV6 B;  2XOK G;  5L3E A;  3RYC B;  2GV9 A;  4R7C A;  2B1I A;  1VQ6 V;  1YCI A;  4QPJ A;  1ZX3 A;  4X1I B;  3JAL B;  3CC2 V;  3BPZ A;  3SYC A;  2Q0A A;  4GKK O;  3LNN A;  5LP6 C;  1XNQ B;  3ABM B;  4ZOL B;  4U3J A;  3RYF B;  1FD9 A;  3CME V;  2E5L B;  1EN4 A;  4BR6 A;  2Q6A A;  3JAR B;  1FAF A;  1R6N A;  3VBB A;  3DTU B;  3FAV A;  2C2A A;  4MVS A;  5JVD B;  3O65 A;  1RP3 B;  1PPJ H;  1L8D A;  1BL8 A;  3S3W A;  1R3K C;  4UCO A;  3FB8 C;  1LR1 A;  4FFB B;  4DV2 O;  5D5Q A;  3TXQ A;  1BCC H;  2PF4 E;  1XMQ O;  1HR0 O;  2X7R B;  1E1R G;  2RDC A;  2EIN B;  3JAW A;  4DR7 O;  2W6I G;  1AI7 A;  2UXN A;  2DQ3 A;  3DXR A;  4KXR A;  3SPC A;  4ABM A;  3R65 A;  2YIB D;  2HJD A;  4EB6 A;  4GX0 A;  4IIJ B;  3ZHQ A;  4X8A A;  5IE9 A;  3BAB A;  3OTO O;  1W59 A;  4JI3 O;  2Q5Z A;  1YDX A;  3ZCC A;  3H1L H;  4IHJ B;  3E8G A;  1XMO B;  3OGC C;  5EK0 A;  2X6A A;  2ZKO A;  1Q3E A;  3VQY A;  2OIE A;  1ZSP A;  4JYC A;  1WP8 A;  4KHP B;  1WA8 A;  1ENV A;  3ZRS A;  2E5L O;  2N74 A;  4FK5 C;  1DGS A;  3ASN B;  4GYC B;  4W4L A;  4LF7 B;  4I50 A;  1TAE A;  1B06 A;  2N04 A;  1ZWI C;  3IFX A;  4QPK A;  5CB4 A;  3MDS A;  2DN9 A;  4LF4 B;  2VQE B;  1F51 A;  1R73 A;  1JMK C;  3VQW A;  1AIL A;  1V55 B;  4O4H B;  4J80 A;  2YDE A;  4TSF G;  1N33 B;  1IXM A;  3FYI B;  4B3M B;  1GRJ A;  1IDS A;  1M57 C;  1FXV A;  3RVZ A;  1BSM A;  1IBL B;  1VQO V;  2X6C A;  4FVM A;  3W7S A;  3JAT B;  3WB1 A;  1L0L H;  5J9P C;  4TWK A;  1GO3 F;  1GK9 A;  4NYK A;  3FB7 C;  5EBM C;  5J2U A;  2EIM B;  5L3B A;  1XMO O;  3SR2 C;  1PNL A;  4YHH B;  1GH6 A;  3OFN G;  3K5L A;  1I0H A;  3ZHV A;  2BSK A;  1S0V A;  5JCO A;  2ZE6 A;  1J5E O;  2CTW A;  3CJH A;  2QJ1 A;  2VWK A;  1QLE B;  5TIS Z;  1SKV A;  4JYA O;  2GSM B;  2IH1 C;  2CK3 G;  2EIK B;  3JYC A;  4KHP O;  5AG2 A;  1N0N A;  2QTO A;  1H2M A;  2EZO A;  1PV0 A;  3SJA C;  2JEX A;  1Q82 W;  1P4R A;  2V4D A;  4AIL C;  1DF5 A;  1OCZ C;  4LF7 O;  1ARO P;  4IYI A;  1Q81 W;  4P9O A;  3ABK B;  2EX3 A;  3ZRV A;  3E22 A;  1M56 C;  3P3N A;  4MTG A;  1WB7 A;  4X1K B;  2EIL B;  1RSO B;  3BCC H;  2CH7 B;  4LH7 A;  1BS3 A;  1N34 B;  3D36 A;  3BEH A;  4B3M O;  2E75 B;  1KD1 W;  1CP9 A;  1IBL O;  1TGO A;  2QM8 A;  3ZRW A;  1AJP A;  3QO8 A;  4D7S A;  2FML A;  1O9G A;  5IWA B;  3ASO B;  5CA1 B;  3QO7 A;  4DXW A;  2LFR A;  2P90 A;  4JI0 B;  4DV4 O;  1R6T A;  1VEW A;  2EZP A;  2W0F C;  4JI8 O;  1IUR A;  5HFM A;  1Y76 A;  1YIT V;  3MHH C;  2NR5 A;  3L73 H;  4WFE A;  1NZ6 A;  1L1F A;  2GUZ B;  5CMU A;  4MSW C;  5KA5 A;  3A8T A;  1Q6I A;  2IJK A;  3WFV A;  1DF4 A;  1H8E G;  5LYJ A;  4JI1 O;  1PKX