3ZRVA

The high resolution structure of a dimeric hamp-dhp fusion displays asymmetry - a291f mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
108
structure length
108
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 46
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrvA00
2WWWA 1IXMA 1F51A 5B1NA 4MT8A 3ZRXA 4QPKA 4GCZA 3ZRWB 3ZRWA 2P67A 5IDJA 4U7OA 3ZCCA 4Q20A 2LFRA 2LFSA 1JOYA 4ZKIA 4KP4A 4U7NA 4FPPA 3TK1A 3A0RA 4JYCA 4JAVA 4I5SA 5C93A 3DGEA 4BIUA 2QM8A 3NXSA 4QPJA 2QM7A 2C2AA 4BIZA 4FMTA 2FTKA 4JASA 4GT1A 3ZRVA 4MTXA 4JAUA 3P32A 4LC1A 5B1OA 3D36A 4JYBA 3MD0A
chains in the Genus database with same CATH superfamily
1MA1A 1F51A 3ZHUA 4JYYA 4BAYA 1WP7A 3RYHA 5DECA 3BAAA 2WLMA 2HVJC 3CE2A 1E1RG 5EC2C 3TETA 4GX5A 2YI8A 1JFFA 2OTLV 1EN4A 1QVFU 1GN6A 3WB0A 1F23A 1K92A 3JASA 1Y4MA 3OUSA 3BRCA 3EHBB 1AILA 2XNDG 3B8MA 4FM0A 3UCSC 3OUFA 1OCZC 1NVPD 3N2GA 2VWKA 5EK0A 1GN3A 1S5HC 3NR7A 3LDEA 5FNVA 4OX9O 1EM1A 2PI4A 4JZ2A 1VF7A 4I4TB 2X0LA 3ICXA 4CH5A 1RPOA 2GUZA 1R73A 4JI3O 3APOA 1IX9A 5IYZA 3P32A 4NTXA 1H2KA 4UCSA 3F7YC 2Y48A 5B1BC 2NLJC 1KUQA 4WBNA 2ADPA 2ZNJA 3LSUA 3JAMN 5GONB 3TXQA 4NXNO 1Q81W 2IJIA 2YSUB 5KA5A 3AG2B 3HR0A 2DQ0A 3ZEDA 2R70A 3UO3A 1H2SB 4DV3O 3L74H 2RQ6A 3SYPA 2F66C 1JR9A 2B9ZA 4P9PA 4BW9A 4NVPA 1DF4A 1ZL8A 3AK3A 3FYEB 4K35A 3JAWA 5A2QN 4ZKIA 2CTQA 4JI2B 1KKCA 1VIBA 1E1QG 1NI8A 3SYQA 2IJKA 3J81N 4MVQA 4FLUA 4LC1A 4O4JA 1XL4A 1IDSA 1SETA 3WG7B 4X1KA 1BQ0A 3MDSA 1QHTA 4JAAA 2EILB 3JD1A 3SPJA 4R6ZA 3RWRD 1Q3EA 3AK2A 5KUKA 3KCYA 4YJ3A 3Q4HB 1NBMG 3L75H 3D3QA 1GN2A 2H3OA 2E74B 4DR3O 2NN4A 2UUAB 4DV0O 2RCVA 3IFXA 2KQXA 4JI1B 2A79B 5LGTA 3W7TA 1I5XA 2YXYA 4DK1A 2BTOA 1AI7A 2MW2B 5KX5A 3SPGA 2LO1A 4DW1A 3U0ZA 2E5LO 1YJ9V 1YF2A 2YC0A 4FLWA 5CMUA 2HEPA 1SQVH 3BA8A 4JI5B 1VQ6V 2QSAA 2VQFB 2G38A 3RVYA 3K5LA 2HHHB 1XUQA 1R3JC 3ZHSA 3N2KA 4MTFA 3P3PA 3P30A 1QR8A 2P22C 3PN1A 4LF7O 2F23A 1IBLO 4MW3A 4LF8O 4B3RB 5B1AB 1KU9A 1SF9A 5LMNO 2ZINA 2QDOA 5LA6B 4FZ0A 1OCZB 4DO2A 5LHGA 3CRMA 1Y74B 2OCHA 5KHHA 2QM4A 3QO5A 4DV0B 4O4HB 4BIZA 2ZNIA 4FLVA 3T1YO 1QNMA 3ABUA 2BOBC 1ZUQA 2L6LA 2QTSA 3JAKB 1WNSA 1SQBH 1GM9A 3A8TA 1QLEB 1ZAUA 3HPLC 4RWUA 1N8RW 1CPYA 4LFCB 4X62O 2YEVA 5LL6Y 1WA8A 1CP9A 3LUTB 5H9CA 1Y67A 1JFFB 4DR1O 3JAWB 1OCRC 3W7XA 5JJNB 2B1GA 3WFVA 3L70H 4X20A 2Y0PA 3JARB 3OGIB 1LR1A 2ZIMA 2ZKOA 1S5JA 5IY5C 2QKCA 1KBHA 5JVDA 1MG1A 4TQDA 1XNRO 3PJSK 1ZL8B 1S72V 3ASOC 2WLKA 4FM2A 2FTKA 4GT1A 1V55C 2W6JG 4DR7O 4TWKA 2EIKB 2RJZA 2ADQB 3QVNA 3GWOA 4CBCA 2Q8VA 2JGUA 4TV9B 4UB8Z 5H6QA 4PI2A 4X8AA 3ABLC 1FJGB 4MVZA 1VF6A 4GX2A 4NXMO 3K04A 2QE7G 4KL1A 5CBFA 2ZXWB 2KG7A 3HB3B 3ABMC 4XDLA 2GSMB 1K73W 1GKFA 3EFFK 4MTOA 2JGDB 5EBWC 3N2GB 1K8AW 2KSDA 5IWAO 4I9WA 2PGGA 2AW9A 2OCCB 2UXCO 2AZ2A 4KP4A 4W4LA 2AGAA 1N34O 2ZR3A 5FNVB 2BSKB 1KB9F 4F6RA 2PTMA 2OIGA 1R6KA 2Q9LA 3OR6C 1N33O 1XL6A 4PA9A 5IDJA 1S0VA 4JYBA 3SJQC 2LJ2A 3OD4A 2DE0X 1DGSA 3KKYA 4IYIA 4Q20A 3UT5A 3U11A 3BABA 3ZRSA 2YXLA 1BSMA 1NTMH 3CHXA 3HKCA 2ZR2A 2ZCEA 1BL8A 5B3SC 1VP7A 3K0DA 2CTWA 1QQCA 4DV7B 1VQNV 1MABG 4R8CA 4GX1A 4PA6A 5LHHA 2DWDC 3MAQA 1IBKO 1EBOA 1XMQO 3K57A 1L0LH 1N36B 2Q0AA 3K03A 3JD2A 2P5OA 4IGGA 1PKXA 3B2EE 3FFQA 1PNMA 1J5EO 4P30A 2F4VB 1VQ9V 1P84F 4QJFB 1HNXB 3T1HO 1V9PA 4LNUA 2DW4A 1P7BA 4X1YB 2EIMB 3CXHF 3TXSA 4KFMA 5JWPA 1G1XB 5HFMA 1HNWB 1SA0B 4PDMA 3I56V 4PA4A 4WBNB 4YY3B 2P67A 2XAGA 3K5OA 5L3FA 1RM1B 3VQVA 1M4UA 4GUNA 3RVZA 5IYZB 1XHZA 2P7TC 4OX9B 3T4DA 4F6EA 4JI4O 3CCVV 5JCOA 2GUZB 2JJ1G 3N27A 5AG2A 1BZKA 2LFSA 2UU9O 1VQOV 2A3QA 4G2KA 5KHJA 3H1KH 3OEEG 1K97A 2Z5UA 4O2AA 5LMNB 3JSLA 3CX5F 4X65O 4DR5O 4B3RO 3SJCC 1M57B 4NXMB 1IBLB 3ZMVA 4NTWA 3OTFA 2NNUA 2QGNA 3ZRVA 1FXKA 1VQ7V 4RAIA 4BWAA 4NR1A 3QO8A 4DV6O 1R1BA 2BSKA 2LP7A 4XDJA 4L87A 2VQEO 4HZ3A 2ZE7A 2UUBB 1HW7A 4P9OA 4GKKB 5C93A 2E5LB 2IBZH 1OCOC 5L3DA 1BHBA 1R3IC 3BHPA 1R6NA 4B08A 2GV9A 2Q5ZA 4IHJB 1S76D 2ATKC 2IH1C 4GYCB 2YS8A 4HYOA 2DOSA 5TISZ 5LGNA 1PV0A 3E8HA 1JX9A 1PD3A 3HKBA 1P7GA 1D2DA 2IJJA 2RN9A 4DYLA 4LH7A 4HNAB 4J42A 1YJNV 2OWOA 4W4KA 1QCEA 2CGNA 4CS3A 3OFNG 1CXZB 1YSCA 4LF7B 4JI6B 5B5EZ 1QLNA 4LNUB 2H8PC 2CK3G 1GN4A 1F7YA 1HNZB 2QWRB 3K58A 3DXRB 3CXCU 5D5PA 5EC1C 3RT3C 2FB5A 3I5DA 3TK1A 1YHQV 5D5QA 1Q82W 3SR2C 5EBLC 5FLXN 2UXCB 5IWAB 4DUYO 4FM1A 5B1OA 4EEQA 1FXKB 1IXMA 4FJCC 2CUGA 3JATA 2W0FC 5IJ9A 4FK5C 1XDCA 1Y76B 3FB5C 2UUAO 3OAAG 5DEDA 2EBOA 1ROPA 3CCEV 5H5NA 2ITCC 4ZHQB 1AI5A 4QE7A 3ZJZA 5EBMC 4UVAA 1XNQO 2Z0AA 1HNZO 3UKMA 3B40A 3ZBHA 4AHCA 2WLJA 4DR6O 5H2FZ 2EZOA 1A32A 1VQLV 4JV5B 2YDEA 2QA4V 1XNQB 1GRJA 3H01A 2OIEA 5F2VO 2QKSA 3AG4C 3OTOB 2ZM6B 4B3SO 4GKJO 2BCCH 2UXDO 4J41A 1Y74A 3D8CA 1H38A 3OM3B 5LA6A 2GBOA 1WN7A 4I55A 4JAUA 4TUYB 3A0BZ 4B7KA 1I5YA 4MT8A 3CCUV 3ABLB 2JEUA 4WFEA 3HKDB 1AI4A 3E8GA 4ZI7B 5EYPA 1Q43A 3RW0A 2WSSG 1W0KG 1GH6A 4MVUA 4H33A 1LUVA 1WPBA 3KZIZ 4FFBA 2XAHA 3CRRA 3H9VA 2FKXA 2N05A 2YIAA 2BTQA 2EULA 5J2UB 4DXWA 1NH2D 1HWYA 1Q6HA 1R3LC 3CJHB 1AP5A 4K8XA 5JJJB 4OGQB 1VEWA 1JCHA 1LUWA 4DV2B 1BGYH 1AB3A 4JI3B 3T4ZA 2QM8A 1I0HA 2V7QG 5JH7B 4UCOA 4DUYB 1V54C 1M1KW 2YEVB 4P2ZA 2KKWA 1R3KC 2L35A 4ZOLB 3JARA 2QTOA 2AZ0A 2YIDA 1MMMA 2R9RB 5BXZA 3WB2A 4U7NA 2P6JA 4UV9A 4LF8B 4WFAV 4UB6Z 1EZVH 3HKEA 5B3SB 4YY3O 1PL0A 1EFRG 2DWEC 1HR0B 4JI6O 5LXTB 