2NLJC

Potassium channel kcsa(m96v)-fab complex in kcl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVVVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment light chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nljC00
1V54C 4CBCA 2QKSA 3RVZA 4MVZA 2EIJC 2HVKC 4MVOA 2IH3C 2WLMA 3TETA 2HFEC 2ITDC 3FB7C 3T4ZA 5BZBA 5EBLC 1KKDA 3LDCA 3K03A 2X6BA 3RW0A 4LP8A 1ORQC 1OCZC 5CBHA 4X88A 3HPLC 3RBZA 1P7BA 3K0GA 4P9PA 4MVQA 4QE7A 2ZD9A 2QTOA 1G4YB 2DYRC 3AG1C 3R65A 4R8CA 1K4CC 3LUTB 2X6AA 2ZXWC 4MVUA 4R6ZA 4J9ZB 1R3KC 4MVRA 4WFEA 4G28B 3TCUA 4MTGA 1OCRC 3UKMA 5J9PC 4PA3A 1J95A 4ZBMA 3OUFA 4MW3A 4QNHB 5CBGA 3LDDA 3LDEA 3FB5C 5EBWC 3SPJA 5EC2C 1LNQA 2EINC 3OGCC 3ABMC 4F4LA 2AHYA 4MVSA 5E1AC 5B1BC 1JVMA 2K1EA 3FB6C 4P30A 3ZRSA 3K0DA 4QE9A 5EC1C 4X89A 2Q68A 3WG7C 4P2ZA 3SYPA 3E8BA 1S5HC 4GX5A 3SPCA 2AHZA 2H8PC 3AG3C 3STZC 3GB7C 1XL6A 2Q69A 4OXSA 4XDJA 2R9RB 3ASOC 3E89A 4GX1A 4JTCB 4KFMA 4BW5A 5CBFA 3SYAA 4WFFA 2DWDC 3SPHA 2HG5C 3SYCA 5B3SC 2WLNA 4G27B 2A9HA 2A0LA 2WLLB 4MTOA 4MSWC 2WLJA 4PDLA 4H37A 3SPIA 1OCOC 4XDLA 3RVYA 2Q67A 3SYQA 4RAIA 3OR6C 4RUEA 1BL8A 3E8HA 3F5WC 1V55C 3EFFK 3KG2A 2DWEC 4XDKA 3E86A 3UM7A 2KB1A 4HZ3A 3T1CA 2ITCC 2NLJC 2JK5C 5KUMA 4GX2A 3F7VC 3K04A 1XL4A 3SYOA 2Q6AA 3AG4C 4H33A 4MW8A 4R7CA 3BEHA 3STLC 3E8GA 3VOUA 2BOCC 2OCCC 2YEVA 4RUFA 5IY5C 4PDMA 4MVMA 2A79B 2ATKC 4P9OA 3E83A 2P7TC 3AG2C 4HYOA 2Y69C 5B1AC 2WLIB 2WLLA 3F7YC 4TWKA 3ABKC 1R3JC 4WFHA 3SPGA 3X2QC 3FB8C 4DXWA 4EKWA 3T4DA 4LBEC 2DYSC 1K4DC 3IFXA 4MS2A 1QLEC 3ASNC 4R50A 4WFGA 3IGAC 4MTFA 1OCCC 3JYCA 1M57C 5EBMC 3ABLC 2EILC 3LNMB 5EK0A 1ZWIC 3E8FA 1R3IC 4GX0A 3OR7C 4PA7A 2HVJC 3T2MA 4PDVA 2IH1C 1M56C 4JTDB 3SJQC 3K08A 2EIKC 3K06A 4JTAB 3PJSK 4X8AA 2EIMC 2BOBC 2X6CA 4PA4A 1R3LC 2WLHA 3ZJZA 2W0FC 5KUKA 3OUSA 4J9YB 4PA6A 4LCUC 4I9WA 4PA9A 4RO2A 2WLIA 4PDRA 4UUJC 2HJFC 2WLKA
chains in the Genus database with same CATH superfamily
3LSSA 2QKSA 3AG7A 1MZEA 1MOFA 4TT3G 1I0HA 4LF9O 1HW7A 3ABTA 3N2KB 2PZSA 1Q86W 4DV0B 4FVMA 4O2BB 1DTOA 1G6UA 4K8XA 3C3TA 1OCOB 3JAKA 1S5JA 4BIUA 2GDSA 3BA9A 1D5AA 2CE4A 2CH7A 2UU9O 1QBZA 4FZ0A 1KC8W 4J41A 4X62O 2Q0AA 5IYZA 1TGOA 2JEUA 3E22A 4O4JB 2WA4A 3X2QB 3UO2A 1QLEB 1I94B 4NTXA 3SYAA 4K0KB 3G6BA 4CC6A 2GTAA 4DK0A 3S3XA 5LOVA 2JVDA 4DR4O 2VWKA 4CZZA 4XDLA 4AQYO 2ZNIA 4H0LB 5L3CA 3OMNB 5JCOA 1VQ9V 1BCCH 1LUWA 2BOCC 2OCCC 4JI5B 5IWAO 3OMIB 1I94O 3I56V 3ABKC 3FFQA 2IJIA 4MS2A 1GN6A 2CGNA 3ASNC 2Z5UA 3IGAC 4G2KA 4R50A 1MNGA 2YXLA 3ABLC 5IYDO 5B3SB 1NR7A 2EBOA 4I9QA 1HNZO 1LUVA 2W0FC 2BTQA 2JRIA 1RM1C 4O4IA 3ML0A 3ETDA 4LF8B 3RWRD 2IM9A 2VS0A 3CCEV 2HHHB 2BSKB 5JVDB 4LF7B 1Y74A 4UVAA 1CP9A 4DR5B 4X65O 5B1AB 1YDXA 4B3SO 1RFYA 1K4CC 4R6ZA 3N2GA 4UCTA 2XAGA 3I55V 2EX3A 3UKMA 1IBLB 4J7JA 5IE9A 3FAVA 1VMGA 1QVGU 3M99B 2EINC 3BPZA 5DEDA 3AG4B 4I4TA 5C8YB 2V1DA 5KHHA 5K1PA 4P2ZA 2UXCO 1BE3H 3D36A 3B77A 3E22B 2PY5A 2AZ2A 1PKXA 4Q6GA 4IHJB 4GX1A 4UV9A 2HJDA 2ZCEA 3N27A 1L8DA 1GM8A 5GTHZ 4JZ2A 4FFKA 4LFAO 4JI0O 4ZKIA 5LP6C 5LOVB 2P67A 3CMEV 3OR6C 4HBNA 2UUBB 3GWKC 1NR1A 2QWQB 2LFRA 4GKKO 3K04A 1HDJA 3K3WA 2Y0PA 1NTZH 4JI1O 2F95B 1FKAO 1J5EB 2N74A 2Y0IA 2GTSA 1D5NA 4NTWA 2VQFO 1QU7A 3JCZA 1NTKH 3H1IH 3JD3A 3QF7A 4B7KA 1OV9A 1ENVA 3D3IA 4JTDB 3SJQC 3K06A 4X1KA 1N33B 3CXHF 3ZHTA 5FLXN 3OUSA 2BE3A 1TUEB 2BTQB 4UUJC 4YXWG 4O4IB 1S0VA 3O9OA 2HKOA 2LFSA 3B2EE 1N8RW 5IT9N 4JYAB 1B06A 2X6BA 2QWRB 1XMOB 2QWOB 1KP3A 1Y74B 2Q0OC 4LF5B 4JI6O 2OIGA 1G4YB 4CS3A 1VF6A 1R3KC 5KA5A 3L73H 4ZBMA 4X20B 1AR4A 2IW5A 2E3CA 2E5LO 4FMTA 5JH7A 1ZSPA 3FB5C 5L3EA 4F4LA 4LF6B 3OGCC 2R70A 3JD2A 1IBMB 4I4TB 3RGBA 1QR8A 1XHXA 2CTPA 3APQA 2CDYA 3RYHA 1XL6A 4JPRA 1YF2A 1Q8IA 4B3RB 2L6LA 1S77D 4YJ3A 5L3GA 1MSDA 3CC7V 1FJGB 3KG2A 2JS5A 5H5NA 3KCXA 1FXVA 1TUBA 3VQVA 2JEXA 2NLJC 3F7VC 3SYOA 2Q6AA 1HNWO 4RUFA 2HR3A 3OT7A 1PPJH 4X1IA 2IJKA 1XMQB 2WLLA 4JI2O 4JI8O 5FPRA 1XNRO 2W0XA 2K9PA 3IJ4A 4B7EA 1JQ0A 1P84F 2XAJA 2YICA 3ABMB 3CSXA 2EIKC 2ZM6O 2DOSA 2X6CA 4X1KB 4LFBB 5KX5A 3ZEDA 4CS2A 2E74B 3ASOB 3LDCA 1L1FA 1M93A 4I5SA 1M9NA 1OCZC 3TXSA 1SC5B 1DK1A 4MVQA 3UT5A 5GW7A 2OCHA 1N34B 2X6AA 2ZXWC 5EYPA 4DUYB 4MVRA 1YXBA 2YC0A 4JF3A 3ZMSA 1OHHG 1K97A 1S72V 4OX9O 3LDDA 1JMKC 4B3MO 3CCSV 3T1YB 1Y6XA 2VRZA 5LYJB 4FLZA 2K1EA 2Q68A 4FPPA 4NR1A 3TK1A 1YITV 2ZQMA 1W0JG 1YHQV 2VWJA 4JTCB 4H44B 3T1HO 1H2NA 1VQ8V 4LF4B 1VIBA 2JGDB 4YJ3B 1U97A 4U3FH 1G8MA 4GT1A 4JAVA 3IAYA 1OCOC 1WA8B 3K5NA 3RVYA 1AJQA 3SYQA 2V4DA 3EFFK 3P3PA 4LFCO 5FNVB 1TUBB 4DR7B 2FTKA 5A2QN 1WJZA 1MA1A 4DRXA 5FL7G 4X1IB 3QVNA 2P90A 3JSNA 3X2QC 1EN5A 4U3JA 1QLEC 3CS5A 3AK3A 3OW2U 4JV5B 3OR7C 4BW9A 3UO3A 1XQ8A 4WBNA 5KX5B 3UQ8A 4JYCA 4ZHQA 1ZTEA 3ZN0A 4RQEA 3C3SA 2HP8A 1ORQC 5CBHA 2ADQB 4DUZO 2ODMA 4CH3A 1O9GA 2ZDIA 5CA3A 5JJJB 4TV9A 5EYPB 1W0KG 4D7TA 4QGPA 2AZ0A 3K79A 4YHHB 3O65A 5EC2C 3ETGA 1RSOB 4DV5B 2VQEO 2OTJV 5GTIZ 5DM6V 2Y69B 1GN2A 1NKDA 5IDJA 1KQSU 5CBFA 2QWNB 4K3AA 3WFVA 1M57B 1NH2D 4J80A 2A0LA 5BMVA 4JI3O 1SQPH 4IT5A 1DF4A 3BAAA 4MSWC 1VQ4V 1Y76B 2C2AA 4CH4A 2CAZC 4H37A 3CE2A 2M6YA 1XNQO 2H3OA 3F5WC 4LNUA 3CXCU 4EFBA 2QM4A 2R9IA 2JK5C 3CCUV 3AG4C 5CA0B 2UXDO 2P5OA 2B1GA 4DK1A 3CHXA 2UUCO 5A9GA 5DECA 4DRXB 4DW1A 4NYKA 1PD3A 4TWKA 1R3JC 3BVOA 3AG1B 1EFRG 3CRMA 3J80N 4NXMO 4EB6A 1FFTB 5IYBO 2NN4A 4DV1B 1ZWIC 1JPXA 4UFZA 3ZRXA 1W2BU 3ZMVA 5LMNO 1HWYA 1EZJA 3PJSK 2WWWA 2CTWA 2P6JA 1F51A 3WG7B 1SESA 1K5QA 4AILC 3OM3B 5LGTA 2HVKC 5JCOC 2X0LA 1KYOF 4TV8A 1GKFA 3JAMN 4KP4A 3BA8A 2QM7A 3W7SA 4HAMA 3LSUA 3CB2A 2LW7A 4AHCA 4ZI7B 3LUTB 1HNXB 2F4VO 3RN4A 1AI4A 4UB6Z 1IVSA 2QE7G 4RQFA 4QNHB 5L3DA 5K1XA 2BSKA 4JYBA 5JVDA 5EIBC 3FB6C 5EC1C 1XHZA 2Y4TA 1BZKA 3KCYA 4OGQB 3DC6A 3G80A 4F6RB 