2NLJC

Potassium channel kcsa(m96v)-fab complex in kcl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVVVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment light chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nljC00
2Q68A 2H8PC 3SYPA 2A9HA 2Q69A 1ZWIC 3BEHA 4MVUA 2DWEC 4WFGA 2DWDC 4KFMA 4QE7A 4X8AA 3STLC 2EILC 5EBLC 4LBEC 3RVZA 4MVZA 4MVSA 4MTGA 3UM7A 4BW5A 2HVJC 3RBZA 2ATKC 4G27B 4HYOA 4PDMA 2W0FC 4LP8A 4PA7A 4DXWA 1KKDA 3LDEA 3K0GA 2QTOA 5B1BC 3SYOA 2X6BA 3OR7C 3AG4C 4PA6A 4UUJC 4OXSA 3ZJZA 2KB1A 3GB7C 3SYAA 2Q67A 4LCUC 5EC2C 3T1CA 3R65A 3AG3C 3T2MA 3UKMA 3FB6C 4TWKA 1R3LC 4P2ZA 1J95A 1R3JC 3E8FA 3PJSK 1ORQC 4GX0A 4WFEA 3STZC 1P7BA 1BL8A 5CBFA 2ZXWC 1LNQA 3OGCC 4MTOA 4MVRA 4WFHA 2JK5C 4P9OA 2HG5C 2WLHA 3VOUA 4P30A 4P9PA 1V54C 4G28B 1K4DC 4R8CA 4JTAB 4MTFA 2IH3C 2EIJC 2DYRC 5KUKA 2ITCC 1OCOC 2WLLB 4JTCB 2Q6AA 3SYCA 3F7VC 2WLLA 3OUFA 2A0LA 3KG2A 3K08A 3SPJA 3F7YC 2WLKA 4R6ZA 2X6CA 1M57C 2OCCC 1K4CC 4CBCA 5BZBA 2AHZA 3SPCA 1XL4A 4H37A 2K1EA 3SJQC 3TCUA 2IH1C 3K0DA 1M56C 2HJFC 4X88A 5EC1C 4PDLA 3K06A 5B1AC 2ITDC 2WLNA 2WLMA 3LDCA 4MW3A 5EBWC 2WLJA 3FB8C 4MVOA 2YEVA 1OCRC 4MVMA 4PDVA 5E1AC 3RVYA 3OUSA 3LNMB 3SPIA 5CBGA 3ABMC 1S5HC 4H33A 2HFEC 2BOCC 2BOBC 4J9YB 3HPLC 2AHYA 3LUTB 4MSWC 3SYQA 5EK0A 3X2QC 3E8BA 3ABLC 5IY5C 1XL6A 3AG2C 3EFFK 2QKSA 3E8HA 1OCCC 4MS2A 2P7TC 3IGAC 3JYCA 3T4ZA 3ZRSA 1V55C 3ASNC 4GX1A 2WLIB 4R7CA 4JTDB 2WLIA 2EIKC 2EIMC 4WFFA 3LDDA 5B3SC 5J9PC 3K03A 4ZBMA 1G4YB 4XDKA 3TETA 3FB5C 4MW8A 4PA9A 3FB7C 4F4LA 4I9WA 4XDJA 3E86A 2X6AA 2ZD9A 1OCZC 3IFXA 5CBHA 2Y69C 4XDLA 3E8GA 3E89A 4RUEA 3ASOC 3OR6C 4QE9A 3SPHA 4X89A 4EKWA 4MVQA 3E83A 2EINC 2NLJC 3F5WC 2HVKC 4RUFA 4J9ZB 4R50A 4GX2A 4RO2A 2R9RB 4RAIA 4PA4A 3RW0A 1JVMA 4GX5A 1QLEC 2A79B 5EBMC 1R3IC 1R3KC 3ABKC 3WG7C 5KUMA 3SPGA 3T4DA 4QNHB 4PA3A 4PDRA 2DYSC 3AG1C 4HZ3A 3K04A
chains in the Genus database with same CATH superfamily
3ABKB 2JGDA 2A9HA 3OT7A 1ZL8B 4WFGA 3B77A 5KHJA 1IBMO 3OEEG 1QR9A 5LP6A 1I7FA 3OEHG 4MTGA 4LH7A 2BCCH 3ML0A 1KKDA 4DUZB 4PELA 4UCRA 1VQKV 2QDOA 3KKYA 1J5EO 3AG4C 5JJJB 2DN9A 3JASA 5EIBD 4E4EA 4GX0A 1YJ9V 3OGCC 4QJFB 1GK9A 4P30A 4AI8A 3OAAG 5EYPA 4MTFA 2YIBD 5FLXN 2EILB 4J41A 4FLXA 2Q0OC 1NT2B 4DV7B 4O4HB 2XOKG 5EC1C 5CB4A 2Y4UA 4JZGA 2QM7A 4DV1O 1RSOA 2R9AA 4JYAO 5CBGA 3W7XA 4PD4F 4KHPB 1IZ3A 4X9QA 4YJ2B 1OCCC 4O4IB 3BVOA 3CHXA 2OCCB 1K3EA 4U3JB 5LMUO 4ZHQB 4FK5C 2Z3YA 1MNGA 2Y0PA 1YJNV 1M56B 3M99B 1NKDA 5A2QN 3CMEV 2KKWA 2WSSG 2UUAB 1XNRO 2ILMA 4X89A 2RN9A 1I5YA 2NLJC 2P90A 5LYJB 4RO2A 1AROP 4NKGB 1AVMA 3ABKC 2L35A 1RM1B 3JATB 3ASNB 3WB1A 3CE2A 4K3AA 5LA6A 2YC0A 5IJ9B 4B3TB 1EN5A 3ZRWB 4LF6B 3CMAV 3MD0A 3ZMTA 3HKCB 4G27B 2E76B 4MTXA 5CA3A 2EBOA 3CS5A 3LDEA 1QVGU 1TVKA 3FYIB 2KSDA 5EC2C 4NYKA 2BTQA 2VQEO 1IVSA 3FYEB 4QPKA 3E8FA 1R6TA 4GYCB 2IU0A 4FFBB 2JS5A 4MVRA 2WLHA 3VOUA 1R6KA 2JRIA 2AZ2A 3G67A 3CC2V 2EIJC 1FXKB 1KYOF 3H1HH 2LJ2A 2BSKB 3SYCA 3OTFA 4I7ZB 3TXSA 3OUFA 2BE3A 3AG7A 4NVPA 5IT9N 1PL4A 3KG2A 5JQGA 1QHTA 5J2UB 1EBOA 5C93A 1VQ7V 1KD1W 1Q86W 4DR7O 1MMMA 3APQA 4LWSB 2JEUA 3I55V 2FMLA 1XHXA 1IXBA 4MVOA 2JEXA 1A32A 3OD4A 4LF9B 4MVMA 2M6YA 2P4VA 3OUSA 4FLYA 3ABMC 4O2BA 2F66C 4DR1O 4DW0A 2E75B 2LQTA 2RNBA 3D3QA 4BIUA 1JOYA 1ZAUA 4ICGA 2YXLA 2QJ1A 2Q7EA 1XEQA 3E22A 3OMIB 3K9AA 2PZSA 3O65A 4FLUA 2XNDG 5J9PC 1GH6A 2R72A 3CXCU 2ZQMA 4DV2B 3T1YO 1KECA 5L3GA 3F5WC 2P4KA 4I55B 1RM1C 1R3IC 2ODMA 1R3KC 5H5NA 5B66Z 3CCEV 3FAVA 1TUEB 1YEWA 1XNQO 1E1RG 4IIJB 1K92A 1JJ2U 4B08A 4BIOA 3RVZA 3N2KB 4GZRB 4MVZA 4MVSA 1FS0G 3K0GA 2QTOA 4IYHA 1S72V 3D36A 3ZN1A 4GKKO 4UUJC 5K1XA 4TT3G 1YZBA 3OMAB 2CH7A 1N8RW 1GN4A 4CS4A 1Z5WA 2ZT9B 1XDCA 2QKCA 1N34O 3TJTA 3CD6V 3K9SA 2JJ1G 1F7YA 4U7OA 1FPOA 4DV5O 1W59A 3HR0A 1FXVA 3VQXA 3OW2U 4LFBO 5KMGA 5BMVA 2WLLA 2A0LA 2ZE6A 2X7RB 4JYYA 1OJHA 1M57C 3WB2A 2VQFB 4DR2B 3DXRA 1V9PA 1VQ4V 1BCCH 1SQXH 4TV8B 3JAWA 4X1KA 2E5LB 3CP1A 4MSWC 4JAUA 3H1LH 5IY5C 3SR2C 2XT9A 1BE3H 1V54B 5CA0A 3JALB 4X62O 4O2AA 3ZRSA 2XHBA 4AQYO 3UCSC 2WLIA 3LDDA 3IC9A 4X20B 1GN3A 5LP6C 4DR5B 3H1KH 3W7WA 1Y66A 2XASA 5CBHA 1WPBA 1L8DA 3DSQA 5J2TB 1CXZB 4E2LA 1TVKB 5F2VO 5L3FA 1B3QA 3UO2A 2UXDO 3X2QB 2UXBB 1GAXA 3CWBH 1S76D 3SPGA 1T5EA 4PDRA 4FM0A 4ZOLA 4HZ3A 4NTYA 1AJPA 1AJQA 3A0HZ 1RPOA 2LO1A 3CCSV 3CPWU 5EBLC 2EZOA 2IBZH 5DECA 2Q4PA 1BMFG 3ZHUA 4GKJO 5L3EA 3SYOA 4UCOA 3EVKA 2YICA 3CSXA 4N21A 1JMKC 3D3IA 3UKMA 2F23A 1K34A 5DEDA 3PJSK 3ICXA 2RJZA 2QTSA 4DV4O 2EJ7A 3T1HB 1JFFB 4F6EA 1O9GA 2IJJA 1K7DA 1F23A 4OX9B 3B4SA 2QWNB 1HNWO 3JCUZ 4JTCB 2N04A 2JVDA 4DR3O 2QGNA 2G38A 3U10A 2IH1C 2ADQB 2QWQB 4DV6B 5E79Z 2GSMB 3N27A 1M90W 3JSNA 4DV3O 4KL1A 2UUCB 3E35A 4JYBA 3BY6A 3ZRVA 3UO3A 2UXXA 2FB5A 3K03A 1EN6A 3ZEDA 1KQSU 1Y74B 4AILC 1DK1A 1BS3A 4DR4O 5LHGA 1GKFA 3E86A 3IFXA 1DTOA 2R9IA 3A8TA 5B1AB 3CCQV 3H1IH 4IGGA 3K3WA 4X1YB 1E79G 2DOSA 2WA3A 4PA4A 4U3FH 3VQVA 4IHJA 1KKCA 3UM7A 3SYPA 2L6LA 1YI2V 1ZWIC 4KFMA 1H2MA 4B3TO 1K5SA 1NZ6A 5CA1A 4DR6B 3J7AU 3CCLV 1OCZB 2IJKA 1S0VA 2Q73A 2ARHA 1H8EG 5DN6G 1UPGA 2GUZB 3OR7C 1YF2A 1Y67A 1FJGB 3W7UA 3ZJZA 3AG3C 4TWKA 4CH5A 4FLWA 5L3BA 3ETGA 4UFZA 1W2BU 3STZC 1P7BA 3K57A 2ZXWC 4JASA 3AG1B 2X0LA 2YI9A 2PF4E 1IX9A 3DTUB 3ZMSA 3DC5A 4LNUA 2LGWA 3SPJA 4CBCA 2ZE8A 1NBMG 4J10A 2UXNA 5JCOA 1P49A 2LFRA 3AG4B 4TUYA 4DV0B 4GT1A 4TOIA 1VQNV 2PYJA 2GTAA 3IC7A 2A06H 5LBQA 1TUBA 4DYLA 1EFRG 1WLEA 1K33A 2EIMB 2Z5UA 3CRAA 1Q43A 3OR6C 3D36C 4EKWA 4O4JB 5LXTA 3ZMZA 3ZHTA 5IJ0B 5LGNA 1QNMA 3CCRV 1OCCB 3BPZA 5KUMA 2XUMA 4I0XA 4JI3B 2O57A 1VP7A 5LMNO 2PYLA 5JWPA 5IYZB 2CUGA 2CTWA 4FLTA 5IYDO 2A7WA 5EZYB 4BW5A 1FKAO 1ENVA 2P6JA 2UUBB 4YHHB 1MSDA 2Q67A 1VQMV 1AB3A 1R3JC 5CBFA 1GMGA 5C8YA 