2QWOB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwoB00
2L6LA 3UO3A 4J7ZA 2LO1A 2QWQB 1FPOA 4RWUA 2KQXA 2CTRA 3AG7A 2QWOB 2QWNB 3APQA 2N04A 2OCHA 3APOA 1GH6A 2CTPA 1XBLA 2YS8A 2GUZA 2M6YA 2Y4TA 4IT5A 1IURA 3UCSC 2PF4E 2N05A 2QWRB 2LGWA 1FAFA 1HDJA 2YUAA 1BQ0A 3BVOA 1BQZA 1NZ6A 2CUGA 2EJ7A 4J80A 2DN9A 2QWPB 2CTQA 2QSAA 2GUZB 1WJZA 2CTWA 1N4CA 2DMXA 2Y4UA 3UO2A
chains in the Genus database with same CATH superfamily
3LUTB 1VQ4V 4IHJB 4X65O 5A9GA 2PYJA 3P30A 4RWUA 4EFEA 3X2QB 4JF3A 2ZNJA 1Y6XA 4LF6B 2JVDA 1NTKH 1ZLZA 3BY6A 1XHXA 5FL7G 3RVZA 1KKCA 1GRJA 2EILC 2E74B 4TUYB 3SPJA 1S5HC 1BT8A 4H13B 3ETGA 1K3EA 4DW1A 4DUYB 2X6BA 3OGIB 3CB2A 3CCQV 4ZIBA 4HZ3A 3CCSV 4AHCA 4X20B 4GKJO 4WFFA 4TQDA 2ITCC 4O4LB 3ETEA 3ZHSA 5JJJB 3AEIA 4ZOLB 2ZR3A 2OIGA 1PPJH 2NN4A 5B3SC 2WWWA 5B1AC 1JQ0A 2WPDG 4DR6O 2FB5A 1NKDA 4JYYA 4FFBA 2P6JA 4AQYB 2Q5ZA 4JAVA 1HR0B 2UUBB 2PY5A 2GV9A 4HYOA 4DV7B 3D8CA 2PYLA 3CXHF 4JI6O 3HR0A 2IW5A 1Q5OA 5E79Z 3ZMUA 4MW8A 4DV5O 4UVBA 4IGGA 1KB9F 2L35A 3BPZA 3ABKC 1OCCC 1P84F 2IH1C 4DRXA 1R6NA 1NH2D 2HFEC 3RFRA 2Y48A 3WG7B 1H38A 3OEEG 4I7ZB 2YIBA 3ABKB 2QE7G 3E8FA 4O4JB 1QVGU 4F6RB 2LFSA 3S3XA 4NYKA 4J10A 3CMAV 3ZHTA 1MZEA 2FTKA 2HHHO 1IBKO 1VQMV 5LMUB 3K08A 2ZKOA 3T4DA 2QTSA 4X1YA 2OCCC 4WFHA 5B1NA 1N32O 5CBHA 2DOSA 1XREA 2OCCB 3ZHQA 1S5LZ 3L9DA 1ZAUA 2QDOA 4YHHB 1HW7A 3F5TA 1VQOV 3CRMA 3WB0A 3FB5C 3ABMC 2QGNA 3K58A 1DF5A 3AG7A 4QE7A 3ZMTA 5L3CA 2A79B 2F95B 1L8DA 2HR3A 4FFBB 1AJNA 1RM1B 2VQEB 2JS3A 3ABMB 5L3GA 1GM8A 1NQTA 5KMGA 5H2FZ 2JK5C 4CC5A 1H2LA 4ABMA 5LGUA 3CCJV 1OV9A 2ZT9B 5KUMA 4DRXB 1BHAA 2GTAA 4FLXA 3CEIA 5EIBD 1ZL8A 2BTQA 4UV8A 2F23A 4G2KA 4X64O 3TJTA 2NR5A 3WB1A 1DGSA 4DW0A 3K9AA 5BZBA 1VQ9V 5IJ0A 4AILC 1JJ2U 4PD4F 3J81N 1WB7A 3MDSA 3D36C 3L71H 3E22B 1W0JG 4J9ZB 3JCZA 4KUMA 2XT9A 3S3WA 1R3IC 5DM6V 4I50A 5H6RA 1OCRB 5KHJA 2XAJA 5J2TA 3OTOO 3QNEA 3HKCA 4EB6A 4LF5O 3OR7C 1GTOA 5CBGA 3L70H 5J2UA 3K3WA 3QTCA 1GKFA 4YJ3A 2Q0AA 1XNRB 1WP7A 4PA4A 5L3FA 2Q4PA 5EC1C 4KP4A 1V55C 4JTAB 2BOBC 1M90W 1MG1A 4I0XA 3CXCU 4GKKO 1PNKA 2D3OW 4RUFA 2ZQMA 3CHXA 3DSQA 4JZ2A 2P4KA 2QR4A 2UUCO 4BW9A 2HJFC 1VF7A 2F93B 1SERA 4YIPA 1YJWV 3CC4V 5KMGB 5F2VO 3SPCA 3JARA 1XMOB 3E89A 5CA0A 3KKYA 4LWSA 4LBEC 2GBOA 3ZMZA 4J80A 4FLZA 5LP6A 1N4CA 3STZC 1ZL8B 1IBLO 2BTQB 1LUWA 3IGAC 4LF7B 1XL6A 1GN6A 1KKDA 1EN5A 1I0HA 3K0GA 2V4DA 3E83A 1O9GA 5LL6Y 5IJ0B 2YUAA 4BIUA 4CS2A 3ZRWA 1RPOA 1WB8A 4JI7O 3DC6A 1QLNA 1SKVA 1WA8A 5LGTA 2JEXA 4MVUA 2EIJB 2UU9O 3K57A 1FFXA 1IZ3A 2IJHA 4NTYA 1K33A 2W0XA 1W0KG 2W6JG 1IBMO 2ZNIA 4FIPC 4EFBA 5J2TB 2X6CA 3JASA 1XBLA 3HKCB 5LBQA 1NH2B 3E2EA 4FLYA 4J9YB 4YJ3B 4U3FH 2Q7HA 5BR8B 4LFCO 4DR5O 1BS3A 3JAWA 3E8GA 4UCVA 2QSAA 4D7TA 2ZIOA 1T5EA 4U3JA 3T1CA 1YXBA 1ZX3A 3OE7G 2H8PC 4DUZB 4MVRA 2N04A 4LFBO 1VARA 3ZX6A 1JMKC 4YIOA 2Y4TA 2PUSA 2EINB 2QA4V 1Q43A 1OCZC 4DR7O 4LCUC 4CBCA 4FLTA 1Z5WA 3JARB 1US6A 4LWSB 3K79A 2Q69A 3KZIZ 3U10A 1FXVA 5LP6B 2UUAB 3RGBA 1XDCA 2XTAA 4HAMA 1H2NA 2FMLA 2V7QG 4DV4O 4LF4B 2E5LO 3A2FA 3OTFA 1H2MA 1JVMA 3P3PA 1IVSA 3LSSA 1MNGA 3BVOA 2EJ7A 4I9QA 4LC1A 2HP8A 4NXMB 1JPXA 1NR7A 4KL1A 4B3SO 2B1GA 3ZRWB 4R8CA 1VEWA 3C3TA 1WA8B 4QJFB 5EIBC 1COWG 1FFXB 5JH7A 3UCSC 1P49A 4XBFA 4K8ZA 4Z1MG 4DV3B 1Y66A 3JASB 2WLKA 4K0KO 2H3OA 2QEXV 1YIJV 5JJNB 2AZ0A 1LUVA 1PP9H 3JAWB 4X66B 3CD6V 4U3JB 2KG7A 1XNQB 2EIMC 5HFLA 3SYQA 3T1HO 4ZHQB 3B4SA 4PA7A 4QPKA 1CPYA 4JZGA 1D5AA 3HKBA 2OWOA 2EIMB 1B6QA 4J7ZA 1MMMA 4JV5B 4RAIA 1QR9A 5IJ9A 1DTOA 4GUNA 4GX5A 3GB7C 5KHKA 3I56V 2HKOA 1I94B 4JI2B 2F4VB 3B09A 3NXSA 5KA5A 4N21A 2DWDC 3SJQC 2Z0AA 3MAQA 1FXHA 1VQ5V 3ZHUA 1QBZA 1CP9A 1Q3EA 2VWJA 5FPOA 2ZCEA 4K3AA 4TT3G 1RSOA 2Q8VA 1S3JA 2A0LA 4X1KA 4YY3B 1K4CC 4RQFA 1NS1A 1VQNV 4BIZA 3BABA 3L74H 4IHJA 1VQ7V 4HBNA 4DV7O 2RMKB 1NJIW 3K5MA 5JH7B 2Y0PA 3P3NA 1S72V 4D7SA 4O4HA 1AB3A 3BAAA 4ZBMA 1YHQV 2XASA 5KA6A 1QLEC 2P7TC 