2W6IG 3GB7C 4MTXA 3A8TA 1WLEA 2CGOA 3DXRB 4WFFA 3SJCC 1KP2A 2F66C 1PL0A 4NXNB 5GONA 2L35A 5BMVB 2A3QA 5C8YA 2QKAA 4CS4A 2HLDG 1WPBA 1VQ6V 3H9VA 5KHGA 3J81N 4FLUA 3DTUB 1YJNV 4LNUB 3K5LA 1YI2V 4LH6A 1XL4A 1B6QA 3E8GA 4IHJA 4DV0O 2A7WA 2FKXA 1EZVH 2ATKC 1NVPD 2JDIG 1I5XA 3Q4HA 3ZRWB 3D36C 2DYRB 2PI4A 1OCRB 2W6JG 4EB6B 1K34A 1TAEA 1NZ6A 4PA7A 1AP5A 4GKJB 1MG1A 2YIBA 1GH6A 5B1BB 4PA4A 2YI8A 1BGYH 4RO2A 2WLKA 1M5IA 1V54C 4CBCA 2PYJA 5TISZ 4DYLA 4IGGA 4DR6B 2DMXA 4K0KO 1IBKB 3OEHG 4W4LA 3K03A 3WB0A 2YXYA 4TV8B 5LHGA 1P7BA 3DSQA 4QE7A 1VQPV 1K73W 1GM7A 1QVFU 1FPOA 4BR6A 4MTGA 2JJ2G 5HFLA 4JI4B 4GKJO 2Q7GA 3CCLV 3QNEA 4JI5O 1THZA 2YDEA 3ABMC 5IJ0A 5H6QA 2R72A 1JVMA 3CRRA 4IYHA 3K0DA 1ZAUA 4H13B 3LNNA 5KA6A 4DR6O 2X7RB 1KB9F 3HKEA 1QCEA 2EJRA 1PV0A 4E2LA 1H8HG 1NS1A 1QR9A 3ASOC 4X20A 1Q6UA 1XI1A 3I5DA 1DF5A 1DGSA 5GONB 3FKSG 4JYYA 1VF6C 2CTQA 1AI6A 4RAIA 4LF8O 3RYIB 3ETEA 2HHHO 3R66A 1CEZA 4Z1MG 2N05A 3P32A 4LF7O 1KKCA 4DR5O 1AR1B 4FLWA 3G71V 1N36B 3E83A 3ZHUA 3MD0A 3APOA 3SPGA 2Z3YA 5IYCO 3Q4HB 3BCCH 4LBEC 5E79Z 1IBLO 3M8AA 1IZ3A 3JALA 1UPGA 1ZLZA 1H2SB 2RCVA 1Q82W 2ZR3A 3MHSC 5D5QA 1YTFB 4GZRB 4DR2B 4LWSB 2AW9A 4X64B 2Q9LA 1K33A 3MHHC 4DV2B 2E75B 5LGNA 2PYLA 1Y67A 2GV9A 1JX9A 2DN9A 2EIJC 4TOIA 4W4KA 1A32A 1KECA 2BCCH 1Q6HA 1B04A 4X88A 3HPLC 3H1JH 5LMUB 4FM2A 2GSMB 1YEWA 4J11A 2UUBO 4PA3A 4JZGA 3AK2A 4MW3A 3L71H 3L74H 1KUQA 4FM0A 1J5EO 1K92A 5E1AC 5CN0A 5IJ0B 3OTOB 3K9SA 3CRCA 3VBBA 4UCSA 1GN4A 4GX5A 1NT2B 4B3TB 1JFFB 3HKEB 1Z2GA 4BIZA 2KKWA 3CCRV 3W7WA 3SYCA 3CC4V 2AXTZ 4G27B 1FAFA 1N33O 3OMAB 5LYJA 5ITZB 1PL4A 2WLJA 4KXRA 2FMLA 1FXHA 1QNMA 2QTSA 3MAQA 1SQGA 2YXHA 3ICXA 4RUEA 4LC1A 1GAXA 1SZTA 1ZL8B 1NTMH 3JSLA 1BMFG 5DN6G 5KUMA 4GX2A 4J7ZA 3WB2A 3A2FA 4JYAO 4GYCB 1XMOO 4MW8A 1Q81W 3ZX6A 1HR0B 1KBHA 3B8NA 4LF5O 1QLNA 3PN1A 2JGDA 2ZE8A 4FIPC 2Y69C 1BSMA 4EKWA 3T4DA 1Q90D 4DW0A 1WA8A 1JCHA 1K7DA 2UXXA 3JALB 1M57C 4LF6O 5FNVA 5KHKA 3ZCCA 2QR4A 3T2MA 1IBMO 4WFAV 1F4MA 4U7NA 2YI9A 1BT8A 2P22C 3HKDB 5LA6B 1Q6IA 4B3RO 3BY6A 4IYIA 4UCVA 3TETA 2Q73A 3SJAC 2QJ1A 1FJGO 3HKCB 2QTOA 1V9PA 3AG1C 1K9MW 1COWG 3CD6V 4N21A 1NJIW 1V55B 4PD4F 4JI7B 3SJBC 3K57A 1LNQA 4NTYA 1XMQO 4EEQA 5AG2A 2GHYA 3NR7A 3WG7C 1RM1B 2CUGA 3G6EV 2H8PC 3B8MA 3QO8A 1PNKA 2IJHA 2Q69A 1IXBA 1R1BA 1YJ9V 4XDJA 1NI8A 2R9RB 3E89A 1OCCB 4KFMA 3ZBHA 3L72H 3CRAA 1R6KA 2HG5C 4O4LB 3GWOA 1AROP 2QDOA 4LFBO 1RSOA 2ZDIC 1WN7A 4IIJA 4Z2WA 2JGUA 4FLVA 1W59A 4AI8A 2F93B 4O2AA 4YY3B 3G67A 1UJWB 1H2GA 2E76B 4PDMA 3SR2C 5KMGA 1QHTA 4DR1B 1N34O 4DUYO 1Y76A 4DV6B 2FL4A 3FX7A 5EIBD 3T1YO 1JOYA 1F23A 1K8AW 5CA0A 4I0XB 4YY3O 1YJWV 5J2TB 4X9QA 3AG3B 5LBQA 4A5UB 3J7AU 1PNMA 4CH6A 4LF4O 3K59A 5EBLC 1KKDA 5C93A 5KAFZ 4YIPA 2IU3A 3BFRA 2ZD9A 3R65A 2DYRC 1Q5OA 3CP1A 3ZMZA 5LHIA 2JS3A 1JR9A 4NB5A 1OCRC 1J95A 1L0LH 5CB4A 4DR7O 2D2CB 5LXTB 1SQFA 3A0BZ 4TSFG 4FLTA 1YVWA 1EBOA 1VQLV 5B1BC 1H2MA 2LGQA 3M7MX 4X89A 2OT5A 4L87A 3SYPA 5JJNB 3STZC 4ZI7A 5BR8B 4JV5O 3E2EA 4X66B 4FFBA 2V7QG 2YEVB 4UCRA 2DQ3A 1LR1A 3SPHA 4DO2A 3B4SA 5B3SC 2DQ0A 4MTOA 1ROPA 2P4KA 2G38A 2JJ1G 2EIMB 2UXBB 4IIJB 4FM1A 4PELA 1B3QA 4O2AB 4F6RA 2PTMA 3OGIB 3BEHA 1WP8A 1SQBH 1YSCA 3DXRA 4UCOA 1BQZA 5KMGB 5B1AC 2EZPA 4FK5C 2AGAA 3THOA 1GMGA 3JD0A 4WF9V 1S5LZ 4YHHO 1BS3A 4GX0A 1AI7A 4DV5O 4UXNA 2UUAB 4JGSA 3ZMUA 2EZOA 4JTAB 2BOBC 5KAIZ 1R3LC 4TQFA 3FYEB 4PHZA 1H2KA 1WAZA 5LHHA 3CCJV 4PDRA 3ZRWA 4DV3B 1N32B 2QSAA 3ZN1A 1AJPA 1T5EA 1P4RA 4QIWF 1SS3A 2RDCA 3K5OA 4GCZA 3RW0A 3LSQA 2O57A 4WFBV 3OFNG 4WFEA 4DV4B 3FYIB 1PNLA 5J9PC 2B5UA 1TVKA 4DR3B 3HKBB 5CBGA 5CB4B 3H1HH 1I7FA 1JJ2U 3LDEA 2AHYA 1GO3F 5EZYA 4QE9A 3K58A 1VQKV 3TJTA 3W7XA 1VEWA 4FZ1A 3W7TA 1S5HC 3L9DA 1F4NA 4N23A 3ZIAG 3CMAV 1R73A 5JWPA 2HEPA 3JARA 3NXSA 4DV1O 1JA8A 4FFBB 1AB3A 2ZE7A 1X4TA 4LF9B 1VQNV 3CWBH 2XOKG 1SA0B 1Y66A 2WSSG 4Z1VA 4R7CA 1X59A 3K5MA 4I55A 3BHPA 2XTAA 4MT8A 3P30A 1VP7A 2UU9B 2MW2B 2WLIB 1HNXO 4X62B 1US6A 5B66Z 3RYIA 2ZIMA 5EK0A 5H6RA 2RN9A 1O9HA 2OIEA 1P49A 4ICGA 5CA1A 1WB8A 4DR4B 2ARHA 1UFIA 3ZJZA 2XASA 2WAMA 3FD9A 4I9WA 4AQYB 1SRYA 4BWAA 2OWOA 1NU1H 3RVZA 1FFXA 1FXKB 2ZKOA 5BZBA 4NXNO 5IWAB 4P9PA 3L75H 1KU9A 3H1LH 3KKYA 3OTFA 4LWSA 4MVUA 3UCSC 3U11A 1IXMA 1RPOA 2JIZG 2P06A 4K8ZA 2DE0X 3JAWB 2B1IA 1OZ0A 1TVKB 1VF7A 2OYQA 4P30A 5IY5B 1MMMA 5F2VO 2Z0AA 5EZYB 1HNZB 1WP7A 3AG2B 2AHZA 1XOUA 4LR3A 5HFMA 2LO1A 1MABG 3JARB 2DWDC 2FYUH 2LP7A 2WLNA 2CK3G 4HNAB 3H01A 3CJHB 2KG7B 4X65B 4X1YB 5JQGA 5L3BA 3CCVV 4B3SB 2Q67A 3OD4A 1BL8A 1V55C 4FLXA 2IJJA 3E86A 4HZ3A 1IBKO 1JFFA 1XILA 2P4VA 3STLC 2ZNJA 1VF5B 4I55B 5B1NA 2GBOA 5KHIA 5ITZA 3RYFA 3ZHSA 3IFXA 5FPOA 2UXCB 4JI4O 1VQOV 4WFGA 1OCCC 3P3NA 1E1QG 3MDSA 1K5SA 1WPXA 1MSWD 1ZL8A 4ASUG 5H2FZ 4L8JA 4I50A 2HVJC 1AJNA 5CA1B 1ZUQA 2GUZA 4LFAB 2ZR2A 4JI0B 3A0RA 2WLHA 3JAKB 3SGIA 1S3JA 2MK3A 4UB8Z 1TA8A 3A0HZ 1FFXB 2CH7B 2ILMA 3FB7C 4GKKB 1D2DA 1SQVH 3IC9A 4K35A 2YIDA 4LP8A 2XAQA 2KSDA 4JI1B 4J7KA 5IYZB 3G4SV 3B40A 1U96A 3U0ZA 1SKVA 2VQFB 5CMUA 1DLBA 2UXNA 4LH7A 1ZX3A 3HKDA 3K9AA 5LA6A 5EBWC 3SPJA 1N36O 4ABMA 1RPRA 2ZT9B 3HKCA 1JJOA 2QM8A 4QPJA 1AR5A 2F23A 3AG3C 2RQ6A 4B08A 2DYSB 2Q8VA 1E79G 2RJZA 1FS0G 4F6EA 4DR2O 2EILB 4YJ2A 2A9HA 4X64O 1M56B 1R6TA 4JI6B 4DV2O 4GUNA 2A06H 5JQGB 3CX5F 3E8HA 4ZIBA 1G1XB 3WB1A 3JASA 4XDKA 1AVMA 3OEEG 2KB1A 3UM7A 4H33A 4YIOA 1VQ7V 3VOUA 2E5LB 1SF9A 4D7SA 4PI0A 1BHAA 3CPWU 1PP9H 5LMUO 2P7TC 4O4LA 1I08A 3JCUZ 4DXWA 3OE7G 1K4DC 2Q4PA 4E4EA 3RYFB 1XUQA 2Y4UA 4MTFA 3VQYA 4J42A 1YCIA 3E8FA 1R3IC 4I50B 3OTOO 4GLXA 4KHPB 3BRCA 5J2UA 1Y4MA 3N2GB 2EIMC 2GUZB 4B3TO 4J9YB 4PA6A 4PA9A 4ZOLA 2ZE6A 2LGWA 3FAVB 1E1RG 3CCQV 4MVZA 4MVOA 2IH3C 2WLMA 1IURA 3QO5A 1XBLA 2IBZH 1HNWB 3TXQA 