3RFRA 4F6RB 4DR5B 1SZTA 5L3CA 1BCCH 4UV8A 5DM6V 3ETGA 1ZWIC 3QF7A 4D6TH 1RSOA 4PHZA 1KYOF 4WF9V 4O4HA 2UXNA 2BTQB 3M7MX 2GTSA 2O57A 1KP3A 2F43G 5LGUA 3FX7A 5CN0A 3AG1C 4OPAA 3JCUZ 2AXTZ 3FB6C 1WB8A 4LF4O 5E79Z 3B77A 1H2LA 4ZI7A 4CS4A 3JALB 3LSSA 4QIWF 4O4IB 3TJTA 2Q67A 4UVBA 5GW7A 3E8FA 3R66A 4H37A 2Z3YA 5JQGA 1M56B 1AR5A 4TV8A 4TV9A 4X88A 4CC5A 4JTCB 4MTXA 1B6QA 2XUMA 4Q6GA 4JAVA 1XOUA 4B3MO 2Y4UA 4B3MB 1FAFA 2ITDC 4X1IB 2K9PA 1K33A 3CCSV 4Z1VA 1OCOB 4KHPO 3F5WC 4HBNA 1KECA 5IJ0A 2Y69B 2UU9B 1TA8A 2UXBB 4YJ3B 4O2BB 5FL7G 5CA0A 4DRXA 1KC8W 3ZRXA 4ZOLA 4LFBB 4DV5O 2Q73A 3SYOA 3X2QC 1Y76A 4D7TA 2ZE5A 5CA1B 2HJFC 3LDDA 4QNHB 3CRQA 4O4JB 1D5NA 3WG7C 5L3BA 1RPRA 3CYOA 1K4DC 2DYSC 3SPHA 2ZE6A 4JI7B 1AVMA 1TUEB 4IT5A 3B4SA 3K06A 4X1KB 1E79G 3CS5A 5CA1A 3D36A 3DSQA 4N21A 4JI0O 4LF6B 2P90A 1M5IA 2RDCA 2M6YA 2ODMA 4DRXB 1FFXA 1RP3B 4UXNA 4WCEV 4IYHA 2E75B 3J80N 1Q5OA 3LNMB 4MVRA 3K9AA 3W7SA 3ZMTA 4RO2A 3ZHTA 5JQGB 4HNAA 2BOCC 4F4LA 1NQTA 3DC6A 4JI4B 1N34B 3ZIAG 1XNRB 4I55B 5B1BB 4R50A 2EIMC 2M7WA 1H8HG 5IT9N 1OCCB 2X6BA 4IIJB 4YIOA 4K0KO 3ZMUA 3CB2A 3FAVA 3N2KB 2Q4PA 4FLTA 3STZC 1SQQH 5JCOC 4OXSA 4DR1B 4LWSA 4XDKA 2QR4A 4X62B 4JI8O 1YI2V 2XASA 3ZN1A 2Y4TA 2UUCB 3JD0A 4J9ZB 4PJ0Z 1N33B 1U96A 1RSOB 3QG5A 3APQA 3T1YB 1N36O 2PZSA 3A2FA 3SGIA 4PD4F 5CBGA 4FVMA 1PPJH 5BMVB 3QTCA 2UXBO 2JDIG 2YIBA 4PI0A 4MW8A 2EINC 1WB7A 1QVGU 3HKEB 3BVOA 4NYKA 2P4VA 3AG2C 3OEHG 2QEXV 4JASA 1TVKB 2GDSA 1CEZA 3ABKB 4A5UB 4CC6A 4KXRA 4JI0B 4LF6O 5J2TB 4JPRA 5IY5B 1AJPA 1S77D 2WLHA 1YTFB 1QU7A 1HR0O 3IC7A 3ETEA 2HKOA 3AG4B 4JTDB 3RBZA 5KHGA 4E4EA 1H2NA 4C7UA 2Q7GA 3CRAA 5LHIA 4TOIA 1IZ3A 2KB1A 1UPGA 4E2LA 2OTJV 3X2QB 4CH3A 4LF4B 5JJEB 3C3TA 1JJ2U 1SKVA 4LF9B 1Q86W 2BE3A 3L9DA 4RUEA 1ZTEA 1MNGA 2ZD9A 4QE9A 5KHIA 2ILMA 4DR2O 4LFCO 1SERA 3RYFA 1G4YB 3IAYA 2DYRB 1V54B 1AI6A 2OT5A 3BCCH 4FZ1A 1FYJA 4TSFG 5BMVA 4DR4O 2JJ2G 5J9PC 2WLLB 5LYJA 2IU0A 3KCXA 2QWOB 3JASB 4BW5A 4YHHO 4JZGA 5IE9A 2GHYA 2WLLA 1PM9A 1AROP 5LMUB 3MHSC 2FYUH 2B5UA 3NXSA 4Z1MG 2NR5A 1K9MW 3ABTA 2UUBO 5ITZB 1SESA 5LBQA 2ZM6O 5C8YB 1X4TA 1HP8A 4DV6B 5FPRA 4B3TB 4YJ2B 3BFRA 1GM8A 2F1MA 4I7ZB 2JS5A 4DR6B 4X89A 2XHBA 1N0JA 4IIJA 3F7VC 1EN6A 2YI9A 2QKAA 1GTOA 1K4CC 2ZE8A 1NT2B 1SA0A 3T1CA 2YUAA 3O9OA 4PA7A 4GZRB 2LW7A 1Q6UA 3OE7G 4D7SA 2DYSB 1VQKV 1NKDA 4K8ZA 1PP9H 3A0RA 4JI1O 1K5QA 4LP8A 3DGEA 2HR3A 3SYCA 4MVOA 5LOVA 5K1XA 4H44B 5CBHA 3OTOO 2EIJB 1XILA 1QR9A 3DTUB 3ZRWB 3GVMA 3FB8C 1AP6A 5JVDB 1GM7A 3OT7A 1OV9A 2LQTA 3G4SV 2AHYA 3EVKA 4JV5O 4FFKA 1HNWO 2RNBA 4EFEA 4TT3G 3HKCB 4LFAB 2A0LA 4ZIBA 2FMLA 1N0NA 4X64B 4ASUG 1H8EG 3B8NA 4FLZA 4LCUC 3CEIA 3MD0A 3ZHQA 4DV4B 2Q68A 2DJVA 5J2TA 5CA0B 4FLYA 4YHHB 3ZMSA 1TUBA 5B1AC 1BHAA 1HDJA 3G6BA 1IXBA 4WFBV 1KP2A 3JD4A 4GKJB 3E8BA 3ASNB 3G6EV 4TQFA 5EZYB 1JPXA 1ZX3A 4GCZA 3ASNC 3K0GA 4DV7O 2KG7B 3LSQA 4JI8B 1J95A 2ZQMA 4NB5A 1XHXA 1IURA 4I50A 2WPDG 4J7ZA 4DV1O 2D3OW 2JS3A 5B1NA 1THZA 4JI2O 4WFGA 4CS2A 5IYCO 3GWKC 1SRYA 1JOYA 1M93A 4FIPC 4FPPA 2Q7EA 5CA3A 2ARHA 1WAZA 4JGSA 1K5SA 4AQYO 2F95B 3SDLA 5KUMA 2WLIA 1BMFG 2CGOA 2H94A 1BE3H 1SC5B 1VF5B 1Y66A 2MK3A 3AG3C 3CD6V 1K34A 3ZX6A 1FPOA 4U3JB 3LDCA 3AG3B 1WPXA 3FB7C 1KMIZ 4FMTA 2XAFA 4MS2A 1AJQA 3QO7A 1W59A 1TAEA 1DTOA 3E35A 2ZIOA 1KQSU 4WFHA 3CCRV 3RYCA 1Z2GA 3ZCCA 1MZEA 3E2EA 5CB4A 4AQYB 2CH7A 1VMGA 4DV5B 1MZFA 5KLVH 4CH4A 4OPHA 1P49A 3AK1A 1GO3F 3ETQA 2EJ7A 3UT5B 3D3IA 4LWSB 1AR4A 3E22B 1SS3A 1EN5A 1NU1H 2WLNA 2JEXA 4DV1B 4DW0A 1MSWD 4DV2O 4EB6B 1COWG 2ZDIC 4O2BA 4DR2B 4JYCA 3B09A 1Q7YW 4G28B 1BS3A 4Z2WA 1OHHG 3K5NA 3E83A 1NR7A 1DK1A 2LGQA 1NTZH 3TGUH 3HKDA 1JA8A 1OJHA 3SPIA 2A7WA 3CSXA 2R72A 4X9QA 3JCZA 4LF9O 4K0KB 2XAQA 2JGDA 2E76B 2HFEC 5KAIZ 3C90A 3CC7V 1K3EA 4J7JA 1W2BU 5IYDO 4CH6A 4LBEC 3SYAA 2CTRA 1YZBA 5KX5B 3ABMB 3IC9A 4LR3A 4LF5B 1R6TA 1B04A 4L8JA 2YXHA 1I7FA 1YXBA 4LH6A 3JYCA 5IYBO 4I4TA 2JK5C 4G27B 1L0NH 2JIZG 3L73H 4X20B 1FFXB 5BR8B 4EB6A 5LXTA 1DF5A 5BR8O 2CE4A 2ETNA 2DQ3A 3ML0A 1S3JA 1GK9A 4I0XA 1N32B 1FXKC 1FJGO 1HNXO 1VF6C 3UM7A 1YJWV 1BT8A 1YCIA 3JATB 4DUZB 4KUMA 1JMKC 2F4VO 3CWBH 4QPKA 3Q4HA 4WFFA 1J5EB 2R9AA 1VQ8V 3M8AA 4AILC 4DR7B 1XEQA 1YVWA 1PNKA 1AR1B 4LFBO 2PF4E 2X7RB 1OZ0A 1WA8B 2WA3A 3RYCB 4H13B 3CCLV 5JH7A 1T5EA 4JTAB 4AI8A 1GMGA 2B1IA 4R7CA 2P4KA 3JAKA 2XAJA 4N23A 1SQXH 3VBBA 1VARA 3VQWA 1VQMV 4TV8B 4YXWG 5FPOA 1V55B 3L71H 2EX3A 4ABMA 3EXAA 2IW5A 1KD1W 1FFTB 2FL4A 3H1HH 1P4RA 3ASOB 5KA6A 4JYAB 3OR7C 3TCUA 1AJNA 3ZHRA 3CJHA 2EIKC 3CMAV 3IJ4A 1D5AA 3CC2V 1IBMO 2Y0IA 4I5SA 4TUYA 4FFBB 5LP6C 3JALA 5LMUO 1Z5WA 1FXHA 5BY1A 4GLXA 2UXXA 1S5LZ 4GX0A 4H0LB 2ZT9B 4MVSA 1NJIW 2V1DA 1L8DA 1WP8A 1N4CA 3K3WA 1UFIA 1UJWB 4ICGA 4GKKO 1M9NA 2N04A 4B7EA 1VQ4V 4B3SB 1NZ6A 4DV3B 4J10A 3E22A 2JVDA 3IGAC 1G8MA 2OCCC 4X64O 2Q6AA 4UCTA 4BIUA 4LFAO 5EIBD 4QPJA 2A9HA 4IL6Z 2D2CB 4RUFA 5EZYA 3CPWU 1NH2B 2WWWA 4ZHQA 1YDXA 3F5TA 1JQ0A 2HVKC 3L72H 4JI5O 1YTFD 1B06A 5GTHZ 2K1EA 1SQGA 3K9SA 3R65A 5KMGB 4J11A 4CZZA 4HAMA 2CH7B 2DMXA 1WLEA 3S3XA 4YIPA 1H2MA 2GTAA 2AHZA 5CB4B 1URFA 4PDLA 4I0XB 1ZSPA 3ZRWA 4PA3A 1BQZA 4NTYA 1FKAO 3MHHC 4DR4B 3ZS8C 3H1LH 2QWQB 3AG1B 5IJ0B 3T2MA 2QM7A 1PL4A 5EYPB 2CTPA 5GTIZ 4B3TO 1Q6IA 2PUSA 1F4NA 1JVMA 2Q0OC 2YICA 4RQFA 4X1IA 3HKBB 4XBFA 3OMAB 4NKGB 2WLIB 1NTKH 5GONA 