3ZRVA

The high resolution structure of a dimeric hamp-dhp fusion displays asymmetry - a291f mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
108
structure length
108
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 46
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrvA00
3MD0A 3NXSA 3ZCCA 4BIUA 2WWWA 1IXMA 3D36A 3ZRVA 1JOYA 4FPPA 4QPJA 1F51A 4MT8A 4JYBA 4U7NA 2P67A 4JAUA 2C2AA 4JASA 3P32A 5B1OA 3ZRWA 4I5SA 4JYCA 4BIZA 4U7OA 2FTKA 4FMTA 3TK1A 4Q20A 2QM7A 2LFSA 2LFRA 4GT1A 4LC1A 4MTXA 3ZRXA 5B1NA 3DGEA 2QM8A 4JAVA 4KP4A 5IDJA 3ZRWB 5C93A 4ZKIA 3A0RA 4QPKA 4GCZA
chains in the Genus database with same CATH superfamily
2DYRB 3L74H 4JI4B 3ZHTA 1Y4MA 4BW5A 4JYBA 4IYHA 1NVPD 3ZJZA 5GONA 4P9OA 1QR9A 1E79G 1YTFD 5IYZA 1NZ6A 1R3JC 3E2EA 1EZVH 4X1KB 4FJCC 4J80A 2JRIA 2ZINA 2P06A 3NXSA 4CC5A 4JI5O 1N33O 4JV5O 2UXCB 1Q90D 1SETA 1OJHA 4DXWA 1VEWA 2BTQB 4JI1B 4B3SB 5J2UA 3L73H 4J10A 1FFXA 3IJ4A 3KCXA 4DYLA 2ZE8A 3JASA 1VQ6V 3G80A 5KAFZ 4GCZA 2A3QA 1XNRO 3ABLB 1PPJH 1Z2GA 4BWAA 5JJJB 1K5QA 2JEUA 1M57B 1R3LC 3UQ8A 3J7AU 4L8JA 2KB1A 3OAAG 1IVSA 5LHHA 1WLEA 4H37A 5LA6B 3O65A 2WLHA 2VS0A 4P9PA 1JA8A 1VQOV 2UXDB 4K0KO 5J9PC 3VOUA 3CRCA 4TUYB 3W7TA 2RNBA 2OIGA 1YDXA 1VQPV 1AJNA 1WB7A 5L3CA 4JYCA 1PD3A 1ROPA 1E1QG 1TVKB 2UXXA 3JATB 3KCYA 4YY3B 4NXNO 1IXBA 3JAMN 5LOVA 1PM9A 1TGOA 1FPOA 1FAFA 3ZMTA 1M1KW 1VF6A 3ABTA 4ZIBA 3TGUH 1GTOA 4OX9O 4PDLA 2ITCC 4R8CA 1JJOA 4O2AA 4D7TA 3P3NA 4JI2B 3A8TA 3ZRWA 1Y67A 1FFTB 2LW1A 5CA0B 4UV9A 2UXNA 3FAVB 4NKGB 4E4EA 5LGUA 3ZMVA 3HKEA 1M5IA 3C3SA 2ZR3A 2P4KA 2ZM6O 2DQ0A 2Y0IA 2YXHA 2IU3A 4DR2O 2CTRA 4O4JB 3ABUA 1H38A 1H2KA 1VF7A 3P3PA 1HNZB 3QO8A 4LNUB 1XMQO 4RQEA 4JI6O 4OXSA 1BQ0A 2BSKA 