5LP6A 4I0XA 4PJ0Z 4R8CA 4CC5A 1Q3EA 4J9ZB 4JI2B 4JI8B 1XEQA 4PI2A 1AP6A 3ZS8C 1AI5A 3IC7A 2XAHA 3HB3B 5J2TA 1XNRB 4KHPO 1HR0O 3CCMV 4MVSA 4NVPA 1FYJA 4WCEV 2NR5A 1R6NA 2OCCB 3KZIZ 3ZRSA 1Q7YW 3L70H 2PUSA 5IJ9A 2ZM6B 3AK1A 2EULA 3SPCA 1V54B 1XREA 3RFRA 3ABKB 1FD9A 1PM9A 4EFEA 4FJCC 2QWPB 1MZFA 3ASNB 4BW5A 1IX9A 5BY1A 1QQCA 5LXTA 4RWUA 3ABLB 1F7YA 4YJ2B 2Q7HA 4I7ZB 3CEIA 3CC2V 2XHBA 1N0NA 1NH2B 2DWEC 3C90A 1H8EG 4O4HA 3JASB 1M1KW 4D6TH 1VQ5V 4OX9B 2XAFA 2YEVA 4U7OA 3VQXA 4B3MB 4MVMA 2A79B 1EN4A 3EVKA 2R9AA 3F7YC 3FB8C 1SQQH 3ZRVA 1YTFD 1NQTA 4JI7O 3S3WA 1OJHA 5LGUA 2YIBD 2IU0A 3D8CA 3T1HB 3CYOA 2EINB 2PF4E 2H94A 4X8AA 2Q5ZA 1HP8A 4QJFB 5J2UB 1YIJV 5KLVH 1H2LA 3RYCA 2F43G 1EN6A 4ZOLB 3U10A 5JH7B 2QKCA 4LFCB 1SERA 1VQMV 3SDLA 4TQDA 3RT3C 3RBZA 5D5PA 2FB5A 4DV7B 3DGEA 3RYHB 5LP6B 3CRQA 2B9ZA 4G28B 3TCUA 1BQ0A 3OUFA 1YZBA 4JASA 2N04A 3EHBB 4DR1O 3ETQA 3GVMA 3W7UA 1XDCA 3E8BA 3ZMTA 2QEXV 1BHBA 3JATA 4DV6O 5IJ9B 1FXKC 4QPKA 4OPAA 2EIJB 5L3FA 1AILA 4OXSA 3D3QA 2YSUB 4OPHA 4DV7O 3HKBA 1Q43A 3VQWA 2WLLB 2QA4V 3JD1A 4DUZB 3SPIA 2OTLV 1VARA 1NBMG 1WB7A 3AEIA 4FLYA 3ZHRA 1N0JA 2KQXA 3QTCA 4CH5A 3T1CA 4O4HB 1CXZB 5IY5C 4P9OA 2LJ2A 1N4CA 3ABUA 3AG2C 2XT9A 4IL6Z 2VQEB 1KD1W 4UV8A 5JJEB 1GK9A 3JYCA 1NVPB 2CTRA 1SA0A 3LNMB 3E35A 1H38A 4TUYA 3UT5B 4PV1B 2M7WA 1GM9A 3QG5A 3K08A 2D3OW 4JI3B 5BR8O 4BIOA 2WLIA 1XNQB 1Z5WA 2HJFC 3RYCB 4X66O 2XUMA 1GTOA 2HFEC 2ITDC 3N2KA 3T4ZA 2ZINA 3TGUH 2UXDB 3K0GA 4J10A 4O2BA 4C7UA 1URFA 4KL1A 4UVBA 1S76D 5B1OA 2UUCB 2UXBO 1SZXA 1SQXH 3ZHQA 1GRJA 2DJVA 1GN3A 2ZIOA 4UCUA 5KHJA 4KUMA 1RP3B 4NXMB 1FXKA 5LL6Y 2WA3A 2PI5A 2XNDG 4BAYA 1K3EA 3EXAA 5LMNB 4O4JA 1M4UA 1P7GA 4JAUA 3JATB 1EM1A 5H9CA 2ETNA 3JAWA 2RMKB 2UUAO 4UVCA 1Z5VA 2PGGA 1I5YA 2Y48A 4U3JB 4PDLA 4XBFA 5B5EZ 2EIKB 2DW4A 2ZE5A 4DV3O 1SETA 1N32O 2F1MA 2RNBA 2ADPA 1L0NH 3OAAG 2F4VB 2WPDG 3ZHVA 2LQTA 2ITCC 2BTOA 3QO7A 3BABA 4WBNB 2QGNA 2YUAA 4HYOA 1OCZB 4HNAA 3DC5A 4WFHA 3CJHA 2KG7A 4DV4O 2DYSC 4X1YA 3B09A 1IDSA 2LW1A 3F5TA 2ZXWB 4Q20A 4DR3O 3WU2Z 5BXZA 2EJ7A 4ZHQB 5EBMC 2EILC 3HR0A 4NKGB 4PDVA 2IH1C 1M56C 4TUYB 1M90W 1WNSA 3JD4A 2YS8A 4JAAA 4TV9B 2NNUA 5KUKA 4LCUC 3H1KH 2Q7EA 2YIAA 1CPYA 1KMIZ
chains in the Genus database with same CATH topology
3BY6A 2QKSA 3LSSA 1MOFA 4JYCA 4TT3G 3TETA 3FB7C 3ABTA 3ZN0A 4RQEA 1Q86W 4LP8A 2XAQA 1ORQC 5CBHA 3G4SV 2QTOA 3AG1C 1K9MW 3CD6V 1COWG 1DTOA 2ZDIA 4N21A 5CA3A 5CMUA 1OCOB 1DLBA 2UXNA 4BIUA 1NJIW 1W0KG 1V55B 3K9AA 3K79A 5EBWC 3SPJA 5EC2C 1LNQA 3ETGA 1QBZA 1KC8W 1RPRA 2OTJV 2GHYA 3WG7C 5DM6V 2QM8A 1RM1B 2JEUA 4QPJA 2Y69B 3G6EV 2H8PC 3B8MA 3X2QB 3AG3C 3QO8A 1NKDA 1PNKA 2IJHA 2Q69A 5IDJA 2DYSB 1YJ9V 4XDJA 1QLEB 2R9RB 1E79G 1KQSU 3E89A 5CBFA 1OCCB 4KFMA 1FS0G 3SYAA 3WFVA 1R6KA 1M57B 2HG5C 2EILB 1NH2D 2A9HA 2A0LA 3GWOA 1AROP 1DF4A 4MSWC 1M56B 1VQ4V 4CZZA 2C2AA 2ZDIC 4H37A 4XDLA 5L3CA 3OMNB 3E8HA 3F5WC 3CXCU 4XDKA 3UM7A 3OEEG 2KB1A 2R9IA 2JK5C 1VQ9V 3CCUV 3AG4C 4H33A 1VQ7V 1UJWB 3VOUA 2BOCC 2OCCC 1H2GA 4PDMA 1BHAA 3CPWU 2B1GA 2P7TC 3OMIB 1PD3A 4TWKA 3ABKC 1R3JC 4DXWA 3I56V 3OE7G 2IJIA 1K4DC 1EFRG 3AG1B 4MS2A 3ASNC 4R50A 2Z5UA 3IGAC 4G2KA 4MTFA 1FFTB 5IYBO 1JOYA 3ABLC 5IYDO 5B3SB 1ZWIC 3E8FA 1R3IC 1F23A 1NR7A 1K8AW 2EBOA 1JPXA 3ZRXA 1W2BU 3ZMVA 1HWYA 1EZJA 1Y4MA 3PJSK 2EIMC 2WWWA 2W0FC 4J9YB 4PA6A 2P6JA 1YJWV 1F51A 3WG7B 4PA9A 1RM1C 3ML0A 1SESA 1K5QA 3ETDA 1E1RG 3AG3B 3OM3B 4MVZA 5LBQA 5LGTA 3CCQV 3CCEV 2HVKC 4MVOA 2IH3C 1PNMA 2WLMA 5EBLC 2X0LA 1KKDA 3QO5A 5C93A 1GKFA 4KP4A 4UVAA 1CP9A 2QM7A 3W7SA 4HAMA 5B1AB 2IU3A 2ZD9A 3R65A 2DYRC 4R8CA 3CP1A 1K4CC 3LUTB 3ZMZA 4R6ZA 4J9ZB 5LHIA 2XAGA 3I55V 1AI4A 1OCRC 3UKMA 1AI5A 1J95A 2QE7G 4RQFA 3IC7A 2XAHA 3HB3B 4QNHB 1QVGU 3M99B 3CCMV 5L3DA 2EINC 4TSFG 4JYBA 1EBOA 3AG4B 4MVSA 1VQLV 4WCEV 5B1BC 2V1DA 1R6NA 2OCCB 3FB6C 3ZRSA 1Q7YW 5EC1C 4X89A 2OT5A 4P2ZA 4L87A 3SYPA 3SPCA 3D36A 3B77A 1V54B 3STZC 3ABKB 2W6IG 3GB7C 4MTXA 4FJCC 1PKXA 3E2EA 3ASNB 1WLEA 2V7QG 2YEVB 4GX1A 4UV9A 4BW5A 2DQ3A 4WFFA 3SPHA 4DO2A 1GM8A 1KP2A 3ABLB 2DQ0A 5B3SC 1PL0A 4ZKIA 4MTOA 1ROPA 2P67A 3CC2V 3CMEV 2HLDG 2JJ1G 2EIMB 3OR6C 1NH2B 2DWEC 1VQ6V 4PELA 1NR1A 1H8EG 3DTUB 2LFRA 1YJNV 1M1KW 1YI2V 3K04A 3K3WA 1XL4A 1VQ5V 1B6QA 3BEHA 3E8GA 2XAFA 2YEVA 1YSCA 4U7OA 4MVMA 2A79B 2ATKC 1NVPD 2JDIG 1I5XA 5B1AC 3F7YC 3ZRWB 3FB8C 2EZPA 3ZRVA 1YTFD 3JCZA 2DYRB 4FK5C 1NQTA 1GMGA 3JD3A 3JD0A 2PI4A 4WF9V 1OCRB 2W6JG 5LGUA 1K34A 2IU0A 4GX0A 1AI7A 4PA7A 1ENVA 3D3IA 4UXNA 4JTDB 3CYOA 2EINB 3SJQC 1MG1A 3K06A 4JGSA 3ZMUA 2EZOA 2H94A 4JTAB 4X8AA 5B1BB 2BOBC 4PA4A 1R3LC 4QJFB 3FYEB 1YIJV 3OUSA 4RO2A 1TUEB 2F43G 5LHHA 4PDRA 4UUJC 3ZRWA 3CCJV 2WLKA 4YXWG 1V54C 4CBCA 1S0VA 1SERA 2HKOA 1VQMV 2LFSA 1N8RW 3ZN1A 1AJPA 1P4RA 4QIWF 3OEHG 3K03A 2X6BA 4GCZA 3RW0A 1KP3A 3LSQA 3RBZA 5LHGA 1P7BA 4QE7A 1G4YB 1VQPV 3DGEA 1K73W 1GM7A 4WFBV 1QVFU 1R3KC 3OFNG 5KA5A 4WFEA 4G28B 3TCUA 3FYIB 4MTGA 2JJ2G 5HFLA 1PNLA 5J9PC 4ZBMA 2B5UA 3OUFA 4JASA 2IW5A 5CBGA 3CCLV 3QNEA 3EHBB 1JJ2U 4FMTA 3LDEA 3FB5C 5L3EA 1THZA 4F4LA 3OGCC 3ABMC 3JD2A 2AHYA 1GO3F 5H6QA 1JVMA 3K0DA 3W7UA 4QE9A 1VQKV 3W7XA 1QR8A 5KA6A 2X7RB 3E8BA 3ZMTA 1S5HC 3W7TA 2QEXV 1BHBA 1F4NA 4N23A 1FXKC 3ZIAG 4QPKA 1QCEA 3CMAV 1XL6A 2EIJB 2EJRA 1R73A 4JPRA 4E2LA 4OXSA 5L3FA 1H8HG 3NXSA 1QR9A 3ASOC 1S77D 2YSUB 5L3GA 1VQNV 3CC7V 2WLLB 2QA4V 3JD1A 1DF5A 2XOKG 3FKSG 3SPIA 2OTLV 1AI6A 1NBMG 3AEIA 4RAIA 3KG2A 3ETEA 1FXVA 3T1CA 2JEXA 2NLJC 1CEZA 3F7VC 4Z1MG 1Y66A 2WSSG 3SYOA 3P32A 2Q6AA 4R7CA 5IY5C 4RUFA 1AR1B 4MT8A 3P30A 3G71V 2HR3A 4P9OA 3E83A 3ABUA 3AG2C 2IJKA 3MD0A 2WLIB 2WLLA 3SPGA 2Z3YA 5IYCO 1KD1W 4LBEC 4UV8A 1NVPB 1GK9A 3JYCA 5EK0A 3LNMB 5H6RA 1Q82W 2ZR3A 3MHSC 3E35A 1JQ0A 1YTFB 