2QWOB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
b'DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwoB00
2M6YA 1FPOA 2N04A 4J7ZA 2YS8A 3APOA 2CTQA 1IURA 2KQXA 2LO1A 1XBLA 2CTWA 2DN9A 2Y4UA 4J80A 2GUZA 4RWUA 3BVOA 1BQZA 3APQA 3UCSC 1NZ6A 1GH6A 2QWPB 1BQ0A 2LGWA 2QWNB 2QWOB 2EJ7A 2QWRB 3UO3A 2PF4E 2L6LA 4IT5A 1HDJA 2QSAA 2CUGA 3AG7A 1FAFA 1N4CA 2Y4TA 2GUZB 1WJZA 2QWQB 2OCHA 2YUAA 2DMXA 2CTPA 2CTRA 2N05A 3UO2A
chains in the Genus database with same CATH superfamily
4CH4A 3A0HZ 3JARB 3ABMB 3ZHSA 4LF7O 1NQTA 1QVFU 1LUVA 2UXDO 2CAZC 5L3EA 2CGNA 1BCCH 1OJHA 4ZHQA 2OYQA 3ZCCA 2JJ1G 3OE7G 2WAMA 1MSWD 2KB1A 2AZ2A 4JYAB 1FXKA 4DO2A 1GMGA 4XDKA 1DTOA 2QWQB 4DR2B 3ZHTA 2IU3A 3UO2A 3JASA 4H44B 4DR4B 4CC6A 4ZHQB 4MVRA 2LO1A 3RGBA 1L8DA 4X65O 1QLEC 2JS5A 1N34B 1FFXA 1G6UA 4DXWA 5DM6V 4HBNA 3SJAC 3K06A 3B2EE 3JASB 1OCCB 2YC0A 4BIUA 2YIBD 1EFRG 5J2UA 4FLYA 4IYHA 2ZIOA 3OW2U 1TA8A 2JGDB 2IJHA 1O9GA 3CSXA 2W6IG 5L3DA 1FFXB 3F7YC 4TT3G 3OUSA 2MK3A 4O4LA 4D7TA 2YI8A 4JI7B 2QM4A 3TGUH 3T1HO 4NYKA 4NXMB 2A79B 4JI8O 1XOUA 1K34A 3VQXA 1JFFB 2Y4UA 3VOUA 3A8TA 4GLXA 3L74H 4IGGA 3BRCA 1R3LC 3SPGA 3CCSV 3L70H 4TQFA 4G27B 3KG2A 4B3TO 2AXTZ 4ASUG 2XASA 2BCCH 4I9QA 1AP6A 2OIEA 1V55B 3WB2A 3AG4C 4U3FH 1KBHA 1K8AW 1N33B 1B06A 5B1BB 2YIBA 5BY1A 5LGUA 1WPXA 4LFBO 3APOA 3E83A 2ZE8A 3IJ4A 5J2TA 2F95B 1PKXA 4JTCB 1R3IC 1HNWB 1YHQV 1X59A 3RN4A 2AGAA 2HJDA 4F6RA 2UUBB 2WLMA 1U96A 4UCTA 4D6TH 3ZHVA 4LFAO 4AQYB 5E1AC 2ZDIA 3JAKB 2CTRA 1ZWIC 2MW2B 3CCVV 1YZBA 2DYRB 3OM3B 2PI4A 4F6RB 1IBLB 1QU7A 2QEXV 4X1IB 1XREA 3H01A 4KHPO 2ITDC 4J7JA 3SYPA 4IYIA 4MVZA 1R6KA 1P7GA 4WFGA 1SC5B 4RQEA 3I55V 3E35A 1PNLA 1MOFA 4I0XB 3VQYA 4JTAB 5B5EZ 2NR5A 1I5XA 3ZHRA 2GUZA 5KX5A 3A2FA 2ADPA 4GKJB 4B3RB 1KMIZ 2HG5C 2PF4E 4DV5B 4LF5B 1KD1W 3G71V 2Q0AA 3LDEA 2A9HA 2DQ0A 3G80A 4P2ZA 1S72V 3HKEB 4GX2A 2Q6AA 2DYSC 1D5AA 5KX5B 1SQFA 3TCUA 5BR8O 2HVJC 4YHHO 3RYHB 4GX0A 2XAFA 1G4YB 3L72H 3CWBH 4JAUA 5EBLC 3UKMA 1GN4A 2B1IA 1X4TA 1V54C 4EFEA 2QE7G 4N23A 3H1IH 3L71H 2EIMC 2WSSG 1US6A 3K04A 4FLTA 2XT9A 1BT8A 1EN6A 3RYFB 1JOYA 2EJ7A 4TOIA 3HKBB 2E5LB 1PL4A 3S3XA 4MW8A 2UUCO 5LGTA 4O4IA 4R8CA 4DR1B 4DR5O 1W2BU 1VQ4V 4F4LA 3HPLC 4MTGA 2K9PA 3M8AA 3S3WA 5KMGB 4WBNA 3G4SV 1NVPB 1WA8B 2XAHA 3RFRA 4B3SB 1KQSU 4HZ3A 2ZE5A 2ZIMA 3QTCA 1Q43A 1M90W 1YJWV 2LP7A 3ZMTA 3U0ZA 4X64B 4WBNB 1K7DA 1UPGA 3C3TA 1FXHA 4BAYA 3CMAV 2JGUA 4P9OA 5L3CA 1OCOC 4I4TA 4UCRA 1RPRA 5LP6C 3B09A 3KZIZ 1SA0A 1R3KC 1IDSA 4DR3O 2JEUA 5IJ9A 4HAMA 3FAVA 3AK2A 1E79G 2WLIA 1BE3H 5EYPB 3H1LH 2V7QG 4JZGA 3OMAB 1SA0B 1P4RA 2FKXA 4WFEA 4BW5A 3OMIB 1J5EO 2RN9A 3T2MA 2WLIB 2HJFC 2CH7B 2DQ3A 3CX5F 3VBBA 3RBZA 5JH7A 2ATKC 4XBFA 3CJHB 5BXZA 5LHGA 5KLVH 2Y0IA 4CC5A 2VWKA 1NKDA 3H1HH 4GCZA 3JD0A 4UCUA 2UXXA 5CN0A 3WG7C 5LMUB 3C3SA 1HNZB 3AG3B 5IYBO 4WFAV 2EINC 2QGNA 2R9AA 3N2GB 4DW0A 5JH7B 4DV6B 2P5OA 3W7UA 1XUQA 2EIKC 2VQEB 4K0KO 1FKAO 5LHIA 5HFLA 4A5UB 4FFBB 1VQ9V 2X6BA 2ZD9A 4JI0B 4FM0A 3LNNA 5KA5A 3ETGA 5A2QN 2X6CA 2DJVA 2VQFO 3SDLA 5BMVB 2ITCC 2BOCC 1GM7A 4PD4F 1QQCA 2KSDA 3AEIA 1KECA 3QG5A 2P6JA 1QR9A 1BGYH 4LWSA 3OUFA 3ETQA 4H33A 3SJQC 4X1YB 5CBFA 2H3OA 2OTLV 4RWUA 3IC7A 5B1AC 2ZE6A 5JJEB 4O2BA 5EK0A 5KA6A 4WFBV 3SYOA 2WLJA 4LWSB 4LF7B 3BAAA 2PYJA 4BR6A 5LYJA 1NJIW 2UXDB 4DV7B 5KHGA 2ZINA 2DWEC 4RUFA 1CPYA 2KQXA 3AK1A 2ZM6O 5LYJB 3TK1A 2IH1C 2LGWA 2XOKG 2YI9A 5IJ0A 2BOBC 1Z5WA 4PA7A 2R9RB 4W4KA 1YJ9V 1SQVH 2IM9A 5JQGA 1OCRB 4ICGA 2EX3A 2Q0OC 3CCMV 1H8HG 4FMTA 2BSKB 1VQOV 5LBQA 3EHBB 1AR1B 2YXHA 4B3MO 1YTFD 1YIJV 3K9SA 5JQGB 4KUMA 1NTZH 2L35A 4GUNA 5GW7A 1IBKO 2RCVA 2WLHA 1XMOO 4PV1B 2RJZA 4IHJB 4TSFG 3ASOB 4JTDB 5GONB 5LOVB 3T1HB 3T1YB 1VF7A 3STLC 3AG2B 2WLLB 4DR7O 4HNAB 1B04A 1GKFA 1DF5A 2YSUB 1BHBA 3OGCC 3I5DA 4NKGB 1Q6IA 3W7XA 2B9ZA 2AZ0A 4X62B 2P90A 1VQLV 1XILA 3ASNC 3K59A 4P30A 3CCJV 4UCVA 1IXBA 5EBWC 1AP5A 5LL6Y 1HR0O 2JDIG 