1GMGA 5A2QN 5ITZB 1XNQB 3LDDA 1J5EO 2UXBB 2QM8A 2BTOA 5L3BA 3CCRV 3E8BA 2NNUA 2CTQA 1DK1A 1GN2A 1SQVH 2P67A 2FL4A 3ZMSA 3OEEG 4DRXB 4I50B 4Z1MG 3A0HZ 3BA9A 3ASOB 5BY1A 1JCHA 1PNKA 3K59A 2E5LO 1H2GA 4GKKO 1WJZA 3C3TA 3DSQA 3LNMB 1MZFA 1Q6UA 2YIAA 1TA8A 3HKBB 4TWKA 3CRRA 2XAHA 2JJ1G 3EVKA 4XDJA 4FZ0A 5TISZ 4DR5O 3L9DA 2F4VO 3CJHA 3ZMUA 2XHBA 5GW7A 3CSXA 4JYAB 4JI3O 4X1YA 3QO5A 4PA9A 2QKSA 2GV9A 1VQ8V 2UU9O 4DV6O 1O9GA 2O57A 1KBHA 4EKWA 1XMOB 5E1AC 2Y4TA 3HKCA 2QM4A 3K04A 3OUFA 4QGPA 1IBKO 3D36C 2VQEO 4B3RO 1FJGO 1YF2A 4JAVA 3X2QB 4LF7B 2YIBD 3DC6A 3BRCA 2PZSA 1JFFB 3E89A 5LHIA 1YTFB 5IYDO 2V4DA 4FLUA 2FB5A 4FVMA 4LF8O 2OCCB 4MTXA 3T1CA 3CRMA 3JD2A 4FFKA 3SPIA 2CGOA 3RVYA 3H1IH 3RYFA 4DO2A 3ZHVA 3SJAC 4G27B 4DV5O 5E79Z 3AEIA 4B3TO 2ZE5A 4CS3A 4DR7O 1NTMH 4ICGA 3SGIA 1RM1B 4MW3A 3GWOA 3TK1A 4YJ3B 1WNSA 3OE7G 1N32O 2AZ2A 3H9VA 5CA3A 5L3GA 4JZ2A 5B1BB 1K3EA 2Q7HA 3IFXA 4PHZA 3EHBB 3WB1A 4I0XA 1S0VA 3HKDA 5KX5A 4H33A 3CCSV 4X64O 3BFRA 4FFBA 3O9OA 2EIMB 3AG4B 5KHIA 2X7RB 5B1NA 3F7VC 5EC2C 3RWRD 3ZRSA 4HYOA 1HWYA 3ZCCA 1KB9F 2W6JG 4W4KA 5IYCO 3D36A 5JH7A 3BHPA 5LXTA 3SPJA 3WU2Z 2R72A 3RYHA 3K58A 2ETNA 5GTIZ 1M4UA 4WBNB 1KMIZ 4Q20A 1OCZB 5C8YB 2LQTA 4MW8A 1W59A 4X1IA 1SQBH 5LMNB 1D5AA 3RN4A 5BMVA 4Z1VA 1ENVA 1NR7A 2XAFA 4DUZB 2Q9LA 3CMEV 1FXKB 2ZXWC 2HVKC 2JS5A 5JJNB 2PGGA 3WG7B 2G38A 2HFEC 3L72H 1SQGA 3M8AA 1MSWD 1GM7A 2DYSC 1VQKV 1IDSA 2JS3A 4F6RA 1Q81W 4NXMB 3TXQA 4NB5A 1K92A 4XDLA 1DF5A 1XQ8A 4JAUA 4LWSA 1JR9A 2QDOA 1JPXA 3H1HH 3E8HA 3L71H 4TV9A 4X66B 4U7OA 1I08A 4NTXA 2F95B 5EYPB 2HJFC 3U11A 4OPHA 2EIJB 4FM2A 4IIJA 5BR8O 1XI1A 1BZKA 3CXHF 1B3QA 3MHHC 1URFA 5FNVB 3J81N 4MT8A 4EB6A 3B09A 1KKCA 5EBWC 4DV3O 2A9HA 3UCSC 3TETA 