2NLJC

Potassium channel kcsa(m96v)-fab complex in kcl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVVVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment light chain
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nljC00
4GX2A 3OR6C 4PA3A 2Q68A 2H8PC 4MSWC 4WFHA 3EFFK 4MVUA 3UKMA 4XDJA 4R6ZA 2Q67A 2WLLA 3FB7C 5J9PC 2WLNA 2WLLB 3WG7C 4LCUC 4MVSA 4MVMA 4WFFA 4PA4A 2P7TC 2A9HA 2JK5C 1OCOC 1ZWIC 4XDLA 3T2MA 1LNQA 5CBHA 3AG3C 3ASOC 4LBEC 1K4CC 2Q69A 3SPJA 1R3IC 3E8GA 3HPLC 5B1BC 2QKSA 5B1AC 2WLIB 3RW0A 3SPHA 1BL8A 2HFEC 4P30A 2ITDC 3F5WC 2ZD9A 3AG4C 1KKDA 2IH1C 3OGCC 3X2QC 5BZBA 3K03A 5KUMA 3UM7A 3ABLC 3TCUA 4MTOA 4KFMA 4RAIA 3LNMB 2IH3C 3R65A 4MW3A 3F7VC 2QTOA 3AG1C 2DYSC 3RVYA 1OCRC 3LDCA 2Q6AA 2EIJC 2ITCC 2K1EA 2ATKC 3K06A 3STLC 4QE7A 3JYCA 4MS2A 2WLKA 1XL4A 4WFEA 4J9YB 3SJQC 4J9ZB 3LDEA 3SPGA 2HJFC 2HG5C 3T4ZA 4PA6A 2WLHA 3BEHA 4GX1A 3ZRSA 2ZXWC 2X6AA 5EC2C 1JVMA 2W0FC 3E8FA 2R9RB 2EIMC 2HVJC 2OCCC 3LUTB 3SYOA 4G27B 4QNHB 2BOBC 4LP8A 4CBCA 3E89A 3OUFA 1S5HC 3K04A 3SYAA 5CBGA 3PJSK 3STZC 1XL6A 3SYPA 5KUKA 4MTGA 4X89A 2Y69C 4PDVA 4HYOA 4PA9A 3SPCA 4PDLA 4P9OA 1M56C 4JTAB 4MVRA 4R7CA 2DWDC 4JTDB 3FB5C 4I9WA 3RVZA 5EBLC 4G28B 1K4DC 2EIKC 5EK0A 1J95A 1R3KC 3SYQA 4QE9A 3IFXA 3E8BA 4DXWA 3E83A 1V54C 4RUEA 4XDKA 5EBWC 3FB8C 3FB6C 4GX5A 3ZJZA 2DYRC 4PA7A 1QLEC 2YEVA 4GX0A 2A79B 3TETA 1M57C 2A0LA 2BOCC 2WLIA 4PDMA 4TWKA 4HZ3A 3ABMC 5EBMC 3SYCA 3T1CA 3VOUA 5CBFA 4H37A 3AG2C 3K0GA 2X6CA 3E8HA 4ZBMA 5IY5C 2X6BA 1ORQC 4MVQA 1R3JC 5E1AC 4P9PA 4P2ZA 4X88A 4BW5A 4MVOA 4MTFA 4JTCB 3K0DA 3K08A 2HVKC 4H33A 4PDRA 2EILC 3SPIA 2WLMA 2DWEC 4WFGA 3ABKC 4X8AA 2NLJC 4R50A 2AHZA 3E86A 4RUFA 3OR7C 4UUJC 1OCZC 3ASNC 1R3LC 4MW8A 1V55C 2EINC 2WLJA 4RO2A 4MVZA 3F7YC 4OXSA 2AHYA 2KB1A 3RBZA 5EC1C 4EKWA 3IGAC 4R8CA 3OUSA 3KG2A 4F4LA 1OCCC 3LDDA 5B3SC 3GB7C 3T4DA 1G4YB 1P7BA
chains in the Genus database with same CATH superfamily
2JEXA 4PA3A 1U97A 4MSWC 5L3BA 4NB5A 3SJCC 1XILA 1Q6HA 1OCOC 2CUGA 5JH7A 2Q9LA 2WA3A 5K1XA 4L8JA 1MG1A 1Q43A 1B6QA 1BL8A 4IL6Z 4H13B 2Q8VA 4NTWA 3BA9A 1JA8A 3C90A 1DGSA 4OX9B 1COWG 4WFBV 3IAYA 4JI4O 1BMFG 1K7DA 4TQDA 4UCUA 4J9ZB 3AEIA 2XUMA 2HEPA 3WB0A 1K9MW 3SYOA 1RM1B 3DC6A 1SQXH 4ZI7B 3RT3C 1XMQO 3CXCU 1GN6A 4HNAB 1RFYA 4K3AA 3BRCA 5IJ9B 2JGUA 4B3SB 1ZL8B 4ZKIA 4DV5B 3K3WA 3ZRXA 2XAFA 3BY6A 1GH6A 3CPWU 4PA7A 1HR0B 1SQGA 5BR8O 2UXDO 4JYAB 1YJNV 1AI7A 5EYPA 1GK9A 1MNGA 1W59A 3JAKA 4DUZB 4IIJA 3OMIB 4DK1A 1FXHA 2QTSA 3JAKB 4XBFA 2DWEC 5LL6Y 3JALB 4QGPA 3I55V 4UVCA 4J41A 1QR8A 4DR1O 1NT2B 2KB1A 3P30A 4BAYA 5BMVB 1M5IA 1IBMB 1SA0A 1NBMG 1N36B 2Q7HA 4WFHA 4X1IA 1S77D 2BTQB 1HNXB 1W0KG 3M99B 5J9PC 1AI6A 1WA8A 1QNMA 2RQ6A 1VQLV 1WA8B 4ZIBA 2EIKB 3T2MA 5CB4A 5LMNO 3H01A 1GM9A 3B40A 5AG2A 4B3MB 1BHAA 5JVDB 4DV1B 3DTUB 2HFEC 1VQNV 4YXWG 1N0JA 1K73W 1M90W 1QLEB 3CC7V 2ARHA 4H44B 2UU9B 1YSCA 3B77A 1FS0G 3ABLC 1VF6C 4KL1A 4C7UA 1NVPD 2E5LB 2P5OA 3KCYA 2VQFO 1VQ6V 3CB2A 4DUZO 3A8TA 3Q4HB 3E2EA 3QTCA 3SJQC 4NXNO 4YY3B 3G6EV 4KUMA 1BGYH 2R9RB 3ZRWB 3ETQA 1N34B 2UXBB 3PN1A 2L35A 3SYAA 3BABA 3CMEV 4B3SO 4R7CA 4LFBO 5LA6B 2EINB 2EIMB 1PV0A 2A79B 4DUYB 1M57C 2ZINA 5B1OA 2KG7A 5EBMC 1JPXA 2KG7B 2XNDG 5E1AC 3B09A 1LUVA 3CRQA 4X1KA 3C3TA 3QO7A 4WBNB 1ZUQA 4R50A 3CCVV 2BTOA 3RYCA 2ZQMA 4WBNA 3ASNC 2WLJA 4MVZA 5IJ0A 4JYBA 2G38A 2E76B 4FVMA 5CMUA 3GB7C 5IWAB 2GSMB 2Q67A 1TUEB 1VQKV 2OWOA 4MVMA 3WB1A 4PA4A 4EFBA 4DR2O 1D2DA 1ZL8A 2RMKB 5L3FA 4UCOA 2IU0A 2FKXA 3SPJA 3BVOA 3JASB 2WLIB 1VQ4V 4LWSB 4I55A 3CS5A 3CCEV 4NTXA 4B3TO 2N04A 3BCCH 5D5QA 5ITZA 4RQFA 4D7SA 3EVKA 3ABLB 2EILB 2GUZB 4CZZA 1FPOA 4MW3A 4DUYO 1Q81W 1D5AA 1L0NH 1OCRC 2EIJC 2ZE8A 2OIEA 1UFIA 1IBKO 4GX1A 5LHIA 1QBZA 2DYRB 2OTJV 1XHXA 1AP6A 3E89A 2Y4TA 3STZC 1NS1A 1GAXA 4NXNB 4YY3O 4CH5A 4X66B 3L9DA 2NN4A 3AK1A 1R3KC 3L75H 5CB4B 5B1NA 3OFNG 2AZ0A 5EBWC 3KKYA 5JVDA 1QR9A 2X7RB 1BQ0A 1K8AW 2LFRA 4H37A 2ILMA 3K0GA 4X1KB 4GT1A 2PYJA 3I56V 4FZ0A 2PI5A 1ENVA 4JI5O 2F43G 2UXXA 4K8ZA 4X8AA 4O4HA 3P3PA 4O4HB 4UCVA 2CH7B 4PJ0Z 3M7MX 4WF9V 1IBLO 2P4VA 3K5OA 2ZM6B 3F5TA 4J7KA 1VQPV 2YIBA 4ZI7A 4G2KA 1PPJH 5DEDA 3FD9A 1P49A 4X65B 1XHZA 1K92A 2QM4A 2VWKA 4GKKO 1HNZO 1IDSA 1M93A 3JASA 4JI3B 4LWSA 1S3JA 3CRAA 2EJRA 4TT3G 1AJQA 1LUWA 4U3JA 2EZPA 3CJHB 3ZCCA 4K0KB 4MT8A 2ADPA 2ETNA 2JIZG 4DR4O 1Z5WA 4J11A 2QTOA 1KC8W 4LF5O 5GTIZ 4NXMB 4JI0B 4JI2B 4WFEA 2YDEA 2B9ZA 4BIZA 5H9CA 2HG5C 1R6KA 2W0XA 2X6AA 4X1IB 3E8FA 5KX5A 2EIMC 3L70H 4B7EA 4QPKA 5KAIZ 3DC5A 2UXBO 1GKFA 2PF4E 3P3NA 2EIKC 1ZAUA 3SR2C 2CTRA 3KCXA 2YEVB 3UO3A 3SDLA 4NVPA 2OYQA 5D5PA 1ZSPA 1Y67A 2X6BA 3JCZA 5J2UB 4ASUG 3RFRA 1F7YA 4JV5B 2HVKC 2WLMA 3E22A 2NLJC 2AHZA 3RYFA 4RUFA 2CGNA 4IHJA 4MW8A 5LMUO 3A2FA 2LGQA 4LFAO 1BSMA 3K5LA 2IW5A 2LW1A 3DXRB 1JFFB 2WLNA 5EIBD 2ZDIA 4LH7A 4QJFB 4DRXA 3OTOO 3T1HO 3ZHSA 1WPBA 4UV9A 4FIPC 1Y6XA 3U11A 4Q6GA 3G67A 1N32B 1F4MA 2RCVA 3TGUH 3RW0A 3F5WC 1DF4A 1RM1C 3THOA 4DV6B 2UXNA 2DW4A 4JI6O 2RDCA 2OCHA 4DR5B 4DV0O 1G1XB 2P4KA 3JYCA 1PNLA 5LHHA 5H5NA 1R1BA 2UUCB 4DV3B 1BQZA 1HP8A 4BIUA 2JS3A 2W0FC 5JWPA 2H3OA 4FLTA 1VQ7V 3OW2U 4DV3O 4PI0A 2ZE6A 3LNNA 1Q82W 4N21A 4O4LA 1X59A 5LXTA 1XL6A 1VQ5V 2QM7A 3JD2A 3CCUV 1P84F 2AZ2A 4RUEA 3E35A 2OCCB 3VQXA 1SQPH 4I55B 1WP8A 4O4IB 3GVMA 2UUBB 2YXHA 1Q8IA 1W0JG 5L3EA 4HZ3A 5EYPB 3SYCA 1BT8A 1JCHA 3D8CA 1NU1H 1R73A 1MABG 1BE3H 2HKOA 4GLXA 4IHJB 2P06A 2PTMA 1JR9A 2IJKA 3E86A 2ZCEA 3W7TA 1KKCA 5LGUA 2LP7A 1GRJA 4JI4B 1AJNA 4RWUA 2EULA 5HFLA 3H1HH 1YEWA 3W7XA 4K8XA 1P7BA 3P32A 3K59A 1IURA 5LP6B 1FFXA 2R9AA 1RSOA 3G80A 1TVKB 2A7WA 4QIWF 2F66C 1OCOB 5BXZA 5BY1A 4UCSA 1AR4A 2XOKG 4J10A 1U96A 4O4JB 1KU9A 4HAMA 1IXBA 4DW0A 3K57A 4WCEV 1GMGA 2IH1C 