4O4LA 3CC4V 3OW2U 3H1JH 5KHKA 1OCCC 4MSWC 2EINB 4EKWA 3T1HB 1IVSA 2IH3C 2VRZA 4MVMA 5HFLA 3U10A 3I55V 4O4IA 1I94O 5E1AC 1FD9A 1XQ8A 1IBMB 3J7AU 2XTAA 4U7OA 5H6RA 3A0HZ 2VQEB 2QJ1A 1KKDA 3UQ8A 4I50B 2IU3A 3G80A 4JYAO 4DUZO 4QGPA 1SQFA 1SZXA 3C3SA 3CMEV 1QBZA 4NXNB 5DN6G 3AEIA 4BR6A 2QWNB 4J7KA 3CCMV 2VQFO 4J80A 1MOFA 4X65B 4O2AB 3VQYA 1PNLA 2HP8A 1U97A 1W0JG 5LP6B 2HJDA 3LNNA 2PYLA 1QLEC 3ABKC 4UCRA 4U3FH 2CDYA 3K79A 5LYJB 4UFZA 3CCQV 2F93B 2DN9A 3S3WA 1XREA 3RYHB 2IJHA 4DR3B 2ZDIA 4U3JA 1US6A 2Y69C 1RM1C 3K5MA 2WAMA 2P06A 4PDVA 3DXRA 1K7DA 4RQEA 2UUCO 5LOVB 2PI5A 3WU2Z 1F4MA 4BIOA 1H2GA 1NR1A 2XOKG 4PV1B 4X1YA 3OMIB 2X6CA 5J2UA 4PELA 1XI1A 1FXVA 1ZLZA 4UUJC 4O4LB 2VS0A 2CAZC 2QWPB 3KG2A 4UCVA 1G6UA 2HLDG 2N74A 2W0XA 3UO2A 4LF5O 3K59A 1O9GA 4IHJA 3RYIA 2X6AA 1L1FA 3SPCA 2ZXWC 1XMQB 3AG7A 1Z5VA 2UXDB 1LNQA 1Y6XA 1IBKB 2OYQA 3ZN0A 1TVKA 5L3GA 3BA9A 3GB7C 3ETDA 5BZBA 4J9YB 5C8YA 1GAXA 4MTGA 2C2AA 5LP6A 5L3EA 3ZHVA 1XBLA 1ENVA 5B66Z 3JSNA 4YJ2A 5KMGA 4DK0A 1RFYA 1NS1A 3G71V 3E89A 3FD9A 2WA4A 3WB1A 1I08A 1M56C 1TUBB 5EIBC 5ITZA 2IM9A 3SJAC 2V4DA 2JRIA 3H1IH 1OCRB 1TGOA 1MSDA 3SJBC 1SQPH 3RN4A 1XMOB 2LW1A 5K1PA 4FLXA 1M90W 3VQXA 5IJ9B 3W7WA 3CRCA 3RYFB 2Q7HA 1NVPB 2A06H 1YITV 1JJOA 2PYJA 3RYIB 3CCJV 3FKSG 3DC5A 3M99B 1ORQC 3D36C 3STLC 3P3NA 1N32O 3QNEA 2RMKB 1O9HA 2PY5A 1VQ5V 3E86A 1DLBA 2LGWA 2R9IA 2EZPA 5KAFZ 3RGBA 3OMNB 4I9QA 3FAVB 1WJZA 4UVCA 2W6IG 2HG5C 2XT9A 4EFBA 4JI7O 2EIJC 4K3AA 2YIBD 2HHHO 2EILC 1Q8IA 4X66O 1M57C 3O65A 3G67A 1Q90D 3OGCC 3JD3A 3K08A 3FYIB 3VOUA 1X59A 2EJRA 1FS0G 4PDRA 1I94B 2LFRA 1EZJA 4UCUA 3ZMZA 1XMOO 4X66B 2VWJA 3CP1A 1VQPV 3BPZA 3W7UA 5A9GA 3BEHA 3BY6A 4KHPB 1YEWA 2DYRC 1YIJV 4DV4O 4ZBMA 2E3CA 1B3QA 4JF3A 2Q69A 3THOA
chains in the Genus database with same CATH topology
1VQOV 1F51A 4KUMA 4G2KA 5CBGA 4QPKA 4BAYA 4WFFA 3OEEG 1K97A 1VQ8V 2Z5UA 2WLMA 2HVJC 3TETA 1E1RG 5EC2C 2JDIG 1PNKA 1AR1B 4GX5A 4MW8A 2OTLV 2X7RB 2EINC 1QVFU 1QVGU 1M57B 1OZ0A 1F23A 3ZMVA 1K92A 3OUSA 1Y4MA 3CCLV 3EHBB 2XNDG 3OEHG 3AG2C 2QEXV 4JASA 2NNUA 3B8MA 4JTAB 3ZRVA 3ABKB 1FXKA 1CEZA 1VQ7V 3OUFA 1GMGA 1OCZC 4RAIA 1NVPD 2B1IA 4R7CA 5EK0A 4JPRA 1S5HC 2XAJA 3QO8A 5IY5B 3LDEA 1AJPA 2LP7A 2WLHA 4N23A 1YTFB 1S77D 4XDJA 4L87A 2PI4A 4HZ3A 3VBBA 3IC7A 3ETEA 2HKOA 2X0LA 3AG4B 1VQMV 4YXWG 4P9OA 5C93A 1RPOA 4JTDB 1OCOC 1V55B 3RBZA 5L3DA 1R73A 1BHBA 1R3IC 2IW5A 1KD1W 5LHIA 1FFTB 1R6NA 2KB1A 4E2LA 2OTJV 1P4RA 3ASOB 3P32A 5KA6A 3X2QB 3F7YC 3OR7C 2Y48A 1S76D 2ATKC 2IH1C 5B1BC 3TCUA 1AJNA 2NLJC 4HYOA 2EIKC 5LGNA 3CMAV 3E8HA 1JJ2U 1JX9A 1PD3A 1Q81W 2IJIA 3CC2V 2YSUB 5KA5A 2IJJA 4I5SA 3AG2B 1Q86W 1YJNV 2DQ0A 1QCEA 1FXHA 3OFNG 1YSCA 4RUEA 2UXXA 1QLNA 4GX0A 2H8PC 2CK3G 4MVSA 2ZD9A 1NJIW 2V1DA 4QE9A 3SYPA 3K3WA 1UJWB 4P9PA 1M9NA 1DF4A 3CXCU 1VQ4V 1SERA 3FYEB 5EC1C 1G4YB 4ZKIA 2DYRB 3TK1A 1YHQV 3IGAC 1G8MA 2OCCC 1Q82W 2Q6AA 1E1QG 1AI6A 1V54B 4BIUA 2OT5A 4QPJA 3SYQA 5EBLC 2A9HA 2IJKA 4RUFA 4MVQA 4TSFG 4LC1A 5B1OA 3CPWU 2JJ2G 5J9PC 1NH2B 1FXKB 1IXMA 2WLLB 2WWWA 4FJCC 2IU0A 1XL4A 2W0FC 1JQ0A 2HVKC 4FK5C 4BW5A 3FB5C 1SETA 3WG7B 1YTFD 3OAAG 2K1EA 2EBOA 2GHYA 1ROPA 3R65A 3CCEV 2ITCC 2WLLA 1AI5A 4QE7A 3ZJZA 5EBMC 1AROP 2EILB 3JD1A 4UVAA 3MHSC 3SPJA 4R6ZA 4CZZA 2B5UA 3NXSA 3UKMA 4HAMA 5KUKA 4Z1MG 1WLEA 1K9MW 2WLJA 1NBMG 3ABTA 1SESA 2EZOA 5LBQA 1VQLV 2AHZA 2QA4V 3IFXA 4PDLA 3H01A 3ZRWA 4PA3A 2A79B 2QKSA 3AG4C 5LGTA 3MHHC 3W7TA 1GM8A 1I5XA 1AI7A 4X89A 3SPGA 1H38A 3OM3B 3AG1B 3F7VC 1YJ9V 3T2MA 2QM7A 1GTOA 1K4CC 5CMUA 4JAUA 4RQFA 1F4NA 1JVMA 3T1CA 1VQ6V 1I5YA 4MT8A 3RVYA 4XBFA 1R3JC 3OMAB 4PA7A 2WLIB 3CCUV 3ABLB 2JEUA 3CC4V 3OW2U 3OE7G 1OCCC 4MTFA 4WFEA 3E8GA 1AI4A 2DYSB 1QR8A 2EINB 3P30A 1NKDA 4MSWC 4EKWA 1VQKV 3RW0A 3A0RA 2WSSG 1W0KG 1K5QA 4MVUA 4LP8A 4H33A 4MW3A 3DGEA 2HR3A 3SYCA 5B1AB 2XAHA 4MVOA 2IH3C 5CBHA 2EIJB 4MVMA 5HFLA 1QR9A 3I55V 3DTUB 3ZRWB 5E1AC 3FB8C 1GM7A 4DXWA 1NH2D 1HWYA 3G4SV 1R3LC 2AHYA 4U7OA 1OCZB 4DO2A 5LHGA 5H6RA 1JCHA 4TT3G 2A0LA 3QO5A 1KKDA 3T4ZA 2QM8A 4ASUG 2IU3A 1H8EG 4BIZA 3B8NA 2V7QG 3CMEV 1V54C 1QBZA 1M1KW 2YEVB 3ABUA 5DN6G 4LCUC 4P2ZA 3AEIA 3MD0A 2BOBC 1R3KC 2QTOA 3CCMV 2Q68A 1MOFA 1GM9A 1PNLA 1W0JG 2R9RB 1QLEB 3HPLC 3ZMSA 4U7NA 2P6JA 4UV9A 1N8RW 1CPYA 5B1AC 4WFAV 1BHAA 2YEVA 1QLEC 5B3SB 1CP9A 3LUTB 3ABKC 5H9CA 4WFBV 1KP2A 3JD4A 1PL0A 1EFRG 1OCRC 2DWEC 3E8BA 3K79A 3ASNB 3CCQV 3G6EV 3W7XA 2B1GA 3WFVA 1JPXA 4GCZA 3ASNC 1SZTA 5L3CA 2IJHA 3K0GA 3LSQA 4UV8A 2ZDIA 5DM6V 3ETGA 1ZWIC 5IY5C 2Y69C 1RM1C 1MG1A 2WAMA 4PDVA 4WF9V 1J95A 2UXNA 2ZQMA 3PJSK 1K7DA 2WPDG 1S72V 4RQEA 1KP3A 3ASOC 2F43G 2WLKA 5LGUA 2FTKA 2PI5A 4GT1A 1V55C 5CN0A 1F4MA 2W6JG 1H2GA 3AG1C 4TWKA 1NR1A 2XOKG 2EIKB 2D3OW 3FB6C 3OMIB 3GWOA 2X6CA 4CBCA 5B1NA 1THZA 3B77A 4WFGA 5IYCO 5H6QA 4PELA 1FXVA 3LSSA 4QIWF 4UUJC 1SRYA 2Q67A 1JOYA 4UVBA 3ABLC 4X8AA 5GW7A 3E8FA 4MVZA 4FIPC 4FPPA 3KG2A 4GX2A 4H37A 2Z3YA 1M56B 5CA3A 2HLDG 3K04A 2QE7G 4JGSA 4X88A 5CBFA 1K5SA 2ZXWB 3HB3B 3ABMC 4JTCB 4MTXA 1B6QA 4XDLA 2GSMB 4JAVA 5KUMA 1K73W 1GKFA 3EFFK 2X6AA 4MTOA 1L1FA 3SPCA 2ZXWC 5EBWC 1K8AW 2WLIA 1BMFG 2ITDC 1LNQA 1K33A 2H94A 4I9WA 3ZN0A 3CCSV 5L3GA 2OCCB 1Y66A 1OCOB 2MK3A 3AG3C 3CD6V 1K34A 3GB7C 3ETDA 4KP4A 5BZBA 4J9YB 2ZR3A 3F5WC 3LDCA 3AG3B 1KECA 2Y69B 1WPXA 4MTGA 3FB7C 2C2AA 5L3EA 