1H2LA 1CXZB 4KUMA 2Q7GA 1M56B 1K33A 3OR7C 3A2FA 3JALA 3ZN1A 5GONB 3ZEDA 4Z2WA 4TSFG 3T4ZA 1FYJA 5IYZB 1B6QA 3AG1B 3T1HO 2C2AA 5CBGA 4GX1A 2ZIOA 3U10A 2VQFB 4TQDA 2HR3A 1NKDA 3ABMB 2GTAA 2QGNA 3CPWU 4LF4B 1O9HA 4IHJA 3CCUV 1B06A 4H44B 1WA8A 5A9GA 3LSQA 1V54B 4MVSA 1HDJA 4MTFA 1BHBA 5CBFA 1IURA 3Q4HA 1BSMA 3VBBA 1FFXB 1AI7A 1G4YB 2EIKB 4HBNA 3JASB 5KAIZ 1COWG 2Y48A 3DXRA 2L35A 5FPOA 1OCRB 1VQ9V 1SF9A 1N34O 3UT5A 5CMUA 4FIPC 4X62O 2Y69B 3OTFA 4LFAO 2E75B 1OCOB 5H6RA 1AI4A 2IW5A 2JDIG 1LUVA 4CS2A 2JGDA 4JI5B 1N33B 2L6LA 1XHZA 1JX9A 1FXHA 1YXBA 5B1AB 3RYCA 1ZTEA 2OYQA 3I5DA 4F4LA 1YJNV 3BCCH 3OMAB 4KL1A 1XILA 2XUMA 1AR4A 2PF4E 1K34A 3MHSC 1VARA 5LOVB 1DLBA 1L8DA 1VQ5V 2JJ2G 3GWKC 4UVCA 3N27A 4O4LA 1FXVA 2X6CA 1NJIW 4O2AB 1GM8A 1YHQV 4B3MO 3ZRWB 4H13B 4DK0A 3D8CA 1NQTA 3SYAA 5EBLC 1Y74A 3HPLC 2CK3G 4KFMA 3HKEB 2E76B 1ZAUA 4K0KB 3F5TA 4YHHO 2R9IA 4DR1B 3IAYA 2QTOA 3K57A 3MDSA 1I5XA 2XTAA 5IY5C 4JI8O 3FFQA 1S5LZ 1QLEB 2RMKB 2BSKB 4NXNB 1PL0A 3STZC 2XT9A 2QE7G 3OT7A 3S3XA 4GX5A 1I0HA 4OX9B 4RUEA 2UUAO 4LFBO 3ABKC 1IZ3A 2WLNA 5B3SC 1FD9A 1E1RG 4IYIA 2QR4A 2Q4PA 3BPZA 2Z5UA 3JD3A 2YI8A 4J42A 3WB0A 3ASNB 5JVDA 2OT5A 4JZGA 2QA4V 2ODMA 1P7GA 2ATKC 4NTWA 1P4RA 4U3JA 3UO3A 5KHKA 2ZM6B 4DUYO 1Q8IA 2VWJA 4DR2B 4K8XA 4EFEA 4J7KA 4ASUG 1TUBA 1M93A 2AHYA 1MA1A 4JI6B 1AR1B 3K06A 3E35A 5LMUO 1SKVA 2YICA 1J5EB 2YIBA 4DR6O 4LFCB 1L0NH 2Q68A 2Z0AA 3CJHB 5J2TA 1HNWO 4X20A 1OZ0A 5IJ0A 1H8EG 2RJZA 4TOIA 2Q69A 4J9YB 1GAXA 1QVGU 1V55B 1IBMO 2DYRC 2E5LB 4OPAA 4IGGA 3HKCB 4ZI7A 2DMXA 4MVQA 3T1YO 5FL7G 4E2LA 2ZDIC 2PYJA 1S5JA 4WFEA 1ORQC 1IX9A 3ICXA 4CH6A 4AQYO 2DN9A 2LFSA 4DV7O 3APQA 4DR5B 3LDCA 2LP7A 2IH3C 2PI5A 1XREA 2PYLA 2DW4A 4DV2O 2QWQB 