5GONB 1TA8A 2YS8A 4DRXA 4HBNA 1VQ6V 4JI6B 3RWRD 3S3WA 4EFEA 4CC6A 3TCUA 1PNLA 1AILA 2VQFO 3DC6A 1W0JG 4PDVA 5E1AC 4JI4O 1WJZA 1N36B 2HFEC 3G6BA 2F4VO 4J9YB 4YIOA 1BZKA 1L0NH 4CH6A 1E1QG 4IHJB 2EIJB 2HR3A 2LW1A 4J42A 4YJ3A 4RQEA 2EIMC 4UV8A 1KP3A 4WBNB 3FB5C 3OMNB 2ZDIA 3KZIZ 4I50B 1BT8A 1PM9A 1VMGA 2V1DA 1GTOA 4JF3A 2CGOA 2VS0A 3CCUV 3MHSC 4OGQB 4MVQA 3ABMB 4J9ZB 2B1IA 2R9RB 2YIAA 4OPHA 1KC8W 2H3OA 2UXBO 3H01A 4BIZA 1S5LZ 2XAHA 2FTKA 4IL6Z 3N2GA 1THZA 5IYBO 5KLVH 3RT3C 4CH4A 3FD9A 4JI8B 4LNUB 4PJ0Z 2JS3A 2W0FC 1K9MW 3RYCA 3JD0A 4TV9A 1XI1A 5FNVB 4X1IB 3GB7C 3SYAA 3T1CA 3R65A 4NXMB 4Q20A 4B3RB 1P84F 3RYHB 4TSFG 1BL8A 3T1HO 4KUMA 3JCZA 3SDLA 5BR8B 4R8CA 4JI1B 3RFRA 4OX9O 5ITZB 4PV1B 2ADPA 4HNAB 1KUQA 3K08A 5CN0A 3JAKA 1BHAA 2K1EA 5KHKA 1LR1A 3RYFB 1YVWA 1N0JA 1OCRC 1I08A 3I5DA 1QR8A 1SA0A 2AHYA 2UUCO 2A3QA 4F6RA 4UCSA 1CP9A 1TAEA 2WA4A 4LF8O 1V55C 1JCHA 4I5SA 1Q90D 2IJIA 2OTLV 3LSQA 2QM8A 4H0LB 3ZMUA 1JPXA 2Q8VA 3P32A 3PN1A 4DW1A 1AI5A 1M57B 4PA9A 1N32B 2MW2B 4I9WA 4XDJA 4DUYO 2OIEA 3OM3B 2Y69C 2JDIG 4XDLA 3CRCA 3E89A 4OPAA 4NB5A 3SJCC 2YXYA 5IWAB 1NTZH 5JH7B 4GX2A 4X64B 4RQFA 1Y76B 1VQ8V 5IY5B 2W0XA 2V7QG 3CC7V 2YDEA 4IYIA 4UB8Z 2JGDB 3U0ZA 3BHPA 2Q68A 2UXCO 1EN4A 1YCIA 4GCZA 5C8YB 2B5UA 1RFYA 4I9QA 5LP6B 5LL6Y 3WFVA 1Q82W 4JI7O 2CTPA 5L3DA 4DR6O 3RN4A 5JCOC 2F93B 4J7JA 5B1BC 1HP8A 1PNKA 4PA6A 3OTOO 2KB1A 3JASB 3S3XA 4DO2A 1VEWA 3UQ8A 1G8MA 2QA4V 3ZHQA 1RPRA 2IM9A 4FFKA 4X65B 4TQDA 5EYPB 4CS2A 4YY3B 3Q4HA 4WCEV 5FL7G 3M7MX 3JAMN 2WLKA 5BXZA 3QO7A 3K5NA 5CB4B 2KG7A 4JYCA 1RSOB 2WLJA 4DV0O 3SPIA 1KBHA 3SJBC 4CS3A 3HKBA 2BOBC 3R66A 1K73W 2PTMA 4PI2A 1HNZB 2VWJA 2B9ZA 2UU9B 2ZM6B 1WPXA 5JJEB 4R7CA 5KX5A 5KAIZ 2N05A 2P06A 3UT5A 1QVFU 4B3MB 2X6AA 1IBMB 1VF6A 2FYUH 2ZR3A 2YI8A 3E8GA 5AG2A 3BA9A 4CZZA 4I4TA 1XMOB 1SQBH 3HKEA 1BQ0A 4RAIA 1J5EB 3CRRA 1G1XB 4GX5A 2CE4A 3VBBA 3B09A 3JARA 1I0HA 2HHHO 2LGQA 1YIJV 3T4DA 3BCCH 4MT8A 4GUNA 1WP7A 2DQ0A 4JI5O 5LA6B 4P2ZA 2KQXA 1Q6IA 3G6EV 3CJHA 2DWDC 5KA5A 3HKDA 3STLC 3EXAA 1WB8A 2WWWA 1Q6HA 3KCXA 3ETQA 2LFSA 1XMQB 4PA7A 2QWRB 3JAKB 3J81N 1D5NA 3ZRXA 2BTQB 4YHHO 1GN6A 2Z0AA 2AGAA 4JI2O 1R3LC 4DV1B 4K8ZA 4EB6A 1IBKO 3EHBB 4JYAB 1ORQC 4BAYA 5GTHZ 4ASUG 4JI0B 1FFXA 3MAQA 4G28B 4NTWA 3CYOA 1WN7A 3ZIAG 4JI6O 2DMXA 1Q5OA 5JQGB 1NR7A 1VQPV 4DUZO 1Q3EA 2ZDIC 2HJDA 5BZBA 1M1KW 1CEZA 3K59A 5LMUB 3ZS8C 4PDLA 2ITDC 1XREA 5EBWC 2HKOA 4JAAA 4O2BB 3AG3B 1XNRB 1S3JA 3LUTB 1H38A 2ZXWB 3AG2C 2QWPB 3EFFK 2QKSA 1H2SB 5KA6A 4JV5B 3E22B 2P7TC 3QVNA 4A5UB 2C2AA 2EIKC 2HLDG 5K1PA 1IURA 3TETA 4DV7O 4KXRA 5B3SB 1FAFA 3CB2A 2HP8A 4EFBA 1GO3F 2XAJA 3WB0A 1GN2A 2EINC 2WPDG 1MABG 3ASOB 3RGBA 1O9HA 4KHPO 4O4LA 2QR4A 4PI0A 2RMKB 5EBMC 2VQEB 2Q0AA 3FAVB 4PA3A 2Q9LA 4ABMA 4D7SA 1YJWV 4YIPA 1LUWA 3ABUA 4FMTA 1ZL8A 1NH2B 4QE7A 1R1BA 4Z1MG 1TGOA 3AK1A 3KCYA 5KAFZ 1US6A 4JI8O 2UUAO 4FZ1A 1F4NA 2B1GA 2CH7B 3L70H 1AP6A 4NXMO 3ETEA 1J95A 5HFLA 4B3RO 1FYJA 1Y6XA 3HKBB 4N23A 4P9PA 1COWG 5BR8O 4LF6O 1OHHG 5KMGB 5BMVB 1Q8IA 2WLLB 3F7VC 3K79A 5H9CA 5KX5B 1GRJA 1WNSA 2X6CA 2AHZA 2GDSA 3DXRB 4O4HA 4X88A 5KHGA 4MW3A 3T1YB 1K5QA 2CTRA 3B40A 3QNEA 3JAWB 3ZBHA 3JD3A 1KMIZ 2JGUA 1XBLA 4X1KB 3CRMA 2E3CA 1AI4A 5IDJA 5H6QA 1PKXA 3JD1A 4B7EA 5CA0B 1IBLB 3W7SA 4YJ2A 1BQZA 4O2AB 4LFAB 3IGAC 4O4IA 1SZTA 2ZE5A 2WLIB 1K97A 3TK1A 5B3SC 1GM9A 4ZBMA 3TGUH 4U3JA 1Z2GA 4LF9O 2EJRA 4LF4B 1SQFA 3ASOC 1H8HG 3WU2Z 1N33B 2LW7A 5LYJA 4K0KB 2NR5A 1QCEA 1PD3A 4ZKIA 2MK3A 2M7WA 4ZOLB 4BWAA 3JATA 4XBFA 2DYSC 3K04A 2H8PC 3U11A 2VWKA 4UCTA 4LF5B 3OFNG 4DV2O 3ZRWA 4LFBB 3C3SA 2IJHA 1L0LH 3RBZA 3HKCA 2ZIOA 4PDMA 1BSMA 3OGIB 2RQ6A 1LNQA 4FFBA 2HG5C 3DGEA 4EEQA 4UCVA 2D2CB 2ITCC 1HR0B 1OCOC 4YY3O 3ZHVA 1FXKA 2BSKA 3CEIA 1WB7A 1MZFA 3F7YC 2YIBA 5J2UA 1VF6C 1EZVH 3SJQC 4LWSA 1OZ0A 2WLMA 4D6TH 3LNMB 5BY1A 2YUAA 1S5HC 1NTKH 3IJ4A 2YIDA 5EK0A 3E8BA 5LHHA 1NTMH 2UXDB 2V4DA 2PI4A 1XQ8A 1B6QA 3B2EE 3JYCA 2ZM6O 2IU3A 3CCMV 3QTCA 4UVBA 4RWUA 3O9OA 4WFAV 3QG5A 5L3CA 1H2GA 1SQPH 4DR2O 1URFA 1VF5B 4B3MO 4U7NA 4Z1VA 1OCRB 1YTFB 1SZXA 4GKJB 3GWKC 3ZMVA 2E5LO 4R50A 1XMOO 2CTQA 1H2LA 3FKSG 4I55A 2AZ0A 1QLEC 1XOUA 1VQ5V 3WG7C 4LFCB 4AHCA 1ZLZA 1V55B 4LF7B 2Q69A 3QO8A 2DWEC 4DV4B 4DR5O 3ZN0A 5CA1B 4K35A 4Q6GA 1I5XA 4IIJA 2JIZG 1BHBA 5FPOA 1SETA 3L71H 1HNWB 2Y69B 4UVCA 3N2KA 2CDYA 2XAFA 3A0BZ 2F1MA 1XMQO 4DR3B 2ZINA 2DQ3A 2ZCEA 1F51A 3APOA 1R73A 1M93A 4WFEA 2YXHA 4DV3B 5TISZ 1NJIW 4P9OA 4JI0O 1Z5VA 1K4DC 2PGGA 1NS1A 4B7KA 5B1OA 4JAVA 1UFIA 3CXHF 5A9GA 1MA1A 1U96A 1CPYA 5B1BB 4TUYB 3CX5F 2Q7GA 4DR4B 3L72H 1I94B 2F43G 2YEVA 1PP9H 3THOA 4TV8A 2DW4A 2FL4A 1SQQH 3I56V 3SYQA 2PI5A 3CCJV 3ABLC 1XL6A 4BW9A 1UJWB 1QBZA 4JV5O 4FIPC 3JALA 3T4ZA 1TUBB 2CAZC 4UB6Z 2Q7HA 4GX1A 1ROPA 4WFFA 2W6JG 4XDKA 3L74H 5LGTA 4ZI7A 2VRZA 4X20A 3ZHRA 4F4LA 2OTJV 4DV6O 3M8AA 1YDXA 3RYIA 4LC1A 4FLZA 1U97A 5LXTB 5J2TA 1M9NA 4FM1A 2NNUA 4W4LA 1NQTA 5LGUA 5LHIA 4I0XB 2OYQA 1SERA 1FD9A 3BEHA 1F4MA 2P5OA 4X8AA 2Y0IA 2EILC 4LBEC 4YXWG 2DE0X 4FZ0A 4HYOA 1L1FA 2H94A 2JJ2G 4H13B 2X6BA 1HNXB 1MSWD 4OXSA 1K8AW 1MZEA 1AJNA 3FB6C 2LP7A 1Y4MA 1SRYA 4DK0A 4X66B 1AR4A 4NR1A 1S5JA 2JK5C 4DRXB 1AP5A 5IYCO 3ETDA 1JFFA 5D5QA 1WP8A 2ZIMA 3G4SV 4L87A 2OIGA 2GHYA 1MOFA 1W0KG 2OCCC 3BABA 4GLXA 1FJGO 1XHZA 2PY5A 1FXHA 1M56C 1PPJH 4K8XA 1N4CA 3LDCA 5JVDA 2EZPA 3RVYA 3MHHC 1YHQV 1P4RA 3JSLA 3IAYA 1RP3B 3FX7A 2AW9A 2Q5ZA 1IBLO 1NVPD 2E74B 5FPRA 4MS2A 2R70A 2BTOA 4LFAO 3ASNC 4YJ3B 1NI8A 4MW8A 4LH6A 5LMNB 1Y74A 1KU9A 4TQFA 3K5OA 4LF4O 3H9VA 1SQGA 3HB3B 4NXNB 1N33O 1R6NA 3E83A 4X1YA 3RW0A 2EULA 4FM2A 1JVMA 1VARA 5IE9A 3P30A 4K0KO 2A79B 3AG2B 4B3SB 1B04A 5EIBC 3N2GB 2EIKB 4MVUA 4IT5A 4J80A 1FXKC 4ZIBA 4LF5O 1D5AA 1ZTEA 