2NLJC

Potassium channel kcsa(m96v)-fab complex in kcl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVVVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment light chain
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nljC00
2YEVA 2HVKC 2WLLA 4QE9A 3RVZA 3WG7C 4UUJC 3LDCA 3E8FA 4GX0A 4MVUA 3GB7C 2WLNA 1V54C 2HVJC 2OCCC 3SPCA 3FB5C 1LNQA 3ABLC 4QNHB 4MTFA 4JTCB 2QKSA 1OCCC 4XDKA 3SJQC 2KB1A 4LP8A 4X8AA 1QLEC 3EFFK 2Q67A 4XDJA 5CBFA 1BL8A 3RBZA 2AHYA 4MVOA 5B1AC 5IY5C 3ABMC 3LDEA 3IFXA 3AG2C 2WLIB 2JK5C 4GX1A 5CBGA 4PDMA 4RUFA 4PA7A 2AHZA 3LUTB 3E86A 4PDVA 3ASOC 2A79B 2Y69C 2EIMC 2BOBC 4MW8A 1K4DC 3AG4C 3JYCA 4J9ZB 4R7CA 3UKMA 3OUSA 4MTOA 1ZWIC 4MVQA 4BW5A 4LBEC 3T2MA 4RUEA 3OR7C 3ZRSA 1M57C 3SPGA 3T1CA 4ZBMA 4R50A 4DXWA 2DYRC 4PA6A 3SYQA 2EIJC 5EC1C 4JTDB 2IH1C 2X6BA 2BOCC 5B1BC 5EBWC 2DWDC 4GX5A 4R6ZA 2Q69A 4MVRA 4GX2A 3SYOA 4P2ZA 4WFGA 1ORQC 3SYCA 4EKWA 2ZXWC 4PA9A 3PJSK 4F4LA 2DYSC 4MVSA 4G27B 2P7TC 4HZ3A 5E1AC 3T4DA 5B3SC 2WLJA 1M56C 3RVYA 4MVZA 1XL4A 3F7YC 3FB7C 4KFMA 2WLIA 3E83A 4H37A 3UM7A 3AG1C 4JTAB 2WLHA 2R9RB 4MW3A 4QE7A 4TWKA 1S5HC 3IGAC 4P9OA 4RO2A 3FB8C 5J9PC 2EIKC 3F7VC 3SPHA 1OCZC 3OUFA 3HPLC 4G28B 4PA3A 4I9WA 2HFEC 3SPIA 3E8HA 4RAIA 2X6AA 1P7BA 1R3LC 2Q68A 3TCUA 5BZBA 2NLJC 3R65A 3STLC 3STZC 4P30A 2A9HA 2X6CA 4PDLA 3TETA 4WFEA 3RW0A 3FB6C 3OR6C 4P9PA 4WFFA 2DWEC 2EINC 4MS2A 3E8GA 2W0FC 3K06A 4WFHA 1XL6A 5KUMA 3VOUA 1J95A 5EBMC 2Q6AA 4J9YB 1R3IC 4MVMA 2WLKA 3LNMB 3K08A 4OXSA 2ITCC 4XDLA 3SYAA 4PA4A 5KUKA 2ZD9A 3K0DA 3E8BA 4HYOA 4CBCA 1KKDA 2EILC 2H8PC 4X89A 3SPJA 4X88A 1R3KC 5CBHA 3T4ZA 2QTOA 1JVMA 1OCRC 3K0GA 5EC2C 3K04A 3LDDA 4MTGA 3SYPA 1G4YB 4PDRA 2ITDC 2WLLB 3ABKC 1V55C 4MSWC 2WLMA 1K4CC 3E89A 3K03A 3ASNC 3AG3C 4R8CA 3F5WC 3ZJZA 2HJFC 2A0LA 2IH3C 1OCOC 3BEHA 1R3JC 3KG2A 4LCUC 5EK0A 3X2QC 2ATKC 5EBLC 2HG5C 2K1EA 3OGCC 4H33A
chains in the Genus database with same CATH superfamily
3WFVA 2HVKC 4DW0A 1QVGU 5L3CA 4X65O 4U7OA 4EEQA 2QKSA 1S76D 4CZZA 2EX3A 3EFFK 2WSSG 2PUSA 1GM7A 1H2MA 1ZLZA 1AI4A 5J2TB 3BHPA 2N05A 4JI4B 3AG4C 4BW5A 4MTOA 3ZMTA 1GN6A 1M57B 2DOSA 2JDIG 1A32A 1H2GA 4PA6A 5JQGB 1QQCA 2HLDG 4FVMA 1GH6A 3CS5A 4J11A 1WB7A 3G67A 1WN7A 5B3SC 1HWYA 5EIBD 4O2AB 1IDSA 3VQYA 3CRAA 3BPZA 3SPHA 2UXNA 1NR7A 1MMMA 3TK1A 2X6AA 3STLC 3L70H 5IYBO 2H94A 5FPRA 1VP7A 4O4JB 1JFFB 5EZYB 1N0JA 2P06A 3ZBHA 1N33O 3ZHUA 5KHKA 4JI3B 5GONB 3K08A 1YEWA 1HNXB 3CEIA 1EBOA 1FFTB 4FLZA 2ZD9A 3HR0A 4LR3A 3CJHB 3WG7B 3K79A 1WP7A 2EJ7A 2QDOA 3FYEB 2Q0AA 3SYPA 1QCEA 5B5EZ 2V4DA 1YI2V 2ADQB 4L87A 1B6QA 1K4CC 1Y74A 1FPOA 2VQEB 2K1EA 3CSXA 2YEVA 2RNBA 3JCZA 4GYCB 1S77D 3HKBA 3GB7C 3A0RA 3P3PA 2ZIMA 1SS3A 5H6RA 1QLEC 4O4HA 4YJ2A 3D36A 3RBZA 3PN1A 5B1AC 4Z1VA 3I55V 5IYZA 1VF6C 1V54B 4PDVA 2Y69C 1KB9F 2GTAA 3RFRA 3ZMVA 1UJWB 4DV5B 5LGUA 1ROPA 2ZQMA 1FYJA 1FXKC 2VWJA 1N33B 4LFBB 1I94B 4PA9A 5FL7G 3AG7A 1URFA 1M56C 2KKWA 3ZHSA 1MSWD 1GM9A 1IBMB 1G8MA 2HR3A 2WLHA 4B3SB 4TWKA 3TXQA 3AG1B 2UUAO 1YITV 4TQFA 4PA3A 4JYYA 1RPOA 4N21A 4DR5B 1K92A 2X6CA 2VWKA 4ZOLA 1VIBA 4WFFA 1VQLV 3ZEDA 3LNNA 1N36B 3Q4HB 1OCCB 2Q6AA 4J9YB 4DUZO 3CD6V 3O9OA 3ML0A 4PA4A 3CCMV 3K5MA 5H2FZ 2MK3A 4DR4O 1VF6A 4NKGB 4BR6A 3NR7A 3J80N 1YCIA 4J10A 2WAMA 2HHHB 1JX9A 3N27A 4U7NA 4L8JA 4JASA 3X2QC 3CCVV 1VQKV 3OMIB 4QE7A 1VQOV 5IT9N 4N23A 4JI2B 4CC5A 2HP8A 3C3SA 1YXBA 2PZSA 4GLXA 5IYZB 1THZA 4MTFA 3DC5A 4XDKA 3E2EA 4JAAA 2FTKA 2QA4V 1N0NA 3N2GB 1LR1A 1RM1B 1P7GA 4PA7A 3ABLB 2EILB 4PI2A 2EIMC 4LF6O 2BOBC 4O2BB 3RWRD 4X9QA 1M1KW 4K8ZA 1Q6UA 2ZCEA 1SF9A 4LF7B 2P6JA 5B1BC 2NNUA 2DYSB 2QWOB 1VQ9V 4FJCC 2UUBO 5K1XA 1AI6A 4MVZA 3CJHA 4X20B 1T5EA 4UVAA 1IXMA 4P9OA 3ASOB 4FK5C 1FD9A 2QM8A 3K3WA 4DV2B 4YJ3A 4ZHQA 2ETNA 3H1IH 1EFRG 3FB6C 1QVFU 4DUYO 3L72H 1SERA 1KUQA 3OFNG 1R3IC 2R9IA 2ZIOA 3MD0A 4JI6O 4J7ZA 4K35A 4X88A 2YXYA 3T4ZA 1YZBA 2Q7EA 3OTOO 1IBLB 3K04A 4MTGA 2YIBD 3UO2A 2WLLB 4FLWA 1GN2A 2K9PA 2WLMA 3N2KB 3K03A 5H5NA 3ASNC 5KMGB 3THOA 3BFRA 4O4IB 4B3RB 3G71V 1IURA 3TGUH 3D3QA 3D3IA 2PYLA 1KKCA 3U10A 4B3TO 4B3RO 1Y6XA 4X62B 2FL4A 1BL8A 1US6A 2EINB 1N8RW 5EIBC 1SZTA 2FYUH 4RUFA 5DECA 1XMOB 1UFIA 2CK3G 2OYQA 4MW8A 5FNVA 4J9ZB 3VQXA 3MAQA 3BA9A 5JJEB 3ZN0A 3HKDB 3K9AA 2UUBB 4AHCA 1SQFA 2A7WA 1YIJV 4MT8A 4FZ0A 2GSMB 1AJNA 3OGIB 2PF4E 1AI5A 3H1HH 5J2UA 1XL4A 1K3EA 5KHIA 4LFAB 5K1PA 4X1KA 2LJ2A 2HFEC 1Y66A 4D6TH 4Q6GA 4NXMB 3ASNB 1P4RA 4P9PA 4UV8A 1TUBA 1NR1A 2ZINA 2W0FC 2E76B 2B1IA 3JALB 3VOUA 1OCZB 1J95A 4B3TB 2WLKA 2CTRA 3A0HZ 1ZSPA 4UB8Z 3DXRB 4IHJB 2UXDB 3EVKA 1YHQV 1NTKH 1NZ6A 3D36C 5KMGA 1OZ0A 3EHBB 2PYJA 5LMUO 1RSOA 2ITDC 4O2BA 2O57A 5HFMA 4LF9O 2BTOA 2Q8VA 3B77A 1Z2GA 4DV7B 4UFZA 1SKVA 5LGTA 1MOFA 3HKEB 3ZMUA 2DW4A 2F43G 2XOKG 2OCCC 2DQ0A 1HW7A 3ABTA 2CTQA 1SA0A 2GUZB 4JV5B 4IT5A 2P67A 4DV3B 1FXKA 1CPYA 4FFKA 1AROP 3LSSA 5IY5C 5BXZA 3QG5A 2LGWA 5B66Z 1MABG 1I0HA 4RUEA 4YXWG 5LMNO 3ZRWB 4WFAV 2A3QA 2F66C 5LA6A 2XASA 4FFBA 1XNRO 4R6ZA 3B8MA 4DK0A 1NVPB 4F4LA 4G27B 5HFLA 1VQPV 4DV0B 4TOIA 4I4TB 3ZMSA 4DR3B 1M90W 5CB4A 2DYRB 1RFYA 2UXDO 4JTAB 5F2VO 4DO2A 3J81N 3F7VC 3BAAA 1VQ4V 3OUFA 2FKXA 4K0KB 2QM7A 3I5DA 1I08A 4LF6B 1N36O 3CRQA 4LNUA 3OEHG 3OR6C 2IU3A 3E22B 2IJHA 4DR1B 1Y4MA 4DR4B 1XBLA 5IDJA 5DEDA 3MHHC 3BRCA 1XQ8A 1WPBA 1KKDA 4X1YB 1LUWA 2GBOA 2H8PC 4WFBV 3CPWU 1R3KC 3SR2C 2CUGA 4PJ0Z 2NN4A 5IY5B 2MW2B 4ICGA 3HKEA 4I9QA 3ZJZA 3ZN1A 3CMAV 3F5WC 2HJFC 1BS3A 1Q82W 4JV5O 1VQNV 4YY3B 3VQWA 3RYFA 1FJGO 3CC7V 3ZHQA 3GVMA 4NTYA 4GX0A 4FLTA 1YDXA 3ZS8C 3L75H 1GRJA 1PNLA 3BA8A 2UXCB 3C90A 4CH5A 5JJNB 2XHBA 1U97A 4MVOA 3B8NA 4LH7A 4GX1A 2ZR3A 4DV5O 1VQ7V 4X1KB 1JFFA 1H2LA 1Y76B 2A79B 4IIJA 4ZI7B 1WAZA 1BCCH 2PY5A 1HNWO 4TUYB 2DWDC 