3ZRVA

The high resolution structure of a dimeric hamp-dhp fusion displays asymmetry - a291f mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
108
structure length
108
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 46
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrvA00
2WWWA 4JAUA 5B1OA 3ZRVA 4U7NA 4QPJA 4U7OA 4JAVA 3NXSA 5C93A 4JYBA 1JOYA 3MD0A 4ZKIA 4FMTA 5B1NA 3ZRXA 4GCZA 2QM8A 2P67A 2LFRA 2C2AA 2LFSA 4JYCA 4MT8A 4MTXA 4QPKA 4Q20A 4BIZA 4GT1A 3ZRWB 1IXMA 2QM7A 3A0RA 3ZCCA 4JASA 2FTKA 4KP4A 3D36A 5IDJA 3DGEA 4BIUA 4I5SA 1F51A 3TK1A 4FPPA 3ZRWA 4LC1A 3P32A
chains in the Genus database with same CATH superfamily
4MVZA 4X9QA 1NTZH 2DYRC 1KP3A 1THZA 4MVUA 3KCYA 3SYOA 2Y4UA 4X1YA 3JARB 3IJ4A 3HB3B 4I4TB 2GBOA 4TQDA 3K5OA 2UUBB 1PNKA 2GTAA 2P4VA 1F4NA 1RFYA 3SDLA 1TVKA 2B1GA 1O9HA 5CA3A 3G80A 2VS0A 1TA8A 1M93A 1P4RA 3RT3C 3OAAG 2LO1A 3UT5B 2YDEA 4U7OA 1R6TA 2UUBO 2DMXA 1RM1C 4YXWG 1SERA 1OCRC 1NVPB 2R9IA 1KUQA 3CCQV 4JF3A 2FTKA 3OD4A 1QLEC 4J11A 4MW8A 3OTOB 4UXNA 1D5NA 1QHTA 1B3QA 4O4IA 2Q8VA 1VARA 1N33B 3CRQA 3JCUZ 1Z5VA 2ITDC 2H3OA 2KKWA 3JD1A 4JI3O 2XT9A 5GONB 2UXCO 3VQVA 5IDJA 2LJ2A 2X6AA 5H6RA 1VQ6V 2OCCB 3C3SA 2IH1C 2IJJA 2FYUH 2Z0AA 2EIMC 2HFEC 3C3TA 2F66C 1UJWB 2R72A 5J9PC 2H8PC 4QE9A 3AG3C 4X1KB 3E8BA 4LBEC 2GHYA 4OX9B 3OUFA 1ENVA 2FKXA 2ZM6B 2JVDA 2JJ1G 4FPPA 4C7UA 5L3CA 3G6EV 3ASOB 4LH7A 1YTFD 4BAYA 2QWQB 3CS5A 4MVQA 4DRXA 2EX3A 1WNSA 5BY1A 4GKKB 2MW2B 1F23A 2ZR2A 2QWOB 1VQKV 3SPHA 4PI0A 3ZN0A 2L6LA 1AP5A 1F51A 2Q9LA 1QQCA 4OGQB 5FLXN 4QGPA 4RQFA 1OCZB 1H2GA 4J42A 3A2FA 5IYCO 2QWRB 3B09A 4B08A 1VF5B 1H2NA 1BT8A 2LGQA 1FXKA 3W7SA 4J9ZB 1SQFA 3L9DA 3SJQC 1VQ4V 4BIUA 4PDMA 3I55V 1SQVH 2WLNA 3FD9A 2RN9A 1S0VA 1JX9A 2CK3G 1GH6A 1QNMA 1ZX3A 3A8TA 4WBNB 4GX0A 3ZHQA 3K03A 4MVMA 2Y69C 4FMTA 4F4LA 2RQ6A 3ABTA 1HNZB 3OEEG 1XMOB 1SQQH 5A2QN 1Q90D 3QF7A 2Y0IA 4FZ0A 4HBNA 1CP9A 4I5SA 5GONA 4X88A 5KHIA 1WP8A 2KQXA 3G71V 5H9CA 1Y76B 1Q3EA 1OHHG 3TCUA 5CBHA 2X6BA 4UVBA 3PN1A 2X7RB 3UCSC 2LFSA 5BMVA 4OX9O 1F4MA 1N36B 2WLLA 2V4DA 3EXAA 1XEQA 2QGNA 1YEWA 3K0GA 4FZ1A 4LCUC 4RAIA 4PELA 2WLLB 5KUMA 1GN2A 4FLWA 3N2KB 3T4DA 1RPOA 3QVNA 5F2VO 4JI8B 3OR7C 2OTLV 4G28B 1X4TA 3RVYA 4X8AA 2AGAA 1EM1A 4TQFA 4DV1B 3DSQA 4PA7A 1DK1A 2YC0A 1OZ0A 2N04A 3DTUB 1NH2B 3FB5C 1CEZA 1SC5B 4K3AA 2EZOA 2CH7A 5KAIZ 3OEHG 4CBCA 1GK9A 4X64O 4X1YB 1ZLZA 2EBOA 1IBKB 3OGIB 4WCEV 5JCOC 4ZI7B 3FYIB 5J2UA 2YXYA 2HVJC 3P3NA 1JCHA 4AILC 2LGWA 2RNBA 5JH7B 4GX5A 4MS2A 2ARHA 2GDSA 4PV1B 2UUCB 4DV5B 3RFRA 4B3MO 2AXTZ 1ZWIC 2ZE5A 2HG5C 1L0LH 2QJ1A 5EBWC 1SQPH 2LFRA 1SF9A 3K79A 1P49A 1ZSPA 3JALA 1EBOA 4LFAO 4FFBB 1N0NA 4QE7A 1PPJH 1BS3A 3QO5A 1SETA 3FAVA 2P22C 3CCJV 2ZT9B 1YVWA 1KD1W 3ZMSA 4H33A 3AG4C 3TGUH 1J5EO 3BAAA 3BFRA 3CX5F 1KP2A 1MA1A 2AZ2A 1YTFB 2BOBC 4GZRB 1H8EG 4LF7O 1K5SA 4MVOA 1HNXO 4YHHO 2OTJV 4NKGB 5KHJA 3RN4A 3APQA 1EZJA 3T4ZA 3HKBA 2E3CA 1Y66A 2AZ0A 1KU9A 1Q6HA 3CXCU 4DV7B 3GB7C 4B3MB 2BOCC 2MK3A 3HKDB 4TUYB 1H2LA 2GV9A 4ZOLA 2IU3A 4CH4A 4DK0A 4LF9O 4JTDB 5L3DA 1E1QG 3HR0A 1P7BA 2JIZG 2ODMA 2IW5A 3E22B 3THOA 3X2QC 2YEVA 3ZHVA 4UV9A 1IBKO 2XAJA 1PV0A 4JI1B 5LL6Y 1N8RW 2K1EA 3D3IA 1K5QA 4MT8A 4ZIBA 4RO2A 4Q20A 1XHZA 1BCCH 3CRRA 2PI4A 1NTKH 4DR4B 5KUKA 1AROP 3CHXA 5JVDB 4FVMA 1KECA 4I50B 1AR4A 3J80N 3OFNG 2F4VO 3OUSA 2E76B 1VF6A 2P5OA 3RYHA 3MAQA 3FB6C 3B4SA 2HKOA 3OE7G 2UUAB 1FFXA 4K8XA 4LF8B 1PKXA 2B1IA 3OT7A 4GYCB 2JGUA 5CB4B 3DC6A 3CRCA 3BY6A 2EIKB 4B3TB 4DV3B 1DTOA 4JI0B 1GN6A 3CYOA 1BE3H 4R6ZA 4DR1O 3R65A 3W7WA 4TUYA 1XMQO 3RYFA 1XHXA 1NZ6A 3UO3A 3AK3A 1OCZC 4GX2A 1BMFG 3SJAC 4F6RA 1FJGO 2VWKA 1FAFA 2ZXWC 1YIJV 4JYBA 1GM8A 1WN7A 1JPXA 4J7JA 3MD0A 4NXNO 1D5AA 3LNNA 4DR7B 3K9SA 2Y48A 5IWAO 4DK1A 2PF4E 4CH3A 5L3FA 1NH2D 2YI8A 4HNAA 4LFCB 4Z1VA 4OPHA 3ETDA 3L75H 5FPRA 4O4IB 2Q69A 5IY5C 4DV3O 2F93B 3K04A 4J7ZA 4DO2A 2CE4A 2HEPA 1AR1B 5JQGB 1FS0G 3LUTB 3IGAC 2ZM6O 1WPBA 4HZ3A 4ZHQA 3C90A 2HHHB 4YIPA 2JDIG 1SQGA 4X20B 5HFLA 5JH7A 4I9QA 3L71H 3ZRVA 2QA4V 2CAZC 1YZBA 4TWKA 1G1XB 3JAKA 2DYSB 2LP7A 1TUEB 1TGOA 4QIWF 5J2UB 1DF5A 3APOA 4NVPA 1J5EB 4R7CA 4WF9V 4DV6B 2ZDIC 2R9RB 1W59A 4YHHB 2F95B 3VQXA 2JJ2G 3G67A 4GKJO 2KB1A 2B9ZA 4DV2O 1QU7A 4CC6A 4DYLA 5BXZA 4AHCA 3BA8A 3K08A 1MZFA 2ZD9A 1GM7A 3D36A 4FIPC 3EHBB 3MDSA 1I5XA 4ZBMA 4E2LA 4B7KA 5EC1C 4LWSA 1XNRB 4IYHA 3CC2V 2G38A 5IE9A 1HDJA 4MSWC 3PJSK 2IBZH 3WFVA 3JASA 5JCOA 3D3QA 2DYRB 5AG2A 1XBLA 1FKAO 2YS8A 3ZMTA 3HKCA 5KX5B 3S3WA 4JI4B 3ZRWA 4LH6A 5B1BC 3LDDA 4LFBO 5JJNB 4DR4O 4JI5O 3D36C 4YJ3B 2BTOA 2AW9A 2HJFC 3AG4B 4J80A 4OPAA 2ZIMA 2F4VB 1HP8A 5LBQA 3HKDA 5LYJB 4BIZA 4O4HA 4JI4O 2Q6AA 3H9VA 1L0NH 3SYPA 4LFBB 1ORQC 4TV8A 1OCCB 4DV1O 1DLBA 3QNEA 2JGDA 4WFEA 4DW0A 4I9WA 3WB1A 3KCXA 3K06A 2VQFB 2Q7EA 3J81N 2RMKB 3ZRXA 1Y67A 3ZS8C 1R73A 4JI3B 1FXKB 3ABKB 1AJQA 2A0LA 2ADPA 4YJ3A 5LP6C 3P3PA 5JJEB 1BL8A 3RWRD 3K57A 2QTSA 2PI5A 1NR7A 1HR0O 2XHBA 4J7KA 4LF4B 1SZTA 3VQYA 1M57C 1Y6XA 2PYLA 4CZZA 1XMOO 2UXNA 2YXLA 4DUZO 4LF5B 4DR5O 2ZNJA 2P4KA 1XUQA 2UUCO 2CGNA 4PD4F 4W4LA 3U0ZA 1AJPA 2P7TC 4H44B 1IXMA 3U10A 2HP8A 1TUBB 4ZHQB 4FM2A 4JYAB 5K1PA 5B1AB 1R6NA 5B1OA 1GMGA 4ASUG 1IURA 4PA4A 4JAVA 3TJTA 1SA0A 1E1RG 4ABMA 3M8AA 2ZE8A 1NI8A 3ASNC 1ZL8B 2Q67A 1Y74A 4NTWA 2EJRA 2E75B 5H5NA 1AI7A 3E8FA 