A;  4DK1 A;  1VQ5 V;  4RAI A;  2ZE8 A;  5LGU A;  3CCS V;  2OWO A;  4CS2 A;  2ZD9 A;  1VQK V;  3IAY A;  2PUS A;  4FZ1 A;  3KKY A;  1K9M W;  4FIP C;  5DEC A;  1K34 A;  4DR1 B;  3ZN0 A;  2UU9 B;  4IGG A;  4L87 A;  1WJZ A;  3SPH A;  3UO2 A;  1B6Q A;  4A5U B;  4LBE C;  3A0H Z;  3X2Q B;  1Q43 A;  3HB3 B;  2FB5 A;  1N34 O;  3DC5 A;  2AW9 A;  3CRC A;  5KMG A;  3T2M A;  1UJW B;  1K3E A;  2FKX A;  2NN4 A;  4K8Z A;  2P4K A;  4PJ0 Z;  3ETQ A;  1HNX O;  4FM0 A;  2IJI A;  5IWA O;  1SER A;  4H13 B;  4WFF A;  4JI0 O;  4B3T B;  1V54 C;  3K57 A;  2DMX A;  5E1A C;  5JCO C;  2BE3 A;  3ABT A;  1OCO C;  2H8P C;  3UCS C;  2YIC A;  1NI8 A;  2PY5 A;  1I08 A;  3HKC B;  1Z2G A;  1VF7 A;  1R3J C;  5JH7 B;  2DWD C;  1NTZ H;  1QVG U;  1KUQ A;  3JD2 A;  2IJJ A;  1SZT A;  5H6Q A;  3A0R A;  3CCV V;  1QNM A;  5IYZ A;  5KX5 A;  2Q69 A;  2ETN A;  2UU9 O;  4B3S O;  2EIJ B;  4UB6 Z;  1MAB G;  2LJ2 A;  1WN7 A;  3ZHS A;  4JAA A;  2CDY A;  3K04 A;  3CCU V;  4JI6 O;  1S5H C;  2WLI B;  3K06 A;  3H1J H;  3OD4 A;  4F6R A;  2ZM6 O;  3D36 C;  1O9H A;  4JYB A;  4LFC B;  1ORQ C;  2ZE7 A;  2X0L A;  3RYI A;  4UCR A;  1OCR B;  3U11 A;  5JJE B;  2ZE5 A;  1BMF G;  4WBN A;  2JK5 C;  2M6Y A;  4MW8 A;  4O2B A;  2VQF B;  2WA4 A;  5GTH Z;  2CTR A;  2HP8 A;  4DR4 O;  1G1X B;  4DRX B;  4GCZ A;  3P30 A;  2JEU A;  2R9A A;  2RJZ A;  2Z5U A;  3QG5 A;  3AG1 B;  2F95 B;  3JAK A;  3OR7 C;  3A2F A;  5L3C A;  3AG2 B;  3AK2 A;  1GN6 A;  3S3X A;  4DV1 B;  1I94 B;  4MTO A;  3OE7 G;  1Q86 W;  2VWJ A;  1KBH A;  5KHI A;  5LA6 A;  4C7U A;  1YHQ V;  5KA6 A;  3OAA G;  5KAF Z;  1SA0 B;  1AR1 B;  3J7A U;  1JJO A;  5CA0 B;  4WFA V;  3OTF A;  5CBF A;  4O4J A;  1VIB A;  2Y48 A;  3OW2 U;  3GWO A;  4DUZ B;  2ADQ B;  4O4I A;  5KHK A;  1K97 A;  5H5N A;  5B1A B;  1OZ0 A;  1OCC B;  5IJ0 A;  4J7Z A;  2UXB O;  3CSX A;  3ZMS A;  2FL4 A;  2RMK B;  3D3Q A;  3FYE B;  2YEV A;  3KZI Z;  4X9Q A;  1DK1 A;  1R6K A;  1MNG A;  1YVW A;  3CB2 A;  3K08 A;  2YID A;  1FXK B;  1HP8 A;  1JVM A;  3AG4 C;  3OMI B;  4JF3 A;  1W0J G;  1ZTE A;  2B5U A;  2VQF O;  4JI2 B;  2WLH A;  2KQX A;  1CXZ B;  5FL7 G;  4KP4 A;  2UUA O;  3GWK C;  3K9A A;  1KKD A;  4PHZ A;  4NKG B;  5IDJ A;  3IC9 A;  5JQG B;  1NT2 B;  4KL1 A;  3STL C;  2ZIO A;  3ABL B;  1Q5O A;  3NR7 A;  1QHT A;  1K92 A;  2IJH A;  2Y0P A;  1ZL8 B;  4X1I A;  5IJ9 A;  1V9P A;  1M4U A;  1N32 B;  1HNW O;  5B3S B;  1VF6 A;  1NR7 A;  3M7M X;  2Y69 C;  2JIZ G;  2ZXW C;  2GHY A;  3QVN A;  4GT1 A;  3E35 A;  3ZHU A;  1XDC A;  3CS5 A;  4ZOL A;  1XBL A;  3H01 A;  5FNV A;  3F5W C;  4RUE A;  1X59 A;  4ICG A;  5LOV B;  4G27 B;  2DOS