1W0JG 3JSNA 2JJ1G 5EZYA 2OT5A 1GN4A 4X62O 1QLEB 3DXRA 2P22C 3IGAC 1BSMA 4JI4O 3ETEA 1TA8A 2E5LO 2XAQA 5CA0A 2CAZC 3JARB 1P7BA 5KA5A 4PDLA 5EYPA 1M5IA 3WU2Z 3H9VA 4WFHA 4DV2O 3FFQA 4KUMA 1KQSU 1O9GA 4AILC 4NYKA 3LNMB 4UCVA 3W7UA 2AZ2A 3ETDA 4CBCA 1OCOB 4LF4B 4X89A 4FFBB 3K0GA 4AI8A 4YY3O 4PDRA 2UUCB 2GV9A 3OMNB 1ZUQA 3OTFA 1U96A 1D5AA 5KAIZ 1X4TA 4EFBA 4QNHB 3K59A 1JOYA 4JYCA 2QKCA 1JJOA 1Q3EA 2JVDA 4ZOLB 2ADPA 4GKJB 2ZDIA 2F23A 2YS8A 4K3AA 2ZM6O 4EB6B 1Y74B 2QSAA 3B40A 5LMUB 3C3TA 3T1YO 4NXNB 4UXNA 1M57C 5FPOA 3IAYA 3ETQA 3AG4B 1XNQB 2W0XA 2EIJC 5BR8B 4JTDB 5CA3A 1HDJA 1MZEA 1K34A 1RPRA 1I7FA 3ZHRA 4JZGA 3SYOA 3AK1A 4DW1A 5B1AB 4EKWA 1BT8A 2X0LA 2JS3A 3JATB 2ZDIC 2P5OA 5LHIA 1KMIZ 1Q7YW 2WLIA 2D3OW 3G4SV 1PKXA 3OTOB 3FB8C 2ZT9B 5J9PC 1Z5WA 3B2EE 4E2LA 3OM3B 2UUCO 4O4LA 1MSDA 2Q68A 4H0LB 3R65A 3AK3A 4OX9B 3BCCH 5ITZB 3WB1A 3CC2V 5IJ9B 4IIJB 1VQMV 4MVMA 1IBLO 3DSQA 1LUVA 3RYIB 2EIMB 2EILC 4WF9V 1WNSA 1K5QA 1KC8W 2Y0IA 1XHZA 1OCRC 1TAEA 2BTQB 2UUAB 1BHAA 3WB2A 3HKCB 1TVKB 1DTOA 2PGGA 4R8CA 5LGNA 1M4UA 1PPJH 5EK0A 1N32B 1KP3A 3LSUA 1XOUA 3Q4HA 4KP4A 3L71H 4UUJC 2CTWA 4DR1O 3R66A 3ZCCA 1KD1W 3X2QB 2QEXV 3BABA 4MVUA 3ZMZA 1S5LZ 4U3FH 4GKJO 2OIEA 4UV9A 3JARA 1VF7A 5CA0B 1FXVA 4FLUA 4X8AA 1G6UA 5L3DA 2EULA 3QNEA 3LDEA 5CBGA 4DK1A 4XBFA 5LBQA 3H01A 4KHPO 3N2GA 2JIZG 5LYJA 4DR6B 3B4SA 4U3JB 3L73H 2IH1C 3O65A 2F4VO 1L1FA 4GX5A 1YTFD 1HNZB 2OTJV 4NTWA 1E1QG 3CB2A 1R1BA 2EIJB 3AG1C 4FM2A 3RYCB 2VS0A 3CX5F 2D2CB 1VQ5V 3HPLC 2GDSA 3OMAB 2W6JG 1AVMA 5BZBA 1R73A 3CCLV 3L9DA 4W4KA 4B7EA 4WCEV 4PELA 3E8GA 2IJJA 1SQGA 1SQVH 2XNDG 2UXBB 4C7UA 3JD4A 2WA3A 5EBMC 1I94O 5FNVB 2Y69B 3CP1A 3K0DA 2YIDA 3RN4A 4I0XB 1JR9A 2RQ6A 1F23A 5B1OA 4EB6A 3ABKC 1YJWV 1OCRB 4MSWC 1GK9A 1KBHA 2A0LA 1DLBA 2WLLA 4QE9A 4CH6A 4LFCB 3UT5A 1LNQA 2JGDB 1K73W 2B1GA 4O4IA 3SJQC 3CCRV 4TV8A 5JVDA 3CCUV 4WBNA 2AW9A 3A0BZ 5IJ9A 1SESA 2KQXA 4LF5O 2YI9A 1QHTA 4FZ1A 3JAMN 3KZIZ 2YIBA 3T2MA 3OR7C 2KSDA 4JI0B 4KL1A 3CWBH 4GZRB 1Q43A 5ITZA 2CDYA 2LP7A 3NXSA 3W7WA 3PJSK 3SJAC 4CS4A 3FB7C 5J2TA 1AR5A 2LGQA 4H37A 2R9RB 2Q7GA 2QM4A 3D8CA 5JCOC 2EBOA 2P4KA 1MZFA 4IYHA 4DUYB 1XDCA 5J2UB 3JSLA 1AI7A 1H2NA 2B5UA 2UXBO 3HKDA 4YHHB 3STZC 2RN9A 1BZKA 4B7KA 4P30A 2ARHA 2QE7G 3RW0A 1V55B 2LW1A 4JI2O 4ASUG 1N34O 3E35A 5KUMA 2IU0A 1CXZB 1SETA 2P4VA 2JEUA 1KU9A 1GM8A 2ZE7A 2ITCC 3J7AU 1O9HA 3CRMA 3TXSA 1JVMA 1VF5B 3FKSG 2ZKOA 3CXHF 1QR8A 2UXXA 5JWPA 3SGIA 2LFRA 5JCOA 2AZ0A 2RCVA 3P30A 4TT3G 4LF4O 2JEXA 4IHJA 1TUBB 4OPAA 1OCOC 1X59A 3KG2A 3QTCA 1PD3A 2P90A 1PNKA 2XAJA 3LDCA 1TGOA 3P32A 2HVJC 3SPCA 3FB5C 2PI5A 5C8YA 1KECA 5IWAO 4CS3A 2DE0X 3RYCA 4PDMA 5L3FA 4B3SO 4I5SA 3LUTB 5DN6G 4JI8B 4CC6A 1HNWB 1SQPH 1BE3H 2Z5UA 5IE9A 2Q9LA 2JJ2G 1TUEB 4ZBMA 4FPPA 2DYRC 2H3OA 1Q5OA 2YEVB 2DN9A 2YXHA 2ZR2A 2GUZA 4TV9A 3ZRWA 4NB5A 4X64B 4DV6O 1ORQC 5L3GA 3MDSA 3JD0A 1VQ8V 4JI5O 3BVOA 5E1AC 1XEQA 1BGYH 3RYHA 2E5LB 2AXTZ 4JI1O 4DV6B 3FYIB 3CC4V 1XMOO 3UT5B 1FFXA 4JI5B 4I55A 5LOVB 1EZVH 4I9WA 4IL6Z 5A9GA 2GHYA 3SPIA 3OW2U 2ZE6A 1XREA 4TSFG 1AJPA 2ZXWB 5CMUA 4D7TA 4HNAA 4IYIA 2WA4A 3K57A 3GWKC 4OX9O 2Z0AA 4ZI7A 4DV4B 3SDLA 3LSQA 1FXHA 2YIAA 5KX5B 2BCCH 4BWAA 1OV9A 2QR4A 4RQEA 4CH3A 3H1KH 3APQA 1SZXA 2CE4A 2CTPA 3UCSC 1Y76A 3TJTA 3ZX6A 5L3EA 3JAWA 5BMVB 2CH7A 1YVWA 1NQTA 2HG5C 5BY1A 3G80A 4DRXA 3ZHTA 1VMGA 2OWOA 1GN3A 1JCHA 3APOA 2KB1A 2Y4UA 1W59A 4DV1B 3K5LA 3JASB 1RM1C 1KYOF 2QWQB 4Z1MG 1EM1A 3P3NA 5JH7B 5BR8O 1NTMH 1EN4A 1Z5VA 4UB6Z 2QKAA 1AJQA 4GKKO 3ZRSA 4QJFB 4I50B 4JYBA 3JAKA 5EC1C 3RYHB 2BOCC 2X6BA 4KHPB 1EN5A 3W7SA 3ABMB 3U11A 1NH2D 2M7WA 1OHHG 4JI6B 3OT7A 4DV4O 1AB3A 1HR0O 4DR2B 2E75B 5FLXN 2F93B 3CCQV 2GTSA 2Q7HA 4RO2A 5LP6A 3K5OA 3ZIAG 4DR3O 4RAIA 3T1HB 3F5TA 3N2KA 1CP9A 3TETA 4BW9A 3OD4A 3DGEA 2EINC 3H1LH 1COWG 4LC1A 1H38A 1IZ3A 2IW5A 1Q81W 4LF8O 2BSKB 5C8YB 1F4MA 1DF5A 1F4NA 2XAHA 2WWWA 4LF9B 1M56B 4ABMA 3LDDA 4JI7O 1G4YB 2XAFA 3U0ZA 5C93A 3CYOA 1QR9A 5EYPB 1NJIW 3E89A 4GKKB 3AG3C 4ZHQB 3JATA 3L74H 2IH3C 1SQXH 5DM6V 2ATKC 3G6BA 2Y0PA 1Q6HA 5LHGA 2QWPB 3QO7A 2QTSA 3ZRVA 5KHHA 2IM9A 2B9ZA 4LFBO 4NR1A 1IBKO 4FLXA 4QPKA 4JAVA 1WJZA 1XMQB 4J41A 1H8EG 4KXRA 1ZX3A 4JI0O 3QVNA 2UXCO 1H8HG 4E4EA 4K0KO 4MTXA 5CA1B 3OUSA 1ZWIC 3RT3C 1P84F 1YTFB 4UCTA 3IC7A 1KP2A 1EN6A 3T1CA 1BQZA 5H6QA 2R72A 5KX5A 1SQQH 2DMXA 1K7DA 2Q0OC 2XAGA 3OEEG 4O2AA 1W0KG 2BTQA 1R6NA 2C2AA 2ZXWC 3HKCA 3W7TA 2DYSC 5B1NA 1XHXA 1NU1H 3T4DA 4LF7O 3JAWB 1WA8B 3JD2A 1ZL8B 3QF7A 3T1HO 3RYIA 1IX9A 4PHZA 2ZNJA 4DRXB 1K8AW 2DQ3A 4UVBA 2EJRA 4YIPA 2L35A 2KG7B 3E8HA 2ODMA 1TVKA 3T1YB 4NXNO 2BSKA 2HKOA 5IJ0A 5LL6Y 2DWEC 4FIPC 4O4LB 4QGPA 3K9SA 3OE7G 2FB5A 3HKBB 5AG2A 3SYAA 1Q8IA 4HYOA 2OTLV 1IVSA 5CN0A 4BAYA 4U3JA 4K8XA 2QTOA 2LO1A 3JD3A 4OPHA 1B06A 4QIWF 4JGSA 4H44B 4GUNA 4LFCO 3ICXA 1BHBA 4NXMO 2ZE5A 1IBKB 1D2DA 4O4JA 3OGCC 3JAKB 2Z3YA 4J7JA 1XNRB 1NKDA 5GONA 3E8FA 4AQYO 2HHHO 4JTCB 1FKAO 1OCCC 1JMKC 4DV0O 2Y48A 2QWRB 4HBNA 3M7MX 5JJJB 5CB4B 4FM1A 2JK5C 3DC6A 1CEZA 2OCCB 2XTAA 3HB3B 3ASOC 1S0VA 5KAFZ 2YDEA 4MVQA 1VEWA 4LBEC 2RDCA 4LNUB 5IYCO 2FMLA 1NTZH 4DXWA 4GT1A 1N34B 4DV7O 3H1JH 1JQ0A 4YIOA 1UPGA 4O4HB 1IXBA 5B1BB 4EFEA 1FXKB 4F6EA 4DV3O 2V7QG 1BQ0A 3F7YC 4X1YA 4KFMA 2EIKB 3AEIA 4JAUA 3EXAA 4ZIBA 1GAXA 4D7SA 4MW3A 2F1MA 4NTXA 2EIKC 4I0XA 1QBZA 1OCZC 5LYJB 3AG3B 4FMTA 1V9PA 2JGDA 4YJ2B 1XILA 2NLJC 3OAAG 2LQTA 1M93A 3FD9A 2X7RB 4WFEA 4B08A 4MS2A 4Q20A 4J7KA 1XI1A 4J80A 2AGAA 2VRZA 1L8DA 2YUAA 1K33A 1PM9A 1DK1A 5LXTB 3CHXA 1GO3F 1NBMG 1HR0B 2ZNIA 5CBHA 1Y67A 5JVDB 2EZPA 4B3MB 3WB0A 1YJ9V 4LFAO 5H9CA 2NR5A 4X65B 1ZL8A 2PTMA 1R3JC 5EBLC 3ZHVA 3WG7C 3KCYA 5L3BA 1K97A 1PL0A 3CMEV 2ZE8A 1J5EB 3ZRXA 2YICA 4JI8O 2Q67A 5TISZ 