1H38A 2XAJA 2M7WA 1GM9A 3ABMB 3K08A 2EIKC 2D3OW 2X6CA 3ZJZA 1K33A 2XASA 3MHHC 2WAMA 4I9WA 2WLIA 1SRYA 5LGNA 2HJFC 3RVZA 1FXKB 1JX9A 2EIJC 1GTOA 2HFEC 2ITDC 3T4ZA 5BZBA 3ASOB 3LDCA 1L1FA 1KECA 4I5SA 1M9NA 1OCZC 4X88A 3HPLC 3K0GA 4P9PA 4MVQA 4UVBA 5GW7A 1S76D 5B1OA 2GSMB 2X6AA 2ZXWC 4MVUA 1IXMA 4MVRA 1RPOA 2JIZG 4JF3A 4PA3A 3ZMSA 1OHHG 4KUMA 4MW3A 1K97A 1OZ0A 2B1IA 1S72V 3LDDA 1FXKA 3CCSV 1K92A 2PI5A 2XNDG 5E1AC 4BAYA 5CN0A 1K3EA 2K1EA 4P30A 5IY5B 3VBBA 2Q68A 3AG2B 4FPPA 3TK1A 1YITV 4GX5A 2AHZA 2ZQMA 4JAUA 5HFMA 1W0JG 4BIZA 3CCRV 1MABG 5H9CA 3W7WA 1YHQV 4JTCB 1VQ8V 2DWDC 2LP7A 3SYCA 3CC4V 2WLNA 4UVCA 4G27B 2CK3G 3OMAB 1I5YA 1G8MA 3H01A 2Y48A 2WLJA 4GT1A 4JAVA 4PDLA 4XBFA 1FXHA 1OCOC 2EIKB 5L3BA 2DW4A 3RVYA 3CCVV 2Q67A 1AJQA 3SYQA 1SETA 4RUEA 4LC1A 1BL8A 1V55C 3EFFK 2IJJA 3OAAG 1SZTA 3E86A 2WPDG 1BMFG 4HZ3A 5DN6G 2ITCC 5KUMA 4GX2A 1Q81W 4MW8A 3STLC 2FTKA 3B8NA 3QO7A 1QLNA 5B1NA 5FL7G 4HYOA 4FIPC 1OCZB 2Y69C 2P90A 3X2QC 4WFHA 4EKWA 3T4DA 2DYSC 3IFXA 1VQOV 4Q20A 1QLEC 2ZXWB 4WFGA 1OCCC 1E1QG 1JCHA 1K7DA 3OW2U 2UXXA 1K5SA 1WPXA 1MSWD 1M57C 5EBMC 2EILC 4ASUG 3ZCCA 3OR7C 3T2MA 2HVJC 4PDVA 2IH1C 1M56C 1F4MA 4WFAV 4U7NA 1AJNA 1M90W 2ZR2A 3JD4A 3A0RA 2WLHA 2NNUA 5KUKA 4LCUC 1S3JA 1CPYA 2MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 C;  4CBC A;  2QKS A;  3RVZ A;  4MVZ A;  2EIJ C;  2HVK C;  4MVO A;  2IH3 C;  2WLM A;  3TET A;  2HFE C;  2ITD C;  3FB7 C;  3T4Z A;  5BZB A;  5EBL C;  1KKD A;  3LDC A;  3K03 A;  2X6B A;  3RW0 A;  4LP8 A;  1ORQ C;  1OCZ C;  5CBH A;  4X88 A;  3HPL C;  3RBZ A;  1P7B A;  3K0G A;  4P9P A;  4MVQ A;  4QE7 A;  2ZD9 A;  2QTO A;  1G4Y B;  2DYR C;  3AG1 C;  3R65 A;  4R8C A;  1K4C C;  3LUT B;  2X6A A;  2ZXW C;  4MVU A;  4R6Z A;  4J9Z B;  1R3K C;  4MVR A;  4WFE A;  4G28 B;  3TCU A;  4MTG A;  1OCR C;  3UKM A;  5J9P C;  4PA3 A;  1J95 A;  4ZBM A;  3OUF A;  4MW3 A;  4QNH B;  5CBG A;  3LDD A;  3LDE A;  3FB5 C;  5EBW C;  3SPJ A;  5EC2 C;  1LNQ A;  2EIN C;  3OGC C;  3ABM C;  4F4L A;  2AHY A;  4MVS A;  5E1A C;  5B1B C;  1JVM A;  2K1E A;  3FB6 C;  4P30 A;  3ZRS A;  3K0D A;  4QE9 A;  5EC1 C;  4X89 A;  2Q68 A;  3WG7 C;  4P2Z A;  3SYP A;  3E8B A;  1S5H C;  4GX5 A;  3SPC A;  2AHZ A;  2H8P C;  3AG3 C;  3STZ C;  3GB7 C;  1XL6 A;  2Q69 A;  4OXS A;  4XDJ A;  2R9R B;  3ASO C;  3E89 A;  4GX1 A;  4JTC B;  4KFM A;  4BW5 A;  5CBF A;  3SYA A;  4WFF A;  2DWD C;  3SPH A;  2HG5 C;  3SYC A;  5B3S C;  2WLN A;  4G27 B;  2A9H A;  2A0L A;  2WLL B;  4MTO A;  4MSW C;  2WLJ A;  4PDL A;  4H37 A;  3SPI A;  1OCO C;  4XDL A;  3RVY A;  2Q67 A;  3SYQ A;  4RAI A;  3OR6 C;  4RUE A;  1BL8 A;  3E8H A;  3F5W C;  1V55 C;  3EFF K;  3KG2 A;  2DWE C;  4XDK A;  3E86 A;  3UM7 A;  2KB1 A;  4HZ3 A;  3T1C A;  2ITC C;  2NLJ C;  2JK5 C;  5KUM A;  4GX2 A;  3F7V C;  3K04 A;  1XL4 A;  3SYO A;  2Q6A A;  3AG4 C;  4H33 A;  4MW8 A;  4R7C A;  3BEH A;  3STL C;  3E8G A;  3VOU A;  2BOC C;  2OCC C;  2YEV A;  4RUF A;  5IY5 C;  4PDM A;  4MVM A;  2A79 B;  2ATK C;  4P9O A;  3E83 A;  2P7T C;  3AG2 C;  4HYO A;  2Y69 C;  5B1A C;  2WLI B;  2WLL A;  3F7Y C;  4TWK A;  3ABK C;  1R3J C;  4WFH A;  3SPG A;  3X2Q C;  3FB8 C;  4DXW A;  4EKW A;  3T4D A;  4LBE C;  2DYS C;  1K4D C;  3IFX A;  4MS2 A;  1QLE C;  3ASN C;  4R50 A;  4WFG A;  3IGA C;  4MTF A;  1OCC C;  3JYC A;  1M57 C;  5EBM C;  3ABL C;  2EIL C;  3LNM B;  5EK0 A;  1ZWI C;  3E8F A;  1R3I C;  4GX0 A;  3OR7 C;  4PA7 A;  2HVJ C;  3T2M A;  4PDV A;  2IH1 C;  1M56 C;  4JTD B;  3SJQ C;  3K08 A;  2EIK C;  3K06 A;  4JTA B;  3PJS K;  4X8A A;  2EIM C;  2BOB C;  2X6C A;  4PA4 A;  1R3L C;  2WLH A;  3ZJZ A;  2W0F C;  5KUK A;  3OUS A;  4J9Y B;  4PA6 A;  4LCU C;  4I9W A;  4PA9 A;  4RO2 A;  2WLI A;  4PDR A;  4UUJ C;  2HJF C;  2WLK A; 
#chains in the Genus database with same CATH topology
 3LSS A;  2QKS A;  3AG7 A;  1MZE A;  1MOF A;  4TT3 G;  1I0H A;  4LF9 O;  1HW7 A;  3ABT A;  3N2K B;  2PZS A;  1Q86 W;  4DV0 B;  4FVM A;  4O2B B;  1DTO A;  1G6U A;  4K8X A;  3C3T A;  1OCO B;  3JAK A;  1S5J A;  4BIU A;  2GDS A;  3BA9 A;  1D5A A;  2CE4 A;  2CH7 A;  2UU9 O;  1QBZ A;  4FZ0 A;  1KC8 W;  4J41 A;  4X62 O;  2Q0A A;  5IYZ A;  1TGO A;  2JEU A;  3E22 A;  4O4J B;  2WA4 A;  3X2Q B;  3UO2 A;  1QLE B;  1I94 B;  4NTX A;  3SYA A;  4K0K B;  3G6B A;  4CC6 A;  2GTA A;  4DK0 A;  3S3X A;  5LOV A;  2JVD A;  4DR4 O;  2VWK A;  4CZZ A;  4XDL A;  4AQY O;  2ZNI A;  4H0L B;  5L3C A;  3OMN B;  5JCO A;  1VQ9 V;  1BCC H;  1LUW A;  2BOC C;  2OCC C;  4JI5 B;  5IWA O;  3OMI B;  1I94 O;  3I56 V;  3ABK C;  3FFQ A;  2IJI A;  4MS2 A;  1GN6 A;  2CGN A;  3ASN C;  2Z5U A;  3IGA C;  4G2K A;  4R50 A;  1MNG A;  2YXL A;  3ABL C;  5IYD O;  5B3S B;  1NR7 A;  2EBO A;  4I9Q A;  1HNZ O;  1LUV A;  2W0F C;  2BTQ A;  2JRI A;  1RM1 C;  4O4I A;  3ML0 A;  3ETD A;  4LF8 B;  3RWR D;  2IM9 A;  2VS0 A;  3CCE V;  2HHH B;  2BSK B;  5JVD B;  4LF7 B;  1Y74 A;  4UVA A;  1CP9 A;  4DR5 B;  4X65 O;  5B1A B;  1YDX A;  4B3S O;  1RFY A;  1K4C C;  4R6Z A;  3N2G A;  4UCT A;  2XAG A;  3I55 V;  2EX3 A;  3UKM A;  1IBL B;  4J7J A;  5IE9 A;  3FAV A;  1VMG A;  1QVG U;  3M99 B;  2EIN C;  3BPZ A;  5DED A;  3AG4 B;  4I4T A;  5C8Y B;  2V1D A;  5KHH A;  5K1P A;  4P2Z A;  2UXC O;  1BE3 H;  3D36 A;  3B77 A;  3E22 B;  2PY5 A;  2AZ2 A;  1PKX A;  4Q6G A;  4IHJ B;  4GX1 A;  4UV9 A;  2HJD A;  2ZCE A;  3N27 A;  1L8D A;  1GM8 A;  5GTH Z;  4JZ2 A;  4FFK A;  4LFA O;  4JI0 O;  4ZKI A;  5LP6 C;  5LOV B;  2P67 A;  3CME V;  3OR6 C;  4HBN A;  2UUB B;  3GWK C;  1NR1 A;  2QWQ B;  2LFR A;  4GKK O;  3K04 A;  1HDJ A;  3K3W A;  2Y0P A;  1NTZ H;  4JI1 O;  2F95 B;  1FKA O;  1J5E B;  2N74 A;  2Y0I A;  2GTS A;  1D5N A;  4NTW