A;  3JAR A;  3THO A;  2Q8V A;  3BA8 A;  4NXM O;  4NXN O;  4H0L B;  5LP6 B;  2IH3 C;  1KQS U;  5LMU B;  5JVD A;  4DUZ O;  4DK0 A;  1FS0 G;  4DV2 B;  4O2A B;  3FX7 A;  2Y0I A;  4FFB A;  1XMQ B;  1HR0 B;  1KB9 F;  1Y66 A;  1MZF A;  5K1X A;  5E79 Z;  1NH2 D;  4ZBM A;  4KUM A;  5KAI Z;  3B8N A;  5B1N A;  3E86 A;  4UVA A;  5IYD O;  2ARH A;  1IBK O;  3CRA A;  2L35 A;  1FJG O;  1S76 D;  4PI2 A;  1FFX B;  4X1Y B;  1VMG A;  4IIJ A;  2WLM A;  3OTO B;  4JI3 B;  2HHH O;  1XEQ A;  2A3Q A;  1YTF D;  2ODM A;  1THZ A;  1SQF A;  1F4N A;  3QF7 A;  4IHJ A;  5D5P A;  5KHG A;  1LNQ A;  3L72 H;  1P7G A;  1IVS A;  4TQF A;  5KUM A;  1JOY A;  2P6J A;  2QEX V;  3B4S A;  2D3O W;  3ZMT A;  4X62 B;  2LFS A;  1KC8 W;  1N32 O;  1OV9 A;  4DR3 O;  1ZUQ A;  3ZBH A;  4WCE V;  4LR3 A;  3FD9 A;  1IXB A;  3RN4 A;  3Q4H B;  4PA6 A;  3RFR A;  4HAM A;  5HFL A;  2QTS A;  2PYL A;  3RT3 C;  3G6B A;  4FLX A;  4FM1 A;  5LMU O;  2GTA A;  1NVP D;  4FLZ A;  2KSD A;  5B1O A;  3KG2 A;  5LHG A;  5EC1 C;  3ZMZ A;  1N0J A;  4Z1M G;  4FLT A;  2KB1 A;  3UM7 A;  1Y6X A;  2UXD O;  5BMV B;  1CEZ A;  1NR1 A;  3L70 H;  1X4T A;  4O4H A;  5LL6 Y;  4BIZ A;  5EYP B;  4E4E A;  4R8C A;  1TUE B;  4I55 A;  2Y4U A;  3JAS B;  5KLV H;  2MW2 B;  4JAU A;  2JVD A;  3JAT A;  2BCC H;  3AG3 C;  2BTO A;  4RWU A;  4X20 B;  2HJF C;  2IBZ H;  4JZG A;  3ZMU A;  2D2C B;  4PI0 A;  2XAH A;  4FJC C;  4D6T H;  1NJI W;  4JGS A;  5H2F Z;  2QM4 A;  4RQF A;  3SJB C;  3VOU A;  1XIL A;  1VP7 A;  1J5E B;  4X62 O;  2QKC A;  4QIW F;  4JYA B;  1SET A;  3WG7 B;  2GBO A;  2F43 G;  1VF6 C;  5JWP A;  1QR9 A;  1K7D A;  4HYO A;  1YIJ V;  2LW7 A;  4UCS A;  3ZS8 C;  4IL6 Z;  3ABM C;  3JD3 A;  3W7X A;  3KCY A;  2UUC O;  3SPJ A;  2E76 B;  4MVU A;  5B1B C;  1URF A;  2AHZ A;  3BFR A;  4JI5 B;  1K8A W;  1R3L C;  4MS2 A;  1EBO A;  4OPH A;  4U7O A;  4RUF A;  3U0Z A;  2AZ0 A;  4X1K A;  3RBZ A;  1YSC A;  5ITZ B;  1RSO A;  1RFY A;  4J42 A;  2CH7 A;  4ASU G;  2EIN C;  3HKE A;  1XNR O;  1M56 B;  1YJW V;  1WLE A;  4K0K B;  5CA3 A;  4BW9 A;  4TOI A;  1US6 A;  2VRZ A;  4JI7 O;  2YXH A;  1JFF B;  3SGI A;  4DV4 B;  4YJ2 A;  1BHA A;  2YIA A;  1K4D C;  4UCV A;  3HPL C;  4L8J A;  4JI8 B;  3F7Y C;  3LSU A;  4ZI7 B;  2FYU H;  5DN6 G;  4LWS A;  1B04 A;  4B3R B;  4DW1 A;  4JV5 O;  5IT9 N;  1YJN V;  4WFH A;  4CZZ A;  4TUY B;  3NXS A;  3AK1 A;  4ZKI A;  2EBO A;  4JI1 B;  1QLN A;  1TVK B;  3JAM N;  1G4Y B;  3R66 A;  3QTC A;  3CPW U;  1F7Y A;  3HKB A;  2QDO A;  1M90 W;  3ASN C;  5EZY A;  3TXS A;  2ZQM A;  1SRY A;  4YJ3 B;  4FPP A;  1WA8 B;  4JI5 O;  2WAM A;  4I0X B;  3OGI B;  4TV9 B;  2EUL