1WA8A 1JA8A 3ABMC 3IFXA 2YC0A 3AG2C 5IJ0B 1AR4A 1DGSA 2F95B 1S5JA 1PV0A 4LWSA 2HJDA 4JI7B 1YSCA 1AILA 1YJNV 1ENVA 4JPRA 2KG7A 4WBNB 3JYCA 1HP8A 3SPGA 1HNZO 4YJ3B 1VQ6V 4PV1B 4LH6A 2W6IG 1NT2B 4W4LA 1FJGB 3G6EV 5EBWC 1I5YA 5B3SB 1YF2A 2Q69A 4MVRA 3AK2A 4P2ZA 1L0NH 4PD4F 4WFGA 1QLNA 4TV8B 4MVSA 1Q90D 2YSUB 4F6RA 2P7TC 4HZ3A 5GTIZ 4DV1O 3E83A 2IBZH 2JGUA 1NVPD 4BIZA 1AR1B 1K9MW 2Q73A 4LF5B 1NS1A 4G28B 3B09A 2E3CA 4DR2O 3JCUZ 1QNMA 1PP9H 4A5UB 4CS2A 3K06A 4TUYA 3KKYA 5GW7A 3CRRA 5E79Z 4OXSA 1NI8A 4JZ2A 2IJIA 3CRCA 3E8BA 1AP6A 1R6KA 3SPJA 4FM0A 2OCHA 1F7YA 2YI8A 1ZAUA 3DTUB 4JI3O 2VQEO 4LF8B 1Q86W 1V55C 4X20A 1P49A 4DR5O 3BEHA 4J42A 3QO5A 1GTOA 4RQFA 2DJVA 4Z2WA 2BE3A 1S72V 3RVZA 4JF3A 4X1IB 5LHHA 4ZKIA 3ABLC 4I55B 4LWSB 1PNMA 4LP8A 2LFSA 4XDJA 5D5QA 1WP8A 2EZOA 2WLIB 5LMNB 4DR6O 5LP6C 2HEPA 1RP3B 2QGNA 3E86A 2Q4PA 1F51A 1Q6IA 2R70A 4BIOA 4HNAB 1FFXB 3UKMA 5LOVA 1VARA 4F6RB 3SYQA 1IBMO 4GX2A 4X66B 3SJBC 2RMKB 3JALA 4FLVA 1DF4A 3RGBA 5LXTA 2Y4TA 2WLJA 3RVYA 1SC5B 4BIUA 3UM7A 3M99B 3I56V 1E1RG 1S3JA 1I5XA 4TQDA 3CCSV 2ZM6B 5KHJA 5A2QN 1E79G 5GTHZ 3UQ8A 3TCUA 1R3LC 2OIGA 1RSOB 4H13B 3A8TA 2A9HA 1MA1A 3ABKB 5JQGA 4TV9B 4FLYA 5BMVA 2CH7B 1XL6A 1ZTEA 2JRIA 1D5NA 3K58A 3UO3A 3FAVA 4X64O 4CH4A 2CGNA 3K5NA 1QU7A 4I7ZB 5KUKA 1XMQO 4GCZA 4JI1B 2G38A 2IJKA 3ETGA 2N74A 5EC2C 3CCEV 4DUZB 1MNGA 3IJ4A 1G1XB 1BMFG 1L0LH 3GWOA 2Q5ZA 2QJ1A 5KA6A 2UU9B 2XUMA 4JYAB 1WPXA 1JJ2U 1JPXA 1PL4A 1EZJA 1SA0B 4RWUA 2XT9A 1GKFA 4H33A 4I50A 5D5PA 1R6TA 1H2SB 2A06H 2YXLA 3S3XA 3ABUA 4JYAO 2WLNA 1V54C 4X66O 2VQFO 1N4CA 5CBFA 4DYLA 2AHYA 1B3QA 4AQYB 1NH2B 3AG2B 2AHZA 1WLEA 5IWAB 3CCJV 2R9AA 3CXCU 1K4DC 2JS5A 2L6LA 4R7CA 1XUQA 5LA6B 1W2BU 4DR7B 4UCUA 4R50A 5JH7A 1N32O 4UCRA 1FAFA 3MHSC 4I4TA 4UCOA 2E74B 4NVPA 3E22A 3SYCA 2N04A 1J5EO 4DR7O 4PI0A 1XNQO 3JASA 1K5SA 4HAMA 4YHHO 3S3WA 4X1IA 1S5HC 4OGQB 1B04A 3VBBA 4QPJA 1WB8A 3QO8A 5KHGA 2UU9O 4UCSA 3FAVB 5LP6B 5IYDO 2RJZA 1SRYA 3BY6A 3M8AA 1AP5A 1M9NA 3VQVA 2F4VB 2PI4A 3IC9A 3JD1A 2VQFB 2QWNB 2CGOA 4G2KA 4XDLA 5CA1A 1FS0G 4UVCA 1GMGA 3CE2A 3W7XA 2ILMA 1H2KA 5KLVH 2WPDG 3SJCC 2M6YA 3A2FA 4IGGA 1HNXO 3RYFB 2LW7A 1SQBH 3FX7A 1MG1A 4B3MO 4LCUC 2V1DA 1OJHA 3KCXA
chains in the Genus database with same CATH topology
3WFVA 1DLBA 2HVKC 2WLLA 4QE9A 2Z3YA 5LGTA 1MOFA 1NKDA 1QVGU 3E8FA 3ZMUA 2DW4A 5L3CA 2F43G 2XOKG 2OCCC 2DQ0A 3ABTA 4U7OA 1LNQA 1K73W 2B1GA 4JTCB 2QKSA 1OCCC 1S76D 3SJQC 4CZZA 2P67A 3CCRV 3EFFK 1FXKA 2WSSG 2Y48A 1CPYA 1GM7A 1AROP 3LSSA 5IY5C 3CCUV 1AI4A 2JK5C 1SESA 1CEZA 2OCCB 3HB3B 1MABG 3ASOC 1S0VA 3AG4C 4BW5A 4MTOA 4MVQA 3ZMTA 4LBEC 1M57B 4RUEA 3OR7C 4YXWG 3T2MA 3ZRWB 4WFAV 5IYCO 2JDIG 4DXWA 1H2GA 4PA6A 4GT1A 2HLDG 2XASA 1JQ0A 2LP7A 4R6ZA 3B8MA 1NVPB 3NXSA 3W7WA 3PJSK 5B1BB 4F4LA 4G27B 5HFLA 1VQPV 1FXKB 5B3SC 2V7QG 3ZMSA 3FB7C 3F7YC 1M90W 4KFMA 2EIKB 4H37A 1HWYA 3AEIA 2DYRB 4JAUA 4JTAB 2R9RB 4MW3A 4DO2A 2EBOA 2EIKC 3F7VC 3SPHA 1QBZA 1VQ4V 1OCZC 2UXNA 3OUFA 1NR7A 1AI7A 2QM7A 3AG3B 4FMTA 3TK1A 2X6AA 2B5UA 2NLJC 3STLC 3STZC 3OAAG 4P30A 2X7RB 2QE7G 4WFEA 3RW0A 3OEHG 1V55B 5IYBO 3OR6C 2H94A 4ASUG 2IU3A 4MS2A 4Q20A 3E35A 2IJHA 5KUMA 2IU0A 1Y4MA 1SETA 2JEUA 5IDJA 1K33A 3MHHC 3K08A 1GM8A 2ITCC 1EBOA 1FFTB 1GO3F 2ZD9A 3WG7B 1NBMG 1KKDA 3K79A 4WFBV 2H8PC 3CPWU 5CBHA 1R3KC 2EZPA 1JVMA 3FYEB 3FKSG 1YJ9V 1QR8A 2UXXA 1QCEA 3SYPA 2LFRA 5IY5B 1YI2V 4L87A 5H9CA 3P30A 1B6QA 4TT3G 1K4CC 2JEXA 3ZJZA 3ZN1A 3CMAV 3F5WC 2HJFC 1OCOC 1Q82W 1R3JC 3KG2A 1PD3A 5EBLC 2P90A 2K1EA 1VQNV 2YEVA 1PNKA 3JCZA 2XAJA 3WG7C 5L3BA 3CC7V 3LDCA 1S77D 1K97A 4GX0A 3P32A 3GB7C 2HVJC 3A0RA 3SPCA 1PL0A 3CMEV 3FB5C 1PNLA 3ZRXA 5H6RA 2PI5A 1QLEC 1KECA 2Q67A 3D36A 3RBZA 4MVOA 5B1AC 3B8NA 3ABMC 3IFXA 3AG2C 3I55V 4GX1A 2ZR3A 4PDMA 5L3FA 4I5SA 3LUTB 5DN6G 1VQ7V 1V54B 4PDVA 1YSCA 1YJNV 1ENVA 2A79B 2Y69C 4JPRA 3JYCA 2Z5UA 3ZMVA 2JJ2G 3SPGA 1TUEB 4ZBMA 4FPPA 1UJWB 1VQ6V 2DYRC 2YEVB 2W6IG 5LGUA 3G6EV 1ROPA 5EBWC 2ZR2A 1I5YA 2ZQMA 2DWDC 1FXKC 5B3SB 2Q69A 4MVRA 3ZRWA 4P2ZA 1W0JG 1ORQC 4WFGA 5L3GA 1QLNA 2JJ1G 3JD0A 1VQ8V 4PA9A 4MVSA 2OT5A 2YSUB 5FL7G 2P7TC 4HZ3A 5E1AC 1M56C 1QLEB 3E83A 1MSWD 1GM9A 1G8MA 2HR3A 2WLHA 1NVPD 4BIZA 4TWKA 1AR1B 3FYIB 3CC4V 3AG1B 3IGAC 1K9MW 1YITV 3ETEA 4G28B 4PA3A 4I9WA 2XAQA 2GHYA 3SPIA 3OW2U 1RPOA 1P7BA 4N21A 4TSFG 5KA5A 1K92A 4PDLA 2X6CA 1AJPA 2ZXWB 4WFFA 5CMUA 1VQLV 3K06A 4WFHA 5GW7A 4KUMA 1KQSU 1OCCB 2Q6AA 4J9YB 3LNMB 4OXSA 3CD6V 3W7UA 2IJIA 3ETDA 3ML0A 4PA4A 3CCMV 4CBCA 3E8BA 1OCOB 3LSQA 1FXHA 1R6KA 2MK3A 4X89A 3SPJA 3DTUB 3K0GA 1Q86W 4RQEA 4PDRA 1V55C 2WAMA 3OMNB 5L3EA 1JX9A 4U7NA 3BEHA 4JASA 3X2QC 3CCVV 1VQKV 3OMIB 1GTOA 1NQTA 3QO5A 2HG5C 4QE7A 4RQFA 1VQOV 1S72V 4N23A 3RVZA 4JF3A 5LHHA 4ZKIA 1THZA 3ABLC 4QNHB 4MTFA 1JCHA 1PNMA 4XDKA 3E2EA 2KB1A 4LP8A 2LFSA 4XDJA 2EZOA 4JYCA 1JOYA 2FTKA 2WLIB 2QA4V 1RM1C 1RM1B 2ZDIA 4PA7A 4Z1MG 3ABLB 3E86A 2EILB 1F51A 2EIMC 2BOBC 3UKMA 1AJQA 3ZRSA 1M1KW 4QJFB 4UXNA 1M57C 3AG4B 4JYBA 3SYQA 2EIJC 5EC1C 4JTDB 2P6JA 5CA3A 2BOCC 2X6BA 5B1BC 1K34A 1RPRA 3W7SA 2NNUA 3ABMB 4GX2A 3SYOA 5B1AB 2DYSB 4EKWA 1NH2D 2X0LA 2M7WA 1DF4A 1VQ9V 1OHHG 4FJCC 2ZDIC 5LHIA 2WLJA 1AI6A 3RVYA 4MVZA 1Q7YW 4BIUA 3UM7A 2WLIA 3M99B 2D3OW 3I56V 3G4SV 1E1RG 1S3JA 1PKXA 3CCQV 1I5XA 4UVAA 1IXMA 4P9OA 4RO2A 3FB8C 5J9PC 3ASOB 4FK5C 3ZIAG 4E2LA 2QM8A 3CCSV 3OM3B 1E79G 4RAIA 2Q68A 3K3WA 1R3LC 3TCUA 3R65A 1CP9A 3TETA 2A9HA 1EFRG 3FB6C 3DGEA 3ABKB 1QVFU 2EINC 3CC2V 1SERA 1XL6A 3OFNG 1COWG 4LC1A 1VQMV 1H38A 1R3IC 2IW5A 4MVMA 2R9IA 1Q81W 3MD0A 5KUKA 1F4MA 2EIMB 1DF5A 4GCZA 2EILC 1F4NA 4WF9V 4X88A 2XAHA 2WWWA 1K5QA 3T4ZA 2IJKA 1KC8W 3ETGA 1OCRC 5EC2C 1M56B 3CCEV 3K04A 3LDDA 4MTGA 1BHAA 1G4YB 2XAFA 1BMFG 1DTOA 