3B8NA 1M57C 4N23A 1R6KA 2N05A 1NVPB 4BAYA 1J95A 5EBLC 2H94A 2KG7B 1E79G 3JATA 3OMNB 4JPRA 3SYCA 4QIWF 4LH6A 4X20A 1QLEB 1MSDA 2YSUB 3FAVA 4JYCA 1M57B 2R9AA 3SJAC 3A8TA 1YJ9V 3A0HZ 4FZ1A 1XI1A 5LMUO 4FJCC 3TGUH 4J42A 1BZKA 2QWRB 1PL0A 5IJ9B 1BSMA 1PL4A 2LW7A 5KX5A 2DMXA 3SPGA 3ZIAG 3RYCA 4IL6Z 3APQA 4OPHA 5KHGA 5EK0A 5HFMA 3H01A 4OX9O 3U11A 4YHHO 5LHIA 4AI8A 1KP3A 3L72H 1RSOB 1NTZH 4X1KB 4FPPA 1ZSPA 1SRYA 4QPJA 1R3LC 4XDKA 2HEPA 2CGOA 2VQEO 3ZS8C 3CP1A 3GVMA 4PA9A 3CE2A 2QTOA 3AG3C 2UXCO 4O4HB 2ADQB 2XAQA 1QU7A 1FXKC 3G6EV 2R72A 4DXWA 3WB2A 4X62B 5FNVA 1J5EO 2X0LA 4QGPA 1ZTEA 2EILB 5CMUA 1PM9A 3UT5A 3JATB 4MVSA 3SYOA 2DQ3A 3FAVB 2AXTZ 3OW2U 3ETQA 5FPRA 2EZOA 5DECA 3IJ4A 3HB3B 3JD4A 1AROP 3ZN1A 2Q9LA 3JD2A 1YI2V 1JOYA 4X9QA 3JCUZ 4I4TA 3D3QA 2MW2B 1G1XB 2ATKC 5KX5B 1SZXA 1O9HA 1VQPV 1NT2B 2C2AA 5B3SB 5B1AB 3RYCB 4TSFG 4DR3B 1AI4A 1HNXB 5JCOA 3I55V 1XNRO 2OT5A 3HKEA 4A5UB 2UXBO 5JVDA 1SZTA 2BE3A 3MHHC 4JAAA 5IYCO 1BHBA 3K9SA 2EULA 3SJBC 1OCCB 3K06A 1KP2A 1W2BU 3T1YB 1XILA 3ZMVA 2YIAA 1CEZA 1NZ6A 1N34B 1WN7A 2YDEA 3E22A 4LF8B 3JD3A 1Q6HA 2PI5A 1B06A 1XMOO 1PNMA 1FKAO 3H1HH 4JTDB 5FNVB 5K1XA 1TUBA 4O2AA 3KCXA 3K5OA 3D36A 1X59A 2AGAA 2A3QA 2RQ6A 3UT5B 3AG2C 1AI7A 4DV0B 4RO2A 1XHZA 3DGEA 5BMVA 4CH6A 2OYQA 4F4LA 2GHYA 3F5WC 4FM0A 1JCHA 4MTOA 1XQ8A 2CK3G 1S77D 4L87A 2ZE5A 1Q81W 5JCOC 2N74A 3BA8A 4I4TB 5J9PC 4UCRA 1GN4A 2ZXWC 4LFAB 3ZMSA 3W7XA 1WPBA 2ADPA 3DC5A 3FYEB 5KUKA 5BR8O 5D5QA 1MZFA 2R9IA 3HKEB 4FFKA 4X65B 5JVDB 2B5UA 5EBWC 2JJ1G 2JS5A 1N36B 1U97A 4LNUA 2DWEC 3JD0A 4DUZO 2QKAA 2QM8A 1BMFG 4KHPB 1SA0A 3TK1A 4NTXA 4MW3A 3EHBB 1AR1B 3NR7A 3N2KA 5CN0A 3M99B 4B3MB 2IH3C 3U0ZA 3CCMV 5GTIZ 4W4KA 2MK3A 1H8HG 2NNUA 3ZRVA 4UCUA 3PN1A 3FB6C 1TUBB 4O2AB 1WNSA 4QE9A 4NKGB 2YICA 4H37A 2UUAO 3RWRD 4CH3A 4UCSA 1ORQC 2PTMA 4JI4B 3HPLC 5BMVB 4JASA 3IC9A 3OAAG 4TV8A 4NXMO 5IY5C 1AR4A 1G8MA 2ZM6B 4B3TB 4ZKIA 4FVMA 2WLJA 1D5NA 4JTCB 2QKCA 3ML0A 2YXHA 3CRQA 2WSSG 2ZDIC 4UCTA 4G28B 1V55B 5CA1A 4DV3O 3EVKA 4W4LA 1K9MW 2WLNA 4MVMA 1ROPA 2GUZA 3UM7A 1M1KW 3BA9A 2LFRA 3CSXA 1YTFD 3JAMN 5CBFA 5LGNA 5LXTA 2K1EA 3AG4C 5IYDO 2EZPA 2CTQA 1F4MA 1IBKB 2ARHA 3UO2A 2L6LA 1XNQO 4WFBV 2Z3YA 2CE4A 3BFRA 4MTGA 2OCHA 4LNUB 4ASUG 2GDSA 3VBBA 1EFRG 1FD9A 1SA0B 4NR1A 1R3KC 2RNBA 4UVAA 2QM4A 3FD9A 3N2KB 2PI4A 3ASNC 2UXDB 4JV5O 1AVMA 1N0NA 4PDRA 4U7OA 5E1AC 2RCVA 3E8BA 4UB8Z 4JI2O 1I94O 1H2GA 4FLUA 2F4VO 2Q73A 4PJ0Z 1Y4MA 1Q8IA 3K59A 1R3JC 3CCVV 4DR2B 4G27B 2F1MA 3H1LH 2HVJC 4DV6B 4J11A 4WFGA 1N33B 4IYIA 1I7FA 4Z1VA 4YY3O 4TV8B 5FLXN 1Y74A 4MVZA 4ICGA 5ITZA 4L8JA 2GSMB 3ZHRA 5KHHA 4ZHQA 1XEQA 1S76D 2IJJA 1QHTA 3AK2A 1XUQA 1HDJA 3G71V 4WFAV 5CA1B 3CWBH 5D5PA 3CX5F 2VQFB 3TXQA 4NXNB 1KUQA 2GUZB 4LR3A 2JJ2G 4DK1A 5LXTB 3H1KH 1MA1A 1YCIA 2P90A 4FK5C 2F43G 1P7GA 1OCZB 5IYBO 2P06A 5DEDA 1NU1H 3LSQA 4JYAB 2JIZG 5IWAO 4JI0B 4WBNA 1THZA 2VRZA 2VS0A 3SDLA 1OJHA 4FMTA 3RBZA 4B3RB 1AILA 2YXLA 2EX3A 4DR4B 3M8AA 5LA6A 1XL4A 4JI3B 1UPGA 3ICXA 3LDDA 2A7WA 2BCCH 3LDCA 2Z5UA 4JI8B 3H9VA 4OGQB 2JEUA 3LNMB 1NTMH 1IX9A 1Z5VA 5IE9A 4GX2A 1Q86W 3RVYA 2BTOA 4U7NA 2Q67A 2DW4A 4TWKA 3VOUA 3LNNA 1M5IA 3STLC 1Y74B 5ITZB 5BY1A 3RW0A 1TUEB 2IU3A 1I5YA 2HVKC 4X8AA 1K34A 2DN9A 2IJIA 2X6AA 4LF6O 1EM1A 2QWOB 3SR2C 1AP6A 2YEVA 4EKWA 1IDSA 3OFNG 3SPHA 4Q20A 1HNWB 4IYHA 1PV0A 4X62O 4DUYO 1E1QG 4JI1B 2IU0A 5LMNB 1DK1A 3QO8A 3ASOC 5IT9N 4JGSA 3OD4A 4JI7B 1K4DC 3D3IA 2CAZC 4WBNB 3LSUA 4P9PA 2QJ1A 4CZZA 4PDVA 1IBMB 1SC5B 3K5LA 4FM2A 1TA8A 5LA6B 1BCCH 4AQYO 1HR0O 2UUBO 4UVCA 4UFZA 3T2MA 5B1BC 4LP8A 3SYPA 2ZE8A 1YTFB 5JJEB 1HNZB 2EJRA 2Y4UA 4I55A 2Q0OC 4DR5B 4MVOA 1S5JA 3G67A 2V1DA 3FX7A 3CRAA 4B7EA 2UXNA 4DR3O 3A0RA 1HNXO 3G6BA 1YSCA 1JA8A 1M93A 1L0NH 1FXKA 1V9PA 1R1BA 1HWYA 4YJ2A 4DV1B 5EC2C 1IXBA 3KCYA 3W7WA 2RJZA 1F51A 3RYIA 3AK3A 3T1YO 2W6IG 1L0LH 1H2SB 2FL4A 2KKWA 5EYPA 4ZI7A 1BGYH 3N27A 3CMEV 3JAKA 