A;  4UFZ A;  4QNH B;  4LF5 O;  4UXN A;  2ZDI A;  2E74 B;  1I5Y A;  1L0N H;  4O4L B;  1E1Q G;  1V55 C;  4B08 A;  1N4C A;  1VQ9 V;  4J10 A;  5CB4 B;  4K0K O;  2CTP A;  5H9C A;  2CGO A;  3UQ8 A;  3K79 A;  3JD0 A;  1HNX B;  3ZHT A;  2W6J G;  2EJR A;  2XT9 A;  4J9Z B;  1QR8 A;  5KHJ A;  3E2E A;  4CS3 A;  3CRQ A;  4MVR A;  1JCH A;  4B3R O;  2EIM C;  1J95 A;  4DR2 O;  1RPO A;  4D7T A;  2H3O A;  5LHH A;  2DQ0 A;  1SF9 A;  3K0G A;  1VQ8 V;  1QLE C;  3A0B Z;  2ZR3 A;  2EIK C;  2ZR2 A;  2BSK B;  4QJF B;  2XHB A;  5EBW C;  2NLJ C;  3UO3 A;  2HLD G;  2PGG A;  5F2V O;  2H94 A;  1I7F A;  4DR6 B;  3BY6 A;  3CCL V;  4B3S B;  4PA4 A;  4EFE A;  3BVO A;  3HKD B;  4UVB A;  4FZ0 A;  4PEL A;  4X66 O;  3ABK C;  4GX1 A;  4JI6 B;  1XHZ A;  3P32 A;  1PD3 A;  4NVP A;  3OMA B;  4GLX A;  3AK3 A;  1QVF U;  1AVM A;  2QR4 A;  4GUN A;  2ZM6 B;  2WLI A;  2A06 H;  2DYR B;  4JI4 O;  3CP1 A;  1SES A;  3PN1 A;  1AI5 A;  1QQC A;  1N36 O;  1M5I A;  1GN4 A;  5A9G A;  2YI8 A;  2WLL A;  3CE2 A;  2Z3Y A;  1WAZ A;  1M93 A;  2QGN A;  4DR4 B;  4PA7 A;  3ASO C;  3JCZ A;  4KFM A;  3CEI A;  3TK1 A;  4R6Z A;  4J11 A;  4JZ2 A;  4X64 B;  1TA8 A;  2DYS B;  5KUK A;  4WFB V;  4G2K A;  4JTC B;  1H38 A;  2AGA A;  2IW5 A;  4QE7 A;  5GON A;  2F4V O;  2A79 B;  4CC6 A;  4LC1 A;  5BZB A;  2UUB O;  2DWE C;  3OEH G;  2QWP B;  1ZAU A;  3W7U A;  4J41 A;  2LGW A;  4BWA A;  2XND G;  3TGU H;  2R9I A;  3SYP A;  1Z5V A;  1VQ4 V;  4UV8 A;  1SQV H;  2QKA A;  4MVM A;  4DR6 O;  3PJS K;  4EFB A;  1RM1 C;  1Y4M A;  1SA0 A;  1WB8 A;  4YIO A;  1H2L A;  5CA0 A;  2V1D A;  3CRM A;  5C8Y A;  1WPB A;  2QA4 V;  4DV3 B;  2OIG A;  5EBL C;  2ZDI C;  5B66 Z;  2UXB B;  4JPR A;  3OEE G;  3X2Q C;  3CX5 F;  3T1H B;  3RYH A;  1MMM A;  3OMN B;  4IYH A;  1Q6H A;  3SPG A;  1IBM B;  1XL6 A;  4MW3 A;  4F6E A;  2IU0 A;  1M9N A;  3T4D A;  1FXK A;  2GDS A;  5KMG B;  2DJV A;  1GN2 A;  3OM3 B;  2OYQ A;  1VQN V;  2UUA B;  4X64 O;  3ML0 A;  5BXZ A;  1S72 V;  2P5O A;  4Q6G A;  4FLU A;  1QCE A;  1GKF A;  4TT3 G;  3QNE A;  3K0D A;  1TUB B;  1XL4 A;  4GKJ B;  3OUF A;  5JQG A;  1PM9 A;  1MOF A;  3CYO A;  3LSS A;  3BHP A;  4X88 A;  1HNW B;  5DED A;  1ZL8 A;  1P7B A;  4EKW A;  3SYA A;  1WP7 A;  4H33 A;  3N2K A;  1XOU A;  2Q0O C;  3ETG A;  4NTY A;  2A0L A;  2EJ7 A;  4G28 B;  2AHY A;  2LW1 A;  3ZIA G;  5K1P A;  3ZHR A;  4NXN B;  4NXM B;  2Q7G A;  5C93 A;  5BR8 O;  5H6R A;  2EIJ C;  2ZXW B;  3ETE A;  1KP3 A;  4I5S A;  1GM8 A;  4AQY O;  1T5E A;  5KX5 B;  4QE9 A;  4DV3 O;  2HEP A;  3G6E V;  5CN0 A;  2OCH A;  1YEW A;  3VQV A;  1PNM A;  5IY5 B;  1Y74 B;  5JJN B;  3T1H O;  1UPG