4FMTA 1ENVA 1R6KA 2XAFA 4MS2A 1AJQA 5FL7G 3QO7A 3OR6C 1XL6A 4PA9A 5IDJA 1KC8W 4JYBA 1S0VA 1DTOA 3E35A 3ZRXA 3SJQC 3G71V 1KQSU 4WFHA 3E89A 3SYOA 3CCRV 3X2QC 3ZCCA 4Q20A 2HJFC 3LDDA 4QNHB 1M56C 3E2EA 3ZRSA 3WG7C 5L3BA 1RPRA 3CYOA 1K4DC 2DYSC 1OCRB 3SPHA 2ZR2A 1BL8A 1TUEB 1GO3F 5B3SC 3K0DA 3K06A 1E79G 3D3IA 1M90W 3D36A 1VQNV 4N21A 1MABG 2P90A 2WLNA 3W7WA 2JEXA 4R8CA 4GX1A 4PA6A 5LHHA 1MSWD 1NVPB 1COWG 1YITV 2ZDIC 2DWDC 4UXNA 4JYCA 4WCEV 3CCJV 1Q7YW 3FKSG 4G28B 1EBOA 1OHHG 3E83A 3M99B 1NR7A 1ORQC 3K03A 3LNMB 4MVRA 3K9AA 3STLC 3W7SA 3SPIA 3JD2A 3ZMTA 3QNEA 4RO2A 1PKXA 1VQ5V 3E86A 2BOCC 1DLBA 1PNMA 2R9IA 3JCZA 2EZPA 4P30A 1NQTA 4F4LA 2XAQA 3OMNB 3ZIAG 1VQ9V 5B1BB 2HFEC 4QJFB 4R50A 2EIMC 2M7WA 3CC7V 1H8HG 1K3EA 4UVCA 2W6IG 2DW4A 1P7BA 2HG5C 1W2BU 1OCCB 2X6BA 5IYDO 2EIMB 4LBEC 3SYAA 3ZMUA 2EIJC 3ABMB 4KFMA 3STZC 2EILC 4OXSA 1M57C 5HFMA 3OGCC 3JD3A 4PDMA 3K08A 3I56V 3FYIB 3JYCA 4PA4A 3VOUA 5IYBO 2JK5C 2EJRA 2P67A 2XAGA 4XDKA 5L3FA 1FS0G 1RM1B 4G27B 4PDRA 2LFRA 1EZJA 3ZMZA 3CP1A 3RVZA 1YI2V 1VQPV 2P7TC 3W7UA 2JIZG 2XASA 3ZN1A 3T4DA 3CCVV 1DF5A 3BEHA 3BY6A 3JD0A 2DQ3A 2DYRC 3ML0A 1YIJV 4J9ZB 1S3JA 1GK9A 1FXKC 2JJ1G 4ZBMA 4JF3A 2Q69A 3UM7A 1YJWV 2LFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  1IXM A;  1F51 A;  5B1N A;  4MT8 A;  3ZRX A;  4QPK A;  4GCZ A;  3ZRW B;  3ZRW A;  2P67 A;  5IDJ A;  4U7O A;  3ZCC A;  4Q20 A;  2LFR A;  2LFS A;  1JOY A;  4ZKI A;  4KP4 A;  4U7N A;  4FPP A;  3TK1 A;  3A0R A;  4JYC A;  4JAV A;  4I5S A;  5C93 A;  3DGE A;  4BIU A;  2QM8 A;  3NXS A;  4QPJ A;  2QM7 A;  2C2A A;  4BIZ A;  4FMT A;  2FTK A;  4JAS A;  4GT1 A;  3ZRV A;  4MTX A;  4JAU A;  3P32 A;  4LC1 A;  5B1O A;  3D36 A;  4JYB A;  3MD0 A; 
#chains in the Genus database with same CATH topology
 1MA1 A;  1F51 A;  3ZHU A;  4JYY A;  4BAY A;  1WP7 A;  3RYH A;  5DEC A;  3BAA A;  2WLM A;  2HVJ C;  3CE2 A;  1E1R G;  5EC2 C;  3TET A;  4GX5 A;  2YI8 A;  1JFF A;  2OTL V;  1EN4 A;  1QVF U;  1GN6 A;  3WB0 A;  1F23 A;  1K92 A;  3JAS A;  1Y4M A;  3OUS A;  3BRC A;  3EHB B;  1AIL A;  2XND G;  3B8M A;  4FM0 A;  3UCS C;  3OUF A;  1OCZ C;  1NVP D;  3N2G A;  2VWK A;  5EK0 A;  1GN3 A;  1S5H C;  3NR7 A;  3LDE A;  5FNV A;  4OX9 O;  1EM1 A;  2PI4 A;  4JZ2 A;  1VF7 A;  4I4T B;  2X0L A;  3ICX A;  4CH5 A;  1RPO A;  2GUZ A;  1R73 A;  4JI3 O;  3APO A;  1IX9 A;  5IYZ A;  3P32 A;  4NTX A;  1H2K A;  4UCS A;  3F7Y C;  2Y48 A;  5B1B C;  2NLJ C;  1KUQ A;  4WBN A;  2ADP A;  2ZNJ A;  3LSU A;  3JAM N;  5GON B;  3TXQ A;  4NXN O;  1Q81 W;  2IJI A;  2YSU B;  5KA5 A;  3AG2 B;  3HR0 A;  2DQ0 A;  3ZED A;  2R70 A;  3UO3 A;  1H2S B;  4DV3 O;  3L74 H;  2RQ6 A;  3SYP A;  2F66 C;  1JR9 A;  2B9Z A;  4P9P A;  4BW9 A;  4NVP A;  1DF4 A;  1ZL8 A;  3AK3 A;  3FYE B;  4K35 A;  3JAW A;  5A2Q N;  4ZKI A;  2CTQ A;  4JI2 B;  1KKC A;  1VIB A;  1E1Q G;  1NI8 A;  3SYQ A;  2IJK A;  3J81 N;  4MVQ A;  4FLU A;  4LC1 A;  4O4J A;  1XL4 A;  1IDS A;  1SET A;  3WG7 B;  4X1K A;  1BQ0 A;  3MDS A;  1QHT A;  4JAA A;  2EIL B;  3JD1 A;  3SPJ A;  4R6Z A;  3RWR D;  1Q3E A;  3AK2 A;  5KUK A;  3KCY A;  4YJ3 A;  3Q4H B;  1NBM G;  3L75 H;  3D3Q A;  1GN2 A;  2H3O A;  2E74 B;  4DR3 O;  2NN4 A;  2UUA B;  4DV0 O;  2RCV A;  3IFX A;  2KQX A;  4JI1 B;  2A79 B;  5LGT A;  3W7T A;  1I5X A;  2YXY A;  4DK1 A;  2BTO A;  1AI7 A;  2MW2 B;  5KX5 A;  3SPG A;  2LO1 A;  4DW1 A;  3U0Z A;  2E5L O;  1YJ9 V;  1YF2 A;  2YC0 A;  4FLW A;  5CMU A;  2HEP A;  1SQV H;  3BA8 A;  4JI5 B;  1VQ6 V;  2QSA A;  2VQF B;  2G38 A;  3RVY A;  3K5L A;  2HHH B;  1XUQ A;  1R3J C;  3ZHS A;  3N2K A;  4MTF A;  3P3P A;  3P30 A;  1QR8 A;  2P22 C;  3PN1 A;  4LF7 O;  2F23 A;  1IBL O;  4MW3 A;  4LF8 O;  4B3R B;  5B1A B;  1KU9 A;  1SF9 A;  5LMN O;  2ZIN A;  2QDO A;  5LA6 B;  4FZ0 A;  1OCZ B;  4DO2 A;  5LHG A;  3CRM A;  1Y74 B;  2OCH A;  5KHH A;  2QM4 A;  3QO5 A;  4DV0 B;  4O4H B;  4BIZ A;  2ZNI A;  4FLV A;  3T1Y O;  1QNM A;  3ABU A;  2BOB C;  1ZUQ A;  2L6L A;  2QTS A;  3JAK B;  1WNS A;  1SQB H;  1GM9 A;  3A8T A;  1QLE B;  1ZAU A;  3HPL C;  4RWU A;  1N8R W;  1CPY A;  4LFC B;  4X62 O;  2YEV A;  5LL6 Y;  1WA8 A;  1CP9 A;  3LUT B;  5H9C A;  1Y67 A;  1JFF B;  4DR1 O;  3JAW B;  1OCR C;  3W7X A;  5JJN B;  2B1G A;  3WFV A;  3L70 H;  4X20 A;  2Y0P A;  3JAR B;  3OGI B;  1LR1 A;  2ZIM A;  2ZKO A;  1S5J A;  5IY5 C;  2QKC A;  1KBH A;  5JVD A;  1MG1 A;  4TQD A;  1XNR O;  3PJS K;  1ZL8 B;  1S72 V;  3ASO C;  2WLK A;  4FM2 A;  2FTK A;  4GT1 A;  1V55 C;  2W6J G;  4DR7 O;  4TWK A;  2EIK B;  2RJZ A;  2ADQ B;  3QVN A;  3GWO A;  4CBC A;  2Q8V A;  2JGU A;  4TV9 B;  4UB8 Z;  5H6Q A;  4PI2 A;  4X8A A;  3ABL C;  1FJG B;  4MVZ A;  1VF6 A;  4GX2 A;  4NXM O;  3K04 A;  2QE7 G;  4KL1 A;  5CBF A;  2ZXW B;  2KG7 A;  3HB3 B;  3ABM C;  4XDL A;  2GSM B;  1K73 W;  1GKF A;  3EFF K;  4MTO A;  2JGD B;  5EBW C;  3N2G B;  1K8A W;  2KSD A;  5IWA O;  4I9W A;  2PGG A;  2AW9 A;  2OCC B;  2UXC O;  2AZ2 A;  4KP4 A;  4W4L A;  2AGA A;  1N34 O;  2ZR3 A;  5FNV B;  2BSK B;  1KB9 F;  4F6R A;  2PTM A;  2OIG A;  1R6K A;  2Q9L A;  3OR6 C;  1N33 O;  1XL6 A;  4PA9 A;  5IDJ A;  1S0V A;  4JYB A;  3SJQ C;  2LJ2 A;  3OD4 A;  2DE0 X;  1DGS A;  3KKY A;  4IYI A;  4Q20 A;  3UT5 A;  3U11 A;  3BAB A;  3ZRS A;  2YXL A;  1BSM A;  1NTM H;  