3L75H 2P67A 2HVJC 4DXWA 4LP8A 3RYCB 4TV9B 2EINB 2GUZA 3GVMA 4LCUC 2YEVB 1NH2D 4JI4B 4DK1A 1AR1B 4JI3O 2F4VB 1YSCA 3VQWA 1SQVH 5B1NA 3LSSA 3LNNA 3GWOA 1HR0O 3L73H 2DYRB 4R6ZA 2XTAA 2XAQA 3SPCA 4ZI7B 3CC4V 1DF5A 2N74A 2UUBO 3ZX6A 3LSUA 1DGSA 2WLNA 3FB8C 3RYIB 5LOVA 2QEXV 2D3OW 1JR9A 4H33A 1SA0B 2EX3A 1G6UA 3BRCA 4UCUA 4F6RB 1VQLV 3P3NA 2CGNA 2W6IG 1P7GA 1NVPB 4WFBV 2QWOB 1G4YB 4UVAA 1MG1A 2AXTZ 1PL0A 3P3PA 3G71V 1N36O 4PHZA 4JPRA 1S77D 4RUFA 2HVKC 3BA8A 4O4JA 5IJ0A 2GTSA 4HAMA 1Q6UA 1HDJA 3W7TA 4LFCO 2QKAA 2RCVA 1PV0A 4Z2WA 4LF7O 5CMUA 4J7ZA 2QM4A 5IYZA 2YSUB 3SJAC 1ZSPA 5EZYA 2ATKC 2Y4TA 4BR6A 1WA8A 2ZNIA 3ZHSA 5H6RA 5JJNB 1EM1A 2ZR2A 5JVDB 2ETNA 3JD4A 1KP2A 3K58A 2OCHA 3C90A 1OV9A 3NXSA 4MTOA 1SF9A 2DYSB 2QSAA 1QQCA 1V54C 5GONA 3D8CA 4JTAB 2IH3C 4C7UA 2DYRC 4LF8B 3Q4HB 3MDSA 3OE7G 2F95B 4DR7B 3K5LA 1XL4A 4H37A 1XUQA 4FLVA 2KG7B 1ZUQA 3CCVV 4DUYB 1HW7A 2OT5A 2OWOA 1I94O 3QF7A 1SKVA 5HFMA 4DR1B 1SS3A 1H2NA 2BOCC 1B06A 3HPLC 1JX9A 1GM7A 1SESA 5KHHA 3X2QC 4JI1O 1JQ0A 3E8HA 4WF9V 1PNMA 3ZCCA 1OCOB 3SGIA 1M4UA 1AR5A 1AI6A 3CRQA 3UT5B 4FVMA 2UXCB 4WBNA 4FPPA 1FFTB 2ZD9A 4I50A 1SC5B 4JI7B 1IDSA 1VQOV 4I4TB 1DF4A 2DJVA 4RUEA 1VF7A 3BAAA 4QE9A 3SPHA 3QO5A 4G2KA 4QIWF 3HKEB 1D2DA 4JGSA 1H2KA 3JARB 3OTOB 2WAMA 4H44B 4QGPA 1QU7A 5D5PA 1X59A 4QNHB 4FJCC 3VQYA 1K4CC 1BGYH 3B8NA 3CJHB 1XNQB 1N32O 3L9DA 3HKDB 4NTXA 4ZHQA 1YTFD 4W4KA 2K9PA 1AI7A 3A0RA 1GM8A 1YXBA 2ZKOA 3B8MA 5H2FZ 5IWAO 3F5TA 4JZ2A 5KHIA 4GKKB 4X64O 4J11A 4LR3A 1JJOA 2ZE7A 1HNXO 2XAGA 3A2FA 5FNVA 4X1IA 3T2MA 1WAZA 4EB6B 1QLEB 2Y48A 1N34B 5LOVB 1XILA 3J80N 2QE7G 3WG7B 1FFXB 3RYHA 4X66O 4WFHA 4DV5B 2FKXA 5IJ9A 3AK2A 4D7TA 3TXQA 5KUKA 2IW5A 2Q6AA 2HEPA 1KB9F 3AEIA 5ITZA 1ZX3A 4HNAA 3JD2A 3NR7A 4QPJA 1EZJA 3K5MA 2RDCA 1IXMA 2CK3G 3K0DA 2HJFC 5B1AC 3K06A 2ZNJA 1YITV 1VIBA 1M5IA 3RYFA 1QLNA 5GW7A 3G80A 3H1JH 4X65O 3AK3A 4CH3A 1X4TA 4X62B 2GBOA 4AQYB 2HHHB 2PUSA 1DLBA 4JTDB 1VQ9V 4JI5B 3ABTA 2P22C 3FB7C 4L8JA 4J7KA 1OCZC 1N0NA 5B5EZ 5GTIZ 5DM6V 4NXNO 1LUVA 4O4LB 1JA8A 4CC5A 1Q7YW 1Q81W 1HNZO 2GV9A 3C3TA 3FFQA 1WA8B 1NU1H 5JH7A 2UU9O 1Y76A 3E2EA 3ABLB 1NR1A 4UXNA 4B3SO 4JI2B 1HWYA 1IBKB 4UV9A 3BFRA 2NN4A 3AG1C 4KP4A
chains in the Genus database with same CATH topology
3ABKB 3SYPA 1SERA 2A9HA 3BEHA 1ZWIC 1YI2V 1F4MA 4WFGA 2DWDC 4KFMA 5KA5A 3B77A 3STLC 4X8AA 2EILC 3OEEG 1K5SA 4LBEC 2WWWA 1QR9A 4YXWG 3CCLV 1OCZB 2IJKA 3OEHG 1S0VA 4MTGA 2LFSA 3ML0A 4HYOA 1L1FA 2H94A 2JJ2G 4PA7A 1KKDA 4PELA 1H8EG 1VQKV 5DN6G 2X6BA 1MSWD 3OR7C 3ZRXA 3AG4C 4OXSA 3W7UA 3ZJZA 1K8AW 3AG3C 1AJNA 3FB6C 4TWKA 1R3LC 2LP7A 1Y4MA 5L3BA 1SRYA 3EHBB 3ETGA 1ORQC 4GX0A 1W2BU 1YJ9V 3STZC 1P7BA 4BAYA 2ZXWC 4ASUG 3OGCC 2JK5C 4JASA 4QJFB 1GK9A 2X0LA 3AG1B 4P30A 5IYCO 4G28B 3ETDA 3OAAG 4MTFA 3DTUB 3CYOA 3ZMSA 3G4SV 4L87A 2EILB 3ZIAG 2GHYA 1NR7A 1VQPV 1MOFA 3SPJA 1W0KG 2ZDIC 4CBCA 2OCCC 5BZBA 1M1KW 1CEZA 1NBMG 2XOKG 2UXNA 1M56C 1FXHA 5EC1C 2LFRA 4PDLA 3AG4B 2ITDC 3LDCA 5EBWC 2QM7A 2EZPA 3RVYA 2HKOA 3AG3B 3MHHC 5CBGA 1YHQV 1P4RA 1S3JA 4GT1A 3LUTB 3W7XA 1H38A 2ZXWB 1VQNV 3AG2C 3EFFK 2QKSA 5KA6A 1OCCC 1NVPD 4MS2A 2P7TC 3IC7A 3ASNC 5LBQA 2C2AA 2EIKC 2HLDG 1EFRG 3TETA 3G6EV 1WLEA 2OCCB 1K3EA 4MW8A 1K33A 2EIMB 5B3SB 2Z5UA 4FK5C 2Z3YA 1YJNV 1M56B 3M99B 1GO3F 1NKDA 3CMEV 3OR6C 3HB3B 2XAJA 2WSSG 4X89A 1R6NA 4EKWA 3E83A 2EINC 2WPDG 1I5YA 1MABG 2NLJC 3ASOB 2P90A 3ZMZA 4RO2A 3RW0A 1AROP 1JVMA 5LGNA 3P30A 2A79B 5EBMC 3CCRV 3AG2B 1OCCB 3ABKC 1RM1B 5KUMA 3ASNB 4PA3A 1YJWV 2EIKB 4MVUA 3ABUA 4FMTA 1NH2B 1FXKC 4QE7A 3ZRWB 4Z1MG 3CMAV 5IYDO 3MD0A 3ZMTA 4BW5A 2P67A 2HVJC 4DXWA 4G27B 4MTXA 4LP8A 1F4NA 2EBOA 5CA3A 1QVGU 3LDEA 1ENVA 2B1GA 2P6JA 3FYIB 2EINB 2Q67A 4LCUC 5EC2C 1VQMV 3FYEB 3ETEA 2YEVB 4QPKA 1J95A 1NH2D 1R3JC 3E8FA 5HFLA 2IU0A 1AR1B 5CBFA 1GMGA 4MVRA 4N23A 1YSCA 2WLHA 3VOUA 1R6KA 4P9PA 1COWG 1OHHG 3CC2V 2EIJC 3LSSA 5B1NA 1FXKB 1VQ6V 2WLLB 3GWOA 3SYCA 3F7VC 3K79A 3OUFA 5H9CA 2DYRB 3KG2A 1VQ7V 1EBOA 4R6ZA 5C93A 2X6CA 2XAQA 1KD1W 1Q86W 2AHZA 3SPCA 3CC4V 1DF5A 2JEUA 3TCUA 3I55V 1PNLA 4X88A 1W0JG 2WLNA 4MW3A 3FB8C 2JEXA 4MVOA 1K5QA 4MVMA 4PDVA 5E1AC 2D3OW 3OUSA 2QEXV 3QNEA 3ABMC 4H33A 2HFEC 3JD3A 4J9YB 1AI4A 5IDJA 5H6QA 4BIUA 1JOYA 1PKXA 3JD1A 3W7SA 1VQLV 3IGAC 1E1QG 3OMIB 2EIJB 1SZTA 2HR3A 3K9AA 2WLIB 1K97A 2W6IG 3TK1A 1NVPB 4RQEA 5B3SC 2EIMC 4UV8A 2XNDG 5J9PC 1KP3A 4WFBV 1GM9A 4ZBMA 1G4YB 3FB5C 4UVAA 3OMNB 2ZDIA 1MG1A 3CXCU 2ZQMA 1PL0A 2V1DA 1GTOA 2EJRA 4JF3A 1KECA 5L3GA 3G71V 3ASOC 1H8HG 3CCUV 3MHSC 4MVQA 3ABMB 4JPRA 1S77D 3F5WC 2HVKC 4RUFA 4J9ZB 2B1IA 2R9RB 1RM1C 1KC8W 1QCEA 1PD3A 1R3IC 4ZKIA 3H01A 1R3KC 4HAMA 4BIZA 2MK3A 2M7WA 2XAHA 3W7TA 3CCEV 2FTKA 4XBFA 2DYSC 3K04A 2H8PC 1TUEB 5CMUA 1E1RG 1THZA 1K92A 2YSUB 5IYBO 1JJ2U 3OFNG 3RVZA 3ZRWA 2IJHA 4MVZA 4MVSA 3RBZA 1FS0G 2ATKC 4PDMA 2W0FC 3K0GA 1K9MW 2QTOA 3JD0A 1S72V 3D36A 3ZN1A 4UUJC 4TT3G 3OMAB 3GB7C 5H6RA 3SYAA 1N8RW 3T1CA 3R65A 2ZR2A 3JD4A 4Q20A 4P2ZA 1KP2A 3CD6V 2JJ1G 4TSFG 4U7OA 1BL8A 3NXSA 1LNQA 4MTOA 2DYSB 2HG5C 1V54C 4KUMA 3JCZA 4R8CA 3DGEA 4JTAB 1FXVA 2IH3C 2DYRC 3OW2U 2ITCC 1OCOC 1FXKA 2WLLA 2A0LA 2X7RB 3K08A 3OE7G 3F7YC 1M57C 5CN0A 1XL4A 4H37A 1BHAA 2K1EA 3SJQC 3CCVV 1VQ4V 1OZ0A 2OT5A 2WLMA 1OCRC 5HFMA 3LNMB 1S5HC 2BOCC 1QR8A 3HPLC 1JX9A 1GM7A 2AHYA 3CP1A 4MSWC 4JAUA 1SESA 5EK0A 3X2QC 3E8BA 5LHHA 1JQ0A 1CP9A 5IY5C 1V54B 3E8HA 2PI4A 1B6QA 4WF9V 3JYCA 3ZRSA 1V55C 1PNMA 1JCHA 2IU3A 4I5SA 3ZCCA 1OCOB 3CCMV 2IJIA 4UVBA 2OTLV 2WLIA 3LSQA 2QM8A 3LDDA 4WFAV 3ZMUA 1AI6A 1JPXA 3P32A 5L3CA 1H2GA 1AI5A 1M57B 4FPPA 4PA9A 4I9WA 4XDJA 1FFTB 3OM3B 3W7WA 1Y66A 2ZD9A 2XASA 5CBHA 2Y69C 2JDIG 4XDLA 1VQOV 3E89A 1DF4A 4RUEA 4U7NA 1OCRB 4QE9A 3SPHA 1YTFB 4E2LA 