A;  3IJ4 A;  4WFG A;  3JCU Z;  3BRC A;  1IBM O;  1JPX A;  3CRR A;  4HNA A;  1IBK B;  4F6R B;  4TQD A;  4I4T B;  5L3D A;  1FJG B;  5EC2 C;  3UT5 B;  1FFX A;  4LNU B;  2RN9 A;  4NR1 A;  2OCC C;  4CH6 A;  1W2B U;  1NH2 B;  2HHH B;  2WSS G;  2JRI A;  2VS0 A;  3F7V C;  4WBN B;  2LGQ A;  4DW0 A;  2BTQ B;  3K59 A;  2UXC O;  3AG1 C;  3CD6 V;  5J2T B;  4FFK A;  4GKJ O;  3RYC A;  1YF2 A;  2ITD C;  4DV5 O;  2K9P A;  2X6B A;  2WWW A;  2JDI G;  3AG2 C;  3JAL A;  2YS8 A;  3JAK B;  4DR3 B;  4ZHQ B;  3JD4 A;  2A9H A;  1EM1 A;  4CH3 A;  2BOC C;  4BIO A;  4DR5 B;  1MSW D;  2E3C A;  3LUT B;  3RYF A;  3MAQ A;  5LXT B;  3B8M A;  1Z5W A;  4OPA A;  4RQE A;  1GTO A;  2KG7 B;  2L6L A;  3JD1 A;  2F66 C;  4MVQ A;  1QBZ A;  1ZLZ A;  2BOB C;  4K35 A;  4Z1V A;  3G4S V;  1AJQ A;  2Q67 A;  2UXD B;  4DO2 A;  3O9O A;  2HVJ C;  3H1I H;  1GM9 A;  2YXL A;  4LP8 A;  4P30 A;  1OCC C;  4JYY A;  4O4J B;  3ZN1 A;  2WPD G;  5FPR A;  2R9R B;  3HR0 A;  3K5N A;  4UCU A;  2CE4 A;  3G80 A;  3N2G B;  4NTW A;  4W4K A;  1FXK C;  2DE0 X;  5GW7 A;  3SPI A;  4BIU A;  4H37 A;  4CS4 A;  4XBF A;  4Q20 A;  3G71 V;  4X20 A;  3J81 N;  4XDJ A;  3D3I A;  1EN5 A;  4JAS A;  4U7N A;  3B40 A;  2P7T C;  1YXB A;  2PI5 A;  1SQP H;  1VQ7 V;  1AB3 A;  1MA1 A;  2F23 A;  2PZS A;  1VQM V;  2HVK C;  5DM6 V;  5LHI A;  1COW G;  4R50 A;  3ABL C;  1MG1 A;  3CCJ V;  3F5T A;  4FMT A;  5B3S C;  1R3I C;  4DR5 O;  1Q90 D;  4H44 B;  4J9Y B;  3TCU A;  2Q7H A;  4NTX A;  4UV9 A;  3JSL A;  2UUC B;  5IJ9 B;  4YY3 O;  3CWB H;  2PI4 A;  1UFI A;  1BQZ A;  1S5J A;  5FNV B;  4ZIB A;  5FLX N;  5B1B B;  2JGD B;  3TJT A;  4I7Z B;  5ITZ A;  1XNR B;  2HFE C;  2K1E A;  3I55 V;  1R1B A;  5LGT A;  1GN3 A;  2Q4P A;  2NNU A;  2XAS A;  4CH4 A;  4TV8 B;  4PV1 B;  1IZ3 A;  5A2Q N;  4JI7 B;  1M57 B;  3ABU A;  1VQL V;  2ILM A;  2ADP A;  1JFF A;  4HBN A;  4N23 A;  1AR4 A;  2LQT A;  2B9Z A;  1Y67 A;  2F93 B;  4LFB B;  4LCU C;  4ZI7 A;  3K3W A;  4WF9 V;  4JV5 B;  3W7T A;  4DV6 O;  1K33 A;  3M8A A;  4TUY A;  4LFA B;  4CH5 A;  2Y4T A;  3EVK A;  1TVK A;  1BGY H;  2ZNI A;  1Q8I A;  1YJ9 V;  1PL4 A;  5LBQ A;  4EEQ A;  3K5M A;  4PD4 F;  4U3J B;  4F4L A;  1QU7 A;  1KP2 A;  4YJ3 A;  1S5L Z;  1F4M A;  1XNQ O;  3B2E E;  2OTJ V;  2Z0A A;  3FAV B;  3STZ C;  4LF5 B;  4I0X A;  1OCZ B;  2ZIN A;  1BT8 A;  4TV9 A;  1FPO A;  3OUS A;  2W0X A;  2P67 A;  1VF5 B;  4B7K A;  2A7W A;  4O4L A;  3I56 V;  2GTS A;  1NTK H;  4FLV A;  3FB5 C;  2QWO B;  2JJ2 G;  3JAW B;  1JX9 A;  2LP7 A;  2XAQ A;  1JR9 A;  5CA1 A;  2FTK A;  1AR5 A;  3DXR B;  1K4C C;  1AJN A;  2CAZ C;  2QE7 G;  1PL0 A;  2Q68 A;  4FM2 