3CHX A;  3HKC A;  2ZR2 A;  2ZCE A;  1BL8 A;  5B3S C;  1VP7 A;  3K0D A;  2CTW A;  1QQC A;  4DV7 B;  1VQN V;  1MAB G;  4R8C A;  4GX1 A;  4PA6 A;  5LHH A;  2DWD C;  3MAQ A;  1IBK O;  1EBO A;  1XMQ O;  3K57 A;  1L0L H;  1N36 B;  2Q0A A;  3K03 A;  3JD2 A;  2P5O A;  4IGG A;  1PKX A;  3B2E E;  3FFQ A;  1PNM A;  1J5E O;  4P30 A;  2F4V B;  1VQ9 V;  1P84 F;  4QJF B;  1HNX B;  3T1H O;  1V9P A;  4LNU A;  2DW4 A;  1P7B A;  4X1Y B;  2EIM B;  3CXH F;  3TXS A;  4KFM A;  5JWP A;  1G1X B;  5HFM A;  1HNW B;  1SA0 B;  4PDM A;  3I56 V;  4PA4 A;  4WBN B;  4YY3 B;  2P67 A;  2XAG A;  3K5O A;  5L3F A;  1RM1 B;  3VQV A;  1M4U A;  4GUN A;  3RVZ A;  5IYZ B;  1XHZ A;  2P7T C;  4OX9 B;  3T4D A;  4F6E A;  4JI4 O;  3CCV V;  5JCO A;  2GUZ B;  2JJ1 G;  3N27 A;  5AG2 A;  1BZK A;  2LFS A;  2UU9 O;  1VQO V;  2A3Q A;  4G2K A;  5KHJ A;  3H1K H;  3OEE G;  1K97 A;  2Z5U A;  4O2A A;  5LMN B;  3JSL A;  3CX5 F;  4X65 O;  4DR5 O;  4B3R O;  3SJC C;  1M57 B;  4NXM B;  1IBL B;  3ZMV A;  4NTW A;  3OTF A;  2NNU A;  2QGN A;  3ZRV A;  1FXK A;  1VQ7 V;  4RAI A;  4BWA A;  4NR1 A;  3QO8 A;  4DV6 O;  1R1B A;  2BSK A;  2LP7 A;  4XDJ A;  4L87 A;  2VQE O;  4HZ3 A;  2ZE7 A;  2UUB B;  1HW7 A;  4P9O A;  4GKK B;  5C93 A;  2E5L B;  2IBZ H;  1OCO C;  5L3D A;  1BHB A;  1R3I C;  3BHP A;  1R6N A;  4B08 A;  2GV9 A;  2Q5Z A;  4IHJ B;  1S76 D;  2ATK C;  2IH1 C;  4GYC B;  2YS8 A;  4HYO A;  2DOS A;  5TIS Z;  5LGN A;  1PV0 A;  3E8H A;  1JX9 A;  1PD3 A;  3HKB A;  1P7G A;  1D2D A;  2IJJ A;  2RN9 A;  4DYL A;  4LH7 A;  4HNA B;  4J42 A;  1YJN V;  2OWO A;  4W4K A;  1QCE A;  2CGN A;  4CS3 A;  3OFN G;  1CXZ B;  1YSC A;  4LF7 B;  4JI6 B;  5B5E Z;  1QLN A;  4LNU B;  2H8P C;  2CK3 G;  1GN4 A;  1F7Y A;  1HNZ B;  2QWR B;  3K58 A;  3DXR B;  3CXC U;  5D5P A;  5EC1 C;  3RT3 C;  2FB5 A;  3I5D A;  3TK1 A;  1YHQ V;  5D5Q A;  1Q82 W;  3SR2 C;  5EBL C;  5FLX N;  2UXC B;  5IWA B;  4DUY O;  4FM1 A;  5B1O A;  4EEQ A;  1FXK B;  1IXM A;  4FJC C;  2CUG A;  3JAT A;  2W0F C;  5IJ9 A;  4FK5 C;  1XDC A;  1Y76 B;  3FB5 C;  2UUA O;  3OAA G;  5DED A;  2EBO A;  1ROP A;  3CCE V;  5H5N A;  2ITC C;  4ZHQ B;  1AI5 A;  4QE7 A;  3ZJZ A;  5EBM C;  4UVA A;  1XNQ O;  2Z0A A;  1HNZ O;  3UKM A;  3B40 A;  3ZBH A;  4AHC A;  2WLJ A;  4DR6 O;  5H2F Z;  2EZO A;  1A32 A;  1VQL V;  4JV5 B;  2YDE A;  2QA4 V;  1XNQ B;  1GRJ A;  3H01 A;  2OIE A;  5F2V O;  2QKS A;  3AG4 C;  3OTO B;  2ZM6 B;  4B3S O;  4GKJ O;  2BCC H;  2UXD O;  4J41 A;  1Y74 A;  3D8C A;  1H38 A;  3OM3 B;  5LA6 A;  2GBO A;  1WN7 A;  4I55 A;  4JAU A;  4TUY B;  3A0B Z;  4B7K A;  1I5Y A;  4MT8 A;  3CCU V;  3ABL B;  2JEU A;  4WFE A;  3HKD B;  1AI4 A;  3E8G A;  4ZI7 B;  5EYP A;  1Q43 A;  3RW0 A;  2WSS G;  1W0K G;  1GH6 A;  4MVU A;  4H33 A;  1LUV A;  1WPB A;  3KZI Z;  4FFB A;  2XAH A;  3CRR A;  3H9V A;  2FKX A;  2N05 A;  2YIA A;  2BTQ A;  2EUL A;  5J2U B;  4DXW A;  1NH2 D;  1HWY A;  1Q6H A;  1R3L C;  3CJH B;  1AP5 A;  4K8X A;  5JJJ B;  4OGQ B;  1VEW A;  1JCH A;  1LUW A;  4DV2 B;  1BGY H;  1AB3 A;  4JI3 B;  3T4Z A;  2QM8 A;  1I0H A;  2V7Q G;  5JH7 B;  4UCO A;  4DUY B;  1V54 C;  1M1K W;  2YEV B;  4P2Z A;  2KKW A;  1R3K C;  2L35 A;  4ZOL B;  3JAR A;  2QTO A;  2AZ0 A;  2YID A;  1MMM A;  2R9R B;  5BXZ A;  3WB2 A;  4U7N A;  2P6J A;  4UV9 A;  4LF8 B;  4WFA V;  4UB6 Z;  1EZV H;  3HKE A;  5B3S B;  4YY3 O;  1PL0 A;  1EFR G;  2DWE C;  1HR0 B;  4JI6 O;  5LXT B;  3RFR A;  4F6R B;  4DR5 B;  1SZT A;  5L3C A;  1BCC H;  4UV8 A;  5DM6 V;  3ETG A;  1ZWI C;  3QF7 A;  4D6T H;  1RSO A;  4PHZ A;  1KYO F;  4WF9 V;  4O4H A;  2UXN A;  2BTQ B;  3M7M X;  2GTS A;  2O57 A;  1KP3 A;  2F43 G;  5LGU A;  3FX7 A;  5CN0 A;  3AG1 C;  4OPA A;  3JCU Z;  2AXT Z;  3FB6 C;  1WB8 A;  4LF4 O;  5E79 Z;  3B77 A;  1H2L A;  4ZI7 A;  4CS4 A;  3JAL B;  3LSS A;  4QIW F;  4O4I B;  3TJT A;  2Q67 A;  4UVB A;  5GW7 A;  3E8F A;  3R66 A;  4H37 A;  2Z3Y A;  5JQG A;  1M56 B;  1AR5 A;  4TV8 A;  4TV9 A;  4X88 A;  4CC5 A;  4JTC B;  4MTX A;  1B6Q A;  2XUM A;  4Q6G A;  4JAV A;  1XOU A;  4B3M O;  2Y4U A;  4B3M B;  1FAF A;  2ITD C;  4X1I B;  2K9P A;  1K33 A;  3CCS V;  4Z1V A;  1OCO B;  4KHP O;  3F5W C;  4HBN A;  1KEC A;  5IJ0 A;  2Y69 B;  2UU9 B;  1TA8 A;  2UXB B;  4YJ3 B;  4O2B B;  5FL7 G;  5CA0 A;  4DRX A;  1KC8 W;  3ZRX A;  4ZOL A;  4LFB B;  4DV5 O;  2Q73 A;  3SYO A;  3X2Q C;  1Y76 A;  4D7T A;  2ZE5 A;  5CA1 B;  2HJF C;  3LDD A;  4QNH B;  3CRQ A;  4O4J B;  1D5N A;  3WG7 C;  5L3B A;  1RPR A;  3CYO A;  1K4D C;  2DYS C;  3SPH A;  2ZE6 A;  4JI7 B;  1AVM A;  1TUE B;  4IT5 A;  3B4S A;  3K06 A;  4X1K B;  1E79 G;  3CS5 A;  5CA1 A;  3D36 A;  3DSQ A;  4N21 A;  4JI0 O;  4LF6 B;  2P90 A;  1M5I A;  2RDC A;  2M6Y A;  2ODM A;  4DRX B;  1FFX A;  1RP3 B;  4UXN A;  4WCE V;  4IYH A;  2E75 B;  3J80 N;  1Q5O A;  3LNM B;  4MVR A;  3K9A A;  3W7S A;  3ZMT A;  4RO2 A;  3ZHT A;  5JQG B;  4HNA A;  2BOC C;  4F4L A;  1NQT A;  3DC6 A;  4JI4 B;  1N34 B;  3ZIA G;  1XNR B;  4I55 B;  5B1B B;  4R50 A;  2EIM C;  2M7W A;  1H8H G;  5IT9 N;  1OCC B;  2X6B A;  4IIJ B;  4YIO A;  4K0K O;  3ZMU A;  3CB2 A;  3FAV A;  3N2K B;  2Q4P A;  4FLT A;  3STZ C;  1SQQ H;  5JCO C;  4OXS A;  4DR1 B;  4LWS A;  4XDK A;  2QR4 A;  4X62 B;  4JI8 O;  1YI2 V;  2XAS A;  3ZN1 A;  2Y4T A;  2UUC B;  3JD0 