3QO5A 4G2KA 4QIWF 3ZMVA 4R50A 4GX2A 5L3FA 4JGSA 3FKSG 4RQFA 1QLEC 3X2QB 1VQ8V 1VQ5V 5IY5B 2WAMA 2V7QG 3CC7V 3WG7C 1S76D 3SPGA 4QNHB 1V55B 4PDRA 4FJCC 1K4CC 4HZ3A 2Q68A 2Q69A 3B8NA 4GCZA 1AJPA 2DWEC 3QO8A 2B5UA 1AJQA 3ZN0A 1RPOA 3CCSV 1YTFD 3CPWU 1Q82W 1I5XA 5EBLC 3WFVA 2JIZG 1AI7A 1BHBA 1SETA 2EZOA 5L3DA 3A0RA 1GM8A 2Y69B 4UVCA 2XAFA 1BMFG 3B8MA 5L3EA 3SYOA 5B1BC 2DQ3A 1PNKA 4PA6A 4N21A 2KB1A 1F51A 2XAGA 3T2MA 3D3IA 3UKMA 1QLEB 2Y48A 1K34A 3PJSK 1R73A 4DO2A 2QE7G 4WFEA 3WG7B 1G8MA 4WFHA 1NJIW 4P9OA 2QA4V 1RPRA 1K4DC 2IJJA 1K7DA 1F23A 5KUKA 2IW5A 4JTCB 2Q6AA 4WCEV 5FL7G 3AEIA 2WLKA 3JD2A 5B1OA 4JAVA 4QPJA 3QO7A 1EZJA 1CPYA 5B1BB 1IXMA 2IH1C 2CK3G 3K0DA 2HJFC 5B1AC 3K06A 4JYCA 1YITV 2F43G 2GSMB 2WLJA 2YEVA 3SPIA 1QLNA 1M90W 5GW7A 2DW4A 2BOBC 1K73W 3E35A 3SYQA 3I56V 2PI5A 3CCJV 3ABLC 1XL6A 4JYBA 1UJWB 1QBZA 3BY6A 3ZRVA 4FIPC 1WPXA 3T4ZA 4GX1A 4R7CA 1DLBA 1ROPA 4JTDB 1VQ9V 4WFFA 2UXXA 3K03A 2W6JG 4XDKA 5LGTA 1KQSU 3ABTA 3FB7C 4F4LA 1QVFU 5LHGA 2OTJV 1GKFA 3E86A 2X6AA 3IFXA 1OCZC 1DTOA 2R9IA 2ZR3A 5B1AB 3E8GA 3CCQV 4LC1A 3K3WA 4CZZA 5DM6V 1M9NA 1E79G 1Q81W 2NNUA 1Q7YW 4RAIA 4PA4A 4GX5A 3VBBA 3E2EA 3ABLB 1NR1A 4UXNA 1NQTA 5LGUA 5LHIA 1HWYA 1YIJV 4UV9A 3T4DA 4MT8A 2DQ0A 3AG1C 3UM7A 4KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q68 A;  2H8P C;  3SYP A;  2A9H A;  2Q69 A;  1ZWI C;  3BEH A;  4MVU A;  2DWE C;  4WFG A;  2DWD C;  4KFM A;  4QE7 A;  4X8A A;  3STL C;  2EIL C;  5EBL C;  4LBE C;  3RVZ A;  4MVZ A;  4MVS A;  4MTG A;  3UM7 A;  4BW5 A;  2HVJ C;  3RBZ A;  2ATK C;  4G27 B;  4HYO A;  4PDM A;  2W0F C;  4LP8 A;  4PA7 A;  4DXW A;  1KKD A;  3LDE A;  3K0G A;  2QTO A;  5B1B C;  3SYO A;  2X6B A;  3OR7 C;  3AG4 C;  4PA6 A;  4UUJ C;  4OXS A;  3ZJZ A;  2KB1 A;  3GB7 C;  3SYA A;  2Q67 A;  4LCU C;  5EC2 C;  3T1C A;  3R65 A;  3AG3 C;  3T2M A;  3UKM A;  3FB6 C;  4TWK A;  1R3L C;  4P2Z A;  1J95 A;  1R3J C;  3E8F A;  3PJS K;  1ORQ C;  4GX0 A;  4WFE A;  3STZ C;  1P7B A;  1BL8 A;  5CBF A;  2ZXW C;  1LNQ A;  3OGC C;  4MTO A;  4MVR A;  4WFH A;  2JK5 C;  4P9O A;  2HG5 C;  2WLH A;  3VOU A;  4P30 A;  4P9P A;  1V54 C;  4G28 B;  1K4D C;  4R8C A;  4JTA B;  4MTF A;  2IH3 C;  2EIJ C;  2DYR C;  5KUK A;  2ITC C;  1OCO C;  2WLL B;  4JTC B;  2Q6A A;  3SYC A;  3F7V C;  2WLL A;  3OUF A;  2A0L A;  3KG2 A;  3K08 A;  3SPJ A;  3F7Y C;  2WLK A;  4R6Z A;  2X6C A;  1M57 C;  2OCC C;  1K4C C;  4CBC A;  5BZB A;  2AHZ A;  3SPC A;  1XL4 A;  4H37 A;  2K1E A;  3SJQ C;  3TCU A;  2IH1 C;  3K0D A;  1M56 C;  2HJF C;  4X88 A;  5EC1 C;  4PDL A;  3K06 A;  5B1A C;  2ITD C;  2WLN A;  2WLM A;  3LDC A;  4MW3 A;  5EBW C;  2WLJ A;  3FB8 C;  4MVO A;  2YEV A;  1OCR C;  4MVM A;  4PDV A;  5E1A C;  3RVY A;  3OUS A;  3LNM B;  3SPI A;  5CBG A;  3ABM C;  1S5H C;  4H33 A;  2HFE C;  2BOC C;  2BOB C;  4J9Y B;  3HPL C;  2AHY A;  3LUT B;  4MSW C;  3SYQ A;  5EK0 A;  3X2Q C;  3E8B A;  3ABL C;  5IY5 C;  1XL6 A;  3AG2 C;  3EFF K;  2QKS A;  3E8H A;  1OCC C;  4MS2 A;  2P7T C;  3IGA C;  3JYC A;  3T4Z A;  3ZRS A;  1V55 C;  3ASN C;  4GX1 A;  2WLI B;  4R7C A;  4JTD B;  2WLI A;  2EIK C;  2EIM C;  4WFF A;  3LDD A;  5B3S C;  5J9P C;  3K03 A;  4ZBM A;  1G4Y B;  4XDK A;  3TET A;  3FB5 C;  4MW8 A;  4PA9 A;  3FB7 C;  4F4L A;  4I9W A;  4XDJ A;  3E86 A;  2X6A A;  2ZD9 A;  1OCZ C;  3IFX A;  5CBH A;  2Y69 C;  4XDL A;  3E8G A;  3E89 A;  4RUE A;  3ASO C;  3OR6 C;  4QE9 A;  3SPH A;  4X89 A;  4EKW A;  4MVQ A;  3E83 A;  2EIN C;  2NLJ C;  3F5W C;  2HVK C;  4RUF A;  4J9Z B;  4R50 A;  4GX2 A;  4RO2 A;  2R9R B;  4RAI A;  4PA4 A;  3RW0 A;  1JVM A;  4GX5 A;  1QLE C;  2A79 B;  5EBM C;  1R3I C;  1R3K C;  3ABK C;  3WG7 C;  5KUM A;  3SPG A;  3T4D A;  4QNH B;  4PA3 A;  4PDR A;  2DYS C;  3AG1 C;  4HZ3 A;  3K04 A; 
#chains in the Genus database with same CATH topology
 3ABK B;  2JGD A;  2A9H A;  3OT7 A;  1ZL8 B;  4WFG A;  3B77 A;  5KHJ A;  1IBM O;  3OEE G;  1QR9 A;  5LP6 A;  1I7F A;  3OEH G;  4MTG A;  4LH7 A;  2BCC H;  3ML0 A;  1KKD A;  4DUZ B;  4PEL A;  4UCR A;  1VQK V;  2QDO A;  3KKY A;  1J5E O;  3AG4 C;  5JJJ B;  2DN9 A;  3JAS A;  5EIB D;  4E4E A;  4GX0 A;  1YJ9 V;  3OGC C;  4QJF B;  1GK9 A;  4P30 A;  4AI8 A;  3OAA G;  5EYP A;  4MTF A;  2YIB D;  5FLX N;  2EIL B;  4J41 A;  4FLX A;  2Q0O C;  1NT2 B;  4DV7 B;  4O4H B;  2XOK G;  5EC1 C;  5CB4 A;  2Y4U A;  4JZG A;  2QM7 A;  4DV1 O;  1RSO A;  2R9A A;  4JYA O;  5CBG A;  3W7X A;  4PD4 F;  4KHP B;  1IZ3 A;  4X9Q A;  4YJ2 B;  1OCC C;  4O4I B;  3BVO A;  3CHX A;  2OCC B;  1K3E A;  4U3J B;  5LMU O;  4ZHQ B;  4FK5 C;  2Z3Y A;  1MNG A;  2Y0P A;  1YJN V;  1M56 B;  3M99 B;  1NKD A;  5A2Q N;  3CME V;  2KKW A;  2WSS G;  2UUA B;  1XNR O;  2ILM A;  4X89 A;  2RN9 A;  1I5Y A;  2NLJ C;  2P90 A;  5LYJ B;  4RO2 A;  1ARO P;  4NKG B;  1AVM A;  3ABK C;  2L35 A;  1RM1 B;  3JAT B;  3ASN B;  3WB1 A;  3CE2 A;  4K3A A;  5LA6 A;  2YC0 A;  5IJ9 B;  4B3T B;  1EN5 A;  3ZRW B;  4LF6 B;  3CMA V;  3MD0 A;  3ZMT A;  3HKC B;  4G27 B;  2E76 B;  4MTX A;  5CA3 A;  2EBO A;  3CS5 A;  3LDE A;  1QVG U;  1TVK A;  3FYI B;  2KSD A;  5EC2 C;  4NYK A;  2BTQ A;  2VQE O;  1IVS A;  3FYE B;  4QPK A;  3E8F A;  1R6T A;  4GYC B;  2IU0 A;  4FFB B;  2JS5 A;  4MVR A;  2WLH A;  3VOU A;  1R6K A;  2JRI A;  2AZ2 A;  3G67 A;  3CC2 V;  2EIJ C;  1FXK B;  1KYO F;  3H1H H;  2LJ2 A;  2BSK B;  3SYC A;  3OTF A;  4I7Z B;  3TXS A;  3OUF A;  2BE3 A;  3AG7 A;  4NVP A;  5IT9 N;  1PL4 A;  3KG2 A;  5JQG A;  1QHT A;  5J2U B;  1EBO A;  5C93 A;  1VQ7 V;  1KD1 W;  1Q86 W;  4DR7 O;  1MMM A;  3APQ A;  4LWS B;  2JEU A;  3I55 V;  2FML A;  1XHX A;  1IXB A;  4MVO A;  2JEX A;  1A32 A;  3OD4 A;  4LF9 B;  4MVM A;  2M6Y A;  2P4V A;  3OUS