3ZRVA

The high resolution structure of a dimeric hamp-dhp fusion displays asymmetry - a291f mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
108
structure length
108
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 46
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrvA00
3ZRXA 4BIUA 3P32A 2LFRA 3D36A 4Q20A 5IDJA 4FPPA 2QM7A 4JAUA 1F51A 4U7OA 5B1NA 3ZRWB 5C93A 4LC1A 4QPJA 4FMTA 3A0RA 3MD0A 3TK1A 3DGEA 3NXSA 4I5SA 4JAVA 4GT1A 4ZKIA 2FTKA 4JYCA 4QPKA 4U7NA 3ZRVA 4MTXA 3ZCCA 1JOYA 4GCZA 2P67A 4JYBA 2LFSA 2WWWA 2C2AA 3ZRWA 2QM8A 4BIZA 4JASA 1IXMA 4MT8A 4KP4A 5B1OA
chains in the Genus database with same CATH superfamily
1TUBA 2EINC 4PA7A 3KCXA 1L0LH 4FM0A 2BE3A 1Q6HA 4MVSA 5IJ9A 1QQCA 1Q81W 4DV4B 3AK3A 2Q9LA 3UCSC 1AJPA 1SKVA 3AG3C 4DRXA 4K0KB 3F5WC 1SQGA 2YC0A 5EK0A 2IJIA 4IHJA 3M99B 1VQ4V 1JFFA 1BSMA 4RQFA 1N36B 1GN2A 2OCHA 3K06A 3L9DA 2LJ2A 3FB5C 1F23A 1BGYH 1IBLO 4E2LA 5CBGA 2Q4PA 4AHCA 4X62O 4DV5B 1KC8W 3B2EE 1FJGO 2F93B 1XMOO 2A79B 4B3SB 3BA9A 3ZS8C 1MSDA 2XAGA 4XDJA 3CCRV 1UFIA 2QR4A 2Q7EA 3OMNB 4X1KB 1SC5B 2P22C 4I55B 1GN4A 1G6UA 1TUBB 4NXNO 1VQ5V 4JI3B 1XNQB 3JSNA 1IBMO 1RFYA 1VF6A 2UUBB 5IYCO 5IJ9B 2D2CB 4X64O 1P4RA 2R9IA 1N33O 1HWYA 1MNGA 3SYOA 2Q69A 3JAWB 4IHJB 3VQVA 4FFKA 5GONA 3ZMZA 3ABKC 3LDEA 1PP9H 4JAVA 3AG1C 3WB1A 1KU9A 2FKXA 2P90A 1PPJH 2HKOA 4FLTA 3ZN1A 2X6CA 3A8TA 1PL0A 1URFA 2RMKB 5B1NA 3H1LH 5AG2A 1OCRB 4IT5A 2ZE7A 4EB6A 3CCUV 1HR0O 3SPHA 4MTFA 2Z3YA 2DYRC 3ASOC 3RYIA 5JCOA 4DR3O 1J5EO 1HNXO 2AZ0A 4DR6O 1OCCC 3BA8A 1PL4A 4DV7B 1VP7A 1AROP 2Y0IA 3JATA 1AI4A 1GN3A 3JD1A 3RYCA 3OR7C 1TA8A 1K5SA 4YHHO 2EIMB 3SYQA 5KAIZ 2AXTZ 2Y4UA 1GH6A 1GM9A 1FFXA 3LDCA 1K4CC 5IY5B 1BCCH 1XL6A 5IJ0A 5H6QA 4WFAV 3AG2B 4JPRA 2GSMB 3BEHA 3L70H 2XAJA 3JCZA 1H8EG 4MSWC 4W4KA 4MVMA 1NTMH 3ABMC 4LFCB 4GX2A 2YXYA 1XEQA 1R3JC 3H1HH 2Z0AA 3SGIA 3OTFA 4X89A 2OWOA 4X62B 5GTHZ 3EVKA 1FJGB 1XMOB 3RYIB 4LFBO 3ZMTA 4E4EA 5A2QN 2ZNIA 3CHXA 3RYFB 3NR7A 1NH2B 3ASNC 2IH3C 1KP3A 1ZUQA 4RUEA 3ZHRA 3CWBH 1P7BA 2ODMA 3J81N 5KHHA 1N0NA 5CBHA 3CEIA 5E1AC 4YJ2B 3FX7A 4NKGB 1AR1B 1I5YA 3OW2U 1FFXB 4RUFA 2F23A 4X64B 4F4LA 1N34O 4GKKO 3FB7C 1PNLA 1ZLZA 2HFEC 4DR1B 4LNUB 1Q43A 1GAXA 3RW0A 1N0JA 1VQ9V 2PTMA 2VQEB 4MTOA 4UV8A 1WP8A 1DTOA 2KSDA 1R3IC 1VARA 4LBEC 2DYSB 1PD3A 4YXWG 1DF5A 1Z5WA 2QGNA 4UXNA 2R72A 1WN7A 4DV1B 1OV9A 3CPWU 5LMUO 2CTRA 2W6JG 2GV9A 5C8YA 3OAAG 3J7AU 1S72V 3DXRA 2F1MA 3GVMA 1SQVH 3ZHSA 4DUZO 2PF4E 3WG7B 1ZTEA 2YXLA 1YITV 1HR0B 4KFMA 3CE2A 3Q4HA 2H94A 4FLZA 4X9QA 3VBBA 2ATKC 1GK9A 4DR6B 2Q7GA 1KUQA 1D5AA 1NR7A 4O4JB 1EN4A 3K04A 2X0LA 3JD0A 1KP2A 4DR2B 4LF8B 3OEHG 2E5LO 1OZ0A 3UT5A 1WPBA 4ASUG 1XDCA 4UCTA 2AHZA 2Y69B 4DK0A 4TUYA 1VQ8V 3BCCH 1NVPD 4LF6B 2ZXWB 4NXMB 5JQGA 4RO2A 3ETEA 2CTQA 5EIBD 3CCSV 2DN9A 4OXSA 1G1XB 2EX3A 4PV1B 1FXKB 5IT9N 1K34A 3G6BA 4JASA 5B5EZ 5C8YB 1BHBA 2E76B 3K79A 4ZBMA 1OCRC 3DXRB 1N8RW 1WP7A 3L73H 1K7DA 2KQXA 1ZL8B 4I5SA 4NB5A 3SJCC 1MABG 4ZHQA 3UQ8A 3HR0A 4LH6A 1QBZA 3Q4HB 2KKWA 4TQDA 3E22A 1H38A 2B9ZA 4LFBB 2W6IG 4YY3B 3SPIA 4J9YB 2R70A 4ZI7A 5LHIA 2JS3A 5BR8B 1CEZA 1VF6C 2BCCH 2WPDG 4TWKA 1M57B 4FVMA 4FZ1A 1XOUA 3CMAV 2UXNA 2Q73A 3FYIB 4O4LB 3EXAA 5KX5B 4FFBB 4TUYB 3X2QB 3AG4B 5B1OA 3TJTA 3C90A 5IY5C 3ZIAG 4A5UB 1N34B 1RSOA 1YJNV 4GKKB 4FPPA 5KMGA 3ZN0A 4QE9A 3L71H 4PA4A 3MD0A 3E2EA 4IL6Z 1P7GA 1H2KA 1VQPV 2NLJC 3F7VC 3I56V 4DR4B 2WAMA 3HKDA 2UUCO 2Q67A 1V55C 5B3SB 2YSUB 2WA4A 1SA0B 4LF4O 4FM2A 4FLXA 5LMUB 3JSLA 2QWPB 3QVNA 1IVSA 4R6ZA 4X88A 5JCOC 1BHAA 2JGDB 1AP6A 2EJRA 1BL8A 1N4CA 1M56C 3H1IH 2CK3G 2PI4A 1XILA 2EILC 4ZI7B 2EZPA 1JPXA 4DV4O 2BSKA 4D7SA 1G4YB 4JI0O 4UV9A 3GWKC 2ZR3A 2P4KA 3JD2A 4DV2B 4K0KO 4DV0O 3J80N 1H2NA 4LC1A 1FKAO 1N36O 5DM6V 1QLEB 4FLVA 1AP5A 3AK2A 4GCZA 4RWUA 1E1RG 4ABMA 3I55V 3H1KH 3ZJZA 4JI4O 4UB6Z 2YIAA 3MHHC 2B1GA 2IU3A 2ZE8A 1KYOF 2OT5A 3WFVA 4B3SO 4Z1MG 4UCVA 1SZTA 2DYSC 4JAUA 3HKDB 1FXHA 1IDSA 2QWQB 4H13B 3HB3B 3OMIB 4QPJA 4P9PA 4B3TB 2UU9O 3K58A 3K03A 3JAKA 3WB0A 5B1AB 1H2LA 4JI3O 3RVYA 1L1FA 1JQ0A 4XDLA 1F51A 2ADQB 4EKWA 2UXBO 3IC9A 4QNHB 2WLIB 4PA6A 1OJHA 4TV9A 2DQ0A 2ZDIA 4I4TA 3ETQA 4FLYA 3KG2A 4X8AA 1H2MA 2XOKG 3CYOA 5ITZB 1HW7A 4OX9B 2WLHA 4BIUA 2UXXA 5J2TB 3BRCA 2ZKOA 3K0GA 4NVPA 2H8PC 2Y69C 1F4NA 2XASA 4X65O 3ZMVA 1VIBA 2ZXWC 4X1YB 2E75B 1NU1H 2Q0AA 5LMNB 3CC7V 1I94B 2Q68A 1G8MA 5EIBC 1YVWA 3VQYA 3JAKB 2Q5ZA 1Y6XA 1Y74A 1MA1A 3WU2Z 4TQFA 4ZIBA 2UUCB 5JJJB 4HAMA 5IYDO 4DV7O 1X59A 4YIPA 1XHXA 4GT1A 1XI1A 4CH5A 2DWDC 1XMQO 1AJQA 3W7TA 1TGOA 2OTLV 3CS5A 3G67A 1L0NH 5IDJA 4MTGA 2HVJC 1M57C 3SPGA 4JI0B 3UM7A 1S3JA 5DEDA 2IJHA 4D7TA 3B8NA 4JYBA 2HEPA 4DV0B 1EN6A 4BIOA 2UXCB 3JAWA 3X2QC 4NTYA 2W0FC 2ITDC 3AG4C 1TUEB 3ABUA 5BMVA 2HHHB 4DYLA 4HNAA 3P32A 3K9SA 2PYJA 4UCRA 4LFCO 2YXHA 2PZSA 2P7TC 3K57A 4JI4B 1YIJV 3HKCA 3OUFA 1GTOA 1YJ9V 5EC2C 5FNVA 1Y74B 1XREA 3CRCA 4DXWA 5H9CA 2GDSA 4EFEA 1LUWA 3THOA 2YIDA 5KAFZ 2K1EA 2QTSA 2UU9B 1BMFG 4PHZA 1I0HA 3APOA 1F7YA 3D8CA 1JOYA 4JAAA 1OCZC 3T1YB 4UCOA 2UXBB 1YSCA 2Q6AA 5B1BB 4WFBV 3G4SV 4DR1O 4LH7A 2QM4A 5LXTB 1NR1A 2VQEO 2B1IA 5EZYB 1THZA 2Q0OC 3S3WA 2GHYA 3R66A 5BMVB 4KUMA 1K3EA 1QLEC 5CMUA 3CXCU 4HNAB 4OPHA 1RPRA 3G80A 2LFSA 4DV1O 2QM8A 1R6NA 3HKCB 1IX9A 2QE7G 4H44B 1YJWV 4JYAB 1VQMV 4PA9A 1WA8A 3FYEB 