3H1LH 4H13B 1P84F 1SQXH 1SRYA 5LHIA 4IIJB 3SGIA 2QKAA 3F7VC 3JAWB 1GN4A 1K33A 1Q6IA 1K8AW 4UB8Z 1XL4A 1QCEA 4JV5B 3A0RA 5HFMA 4JPRA 5KA5A 1N4CA 2EILC 3F7YC 4PA9A 2YXHA 4IIJA 1JOYA 2ITCC 3F5TA 3KZIZ 2YUAA 1FXVA 4I0XA 3LSSA 1BHAA 1K92A 4MTOA 4Z1MG 2OYQA 4DV5O 4JYYA 1RP3B 5CB4A 3BHPA 2UXBO 1RSOA 1Z5WA 4K0KO 1K4CC 3JASB 3RBZA 1SA0B 5KHGA 1S72V 5J2TB 2N05A 4EFBA 4EFEA 2NLJC 4LWSB 4X66O 1G4YB 4MVSA 3SPGA 5EYPA 4JYAO 4LF8O 2QWNB 2ATKC 2HVKC 5CA1B 3FB7C 2A3QA 1H2SB 2XNDG 4O2BA 2Q68A 3ASNB 3I56V 4AQYB 1DF4A 3RYCA 4IHJB 3T1YO 2RCVA 4IL6Z 4CS4A 4LF5O 4PDRA 2M7WA 4JAAA 1WPXA 3G6BA 4H37A 1N32O 4B3SO 2F23A 1L1FA 2WWWA 2IU0A 2QSAA 2WA4A 3ZHRA 2UXDO 4XBFA 4U7NA 1N0JA 4WFGA 4TOIA 2ZCEA 3T1HB 4NB5A 5FPOA 5CA1A 3CC7V 4CS2A 2ILMA 2EIMB 2XUMA 3QTCA 1RPRA 2N74A 5JJJB 2GTSA 5H2FZ 4A5UB 2OCCC 1MNGA 5JVDA 1CPYA 1PNLA 1R6KA 3R66A 5FNVB 5LP6A 1QR9A 1SKVA 4PDLA 1JMKC 2WLJA 1GO3F 3JD4A 3CCMV 3K59A 4AQYO 3KKYA 3JSNA 5JWPA 1K3EA 3QO7A 3CXHF 4BR6A 1AR5A 1QLEB 1K4DC 3DC5A 2GUZA 2PZSA 3LSUA 1L8DA 2IM9A 4DV4B 4QPJA 3E8GA 1FPOA 1R3LC 2EZPA 5ITZA 1B04A 1US6A 1QR8A 2KSDA 1BQZA 1AI5A 3CCLV 3ZIAG 4O4LB 4LP8A 2VRZA 4MW3A 5B1BB 4PA3A 1HNWO 4XDLA 5D5QA 1N34O 4X65O 3LSQA 2DQ3A 2D3OW 1SS3A 3OW2U 4NR1A 3K0DA 1VQOV 4KHPO 2CTRA 2UXBB 1IBMB 2M6YA 1DGSA 2ZDIA 5B1NA 1GN3A 3E83A 2CH7B 2DWDC 3STZC 4AI8A 3W7XA 2PGGA 4GKJB 1FYJA 4LC1A 2V7QG 4F6EA 4NXNB 5IYZA 4FLVA 3ZMUA 4FFBA 4B3RB 2LQTA 2YICA 1G8MA 2XAQA 2YIAA 1Q86W 1M5IA 4BIOA 1XNRO 3I5DA 2PYJA 1MSDA 5LHGA 4UCVA 1VIBA 1YF2A 1I08A 1J95A 1AILA 2P90A 1HNWB 1QLNA 2KG7B 1PM9A 5L3EA 5BZBA 1VF7A 4JI8O 2QM8A 3AK1A 4HNAB 3IAYA 1VP7A 3CC4V 4O4LA 4PA6A 3GWKC 1YJNV 3AEIA 3E35A 5IT9N 3T1HO 4XDJA 4DW1A 3CWBH 1K34A 3A0HZ 1BSMA 3MHSC 4JZ2A 1ZAUA 4WFBV 3CJHA 3ZBHA 1Q6UA 3WG7C 5TISZ 3RYIB 1JQ0A 3ZMVA 5LMNB 3OMAB 4NTXA 3S3XA 4J10A 2JGDB 2EIJC 4N23A 3ETGA 2OCHA 2AHYA 5IY5B 4UVAA 5GTIZ 4MTXA 2A06H 1WJZA 4GT1A 1JVMA 5C8YA 4E4EA 1HNZO 1M56B 3SPJA 3ZX6A 3TETA 3N2KA 1S3JA 3ZHUA 4P2ZA 2LW1A 4DV0O 2PY5A 2VQFO 1OJHA 3FKSG 2Y4TA 5CN0A 4LF9B 1TUBA 3FFQA 2BSKA 2E74B 5IYBO 3ZHSA 4DV4O 4JI1O 1KKDA 3HKCB 5KX5A 2ZXWB 3OTOO 2WLMA 2WLHA 4O4JA 1K73W 1XQ8A 5LGNA 2PTMA 4B3TO 3EFFK 5L3GA 2Q4PA 1ROPA 1LUWA 4LFCO 4D6TH 2IJHA 3H1IH 5LA6A 2BTQB 3K5LA 4P30A 4I50A 3VQWA 2JRIA 2XAFA 2EULA 3JARA 2QE7G 3FYEB 1MMMA 1E79G 2EIKC 3B77A 4O2AA 3IC7A 2A7WA 3CCSV 1LNQA 3JD3A 2Q7HA 4CH5A 5C8YB 1HNXB 4GLXA 4DV0B 1AVMA 4LNUA 3STLC 1S76D 2QKSA 2QWPB 1AI6A 2ZINA 5BR8O 1YJ9V 5ITZB 4PI2A 1V54C 5J2TA 3NR7A 3ICXA 4EEQA 1AB3A 3A0BZ 4DV2B 4FLTA 2RJZA 1FJGB 2OIEA 4D7TA 2DQ0A 1M90W 4UCRA 3BRCA 4DRXB 2ZE7A 3X2QB 1B6QA 4QJFB 3DGEA 1PNMA 5CBFA 3JD2A 4KFMA 1K97A 1S5HC 3BABA 1URFA 5LXTB 3B8NA 5K1XA 1YI2V 4N21A 2JS5A 1T5EA 2R9AA 4DXWA 3AG2B 4OXSA 4EB6B 1YITV 2UUAO 4WFHA 4D7SA 2XAGA 5EZYB 3CPWU 3CCEV 4DUYB 4U3JA 3ABLC 5B3SC 3H1HH 1FFTB 3HKEB 4J41A 3P32A 3Q4HA 4R50A 1O9GA 2AHZA 3TXSA 1B06A 3RW0A 4WBNA 1KC8W 1IBLB 4MTGA 3FX7A 4UCOA 1D2DA 2W6JG 5B5EZ 4FLZA 4O2AB 3CCVV 4I7ZB 2E5LB 2KG7A 4DR2B 1S77D 1MOFA 1V55B 3ETQA 2JEXA 3ML0A 4GKKO 4DR3O 3AG1B 2PUSA 3GVMA 4X62O 1AI4A 2FL4A 2CTQA 4FM0A 5JQGA 2OIGA 1VMGA 2K9PA 2W6IG 5GTHZ 5LGTA 1KMIZ 4KUMA 3OM3B 1OCCC 2WPDG 2UXDB 3OMNB 5IJ0B 4EKWA 3CCRV 4X62B 4KXRA 3RYHB 2FB5A 2BE3A 4JI7B 1P7GA 3JATA 4NYKA 2FMLA 2X0LA 4TV9B 2RDCA 3AG7A 3H1JH 3K3WA 4JTAB 3L72H 4B7EA 4X64B 3FB8C 4X1KA 3ZMZA 2HHHO 3IFXA 2ZNIA 1NBMG 4CC5A 2EJ7A 1Y76A 4U3FH 3AG2C 1BQ0A 4NXMB 1LUVA 4NTYA 1I5YA 4L8JA 4QPKA 2B5UA 3LDEA 3QO8A 3CJHB 1U97A 1OV9A 4JGSA 1K9MW 1EN6A 1KYOF 1S5JA 4RUEA 4I55B 2ZKOA 2DE0X 3JCZA 5CA0B 3K5MA 1GRJA 2Q7GA 3CRMA 3D8CA 2NR5A 3L70H 3M7MX 4IHJA 4X65B 5KMGB 1W2BU 3E89A 1QVGU 2CUGA 3CE2A 1YHQV 2YIDA 1WB8A 2YIBA 2DWEC 5EBMC 3ZEDA 2E5LO 1JR9A 3TXQA 1M4UA 4DR2O 3E2EA 1MSWD 2WSSG 4JV5O 5EYPB 4CS3A 1IBMO 1TAEA 3WU2Z 2DYSC 3FAVB 3J7AU 2ZE6A 5IYZB 1N33O 4NXMO 1IBLO 2NNUA 3RGBA 2OWOA 3JAMN 3CRAA 3OMIB 4JI6B 2YEVB 2YIBD 2BSKB 1I0HA 1Q43A 4P9OA 1YJWV 4FLUA 2Q0AA 3JD0A 3L73H 1ZTEA 3SPCA 3SYCA 4WFAV 4JYCA 3VOUA 3K58A 2BCCH 1EN5A 4K8ZA 2UU9B 1YXBA 2QM7A 3CP1A 1NT2B 4X89A 3BVOA 1VQ8V 1YSCA 3OGCC 2CTWA 1OCOC 4RWUA 1MG1A 1EN4A 4ZKIA 3RYIA 3E8HA 1NS1A 1GAXA 4TV9A 2C2AA 1BGYH 4IT5A 1OCOB 4Q6GA 1Q7YW 2XTAA 3ASOC 2V1DA 1HWYA 4PJ0Z 5E1AC 1XILA 1H38A 4EB6A 2R70A 1H2MA 1M56C 1Y74B 1N32B 2XAHA 4I0XB 3AG3B 3GWOA 4H0LB 5BR8B 4K35A 1VQ5V 4LF4O 2EIJB 1PP9H 4Z2WA 2WAMA 3SJBC 1W0KG 5FL7G 2A79B 2DJVA 5B66Z 2IJKA 1AJNA 2VQEO 1Q8IA 1VQPV 4JTCB 2Q73A 2P06A 4MTFA 3W7UA 1JA8A 4JZGA 4LF6O 4DR6O 2ETNA 4DR1B 4G2KA 3N27A 5EIBC 4DV7O 1I7FA 3T1YB 3CSXA 4BWAA 4TSFG 4JI5B 5LHHA 4JI2O 3CB2A 4JI7O 1S5LZ 1TVKB 4PHZA 4JI6O 4CH6A 2W0FC 3ZCCA 2JS3A 1IX9A 1BZKA 1NR1A 3CCUV 1CXZB 4IYIA 3G4SV 1H2KA 4JAUA 1OCRB 2D2CB 1ZL8A 1RM1B 5EZYA 4O2BB 3M99B 1Z2GA 2F43G 2GSMB 4UCUA 1PL4A 5IJ9B 5KHHA 1G6UA 5EK0A 4IGGA 3T2MA 2QKCA 1PL0A 3OR6C 4W4KA 1Q81W 5IYDO 1A32A 4X20A 3H01A 3UM7A 3DXRA 2BTQA 1WAZA 1N34B 2H94A 5LGUA 2HJDA 1HR0B 2DW4A 4PDVA 2DN9A 1WA8A 5LOVB 4RQEA 3L74H 3ETEA 3ZN1A 5CMUA 1IXBA 1XNQO 1R3KC 1Q5OA 4YJ2B 2QTOA 2X6CA 4DR3B 1EFRG 3B40A 3E86A 3O65A 4FLXA 1NU1H 3ZJZA 2EINB 3UO2A 4X1IB 2WA3A 1R1BA 4GX1A 4DV6O 3DXRB 3LNMB 2QDOA 4LNUB 4X66B 4JASA 3SR2C 2XOKG 1LR1A 4FK5C 2ADQB 1KB9F 1IDSA 4UB6Z 4TV8B 3EVKA 1AP6A 4O4HB 3JAWA 4JI2B 