A;  4J9Z B;  4PJ0 Z;  1N33 B;  1U96 A;  1RSO B;  3QG5 A;  3APQ A;  3T1Y B;  1N36 O;  2PZS A;  3A2F A;  3SGI A;  4PD4 F;  5CBG A;  4FVM A;  1PPJ H;  5BMV B;  3QTC A;  2UXB O;  2JDI G;  2YIB A;  4PI0 A;  4MW8 A;  2EIN C;  1WB7 A;  1QVG U;  3HKE B;  3BVO A;  4NYK A;  2P4V A;  3AG2 C;  3OEH G;  2QEX V;  4JAS A;  1TVK B;  2GDS A;  1CEZ A;  3ABK B;  4A5U B;  4CC6 A;  4KXR A;  4JI0 B;  4LF6 O;  5J2T B;  4JPR A;  5IY5 B;  1AJP A;  1S77 D;  2WLH A;  1YTF B;  1QU7 A;  1HR0 O;  3IC7 A;  3ETE A;  2HKO A;  3AG4 B;  4JTD B;  3RBZ A;  5KHG A;  4E4E A;  1H2N A;  4C7U A;  2Q7G A;  3CRA A;  5LHI A;  4TOI A;  1IZ3 A;  2KB1 A;  1UPG A;  4E2L A;  2OTJ V;  3X2Q B;  4CH3 A;  4LF4 B;  5JJE B;  3C3T A;  1JJ2 U;  1SKV A;  4LF9 B;  1Q86 W;  2BE3 A;  3L9D A;  4RUE A;  1ZTE A;  1MNG A;  2ZD9 A;  4QE9 A;  5KHI A;  2ILM A;  4DR2 O;  4LFC O;  1SER A;  3RYF A;  1G4Y B;  3IAY A;  2DYR B;  1V54 B;  1AI6 A;  2OT5 A;  3BCC H;  4FZ1 A;  1FYJ A;  4TSF G;  5BMV A;  4DR4 O;  2JJ2 G;  5J9P C;  2WLL B;  5LYJ A;  2IU0 A;  3KCX A;  2QWO B;  3JAS B;  4BW5 A;  4YHH O;  4JZG A;  5IE9 A;  2GHY A;  2WLL A;  1PM9 A;  1ARO P;  5LMU B;  3MHS C;  2FYU H;  2B5U A;  3NXS A;  4Z1M G;  2NR5 A;  1K9M W;  3ABT A;  2UUB O;  5ITZ B;  1SES A;  5LBQ A;  2ZM6 O;  5C8Y B;  1X4T A;  1HP8 A;  4DV6 B;  5FPR A;  4B3T B;  4YJ2 B;  3BFR A;  1GM8 A;  2F1M A;  4I7Z B;  2JS5 A;  4DR6 B;  4X89 A;  2XHB A;  1N0J A;  4IIJ A;  3F7V C;  1EN6 A;  2YI9 A;  2QKA A;  1GTO A;  1K4C C;  2ZE8 A;  1NT2 B;  1SA0 A;  3T1C A;  2YUA A;  3O9O A;  4PA7 A;  4GZR B;  2LW7 A;  1Q6U A;  3OE7 G;  4D7S A;  2DYS B;  1VQK V;  1NKD A;  4K8Z A;  1PP9 H;  3A0R A;  4JI1 O;  1K5Q A;  4LP8 A;  3DGE A;  2HR3 A;  3SYC A;  4MVO A;  5LOV A;  5K1X A;  4H44 B;  5CBH A;  3OTO O;  2EIJ B;  1XIL A;  1QR9 A;  3DTU B;  3ZRW B;  3GVM A;  3FB8 C;  1AP6 A;  5JVD B;  1GM7 A;  3OT7 A;  1OV9 A;  2LQT A;  3G4S V;  2AHY A;  3EVK A;  4JV5 O;  4FFK A;  1HNW O;  2RNB A;  4EFE A;  4TT3 G;  3HKC B;  4LFA B;  2A0L A;  4ZIB A;  2FML A;  1N0N A;  4X64 B;  4ASU G;  1H8E G;  3B8N A;  4FLZ A;  4LCU C;  3CEI A;  3MD0 A;  3ZHQ A;  4DV4 B;  2Q68 A;  2DJV A;  5J2T A;  5CA0 B;  4FLY A;  4YHH B;  3ZMS A;  1TUB A;  5B1A C;  1BHA A;  1HDJ A;  3G6B A;  1IXB A;  4WFB V;  1KP2 A;  3JD4 A;  4GKJ B;  3E8B A;  3ASN B;  3G6E V;  4TQF A;  5EZY B;  1JPX A;  1ZX3 A;  4GCZ A;  3ASN C;  3K0G A;  4DV7 O;  2KG7 B;  3LSQ A;  4JI8 B;  1J95 A;  2ZQM A;  4NB5 A;  1XHX A;  1IUR A;  4I50 A;  2WPD G;  4J7Z A;  4DV1 O;  2D3O W;  2JS3 A;  5B1N A;  1THZ A;  4JI2 O;  4WFG A;  4CS2 A;  5IYC O;  3GWK C;  1SRY A;  1JOY A;  1M93 A;  4FIP C;  4FPP A;  2Q7E A;  5CA3 A;  2ARH A;  1WAZ A;  4JGS A;  1K5S A;  4AQY O;  2F95 B;  3SDL A;  5KUM A;  2WLI A;  1BMF G;  2CGO A;  2H94 A;  1BE3 H;  1SC5 B;  1VF5 B;  1Y66 A;  2MK3 A;  3AG3 C;  3CD6 V;  1K34 A;  3ZX6 A;  1FPO A;  4U3J B;  3LDC A;  3AG3 B;  1WPX A;  3FB7 C;  1KMI Z;  4FMT A;  2XAF A;  4MS2 A;  1AJQ A;  3QO7 A;  1W59 A;  1TAE A;  1DTO A;  3E35 A;  2ZIO A;  1KQS U;  4WFH A;  3CCR V;  3RYC A;  1Z2G A;  3ZCC A;  1MZE A;  3E2E A;  5CB4 A;  4AQY B;  2CH7 A;  1VMG A;  4DV5 B;  1MZF A;  5KLV H;  4CH4 A;  4OPH A;  1P49 A;  3AK1 A;  1GO3 F;  3ETQ A;  2EJ7 A;  3UT5 B;  3D3I A;  4LWS B;  1AR4 A;  3E22 B;  1SS3 A;  1EN5 A;  1NU1 H;  2WLN A;  2JEX A;  4DV1 B;  4DW0 A;  1MSW D;  4DV2 O;  4EB6 B;  1COW G;  2ZDI C;  4O2B A;  4DR2 B;  4JYC A;  3B09 A;  1Q7Y W;  4G28 B;  1BS3 A;  4Z2W A;  1OHH G;  3K5N A;  3E83 A;  1NR7 A;  1DK1 A;  2LGQ A;  1NTZ H;  3TGU H;  3HKD A;  1JA8 A;  1OJH A;  3SPI A;  2A7W A;  3CSX A;  2R72 A;  4X9Q A;  3JCZ A;  4LF9 O;  4K0K B;  2XAQ A;  2JGD A;  2E76 B;  2HFE C;  5KAI Z;  3C90 A;  3CC7 V;  1K3E A;  4J7J A;  1W2B U;  5IYD O;  4CH6 A;  4LBE C;  3SYA A;  2CTR A;  1YZB A;  5KX5 B;  3ABM B;  3IC9 A;  4LR3 A;  4LF5 B;  1R6T A;  1B04 A;  4L8J A;  2YXH A;  1I7F A;  1YXB A;  4LH6 A;  3JYC A;  5IYB O;  4I4T A;  2JK5 C;  4G27 B;  1L0N H;  2JIZ G;  3L73 H;  4X20 B;  1FFX B;  5BR8 B;  4EB6 A;  5LXT A;  1DF5 A;  5BR8 O;  2CE4 A;  2ETN A;  2DQ3 A;  3ML0 A;  1S3J A;  1GK9 A;  4I0X A;  1N32 B;  1FXK C;  1FJG O;  1HNX O;  1VF6 C;  3UM7 A;  1YJW V;  1BT8 A;  1YCI A;  3JAT B;  4DUZ B;  4KUM A;  1JMK C;  2F4V O;  3CWB H;  4QPK A;  3Q4H A;  4WFF A;  1J5E B;  2R9A A;  1VQ8 V;  3M8A A;  4AIL C;  4DR7 B;  1XEQ A;  1YVW A;  1PNK A;  1AR1 B;  4LFB O;  2PF4 E;  2X7R B;  1OZ0 A;  1WA8 B;  2WA3 A;  3RYC B;  4H13 B;  3CCL V;  5JH7 A;  1T5E A;  4JTA B;  4AI8 A;  1GMG A;  2B1I A;  4R7C A;  2P4K A;  3JAK A;  2XAJ A;  4N23 A;  1SQX H;  3VBB A;  1VAR A;  3VQW A;  1VQM V;  4TV8 B;  4YXW G;  5FPO A;  1V55 B;  3L71 H;  2EX3 A;  4ABM A;  3EXA A;  2IW5 A;  1KD1 W;  1FFT B;  2FL4 A;  3H1H H;  1P4R A;  3ASO B;  5KA6 A;  4JYA B;  3OR7 C;  3TCU A;  1AJN A;  3ZHR A;  3CJH A;  2EIK C;  3CMA V;  3IJ4 A;  1D5A A;  3CC2 V;  1IBM O;  2Y0I A;  4I5S A;  4TUY A;  4FFB B;  5LP6 C;  3JAL A;  5LMU O;  1Z5W A;  1FXH A;  5BY1 A;  4GLX A;  2UXX A;  1S5L Z;  4GX0 A;  4H0L B;  2ZT9 B;  4MVS A;  1NJI W;  2V1D A;  1L8D A;  1WP8 A;  1N4C A;  3K3W A;  1UFI A;  1UJW B;  4ICG A;  4GKK O;  1M9N A;  2N04 A;  4B7E A;  1VQ4 V;  4B3S B;  1NZ6 A;  4DV3 B;  4J10 A;  3E22 A;  2JVD A;  3IGA C;  1G8M