4X65B 2JIZG 5FNVB 4K8ZA 3FKSG 2CTWA 4EFBA 2UUAB 2F66C 4FJCC 2MK3A 3T1HB 1W2BU 2JS5A 1E79G 5KUMA 4IYIA 4I9WA 2WSSG 1AI5A 4PD4F 4TSFG 2UXDB 1V54B 4IGGA 1QVGU 1M93A 3RYFA 2WLLB 4K3AA 2BOCC 1VF7A 4PA3A 2YDEA 4H0LB 2G38A 1XMQB 3VQWA 4FLUA 1B04A 2VQFO 4DR2O 1Q82W 4PDMA 4LF8O 1MG1A 3K5NA 3W7UA 2L35A 4R8CA 4BW9A 3BAAA 4YJ2A 4DW1A 4LR3A 5CB4B 2PYLA 2WA3A 4RAIA 4DW0A 4LF6O 1FFTB 1AI7A 4NXMO 1NS1A 2V7QG 2AHYA 1R3KC 4LNUA 5CA1B 1NKDA 2QWNB 2X6AA 3SJQC 2GBOA 2DWEC 3EFFK 2EJ7A 2EIKB 1WA8B 1Q90D 3DC6A 1KECA 4DV3O 3G71V 2DMXA 3ZMUA 1GN6A 2JEXA 1QHTA 5LHHA 5IYBO 4JI7O 2CGNA 5KA5A 4JV5O 3ZHQA 4CC5A 5LP6B 2ZM6B 1NH2D 2CH7A 4YY3O 1QLNA 2IU0A 3HKEB 5JJNB 1FPOA 5BR8O 2HR3A 1W0JG 3IC7A 3OT7A 1KMIZ 4DR7B 1JA8A 4CS4A 3CB2A 3GB7C 1PNKA 4MVQA 2ZDIC 3JAMN 5LGUA 4J10A 1Y67A 2XHBA 4U7OA 1US6A 2EZOA 3RT3C 2N74A 4O4JA 4JTAB 4JI1B 4J42A 3IAYA 3CD6V 4GX0A 3M7MX 1S5LZ 2K9PA 4AQYO 2B5UA 3VQXA 4GX5A 3QTCA 2GTAA 2IM9A 3MHSC 4DR4O 1WJZA 3CXHF 3D36A 2YI9A 3TXQA 3E89A 1Y66A 1FXKA 1MSWD 4UVCA 3ZEDA 1H8HG 2Q7HA 3N27A 5LYJB 1EFRG 1LUVA 2IBZH 4Z1VA 2KG7B 3R65A 2LQTA 2CH7B 4TT3G 4CH4A 3K3WA 1ZL8A 1ROPA 1SRYA 3C3TA 3CSXA 2EULA 1OCOB 2ZE6A 1CP9A 3AK1A 5CA0B 4K8XA 1QR8A 4QIWF 1K73W 3NXSA 4MVOA 1JJOA 4JTCB 4DV2O 2FB5A 2OYQA 1TAEA 4J80A 2ARHA 3CCLV 1GKFA 4Z2WA 4B3MO 3LSQA 3RN4A 1GMGA 2CAZC 2VQFB 1CXZB 2EIJB 3TCUA 4GLXA 4O4LA 2XAFA 2ETNA 5KX5A 1YDXA 4FFBA 3ABLB 1UJWB 1AR4A 1RM1B 3CRQA 5EC1C 1S77D 2QTOA 4DK1A 3BFRA 4NYKA 4D6TH 1H2SB 2LW1A 2JJ1G 1L8DA 4B3TO 4IYHA 2YIBA 4JI8O 1DLBA 5GTIZ 4DV3B 3ABTA 1VQ7V 1I5XA 4FM1A 4QGPA 1SA0A 4MS2A 3KKYA 3DC5A 4JI7B 4J7ZA 3E8HA 4JV5B 4U3JB 4J7KA 4J7JA 2JGDA 1YI2V 4O2AB 5JWPA 2QWOB 1Q8IA 1K33A 4OX9O 5L3CA 3A0RA 2EIMC 4BW5A 3ZCCA 2IH1C 4IIJA 1R6TA 1E1QG 3OE7G 4N21A 3TETA 5LMNO 3AG2C 1I94O 4MW8A 2YIBD 4WBNA 3QG5A 3L75H 1TVKA 4J9ZB 2EIKC 2GUZA 4AQYB 2E74B 1OHHG 2QA4V 5L3EA 3LDDA 3VOUA 4CS3A 1Q6UA 4KP4A 4CBCA 4X66B 2ADPA 3ZRXA 3E8FA 1JCHA 2M7WA 4HYOA 1DK1A 3WB2A 1Q7YW 2QM7A 4LF7B 4F6RA 5CA3A 4ICGA 5HFMA 5DECA 4FMTA 5EYPA 5LBQA 2DW4A 3K59A 4PJ0Z 3SPCA 3KZIZ 1BT8A 2C2AA 3TGUH 2WLIA 4Q6GA 4I9QA 4LF9B 3OD4A 3M8AA 2UXCO 2ITCC 4MVZA 4IIJB 1LR1A 5ITZA 2HHHO 1NBMG 4B3MB 1HNZB 3FAVA 2IJJA 5J2TA 1QVFU 1K92A 4WBNB 2IW5A 4GKJO 1JVMA 1TVKB 1YXBA 2RQ6A 4JZGA 2GUZB 3ICXA 1FS0G 5D5PA 4X1YA 5FL7G 2Q8VA 2A0LA 1GRJA 1AI6A 3AG1B 2HG5C 3EHBB 5IWAO 4ZKIA 2OIGA 3AEIA 3N2GA 4JI8B 1KBHA 3IGAC 3FB6C 4F6RB 2JVDA 1S0VA 3WG7C 1IXMA 3LSUA 5IYZA 3JALB 2XUMA 1VF5B 4PELA 5EYPB 3T1YO 3BY6A 3ZRWB 4RQEA 4ZOLA 3ZBHA 1SETA 3DTUB 4CH3A 4WFGA 2YUAA 4JF3A 1BQZA 4MW3A 1W0KG 2FTKA 2ZD9A 2DYRB 3CCVV 3HPLC 5L3GA 1N32B 2RNBA 4MVRA 2EIJC 3FAVB 2FMLA 2H3OA 2OTJV 3QO8A 3ABLC 4JYAO 1IXBA 1X4TA 5LA6B 3P3NA 4QJFB 4JI5B 3D36C 1DF4A 4JGSA 1COWG 1RPOA 2P6JA 2N05A 1A32A 1FXKC 4KHPO 2UUAO 1VQKV 3P30A 3T1HO 1ZSPA 3N2GB 4CH6A 5HFLA 4O4HA 1SERA 1K8AW 5C93A 2UXDO 1K5QA 3BABA 3MDSA 2JEUA 3JASB 5H2FZ 2LGQA 3SJBC 3RYHB 3OFNG 4G27B 5IYZB 5K1XA 2P67A 1SS3A 4ZOLB 2WLNA 2BTQB 3C3SA 4BIZA 1JMKC 5KHKA 4XDKA 3ZX6A 3IFXA 3SDLA 2HP8A 4WFEA 1M4UA 2F4VB 5JH7B 3FB8C 5IE9A 5E79Z 4HBNA 3HKBA 5LXTA 4PI2A 4LF5B 2RDCA 4JZ2A 5EZYA 5FPRA 2PY5A 1HDJA 3T4DA 3B77A 1JJ2U 2F43G 4FZ0A 1Q3EA 2R9AA 1NTKH 3JARB 1NJIW 4PI0A 4AILC 4GKJB 4YJ3A 1JX9A 2CGOA 4R7CA 1GM7A 3LSSA 2CE4A 2L6LA 2ZM6O 2WWWA 4O4HB 5B3SC 2XAQA 3B40A 3SJAC 1NT2B 3SYCA 5KLVH 2A7WA 5LL6Y 4DV6O 5IWAB 4LCUC 1XUQA 4DR7O 1K9MW 3OEEG 2NN4A 3GWOA 3RGBA 1YZBA 5KUKA 5H6RA 4DR5B 2LW7A 2WLLA 3ETDA 1QU7A 2VWKA 3CMEV 1JR9A 2Y0PA 3CCMV 1W59A 4H33A 1K4DC 3ZMSA 4F6EA 2AGAA 1SF9A 1NTZH 4JI1O 3HKBB 1EZJA 4UCUA 1I08A 4JI6B 3H01A 3T1CA 1EBOA 3K08A 5CB4A 3E35A 3W7XA 1R6KA 3RBZA 3SYAA 3W7SA 5CA1A 3H1JH 2XNDG 1M1KW 4LWSA 2HVKC 2PUSA 4YJ3B 2RJZA 4DRXB 4P9OA 4BR6A 5LGNA 1PKXA 4WF9V 2CDYA 1JFFB 1Y76A 4I0XA 4LFAO 1PM9A 5KHGA 4KHPB 1WLEA 1AB3A 1SQXH 1KQSU 1DGSA 5LP6A 4DUYB 1FXVA 5B1AC 3HKEA 4W4LA 1EM1A 2Z5UA 5BXZA 3AG7A 1MZFA 2RCVA 1U97A 3CX5F 5CBFA 4J11A 2N04A 2O57A 1Z2GA 4JYCA 1SZXA 4P2ZA 3CCJV 4G2KA 3STZC 1ZWIC 1MOFA 1S5HC 5FPOA 2DE0X 3G6EV 4JI2B 2BTOA 4PDLA 3PN1A 1QCEA 4LWSB 5KA6A 1XNRB 2PGGA 1YTFD 2QEXV 1KKCA 3L72H 1I7FA 1Q5OA 1YTFB 5BY1A 1SQFA 2JDIG 5GONB 1Y76B 4I0XB 2F95B 3BPZA 4PDVA 5LYJA 4G28B 2KG7A 4J41A 1ENVA 4L87A 1SQBH 5D5QA 2AZ2A 2QSAA 3RVZA 3U0ZA 3P3PA 1VQNV 4MTXA 3CRAA 1V55B 2ZNJA 4DV6B 3QO5A 4OGQB 3E8BA 1IBLB 4KL1A 4EB6B 5CA0A 1S76D 5K1PA 4HZ3A 4X1IA 1D5NA 1VQLV 1WB8A 2CTPA 2LO1A 3U10A 1WB7A 4N23A 5JJEB 2ZQMA 1M56B 1NQTA 1VEWA 5L3DA 1U96A 2EILB 2D3OW 3ZRVA 2AW9A 3JATB 2JK5C 3RYCB 3K5LA 1FYJA 2KB1A 3CRRA 2PI5A 4L8JA 4NXNB 5J2UA 1B6QA 3CJHA 1IBMB 3H9VA 4B7KA 1VQOV 2V1DA 5F2VO 3RFRA 4X66O 4AI8A 1T5EA 3IJ4A 4U3FH 5IJ0B 1H2GA 4TOIA 2YEVA 4I50A 4LF7O 1N33B 4R50A 1KKDA 4O4IA 2YI8A 1BQ0A 1P49A 1YF2A 2DOSA 4C7UA 4LFAB 2MW2B 3I5DA 3OGIB 5EBMC 4U3JA 1SESA 4FK5C 2A9HA 4TV8A 4LF9O 2X7RB 4LP8A 4X1IB 3SR2C 4O2AA 2HJFC 2JGUA 3K0DA 2A06H 4O2BA 3OTOO 3ZHTA 3L74H 3UO2A 2WLKA 1M90W 4NTWA 1B06A 2QKSA 3OR6C 3D3QA 1HNZO 3QO7A 4X20A 1IURA 3OGCC 2ZIMA 5B1BC 3K5OA 4Q20A 4WCEV 4H37A 1IZ3A 2E3CA 4DR3B 1J5EB 1HNXB 3JCUZ 5KHJA 1VQ6V 3CCEV 5J2UB 4K35A 3STLC 3CJHB 1Y4MA 3CP1A 1M9NA 4GZRB 2DJVA 5FLXN 1IBKO 5EBWC 4YHHB 3LUTB 1RP3B 3JYCA 2YEVB 4I50B 3QNEA 3FFQA 4O4IB 1QR9A 1WAZA 3K5MA 1SQPH 2W0XA 3SYPA 