A;  2VQF O;  1QU7 A;  3JCZ A;  1NTK H;  3H1I H;  3JD3 A;  3QF7 A;  4B7K A;  1OV9 A;  1ENV A;  3D3I A;  4JTD B;  3SJQ C;  3K06 A;  4X1K A;  1N33 B;  3CXH F;  3ZHT A;  5FLX N;  3OUS A;  2BE3 A;  1TUE B;  2BTQ B;  4UUJ C;  4YXW G;  4O4I B;  1S0V A;  3O9O A;  2HKO A;  2LFS A;  3B2E E;  1N8R W;  5IT9 N;  4JYA B;  1B06 A;  2X6B A;  2QWR B;  1XMO B;  2QWO B;  1KP3 A;  1Y74 B;  2Q0O C;  4LF5 B;  4JI6 O;  2OIG A;  1G4Y B;  4CS3 A;  1VF6 A;  1R3K C;  5KA5 A;  3L73 H;  4ZBM A;  4X20 B;  1AR4 A;  2IW5 A;  2E3C A;  2E5L O;  4FMT A;  5JH7 A;  1ZSP A;  3FB5 C;  5L3E A;  4F4L A;  4LF6 B;  3OGC C;  2R70 A;  3JD2 A;  1IBM B;  4I4T B;  3RGB A;  1QR8 A;  1XHX A;  2CTP A;  3APQ A;  2CDY A;  3RYH A;  1XL6 A;  4JPR A;  1YF2 A;  1Q8I A;  4B3R B;  2L6L A;  1S77 D;  4YJ3 A;  5L3G A;  1MSD A;  3CC7 V;  1FJG B;  3KG2 A;  2JS5 A;  5H5N A;  3KCX A;  1FXV A;  1TUB A;  3VQV A;  2JEX A;  2NLJ C;  3F7V C;  3SYO A;  2Q6A A;  1HNW O;  4RUF A;  2HR3 A;  3OT7 A;  1PPJ H;  4X1I A;  2IJK A;  1XMQ B;  2WLL A;  4JI2 O;  4JI8 O;  5FPR A;  1XNR O;  2W0X A;  2K9P A;  3IJ4 A;  4B7E A;  1JQ0 A;  1P84 F;  2XAJ A;  2YIC A;  3ABM B;  3CSX A;  2EIK C;  2ZM6 O;  2DOS A;  2X6C A;  4X1K B;  4LFB B;  5KX5 A;  3ZED A;  4CS2 A;  2E74 B;  3ASO B;  3LDC A;  1L1F A;  1M93 A;  4I5S A;  1M9N A;  1OCZ C;  3TXS A;  1SC5 B;  1DK1 A;  4MVQ A;  3UT5 A;  5GW7 A;  2OCH A;  1N34 B;  2X6A A;  2ZXW C;  5EYP A;  4DUY B;  4MVR A;  1YXB A;  2YC0 A;  4JF3 A;  3ZMS A;  1OHH G;  1K97 A;  1S72 V;  4OX9 O;  3LDD A;  1JMK C;  4B3M O;  3CCS V;  3T1Y B;  1Y6X A;  2VRZ A;  5LYJ B;  4FLZ A;  2K1E A;  2Q68 A;  4FPP A;  4NR1 A;  3TK1 A;  1YIT V;  2ZQM A;  1W0J G;  1YHQ V;  2VWJ A;  4JTC B;  4H44 B;  3T1H O;  1H2N A;  1VQ8 V;  4LF4 B;  1VIB A;  2JGD B;  4YJ3 B;  1U97 A;  4U3F H;  1G8M A;  4GT1 A;  4JAV A;  3IAY A;  1OCO C;  1WA8 B;  3K5N A;  3RVY A;  1AJQ A;  3SYQ A;  2V4D A;  3EFF K;  3P3P A;  4LFC O;  5FNV B;  1TUB B;  4DR7 B;  2FTK A;  5A2Q N;  1WJZ A;  1MA1 A;  4DRX A;  5FL7 G;  4X1I B;  3QVN A;  2P90 A;  3JSN A;  3X2Q C;  1EN5 A;  4U3J A;  1QLE C;  3CS5 A;  3AK3 A;  3OW2 U;  4JV5 B;  3OR7 C;  4BW9 A;  3UO3 A;  1XQ8 A;  4WBN A;  5KX5 B;  3UQ8 A;  4JYC A;  4ZHQ A;  1ZTE A;  3ZN0 A;  4RQE A;  3C3S A;  2HP8 A;  1ORQ C;  5CBH A;  2ADQ B;  4DUZ O;  2ODM A;  4CH3 A;  1O9G A;  2ZDI A;  5CA3 A;  5JJJ B;  4TV9 A;  5EYP B;  1W0K G;  4D7T A;  4QGP A;  2AZ0 A;  3K79 A;  4YHH B;  3O65 A;  5EC2 C;  3ETG A;  1RSO B;  4DV5 B;  2VQE O;  2OTJ V;  5GTI Z;  5DM6 V;  2Y69 B;  1GN2 A;  1NKD A;  5IDJ A;  1KQS U;  5CBF A;  2QWN B;  4K3A A;  3WFV A;  1M57 B;  1NH2 D;  4J80 A;  2A0L A;  5BMV A;  4JI3 O;  1SQP H;  4IT5 A;  1DF4 A;  3BAA A;  4MSW C;  1VQ4 V;  1Y76 B;  2C2A A;  4CH4 A;  2CAZ C;  4H37 A;  3CE2 A;  2M6Y A;  1XNQ O;  2H3O A;  3F5W C;  4LNU A;  3CXC U;  4EFB A;  2QM4 A;  2R9I A;  2JK5 C;  3CCU V;  3AG4 C;  5CA0 B;  2UXD O;  2P5O A;  2B1G A;  4DK1 A;  3CHX A;  2UUC O;  5A9G A;  5DEC A;  4DRX B;  4DW1 A;  4NYK A;  1PD3 A;  4TWK A;  1R3J C;  3BVO A;  3AG1 B;  1EFR G;  3CRM A;  3J80 N;  4NXM O;  4EB6 A;  1FFT B;  5IYB O;  2NN4 A;  4DV1 B;  1ZWI C;  1JPX A;  4UFZ A;  3ZRX A;  1W2B U;  3ZMV A;  5LMN O;  1HWY A;  1EZJ A;  3PJS K;  2WWW A;  2CTW A;  2P6J A;  1F51 A;  3WG7 B;  1SES A;  1K5Q A;  4AIL C;  3OM3 B;  5LGT A;  2HVK C;  5JCO C;  2X0L A;  1KYO F;  4TV8 A;  1GKF A;  3JAM N;  4KP4 A;  3BA8 A;  2QM7 A;  3W7S A;  4HAM A;  3LSU A;  3CB2 A;  2LW7 A;  4AHC A;  4ZI7 B;  3LUT B;  1HNX B;  2F4V O;  3RN4 A;  1AI4 A;  4UB6 Z;  1IVS A;  2QE7 G;  4RQF A;  4QNH B;  5L3D A;  5K1X A;  2BSK A;  4JYB A;  5JVD A;  5EIB C;  3FB6 C;  5EC1 C;  1XHZ A;  2Y4T A;  1BZK A;  3KCY A;  4OGQ B;  3DC6 A;  3G80 A;  4F6R B;  2W6I G;  3GB7 C;  4MTX A;  3A8T A;  1WLE A;  2CGO A;  3DXR B;  4WFF A;  3SJC C;  1KP2 A;  2F66 C;  1PL0 A;  4NXN B;  5GON A;  2L35 A;  5BMV B;  2A3Q A;  5C8Y A;  2QKA A;  4CS4 A;  2HLD G;  1WPB A;  1VQ6 V;  3H9V A;  5KHG A;  3J81 N;  4FLU A;  3DTU B;  1YJN V;  4LNU B;  3K5L A;  1YI2 V;  4LH6 A;  1XL4 A;  1B6Q A;  3E8G A;  4IHJ A;  4DV0 O;  2A7W A;  2FKX A;  1EZV H;  2ATK C;  1NVP D;  2JDI G;  1I5X A;  3Q4H A;  3ZRW B;  3D36 C;  2DYR B;  2PI4 A;  1OCR B;  2W6J G;  4EB6 B;  1K34 A;  1TAE A;  1NZ6 A;  4PA7 A;  1AP5 A;  4GKJ B;  1MG1 A;  2YIB A;  1GH6 A;  5B1B B;  4PA4 A;  2YI8 A;  1BGY H;  4RO2 A;  2WLK A;  1M5I A;  1V54 C;  4CBC A;  2PYJ A;  5TIS Z;  4DYL A;  4IGG A;  4DR6 B;  2DMX A;  4K0K O;  1IBK B;  3OEH G;  4W4L A;  3K03 A;  3WB0 A;  2YXY A;  4TV8 B;  5LHG A;  1P7B A;  3DSQ A;  4QE7 A;  1VQP V;  1K73 W;  1GM7 A;  1QVF U;  1FPO A;  4BR6 A;  4MTG A;  2JJ2 G;  5HFL A;  4JI4 B;  4GKJ O;  2Q7G A;  3CCL V;  3QNE A;  4JI5 O;  1THZ A;  2YDE A;  3ABM C;  5IJ0 A;  5H6Q A;  2R72 A;  1JVM A;  3CRR A;  4IYH A;  3K0D A;  1ZAU A;  4H13 B;  3LNN A;  5KA6 A;  4DR6 O;  2X7R B;  1KB9 F;  3HKE A;  1QCE A;  2EJR A;  1PV0 A;  4E2L A;  1H8H G;  1NS1 A;  1QR9 A;  3ASO C;  4X20 A;  1Q6U A;  1XI1 A;  3I5D A;  1DF5 A;  1DGS A;  5GON B;  3FKS G;  4JYY A;  1VF6 C;  2CTQ A;  1AI6 A;  4RAI A;  4LF8 O;  3RYI B;  3ETE A;  2HHH O;  3R66 A;  1CEZ A;  4Z1M G;  2N05 A;  3P32 A;  4LF7 O;  1KKC A;  4DR5 O;  1AR1 B;  4FLW A;  3G71 V;  1N36 B;  3E83 A;  3ZHU A;  3MD0 A;  3APO A;  3SPG A;  2Z3Y A;  5IYC O;  3Q4H B;  3BCC H;  4LBE C;  5E79 Z;  1IBL O;  3M8A A;  1IZ3 A;  3JAL A;  1UPG A;  1ZLZ A;  1H2S B;  2RCV A;  1Q82 W;  2ZR3 A;  3MHS C;  5D5Q A;  1YTF B;  4GZR B;  4DR2 B;  4LWS B;  2AW9 A;  4X64 B;  2Q9L A;  1K33 A;  3MHH C;  4DV2 B;  2E75 B;  5LGN A;  2PYL A;  1Y67 A;  2GV9 A;  1JX9 A;  2DN9 A;  2EIJ C;  4TOI A;  4W4K A;  1A32 A;  