4UUJC 4GX5A 3HB3B 3KKYA 3E22A 1FPOA 2A3QA 1NTKH 1K5QA 3ABLC 4X89A 5EC1C 2HFEC 3JATA 3AG1C 2H94A 1THZA 3Q4HB 3IC9A 2EZOA 4O4HB 3FYIB 3K5OA 3RVZA 1VQ6V 4DUYO 1RSOA 4BWAA 4MVQA 2CUGA 2D2CB 1WN7A 5L3GA 3FB6C 4KHPB 5FNVB 1J95A 3ZRWA 2Y0PA 3SPIA 3E8HA 4JI4O 1N0NA 3BABA 1DLBA 3SGIA 1W59A 1V9PA 2EILC 3UM7A 4J11A 4LH7A 1VARA 1OV9A 1PD3A 1I94O 2W0FC 1JR9A 1JX9A 4CH5A 5KHJA 1ZL8B 4DK1A 5D5PA 1QR8A 2PY5A 1VQPV 5EZYB 4LF4B 1K97A 2EBOA 2GTSA 3MDSA 4FJCC 4U3JB 3JD2A 4O4JB 1N32B 3H9VA 2UU9O 1OZ0A 2Y69C 4XDLA 4PELA 4AHCA 5KHKA 2YXLA 1SZTA 3CXCU 4YHHB 1WP8A 2EIJB 1HDJA 3K5NA 5ITZA 4PA9A 2Q67A 1SKVA 5EBMC 3OMNB 2P67A 1QLEB 3JYCA 2YS8A 4J42A 3ZRVA 3OEHG 1PP9H 3ZBHA 2Q8VA 4NB5A 1F7YA 1D2DA 5H5NA 1XNRO 3R65A 3SJCC 1GH6A 3ABMC 1FXVA 2JGDA 5ITZB 4IL6Z 1NH2D 2JS3A 4MS2A 4LCUC 2IU0A 1COWG 3D3QA 2PUSA 5H6RA 2Q68A 3ZMVA 1JJOA 1HW7A 4DR5B 4JI5B 1XMQB 2RMKB 4FM1A 1XNQO 4FZ1A 3ICXA 4NTYA 2EJRA 4DV0B 1N36O 3EXAA 4FLVA 1JFFA 1UFIA 2R9IA 2F1MA 5A9GA 3CRQA 4BIOA 1FXKC 2XAJA 2FYUH 2UXNA 2LQTA 1RM1C 5DN6G 3HKCA 4B7EA 3P3PA 1OCCC 3D36A 2ETNA 1DGSA 4R50A 4DYLA 3T4DA 1DK1A 4RO2A 3OT7A 1MZEA 4CH3A 5FLXN 3HKCB 3AG4B 2BTQA 4DR6O 4OXSA 4DR3B 1K5SA 1E1RG 1QHTA 3ZN1A 1MMMA 5EIBC 4JI1O 5IYZB 1R6NA 5BZBA 1B6QA 2LW1A 3THOA 1S5JA 2QJ1A 3JAKA 2BTQB 4OPAA 1GO3F 4B7KA 3E86A 1PPJH 4CS3A 1AJQA 2WA4A 2Z0AA 4Z2WA 1M93A 1NH2B 1J5EB 3QO5A 3WU2Z 4EEQA 3ZJZA 4X1IA 2YXYA 5F2VO 1KP2A 1ZX3A 4JI3O 3CXHF 3GB7C 3RVYA 1HP8A 5DEDA 3M7MX 3JAWB 1TUBB 4LF9O 4O2AB 4I0XA 1VEWA 4FM2A 1P7BA 1UJWB 1PV0A 1G8MA 4PDRA 1AVMA 1K73W 4HYOA 4X9QA 5L3FA 3JCZA 4KXRA 2AHYA 3ZS8C 4K0KB 4Z1VA 3E89A 4JASA 4FK5C 4DV4O 2W0XA 3HKEA 2Q7GA 1NVPD 3U10A 1H2SB 3UT5B 4ZKIA 2HHHO 2VQFB 5CBGA 1EZVH 2JRIA 4PDVA 2B1GA 2DYSB 2BTOA 4TV8B 3RYHA 2ZDIC 3EVKA 4X88A 3ABKC 2VWJA 3F5TA 4E4EA 4J41A 3F5WC 3CEIA 2JJ2G 4EKWA 1EZJA 1OCZB 4H37A 2ZXWC 4L8JA 2FMLA 3X2QC 1KYOF 2Q7EA 3OTFA 4J9YB 4DV2O 3CRMA 4EB6B 2FB5A 5CA3A 1AJPA 2OCCC 1V54B 3STZC 2GDSA 4DUZO 4I50B 3RYFA 4MVUA 3HKBA 1PNKA 2EIMB 1YEWA 3TXSA 3W7TA 4G28B 1QCEA 1JCHA 3JCUZ 2PYLA 3CC4V 4UCSA 3JD3A 2IW5A 2ZM6B 4DR2O 3UO3A 1M57C 5KMGA 4LC1A 4LF6O 3P3NA 1WA8A 4X66O 4FLXA 3AG7A 4DR4O 5DECA 1K33A 4NTXA 1WNSA 2QKCA 3LSSA 5JCOA 1U97A 2Q73A 5IY5C 4WCEV 2HR3A 1Z5VA 4L87A 3CCLV 3SJBC 2NN4A 1LNQA 3N2KB 2QSAA 1Y67A 1GAXA 4LF8B 3AK3A 2E74B 1ZSPA 2CTPA 5CB4B 1AI4A 5LP6B 1XMOB 2ADQB 5EYPA 1SQGA 2P22C 3FB8C 5JWPA 4UB6Z 1Q82W 3MHSC 3BFRA 4DR7B 1SS3A 1H2NA 1QBZA 2HLDG 2QM8A 3IFXA 1SQXH 4OX9B 4LNUA 3B8NA 1JMKC 5LHHA 2CH7A 2N05A 2WA3A 3MHHC 2Q7HA 2A06H 4DRXB 3CJHA 3QO7A 4RUEA 4YJ2B 1K4CC 2F4VB 2GHYA 4PA6A 3HKDB 4LNUB 4JZ2A 2QR4A 4K35A 1N33O 3QNEA 3N2GA 4IIJA 1HR0B 4FLUA 2E75B 1EBOA 4I7ZB 3WG7B 1ZAUA 3RT3C 1VQ5V 4LFCB 1MABG 1KKCA 3L9DA 2P06A 2ZE7A 2UUBO 2NLJC 2P4KA 4NXNO 2EIKB 4FFBA 4N21A 4QPKA 4UFZA 4KP4A 4IIJB 1SRYA 3ZN0A 1FYJA 1GM9A 3P32A 3O65A 5BMVA 1G1XB 4DUYB 3CRAA 3K08A 4MW3A 1H2KA 2JIZG 3G6EV 1WP7A 1DF4A 4MSWC 4UV9A 4DV1O 2IH3C 3H1KH 2XHBA 1ZLZA 1M9NA 4Q20A 2E76B 4X1YA 3DC5A 3D3IA 1SQBH 5KAFZ 1JPXA 3CE2A 2DOSA 1FJGO 2G38A 4CS2A 3LSUA 1I94B 5JJNB 1YCIA 1M56B 5B1AB 1IX9A 2LFRA 4J7ZA 4ZOLA 4LF5O 1Q8IA 3BCCH 4MVSA 4GKKO 2YICA 3KCXA 5LA6B 5KUKA 2DW4A 3OFNG 1ORQC 4ZOLB 1M1KW 4CH6A 1XL4A 2QM7A 2XUMA 4TUYB 1KUQA 1GM8A 2WPDG 1YJNV 3K03A 1SERA 4X1KB 4J9ZB 5CA1B 1VMGA 5FPOA 3OD4A 1Y4MA 1XNRB 2BSKA 2W6JG 4X65B 2L6LA 1R1BA 3E8GA 3QF7A 2OIGA 3JD4A 1N4CA 1PM9A 4U7NA 1S5LZ 3L75H 1AI7A 4ZI7B 2Z5UA 3TETA 1IZ3A 1W0JG 4IHJA 5GONA 5LOVA 3J7AU 3PN1A 1Q7YW 4MTOA 5H6QA 4I5SA 4DR1O 5LMNO 2JEXA 1YSCA 2WLLA 1XNQB 4D7SA 4HNAA 1N36B 3N27A 3FX7A 3FB5C 5IWAO 1MG1A 4GT1A 4Z1MG 5IYCO 1VF6A 1Q86W 2H8PC 4X8AA 2VS0A 4JI8B 3G67A 2HKOA 1MSDA 3OTOO 3TXQA 1KB9F 5L3BA 4YY3O 1VP7A 5H9CA 3E2EA 4X20B 4B3TB 2E3CA 3IGAC 2UXCO 3UQ8A 1CXZB 3JALB 4DR6B 3B40A 4JYYA 4FPPA 1SETA 3ASOC 2HP8A 1SQQH 1XQ8A 4GYCB 3MAQA 3UCSC 3DTUB 5JVDB 5IT9N 4CBCA 