2WLLB 5C93A 3CYOA 3GWOA 1QR9A 1NJIW 2WLMA 5KA6A 3K03A 3E89A 3ASNC 3AG3C 4R8CA 5LGNA 1WPXA 1JJ2U 1JPXA 2IH3C 1EZJA 5EK0A 5DM6V 2ATKC 1KP3A 1GKFA 4H33A 5LHGA 4KP4A 3G71V 3QO7A 4UUJC 3ZRVA 3D3IA 3ZCCA 3X2QB 1KD1W 4MVUA 3ABUA 3ZMZA 2WLNA 1V54C 2QEXV 4UV9A 1FXVA 4X8AA 5CBFA 4QPKA 4JAVA 3QNEA 5L3DA 1BL8A 2AHYA 2EINB 3LDEA 1N8RW 1H8EG 5CBGA 1SZTA 1NH2B 3AG2B 4RUFA 2AHZA 1WLEA 1H8HG 3CCJV 2CK3G 4XBFA 4MW8A 3CXCU 1K4DC 4MTXA 4J9ZB 3H01A 4R7CA 5LBQA 3OUSA 1ZWIC 2JIZG 1YTFB 3IC7A 1KP2A 3ZN0A 1W2BU 3T1CA 3K9AA 5H6QA 4R50A 3MHSC 2IH1C 1K7DA 1YIJV 4MT8A 1L1FA 2XAGA 4GX5A 3OEEG 2GSMB 1AJNA 1W0KG 3SYCA 1R6NA 1YTFD 2C2AA 1AI5A 2ZXWC 3W7TA 2DYSC 5B1NA 3T4DA 2OTJV 1K5SA 1E1QG 4HAMA 3JD2A 1XL4A 1K3EA 2EIJB 3AG1C 1K8AW 1S5HC 2DQ3A 4UVBA 2EJRA 1VQ5V 3VBBA 3HPLC 3OMAB 2W6JG 4QPJA 2HFEC 3E8HA 3QO8A 5BZBA 1R73A 1Y66A 3CCLV 3ASNB 1P4RA 5IYDO 1SRYA 2HKOA 4P9PA 4UV8A 3BY6A 4WCEV 2DWEC 4PELA 1NR1A 3E8GA 4FIPC 2IJJA 2W0FC 2B1IA 1M9NA 2XNDG 2PI4A 3VOUA 3JD4A 1OCZB 3OE7G 3JD1A 1J95A 5EBMC 2WLKA 4G2KA 4XDLA 3SYAA 1FS0G 2Y69B 3CP1A 3K0DA 4HYOA 2OTLV 5CN0A 4BAYA 4UVCA 1GMGA 3W7XA 2QTOA 1YHQV 3JD3A 2WPDG 1OZ0A 3EHBB 1F23A 5B1OA 4QIWF 4JGSA 2ITDC 3ABKC 1YJWV 1OCRB 4MSWC 5HFMA 1BHBA 1MG1A 1GK9A 2A0LA 4LCUC 3B77A 2V1DA 3OGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV A;  2HVK C;  2WLL A;  4QE9 A;  3RVZ A;  3WG7 C;  4UUJ C;  3LDC A;  3E8F A;  4GX0 A;  4MVU A;  3GB7 C;  2WLN A;  1V54 C;  2HVJ C;  2OCC C;  3SPC A;  3FB5 C;  1LNQ A;  3ABL C;  4QNH B;  4MTF A;  4JTC B;  2QKS A;  1OCC C;  4XDK A;  3SJQ C;  2KB1 A;  4LP8 A;  4X8A A;  1QLE C;  3EFF K;  2Q67 A;  4XDJ A;  5CBF A;  1BL8 A;  3RBZ A;  2AHY A;  4MVO A;  5B1A C;  5IY5 C;  3ABM C;  3LDE A;  3IFX A;  3AG2 C;  2WLI B;  2JK5 C;  4GX1 A;  5CBG A;  4PDM A;  4RUF A;  4PA7 A;  2AHZ A;  3LUT B;  3E86 A;  4PDV A;  3ASO C;  2A79 B;  2Y69 C;  2EIM C;  2BOB C;  4MW8 A;  1K4D C;  3AG4 C;  3JYC A;  4J9Z B;  4R7C A;  3UKM A;  3OUS A;  4MTO A;  1ZWI C;  4MVQ A;  4BW5 A;  4LBE C;  3T2M A;  4RUE A;  3OR7 C;  3ZRS A;  1M57 C;  3SPG A;  3T1C A;  4ZBM A;  4R50 A;  4DXW A;  2DYR C;  4PA6 A;  3SYQ A;  2EIJ C;  5EC1 C;  4JTD B;  2IH1 C;  2X6B A;  2BOC C;  5B1B C;  5EBW C;  2DWD C;  4GX5 A;  4R6Z A;  2Q69 A;  4MVR A;  4GX2 A;  3SYO A;  4P2Z A;  4WFG A;  1ORQ C;  3SYC A;  4EKW A;  2ZXW C;  4PA9 A;  3PJS K;  4F4L A;  2DYS C;  4MVS A;  4G27 B;  2P7T C;  4HZ3 A;  5E1A C;  3T4D A;  5B3S C;  2WLJ A;  1M56 C;  3RVY A;  4MVZ A;  1XL4 A;  3F7Y C;  3FB7 C;  4KFM A;  2WLI A;  3E83 A;  4H37 A;  3UM7 A;  3AG1 C;  4JTA B;  2WLH A;  2R9R B;  4MW3 A;  4QE7 A;  4TWK A;  1S5H C;  3IGA C;  4P9O A;  4RO2 A;  3FB8 C;  5J9P C;  2EIK C;  3F7V C;  3SPH A;  1OCZ C;  3OUF A;  3HPL C;  4G28 B;  4PA3 A;  4I9W A;  2HFE C;  3SPI A;  3E8H A;  4RAI A;  2X6A A;  1P7B A;  1R3L C;  2Q68 A;  3TCU A;  5BZB A;  2NLJ C;  3R65 A;  3STL C;  3STZ C;  4P30 A;  2A9H A;  2X6C A;  4PDL A;  3TET A;  4WFE A;  3RW0 A;  3FB6 C;  3OR6 C;  4P9P A;  4WFF A;  2DWE C;  2EIN C;  4MS2 A;  3E8G A;  2W0F C;  3K06 A;  4WFH A;  1XL6 A;  5KUM A;  3VOU A;  1J95 A;  5EBM C;  2Q6A A;  4J9Y B;  1R3I C;  4MVM A;  2WLK A;  3LNM B;  3K08 A;  4OXS A;  2ITC C;  4XDL A;  3SYA A;  4PA4 A;  5KUK A;  2ZD9 A;  3K0D A;  3E8B A;  4HYO A;  4CBC A;  1KKD A;  2EIL C;  2H8P C;  4X89 A;  3SPJ A;  4X88 A;  1R3K C;  5CBH A;  3T4Z A;  2QTO A;  1JVM A;  1OCR C;  3K0G A;  5EC2 C;  3K04 A;  3LDD A;  4MTG A;  3SYP A;  1G4Y B;  4PDR A;  2ITD C;  2WLL B;  3ABK C;  1V55 C;  4MSW C;  2WLM A;  1K4C C;  3E89 A;  3K03 A;  3ASN C;  3AG3 C;  4R8C A;  3F5W C;  3ZJZ A;  2HJF C;  2A0L A;  2IH3 C;  1OCO C;  3BEH A;  1R3J C;  3KG2 A;  4LCU C;  5EK0 A;  3X2Q C;  2ATK C;  5EBL C;  2HG5 C;  2K1E A;  3OGC C;  4H33 A; 
#chains in the Genus database with same CATH topology
 3WFV A;  2HVK C;  4DW0 A;  1QVG U;  5L3C A;  4X65 O;  4U7O A;  4EEQ A;  2QKS A;  1S76 D;  4CZZ A;  2EX3 A;  3EFF K;  2WSS G;  2PUS A;  1GM7 A;  1H2M A;  1ZLZ A;  1AI4 A;  5J2T B;  3BHP A;  2N05 A;  4JI4 B;  3AG4 C;  4BW5 A;  4MTO A;  3ZMT A;  1GN6 A;  1M57 B;  2DOS A;  2JDI G;  1A32 A;  1H2G A;  4PA6 A;  5JQG B;  1QQC A;  2HLD G;  4FVM A;  1GH6 A;  3CS5 A;  4J11 A;  1WB7 A;  3G67 A;  1WN7 A;  5B3S C;  1HWY A;  5EIB D;  4O2A B;  1IDS A;  3VQY A;  3CRA A;  3BPZ A;  3SPH A;  2UXN A;  1NR7 A;  1MMM A;  3TK1 A;  2X6A A;  3STL C;  3L70 H;  5IYB O;  2H94 A;  5FPR A;  1VP7 A;  4O4J B;  1JFF B;  5EZY B;  1N0J A;  2P06 A;  3ZBH A;  1N33 O;  3ZHU A;  5KHK A;  4JI3 B;  5GON B;  3K08 A;  1YEW A;  1HNX B;  3CEI A;  1EBO A;  1FFT B;  4FLZ A;  2ZD9 A;  3HR0 A;  4LR3 A;  3CJH B;  3WG7 B;  3K79 A;  1WP7 A;  2EJ7 A;  2QDO A;  3FYE B;  2Q0A A;  3SYP A;  1QCE A;  5B5E Z;  2V4D A;  1YI2 V;  2ADQ B;  4L87 A;  1B6Q A;  1K4C C;  1Y74 A;  1FPO A;  2VQE B;  2K1E A;  3CSX A;  2YEV A;  2RNB A;  3JCZ A;  4GYC B;  1S77 D;  3HKB A;  3GB7 C;  3A0R A;  3P3P A;  2ZIM A;  1SS3 A;  5H6R A;  1QLE C;  4O4H A;  4YJ2 A;  3D36 A;  3RBZ A;  3PN1 A;  5B1A C;  4Z1V A;  3I55 V;  5IYZ A;  1VF6 C;  1V54 B;  4PDV A;  2Y69 C;  1KB9 F;  2GTA A;  3RFR A;  3ZMV A;  1UJW B;  4DV5 B;  5LGU A;  1ROP A;  2ZQM A;  1FYJ A;  1FXK C;  2VWJ A;  1N33 B;  4LFB B;  1I94 B;  4PA9 A;  5FL7 G;  3AG7 A;  1URF A;  1M56 C;  2KKW A;  3ZHS A;  1MSW D;  1GM9 A;  1IBM B;  1G8M A;  2HR3 A;  2WLH A;  4B3S B;  4TWK A;  3TXQ A;  3AG1 B;  2UUA O;  1YIT V;  4TQF A;  4PA3 A;  4JYY A;  1RPO A;  4N21 A;  4DR5 B;  1K92 A;  2X6C A;  2VWK A;  4ZOL A;  1VIB A;  4WFF A;  1VQL V;  3ZED A;  3LNN A;  1N36 B;  3Q4H B;  1OCC B;  2Q6A A;  4J9Y B;  4DUZ O;  3CD6 V;  3O9O A;  3ML0 A;  4PA4 A;  3CCM V;  3K5M A;  5H2F Z;  2MK3 