1KEC A;  2BCC H;  1Q6H A;  1B04 A;  4X88 A;  3HPL C;  3H1J H;  5LMU B;  4FM2 A;  2GSM B;  1YEW A;  4J11 A;  2UUB O;  4PA3 A;  4JZG A;  3AK2 A;  4MW3 A;  3L71 H;  3L74 H;  1KUQ A;  4FM0 A;  1J5E O;  1K92 A;  5E1A C;  5CN0 A;  5IJ0 B;  3OTO B;  3K9S A;  3CRC A;  3VBB A;  4UCS A;  1GN4 A;  4GX5 A;  1NT2 B;  4B3T B;  1JFF B;  3HKE B;  1Z2G A;  4BIZ A;  2KKW A;  3CCR V;  3W7W A;  3SYC A;  3CC4 V;  2AXT Z;  4G27 B;  1FAF A;  1N33 O;  3OMA B;  5LYJ A;  5ITZ B;  1PL4 A;  2WLJ A;  4KXR A;  2FML A;  1FXH A;  1QNM A;  2QTS A;  3MAQ A;  1SQG A;  2YXH A;  3ICX A;  4RUE A;  4LC1 A;  1GAX A;  1SZT A;  1ZL8 B;  1NTM H;  3JSL A;  1BMF G;  5DN6 G;  5KUM A;  4GX2 A;  4J7Z A;  3WB2 A;  3A2F A;  4JYA O;  4GYC B;  1XMO O;  4MW8 A;  1Q81 W;  3ZX6 A;  1HR0 B;  1KBH A;  3B8N A;  4LF5 O;  1QLN A;  3PN1 A;  2JGD A;  2ZE8 A;  4FIP C;  2Y69 C;  1BSM A;  4EKW A;  3T4D A;  1Q90 D;  4DW0 A;  1WA8 A;  1JCH A;  1K7D A;  2UXX A;  3JAL B;  1M57 C;  4LF6 O;  5FNV A;  5KHK A;  3ZCC A;  2QR4 A;  3T2M A;  1IBM O;  4WFA V;  1F4M A;  4U7N A;  2YI9 A;  1BT8 A;  2P22 C;  3HKD B;  5LA6 B;  1Q6I A;  4B3R O;  3BY6 A;  4IYI A;  4UCV A;  3TET A;  2Q73 A;  3SJA C;  2QJ1 A;  1FJG O;  3HKC B;  2QTO A;  1V9P A;  3AG1 C;  1K9M W;  1COW G;  3CD6 V;  4N21 A;  1NJI W;  1V55 B;  4PD4 F;  4JI7 B;  3SJB C;  3K57 A;  1LNQ A;  4NTY A;  1XMQ O;  4EEQ A;  5AG2 A;  2GHY A;  3NR7 A;  3WG7 C;  1RM1 B;  2CUG A;  3G6E V;  2H8P C;  3B8M A;  3QO8 A;  1PNK A;  2IJH A;  2Q69 A;  1IXB A;  1R1B A;  1YJ9 V;  4XDJ A;  1NI8 A;  2R9R B;  3E89 A;  1OCC B;  4KFM A;  3ZBH A;  3L72 H;  3CRA A;  1R6K A;  2HG5 C;  4O4L B;  3GWO A;  1ARO P;  2QDO A;  4LFB O;  1RSO A;  2ZDI C;  1WN7 A;  4IIJ A;  4Z2W A;  2JGU A;  4FLV A;  1W59 A;  4AI8 A;  2F93 B;  4O2A A;  4YY3 B;  3G67 A;  1UJW B;  1H2G A;  2E76 B;  4PDM A;  3SR2 C;  5KMG A;  1QHT A;  4DR1 B;  1N34 O;  4DUY O;  1Y76 A;  4DV6 B;  2FL4 A;  3FX7 A;  5EIB D;  3T1Y O;  1JOY A;  1F23 A;  1K8A W;  5CA0 A;  4I0X B;  4YY3 O;  1YJW V;  5J2T B;  4X9Q A;  3AG3 B;  5LBQ A;  4A5U B;  3J7A U;  1PNM A;  4CH6 A;  4LF4 O;  3K59 A;  5EBL C;  1KKD A;  5C93 A;  5KAF Z;  4YIP A;  2IU3 A;  3BFR A;  2ZD9 A;  3R65 A;  2DYR C;  1Q5O A;  3CP1 A;  3ZMZ A;  5LHI A;  2JS3 A;  1JR9 A;  4NB5 A;  1OCR C;  1J95 A;  1L0L H;  5CB4 A;  4DR7 O;  2D2C B;  5LXT B;  1SQF A;  3A0B Z;  4TSF G;  4FLT A;  1YVW A;  1EBO A;  1VQL V;  5B1B C;  1H2M A;  2LGQ A;  3M7M X;  4X89 A;  2OT5 A;  4L87 A;  3SYP A;  5JJN B;  3STZ C;  4ZI7 A;  5BR8 B;  4JV5 O;  3E2E A;  4X66 B;  4FFB A;  2V7Q G;  2YEV B;  4UCR A;  2DQ3 A;  1LR1 A;  3SPH A;  4DO2 A;  3B4S A;  5B3S C;  2DQ0 A;  4MTO A;  1ROP A;  2P4K A;  2G38 A;  2JJ1 G;  2EIM B;  2UXB B;  4IIJ B;  4FM1 A;  4PEL A;  1B3Q A;  4O2A B;  4F6R A;  2PTM A;  3OGI B;  3BEH A;  1WP8 A;  1SQB H;  1YSC A;  3DXR A;  4UCO A;  1BQZ A;  5KMG B;  5B1A C;  2EZP A;  4FK5 C;  2AGA A;  3THO A;  1GMG A;  3JD0 A;  4WF9 V;  1S5L Z;  4YHH O;  1BS3 A;  4GX0 A;  1AI7 A;  4DV5 O;  4UXN A;  2UUA B;  4JGS A;  3ZMU A;  2EZO A;  4JTA B;  2BOB C;  5KAI Z;  1R3L C;  4TQF A;  3FYE B;  4PHZ A;  1H2K A;  1WAZ A;  5LHH A;  3CCJ V;  4PDR A;  3ZRW A;  4DV3 B;  1N32 B;  2QSA A;  3ZN1 A;  1AJP A;  1T5E A;  1P4R A;  4QIW F;  1SS3 A;  2RDC A;  3K5O A;  4GCZ A;  3RW0 A;  3LSQ A;  2O57 A;  4WFB V;  3OFN G;  4WFE A;  4DV4 B;  3FYI B;  1PNL A;  5J9P C;  2B5U A;  1TVK A;  4DR3 B;  3HKB B;  5CBG A;  5CB4 B;  3H1H H;  1I7F A;  1JJ2 U;  3LDE A;  2AHY A;  1GO3 F;  5EZY A;  4QE9 A;  3K58 A;  1VQK V;  3TJT A;  3W7X A;  1VEW A;  4FZ1 A;  3W7T A;  1S5H C;  3L9D A;  1F4N A;  4N23 A;  3ZIA G;  3CMA V;  1R73 A;  5JWP A;  2HEP A;  3JAR A;  3NXS A;  4DV1 O;  1JA8 A;  4FFB B;  1AB3 A;  2ZE7 A;  1X4T A;  4LF9 B;  1VQN V;  3CWB H;  2XOK G;  1SA0 B;  1Y66 A;  2WSS G;  4Z1V A;  4R7C A;  1X59 A;  3K5M A;  4I55 A;  3BHP A;  2XTA A;  4MT8 A;  3P30 A;  1VP7 A;  2UU9 B;  2MW2 B;  2WLI B;  1HNX O;  4X62 B;  1US6 A;  5B66 Z;  3RYI A;  2ZIM A;  5EK0 A;  5H6R A;  2RN9 A;  1O9H A;  2OIE A;  1P49 A;  4ICG A;  5CA1 A;  1WB8 A;  4DR4 B;  2ARH A;  1UFI A;  3ZJZ A;  2XAS A;  2WAM A;  3FD9 A;  4I9W A;  4AQY B;  1SRY A;  4BWA A;  2OWO A;  1NU1 H;  3RVZ A;  1FFX A;  1FXK B;  2ZKO A;  5BZB A;  4NXN O;  5IWA B;  4P9P A;  3L75 H;  1KU9 A;  3H1L H;  3KKY A;  3OTF A;  4LWS A;  4MVU A;  3UCS C;  3U11 A;  1IXM A;  1RPO A;  2JIZ G;  2P06 A;  4K8Z A;  2DE0 X;  3JAW B;  2B1I A;  1OZ0 A;  1TVK B;  1VF7 A;  2OYQ A;  4P30 A;  5IY5 B;  1MMM A;  5F2V O;  2Z0A A;  5EZY B;  1HNZ B;  1WP7 A;  3AG2 B;  2AHZ A;  1XOU A;  4LR3 A;  5HFM A;  2LO1 A;  1MAB G;  3JAR B;  2DWD C;  2FYU H;  2LP7 A;  2WLN A;  2CK3 G;  4HNA B;  3H01 A;  3CJH B;  2KG7 B;  4X65 B;  4X1Y B;  5JQG A;  5L3B A;  3CCV V;  4B3S B;  2Q67 A;  3OD4 A;  1BL8 A;  1V55 C;  4FLX A;  2IJJ A;  3E86 A;  4HZ3 A;  1IBK O;  1JFF A;  1XIL A;  2P4V A;  3STL C;  2ZNJ A;  1VF5 B;  4I55 B;  5B1N A;  2GBO A;  5KHI A;  5ITZ A;  3RYF A;  3ZHS A;  3IFX A;  5FPO A;  2UXC B;  4JI4 O;  1VQO V;  4WFG A;  1OCC C;  3P3N A;  1E1Q G;  3MDS A;  1K5S A;  1WPX A;  1MSW D;  1ZL8 A;  4ASU G;  5H2F Z;  4L8J A;  4I50 A;  2HVJ C;  1AJN A;  5CA1 B;  1ZUQ A;  2GUZ A;  4LFA B;  2ZR2 A;  4JI0 B;  3A0R A;  2WLH A;  3JAK B;  3SGI A;  1S3J A;  2MK3 A;  4UB8 Z;  1TA8 A;  3A0H Z;  1FFX B;  2CH7 B;  2ILM A;  3FB7 C;  4GKK B;  1D2D A;  1SQV H;  3IC9 A;  4K35 A;  2YID A;  4LP8 A;  2XAQ A;  2KSD A;  4JI1 B;  4J7K A;  5IYZ B;  3G4S V;  3B40 A;  1U96 A;  3U0Z A;  1SKV A;  2VQF B;  5CMU A;  1DLB A;  2UXN A;  4LH7 A;  1ZX3 A;  3HKD A;  3K9A A;  5LA6 A;  5EBW C;  3SPJ A;  1N36 O;  4ABM A;  1RPR A;  2ZT9 B;  3HKC A;  1JJO