2QWOB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwoB00
2QWPB 2N04A 2LO1A 2M6YA 1XBLA 1BQZA 3APOA 1FAFA 2OCHA 2QSAA 2CUGA 1GH6A 4RWUA 3UCSC 4J7ZA 2Y4UA 2PF4E 4IT5A 2Y4TA 3UO3A 2CTWA 3UO2A 3BVOA 1N4CA 2EJ7A 2CTPA 2KQXA 1FPOA 1BQ0A 3APQA 2QWNB 2YUAA 2QWOB 2N05A 2L6LA 2CTQA 2LGWA 3AG7A 2DN9A 4J80A 1WJZA 1IURA 2GUZA 2GUZB 2CTRA 2QWQB 2DMXA 2YS8A 1HDJA 2QWRB 1NZ6A
chains in the Genus database with same CATH superfamily
1YF2A 1UJWB 3B2EE 2ZD9A 4I4TA 1TUBA 1H2NA 1FFXA 4FLTA 4MVMA 4UVAA 4X1YA 3WB2A 3K04A 5CA1A 4U3JA 1ZL8B 2WLIA 1VQ4V 2ZNJA 2YIBA 1DLBA 2EJRA 2QWQB 1FJGO 1SQVH 2QWRB 5DEDA 1QHTA 3AG1C 1MZEA 2JGUA 3BAAA 4W4KA 3APOA 5IT9N 3N2GA 5KHKA 4DV1O 4DR3B 3HPLC 3JAMN 5IY5C 3SJQC 4LH6A 3RN4A 5J9PC 4LP8A 1OJHA 1N33B 2ZXWB 4O4LA 3F5TA 2E5LB 2B9ZA 1YVWA 2WSSG 4BR6A 4JI8B 2KSDA 5B66Z 3TETA 5BMVA 2XHBA 2D2CB 1BHBA 5F2VO 4P9PA 4GX1A 2ARHA 4X9QA 3ASNC 4Z1MG 1L8DA 2CTWA 3LSUA 4AQYO 1X59A 1F23A 1AJPA 2YEVB 5EIBD 1IBMB 3X2QC 1Q7YW 1P7BA 2W6IG 2JDIG 3RYCB 2F1MA 1VQPV 3HR0A 3ABLB 4IIJA 5FNVA 1WA8B 3JARB 1QQCA 1Q8IA 2IBZH 4NR1A 5EC2C 1G4YB 4ZOLA 1Y74A 3FFQA 2ITCC 3STLC 4JI8O 3K3WA 3AG2C 4OPAA 1GMGA 2PF4E 2QE7G 1M4UA 2P4KA 1F7YA 4LFAO 3BHPA 1QLEC 4GKJB 3ABKB 4UB6Z 5KMGB 4RQFA 3BPZA 3UKMA 3E8FA 3E8GA 1K9MW 5K1XA 2LO1A 3BEHA 4DR7O 4PA7A 4PDMA 5LHHA 4K8ZA 5CA3A 2ZIMA 3F7VC 3CX5F 4NXMO 2B1GA 2VQEB 2IH3C 4H13B 1GM7A 4PA4A 2LGWA 2Q9LA 1WPBA 1VQKV 1AR4A 4G2KA 1KQSU 3A0HZ 2Y4TA 4JAVA 3JSNA 3T1HO 4H37A 4DV6B 2LFRA 2F95B 4WF9V 1YHQV 2DQ0A 1HDJA 4O4HA 4HZ3A 4UV8A 1EFRG 2QKAA 3CRQA 2OCHA 1M57C 1VP7A 1KC8W 1KKCA 4ZBMA 3K5OA 3JCZA 2VS0A 1N4CA 3CRRA 4DR2B 1NT2B 3ZHUA 1B04A 4FLVA 1YXBA 2ZM6O 3FB6C 2JS3A 3K0GA 2E74B 4QE9A 4O4JA 3JD2A 1N32O 1J5EO 3NXSA 4B3TB 4JYAO 5CB4A 3OR6C 1K73W 3JASB 3OEEG 4ZKIA 1H2GA 1U97A 3E89A 3SJCC 3DTUB 4DV5B 1R3KC 2IM9A 3A0RA 1NI8A 1H2SB 1WB7A 4LWSA 3QG5A 2OWOA 4DR2O 3E2EA 1IURA 4JI2O 3AG4C 3AG2B 3T2MA 4AI8A 2XAJA 4PD4F 2IJHA 1SF9A 3J81N 2IH1C 3ZS8C 2AGAA 5C8YB 3FD9A 1GM9A 2DYRB 3EFFK 2IU3A 1GKFA 5KAFZ 3ZIAG 4I0XA 1D5NA 4H33A 2BCCH 1YJNV 3N2KA 1K97A 2OCCC 2UUAB 1XHZA 4ZI7B 1JR9A 1AI5A 4BIZA 4F6RA 4TOIA 3CXCU 2XOKG 4JZGA 3RYHA 4GKKB 3SDLA 1WPXA 1OV9A 2WPDG 4JTCB 4KUMA 1DTOA 4NTXA 2CTPA 5BMVB 4JI3O 1RFYA 3TGUH 5IYZA 3ABKC 5JH7B 4XDLA 1Y74B 2Z3YA 2O57A 3SYQA 3WG7C 4JI4B 2QGNA 2ZXWC 4XBFA 4CH6A 4LF8B 3HKBA 3CMAV 3DXRA 2UUAO 5BR8B 4ABMA 1IBLB 3DC5A 1SESA 4DW0A 2YIBD 2V4DA 3IGAC 1TVKB 1EN5A 4FFKA 4GZRB 1AJQA 2YIDA 1I5XA 5BY1A 4I55A 4X20B 3ZMTA 2JIZG 2CGNA 3ETDA 2DOSA 4X64O 2HKOA 1GO3F 4QPJA 3LDCA 2E3CA 2Y0IA 4J7ZA 3SJAC 1OCCC 2Y69C 3SJBC 4DR4B 2CUGA 1V9PA 3T4ZA 3ASNB 3ASOC 1SS3A 3ASOB 1KP3A 4Z2WA 1MMMA 1NH2B 1EZVH 3CC2V 1MABG 2Q5ZA 2CAZC 5IYZB 5DN6G 3T1YB 1NS1A 1YI2V 3FB5C 2VWJA 1VARA 4HNAB 1BQZA 3LUTB 2IU0A 1T5EA 1XMQO 4BW9A 1K5QA 2HHHB 4DR1O 4I55B 1QLNA 1NKDA 4DRXA 4JI6B 1YIJV 4NTWA 4JV5B 1XNQO 3QTCA 3OE7G 5L3EA 1XDCA 3ZMVA 2PUSA 4I50B 2X6BA 5CA0A 2FTKA 2WLKA 2QWPB 2GTSA 3L75H 3R66A 4TUYB 4PHZA 1PPJH 3WB1A 1XNRB 3SGIA 3ZHQA 5JVDA 1DF4A 4JI6O 5LOVA 3SPIA 4U7NA 3LNNA 2NLJC 1I5YA 5KUKA 4YHHB 4BW5A 4X65O 1NR7A 4UUJC 3I55V 1WN7A 3LSQA 3JAWB 5IJ0B 4I7ZB 1F4MA 3ABLC 1Z5VA 2CTQA 3BA9A 4DR5O 2ZE6A 1JQ0A 1MSDA 2B1IA 4P2ZA 5E79Z 1AR5A 5LMUO 2XASA 5ITZA 2ADQB 2EZOA 1E79G 2YXYA 3CRMA 1V55B 3E22A 3ETQA 2OT5A 4JAAA 2A7WA 1JOYA 3BVOA 3K06A 1FXKC 3D8CA 4DXWA 3JATA 3OEHG 3OTFA 2WLHA 2EIMB 4J9YB 3CC4V 1VQ7V 1VQ8V 2QTOA 4MW3A 3ABTA 4IYHA 3CRAA 1YITV 1VIBA 4PJ0Z 3UO2A 5LOVB 1Q6HA 1JPXA 3LNMB 3UT5B 4K3AA 5H9CA 3AG7A 2NNUA 1NH2D 1K8AW 4DR7B 1KB9F 2V7QG 1K5SA 3G71V 2QM8A 3D3IA 4YJ3B 4X1KB 2EILB 2DWDC 4LBEC 2UXCB 3A2FA 3JALA 2L6LA 4UVBA 4Q20A 2B5UA 4OPHA 1Y4MA 2LW7A 2F4VO 2X7RB 3JCUZ 1CP9A 3BFRA 2EBOA 2E5LO 4JYCA 4MVOA 2RNBA 5D5PA 3D36A 4HYOA 2JK5C 2P06A 3RYFB 2Z0AA 4DR3O 3ABMC 1ENVA 5B3SC 4MSWC 4XDJA 5LHIA 2QWOB 2N05A 3LSSA 3RT3C 2EILC 1NTKH 3MHSC 