4O2BB 5DECA 3ZHTA 3QG5A 3UM7A 2IJJA 5CA1B 1CEZA 4NKGB 1ZLZA 1OCZB 2YIAA 2PUSA 5DM6V 3KZIZ 1NVPB 3RVYA 5JCOA 2XAJA 2ATKC 4B3RB 3CYOA 2EIJB 4FFKA 1VMGA 4J9YB 3SPGA 3J7AU 2WLHA 5JJJB 3MDSA 1QHTA 3VQWA 1M56B 4LP8A 3ZBHA 3D3QA 1EN5A 1GN4A 3A0HZ 2ADQB 2BCCH 5LYJB 4N23A 4DR6O 4JTAB 1NQTA 2D3OW 3T1YO 4O4IA 1K97A 4QE9A 5LMNB 1R6NA 5F2VO 4LF4B 4LF9B 4PD4F 4MTXA 5C8YA 2AXTZ 4U3JB 3CJHA 1I08A 3VOUA 4OPHA 3B4SA 5CBFA 2X6CA 3E8HA 5IY5C 1P7GA 3CMAV 2E3CA 1WLEA 1PKXA 2DYSB 1O9GA 2A3QA 3MHSC 5IJ0B 2VQFB 4J80A 1EN4A 1X4TA 3OUSA 4UV8A 1KP3A 1NH2D 4YHHO 3ABMB 2DN9A 2XT9A 4LFAB 4I5SA 4DK0A 5A9GA 4UB8Z 4XDLA 3ASOC 1KMIZ 4ABMA 3CEIA 5H6QA 3E8GA 4O2BA 3GWOA 3ZMTA 2Q73A 3JD3A 2ZD9A 4KXRA 5ITZB 5BR8B 5KAFZ 4ZHQA 3B8NA 3RYFB 1FAFA 3LDCA 5K1PA 1IBLB 2QM8A 1AP5A 5KA5A 1YITV 2WLKA 1XL4A 4X20A 3BEHA 4I50B 2B5UA 1MOFA 3LUTB 3DXRA 4LH6A 3LSQA 2ZNIA 2IU3A 1AB3A 4PA9A 4DRXB 1HR0O 1DTOA 4GCZA 1S5LZ 1Z2GA 4X62B 2EZOA 4JI8O 5DN6G 4XDKA 1N0NA 5CA0A 3WB2A 4GX0A 3ZRVA 2LGWA 3CC4V 3AK2A 4OX9O 1I5XA 2YICA 2ZR3A 4U7OA 3ZIAG 5LOVB 5LGTA 4MVOA 4DV6O 1TGOA 3QO5A 4LF5B 4BWAA 4WFGA 2E75B 1RP3B 4DV7O 3ABUA 3CP1A 4DR4B 2WAMA 3H1KH 4FZ1A 3X2QB 2GTSA 4DR7B 1VEWA 1WN7A 2A06H 1HNXO 4E4EA 5GTHZ 1VARA 4KP4A 5FLXN 1WP7A 4R6ZA 4DV2B 1G6UA 3WG7B 2P7TC 4GKKB 2JK5C 2CAZC 1GM8A 1MZEA 4BR6A 1K4CC 4GUNA 3JSLA 1R3IC 5B1AB 3FFQA 4IT5A 1XNQB 3K5NA 3BA8A 3SPHA 4B3TB 4JI5B 1XMOO 2E5LO 1OCCB 1M4UA 4X62O 1SQQH 4K35A 2QKAA 1OHHG 2ZXWB 1MA1A 4JV5O 2CE4A 4UFZA 4QE7A 3GWKC 3UT5B 4JI7B 2OT5A 2GV9A 1QQCA 1KP2A 3D3IA 5IWAO 5EC2C 1HDJA 1JVMA 1KB9F 1K33A 1O9HA 3ZMUA 3MHHC 2L6LA 5CBGA 3CCJV 4MTGA 3CCRV 4LFCO 4PDLA 4JYAO 1M56C 1F51A 2YXLA 4O4JA 4UB6Z 5TISZ 1V54C 3L72H 4GX5A 3FB6C 1EFRG 2Y48A 3TETA 4D6TH 4TWKA 5LOVA 1H2LA 1SETA 2O57A 2CDYA 3AG2C 4JGSA 4KHPO 4P2ZA 2CH7A 2HHHO 1FJGB 1KBHA 5CA3A 2WPDG 1NTMH 2QSAA 4DYLA 2QKCA 5KA6A 4NTYA 2EX3A 1NI8A 4LF8B 2IJHA 4R8CA 1S72V 1VP7A 1F23A 1PL0A 2MK3A 5B3SB 5LYJA 3H1IH 2H8PC 5L3DA 2C2AA 1JFFA 2NNUA 3N27A 4LNUB 3JSNA 1GN2A 4LCUC 4WFFA 3RYHA 1YXBA 4LNUA 1ZWIC 3AG3C 2QA4V 5JJNB 1B3QA 2Q0OC 2QKSA 1I5YA 1H8EG 3AG4C 3JCUZ 1E1RG 1THZA 4TUYA 1PL4A 1XEQA 3X2QC 2Q0AA 4LF8O 1E79G 4I9QA 3R65A 2F4VO 2QWQB 1D5NA 3UT5A 5FNVB 1H2MA 2Q6AA 1S0VA 1E1QG 3ML0A 3CD6V 1AJPA 2CGOA 1AI4A 2HJDA 3HB3B 3K79A 4UCTA 1NKDA 2HJFC 4ICGA 4JASA 1JMKC 4YJ3A 3JAWB 3JD1A 2N05A 1N34O 4LF7O 1VQ8V 3JAWA 5LHGA 3O9OA 4FM0A 1N32O 1Q3EA 4JTDB 1IXMA 2LJ2A 1K34A 3QF7A 2KSDA 4ZHQB 3HKEB 1NJIW 3HKBA 2WA4A 5A2QN 1N8RW 2BOCC 4JPRA 4PELA 1SKVA 4ZBMA 1G8MA 1XBLA 4X88A 4FPPA 1WAZA 1YF2A 3N2GB 1NR7A 4B3RO 1Q6IA 3SJAC 3NXSA 3RN4A 4I50A 3A0RA 1SQBH 2AHYA 4X20B 3TJTA 1YIJV 3VBBA 2HHHB 4JI6B 5LP6A 1FFXB 2E74B 3JARA 3IC9A 1XUQA 2XHBA 4DR7O 3JD0A 1YTFB 2LQTA 2QE7G 3HKDB 4MVSA 2CTPA 2A9HA 3HKDA 5CA0B 5JJEB 2QEXV 1H2NA 2Q69A 1LR1A 1GO3F 1SESA 1WNSA 3FKSG 4IGGA 5B1BC 4RQEA 4X9QA 3ETEA 3RGBA 2DE0X 3ZX6A 1AVMA 2N74A 1BCCH 5CA1A 3ZMSA 5IYZA 3JAMN 3CCLV 3TCUA 4B7KA 5IYZB 1GTOA 2VQEO 2W6IG 1JQ0A 5IT9N 2Y69B 3CCQV 2D2CB 5LMUB 2RJZA 2Q5ZA 3T4ZA 1B06A 2PYLA 5FPRA 4O4LB 3G71V 1FYJA 4D7TA 3ZEDA 1L8DA 4EFEA 4G27B 1AR5A 3AG4B 4TV8B 4EEQA 2X0LA 2Z5UA 2YUAA 2Y0PA 2UXCO 2DWDC 3AG3B 3VQVA 4IYHA 1J95A 5EK0A 1MZFA 3UO2A 4PV1B 3IFXA 2VQEB 4DXWA 3DSQA 3ASNB 3OEEG 4LFCB 2IBZH 4I4TB 3U10A 4L87A 1SZTA 2JDIG 5KHKA 4PDMA 1M9NA 2Y4UA 1ZX3A 5IYCO 1OJHA 3WFVA 1H2SB 2YXYA 2YC0A 3B8MA 3TXSA 4MTFA 2JS5A 3M8AA 2UUAO 3S3WA 5FPOA 3ABKC 3JD4A 4DR5O 1WPXA 4J7JA 4AILC 4NXMO 1QCEA 4JI2O 1OCZC 1V55C 1WB8A 3ABKB 4U3FH 2F1MA 3RBZA 3FAVA 3JARB 4F6RA 5KMGA 4FLYA 2QWPB 4JI1B 1RSOB 4F4LA 1Q90D 3LDDA 4P9PA 1CPYA 3ETGA 4YHHB 1WB7A 2ZM6O 1FXVA 5E79Z 2WLLB 3ZMVA 4DR3O 1N33B 1IX9A 3OTFA 4JI8B 3BPZA 5KHHA 2OTLV 2LW7A 4J7ZA 3I5DA 1K3EA 2QWNB 4NR1A 3RYIA 1PNMA 4X65O 2UUAB 3OEHG 5J2UA 1KD1W 2R9IA 1YVWA 3TXQA 2H94A 3ICXA 3K03A 1H38A 3E22B 3CRCA 3F7VC 3SJBC 2V1DA 5JCOC 3N2GA 1SC5B 2K1EA 3RWRD 5KLVH 4FLXA 1XREA 3CRRA 2PY5A 3CHXA 4DR3B 1N33O 4FM1A 3OMNB 2GTAA 4H0LB 3UCSC 2HVJC 2OCCC 1AR1B 1XDCA 3CCMV 4LFBB 3PJSK 3CX5F 4BW9A 2Q7EA 2JGDA 4YJ2A 2B1IA 4ZOLA 1R6TA 1YZBA 1K4DC 4I4TA 5EBLC 1H2GA 3L74H 3FB8C 2DOSA 1NTZH 5L3GA 4IYIA 4TUYB 4TV9A 1P4RA 4FMTA 4X1YB 5LGNA 2GBOA 2JEUA 1AROP 2YI9A 4MVQA 3ZS8C 1FXKB 2BE3A 4JI0O 1VQOV 3K08A 1SRYA 2FTKA 2EILC 1JJ2U 3HKCA 4F6RB 5KMGB 3HKCB 1J5EO 4YJ3B 1FD9A 4FJCC 4OXSA 2AW9A 5EC1C 1URFA 1OCCC 3K9AA 3UQ8A 4DW1A 2R70A 4E2LA 1QVFU 1MSWD 4XDJA 1TAEA 3ZHRA 2XTAA 1HNZB 5GONA 1EZJA 5CBHA 2IJIA 1YDXA 4CH3A 1FFTB 1XNQO 1UJWB 2MW2B 5KHGA 3ZHQA 2PI4A 1YJWV 2Z0AA 4RAIA 4FLWA 2YIDA 4X64O 1JOYA 3D36A 3TK1A 3J80N 1H8HG 2EJ7A 3STLC 3FYEB 1BZKA 3L73H 3LDEA 3RYCB 3S3XA 3MD0A 4UVAA 1TVKA 2JRIA 3LSUA 2JJ2G 5J2TB 1IVSA 4QNHB 4LF7B 1Y74B 4YJ2B 4JAVA 4LR3A 4UCRA 3L71H 4WFAV 4UXNA 4LF4O 2Q4PA 3OAAG 1K5QA 4HNAA 4MVRA 3FB5C 3RVZA 2VRZA 2QR4A 4UVBA 1TUBA 3IC7A 2P67A 4BIOA 1XMOB 1M1KW 3EXAA 3CCSV 1ORQC 4JTCB 2VS0A 1SS3A 4H33A 4JI7O 2F95B 1FKAO 2ZIOA 4K0KO 5KHIA 1PNKA 2HR3A 3F7YC 2QJ1A 1VIBA 4OPAA 4EKWA 3DGEA 2YSUB 4JZGA 3OE7G 1FXKC 1SF9A 3T4DA 2ZT9B 3QNEA 4TV8A 3FYIB 2ZR2A 3OR6C 1SA0B 4CS2A 3EFFK 3OM3B 4MVUA 1YI2V 3ASOB 4TSFG 4JI1O 2CTQA 1K5SA 4CS3A 1LNQA 5H2FZ 1MSDA 4AQYB 3CRMA 1JJOA 5B1BB 1TA8A 1B04A 2HLDG 2QGNA 4P30A 2ITDC 1KKDA 1AI5A 3IJ4A 2ODMA 1JX9A 5EZYB 5IE9A 5EZYA 4QPJA 3JATA 1NH2B 4I0XA 2UUBO 3K06A 4DV7B 1YTFD 3FAVB 2DMXA 3AG1B 1UPGA 1VF5B 5KHJA 2LO1A 1SQFA 1KECA 4DV4B 2CK3G 4CS4A 1S5JA 1CP9A 4PDVA 2M6YA 3SPCA 4DR6B 4P9OA 3RYIB 4DO2A 1I94O 4J42A 4G28B 3SYQA 4EB6A 4LF9O 3E83A 3HKBB 4DV1O 4EB6B 3K9SA 3ZJZA 2DYRC 2WSSG 3CWBH 5JQGB 2UXDB 2A0LA 5LP6C 4KHPB 1NR1A 1Q5OA 2F93B 1PD3A 1R3JC 1S76D 4HBNA 2JJ1G 5C93A 4LF6B 2YIBD 1SERA 4AHCA 