3RYFB 3IC9A 2LW7A 3BPZA 3AG1C 3CMAV 1Q82W 1FXHA 2UXXA 1V55C 1JJOA 4X1IA 3H1KH 3ZRSA 1KQSU 5GW7A 2QM4A 1WP7A 4K0KB 4YJ2A 3W7TA 4B3SB 4P9PA 1VF6C 5DN6G 1WLEA 3ABMB 1I94O 4O4JB 1WA8B 3AK2A 3CEIA 3JALB 4KHPB 1M9NA 5LMUB 2WLIA 1PD3A 2WLKA 4KP4A 5CBGA 2CDYA 5B3SB 3ABLB 2QEXV 3QG5A 2UXCB 5DM6V 1XL6A 3UQ8A 4WFFA 4FJCC 3F5WC 2A9HA 2CTPA 3UT5A 5DECA 2Q5ZA 1M1KW 4FLYA 4GCZA 2IH3C 3RVZA 1Y4MA 4ZI7A 3HPLC 1XNQB 2ZIOA 5KAFZ 4FM1A 1MZEA 1SQBH 1QBZA 1VEWA 4UUJC 2IJIA 2ZQMA 2QR4A 1KKCA 2OT5A 2F1MA 4UCSA 1BHBA 3P30A 1V9PA 3K5NA 4DR7O 5C93A 4LF6B 4U3JB 3ABUA 1NTMH 2P67A 1GM9A 2YSUB 1VQNV 4UVCA 2HR3A 2JEUA 3JAKB 2Z3YA 1XI1A 5EC2C 2ZR3A 1UFIA 1NQTA 1V54B 4J9YB 5LYJA 3BCCH 4DR5B 1SESA 2O57A 3OTFA 4MVRA 3SPIA 3JATB 2Y69B 3VBBA 3KG2A 3BA9A 5BMVB 3B2EE 3K9AA 5LMNO 5EIBD 3ZRWB 1VQ9V 2EILB 3BEHA 4GUNA 2Z5UA 1K7DA 5IJ0A 4HYOA 3N2GB 1GTOA 1IVSA 5A9GA 1EZVH 5LOVA 2HLDG 1KBHA 1FFXB 4LR3A 5E79Z 4UFZA 5KLVH 4JI0O 5H6QA 1YDXA 4I4TA 4QNHB 2WLIB 1XMQB 3UKMA 1ZUQA 5KHKA 2Y0PA 3SYAA 3O9OA 5EBLC 4YY3B 5KMGA 4ICGA 2NN4A 3B8MA 3E22A 4R8CA 1GKFA 3LDCA 1I94B 1JJ2U 5CA0A 1R3IC 2DOSA 4I55A 5LA6B 4DR6B 5B1AC 4KL1A 1VQLV 3WB0A 2L35A 3Q4HB 4LFAB 5D5PA 4RUFA 1R3JC 1N36O 3WB2A 3HKEA 1QVFU 4B3RO 4ZOLB 2XASA 1YCIA 2GUZB 4DUZB 1WB7A 4BW9A 2Q0OC 2P6JA 3ABMC 2UU9O 1VQ7V 4G27B 1F7YA 1M57B 1COWG 3CMEV 1XDCA 2YI9A 3ZHTA 3WG7B 4TT3G 1JFFB 5LXTA 3SJCC 1MABG 5L3BA 1SZXA 4LF7B 2VWJA 5FNVA 5LP6B 4YIOA 3NXSA 1FXKC 2CGOA 3ABKC 1JFFA 5DEDA 4YY3O 3MHHC 1RSOB 4HAMA 3N2GA 4FFKA 1IZ3A 3JYCA 4XDKA 1FD9A 1X59A 2W0XA 1UPGA 3U11A 3TK1A 1XREA 1W0JG 5LMUO 5KA6A 3SYQA 4BW5A 1HW7A 1XOUA 3CD6V 1VQMV 1U96A 4UV8A 1NJIW 2EINC 2VQEB 1NVPD 4F6RB 3RYCB 3JSLA 2JK5C 4L87A 1NKDA 3HKBB 4UCTA 3T1CA 5IJ9A 5IWAB 1H8HG 4DUYO
chains in the Genus database with same CATH topology
1YSCA 3OGCC 4MVZA 2ZXWC 3OW2U 2DYRC 1KP3A 3K0DA 1THZA 4MVUA 1VQOV 1OCOC 1YIJV 3SYOA 2ZDIA 4JYBA 1GM8A 1MG1A 1JPXA 3MD0A 4ZKIA 3E8HA 5B1NA 3HB3B 3E83A 2C2AA 2DWDC 1OCOB 3STZC 3W7XA 2Y48A 1Q7YW 1PNKA 3ASOC 2V1DA 1HWYA 5E1AC 5L3FA 1H38A 1F4NA 1NH2D 2B1GA 5CA3A 4LC1A 1M56C 2V7QG 3ETDA 1P4RA 2XAHA 3OAAG 3ZMUA 3AG3B 3GWOA 4U7OA 2Q69A 5IY5C 1VQ5V 1G8MA 2XAQA 2EIJB 1RM1C 1Q86W 3K04A 4YXWG 4DO2A 1AR1B 2WAMA 1SERA 1W0KG 1FS0G 5LHGA 3LUTB 5FL7G 1OCRC 3IGAC 1NVPB 2A79B 2R9IA 3CCQV 4HZ3A 4JF3A 2IJKA 1AJNA 2FTKA 1VQPV 1J95A 2P90A 4JTCB 4MTFA 1QLEC 2JDIG 1QLNA 3W7UA 4MW8A 5HFLA 4UXNA 3ZRVA 2QA4V 4TWKA 5L3EA 4G2KA 5BZBA 2DYSB 2LP7A 4TSFG 1TUEB 2QM8A 5LHHA 4QIWF 3CC4V 1DF5A 4PA6A 1YJNV 3AEIA 3E35A 2ITDC 4XDJA 3JD1A 2W0FC 1K34A 3ZCCA 4R7CA 4WF9V 5IDJA 3MHSC 1NR1A 4WFBV 5H6RA 2X6AA 3CCUV 2OCCB 1VQ6V 2IH1C 2ZDIC 2R9RB 3WG7C 2IJJA 3G4SV 4JAUA 1JQ0A 2EIMC 2HFEC 1OCRB 3ZMVA 3OMAB 1UJWB 2JJ2G 2KB1A 1RM1B 2EIJC 4N23A 3ETGA 3M99B 2AHYA 5IY5B 2F43G 2GSMB 4UVAA 2H8PC 5J9PC 4QE9A 3AG3C 4MTXA 5EK0A 3E8BA 4GT1A 4LBEC 1JVMA 2GHYA 3K08A 3T2MA 1M56B 1PL0A 2ZD9A 3OR6C 3SPJA 1GM7A 3TETA 5IYDO 1Q81W 1S3JA 3D36A 1ENVA 3OUFA 4FIPC 3EHBB 4P2ZA 2JJ1G 4FPPA 3H01A 1I5XA 4ZBMA 4E2LA 5L3CA 3UM7A 3G6EV 3ASOB 5EC1C 3FKSG 5CN0A 1YTFD 2H94A 5LGUA 4BAYA 3CC2V 4MVQA 2DW4A 4MSWC 3PJSK 4PDVA 5IYBO 3WFVA 1F23A 1KKDA 2ZR2A 4RQEA 2DYRB 1VQKV 2ZXWB 2WLMA 2WLHA 3ETEA 3SPHA 3ZN1A 5CMUA 3ZN0A 1K73W 3ZMTA 5LGNA 1R3KC 1F51A 2QTOA 3EFFK 3ZRWA 4RQFA 1OCZB 2X6CA 1H2GA 1EFRG 5L3GA 3E86A 3LDDA 1ROPA 5B1BC 5IYCO 3ZJZA 2EINB 2IJHA 2HJFC 3AG4B 4P30A 2XAFA 4GX1A 5LBQA 2QE7G 3LNMB 1FXKA 3FYEB 3W7SA 4BIZA 4J9ZB 2Q6AA 1E79G 2EIKC 3B77A 3SJQC 1VQ4V 3IC7A 4JASA 3SYPA 3CCSV 1LNQA 2XOKG 3JD3A 1ORQC 4PDMA 4BIUA 3I55V 4FK5C 1OCCB 2WLNA 1DLBA 1S0VA 1JX9A 2CK3G 3QNEA 4WFEA 4I9WA 3K06A 4GX0A 3K03A 4MVMA 3STLC 1S76D 2Y69C 4FMTA 4F4LA 3ZRXA 2QKSA 3AG1C 3CMAV 1Q82W 1FXHA 3ABTA 2UXXA 1AI6A 1R73A 3OEEG 1FXKB 3ABKB 1BHAA 1AJQA 1V55C 1YJ9V 2A0LA 1KQSU 3ZRSA 5GW7A 1CP9A 1V54C 1BL8A 4I5SA 4X88A 2PI5A 1NR7A 3W7TA 3G71V 1SZTA 4P9PA 5DN6G 1WLEA 5H9CA 1OHHG 3TCUA 1M57C 5CBHA 4CZZA 2UXNA 2X6BA 3ABMB 4UVBA 2DQ0A 1M90W 2X7RB 1AJPA 2LFSA 2P7TC 1F4MA 3X2QB 2WLLA 1M9NA 1B6QA 1IXMA 2WLIA 1PD3A 4QJFB 2WLKA 3K0GA 4KP4A 5CBGA 3DGEA 1PNMA 5CBFA 3JD2A 4LCUC 4KFMA 5B3SB 3ABLB 4RAIA 5B1AB 4PELA 2QEXV 1K97A 2WLLB 1S5HC 5KUMA 1R6NA 5DM6V 5B1OA 1GMGA 3B8NA 4ASUG 1XL6A 1YI2V 3T4DA 1RPOA 4PA4A 4WFFA 4N21A 3OR7C 4FJCC 3F5WC 2A9HA 4JAVA 2OTLV 1E1RG 1M1KW 4DXWA 3AG2B 4G28B 4GCZA 3RVYA 4X8AA 3ASNC 2IH3C 4OXSA 1YITV 3RVZA 1Y4MA 2Q67A 3HPLC 4WFHA 2XAGA 2EJRA 3CPWU 4PA7A 3CCEV 1AI7A 3E8FA 3ABLC 5B3SC 1QBZA 4UUJC 1FFTB 2IJIA 1OZ0A 2ZQMA 3DTUB 3P32A 1NH2B 3FB5C 1CEZA 4R50A 2AHZA 1SRYA 2EZOA 2OT5A 5LHIA 1BHBA 3P30A 3OEHG 4CBCA 1GK9A 5C93A 3RW0A 3F7VC 1KC8W 2EBOA 3ABUA 4WCEV 1K33A 4MTGA 1K8AW 3FYIB 2P67A 1GM9A 2YSUB 1VQNV 4UVCA 1XL4A 2HR3A 1QCEA 2JEUA 2W6JG 2HVJC 2Z3YA 3A0RA 5HFMA 5EC2C 2ZR3A 1JCHA 4JPRA 3CCVV 1NQTA 1V54B 4J9YB 5KA5A 1S77D 2EILC 4GX5A 4MS2A 1MOFA 1SESA 3F7YC 4PA9A 1V55B 2JEXA 4MVRA 1ZWIC 3ML0A 1JOYA 2HG5C 3AG1B 3SPIA 2Y69B 3VBBA 5EBWC 1AI4A 2LFRA 2ITCC 3KG2A 3K79A 3K9AA 3ZRWB 1EBOA 1FXVA 1VQ9V 3LSSA 2EILB 1K92A 2W6IG 3BEHA 4MTOA 5LGTA 2Z5UA 4KUMA 1K7DA 1OCCC 3OM3B 4QE7A 4Z1MG 2WPDG 4HYOA 3OMNB 1GTOA 3QO5A 1SETA 1K4CC 3RBZA 2HLDG 4EKWA 3CCRV 3CCJV 1S72V 1KD1W 3ZMSA 4H33A 3AG4C 5H6QA 2NLJC 1KP2A 1YTFB 2BOBC 1G4YB 4MVSA 2X0LA 3SPGA 