A;  4FLY A;  3ABM C;  4O2B A;  2F66 C;  4DR1 O;  4DW0 A;  2E75 B;  2LQT A;  2RNB A;  3D3Q A;  4BIU A;  1JOY A;  1ZAU A;  4ICG A;  2YXL A;  2QJ1 A;  2Q7E A;  1XEQ A;  3E22 A;  3OMI B;  3K9A A;  2PZS A;  3O65 A;  4FLU A;  2XND G;  5J9P C;  1GH6 A;  2R72 A;  3CXC U;  2ZQM A;  4DV2 B;  3T1Y O;  1KEC A;  5L3G A;  3F5W C;  2P4K A;  4I55 B;  1RM1 C;  1R3I C;  2ODM A;  1R3K C;  5H5N A;  5B66 Z;  3CCE V;  3FAV A;  1TUE B;  1YEW A;  1XNQ O;  1E1R G;  4IIJ B;  1K92 A;  1JJ2 U;  4B08 A;  4BIO A;  3RVZ A;  3N2K B;  4GZR B;  4MVZ A;  4MVS A;  1FS0 G;  3K0G A;  2QTO A;  4IYH A;  1S72 V;  3D36 A;  3ZN1 A;  4GKK O;  4UUJ C;  5K1X A;  4TT3 G;  1YZB A;  3OMA B;  2CH7 A;  1N8R W;  1GN4 A;  4CS4 A;  1Z5W A;  2ZT9 B;  1XDC A;  2QKC A;  1N34 O;  3TJT A;  3CD6 V;  3K9S A;  2JJ1 G;  1F7Y A;  4U7O A;  1FPO A;  4DV5 O;  1W59 A;  3HR0 A;  1FXV A;  3VQX A;  3OW2 U;  4LFB O;  5KMG A;  5BMV A;  2WLL A;  2A0L A;  2ZE6 A;  2X7R B;  4JYY A;  1OJH A;  1M57 C;  3WB2 A;  2VQF B;  4DR2 B;  3DXR A;  1V9P A;  1VQ4 V;  1BCC H;  1SQX H;  4TV8 B;  3JAW A;  4X1K A;  2E5L B;  3CP1 A;  4MSW C;  4JAU A;  3H1L H;  5IY5 C;  3SR2 C;  2XT9 A;  1BE3 H;  1V54 B;  5CA0 A;  3JAL B;  4X62 O;  4O2A A;  3ZRS A;  2XHB A;  4AQY O;  3UCS C;  2WLI A;  3LDD A;  3IC9 A;  4X20 B;  1GN3 A;  5LP6 C;  4DR5 B;  3H1K H;  3W7W A;  1Y66 A;  2XAS A;  5CBH A;  1WPB A;  1L8D A;  3DSQ A;  5J2T B;  1CXZ B;  4E2L A;  1TVK B;  5F2V O;  5L3F A;  1B3Q A;  3UO2 A;  2UXD O;  3X2Q B;  2UXB B;  1GAX A;  3CWB H;  1S76 D;  3SPG A;  1T5E A;  4PDR A;  4FM0 A;  4ZOL A;  4HZ3 A;  4NTY A;  1AJP A;  1AJQ A;  3A0H Z;  1RPO A;  2LO1 A;  3CCS V;  3CPW U;  5EBL C;  2EZO A;  2IBZ H;  5DEC A;  2Q4P A;  1BMF G;  3ZHU A;  4GKJ O;  5L3E A;  3SYO A;  4UCO A;  3EVK A;  2YIC A;  3CSX A;  4N21 A;  1JMK C;  3D3I A;  3UKM A;  2F23 A;  1K34 A;  5DED A;  3PJS K;  3ICX A;  2RJZ A;  2QTS A;  4DV4 O;  2EJ7 A;  3T1H B;  1JFF B;  4F6E A;  1O9G A;  2IJJ A;  1K7D A;  1F23 A;  4OX9 B;  3B4S A;  2QWN B;  1HNW O;  3JCU Z;  4JTC B;  2N04 A;  2JVD A;  4DR3 O;  2QGN A;  2G38 A;  3U10 A;  2IH1 C;  2ADQ B;  2QWQ B;  4DV6 B;  5E79 Z;  2GSM B;  3N27 A;  1M90 W;  3JSN A;  4DV3 O;  4KL1 A;  2UUC B;  3E35 A;  4JYB A;  3BY6 A;  3ZRV A;  3UO3 A;  2UXX A;  2FB5 A;  3K03 A;  1EN6 A;  3ZED A;  1KQS U;  1Y74 B;  4AIL C;  1DK1 A;  1BS3 A;  4DR4 O;  5LHG A;  1GKF A;  3E86 A;  3IFX A;  1DTO A;  2R9I A;  3A8T A;  5B1A B;  3CCQ V;  3H1I H;  4IGG A;  3K3W A;  4X1Y B;  1E79 G;  2DOS A;  2WA3 A;  4PA4 A;  4U3F H;  3VQV A;  4IHJ A;  1KKC A;  3UM7 A;  3SYP A;  2L6L A;  1YI2 V;  1ZWI C;  4KFM A;  1H2M A;  4B3T O;  1K5S A;  1NZ6 A;  5CA1 A;  4DR6 B;  3J7A U;  3CCL V;  1OCZ B;  2IJK A;  1S0V A;  2Q73 A;  2ARH A;  1H8E G;  5DN6 G;  1UPG A;  2GUZ B;  3OR7 C;  1YF2 A;  1Y67 A;  1FJG B;  3W7U A;  3ZJZ A;  3AG3 C;  4TWK A;  4CH5 A;  4FLW A;  5L3B A;  3ETG A;  4UFZ A;  1W2B U;  3STZ C;  1P7B A;  3K57 A;  2ZXW C;  4JAS A;  3AG1 B;  2X0L A;  2YI9 A;  2PF4 E;  1IX9 A;  3DTU B;  3ZMS A;  3DC5 A;  4LNU A;  2LGW A;  3SPJ A;  4CBC A;  2ZE8 A;  1NBM G;  4J10 A;  2UXN A;  5JCO A;  1P49 A;  2LFR A;  3AG4 B;  4TUY A;  4DV0 B;  4GT1 A;  4TOI A;  1VQN V;  2PYJ A;  2GTA A;  3IC7 A;  2A06 H;  5LBQ A;  1TUB A;  4DYL A;  1EFR G;  1WLE A;  1K33 A;  2EIM B;  2Z5U A;  3CRA A;  1Q43 A;  3OR6 C;  3D36 C;  4EKW A;  4O4J B;  5LXT A;  3ZMZ A;  3ZHT A;  5IJ0 B;  5LGN A;  1QNM A;  3CCR V;  1OCC B;  3BPZ A;  5KUM A;  2XUM A;  4I0X A;  4JI3 B;  2O57 A;  1VP7 A;  5LMN O;  2PYL A;  5JWP A;  5IYZ B;  2CUG A;  2CTW A;  4FLT A;  5IYD O;  2A7W A;  5EZY B;  4BW5 A;  1FKA O;  1ENV A;  2P6J A;  2UUB B;  4YHH B;  1MSD A;  2Q67 A;  1VQM V;  1AB3 A;  1R3J C;  5CBF A;  1GMG A;  5C8Y A;  5GON B;  1TA8 A;  2YS8 A;  4DRX A;  4HBN A;  1VQ6 V;  4JI6 B;  3RWR D;  3S3W A;  4EFE A;  4CC6 A;  3TCU A;  1PNL A;  1AIL A;  2VQF O;  3DC6 A;  1W0J G;  4PDV A;  5E1A C;  4JI4 O;  1WJZ A;  1N36 B;  2HFE C;  3G6B A;  2F4V O;  4J9Y B;  4YIO A;  1BZK A;  1L0N H;  4CH6 A;  1E1Q G;  4IHJ B;  2EIJ B;  2HR3 A;  2LW1 A;  4J42 A;  4YJ3 A;  4RQE A;  2EIM C;  4UV8 A;  1KP3 A;  4WBN B;  3FB5 C;  3OMN B;  2ZDI A;  3KZI Z;  4I50 B;  1BT8 A;  1PM9 A;  1VMG A;  2V1D A;  1GTO A;  4JF3 A;  2CGO A;  2VS0 A;  3CCU V;  3MHS C;  4OGQ B;  4MVQ A;  3ABM B;  4J9Z B;  2B1I A;  2R9R B;  2YIA A;  4OPH A;  1KC8 W;  2H3O A;  2UXB O;  3H01 A;  4BIZ A;  1S5L Z;  2XAH A;  2FTK A;  4IL6 Z;  3N2G A;  1THZ A;  5IYB O;  5KLV H;  3RT3 C;  4CH4 A;  3FD9 A;  4JI8 B;  4LNU B;  4PJ0 Z;  2JS3 A;  2W0F C;  1K9M W;  3RYC A;  3JD0 A;  4TV9 A;  1XI1 A;  5FNV B;  4X1I B;  3GB7 C;  3SYA A;  3T1C A;  3R65 A;  4NXM B;  4Q20 A;  4B3R B;  1P84 F;  3RYH B;  4TSF G;  1BL8 A;  3T1H O;  4KUM A;  3JCZ A;  3SDL A;  5BR8 B;  4R8C A;  4JI1 B;  3RFR A;  4OX9 O;  5ITZ B;  4PV1 B;  2ADP A;  4HNA B;  1KUQ A;  3K08 A;  5CN0 A;  3JAK A;  1BHA A;  2K1E A;  5KHK A;  1LR1 A;  3RYF B;  1YVW A;  1N0J A;  1OCR C;  1I08 A;  3I5D A;  1QR8 A;  1SA0 A;  2AHY A;  2UUC O;  2A3Q A;  4F6R A;  4UCS A;  1CP9 A;  1TAE A;  2WA4 A;  4LF8 O;  1V55 C;  1JCH A;  4I5S A;  1Q90 D;  2IJI A;  2OTL V;  3LSQ A;  2QM8 A;  4H0L B;  3ZMU A;  1JPX A;  2Q8V A;  3P32 A;  3PN1 A;  4DW1 A;  1AI5 A;  1M57 B;  4PA9 A;  1N32 B;  2MW2 B;  4I9W A;  4XDJ A;  4DUY O;  2OIE A;  3OM3 B;  2Y69 C;  2JDI G;  4XDL A;  3CRC A;  3E89 A;  4OPA A;  4NB5 A;  3SJC C;  2YXY A;  5IWA B;  1NTZ H;  5JH7 B;  4GX2 A;  4X64 B;  4RQF A;  1Y76 B;  1VQ8 V;  5IY5 B;  2W0X A;  2V7Q G;  3CC7 V;  2YDE A;  4IYI A;  4UB8 Z;  2JGD B;  3U0Z A;  3BHP A;  2Q68 A;  2UXC O;  1EN4 A;  1YCI A;  4GCZ A;  5C8Y B;  2B5U A;  1RFY A;  4I9Q A;  