A;  4DR4 O;  1VF6 A;  4NKG B;  4BR6 A;  3NR7 A;  3J80 N;  1YCI A;  4J10 A;  2WAM A;  2HHH B;  1JX9 A;  3N27 A;  4U7N A;  4L8J A;  4JAS A;  3X2Q C;  3CCV V;  1VQK V;  3OMI B;  4QE7 A;  1VQO V;  5IT9 N;  4N23 A;  4JI2 B;  4CC5 A;  2HP8 A;  3C3S A;  1YXB A;  2PZS A;  4GLX A;  5IYZ B;  1THZ A;  4MTF A;  3DC5 A;  4XDK A;  3E2E A;  4JAA A;  2FTK A;  2QA4 V;  1N0N A;  3N2G B;  1LR1 A;  1RM1 B;  1P7G A;  4PA7 A;  3ABL B;  2EIL B;  4PI2 A;  2EIM C;  4LF6 O;  2BOB C;  4O2B B;  3RWR D;  4X9Q A;  1M1K W;  4K8Z A;  1Q6U A;  2ZCE A;  1SF9 A;  4LF7 B;  2P6J A;  5B1B C;  2NNU A;  2DYS B;  2QWO B;  1VQ9 V;  4FJC C;  2UUB O;  5K1X A;  1AI6 A;  4MVZ A;  3CJH A;  4X20 B;  1T5E A;  4UVA A;  1IXM A;  4P9O A;  3ASO B;  4FK5 C;  1FD9 A;  2QM8 A;  3K3W A;  4DV2 B;  4YJ3 A;  4ZHQ A;  2ETN A;  3H1I H;  1EFR G;  3FB6 C;  1QVF U;  4DUY O;  3L72 H;  1SER A;  1KUQ A;  3OFN G;  1R3I C;  2R9I A;  2ZIO A;  3MD0 A;  4JI6 O;  4J7Z A;  4K35 A;  4X88 A;  2YXY A;  3T4Z A;  1YZB A;  2Q7E A;  3OTO O;  1IBL B;  3K04 A;  4MTG A;  2YIB D;  3UO2 A;  2WLL B;  4FLW A;  1GN2 A;  2K9P A;  2WLM A;  3N2K B;  3K03 A;  5H5N A;  3ASN C;  5KMG B;  3THO A;  3BFR A;  4O4I B;  4B3R B;  3G71 V;  1IUR A;  3TGU H;  3D3Q A;  3D3I A;  2PYL A;  1KKC A;  3U10 A;  4B3T O;  4B3R O;  1Y6X A;  4X62 B;  2FL4 A;  1BL8 A;  1US6 A;  2EIN B;  1N8R W;  5EIB C;  1SZT A;  2FYU H;  4RUF A;  5DEC A;  1XMO B;  1UFI A;  2CK3 G;  2OYQ A;  4MW8 A;  5FNV A;  4J9Z B;  3VQX A;  3MAQ A;  3BA9 A;  5JJE B;  3ZN0 A;  3HKD B;  3K9A A;  2UUB B;  4AHC A;  1SQF A;  2A7W A;  1YIJ V;  4MT8 A;  4FZ0 A;  2GSM B;  1AJN A;  3OGI B;  2PF4 E;  1AI5 A;  3H1H H;  5J2U A;  1XL4 A;  1K3E A;  5KHI A;  4LFA B;  5K1P A;  4X1K A;  2LJ2 A;  2HFE C;  1Y66 A;  4D6T H;  4Q6G A;  4NXM B;  3ASN B;  1P4R A;  4P9P A;  4UV8 A;  1TUB A;  1NR1 A;  2ZIN A;  2W0F C;  2E76 B;  2B1I A;  3JAL B;  3VOU A;  1OCZ B;  1J95 A;  4B3T B;  2WLK A;  2CTR A;  3A0H Z;  1ZSP A;  4UB8 Z;  3DXR B;  4IHJ B;  2UXD B;  3EVK A;  1YHQ V;  1NTK H;  1NZ6 A;  3D36 C;  5KMG A;  1OZ0 A;  3EHB B;  2PYJ A;  5LMU O;  1RSO A;  2ITD C;  4O2B A;  2O57 A;  5HFM A;  4LF9 O;  2BTO A;  2Q8V A;  3B77 A;  1Z2G A;  4DV7 B;  4UFZ A;  1SKV A;  5LGT A;  1MOF A;  3HKE B;  3ZMU A;  2DW4 A;  2F43 G;  2XOK G;  2OCC C;  2DQ0 A;  1HW7 A;  3ABT A;  2CTQ A;  1SA0 A;  2GUZ B;  4JV5 B;  4IT5 A;  2P67 A;  4DV3 B;  1FXK A;  1CPY A;  4FFK A;  1ARO P;  3LSS A;  5IY5 C;  5BXZ A;  3QG5 A;  2LGW A;  5B66 Z;  1MAB G;  1I0H A;  4RUE A;  4YXW G;  5LMN O;  3ZRW B;  4WFA V;  2A3Q A;  2F66 C;  5LA6 A;  2XAS A;  4FFB A;  1XNR O;  4R6Z A;  3B8M A;  4DK0 A;  1NVP B;  4F4L A;  4G27 B;  5HFL A;  1VQP V;  4DV0 B;  4TOI A;  4I4T B;  3ZMS A;  4DR3 B;  1M90 W;  5CB4 A;  2DYR B;  1RFY A;  2UXD O;  4JTA B;  5F2V O;  4DO2 A;  3J81 N;  3F7V C;  3BAA A;  1VQ4 V;  3OUF A;  2FKX A;  4K0K B;  2QM7 A;  3I5D A;  1I08 A;  4LF6 B;  1N36 O;  3CRQ A;  4LNU A;  3OEH G;  3OR6 C;  2IU3 A;  3E22 B;  2IJH A;  4DR1 B;  1Y4M A;  4DR4 B;  1XBL A;  5IDJ A;  5DED A;  3MHH C;  3BRC A;  1XQ8 A;  1WPB A;  1KKD A;  4X1Y B;  1LUW A;  2GBO A;  2H8P C;  4WFB V;  3CPW U;  1R3K C;  3SR2 C;  2CUG A;  4PJ0 Z;  2NN4 A;  5IY5 B;  2MW2 B;  4ICG A;  3HKE A;  4I9Q A;  3ZJZ A;  3ZN1 A;  3CMA V;  3F5W C;  2HJF C;  1BS3 A;  1Q82 W;  4JV5 O;  1VQN V;  4YY3 B;  3VQW A;  3RYF A;  1FJG O;  3CC7 V;  3ZHQ A;  3GVM A;  4NTY A;  4GX0 A;  4FLT A;  1YDX A;  3ZS8 C;  3L75 H;  1GRJ A;  1PNL A;  3BA8 A;  2UXC B;  3C90 A;  4CH5 A;  5JJN B;  2XHB A;  1U97 A;  4MVO A;  3B8N A;  4LH7 A;  4GX1 A;  2ZR3 A;  4DV5 O;  1VQ7 V;  4X1K B;  1JFF A;  1H2L A;  1Y76 B;  2A79 B;  4IIJ A;  4ZI7 B;  1WAZ A;  1BCC H;  2PY5 A;  1HNW O;  4TUY B;  2DWD C;  1W0J G;  3JSN A;  2JJ1 G;  5EZY A;  2OT5 A;  1GN4 A;  4X62 O;  1QLE B;  3DXR A;  2P22 C;  3IGA C;  1BSM A;  4JI4 O;  3ETE A;  1TA8 A;  2E5L O;  2XAQ A;  5CA0 A;  2CAZ C;  3JAR B;  1P7B A;  5KA5 A;  4PDL A;  5EYP A;  1M5I A;  3WU2 Z;  3H9V A;  4WFH A;  4DV2 O;  3FFQ A;  4KUM A;  1KQS U;  1O9G A;  4AIL C;  4NYK A;  3LNM B;  4UCV A;  3W7U A;  2AZ2 A;  3ETD A;  4CBC A;  1OCO B;  4LF4 B;  4X89 A;  4FFB B;  3K0G A;  4AI8 A;  4YY3 O;  4PDR A;  2UUC B;  2GV9 A;  3OMN B;  1ZUQ A;  3OTF A;  1U96 A;  1D5A A;  5KAI Z;  1X4T A;  4EFB A;  4QNH B;  3K59 A;  1JOY A;  4JYC A;  2QKC A;  1JJO A;  1Q3E A;  2JVD A;  4ZOL B;  2ADP A;  4GKJ B;  2ZDI A;  2F23 A;  2YS8 A;  4K3A A;  2ZM6 O;  4EB6 B;  1Y74 B;  2QSA A;  3B40 A;  5LMU B;  3C3T A;  3T1Y O;  4NXN B;  4UXN A;  1M57 C;  5FPO A;  3IAY A;  3ETQ A;  3AG4 B;  1XNQ B;  2W0X A;  2EIJ C;  5BR8 B;  4JTD B;  5CA3 A;  1HDJ A;  1MZE A;  1K34 A;  1RPR A;  1I7F A;  3ZHR A;  4JZG A;  3SYO A;  3AK1 A;  4DW1 A;  5B1A B;  4EKW A;  1BT8 A;  2X0L A;  2JS3 A;  3JAT B;  2ZDI C;  2P5O A;  5LHI A;  1KMI Z;  1Q7Y W;  2WLI A;  2D3O W;  3G4S V;  1PKX A;  3OTO B;  3FB8 C;  2ZT9 B;  5J9P C;  1Z5W A;  3B2E E;  4E2L A;  3OM3 B;  2UUC O;  4O4L A;  1MSD A;  2Q68 A;  4H0L B;  3R65 A;  3AK3 A;  4OX9 B;  3BCC H;  5ITZ B;  3WB1 A;  3CC2 V;  5IJ9 B;  4IIJ B;  1VQM V;  4MVM A;  1IBL O;  3DSQ A;  1LUV A;  3RYI B;  2EIM B;  2EIL C;  4WF9 V;  1WNS A;  1K5Q A;  1KC8 W;  2Y0I A;  1XHZ A;  1OCR C;  1TAE A;  2BTQ B;  2UUA B;  1BHA A;  3WB2 A;  3HKC B;  1TVK B;  1DTO A;  2PGG A;  4R8C A;  5LGN A;  1M4U A;  1PPJ H;  5EK0 A;  1N32 B;  1KP3 A;  3LSU A;  1XOU A;  3Q4H A;  4KP4 A;  3L71 H;  4UUJ C;  2CTW A;  4DR1 O;  3R66 A;  3ZCC A;  1KD1 W;  3X2Q B;  2QEX V;  3BAB A;  4MVU A;  3ZMZ A;  1S5L Z;  4U3F H;  4GKJ O;  2OIE A;  4UV9 A;  3JAR A;  1VF7 A;  5CA0 B;  1FXV A;  4FLU A;  4X8A A;  1G6U A;  5L3D A;  2EUL A;  3QNE A;  