4QNHB 2WLIB 1H8EG 3UKMA 1K5SA 3K3WA 4JTAB 4MVOA 2OTJV 2ATKC 2HVKC 3FB8C 1EZJA 3FB7C 3T4ZA 3ZMZA 3IFXA 2XNDG 3SYAA 1NBMG 5EBLC 2Q68A 3ASNB 3I56V 1Y66A 3CXCU 1DF4A 3GB7C 3AG2C 2BOCC 2MK3A 3B8MA 4R8CA 1I5YA 4QPKA 2B5UA 1GKFA 3LDEA 3LDCA 1JJ2U 3QO8A 2M7WA 4PDRA 4JGSA 1WPXA 1R3IC 1K9MW 2IU3A 5B1AC 1VQLV 4H37A 4RUEA 4JTDB 1R3JC 3JCZA 4RUFA 5L3DA 1QVFU 1L1FA 1E1QG 1P7BA 2JIZG 2WWWA 2XASA 2IU0A 2IW5A 3X2QC 2YEVA 4XBFA 4UV9A 4U7NA 2XAJA 4WFGA 1N8RW 2P6JA 1W2BU 2K1EA 3ABMC 3D3IA 3CC7V 3E89A 1VQ7V 1QVGU 4G27B 1K5QA 1M57B 4MT8A 1YHQV 4RO2A 4Q20A 1COWG 2PI4A 3CMEV 2EIMB 1RPRA 2DWEC 5EBMC 3WG7B 4TT3G 3E2EA 2OCCC 1MSWD 1MABG 5KUKA 2WSSG 1AROP 5L3BA 1CPYA 1PNLA 1KECA 1R6KA 1QR9A 4PDLA 3OFNG 3OUSA 3NXSA 2WLJA 1FXKC 3ABKC 1GO3F 3FB6C 3JD4A 2HKOA 3OE7G 3CCMV 2DYSC 3MHHC 1PKXA 2B1IA 4HAMA 1K3EA 3JYCA 4XDKA 3QO7A 2NNUA 3OMIB 1QLEB 3TK1A 2YEVB 1K4DC 1W0JG 3BY6A 2EIKB 5KA6A 4P9OA 1YJWV 1DTOA 3JD0A 4QPJA 3E8GA 3SYQA 1R3LC 2EZPA 4BW5A 3CYOA 3SPCA 1QR8A 4R6ZA 3SYCA 3CD6V 4WFAV 1AI5A 4UV8A 3CCLV 3R65A 3ZIAG 1VQMV 4JYCA 1NJIW 3W7WA 2EINC 4LP8A 3VOUA 4MW3A 1NVPD 5B1BB 4PA3A 2QM7A 3CP1A 1OCZC 2JK5C 4L87A 1NKDA 4GX2A 4X89A 3T1CA 4XDLA 3LSQA 2DQ3A 1BMFG 1H8HG 1VQ8V 2D3OW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  4JAU A;  5B1O A;  3ZRV A;  4U7N A;  4QPJ A;  4U7O A;  4JAV A;  3NXS A;  5C93 A;  4JYB A;  1JOY A;  3MD0 A;  4ZKI A;  4FMT A;  5B1N A;  3ZRX A;  4GCZ A;  2QM8 A;  2P67 A;  2LFR A;  2C2A A;  2LFS A;  4JYC A;  4MT8 A;  4MTX A;  4QPK A;  4Q20 A;  4BIZ A;  4GT1 A;  3ZRW B;  1IXM A;  2QM7 A;  3A0R A;  3ZCC A;  4JAS A;  2FTK A;  4KP4 A;  3D36 A;  5IDJ A;  3DGE A;  4BIU A;  4I5S A;  1F51 A;  3TK1 A;  4FPP A;  3ZRW A;  4LC1 A;  3P32 A; 
#chains in the Genus database with same CATH topology
 4MVZ A;  4X9Q A;  1NTZ H;  2DYR C;  1KP3 A;  1THZ A;  4MVU A;  3KCY A;  3SYO A;  2Y4U A;  4X1Y A;  3JAR B;  3IJ4 A;  3HB3 B;  4I4T B;  2GBO A;  4TQD A;  3K5O A;  2UUB B;  1PNK A;  2GTA A;  2P4V A;  1F4N A;  1RFY A;  3SDL A;  1TVK A;  2B1G A;  1O9H A;  5CA3 A;  3G80 A;  2VS0 A;  1TA8 A;  1M93 A;  1P4R A;  3RT3 C;  3OAA G;  2LO1 A;  3UT5 B;  2YDE A;  4U7O A;  1R6T A;  2UUB O;  2DMX A;  1RM1 C;  4YXW G;  1SER A;  1OCR C;  1NVP B;  2R9I A;  1KUQ A;  3CCQ V;  4JF3 A;  2FTK A;  3OD4 A;  1QLE C;  4J11 A;  4MW8 A;  3OTO B;  4UXN A;  1D5N A;  1QHT A;  1B3Q A;  4O4I A;  2Q8V A;  1VAR A;  1N33 B;  3CRQ A;  3JCU Z;  1Z5V A;  2ITD C;  2H3O A;  2KKW A;  3JD1 A;  4JI3 O;  2XT9 A;  5GON B;  2UXC O;  3VQV A;  5IDJ A;  2LJ2 A;  2X6A A;  5H6R A;  1VQ6 V;  2OCC B;  3C3S A;  2IH1 C;  2IJJ A;  2FYU H;  2Z0A A;  2EIM C;  2HFE C;  3C3T A;  2F66 C;  1UJW B;  2R72 A;  5J9P C;  2H8P C;  4QE9 A;  3AG3 C;  4X1K B;  3E8B A;  4LBE C;  2GHY A;  4OX9 B;  3OUF A;  1ENV A;  2FKX A;  2ZM6 B;  2JVD A;  2JJ1 G;  4FPP A;  4C7U A;  5L3C A;  3G6E V;  3ASO B;  4LH7 A;  1YTF D;  4BAY A;  2QWQ B;  3CS5 A;  4MVQ A;  4DRX A;  2EX3 A;  1WNS A;  5BY1 A;  4GKK B;  2MW2 B;  1F23 A;  2ZR2 A;  2QWO B;  1VQK V;  3SPH A;  4PI0 A;  3ZN0 A;  2L6L A;  1AP5 A;  1F51 A;  2Q9L A;  1QQC A;  4OGQ B;  5FLX N;  4QGP A;  4RQF A;  1OCZ B;  1H2G A;  4J42 A;  3A2F A;  5IYC O;  2QWR B;  3B09 A;  4B08 A;  1VF5 B;  1H2N A;  1BT8 A;  2LGQ A;  1FXK A;  3W7S A;  4J9Z B;  1SQF A;  3L9D A;  3SJQ C;  1VQ4 V;  4BIU A;  4PDM A;  3I55 V;  1SQV H;  2WLN A;  3FD9 A;  2RN9 A;  1S0V A;  1JX9 A;  2CK3 G;  1GH6 A;  1QNM A;  1ZX3 A;  3A8T A;  4WBN B;  4GX0 A;  3ZHQ A;  3K03 A;  4MVM A;  2Y69 C;  4FMT A;  4F4L A;  2RQ6 A;  3ABT A;  1HNZ B;  3OEE G;  1XMO B;  1SQQ H;  5A2Q N;  1Q90 D;  3QF7 A;  2Y0I A;  4FZ0 A;  4HBN A;  1CP9 A;  4I5S A;  5GON A;  4X88 A;  5KHI A;  1WP8 A;  2KQX A;  3G71 V;  5H9C A;  1Y76 B;  1Q3E A;  1OHH G;  3TCU A;  5CBH A;  2X6B A;  4UVB A;  3PN1 A;  2X7R B;  3UCS C;  2LFS A;  5BMV A;  4OX9 O;  1F4M A;  1N36 B;  2WLL A;  2V4D A;  3EXA A;  1XEQ A;  2QGN A;  1YEW A;  3K0G A;  4FZ1 A;  4LCU C;  4RAI A;  4PEL A;  2WLL B;  5KUM A;  1GN2 A;  4FLW A;  3N2K B;  3T4D A;  1RPO A;  3QVN A;  5F2V O;  4JI8 B;  3OR7 C;  2OTL V;  4G28 B;  1X4T A;  3RVY A;  4X8A A;  2AGA A;  1EM1 A;  4TQF A;  4DV1 B;  3DSQ A;  4PA7 A;  1DK1 A;  2YC0 A;  1OZ0 A;  2N04 A;  3DTU B;  1NH2 B;  3FB5 C;  1CEZ A;  1SC5 B;  4K3A A;  2EZO A;  2CH7 A;  5KAI Z;  3OEH G;  4CBC A;  1GK9 A;  4X64 O;  4X1Y B;  1ZLZ A;  2EBO A;  1IBK B;  3OGI B;  4WCE V;  5JCO C;  4ZI7 B;  3FYI B;  5J2U A;  2YXY A;  2HVJ C;  3P3N A;  1JCH A;  4AIL C;  2LGW A;  2RNB A;  5JH7 B;  4GX5 A;  4MS2 A;  2ARH A;  2GDS A;  4PV1 B;  2UUC B;  4DV5 B;  3RFR A;  4B3M O;  2AXT Z;  1ZWI C;  2ZE5 A;  2HG5 C;  1L0L H;  2QJ1 A;  5EBW C;  1SQP H;  2LFR A;  1SF9 A;  3K79 A;  1P49 A;  1ZSP A;  3JAL A;  1EBO A;  4LFA O;  4FFB B;  1N0N A;  4QE7 A;  1PPJ H;  1BS3 A;  3QO5 A;  1SET A;  3FAV A;  2P22 C;  3CCJ V;  2ZT9 B;  1YVW A;  1KD1 W;  3ZMS A;  4H33 A;  3AG4 C;  3TGU H;  1J5E O;  3BAA A;  3BFR A;  3CX5 F;  1KP2 A;  1MA1 A;  2AZ2 A;  1YTF B;  2BOB C;  4GZR B;  1H8E G;  4LF7 O;  1K5S A;  4MVO A;  1HNX O;  4YHH O;  2OTJ V;  4NKG B;  5KHJ A;  3RN4 A;  3APQ A;  1EZJ A;  3T4Z A;  3HKB A;  2E3C A;  1Y66 A;  2AZ0 A;  1KU9 A;  1Q6H A;  3CXC U;  4DV7 B;  3GB7 C;  4B3M B;  2BOC C;  2MK3 A;  3HKD B;  4TUY B;  