5LP6 B;  5LL6 Y;  3WFV A;  1Q82 W;  4JI7 O;  2CTP A;  5L3D A;  4DR6 O;  3RN4 A;  5JCO C;  2F93 B;  4J7J A;  5B1B C;  1HP8 A;  1PNK A;  4PA6 A;  3OTO O;  2KB1 A;  3JAS B;  3S3X A;  4DO2 A;  1VEW A;  3UQ8 A;  1G8M A;  2QA4 V;  3ZHQ A;  1RPR A;  2IM9 A;  4FFK A;  4X65 B;  4TQD A;  5EYP B;  4CS2 A;  4YY3 B;  3Q4H A;  4WCE V;  5FL7 G;  3M7M X;  3JAM N;  2WLK A;  5BXZ A;  3QO7 A;  3K5N A;  5CB4 B;  2KG7 A;  4JYC A;  1RSO B;  2WLJ A;  4DV0 O;  3SPI A;  1KBH A;  3SJB C;  4CS3 A;  3HKB A;  2BOB C;  3R66 A;  1K73 W;  2PTM A;  4PI2 A;  1HNZ B;  2VWJ A;  2B9Z A;  2UU9 B;  2ZM6 B;  1WPX A;  5JJE B;  4R7C A;  5KX5 A;  5KAI Z;  2N05 A;  2P06 A;  3UT5 A;  1QVF U;  4B3M B;  2X6A A;  1IBM B;  1VF6 A;  2FYU H;  2ZR3 A;  2YI8 A;  3E8G A;  5AG2 A;  3BA9 A;  4CZZ A;  4I4T A;  1XMO B;  1SQB H;  3HKE A;  1BQ0 A;  4RAI A;  1J5E B;  3CRR A;  1G1X B;  4GX5 A;  2CE4 A;  3VBB A;  3B09 A;  3JAR A;  1I0H A;  2HHH O;  2LGQ A;  1YIJ V;  3T4D A;  3BCC H;  4MT8 A;  4GUN A;  1WP7 A;  2DQ0 A;  4JI5 O;  5LA6 B;  4P2Z A;  2KQX A;  1Q6I A;  3G6E V;  3CJH A;  2DWD C;  5KA5 A;  3HKD A;  3STL C;  3EXA A;  1WB8 A;  2WWW A;  1Q6H A;  3KCX A;  3ETQ A;  2LFS A;  1XMQ B;  4PA7 A;  2QWR B;  3JAK B;  3J81 N;  1D5N A;  3ZRX A;  2BTQ B;  4YHH O;  1GN6 A;  2Z0A A;  2AGA A;  4JI2 O;  1R3L C;  4DV1 B;  4K8Z A;  4EB6 A;  1IBK O;  3EHB B;  4JYA B;  1ORQ C;  4BAY A;  5GTH Z;  4ASU G;  4JI0 B;  1FFX A;  3MAQ A;  4G28 B;  4NTW A;  3CYO A;  1WN7 A;  3ZIA G;  4JI6 O;  2DMX A;  1Q5O A;  5JQG B;  1NR7 A;  1VQP V;  4DUZ O;  1Q3E A;  2ZDI C;  2HJD A;  5BZB A;  1M1K W;  1CEZ A;  3K59 A;  5LMU B;  3ZS8 C;  4PDL A;  2ITD C;  1XRE A;  5EBW C;  2HKO A;  4JAA A;  4O2B B;  3AG3 B;  1XNR B;  1S3J A;  3LUT B;  1H38 A;  2ZXW B;  3AG2 C;  2QWP B;  3EFF K;  2QKS A;  1H2S B;  5KA6 A;  4JV5 B;  3E22 B;  2P7T C;  3QVN A;  4A5U B;  2C2A A;  2EIK C;  2HLD G;  5K1P A;  1IUR A;  3TET A;  4DV7 O;  4KXR A;  5B3S B;  1FAF A;  3CB2 A;  2HP8 A;  4EFB A;  1GO3 F;  2XAJ A;  3WB0 A;  1GN2 A;  2EIN C;  2WPD G;  1MAB G;  3ASO B;  3RGB A;  1O9H A;  4KHP O;  4O4L A;  2QR4 A;  4PI0 A;  2RMK B;  5EBM C;  2VQE B;  2Q0A A;  3FAV B;  4PA3 A;  2Q9L A;  4ABM A;  4D7S A;  1YJW V;  4YIP A;  1LUW A;  3ABU A;  4FMT A;  1ZL8 A;  1NH2 B;  4QE7 A;  1R1B A;  4Z1M G;  1TGO A;  3AK1 A;  3KCY A;  5KAF Z;  1US6 A;  4JI8 O;  2UUA O;  4FZ1 A;  1F4N A;  2B1G A;  2CH7 B;  3L70 H;  1AP6 A;  4NXM O;  3ETE A;  1J95 A;  5HFL A;  4B3R O;  1FYJ A;  1Y6X A;  3HKB B;  4N23 A;  4P9P A;  1COW G;  5BR8 O;  4LF6 O;  1OHH G;  5KMG B;  5BMV B;  1Q8I A;  2WLL B;  3F7V C;  3K79 A;  5H9C A;  5KX5 B;  1GRJ A;  1WNS A;  2X6C A;  2AHZ A;  2GDS A;  3DXR B;  4O4H A;  4X88 A;  5KHG A;  4MW3 A;  3T1Y B;  1K5Q A;  2CTR A;  3B40 A;  3QNE A;  3JAW B;  3ZBH A;  3JD3 A;  1KMI Z;  2JGU A;  1XBL A;  4X1K B;  3CRM A;  2E3C A;  1AI4 A;  5IDJ A;  5H6Q A;  1PKX A;  3JD1 A;  4B7E A;  5CA0 B;  1IBL B;  3W7S A;  4YJ2 A;  1BQZ A;  4O2A B;  4LFA B;  3IGA C;  4O4I A;  1SZT A;  2ZE5 A;  2WLI B;  1K97 A;  3TK1 A;  5B3S C;  1GM9 A;  4ZBM A;  3TGU H;  4U3J A;  1Z2G A;  4LF9 O;  2EJR A;  4LF4 B;  1SQF A;  3ASO C;  1H8H G;  3WU2 Z;  1N33 B;  2LW7 A;  5LYJ A;  4K0K B;  2NR5 A;  1QCE A;  1PD3 A;  4ZKI A;  2MK3 A;  2M7W A;  4ZOL B;  4BWA A;  3JAT A;  4XBF A;  2DYS C;  3K04 A;  2H8P C;  3U11 A;  2VWK A;  4UCT A;  4LF5 B;  3OFN G;  4DV2 O;  3ZRW A;  4LFB B;  3C3S A;  2IJH A;  1L0L H;  3RBZ A;  3HKC A;  2ZIO A;  4PDM A;  1BSM A;  3OGI B;  2RQ6 A;  1LNQ A;  4FFB A;  2HG5 C;  3DGE A;  4EEQ A;  4UCV A;  2D2C B;  2ITC C;  1HR0 B;  1OCO C;  4YY3 O;  3ZHV A;  1FXK A;  2BSK A;  3CEI A;  1WB7 A;  1MZF A;  3F7Y C;  2YIB A;  5J2U A;  1VF6 C;  1EZV H;  3SJQ C;  4LWS A;  1OZ0 A;  2WLM A;  4D6T H;  3LNM B;  5BY1 A;  2YUA A;  1S5H C;  1NTK H;  3IJ4 A;  2YID A;  5EK0 A;  3E8B A;  5LHH A;  1NTM H;  2UXD B;  2V4D A;  2PI4 A;  1XQ8 A;  1B6Q A;  3B2E E;  3JYC A;  2ZM6 O;  2IU3 A;  3CCM V;  3QTC A;  4UVB A;  4RWU A;  3O9O A;  4WFA V;  3QG5 A;  5L3C A;  1H2G A;  1SQP H;  4DR2 O;  1URF A;  1VF5 B;  4B3M O;  4U7N A;  4Z1V A;  1OCR B;  1YTF B;  1SZX A;  4GKJ B;  3GWK C;  3ZMV A;  2E5L O;  4R50 A;  1XMO O;  2CTQ A;  1H2L A;  3FKS G;  4I55 A;  2AZ0 A;  1QLE C;  1XOU A;  1VQ5 V;  3WG7 C;  4LFC B;  4AHC A;  1ZLZ A;  1V55 B;  4LF7 B;  2Q69 A;  3QO8 A;  2DWE C;  4DV4 B;  4DR5 O;  3ZN0 A;  5CA1 B;  4K35 A;  4Q6G A;  1I5X A;  4IIJ A;  2JIZ G;  1BHB A;  5FPO A;  1SET A;  3L71 H;  1HNW B;  2Y69 B;  4UVC A;  3N2K A;  2CDY A;  2XAF A;  3A0B Z;  2F1M A;  1XMQ O;  4DR3 B;  2ZIN A;  2DQ3 A;  2ZCE A;  1F51 A;  3APO A;  1R73 A;  1M93 A;  4WFE A;  2YXH A;  4DV3 B;  5TIS Z;  1NJI W;  4P9O A;  4JI0 O;  1Z5V A;  1K4D C;  2PGG A;  1NS1 A;  4B7K A;  5B1O A;  4JAV A;  1UFI A;  3CXH F;  5A9G A;  1MA1 A;  1U96 A;  1CPY A;  5B1B B;  4TUY B;  3CX5 F;  2Q7G A;  4DR4 B;  3L72 H;  1I94 B;  2F43 G;  2YEV A;  1PP9 H;  3THO A;  4TV8 A;  2DW4 A;  2FL4 A;  1SQQ H;  3I56 V;  3SYQ A;  2PI5 A;  3CCJ V;  3ABL C;  1XL6 A;  4BW9 A;  1UJW B;  1QBZ A;  4JV5 O;  4FIP C;  3JAL A;  3T4Z A;  1TUB B;  2CAZ C;  4UB6 Z;  2Q7H A;  4GX1 A;  1ROP A;  4WFF A;  2W6J G;  4XDK A;  3L74 H;  5LGT A;  4ZI7 A;  2VRZ A;  4X20 A;  3ZHR A;  4F4L A;  2OTJ V;  4DV6 O;  3M8A A;  1YDX A;  3RYI A;  4LC1 A;  4FLZ A;  1U97 A;  5LXT B;  5J2T A;  1M9N A;  4FM1 A;  2NNU A;  4W4L A;  1NQT A;  5LGU A;  5LHI A;  4I0X B;  2OYQ A;  1SER A;  1FD9 A;  3BEH A;  1F4M A;  2P5O A;  4X8A A;  2Y0I A;  2EIL C;  4LBE C;  4YXW G;  2DE0 X;  4FZ0 A;  4HYO A;  1L1F A;  2H94 A;  2JJ2 G;  4H13 B;  2X6B A;  1HNX B;  1MSW D;  4OXS A;  1K8A W;  1MZE A;  1AJN A;  3FB6 C;  2LP7 