1QVGU 5CA0B 4LFBB 2GTAA 4JV5O 4DV3O 1EN4A 2FTKA 3J81N 4UCOA 4YJ3B 3Q4HA 5LXTA 1H8EG 4O4HA 5KHIA 3ABLB 2EZPA 3BPZA 1BS3A 2WLKA 1R6TA 5B1OA 4LFAB 2CTQA 5IE9A 2YDEA 4QE9A 2AHZA 5FNVA 3R66A 5LXTB 3OEEG 4ABMA 1GN3A 4FLWA 3KCYA 1AR5A 4JYCA 3SPCA 1K4DC 5B1NA 5B66Z 3RYIB 5LMUO 2EILB 2UXBO 1NR1A 1NTMH 4MTFA 2RNBA 1Y76B 1ZL8A 3T1CA 5EZYA 4MTXA 2XAQA 4U3JA 3OR7C 4E2LA 2ZKOA 5C8YA 4O4JA 4DV4B 4BW9A 1KKDA 2AW9A 1LR1A 4JPRA 4LH6A 2PGGA 2HVKC 2Y69B 3ZRSA 2N04A 5C8YB 1GTOA 1Y66A 1Y74B 4BIZA 4P9PA 5E79Z 1WB7A 4NR1A 1NR7A 2PI5A 2X7RB 3K5MA 1BSMA 1TUEB 1YI2V 2YIDA 5BR8B 1XHZA 4GX1A 2UUAO 3EFFK 3B8MA 4DV2B 3W7SA 4QE7A 4MT8A 1F4MA 4FIPC 3RYCB 5B3SC 3PJSK 4DUZB 1WAZA 2B5UA 4JI2O 1IBMO 3JSLA 1Q3EA 1VIBA 1LUWA 1YITV 2Y48A 2C2AA 4DV7O 2QWNB 3JAMN 4K8XA 4FZ0A 1VQKV 2EIJC 4LF6B 4UV8A 4X66B 2UUCB 4K8ZA 3DGEA 2XNDG 3BHPA 1FXKB 2Q5ZA 1FFTB 3D8CA 1K92A 1Q81W 1RM1B 1HNXO 5JJJB 1SZXA 3GVMA 4UXNA 3ABUA 4NVPA 3T4ZA 1F51A 5K1XA 3CC2V 1XBLA 4WFHA 2RDCA 2DE0X 5IYZA 4R6ZA 3ETDA 5J2UB 4DW1A 3SYCA 1TGOA 2F43G 1VQ8V 4LP8A 4IT5A 3T1YO 4FFKA 4U7OA 5LGNA 2A0LA 2DMXA 4DK0A 2XAGA 1Q6UA 4O4LB 3B4SA 1S0VA 1PNMA 4H0LB 1I5YA 1ZUQA 1H2MA 2IJJA 1GN6A 3JAWA 4X62O 1TUBA 4O2AA 4Q6GA 1AR4A 3D36C 4PJ0Z 1XHXA 3CCRV 3ZHUA 1XEQA 1V55C 4J80A 4UVBA 1VQNV 3BVOA 3O9OA 5B1BC 1CEZA 5K1PA 4TQDA 2EULA 3CD6V 2QWOB 2R72A 1K3EA 3SPJA 4NXNB 5J2TB 2CE4A 3UT5A 2K1EA 3DXRA 4JI6O 3OR6C 1ROPA 5KHHA 5KAIZ 2QKAA 4TV8A 4OGQB 4CS4A 5C93A 5EC2C 3C90A 3CMEV 3QVNA 2DYRC 4DV1B 2ZR2A 3ABKB 3DXRB 1AI5A 1JQ0A 2CDYA 3FKSG 1MNGA 1S77D 5IDJA 2GBOA 1SESA 4EB6A 1FJGB 3FYEB 2ZXWB 2IBZH 3X2QB 3TJTA 3ZRXA 4ZBMA 5J9PC 4I50A 3H1JH 3MD0A 1H2GA 2QWPB 2OCCB 3FD9A 4LF4O 2V1DA 3FB7C 1NI8A 1NS1A 4TWKA 2LW7A 1N32O 2GSMB 2Y4TA 4GKKB 1B3QA 1WJZA 2GUZB 3QO8A 1KP3A 1BZKA 2OWOA 4RQFA 1KC8W 3DC6A 3ZMZA 1H2LA 2X6AA 2QTOA 5KUMA 4YIPA 1JJ2U 3APQA 2CK3G 1M57B 1JA8A 4JYAO 1GK9A 1OCZC 1P49A 4YIOA 2XTAA 4I55A 3BA9A 3N2KA 5IY5B 1N34O 1S3JA 2IJKA 4WFFA 4I55B 4PDMA 3LNMB 3K57A 5CB4A 5LP6A 2R70A 1ZTEA 2PTMA 1NBMG 4LBEC 3M99B 4B3MB 5LMNB 4JI5O 3FFQA 4JAVA 3VQWA 3K79A 1OCOB 1XMQO 4EFBA 4DV0O 1IBKB 4YXWG 2JVDA 5IWAB 2CTWA 3CCQV 4QJFB 4UVCA 1I7FA 1R73A 1M5IA 4O4IB 2JK5C 2PZSA 4JI7O 4W4LA 4NTWA 4DRXA 4NXMO 2OTJV 4YJ2A 3OTOB 2FL4A 2ODMA 1PL0A 2WWWA 4YY3B 3HKDA 3G6BA 1E1QG 3NR7A 2P7TC 5JCOC 1WLEA 1JVMA 1AILA 2UXCB 3ZIAG 1L0LH 1FD9A 1BHAA 1RPOA 3SYAA 3ZEDA 1EM1A 4PA4A 4JV5B 1FAFA 4I4TB 4DV3B 5CMUA 4PDLA 1AJNA 1N8RW 2EINB 5IJ9B 3LUTB 1HNWO 3FAVB 3J80N 3SPHA 3OGIB 5TISZ 1NU1H 1TVKA 4AQYO 4RAIA 3ZHQA 3CC7V 3U11A 3CRCA 3E8FA 3ZX6A 1BL8A 1IBLO 4LR3A 1F23A 1TVKB 3W7WA 2UXBB 1M4UA 4JI4B 1Q90D 4QGPA 1S76D 1IVSA 2Q9LA 3AG3C 4B08A 1N0JA 3CYOA 2ZNJA 4JAAA 4AILC 2YUAA 4MVMA 1P84F 4PA3A 2O57A 3RWRD 1URFA 4KFMA 3LSQA 3CCUV 5LA6A 4GKJO 2ZQMA 2VRZA 4B3RO 1H38A 3F7VC 4DV5O 3CB2A 2QA4V 3ETEA 2ZCEA 1XI1A 2UU9B 2GV9A 4TUYA 3GWOA 1NT2B 4X1KA 2LJ2A 5CA1A 5HFMA 3ABTA 2OT5A 2UUAB 3K58A 2LFSA 2M6YA 1YDXA 2KKWA 4JYBA 1F4NA 1M56C 2DN9A 1BQZA 4QNHB 5GTHZ 4F6EA 4WF9V 2WLNA 1VQMV 2YEVA 4JI2B 2ZR3A 1IBMB 4ZI7A 2M7WA 2CGOA 3B77A 1FS0G 3ML0A 3LDDA 1XDCA 1T5EA 2KG7A 1YF2A 2QDOA 4O2BB 1Q5OA 4H13B 2RQ6A 2YIAA 3VQVA 1OHHG 4R7CA 2YEVB 3E8BA 4UVAA 3CP1A 2E5LO 1XL6A 1Z2GA 2KG7B 1O9HA 4JF3A 4I9WA 3GWKC 1YXBA 4OPHA 3HR0A 4FLZA 3NXSA 3P30A 1L1FA 3A0BZ 1HNXB 1GRJA 2HEPA 4QPJA 4B3SO 4X20A 1MA1A 1OCRC 3BEHA 2Q4PA 3WB0A 1Q6HA 3WFVA 5IJ0B 3BY6A 1A32A 3JALA 2IJIA 1MZFA 4LF8O 4X64O 3K0DA 3L73H 1KU9A 5JVDA 1K9MW 5CA0A 4GZRB 3I56V 4FVMA 4JGSA 1Y6XA 3ASNB 3CPWU 1R3JC 4YJ3A 4C7UA 1EN5A 4TV9A 1AI6A 1IURA 2ZNIA 2DWDC 2F23A 2P4VA 3K9AA 3K3WA 5AG2A 2ARHA 3AG2C 4JI1B 1S5HC 3K0GA 4J7KA 3LDCA 4OX9O 4PI2A 1IXMA 3BA8A 3CHXA 3RW0A 2BE3A 4TV9B 2N74A 3JD1A 1VF6C 4CZZA 1I0HA 3A0RA 2ZT9B 2F4VO 3AG1B 4G2KA 2Q69A 3K5LA 4AI8A 3RYIA 4JI3B 1QLNA 3CRRA 4MVOA 1YVWA 1CP9A 1Y76A 1AB3A 1WPBA 1VF5B 2LGQA 5D5QA 2F66C 4LF9B 1GN2A 2QTSA 1RP3B 4K3AA 3IAYA 4XDJA 4LFCO 2Z3YA 3JSNA 1W0KG 1D5NA 1WB8A 1HNZO 1SQPH 4KL1A 1RFYA 4JI6B 4DV6O 5H2FZ 1YTFB 2X0LA 1I08A 3DSQA 5FL7G 2NNUA 1BQ0A 2VQEO 1Y74A 3E22B 2QWRB 1L0NH 5IYDO 3CS5A 1ENVA 4JI0O 2OCHA 3JATB 2HHHB 1TAEA 5GTIZ 1BMFG 4PHZA 3WB1A 4UB8Z 3SYQA 2QKSA 3ZMUA 1RSOB 3SR2C 3CCEV 4QIWF 1NZ6A 3RYCA 2D3OW 1AROP 1HWYA 2ILMA 4PI0A 3JARA 3ZMSA 3ZRWB 1QNMA 1SF9A 1VQ7V 4J10A 5B3SB 2A7WA 5FPRA 3OAAG 2V4DA 5EIBD 2F93B 4ZIBA 5CBHA