4FLUA 3OR7C 3WU2Z 1I0HA 3K5MA 1Z5VA 1XMQB 1IBMO 4JYCA 2ZIMA 1J5EB 1G4YB 1GN3A 4GKJO 1KYOF 1XNRB 4GX2A 4GKJB 3RYHB 3N2KB 1XNRO 3OT7A 1OV9A 1KQSU 3CXHF 5FL7G 1VF6A 5KX5B 3CSXA 2BTQA 2BSKB 4CH6A 3ZHVA 3ETDA 4AQYO 3HPLC 2XAGA 2ZKOA 4LF6O 4B3MO 2YS8A 4Z1MG 3APQA 4FFBB 3JATB 4DV5O 4YIOA 5KUMA 2DQ0A 4OGQB 4MTOA 4KFMA 1FJGO 1F4NA 3LNMB 1VQMV 2PZSA 1DK1A 1KUQA 1N36O 2DJVA 1HWYA 2NR5A 1QLNA 3OD4A 4DR1B 1MMMA 3VQYA 3QVNA 2ZXWC 2OIGA 1OZ0A 3U0ZA 4CBCA 3O65A 2ZNJA 1VF7A 3K04A 4CC6A 2IM9A 2Y69C 4W4KA 4HYOA 4DV4O 1N4CA 3T1YB 3W7WA 1I94B 1ROPA 1EN6A 4PHZA 1Y4MA 5IDJA 4JZ2A 5LA6A 3ABTA 1Q7YW 3H1LH 3W7SA 3ABMC 3T1CA 1NZ6A 2M7WA 3ZN1A 4U7NA 4PI2A 2XASA 1HW7A 4I0XB 3AK3A 1EZVH 4AI8A 1WJZA 2FYUH 4JAAA 2Y0IA 1SZXA 3EHBB 3ZMZA 3IGAC 2K9PA 3KG2A 2GDSA 2P90A 2B1GA 1Y74A 2Q68A 2AGAA 1PM9A 2XAHA 2WLLA 4FLZA 2PGGA 3WG7C 1US6A 4DR2B 4Q20A 2RN9A 4LBEC 5HFMA 4YIPA 4FFBA 3MAQA 2FL4A 3LSSA 5B1AC 5IYDO 3OTOB 3T1HB 5JQGA 2Z3YA 2XAQA 3ZN0A 2V7QG 3OMAB 1PP9H 4LC1A 2IH3C 4CH4A 4IIJB 1H2KA 3AG1C 2HP8A 3J81N 2ITCC 2KKWA 1A32A 2V4DA 3G6BA 1M57B 4MS2A 5L3CA 1XQ8A 3HR0A 1V55B 1QVGU 4O2AA 1QU7A 1EBOA 3APOA 1XI1A 1S5HC 3N2KA 1CXZB 3SYPA 1SQVH 1ZTEA 5H6RA 5B66Z 3H9VA 3C3SA 2VWJA 1QLEC 2YI8A 4TV9B 4X1YA 4JI3O 2UU9O 5EIBC 2CTWA 5FNVA 5IY5B 3G4SV 4BW5A 4PDRA 4I7ZB 1Q86W 5LBQA 2DQ3A 1Y76A 1RPOA 1YHQV 1DLBA 1R3LC 1Y76B 4DV0B 1W2BU 4RO2A 3Q4HA 4TQFA 4JYYA 3AG7A 5B3SC 1IZ3A 3FX7A 2UUCO 2FB5A 3ZRWA 1AILA 3UKMA 5IJ9A 4JAUA 3NR7A 3QO8A 4Z2WA 4A5UB 3FB7C 5GONB 1V54B 4NYKA 2ZDIC 3D36C 4B08A 3HKEA 3OGIB 2LFSA 3B2EE 1EM1A 1Y66A 3AG2B 3BFRA 5JH7B 3BHPA 5GW7A 1Q6UA 5CN0A 3ZHUA 4FK5C 3OGCC 1L1FA 1HNWO 4FM2A 5C8YB 5BZBA 1HNWB 1RPRA 1GM7A 1I7FA 3K58A 2DYSC 2RNBA 3JALA 3CE2A 2ZE7A 3CC2V 1BHBA 5BMVA 1T5EA 5IYBO 1VQ9V 4PA6A 3ZRSA 4O2AB 1DF5A 5J2TA 4CC5A 2UXCB 2BSKA 2Q7GA 2BOBC 2JGDB 2R72A 3OUFA 2P22C 4ZOLB 5KUKA 4X89A 4X66O 5B5EZ 4I9WA 5LXTB 1YJ9V 2QDOA 3E8BA 2P6JA 3H1JH 1YCIA 2ZE5A 1V9PA 4DV2O 2W6JG 4GZRB 1TUBB 4JF3A 2YEVA 2QWRB 1XOUA 2JVDA 1FXKA 4F6EA 2WLIA 2F4VB 3SGIA 1BS3A 2F23A 2GHYA 1L0LH 3K0DA 3SPIA 1OCRB 3R66A 2FMLA 2WWWA 4TOIA 4Z1VA 4FLVA 2GUZA 2EBOA 4UUJC 3W7UA 2EINC 2KQXA 3A0BZ 1IBKB 4W4LA 1NTKH 2QWOB 4GYCB 4X64B 3BAAA
chains in the Genus database with same CATH topology
2JEXA 3QNEA 2IW5A 2ZR2A 3FYIB 3OR6C 4PA3A 2H8PC 4MSWC 3EFFK 3OM3B 4MVUA 5L3DA 5L3BA 2C2AA 3ASOB 4TSFG 1YI2V 2NNUA 1K5SA 2WLNA 2ZDIA 4LCUC 4WFFA 1OCOC 4QJFB 1ZWIC 1LNQA 3AG3C 2QA4V 4UV9A 4FIPC 5B1BB 1MG1A 1B6QA 1F4MA 2QKSA 2HLDG 1I5YA 3RW0A 1H8EG 1BL8A 4P30A 2ITDC 3F5WC 1DF4A 3AG4C 1E1RG 1THZA 1RM1C 1AI5A 1KKDA 3X2QC 1JX9A 1E79G 4QPJA 2UXNA 3R65A 2DW4A 1NH2B 1COWG 4WFBV 2Q6AA 1S0VA 1E1QG 3K06A 3ML0A 3CD6V 1AJPA 1BMFG 1K7DA 1YTFD 1AI4A 3JYCA 3AG1B 3HB3B 3K79A 1PNLA 5LHHA 4J9ZB 1KECA 1NKDA 2HJFC 3AEIA 4JASA 4BIUA 2W0FC 1K9MW 3JD1A 2CK3G 1VQ7V 3OW2U 3SYOA 1VQ8V 5LHGA 1RM1B 3CXCU 1Q82W 4N21A 1CP9A 1XL6A 1VQ5V 4PDVA 2QM7A 3SPCA 4ZKIA 4P9OA 4DO2A 4JTDB 3K3WA 3JD2A 4G28B 3CCUV 3ZRXA 2XAFA 3BY6A 1IXMA 3SYQA 1K34A 3E83A 4RUEA 3E35A 3CPWU 3ZJZA 2DYRC 2OCCB 2WSSG 4PA7A 1NJIW 1N8RW 2A0LA 2BOCC 4JPRA 1W0JG 5L3EA 4PELA 4HZ3A 3SYCA 1JCHA 1YJNV 1AI7A 1NR1A 4ZBMA 1GK9A 1R73A 1G8MA 1PD3A 1R3JC 1S76D 1MABG 4X88A 2HKOA 3OMIB 4FPPA 1FXHA 2JJ1G 5C93A 1NR7A 4XBFA 2DWEC 1SERA 3I55V 2IJKA 3E86A 4UVCA 3OR7C 3W7TA 3NXSA 1QR8A 5LGUA 3A0RA 2LP7A 1AJNA 2AHYA 2KB1A 3P30A 4BAYA 5HFLA 1YIJV 1NBMG 3VBBA 3W7XA 4JYCA 1G4YB 1P7BA 3P32A 4GX2A 4WFHA 1KQSU 4QIWF 5FL7G 3JD0A 1YTFB 1S77D 1OCOB 1W0KG 2QE7G 3M99B 5J9PC 1AI6A 4MVSA 1VQLV 2A9HA 2XOKG 2EIKB 3T2MA 3H01A 1GM9A 2QEXV 3ETDA 2Q69A 1GO3F 1SESA 4HAMA 3FKSG 1BHAA 3HPLC 2XAGA 5B1BC 4RQEA 3ETEA 3DTUB 2HFEC 1VQNV 4YXWG 4WCEV 4Z1MG 1GMGA 1K73W 1M90W 2IH1C 1QLEB 3CC7V 1YSCA 3ZMSA 3B77A 5KUMA 3UM7A 1FS0G 2IJJA 3ABLC 3TCUA 3CCLV 2DQ0A 1CEZA 4MTOA 1GTOA 4KFMA 1OCZB 1NVPD 1F4NA 3LNMB 1VQMV 5DM6V 2W6IG 1NVPB 3RVYA 2XAJA 1JQ0A 2ATKC 2Y69B 3CCQV 1VQ6V 3CYOA 1HWYA 2EIJB 3E2EA 1QLNA 4J9YB 3SJQC 3T4ZA 3SPGA 2WLHA 3G6EV 4KUMA 2ZXWC 3G71V 1OZ0A 2R9RB 3ZRWB 4G27B 3AG4B 1M56B 4LP8A 4CBCA 3K04A 3SYAA 2X0LA 2Z5UA 2Y69C 4HYOA 3CMEV 4N23A 4JTAB 4R7CA 2DWDC 3AG3B 3W7WA 1NQTA 2D3OW 5EK0A 1J95A 1ROPA 1Y4MA 1K97A 4QE9A 3IFXA 1R6NA 2EINB 4DXWA 5IDJA 3ASNB 3OEEG 3ABTA 2EIMB 4MTXA 2A79B 4L87A 1SZTA 1M57C 2JDIG 1Q7YW 4PDMA 1M9NA 5B1OA 3W7SA 3ABMC 5EBMC 3T1CA 3VOUA 5CBFA 5IYCO 1JPXA 3WFVA 2X6CA 3E8HA 5IY5C 2XNDG 2M7WA 5E1AC 3B8MA 3ZN1A 4U7NA 3CMAV 4MTFA 1WLEA 1PKXA 2DYSB 3ABKC 3JD4A 2XASA 3QO7A 1WPXA 3CCVV 4R50A 1QCEA 3MHSC 1OCZC 2ZQMA 3ASNC 1V55C 2WLJA 4MVZA 3ABKB 4JYBA 3RBZA 3EHBB 3IGAC 3ZMZA 3OUSA 4UV8A 3KG2A 5CMUA 4F4LA 3LDDA 3GB7C 2P90A 1KP3A 2GSMB 1NH2D 4P9PA 2B1GA 1CPYA 3ABMB 3ETGA 2Q68A 2Q67A 1FXVA 1TUEB 2XAHA 2WLLA 1VQKV 4I5SA 2WLLB 3WG7C 3ZMVA 4MVMA 4PA4A 4XDLA 4Q20A 5L3FA 2OTLV 3ASOC 2IU0A 4LBEC 5HFMA 5H6QA 1K3EA 3SPJA 1PNMA 3E8GA 3GWOA 3LSSA 3ZMTA 3JD3A 3OEHG 5B1AC 2WLIB 5IYDO 1VQ4V 1KD1W 2R9IA 2ZD9A 3CCEV 2Z3YA 2H94A 2XAQA 3ZN0A 3K03A 1H38A 2V7QG 4RQFA 3OMAB 3ABLB 3B8NA 4LC1A 2EILB 4CZZA 2IH3C 4MW3A 3F7VC 1Q81W 2V1DA 3AG1C 1OCRC 3LDCA 2EIJC 2ITCC 2K1EA 2QM8A 5KA5A 1M57B 4MS2A 2WLKA 1XL4A 1YITV 5L3CA 3BEHA 4GX1A 3OMNB 1V55B 2B5UA 5LHIA 1MOFA 1QBZA 2DYRB 2HVJC 2OCCC 3LUTB 2OTJV 1AR1B 3LSQA 1QVGU 1EBOA 2IU3A 3E89A 3CCMV 1S5HC 3PJSK 3STZC 3SYPA 4PA9A 1DTOA 5H6RA 4GCZA 2B1IA 5EBLC 1K4DC 1R3KC 2EZOA 3OFNG 5B1NA 5DN6G 1H2GA 1F23A 5EBWC 4XDKA 3FB8C 1QLEC 5L3GA 4GX0A 1QR9A 1P4RA 4FMTA 5LGNA 2X7RB 1K8AW 3ZRVA 2JEUA 2LFRA 4H37A 1AROP 3K0GA 3CC4V 4MVQA 5IY5B 1I5XA 4GT1A 2ZR3A 1FXKB 4U7OA 3G4SV 3ZIAG 3I56V 2PI5A 1ENVA 4BW5A 4MVOA 5LGTA 2F43G 1VQOV 3K08A 2UXXA 3QO5A 1SRYA 2FTKA 2EILC 4PDRA 1Q86W 