4RO2A 4MSWC 1VMGA 5JQGA 1M9NA 2EILB 2GUZA 4DV6B 3I55V 2VRZA 3RYFB 3CCVV 4JI4O 3BA8A 4O4HA 4I55A 4O4IA 2IH1C 2PUSA 3AK3A 3WB2A 1IBKB 3KZIZ 2VQEB 1BCCH 2AW9A 2Y4UA 4B3RB 5CB4A 3ZRVA 2Q8VA 1WP7A 1Q86W 2NN4A 2ILMA 4I5SA 1QVFU 4YIPA 4GX2A 5LGTA 3OUSA 1BGYH 4NVPA 1N0NA 3SYOA 3W7SA 5K1XA 4I0XB 2DWDC 3HKDB 5KX5B 4FLVA 1LR1A 4D6TH 3CC4V 3AG2B 4ZKIA 4LF8B 2F66C 3MD0A 1I7FA 3N2KA 3JSLA 3QO7A 2X0LA 4FFBB 4WFBV 4FLYA 2WA3A 1NH2B 1MG1A 3E8GA 5KUKA 1RSOA 4HZ3A 3FD9A 3FB5C 4Q6GA 3OMIB 4DV5B 5IWAO 2UUBO 4B3TB 2UUCO 3ETQA 3ZRXA 4DK1A 5LXTB 4DV1O 1ZWIC 2ZE6A 2BOCC 1PL4A 3RYHB 3E22A 5KUMA 4CH5A 4DW1A 1N32B 1JOYA 1CP9A 3CCMV 4FPPA 1ZSPA 1HP8A 2Q6AA 4GKJO 3RVZA 1YSCA 3QG5A 4LF6O 2UXDO 5L3DA 3SJQC 1XOUA 4X1IB 1XHXA 1N36B 4PJ0Z 2LGWA 1Y6XA 3CB2A 3OW2U 4X64B 5BMVB 1Q7YW 3CE2A 3CC7V 4JI7O 2Z3YA 2WWWA 3KKYA 2M7WA 2IM9A 2HLDG 1SERA 4YY3O 1EN6A 1LUWA 4UCRA 2DOSA 2D2CB 1YITV 4H0LB 1VQMV 2Y0PA 2OWOA 5EK0A 3I56V 4FLWA 1G1XB 3W7XA 4F6RB 1PNLA 2LJ2A 2HHHO 1D2DA 4LWSB 2QWPB 3QVNA 5LP6C 1ZL8A 4UVBA 1NVPB 4TV9B 4KHPB 1EZJA 1NU1H 2MK3A 2QJ1A 3CYOA 3VQWA 3QNEA 1AP6A 1NI8A 2CTPA 1HNXO 4IIJB 3F7YC 1IBLO 2ADQB 3ZHQA 2OTJV 2KSDA 1G8MA 1GO3F 4L87A 3B4SA 1K8AW 1KP3A 4I4TB 4EB6B 3OFNG 2W0XA 4YJ2B 2XNDG 3G6BA 1HW7A 3BY6A 3G4SV 2ADPA 3OTOO 1SQXH 1K4DC 1V9PA 1XNQO 1YCIA 5BZBA 3JALB 4UB8Z 1CPYA 4MVUA 3K79A 3JAKA 1QCEA 1US6A 4NYKA 1YI2V 2Q7EA 1QNMA 4TQFA 2CE4A 4CS4A 3CRAA 4IHJB 5JCOC 3W7UA 2IU0A 3UKMA 4JTCB 5KHGA 4UV8A 3Q4HB 4O2BA 4LNUA 2CH7A 2LO1A 2CUGA 3ZHUA 4DV3B 3G67A 4BIOA 4RQFA 1SZXA 1H2SB 2DYSB 2F93B 4QIWF 1DF4A 3SJCC 1QHTA 3DXRB 2XASA 4LP8A 3AG3B 2WLKA 4F6EA 3ZMZA 4GX0A 2OCHA 2P90A 4PDRA 3SDLA 1RFYA 3UT5B 5LP6A 1BQZA 3P30A 1FKAO 4MVOA 4UB6Z 4DRXA 4UUJC 3LUTB 