chains in the Genus database with same CATH topology
2M6YA 1FPOA 2N04A 4J7ZA 2YS8A 3APOA 2CTQA 1IURA 2KQXA 2LO1A 1XBLA 2CTWA 2DN9A 2Y4UA 4J80A 2GUZA 4RWUA 3BVOA 1BQZA 3APQA 3UCSC 1NZ6A 1GH6A 2QWPB 1BQ0A 2LGWA 2QWNB 2QWOB 2EJ7A 2QWRB 3UO3A 2PF4E 2L6LA 4IT5A 1HDJA 2QSAA 2CUGA 3AG7A 1FAFA 1N4CA 2Y4TA 2GUZB 1WJZA 2QWQB 2OCHA 2YUAA 2DMXA 2CTPA 2CTRA 2N05A 3UO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Y A;  1FPO A;  2N04 A;  4J7Z A;  2YS8 A;  3APO A;  2CTQ A;  1IUR A;  2KQX A;  2LO1 A;  1XBL A;  2CTW A;  2DN9 A;  2Y4U A;  4J80 A;  2GUZ A;  4RWU A;  3BVO A;  1BQZ A;  3APQ A;  3UCS C;  1NZ6 A;  1GH6 A;  2QWP B;  1BQ0 A;  2LGW A;  2QWN B;  2QWO B;  2EJ7 A;  2QWR B;  3UO3 A;  2PF4 E;  2L6L A;  4IT5 A;  1HDJ A;  2QSA A;  2CUG A;  3AG7 A;  1FAF A;  1N4C A;  2Y4T A;  2GUZ B;  1WJZ A;  2QWQ B;  2OCH A;  2YUA A;  2DMX A;  2CTP A;  2CTR A;  2N05 A;  3UO2 A; 
#chains in the Genus database with same CATH topology
 4CH4 A;  3A0H Z;  3JAR B;  3ABM B;  3ZHS A;  4LF7 O;  1NQT A;  1QVF U;  1LUV A;  2UXD O;  2CAZ C;  5L3E A;  2CGN A;  1BCC H;  1OJH A;  4ZHQ A;  2OYQ A;  3ZCC A;  2JJ1 G;  3OE7 G;  2WAM A;  1MSW D;  2KB1 A;  2AZ2 A;  4JYA B;  1FXK A;  4DO2 A;  1GMG A;  4XDK A;  1DTO A;  2QWQ B;  4DR2 B;  3ZHT A;  2IU3 A;  3UO2 A;  3JAS A;  4H44 B;  4DR4 B;  4CC6 A;  4ZHQ B;  4MVR A;  2LO1 A;  3RGB A;  1L8D A;  4X65 O;  1QLE C;  2JS5 A;  1N34 B;  1FFX A;  1G6U A;  4DXW A;  5DM6 V;  4HBN A;  3SJA C;  3K06 A;  3B2E E;  3JAS B;  1OCC B;  2YC0 A;  4BIU A;  2YIB D;  1EFR G;  5J2U A;  4FLY A;  4IYH A;  2ZIO A;  3OW2 U;  1TA8 A;  2JGD B;  2IJH A;  1O9G A;  3CSX A;  2W6I G;  5L3D A;  1FFX B;  3F7Y C;  4TT3 G;  3OUS A;  2MK3 A;  4O4L A;  4D7T A;  2YI8 A;  4JI7 B;  2QM4 A;  3TGU H;  3T1H O;  4NYK A;  4NXM B;  2A79 B;  4JI8 O;  1XOU A;  1K34 A;  3VQX A;  1JFF B;  2Y4U A;  3VOU A;  3A8T A;  4GLX A;  3L74 H;  4IGG A;  3BRC A;  1R3L C;  3SPG A;  3CCS V;  3L70 H;  4TQF A;  4G27 B;  3KG2 A;  4B3T O;  2AXT Z;  4ASU G;  2XAS A;  2BCC H;  4I9Q A;  1AP6 A;  2OIE A;  1V55 B;  3WB2 A;  3AG4 C;  4U3F H;  1KBH A;  1K8A W;  1N33 B;  1B06 A;  5B1B B;  2YIB A;  5BY1 A;  5LGU A;  1WPX A;  4LFB O;  3APO A;  3E83 A;  2ZE8 A;  3IJ4 A;  5J2T A;  2F95 B;  1PKX A;  4JTC B;  1R3I C;  1HNW B;  1YHQ V;  1X59 A;  3RN4 A;  2AGA A;  2HJD A;  4F6R A;  2UUB B;  2WLM A;  1U96 A;  4UCT A;  4D6T H;  3ZHV A;  4LFA O;  4AQY B;  5E1A C;  2ZDI A;  3JAK B;  2CTR A;  1ZWI C;  2MW2 B;  3CCV V;  1YZB A;  2DYR B;  3OM3 B;  2PI4 A;  4F6R B;  1IBL B;  1QU7 A;  2QEX V;  4X1I B;  1XRE A;  3H01 A;  4KHP O;  2ITD C;  4J7J A;  3SYP A;  4IYI A;  4MVZ A;  1R6K A;  1P7G A;  4WFG A;  1SC5 B;  4RQE A;  3I55 V;  3E35 A;  1PNL A;  1MOF A;  4I0X B;  3VQY A;  4JTA B;  5B5E Z;  2NR5 A;  1I5X A;  3ZHR A;  2GUZ A;  5KX5 A;  3A2F A;  2ADP A;  4GKJ B;  4B3R B;  1KMI Z;  2HG5 C;  2PF4 E;  4DV5 B;  4LF5 B;  1KD1 W;  3G71 V;  2Q0A A;  3LDE A;  2A9H A;  2DQ0 A;  3G80 A;  4P2Z A;  1S72 V;  3HKE B;  4GX2 A;  2Q6A A;  2DYS C;  1D5A A;  5KX5 B;  1SQF A;  3TCU A;  5BR8 O;  2HVJ C;  4YHH O;  3RYH B;  4GX0 A;  2XAF A;  1G4Y B;  3L72 H;  3CWB H;  4JAU A;  5EBL C;  3UKM A;  1GN4 A;  2B1I A;  1X4T A;  1V54 C;  4EFE A;  2QE7 G;  4N23 A;  3H1I H;  3L71 H;  2EIM C;  2WSS G;  1US6 A;  3K04 A;  4FLT A;  2XT9 A;  1BT8 A;  1EN6 A;  3RYF B;  1JOY A;  2EJ7 A;  4TOI A;  3HKB B;  2E5L B;  1PL4 A;  3S3X A;  4MW8 