3LDE A;  5CBG A;  4DK1 A;  4XBF A;  5LBQ A;  3H01 A;  4KHP O;  3N2G A;  2JIZ G;  5LYJ A;  4DR6 B;  3B4S A;  4U3J B;  3L73 H;  2IH1 C;  3O65 A;  2F4V O;  1L1F A;  4GX5 A;  1YTF D;  1HNZ B;  2OTJ V;  4NTW A;  1E1Q G;  3CB2 A;  1R1B A;  2EIJ B;  3AG1 C;  4FM2 A;  3RYC B;  2VS0 A;  3CX5 F;  2D2C B;  1VQ5 V;  3HPL C;  2GDS A;  3OMA B;  2W6J G;  1AVM A;  5BZB A;  1R73 A;  3CCL V;  3L9D A;  4W4K A;  4B7E A;  4WCE V;  4PEL A;  3E8G A;  2IJJ A;  1SQG A;  1SQV H;  2XND G;  2UXB B;  4C7U A;  3JD4 A;  2WA3 A;  5EBM C;  1I94 O;  5FNV B;  2Y69 B;  3CP1 A;  3K0D A;  2YID A;  3RN4 A;  4I0X B;  1JR9 A;  2RQ6 A;  1F23 A;  5B1O A;  4EB6 A;  3ABK C;  1YJW V;  1OCR B;  4MSW C;  1GK9 A;  1KBH A;  2A0L A;  1DLB A;  2WLL A;  4QE9 A;  4CH6 A;  4LFC B;  3UT5 A;  1LNQ A;  2JGD B;  1K73 W;  2B1G A;  4O4I A;  3SJQ C;  3CCR V;  4TV8 A;  5JVD A;  3CCU V;  4WBN A;  2AW9 A;  3A0B Z;  5IJ9 A;  1SES A;  2KQX A;  4LF5 O;  2YI9 A;  1QHT A;  4FZ1 A;  3JAM N;  3KZI Z;  2YIB A;  3T2M A;  3OR7 C;  2KSD A;  4JI0 B;  4KL1 A;  3CWB H;  4GZR B;  1Q43 A;  5ITZ A;  2CDY A;  2LP7 A;  3NXS A;  3W7W A;  3PJS K;  3SJA C;  4CS4 A;  3FB7 C;  5J2T A;  1AR5 A;  2LGQ A;  4H37 A;  2R9R B;  2Q7G A;  2QM4 A;  3D8C A;  5JCO C;  2EBO A;  2P4K A;  1MZF A;  4IYH A;  4DUY B;  1XDC A;  5J2U B;  3JSL A;  1AI7 A;  1H2N A;  2B5U A;  2UXB O;  3HKD A;  4YHH B;  3STZ C;  2RN9 A;  1BZK A;  4B7K A;  4P30 A;  2ARH A;  2QE7 G;  3RW0 A;  1V55 B;  2LW1 A;  4JI2 O;  4ASU G;  1N34 O;  3E35 A;  5KUM A;  2IU0 A;  1CXZ B;  1SET A;  2P4V A;  2JEU A;  1KU9 A;  1GM8 A;  2ZE7 A;  2ITC C;  3J7A U;  1O9H A;  3CRM A;  3TXS A;  1JVM A;  1VF5 B;  3FKS G;  2ZKO A;  3CXH F;  1QR8 A;  2UXX A;  5JWP A;  3SGI A;  2LFR A;  5JCO A;  2AZ0 A;  2RCV A;  3P30 A;  4TT3 G;  4LF4 O;  2JEX A;  4IHJ A;  1TUB B;  4OPA A;  1OCO C;  1X59 A;  3KG2 A;  3QTC A;  1PD3 A;  2P90 A;  1PNK A;  2XAJ A;  3LDC A;  1TGO A;  3P32 A;  2HVJ C;  3SPC A;  3FB5 C;  2PI5 A;  5C8Y A;  1KEC A;  5IWA O;  4CS3 A;  2DE0 X;  3RYC A;  4PDM A;  5L3F A;  4B3S O;  4I5S A;  3LUT B;  5DN6 G;  4JI8 B;  4CC6 A;  1HNW B;  1SQP H;  1BE3 H;  2Z5U A;  5IE9 A;  2Q9L A;  2JJ2 G;  1TUE B;  4ZBM A;  4FPP A;  2DYR C;  2H3O A;  1Q5O A;  2YEV B;  2DN9 A;  2YXH A;  2ZR2 A;  2GUZ A;  4TV9 A;  3ZRW A;  4NB5 A;  4X64 B;  4DV6 O;  1ORQ C;  5L3G A;  3MDS A;  3JD0 A;  1VQ8 V;  4JI5 O;  3BVO A;  5E1A C;  1XEQ A;  1BGY H;  3RYH A;  2E5L B;  2AXT Z;  4JI1 O;  4DV6 B;  3FYI B;  3CC4 V;  1XMO O;  3UT5 B;  1FFX A;  4JI5 B;  4I55 A;  5LOV B;  1EZV H;  4I9W A;  4IL6 Z;  5A9G A;  2GHY A;  3SPI A;  3OW2 U;  2ZE6 A;  1XRE A;  4TSF G;  1AJP A;  2ZXW B;  5CMU A;  4D7T A;  4HNA A;  4IYI A;  2WA4 A;  3K57 A;  3GWK C;  4OX9 O;  2Z0A A;  4ZI7 A;  4DV4 B;  3SDL A;  3LSQ A;  1FXH A;  2YIA A;  5KX5 B;  2BCC H;  4BWA A;  1OV9 A;  2QR4 A;  4RQE A;  4CH3 A;  3H1K H;  3APQ A;  1SZX A;  2CE4 A;  2CTP A;  3UCS C;  1Y76 A;  3TJT A;  3ZX6 A;  5L3E A;  3JAW A;  5BMV B;  2CH7 A;  1YVW A;  1NQT A;  2HG5 C;  5BY1 A;  3G80 A;  4DRX A;  3ZHT A;  1VMG A;  2OWO A;  1GN3 A;  1JCH A;  3APO A;  2KB1 A;  2Y4U A;  1W59 A;  4DV1 B;  3K5L A;  3JAS B;  1RM1 C;  1KYO F;  2QWQ B;  4Z1M G;  1EM1 A;  3P3N A;  5JH7 B;  5BR8 O;  1NTM H;  1EN4 A;  1Z5V A;  4UB6 Z;  2QKA A;  1AJQ A;  4GKK O;  3ZRS A;  4QJF B;  4I50 B;  4JYB A;  3JAK A;  5EC1 C;  3RYH B;  2BOC C;  2X6B A;  4KHP B;  1EN5 A;  3W7S A;  3ABM B;  3U11 A;  1NH2 D;  2M7W A;  1OHH G;  4JI6 B;  3OT7 A;  4DV4 O;  1AB3 A;  1HR0 O;  4DR2 B;  2E75 B;  5FLX N;  2F93 B;  3CCQ V;  2GTS A;  2Q7H A;  4RO2 A;  5LP6 A;  3K5O A;  3ZIA G;  4DR3 O;  4RAI A;  3T1H B;  3F5T A;  3N2K A;  1CP9 A;  3TET A;  4BW9 A;  3OD4 A;  3DGE A;  2EIN C;  3H1L H;  1COW G;  4LC1 A;  1H38 A;  1IZ3 A;  2IW5 A;  1Q81 W;  4LF8 O;  2BSK B;  5C8Y B;  1F4M A;  1DF5 A;  1F4N A;  2XAH A;  2WWW A;  4LF9 B;  1M56 B;  4ABM A;  3LDD A;  4JI7 O;  1G4Y B;  2XAF A;  3U0Z A;  5C93 A;  3CYO A;  1QR9 A;  5EYP B;  1NJI W;  3E89 A;  4GKK B;  3AG3 C;  4ZHQ B;  3JAT A;  3L74 H;  2IH3 C;  1SQX H;  5DM6 V;  2ATK C;  3G6B A;  2Y0P A;  1Q6H A;  5LHG A;  2QWP B;  3QO7 A;  2QTS A;  3ZRV A;  5KHH A;  2IM9 A;  2B9Z A;  4LFB O;  4NR1 A;  1IBK O;  4FLX A;  4QPK A;  4JAV A;  1WJZ A;  1XMQ B;  4J41 A;  1H8E G;  4KXR A;  1ZX3 A;  4JI0 O;  3QVN A;  2UXC O;  1H8H G;  4E4E A;  4K0K O;  4MTX A;  5CA1 B;  3OUS A;  1ZWI C;  3RT3 C;  1P84 F;  1YTF B;  4UCT A;  3IC7 A;  1KP2 A;  1EN6 A;  3T1C A;  1BQZ A;  5H6Q A;  2R72 A;  5KX5 A;  1SQQ H;  2DMX A;  1K7D A;  2Q0O C;  2XAG A;  3OEE G;  4O2A A;  1W0K G;  2BTQ A;  1R6N A;  2C2A A;  2ZXW C;  3HKC A;  3W7T A;  2DYS C;  5B1N A;  1XHX A;  1NU1 H;  3T4D A;  4LF7 O;  3JAW B;  1WA8 B;  3JD2 A;  1ZL8 B;  3QF7 A;  3T1H O;  3RYI A;  1IX9 A;  4PHZ A;  2ZNJ A;  4DRX B;  1K8A W;  2DQ3 A;  4UVB A;  2EJR A;  4YIP A;  2L35 A;  2KG7 B;  3E8H A;  2ODM A;  1TVK A;  3T1Y B;  4NXN O;  2BSK A;  2HKO A;  5IJ0 A;  5LL6 Y;  2DWE C;  4FIP C;  4O4L B;  4QGP A;  3K9S A;  3OE7 G;  2FB5 A;  3HKB B;  5AG2 A;  3SYA A;  1Q8I A;  4HYO A;  2OTL V;  1IVS A;  5CN0 A;  4BAY A;  4U3J A;  4K8X A;  2QTO A;  2LO1 A;  3JD3 A;  4OPH A;  1B06 A;  4QIW F;  4JGS A;  4H44 B;  4GUN A;  4LFC O;  3ICX A;  1BHB A;  4NXM O;  2ZE5 A;  1IBK B;  1D2D A;  4O4J A;  3OGC C;  3JAK B;  2Z3Y A;  4J7J A;  1XNR B;  1NKD A;  5GON A;  3E8F A;  4AQY O;  2HHH O;  4JTC B;  1FKA O;  1OCC C;  1JMK C;  4DV0 O;  2Y48 A;  2QWR B;  4HBN A;  3M7M X;  5JJJ B;  5CB4 B;  4FM1 A;  2JK5 C;  3DC6 A;  1CEZ A;  2OCC B;  2XTA A;  3HB3 B;  3ASO C;  1S0V A;  5KAF Z;  2YDE A;  4MVQ A;  1VEW A;  4LBE C;  2RDC A;  4LNU B;  5IYC O;  2FML A;  1NTZ H;  4DXW