4KP4A 1OCCC 2W0FC 2PI4A 3M7MX 1R6NA 2JGDB 5AG2A 2ZIMA 1WPBA 3G71V 1YJWV 4DV0O 5EC1C 2F23A 3JD1A 1YVWA 3STLC 3RYCB 2EINB 4RUFA 1RM1C 1DGSA 3D3IA 3JAWA 5H9CA 4FMTA 4OGQB 5GTHZ 4CZZA 3LNNA 1Q3EA 3CCLV 4X65O 1N34B 4R6ZA 4O4LB 4HNAA 1GN6A 2WLJA 4UCSA 1EM1A 4LFAB 2E74B 1N8RW 1GK9A 1MMMA 1QBZA 5B66Z 1Y74B 2RQ6A 5D5PA 2D3OW 3AK2A 5IDJA 3CCEV 4PA3A 2EBOA 3M99B 4QNHB 3RFRA 4MS2A 1SA0A 2P7TC 3SYCA 1JJ2U 2IJHA 4PA4A 1Z5WA 1AB3A 1JQ0A 4BIZA 1OCZC 4FLXA 2HG5C 4K8ZA 1Y66A 3B40A 2V1DA 2IBZH 4R7CA 1VQ4V 4MTOA 1KC8W 4KXRA 3SPCA 1X4TA 3H1JH 3R66A 1G6UA 1OV9A 1AROP 3A0BZ 5CN0A 4TV8A 4TT3G 4B3MB 5EZYA 4AI8A 3B8NA 3CCQV 4LR3A 1Q6HA 1GM9A 3RBZA 5JVDB 3H01A 4JGSA 3WG7C 3JARA 4U3JB 1R6TA 2QKAA 1HR0O 4BIUA 1H8HG 2YSUB 1RPOA 3W7WA 1TUBB 2B1IA 5J2UB 1PNMA 4CC6A 3HR0A 3QF7A 4J11A 1R3IC 1BHAA 1ZLZA 4K35A 4X88A 3GVMA 2HJDA 4GYCB 3CWBH 3OEHG 2EZPA 4DR3O 4DR4O 1NBMG 1VIBA 3K0GA 5CA1A 4MVZA 5EIBD 1YEWA 2WLLA 5J2TB 2EJRA 1TUEB 2UUAB 1JMKC 4LFBB 1EN4A 4X20B 1T5EA 5IJ0B 4JAAA 1S3JA 3CEIA 1BMFG 1F51A 1NS1A 4D7SA 1SQFA 4DW0A 2ZNIA 4JV5B 1LNQA 2GSMB 3E83A 4ZI7B 4FLZA 1EN5A 3EFFK 4WFAV 4FM0A 3KG2A 1YZBA 3N2GA 4WF9V 1Q6IA 2DJVA 2KQXA 1WB8A 3SYPA 1AI6A 2EJ7A 4UVAA 3PN1A 2DE0X 3CRQA 5IT9N 2DWEC 3B77A 1XBLA 3OGIB 4U7NA 3RW0A 2XAJA 3K5LA 2JVDA 1XNRB 1JVMA 2GDSA 1UFIA 3AK1A 2XAGA 4JI0O 2IJJA 1GN3A 1F4MA 3S3WA 1YJ9V 2HP8A 2K9PA 5IJ9A 4B7KA 5JQGB 1NTKH 4YIOA 3K08A 2R70A 2GUZB 1R6KA 2EIKC 2ZT9B 2GHYA 2IJIA 4I9QA 4O4HB 1J95A 4I55B 4O4IB 1XL6A 3T1YB 1P84F 2QWNB 5CB4B 2F43G 4AQYB 2Y69C 1XDCA 4MVMA 4PDVA 1OCOC 4X8AA 1AJPA 4DV7B 4G28B 4WFGA 3H1LH 5LGNA 2DQ3A 4JASA 1AP5A 4XBFA 5DECA 5DM6V 4DV2B 1R3KC 3RYIA 3ZBHA 3N2KB 5B1AC 3THOA 4LF9O 4J9ZB 1W2BU 4RWUA 2YUAA 3PJSK 