A;  2OCC C;  4X64 O;  2Q6A A;  4UCT A;  4BIU A;  4LFA O;  5EIB D;  4QPJ A;  2A9H A;  4IL6 Z;  2D2C B;  4RUF A;  5EZY A;  3CPW U;  1NH2 B;  2WWW A;  4ZHQ A;  1YDX A;  3F5T A;  1JQ0 A;  2HVK C;  3L72 H;  4JI5 O;  1YTF D;  1B06 A;  5GTH Z;  2K1E A;  1SQG A;  3K9S A;  3R65 A;  5KMG B;  4J11 A;  4CZZ A;  4HAM A;  2CH7 B;  2DMX A;  1WLE A;  3S3X A;  4YIP A;  1H2M A;  2GTA A;  2AHZ A;  5CB4 B;  1URF A;  4PDL A;  4I0X B;  1ZSP A;  3ZRW A;  4PA3 A;  1BQZ A;  4NTY A;  1FKA O;  3MHH C;  4DR4 B;  3ZS8 C;  3H1L H;  2QWQ B;  3AG1 B;  5IJ0 B;  3T2M A;  2QM7 A;  1PL4 A;  5EYP B;  2CTP A;  5GTI Z;  4B3T O;  1Q6I A;  2PUS A;  1F4N A;  1JVM A;  2Q0O C;  2YIC A;  4RQF A;  4X1I A;  3HKB B;  4XBF A;  3OMA B;  4NKG B;  2WLI B;  1NTK H;  5GON A;  4O4L A;  3CC4 V;  3OW2 U;  3H1J H;  5KHK A;  1OCC C;  4MSW C;  2EIN B;  4EKW A;  3T1H B;  1IVS A;  2IH3 C;  2VRZ A;  4MVM A;  5HFL A;  3U10 A;  3I55 V;  4O4I A;  1I94 O;  5E1A C;  1FD9 A;  1XQ8 A;  1IBM B;  3J7A U;  2XTA A;  4U7O A;  5H6R A;  3A0H Z;  2VQE B;  2QJ1 A;  1KKD A;  3UQ8 A;  4I50 B;  2IU3 A;  3G80 A;  4JYA O;  4DUZ O;  4QGP A;  1SQF A;  1SZX A;  3C3S A;  3CME V;  1QBZ A;  4NXN B;  5DN6 G;  3AEI A;  4BR6 A;  2QWN B;  4J7K A;  3CCM V;  2VQF O;  4J80 A;  1MOF A;  4X65 B;  4O2A B;  3VQY A;  1PNL A;  2HP8 A;  1U97 A;  1W0J G;  5LP6 B;  2HJD A;  3LNN A;  2PYL A;  1QLE C;  3ABK C;  4UCR A;  4U3F H;  2CDY A;  3K79 A;  5LYJ B;  4UFZ A;  3CCQ V;  2F93 B;  2DN9 A;  3S3W A;  1XRE A;  3RYH B;  2IJH A;  4DR3 B;  2ZDI A;  4U3J A;  1US6 A;  2Y69 C;  1RM1 C;  3K5M A;  2WAM A;  2P06 A;  4PDV A;  3DXR A;  1K7D A;  4RQE A;  2UUC O;  5LOV B;  2PI5 A;  3WU2 Z;  1F4M A;  4BIO A;  1H2G A;  1NR1 A;  2XOK G;  4PV1 B;  4X1Y A;  3OMI B;  2X6C A;  5J2U A;  4PEL A;  1XI1 A;  1FXV A;  1ZLZ A;  4UUJ C;  4O4L B;  2VS0 A;  2CAZ C;  2QWP B;  3KG2 A;  4UCV A;  1G6U A;  2HLD G;  2N74 A;  2W0X A;  3UO2 A;  4LF5 O;  3K59 A;  1O9G A;  4IHJ A;  3RYI A;  2X6A A;  1L1F A;  3SPC A;  2ZXW C;  1XMQ B;  3AG7 A;  1Z5V A;  2UXD B;  1LNQ A;  1Y6X A;  1IBK B;  2OYQ A;  3ZN0 A;  1TVK A;  5L3G A;  3BA9 A;  3GB7 C;  3ETD A;  5BZB A;  4J9Y B;  5C8Y A;  1GAX A;  4MTG A;  2C2A A;  5LP6 A;  5L3E A;  3ZHV A;  1XBL A;  1ENV A;  5B66 Z;  3JSN A;  4YJ2 A;  5KMG A;  4DK0 A;  1RFY A;  1NS1 A;  3G71 V;  3E89 A;  3FD9 A;  2WA4 A;  3WB1 A;  1I08 A;  1M56 C;  1TUB B;  5EIB C;  5ITZ A;  2IM9 A;  3SJA C;  2V4D A;  2JRI A;  3H1I H;  1OCR B;  1TGO A;  1MSD A;  3SJB C;  1SQP H;  3RN4 A;  1XMO B;  2LW1 A;  5K1P A;  4FLX A;  1M90 W;  3VQX A;  5IJ9 B;  3W7W A;  3CRC A;  3RYF B;  2Q7H A;  1NVP B;  2A06 H;  1YIT V;  1JJO A;  2PYJ A;  3RYI B;  3CCJ V;  3FKS G;  3DC5 A;  3M99 B;  1ORQ C;  3D36 C;  3STL C;  3P3N A;  1N32 O;  3QNE A;  2RMK B;  1O9H A;  2PY5 A;  1VQ5 V;  3E86 A;  1DLB A;  2LGW A;  2R9I A;  2EZP A;  5KAF Z;  3RGB A;  3OMN B;  4I9Q A;  3FAV B;  1WJZ A;  4UVC A;  2W6I G;  2HG5 C;  2XT9 A;  4EFB A;  4JI7 O;  2EIJ C;  4K3A A;  2YIB D;  2HHH O;  2EIL C;  1Q8I A;  4X66 O;  1M57 C;  3O65 A;  3G67 A;  1Q90 D;  3OGC C;  3JD3 A;  3K08 A;  3FYI B;  3VOU A;  1X59 A;  2EJR A;  1FS0 G;  4PDR A;  1I94 B;  2LFR A;  1EZJ A;  4UCU A;  3ZMZ A;  1XMO O;  4X66 B;  2VWJ A;  3CP1 A;  1VQP V;  3BPZ A;  3W7U A;  5A9G A;  3BEH A;  3BY6 A;  4KHP B;  1YEW A;  2DYR C;  1YIJ V;  4DV4 O;  4ZBM A;  2E3C A;  1B3Q A;  4JF3 A;  2Q69 A;  3THO A; 
#chains in the Genus database with same CATH homology
 1VQO V;  1F51 A;  4KUM A;  4G2K A;  5CBG A;  4QPK A;  4BAY A;  4WFF A;  3OEE G;  1K97 A;  1VQ8 V;  2Z5U A;  2WLM A;  2HVJ C;  3TET A;  1E1R G;  5EC2 C;  2JDI G;  1PNK A;  1AR1 B;  4GX5 A;  4MW8 A;  2OTL V;  2X7R B;  2EIN C;  1QVF U;  1QVG U;  1M57 B;  1OZ0 A;  1F23 A;  3ZMV A;  1K92 A;  3OUS A;  1Y4M A;  3CCL V;  3EHB B;  2XND G;  3OEH G;  3AG2 C;  2QEX V;  4JAS A;  2NNU A;  3B8M A;  4JTA B;  3ZRV A;  3ABK B;  1FXK A;  1CEZ A;  1VQ7 V;  3OUF A;  1GMG A;  1OCZ C;  4RAI A;  1NVP D;  2B1I A;  4R7C A;  5EK0 A;  4JPR A;  1S5H C;  2XAJ A;  3QO8 A;  5IY5 B;  3LDE A;  1AJP A;  2LP7 A;  2WLH A;  4N23 A;  1YTF B;  1S77 D;  4XDJ A;  4L87 A;  2PI4 A;  4HZ3 A;  3VBB A;  3IC7 A;  3ETE A;  2HKO A;  2X0L A;  3AG4 B;  1VQM V;  4YXW G;  4P9O A;  5C93 A;  1RPO A;  4JTD B;  1OCO C;  1V55 B;  3RBZ A;  5L3D A;  1R73 A;  1BHB A;  1R3I C;  2IW5 A;  1KD1 W;  5LHI A;  1FFT B;  1R6N A;  2KB1 A;  4E2L A;  2OTJ V;  1P4R A;  3ASO B;  3P32 A;  5KA6 A;  3X2Q B;  3F7Y C;  3OR7 C;  2Y48 A;  1S76 D;  2ATK C;  2IH1 C;  5B1B C;  3TCU A;  1AJN A;  2NLJ C;  4HYO A;  2EIK C;  5LGN A;  3CMA V;  3E8H A;  1JJ2 U;  1JX9 A;  1PD3 A;  1Q81 W;  2IJI A;  3CC2 V;  2YSU B;  5KA5 A;  2IJJ A;  4I5S A;  3AG2 B;  1Q86 W;  1YJN V;  2DQ0 A;  1QCE A;  1FXH A;  3OFN G;  1YSC A;  4RUE A;  2UXX A;  1QLN A;  4GX0 A;  2H8P C;  2CK3 G;  4MVS A;  2ZD9 A;  1NJI W;  2V1D A;  4QE9 A;  3SYP A;  3K3W A;  1UJW B;  4P9P A;  1M9N A;  1DF4 A;  3CXC U;  1VQ4 V;  1SER A;  3FYE B;  5EC1 C;  1G4Y B;  4ZKI A;  2DYR B;  3TK1 A;  1YHQ V;  3IGA C;  1G8M A;  2OCC C;  1Q82 W;  2Q6A A;  1E1Q G;  1AI6 A;  1V54 B;  4BIU A;  2OT5 A;  4QPJ A;  3SYQ A;  5EBL C;  2A9H A;  2IJK A;  4RUF A;  4MVQ A;  4TSF G;  4LC1 A;  5B1O A;  3CPW U;  2JJ2 G;  5J9P C;  1NH2 B;  1FXK B;  