A;  3SJQ C;  4I55 B;  2XAG A;  4EB6 B;  4JAV A;  1H2K A;  4LFB O;  4MT8 A;  1KMI Z;  4DR2 B;  1GM7 A;  3LDC A;  3LDE A;  4HZ3 A;  2GUZ A;  2Q73 A;  1S77 D;  1LUV A;  2XUM A;  1W0K G;  4I9Q A;  4LFA O;  3K03 A;  2P22 C;  1WPX A;  3B09 A;  3WG7 C;  2QM7 A;  1GAX A;  4LF9 B;  1OJH A;  4J7K A;  3ZX6 A;  2YXY A;  3K58 A;  2QWR B;  3BA9 A;  3FKS G;  4X66 B;  3HKD A;  1NBM G;  4P9P A;  4NB5 A;  3D8C A;  4BAY A;  2P06 A;  1SQQ H;  3RW0 A;  4I50 B;  3WU2 Z;  4QGP A;  4MVO A;  1JJ2 U;  1P49 A;  2XTA A;  4JI4 B;  1AI4 A;  4UCT A;  5JJJ B;  3GVM A;  1H2S B;  4LF6 B;  3L9D A;  2F1M A;  1N36 B;  1SZX A;  4LF4 O;  2VQE O;  4OXS A;  4CBC A;  4UVC A;  2M7W A;  3HKE B;  2R70 A;  1K5Q A;  4XDK A;  1YZB A;  3APO A;  4GX5 A;  2IU3 A;  5GTI Z;  1N33 O; 
#chains in the Genus database with same CATH homology
 2GHY A;  3X2Q C;  3E8G A;  4GT1 A;  3E35 A;  3OGC C;  5EK0 A;  3H01 A;  3OMN B;  3F5W C;  4RUE A;  4G27 B;  3SPG A;  2X6A A;  1H8H G;  1XL6 A;  1K5S A;  2IH3 C;  1KQS U;  4MW3 A;  2XAF A;  2IU0 A;  1V54 B;  4JYC A;  1M9N A;  1FS0 G;  3T4D A;  1FXK A;  1ENV A;  3ZRS A;  3OM3 B;  4E2L A;  1VQN V;  1Y66 A;  4FK5 C;  1NH2 D;  4YXW G;  3ML0 A;  3ZRX A;  3ASN B;  3EHB B;  4ZBM A;  1S72 V;  4KUM A;  1OCO B;  3B8N A;  3E89 A;  5B1N A;  3E86 A;  4UVA A;  1QCE A;  1ZWI C;  1GKF A;  4TT3 G;  5IYD O;  3QNE A;  3K0D A;  3IFX A;  4XDL A;  4QPK A;  1XL4 A;  3OUF A;  3CC4 V;  1S76 D;  3GB7 C;  3E8B A;  5CBG A;  1F51 A;  1KEC A;  1R73 A;  2JJ1 G;  1MOF A;  2WLM A;  3CYO A;  3LSS A;  4X88 A;  1JQ0 A;  1V55 B;  2EIL C;  1P7B A;  4EKW A;  4TSF G;  3SYA A;  1YTF D;  4N21 A;  1IXM A;  4H33 A;  3FYI B;  1RM1 B;  1M57 C;  1THZ A;  3ETG A;  1FXV A;  2A0L A;  1F4N A;  4G28 B;  2AHY A;  3RVZ A;  5CBH A;  3ZIA G;  1VQO V;  1LNQ A;  2X6C A;  3W7S A;  1F23 A;  2WLN A;  5KUM A;  1JOY A;  2P6J A;  5J9P C;  4TWK A;  1I5X A;  5C93 A;  5L3F A;  2D3O W;  5H6R A;  3ZMT A;  2QEX V;  2EIJ C;  2LFS A;  2ZXW B;  1KC8 W;  3E83 A;  1GO3 F;  1GK9 A;  1KP3 A;  3ETE A;  2WLJ A;  1GM8 A;  3FB7 C;  4I5S A;  4QE9 A;  3M99 B;  3T1C A;  5EBM C;  4WCE V;  3G6E V;  5CN0 A;  2EIM B;  1PNM A;  5IY5 B;  5L3B A;  1PNK A;  3ZJZ A;  1DTO A;  1PNL A;  3LNM B;  3ZRW B;  3OFN G;  4WFG A;  4PA6 A;  4HAM A;  5HFL A;  1S0V A;  2MK3 A;  4PDL A;  1JPX A;  4PDR A;  2ATK C;  1QLE B;  2GSM B;  1NVP D;  2IH1 C;  2CK3 G;  2EIK B;  5L3D A;  3JYC A;  3KG2 A;  5B1O A;  5EC1 C;  5LHG A;  3ZMZ A;  4Z1M G;  2QTO A;  2EZO A;  2KB1 A;  5EC2 C;  2JEX A;  3UM7 A;  1Q82 W;  1P4R A;  1CEZ A;  2OCC C;  1W2B U;  1NH2 B;  1NR1 A;  2WLK A;  2WSS G;  3F7V C;  2OT5 