1JJ2U 4WFGA 5LBQA 2DQ3A 4X8AA 1RPOA 1YHQV 3ABUA 1DLBA 1R3LC 1W2BU 4RO2A 4FJCC 3CP1A 4WF9V 2WAMA 4OXSA 3X2QB 5EC1C 1OCCC 5B3SC 1VQPV 3K9AA 4E2LA 4G2KA 1QVFU 1MSWD 3ZRWA 4KP4A 3UKMA 4XDJA 4R6ZA 4JAUA 3QO8A 3FB7C 1V54B 2P7TC 2ZDIC 1EZJA 1K92A 3WG7B 2JK5C 2LFSA 1GM8A 2IJIA 5CBHA 1K4CC 1FFTB 1R3IC 5B1AB 1Y66A 1UJWB 1S3JA 3AG2B 2EJRA 3SPHA 5GW7A 1OCCB 1AJQA 4TT3G 5CN0A 2EZPA 4FK5C 3OGCC 1L1FA 2PI4A 3ZCCA 5BZBA 1OHHG 4MT8A 2ZXWB 1YJWV 4RAIA 2JIZG 1RPRA 1GM7A 2QTOA 2DYSC 1JOYA 3D36A 3TK1A 1H8HG 1KC8W 3CC2V 3STLC 1BHBA 3FYEB 4QE7A 4WFEA 5IYBO 4BIZA 1VQ9V 2OT5A 3LDEA 5H9CA 2HG5C 1KP2A 4PA6A 3MD0A 3ZRSA 3D3IA 1R6KA 4UVAA 2X6AA 5EC2C 1DF5A 1JVMA 3E8FA 2EIMC 2JJ2G 1K33A 3ZMUA 4QNHB 2BOBC 3OUFA 3MHHC 4JAVA 5CBGA 3CCJV 5KUKA 4MTGA 4X89A 3CCRV 4WFAV 4UXNA 4QPKA 3OAAG 4PDLA 1K5QA 1M56C 4MVRA 1F51A 1GKFA 3FB5C 4I9WA 3RVZA 2EIKC 1YJ9V 3E8BA 4UVBA 1V54C 2P6JA 5B3SB 2YEVB 3FB6C 4GX5A 2W6JG 1EFRG 4JF3A 2YEVA 2Y48A 3TETA 3IC7A 1FXKA 2WLIA 2P67A 4TWKA 1SETA 3AG2C 4JGSA 2GHYA 1M1KW 2X6BA 1ORQC 3CCSV 3JCZA 4ASUG 4P2ZA 4JTCB 3K0DA 4H33A 2HVKC 3SPIA 1OCRB 2WLMA 2WWWA 5CA3A 2NLJC 2AHZA 4RUFA 2WPDG 2EBOA 4UUJC 3W7UA 4MW8A 5KA6A 1PNKA 2EINC 2HR3A 3F7YC 4EKWA 2IJHA 3DGEA 4R8CA 1S72V 2YSUB 3OE7G 1FXKC 1PL0A 2MK3A 3T4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX2 A;  3OR6 C;  4PA3 A;  2Q68 A;  2H8P C;  4MSW C;  4WFH A;  3EFF K;  4MVU A;  3UKM A;  4XDJ A;  4R6Z A;  2Q67 A;  2WLL A;  3FB7 C;  5J9P C;  2WLN A;  2WLL B;  3WG7 C;  4LCU C;  4MVS A;  4MVM A;  4WFF A;  4PA4 A;  2P7T C;  2A9H A;  2JK5 C;  1OCO C;  1ZWI C;  4XDL A;  3T2M A;  1LNQ A;  5CBH A;  3AG3 C;  3ASO C;  4LBE C;  1K4C C;  2Q69 A;  3SPJ A;  1R3I C;  3E8G A;  3HPL C;  5B1B C;  2QKS A;  5B1A C;  2WLI B;  3RW0 A;  3SPH A;  1BL8 A;  2HFE C;  4P30 A;  2ITD C;  3F5W C;  2ZD9 A;  3AG4 C;  1KKD A;  2IH1 C;  3OGC C;  3X2Q C;  5BZB A;  3K03 A;  5KUM A;  3UM7 A;  3ABL C;  3TCU A;  4MTO A;  4KFM A;  4RAI A;  3LNM B;  2IH3 C;  3R65 A;  4MW3 A;  3F7V C;  2QTO A;  3AG1 C;  2DYS C;  3RVY A;  1OCR C;  3LDC A;  2Q6A A;  2EIJ C;  2ITC C;  2K1E A;  2ATK C;  3K06 A;  3STL C;  4QE7 A;  3JYC A;  4MS2 A;  2WLK A;  1XL4 A;  4WFE A;  4J9Y B;  3SJQ C;  4J9Z B;  3LDE A;  3SPG A;  2HJF C;  2HG5 C;  3T4Z A;  4PA6 A;  2WLH A;  3BEH A;  4GX1 A;  3ZRS A;  2ZXW C;  2X6A A;  5EC2 C;  1JVM A;  2W0F C;  3E8F A;  2R9R B;  2EIM C;  2HVJ C;  2OCC C;  3LUT B;  3SYO A;  4G27 B;  4QNH B;  2BOB C;  4LP8 A;  4CBC A;  3E89 A;  3OUF A;  1S5H C;  3K04 A;  3SYA A;  5CBG A;  3PJS K;  3STZ C;  1XL6 A;  3SYP A;  5KUK A;  4MTG A;  4X89 A;  2Y69 C;  4PDV A;  4HYO A;  4PA9 A;  3SPC A;  4PDL A;  4P9O A;  1M56 C;  4JTA B;  4MVR A;  4R7C A;  2DWD C;  4JTD B;  3FB5 C;  4I9W A;  3RVZ A;  5EBL C;  4G28 B;  1K4D C;  2EIK C;  5EK0 A;  1J95 A;  1R3K C;  3SYQ A;  4QE9 A;  3IFX A;  3E8B A;  4DXW A;  3E83 A;  1V54 C;  4RUE A;  4XDK A;  5EBW C;  3FB8 C;  3FB6 C;  4GX5 A;  3ZJZ A;  2DYR C;  4PA7 A;  1QLE C;  2YEV A;  4GX0 A;  2A79 B;  3TET A;  1M57 C;  2A0L A;  2BOC C;  2WLI A;  4PDM A;  4TWK A;  4HZ3 A;  3ABM C;  5EBM C;  3SYC A;  3T1C A;  3VOU A;  5CBF A;  4H37 A;  3AG2 C;  3K0G A;  2X6C A;  3E8H A;  4ZBM A;  5IY5 C;  2X6B A;  1ORQ C;  4MVQ A;  1R3J C;  5E1A C;  4P9P A;  4P2Z A;  4X88 A;  4BW5 A;  4MVO A;  4MTF A;  4JTC B;  3K0D A;  3K08 A;  2HVK C;  4H33 A;  4PDR A;  2EIL C;  3SPI A;  2WLM A;  2DWE C;  4WFG A;  3ABK C;  4X8A A;  2NLJ C;  4R50 A;  2AHZ A;  3E86 A;  4RUF A;  3OR7 C;  4UUJ C;  1OCZ C;  3ASN C;  1R3L C;  4MW8 A;  1V55 C;  2EIN C;  2WLJ A;  4RO2 A;  4MVZ A;  3F7Y C;  4OXS A;  2AHY A;  2KB1 A;  3RBZ A;  5EC1 C;  4EKW A;  3IGA C;  4R8C A;  3OUS A;  3KG2 A;  4F4L A;  1OCC C;  3LDD A;  5B3S C;  3GB7 C;  3T4D A;  1G4Y B;  1P7B A; 
#chains in the Genus database with same CATH topology
 2JEX A;  4PA3 A;  1U97 A;  4MSW C;  5L3B A;  4NB5 A;  3SJC C;  1XIL A;  1Q6H A;  1OCO C;  2CUG A;  5JH7 A;  2Q9L A;  2WA3 A;  5K1X A;  4L8J A;  1MG1 A;  1Q43 A;  1B6Q A;  1BL8 A;  4IL6 Z;  4H13 B;  2Q8V A;  4NTW A;  3BA9 A;  1JA8 A;  3C90 A;  1DGS A;  4OX9 B;  1COW G;  4WFB V;  3IAY A;  4JI4 O;  1BMF G;  1K7D A;  4TQD A;  4UCU A;  4J9Z B;  3AEI A;  2XUM A;  2HEP A;  3WB0 A;  1K9M W;  3SYO A;  1RM1 B;  3DC6 A;  1SQX H;  4ZI7 B;  3RT3 C;  1XMQ O;  3CXC U;  1GN6 A;  4HNA B;  1RFY A;  4K3A A;  3BRC A;  5IJ9 B;  2JGU A;  4B3S B;  1ZL8 B;  4ZKI A;  4DV5 B;  3K3W A;  3ZRX A;  2XAF A;  3BY6 A;  1GH6 A;  3CPW U;  4PA7 A;  1HR0 B;  1SQG A;  5BR8 O;  2UXD O;  4JYA B;  1YJN V;  1AI7 A;  5EYP A;  1GK9 A;  1MNG A;  1W59 A;  3JAK A;  4DUZ B;  4IIJ A;  3OMI B;  4DK1 A;  1FXH A;  2QTS A;  3JAK B;  4XBF A;  2DWE C;  5LL6 Y;  3JAL B;  4QGP A;  3I55 V;  4UVC A;  4J41 A;  1QR8 A;  4DR1 O;  1NT2 B;  2KB1 A;  3P30 A;  4BAY A;  5BMV B;  1M5I A;  1IBM B;  1SA0 A;  1NBM G;  1N36 B;  2Q7H A;  4WFH A;  4X1I A;  1S77 D;  2BTQ B;  1HNX B;  1W0K G;  3M99 B;  5J9P C;  1AI6 A;  1WA8 A;  1QNM A;  2RQ6 A;  1VQL V;  1WA8 B;  4ZIB A;  2EIK B;  3T2M A;  5CB4 A;  5LMN O;  3H01 A;  1GM9 A;  3B40 A;  5AG2 A;  4B3M B;  1BHA A;  5JVD B;  4DV1 B;  3DTU B;  2HFE C;  1VQN V;  4YXW G;  1N0J A;  1K73 W;  1M90 W;  1QLE B;  3CC7 V;  2ARH A;  4H44 B;  2UU9 B;  1YSC A;  3B77 A;  1FS0 G;  3ABL C;  1VF6 C;  4KL1 A;  4C7U A;  1NVP D;  2E5L B;  2P5O A;  3KCY A;  2VQF O;  1VQ6 V;  3CB2 A;  4DUZ O;  3A8T A;  3Q4H B;  3E2E A;  3QTC A;  3SJQ C;  4NXN O;  4YY3 B;  3G6E V;  4KUM A;  1BGY H;  2R9R B;  3ZRW B;  3ETQ A;  1N34 B;  2UXB B;  3PN1 A;  2L35 A;  3SYA A;  3BAB A;  3CME V;  4B3S O;  4R7C A;  4LFB O;  5LA6 B;  2EIN B;  2EIM B;  1PV0 A;  2A79 B;  4DUY B;  1M57 C;  2ZIN A;  5B1O A;  2KG7 A;  5EBM C;  1JPX A;  2KG7 B;  2XND G;  5E1A C;  3B09 A;  1LUV A;  3CRQ A;  4X1K A;  3C3T A;  3QO7 A;  4WBN B;  1ZUQ A;  4R50 A;  3CCV V;  2BTO A;  3RYC A;  2ZQM A;  4WBN A;  3ASN C;  2WLJ A;  4MVZ A;  5IJ0 A;  4JYB A;  2G38 A;  2E76 B;  4FVM A;  5CMU A;  3GB7 C;  5IWA B;  2GSM B;  2Q67 A;  1TUE B;  1VQK V;  2OWO A;  4MVM A;  3WB1 A;  4PA4 A;  4EFB A;  4DR2 O;  1D2D A;  1ZL8 A;  2RMK B;  5L3F A;  4UCO A;  2IU0 A;  2FKX A;  3SPJ A;  3BVO A;  3JAS B;  2WLI B;  1VQ4 V;  4LWS B;  4I55 A;  3CS5 A;  3CCE V;  4NTX A;  4B3T O;  2N04 A;  3BCC H;  5D5Q A;  5ITZ A;  4RQF A;  4D7S A;  3EVK A;  3ABL B;  2EIL B;  2GUZ B;  4CZZ A;  1FPO A;  4MW3 A;  4DUY O;  1Q81 W;  1D5A A;  1L0N H;  1OCR C;  2EIJ C;  2ZE8 A;  2OIE A;  1UFI A;  1IBK O;  4GX1 A;  5LHI A;  1QBZ A;  2DYR B;  2OTJ V;  1XHX A;  1AP6 A;  3E89 A;  2Y4T A;  3STZ C;  1NS1 A;  1GAX A;  4NXN B;  4YY3 O;  4CH5 A;  4X66 B;  3L9D A;  2NN4 A;  3AK1 A;  1R3K C;  3L75 H;  5CB4 B;  5B1N A;  3OFN G;  2AZ0 A;  5EBW C;  3KKY A;  5JVD A;  1QR9 A;  2X7R B;  1BQ0 A;  1K8A W;  2LFR A;  4H37 A;  2ILM A;  3K0G A;  4X1K B;  4GT1 A;  2PYJ A;  3I56 V;  4FZ0 A;  2PI5 A;  1ENV A;  4JI5 O;  2F43 G;  2UXX A;  4K8Z A;  4X8A A;  4O4H A;  3P3P A;  4O4H B;  4UCV A;  2CH7 B;  4PJ0 Z;  3M7M X;  4WF9 V;  1IBL O;  2P4V A;  3K5O A;  2ZM6 B;  3F5T A;  4J7K A;  1VQP V;  2YIB A;  4ZI7 A;  4G2K A;  1PPJ H;  5DED A;  3FD9 A;  1P49 A;  4X65 B;  1XHZ A;  1K92 A;  2QM4 A;  2VWK A;  4GKK O;  1HNZ O;  1IDS A;  1M93 A;  3JAS A;  4JI3 B;  4LWS A;  1S3J A;  3CRA A;  2EJR A;  4TT3 G;  1AJQ A;  1LUW A;  4U3J A;  2EZP A;  3CJH B;  3ZCC A;  4K0K B;  4MT8 A;  2ADP A;  2ETN A;  2JIZ G;  4DR4 O;  1Z5W A;  4J11 A;  2QTO A;  1KC8 W;  4LF5 O;  5GTI Z;  4NXM B;  4JI0 B;  4JI2 B;  4WFE A;  2YDE A;  2B9Z A;  4BIZ A;  5H9C A;  2HG5 C;  1R6K A;  2W0X A;  2X6A A;  4X1I B;  3E8F A;  5KX5 A;  2EIM C;  3L70 H;  4B7E A;  4QPK A;  5KAI Z;  3DC5 A;  2UXB O;  1GKF A;  2PF4 E;  3P3N A;  2EIK C;  1ZAU A;  3SR2 C;  2CTR A;  3KCX A;  2YEV B;  3UO3 A;  3SDL A;  4NVP A;  2OYQ A;  5D5P A;  1ZSP A;  1Y67 A;  2X6B A;  3JCZ A;  5J2U B;  4ASU G;  3RFR A;  1F7Y A;  4JV5 B;  2HVK C;  2WLM A;  3E22 A;  2NLJ C;  2AHZ A;  3RYF A;  4RUF A;  2CGN A;  4IHJ A;  4MW8 A;  5LMU O;  3A2F A;  2LGQ A;  4LFA O;  1BSM A;  3K5L A;  2IW5 A;  2LW1 A;  3DXR B;  1JFF B;  2WLN A;  5EIB D;  2ZDI A;  4LH7 A;  4QJF B;  4DRX A;  3OTO O;  3T1H O;  3ZHS A;  1WPB A;  4UV9 A;  4FIP C;  1Y6X A;  3U11 A;  4Q6G A;  3G67 A;  1N32 B;  1F4M A;  2RCV A;  3TGU H;  3RW0 A;  3F5W C;  1DF4 A;  1RM1 C;  3THO A;  4DV6 B;  2UXN A;  2DW4 A;  4JI6 O;  2RDC A;  2OCH A;  4DR5 B;  4DV0 O;  1G1X B;  2P4K A;  3JYC A;  1PNL A;  5LHH A;  5H5N A;  1R1B A;  2UUC B;  4DV3 B;  1BQZ A;  1HP8 A;  4BIU A;  2JS3 A;  2W0F C;  5JWP A;  2H3O A;  4FLT A;  1VQ7 V;  3OW2 U;  4DV3 O;  4PI0 A;  2ZE6 A;  3LNN A;  1Q82 W;  4N21 A;  4O4L A;  1X59 A;  5LXT A;  1XL6 A;  1VQ5 V;  2QM7 A;  3JD2 A;  3CCU V;  1P84 F;  2AZ2 A;  4RUE A;  3E35 A;  2OCC B;  3VQX A;  1SQP H;  4I55 B;  1WP8 A;  4O4I B;  3GVM A;  2UUB B;  2YXH A;  1Q8I A;  1W0J G;  5L3E A;  4HZ3 A;  5EYP B;  3SYC A;  1BT8 A;  1JCH A;  3D8C A;  1NU1 H;  1R73 A;  1MAB G;  1BE3 H;  2HKO A;  4GLX A;  4IHJ B;  2P06 A;  2PTM A;  1JR9 A;  2IJK A;  3E86 A;  2ZCE A;  3W7T A;  1KKC A;  5LGU A;  2LP7 A;  1GRJ A;  4JI4 B;  1AJN A;  4RWU A;  2EUL A;  5HFL A;  3H1H H;  1YEW A;  3W7X A;  4K8X A;  1P7B A;  3P32 A;  3K59 A;  1IUR A;  5LP6 B;  1FFX A;  2R9A A;  1RSO A;  3G80 A;  1TVK B;  2A7W A;  4QIW F;  2F66 C;  1OCO B;  5BXZ A;  5BY1 A;  4UCS A;  1AR4 A;  2XOK G;  4J10 A;  1U96 A;  4O4J B;  1KU9 A;  4HAM A;  1IXB A;  4DW0 A;  3K57 A;  4WCE V;  1GMG A;  2IH1 C;  4O2B B;  5DEC A;  3ZHT A;  3QG5 A;  3UM7 A;  2IJJ A;  5CA1 B;  1CEZ A;  4NKG B;  1ZLZ A;  1OCZ B;  2YIA A;  2PUS A;  5DM6 V;  3KZI Z;  1NVP B;  3RVY A;  5JCO A;  2XAJ A;  2ATK C;  4B3R B;  3CYO A;  2EIJ B;  4FFK A;  1VMG A;  4J9Y B;  3SPG A;  3J7A U;  2WLH A;  5JJJ B;  3MDS A;  1QHT A;  3VQW A;  1M56 B;  4LP8 A;  3ZBH A;  3D3Q A;  1EN5 A;  1GN4 A;  3A0H Z;  2ADQ B;  2BCC H;  5LYJ B;  4N23 A;  4DR6 O;  4JTA B;  1NQT A;  2D3O W;  3T1Y O;  4O4I A;  1K97 A;  4QE9 A;  5LMN B;  1R6N A;  5F2V O;  4LF4 B;  4LF9 B;  4PD4 F;  4MTX A;  5C8Y A;  2AXT Z;  4U3J B;  3CJH A;  1I08 A;  3VOU A;  4OPH A;  3B4S A;  5CBF A;  2X6C A;  3E8H A;  5IY5 C;  1P7G A;  3CMA V;  2E3C A;  1WLE A;  1PKX A;  2DYS B;  1O9G A;  2A3Q A;  3MHS C;  5IJ0 B;  2VQF B;  4J80 A;  1EN4 A;  1X4T A;  3OUS A;  4UV8 A;  1KP3 A;  1NH2 D;  4YHH O;  3ABM B;  2DN9 A;  2XT9 A;  4LFA B;  4I5S A;  4DK0 A;  5A9G A;  4UB8 Z;  4XDL A;  3ASO C;  1KMI Z;  4ABM A;  3CEI A;  5H6Q A;  3E8G A;  4O2B A;  3GWO A;  3ZMT A;  2Q73 A;  3JD3 A;  2ZD9 A;  4KXR A;  5ITZ B;  5BR8 B;  5KAF Z;  4ZHQ A;  3B8N A;  3RYF B;  1FAF A;  3LDC A;  5K1P A;  1IBL B;  2QM8 A;  1AP5 A;  5KA5 A;  1YIT V;  2WLK A;  1XL4 A;  4X20 A;  3BEH A;  4I50 B;  2B5U A;  1MOF A;  3LUT B;  3DXR A;  4LH6 A;  3LSQ A;  2ZNI A;  2IU3 A;  1AB3 A;  4PA9 A;  4DRX B;  1HR0 O;  1DTO A;  4GCZ A;  1S5L Z;  1Z2G A;  4X62 B;  2EZO A;  4JI8 O;  5DN6 G;  4XDK A;  1N0N A;  5CA0 A;  3WB2 A;  4GX0 A;  3ZRV A;  2LGW A;  3CC4 V;  3AK2 A;  4OX9 O;  1I5X A;  2YIC A;  2ZR3 A;  4U7O A;  3ZIA G;  5LOV B;  5LGT A;  4MVO A;  4DV6 O;  1TGO A;  3QO5 A;  4LF5 B;  4BWA A;  4WFG A;  2E75 B;  1RP3 B;  4DV7 O;  3ABU A;  3CP1 A;  4DR4 B;  2WAM A;  3H1K H;  4FZ1 A;  3X2Q B;  2GTS A;  4DR7 B;  1VEW A;  1WN7 A;  2A06 H;  1HNX O;  4E4E A;  5GTH Z;  1VAR A;  4KP4 A;  5FLX N;  1WP7 A;  4R6Z A;  4DV2 B;  1G6U A;  3WG7 B;  2P7T C;  4GKK B;  