1IXM A;  2WLL B;  2WWW A;  4FJC C;  2IU0 A;  1XL4 A;  2W0F C;  1JQ0 A;  2HVK C;  4FK5 C;  4BW5 A;  3FB5 C;  1SET A;  3WG7 B;  1YTF D;  3OAA G;  2K1E A;  2EBO A;  2GHY A;  1ROP A;  3R65 A;  3CCE V;  2ITC C;  2WLL A;  1AI5 A;  4QE7 A;  3ZJZ A;  5EBM C;  1ARO P;  2EIL B;  3JD1 A;  4UVA A;  3MHS C;  3SPJ A;  4R6Z A;  4CZZ A;  2B5U A;  3NXS A;  3UKM A;  4HAM A;  5KUK A;  4Z1M G;  1WLE A;  1K9M W;  2WLJ A;  1NBM G;  3ABT A;  1SES A;  2EZO A;  5LBQ A;  1VQL V;  2AHZ A;  2QA4 V;  3IFX A;  4PDL A;  3H01 A;  3ZRW A;  4PA3 A;  2A79 B;  2QKS A;  3AG4 C;  5LGT A;  3MHH C;  3W7T A;  1GM8 A;  1I5X A;  1AI7 A;  4X89 A;  3SPG A;  1H38 A;  3OM3 B;  3AG1 B;  3F7V C;  1YJ9 V;  3T2M A;  2QM7 A;  1GTO A;  1K4C C;  5CMU A;  4JAU A;  4RQF A;  1F4N A;  1JVM A;  3T1C A;  1VQ6 V;  1I5Y A;  4MT8 A;  3RVY A;  4XBF A;  1R3J C;  3OMA B;  4PA7 A;  2WLI B;  3CCU V;  3ABL B;  2JEU A;  3CC4 V;  3OW2 U;  3OE7 G;  1OCC C;  4MTF A;  4WFE A;  3E8G A;  1AI4 A;  2DYS B;  1QR8 A;  2EIN B;  3P30 A;  1NKD A;  4MSW C;  4EKW A;  1VQK V;  3RW0 A;  3A0R A;  2WSS G;  1W0K G;  1K5Q A;  4MVU A;  4LP8 A;  4H33 A;  4MW3 A;  3DGE A;  2HR3 A;  3SYC A;  5B1A B;  2XAH A;  4MVO A;  2IH3 C;  5CBH A;  2EIJ B;  4MVM A;  5HFL A;  1QR9 A;  3I55 V;  3DTU B;  3ZRW B;  5E1A C;  3FB8 C;  1GM7 A;  4DXW A;  1NH2 D;  1HWY A;  3G4S V;  1R3L C;  2AHY A;  4U7O A;  1OCZ B;  4DO2 A;  5LHG A;  5H6R A;  1JCH A;  4TT3 G;  2A0L A;  3QO5 A;  1KKD A;  3T4Z A;  2QM8 A;  4ASU G;  2IU3 A;  1H8E G;  4BIZ A;  3B8N A;  2V7Q G;  3CME V;  1V54 C;  1QBZ A;  1M1K W;  2YEV B;  3ABU A;  5DN6 G;  4LCU C;  4P2Z A;  3AEI A;  3MD0 A;  2BOB C;  1R3K C;  2QTO A;  3CCM V;  2Q68 A;  1MOF A;  1GM9 A;  1PNL A;  1W0J G;  2R9R B;  1QLE B;  3HPL C;  3ZMS A;  4U7N A;  2P6J A;  4UV9 A;  1N8R W;  1CPY A;  5B1A C;  4WFA V;  1BHA A;  2YEV A;  1QLE C;  5B3S B;  1CP9 A;  3LUT B;  3ABK C;  5H9C A;  4WFB V;  1KP2 A;  3JD4 A;  1PL0 A;  1EFR G;  1OCR C;  2DWE C;  3E8B A;  3K79 A;  3ASN B;  3CCQ V;  3G6E V;  3W7X A;  2B1G A;  3WFV A;  1JPX A;  4GCZ A;  3ASN C;  1SZT A;  5L3C A;  2IJH A;  3K0G A;  3LSQ A;  4UV8 A;  2ZDI A;  5DM6 V;  3ETG A;  1ZWI C;  5IY5 C;  2Y69 C;  1RM1 C;  1MG1 A;  2WAM A;  4PDV A;  4WF9 V;  1J95 A;  2UXN A;  2ZQM A;  3PJS K;  1K7D A;  2WPD G;  1S72 V;  4RQE A;  1KP3 A;  3ASO C;  2F43 G;  2WLK A;  5LGU A;  2FTK A;  2PI5 A;  4GT1 A;  1V55 C;  5CN0 A;  1F4M A;  2W6J G;  1H2G A;  3AG1 C;  4TWK A;  1NR1 A;  2XOK G;  2EIK B;  2D3O W;  3FB6 C;  3OMI B;  3GWO A;  2X6C A;  4CBC A;  5B1N A;  1THZ A;  3B77 A;  4WFG A;  5IYC O;  5H6Q A;  4PEL A;  1FXV A;  3LSS A;  4QIW F;  4UUJ C;  1SRY A;  2Q67 A;  1JOY A;  4UVB A;  3ABL C;  4X8A A;  5GW7 A;  3E8F A;  4MVZ A;  4FIP C;  4FPP A;  3KG2 A;  4GX2 A;  4H37 A;  2Z3Y A;  1M56 B;  5CA3 A;  2HLD G;  3K04 A;  2QE7 G;  4JGS A;  4X88 A;  5CBF A;  1K5S A;  2ZXW B;  3HB3 B;  3ABM C;  4JTC B;  4MTX A;  1B6Q A;  4XDL A;  2GSM B;  4JAV A;  5KUM A;  1K73 W;  1GKF A;  3EFF K;  2X6A A;  4MTO A;  1L1F A;  3SPC A;  2ZXW C;  5EBW C;  1K8A W;  2WLI A;  1BMF G;  2ITD C;  1LNQ A;  1K33 A;  2H94 A;  4I9W A;  3ZN0 A;  3CCS V;  5L3G A;  2OCC B;  1Y66 A;  1OCO B;  2MK3 A;  3AG3 C;  3CD6 V;  1K34 A;  3GB7 C;  3ETD A;  4KP4 A;  5BZB A;  4J9Y B;  2ZR3 A;  3F5W C;  3LDC A;  3AG3 B;  1KEC A;  2Y69 B;  1WPX A;  4MTG A;  3FB7 C;  2C2A A;  5L3E A;  4FMT A;  1ENV A;  1R6K A;  2XAF A;  4MS2 A;  1AJQ A;  5FL7 G;  3QO7 A;  3OR6 C;  1XL6 A;  4PA9 A;  5IDJ A;  1KC8 W;  4JYB A;  1S0V A;  1DTO A;  3E35 A;  3ZRX A;  3SJQ C;  3G71 V;  1KQS U;  4WFH A;  3E89 A;  3SYO A;  3CCR V;  3X2Q C;  3ZCC A;  4Q20 A;  2HJF C;  3LDD A;  4QNH B;  1M56 C;  3E2E A;  3ZRS A;  3WG7 C;  5L3B A;  1RPR A;  3CYO A;  1K4D C;  2DYS C;  1OCR B;  3SPH A;  2ZR2 A;  1BL8 A;  1TUE B;  1GO3 F;  5B3S C;  3K0D A;  3K06 A;  1E79 G;  3D3I A;  1M90 W;  3D36 A;  1VQN V;  4N21 A;  1MAB G;  2P90 A;  2WLN A;  3W7W A;  2JEX A;  4R8C A;  4GX1 A;  4PA6 A;  5LHH A;  1MSW D;  1NVP B;  1COW G;  1YIT V;  2ZDI C;  2DWD C;  4UXN A;  4JYC A;  4WCE V;  3CCJ V;  1Q7Y W;  3FKS G;  4G28 B;  1EBO A;  1OHH G;  3E83 A;  3M99 B;  1NR7 A;  1ORQ C;  3K03 A;  3LNM B;  4MVR A;  3K9A A;  3STL C;  3W7S A;  3SPI A;  3JD2 A;  3ZMT A;  3QNE A;  4RO2 A;  1PKX A;  1VQ5 V;  3E86 A;  2BOC C;  1DLB A;  1PNM A;  2R9I A;  3JCZ A;  2EZP A;  4P30 A;  1NQT A;  4F4L A;  2XAQ A;  3OMN B;  3ZIA G;  1VQ9 V;  5B1B B;  2HFE C;  4QJF B;  4R50 A;  2EIM C;  2M7W A;  3CC7 V;  1H8H G;  1K3E A;  4UVC A;  2W6I G;  2DW4 A;  1P7B A;  2HG5 C;  1W2B U;  1OCC B;  2X6B A;  5IYD O;  2EIM B;  4LBE C;  3SYA A;  3ZMU A;  2EIJ C;  3ABM B;  4KFM A;  3STZ C;  2EIL C;  4OXS A;  1M57 C;  5HFM A;  3OGC C;  3JD3 A;  4PDM A;  3K08 A;  3I56 V;  3FYI B;  3JYC A;  4PA4 A;  3VOU A;  5IYB O;  2JK5 C;  2EJR A;  2P67 A;  2XAG A;  4XDK A;  5L3F A;  1FS0 G;  1RM1 B;  4G27 B;  4PDR A;  2LFR A;  1EZJ A;  3ZMZ A;  3CP1 A;  3RVZ A;  1YI2 V;  1VQP V;  2P7T C;  3W7U A;  2JIZ G;  2XAS A;  3ZN1 A;  3T4D A;  3CCV V;  1DF5 A;  3BEH A;  3BY6 A;  3JD0 A;  2DQ3 A;  2DYR C;  3ML0 A;  1YIJ V;  4J9Z B;  1S3J A;  1GK9 A;  1FXK C;  2JJ1 G;  4ZBM A;  4JF3 A;  2Q69 A;  3UM7 A;  1YJW V;  2LFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...