2ODMA 2M6YA 1N34O 5IYZA 4LF8O 2YEVB 2W0FC 1DF4A 2PZSA 4LF9B 2AZ2A 4DK0A 5K1PA 2DE0X 5AG2A 1ZWIC 1AI6A 1ZUQA 4FLWA 1FPOA 1G4YB 4IIJA 2P4VA 3IAYA 4BIOA 2YIBD 5B5EZ 5LHGA 4BW5A 3OUFA 1GN3A 4DV2B 1XMQB 1KD1W 5L3DA 1JR9A 2LP7A 1KECA 1Q6UA 3FB7C 3ZBHA 4MTFA 4NVPA 1MOFA 3OEHG 4C7UA 4FLVA 1VF6C 4K0KB 3RT3C 2XHBA 2LJ2A 1M9NA 4I55B 4Z2WA 1QR8A 3X2QC 3E8HA 3G4SV 4B08A 4UUJC 4GLXA 5A2QN 2CUGA 4E2LA 4CS4A 2WLMA 3AG3B 4FM1A 3VQYA 4JAUA 3JSNA 2CTRA 1BE3H 3OGCC 1FXKB 4DYLA 1N36O 2E3CA 4YJ2B 1GO3F 2LW1A 3RYIB 1SQVH 1N8RW 4KHPO 5EYPB 4ZI7B 4X1IB 3ZRSA 1YITV 1SQGA 3JAKB 5C8YA 5LYJA 1WJZA 3JSLA 4B3MO 3H1JH 2A06H 4UB6Z 1P7BA 5IYZB 3EFFK 1VMGA 3QO5A 3CCLV 2CTPA 4BR6A 1KMIZ 1QNMA 2WA4A 1K5QA 4H0LB 3PJSK 2YXYA 4IIJB 3Q4HA 2FYUH 1BQZA 1VQ6V 3W7TA 1DLBA 4JI4O 4O2BA 3B40A 2X7RB 3FB8C 2WLIA 2ZM6O 4B3TO 1PKXA 1SQFA 3OMAB 3WG7C 2YC0A 2PF4E 2JGDA 1BQ0A 1F23A 1KU9A 3LDEA 4JI5B 4DR1B 3R65A 4MSWC 1SETA 4O4IA 1OZ0A 2OIEA 1RFYA 5JQGA 4J41A 4CC6A 1EN6A 5CB4A 4P30A 1K97A 4YXWG 1UJWB 2QM7A 2YI8A 3THOA 4WCEV 3TXSA 1IURA 1VP7A 2XAGA 3L75H 4D6TH 2O57A 4LF7O 3AG1C 1GN2A 3ZN0A 2Y0IA 1NBMG 2LGQA 1Y67A 4WF9V 1YZBA 2E76B 2QKSA 3AG2B 5C8YB 5LYJB 1FJGB 2UXDO 1NR1A 3AG1B 1FYJA 3UKMA 1GMGA 2ZIMA 3K5NA 3CJHA 2LGWA 4OX9B 1M4UA 1YJNV 1RM1C 2CTWA 1OHHG 4GZRB 2HG5C 5C93A 2AHZA 1U96A 3ZCCA 4DR2O 3Q4HB 4CH4A 2ZDIA 4DV6O 3J7AU 3F7YC 1GH6A 3MHSC 1I5XA 3T4ZA 1MSWD 1BL8A 3QO7A 4O2BB 3O9OA 1QCEA 1N33O 3GWOA 2ZXWB 2JGUA 3G80A 1Q7YW 5EZYA 1AR5A 2WLIB 3SPIA 5KAIZ 2UXCB 1RP3B 1JJOA 2ZD9A 4PV1B 1SQPH 2D2CB 2P67A 4OPAA 4J7KA 1SQBH 2Y69C 3QG5A 5B66Z 2JGDB 1Y76A 4H44B 4TOIA 3RYFA 5GW7A 3F7VC 4O4IB 1J5EB 1N0JA 4PI0A 2JRIA 3N2GA 2VQFO 4R6ZA 4RUEA 4NXNO 2IJKA 5JQGB 2Y69B 3SGIA 3GWKC 1GM9A 5CB4B 1Q90D 1FFTB 2XUMA 4GKJB 2KSDA 3L73H 3J80N 3EXAA 3CCUV 2ZE7A 1EN4A 2ILMA 3IFXA 3WU2Z 3CC2V 3C90A 3CCRV 1OCRC 3IC7A 5KHIA 1VQKV 4LF4O 1A32A 5TISZ 2XNDG 1VQ8V 4JYAO 4X1YB 3BCCH 2YS8A 4DR6B 1K73W 4JI0O 4IT5A 1KC8W 4JI6B 3JYCA 4PHZA 3W7UA 4R7CA 2XAFA 4PA3A 4B3RO 4NTWA 3DXRA 4DR4O 1XOUA 2AW9A 2Q6AA 4JI3O 4DV5B 3CJHB 1FS0G 1TVKA 1WPXA 3SYAA 3SJCC 4JI8O 5IY5B 1CXZB 2KB1A 5LOVA 1K8AW 2UXBB 2P22C 1S0VA 3ZEDA 4Q6GA 4NB5A 4KXRA 3R66A 3ZRXA 4PI2A 4TQFA 4QNHB 4P2ZA 3OR6C 1OCOC 5GONA 1GK9A 4HNAA 1P4RA 2WLLA 1LR1A 4GYCB 4X66O 1UFIA 2HHHB 3UO3A 5EZYB 3E35A 1JX9A 3A0BZ 3CS5A 1OCOB 4B7KA 4P9OA 2BOCC 3AG4B 1KYOF 1B04A 2IBZH 1SESA 4DO2A 1Y76B 3FKSG 3RYFB 3N2GB 1N32B 3E86A 3P32A 4E4EA 2DYRC 1HNWO 2F66C 1NVPD 4WFEA 1X4TA 3K0DA 4JI1O 1SQQH 1H2KA 5LMNO 2EIJC 4UCOA 3ASNB 3ABUA 3W7SA 3H1IH 2DYRB 3K04A 2XOKG 2YI9A 1ENVA 4PDMA 5H6QA 1TGOA 3BEHA 4I9WA 4I50B 3JALA 3OUSA 4GT1A 3DXRB 3OMIB 3FFQA 3TCUA 4EB6B 3RN4A 5J2UB 3CCEV 1TVKB 1R73A 1HNZO 1JFFA 1KBHA 1KQSU 4R50A 5LOVB 4GCZA 2QWPB 5L3BA 2EINC 2IM9A 4GX0A 2WA3A 4OXSA 3ZHVA 4I0XB 5GONB 4X64B 4HNAB 2K9PA 1WAZA 1AJPA 4F6EA 2WLLB 3KG2A 1D2DA 2CH7A 4FZ0A 3JD1A 4I5SA 4DV1O 4K8XA 3RYHA 4UV9A 1NI8A 5LP6C 1VF5B 4PDLA 1L1FA 2G38A 4GX1A 5CA0B 3I5DA 1IXMA 2OTLV 1F4NA 3VQVA 3HKDA 1W59A 3OTOB 4PA6A 2UXXA 1YDXA 4LF5B 4LF9O 2B1IA 2HLDG 1Z2GA 4JYBA 2WAMA 3QF7A 1G6UA 5GTHZ 2PGGA 1TAEA 3QVNA 1GAXA 1PNLA 4H33A 1H8EG 2EIKC 2ZE6A 3ABTA 3CRCA 4J7JA 1K7DA 1YF2A 4DV2O 4GKKB 1XMQO 1EZVH 4CS3A 5H5NA 2EIKB 2YIDA 3CRRA 5CA3A 2UUCB 3JALB 1K92A 2Q7GA 2DYSC 1EBOA 2DQ0A 3FYIB 3MD0A 3M7MX 3VQWA 3BHPA 2ZINA 4EEQA 1JFFB 2KQXA 2FKXA 2DYSB 3TETA 3OT7A 1B3QA 1E1RG 1IBLB 1SS3A 2JDIG 3B77A 5KAFZ 4MS2A 3OM3B 4LH7A 2CDYA 1RPRA 3CYOA 2CH7B 5B1OA 3RYHB 2R9RB 2QWQB 3ZJZA 2OTJV 2XAHA 4CH5A 2CGNA 2UU9B 3ASOB 5BXZA 3HKDB 2BSKA 2AHYA 2NLJC 4TV9A 4XDLA 4PELA 1F7YA 1QVFU 4UXNA 3AK1A 4LFCB 1QQCA 1V54C 2QWNB 4MVQA 1HP8A 1YEWA 3K03A 1VF6A 1VQLV 5B1BB 1SQXH 5JWPA 2GTSA 3VQXA 1EZJA 4LFBB 1V54B 1M56C 5KLVH 3UQ8A 2ETNA 2M7WA 2B9ZA 4DR7B 1Q6IA 1WP8A 3ABLC 3O65A 4TUYA 1R6TA 2ZR2A 1M56B 4X1IA 5DN6G 4JI5O 4DR1O 1PD3A 4KFMA 3DTUB 2Q7EA 1AJQA 1LNQA 5H9CA 3B2EE 3ABLB 2EBOA 2HJDA 4DV4B 5L3EA 2E5LB 4RQEA 2ITDC 3C3SA 5LHHA 5IWAB 3WFVA 4K35A 4O4LA 1K5SA 2RN9A 2VWKA 3HKBB 4MT8A 1I08A 2Q68A 4ZOLA 4DV0O 4X88A 4B3SB 5EBMC 2A9HA 1GM7A 4MTXA 2LQTA 1Q82W 1AP5A 1SF9A 2R70A 1VIBA 1FAFA 4BWAA 3ETDA 1YVWA 4X89A 2RDCA 5IDJA 2BSKB 1FJGO 1AI5A 2LO1A 3B8MA 4TV9B 4XDJA 3CC7V 3APOA 1WLEA 3BRCA 1URFA 2DJVA 4LFAO 2WLHA 1MABG 2E75B 3CPWU 4O4JA 2P5OA 4F6RA 3T1HB