A;  2UUC O;  5LGT A;  4O4I A;  4R8C A;  4DR1 B;  4DR5 O;  1W2B U;  1VQ4 V;  4F4L A;  3HPL C;  4MTG A;  2K9P A;  3M8A A;  3S3W A;  5KMG B;  4WBN A;  3G4S V;  1NVP B;  1WA8 B;  2XAH A;  3RFR A;  4B3S B;  1KQS U;  4HZ3 A;  2ZE5 A;  2ZIM A;  3QTC A;  1Q43 A;  1M90 W;  1YJW V;  2LP7 A;  3ZMT A;  3U0Z A;  4X64 B;  4WBN B;  1K7D A;  1UPG A;  3C3T A;  1FXH A;  4BAY A;  3CMA V;  2JGU A;  4P9O A;  5L3C A;  1OCO C;  4I4T A;  4UCR A;  1RPR A;  5LP6 C;  3B09 A;  3KZI Z;  1SA0 A;  1R3K C;  1IDS A;  4DR3 O;  2JEU A;  5IJ9 A;  4HAM A;  3FAV A;  3AK2 A;  1E79 G;  2WLI A;  1BE3 H;  5EYP B;  3H1L H;  2V7Q G;  4JZG A;  3OMA B;  1SA0 B;  1P4R A;  2FKX A;  4WFE A;  4BW5 A;  3OMI B;  1J5E O;  2RN9 A;  3T2M A;  2WLI B;  2HJF C;  2CH7 B;  2DQ3 A;  3CX5 F;  3VBB A;  3RBZ A;  5JH7 A;  2ATK C;  4XBF A;  3CJH B;  5BXZ A;  5LHG A;  5KLV H;  2Y0I A;  4CC5 A;  2VWK A;  1NKD A;  3H1H H;  4GCZ A;  3JD0 A;  4UCU A;  2UXX A;  5CN0 A;  3WG7 C;  5LMU B;  3C3S A;  1HNZ B;  3AG3 B;  5IYB O;  4WFA V;  2EIN C;  2QGN A;  2R9A A;  3N2G B;  4DW0 A;  5JH7 B;  4DV6 B;  2P5O A;  3W7U A;  1XUQ A;  2EIK C;  2VQE B;  4K0K O;  1FKA O;  5LHI A;  5HFL A;  4A5U B;  4FFB B;  1VQ9 V;  2X6B A;  2ZD9 A;  4JI0 B;  4FM0 A;  3LNN A;  5KA5 A;  3ETG A;  5A2Q N;  2X6C A;  2DJV A;  2VQF O;  3SDL A;  5BMV B;  2ITC C;  2BOC C;  1GM7 A;  4PD4 F;  1QQC A;  2KSD A;  3AEI A;  1KEC A;  3QG5 A;  2P6J A;  1QR9 A;  1BGY H;  4LWS A;  3OUF A;  3ETQ A;  4H33 A;  3SJQ C;  4X1Y B;  5CBF A;  2H3O A;  2OTL V;  4RWU A;  3IC7 A;  5B1A C;  2ZE6 A;  5JJE B;  4O2B A;  5EK0 A;  5KA6 A;  4WFB V;  3SYO A;  2WLJ A;  4LWS B;  4LF7 B;  3BAA A;  2PYJ A;  4BR6 A;  5LYJ A;  1NJI W;  2UXD B;  4DV7 B;  5KHG A;  2ZIN A;  2DWE C;  4RUF A;  1CPY A;  2KQX A;  3AK1 A;  2ZM6 O;  5LYJ B;  3TK1 A;  2IH1 C;  2LGW A;  2XOK G;  2YI9 A;  5IJ0 A;  2BOB C;  1Z5W A;  4PA7 A;  2R9R B;  4W4K A;  1YJ9 V;  1SQV H;  2IM9 A;  5JQG A;  1OCR B;  4ICG A;  2EX3 A;  2Q0O C;  3CCM V;  1H8H G;  4FMT A;  2BSK B;  1VQO V;  5LBQ A;  3EHB B;  1AR1 B;  2YXH A;  4B3M O;  1YTF D;  1YIJ V;  3K9S A;  5JQG B;  4KUM A;  1NTZ H;  2L35 A;  4GUN A;  5GW7 A;  1IBK O;  2RCV A;  2WLH A;  1XMO O;  4PV1 B;  2RJZ A;  4IHJ B;  4TSF G;  3ASO B;  4JTD B;  5GON B;  5LOV B;  3T1H B;  3T1Y B;  1VF7 A;  3STL C;  3AG2 B;  2WLL B;  4DR7 O;  4HNA B;  1B04 A;  1GKF A;  1DF5 A;  2YSU B;  1BHB A;  3OGC C;  3I5D A;  4NKG B;  1Q6I A;  3W7X A;  2B9Z A;  2AZ0 A;  4X62 B;  2P90 A;  1VQL V;  1XIL A;  3ASN C;  3K59 A;  4P30 A;  3CCJ V;  4UCV A;  1IXB A;  5EBW C;  1AP5 A;  5LL6 Y;  1HR0 O;  2JDI G;  4UUJ C;  4GX5 A;  3HB3 B;  3KKY A;  3E22 A;  1FPO A;  2A3Q A;  1NTK H;  1K5Q A;  3ABL C;  4X89 A;  5EC1 C;  2HFE C;  3JAT A;  3AG1 C;  2H94 A;  1THZ A;  3Q4H B;  3IC9 A;  2EZO A;  4O4H B;  3FYI B;  3K5O A;  3RVZ A;  1VQ6 V;  4DUY O;  1RSO A;  4BWA A;  4MVQ A;  2CUG A;  2D2C B;  1WN7 A;  5L3G A;  3FB6 C;  4KHP B;  5FNV B;  1J95 A;  3ZRW A;  2Y0P A;  3SPI A;  3E8H A;  4JI4 O;  1N0N A;  3BAB A;  1DLB A;  3SGI A;  1W59 A;  1V9P A;  2EIL C;  3UM7 A;  4J11 A;  4LH7 A;  1VAR A;  1OV9 A;  1PD3 A;  1I94 O;  2W0F C;  1JR9 A;  1JX9 A;  4CH5 A;  5KHJ A;  1ZL8 B;  4DK1 A;  5D5P A;  1QR8 A;  2PY5 A;  1VQP V;  5EZY B;  4LF4 B;  1K97 A;  2EBO A;  2GTS A;  3MDS A;  4FJC C;  4U3J B;  3JD2 A;  4O4J B;  1N32 B;  3H9V A;  2UU9 O;  1OZ0 A;  2Y69 C;  4XDL A;  4PEL A;  4AHC A;  5KHK A;  2YXL A;  1SZT A;  3CXC U;  4YHH B;  1WP8 A;  2EIJ B;  1HDJ A;  3K5N A;  5ITZ A;  4PA9 A;  2Q67 A;  1SKV A;  5EBM C;  3OMN B;  2P67 A;  1QLE B;  3JYC A;  2YS8 A;  4J42 A;  3ZRV A;  3OEH G;  1PP9 H;  3ZBH A;  2Q8V A;  4NB5 A;  1F7Y A;  1D2D A;  5H5N A;  1XNR O;  3R65 A;  3SJC C;  1GH6 A;  3ABM C;  1FXV A;  2JGD A;  5ITZ B;  4IL6 Z;  1NH2 D;  2JS3 A;  4MS2 A;  4LCU C;  2IU0 A;  1COW G;  3D3Q A;  2PUS A;  5H6R A;  2Q68 A;  3ZMV A;  1JJO A;  