A;  1Y4M A;  1SRY A;  4DK0 A;  4X66 B;  1AR4 A;  4NR1 A;  1S5J A;  2JK5 C;  4DRX B;  1AP5 A;  5IYC O;  3ETD A;  1JFF A;  5D5Q A;  1WP8 A;  2ZIM A;  3G4S V;  4L87 A;  2OIG A;  2GHY A;  1MOF A;  1W0K G;  2OCC C;  3BAB A;  4GLX A;  1FJG O;  1XHZ A;  2PY5 A;  1FXH A;  1M56 C;  1PPJ H;  4K8X A;  1N4C A;  3LDC A;  5JVD A;  2EZP A;  3RVY A;  3MHH C;  1YHQ V;  1P4R A;  3JSL A;  3IAY A;  1RP3 B;  3FX7 A;  2AW9 A;  2Q5Z A;  1IBL O;  1NVP D;  2E74 B;  5FPR A;  4MS2 A;  2R70 A;  2BTO A;  4LFA O;  3ASN C;  4YJ3 B;  1NI8 A;  4MW8 A;  4LH6 A;  5LMN B;  1Y74 A;  1KU9 A;  4TQF A;  3K5O A;  4LF4 O;  3H9V A;  1SQG A;  3HB3 B;  4NXN B;  1N33 O;  1R6N A;  3E83 A;  4X1Y A;  3RW0 A;  2EUL A;  4FM2 A;  1JVM A;  1VAR A;  5IE9 A;  3P30 A;  4K0K O;  2A79 B;  3AG2 B;  4B3S B;  1B04 A;  5EIB C;  3N2G B;  2EIK B;  4MVU A;  4IT5 A;  4J80 A;  1FXK C;  4ZIB A;  4LF5 O;  1D5A A;  1ZTE A;  3L75 H;  2P67 A;  2HVJ C;  4DXW A;  4LP8 A;  3RYC B;  4TV9 B;  2EIN B;  2GUZ A;  3GVM A;  4LCU C;  2YEV B;  1NH2 D;  4JI4 B;  4DK1 A;  1AR1 B;  4JI3 O;  2F4V B;  1YSC A;  3VQW A;  1SQV H;  5B1N A;  3LSS A;  3LNN A;  3GWO A;  1HR0 O;  3L73 H;  2DYR B;  4R6Z A;  2XTA A;  2XAQ A;  3SPC A;  4ZI7 B;  3CC4 V;  1DF5 A;  2N74 A;  2UUB O;  3ZX6 A;  3LSU A;  1DGS A;  2WLN A;  3FB8 C;  3RYI B;  5LOV A;  2QEX V;  2D3O W;  1JR9 A;  4H33 A;  1SA0 B;  2EX3 A;  1G6U A;  3BRC A;  4UCU A;  4F6R B;  1VQL V;  3P3N A;  2CGN A;  2W6I G;  1P7G A;  1NVP B;  4WFB V;  2QWO B;  1G4Y B;  4UVA A;  1MG1 A;  2AXT Z;  1PL0 A;  3P3P A;  3G71 V;  1N36 O;  4PHZ A;  4JPR A;  1S77 D;  4RUF A;  2HVK C;  3BA8 A;  4O4J A;  5IJ0 A;  2GTS A;  4HAM A;  1Q6U A;  1HDJ A;  3W7T A;  4LFC O;  2QKA A;  2RCV A;  1PV0 A;  4Z2W A;  4LF7 O;  5CMU A;  4J7Z A;  2QM4 A;  5IYZ A;  2YSU B;  3SJA C;  1ZSP A;  5EZY A;  2ATK C;  2Y4T A;  4BR6 A;  1WA8 A;  2ZNI A;  3ZHS A;  5H6R A;  5JJN B;  1EM1 A;  2ZR2 A;  5JVD B;  2ETN A;  3JD4 A;  1KP2 A;  3K58 A;  2OCH A;  3C90 A;  1OV9 A;  3NXS A;  4MTO A;  1SF9 A;  2DYS B;  2QSA A;  1QQC A;  1V54 C;  5GON A;  3D8C A;  4JTA B;  2IH3 C;  4C7U A;  2DYR C;  4LF8 B;  3Q4H B;  3MDS A;  3OE7 G;  2F95 B;  4DR7 B;  3K5L A;  1XL4 A;  4H37 A;  1XUQ A;  4FLV A;  2KG7 B;  1ZUQ A;  3CCV V;  4DUY B;  1HW7 A;  2OT5 A;  2OWO A;  1I94 O;  3QF7 A;  1SKV A;  5HFM A;  4DR1 B;  1SS3 A;  1H2N A;  2BOC C;  1B06 A;  3HPL C;  1JX9 A;  1GM7 A;  1SES A;  5KHH A;  3X2Q C;  4JI1 O;  1JQ0 A;  3E8H A;  4WF9 V;  1PNM A;  3ZCC A;  1OCO B;  3SGI A;  1M4U A;  1AR5 A;  1AI6 A;  3CRQ A;  3UT5 B;  4FVM A;  2UXC B;  4WBN A;  4FPP A;  1FFT B;  2ZD9 A;  4I50 A;  1SC5 B;  4JI7 B;  1IDS A;  1VQO V;  4I4T B;  1DF4 A;  2DJV A;  4RUE A;  1VF7 A;  3BAA A;  4QE9 A;  3SPH A;  3QO5 A;  4G2K A;  4QIW F;  3HKE B;  1D2D A;  4JGS A;  1H2K A;  3JAR B;  3OTO B;  2WAM A;  4H44 B;  4QGP A;  1QU7 A;  5D5P A;  1X59 A;  4QNH B;  4FJC C;  3VQY A;  1K4C C;  1BGY H;  3B8N A;  3CJH B;  1XNQ B;  1N32 O;  3L9D A;  3HKD B;  4NTX A;  4ZHQ A;  1YTF D;  4W4K A;  2K9P A;  1AI7 A;  3A0R A;  1GM8 A;  1YXB A;  2ZKO A;  3B8M A;  5H2F Z;  5IWA O;  3F5T A;  4JZ2 A;  5KHI A;  4GKK B;  4X64 O;  4J11 A;  4LR3 A;  1JJO A;  2ZE7 A;  1HNX O;  2XAG A;  3A2F A;  5FNV A;  4X1I A;  3T2M A;  1WAZ A;  4EB6 B;  1QLE B;  2Y48 A;  1N34 B;  5LOV B;  1XIL A;  3J80 N;  2QE7 G;  3WG7 B;  1FFX B;  3RYH A;  4X66 O;  4WFH A;  4DV5 B;  2FKX A;  5IJ9 A;  3AK2 A;  4D7T A;  3TXQ A;  5KUK A;  2IW5 A;  2Q6A A;  2HEP A;  1KB9 F;  3AEI A;  5ITZ A;  1ZX3 A;  4HNA A;  3JD2 A;  3NR7 A;  4QPJ A;  1EZJ A;  3K5M A;  2RDC A;  1IXM A;  2CK3 G;  3K0D A;  2HJF C;  5B1A C;  3K06 A;  2ZNJ A;  1YIT V;  1VIB A;  1M5I A;  3RYF A;  1QLN A;  5GW7 A;  3G80 A;  3H1J H;  4X65 O;  3AK3 A;  4CH3 A;  1X4T A;  4X62 B;  2GBO A;  4AQY B;  2HHH B;  2PUS A;  1DLB A;  4JTD B;  1VQ9 V;  4JI5 B;  3ABT A;  2P22 C;  3FB7 C;  4L8J A;  4J7K A;  1OCZ C;  1N0N A;  5B5E Z;  5GTI Z;  5DM6 V;  4NXN O;  1LUV A;  4O4L B;  1JA8 A;  4CC5 A;  1Q7Y W;  1Q81 W;  1HNZ O;  2GV9 A;  3C3T A;  3FFQ A;  1WA8 B;  1NU1 H;  5JH7 A;  2UU9 O;  1Y76 A;  3E2E A;  3ABL B;  1NR1 A;  4UXN A;  4B3S O;  4JI2 B;  1HWY A;  1IBK B;  4UV9 A;  3BFR A;  2NN4 A;  3AG1 C;  4KP4 A; 
#chains in the Genus database with same CATH homology
 3ABK B;  3SYP A;  1SER A;  2A9H A;  3BEH A;  1ZWI C;  1YI2 V;  1F4M A;  4WFG A;  2DWD C;  4KFM A;  5KA5 A;  3B77 A;  3STL C;  4X8A A;  2EIL C;  3OEE G;  1K5S A;  4LBE C;  2WWW A;  1QR9 A;  4YXW G;  3CCL V;  1OCZ B;  2IJK A;  3OEH G;  1S0V A;  4MTG A;  2LFS A;  3ML0 A;  4HYO A;  1L1F A;  2H94 A;  2JJ2 G;  4PA7 A;  1KKD A;  4PEL A;  1H8E G;  1VQK V;  5DN6 G;  2X6B A;  1MSW D;  3OR7 C;  3ZRX A;  3AG4 C;  4OXS A;  3W7U A;  3ZJZ A;  1K8A W;  3AG3 C;  1AJN A;  3FB6 C;  4TWK A;  1R3L C;  2LP7 A;  1Y4M A;  5L3B A;  1SRY A;  3EHB B;  3ETG A;  1ORQ C;  4GX0 A;  1W2B U;  1YJ9 V;  3STZ C;  1P7B A;  4BAY A;  2ZXW C;  4ASU G;  3OGC C;  2JK5 C;  4JAS A;  4QJF B;  1GK9 A;  2X0L A;  3AG1 B;  4P30 A;  5IYC O;  4G28 B;  3ETD A;  3OAA G;  4MTF A;  3DTU B;  3CYO A;  3ZMS A;  3G4S V;  4L87 A;  2EIL B;  3ZIA G;  2GHY A;  1NR7 A;  1VQP V;  1MOF A;  3SPJ A;  1W0K G;  2ZDI C;  4CBC A;  2OCC C;  5BZB A;  1M1K W;  1CEZ A;  1NBM G;  2XOK G;  2UXN A;  1M56 C;  1FXH A;  5EC1 C;  2LFR A;  4PDL A;  3AG4 B;  2ITD C;  3LDC A;  5EBW C;  2QM7 A;  2EZP A;  3RVY A;  2HKO A;  3AG3 B;  3MHH C;  5CBG A;  1YHQ V;  1P4R A;  1S3J A;  4GT1 A;  3LUT B;  3W7X A;  1H38 A;  2ZXW B;  1VQN V;  3AG2 C;  3EFF K;  2QKS A;  5KA6 A;  1OCC C;  1NVP D;  4MS2 A;  2P7T C;  3IC7 A;  3ASN C;  5LBQ A;  2C2A A;  2EIK C;  2HLD G;  1EFR G;  3TET A;  3G6E V;  1WLE A;  