1H2L A;  2GV9 A;  4ZOL A;  2IU3 A;  4CH4 A;  4DK0 A;  4LF9 O;  4JTD B;  5L3D A;  1E1Q G;  3HR0 A;  1P7B A;  2JIZ G;  2ODM A;  2IW5 A;  3E22 B;  3THO A;  3X2Q C;  2YEV A;  3ZHV A;  4UV9 A;  1IBK O;  2XAJ A;  1PV0 A;  4JI1 B;  5LL6 Y;  1N8R W;  2K1E A;  3D3I A;  1K5Q A;  4MT8 A;  4ZIB A;  4RO2 A;  4Q20 A;  1XHZ A;  1BCC H;  3CRR A;  2PI4 A;  1NTK H;  4DR4 B;  5KUK A;  1ARO P;  3CHX A;  5JVD B;  4FVM A;  1KEC A;  4I50 B;  1AR4 A;  3J80 N;  3OFN G;  2F4V O;  3OUS A;  2E76 B;  1VF6 A;  2P5O A;  3RYH A;  3MAQ A;  3FB6 C;  3B4S A;  2HKO A;  3OE7 G;  2UUA B;  1FFX A;  4K8X A;  4LF8 B;  1PKX A;  2B1I A;  3OT7 A;  4GYC B;  2JGU A;  5CB4 B;  3DC6 A;  3CRC A;  3BY6 A;  2EIK B;  4B3T B;  4DV3 B;  1DTO A;  4JI0 B;  1GN6 A;  3CYO A;  1BE3 H;  4R6Z A;  4DR1 O;  3R65 A;  3W7W A;  4TUY A;  1XMQ O;  3RYF A;  1XHX A;  1NZ6 A;  3UO3 A;  3AK3 A;  1OCZ C;  4GX2 A;  1BMF G;  3SJA C;  4F6R A;  1FJG O;  2VWK A;  1FAF A;  2ZXW C;  1YIJ V;  4JYB A;  1GM8 A;  1WN7 A;  1JPX A;  4J7J A;  3MD0 A;  4NXN O;  1D5A A;  3LNN A;  4DR7 B;  3K9S A;  2Y48 A;  5IWA O;  4DK1 A;  2PF4 E;  4CH3 A;  5L3F A;  1NH2 D;  2YI8 A;  4HNA A;  4LFC B;  4Z1V A;  4OPH A;  3ETD A;  3L75 H;  5FPR A;  4O4I B;  2Q69 A;  5IY5 C;  4DV3 O;  2F93 B;  3K04 A;  4J7Z A;  4DO2 A;  2CE4 A;  2HEP A;  1AR1 B;  5JQG B;  1FS0 G;  3LUT B;  3IGA C;  2ZM6 O;  1WPB A;  4HZ3 A;  4ZHQ A;  3C90 A;  2HHH B;  4YIP A;  2JDI G;  1SQG A;  4X20 B;  5HFL A;  5JH7 A;  4I9Q A;  3L71 H;  3ZRV A;  2QA4 V;  2CAZ C;  1YZB A;  4TWK A;  1G1X B;  3JAK A;  2DYS B;  2LP7 A;  1TUE B;  1TGO A;  4QIW F;  5J2U B;  1DF5 A;  3APO A;  4NVP A;  1J5E B;  4R7C A;  4WF9 V;  4DV6 B;  2ZDI C;  2R9R B;  1W59 A;  4YHH B;  2F95 B;  3VQX A;  2JJ2 G;  3G67 A;  4GKJ O;  2KB1 A;  2B9Z A;  4DV2 O;  1QU7 A;  4CC6 A;  4DYL A;  5BXZ A;  4AHC A;  3BA8 A;  3K08 A;  1MZF A;  2ZD9 A;  1GM7 A;  3D36 A;  4FIP C;  3EHB B;  3MDS A;  1I5X A;  4ZBM A;  4E2L A;  4B7K A;  5EC1 C;  4LWS A;  1XNR B;  4IYH A;  3CC2 V;  2G38 A;  5IE9 A;  1HDJ A;  4MSW C;  3PJS K;  2IBZ H;  3WFV A;  3JAS A;  5JCO A;  3D3Q A;  2DYR B;  5AG2 A;  1XBL A;  1FKA O;  2YS8 A;  3ZMT A;  3HKC A;  5KX5 B;  3S3W A;  4JI4 B;  3ZRW A;  4LH6 A;  5B1B C;  3LDD A;  4LFB O;  5JJN B;  4DR4 O;  4JI5 O;  3D36 C;  4YJ3 B;  2BTO A;  2AW9 A;  2HJF C;  3AG4 B;  4J80 A;  4OPA A;  2ZIM A;  2F4V B;  1HP8 A;  5LBQ A;  3HKD A;  5LYJ B;  4BIZ A;  4O4H A;  4JI4 O;  2Q6A A;  3H9V A;  1L0N H;  3SYP A;  4LFB B;  1ORQ C;  4TV8 A;  1OCC B;  4DV1 O;  1DLB A;  3QNE A;  2JGD A;  4WFE A;  4DW0 A;  4I9W A;  3WB1 A;  3KCX A;  3K06 A;  2VQF B;  2Q7E A;  3J81 N;  2RMK B;  3ZRX A;  1Y67 A;  3ZS8 C;  1R73 A;  4JI3 B;  1FXK B;  3ABK B;  1AJQ A;  2A0L A;  2ADP A;  4YJ3 A;  5LP6 C;  3P3P A;  5JJE B;  1BL8 A;  3RWR D;  3K57 A;  2QTS A;  2PI5 A;  1NR7 A;  1HR0 O;  2XHB A;  4J7K A;  4LF4 B;  1SZT A;  3VQY A;  1M57 C;  1Y6X A;  2PYL A;  4CZZ A;  1XMO O;  2UXN A;  2YXL A;  4DUZ O;  4LF5 B;  4DR5 O;  2ZNJ A;  2P4K A;  1XUQ A;  2UUC O;  2CGN A;  4PD4 F;  4W4L A;  3U0Z A;  1AJP A;  2P7T C;  4H44 B;  1IXM A;  3U10 A;  2HP8 A;  1TUB B;  4ZHQ B;  4FM2 A;  4JYA B;  5K1P A;  5B1A B;  1R6N A;  5B1O A;  1GMG A;  4ASU G;  1IUR A;  4PA4 A;  4JAV A;  3TJT A;  1SA0 A;  1E1R G;  4ABM A;  3M8A A;  2ZE8 A;  1NI8 A;  3ASN C;  1ZL8 B;  2Q67 A;  1Y74 A;  4NTW A;  2EJR A;  2E75 B;  5H5N A;  1AI7 A;  3E8F A;  3H1L H;  4H13 B;  1P84 F;  1SQX H;  1SRY A;  5LHI A;  4IIJ B;  3SGI A;  2QKA A;  3F7V C;  3JAW B;  1GN4 A;  1K33 A;  1Q6I A;  1K8A W;  4UB8 Z;  1XL4 A;  1QCE A;  4JV5 B;  3A0R A;  5HFM A;  4JPR A;  5KA5 A;  1N4C A;  2EIL C;  3F7Y C;  4PA9 A;  2YXH A;  4IIJ A;  1JOY A;  2ITC C;  3F5T A;  3KZI Z;  2YUA A;  1FXV A;  4I0X A;  3LSS A;  1BHA A;  1K92 A;  4MTO A;  4Z1M G;  2OYQ A;  4DV5 O;  4JYY A;  1RP3 B;  5CB4 A;  3BHP A;  2UXB O;  1RSO A;  1Z5W A;  4K0K O;  1K4C C;  3JAS B;  3RBZ A;  1SA0 B;  5KHG A;  1S72 V;  5J2T B;  2N05 A;  4EFB A;  4EFE A;  2NLJ C;  4LWS B;  4X66 O;  1G4Y B;  4MVS A;  3SPG A;  5EYP A;  4JYA O;  4LF8 O;  2QWN B;  2ATK C;  2HVK C;  5CA1 B;  3FB7 C;  2A3Q A;  1H2S B;  2XND G;  4O2B A;  2Q68 A;  3ASN B;  3I56 V;  4AQY B;  1DF4 A;  3RYC A;  4IHJ B;  3T1Y O;  2RCV A;  4IL6 Z;  4CS4 A;  4LF5 O;  4PDR A;  2M7W A;  4JAA A;  1WPX A;  3G6B A;  4H37 A;  1N32 O;  4B3S O;  2F23 A;  1L1F A;  2WWW A;  2IU0 A;  2QSA A;  2WA4 A;  3ZHR A;  2UXD O;  4XBF A;  4U7N A;  1N0J A;  4WFG A;  4TOI A;  2ZCE A;  3T1H B;  4NB5 A;  5FPO A;  5CA1 A;  3CC7 V;  4CS2 A;  2ILM A;  2EIM B;  2XUM A;  3QTC A;  1RPR A;  2N74 A;  5JJJ B;  2GTS A;  5H2F Z;  4A5U B;  2OCC C;  1MNG A;  5JVD A;  1CPY A;  1PNL A;  1R6K A;  3R66 A;  5FNV B;  5LP6 A;  1QR9 A;  1SKV A;  4PDL A;  1JMK C;  2WLJ A;  1GO3 F;  3JD4 A;  3CCM V;  3K59 A;  4AQY O;  3KKY A;  3JSN A;  5JWP A;  1K3E A;  3QO7 A;  3CXH F;  4BR6 A;  1AR5 A;  1QLE B;  1K4D C;  3DC5 A;  2GUZ A;  2PZS A;  3LSU A;  1L8D A;  2IM9 A;  4DV4 B;  4QPJ A;  3E8G A;  1FPO A;  1R3L C;  2EZP A;  5ITZ A;  1B04 A;  1US6 A;  1QR8 A;  2KSD A;  1BQZ A;  1AI5 A;  3CCL V;  3ZIA G;  4O4L B;  4LP8 A;  2VRZ A;  4MW3 A;  5B1B B;  4PA3 A;  1HNW O;  4XDL A;  5D5Q A;  1N34 O;  4X65 O;  3LSQ A;  2DQ3 A;  2D3O W;  1SS3 A;  3OW2 U;  4NR1 A;  