1HW7 A;  4DR5 B;  4JI5 B;  1XMQ B;  2RMK B;  4FM1 A;  1XNQ O;  4FZ1 A;  3ICX A;  4NTY A;  2EJR A;  4DV0 B;  1N36 O;  3EXA A;  4FLV A;  1JFF A;  1UFI A;  2R9I A;  2F1M A;  5A9G A;  3CRQ A;  4BIO A;  1FXK C;  2XAJ A;  2FYU H;  2UXN A;  2LQT A;  1RM1 C;  5DN6 G;  3HKC A;  4B7E A;  3P3P A;  1OCC C;  3D36 A;  2ETN A;  1DGS A;  4R50 A;  4DYL A;  3T4D A;  1DK1 A;  4RO2 A;  3OT7 A;  1MZE A;  4CH3 A;  5FLX N;  3HKC B;  3AG4 B;  2BTQ A;  4DR6 O;  4OXS A;  4DR3 B;  1K5S A;  1E1R G;  1QHT A;  3ZN1 A;  1MMM A;  5EIB C;  4JI1 O;  5IYZ B;  1R6N A;  5BZB A;  1B6Q A;  2LW1 A;  3THO A;  1S5J A;  2QJ1 A;  3JAK A;  2BTQ B;  4OPA A;  1GO3 F;  4B7K A;  3E86 A;  1PPJ H;  4CS3 A;  1AJQ A;  2WA4 A;  2Z0A A;  4Z2W A;  1M93 A;  1NH2 B;  1J5E B;  3QO5 A;  3WU2 Z;  4EEQ A;  3ZJZ A;  4X1I A;  2YXY A;  5F2V O;  1KP2 A;  1ZX3 A;  4JI3 O;  3CXH F;  3GB7 C;  3RVY A;  1HP8 A;  5DED A;  3M7M X;  3JAW B;  1TUB B;  4LF9 O;  4O2A B;  4I0X A;  1VEW A;  4FM2 A;  1P7B A;  1UJW B;  1PV0 A;  1G8M A;  4PDR A;  1AVM A;  1K73 W;  4HYO A;  4X9Q A;  5L3F A;  3JCZ A;  4KXR A;  2AHY A;  3ZS8 C;  4K0K B;  4Z1V A;  3E89 A;  4JAS A;  4FK5 C;  4DV4 O;  2W0X A;  3HKE A;  2Q7G A;  1NVP D;  3U10 A;  1H2S B;  3UT5 B;  4ZKI A;  2HHH O;  2VQF B;  5CBG A;  1EZV H;  2JRI A;  4PDV A;  2B1G A;  2DYS B;  2BTO A;  4TV8 B;  3RYH A;  2ZDI C;  3EVK A;  4X88 A;  3ABK C;  2VWJ A;  3F5T A;  4E4E A;  4J41 A;  3F5W C;  3CEI A;  2JJ2 G;  4EKW A;  1EZJ A;  1OCZ B;  4H37 A;  2ZXW C;  4L8J A;  2FML A;  3X2Q C;  1KYO F;  2Q7E A;  3OTF A;  4J9Y B;  4DV2 O;  3CRM A;  4EB6 B;  2FB5 A;  5CA3 A;  1AJP A;  2OCC C;  1V54 B;  3STZ C;  2GDS A;  4DUZ O;  4I50 B;  3RYF A;  4MVU A;  3HKB A;  1PNK A;  2EIM B;  1YEW A;  3TXS A;  3W7T A;  4G28 B;  1QCE A;  1JCH A;  3JCU Z;  2PYL A;  3CC4 V;  4UCS A;  3JD3 A;  2IW5 A;  2ZM6 B;  4DR2 O;  3UO3 A;  1M57 C;  5KMG A;  4LC1 A;  4LF6 O;  3P3N A;  1WA8 A;  4X66 O;  4FLX A;  3AG7 A;  4DR4 O;  5DEC A;  1K33 A;  4NTX A;  1WNS A;  2QKC A;  3LSS A;  5JCO A;  1U97 A;  2Q73 A;  5IY5 C;  4WCE V;  2HR3 A;  1Z5V A;  4L87 A;  3CCL V;  3SJB C;  2NN4 A;  1LNQ A;  3N2K B;  2QSA A;  1Y67 A;  1GAX A;  4LF8 B;  3AK3 A;  2E74 B;  1ZSP A;  2CTP A;  5CB4 B;  1AI4 A;  5LP6 B;  1XMO B;  2ADQ B;  5EYP A;  1SQG A;  2P22 C;  3FB8 C;  5JWP A;  4UB6 Z;  1Q82 W;  3MHS C;  3BFR A;  4DR7 B;  1SS3 A;  1H2N A;  1QBZ A;  2HLD G;  2QM8 A;  3IFX A;  1SQX H;  4OX9 B;  4LNU A;  3B8N A;  1JMK C;  5LHH A;  2CH7 A;  2N05 A;  2WA3 A;  3MHH C;  2Q7H A;  2A06 H;  4DRX B;  3CJH A;  3QO7 A;  4RUE A;  4YJ2 B;  1K4C C;  2F4V B;  2GHY A;  4PA6 A;  3HKD B;  4LNU B;  4JZ2 A;  2QR4 A;  4K35 A;  1N33 O;  3QNE A;  3N2G A;  4IIJ A;  1HR0 B;  4FLU A;  2E75 B;  1EBO A;  4I7Z B;  3WG7 B;  1ZAU A;  3RT3 C;  1VQ5 V;  4LFC B;  1MAB G;  1KKC A;  3L9D A;  2P06 A;  2ZE7 A;  2UUB O;  2NLJ C;  2P4K A;  4NXN O;  2EIK B;  4FFB A;  4N21 A;  4QPK A;  4UFZ A;  4KP4 A;  4IIJ B;  1SRY A;  3ZN0 A;  1FYJ A;  1GM9 A;  3P32 A;  3O65 A;  5BMV A;  1G1X B;  4DUY B;  3CRA A;  3K08 A;  4MW3 A;  1H2K A;  2JIZ G;  3G6E V;  1WP7 A;  1DF4 A;  4MSW C;  4UV9 A;  4DV1 O;  2IH3 C;  3H1K H;  2XHB A;  1ZLZ A;  1M9N A;  4Q20 A;  2E76 B;  4X1Y A;  3DC5 A;  3D3I A;  1SQB H;  5KAF Z;  1JPX A;  3CE2 A;  2DOS A;  1FJG O;  2G38 A;  4CS2 A;  3LSU A;  1I94 B;  5JJN B;  1YCI A;  1M56 B;  5B1A B;  1IX9 A;  2LFR A;  4J7Z A;  4ZOL A;  4LF5 O;  1Q8I A;  3BCC H;  4MVS A;  4GKK O;  2YIC A;  3KCX A;  5LA6 B;  5KUK A;  2DW4 A;  3OFN G;  1ORQ C;  4ZOL B;  1M1K W;  4CH6 A;  1XL4 A;  2QM7 A;  2XUM A;  4TUY B;  1KUQ A;  1GM8 A;  2WPD G;  1YJN V;  3K03 A;  1SER A;  4X1K B;  4J9Z B;  5CA1 B;  1VMG A;  5FPO A;  3OD4 A;  1Y4M A;  1XNR B;  2BSK A;  2W6J G;  4X65 B;  2L6L A;  1R1B A;  3E8G A;  3QF7 A;  2OIG A;  3JD4 A;  1N4C A;  1PM9 A;  4U7N A;  1S5L Z;  3L75 H;  1AI7 A;  4ZI7 B;  2Z5U A;  