chains in the Genus database with same CATH topology
2L6LA 3UO3A 4J7ZA 2LO1A 2QWQB 1FPOA 4RWUA 2KQXA 2CTRA 3AG7A 2QWOB 2QWNB 3APQA 2N04A 2OCHA 3APOA 1GH6A 2CTPA 1XBLA 2YS8A 2GUZA 2M6YA 2Y4TA 4IT5A 1IURA 3UCSC 2PF4E 2N05A 2QWRB 2LGWA 1FAFA 1HDJA 2YUAA 1BQ0A 3BVOA 1BQZA 1NZ6A 2CUGA 2EJ7A 4J80A 2DN9A 2QWPB 2CTQA 2QSAA 2GUZB 1WJZA 2CTWA 1N4CA 2DMXA 2Y4UA 3UO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  3UO3 A;  4J7Z A;  2LO1 A;  2QWQ B;  1FPO A;  4RWU A;  2KQX A;  2CTR A;  3AG7 A;  2QWO B;  2QWN B;  3APQ A;  2N04 A;  2OCH A;  3APO A;  1GH6 A;  2CTP A;  1XBL A;  2YS8 A;  2GUZ A;  2M6Y A;  2Y4T A;  4IT5 A;  1IUR A;  3UCS C;  2PF4 E;  2N05 A;  2QWR B;  2LGW A;  1FAF A;  1HDJ A;  2YUA A;  1BQ0 A;  3BVO A;  1BQZ A;  1NZ6 A;  2CUG A;  2EJ7 A;  4J80 A;  2DN9 A;  2QWP B;  2CTQ A;  2QSA A;  2GUZ B;  1WJZ A;  2CTW A;  1N4C A;  2DMX A;  2Y4U A;  3UO2 A; 
#chains in the Genus database with same CATH topology
 3LUT B;  1VQ4 V;  4IHJ B;  4X65 O;  5A9G A;  2PYJ A;  3P30 A;  4RWU A;  4EFE A;  3X2Q B;  4JF3 A;  2ZNJ A;  1Y6X A;  4LF6 B;  2JVD A;  1NTK H;  1ZLZ A;  3BY6 A;  1XHX A;  5FL7 G;  3RVZ A;  1KKC A;  1GRJ A;  2EIL C;  2E74 B;  4TUY B;  3SPJ A;  1S5H C;  1BT8 A;  4H13 B;  3ETG A;  1K3E A;  4DW1 A;  4DUY B;  2X6B A;  3OGI B;  3CB2 A;  3CCQ V;  4ZIB A;  4HZ3 A;  3CCS V;  4AHC A;  4X20 B;  4GKJ O;  4WFF A;  4TQD A;  2ITC C;  4O4L B;  3ETE A;  3ZHS A;  5JJJ B;  3AEI A;  4ZOL B;  2ZR3 A;  2OIG A;  1PPJ H;  2NN4 A;  5B3S C;  2WWW A;  5B1A C;  1JQ0 A;  2WPD G;  4DR6 O;  2FB5 A;  1NKD A;  4JYY A;  4FFB A;  2P6J A;  4AQY B;  2Q5Z A;  4JAV A;  1HR0 B;  2UUB B;  2PY5 A;  2GV9 A;  4HYO A;  4DV7 B;  3D8C A;  2PYL A;  3CXH F;  4JI6 O;  3HR0 A;  2IW5 A;  1Q5O A;  5E79 Z;  3ZMU A;  4MW8 A;  4DV5 O;  4UVB A;  4IGG A;  1KB9 F;  2L35 A;  3BPZ A;  3ABK C;  1OCC C;  1P84 F;  2IH1 C;  4DRX A;  1R6N A;  1NH2 D;  2HFE C;  3RFR A;  2Y48 A;  3WG7 B;  1H38 A;  3OEE G;  4I7Z B;  2YIB A;  3ABK B;  2QE7 G;  3E8F A;  4O4J B;  1QVG U;  4F6R B;  2LFS A;  3S3X A;  4NYK A;  4J10 A;  3CMA V;  3ZHT A;  1MZE A;  2FTK A;  2HHH O;  1IBK O;  1VQM V;  5LMU B;  3K08 A;  2ZKO A;  3T4D A;  2QTS A;  4X1Y A;  2OCC C;  4WFH A;  5B1N A;  1N32 O;  5CBH A;  2DOS A;  1XRE A;  2OCC B;  3ZHQ A;  1S5L Z;  3L9D A;  1ZAU A;  2QDO A;  4YHH B;  1HW7 A;  3F5T A;  1VQO V;  3CRM A;  3WB0 A;  3FB5 C;  3ABM C;  2QGN A;  3K58 A;  1DF5 A;  3AG7 A;  4QE7 A;  3ZMT A;  5L3C A;  2A79 B;  2F95 B;  1L8D A;  2HR3 A;  4FFB B;  1AJN A;  1RM1 B;  2VQE B;  2JS3 A;  3ABM B;  5L3G A;  1GM8 A;  1NQT A;  5KMG A;  5H2F Z;  2JK5 C;  4CC5 A;  1H2L A;  4ABM A;  5LGU A;  3CCJ V;  1OV9 A;  2ZT9 B;  5KUM A;  4DRX B;  1BHA A;  2GTA A;  4FLX A;  3CEI A;  5EIB D;  1ZL8 A;  2BTQ A;  4UV8 A;  2F23 A;  4G2K A;  4X64 O;  3TJT A;  2NR5 A;  3WB1 A;  1DGS A;  4DW0 A;  3K9A A;  5BZB A;  1VQ9 V;  5IJ0 A;  4AIL C;  1JJ2 U;  4PD4 F;  3J81 N;  1WB7 A;  3MDS A;  3D36 C;  3L71 H;  3E22 B;  1W0J G;  4J9Z B;  3JCZ A;  4KUM A;  2XT9 A;  3S3W A;  1R3I C;  5DM6 V;  4I50 A;  5H6R A;  1OCR B;  5KHJ A;  2XAJ A;  5J2T A;  3OTO O;  3QNE A;  3HKC A;  4EB6 A;  4LF5 O;  3OR7 C;  1GTO A;  5CBG A;  3L70 H;  5J2U A;  3K3W A;  3QTC A;  1GKF A;  4YJ3 A;  2Q0A A;  1XNR B;  1WP7 A;  4PA4 A;  5L3F A;  2Q4P A;  5EC1 C;  4KP4 A;  1V55 C;  4JTA B;  2BOB C;  1M90 W;  1MG1 A;  4I0X A;  3CXC U;  4GKK O;  1PNK A;  2D3O W;  4RUF A;  2ZQM A;  3CHX A;  3DSQ A;  