3K0D A;  1VQO V;  4KHP O;  2CTR A;  2UXB B;  1IBM B;  2M6Y A;  1DGS A;  2ZDI A;  5B1N A;  1GN3 A;  3E83 A;  2CH7 B;  2DWD C;  3STZ C;  4AI8 A;  3W7X A;  2PGG A;  4GKJ B;  1FYJ A;  4LC1 A;  2V7Q G;  4F6E A;  4NXN B;  5IYZ A;  4FLV A;  3ZMU A;  4FFB A;  4B3R B;  2LQT A;  2YIC A;  1G8M A;  2XAQ A;  2YIA A;  1Q86 W;  1M5I A;  4BIO A;  1XNR O;  3I5D A;  2PYJ A;  1MSD A;  5LHG A;  4UCV A;  1VIB A;  1YF2 A;  1I08 A;  1J95 A;  1AIL A;  2P90 A;  1HNW B;  1QLN A;  2KG7 B;  1PM9 A;  5L3E A;  5BZB A;  1VF7 A;  4JI8 O;  2QM8 A;  3AK1 A;  4HNA B;  3IAY A;  1VP7 A;  3CC4 V;  4O4L A;  4PA6 A;  3GWK C;  1YJN V;  3AEI A;  3E35 A;  5IT9 N;  3T1H O;  4XDJ A;  4DW1 A;  3CWB H;  1K34 A;  3A0H Z;  1BSM A;  3MHS C;  4JZ2 A;  1ZAU A;  4WFB V;  3CJH A;  3ZBH A;  1Q6U A;  3WG7 C;  5TIS Z;  3RYI B;  1JQ0 A;  3ZMV A;  5LMN B;  3OMA B;  4NTX A;  3S3X A;  4J10 A;  2JGD B;  2EIJ C;  4N23 A;  3ETG A;  2OCH A;  2AHY A;  5IY5 B;  4UVA A;  5GTI Z;  4MTX A;  2A06 H;  1WJZ A;  4GT1 A;  1JVM A;  5C8Y A;  4E4E A;  1HNZ O;  1M56 B;  3SPJ A;  3ZX6 A;  3TET A;  3N2K A;  1S3J A;  3ZHU A;  4P2Z A;  2LW1 A;  4DV0 O;  2PY5 A;  2VQF O;  1OJH A;  3FKS G;  2Y4T A;  5CN0 A;  4LF9 B;  1TUB A;  3FFQ A;  2BSK A;  2E74 B;  5IYB O;  3ZHS A;  4DV4 O;  4JI1 O;  1KKD A;  3HKC B;  5KX5 A;  2ZXW B;  3OTO O;  2WLM A;  2WLH A;  4O4J A;  1K73 W;  1XQ8 A;  5LGN A;  2PTM A;  4B3T O;  3EFF K;  5L3G A;  2Q4P A;  1ROP A;  1LUW A;  4LFC O;  4D6T H;  2IJH A;  3H1I H;  5LA6 A;  2BTQ B;  3K5L A;  4P30 A;  4I50 A;  3VQW A;  2JRI A;  2XAF A;  2EUL A;  3JAR A;  2QE7 G;  3FYE B;  1MMM A;  1E79 G;  2EIK C;  3B77 A;  4O2A A;  3IC7 A;  2A7W A;  3CCS V;  1LNQ A;  3JD3 A;  2Q7H A;  4CH5 A;  5C8Y B;  1HNX B;  4GLX A;  4DV0 B;  1AVM A;  4LNU A;  3STL C;  1S76 D;  2QKS A;  2QWP B;  1AI6 A;  2ZIN A;  5BR8 O;  1YJ9 V;  5ITZ B;  4PI2 A;  1V54 C;  5J2T A;  3NR7 A;  3ICX A;  4EEQ A;  1AB3 A;  3A0B Z;  4DV2 B;  4FLT A;  2RJZ A;  1FJG B;  2OIE A;  4D7T A;  2DQ0 A;  1M90 W;  4UCR A;  3BRC A;  4DRX B;  2ZE7 A;  3X2Q B;  1B6Q A;  4QJF B;  3DGE A;  1PNM A;  5CBF A;  3JD2 A;  4KFM A;  1K97 A;  1S5H C;  3BAB A;  1URF A;  5LXT B;  3B8N A;  5K1X A;  1YI2 V;  4N21 A;  2JS5 A;  1T5E A;  2R9A A;  4DXW A;  3AG2 B;  4OXS A;  4EB6 B;  1YIT V;  2UUA O;  4WFH A;  4D7S A;  2XAG A;  5EZY B;  3CPW U;  3CCE V;  4DUY B;  4U3J A;  3ABL C;  5B3S C;  3H1H H;  1FFT B;  3HKE B;  4J41 A;  3P32 A;  3Q4H A;  4R50 A;  1O9G A;  2AHZ A;  3TXS A;  1B06 A;  3RW0 A;  4WBN A;  1KC8 W;  1IBL B;  4MTG A;  3FX7 A;  4UCO A;  1D2D A;  2W6J G;  5B5E Z;  4FLZ A;  4O2A B;  3CCV V;  4I7Z B;  2E5L B;  2KG7 A;  4DR2 B;  1S77 D;  1MOF A;  1V55 B;  3ETQ A;  2JEX A;  3ML0 A;  4GKK O;  4DR3 O;  3AG1 B;  2PUS A;  3GVM A;  4X62 O;  1AI4 A;  2FL4 A;  2CTQ A;  4FM0 A;  5JQG A;  2OIG A;  1VMG A;  2K9P A;  2W6I G;  5GTH Z;  5LGT A;  1KMI Z;  4KUM A;  3OM3 B;  1OCC C;  2WPD G;  2UXD B;  3OMN B;  5IJ0 B;  4EKW A;  3CCR V;  4X62 B;  4KXR A;  3RYH B;  2FB5 A;  2BE3 A;  4JI7 B;  1P7G A;  3JAT A;  4NYK A;  2FML A;  2X0L A;  4TV9 B;  2RDC A;  3AG7 A;  3H1J H;  3K3W A;  4JTA B;  3L72 H;  4B7E A;  4X64 B;  3FB8 C;  4X1K A;  3ZMZ A;  2HHH O;  3IFX A;  2ZNI A;  1NBM G;  4CC5 A;  2EJ7 A;  1Y76 A;  4U3F H;  3AG2 C;  1BQ0 A;  4NXM B;  1LUV A;  4NTY A;  1I5Y A;  4L8J A;  4QPK A;  2B5U A;  3LDE A;  3QO8 A;  3CJH B;  1U97 A;  1OV9 A;  4JGS A;  1K9M W;  1EN6 A;  1KYO F;  1S5J A;  4RUE A;  4I55 B;  2ZKO A;  2DE0 X;  3JCZ A;  5CA0 B;  3K5M A;  1GRJ A;  2Q7G A;  3CRM A;  3D8C A;  2NR5 A;  3L70 H;  3M7M X;  4IHJ A;  4X65 B;  5KMG B;  1W2B U;  3E89 A;  1QVG U;  2CUG A;  3CE2 A;  1YHQ V;  2YID A;  1WB8 A;  2YIB A;  2DWE C;  5EBM C;  3ZED A;  2E5L O;  1JR9 A;  3TXQ A;  1M4U A;  4DR2 O;  3E2E A;  1MSW D;  2WSS G;  4JV5 O;  5EYP B;  4CS3 A;  1IBM O;  1TAE A;  3WU2 Z;  2DYS C;  3FAV B;  3J7A U;  2ZE6 A;  5IYZ B;  1N33 O;  4NXM O;  1IBL O;  2NNU A;  3RGB A;  2OWO A;  3JAM N;  3CRA A;  3OMI B;  4JI6 B;  2YEV B;  2YIB D;  2BSK B;  1I0H A;  1Q43 A;  4P9O A;  1YJW V;  4FLU A;  2Q0A A;  3JD0 A;  3L73 H;  1ZTE A;  3SPC A;  3SYC A;  4WFA V;  4JYC A;  3VOU A;  3K58 A;  2BCC H;  1EN5 A;  4K8Z A;  2UU9 B;  1YXB A;  2QM7 A;  3CP1 A;  1NT2 B;  4X89 A;  3BVO A;  1VQ8 V;  1YSC A;  3OGC C;  2CTW A;  1OCO C;  4RWU A;  1MG1 A;  1EN4 A;  4ZKI A;  3RYI A;  3E8H A;  1NS1 A;  1GAX A;  4TV9 A;  2C2A A;  1BGY H;  4IT5 A;  1OCO B;  4Q6G A;  1Q7Y W;  2XTA A;  3ASO C;  2V1D A;  1HWY A;  4PJ0 Z;  5E1A C;  1XIL A;  1H38 A;  4EB6 A;  2R70 A;  1H2M A;  1M56 C;  1Y74 B;  1N32 B;  2XAH A;  4I0X B;  3AG3 B;  3GWO A;  4H0L B;  5BR8 B;  4K35 A;  1VQ5 V;  4LF4 O;  2EIJ B;  1PP9 H;  4Z2W A;  2WAM A;  3SJB C;  1W0K G;  5FL7 G;  2A79 B;  2DJV A;  5B66 Z;  2IJK A;  1AJN A;  2VQE O;  1Q8I A;  1VQP V;  4JTC B;  2Q73 A;  2P06 A;  4MTF A;  3W7U A;  1JA8 A;  4JZG A;  4LF6 O;  4DR6 O;  2ETN A;  4DR1 B;  4G2K A;  3N27 A;  5EIB C;  4DV7 O;  1I7F A;  3T1Y B;  3CSX A;  4BWA A;  4TSF G;  4JI5 B;  5LHH A;  4JI2 O;  3CB2 A;  4JI7 O;  1S5L Z;  1TVK B;  4PHZ A;  4JI6 O;  4CH6 A;  2W0F C;  3ZCC A;  2JS3 A;  1IX9 A;  1BZK A;  1NR1 A;  3CCU V;  1CXZ B;  4IYI A;  3G4S V;  1H2K A;  4JAU A;  1OCR B;  2D2C B;  1ZL8 A;  1RM1 B;  5EZY A;  4O2B