3TET A;  1IZ3 A;  1W0J G;  4IHJ A;  5GON A;  5LOV A;  3J7A U;  3PN1 A;  1Q7Y W;  4MTO A;  5H6Q A;  4I5S A;  4DR1 O;  5LMN O;  2JEX A;  1YSC A;  2WLL A;  1XNQ B;  4D7S A;  4HNA A;  1N36 B;  3N27 A;  3FX7 A;  3FB5 C;  5IWA O;  1MG1 A;  4GT1 A;  4Z1M G;  5IYC O;  1VF6 A;  1Q86 W;  2H8P C;  4X8A A;  2VS0 A;  4JI8 B;  3G67 A;  2HKO A;  1MSD A;  3OTO O;  3TXQ A;  1KB9 F;  5L3B A;  4YY3 O;  1VP7 A;  5H9C A;  3E2E A;  4X20 B;  4B3T B;  2E3C A;  3IGA C;  2UXC O;  3UQ8 A;  1CXZ B;  3JAL B;  4DR6 B;  3B40 A;  4JYY A;  4FPP A;  1SET A;  3ASO C;  2HP8 A;  1SQQ H;  1XQ8 A;  4GYC B;  3MAQ A;  3UCS C;  3DTU B;  5JVD B;  5IT9 N;  4CBC A;  1QVG U;  5CA0 B;  4LFB B;  2GTA A;  4JV5 O;  4DV3 O;  1EN4 A;  2FTK A;  3J81 N;  4UCO A;  4YJ3 B;  3Q4H A;  5LXT A;  1H8E G;  4O4H A;  5KHI A;  3ABL B;  2EZP A;  3BPZ A;  1BS3 A;  2WLK A;  1R6T A;  5B1O A;  4LFA B;  2CTQ A;  5IE9 A;  2YDE A;  4QE9 A;  2AHZ A;  5FNV A;  3R66 A;  5LXT B;  3OEE G;  4ABM A;  1GN3 A;  4FLW A;  3KCY A;  1AR5 A;  4JYC A;  3SPC A;  1K4D C;  5B1N A;  5B66 Z;  3RYI B;  5LMU O;  2EIL B;  2UXB O;  1NR1 A;  1NTM H;  4MTF A;  2RNB A;  1Y76 B;  1ZL8 A;  3T1C A;  5EZY A;  4MTX A;  2XAQ A;  4U3J A;  3OR7 C;  4E2L A;  2ZKO A;  5C8Y A;  4O4J A;  4DV4 B;  4BW9 A;  1KKD A;  2AW9 A;  1LR1 A;  4JPR A;  4LH6 A;  2PGG A;  2HVK C;  2Y69 B;  3ZRS A;  2N04 A;  5C8Y B;  1GTO A;  1Y66 A;  1Y74 B;  4BIZ A;  4P9P A;  5E79 Z;  1WB7 A;  4NR1 A;  1NR7 A;  2PI5 A;  2X7R B;  3K5M A;  1BSM A;  1TUE B;  1YI2 V;  2YID A;  5BR8 B;  1XHZ A;  4GX1 A;  2UUA O;  3EFF K;  3B8M A;  4DV2 B;  3W7S A;  4QE7 A;  4MT8 A;  1F4M A;  4FIP C;  3RYC B;  5B3S C;  3PJS K;  4DUZ B;  1WAZ A;  2B5U A;  4JI2 O;  1IBM O;  3JSL A;  1Q3E A;  1VIB A;  1LUW A;  1YIT V;  2Y48 A;  2C2A A;  4DV7 O;  2QWN B;  3JAM N;  4K8X A;  4FZ0 A;  1VQK V;  2EIJ C;  4LF6 B;  4UV8 A;  4X66 B;  2UUC B;  4K8Z A;  3DGE A;  2XND G;  3BHP A;  1FXK B;  2Q5Z A;  1FFT B;  3D8C A;  1K92 A;  1Q81 W;  1RM1 B;  1HNX O;  5JJJ B;  1SZX A;  3GVM A;  4UXN A;  3ABU A;  4NVP A;  3T4Z A;  1F51 A;  5K1X A;  3CC2 V;  1XBL A;  4WFH A;  2RDC A;  2DE0 X;  5IYZ A;  4R6Z A;  3ETD A;  5J2U B;  4DW1 A;  3SYC A;  1TGO A;  2F43 G;  1VQ8 V;  4LP8 A;  4IT5 A;  3T1Y O;  4FFK A;  4U7O A;  5LGN A;  2A0L A;  2DMX A;  4DK0 A;  2XAG A;  1Q6U A;  4O4L B;  3B4S A;  1S0V A;  1PNM A;  4H0L B;  1I5Y A;  1ZUQ A;  1H2M A;  2IJJ A;  1GN6 A;  3JAW A;  4X62 O;  1TUB A;  4O2A A;  4Q6G A;  1AR4 A;  3D36 C;  4PJ0 Z;  1XHX A;  3CCR V;  3ZHU A;  1XEQ A;  1V55 C;  4J80 A;  4UVB A;  1VQN V;  3BVO A;  3O9O A;  5B1B C;  1CEZ A;  5K1P A;  4TQD A;  2EUL A;  3CD6 V;  2QWO B;  2R72 A;  1K3E A;  3SPJ A;  4NXN B;  5J2T B;  2CE4 A;  3UT5 A;  2K1E A;  3DXR A;  4JI6 O;  3OR6 C;  1ROP A;  5KHH A;  5KAI Z;  2QKA A;  4TV8 A;  4OGQ B;  4CS4 A;  5C93 A;  5EC2 C;  3C90 A;  3CME V;  3QVN A;  2DYR C;  4DV1 B;  2ZR2 A;  3ABK B;  3DXR B;  1AI5 A;  1JQ0 A;  2CDY A;  3FKS G;  1MNG A;  1S77 D;  5IDJ A;  2GBO A;  1SES A;  4EB6 A;  1FJG B;  3FYE B;  2ZXW B;  2IBZ H;  3X2Q B;  3TJT A;  3ZRX A;  4ZBM A;  5J9P C;  4I50 A;  3H1J H;  3MD0 A;  1H2G A;  2QWP B;  2OCC B;  3FD9 A;  4LF4 O;  2V1D A;  3FB7 C;  1NI8 A;  1NS1 A;  4TWK A;  2LW7 A;  1N32 O;  2GSM B;  2Y4T A;  4GKK B;  1B3Q A;  1WJZ A;  2GUZ B;  3QO8 A;  1KP3 A;  1BZK A;  2OWO A;  4RQF A;  1KC8 W;  3DC6 A;  3ZMZ A;  1H2L A;  2X6A A;  2QTO A;  5KUM A;  4YIP A;  1JJ2 U;  3APQ A;  2CK3 G;  1M57 B;  1JA8 A;  4JYA O;  1GK9 A;  1OCZ C;  1P49 A;  4YIO A;  2XTA A;  4I55 A;  3BA9 A;  3N2K A;  5IY5 B;  1N34 O;  1S3J A;  2IJK A;  4WFF A;  4I55 B;  4PDM A;  3LNM B;  3K57 A;  5CB4 A;  5LP6 A;  2R70 A;  1ZTE A;  2PTM A;  1NBM G;  4LBE C;  3M99 B;  4B3M B;  5LMN B;  4JI5 O;  3FFQ A;  4JAV A;  3VQW A;  3K79 A;  1OCO B;  1XMQ O;  4EFB A;  4DV0 O;  1IBK B;  4YXW G;  2JVD A;  5IWA B;  2CTW A;  3CCQ V;  4QJF