5L3BA 3MAQA 1NVPB 4UCSA 2FL4A 2QKCA 3E8GA 2OCCB 4TV8B 1LNQA 1V54C 3LNMB 4P30A 4O2BB 1B3QA 3UKMA 1N32O 1Z5VA 3TK1A 4CS2A 4X20B 2IJKA 2ZT9B 2WLMA 1D2DA 4MVUA 1R3LC 5LOVA 1HNWO 4NTXA 3BHPA 2EINB 4JI5O 3O9OA 1KB9F 2JRIA 4UVBA 5CN0A 1O9HA 5B66Z 2DQ3A 4UB8Z 4FIPC 2LGWA 1AR5A 2XAHA 2YS8A 4UFZA 3AG3B 3UT5B 1ORQC 2LP7A 3E86A 5H5NA 2QDOA 4I7ZB 4B3RO 2QKAA 5LGTA 1AJNA 1AILA 5JQGB 2HJDA 5LP6C 1WPXA 2XTAA 4B08A 3CC2V 3E83A 4BAYA 3OM3B 3PJSK 1NZ6A 2NNUA 3JALA 1BZKA 4U7NA 3JD4A 5GW7A 2VRZA 4CC6A 1O9GA 4WFFA 1FAFA 3ZRWA 2F4VO 1NI8A 1YHQV 4ZHQB 2X6BA 4JYYA 4GUNA 2ILMA 1YEWA 3B8MA 1GO3F 1KD1W 1XBLA 1PV0A 1VMGA 4LF5O 2WLJA 3E22B 2ZE5A 5BZBA 3ML0A 5LOVB 3OTOB 2ZR2A 4DUZB 3JD3A 4PDRA 1XHZA 4WFHA 2V4DA 3A2FA 1OCZB 1QNMA 4EEQA 3N2KA 2A3QA 4DO2A 4QPKA 1R1BA 2EBOA 5LA6A 2YICA 2VWJA 2Y48A 2JJ2G 2QJ1A 1R73A 1WNSA 2NR5A 1K97A 3ABKB 1BS3A 1IBKB 1CPYA 1RSOB 2HLDG 4NR1A 5KMGB 2E5LB 3KCYA 3ETGA 1F4MA 4XBFA 4DV5O 1Q86W 3JASA 3BVOA 3RYHA 1GM8A 4DR5O 4YIOA 3B4SA 4UUJC 3A0HZ 4BWAA 1OCOC 2BTQA 4QE7A 3F5TA 1BE3H 2BOBC 5DN6G 2ZCEA 1UPGA 2GTSA 4JI6O 3ASOB 4KXRA 5TISZ 4B7EA 2ZIOA 3UO3A 2OIEA 1HP8A 3ZHVA 5JVDA 1XNQO 1OCCB 3CRMA 1AVMA 4UVAA 5JH7A 2M6YA 2UUBO 2R9RB 1P84F 3O65A 2BSKB 3N2KB 1EZVH 2XT9A 1HNWB 3DGEA 1RM1C 5LHGA 3OUSA 3TXSA 2ZINA 3DSQA 4CZZA 3QF7A 2QWRB 3FD9A 3T2MA 1SQQH 3ZHUA 1ZAUA 4MT8A 2P4VA 1PNMA 3JARA 1V9PA 3T4ZA 5A9GA 1M5IA 3OMAB 4DUYO 3SPJA 5L3FA 1XL4A 2RN9A 2FYUH 1EN5A 3A0BZ 4JTDB 4OPAA 3APQA 3S3XA 1FD9A 1MZEA 4B3RB 1MMMA 4GYCB 4FLWA 3F7YC 3ABMB 3RWRD 1YCIA 5KHIA 2OCCC 1XQ8A 4GX1A 1J95A 1S5JA 2LFRA 3B09A 2P5OA 2CUGA 2P06A 3ZRSA 5J9PC 1Q6IA 3CC4V 1ZX3A 2Y4TA 3CCQV 3U11A 3K9AA 4LF4B 5JVDB 3LNNA 4JI2O 3ASNB 5EBLC 3D3IA 2VS0A 4X1KA 4TV9B 4I55A 1XNRO 4I4TB 3W7WA
chains in the Genus database with same CATH topology
2EINC 4UV9A 3G6EV 4PA7A 1GMGA 2ZR3A 2EIJB 3JD2A 3TCUA 4PDLA 2XAFA 1QCEA 4MVSA 4LC1A 1Q81W 3ABLB 5KA6A 1UJWB 5DM6V 1RM1B 1YTFD 2QEXV 5EC1C 1QLEB 1S77D 2QTOA 1AJPA 3AG3C 4GCZA 1E1RG 1YTFB 3F5WC 3I55V 2JJ1G 5EK0A 2IJIA 3ZJZA 3M99B 2JDIG 1VQ4V 3MHHC 2B1GA 4RQFA 2IU3A 2OT5A 3K06A 4PDVA 3WFVA 4Z1MG 4G28B 3FB5C 1DLBA 1SZTA 2DYSC 4JAUA 1ENVA 1F23A 1FXHA 3ABTA 1VQ7V 4L87A 4E2LA 1I5XA 5CBGA 3HB3B 3OMIB 4MS2A 4QPJA 3RVZA 4P9PA 1KC8W 3K03A 1VQNV 3E8HA 2A79B 4MTXA 1V55B 2XAGA 3QO5A 3E8BA 5B1AB 4XDJA 1S76D 4HZ3A 3CCRV 3RVYA 1YI2V 1L1FA 1VQLV 1JQ0A 4XDLA 4N23A 3OMNB 1F51A 4EKWA 1K33A 4QNHB 2WLIB 2ZQMA 5L3CA 4PA6A 1M56B 1NQTA 3A0RA 2DQ0A 5L3DA 2EIMC 2ZDIA 2EILB 1VQ5V 4BW5A 2D3OW 3KG2A 3ZRVA 3ZCCA 4X8AA 5IYCO 2JK5C 2XOKG 2IH1C 3CYOA 2KB1A 1P4RA 2WLHA 2PI5A 4BIUA 2UXXA 2R9IA 1E1QG 3OE7G 1HWYA 1B6QA 4N21A 3TETA 3SYOA 1VQOV 3AG2C 2V1DA 3K0GA 4MW8A 2Q69A 2H8PC 2Y69C 1F4NA 3ZMZA 3ABKC 2XASA 3LDEA 3ZMVA 4J9ZB 2EIKC 4JAVA 3AG1C 1OHHG 2ZXWC 2QA4V 1H2GA 5L3EA 2YEVA 4R50A 1KKDA 2P90A 3LDDA 3VOUA 3CC7V 2HKOA 2Q68A 3ZN1A 1G8MA 4KP4A 4CBCA 2X6CA 3ZRXA 3E8FA 1JCHA 2M7WA 4HYOA 1PL0A 1Q7YW 5EBMC 2QM7A 5B1NA 5CA3A 1OCRB 1SESA 4FK5C 2A9HA 5HFMA 4FMTA 4HAMA 5IYDO 2X7RB 4LP8A 3CCUV 4GT1A 3SPHA 4MTFA 2Z3YA 5LBQA 2DYRC 3ASOC 2DW4A 2HJFC 2DWDC 3K0DA 3SPCA 2C2AA 1M90W 2WLKA 1AJQA 2QKSA 3OR6C 2WLIA 1OCCC 3W7TA 3QO7A 3OGCC 2OTLV 5B1BC 4Q20A 4WCEV 5IDJA 1AROP 2ITCC 1AI4A 4MTGA 4H37A 4MVZA 2HVJC 1M57C 3JD1A 3OR7C 1K5SA 2EIMB 3SYQA 1NBMG 3SPGA 1VQ6V 3CCEV 3UM7A 1S3JA 1GM9A 3STLC 1Y4MA 2IJHA 2IJJA 3B8NA 3CP1A 4JYBA 1QVFU 1K92A 1M9NA 2IW5A 3X2QC 2W0FC 2ITDC 3AG4C 1TUEB 1JVMA 3ABUA 3LDCA 5EBWC 3LUTB 1K4CC 5IY5B 1FS0G 1XL6A 3P32A 3JYCA 5H6QA 4WFAV 5FL7G 2YEVB 3QNEA 2A0LA 3AG2B 2P7TC 1QR9A 4JPRA 1AI6A 2GSMB 3BEHA 1YIJV 2XAJA 3OUFA 3JCZA 3AG1B 2HG5C 3EHBB 3SYPA 1GTOA 1H8EG 4ZKIA 1YJ9V 5EC2C 4MSWC 5L3BA 4MVMA 3AEIA 1NVPB 3IGAC 3ABMC 3FB6C 4GX2A 1S0VA 4DXWA 5H9CA 3E8GA 1R3JC 2OCCB 3WG7C 1IXMA 1LNQA 1V54C 3LNMB 4X89A 2K1EA 4PELA 1BMFG 3BY6A 4P30A 3ZRWB 3ZMTA 4RQEA 3UKMA 1SETA 3DTUB 4WFGA 3TK1A 4JF3A 4MW3A 3ASNC 2IH3C 1NH2B 1KP3A 1W0KG 2FTKA 2ZD9A 2IJKA 2DYRB 4RUEA 1JOYA 3CCVV 2WLMA 3HPLC 1OCZC 4MVUA 5L3GA 1R3LC 1P7BA 1YSCA 2Q6AA 2EINB 4MVRA 5B1BB 4WFBV 2EIJC 3G4SV 5CBHA 5E1AC 4UVBA 1NR1A 5CN0A 2B1IA 1AR1B 2DQ3A 1I5YA 3QO8A 1THZA 3ABLC 3OW2U 2OTJV 4FIPC 2GHYA 4RUFA 4F4LA 4KUMA 4QJFB 1K3EA 1QLEC 2XAHA 5CMUA 3FB7C 1PNLA 3CXCU 2HFEC 1DF4A 4JGSA 1COWG 3AG3B 1RPOA 1ORQC 1RPRA 3RW0A 2LP7A 2P6JA 3E86A 2LFSA 1VQ9V 4MTOA 2QM8A 1FXKC 1R6NA 4UV8A 2QE7G 1YJWV 1DTOA 1VQMV 1VQKV 3P30A 4PA9A 3FYEB 5LGTA 1AJNA 1R3IC 2JIZG 4LBEC 2DYSB 1PD3A 4YXWG 3FKSG 5HFLA 1WPXA 1DF5A 1SERA 4UXNA 1K8AW 3CC2V 5C93A 1K5QA 3E83A 4BAYA 2JEUA 3OM3B 3CPWU 3PJSK 3OFNG 4G27B 2W6JG 4FJCC 2NNUA 3OAAG 4U7NA 3JD4A 2MK3A 5GW7A 1S72V 2P67A 1W2BU 1E79G 5KUMA 4I9WA 4WFFA 2WLNA 2WSSG 3ZRWA 1AI5A 4TSFG 3WG7B 4BIZA 1YHQV 1V54B 4XDKA 1QVGU 2X6BA 1YITV 2WLLB 2BOCC 3B8MA 1GO3F 4KFMA 1KD1W 3IFXA 2WLJA 2H94A 4PA3A 5BZBA 3ML0A 4WFEA 2ZR2A 3JD3A 4PDRA 3VBBA 1Q82W 2ATKC 4PDMA 4WFHA 1GK9A 3FB8C 1MG1A 3W7UA 4R8CA 1OCZB 1NR7A 4DO2A 4QPKA 4RAIA 2EBOA 3K04A 2X0LA 3JD0A 1KP2A 1FFTB 3T4DA 1AI7A 3B77A 2V7QG 2Y48A 2AHYA 2JJ2G 3OEHG 2F43G 1JJ2U 1R3KC 1OZ0A 1NKDA 1R73A 2X6AA 4ASUG 2AHZA 2Y69B 3SJQC 1K97A 2DWEC 3ABKB 3EFFK 1NJIW 1VQ8V 2EIKB 1NVPD 1CPYA 1JX9A 1KECA 4R7CA 2ZXWB 3G71V 2HLDG 1GM7A 3LSSA 4RO2A 3ETEA 3CCSV 4OXSA 2WWWA 3ZMUA 3ETGA 5B3SC 