B;  3M99 B;  1Z2G A;  2F43 G;  2GSM B;  4UCU A;  1PL4 A;  5IJ9 B;  5KHH A;  1G6U A;  5EK0 A;  4IGG A;  3T2M A;  2QKC A;  1PL0 A;  3OR6 C;  4W4K A;  1Q81 W;  5IYD O;  1A32 A;  4X20 A;  3H01 A;  3UM7 A;  3DXR A;  2BTQ A;  1WAZ A;  1N34 B;  2H94 A;  5LGU A;  2HJD A;  1HR0 B;  2DW4 A;  4PDV A;  2DN9 A;  1WA8 A;  5LOV B;  4RQE A;  3L74 H;  3ETE A;  3ZN1 A;  5CMU A;  1IXB A;  1XNQ O;  1R3K C;  1Q5O A;  4YJ2 B;  2QTO A;  2X6C A;  4DR3 B;  1EFR G;  3B40 A;  3E86 A;  3O65 A;  4FLX A;  1NU1 H;  3ZJZ A;  2EIN B;  3UO2 A;  4X1I B;  2WA3 A;  1R1B A;  4GX1 A;  4DV6 O;  3DXR B;  3LNM B;  2QDO A;  4LNU B;  4X66 B;  4JAS A;  3SR2 C;  2XOK G;  1LR1 A;  4FK5 C;  2ADQ B;  1KB9 F;  1IDS A;  4UB6 Z;  4TV8 B;  3EVK A;  1AP6 A;  4O4H B;  3JAW A;  4JI2 B;  3RYF B;  3IC9 A;  2LW7 A;  3BPZ A;  3AG1 C;  3CMA V;  1Q82 W;  1FXH A;  2UXX A;  1V55 C;  1JJO A;  4X1I A;  3H1K H;  3ZRS A;  1KQS U;  5GW7 A;  2QM4 A;  1WP7 A;  4K0K B;  4YJ2 A;  3W7T A;  4B3S B;  4P9P A;  1VF6 C;  5DN6 G;  1WLE A;  3ABM B;  1I94 O;  4O4J B;  1WA8 B;  3AK2 A;  3CEI A;  3JAL B;  4KHP B;  1M9N A;  5LMU B;  2WLI A;  1PD3 A;  2WLK A;  4KP4 A;  5CBG A;  2CDY A;  5B3S B;  3ABL B;  2QEX V;  3QG5 A;  2UXC B;  5DM6 V;  1XL6 A;  3UQ8 A;  4WFF A;  4FJC C;  3F5W C;  2A9H A;  2CTP A;  3UT5 A;  5DEC A;  2Q5Z A;  1M1K W;  4FLY A;  4GCZ A;  2IH3 C;  3RVZ A;  1Y4M A;  4ZI7 A;  3HPL C;  1XNQ B;  2ZIO A;  5KAF Z;  4FM1 A;  1MZE A;  1SQB H;  1QBZ A;  1VEW A;  4UUJ C;  2IJI A;  2ZQM A;  2QR4 A;  1KKC A;  2OT5 A;  2F1M A;  4UCS A;  1BHB A;  3P30 A;  1V9P A;  3K5N A;  4DR7 O;  5C93 A;  4LF6 B;  4U3J B;  3ABU A;  1NTM H;  2P67 A;  1GM9 A;  2YSU B;  1VQN V;  4UVC A;  2HR3 A;  2JEU A;  3JAK B;  2Z3Y A;  1XI1 A;  5EC2 C;  2ZR3 A;  1UFI A;  1NQT A;  1V54 B;  4J9Y B;  5LYJ A;  3BCC H;  4DR5 B;  1SES A;  2O57 A;  3OTF A;  4MVR A;  3SPI A;  3JAT B;  2Y69 B;  3VBB A;  3KG2 A;  3BA9 A;  5BMV B;  3B2E E;  3K9A A;  5LMN O;  5EIB D;  3ZRW B;  1VQ9 V;  2EIL B;  3BEH A;  4GUN A;  2Z5U A;  1K7D A;  5IJ0 A;  4HYO A;  3N2G B;  1GTO A;  1IVS A;  5A9G A;  1EZV H;  5LOV A;  2HLD G;  1KBH A;  1FFX B;  4LR3 A;  5E79 Z;  4UFZ A;  5KLV H;  4JI0 O;  5H6Q A;  1YDX A;  4I4T A;  4QNH B;  2WLI B;  1XMQ B;  3UKM A;  1ZUQ A;  5KHK A;  2Y0P A;  3SYA A;  3O9O A;  5EBL C;  4YY3 B;  5KMG A;  4ICG A;  2NN4 A;  3B8M A;  3E22 A;  4R8C A;  1GKF A;  3LDC A;  1I94 B;  1JJ2 U;  5CA0 A;  1R3I C;  2DOS A;  4I55 A;  5LA6 B;  4DR6 B;  5B1A C;  4KL1 A;  1VQL V;  3WB0 A;  2L35 A;  3Q4H B;  4LFA B;  5D5P A;  4RUF A;  1R3J C;  1N36 O;  3WB2 A;  3HKE A;  1QVF U;  4B3R O;  4ZOL B;  2XAS A;  1YCI A;  2GUZ B;  4DUZ B;  1WB7 A;  4BW9 A;  2Q0O C;  2P6J A;  3ABM C;  2UU9 O;  1VQ7 V;  4G27 B;  1F7Y A;  1M57 B;  1COW G;  3CME V;  1XDC A;  2YI9 A;  3ZHT A;  3WG7 B;  4TT3 G;  1JFF B;  5LXT A;  3SJC C;  1MAB G;  5L3B A;  1SZX A;  4LF7 B;  2VWJ A;  5FNV A;  5LP6 B;  4YIO A;  3NXS A;  1FXK C;  2CGO A;  3ABK C;  1JFF A;  5DED A;  4YY3 O;  3MHH C;  1RSO B;  4HAM A;  3N2G A;  4FFK A;  1IZ3 A;  3JYC A;  4XDK A;  1FD9 A;  1X59 A;  2W0X A;  1UPG A;  3U11 A;  3TK1 A;  1XRE A;  1W0J G;  5LMU O;  5KA6 A;  3SYQ A;  4BW5 A;  1HW7 A;  1XOU A;  3CD6 V;  1VQM V;  1U96 A;  4UV8 A;  1NJI W;  2EIN C;  2VQE B;  1NVP D;  4F6R B;  3RYC B;  3JSL A;  2JK5 C;  4L87 A;  1NKD A;  3HKB B;  4UCT A;  3T1C A;  5IJ9 A;  5IWA B;  1H8H G;  4DUY O; 
#chains in the Genus database with same CATH homology
 1YSC A;  3OGC C;  4MVZ A;  2ZXW C;  3OW2 U;  2DYR C;  1KP3 A;  3K0D A;  1THZ A;  4MVU A;  1VQO V;  1OCO C;  1YIJ V;  3SYO A;  2ZDI A;  4JYB A;  1GM8 A;  1MG1 A;  1JPX A;  3MD0 A;  4ZKI A;  3E8H A;  5B1N A;  3HB3 B;  3E83 A;  2C2A A;  2DWD C;  1OCO B;  3STZ C;  3W7X A;  2Y48 A;  1Q7Y W;  1PNK A;  3ASO C;  2V1D A;  1HWY A;  5E1A C;  5L3F A;  1H38 A;  1F4N A;  1NH2 D;  2B1G A;  5CA3 A;  4LC1 A;  1M56 C;  2V7Q G;  3ETD A;  1P4R A;  2XAH A;  3OAA G;  3ZMU A;  3AG3 B;  3GWO A;  4U7O A;  2Q69 A;  5IY5 C;  1VQ5 V;  1G8M A;  2XAQ A;  2EIJ B;  1RM1 C;  1Q86 W;  3K04 A;  4YXW G;  4DO2 A;  1AR1 B;  2WAM A;  1SER A;  1W0K G;  1FS0 G;  5LHG A;  3LUT B;  5FL7 G;  1OCR C;  3IGA C;  1NVP B;  2A79 B;  2R9I A;  3CCQ V;  4HZ3 A;  4JF3 A;  2IJK A;  1AJN A;  2FTK A;  1VQP V;  1J95 A;  2P90 A;  4JTC B;  4MTF A;  1QLE C;  2JDI G;  1QLN A;  3W7U A;  4MW8 A;  5HFL A;  4UXN A;  3ZRV A;  2QA4 V;  4TWK A;  5L3E A;  4G2K A;  5BZB A;  2DYS B;  2LP7 A;  4TSF G;  1TUE B;  2QM8 A;  5LHH A;  4QIW F;  3CC4 V;  1DF5 A;  4PA6 A;  1YJN V;  3AEI A;  3E35 A;  2ITD C;  4XDJ A;  3JD1 A;  2W0F C;  1K34 A;  3ZCC A;  4R7C A;  4WF9 V;  5IDJ A;  3MHS C;  1NR1 A;  4WFB V;  5H6R A;  2X6A A;  3CCU V;  2OCC B;  1VQ6 V;  2IH1 C;  2ZDI C;  2R9R B;  3WG7 C;  2IJJ A;  3G4S V;  4JAU A;  1JQ0 A;  2EIM C;  2HFE C;  1OCR B;  3ZMV A;  3OMA B;  1UJW B;  2JJ2 G;  2KB1 A;  1RM1 B;  2EIJ C;  4N23 A;  3ETG A;  3M99 B;  2AHY A;  5IY5 B;  2F43 G;  2GSM B;  4UVA A;  2H8P C;  5J9P C;  4QE9 A;  3AG3 C;  4MTX A;  5EK0 A;  3E8B A;  4GT1 A;  4LBE C;  1JVM A;  2GHY A;  3K08 A;  3T2M A;  1M56 B;  1PL0 A;  2ZD9 A;  3OR6 C;  3SPJ A;  1GM7 A;  3TET A;  5IYD O;  1Q81 W;  1S3J A;  3D36 A;  1ENV A;  3OUF A;  4FIP C;  3EHB B;  4P2Z A;  2JJ1 G;  4FPP A;  3H01 A;  