4JZ2 A;  2P4K A;  2QR4 A;  2UUC O;  4BW9 A;  2HJF C;  1VF7 A;  2F93 B;  1SER A;  4YIP A;  1YJW V;  3CC4 V;  5KMG B;  5F2V O;  3SPC A;  3JAR A;  1XMO B;  3E89 A;  5CA0 A;  3KKY A;  4LWS A;  4LBE C;  2GBO A;  3ZMZ A;  4J80 A;  4FLZ A;  5LP6 A;  1N4C A;  3STZ C;  1ZL8 B;  1IBL O;  2BTQ B;  1LUW A;  3IGA C;  4LF7 B;  1XL6 A;  1GN6 A;  1KKD A;  1EN5 A;  1I0H A;  3K0G A;  2V4D A;  3E83 A;  1O9G A;  5LL6 Y;  5IJ0 B;  2YUA A;  4BIU A;  4CS2 A;  3ZRW A;  1RPO A;  1WB8 A;  4JI7 O;  3DC6 A;  1QLN A;  1SKV A;  1WA8 A;  5LGT A;  2JEX A;  4MVU A;  2EIJ B;  2UU9 O;  3K57 A;  1FFX A;  1IZ3 A;  2IJH A;  4NTY A;  1K33 A;  2W0X A;  1W0K G;  2W6J G;  1IBM O;  2ZNI A;  4FIP C;  4EFB A;  5J2T B;  2X6C A;  3JAS A;  1XBL A;  3HKC B;  5LBQ A;  1NH2 B;  3E2E A;  4FLY A;  4J9Y B;  4YJ3 B;  4U3F H;  2Q7H A;  5BR8 B;  4LFC O;  4DR5 O;  1BS3 A;  3JAW A;  3E8G A;  4UCV A;  2QSA A;  4D7T A;  2ZIO A;  1T5E A;  4U3J A;  3T1C A;  1YXB A;  1ZX3 A;  3OE7 G;  2H8P C;  4DUZ B;  4MVR A;  2N04 A;  4LFB O;  1VAR A;  3ZX6 A;  1JMK C;  4YIO A;  2Y4T A;  2PUS A;  2EIN B;  2QA4 V;  1Q43 A;  1OCZ C;  4DR7 O;  4LCU C;  4CBC A;  4FLT A;  1Z5W A;  3JAR B;  1US6 A;  4LWS B;  3K79 A;  2Q69 A;  3KZI Z;  3U10 A;  1FXV A;  5LP6 B;  2UUA B;  3RGB A;  1XDC A;  2XTA A;  4HAM A;  1H2N A;  2FML A;  2V7Q G;  4DV4 O;  4LF4 B;  2E5L O;  3A2F A;  3OTF A;  1H2M A;  1JVM A;  3P3P A;  1IVS A;  3LSS A;  1MNG A;  3BVO A;  2EJ7 A;  4I9Q A;  4LC1 A;  2HP8 A;  4NXM B;  1JPX A;  1NR7 A;  4KL1 A;  4B3S O;  2B1G A;  3ZRW B;  4R8C A;  1VEW A;  3C3T A;  1WA8 B;  4QJF B;  5EIB C;  1COW G;  1FFX B;  5JH7 A;  3UCS C;  1P49 A;  4XBF A;  4K8Z A;  4Z1M G;  4DV3 B;  1Y66 A;  3JAS B;  2WLK A;  4K0K O;  2H3O A;  2QEX V;  1YIJ V;  5JJN B;  2AZ0 A;  1LUV A;  1PP9 H;  3JAW B;  4X66 B;  3CD6 V;  4U3J B;  2KG7 A;  1XNQ B;  2EIM C;  5HFL A;  3SYQ A;  3T1H O;  4ZHQ B;  3B4S A;  4PA7 A;  4QPK A;  1CPY A;  4JZG A;  1D5A A;  3HKB A;  2OWO A;  2EIM B;  1B6Q A;  4J7Z A;  1MMM A;  4JV5 B;  4RAI A;  1QR9 A;  5IJ9 A;  1DTO A;  4GUN A;  4GX5 A;  3GB7 C;  5KHK A;  3I56 V;  2HKO A;  1I94 B;  4JI2 B;  2F4V B;  3B09 A;  3NXS A;  5KA5 A;  4N21 A;  2DWD C;  3SJQ C;  2Z0A A;  3MAQ A;  1FXH A;  1VQ5 V;  3ZHU A;  1QBZ A;  1CP9 A;  1Q3E A;  2VWJ A;  5FPO A;  2ZCE A;  4K3A A;  4TT3 G;  1RSO A;  2Q8V A;  1S3J A;  2A0L A;  4X1K A;  4YY3 B;  1K4C C;  4RQF A;  1NS1 A;  1VQN V;  4BIZ A;  3BAB A;  3L74 H;  4IHJ A;  1VQ7 V;  4HBN A;  4DV7 O;  2RMK B;  1NJI W;  3K5M A;  5JH7 B;  2Y0P A;  3P3N A;  1S72 V;  4D7S A;  4O4H A;  1AB3 A;  3BAA A;  4ZBM A;  1YHQ V;  2XAS A;  5KA6 A;  1QLE C;  2P7T C;  3B8N A;  1M57 C;  4N23 A;  1R6K A;  2N05 A;  1NVP B;  4BAY A;  1J95 A;  5EBL C;  2H94 A;  2KG7 B;  1E79 G;  3JAT A;  3OMN B;  4JPR A;  3SYC A;  4QIW F;  4LH6 A;  4X20 A;  1QLE B;  1MSD A;  2YSU B;  3FAV A;  4JYC A;  1M57 B;  2R9A A;  3SJA C;  3A8T A;  1YJ9 V;  3A0H Z;  4FZ1 A;  1XI1 A;  5LMU O;  4FJC C;  3TGU H;  4J42 A;  1BZK A;  2QWR B;  1PL0 A;  5IJ9 B;  1BSM A;  1PL4 A;  2LW7 A;  5KX5 A;  2DMX A;  3SPG A;  3ZIA G;  3RYC A;  4IL6 Z;  3APQ A;  4OPH A;  5KHG A;  5EK0 A;  5HFM A;  3H01 A;  4OX9 O;  3U11 A;  4YHH O;  5LHI A;  4AI8 A;  1KP3 A;  3L72 H;  1RSO B;  1NTZ H;  4X1K B;  4FPP A;  1ZSP A;  1SRY A;  4QPJ A;  1R3L C;  4XDK A;  2HEP A;  2CGO A;  2VQE O;  3ZS8 C;  3CP1 A;  3GVM A;  4PA9 A;  3CE2 A;  2QTO A;  3AG3 C;  2UXC O;  4O4H B;  2ADQ B;  2XAQ A;  1QU7 A;  1FXK C;  3G6E V;  2R72 A;  4DXW A;  3WB2 A;  4X62 B;  5FNV A;  1J5E O;  2X0L A;  4QGP A;  1ZTE A;  2EIL B;  5CMU A;  1PM9 A;  3UT5 A;  3JAT B;  4MVS A;  3SYO A;  2DQ3 A;  3FAV B;  2AXT Z;  3OW2 U;  3ETQ A;  5FPR A;  2EZO A;  5DEC A;  3IJ4 A;  3HB3 B;  3JD4 A;  1ARO P;  3ZN1 A;  2Q9L A;  3JD2 A;  1YI2 V;  1JOY A;  4X9Q A;  3JCU Z;  4I4T A;  3D3Q A;  2MW2 B;  1G1X B;  2ATK C;  5KX5 B;  1SZX