3UT5A 3OT7A 2YIAA 1RP3B 1EBOA 5KHIA 5H5NA 3QO8A 4OXSA 4O2BB 1LR1A 1L0NH 3DSQA 5JQGA 1XILA 5KA5A 3RYCA 2QA4V 2UUBB 4LF4B 3IC9A 3ABMB 4X20A 1BT8A 5CMUA 4AQYB 4GUNA 1PP9H 5LA6B 3WU2Z 2W0XA 1N33O 1OZ0A 1H2LA 1YCIA 4EB6B 3CRCA 4DR6O 2N04A 4PA3A 4FLXA 1FYJA 3W7XA 4GLXA 2HFEC 1SETA 3ZHVA 2ZR2A 2YXHA 2Y4UA 1YDXA 3W7TA 4FM0A 3TXQA 1JFFA 2M7WA 5B1OA 5A9GA 2VQFB 1PKXA 2R70A 4DV6O 1I94O 1F4NA 4UV9A 4KHPO 2Q68A 4FIPC 4X65B 2QR4A 3CSXA 3OMIB 3EHBB 2BOBC 4LCUC 2HVKC 1Z5WA 1A32A 3G4SV 1VF7A 3ZN1A 1QR9A 2OTLV 4IHJB 1VQ6V 3HKEB 3KCYA 2IW5A 1EZJA 3A0BZ 3S3XA 1K33A 2R9RB 3T1CA 1HNZO 3ZRSA 3HKCA 3PN1A 1WJZA 2XT9A 1P7GA 1XUQA 4X1YB 3TJTA 4L8JA 4X1IA 3F7YC 1XNRO 4H44B 4JASA 4F6RB 2KG7A 4LF9B 1R73A 1SKVA 3UCSC 4DV4O 1BE3H 1K34A 1GK9A 4OGQB 3ZRXA 2OCCB 1WAZA 3T1YO 3SYCA 1S77D 1WP8A 2Q7EA 2E75B 2Y48A 1BGYH 2AXTZ 2QSAA 2WLMA 1Q5OA 1RPRA 5LGNA 3ICXA 3T1HB 1PL4A 5KHJA 3CCEV 1HW7A 3AG1B 3H01A 5LYJB 3L72H 4DK1A 2CH7B 2Q0OC 4LFCB 4K35A 2HEPA 4X66O 4O2AB 1XBLA 2P5OA 4DYLA 1TA8A 3K5LA 1KU9A 1FFXB 4DV0O 4WFGA 1YTFD 1IXBA 1Y67A 1BQ0A 2VQEO 5DM6V 4I4TB 1MA1A 1Q6IA 4B08A 2UXCO 4FFBA 3KG2A 2MW2B 1VQ5V 2N74A 3VBBA 1MG1A 5EC1C 2F66C 3KCXA 3ML0A 3X2QB 1QBZA 2GTAA 2QDOA 4TQFA 4I9QA 4K8XA 1N0JA 2AZ2A 4NVPA 2YI9A 4TV8B 4PI0A 4LF5O 2OYQA 1J95A 4F6EA 3SPHA 1OCOB 4FZ0A 3K9AA 4OX9O 4DW1A 1N34B 1K92A 1BMFG 1PNMA 2WA3A 3FAVB 4FVMA 1SERA 3CS5A 2CE4A 1M56B 3U0ZA 3K58A 4IYIA 2K9PA 2JVDA 2EIJB 4BAYA 3G6BA 4EKWA 5B1NA 3K5MA 3RVZA 1NJIW 5EZYA 2W6JG 3E8BA 1WP7A 1SQFA 2Q8VA 1UFIA 1VQNV 3JD4A 3H1LH 5IJ9A 1ZAUA 1SA0B 4X66B 3ABUA 2DYSB 3H1HH 2YXLA 3O9OA 4EB6A 2ZDIC 4PA9A 4B3RO 1SRYA 2LW1A 4YJ2B 3IAYA 1XOUA 4BWAA 2ZE5A 5LHGA 4GKKO 2PTMA 1KBHA 2M6YA 2QTSA 5LP6A 5KX5A 2ZE7A 4PV1B 3WFVA 1XQ8A 4J7KA 2Q6AA 1OCZB 1S5HC 3CJHB 2FMLA 4D6TH 3JD1A 4UB8Z 2XAHA 5HFLA 4DUZO 4YY3B 1GAXA 3I56V 5J2TA 2ZKOA 2QKCA 3ZBHA 2LQTA 5IWAO 5FNVB 5KAIZ 2V1DA 4P9OA 3M7MX 4DO2A 4Z1VA 4YHHO 1RSOB 4YIOA 1FJGB 5IE9A 1S5LZ 1AI4A 4J9ZB 1XMOO 1R3LC 2DW4A 4YJ2A 4UCRA 5KHGA 3P3PA 2QKSA 1R6TA 3UM7A 3AG3C 2ZM6B 1MZFA 2JRIA 4JI5B 4LF9O 2X0LA 3HKDB 1KYOF 1N8RW 2GDSA 3KKYA 1SQGA 1NTZH 2JGDB 4I9WA 1G8MA 1AB3A 4B7KA 5FL7G 3ZRVA 4R7CA 3RVYA 2P7TC 3EXAA 1JVMA 2HJFC 3ZRWA 1OCZC 4O2AA 5GW7A 3OM3B 4X64B 1VQLV 4FLWA 2Q7HA 4DUYB 4B3SB 4UCSA 1V55C 1M93A 4IT5A 4AHCA 3LDEA 4J7JA 2XAGA 2YICA 2KQXA 4QPKA 4JI7B 5LL6Y 2HJDA 1FPOA 3H1KH 1L1FA 4RO2A 3IC7A 5L3DA 2ZQMA 3GVMA 4JYYA 4LF6O 4FK5C 2UU9O 3AG3B 1KP2A 4CS4A 1JJOA 5A2QN 5GTIZ 2P22C 1MOFA 4NXNO 2EIKC 3SPJA 4MVSA 3E22B 5GONB 4JTDB 4LFBO 1MSWD 5C93A 2Q7GA 4R6ZA 1ZSPA 1FS0G 3K5NA 5EBMC 5JQGB 1H8HG 5L3GA 4DV0B 1KD1W 2IJIA 5LXTB 1W0KG 3ZJZA 3ZHRA 1QNMA 5IYBO 1THZA 1SQQH 1AI7A 1SQPH 4LF7O 2DN9A 3FKSG 1S3JA 4JTAB 4NKGB 4LF8O 4G28B 3K0DA 3FX7A 3RW0A 4UCUA 3E86A 2XUMA 1M90W 4D7SA 2KB1A 1H2MA 1K4CC 3CCSV 4KL1A 2F4VB 3C3TA 4LF7B 3LDDA 4B3MO 4LFCO 4WFHA 5EK0A 2K1EA 3D3QA 1F51A 1PL0A 1GN6A 4D7TA 1SA0A 5KLVH 2HG5C 2WLJA 1I08A 2GV9A 3N27A 1GM8A 4CH3A 3RYIB 3B40A 3VQYA 2AZ0A 3BA8A 5EZYB 2KKWA 1OHHG 4P30A 3L9DA 4ZIBA 5DECA 3AK3A 1IBKB 4PDLA 3DGEA 4NTYA 5LXTA 1NQTA 1FKAO 2ZNIA 4DV3B 3FAVA 4HAMA 4K0KO 2UXDB 1O9GA 3HB3B 4E2LA 3ETEA 5J2UB 2WLNA 1HP8A 4AILC 1AP6A 5BZBA 1HNXB 4J80A 4JI1O 2HVJC 2A3QA 5H2FZ 5EBLC 1XNQB 4DV1B 3TXSA 5KHHA 1DK1A 4C7UA 1BSMA 4WFBV 3PJSK 5L3FA 1XMQB 3CCRV 1SZXA 1W59A 3ZHSA 4O4LB 1Y76A 2W0FC 4DV7B 1GN3A 2ATKC 1NVPB 1XREA 2WWWA 3DXRB 1R3JC 4WFAV 4MTOA 4GX5A 2QM7A 2RQ6A 4NXMB 2GHYA 2ZINA 4RWUA 5B1BC 1P84F 4DR6B 4MVZA 2RCVA 1R6KA 1I0HA 4QE7A 4YXWG 5J2UA 4DV7O 4WFEA 4G27B 1URFA 4A5UB 4Q6GA 2Q69A 3OAAG 3L74H 4JI1B 1R3IC 1FXHA 5GTHZ 1UPGA 3F5WC 4LF4O 2VQFO 2BSKA 3AG4B 4RQEA 3WG7B 2P67A 3ZHTA 3OUSA 3SR2C 3D36C 5LP6C 4PELA 3HKDA 1FFTB 4JGSA 3UO3A 5BXZA 3GWKC 5CA0B 1P4RA 4JV5O 4ZI7A 4TSFG 1IXMA 2LFSA 1ZWIC 3SPCA 4UCVA 3GB7C 2EINB 1GN4A 3FYEB 2PI4A 4MS2A 5GONA 2QM4A 2ITDC 4FM1A 4GYCB 2PYJA 