B;  4UVC A;  1I7F A;  1R73 A;  1M5I A;  4O4I B;  2JK5 C;  2PZS A;  4JI7 O;  4W4L A;  4NTW A;  4DRX A;  4NXM O;  2OTJ V;  4YJ2 A;  3OTO B;  2FL4 A;  2ODM A;  1PL0 A;  2WWW A;  4YY3 B;  3HKD A;  3G6B A;  1E1Q G;  3NR7 A;  2P7T C;  5JCO C;  1WLE A;  1JVM A;  1AIL A;  2UXC B;  3ZIA G;  1L0L H;  1FD9 A;  1BHA A;  1RPO A;  3SYA A;  3ZED A;  1EM1 A;  4PA4 A;  4JV5 B;  1FAF A;  4I4T B;  4DV3 B;  5CMU A;  4PDL A;  1AJN A;  1N8R W;  2EIN B;  5IJ9 B;  3LUT B;  1HNW O;  3FAV B;  3J80 N;  3SPH A;  3OGI B;  5TIS Z;  1NU1 H;  1TVK A;  4AQY O;  4RAI A;  3ZHQ A;  3CC7 V;  3U11 A;  3CRC A;  3E8F A;  3ZX6 A;  1BL8 A;  1IBL O;  4LR3 A;  1F23 A;  1TVK B;  3W7W A;  2UXB B;  1M4U A;  4JI4 B;  1Q90 D;  4QGP A;  1S76 D;  1IVS A;  2Q9L A;  3AG3 C;  4B08 A;  1N0J A;  3CYO A;  2ZNJ A;  4JAA A;  4AIL C;  2YUA A;  4MVM A;  1P84 F;  4PA3 A;  2O57 A;  3RWR D;  1URF A;  4KFM A;  3LSQ A;  3CCU V;  5LA6 A;  4GKJ O;  2ZQM A;  2VRZ A;  4B3R O;  1H38 A;  3F7V C;  4DV5 O;  3CB2 A;  2QA4 V;  3ETE A;  2ZCE A;  1XI1 A;  2UU9 B;  2GV9 A;  4TUY A;  3GWO A;  1NT2 B;  4X1K A;  2LJ2 A;  5CA1 A;  5HFM A;  3ABT A;  2OT5 A;  2UUA B;  3K58 A;  2LFS A;  2M6Y A;  1YDX A;  2KKW A;  4JYB A;  1F4N A;  1M56 C;  2DN9 A;  1BQZ A;  4QNH B;  5GTH Z;  4F6E A;  4WF9 V;  2WLN A;  1VQM V;  2YEV A;  4JI2 B;  2ZR3 A;  1IBM B;  4ZI7 A;  2M7W A;  2CGO A;  3B77 A;  1FS0 G;  3ML0 A;  3LDD A;  1XDC A;  1T5E A;  2KG7 A;  1YF2 A;  2QDO A;  4O2B B;  1Q5O A;  4H13 B;  2RQ6 A;  2YIA A;  3VQV A;  1OHH G;  4R7C A;  2YEV B;  3E8B A;  4UVA A;  3CP1 A;  2E5L O;  1XL6 A;  1Z2G A;  2KG7 B;  1O9H A;  4JF3 A;  4I9W A;  3GWK C;  1YXB A;  4OPH A;  3HR0 A;  4FLZ A;  3NXS A;  3P30 A;  1L1F A;  3A0B Z;  1HNX B;  1GRJ A;  2HEP A;  4QPJ A;  4B3S O;  4X20 A;  1MA1 A;  1OCR C;  3BEH A;  2Q4P A;  3WB0 A;  1Q6H A;  3WFV A;  5IJ0 B;  3BY6 A;  1A32 A;  3JAL A;  2IJI A;  1MZF A;  4LF8 O;  4X64 O;  3K0D A;  3L73 H;  1KU9 A;  5JVD A;  1K9M W;  5CA0 A;  4GZR B;  3I56 V;  4FVM A;  4JGS A;  1Y6X A;  3ASN B;  3CPW U;  1R3J C;  4YJ3 A;  4C7U A;  1EN5 A;  4TV9 A;  1AI6 A;  1IUR A;  2ZNI A;  2DWD C;  2F23 A;  2P4V A;  3K9A A;  3K3W A;  5AG2 A;  2ARH A;  3AG2 C;  4JI1 B;  1S5H C;  3K0G A;  4J7K A;  3LDC A;  4OX9 O;  4PI2 A;  1IXM A;  3BA8 A;  3CHX A;  3RW0 A;  2BE3 A;  4TV9 B;  2N74 A;  3JD1 A;  1VF6 C;  4CZZ A;  1I0H A;  3A0R A;  2ZT9 B;  2F4V O;  3AG1 B;  4G2K A;  2Q69 A;  3K5L A;  4AI8 A;  3RYI A;  4JI3 B;  1QLN A;  3CRR A;  4MVO A;  1YVW A;  1CP9 A;  1Y76 A;  1AB3 A;  1WPB A;  1VF5 B;  2LGQ A;  5D5Q A;  2F66 C;  4LF9 B;  1GN2 A;  2QTS A;  1RP3 B;  4K3A A;  3IAY A;  4XDJ A;  4LFC O;  2Z3Y A;  3JSN A;  1W0K G;  1D5N A;  1WB8 A;  1HNZ O;  1SQP H;  4KL1 A;  1RFY A;  4JI6 B;  4DV6 O;  5H2F Z;  1YTF B;  2X0L A;  1I08 A;  3DSQ A;  5FL7 G;  2NNU A;  1BQ0 A;  2VQE O;  1Y74 A;  3E22 B;  2QWR B;  1L0N H;  5IYD O;  3CS5 A;  1ENV A;  4JI0 O;  2OCH A;  3JAT B;  2HHH B;  1TAE A;  5GTI Z;  1BMF G;  4PHZ A;  3WB1 A;  4UB8 Z;  3SYQ A;  2QKS A;  3ZMU A;  1RSO B;  3SR2 C;  3CCE V;  4QIW F;  1NZ6 A;  3RYC A;  2D3O W;  1ARO P;  1HWY A;  2ILM A;  4PI0 A;  3JAR A;  3ZMS A;  3ZRW B;  1QNM A;  1SF9 A;  1VQ7 V;  4J10 A;  5B3S B;  2A7W A;  5FPR A;  3OAA G;  2V4D A;  5EIB D;  2F93 B;  4ZIB A;  5CBH A; 
#chains in the Genus database with same CATH homology
 2M6Y A;  1FPO A;  2N04 A;  4J7Z A;  2YS8 A;  3APO A;  2CTQ A;  1IUR A;  2KQX A;  2LO1 A;  1XBL A;  2CTW A;  2DN9 A;  2Y4U A;  4J80 A;  2GUZ A;  4RWU A;  3BVO A;  1BQZ A;  3APQ A;  3UCS C;  1NZ6 A;  1GH6 A;  2QWP B;  1BQ0 A;  2LGW A;  2QWN B;  2QWO B;  2EJ7 A;  2QWR B;  3UO3 A;  2PF4 E;  2L6L A;  4IT5 A;  1HDJ A;  2QSA A;  2CUG A;  3AG7 A;  1FAF A;  1N4C A;  2Y4T A;  2GUZ B;  1WJZ A;  2QWQ B;  2OCH A;  2YUA A;  2DMX A;  2CTP A;  2CTR A;  2N05 A;  3UO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...