1I5X A;  4ZBM A;  4E2L A;  5L3C A;  3UM7 A;  3G6E V;  3ASO B;  5EC1 C;  3FKS G;  5CN0 A;  1YTF D;  2H94 A;  5LGU A;  4BAY A;  3CC2 V;  4MVQ A;  2DW4 A;  4MSW C;  3PJS K;  4PDV A;  5IYB O;  3WFV A;  1F23 A;  1KKD A;  2ZR2 A;  4RQE A;  2DYR B;  1VQK V;  2ZXW B;  2WLM A;  2WLH A;  3ETE A;  3SPH A;  3ZN1 A;  5CMU A;  3ZN0 A;  1K73 W;  3ZMT A;  5LGN A;  1R3K C;  1F51 A;  2QTO A;  3EFF K;  3ZRW A;  4RQF A;  1OCZ B;  2X6C A;  1H2G A;  1EFR G;  5L3G A;  3E86 A;  3LDD A;  1ROP A;  5B1B C;  5IYC O;  3ZJZ A;  2EIN B;  2IJH A;  2HJF C;  3AG4 B;  4P30 A;  2XAF A;  4GX1 A;  5LBQ A;  2QE7 G;  3LNM B;  1FXK A;  3FYE B;  3W7S A;  4BIZ A;  4J9Z B;  2Q6A A;  1E79 G;  2EIK C;  3B77 A;  3SJQ C;  1VQ4 V;  3IC7 A;  4JAS A;  3SYP A;  3CCS V;  1LNQ A;  2XOK G;  3JD3 A;  1ORQ C;  4PDM A;  4BIU A;  3I55 V;  4FK5 C;  1OCC B;  2WLN A;  1DLB A;  1S0V A;  1JX9 A;  2CK3 G;  3QNE A;  4WFE A;  4I9W A;  3K06 A;  4GX0 A;  3K03 A;  4MVM A;  3STL C;  1S76 D;  2Y69 C;  4FMT A;  4F4L A;  3ZRX A;  2QKS A;  3AG1 C;  3CMA V;  1Q82 W;  1FXH A;  3ABT A;  2UXX A;  1AI6 A;  1R73 A;  3OEE G;  1FXK B;  3ABK B;  1BHA A;  1AJQ A;  1V55 C;  1YJ9 V;  2A0L A;  1KQS U;  3ZRS A;  5GW7 A;  1CP9 A;  1V54 C;  1BL8 A;  4I5S A;  4X88 A;  2PI5 A;  1NR7 A;  3W7T A;  3G71 V;  1SZT A;  4P9P A;  5DN6 G;  1WLE A;  5H9C A;  1OHH G;  3TCU A;  1M57 C;  5CBH A;  4CZZ A;  2UXN A;  2X6B A;  3ABM B;  4UVB A;  2DQ0 A;  1M90 W;  2X7R B;  1AJP A;  2LFS A;  2P7T C;  1F4M A;  3X2Q B;  2WLL A;  1M9N A;  1B6Q A;  1IXM A;  2WLI A;  1PD3 A;  4QJF B;  2WLK A;  3K0G A;  4KP4 A;  5CBG A;  3DGE A;  1PNM A;  5CBF A;  3JD2 A;  4LCU C;  4KFM A;  5B3S B;  3ABL B;  4RAI A;  5B1A B;  4PEL A;  2QEX V;  1K97 A;  2WLL B;  1S5H C;  5KUM A;  1R6N A;  5DM6 V;  5B1O A;  1GMG A;  3B8N A;  4ASU G;  1XL6 A;  1YI2 V;  3T4D A;  1RPO A;  4PA4 A;  4WFF A;  4N21 A;  3OR7 C;  4FJC C;  3F5W C;  2A9H A;  4JAV A;  2OTL V;  1E1R G;  1M1K W;  4DXW A;  3AG2 B;  4G28 B;  4GCZ A;  3RVY A;  4X8A A;  3ASN C;  2IH3 C;  4OXS A;  1YIT V;  3RVZ A;  1Y4M A;  2Q67 A;  3HPL C;  4WFH A;  2XAG A;  2EJR A;  3CPW U;  4PA7 A;  3CCE V;  1AI7 A;  3E8F A;  3ABL C;  5B3S C;  1QBZ A;  4UUJ C;  1FFT B;  2IJI A;  1OZ0 A;  2ZQM A;  3DTU B;  3P32 A;  1NH2 B;  3FB5 C;  1CEZ A;  4R50 A;  2AHZ A;  1SRY A;  2EZO A;  2OT5 A;  5LHI A;  1BHB A;  3P30 A;  3OEH G;  4CBC A;  1GK9 A;  5C93 A;  3RW0 A;  3F7V C;  1KC8 W;  2EBO A;  3ABU A;  4WCE V;  1K33 A;  4MTG A;  1K8A W;  3FYI B;  2P67 A;  1GM9 A;  2YSU B;  1VQN V;  4UVC A;  1XL4 A;  2HR3 A;  1QCE A;  2JEU A;  2W6J G;  2HVJ C;  2Z3Y A;  3A0R A;  5HFM A;  5EC2 C;  2ZR3 A;  1JCH A;  4JPR A;  3CCV V;  1NQT A;  1V54 B;  4J9Y B;  5KA5 A;  1S77 D;  2EIL C;  4GX5 A;  4MS2 A;  1MOF A;  1SES A;  3F7Y C;  4PA9 A;  1V55 B;  2JEX A;  4MVR A;  1ZWI C;  3ML0 A;  1JOY A;  2HG5 C;  3AG1 B;  3SPI A;  2Y69 B;  3VBB A;  5EBW C;  1AI4 A;  2LFR A;  2ITC C;  3KG2 A;  3K79 A;  3K9A A;  3ZRW B;  1EBO A;  1FXV A;  1VQ9 V;  3LSS A;  2EIL B;  1K92 A;  2W6I G;  3BEH A;  4MTO A;  5LGT A;  2Z5U A;  4KUM A;  1K7D A;  1OCC C;  3OM3 B;  4QE7 A;  4Z1M G;  2WPD G;  4HYO A;  3OMN B;  1GTO A;  3QO5 A;  1SET A;  1K4C C;  3RBZ A;  2HLD G;  4EKW A;  3CCR V;  3CCJ V;  1S72 V;  1KD1 W;  3ZMS A;  4H33 A;  3AG4 C;  5H6Q A;  2NLJ C;  1KP2 A;  1YTF B;  2BOB C;  1G4Y B;  4MVS A;  2X0L A;  3SPG A;  4QNH B;  2WLI B;  1H8E G;  3UKM A;  1K5S A;  3K3W A;  4JTA B;  4MVO A;  2OTJ V;  2ATK C;  2HVK C;  3FB8 C;  1EZJ A;  3FB7 C;  3T4Z A;  3ZMZ A;  3IFX A;  2XND G;  3SYA A;  1NBM G;  5EBL C;  2Q68 A;  3ASN B;  3I56 V;  1Y66 A;  3CXC U;  1DF4 A;  3GB7 C;  3AG2 C;  2BOC C;  2MK3 A;  3B8M A;  4R8C A;  1I5Y A;  4QPK A;  2B5U A;  1GKF A;  3LDE A;  3LDC A;  1JJ2 U;  3QO8 A;  2M7W A;  4PDR A;  4JGS A;  1WPX A;  1R3I C;  1K9M W;  2IU3 A;  5B1A C;  1VQL V;  4H37 A;  4RUE A;  4JTD B;  1R3J C;  3JCZ A;  4RUF A;  5L3D A;  1QVF U;  1L1F A;  1E1Q G;  1P7B A;  2JIZ G;  2WWW A;  2XAS A;  2IU0 A;  2IW5 A;  3X2Q C;  2YEV A;  4XBF A;  4UV9 A;  4U7N A;  2XAJ A;  4WFG A;  1N8R W;  2P6J A;  1W2B U;  2K1E A;  3ABM C;  3D3I A;  3CC7 V;  3E89 A;  1VQ7 V;  1QVG U;  4G27 B;  1K5Q A;  1M57 B;  4MT8 A;  1YHQ V;  4RO2 A;  4Q20 A;  1COW G;  2PI4 A;  3CME V;  2EIM B;  1RPR A;  2DWE C;  5EBM C;  3WG7 B;  4TT3 G;  3E2E A;  2OCC C;  1MSW D;  1MAB G;  5KUK A;  2WSS G;  1ARO P;  5L3B A;  1CPY A;  1PNL A;  1KEC A;  1R6K A;  1QR9 A;  4PDL A;  3OFN G;  3OUS A;  3NXS A;  2WLJ A;  1FXK C;  3ABK C;  1GO3 F;  3FB6 C;  3JD4 A;  2HKO A;  3OE7 G;  3CCM V;  2DYS C;  3MHH C;  1PKX A;  2B1I A;  4HAM A;  1K3E A;  3JYC A;  4XDK A;  3QO7 A;  2NNU A;  3OMI B;  1QLE B;  3TK1 A;  2YEV B;  1K4D C;  1W0J G;  3BY6 A;  2EIK B;  5KA6 A;  4P9O A;  1YJW V;  1DTO A;  3JD0 A;  4QPJ A;  3E8G A;  3SYQ A;  1R3L C;  2EZP A;  4BW5 A;  3CYO A;  3SPC A;  1QR8 A;  4R6Z A;  3SYC A;  3CD6 V;  4WFA V;  1AI5 A;  4UV8 A;  3CCL V;  3R65 A;  3ZIA G;  1VQM V;  4JYC A;  1NJI W;  3W7W A;  2EIN C;  4LP8 A;  3VOU A;  4MW3 A;  1NVP D;  5B1B B;  4PA3 A;  2QM7 A;  3CP1 A;  1OCZ C;  2JK5 C;  4L87 A;  1NKD A;  4GX2 A;  4X89 A;  3T1C A;  4XDL A;  3LSQ A;  2DQ3 A;  1BMF G;  1H8H G;  1VQ8 V;  2D3O W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...