3P3NA 4KP4A 2F43G 5CBGA 3CCJV 3JAWA 5IJ0A 3CYOA 4JI0O 2FB5A 4UCTA 3HKCB 5EYPA 1PNKA 3MD0A 3O65A 5LGUA 1GTOA 2JEUA 1Q90D 4F4LA 4JZ2A 2A79B 4PDRA 4MT8A 2AHYA 4XDKA 2BSKB 3SYOA 5IDJA 4LWSB 2EINC 1NZ6A 1AROP 5KX5B 4JI0B 5JVDB 3B77A 1FXKB 1HWYA 1U96A 3ZX6A 1YJWV 2ZR3A 1JFFB 1IX9A 5BR8O 4LF5B 4TUYA 4HBNA 1M5IA 2EX3A 1AR1B 2GSMB 1ZL8A 4U3JB 3VQXA 4J10A 2GUZB 1B06A 1PV0A 4LH7A 4ASUG 4H0LB 2PGGA 3ZMSA 5LMNB 4WFFA 2DYSC 2LGQA 1RM1B 4X88A 2ETNA 2IJJA 1PD3A 1CXZB 1M56C 5LA6A 1YTFB 1US6A 2EIMC 1YZBA 4JI3B 2UXXA 1R6NA 4N23A 3VQVA 3QVNA 4NXNB 2XNDG 1OCCB 3ZCCA 5B1BB 3JAKB 1LUVA 4I5SA 2ADPA 1IBMO 3ZN0A 2UXBB 3TK1A 3QF7A 4LFBB 1PNLA 3H1IH 3JASA 3MHHC 2RMKB 1Q86W 4JI7O 1DF5A 2CTRA 4DV4B 2BOCC 4X8AA 2H94A 4JYBA 4U3FH 5AG2A 1HNWO 1K7DA 1S76D 1SQXH 1TUEB 1Y76B 5KA6A 4DUYO 4B3SO 4I50A 4JPRA 2PYLA 4FJCC 1ZTEA 3VQWA 1ZX3A 3P30A 1NVPD 1N36B 3KZIZ 3N2KB 2KG7B 4O4IB 2JJ1G 4UVCA 3L71H 2GUZA 5TISZ 4GCZA 1IDSA 2Q0AA 4R8CA 3U11A 4FLUA 5E1AC 3OTOB 1X4TA 5IYDO 2HHHO 2VRZA 1EM1A 2HLDG 3OD4A 3RGBA 2CH7A 1FXKA 3BY6A 1VF6A 1JX9A 1RSOA 3BABA 3GWOA 3CCQV 1B6QA 2A06H 1QVFU 1V54C 2EULA 5FPRA 5JH7A 4B3RB 2D3OW 1IVSA 4NYKA 2HR3A 4DV2B 2UXNA 2WLLA 1FAFA 4YIPA 4QIWF 3H1JH 3JARA 1HR0O 1L0LH 3CJHA 4RUFA 2BTQB 2A9HA 3MAQA 3CCVV 1H2KA 1R1BA 2FYUH 1I94B 5LP6B 5IWAB 1HNXO 1LNQA 2A0LA 2XAFA 1EN4A 1N36O 2DYRC 4BIUA 3W7WA 2YI8A 5H6QA 2OIGA 3WB0A 5ITZB 3NR7A 3B8MA 4WBNA 2MK3A 1XL6A 2YDEA 3OGIB 4DV3O 3K57A 3OW2U 5KUMA 1S72V 1QVGU 2X6AA 4UXNA 4O2BA 1Q82W 3RFRA 4JF3A 2OTJV 3SYPA 5JWPA 1G1XB 2UUBO 1DGSA 1HNWB 1OCRB 4LR3A 2G38A 2Y69B 1QLEB 2FKXA 1COWG 4PDVA 4FLYA 1Q43A 3CCMV 1N34O 4CC5A 4TV8A 2YC0A 4CH4A 3E8HA 3ZRWB 1ROPA 1P49A 3CB2A 2H3OA 2LP7A 3JSLA 1VQ9V 4IGGA 1Y6XA 3ZMZA 1QCEA 3MDSA 1NR1A 4X62O 2JJ2G 5EBWC 2PZSA 5EIBC 1K3EA 5LMNO 2JGDA 4FFBB 1VQMV 3OMNB 1IBLO 4DRXB 2QEXV 1TVKA 2UUCB 2QWNB 2Y0PA 4J11A 3CEIA 4TWKA 3QO5A 2ILMA 4CH5A 2UUCO 2NR5A 2PY5A 3AK2A 3CC7V 5D5QA 4O4HB 4HNAA 3RBZA 1JA8A 4MTGA 4X1KA 3K9SA 4J41A 3J80N 1YJ9V 3W7UA 4MW8A 4LF6B 5B3SB 2LJ2A 4KFMA 4N21A 1AJNA 2CK3G 1QU7A 3CCLV 1FXVA 3BRCA 1YSCA 4MVRA 1O9HA 1RPOA 2IJKA 2P6JA 1Q3EA 5LGTA 4RUEA 1S0VA 4E4EA 1KMIZ 1TGOA 4LNUB 4DR5B 2Z5UA 3FYIB 1N32B 2AHZA 1Q6UA 4X89A 1BCCH 4MVQA 3RYIA 4YJ3A 3SYAA 1Q81W 4B7EA 4KXRA 1W2BU 4FMTA 4RAIA 4FM2A 2UU9B 3K08A 4CC6A 1RM1C 1HR0B 3B4SA 4GX0A 2X6CA 1CPYA 3C3SA 3IJ4A 4JI2B 5B5EZ 2YSUB 1Y66A 3HKBB 4MTXA 2WA4A 4PI2A 1AVMA 3CCUV 1SQBH 2WLLB 1GN2A 5JJNB 3ZMUA 2C2AA 3Q4HB 4TT3G 1BZKA 2RN9A 3I5DA 1NTMH 5LMUB 1AI6A 5IYCO 3HKEA 4K0KB 2WAMA 5EYPB 1VF6C 2CDYA 1NU1H 4PA6A 2YUAA 2P90A 1H8EG 2RDCA 2ZCEA 2VWKA 5FLXN 2R9IA 4DV5O 3M99B 3RWRD 4O4JB 1HNZB 4NB5A 1TAEA 1CEZA 1G6UA 1S5JA 4GT1A 3CMEV 4B3TO 4JYAB 1EN6A 2DWEC 1LUWA 1J5EB 3JYCA 1XI1A 3QNEA 1V54B 2AW9A 2RJZA 4CS3A 5HFMA 1IBKO 1VQOV 3APQA 3C90A 3FB7C 4U7OA 3TCUA 3CXHF 1W0JG 4FLZA 2Q4PA 4ZHQA 2E76B 2DQ3A 3OTOO 4FPPA 4UCOA 4TQDA 3CHXA 1XEQA 3L73H 3CPWU 4KHPB 1E1QG 1XHXA 2ODMA 3H9VA 4YY3O 5CBHA 4L87A 5JJEB 5K1PA 2FL4A 3N2GB 2GBOA 5FPOA 4OX9B 1I7FA 1KUQA 3CP1A 1QR8A 2F93B 2DE0X 1VEWA 5CBFA 2ZIOA 2NN4A 3EVKA 5CA1B 2BE3A 4W4LA 1PM9A 2EZPA 3JAKA 1GRJA 4X62B 2ZE8A 1BHAA 4O4IA 2L35A 3RYFA 1YEWA 2ZDIA 3AK1A 1OCRC 1E1RG 3K79A 5B1AB 1NBMG 5L3CA 1M1KW 1TUBB 4BIOA 3U10A 4ZHQB 4GKJO 4QJFB 4LFAB 5KMGA 1JCHA 3JATB 4DR4O 3FB8C 4JI4O 4MVUA 1N0NA 3STZC 3JALB 4MTFA 1SC5B 3THOA 5H6RA 2JEXA 1D5AA 4EFBA 3S3WA 3J7AU 3E83A 4TV9A 1D2DA 2EJ7A 4GX2A 2PI5A 2H8PC 1FD9A 2F23A 4B3MB 3A8TA 2JS5A 3AEIA 3B8NA 3OMAB 4DK0A 1JMKC 5JCOC 4ZOLB 4IHJA 2Q73A 5LBQA 3T4DA 3W7SA 5J2TB 4JAUA 3JD3A 4CZZA 1KECA 1ZUQA 5IY5B 1AP5A 1WA8A 1VF5B 4CS2A 1WLEA 3CE2A 3QO7A 3IFXA 3JD0A 1ORQC 3CD6V 3BCCH 3ETGA 3SPGA 4WBNB 1WB8A 2QJ1A 4EFEA 1XL4A 5B1AC 4QGPA 5L3BA 4WCEV 1VMGA 1GH6A 1JJ2U 1M57B 3RYHB 2EIKB 5CN0A 3M8AA 4R50A 3G6EV 5C8YA 4LC1A 4JI5O 1M9NA 3ZEDA 3K59A 3R65A 3L70H 5IJ9B 2OIEA 4QNHB 2CGOA 4ICGA 3OFNG 2DJVA 3P32A 2BTQA 4UFZA 3UQ8A 1AILA 4I0XB 5JCOA 2HP8A 4X1IB 2ZT9B 4LNUA 1Z2GA 2R72A 1XMOB 2XTAA 1B3QA 3E35A 1MNGA 3VOUA 3K03A 4J42A 2XAQA 1K4DC 5LYJA 1ZLZA 2P4VA 5CB4B 1H38A 5JJJB 2WLIB 2EIJC 2Q67A 4CBCA 4IIJB 3Q4HA 4EEQA 1BL8A 4DR1B 4DV2O 2UXDO 4IL6Z 1BS3A 3OGCC 2YEVA 3G80A 1WNSA 2R9AA 4TV9B 1OCOC 4FZ1A 1SZTA 3G67A 3DC6A 4DUZB 1KKDA 3B09A 2BTOA 3OUFA 3CWBH 2YS8A 1IZ3A 2DMXA 2UXBO 3OR7C