A;  1O9H A;  1VQP V;  1NT2 B;  2C2A A;  5B3S B;  5B1A B;  3RYC B;  4TSF G;  4DR3 B;  1AI4 A;  1HNX B;  5JCO A;  3I55 V;  1XNR O;  2OT5 A;  3HKE A;  4A5U B;  2UXB O;  5JVD A;  1SZT A;  2BE3 A;  3MHH C;  4JAA A;  5IYC O;  1BHB A;  3K9S A;  2EUL A;  3SJB C;  1OCC B;  3K06 A;  1KP2 A;  1W2B U;  3T1Y B;  1XIL A;  3ZMV A;  2YIA A;  1CEZ A;  1NZ6 A;  1N34 B;  1WN7 A;  2YDE A;  3E22 A;  4LF8 B;  3JD3 A;  1Q6H A;  2PI5 A;  1B06 A;  1XMO O;  1PNM A;  1FKA O;  3H1H H;  4JTD B;  5FNV B;  5K1X A;  1TUB A;  4O2A A;  3KCX A;  3K5O A;  3D36 A;  1X59 A;  2AGA A;  2A3Q A;  2RQ6 A;  3UT5 B;  3AG2 C;  1AI7 A;  4DV0 B;  4RO2 A;  1XHZ A;  3DGE A;  5BMV A;  4CH6 A;  2OYQ A;  4F4L A;  2GHY A;  3F5W C;  4FM0 A;  1JCH A;  4MTO A;  1XQ8 A;  2CK3 G;  1S77 D;  4L87 A;  2ZE5 A;  1Q81 W;  5JCO C;  2N74 A;  3BA8 A;  4I4T B;  5J9P C;  4UCR A;  1GN4 A;  2ZXW C;  4LFA B;  3ZMS A;  3W7X A;  1WPB A;  2ADP A;  3DC5 A;  3FYE B;  5KUK A;  5BR8 O;  5D5Q A;  1MZF A;  2R9I A;  3HKE B;  4FFK A;  4X65 B;  5JVD B;  2B5U A;  5EBW C;  2JJ1 G;  2JS5 A;  1N36 B;  1U97 A;  4LNU A;  2DWE C;  3JD0 A;  4DUZ O;  2QKA A;  2QM8 A;  1BMF G;  4KHP B;  1SA0 A;  3TK1 A;  4NTX A;  4MW3 A;  3EHB B;  1AR1 B;  3NR7 A;  3N2K A;  5CN0 A;  3M99 B;  4B3M B;  2IH3 C;  3U0Z A;  3CCM V;  5GTI Z;  4W4K A;  2MK3 A;  1H8H G;  2NNU A;  3ZRV A;  4UCU A;  3PN1 A;  3FB6 C;  1TUB B;  4O2A B;  1WNS A;  4QE9 A;  4NKG B;  2YIC A;  4H37 A;  2UUA O;  3RWR D;  4CH3 A;  4UCS A;  1ORQ C;  2PTM A;  4JI4 B;  3HPL C;  5BMV B;  4JAS A;  3IC9 A;  3OAA G;  4TV8 A;  4NXM O;  5IY5 C;  1AR4 A;  1G8M A;  2ZM6 B;  4B3T B;  4ZKI A;  4FVM A;  2WLJ A;  1D5N A;  4JTC B;  2QKC A;  3ML0 A;  2YXH A;  3CRQ A;  2WSS G;  2ZDI C;  4UCT A;  4G28 B;  1V55 B;  5CA1 A;  4DV3 O;  3EVK A;  4W4L A;  1K9M W;  2WLN A;  4MVM A;  1ROP A;  2GUZ A;  3UM7 A;  1M1K W;  3BA9 A;  2LFR A;  3CSX A;  1YTF D;  3JAM N;  5CBF A;  5LGN A;  5LXT A;  2K1E A;  3AG4 C;  5IYD O;  2EZP A;  2CTQ A;  1F4M A;  1IBK B;  2ARH A;  3UO2 A;  2L6L A;  1XNQ O;  4WFB V;  2Z3Y A;  2CE4 A;  3BFR A;  4MTG A;  2OCH A;  4LNU B;  4ASU G;  2GDS A;  3VBB A;  1EFR G;  1FD9 A;  1SA0 B;  4NR1 A;  1R3K C;  2RNB A;  4UVA A;  2QM4 A;  3FD9 A;  3N2K B;  2PI4 A;  3ASN C;  2UXD B;  4JV5 O;  1AVM A;  1N0N A;  4PDR A;  4U7O A;  5E1A C;  2RCV A;  3E8B A;  4UB8 Z;  4JI2 O;  1I94 O;  1H2G A;  4FLU A;  2F4V O;  2Q73 A;  4PJ0 Z;  1Y4M A;  1Q8I A;  3K59 A;  1R3J C;  3CCV V;  4DR2 B;  4G27 B;  2F1M A;  3H1L H;  2HVJ C;  4DV6 B;  4J11 A;  4WFG A;  1N33 B;  4IYI A;  1I7F A;  4Z1V A;  4YY3 O;  4TV8 B;  5FLX N;  1Y74 A;  4MVZ A;  4ICG A;  5ITZ A;  4L8J A;  2GSM B;  3ZHR A;  5KHH A;  4ZHQ A;  1XEQ A;  1S76 D;  2IJJ A;  1QHT A;  3AK2 A;  1XUQ A;  1HDJ A;  3G71 V;  4WFA V;  5CA1 B;  3CWB H;  5D5P A;  3CX5 F;  2VQF B;  3TXQ A;  4NXN B;  1KUQ A;  2GUZ B;  4LR3 A;  2JJ2 G;  4DK1 A;  5LXT B;  3H1K H;  1MA1 A;  1YCI A;  2P90 A;  4FK5 C;  2F43 G;  1P7G A;  1OCZ B;  5IYB O;  2P06 A;  5DED A;  1NU1 H;  3LSQ A;  4JYA B;  2JIZ G;  5IWA O;  4JI0 B;  4WBN A;  1THZ A;  2VRZ A;  2VS0 A;  3SDL A;  1OJH A;  4FMT A;  3RBZ A;  4B3R B;  1AIL A;  2YXL A;  2EX3 A;  4DR4 B;  3M8A A;  5LA6 A;  1XL4 A;  4JI3 B;  1UPG A;  3ICX A;  3LDD A;  2A7W A;  2BCC H;  3LDC A;  2Z5U A;  4JI8 B;  3H9V A;  4OGQ B;  2JEU A;  3LNM B;  1NTM H;  1IX9 A;  1Z5V A;  5IE9 A;  4GX2 A;  1Q86 W;  3RVY A;  2BTO A;  4U7N A;  2Q67 A;  2DW4 A;  4TWK A;  3VOU A;  3LNN A;  1M5I A;  3STL C;  1Y74 B;  5ITZ B;  5BY1 A;  3RW0 A;  1TUE B;  2IU3 A;  1I5Y A;  2HVK C;  4X8A A;  1K34 A;  2DN9 A;  2IJI A;  2X6A A;  4LF6 O;  1EM1 A;  2QWO B;  3SR2 C;  1AP6 A;  2YEV A;  4EKW A;  1IDS A;  3OFN G;  3SPH A;  4Q20 A;  1HNW B;  4IYH A;  1PV0 A;  4X62 O;  4DUY O;  1E1Q G;  4JI1 B;  2IU0 A;  5LMN B;  1DK1 A;  3QO8 A;  3ASO C;  5IT9 N;  4JGS A;  3OD4 A;  4JI7 B;  1K4D C;  