A;  2QM8 A;  4QPJ A;  1AR5 A;  2F23 A;  3AG3 C;  2RQ6 A;  4B08 A;  2DYS B;  2Q8V A;  1E79 G;  2RJZ A;  1FS0 G;  4F6E A;  4DR2 O;  2EIL B;  4YJ2 A;  2A9H A;  4X64 O;  1M56 B;  1R6T A;  4JI6 B;  4DV2 O;  4GUN A;  2A06 H;  5JQG B;  3CX5 F;  3E8H A;  4ZIB A;  1G1X B;  3WB1 A;  3JAS A;  4XDK A;  1AVM A;  3OEE G;  2KB1 A;  3UM7 A;  4H33 A;  4YIO A;  1VQ7 V;  3VOU A;  2E5L B;  1SF9 A;  4D7S A;  4PI0 A;  1BHA A;  3CPW U;  1PP9 H;  5LMU O;  2P7T C;  4O4L A;  1I08 A;  3JCU Z;  4DXW A;  3OE7 G;  1K4D C;  2Q4P A;  4E4E A;  3RYF B;  1XUQ A;  2Y4U A;  4MTF A;  3VQY A;  4J42 A;  1YCI A;  3E8F A;  1R3I C;  4I50 B;  3OTO O;  4GLX A;  4KHP B;  3BRC A;  5J2U A;  1Y4M A;  3N2G B;  2EIM C;  2GUZ B;  4B3T O;  4J9Y B;  4PA6 A;  4PA9 A;  4ZOL A;  2ZE6 A;  2LGW A;  3FAV B;  1E1R G;  3CCQ V;  4MVZ A;  4MVO A;  2IH3 C;  2WLM A;  1IUR A;  3QO5 A;  1XBL A;  2IBZ H;  1HNW B;  3TXQ A;  5LP6 A;  4I0X A;  4PJ0 Z;  4R8C A;  4CC5 A;  1Q3E A;  4J9Z B;  4JI2 B;  4JI8 B;  1XEQ A;  4PI2 A;  1AP6 A;  3ZS8 C;  1AI5 A;  3IC7 A;  2XAH A;  3HB3 B;  5J2T A;  1XNR B;  4KHP O;  1HR0 O;  3CCM V;  4MVS A;  4NVP A;  1FYJ A;  4WCE V;  2NR5 A;  1R6N A;  2OCC B;  3KZI Z;  3ZRS A;  1Q7Y W;  3L70 H;  2PUS A;  5IJ9 A;  2ZM6 B;  3AK1 A;  2EUL A;  3SPC A;  1V54 B;  1XRE A;  3RFR A;  3ABK B;  1FD9 A;  1PM9 A;  4EFE A;  4FJC C;  2QWP B;  1MZF A;  3ASN B;  4BW5 A;  1IX9 A;  5BY1 A;  1QQC A;  5LXT A;  4RWU A;  3ABL B;  1F7Y A;  4YJ2 B;  2Q7H A;  4I7Z B;  3CEI A;  3CC2 V;  2XHB A;  1N0N A;  1NH2 B;  2DWE C;  3C90 A;  1H8E G;  4O4H A;  3JAS B;  1M1K W;  4D6T H;  1VQ5 V;  4OX9 B;  2XAF A;  2YEV A;  4U7O A;  3VQX A;  4B3M B;  4MVM A;  2A79 B;  1EN4 A;  3EVK A;  2R9A A;  3F7Y C;  3FB8 C;  1SQQ H;  3ZRV A;  1YTF D;  1NQT A;  4JI7 O;  3S3W A;  1OJH A;  5LGU A;  2YIB D;  2IU0 A;  3D8C A;  3T1H B;  3CYO A;  2EIN B;  2PF4 E;  2H94 A;  4X8A A;  2Q5Z A;  1HP8 A;  4QJF B;  5J2U B;  1YIJ V;  5KLV H;  1H2L A;  3RYC A;  2F43 G;  1EN6 A;  4ZOL B;  3U10 A;  5JH7 B;  2QKC A;  4LFC B;  1SER A;  1VQM V;  3SDL A;  4TQD A;  3RT3 C;  3RBZ A;  5D5P A;  2FB5 A;  4DV7 B;  3DGE A;  3RYH B;  5LP6 B;  3CRQ A;  2B9Z A;  4G28 B;  3TCU A;  1BQ0 A;  3OUF A;  1YZB A;  4JAS A;  2N04 A;  3EHB B;  4DR1 O;  3ETQ A;  3GVM A;  3W7U A;  1XDC A;  3E8B A;  3ZMT A;  2QEX V;  1BHB A;  3JAT A;  4DV6 O;  5IJ9 B;  1FXK C;  4QPK A;  4OPA A;  2EIJ B;  5L3F A;  1AIL A;  4OXS A;  3D3Q A;  2YSU B;  4OPH A;  4DV7 O;  3HKB A;  1Q43 A;  3VQW A;  2WLL B;  2QA4 V;  3JD1 A;  4DUZ B;  3SPI A;  2OTL V;  1VAR A;  1NBM G;  1WB7 A;  3AEI A;  4FLY A;  3ZHR A;  1N0J A;  2KQX A;  3QTC A;  4CH5 A;  3T1C A;  4O4H B;  1CXZ B;  5IY5 C;  4P9O A;  2LJ2 A;  1N4C A;  3ABU A;  3AG2 C;  2XT9 A;  4IL6 Z;  2VQE B;  1KD1 W;  4UV8 A;  5JJE B;  1GK9 A;  3JYC A;  1NVP B;  2CTR A;  1SA0 A;  3LNM B;  3E35 A;  1H38 A;  4TUY A;  3UT5 B;  4PV1 B;  2M7W A;  1GM9 A;  3QG5 A;  3K08 A;  2D3O W;  4JI3 B;  5BR8 O;  4BIO A;  2WLI A;  1XNQ B;  1Z5W A;  2HJF C;  3RYC B;  4X66 O;  2XUM A;  1GTO A;  2HFE C;  2ITD C;  3N2K A;  3T4Z A;  2ZIN A;  3TGU H;  2UXD B;  3K0G A;  4J10 A;  4O2B A;  4C7U A;  1URF A;  4KL1 A;  4UVB A;  1S76 D;  5B1O A;  2UUC B;  2UXB O;  1SZX A;  1SQX H;  3ZHQ A;  1GRJ A;  2DJV A;  1GN3 A;  2ZIO A;  4UCU A;  5KHJ A;  4KUM A;  1RP3 B;  4NXM B;  1FXK A;  5LL6 Y;  2WA3 A;  2PI5 A;  2XND G;  4BAY A;  1K3E A;  3EXA A;  5LMN B;  4O4J A;  1M4U A;  1P7G A;  4JAU A;  3JAT B;  1EM1 A;  5H9C A;  2ETN A;  3JAW A;  2RMK B;  2UUA O;  4UVC A;  1Z5V A;  2PGG A;  1I5Y A;  2Y48 A;  4U3J B;  4PDL A;  4XBF A;  5B5E Z;  2EIK B;  2DW4 A;  2ZE5 A;  4DV3 O;  1SET A;  1N32 O;  2F1M A;  2RNB A;  2ADP A;  1L0N H;  3OAA G;  2F4V B;  2WPD G;  3ZHV A;  2LQT A;  2ITC C;  2BTO A;  3QO7 A;  3BAB A;  4WBN B;  2QGN A;  2YUA A;  4HYO A;  1OCZ B;  4HNA A;  3DC5 A;  4WFH A;  3CJH A;  2KG7 A;  4DV4 O;  2DYS C;  4X1Y A;  3B09 A;  1IDS A;  2LW1 A;  3F5T A;  2ZXW B;  4Q20 A;  4DR3 O;  3WU2 Z;  5BXZ A;  2EJ7 A;  4ZHQ B;  5EBM C;  2EIL C;  3HR0 A;  4NKG B;  4PDV A;  2IH1 C;  1M56 C;  4TUY B;  1M90 W;  1WNS A;  3JD4 A;  2YS8 A;  4JAA A;  4TV9 B;  2NNU A;  5KUK A;  4LCU C;  3H1K H;  2Q7E A;  2YIA A;  1CPY A;  1KMI Z; 
#chains in the Genus database with same CATH homology
 3BY6 A;  2QKS A;  3LSS A;  1MOF A;  4JYC A;  4TT3 G;  3TET A;  3FB7 C;  3ABT A;  3ZN0 A;  4RQE A;  1Q86 W;  4LP8 A;  2XAQ A;  1ORQ C;  5CBH A;  3G4S V;  2QTO A;  3AG1 C;  1K9M W;  3CD6 V;  1COW G;  1DTO A;  2ZDI A;  4N21 A;  5CA3 A;  5CMU A;  1OCO B;  1DLB A;  2UXN A;  4BIU A;  1NJI W;  1W0K G;  1V55 B;  3K9A A;  3K79 A;  5EBW C;  3SPJ A;  5EC2 C;  1LNQ A;  3ETG A;  1QBZ A;  1KC8 W;  1RPR A;  2OTJ V;  2GHY A;  3WG7 C;  5DM6 V;  2QM8 A;  1RM1 B;  2JEU A;  4QPJ A;  2Y69 B;  3G6E V;  2H8P C;  3B8M A;  3X2Q B;  3AG3 C;  3QO8 A;  1NKD A;  1PNK A;  2IJH A;  2Q69 A;  5IDJ A;  2DYS B;  1YJ9 V;  4XDJ A;  1QLE B;  2R9R B;  1E79 G;  1KQS U;  3E89 A;  5CBF A;  1OCC B;  4KFM A;  1FS0 G;  3SYA A;  3WFV A;  1R6K A;  1M57 B;  2HG5 C;  2EIL B;  1NH2 D;  2A9H A;  2A0L A;  3GWO A;  1ARO P;  1DF4 A;  4MSW C;  1M56 B;  1VQ4 V;  4CZZ A;  2C2A A;  2ZDI C;  4H37 A;  4XDL A;  5L3C A;  3OMN B;  3E8H A;  3F5W C;  3CXC U;  4XDK A;  3UM7 A;  3OEE G;  2KB1 A;  2R9I A;  2JK5 C;  1VQ9 V;  3CCU V;  3AG4 C;  4H33 A;  1VQ7 V;  1UJW B;  3VOU A;  2BOC C;  2OCC C;  1H2G A;  4PDM A;  1BHA A;  3CPW U;  2B1G A;  2P7T C;  3OMI B;  1PD3 A;  4TWK A;  3ABK C;  1R3J C;  4DXW A;  3I56 V;  3OE7 G;  2IJI A;  1K4D C;  1EFR G;  3AG1 B;  4MS2 A;  3ASN C;  4R50 A;  2Z5U A;  3IGA C;  4G2K A;  4MTF A;  1FFT B;  5IYB O;  1JOY A;  3ABL C;  5IYD O;  5B3S B;  