A;  4GT1 A;  1N34 B;  4DV7 O;  3H1J H;  1JQ0 A;  4YIO A;  1UPG A;  4O4H B;  1IXB A;  5B1B B;  4EFE A;  1FXK B;  4F6E A;  4DV3 O;  2V7Q G;  1BQ0 A;  3F7Y C;  4X1Y A;  4KFM A;  2EIK B;  3AEI A;  4JAU A;  3EXA A;  4ZIB A;  1GAX A;  4D7S A;  4MW3 A;  2F1M A;  4NTX A;  2EIK C;  4I0X A;  1QBZ A;  1OCZ C;  5LYJ B;  3AG3 B;  4FMT A;  1V9P A;  2JGD A;  4YJ2 B;  1XIL A;  2NLJ C;  3OAA G;  2LQT A;  1M93 A;  3FD9 A;  2X7R B;  4WFE A;  4B08 A;  4MS2 A;  4Q20 A;  4J7K A;  1XI1 A;  4J80 A;  2AGA A;  2VRZ A;  1L8D A;  2YUA A;  1K33 A;  1PM9 A;  1DK1 A;  5LXT B;  3CHX A;  1GO3 F;  1NBM G;  1HR0 B;  2ZNI A;  5CBH A;  1Y67 A;  5JVD B;  2EZP A;  4B3M B;  3WB0 A;  1YJ9 V;  4LFA O;  5H9C A;  2NR5 A;  4X65 B;  1ZL8 A;  2PTM A;  1R3J C;  5EBL C;  3ZHV A;  3WG7 C;  3KCY A;  5L3B A;  1K97 A;  1PL0 A;  3CME V;  2ZE8 A;  1J5E B;  3ZRX A;  2YIC A;  4JI8 O;  2Q67 A;  5TIS Z;  1WA8 A;  1JA8 A;  3ABM C;  3IFX A;  2YC0 A;  3AG2 C;  5IJ0 B;  1AR4 A;  1DGS A;  2F95 B;  1S5J A;  1PV0 A;  4LWS A;  2HJD A;  4JI7 B;  1YSC A;  1AIL A;  1YJN V;  1ENV A;  4JPR A;  2KG7 A;  4WBN B;  3JYC A;  1HP8 A;  3SPG A;  1HNZ O;  4YJ3 B;  1VQ6 V;  4PV1 B;  4LH6 A;  2W6I G;  1NT2 B;  4W4L A;  1FJG B;  3G6E V;  5EBW C;  1I5Y A;  5B3S B;  1YF2 A;  2Q69 A;  4MVR A;  3AK2 A;  4P2Z A;  1L0N H;  4PD4 F;  4WFG A;  1QLN A;  4TV8 B;  4MVS A;  1Q90 D;  2YSU B;  4F6R A;  2P7T C;  4HZ3 A;  5GTI Z;  4DV1 O;  3E83 A;  2IBZ H;  2JGU A;  1NVP D;  4BIZ A;  1AR1 B;  1K9M W;  2Q73 A;  4LF5 B;  1NS1 A;  4G28 B;  3B09 A;  2E3C A;  4DR2 O;  3JCU Z;  1QNM A;  1PP9 H;  4A5U B;  4CS2 A;  3K06 A;  4TUY A;  3KKY A;  5GW7 A;  3CRR A;  5E79 Z;  4OXS A;  1NI8 A;  4JZ2 A;  2IJI A;  3CRC A;  3E8B A;  1AP6 A;  1R6K A;  3SPJ A;  4FM0 A;  2OCH A;  1F7Y A;  2YI8 A;  1ZAU A;  3DTU B;  4JI3 O;  2VQE O;  4LF8 B;  1Q86 W;  1V55 C;  4X20 A;  1P49 A;  4DR5 O;  3BEH A;  4J42 A;  3QO5 A;  1GTO A;  4RQF A;  2DJV A;  4Z2W A;  2BE3 A;  1S72 V;  3RVZ A;  4JF3 A;  4X1I B;  5LHH A;  4ZKI A;  3ABL C;  4I55 B;  4LWS B;  1PNM A;  4LP8 A;  2LFS A;  4XDJ A;  5D5Q A;  1WP8 A;  2EZO A;  2WLI B;  5LMN B;  4DR6 O;  5LP6 C;  2HEP A;  1RP3 B;  2QGN A;  3E86 A;  2Q4P A;  1F51 A;  1Q6I A;  2R70 A;  4BIO A;  4HNA B;  1FFX B;  3UKM A;  5LOV A;  1VAR A;  4F6R B;  3SYQ A;  1IBM O;  4GX2 A;  4X66 B;  3SJB C;  2RMK B;  3JAL A;  4FLV A;  1DF4 A;  3RGB A;  5LXT A;  2Y4T A;  2WLJ A;  3RVY A;  1SC5 B;  4BIU A;  3UM7 A;  3M99 B;  3I56 V;  1E1R G;  1S3J A;  1I5X A;  4TQD A;  3CCS V;  2ZM6 B;  5KHJ A;  5A2Q N;  1E79 G;  5GTH Z;  3UQ8 A;  3TCU A;  1R3L C;  2OIG A;  1RSO B;  4H13 B;  3A8T A;  2A9H A;  1MA1 A;  3ABK B;  5JQG A;  4TV9 B;  4FLY A;  5BMV A;  2CH7 B;  1XL6 A;  1ZTE A;  2JRI A;  1D5N A;  3K58 A;  3UO3 A;  3FAV A;  4X64 O;  4CH4 A;  2CGN A;  3K5N A;  1QU7 A;  4I7Z B;  5KUK A;  1XMQ O;  4GCZ A;  4JI1 B;  2G38 A;  2IJK A;  3ETG A;  2N74 A;  5EC2 C;  3CCE V;  4DUZ B;  1MNG A;  3IJ4 A;  1G1X B;  1BMF G;  1L0L H;  3GWO A;  2Q5Z A;  2QJ1 A;  5KA6 A;  2UU9 B;  2XUM A;  4JYA B;  1WPX A;  1JJ2 U;  1JPX A;  1PL4 A;  1EZJ A;  1SA0 B;  4RWU A;  2XT9 A;  1GKF A;  4H33 A;  4I50 A;  5D5P A;  1R6T A;  1H2S B;  2A06 H;  2YXL A;  3S3X A;  3ABU A;  4JYA O;  2WLN A;  1V54 C;  4X66 O;  2VQF O;  1N4C A;  5CBF A;  4DYL A;  2AHY A;  1B3Q A;  4AQY B;  1NH2 B;  3AG2 B;  2AHZ A;  1WLE A;  5IWA B;  3CCJ V;  2R9A A;  3CXC U;  1K4D C;  2JS5 A;  2L6L A;  4R7C A;  1XUQ A;  5LA6 B;  1W2B U;  4DR7 B;  4UCU A;  4R50 A;  5JH7 A;  1N32 O;  4UCR A;  1FAF A;  3MHS C;  4I4T A;  4UCO A;  2E74 B;  4NVP A;  3E22 A;  3SYC A;  2N04 A;  1J5E O;  4DR7 O;  4PI0 A;  1XNQ O;  3JAS A;  1K5S A;  4HAM A;  4YHH O;  3S3W A;  4X1I A;  1S5H C;  4OGQ B;  1B04 A;  3VBB A;  4QPJ A;  1WB8 A;  3QO8 A;  5KHG A;  2UU9 O;  4UCS A;  3FAV B;  5LP6 B;  5IYD O;  2RJZ A;  1SRY A;  3BY6 A;  3M8A A;  1AP5 A;  1M9N A;  3VQV A;  2F4V B;  2PI4 A;  3IC9 A;  3JD1 A;  2VQF B;  2QWN B;  2CGO A;  4G2K A;  4XDL A;  5CA1 A;  1FS0 G;  4UVC A;  1GMG A;  3CE2 A;  3W7X A;  2ILM A;  1H2K A;  5KLV H;  2WPD G;  3SJC C;  2M6Y A;  3A2F A;  4IGG A;  1HNX O;  3RYF B;  2LW7 A;  1SQB H;  3FX7 A;  1MG1 A;  4B3M O;  4LCU C;  2V1D A;  1OJH A;  3KCX A; 
#chains in the Genus database with same CATH homology
 3WFV A;  1DLB A;  2HVK C;  2WLL A;  4QE9 A;  2Z3Y A;  5LGT A;  1MOF A;  1NKD A;  1QVG U;  3E8F A;  3ZMU A;  2DW4 A;  5L3C A;  2F43 G;  2XOK G;  2OCC C;  2DQ0 A;  3ABT A;  4U7O A;  1LNQ A;  1K73 W;  2B1G A;  4JTC B;  2QKS A;  1OCC C;  1S76 D;  3SJQ C;  4CZZ A;  2P67 A;  3CCR V;  3EFF K;  1FXK A;  2WSS G;  2Y48 A;  1CPY A;  1GM7 A;  1ARO P;  3LSS A;  5IY5 C;  3CCU V;  1AI4 A;  2JK5 C;  1SES A;  1CEZ A;  2OCC B;  3HB3 B;  1MAB G;  3ASO C;  1S0V A;  3AG4 C;  4BW5 A;  4MTO A;  4MVQ A;  3ZMT A;  4LBE C;  1M57 B;  4RUE A;  3OR7 C;  4YXW G;  3T2M A;  3ZRW B;  4WFA V;  5IYC O;  2JDI G;  4DXW A;  1H2G A;  4PA6 A;  4GT1 A;  2HLD G;  2XAS A;  1JQ0 A;  2LP7 A;  4R6Z A;  3B8M A;  1NVP B;  3NXS A;  3W7W A;  3PJS K;  5B1B B;  4F4L A;  4G27 B;  5HFL A;  1VQP V;  1FXK B;  5B3S C;  2V7Q G;  3ZMS A;  3FB7 C;  3F7Y C;  1M90 W;  4KFM A;  2EIK B;  4H37 A;  1HWY A;  3AEI A;  2DYR B;  4JAU A;  4JTA B;  2R9R B;  4MW3 A;  4DO2 A;  2EBO A;  2EIK C;  3F7V C;  3SPH A;  1QBZ A;  1VQ4 V;  1OCZ C;  2UXN A;  3OUF A;  1NR7 A;  1AI7 A;  2QM7 A;  3AG3 B;  4FMT A;  3TK1 A;  2X6A A;  2B5U A;  2NLJ C;  3STL C;  3STZ C;  3OAA G;  4P30 A;  2X7R B;  2QE7 G;  4WFE A;  3RW0 A;  3OEH G;  1V55 B;  5IYB O;  3OR6 C;  2H94 A;  4ASU G;  2IU3 A;  4MS2 A;  4Q20 A;  3E35 A;  2IJH A;  5KUM A;  2IU0 A;  1Y4M A;  1SET A;  2JEU A;  5IDJ A;  1K33 A;  3MHH C;  