A;  1DF5 A;  3W7W A;  1OCZ C;  1ARO P;  4BIZ A;  1Q81 W;  4P9O A;  3ABK B;  3AG1 C;  4R8C A;  3CD6 V;  3ZRV A;  1AI6 A;  1TUE B;  3RVY A;  1M56 C;  4MTG A;  1NQT A;  2ITD C;  2EIL B;  2X6B A;  2WWW A;  3CCM V;  3LDD A;  4JAU A;  4MTX A;  1EFR G;  1FFT B;  2JDI G;  3AG2 C;  3AG3 C;  3CXC U;  2HJF C;  3JD4 A;  3ZMU A;  2A9H A;  3D36 A;  3BEH A;  2BOC C;  1MSW D;  2XAH A;  3IGA C;  4FJC C;  4PA9 A;  1KD1 W;  1CP9 A;  3LUT B;  1NJI W;  2DYR C;  3B8M A;  2DW4 A;  4JGS A;  1GTO A;  2QM8 A;  4RQE A;  4RQF A;  3VOU A;  3ZRW A;  1AJP A;  3QO8 A;  3JD1 A;  3OR6 C;  3ASO B;  3QO7 A;  4DXW A;  2LFR A;  4QIW F;  1SET A;  3WG7 B;  2F43 G;  2P90 A;  4MVQ A;  3DGE A;  1QBZ A;  2V7Q G;  1QR9 A;  1K7D A;  2BOB C;  2EZP A;  4HYO A;  3G4S V;  1AJQ A;  4UUJ C;  1YIJ V;  2Q67 A;  2W0F C;  4DO2 A;  2HVJ C;  4LP8 A;  1GM9 A;  4P30 A;  5HFM A;  1YIT V;  3MHH C;  3ABM C;  1OCC C;  3JD3 A;  4WFE A;  3ZN1 A;  3W7X A;  2WPD G;  2WLL B;  1RPR A;  1L1F A;  2R9R B;  3AG4 B;  3SPJ A;  2DYS C;  5CMU A;  4MSW C;  1H2G A;  4PDV A;  4MVU A;  5KA5 A;  5B1B C;  2B1G A;  2IJK A;  3WFV A;  1DF4 A;  2AHZ A;  2HKO A;  1H8E G;  1K8A W;  1R3L C;  1FXH A;  1PKX A;  4MS2 A;  1FXK C;  1EBO A;  1VQ5 V;  2OCC B;  4U7O A;  5GW7 A;  3SPI A;  4RUF A;  4RAI A;  4PDM A;  4BIU A;  3RBZ A;  3AEI A;  4H37 A;  5LGU A;  3CCS V;  1YSC A;  4XBF A;  4Q20 A;  1Q7Y W;  2ZD9 A;  3G71 V;  1VQK V;  4ASU G;  2EIN C;  1ROP A;  4XDJ A;  3D3I A;  1K9M W;  3CMA V;  1M56 B;  4FIP C;  3T4Z A;  1EZJ A;  1K34 A;  3ZN0 A;  4JAS A;  1WLE A;  4U7N A;  1YJW V;  2P7T C;  4L87 A;  5CA3 A;  2PI5 A;  3UKM A;  1VQ7 V;  1N8R W;  2OTL V;  3SPH A;  1VQM V;  2HVK C;  1B6Q A;  4LBE C;  2Y69 B;  5DM6 V;  5LHI A;  1COW G;  4R50 A;  3ABL C;  1MG1 A;  3CCJ V;  5LGN A;  3X2Q B;  3HB3 B;  3IC7 A;  1BHA A;  2YSU B;  4FMT A;  1K4D C;  3HPL C;  5B3S C;  5L3G A;  1R3I C;  3T2M A;  3F7Y C;  1UJW B;  2HG5 C;  1K3E A;  1VQP V;  4J9Y B;  3TCU A;  5DN6 G;  4UV9 A;  4P2Z A;  2ITC C;  1YJN V;  4WFH A;  2IJI A;  4CZZ A;  1SER A;  3NXS A;  4WFF A;  1OCR C;  2PI4 A;  4ZKI A;  2EBO A;  1QLN A;  1V54 C;  1YI2 V;  3E8H A;  3TET A;  1G4Y B;  2HR3 A;  3CPW U;  5B1B B;  1S3J A;  3QO5 A;  5E1A C;  3SYQ A;  1M90 W;  2HFE C;  2K1E A;  3ASN C;  3ABT A;  2ZQM A;  1OCO C;  1SRY A;  4FPP A;  3SYO A;  2H8P C;  3I55 V;  2WAM A;  4GX2 A;  5LGT A;  1GMG A;  2NNU A;  2XAS A;  1CPY A;  4QNH B;  1R3J C;  4X89 A;  2DWD C;  1QVG U;  1M57 B;  3ABU A;  3JD2 A;  1NKD A;  1HWY A;  2IJJ A;  2ZDI A;  3E8F A;  4JTD B;  1I5Y A;  4UXN A;  1SZT A;  4BW5 A;  3FB6 C;  3A0R A;  5H6Q A;  1E1Q G;  4MVZ A;  4N23 A;  3CCQ V;  2UXX A;  1V55 C;  3CCV V;  1YTF B;  2Q69 A;  1VQ9 V;  4I9W A;  1BHB A;  5H9C A;  4LCU C;  3EFF K;  2EIJ B;  5IYC O;  1MAB G;  3K3W A;  4WF9 V;  3K79 A;  3JD0 A;  3K04 A;  3CCU V;  3W7T A;  4JTA B;  1S5H C;  1K33 A;  3CCE V;  2WLI B;  2W6J G;  3K06 A;  2EJR A;  4MTF A;  3ETD A;  4J9Z B;  1QR8 A;  3LSQ A;  3MHS C;  3E2E A;  4JYB A;  5B1A C;  3CC7 V;  1ORQ C;  1YJ9 V;  4MVR A;  2X0L A;  1JCH A;  5LBQ A;  2EIM C;  1J95 A;  1OCR B;  5IY5 C;  1BMF G;  3MD0 A;  4PA3 A;  1RPO A;  5IYB O;  1OHH G;  5LHH A;  2JK5 C;  1VQL V;  4MW8 A;  1M1K W;  2DQ0 A;  1DLB A;  1G8M A;  3K0G A;  1KP2 A;  4F4L A;  1VQ8 V;  1NVP B;  1F4M A;  1QLE C;  2ZR3 A;  2OTJ V;  2YEV B;  3STZ C;  4GCZ A;  1OCZ B;  2EIK C;  3CCR V;  2ZR2 A;  4QJF B;  3P30 A;  3B77 A;  2JEU A;  3OUS A;  2Z5U A;  2P67 A;  5EBW C;  2NLJ C;  3AG1 B;  2HLD G;  3OR7 C;  2H94 A;  3I56 V;  3BY6 A;  2QKS A;  3CCL V;  4PA4 A;  2XAJ A;  4UVB A;  5L3C A;  3AG2 B;  3ZMV A;  1K73 W;  3AG3 B;  3FB5 C;  4PEL A;  2JJ2 G;  4MTO A;  4RO2 A;  1E79 G;  3ABK C;  4GX1 A;  1JX9 A;  2LP7 A;  3OE7 G;  3P32 A;  1PD3 A;  2XOK G;  3OMA B;  2XAQ A;  5L3E A;  1Q86 W;  2FTK A;  1QVF U;  1YHQ V;  2WLI A;  1K4C C;  1AJN A;  2DYR B;  2QE7 G;  1PL0 A;  5KA6 A;  3CP1 A;  3OAA G;  2Q68 A;  3SJQ C;  2XAG A;  1SES A;  1AR1 B;  4JAV A;  4R7C A;  1AI5 A;  2B1I A;  1VQ6 V;  4MT8 A;  4QPJ A;  4WFA V;  1GM7 A;  3LDC A;  5CBF A;  3LDE A;  3CC2 V;  3SYC A;  4HZ3 A;  2Y48 A;  2WLL A;  3OW2 U;  1S77 D;  3GWO A;  2Z3Y A;  1K97 A;  1W0K G;  3ASO C;  3JCZ A;  4PA7 A;  4KFM A;  5B1A B;  3K03 A;  1OZ0 A;  3ABM B;  1WPX A;  1OCC B;  3TK1 A;  3WG7 C;  3CME V;  4R6Z A;  3ZMS A;  2Q6A A;  2QM7 A;  2DYS B;  3FYE B;  1R6N A;  3VBB A;  2YEV A;  3DTU B;  5KUK A;  4G2K A;  4WFB V;  4JTC B;  2C2A A;  1H38 A;  1R6K A;  2IW5 A;  4MVS A;  4QE7 A;  2A79 B;  4LC1 A;  5BZB A;  3K08 A;  1FXK B;  1BL8 A;  2DWE C;  1JVM A;  3AG4 C;  1R3K C;  3FB8 C;  3OEH G;  3OMI B;  1W0J G;  4JF3 A;  2B5U A;  2WLH A;  3FKS G;  1NBM G;  3W7U A;  2X7R B;  4P9P A;  5FL7 G;  1E1R G;  4KP4 A;  4BAY A;  2EIN B;  3RW0 A;  2W6I G;  3K9A A;  2XND G;  1KKD A;  1AI7 A;  4MVO A;  1JJ2 U;  2R9I A;  2UXN A;  1AI4 A;  3SYP A;  2DQ3 A;  5IDJ A;  1VQ4 V;  4UV8 A;  3SPC A;  4MVM A;  3PJS K;  1RM1 C;  1Y4M A;  3R65 A;  3STL C;  3ABL B;  4GX0 A;  4X8A A;  2IJH A;  1K92 A;  2V1D A;  4OXS A;  4CBC A;  4UVC A;  5B3S B;  1NR7 A;  2M7W A;  2QA4 V;  1K5Q A;  2Y69 C;  4XDK A;  2JIZ G;  4GX5 A;  2IU3 A;  5EBL C;  2ZDI C;  3ZCC A;  2ZXW C;  4JPR A;  3OEE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...