chains in the Genus database with same CATH topology
2QWPB 2N04A 2LO1A 2M6YA 1XBLA 1BQZA 3APOA 1FAFA 2OCHA 2QSAA 2CUGA 1GH6A 4RWUA 3UCSC 4J7ZA 2Y4UA 2PF4E 4IT5A 2Y4TA 3UO3A 2CTWA 3UO2A 3BVOA 1N4CA 2EJ7A 2CTPA 2KQXA 1FPOA 1BQ0A 3APQA 2QWNB 2YUAA 2QWOB 2N05A 2L6LA 2CTQA 2LGWA 3AG7A 2DN9A 4J80A 1WJZA 1IURA 2GUZA 2GUZB 2CTRA 2QWQB 2DMXA 2YS8A 1HDJA 2QWRB 1NZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2N04 A;  2LO1 A;  2M6Y A;  1XBL A;  1BQZ A;  3APO A;  1FAF A;  2OCH A;  2QSA A;  2CUG A;  1GH6 A;  4RWU A;  3UCS C;  4J7Z A;  2Y4U A;  2PF4 E;  4IT5 A;  2Y4T A;  3UO3 A;  2CTW A;  3UO2 A;  3BVO A;  1N4C A;  2EJ7 A;  2CTP A;  2KQX A;  1FPO A;  1BQ0 A;  3APQ A;  2QWN B;  2YUA A;  2QWO B;  2N05 A;  2L6L A;  2CTQ A;  2LGW A;  3AG7 A;  2DN9 A;  4J80 A;  1WJZ A;  1IUR A;  2GUZ A;  2GUZ B;  2CTR A;  2QWQ B;  2DMX A;  2YS8 A;  1HDJ A;  2QWR B;  1NZ6 A; 
#chains in the Genus database with same CATH topology
 1YF2 A;  1UJW B;  3B2E E;  2ZD9 A;  4I4T A;  1TUB A;  1H2N A;  1FFX A;  4FLT A;  4MVM A;  4UVA A;  4X1Y A;  3WB2 A;  3K04 A;  5CA1 A;  4U3J A;  1ZL8 B;  2WLI A;  1VQ4 V;  2ZNJ A;  2YIB A;  1DLB A;  2EJR A;  2QWQ B;  1FJG O;  1SQV H;  2QWR B;  5DED A;  1QHT A;  3AG1 C;  1MZE A;  2JGU A;  3BAA A;  4W4K A;  3APO A;  5IT9 N;  3N2G A;  5KHK A;  4DV1 O;  4DR3 B;  3HPL C;  3JAM N;  5IY5 C;  3SJQ C;  4LH6 A;  3RN4 A;  5J9P C;  4LP8 A;  1OJH A;  1N33 B;  2ZXW B;  4O4L A;  3F5T A;  2E5L B;  2B9Z A;  1YVW A;  2WSS G;  4BR6 A;  4JI8 B;  2KSD A;  5B66 Z;  3TET A;  5BMV A;  2XHB A;  2D2C B;  1BHB A;  5F2V O;  4P9P A;  4GX1 A;  2ARH A;  4X9Q A;  3ASN C;  4Z1M G;  1L8D A;  2CTW A;  3LSU A;  4AQY O;  1X59 A;  1F23 A;  1AJP A;  2YEV B;  5EIB D;  1IBM B;  3X2Q C;  1Q7Y W;  1P7B A;  2W6I G;  2JDI G;  3RYC B;  2F1M A;  1VQP V;  3HR0 A;  3ABL B;  4IIJ A;  5FNV A;  1WA8 B;  3JAR B;  1QQC A;  1Q8I A;  2IBZ H;  4NR1 A;  5EC2 C;  1G4Y B;  4ZOL A;  1Y74 A;  3FFQ A;  2ITC C;  3STL C;  4JI8 O;  3K3W A;  3AG2 C;  4OPA A;  1GMG A;  2PF4 E;  2QE7 G;  1M4U A;  2P4K A;  1F7Y A;  4LFA O;  3BHP A;  1QLE C;  4GKJ B;  3ABK B;  4UB6 Z;  5KMG B;  4RQF A;  3BPZ A;  3UKM A;  3E8F A;  3E8G A;  1K9M W;  5K1X A;  2LO1 A;  3BEH A;  4DR7 O;  4PA7 A;  4PDM A;  5LHH A;  4K8Z A;  5CA3 A;  2ZIM A;  3F7V C;  3CX5 F;  4NXM O;  2B1G A;  2VQE B;  2IH3 C;  4H13 B;  1GM7 A;  4PA4 A;  2LGW A;  2Q9L A;  1WPB A;  1VQK V;  1AR4 A;  4G2K A;  1KQS U;  3A0H Z;  2Y4T A;  4JAV A;  3JSN A;  3T1H O;  4H37 A;  4DV6 B;  2LFR A;  2F95 B;  4WF9 V;  1YHQ V;  2DQ0 A;  1HDJ A;  4O4H A;  4HZ3 A;  4UV8 A;  1EFR G;  2QKA A;  3CRQ A;  2OCH A;  1M57 C;  1VP7 A;  1KC8 W;  1KKC A;  4ZBM A;  3K5O A;  3JCZ A;  2VS0 A;  1N4C A;  3CRR A;  4DR2 B;  1NT2 B;  3ZHU A;  1B04 A;  4FLV A;  1YXB A;  2ZM6 O;  3FB6 C;  2JS3 A;  3K0G A;  2E74 B;  4QE9 A;  4O4J A;  3JD2 A;  1N32 O;  1J5E O;  3NXS A;  4B3T B;  4JYA O;  5CB4 A;  3OR6 C;  1K73 W;  3JAS B;  3OEE G;  4ZKI A;  1H2G A;  1U97 A;  3E89 A;  3SJC C;  3DTU B;  4DV5 B;  1R3K C;  2IM9 A;  3A0R A;  1NI8 A;  1H2S B;  1WB7 A;  4LWS A;  3QG5 A;  2OWO A;  4DR2 O;  3E2E A;  1IUR A;  4JI2 O;  3AG4 C;  3AG2 B;  3T2M A;  4AI8 A;  2XAJ A;  4PD4 F;  2IJH A;  1SF9 A;  3J81 N;  2IH1 C;  3ZS8 C;  2AGA A;  5C8Y B;  3FD9 A;  1GM9 A;  2DYR B;  3EFF K;  2IU3 A;  1GKF A;  5KAF Z;  3ZIA G;  4I0X A;  1D5N A;  4H33 A;  2BCC H;  1YJN V;  3N2K A;  1K97 A;  2OCC C;  2UUA B;  1XHZ A;  4ZI7 B;  