2JEXA 2XAQA 1FXKB 5LHHA 1F4MA 4XBFA 1K34A 4JASA 5IYBO 1Q86W 5KA5A 3SYCA 1GM8A 1BHBA 4LCUC 4UUJC 3K79A 4ZBMA 1OCRC 1K9MW 1OCOC 3OEEG 1N8RW 1NH2D 4QE7A 2IU0A 1QLNA 1K7DA 3GWOA 4I5SA 2BOBC 5KUKA 5DN6G 1MABG 5H6RA 2HR3A 1W0JG 3ETDA 2WLLA 3IC7A 3ASOB 3CMEV 1QBZA 1H38A 3CCMV 2W6IG 3GB7C 1PNKA 3SPIA 4H33A 2ZDIC 1K4DC 1OCCB 4MVQA 4UVAA 4J9YB 5LGUA 3ZMSA 2R9RB 5LHIA 1CEZA 1EZJA 4U7OA 2WPDG 3H01A 2EZOA 1EBOA 4TWKA 3K08A 3T1CA 1M57B 3DGEA 3E35A 1RM1C 5LHGA 3CMAV 3W7XA 1R6KA 2UXNA 3OUSA 3FYIB 3RBZA 4JTAB 3SYAA 3W7SA 4CZZA 3CD6V 4GX0A 2XNDG 1M1KW 3T2MA 4MT8A 3X2QB 3AG4B 2B5UA 1PNMA 2HVKC 4GX5A 5B1OA 5IY5C 3MHSC 3T4ZA 3ZIAG 3D36A 1YJNV 3OMAB 4P9OA 4FPPA 3E89A 5LGNA 3SPJA 5L3FA 1XL4A 1PKXA 1Y66A 4QE9A 3ZN0A 4WF9V 4JTDB 1FXKA 4PA4A 4UVCA 1MSWD 3MD0A 3E2EA 1H8HG 1WLEA 1VQPV 1EFRG 2NLJC 3F7VC 3I56V 2WAMA 3R65A 3F7YC 1KQSU 2Q67A 1V55C 3ABMB 5B3SB 2YSUB 4TT3G 1FXVA 5B1AC 2OCCC 3K3WA 1ROPA 4GX1A 1J95A 1SRYA 2Z5UA 2LFRA 4R6ZA 5CBFA 3ZRSA 5J9PC 1OCOB 4X88A 1BHAA 1CP9A 2EJRA 3CC4V 1BL8A 3CCQV 3K9AA 1M56C 1QR8A 2CK3G 4QIWF 1K73W 3NXSA 2PI4A 4MVOA 2EILC 3ASNB 4JTCB 4JYCA 5EBLC 3D3IA 4P2ZA 3CCJV 4G2KA 3STZC 1ZWIC 1MOFA 1S5HC 2EZPA 3CCLV 1JPXA 1GKFA 3LSQA 1G4YB 3W7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRX A;  4BIU A;  3P32 A;  2LFR A;  3D36 A;  4Q20 A;  5IDJ A;  4FPP A;  2QM7 A;  4JAU A;  1F51 A;  4U7O A;  5B1N A;  3ZRW B;  5C93 A;  4LC1 A;  4QPJ A;  4FMT A;  3A0R A;  3MD0 A;  3TK1 A;  3DGE A;  3NXS A;  4I5S A;  4JAV A;  4GT1 A;  4ZKI A;  2FTK A;  4JYC A;  4QPK A;  4U7N A;  3ZRV A;  4MTX A;  3ZCC A;  1JOY A;  4GCZ A;  2P67 A;  4JYB A;  2LFS A;  2WWW A;  2C2A A;  3ZRW A;  2QM8 A;  4BIZ A;  4JAS A;  1IXM A;  4MT8 A;  4KP4 A;  5B1O A; 
#chains in the Genus database with same CATH topology
 1TUB A;  2EIN C;  4PA7 A;  3KCX A;  1L0L H;  4FM0 A;  2BE3 A;  1Q6H A;  4MVS A;  5IJ9 A;  1QQC A;  1Q81 W;  4DV4 B;  3AK3 A;  2Q9L A;  3UCS C;  1AJP A;  1SKV A;  3AG3 C;  4DRX A;  4K0K B;  3F5W C;  1SQG A;  2YC0 A;  5EK0 A;  2IJI A;  4IHJ A;  3M99 B;  1VQ4 V;  1JFF A;  1BSM A;  4RQF A;  1N36 B;  1GN2 A;  2OCH A;  3K06 A;  3L9D A;  2LJ2 A;  3FB5 C;  1F23 A;  1BGY H;  1IBL O;  4E2L A;  5CBG A;  2Q4P A;  4AHC A;  4X62 O;  4DV5 B;  1KC8 W;  3B2E E;  1FJG O;  2F93 B;  1XMO O;  2A79 B;  4B3S B;  3BA9 A;  3ZS8 C;  1MSD A;  2XAG A;  4XDJ A;  3CCR V;  1UFI A;  2QR4 A;  2Q7E A;  3OMN B;  4X1K B;  1SC5 B;  2P22 C;  4I55 B;  1GN4 A;  1G6U A;  1TUB B;  4NXN O;  1VQ5 V;  4JI3 B;  1XNQ B;  3JSN A;  1IBM O;  1RFY A;  1VF6 A;  2UUB B;  5IYC O;  5IJ9 B;  2D2C B;  4X64 O;  1P4R A;  2R9I A;  1N33 O;  1HWY A;  1MNG A;  3SYO A;  2Q69 A;  3JAW B;  4IHJ B;  3VQV A;  4FFK A;  5GON A;  3ZMZ A;  3ABK C;  3LDE A;  1PP9 H;  4JAV A;  3AG1 C;  3WB1 A;  1KU9 A;  2FKX A;  2P90 A;  1PPJ H;  2HKO A;  4FLT A;  3ZN1 A;  2X6C A;  3A8T A;  1PL0 A;  1URF A;  2RMK B;  5B1N A;  3H1L H;  5AG2 A;  1OCR B;  4IT5 A;  2ZE7 A;  4EB6 A;  3CCU V;  1HR0 O;  3SPH A;  4MTF A;  2Z3Y A;  2DYR C;  3ASO C;  3RYI A;  5JCO A;  4DR3 O;  1J5E O;  1HNX O;  2AZ0 A;  4DR6 O;  1OCC C;  3BA8 A;  1PL4 A;  4DV7 B;  1VP7 A;  1ARO P;  2Y0I A;  3JAT A;  1AI4 A;  1GN3 A;  3JD1 A;  3RYC A;  3OR7 C;  1TA8 A;  1K5S A;  4YHH O;  2EIM B;  3SYQ A;  5KAI Z;  2AXT Z;  2Y4U A;  1GH6 A;  1GM9 A;  1FFX A;  3LDC A;  1K4C C;  5IY5 B;  1BCC H;  1XL6 A;  5IJ0 A;  5H6Q A;  4WFA V;  3AG2 B;  4JPR A;  2GSM B;  3BEH A;  3L70 H;  2XAJ A;  3JCZ A;  1H8E G;  4MSW C;  4W4K A;  4MVM A;  1NTM H;  3ABM C;  4LFC B;  4GX2 A;  2YXY A;  1XEQ A;  1R3J C;  3H1H H;  2Z0A A;  3SGI A;  3OTF A;  4X89 A;  2OWO A;  4X62 B;  5GTH Z;  3EVK A;  1FJG B;  1XMO B;  3RYI B;  4LFB O;  3ZMT A;  4E4E A;  5A2Q N;  2ZNI A;  3CHX A;  3RYF B;  3NR7 A;  1NH2 B;  3ASN C;  2IH3 C;  1KP3 A;  1ZUQ A;  4RUE A;  3ZHR A;  3CWB H;  1P7B A;  2ODM A;  3J81 N;  5KHH A;  1N0N A;  5CBH A;  3CEI A;  5E1A C;  4YJ2 B;  3FX7 A;  4NKG B;  1AR1 B;  1I5Y A;  3OW2 U;  1FFX B;  4RUF A;  2F23 A;  4X64 B;  4F4L A;  1N34 O;  4GKK O;  3FB7 C;  1PNL A;  1ZLZ A;  2HFE C;  4DR1 B;  4LNU B;  1Q43 A;  1GAX A;  3RW0 A;  1N0J A;  1VQ9 V;  2PTM A;  2VQE B;  4MTO A;  4UV8 A;  1WP8 A;  1DTO A;  2KSD A;  1R3I C;  1VAR A;  4LBE C;  2DYS B;  1PD3 A;  4YXW G;  1DF5 A;  1Z5W A;  2QGN A;  4UXN A;  2R72 A;  1WN7 A;  4DV1 B;  1OV9 A;  3CPW U;  5LMU O;  2CTR A;  2W6J G;  2GV9 A;  5C8Y A;  3OAA G;  3J7A U;  1S72 V;  3DXR A;  2F1M A;  3GVM A;  1SQV H;  3ZHS A;  4DUZ O;  2PF4 E;  3WG7 B;  1ZTE A;  2YXL A;  1YIT V;  1HR0 B;  4KFM A;  3CE2 A;  3Q4H A;  2H94 A;  4FLZ A;  4X9Q A;  3VBB A;  2ATK C;  1GK9 A;  4DR6 B;  2Q7G A;  1KUQ A;  1D5A A;  1NR7 A;  4O4J B;  1EN4 A;  3K04 A;  2X0L A;  3JD0 A;  1KP2 A;  4DR2 B;  4LF8 B;  3OEH G;  2E5L O;  1OZ0 A;  3UT5 A;  1WPB A;  4ASU G;  1XDC A;  4UCT A;  2AHZ A;  2Y69 B;  4DK0 A;  4TUY A;  1VQ8 V;  3BCC H;  1NVP D;  4LF6 B;  2ZXW B;  4NXM B;  5JQG A;  4RO2 A;  3ETE A;  2CTQ A;  5EIB D;  3CCS V;  2DN9 A;  4OXS A;  1G1X B;  2EX3 A;  4PV1 B;  1FXK B;  5IT9 N;  1K34 A;  3G6B A;  4JAS A;  5B5E Z;  5C8Y B;  1BHB A;  2E76 B;  3K79 A;  4ZBM A;  1OCR C;  3DXR B;  1N8R W;  1WP7 A;  3L73 H;  1K7D A;  2KQX A;  1ZL8 B;  4I5S A;  4NB5 A;  3SJC C;  1MAB G;  4ZHQ A;  3UQ8 A;  3HR0 A;  4LH6 A;  