1ZWI C;  3E8F A;  1R3I C;  1F23 A;  1NR7 A;  1K8A W;  2EBO A;  1JPX A;  3ZRX A;  1W2B U;  3ZMV A;  1HWY A;  1EZJ A;  1Y4M A;  3PJS K;  2EIM C;  2WWW A;  2W0F C;  4J9Y B;  4PA6 A;  2P6J A;  1YJW V;  1F51 A;  3WG7 B;  4PA9 A;  1RM1 C;  3ML0 A;  1SES A;  1K5Q A;  3ETD A;  1E1R G;  3AG3 B;  3OM3 B;  4MVZ A;  5LBQ A;  5LGT A;  3CCQ V;  3CCE V;  2HVK C;  4MVO A;  2IH3 C;  1PNM A;  2WLM A;  5EBL C;  2X0L A;  1KKD A;  3QO5 A;  5C93 A;  1GKF A;  4KP4 A;  4UVA A;  1CP9 A;  2QM7 A;  3W7S A;  4HAM A;  5B1A B;  2IU3 A;  2ZD9 A;  3R65 A;  2DYR C;  4R8C A;  3CP1 A;  1K4C C;  3LUT B;  3ZMZ A;  4R6Z A;  4J9Z B;  5LHI A;  2XAG A;  3I55 V;  1AI4 A;  1OCR C;  3UKM A;  1AI5 A;  1J95 A;  2QE7 G;  4RQF A;  3IC7 A;  2XAH A;  3HB3 B;  4QNH B;  1QVG U;  3M99 B;  3CCM V;  5L3D A;  2EIN C;  4TSF G;  4JYB A;  1EBO A;  3AG4 B;  4MVS A;  1VQL V;  4WCE V;  5B1B C;  2V1D A;  1R6N A;  2OCC B;  3FB6 C;  3ZRS A;  1Q7Y W;  5EC1 C;  4X89 A;  2OT5 A;  4P2Z A;  4L87 A;  3SYP A;  3SPC A;  3D36 A;  3B77 A;  1V54 B;  3STZ C;  3ABK B;  2W6I G;  3GB7 C;  4MTX A;  4FJC C;  1PKX A;  3E2E A;  3ASN B;  1WLE A;  2V7Q G;  2YEV B;  4GX1 A;  4UV9 A;  4BW5 A;  2DQ3 A;  4WFF A;  3SPH A;  4DO2 A;  1GM8 A;  1KP2 A;  3ABL B;  2DQ0 A;  5B3S C;  1PL0 A;  4ZKI A;  4MTO A;  1ROP A;  2P67 A;  3CC2 V;  3CME V;  2HLD G;  2JJ1 G;  2EIM B;  3OR6 C;  1NH2 B;  2DWE C;  1VQ6 V;  4PEL A;  1NR1 A;  1H8E G;  3DTU B;  2LFR A;  1YJN V;  1M1K W;  1YI2 V;  3K04 A;  3K3W A;  1XL4 A;  1VQ5 V;  1B6Q A;  3BEH A;  3E8G A;  2XAF A;  2YEV A;  1YSC A;  4U7O A;  4MVM A;  2A79 B;  2ATK C;  1NVP D;  2JDI G;  1I5X A;  5B1A C;  3F7Y C;  3ZRW B;  3FB8 C;  2EZP A;  3ZRV A;  1YTF D;  3JCZ A;  2DYR B;  4FK5 C;  1NQT A;  1GMG A;  3JD3 A;  3JD0 A;  2PI4 A;  4WF9 V;  1OCR B;  2W6J G;  5LGU A;  1K34 A;  2IU0 A;  4GX0 A;  1AI7 A;  4PA7 A;  1ENV A;  3D3I A;  4UXN A;  4JTD B;  3CYO A;  2EIN B;  3SJQ C;  1MG1 A;  3K06 A;  4JGS A;  3ZMU A;  2EZO A;  2H94 A;  4JTA B;  4X8A A;  5B1B B;  2BOB C;  4PA4 A;  1R3L C;  4QJF B;  3FYE B;  1YIJ V;  3OUS A;  4RO2 A;  1TUE B;  2F43 G;  5LHH A;  4PDR A;  4UUJ C;  3ZRW A;  3CCJ V;  2WLK A;  4YXW G;  1V54 C;  4CBC A;  1S0V A;  1SER A;  2HKO A;  1VQM V;  2LFS A;  1N8R W;  3ZN1 A;  1AJP A;  1P4R A;  4QIW F;  3OEH G;  3K03 A;  2X6B A;  4GCZ A;  3RW0 A;  1KP3 A;  3LSQ A;  3RBZ A;  5LHG A;  1P7B A;  4QE7 A;  1G4Y B;  1VQP V;  3DGE A;  1K73 W;  1GM7 A;  4WFB V;  1QVF U;  1R3K C;  3OFN G;  5KA5 A;  4WFE A;  4G28 B;  3TCU A;  3FYI B;  4MTG A;  2JJ2 G;  5HFL A;  1PNL A;  5J9P C;  4ZBM A;  2B5U A;  3OUF A;  4JAS A;  2IW5 A;  5CBG A;  3CCL V;  3QNE A;  3EHB B;  1JJ2 U;  4FMT A;  3LDE A;  3FB5 C;  5L3E A;  1THZ A;  4F4L A;  3OGC C;  3ABM C;  3JD2 A;  2AHY A;  1GO3 F;  5H6Q A;  1JVM A;  3K0D A;  3W7U A;  4QE9 A;  1VQK V;  3W7X A;  1QR8 A;  5KA6 A;  2X7R B;  3E8B A;  3ZMT A;  1S5H C;  3W7T A;  2QEX V;  1BHB A;  1F4N A;  4N23 A;  1FXK C;  3ZIA G;  4QPK A;  1QCE A;  3CMA V;  1XL6 A;  2EIJ B;  2EJR A;  1R73 A;  4JPR A;  4E2L A;  4OXS A;  5L3F A;  1H8H G;  3NXS A;  1QR9 A;  3ASO C;  1S77 D;  2YSU B;  5L3G A;  1VQN V;  3CC7 V;  2WLL B;  2QA4 V;  3JD1 A;  1DF5 A;  2XOK G;  3FKS G;  3SPI A;  2OTL V;  1AI6 A;  1NBM G;  3AEI A;  4RAI A;  3KG2 A;  3ETE A;  1FXV A;  3T1C A;  2JEX A;  2NLJ C;  1CEZ A;  3F7V C;  4Z1M G;  1Y66 A;  2WSS G;  3SYO A;  3P32 A;  2Q6A A;  4R7C A;  5IY5 C;  4RUF A;  1AR1 B;  4MT8 A;  3P30 A;  3G71 V;  2HR3 A;  4P9O A;  3E83 A;  3ABU A;  3AG2 C;  2IJK A;  3MD0 A;  2WLI B;  2WLL A;  3SPG A;  2Z3Y A;  5IYC O;  1KD1 W;  4LBE C;  4UV8 A;  1NVP B;  1GK9 A;  3JYC A;  5EK0 A;  3LNM B;  5H6R A;  1Q82 W;  2ZR3 A;  3MHS C;  3E35 A;  1JQ0 A;  1YTF B;  1H38 A;  2XAJ A;  2M7W A;  1GM9 A;  3ABM B;  3K08 A;  2EIK C;  2D3O W;  2X6C A;  3ZJZ A;  1K33 A;  2XAS A;  3MHH C;  2WAM A;  4I9W A;  2WLI A;  1SRY A;  5LGN A;  2HJF C;  3RVZ A;  1FXK B;  1JX9 A;  2EIJ C;  1GTO A;  2HFE C;  2ITD C;  3T4Z A;  5BZB A;  3ASO B;  3LDC A;  1L1F A;  1KEC A;  4I5S A;  1M9N A;  1OCZ C;  4X88 A;  3HPL C;  3K0G A;  4P9P A;  4MVQ A;  4UVB A;  5GW7 A;  1S76 D;  5B1O A;  2GSM B;  2X6A A;  2ZXW C;  4MVU A;  1IXM A;  4MVR A;  1RPO A;  2JIZ G;  4JF3 A;  4PA3 A;  3ZMS A;  1OHH G;  4KUM A;  4MW3 A;  1K97 A;  1OZ0 A;  2B1I A;  1S72 V;  3LDD A;  1FXK A;  3CCS V;  1K92 A;  2PI5 A;  2XND G;  5E1A C;  4BAY A;  5CN0 A;  1K3E A;  2K1E A;  4P30 A;  5IY5 B;  3VBB A;  2Q68 A;  3AG2 B;  4FPP A;  3TK1 A;  1YIT V;  4GX5 A;  2AHZ A;  2ZQM A;  4JAU A;  5HFM A;  1W0J G;  4BIZ A;  3CCR V;  1MAB G;  5H9C A;  3W7W A;  1YHQ V;  4JTC B;  1VQ8 V;  2DWD C;  2LP7 A;  3SYC A;  3CC4 V;  2WLN A;  4UVC A;  4G27 B;  2CK3 G;  3OMA B;  1I5Y A;  1G8M A;  3H01 A;  2Y48 A;  2WLJ A;  4GT1 A;  4JAV A;  4PDL A;  4XBF A;  1FXH A;  1OCO C;  2EIK B;  5L3B A;  2DW4 A;  3RVY A;  3CCV V;  2Q67 A;  1AJQ A;  3SYQ A;  1SET A;  4RUE A;  4LC1 A;  1BL8 A;  1V55 C;  3EFF K;  2IJJ A;  3OAA G;  1SZT A;  3E86 A;  2WPD G;  1BMF G;  4HZ3 A;  5DN6 G;  2ITC C;  5KUM A;  4GX2 A;  1Q81 W;  4MW8 A;  3STL C;  2FTK A;  3B8N A;  3QO7 A;  1QLN A;  5B1N A;  5FL7 G;  4HYO A;  4FIP C;  1OCZ B;  2Y69 C;  2P90 A;  3X2Q C;  4WFH A;  4EKW A;  3T4D A;  2DYS C;  3IFX A;  1VQO V;  4Q20 A;  1QLE C;  2ZXW B;  4WFG A;  1OCC C;  1E1Q G;  1JCH A;  1K7D A;  3OW2 U;  2UXX A;  1K5S A;  1WPX A;  1MSW D;  1M57 C;  5EBM C;  2EIL C;  4ASU G;  3ZCC A;  3OR7 C;  3T2M A;  2HVJ C;  4PDV A;  2IH1 C;  1M56 C;  1F4M A;  4WFA V;  4U7N A;  1AJN A;  1M90 W;  2ZR2 A;  3JD4 A;  3A0R A;  2WLH A;  2NNU A;  5KUK A;  4LCU C;  1S3J A;  1CPY A;  2MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...