1JR9 A;  1AI5 A;  4BIZ A;  4F6R A;  4TOI A;  3CXC U;  2XOK G;  4JZG A;  3RYH A;  4GKK B;  3SDL A;  1WPX A;  1OV9 A;  2WPD G;  4JTC B;  4KUM A;  1DTO A;  4NTX A;  2CTP A;  5BMV B;  4JI3 O;  1RFY A;  3TGU H;  5IYZ A;  3ABK C;  5JH7 B;  4XDL A;  1Y74 B;  2Z3Y A;  2O57 A;  3SYQ A;  3WG7 C;  4JI4 B;  2QGN A;  2ZXW C;  4XBF A;  4CH6 A;  4LF8 B;  3HKB A;  3CMA V;  3DXR A;  2UUA O;  5BR8 B;  4ABM A;  1IBL B;  3DC5 A;  1SES A;  4DW0 A;  2YIB D;  2V4D A;  3IGA C;  1TVK B;  1EN5 A;  4FFK A;  4GZR B;  1AJQ A;  2YID A;  1I5X A;  5BY1 A;  4I55 A;  4X20 B;  3ZMT A;  2JIZ G;  2CGN A;  3ETD A;  2DOS A;  4X64 O;  2HKO A;  1GO3 F;  4QPJ A;  3LDC A;  2E3C A;  2Y0I A;  4J7Z A;  3SJA C;  1OCC C;  2Y69 C;  3SJB C;  4DR4 B;  2CUG A;  1V9P A;  3T4Z A;  3ASN B;  3ASO C;  1SS3 A;  3ASO B;  1KP3 A;  4Z2W A;  1MMM A;  1NH2 B;  1EZV H;  3CC2 V;  1MAB G;  2Q5Z A;  2CAZ C;  5IYZ B;  5DN6 G;  3T1Y B;  1NS1 A;  1YI2 V;  3FB5 C;  2VWJ A;  1VAR A;  4HNA B;  1BQZ A;  3LUT B;  2IU0 A;  1T5E A;  1XMQ O;  4BW9 A;  1K5Q A;  2HHH B;  4DR1 O;  4I55 B;  1QLN A;  1NKD A;  4DRX A;  4JI6 B;  1YIJ V;  4NTW A;  4JV5 B;  1XNQ O;  3QTC A;  3OE7 G;  5L3E A;  1XDC A;  3ZMV A;  2PUS A;  4I50 B;  2X6B A;  5CA0 A;  2FTK A;  2WLK A;  2QWP B;  2GTS A;  3L75 H;  3R66 A;  4TUY B;  4PHZ A;  1PPJ H;  3WB1 A;  1XNR B;  3SGI A;  3ZHQ A;  5JVD A;  1DF4 A;  4JI6 O;  5LOV A;  3SPI A;  4U7N A;  3LNN A;  2NLJ C;  1I5Y A;  5KUK A;  4YHH B;  4BW5 A;  4X65 O;  1NR7 A;  4UUJ C;  3I55 V;  1WN7 A;  3LSQ A;  3JAW B;  5IJ0 B;  4I7Z B;  1F4M A;  3ABL C;  1Z5V A;  2CTQ A;  3BA9 A;  4DR5 O;  2ZE6 A;  1JQ0 A;  1MSD A;  2B1I A;  4P2Z A;  5E79 Z;  1AR5 A;  5LMU O;  2XAS A;  5ITZ A;  2ADQ B;  2EZO A;  1E79 G;  2YXY A;  3CRM A;  1V55 B;  3E22 A;  3ETQ A;  2OT5 A;  4JAA A;  2A7W A;  1JOY A;  3BVO A;  3K06 A;  1FXK C;  3D8C A;  4DXW A;  3JAT A;  3OEH G;  3OTF A;  2WLH A;  2EIM B;  4J9Y B;  3CC4 V;  1VQ7 V;  1VQ8 V;  2QTO A;  4MW3 A;  3ABT A;  4IYH A;  3CRA A;  1YIT V;  1VIB A;  4PJ0 Z;  3UO2 A;  5LOV B;  1Q6H A;  1JPX A;  3LNM B;  3UT5 B;  4K3A A;  5H9C A;  3AG7 A;  2NNU A;  1NH2 D;  1K8A W;  4DR7 B;  1KB9 F;  2V7Q G;  1K5S A;  3G71 V;  2QM8 A;  3D3I A;  4YJ3 B;  4X1K B;  2EIL B;  2DWD C;  4LBE C;  2UXC B;  3A2F A;  3JAL A;  2L6L A;  4UVB A;  4Q20 A;  2B5U A;  4OPH A;  1Y4M A;  2LW7 A;  2F4V O;  2X7R B;  3JCU Z;  1CP9 A;  3BFR A;  2EBO A;  2E5L O;  4JYC A;  4MVO A;  2RNB A;  5D5P A;  3D36 A;  4HYO A;  2JK5 C;  2P06 A;  3RYF B;  2Z0A A;  4DR3 O;  3ABM C;  1ENV A;  5B3S C;  4MSW C;  4XDJ A;  5LHI A;  2QWO B;  2N05 A;  3LSS A;  3RT3 C;  2EIL C;  1NTK H;  3MHS C;  3UT5 A;  3OT7 A;  2YIA A;  1RP3 B;  1EBO A;  5KHI A;  5H5N A;  3QO8 A;  4OXS A;  4O2B B;  1LR1 A;  1L0N H;  3DSQ A;  5JQG A;  1XIL A;  5KA5 A;  3RYC A;  2QA4 V;  2UUB B;  4LF4 B;  3IC9 A;  3ABM B;  4X20 A;  1BT8 A;  5CMU A;  4AQY B;  4GUN A;  1PP9 H;  5LA6 B;  3WU2 Z;  2W0X A;  1N33 O;  1OZ0 A;  1H2L A;  1YCI A;  4EB6 B;  3CRC A;  4DR6 O;  2N04 A;  4PA3 A;  4FLX A;  1FYJ A;  3W7X A;  4GLX A;  2HFE C;  1SET A;  3ZHV A;  2ZR2 A;  2YXH A;  2Y4U A;  1YDX A;  3W7T A;  4FM0 A;  3TXQ A;  1JFF A;  2M7W A;  5B1O A;  5A9G A;  2VQF B;  1PKX A;  2R70 A;  4DV6 O;  1I94 O;  1F4N A;  4UV9 A;  4KHP O;  2Q68 A;  4FIP C;  4X65 B;  2QR4 A;  3CSX A;  3OMI B;  3EHB B;  2BOB C;  4LCU C;  2HVK C;  1Z5W A;  1A32 A;  3G4S V;  1VF7 A;  3ZN1 A;  1QR9 A;  2OTL V;  4IHJ B;  1VQ6 V;  3HKE B;  3KCY A;  2IW5 A;  1EZJ A;  3A0B Z;  3S3X A;  1K33 A;  2R9R B;  3T1C A;  1HNZ O;  3ZRS A;  3HKC A;  3PN1 A;  1WJZ A;  2XT9 A;  1P7G A;  1XUQ A;  4X1Y B;  3TJT A;  4L8J A;  4X1I A;  3F7Y C;  1XNR O;  4H44 B;  4JAS A;  4F6R B;  2KG7 A;  4LF9 B;  1R73 A;  1SKV A;  3UCS C;  4DV4 O;  1BE3 H;  1K34 A;  1GK9 A;  4OGQ B;  3ZRX A;  2OCC B;  1WAZ A;  3T1Y O;  3SYC A;  1S77 D;  1WP8 A;  2Q7E A;  2E75 