1QBZ A;  3Q4H B;  2KKW A;  4TQD A;  3E22 A;  1H38 A;  2B9Z A;  4LFB B;  2W6I G;  4YY3 B;  3SPI A;  4J9Y B;  2R70 A;  4ZI7 A;  5LHI A;  2JS3 A;  5BR8 B;  1CEZ A;  1VF6 C;  2BCC H;  2WPD G;  4TWK A;  1M57 B;  4FVM A;  4FZ1 A;  1XOU A;  3CMA V;  2UXN A;  2Q73 A;  3FYI B;  4O4L B;  3EXA A;  5KX5 B;  4FFB B;  4TUY B;  3X2Q B;  3AG4 B;  5B1O A;  3TJT A;  3C90 A;  5IY5 C;  3ZIA G;  4A5U B;  1N34 B;  1RSO A;  1YJN V;  4GKK B;  4FPP A;  5KMG A;  3ZN0 A;  4QE9 A;  3L71 H;  4PA4 A;  3MD0 A;  3E2E A;  4IL6 Z;  1P7G A;  1H2K A;  1VQP V;  2NLJ C;  3F7V C;  3I56 V;  4DR4 B;  2WAM A;  3HKD A;  2UUC O;  2Q67 A;  1V55 C;  5B3S B;  2YSU B;  2WA4 A;  1SA0 B;  4LF4 O;  4FM2 A;  4FLX A;  5LMU B;  3JSL A;  2QWP B;  3QVN A;  1IVS A;  4R6Z A;  4X88 A;  5JCO C;  1BHA A;  2JGD B;  1AP6 A;  2EJR A;  1BL8 A;  1N4C A;  1M56 C;  3H1I H;  2CK3 G;  2PI4 A;  1XIL A;  2EIL C;  4ZI7 B;  2EZP A;  1JPX A;  4DV4 O;  2BSK A;  4D7S A;  1G4Y B;  4JI0 O;  4UV9 A;  3GWK C;  2ZR3 A;  2P4K A;  3JD2 A;  4DV2 B;  4K0K O;  4DV0 O;  3J80 N;  1H2N A;  4LC1 A;  1FKA O;  1N36 O;  5DM6 V;  1QLE B;  4FLV A;  1AP5 A;  3AK2 A;  4GCZ A;  4RWU A;  1E1R G;  4ABM A;  3I55 V;  3H1K H;  3ZJZ A;  4JI4 O;  4UB6 Z;  2YIA A;  3MHH C;  2B1G A;  2IU3 A;  2ZE8 A;  1KYO F;  2OT5 A;  3WFV A;  4B3S O;  4Z1M G;  4UCV A;  1SZT A;  2DYS C;  4JAU A;  3HKD B;  1FXH A;  1IDS A;  2QWQ B;  4H13 B;  3HB3 B;  3OMI B;  4QPJ A;  4P9P A;  4B3T B;  2UU9 O;  3K58 A;  3K03 A;  3JAK A;  3WB0 A;  5B1A B;  1H2L A;  4JI3 O;  3RVY A;  1L1F A;  1JQ0 A;  4XDL A;  1F51 A;  2ADQ B;  4EKW A;  2UXB O;  3IC9 A;  4QNH B;  2WLI B;  4PA6 A;  1OJH A;  4TV9 A;  2DQ0 A;  2ZDI A;  4I4T A;  3ETQ A;  4FLY A;  3KG2 A;  4X8A A;  1H2M A;  2XOK G;  3CYO A;  5ITZ B;  1HW7 A;  4OX9 B;  2WLH A;  4BIU A;  2UXX A;  5J2T B;  3BRC A;  2ZKO A;  3K0G A;  4NVP A;  2H8P C;  2Y69 C;  1F4N A;  2XAS A;  4X65 O;  3ZMV A;  1VIB A;  2ZXW C;  4X1Y B;  2E75 B;  1NU1 H;  2Q0A A;  5LMN B;  3CC7 V;  1I94 B;  2Q68 A;  1G8M A;  5EIB C;  1YVW A;  3VQY A;  3JAK B;  2Q5Z A;  1Y6X A;  1Y74 A;  1MA1 A;  3WU2 Z;  4TQF A;  4ZIB A;  2UUC B;  5JJJ B;  4HAM A;  5IYD O;  4DV7 O;  1X59 A;  4YIP A;  1XHX A;  4GT1 A;  1XI1 A;  4CH5 A;  2DWD C;  1XMQ O;  1AJQ A;  3W7T A;  1TGO A;  2OTL V;  3CS5 A;  3G67 A;  1L0N H;  5IDJ A;  4MTG A;  2HVJ C;  1M57 C;  3SPG A;  4JI0 B;  3UM7 A;  1S3J A;  5DED A;  2IJH A;  4D7T A;  3B8N A;  4JYB A;  2HEP A;  4DV0 B;  1EN6 A;  4BIO A;  2UXC B;  3JAW A;  3X2Q C;  4NTY A;  2W0F C;  2ITD C;  3AG4 C;  1TUE B;  3ABU A;  5BMV A;  2HHH B;  4DYL A;  4HNA A;  3P32 A;  3K9S A;  2PYJ A;  4UCR A;  4LFC O;  2YXH A;  2PZS A;  2P7T C;  3K57 A;  4JI4 B;  1YIJ V;  3HKC A;  3OUF A;  1GTO A;  1YJ9 V;  5EC2 C;  5FNV A;  1Y74 B;  1XRE A;  3CRC A;  4DXW A;  5H9C A;  2GDS A;  4EFE A;  1LUW A;  3THO A;  2YID A;  5KAF Z;  2K1E A;  2QTS A;  2UU9 B;  1BMF G;  4PHZ A;  1I0H A;  3APO A;  1F7Y A;  3D8C A;  1JOY A;  4JAA A;  1OCZ C;  3T1Y B;  4UCO A;  2UXB B;  1YSC A;  2Q6A A;  5B1B B;  4WFB V;  3G4S V;  4DR1 O;  4LH7 A;  2QM4 A;  5LXT B;  1NR1 A;  2VQE O;  2B1I A;  5EZY B;  1THZ A;  2Q0O C;  3S3W A;  2GHY A;  3R66 A;  5BMV B;  4KUM A;  1K3E A;  1QLE C;  5CMU A;  3CXC U;  4HNA B;  4OPH A;  1RPR A;  3G80 A;  2LFS A;  4DV1 O;  2QM8 A;  1R6N A;  3HKC B;  1IX9 A;  2QE7 G;  4H44 B;  1YJW V;  4JYA B;  1VQM V;  4PA9 A;  1WA8 A;  3FYE B;  4X65 B;  2JIZ G;  5FNV B;  4K8Z A;  3FKS G;  2CTW A;  4EFB A;  2UUA B;  2F66 C;  4FJC C;  2MK3 A;  3T1H B;  1W2B U;  2JS5 A;  1E79 G;  5KUM A;  4IYI A;  4I9W A;  2WSS G;  1AI5 A;  4PD4 F;  4TSF G;  2UXD B;  1V54 B;  4IGG A;  1QVG U;  1M93 A;  3RYF A;  2WLL B;  4K3A A;  2BOC C;  1VF7 A;  4PA3 A;  2YDE A;  4H0L B;  2G38 A;  1XMQ B;  3VQW A;  4FLU A;  1B04 A;  2VQF O;  4DR2 O;  1Q82 W;  4PDM A;  4LF8 O;  1MG1 A;  3K5N A;  3W7U A;  2L35 A;  4R8C A;  4BW9 A;  3BAA A;  4YJ2 A;  4DW1 A;  4LR3 A;  5CB4 B;  2PYL A;  2WA3 A;  4RAI A;  4DW0 A;  4LF6 O;  1FFT B;  1AI7 A;  4NXM O;  1NS1 A;  2V7Q G;  2AHY A;  1R3K C;  4LNU A;  5CA1 B;  1NKD A;  2QWN B;  2X6A A;  3SJQ C;  2GBO A;  2DWE C;  3EFF K;  2EJ7 A;  2EIK B;  1WA8 B;  1Q90 D;  3DC6 A;  1KEC A;  4DV3 O;  3G71 V;  2DMX A;  3ZMU A;  1GN6 A;  2JEX A;  1QHT A;  5LHH A;  5IYB O;  4JI7 O;  2CGN A;  5KA5 A;  4JV5 O;  3ZHQ A;  4CC5 A;  5LP6 B;  2ZM6 B;  1NH2 D;  2CH7 A;  4YY3 O;  1QLN A;  2IU0 A;  3HKE B;  5JJN B;  1FPO A;  5BR8 O;  2HR3 A;  1W0J G;  3IC7 A;  3OT7 A;  1KMI Z;  4DR7 B;  1JA8 A;  4CS4 A;  3CB2 A;  3GB7 C;  1PNK A;  4MVQ A;  2ZDI C;  3JAM N;  5LGU A;  4J10 A;  1Y67 A;  2XHB A;  4U7O A;  1US6 A;  2EZO A;  3RT3 C;  2N74 A;  4O4J A;  4JTA B;  4JI1 B;  4J42 A;  3IAY A;  3CD6 V;  4GX0 A;  3M7M X;  1S5L Z;  2K9P A;  4AQY O;  2B5U A;  3VQX A;  4GX5 A;  3QTC A;  2GTA A;  2IM9 A;  3MHS C;  4DR4 O;  1WJZ A;  3CXH F;  3D36 A;  2YI9 A;  3TXQ A;  3E89 A;  1Y66 A;  1FXK A;  1MSW D;  4UVC A;  3ZED A;  1H8H G;  2Q7H A;  3N27 A;  5LYJ B;  1EFR G;  1LUV A;  2IBZ H;  4Z1V A;  2KG7 B;  3R65 A;  2LQT A;  2CH7 B;  4TT3 G;  4CH4 A;  3K3W A;  1ZL8 A;  1ROP A;  1SRY A;  3C3T A;  3CSX A;  2EUL A;  1OCO B;  2ZE6 A;  1CP9 A;  3AK1 A;  5CA0 B;  4K8X A;  1QR8 A;  4QIW F;  1K73 W;  3NXS A;  4MVO A;  1JJO A;  4JTC