2OCC B;  1K3E A;  4MW8 A;  1K33 A;  2EIM B;  5B3S B;  2Z5U A;  4FK5 C;  2Z3Y A;  1YJN V;  1M56 B;  3M99 B;  1GO3 F;  1NKD A;  3CME V;  3OR6 C;  3HB3 B;  2XAJ A;  2WSS G;  4X89 A;  1R6N A;  4EKW A;  3E83 A;  2EIN C;  2WPD G;  1I5Y A;  1MAB G;  2NLJ C;  3ASO B;  2P90 A;  3ZMZ A;  4RO2 A;  3RW0 A;  1ARO P;  1JVM A;  5LGN A;  3P30 A;  2A79 B;  5EBM C;  3CCR V;  3AG2 B;  1OCC B;  3ABK C;  1RM1 B;  5KUM A;  3ASN B;  4PA3 A;  1YJW V;  2EIK B;  4MVU A;  3ABU A;  4FMT A;  1NH2 B;  1FXK C;  4QE7 A;  3ZRW B;  4Z1M G;  3CMA V;  5IYD O;  3MD0 A;  3ZMT A;  4BW5 A;  2P67 A;  2HVJ C;  4DXW A;  4G27 B;  4MTX A;  4LP8 A;  1F4N A;  2EBO A;  5CA3 A;  1QVG U;  3LDE A;  1ENV A;  2B1G A;  2P6J A;  3FYI B;  2EIN B;  2Q67 A;  4LCU C;  5EC2 C;  1VQM V;  3FYE B;  3ETE A;  2YEV B;  4QPK A;  1J95 A;  1NH2 D;  1R3J C;  3E8F A;  5HFL A;  2IU0 A;  1AR1 B;  5CBF A;  1GMG A;  4MVR A;  4N23 A;  1YSC A;  2WLH A;  3VOU A;  1R6K A;  4P9P A;  1COW G;  1OHH G;  3CC2 V;  2EIJ C;  3LSS A;  5B1N A;  1FXK B;  1VQ6 V;  2WLL B;  3GWO A;  3SYC A;  3F7V C;  3K79 A;  3OUF A;  5H9C A;  2DYR B;  3KG2 A;  1VQ7 V;  1EBO A;  4R6Z A;  5C93 A;  2X6C A;  2XAQ A;  1KD1 W;  1Q86 W;  2AHZ A;  3SPC A;  3CC4 V;  1DF5 A;  2JEU A;  3TCU A;  3I55 V;  1PNL A;  4X88 A;  1W0J G;  2WLN A;  4MW3 A;  3FB8 C;  2JEX A;  4MVO A;  1K5Q A;  4MVM A;  4PDV A;  5E1A C;  2D3O W;  3OUS A;  2QEX V;  3QNE A;  3ABM C;  4H33 A;  2HFE C;  3JD3 A;  4J9Y B;  1AI4 A;  5IDJ A;  5H6Q A;  4BIU A;  1JOY A;  1PKX A;  3JD1 A;  3W7S A;  1VQL V;  3IGA C;  1E1Q G;  3OMI B;  2EIJ B;  1SZT A;  2HR3 A;  3K9A A;  2WLI B;  1K97 A;  2W6I G;  3TK1 A;  1NVP B;  4RQE A;  5B3S C;  2EIM C;  4UV8 A;  2XND G;  5J9P C;  1KP3 A;  4WFB V;  1GM9 A;  4ZBM A;  1G4Y B;  3FB5 C;  4UVA A;  3OMN B;  2ZDI A;  1MG1 A;  3CXC U;  2ZQM A;  1PL0 A;  2V1D A;  1GTO A;  2EJR A;  4JF3 A;  1KEC A;  5L3G A;  3G71 V;  3ASO C;  1H8H G;  3CCU V;  3MHS C;  4MVQ A;  3ABM B;  4JPR A;  1S77 D;  3F5W C;  2HVK C;  4RUF A;  4J9Z B;  2B1I A;  2R9R B;  1RM1 C;  1KC8 W;  1QCE A;  1PD3 A;  1R3I C;  4ZKI A;  3H01 A;  1R3K C;  4HAM A;  4BIZ A;  2MK3 A;  2M7W A;  2XAH A;  3W7T A;  3CCE V;  2FTK A;  4XBF A;  2DYS C;  3K04 A;  2H8P C;  1TUE B;  5CMU A;  1E1R G;  1THZ A;  1K92 A;  2YSU B;  5IYB O;  1JJ2 U;  3OFN G;  3RVZ A;  3ZRW A;  2IJH A;  4MVZ A;  4MVS A;  3RBZ A;  1FS0 G;  2ATK C;  4PDM A;  2W0F C;  3K0G A;  1K9M W;  2QTO A;  3JD0 A;  1S72 V;  3D36 A;  3ZN1 A;  4UUJ C;  4TT3 G;  3OMA B;  3GB7 C;  5H6R A;  3SYA A;  1N8R W;  3T1C A;  3R65 A;  2ZR2 A;  3JD4 A;  4Q20 A;  4P2Z A;  1KP2 A;  3CD6 V;  2JJ1 G;  4TSF G;  4U7O A;  1BL8 A;  3NXS A;  1LNQ A;  4MTO A;  2DYS B;  2HG5 C;  1V54 C;  4KUM A;  3JCZ A;  4R8C A;  3DGE A;  4JTA B;  1FXV A;  2IH3 C;  2DYR C;  3OW2 U;  2ITC C;  1OCO C;  1FXK A;  2WLL A;  2A0L A;  2X7R B;  3K08 A;  3OE7 G;  3F7Y C;  1M57 C;  5CN0 A;  1XL4 A;  4H37 A;  1BHA A;  2K1E A;  3SJQ C;  3CCV V;  1VQ4 V;  1OZ0 A;  2OT5 A;  2WLM A;  1OCR C;  5HFM A;  3LNM B;  1S5H C;  2BOC C;  1QR8 A;  3HPL C;  1JX9 A;  1GM7 A;  2AHY A;  3CP1 A;  4MSW C;  4JAU A;  1SES A;  5EK0 A;  3X2Q C;  3E8B A;  5LHH A;  1JQ0 A;  1CP9 A;  5IY5 C;  1V54 B;  3E8H A;  2PI4 A;  1B6Q A;  4WF9 V;  3JYC A;  3ZRS A;  1V55 C;  1PNM A;  1JCH A;  2IU3 A;  4I5S A;  3ZCC A;  1OCO B;  3CCM V;  2IJI A;  4UVB A;  2OTL V;  2WLI A;  3LSQ A;  2QM8 A;  3LDD A;  4WFA V;  3ZMU A;  1AI6 A;  1JPX A;  3P32 A;  5L3C A;  1H2G A;  1AI5 A;  1M57 B;  4FPP A;  4PA9 A;  4I9W A;  4XDJ A;  1FFT B;  3OM3 B;  3W7W A;  1Y66 A;  2ZD9 A;  2XAS A;  5CBH A;  2Y69 C;  2JDI G;  4XDL A;  1VQO V;  3E89 A;  1DF4 A;  4RUE A;  4U7N A;  1OCR B;  4QE9 A;  3SPH A;  1YTF B;  4E2L A;  3QO5 A;  4G2K A;  4QIW F;  3ZMV A;  4R50 A;  4GX2 A;  5L3F A;  4JGS A;  3FKS G;  4RQF A;  1QLE C;  3X2Q B;  1VQ8 V;  1VQ5 V;  5IY5 B;  2WAM A;  2V7Q G;  3CC7 V;  3WG7 C;  1S76 D;  3SPG A;  4QNH B;  1V55 B;  4PDR A;  4FJC C;  1K4C C;  4HZ3 A;  2Q68 A;  2Q69 A;  3B8N A;  4GCZ A;  1AJP A;  2DWE C;  3QO8 A;  2B5U A;  1AJQ A;  3ZN0 A;  1RPO A;  3CCS V;  1YTF D;  3CPW U;  1Q82 W;  1I5X A;  5EBL C;  3WFV A;  2JIZ G;  1AI7 A;  1BHB A;  1SET A;  2EZO A;  5L3D A;  3A0R A;  1GM8 A;  2Y69 B;  4UVC A;  2XAF A;  1BMF G;  3B8M A;  5L3E A;  3SYO A;  5B1B C;  2DQ3 A;  1PNK A;  4PA6 A;  4N21 A;  2KB1 A;  1F51 A;  2XAG A;  3T2M A;  3D3I A;  3UKM A;  1QLE B;  2Y48 A;  1K34 A;  3PJS K;  1R73 A;  4DO2 A;  2QE7 G;  4WFE A;  3WG7 B;  1G8M A;  4WFH A;  1NJI W;  4P9O A;  2QA4 V;  1RPR A;  1K4D C;  2IJJ A;  1K7D A;  1F23 A;  5KUK A;  2IW5 A;  4JTC B;  2Q6A A;  4WCE V;  5FL7 G;  3AEI A;  2WLK A;  3JD2 A;  5B1O A;  4JAV A;  4QPJ A;  3QO7 A;  1EZJ A;  1CPY A;  5B1B B;  1IXM A;  2IH1 C;  2CK3 G;  3K0D A;  2HJF C;  5B1A C;  3K06 A;  4JYC A;  1YIT V;  2F43 G;  2GSM B;  2WLJ A;  2YEV A;  3SPI A;  1QLN A;  1M90 W;  5GW7 A;  2DW4 A;  2BOB C;  1K73 W;  3E35 A;  3SYQ A;  3I56 V;  2PI5 A;  3CCJ V;  3ABL C;  1XL6 A;  4JYB A;  1UJW B;  1QBZ A;  3BY6 A;  3ZRV A;  4FIP C;  1WPX A;  3T4Z A;  4GX1 A;  4R7C A;  1DLB A;  1ROP A;  4JTD B;  1VQ9 V;  4WFF A;  2UXX A;  3K03 A;  2W6J G;  4XDK A;  5LGT A;  1KQS U;  3ABT A;  3FB7 C;  4F4L A;  1QVF U;  5LHG A;  2OTJ V;  1GKF A;  3E86 A;  2X6A A;  3IFX A;  1OCZ C;  1DTO A;  2R9I A;  2ZR3 A;  5B1A B;  3E8G A;  3CCQ V;  4LC1 A;  3K3W A;  4CZZ A;  5DM6 V;  1M9N A;  1E79 G;  1Q81 W;  2NNU A;  1Q7Y W;  4RAI A;  4PA4 A;  4GX5 A;  3VBB A;  3E2E A;  3ABL B;  1NR1 A;  4UXN A;  1NQT A;  5LGU A;  5LHI A;  1HWY A;  1YIJ V;  4UV9 A;  3T4D A;  4MT8 A;  2DQ0 A;  3AG1 C;  3UM7 A;  4KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...