B;  2Y48 A;  1BGY H;  2AXT Z;  2QSA A;  2WLM A;  1Q5O A;  1RPR A;  5LGN A;  3ICX A;  3T1H B;  1PL4 A;  5KHJ A;  3CCE V;  1HW7 A;  3AG1 B;  3H01 A;  5LYJ B;  3L72 H;  4DK1 A;  2CH7 B;  2Q0O C;  4LFC B;  4K35 A;  2HEP A;  4X66 O;  4O2A B;  1XBL A;  2P5O A;  4DYL A;  1TA8 A;  3K5L A;  1KU9 A;  1FFX B;  4DV0 O;  4WFG A;  1YTF D;  1IXB A;  1Y67 A;  1BQ0 A;  2VQE O;  5DM6 V;  4I4T B;  1MA1 A;  1Q6I A;  4B08 A;  2UXC O;  4FFB A;  3KG2 A;  2MW2 B;  1VQ5 V;  2N74 A;  3VBB A;  1MG1 A;  5EC1 C;  2F66 C;  3KCX A;  3ML0 A;  3X2Q B;  1QBZ A;  2GTA A;  2QDO A;  4TQF A;  4I9Q A;  4K8X A;  1N0J A;  2AZ2 A;  4NVP A;  2YI9 A;  4TV8 B;  4PI0 A;  4LF5 O;  2OYQ A;  1J95 A;  4F6E A;  3SPH A;  1OCO B;  4FZ0 A;  3K9A A;  4OX9 O;  4DW1 A;  1N34 B;  1K92 A;  1BMF G;  1PNM A;  2WA3 A;  3FAV B;  4FVM A;  1SER A;  3CS5 A;  2CE4 A;  1M56 B;  3U0Z A;  3K58 A;  4IYI A;  2K9P A;  2JVD A;  2EIJ B;  4BAY A;  3G6B A;  4EKW A;  5B1N A;  3K5M A;  3RVZ A;  1NJI W;  5EZY A;  2W6J G;  3E8B A;  1WP7 A;  1SQF A;  2Q8V A;  1UFI A;  1VQN V;  3JD4 A;  3H1L H;  5IJ9 A;  1ZAU A;  1SA0 B;  4X66 B;  3ABU A;  2DYS B;  3H1H H;  2YXL A;  3O9O A;  4EB6 A;  2ZDI C;  4PA9 A;  4B3R O;  1SRY A;  2LW1 A;  4YJ2 B;  3IAY A;  1XOU A;  4BWA A;  2ZE5 A;  5LHG A;  4GKK O;  2PTM A;  1KBH A;  2M6Y A;  2QTS A;  5LP6 A;  5KX5 A;  2ZE7 A;  4PV1 B;  3WFV A;  1XQ8 A;  4J7K A;  2Q6A A;  1OCZ B;  1S5H C;  3CJH B;  2FML A;  4D6T H;  3JD1 A;  4UB8 Z;  2XAH A;  5HFL A;  4DUZ O;  4YY3 B;  1GAX A;  3I56 V;  5J2T A;  2ZKO A;  2QKC A;  3ZBH A;  2LQT A;  5IWA O;  5FNV B;  5KAI Z;  2V1D A;  4P9O A;  3M7M X;  4DO2 A;  4Z1V A;  4YHH O;  1RSO B;  4YIO A;  1FJG B;  5IE9 A;  1S5L Z;  1AI4 A;  4J9Z B;  1XMO O;  1R3L C;  2DW4 A;  4YJ2 A;  4UCR A;  5KHG A;  3P3P A;  2QKS A;  1R6T A;  3UM7 A;  3AG3 C;  2ZM6 B;  1MZF A;  2JRI A;  4JI5 B;  4LF9 O;  2X0L A;  3HKD B;  1KYO F;  1N8R W;  2GDS A;  3KKY A;  1SQG A;  1NTZ H;  2JGD B;  4I9W A;  1G8M A;  1AB3 A;  4B7K A;  5FL7 G;  3ZRV A;  4R7C A;  3RVY A;  2P7T C;  3EXA A;  1JVM A;  2HJF C;  3ZRW A;  1OCZ C;  4O2A A;  5GW7 A;  3OM3 B;  4X64 B;  1VQL V;  4FLW A;  2Q7H A;  4DUY B;  4B3S B;  4UCS A;  1V55 C;  1M93 A;  4IT5 A;  4AHC A;  3LDE A;  4J7J A;  2XAG A;  2YIC A;  2KQX A;  4QPK A;  4JI7 B;  5LL6 Y;  2HJD A;  1FPO A;  3H1K H;  1L1F A;  4RO2 A;  3IC7 A;  5L3D A;  2ZQM A;  3GVM A;  4JYY A;  4LF6 O;  4FK5 C;  2UU9 O;  3AG3 B;  1KP2 A;  4CS4 A;  1JJO A;  5A2Q N;  5GTI Z;  2P22 C;  1MOF A;  4NXN O;  2EIK C;  3SPJ A;  4MVS A;  3E22 B;  5GON B;  4JTD B;  4LFB O;  1MSW D;  5C93 A;  2Q7G A;  4R6Z A;  1ZSP A;  1FS0 G;  3K5N A;  5EBM C;  5JQG B;  1H8H G;  5L3G A;  4DV0 B;  1KD1 W;  2IJI A;  5LXT B;  1W0K G;  3ZJZ A;  3ZHR A;  1QNM A;  5IYB O;  1THZ A;  1SQQ H;  1AI7 A;  1SQP H;  4LF7 O;  2DN9 A;  3FKS G;  1S3J A;  4JTA B;  4NKG B;  4LF8 O;  4G28 B;  3K0D A;  3FX7 A;  3RW0 A;  4UCU A;  3E86 A;  2XUM A;  1M90 W;  4D7S A;  2KB1 A;  1H2M A;  1K4C C;  3CCS V;  4KL1 A;  2F4V B;  3C3T A;  4LF7 B;  3LDD A;  4B3M O;  4LFC O;  4WFH A;  5EK0 A;  2K1E A;  3D3Q A;  1F51 A;  1PL0 A;  1GN6 A;  4D7T A;  1SA0 A;  5KLV H;  2HG5 C;  2WLJ A;  1I08 A;  2GV9 A;  3N27 A;  1GM8 A;  4CH3 A;  3RYI B;  3B40 A;  3VQY A;  2AZ0 A;  3BA8 A;  5EZY B;  2KKW A;  1OHH G;  4P30 A;  3L9D A;  4ZIB A;  5DEC A;  3AK3 A;  1IBK B;  4PDL A;  3DGE A;  4NTY A;  5LXT A;  1NQT A;  1FKA O;  2ZNI A;  4DV3 B;  3FAV A;  4HAM A;  4K0K O;  2UXD B;  1O9G A;  3HB3 B;  4E2L A;  3ETE A;  5J2U B;  2WLN A;  1HP8 A;  4AIL C;  1AP6 A;  5BZB A;  1HNX B;  4J80 A;  4JI1 O;  2HVJ C;  2A3Q A;  5H2F Z;  5EBL C;  1XNQ B;  4DV1 B;  3TXS A;  5KHH A;  1DK1 A;  4C7U A;  1BSM A;  4WFB V;  3PJS K;  5L3F A;  1XMQ B;  3CCR V;  1SZX A;  1W59 A;  3ZHS A;  4O4L B;  1Y76 A;  2W0F C;  4DV7 B;  1GN3 A;  2ATK C;  1NVP B;  1XRE A;  2WWW A;  3DXR B;  1R3J C;  