B;  4DV2 O;  2FB5 A;  2OYQ A;  1TAE A;  4J80 A;  2ARH A;  3CCL V;  1GKF A;  4Z2W A;  4B3M O;  3LSQ A;  3RN4 A;  1GMG A;  2CAZ C;  2VQF B;  1CXZ B;  2EIJ B;  3TCU A;  4GLX A;  4O4L A;  2XAF A;  2ETN A;  5KX5 A;  1YDX A;  4FFB A;  3ABL B;  1UJW B;  1AR4 A;  1RM1 B;  3CRQ A;  5EC1 C;  1S77 D;  2QTO A;  4DK1 A;  3BFR A;  4NYK A;  4D6T H;  1H2S B;  2LW1 A;  2JJ1 G;  1L8D A;  4B3T O;  4IYH A;  2YIB A;  4JI8 O;  1DLB A;  5GTI Z;  4DV3 B;  3ABT A;  1VQ7 V;  1I5X A;  4FM1 A;  4QGP A;  1SA0 A;  4MS2 A;  3KKY A;  3DC5 A;  4JI7 B;  4J7Z A;  3E8H A;  4JV5 B;  4U3J B;  4J7K A;  4J7J A;  2JGD A;  1YI2 V;  4O2A B;  5JWP A;  2QWO B;  1Q8I A;  1K33 A;  4OX9 O;  5L3C A;  3A0R A;  2EIM C;  4BW5 A;  3ZCC A;  2IH1 C;  4IIJ A;  1R6T A;  1E1Q G;  3OE7 G;  4N21 A;  3TET A;  5LMN O;  3AG2 C;  1I94 O;  4MW8 A;  2YIB D;  4WBN A;  3QG5 A;  3L75 H;  1TVK A;  4J9Z B;  2EIK C;  2GUZ A;  4AQY B;  2E74 B;  1OHH G;  2QA4 V;  5L3E A;  3LDD A;  3VOU A;  4CS3 A;  1Q6U A;  4KP4 A;  4CBC A;  4X66 B;  2ADP A;  3ZRX A;  3E8F A;  1JCH A;  2M7W A;  4HYO A;  1DK1 A;  3WB2 A;  1Q7Y W;  2QM7 A;  4LF7 B;  4F6R A;  5CA3 A;  4ICG A;  5HFM A;  5DEC A;  4FMT A;  5EYP A;  5LBQ A;  2DW4 A;  3K59 A;  4PJ0 Z;  3SPC A;  3KZI Z;  1BT8 A;  2C2A A;  3TGU H;  2WLI A;  4Q6G A;  4I9Q A;  4LF9 B;  3OD4 A;  3M8A A;  2UXC O;  2ITC C;  4MVZ A;  4IIJ B;  1LR1 A;  5ITZ A;  2HHH O;  1NBM G;  4B3M B;  1HNZ B;  3FAV A;  2IJJ A;  5J2T A;  1QVF U;  1K92 A;  4WBN B;  2IW5 A;  4GKJ O;  1JVM A;  1TVK B;  1YXB A;  2RQ6 A;  4JZG A;  2GUZ B;  3ICX A;  1FS0 G;  5D5P A;  4X1Y A;  5FL7 G;  2Q8V A;  2A0L A;  1GRJ A;  1AI6 A;  3AG1 B;  2HG5 C;  3EHB B;  5IWA O;  4ZKI A;  2OIG A;  3AEI A;  3N2G A;  4JI8 B;  1KBH A;  3IGA C;  3FB6 C;  4F6R B;  2JVD A;  1S0V A;  3WG7 C;  1IXM A;  3LSU A;  5IYZ A;  3JAL B;  2XUM A;  1VF5 B;  4PEL A;  5EYP B;  3T1Y O;  3BY6 A;  3ZRW B;  4RQE A;  4ZOL A;  3ZBH A;  1SET A;  3DTU B;  4CH3 A;  4WFG A;  2YUA A;  4JF3 A;  1BQZ A;  4MW3 A;  1W0K G;  2FTK A;  2ZD9 A;  2DYR B;  3CCV V;  3HPL C;  5L3G A;  1N32 B;  2RNB A;  4MVR A;  2EIJ C;  3FAV B;  2FML A;  2H3O A;  2OTJ V;  3QO8 A;  3ABL C;  4JYA O;  1IXB A;  1X4T A;  5LA6 B;  3P3N A;  4QJF B;  4JI5 B;  3D36 C;  1DF4 A;  4JGS A;  1COW G;  1RPO A;  2P6J A;  2N05 A;  1A32 A;  1FXK C;  4KHP O;  2UUA O;  1VQK V;  3P30 A;  3T1H O;  1ZSP A;  3N2G B;  4CH6 A;  5HFL A;  4O4H A;  1SER A;  1K8A W;  5C93 A;  2UXD O;  1K5Q A;  3BAB A;  3MDS A;  2JEU A;  3JAS B;  5H2F Z;  2LGQ A;  3SJB C;  3RYH B;  3OFN G;  4G27 B;  5IYZ B;  5K1X A;  2P67 A;  1SS3 A;  4ZOL B;  2WLN A;  2BTQ B;  3C3S A;  4BIZ A;  1JMK C;  5KHK A;  4XDK A;  3ZX6 A;  3IFX A;  3SDL A;  2HP8 A;  4WFE A;  1M4U A;  2F4V B;  5JH7 B;  3FB8 C;  5IE9 A;  5E79 Z;  4HBN A;  3HKB A;  5LXT A;  4PI2 A;  4LF5 B;  2RDC A;  4JZ2 A;  5EZY A;  5FPR A;  2PY5 A;  1HDJ A;  3T4D A;  3B77 A;  1JJ2 U;  2F43 G;  4FZ0 A;  1Q3E A;  2R9A A;  1NTK H;  3JAR B;  1NJI W;  4PI0 A;  4AIL C;  4GKJ B;  4YJ3 A;  1JX9 A;  2CGO A;  4R7C A;  1GM7 A;  3LSS A;  2CE4 A;  2L6L A;  2ZM6 O;  2WWW A;  4O4H B;  5B3S C;  2XAQ A;  3B40 A;  3SJA C;  1NT2 B;  3SYC A;  5KLV H;  2A7W A;  5LL6 Y;  4DV6 O;  5IWA B;  4LCU C;  1XUQ A;  4DR7 O;  1K9M W;  3OEE G;  2NN4 A;  3GWO A;  3RGB A;  1YZB A;  5KUK A;  5H6R A;  4DR5 B;  2LW7 A;  2WLL A;  3ETD A;  1QU7 A;  2VWK A;  3CME V;  1JR9 A;  2Y0P A;  3CCM V;  1W59 A;  4H33 A;  1K4D C;  3ZMS A;  4F6E A;  2AGA A;  1SF9 A;  1NTZ H;  4JI1 O;  3HKB B;  1EZJ A;  4UCU A;  1I08 A;  4JI6 B;  3H01 A;  3T1C A;  1EBO A;  3K08 A;  5CB4 A;  3E35 A;  3W7X A;  1R6K A;  3RBZ A;  3SYA A;  3W7S A;  5CA1 A;  3H1J H;  2XND G;  1M1K W;  4LWS A;  2HVK C;  2PUS A;  4YJ3 B;  2RJZ A;  4DRX B;  4P9O A;  4BR6 A;  5LGN A;  1PKX A;  4WF9 V;  2CDY A;  1JFF B;  1Y76 A;  4I0X A;  4LFA O;  1PM9 A;  5KHG A;  4KHP B;  1WLE A;  1AB3 A;  1SQX H;  1KQS U;  1DGS A;  5LP6 A;  4DUY B;  1FXV A;  5B1A C;  3HKE A;  4W4L A;  1EM1 A;  2Z5U A;  5BXZ A;  3AG7 A;  1MZF A;  2RCV A;  1U97 A;  3CX5 F;  5CBF A;  4J11 A;  2N04 A;  2O57 A;  1Z2G A;  4JYC A;  1SZX A;  4P2Z A;  3CCJ V;  4G2K A;  3STZ C;  1ZWI C;  1MOF A;  1S5H C;  5FPO A;  2DE0 X;  3G6E V;  4JI2 B;  2BTO A;  4PDL A;  3PN1 A;  1QCE A;  4LWS B;  5KA6 A;  1XNR B;  2PGG A;  1YTF D;  2QEX V;  1KKC A;  3L72 H;  1I7F A;  1Q5O A;  1YTF B;  5BY1 A;  1SQF A;  2JDI G;  5GON B;  1Y76 B;  4I0X B;  2F95 B;  3BPZ A;  4PDV A;  5LYJ A;  4G28 B;  2KG7 A;  4J41 A;  1ENV A;  4L87 A;  1SQB H;  5D5Q A;  2AZ2 A;  2QSA A;  3RVZ A;  3U0Z A;  3P3P A;  1VQN V;  4MTX A;  3CRA A;  1V55 B;  2ZNJ A;  4DV6 B;  3QO5 A;  4OGQ B;  3E8B A;  1IBL B;  4KL1 A;  4EB6 B;  5CA0 A;  1S76 D;  5K1P A;  4HZ3 A;  4X1I A;  1D5N A;  1VQL V;  1WB8 A;  2CTP A;  2LO1 A;  3U10 A;  1WB7 A;  4N23 A;  5JJE B;  2ZQM A;  1M56 B;  1NQT A;  1VEW A;  5L3D A;  1U96 A;  2EIL B;  2D3O W;  3ZRV A;  2AW9 A;  3JAT B;  2JK5 C;  3RYC B;  3K5L A;  1FYJ A;  2KB1 A;  3CRR A;  2PI5 A;  4L8J A;  4NXN B;  5J2U A;  1B6Q A;  3CJH A;  1IBM B;  3H9V A;  4B7K A;  1VQO V;  2V1D A;  5F2V O;  3RFR A;  4X66 O;  4AI8 A;  1T5E A;  3IJ4 A;  4U3F H;  5IJ0 B;  1H2G A;  4TOI A;  2YEV A;  4I50 A;  4LF7 O;  1N33 B;  4R50 A;  1KKD A;  4O4I A;  2YI8 A;  1BQ0 A;  