2JK5 C;  2CAZ C;  1GM8 A;  1MZE A;  4BR6 A;  1K4C C;  4GUN A;  3JSL A;  1R3I C;  5B1A B;  3FFQ A;  4IT5 A;  1XNQ B;  3K5N A;  3BA8 A;  3SPH A;  4B3T B;  4JI5 B;  1XMO O;  2E5L O;  1OCC B;  1M4U A;  4X62 O;  1SQQ H;  4K35 A;  2QKA A;  1OHH G;  2ZXW B;  1MA1 A;  4JV5 O;  2CE4 A;  4UFZ A;  4QE7 A;  3GWK C;  3UT5 B;  4JI7 B;  2OT5 A;  2GV9 A;  1QQC A;  1KP2 A;  3D3I A;  5IWA O;  5EC2 C;  1HDJ A;  1JVM A;  1KB9 F;  1K33 A;  1O9H A;  3ZMU A;  3MHH C;  2L6L A;  5CBG A;  3CCJ V;  4MTG A;  3CCR V;  4LFC O;  4PDL A;  4JYA O;  1M56 C;  1F51 A;  2YXL A;  4O4J A;  4UB6 Z;  5TIS Z;  1V54 C;  3L72 H;  4GX5 A;  3FB6 C;  1EFR G;  2Y48 A;  3TET A;  4D6T H;  4TWK A;  5LOV A;  1H2L A;  1SET A;  2O57 A;  2CDY A;  3AG2 C;  4JGS A;  4KHP O;  4P2Z A;  2CH7 A;  2HHH O;  1FJG B;  1KBH A;  5CA3 A;  2WPD G;  1NTM H;  2QSA A;  4DYL A;  2QKC A;  5KA6 A;  4NTY A;  2EX3 A;  1NI8 A;  4LF8 B;  2IJH A;  4R8C A;  1S72 V;  1VP7 A;  1F23 A;  1PL0 A;  2MK3 A;  5B3S B;  5LYJ A;  3H1I H;  2H8P C;  5L3D A;  2C2A A;  1JFF A;  2NNU A;  3N27 A;  4LNU B;  3JSN A;  1GN2 A;  4LCU C;  4WFF A;  3RYH A;  1YXB A;  4LNU A;  1ZWI C;  3AG3 C;  2QA4 V;  5JJN B;  1B3Q A;  2Q0O C;  2QKS A;  1I5Y A;  1H8E G;  3AG4 C;  3JCU Z;  1E1R G;  1THZ A;  4TUY A;  1PL4 A;  1XEQ A;  3X2Q C;  2Q0A A;  4LF8 O;  1E79 G;  4I9Q A;  3R65 A;  2F4V O;  2QWQ B;  1D5N A;  3UT5 A;  5FNV B;  1H2M A;  2Q6A A;  1S0V A;  1E1Q G;  3ML0 A;  3CD6 V;  1AJP A;  2CGO A;  1AI4 A;  2HJD A;  3HB3 B;  3K79 A;  4UCT A;  1NKD A;  2HJF C;  4ICG A;  4JAS A;  1JMK C;  4YJ3 A;  3JAW B;  3JD1 A;  2N05 A;  1N34 O;  4LF7 O;  1VQ8 V;  3JAW A;  5LHG A;  3O9O A;  4FM0 A;  1N32 O;  1Q3E A;  4JTD B;  1IXM A;  2LJ2 A;  1K34 A;  3QF7 A;  2KSD A;  4ZHQ B;  3HKE B;  1NJI W;  3HKB A;  2WA4 A;  5A2Q N;  1N8R W;  2BOC C;  4JPR A;  4PEL A;  1SKV A;  4ZBM A;  1G8M A;  1XBL A;  4X88 A;  4FPP A;  1WAZ A;  1YF2 A;  3N2G B;  1NR7 A;  4B3R O;  1Q6I A;  3SJA C;  3NXS A;  3RN4 A;  4I50 A;  3A0R A;  1SQB H;  2AHY A;  4X20 B;  3TJT A;  1YIJ V;  3VBB A;  2HHH B;  4JI6 B;  5LP6 A;  1FFX B;  2E74 B;  3JAR A;  3IC9 A;  1XUQ A;  2XHB A;  4DR7 O;  3JD0 A;  1YTF B;  2LQT A;  2QE7 G;  3HKD B;  4MVS A;  2CTP A;  2A9H A;  3HKD A;  5CA0 B;  5JJE B;  2QEX V;  1H2N A;  2Q69 A;  1LR1 A;  1GO3 F;  1SES A;  1WNS A;  3FKS G;  4IGG A;  5B1B C;  4RQE A;  4X9Q A;  3ETE A;  3RGB A;  2DE0 X;  3ZX6 A;  1AVM A;  2N74 A;  1BCC H;  5CA1 A;  3ZMS A;  5IYZ A;  3JAM N;  3CCL V;  3TCU A;  4B7K A;  5IYZ B;  1GTO A;  2VQE O;  2W6I G;  1JQ0 A;  5IT9 N;  2Y69 B;  3CCQ V;  2D2C B;  5LMU B;  2RJZ A;  2Q5Z A;  3T4Z A;  1B06 A;  2PYL A;  5FPR A;  4O4L B;  3G71 V;  1FYJ A;  4D7T A;  3ZED A;  1L8D A;  4EFE A;  4G27 B;  1AR5 A;  3AG4 B;  4TV8 B;  4EEQ A;  2X0L A;  2Z5U A;  2YUA A;  2Y0P A;  2UXC O;  2DWD C;  3AG3 B;  3VQV A;  4IYH A;  1J95 A;  5EK0 A;  1MZF A;  3UO2 A;  4PV1 B;  3IFX A;  2VQE B;  4DXW A;  3DSQ A;  3ASN B;  3OEE G;  4LFC B;  2IBZ H;  4I4T B;  3U10 A;  4L87 A;  1SZT A;  2JDI G;  5KHK A;  4PDM A;  1M9N A;  2Y4U A;  1ZX3 A;  5IYC O;  1OJH A;  3WFV A;  1H2S B;  2YXY A;  2YC0 A;  3B8M A;  3TXS A;  4MTF A;  2JS5 A;  3M8A A;  2UUA O;  3S3W A;  5FPO A;  3ABK C;  3JD4 A;  4DR5 O;  1WPX A;  4J7J A;  4AIL C;  4NXM O;  1QCE A;  4JI2 O;  1OCZ C;  1V55 C;  1WB8 A;  3ABK B;  4U3F H;  2F1M A;  3RBZ A;  3FAV A;  3JAR B;  4F6R A;  5KMG A;  4FLY A;  2QWP B;  4JI1 B;  1RSO B;  4F4L A;  1Q90 D;  3LDD A;  4P9P A;  1CPY A;  3ETG A;  4YHH B;  1WB7 A;  2ZM6 O;  1FXV A;  5E79 Z;  2WLL B;  3ZMV A;  4DR3 O;  1N33 B;  1IX9 A;  3OTF A;  4JI8 B;  3BPZ A;  5KHH A;  2OTL V;  2LW7 A;  4J7Z A;  3I5D A;  1K3E A;  2QWN B;  4NR1 A;  3RYI A;  1PNM A;  4X65 O;  2UUA B;  3OEH G;  5J2U A;  1KD1 W;  2R9I A;  1YVW A;  3TXQ A;  2H94 A;  3ICX A;  3K03 A;  1H38 A;  3E22 B;  3CRC A;  3F7V C;  3SJB C;  2V1D A;  5JCO C;  3N2G A;  1SC5 B;  2K1E A;  3RWR D;  5KLV H;  4FLX A;  1XRE A;  3CRR A;  2PY5 A;  3CHX A;  4DR3 B;  1N33 O;  4FM1 A;  3OMN B;  2GTA A;  4H0L B;  3UCS C;  2HVJ C;  2OCC C;  1AR1 B;  1XDC A;  3CCM V;  4LFB B;  3PJS K;  3CX5 F;  4BW9 A;  2Q7E A;  2JGD A;  4YJ2 A;  2B1I A;  4ZOL A;  1R6T A;  1YZB A;  1K4D C;  4I4T A;  5EBL C;  1H2G A;  3L74 H;  3FB8 C;  2DOS A;  1NTZ H;  5L3G A;  4IYI A;  4TUY B;  4TV9 A;  1P4R A;  4FMT A;  4X1Y B;  5LGN A;  2GBO A;  2JEU A;  1ARO P;  2YI9 A;  4MVQ A;  3ZS8 C;  1FXK B;  2BE3 A;  4JI0 O;  1VQO V;  3K08 A;  1SRY A;  2FTK A;  2EIL C;  1JJ2 U;  3HKC A;  4F6R B;  5KMG B;  3HKC B;  1J5E O;  4YJ3 B;  1FD9 A;  4FJC C;  4OXS A;  2AW9 A;  5EC1 C;  1URF A;  1OCC C;  3K9A A;  3UQ8 A;  4DW1 A;  2R70 A;  4E2L A;  1QVF U;  1MSW D;  4XDJ A;  1TAE A;  3ZHR A;  2XTA A;  1HNZ B;  5GON A;  1EZJ A;  5CBH A;  2IJI A;  1YDX A;  4CH3 A;  1FFT B;  1XNQ O;  1UJW B;  2MW2 B;  5KHG A;  3ZHQ A;  2PI4 A;  1YJW V;  2Z0A A;  4RAI A;  4FLW A;  2YID A;  4X64 O;  1JOY A;  3D36 A;  3TK1 A;  3J80 N;  1H8H G;  2EJ7 A;  3STL C;  3FYE B;  1BZK A;  3L73 H;  3LDE A;  3RYC B;  3S3X A;  3MD0 A;  4UVA A;  1TVK A;  2JRI A;  3LSU A;  2JJ2 G;  5J2T B;  1IVS A;  4QNH B;  4LF7 B;  1Y74 B;  4YJ2 B;  4JAV A;  4LR3 A;  4UCR A;  3L71 H;  4WFA V;  4UXN A;  4LF4 O;  2Q4P A;  3OAA G;  1K5Q A;  4HNA A;  4MVR A;  3FB5 C;  3RVZ A;  2VRZ A;  2QR4 A;  4UVB A;  1TUB A;  3IC7 A;  2P67 A;  4BIO A;  1XMO B;  1M1K W;  3EXA A;  3CCS V;  1ORQ C;  4JTC B;  2VS0 A;  1SS3 A;  4H33 A;  4JI7 O;  2F95 B;  1FKA O;  2ZIO A;  4K0K O;  5KHI A;  1PNK A;  2HR3 A;  3F7Y C;  2QJ1 A;  1VIB A;  4OPA A;  4EKW A;  3DGE A;  2YSU B;  4JZG A;  3OE7 G;  1FXK C;  1SF9 A;  3T4D A;  2ZT9 B;  3QNE A;  4TV8 A;  3FYI B;  2ZR2 A;  3OR6 