4WFA V;  4MTO A;  4GX5 A;  2QM7 A;  2RQ6 A;  4NXM B;  2GHY A;  2ZIN A;  4RWU A;  5B1B C;  1P84 F;  4DR6 B;  4MVZ A;  2RCV A;  1R6K A;  1I0H A;  4QE7 A;  4YXW G;  5J2U A;  4DV7 O;  4WFE A;  4G27 B;  1URF A;  4A5U B;  4Q6G A;  2Q69 A;  3OAA G;  3L74 H;  4JI1 B;  1R3I C;  1FXH A;  5GTH Z;  1UPG A;  3F5W C;  4LF4 O;  2VQF O;  2BSK A;  3AG4 B;  4RQE A;  3WG7 B;  2P67 A;  3ZHT A;  3OUS A;  3SR2 C;  3D36 C;  5LP6 C;  4PEL A;  3HKD A;  1FFT B;  4JGS A;  3UO3 A;  5BXZ A;  3GWK C;  5CA0 B;  1P4R A;  4JV5 O;  4ZI7 A;  4TSF G;  1IXM A;  2LFS A;  1ZWI C;  3SPC A;  4UCV A;  3GB7 C;  2EIN B;  1GN4 A;  3FYE B;  2PI4 A;  4MS2 A;  5GON A;  2QM4 A;  2ITD C;  4FM1 A;  4GYC B;  2PYJ A;  3P3N A;  4KP4 A;  2F43 G;  5CBG A;  3CCJ V;  3JAW A;  5IJ0 A;  3CYO A;  4JI0 O;  2FB5 A;  4UCT A;  3HKC B;  5EYP A;  1PNK A;  3MD0 A;  3O65 A;  5LGU A;  1GTO A;  2JEU A;  1Q90 D;  4F4L A;  4JZ2 A;  2A79 B;  4PDR A;  4MT8 A;  2AHY A;  4XDK A;  2BSK B;  3SYO A;  5IDJ A;  4LWS B;  2EIN C;  1NZ6 A;  1ARO P;  5KX5 B;  4JI0 B;  5JVD B;  3B77 A;  1FXK B;  1HWY A;  1U96 A;  3ZX6 A;  1YJW V;  2ZR3 A;  1JFF B;  1IX9 A;  5BR8 O;  4LF5 B;  4TUY A;  4HBN A;  1M5I A;  2EX3 A;  1AR1 B;  2GSM B;  1ZL8 A;  4U3J B;  3VQX A;  4J10 A;  2GUZ B;  1B06 A;  1PV0 A;  4LH7 A;  4ASU G;  4H0L B;  2PGG A;  3ZMS A;  5LMN B;  4WFF A;  2DYS C;  2LGQ A;  1RM1 B;  4X88 A;  2ETN A;  2IJJ A;  1PD3 A;  1CXZ B;  1M56 C;  5LA6 A;  1YTF B;  1US6 A;  2EIM C;  1YZB A;  4JI3 B;  2UXX A;  1R6N A;  4N23 A;  3VQV A;  3QVN A;  4NXN B;  2XND G;  1OCC B;  3ZCC A;  5B1B B;  3JAK B;  1LUV A;  4I5S A;  2ADP A;  1IBM O;  3ZN0 A;  2UXB B;  3TK1 A;  3QF7 A;  4LFB B;  1PNL A;  3H1I H;  3JAS A;  3MHH C;  2RMK B;  1Q86 W;  4JI7 O;  1DF5 A;  2CTR A;  4DV4 B;  2BOC C;  4X8A A;  2H94 A;  4JYB A;  4U3F H;  5AG2 A;  1HNW O;  1K7D A;  1S76 D;  1SQX H;  1TUE B;  1Y76 B;  5KA6 A;  4DUY O;  4B3S O;  4I50 A;  4JPR A;  2PYL A;  4FJC C;  1ZTE A;  3VQW A;  1ZX3 A;  3P30 A;  1NVP D;  1N36 B;  3KZI Z;  3N2K B;  2KG7 B;  4O4I B;  2JJ1 G;  4UVC A;  3L71 H;  2GUZ A;  5TIS Z;  4GCZ A;  1IDS A;  2Q0A A;  4R8C A;  3U11 A;  4FLU A;  5E1A C;  3OTO B;  1X4T A;  5IYD O;  2HHH O;  2VRZ A;  1EM1 A;  2HLD G;  3OD4 A;  3RGB A;  2CH7 A;  1FXK A;  3BY6 A;  1VF6 A;  1JX9 A;  1RSO A;  3BAB A;  3GWO A;  3CCQ V;  1B6Q A;  2A06 H;  1QVF U;  1V54 C;  2EUL A;  5FPR A;  5JH7 A;  4B3R B;  2D3O W;  1IVS A;  4NYK A;  2HR3 A;  4DV2 B;  2UXN A;  2WLL A;  1FAF A;  4YIP A;  4QIW F;  3H1J H;  3JAR A;  1HR0 O;  1L0L H;  3CJH A;  4RUF A;  2BTQ B;  2A9H A;  3MAQ A;  3CCV V;  1H2K A;  1R1B A;  2FYU H;  1I94 B;  5LP6 B;  5IWA B;  1HNX O;  1LNQ A;  2A0L A;  2XAF A;  1EN4 A;  1N36 O;  2DYR C;  4BIU A;  3W7W A;  2YI8 A;  5H6Q A;  2OIG A;  3WB0 A;  5ITZ B;  3NR7 A;  3B8M A;  4WBN A;  2MK3 A;  1XL6 A;  2YDE A;  3OGI B;  4DV3 O;  3K57 A;  3OW2 U;  5KUM A;  1S72 V;  1QVG U;  2X6A A;  4UXN A;  4O2B A;  1Q82 W;  3RFR A;  4JF3 A;  2OTJ V;  3SYP A;  5JWP A;  1G1X B;  2UUB O;  1DGS A;  1HNW B;  1OCR B;  4LR3 A;  2G38 A;  2Y69 B;  1QLE B;  2FKX A;  1COW G;  4PDV A;  4FLY A;  1Q43 A;  3CCM V;  1N34 O;  4CC5 A;  4TV8 A;  2YC0 A;  4CH4 A;  3E8H A;  3ZRW B;  1ROP A;  1P49 A;  3CB2 A;  2H3O A;  2LP7 A;  3JSL A;  1VQ9 V;  4IGG A;  1Y6X A;  3ZMZ A;  1QCE A;  3MDS A;  1NR1 A;  4X62 O;  2JJ2 G;  5EBW C;  2PZS A;  5EIB C;  1K3E A;  5LMN O;  2JGD A;  4FFB B;  1VQM V;  3OMN B;  1IBL O;  4DRX B;  2QEX V;  1TVK A;  2UUC B;  2QWN B;  2Y0P A;  4J11 A;  3CEI A;  4TWK A;  3QO5 A;  2ILM A;  4CH5 A;  2UUC O;  2NR5 A;  2PY5 A;  3AK2 A;  3CC7 V;  5D5Q A;  4O4H B;  4HNA A;  3RBZ A;  1JA8 A;  4MTG A;  4X1K A;  3K9S A;  4J41 A;  3J80 N;  1YJ9 V;  3W7U A;  4MW8 A;  4LF6 B;  5B3S B;  2LJ2 A;  4KFM A;  4N21 A;  1AJN A;  2CK3 G;  1QU7 A;  3CCL V;  1FXV A;  3BRC A;  1YSC A;  4MVR A;  1O9H A;  1RPO A;  2IJK