1P49 A;  1YF2 A;  2DOS A;  4C7U A;  4LFA B;  2MW2 B;  3I5D A;  3OGI B;  5EBM C;  4U3J A;  1SES A;  4FK5 C;  2A9H A;  4TV8 A;  4LF9 O;  2X7R B;  4LP8 A;  4X1I B;  3SR2 C;  4O2A A;  2HJF C;  2JGU A;  3K0D A;  2A06 H;  4O2B A;  3OTO O;  3ZHT A;  3L74 H;  3UO2 A;  2WLK A;  1M90 W;  4NTW A;  1B06 A;  2QKS A;  3OR6 C;  3D3Q A;  1HNZ O;  3QO7 A;  4X20 A;  1IUR A;  3OGC C;  2ZIM A;  5B1B C;  3K5O A;  4Q20 A;  4WCE V;  4H37 A;  1IZ3 A;  2E3C A;  4DR3 B;  1J5E B;  1HNX B;  3JCU Z;  5KHJ A;  1VQ6 V;  3CCE V;  5J2U B;  4K35 A;  3STL C;  3CJH B;  1Y4M A;  3CP1 A;  1M9N A;  4GZR B;  2DJV A;  5FLX N;  1IBK O;  5EBW C;  4YHH B;  3LUT B;  1RP3 B;  3JYC A;  2YEV B;  4I50 B;  3QNE A;  3FFQ A;  4O4I B;  1QR9 A;  1WAZ A;  3K5M A;  1SQP H;  2W0X A;  3SYP A;  5L3B A;  3MAQ A;  1NVP B;  4UCS A;  2FL4 A;  2QKC A;  3E8G A;  2OCC B;  4TV8 B;  1LNQ A;  1V54 C;  3LNM B;  4P30 A;  4O2B B;  1B3Q A;  3UKM A;  1N32 O;  1Z5V A;  3TK1 A;  4CS2 A;  4X20 B;  2IJK A;  2ZT9 B;  2WLM A;  1D2D A;  4MVU A;  1R3L C;  5LOV A;  1HNW O;  4NTX A;  3BHP A;  2EIN B;  4JI5 O;  3O9O A;  1KB9 F;  2JRI A;  4UVB A;  5CN0 A;  1O9H A;  5B66 Z;  2DQ3 A;  4UB8 Z;  4FIP C;  2LGW A;  1AR5 A;  2XAH A;  2YS8 A;  4UFZ A;  3AG3 B;  3UT5 B;  1ORQ C;  2LP7 A;  3E86 A;  5H5N A;  2QDO A;  4I7Z B;  4B3R O;  2QKA A;  5LGT A;  1AJN A;  1AIL A;  5JQG B;  2HJD A;  5LP6 C;  1WPX A;  2XTA A;  4B08 A;  3CC2 V;  3E83 A;  4BAY A;  3OM3 B;  3PJS K;  1NZ6 A;  2NNU A;  3JAL A;  1BZK A;  4U7N A;  3JD4 A;  5GW7 A;  2VRZ A;  4CC6 A;  1O9G A;  4WFF A;  1FAF A;  3ZRW A;  2F4V O;  1NI8 A;  1YHQ V;  4ZHQ B;  2X6B A;  4JYY A;  4GUN A;  2ILM A;  1YEW A;  3B8M A;  1GO3 F;  1KD1 W;  1XBL A;  1PV0 A;  1VMG A;  4LF5 O;  2WLJ A;  3E22 B;  2ZE5 A;  5BZB A;  3ML0 A;  5LOV B;  3OTO B;  2ZR2 A;  4DUZ B;  3JD3 A;  4PDR A;  1XHZ A;  4WFH A;  2V4D A;  3A2F A;  1OCZ B;  1QNM A;  4EEQ A;  3N2K A;  2A3Q A;  4DO2 A;  4QPK A;  1R1B A;  2EBO A;  5LA6 A;  2YIC A;  2VWJ A;  2Y48 A;  2JJ2 G;  2QJ1 A;  1R73 A;  1WNS A;  2NR5 A;  1K97 A;  3ABK B;  1BS3 A;  1IBK B;  1CPY A;  1RSO B;  2HLD G;  4NR1 A;  5KMG B;  2E5L B;  3KCY A;  3ETG A;  1F4M A;  4XBF A;  4DV5 O;  1Q86 W;  3JAS A;  3BVO A;  3RYH A;  1GM8 A;  4DR5 O;  4YIO A;  3B4S A;  4UUJ C;  3A0H Z;  4BWA A;  1OCO C;  2BTQ A;  4QE7 A;  3F5T A;  1BE3 H;  2BOB C;  5DN6 G;  2ZCE A;  1UPG A;  2GTS A;  4JI6 O;  3ASO B;  4KXR A;  5TIS Z;  4B7E A;  2ZIO A;  3UO3 A;  2OIE A;  1HP8 A;  3ZHV A;  5JVD A;  1XNQ O;  1OCC B;  3CRM A;  1AVM A;  4UVA A;  5JH7 A;  2M6Y A;  2UUB O;  2R9R B;  1P84 F;  3O65 A;  2BSK B;  3N2K B;  1EZV H;  2XT9 A;  1HNW B;  3DGE A;  1RM1 C;  5LHG A;  3OUS A;  3TXS A;  2ZIN A;  3DSQ A;  4CZZ A;  3QF7 A;  2QWR B;  3FD9 A;  3T2M A;  1SQQ H;  3ZHU A;  1ZAU A;  4MT8 A;  2P4V A;  1PNM A;  3JAR A;  1V9P A;  3T4Z A;  5A9G A;  1M5I A;  3OMA B;  4DUY O;  3SPJ A;  5L3F A;  1XL4 A;  2RN9 A;  2FYU H;  1EN5 A;  3A0B Z;  4JTD B;  4OPA A;  3APQ A;  3S3X A;  1FD9 A;  1MZE A;  4B3R B;  1MMM A;  4GYC B;  4FLW A;  3F7Y C;  3ABM B;  3RWR D;  1YCI A;  5KHI A;  2OCC C;  1XQ8 A;  4GX1 A;  1J95 A;  1S5J A;  2LFR A;  3B09 A;  2P5O A;  2CUG A;  2P06 A;  3ZRS A;  5J9P C;  1Q6I A;  3CC4 V;  1ZX3 A;  2Y4T A;  3CCQ V;  3U11 A;  3K9A A;  4LF4 B;  5JVD B;  3LNN A;  4JI2 O;  3ASN B;  5EBL C;  3D3I A;  2VS0 A;  4X1K A;  4TV9 B;  4I55 A;  1XNR O;  4I4T B;  3W7W A; 
#chains in the Genus database with same CATH homology
 2EIN C;  4UV9 A;  3G6E V;  4PA7 A;  1GMG A;  2ZR3 A;  2EIJ B;  3JD2 A;  3TCU A;  4PDL A;  2XAF A;  1QCE A;  4MVS A;  4LC1 A;  1Q81 W;  3ABL B;  5KA6 A;  1UJW B;  5DM6 V;  1RM1 B;  1YTF D;  2QEX V;  5EC1 C;  1QLE B;  1S77 D;  2QTO A;  1AJP A;  3AG3 C;  4GCZ A;  1E1R G;  1YTF B;  3F5W C;  3I55 V;  2JJ1 G;  5EK0 A;  2IJI A;  3ZJZ A;  3M99 B;  2JDI G;  1VQ4 V;  3MHH C;  2B1G A;  4RQF A;  2IU3 A;  2OT5 A;  3K06 A;  4PDV A;  3WFV A;  4Z1M G;  4G28 B;  3FB5 C;  1DLB A;  1SZT A;  2DYS C;  4JAU A;  1ENV A;  1F23 A;  1FXH A;  3ABT A;  1VQ7 V;  4L87 A;  4E2L A;  1I5X A;  5CBG A;  3HB3 B;  3OMI B;  4MS2 A;  4QPJ A;  3RVZ A;  4P9P A;  1KC8 W;  3K03 A;  1VQN V;  3E8H A;  2A79 B;  4MTX A;  1V55 B;  2XAG A;  3QO5 A;  3E8B A;  5B1A B;  4XDJ A;  1S76 D;  4HZ3 A;  3CCR V;  3RVY A;  1YI2 V;  1L1F A;  1VQL V;  1JQ0 A;  4XDL A;  4N23 A;  3OMN B;  1F51 A;  4EKW A;  1K33 A;  4QNH B;  2WLI B;  2ZQM A;  5L3C A;  4PA6 A;  1M56 B;  1NQT A;  3A0R A;  2DQ0 A;  5L3D A;  2EIM C;  2ZDI A;  2EIL B;  1VQ5 V;  4BW5 A;  2D3O W;  3KG2 A;  3ZRV A;  3ZCC A;  4X8A A;  5IYC O;  2JK5 C;  2XOK G;  2IH1 C;  3CYO A;  2KB1 A;  1P4R A;  2WLH A;  2PI5 A;  4BIU A;  2UXX A;  2R9I A;  1E1Q G;  3OE7 G;  1HWY A;  1B6Q A;  4N21 A;  3TET A;  3SYO A;  1VQO V;  3AG2 C;  2V1D A;  3K0G A;  4MW8 A;  2Q69 A;  2H8P C;  2Y69 C;  1F4N A;  3ZMZ A;  3ABK C;  2XAS A;  3LDE A;  3ZMV A;  4J9Z B;  2EIK C;  4JAV A;  3AG1 C;  1OHH G;  2ZXW C;  2QA4 V;  1H2G A;  5L3E A;  2YEV A;  4R50 A;  1KKD A;  2P90 A;  3LDD A;  3VOU A;  3CC7 V;  2HKO A;  2Q68 A;  3ZN1 A;  1G8M A;  4KP4 A;  4CBC A;  2X6C A;  3ZRX A;  3E8F A;  1JCH A;  2M7W A;  4HYO A;  1PL0 A;  1Q7Y W;  5EBM C;  2QM7 A;  5B1N A;  5CA3 A;  1OCR B;  1SES A;  4FK5 C;  2A9H A;  5HFM A;  4FMT A;  4HAM A;  