3K08 A;  1GM8 A;  2ITC C;  1EBO A;  1FFT B;  1GO3 F;  2ZD9 A;  3WG7 B;  1NBM G;  1KKD A;  3K79 A;  4WFB V;  2H8P C;  3CPW U;  5CBH A;  1R3K C;  2EZP A;  1JVM A;  3FYE B;  3FKS G;  1YJ9 V;  1QR8 A;  2UXX A;  1QCE A;  3SYP A;  2LFR A;  5IY5 B;  1YI2 V;  4L87 A;  5H9C A;  3P30 A;  1B6Q A;  4TT3 G;  1K4C C;  2JEX A;  3ZJZ A;  3ZN1 A;  3CMA V;  3F5W C;  2HJF C;  1OCO C;  1Q82 W;  1R3J C;  3KG2 A;  1PD3 A;  5EBL C;  2P90 A;  2K1E A;  1VQN V;  2YEV A;  1PNK A;  3JCZ A;  2XAJ A;  3WG7 C;  5L3B A;  3CC7 V;  3LDC A;  1S77 D;  1K97 A;  4GX0 A;  3P32 A;  3GB7 C;  2HVJ C;  3A0R A;  3SPC A;  1PL0 A;  3CME V;  3FB5 C;  1PNL A;  3ZRX A;  5H6R A;  2PI5 A;  1QLE C;  1KEC A;  2Q67 A;  3D36 A;  3RBZ A;  4MVO A;  5B1A C;  3B8N A;  3ABM C;  3IFX A;  3AG2 C;  3I55 V;  4GX1 A;  2ZR3 A;  4PDM A;  5L3F A;  4I5S A;  3LUT B;  5DN6 G;  1VQ7 V;  1V54 B;  4PDV A;  1YSC A;  1YJN V;  1ENV A;  2A79 B;  2Y69 C;  4JPR A;  3JYC A;  2Z5U A;  3ZMV A;  2JJ2 G;  3SPG A;  1TUE B;  4ZBM A;  4FPP A;  1UJW B;  1VQ6 V;  2DYR C;  2YEV B;  2W6I G;  5LGU A;  3G6E V;  1ROP A;  5EBW C;  2ZR2 A;  1I5Y A;  2ZQM A;  2DWD C;  1FXK C;  5B3S B;  2Q69 A;  4MVR A;  3ZRW A;  4P2Z A;  1W0J G;  1ORQ C;  4WFG A;  5L3G A;  1QLN A;  2JJ1 G;  3JD0 A;  1VQ8 V;  4PA9 A;  4MVS A;  2OT5 A;  2YSU B;  5FL7 G;  2P7T C;  4HZ3 A;  5E1A C;  1M56 C;  1QLE B;  3E83 A;  1MSW D;  1GM9 A;  1G8M A;  2HR3 A;  2WLH A;  1NVP D;  4BIZ A;  4TWK A;  1AR1 B;  3FYI B;  3CC4 V;  3AG1 B;  3IGA C;  1K9M W;  1YIT V;  3ETE A;  4G28 B;  4PA3 A;  4I9W A;  2XAQ A;  2GHY A;  3SPI A;  3OW2 U;  1RPO A;  1P7B A;  4N21 A;  4TSF G;  5KA5 A;  1K92 A;  4PDL A;  2X6C A;  1AJP A;  2ZXW B;  4WFF A;  5CMU A;  1VQL V;  3K06 A;  4WFH A;  5GW7 A;  4KUM A;  1KQS U;  1OCC B;  2Q6A A;  4J9Y B;  3LNM B;  4OXS A;  3CD6 V;  3W7U A;  2IJI A;  3ETD A;  3ML0 A;  4PA4 A;  3CCM V;  4CBC A;  3E8B A;  1OCO B;  3LSQ A;  1FXH A;  1R6K A;  2MK3 A;  4X89 A;  3SPJ A;  3DTU B;  3K0G A;  1Q86 W;  4RQE A;  4PDR A;  1V55 C;  2WAM A;  3OMN B;  5L3E A;  1JX9 A;  4U7N A;  3BEH A;  4JAS A;  3X2Q C;  3CCV V;  1VQK V;  3OMI B;  1GTO A;  1NQT A;  3QO5 A;  2HG5 C;  4QE7 A;  4RQF A;  1VQO V;  1S72 V;  4N23 A;  3RVZ A;  4JF3 A;  5LHH A;  4ZKI A;  1THZ A;  3ABL C;  4QNH B;  4MTF A;  1JCH A;  1PNM A;  4XDK A;  3E2E A;  2KB1 A;  4LP8 A;  2LFS A;  4XDJ A;  2EZO A;  4JYC A;  1JOY A;  2FTK A;  2WLI B;  2QA4 V;  1RM1 C;  1RM1 B;  2ZDI A;  4PA7 A;  4Z1M G;  3ABL B;  3E86 A;  2EIL B;  1F51 A;  2EIM C;  2BOB C;  3UKM A;  1AJQ A;  3ZRS A;  1M1K W;  4QJF B;  4UXN A;  1M57 C;  3AG4 B;  4JYB A;  3SYQ A;  2EIJ C;  5EC1 C;  4JTD B;  2P6J A;  5CA3 A;  2BOC C;  2X6B A;  5B1B C;  1K34 A;  1RPR A;  3W7S A;  2NNU A;  3ABM B;  4GX2 A;  3SYO A;  5B1A B;  2DYS B;  4EKW A;  1NH2 D;  2X0L A;  2M7W A;  1DF4 A;  1VQ9 V;  1OHH G;  4FJC C;  2ZDI C;  5LHI A;  2WLJ A;  1AI6 A;  3RVY A;  4MVZ A;  1Q7Y W;  4BIU A;  3UM7 A;  2WLI A;  3M99 B;  2D3O W;  3I56 V;  3G4S V;  1E1R G;  1S3J A;  1PKX A;  3CCQ V;  1I5X A;  4UVA A;  1IXM A;  4P9O A;  4RO2 A;  3FB8 C;  5J9P C;  3ASO B;  4FK5 C;  3ZIA G;  4E2L A;  2QM8 A;  3CCS V;  3OM3 B;  1E79 G;  4RAI A;  2Q68 A;  3K3W A;  1R3L C;  3TCU A;  3R65 A;  1CP9 A;  3TET A;  2A9H A;  1EFR G;  3FB6 C;  3DGE A;  3ABK B;  1QVF U;  2EIN C;  3CC2 V;  1SER A;  1XL6 A;  3OFN G;  1COW G;  4LC1 A;  1VQM V;  1H38 A;  1R3I C;  2IW5 A;  4MVM A;  2R9I A;  1Q81 W;  3MD0 A;  5KUK A;  1F4M A;  2EIM B;  1DF5 A;  4GCZ A;  2EIL C;  1F4N A;  4WF9 V;  4X88 A;  2XAH A;  2WWW A;  1K5Q A;  3T4Z A;  2IJK A;  1KC8 W;  3ETG A;  1OCR C;  5EC2 C;  1M56 B;  3CCE V;  3K04 A;  3LDD A;  4MTG A;  1BHA A;  1G4Y B;  2XAF A;  1BMF G;  1DTO A;  2WLL B;  5C93 A;  3CYO A;  3GWO A;  1QR9 A;  1NJI W;  2WLM A;  5KA6 A;  3K03 A;  3E89 A;  3ASN C;  3AG3 C;  4R8C A;  5LGN A;  1WPX A;  1JJ2 U;  1JPX A;  2IH3 C;  1EZJ A;  5EK0 A;  5DM6 V;  2ATK C;  1KP3 A;  1GKF A;  4H33 A;  5LHG A;  4KP4 A;  3G71 V;  3QO7 A;  4UUJ C;  3ZRV A;  3D3I A;  3ZCC A;  3X2Q B;  1KD1 W;  4MVU A;  3ABU A;  3ZMZ A;  2WLN A;  1V54 C;  2QEX V;  4UV9 A;  1FXV A;  4X8A A;  5CBF A;  4QPK A;  4JAV A;  3QNE A;  5L3D A;  1BL8 A;  2AHY A;  2EIN B;  3LDE A;  1N8R W;  1H8E G;  5CBG A;  1SZT A;  1NH2 B;  3AG2 B;  4RUF A;  2AHZ A;  1WLE A;  1H8H G;  3CCJ V;  2CK3 G;  4XBF A;  4MW8 A;  3CXC U;  1K4D C;  4MTX A;  4J9Z B;  3H01 A;  4R7C A;  5LBQ A;  3OUS A;  1ZWI C;  2JIZ G;  1YTF B;  3IC7 A;  1KP2 A;  3ZN0 A;  1W2B U;  3T1C A;  3K9A A;  5H6Q A;  4R50 A;  3MHS C;  2IH1 C;  1K7D A;  1YIJ V;  4MT8 A;  1L1F A;  2XAG A;  4GX5 A;  3OEE G;  2GSM B;  1AJN A;  1W0K G;  3SYC A;  1R6N A;  1YTF D;  2C2A A;  1AI5 A;  2ZXW C;  3W7T A;  2DYS C;  5B1N A;  3T4D A;  2OTJ V;  1K5S A;  1E1Q G;  4HAM A;  3JD2 A;  1XL4 A;  1K3E A;  2EIJ B;  3AG1 C;  1K8A W;  1S5H C;  2DQ3 A;  4UVB A;  2EJR A;  1VQ5 V;  3VBB A;  3HPL C;  3OMA B;  2W6J G;  4QPJ A;  2HFE C;  3E8H A;  3QO8 A;  5BZB A;  1R73 A;  1Y66 A;  3CCL V;  3ASN B;  1P4R A;  5IYD O;  1SRY A;  2HKO A;  4P9P A;  4UV8 A;  3BY6 A;  4WCE V;  2DWE C;  4PEL A;  1NR1 A;  3E8G A;  4FIP C;  2IJJ A;  2W0F C;  2B1I A;  1M9N A;  2XND G;  2PI4 A;  3VOU A;  3JD4 A;  1OCZ B;  3OE7 G;  3JD1 A;  1J95 A;  5EBM C;  2WLK A;  4G2K A;  4XDL A;  3SYA A;  1FS0 G;  2Y69 B;  3CP1 A;  3K0D A;  4HYO A;  2OTL V;  5CN0 A;  4BAY A;  4UVC A;  1GMG A;  3W7X A;  2QTO A;  1YHQ V;  3JD3 A;  2WPD G;  1OZ0 A;  3EHB B;  1F23 A;  5B1O A;  4QIW F;  4JGS A;  2ITD C;  3ABK C;  1YJW V;  1OCR B;  4MSW C;  5HFM A;  1BHB A;  1MG1 A;  1GK9 A;  2A0L A;  4LCU C;  3B77 A;  2V1D A;  3OGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...