C;  1SA0 B;  4CS2 A;  3EFF K;  3OM3 B;  4MVU A;  1YI2 V;  3ASO B;  4TSF G;  4JI1 O;  2CTQ A;  1K5S A;  4CS3 A;  1LNQ A;  5H2F Z;  1MSD A;  4AQY B;  3CRM A;  1JJO A;  5B1B B;  1TA8 A;  1B04 A;  2HLD G;  2QGN A;  4P30 A;  2ITD C;  1KKD A;  1AI5 A;  3IJ4 A;  2ODM A;  1JX9 A;  5EZY B;  5IE9 A;  5EZY A;  4QPJ A;  3JAT A;  1NH2 B;  4I0X A;  2UUB O;  3K06 A;  4DV7 B;  1YTF D;  3FAV B;  2DMX A;  3AG1 B;  1UPG A;  1VF5 B;  5KHJ A;  2LO1 A;  1SQF A;  1KEC A;  4DV4 B;  2CK3 G;  4CS4 A;  1S5J A;  1CP9 A;  4PDV A;  2M6Y A;  3SPC A;  4DR6 B;  4P9O A;  3RYI B;  4DO2 A;  1I94 O;  4J42 A;  4G28 B;  3SYQ A;  4EB6 A;  4LF9 O;  3E83 A;  3HKB B;  4DV1 O;  4EB6 B;  3K9S A;  3ZJZ A;  2DYR C;  2WSS G;  3CWB H;  5JQG B;  2UXD B;  2A0L A;  5LP6 C;  4KHP B;  1NR1 A;  1Q5O A;  2F93 B;  1PD3 A;  1R3J C;  1S76 D;  4HBN A;  2JJ1 G;  5C93 A;  4LF6 B;  2YIB D;  1SER A;  4AHC A;  4FLU A;  3OR7 C;  3WU2 Z;  1I0H A;  3K5M A;  1Z5V A;  1XMQ B;  1IBM O;  4JYC A;  2ZIM A;  1J5E B;  1G4Y B;  1GN3 A;  4GKJ O;  1KYO F;  1XNR B;  4GX2 A;  4GKJ B;  3RYH B;  3N2K B;  1XNR O;  3OT7 A;  1OV9 A;  1KQS U;  3CXH F;  5FL7 G;  1VF6 A;  5KX5 B;  3CSX A;  2BTQ A;  2BSK B;  4CH6 A;  3ZHV A;  3ETD A;  4AQY O;  3HPL C;  2XAG A;  2ZKO A;  4LF6 O;  4B3M O;  2YS8 A;  4Z1M G;  3APQ A;  4FFB B;  3JAT B;  4DV5 O;  4YIO A;  5KUM A;  2DQ0 A;  4OGQ B;  4MTO A;  4KFM A;  1FJG O;  1F4N A;  3LNM B;  1VQM V;  2PZS A;  1DK1 A;  1KUQ A;  1N36 O;  2DJV A;  1HWY A;  2NR5 A;  1QLN A;  3OD4 A;  4DR1 B;  1MMM A;  3VQY A;  3QVN A;  2ZXW C;  2OIG A;  1OZ0 A;  3U0Z A;  4CBC A;  3O65 A;  2ZNJ A;  1VF7 A;  3K04 A;  4CC6 A;  2IM9 A;  2Y69 C;  4W4K A;  4HYO A;  4DV4 O;  1N4C A;  3T1Y B;  3W7W A;  1I94 B;  1ROP A;  1EN6 A;  4PHZ A;  1Y4M A;  5IDJ A;  4JZ2 A;  5LA6 A;  3ABT A;  1Q7Y W;  3H1L H;  3W7S A;  3ABM C;  3T1C A;  1NZ6 A;  2M7W A;  3ZN1 A;  4U7N A;  4PI2 A;  2XAS A;  1HW7 A;  4I0X B;  3AK3 A;  1EZV H;  4AI8 A;  1WJZ A;  2FYU H;  4JAA A;  2Y0I A;  1SZX A;  3EHB B;  3ZMZ A;  3IGA C;  2K9P A;  3KG2 A;  2GDS A;  2P90 A;  2B1G A;  1Y74 A;  2Q68 A;  2AGA A;  1PM9 A;  2XAH A;  2WLL A;  4FLZ A;  2PGG A;  3WG7 C;  1US6 A;  4DR2 B;  4Q20 A;  2RN9 A;  4LBE C;  5HFM A;  4YIP A;  4FFB A;  3MAQ A;  2FL4 A;  3LSS A;  5B1A C;  5IYD O;  3OTO B;  3T1H B;  5JQG A;  2Z3Y A;  2XAQ A;  3ZN0 A;  2V7Q G;  3OMA B;  1PP9 H;  4LC1 A;  2IH3 C;  4CH4 A;  4IIJ B;  1H2K A;  3AG1 C;  2HP8 A;  3J81 N;  2ITC C;  2KKW A;  1A32 A;  2V4D A;  3G6B A;  1M57 B;  4MS2 A;  5L3C A;  1XQ8 A;  3HR0 A;  1V55 B;  1QVG U;  4O2A A;  1QU7 A;  1EBO A;  3APO A;  1XI1 A;  1S5H C;  3N2K A;  1CXZ B;  3SYP A;  1SQV H;  1ZTE A;  5H6R A;  5B66 Z;  3H9V A;  3C3S A;  2VWJ A;  1QLE C;  2YI8 A;  4TV9 B;  4X1Y A;  4JI3 O;  2UU9 O;  5EIB C;  2CTW A;  5FNV A;  5IY5 B;  3G4S V;  4BW5 A;  4PDR A;  4I7Z B;  1Q86 W;  5LBQ A;  2DQ3 A;  1Y76 A;  1RPO A;  1YHQ V;  1DLB A;  1R3L C;  1Y76 B;  4DV0 B;  1W2B U;  4RO2 A;  3Q4H A;  4TQF A;  4JYY A;  3AG7 A;  5B3S C;  1IZ3 A;  3FX7 A;  2UUC O;  2FB5 A;  3ZRW A;  1AIL A;  3UKM A;  5IJ9 A;  4JAU A;  3NR7 A;  3QO8 A;  4Z2W A;  4A5U B;  3FB7 C;  5GON B;  1V54 B;  4NYK A;  2ZDI C;  3D36 C;  4B08 A;  3HKE A;  3OGI B;  2LFS A;  3B2E E;  1EM1 A;  1Y66 A;  3AG2 B;  3BFR A;  5JH7 B;  3BHP A;  5GW7 A;  1Q6U A;  5CN0 A;  3ZHU A;  4FK5 C;  3OGC C;  1L1F A;  1HNW O;  4FM2 A;  5C8Y B;  5BZB A;  1HNW B;  1RPR A;  1GM7 A;  1I7F A;  3K58 A;  2DYS C;  2RNB A;  3JAL A;  3CE2 A;  2ZE7 A;  3CC2 V;  1BHB A;  5BMV A;  1T5E A;  5IYB O;  1VQ9 V;  4PA6 A;  3ZRS A;  4O2A B;  1DF5 A;  5J2T A;  4CC5 A;  2UXC B;  2BSK A;  2Q7G A;  2BOB C;  2JGD B;  2R72 A;  3OUF A;  2P22 C;  4ZOL B;  5KUK A;  4X89 A;  4X66 O;  5B5E Z;  4I9W A;  5LXT B;  1YJ9 V;  2QDO A;  3E8B A;  2P6J A;  3H1J H;  1YCI A;  2ZE5 A;  1V9P A;  4DV2 O;  2W6J G;  4GZR B;  1TUB B;  4JF3 A;  2YEV A;  2QWR B;  1XOU A;  2JVD A;  1FXK A;  4F6E A;  2WLI A;  2F4V B;  3SGI A;  1BS3 A;  2F23 A;  2GHY A;  1L0L H;  3K0D A;  3SPI A;  1OCR B;  3R66 A;  2FML A;  2WWW A;  4TOI A;  4Z1V A;  4FLV A;  2GUZ A;  2EBO A;  4UUJ C;  3W7U A;  2EIN C;  2KQX A;  3A0B Z;  1IBK B;  4W4L A;  1NTK H;  2QWO B;  4GYC B;  4X64 B;  3BAA A; 
#chains in the Genus database with same CATH homology
 2JEX A;  3QNE A;  2IW5 A;  2ZR2 A;  3FYI B;  3OR6 C;  4PA3 A;  2H8P C;  4MSW C;  3EFF K;  3OM3 B;  4MVU A;  5L3D A;  5L3B A;  2C2A A;  3ASO B;  4TSF G;  1YI2 V;  2NNU A;  1K5S A;  2WLN A;  2ZDI A;  4LCU C;  4WFF A;  1OCO C;  4QJF B;  1ZWI C;  1LNQ A;  3AG3 C;  2QA4 V;  4UV9 A;  4FIP C;  5B1B B;  1MG1 A;  1B6Q A;  1F4M A;  2QKS A;  2HLD G;  1I5Y A;  3RW0 A;  1H8E G;  1BL8 A;  4P30 A;  2ITD C;  3F5W C;  1DF4 A;  3AG4 C;  1E1R G;  1THZ A;  1RM1 C;  1AI5 A;  1KKD A;  3X2Q C;  1JX9 A;  1E79 G;  4QPJ A;  2UXN A;  3R65 A;  2DW4 A;  1NH2 B;  1COW G;  4WFB V;  2Q6A A;  1S0V A;  1E1Q G;  3K06 A;  3ML0 A;  3CD6 V;  1AJP A;  1BMF G;  1K7D A;  1YTF D;  1AI4 A;  3JYC A;  3AG1 B;  3HB3 B;  3K79 A;  1PNL A;  5LHH A;  4J9Z B;  1KEC A;  1NKD A;  2HJF C;  3AEI A;  4JAS A;  4BIU A;  2W0F C;  1K9M W;  3JD1 A;  2CK3 G;  1VQ7 V;  3OW2 U;  3SYO A;  1VQ8 V;  5LHG A;  1RM1 B;  3CXC U;  1Q82 W;  4N21 A;  1CP9 A;  1XL6 A;  1VQ5 V;  4PDV A;  2QM7 A;  3SPC A;  4ZKI A;  4P9O A;  4DO2 A;  4JTD B;  3K3W A;  3JD2 A;  4G28 B;  3CCU V;  3ZRX A;  2XAF A;  3BY6 A;  1IXM A;  3SYQ A;  1K34 A;  3E83 A;  4RUE A;  3E35 A;  3CPW U;  3ZJZ A;  2DYR C;  2OCC B;  2WSS G;  4PA7 A;  1NJI W;  1N8R W;  2A0L A;  2BOC C;  4JPR A;  1W0J G;  5L3E A;  4PEL A;  4HZ3 A;  3SYC A;  1JCH A;  1YJN V;  1AI7 A;  1NR1 A;  4ZBM A;  1GK9 A;  1R73 A;  1G8M A;  1PD3 A;  