5IYD O;  2X7R B;  4LP8 A;  3CCU V;  4GT1 A;  3SPH A;  4MTF A;  2Z3Y A;  5LBQ A;  2DYR C;  3ASO C;  2DW4 A;  2HJF C;  2DWD C;  3K0D A;  3SPC A;  2C2A A;  1M90 W;  2WLK A;  1AJQ A;  2QKS A;  3OR6 C;  2WLI A;  1OCC C;  3W7T A;  3QO7 A;  3OGC C;  2OTL V;  5B1B C;  4Q20 A;  4WCE V;  5IDJ A;  1ARO P;  2ITC C;  1AI4 A;  4MTG A;  4H37 A;  4MVZ A;  2HVJ C;  1M57 C;  3JD1 A;  3OR7 C;  1K5S A;  2EIM B;  3SYQ A;  1NBM G;  3SPG A;  1VQ6 V;  3CCE V;  3UM7 A;  1S3J A;  1GM9 A;  3STL C;  1Y4M A;  2IJH A;  2IJJ A;  3B8N A;  3CP1 A;  4JYB A;  1QVF U;  1K92 A;  1M9N A;  2IW5 A;  3X2Q C;  2W0F C;  2ITD C;  3AG4 C;  1TUE B;  1JVM A;  3ABU A;  3LDC A;  5EBW C;  3LUT B;  1K4C C;  5IY5 B;  1FS0 G;  1XL6 A;  3P32 A;  3JYC A;  5H6Q A;  4WFA V;  5FL7 G;  2YEV B;  3QNE A;  2A0L A;  3AG2 B;  2P7T C;  1QR9 A;  4JPR A;  1AI6 A;  2GSM B;  3BEH A;  1YIJ V;  2XAJ A;  3OUF A;  3JCZ A;  3AG1 B;  2HG5 C;  3EHB B;  3SYP A;  1GTO A;  1H8E G;  4ZKI A;  1YJ9 V;  5EC2 C;  4MSW C;  5L3B A;  4MVM A;  3AEI A;  1NVP B;  3IGA C;  3ABM C;  3FB6 C;  4GX2 A;  1S0V A;  4DXW A;  5H9C A;  3E8G A;  1R3J C;  2OCC B;  3WG7 C;  1IXM A;  1LNQ A;  1V54 C;  3LNM B;  4X89 A;  2K1E A;  4PEL A;  1BMF G;  3BY6 A;  4P30 A;  3ZRW B;  3ZMT A;  4RQE A;  3UKM A;  1SET A;  3DTU B;  4WFG A;  3TK1 A;  4JF3 A;  4MW3 A;  3ASN C;  2IH3 C;  1NH2 B;  1KP3 A;  1W0K G;  2FTK A;  2ZD9 A;  2IJK A;  2DYR B;  4RUE A;  1JOY A;  3CCV V;  2WLM A;  3HPL C;  1OCZ C;  4MVU A;  5L3G A;  1R3L C;  1P7B A;  1YSC A;  2Q6A A;  2EIN B;  4MVR A;  5B1B B;  4WFB V;  2EIJ C;  3G4S V;  5CBH A;  5E1A C;  4UVB A;  1NR1 A;  5CN0 A;  2B1I A;  1AR1 B;  2DQ3 A;  1I5Y A;  3QO8 A;  1THZ A;  3ABL C;  3OW2 U;  2OTJ V;  4FIP C;  2GHY A;  4RUF A;  4F4L A;  4KUM A;  4QJF B;  1K3E A;  1QLE C;  2XAH A;  5CMU A;  3FB7 C;  1PNL A;  3CXC U;  2HFE C;  1DF4 A;  4JGS A;  1COW G;  3AG3 B;  1RPO A;  1ORQ C;  1RPR A;  3RW0 A;  2LP7 A;  2P6J A;  3E86 A;  2LFS A;  1VQ9 V;  4MTO A;  2QM8 A;  1FXK C;  1R6N A;  4UV8 A;  2QE7 G;  1YJW V;  1DTO A;  1VQM V;  1VQK V;  3P30 A;  4PA9 A;  3FYE B;  5LGT A;  1AJN A;  1R3I C;  2JIZ G;  4LBE C;  2DYS B;  1PD3 A;  4YXW G;  3FKS G;  5HFL A;  1WPX A;  1DF5 A;  1SER A;  4UXN A;  1K8A W;  3CC2 V;  5C93 A;  1K5Q A;  3E83 A;  4BAY A;  2JEU A;  3OM3 B;  3CPW U;  3PJS K;  3OFN G;  4G27 B;  2W6J G;  4FJC C;  2NNU A;  3OAA G;  4U7N A;  3JD4 A;  2MK3 A;  5GW7 A;  1S72 V;  2P67 A;  1W2B U;  1E79 G;  5KUM A;  4I9W A;  4WFF A;  2WLN A;  2WSS G;  3ZRW A;  1AI5 A;  4TSF G;  3WG7 B;  4BIZ A;  1YHQ V;  1V54 B;  4XDK A;  1QVG U;  2X6B A;  1YIT V;  2WLL B;  2BOC C;  3B8M A;  1GO3 F;  4KFM A;  1KD1 W;  3IFX A;  2WLJ A;  2H94 A;  4PA3 A;  5BZB A;  3ML0 A;  4WFE A;  2ZR2 A;  3JD3 A;  4PDR A;  3VBB A;  1Q82 W;  2ATK C;  4PDM A;  4WFH A;  1GK9 A;  3FB8 C;  1MG1 A;  3W7U A;  4R8C A;  1OCZ B;  1NR7 A;  4DO2 A;  4QPK A;  4RAI A;  2EBO A;  3K04 A;  2X0L A;  3JD0 A;  1KP2 A;  1FFT B;  3T4D A;  1AI7 A;  3B77 A;  2V7Q G;  2Y48 A;  2AHY A;  2JJ2 G;  3OEH G;  2F43 G;  1JJ2 U;  1R3K C;  1OZ0 A;  1NKD A;  1R73 A;  2X6A A;  4ASU G;  2AHZ A;  2Y69 B;  3SJQ C;  1K97 A;  2DWE C;  3ABK B;  3EFF K;  1NJI W;  1VQ8 V;  2EIK B;  1NVP D;  1CPY A;  1JX9 A;  1KEC A;  4R7C A;  2ZXW B;  3G71 V;  2HLD G;  1GM7 A;  3LSS A;  4RO2 A;  3ETE A;  3CCS V;  4OXS A;  2WWW A;  3ZMU A;  3ETG A;  5B3S C;  2JEX A;  2XAQ A;  1FXK B;  5LHH A;  1F4M A;  4XBF A;  1K34 A;  4JAS A;  5IYB O;  1Q86 W;  5KA5 A;  3SYC A;  1GM8 A;  1BHB A;  4LCU C;  4UUJ C;  3K79 A;  4ZBM A;  1OCR C;  1K9M W;  1OCO C;  3OEE G;  1N8R W;  1NH2 D;  4QE7 A;  2IU0 A;  1QLN A;  1K7D A;  3GWO A;  4I5S A;  2BOB C;  5KUK A;  5DN6 G;  1MAB G;  5H6R A;  2HR3 A;  1W0J G;  3ETD A;  2WLL A;  3IC7 A;  3ASO B;  3CME V;  1QBZ A;  1H38 A;  3CCM V;  2W6I G;  3GB7 C;  1PNK A;  3SPI A;  4H33 A;  2ZDI C;  1K4D C;  1OCC B;  4MVQ A;  4UVA A;  4J9Y B;  5LGU A;  3ZMS A;  2R9R B;  5LHI A;  1CEZ A;  1EZJ A;  4U7O A;  2WPD G;  3H01 A;  2EZO A;  1EBO A;  4TWK A;  3K08 A;  3T1C A;  1M57 B;  3DGE A;  3E35 A;  1RM1 C;  5LHG A;  3CMA V;  3W7X A;  1R6K A;  2UXN A;  3OUS A;  3FYI B;  3RBZ A;  4JTA B;  3SYA A;  3W7S A;  4CZZ A;  3CD6 V;  4GX0 A;  2XND G;  1M1K W;  3T2M A;  4MT8 A;  3X2Q B;  3AG4 B;  2B5U A;  1PNM A;  2HVK C;  4GX5 A;  5B1O A;  5IY5 C;  3MHS C;  3T4Z A;  3ZIA G;  3D36 A;  1YJN V;  3OMA B;  4P9O A;  4FPP A;  3E89 A;  5LGN A;  3SPJ A;  5L3F A;  1XL4 A;  1PKX A;  1Y66 A;  4QE9 A;  3ZN0 A;  4WF9 V;  4JTD B;  1FXK A;  4PA4 A;  4UVC A;  1MSW D;  3MD0 A;  3E2E A;  1H8H G;  1WLE A;  1VQP V;  1EFR G;  2NLJ C;  3F7V C;  3I56 V;  2WAM A;  3R65 A;  3F7Y C;  1KQS U;  2Q67 A;  1V55 C;  3ABM B;  5B3S B;  2YSU B;  4TT3 G;  1FXV A;  5B1A C;  2OCC C;  3K3W A;  1ROP A;  4GX1 A;  1J95 A;  1SRY A;  2Z5U A;  2LFR A;  4R6Z A;  5CBF A;  3ZRS A;  5J9P C;  1OCO B;  4X88 A;  1BHA A;  1CP9 A;  2EJR A;  3CC4 V;  1BL8 A;  3CCQ V;  3K9A A;  1M56 C;  1QR8 A;  2CK3 G;  4QIW F;  1K73 W;  3NXS A;  2PI4 A;  4MVO A;  2EIL C;  3ASN B;  4JTC B;  4JYC A;  5EBL C;  3D3I A;  4P2Z A;  3CCJ V;  4G2K A;  3STZ C;  1ZWI C;  1MOF A;  1S5H C;  2EZP A;  3CCL V;  1JPX A;  1GKF A;  3LSQ A;  1G4Y B;  3W7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...