A;  2P6J A;  1Q3E A;  5LGT A;  4RUE A;  1S0V A;  4E4E A;  1KMI Z;  1TGO A;  4LNU B;  4DR5 B;  2Z5U A;  3FYI B;  1N32 B;  2AHZ A;  1Q6U A;  4X89 A;  1BCC H;  4MVQ A;  3RYI A;  4YJ3 A;  3SYA A;  1Q81 W;  4B7E A;  4KXR A;  1W2B U;  4FMT A;  4RAI A;  4FM2 A;  2UU9 B;  3K08 A;  4CC6 A;  1RM1 C;  1HR0 B;  3B4S A;  4GX0 A;  2X6C A;  1CPY A;  3C3S A;  3IJ4 A;  4JI2 B;  5B5E Z;  2YSU B;  1Y66 A;  3HKB B;  4MTX A;  2WA4 A;  4PI2 A;  1AVM A;  3CCU V;  1SQB H;  2WLL B;  1GN2 A;  5JJN B;  3ZMU A;  2C2A A;  3Q4H B;  4TT3 G;  1BZK A;  2RN9 A;  3I5D A;  1NTM H;  5LMU B;  1AI6 A;  5IYC O;  3HKE A;  4K0K B;  2WAM A;  5EYP B;  1VF6 C;  2CDY A;  1NU1 H;  4PA6 A;  2YUA A;  2P90 A;  1H8E G;  2RDC A;  2ZCE A;  2VWK A;  5FLX N;  2R9I A;  4DV5 O;  3M99 B;  3RWR D;  4O4J B;  1HNZ B;  4NB5 A;  1TAE A;  1CEZ A;  1G6U A;  1S5J A;  4GT1 A;  3CME V;  4B3T O;  4JYA B;  1EN6 A;  2DWE C;  1LUW A;  1J5E B;  3JYC A;  1XI1 A;  3QNE A;  1V54 B;  2AW9 A;  2RJZ A;  4CS3 A;  5HFM A;  1IBK O;  1VQO V;  3APQ A;  3C90 A;  3FB7 C;  4U7O A;  3TCU A;  3CXH F;  1W0J G;  4FLZ A;  2Q4P A;  4ZHQ A;  2E76 B;  2DQ3 A;  3OTO O;  4FPP A;  4UCO A;  4TQD A;  3CHX A;  1XEQ A;  3L73 H;  3CPW U;  4KHP B;  1E1Q G;  1XHX A;  2ODM A;  3H9V A;  4YY3 O;  5CBH A;  4L87 A;  5JJE B;  5K1P A;  2FL4 A;  3N2G B;  2GBO A;  5FPO A;  4OX9 B;  1I7F A;  1KUQ A;  3CP1 A;  1QR8 A;  2F93 B;  2DE0 X;  1VEW A;  5CBF A;  2ZIO A;  2NN4 A;  3EVK A;  5CA1 B;  2BE3 A;  4W4L A;  1PM9 A;  2EZP A;  3JAK A;  1GRJ A;  4X62 B;  2ZE8 A;  1BHA A;  4O4I A;  2L35 A;  3RYF A;  1YEW A;  2ZDI A;  3AK1 A;  1OCR C;  1E1R G;  3K79 A;  5B1A B;  1NBM G;  5L3C A;  1M1K W;  1TUB B;  4BIO A;  3U10 A;  4ZHQ B;  4GKJ O;  4QJF B;  4LFA B;  5KMG A;  1JCH A;  3JAT B;  4DR4 O;  3FB8 C;  4JI4 O;  4MVU A;  1N0N A;  3STZ C;  3JAL B;  4MTF A;  1SC5 B;  3THO A;  5H6R A;  2JEX A;  1D5A A;  4EFB A;  3S3W A;  3J7A U;  3E83 A;  4TV9 A;  1D2D A;  2EJ7 A;  4GX2 A;  2PI5 A;  2H8P C;  1FD9 A;  2F23 A;  4B3M B;  3A8T A;  2JS5 A;  3AEI A;  3B8N A;  3OMA B;  4DK0 A;  1JMK C;  5JCO C;  4ZOL B;  4IHJ A;  2Q73 A;  5LBQ A;  3T4D A;  3W7S A;  5J2T B;  4JAU A;  3JD3 A;  4CZZ A;  1KEC A;  1ZUQ A;  5IY5 B;  1AP5 A;  1WA8 A;  1VF5 B;  4CS2 A;  1WLE A;  3CE2 A;  3QO7 A;  3IFX A;  3JD0 A;  1ORQ C;  3CD6 V;  3BCC H;  3ETG A;  3SPG A;  4WBN B;  1WB8 A;  2QJ1 A;  4EFE A;  1XL4 A;  5B1A C;  4QGP A;  5L3B A;  4WCE V;  1VMG A;  1GH6 A;  1JJ2 U;  1M57 B;  3RYH B;  2EIK B;  5CN0 A;  3M8A A;  4R50 A;  3G6E V;  5C8Y A;  4LC1 A;  4JI5 O;  1M9N A;  3ZED A;  3K59 A;  3R65 A;  3L70 H;  5IJ9 B;  2OIE A;  4QNH B;  2CGO A;  4ICG A;  3OFN G;  2DJV A;  3P32 A;  2BTQ A;  4UFZ A;  3UQ8 A;  1AIL A;  4I0X B;  5JCO A;  2HP8 A;  4X1I B;  2ZT9 B;  4LNU A;  1Z2G A;  2R72 A;  1XMO B;  2XTA A;  1B3Q A;  3E35 A;  1MNG A;  3VOU A;  3K03 A;  4J42 A;  2XAQ A;  1K4D C;  5LYJ A;  1ZLZ A;  2P4V A;  5CB4 B;  1H38 A;  5JJJ B;  2WLI B;  2EIJ C;  2Q67 A;  4CBC A;  4IIJ B;  3Q4H A;  4EEQ A;  1BL8 A;  4DR1 B;  4DV2 O;  2UXD O;  4IL6 Z;  1BS3 A;  3OGC C;  2YEV A;  3G80 A;  1WNS A;  2R9A A;  4TV9 B;  1OCO C;  4FZ1 A;  1SZT A;  3G67 A;  3DC6 A;  4DUZ B;  1KKD A;  3B09 A;  2BTO A;  3OUF A;  3CWB H;  2YS8 A;  1IZ3 A;  2DMX A;  2UXB O;  3OR7 C; 
#chains in the Genus database with same CATH homology
 2QWP B;  2N04 A;  2LO1 A;  2M6Y A;  1XBL A;  1BQZ A;  3APO A;  1FAF A;  2OCH A;  2QSA A;  2CUG A;  1GH6 A;  4RWU A;  3UCS C;  4J7Z A;  2Y4U A;  2PF4 E;  4IT5 A;  2Y4T A;  3UO3 A;  2CTW A;  3UO2 A;  3BVO A;  1N4C A;  2EJ7 A;  2CTP A;  2KQX A;  1FPO A;  1BQ0 A;  3APQ A;  2QWN B;  2YUA A;  2QWO B;  2N05 A;  2L6L A;  2CTQ A;  2LGW A;  3AG7 A;  2DN9 A;  4J80 A;  1WJZ A;  1IUR A;  2GUZ A;  2GUZ B;  2CTR A;  2QWQ B;  2DMX A;  2YS8 A;  1HDJ A;  2QWR B;  1NZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...