3D3I A;  2CAZ C;  4WBN B;  3LSU A;  4P9P A;  2QJ1 A;  4CZZ A;  4PDV A;  1IBM B;  1SC5 B;  3K5L A;  4FM2 A;  1TA8 A;  5LA6 B;  1BCC H;  4AQY O;  1HR0 O;  2UUB O;  4UVC A;  4UFZ A;  3T2M A;  5B1B C;  4LP8 A;  3SYP A;  2ZE8 A;  1YTF B;  5JJE B;  1HNZ B;  2EJR A;  2Y4U A;  4I55 A;  2Q0O C;  4DR5 B;  4MVO A;  1S5J A;  3G67 A;  2V1D A;  3FX7 A;  3CRA A;  4B7E A;  2UXN A;  4DR3 O;  3A0R A;  1HNX O;  3G6B A;  1YSC A;  1JA8 A;  1M93 A;  1L0N H;  1FXK A;  1V9P A;  1R1B A;  1HWY A;  4YJ2 A;  4DV1 B;  5EC2 C;  1IXB A;  3KCY A;  3W7W A;  2RJZ A;  1F51 A;  3RYI A;  3AK3 A;  3T1Y O;  2W6I G;  1L0L H;  1H2S B;  2FL4 A;  2KKW A;  5EYP A;  4ZI7 A;  1BGY H;  3N27 A;  3CME V;  3JAK A;  2ODM A;  2M6Y A;  1N34 O;  5IYZ A;  4LF8 O;  2YEV B;  2W0F C;  1DF4 A;  2PZS A;  4LF9 B;  2AZ2 A;  4DK0 A;  5K1P A;  2DE0 X;  5AG2 A;  1ZWI C;  1AI6 A;  1ZUQ A;  4FLW A;  1FPO A;  1G4Y B;  4IIJ A;  2P4V A;  3IAY A;  4BIO A;  2YIB D;  5B5E Z;  5LHG A;  4BW5 A;  3OUF A;  1GN3 A;  4DV2 B;  1XMQ B;  1KD1 W;  5L3D A;  1JR9 A;  2LP7 A;  1KEC A;  1Q6U A;  3FB7 C;  3ZBH A;  4MTF A;  4NVP A;  1MOF A;  3OEH G;  4C7U A;  4FLV A;  1VF6 C;  4K0K B;  3RT3 C;  2XHB A;  2LJ2 A;  1M9N A;  4I55 B;  4Z2W A;  1QR8 A;  3X2Q C;  3E8H A;  3G4S V;  4B08 A;  4UUJ C;  4GLX A;  5A2Q N;  2CUG A;  4E2L A;  4CS4 A;  2WLM A;  3AG3 B;  4FM1 A;  3VQY A;  4JAU A;  3JSN A;  2CTR A;  1BE3 H;  3OGC C;  1FXK B;  4DYL A;  1N36 O;  2E3C A;  4YJ2 B;  1GO3 F;  2LW1 A;  3RYI B;  1SQV H;  1N8R W;  4KHP O;  5EYP B;  4ZI7 B;  4X1I B;  3ZRS A;  1YIT V;  1SQG A;  3JAK B;  5C8Y A;  5LYJ A;  1WJZ A;  3JSL A;  4B3M O;  3H1J H;  2A06 H;  4UB6 Z;  1P7B A;  5IYZ B;  3EFF K;  1VMG A;  3QO5 A;  3CCL V;  2CTP A;  4BR6 A;  1KMI Z;  1QNM A;  2WA4 A;  1K5Q A;  4H0L B;  3PJS K;  2YXY A;  4IIJ B;  3Q4H A;  2FYU H;  1BQZ A;  1VQ6 V;  3W7T A;  1DLB A;  4JI4 O;  4O2B A;  3B40 A;  2X7R B;  3FB8 C;  2WLI A;  2ZM6 O;  4B3T O;  1PKX A;  1SQF A;  3OMA B;  3WG7 C;  2YC0 A;  2PF4 E;  2JGD A;  1BQ0 A;  1F23 A;  1KU9 A;  3LDE A;  4JI5 B;  4DR1 B;  3R65 A;  4MSW C;  1SET A;  4O4I A;  1OZ0 A;  2OIE A;  1RFY A;  5JQG A;  4J41 A;  4CC6 A;  1EN6 A;  5CB4 A;  4P30 A;  1K97 A;  4YXW G;  1UJW B;  2QM7 A;  2YI8 A;  3THO A;  4WCE V;  3TXS A;  1IUR A;  1VP7 A;  2XAG A;  3L75 H;  4D6T H;  2O57 A;  4LF7 O;  3AG1 C;  1GN2 A;  3ZN0 A;  2Y0I A;  1NBM G;  2LGQ A;  1Y67 A;  4WF9 V;  1YZB A;  2E76 B;  2QKS A;  3AG2 B;  5C8Y B;  5LYJ B;  1FJG B;  2UXD O;  1NR1 A;  3AG1 B;  1FYJ A;  3UKM A;  1GMG A;  2ZIM A;  3K5N A;  3CJH A;  2LGW A;  4OX9 B;  1M4U A;  1YJN V;  1RM1 C;  2CTW A;  1OHH G;  4GZR B;  2HG5 C;  5C93 A;  2AHZ A;  1U96 A;  3ZCC A;  4DR2 O;  3Q4H B;  4CH4 A;  2ZDI A;  4DV6 O;  3J7A U;  3F7Y C;  1GH6 A;  3MHS C;  1I5X A;  3T4Z A;  1MSW D;  1BL8 A;  3QO7 A;  4O2B B;  3O9O A;  1QCE A;  1N33 O;  3GWO A;  2ZXW B;  2JGU A;  3G80 A;  1Q7Y W;  5EZY A;  1AR5 A;  2WLI B;  3SPI A;  5KAI Z;  2UXC B;  1RP3 B;  1JJO A;  2ZD9 A;  4PV1 B;  1SQP H;  2D2C B;  2P67 A;  4OPA A;  4J7K A;  1SQB H;  2Y69 C;  3QG5 A;  5B66 Z;  2JGD B;  1Y76 A;  4H44 B;  4TOI A;  3RYF A;  5GW7 A;  3F7V C;  4O4I B;  1J5E B;  1N0J A;  4PI0 A;  2JRI A;  3N2G A;  2VQF O;  4R6Z A;  4RUE A;  4NXN O;  2IJK A;  5JQG B;  2Y69 B;  3SGI A;  3GWK C;  1GM9 A;  5CB4 B;  1Q90 D;  1FFT B;  2XUM A;  4GKJ B;  2KSD A;  3L73 H;  3J80 N;  3EXA A;  3CCU V;  2ZE7 A;  1EN4 A;  2ILM A;  3IFX A;  3WU2 Z;  3CC2 V;  3C90 A;  3CCR V;  1OCR C;  3IC7 A;  5KHI A;  1VQK V;  4LF4 O;  1A32 A;  5TIS Z;  2XND G;  1VQ8 V;  4JYA O;  4X1Y B;  3BCC H;  2YS8 A;  4DR6 B;  1K73 W;  4JI0 O;  4IT5 A;  1KC8 W;  4JI6 B;  3JYC A;  4PHZ A;  3W7U A;  4R7C A;  2XAF A;  4PA3 A;  4B3R O;  4NTW A;  3DXR A;  4DR4 O;  1XOU A;  2AW9 A;  2Q6A A;  4JI3 O;  4DV5 B;  3CJH B;  1FS0 G;  1TVK A;  1WPX A;  3SYA A;  3SJC C;  4JI8 O;  5IY5 B;  