1R3J C;  1S76 D;  1MAB G;  4X88 A;  2HKO A;  3OMI B;  4FPP A;  1FXH A;  2JJ1 G;  5C93 A;  1NR7 A;  4XBF A;  2DWE C;  1SER A;  3I55 V;  2IJK A;  3E86 A;  4UVC A;  3OR7 C;  3W7T A;  3NXS A;  1QR8 A;  5LGU A;  3A0R A;  2LP7 A;  1AJN A;  2AHY A;  2KB1 A;  3P30 A;  4BAY A;  5HFL A;  1YIJ V;  1NBM G;  3VBB A;  3W7X A;  4JYC A;  1G4Y B;  1P7B A;  3P32 A;  4GX2 A;  4WFH A;  1KQS U;  4QIW F;  5FL7 G;  3JD0 A;  1YTF B;  1S77 D;  1OCO B;  1W0K G;  2QE7 G;  3M99 B;  5J9P C;  1AI6 A;  4MVS A;  1VQL V;  2A9H A;  2XOK G;  2EIK B;  3T2M A;  3H01 A;  1GM9 A;  2QEX V;  3ETD A;  2Q69 A;  1GO3 F;  1SES A;  4HAM A;  3FKS G;  1BHA A;  3HPL C;  2XAG A;  5B1B C;  4RQE A;  3ETE A;  3DTU B;  2HFE C;  1VQN V;  4YXW G;  4WCE V;  4Z1M G;  1GMG A;  1K73 W;  1M90 W;  2IH1 C;  1QLE B;  3CC7 V;  1YSC A;  3ZMS A;  3B77 A;  5KUM A;  3UM7 A;  1FS0 G;  2IJJ A;  3ABL C;  3TCU A;  3CCL V;  2DQ0 A;  1CEZ A;  4MTO A;  1GTO A;  4KFM A;  1OCZ B;  1NVP D;  1F4N A;  3LNM B;  1VQM V;  5DM6 V;  2W6I G;  1NVP B;  3RVY A;  2XAJ A;  1JQ0 A;  2ATK C;  2Y69 B;  3CCQ V;  1VQ6 V;  3CYO A;  1HWY A;  2EIJ B;  3E2E A;  1QLN A;  4J9Y B;  3SJQ C;  3T4Z A;  3SPG A;  2WLH A;  3G6E V;  4KUM A;  2ZXW C;  3G71 V;  1OZ0 A;  2R9R B;  3ZRW B;  4G27 B;  3AG4 B;  1M56 B;  4LP8 A;  4CBC A;  3K04 A;  3SYA A;  2X0L A;  2Z5U A;  2Y69 C;  4HYO A;  3CME V;  4N23 A;  4JTA B;  4R7C A;  2DWD C;  3AG3 B;  3W7W A;  1NQT A;  2D3O W;  5EK0 A;  1J95 A;  1ROP A;  1Y4M A;  1K97 A;  4QE9 A;  3IFX A;  1R6N A;  2EIN B;  4DXW A;  5IDJ A;  3ASN B;  3OEE G;  3ABT A;  2EIM B;  4MTX A;  2A79 B;  4L87 A;  1SZT A;  1M57 C;  2JDI G;  1Q7Y W;  4PDM A;  1M9N A;  5B1O A;  3W7S A;  3ABM C;  5EBM C;  3T1C A;  3VOU A;  5CBF A;  5IYC O;  1JPX A;  3WFV A;  2X6C A;  3E8H A;  5IY5 C;  2XND G;  2M7W A;  5E1A C;  3B8M A;  3ZN1 A;  4U7N A;  3CMA V;  4MTF A;  1WLE A;  1PKX A;  2DYS B;  3ABK C;  3JD4 A;  2XAS A;  3QO7 A;  1WPX A;  3CCV V;  4R50 A;  1QCE A;  3MHS C;  1OCZ C;  2ZQM A;  3ASN C;  1V55 C;  2WLJ A;  4MVZ A;  3ABK B;  4JYB A;  3RBZ A;  3EHB B;  3IGA C;  3ZMZ A;  3OUS A;  4UV8 A;  3KG2 A;  5CMU A;  4F4L A;  3LDD A;  3GB7 C;  2P90 A;  1KP3 A;  2GSM B;  1NH2 D;  4P9P A;  2B1G A;  1CPY A;  3ABM B;  3ETG A;  2Q68 A;  2Q67 A;  1FXV A;  1TUE B;  2XAH A;  2WLL A;  1VQK V;  4I5S A;  2WLL B;  3WG7 C;  3ZMV A;  4MVM A;  4PA4 A;  4XDL A;  4Q20 A;  5L3F A;  2OTL V;  3ASO C;  2IU0 A;  4LBE C;  5HFM A;  5H6Q A;  1K3E A;  3SPJ A;  1PNM A;  3E8G A;  3GWO A;  3LSS A;  3ZMT A;  3JD3 A;  3OEH G;  5B1A C;  2WLI B;  5IYD O;  1VQ4 V;  1KD1 W;  2R9I A;  2ZD9 A;  3CCE V;  2Z3Y A;  2H94 A;  2XAQ A;  3ZN0 A;  3K03 A;  1H38 A;  2V7Q G;  4RQF A;  3OMA B;  3ABL B;  3B8N A;  4LC1 A;  2EIL B;  4CZZ A;  2IH3 C;  4MW3 A;  3F7V C;  1Q81 W;  2V1D A;  3AG1 C;  1OCR C;  3LDC A;  2EIJ C;  2ITC C;  2K1E A;  2QM8 A;  5KA5 A;  1M57 B;  4MS2 A;  2WLK A;  1XL4 A;  1YIT V;  5L3C A;  3BEH A;  4GX1 A;  3OMN B;  1V55 B;  2B5U A;  5LHI A;  1MOF A;  1QBZ A;  2DYR B;  2HVJ C;  2OCC C;  3LUT B;  2OTJ V;  1AR1 B;  3LSQ A;  1QVG U;  1EBO A;  2IU3 A;  3E89 A;  3CCM V;  1S5H C;  3PJS K;  3STZ C;  3SYP A;  4PA9 A;  1DTO A;  5H6R A;  4GCZ A;  2B1I A;  5EBL C;  1K4D C;  1R3K C;  2EZO A;  3OFN G;  5B1N A;  5DN6 G;  1H2G A;  1F23 A;  5EBW C;  4XDK A;  3FB8 C;  1QLE C;  5L3G A;  4GX0 A;  1QR9 A;  1P4R A;  4FMT A;  5LGN A;  2X7R B;  1K8A W;  3ZRV A;  2JEU A;  2LFR A;  4H37 A;  1ARO P;  3K0G A;  3CC4 V;  4MVQ A;  5IY5 B;  1I5X A;  4GT1 A;  2ZR3 A;  1FXK B;  4U7O A;  3G4S V;  3ZIA G;  3I56 V;  2PI5 A;  1ENV A;  4BW5 A;  4MVO A;  5LGT A;  2F43 G;  1VQO V;  3K08 A;  2UXX A;  3QO5 A;  1SRY A;  2FTK A;  2EIL C;  4PDR A;  1Q86 W;  1JJ2 U;  4WFG A;  5LBQ A;  2DQ3 A;  4X8A A;  1RPO A;  1YHQ V;  3ABU A;  1DLB A;  1R3L C;  1W2B U;  4RO2 A;  4FJC C;  3CP1 A;  4WF9 V;  2WAM A;  4OXS A;  3X2Q B;  5EC1 C;  1OCC C;  5B3S C;  1VQP V;  3K9A A;  4E2L A;  4G2K A;  1QVF U;  1MSW D;  3ZRW A;  4KP4 A;  3UKM A;  4XDJ A;  4R6Z A;  4JAU A;  3QO8 A;  3FB7 C;  1V54 B;  2P7T C;  2ZDI C;  1EZJ A;  1K92 A;  3WG7 B;  2JK5 C;  2LFS A;  1GM8 A;  2IJI A;  5CBH A;  1K4C C;  1FFT B;  1R3I C;  5B1A B;  1Y66 A;  1UJW B;  1S3J A;  3AG2 B;  2EJR A;  3SPH A;  5GW7 A;  1OCC B;  1AJQ A;  4TT3 G;  5CN0 A;  2EZP A;  4FK5 C;  3OGC C;  1L1F A;  2PI4 A;  3ZCC A;  5BZB A;  1OHH G;  4MT8 A;  2ZXW B;  1YJW V;  4RAI A;  2JIZ G;  1RPR A;  1GM7 A;  2QTO A;  2DYS C;  1JOY A;  3D36 A;  3TK1 A;  1H8H G;  1KC8 W;  3CC2 V;  3STL C;  1BHB A;  3FYE B;  4QE7 A;  4WFE A;  5IYB O;  4BIZ A;  1VQ9 V;  2OT5 A;  3LDE A;  5H9C A;  2HG5 C;  1KP2 A;  4PA6 A;  3MD0 A;  3ZRS A;  3D3I A;  1R6K A;  4UVA A;  2X6A A;  5EC2 C;  1DF5 A;  1JVM A;  3E8F A;  2EIM C;  2JJ2 G;  1K33 A;  3ZMU A;  4QNH B;  2BOB C;  3OUF A;  3MHH C;  4JAV A;  5CBG A;  3CCJ V;  5KUK A;  4MTG A;  4X89 A;  3CCR V;  4WFA V;  4UXN A;  4QPK A;  3OAA G;  4PDL A;  1K5Q A;  1M56 C;  4MVR A;  1F51 A;  1GKF A;  3FB5 C;  4I9W A;  3RVZ A;  2EIK C;  1YJ9 V;  3E8B A;  4UVB A;  1V54 C;  2P6J A;  5B3S B;  2YEV B;  3FB6 C;  4GX5 A;  2W6J G;  1EFR G;  4JF3 A;  2YEV A;  2Y48 A;  3TET A;  3IC7 A;  1FXK A;  2WLI A;  2P67 A;  4TWK A;  1SET A;  3AG2 C;  4JGS A;  2GHY A;  1M1K W;  2X6B A;  1ORQ C;  3CCS V;  3JCZ A;  4ASU G;  4P2Z A;  4JTC B;  3K0D A;  4H33 A;  2HVK C;  3SPI A;  1OCR B;  2WLM A;  2WWW A;  5CA3 A;  2NLJ C;  2AHZ A;  4RUF A;  2WPD G;  2EBO A;  4UUJ C;  3W7U A;  4MW8 A;  5KA6 A;  1PNK A;  2EIN C;  2HR3 A;  3F7Y C;  4EKW A;  2IJH A;  3DGE A;  4R8C A;  1S72 V;  2YSU B;  3OE7 G;  1FXK C;  1PL0 A;  2MK3 A;  3T4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...