1CXZ B;  2KB1 A;  5LOV A;  1K8A W;  2UXB B;  2P22 C;  1S0V A;  3ZED A;  4Q6G A;  4NB5 A;  4KXR A;  3R66 A;  3ZRX A;  4PI2 A;  4TQF A;  4QNH B;  4P2Z A;  3OR6 C;  1OCO C;  5GON A;  1GK9 A;  4HNA A;  1P4R A;  2WLL A;  1LR1 A;  4GYC B;  4X66 O;  1UFI A;  2HHH B;  3UO3 A;  5EZY B;  3E35 A;  1JX9 A;  3A0B Z;  3CS5 A;  1OCO B;  4B7K A;  4P9O A;  2BOC C;  3AG4 B;  1KYO F;  1B04 A;  2IBZ H;  1SES A;  4DO2 A;  1Y76 B;  3FKS G;  3RYF B;  3N2G B;  1N32 B;  3E86 A;  3P32 A;  4E4E A;  2DYR C;  1HNW O;  2F66 C;  1NVP D;  4WFE A;  1X4T A;  3K0D A;  4JI1 O;  1SQQ H;  1H2K A;  5LMN O;  2EIJ C;  4UCO A;  3ASN B;  3ABU A;  3W7S A;  3H1I H;  2DYR B;  3K04 A;  2XOK G;  2YI9 A;  1ENV A;  4PDM A;  5H6Q A;  1TGO A;  3BEH A;  4I9W A;  4I50 B;  3JAL A;  3OUS A;  4GT1 A;  3DXR B;  3OMI B;  3FFQ A;  3TCU A;  4EB6 B;  3RN4 A;  5J2U B;  3CCE V;  1TVK B;  1R73 A;  1HNZ O;  1JFF A;  1KBH A;  1KQS U;  4R50 A;  5LOV B;  4GCZ A;  2QWP B;  5L3B A;  2EIN C;  2IM9 A;  4GX0 A;  2WA3 A;  4OXS A;  3ZHV A;  4I0X B;  5GON B;  4X64 B;  4HNA B;  2K9P A;  1WAZ A;  1AJP A;  4F6E A;  2WLL B;  3KG2 A;  1D2D A;  2CH7 A;  4FZ0 A;  3JD1 A;  4I5S A;  4DV1 O;  4K8X A;  3RYH A;  4UV9 A;  1NI8 A;  5LP6 C;  1VF5 B;  4PDL A;  1L1F A;  2G38 A;  4GX1 A;  5CA0 B;  3I5D A;  1IXM A;  2OTL V;  1F4N A;  3VQV A;  3HKD A;  1W59 A;  3OTO B;  4PA6 A;  2UXX A;  1YDX A;  4LF5 B;  4LF9 O;  2B1I A;  2HLD G;  1Z2G A;  4JYB A;  2WAM A;  3QF7 A;  1G6U A;  5GTH Z;  2PGG A;  1TAE A;  3QVN A;  1GAX A;  1PNL A;  4H33 A;  1H8E G;  2EIK C;  2ZE6 A;  3ABT A;  3CRC A;  4J7J A;  1K7D A;  1YF2 A;  4DV2 O;  4GKK B;  1XMQ O;  1EZV H;  4CS3 A;  5H5N A;  2EIK B;  2YID A;  3CRR A;  5CA3 A;  2UUC B;  3JAL B;  1K92 A;  2Q7G A;  2DYS C;  1EBO A;  2DQ0 A;  3FYI B;  3MD0 A;  3M7M X;  3VQW A;  3BHP A;  2ZIN A;  4EEQ A;  1JFF B;  2KQX A;  2FKX A;  2DYS B;  3TET A;  3OT7 A;  1B3Q A;  1E1R G;  1IBL B;  1SS3 A;  2JDI G;  3B77 A;  5KAF Z;  4MS2 A;  3OM3 B;  4LH7 A;  2CDY A;  1RPR A;  3CYO A;  2CH7 B;  5B1O A;  3RYH B;  2R9R B;  2QWQ B;  3ZJZ A;  2OTJ V;  2XAH A;  4CH5 A;  2CGN A;  2UU9 B;  3ASO B;  5BXZ A;  3HKD B;  2BSK A;  2AHY A;  2NLJ C;  4TV9 A;  4XDL A;  4PEL A;  1F7Y A;  1QVF U;  4UXN A;  3AK1 A;  4LFC B;  1QQC A;  1V54 C;  2QWN B;  4MVQ A;  1HP8 A;  1YEW A;  3K03 A;  1VF6 A;  1VQL V;  5B1B B;  1SQX H;  5JWP A;  2GTS A;  3VQX A;  1EZJ A;  4LFB B;  1V54 B;  1M56 C;  5KLV H;  3UQ8 A;  2ETN A;  2M7W A;  2B9Z A;  4DR7 B;  1Q6I A;  1WP8 A;  3ABL C;  3O65 A;  4TUY A;  1R6T A;  2ZR2 A;  1M56 B;  4X1I A;  5DN6 G;  4JI5 O;  4DR1 O;  1PD3 A;  4KFM A;  3DTU B;  2Q7E A;  1AJQ A;  1LNQ A;  5H9C A;  3B2E E;  3ABL B;  2EBO A;  2HJD A;  4DV4 B;  5L3E A;  2E5L B;  4RQE A;  2ITD C;  3C3S A;  5LHH A;  5IWA B;  3WFV A;  4K35 A;  4O4L A;  1K5S A;  2RN9 A;  2VWK A;  3HKB B;  4MT8 A;  1I08 A;  2Q68 A;  4ZOL A;  4DV0 O;  4X88 A;  4B3S B;  5EBM C;  2A9H A;  1GM7 A;  4MTX A;  2LQT A;  1Q82 W;  1AP5 A;  1SF9 A;  2R70 A;  1VIB A;  1FAF A;  4BWA A;  3ETD A;  1YVW A;  4X89 A;  2RDC A;  5IDJ A;  2BSK B;  1FJG O;  1AI5 A;  2LO1 A;  3B8M A;  4TV9 B;  4XDJ A;  3CC7 V;  3APO A;  1WLE A;  3BRC A;  1URF A;  2DJV A;  4LFA O;  2WLH A;  1MAB G;  2E75 B;  3CPW U;  4O4J A;  2P5O A;  4F6R A;  3T1H B; 
#chains in the Genus database with same CATH homology
 2L6L A;  3UO3 A;  4J7Z A;  2LO1 A;  2QWQ B;  1FPO A;  4RWU A;  2KQX A;  2CTR A;  3AG7 A;  2QWO B;  2QWN B;  3APQ A;  2N04 A;  2OCH A;  3APO A;  1GH6 A;  2CTP A;  1XBL A;  2YS8 A;  2GUZ A;  2M6Y A;  2Y4T A;  4IT5 A;  1IUR A;  3UCS C;  2PF4 E;  2N05 A;  2QWR B;  2LGW A;  1FAF A;  1HDJ A;  2YUA A;  1BQ0 A;  3BVO A;  1BQZ A;  1NZ6 A;  2CUG A;  2EJ7 A;  4J80 A;  2DN9 A;  2QWP B;  2CTQ A;  2QSA A;  2GUZ B;  1WJZ A;  2CTW A;  1N4C A;  2DMX A;  2Y4U A;  3UO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...