4DV4O 4LF5O 1RSOB 1KP2A 2Q0AA 2AGAA 1VF6C 2KG7A 2N04A 3E22B 5KHJA 1KD1W 4UCTA 4A5UB 4UCUA 1XMQB 1K97A 5LYJA 2ZR2A 1MOFA 4GUNA 3K9AA 3FX7A 2YXLA 1I94O 5B1OA 2CAZC 4PD4F 1TAEA 4X1YB 1K73W 3CHXA 2Q5ZA 4NR1A 2YDEA 1QLEC 3CP1A 4RAIA 1UJWB 5H5NA 2B9ZA 3VQYA 5IWAB 2UUBB 5L3FA 2UUCB 4GKKB 4ZOLA 4DV1B 4UFZA 1K7DA 2QKCA 5KA5A 3EXAA 2XOKG 1S77D 3ZHRA 1ZL8B 1PV0A 2H3OA 1U97A 4GKJB 1S5HC 2FKXA 2ZCEA 5F2VO 3ASNC 5KA6A 2F4VB 4LF6B 2M6YA 2E3CA 5FLXN 3OM3B 1D5NA 4J7JA 4DR1O 1ZUQA 4GLXA 4JI7B 4JI3B 3K0DA 1W0KG 2HVJC 4LH6A 2UU9B 1UPGA 2CGNA 1Q43A 2WLIA 3NR7A 2QEXV 3OR6C 1AILA 4UXNA 2YEVA 3HB3B 3GB7C 3ABLC 3JYCA 3UM7A 1FJGB 4PI2A 2EULA 4WFHA 1M57C 3CC2V 2HHHB 1Y76A 4LH7A 5KMGA 3JAKB 2N05A 3T2MA 3F5WC 4ZHQA 3K5MA 4ZBMA 3FYIB 3RT3C 4BR6A 1SQQH 1S76D 3K5NA 2WSSG 4C7UA 3C90A 5JWPA 3TCUA 2LFRA 3FB6C 4LC1A 1V55C 1NR1A 1HNXB 2UXCO 1WPXA 1IBLB 1H2MA 1YIJV 4JI1O 4B3SO 4O2BB 2CH7B 4BW9A 1KQSU 3OGCC 4WCEV 2ZQMA 4PV1B 4X89A 4I7ZB 4UCVA 3OTOB 2JIZG 3BABA 2YI9A 4IT5A 4DR7B 4LFCO 4ABMA 4K3AA 1GN4A 5JH7B 3SPGA 1DTOA 2ZNJA 2YXYA 2ZDIA 3VQVA 5C93A 4N23A 1ZX3A 5LP6B 5H6QA 2VWKA 3IC7A 4LCUC 3JD0A 4X1KA 2EILC 2GBOA 4PA6A 5K1PA 5EIBC 1GKFA 1WN7A 4JPRA 2XAQA 3WFVA 1P49A 2BTQA 2QTSA 3JCZA 2Q67A 3JAWB 5L3EA 2JEXA 2FMLA 2OIEA 3SPHA 4CH4A 2FTKA 5CBHA 3CX5F 4HNAB 2LW7A 3DTUB 1AJQA 1Z5VA 3AG2C 1KUQA 4JI2O 3A0RA 3SYQA 1F4NA 1R73A 5LA6A 4I9WA 2BE3A 2P5OA 1WAZA 3ASOC 1SS3A 3LSUA 1THZA 4DV0B 4NTYA 4W4LA 3FYEB 3K03A 4TUYA 1XL4A 2N74A 1A32A 3K5OA 1SA0B 4EFBA 1HNZO 4U3FH 1GRJA 2ITDC 1TVKA 5FPRA 3JATA 3ZN0A 4JYYA 4X65B 2P22C 5IE9A 2UXBO 2QSAA 1B04A 1KU9A 1KKDA 4X9QA 3L70H 2AZ0A 4TV8B 3SJBC 4R50A 2FYUH 5EZYB 3K3WA 4MTGA 4PDMA 1X59A 2R9AA 5CA0A 2B1GA 1NT2B 3R65A 3B2EE 1OCCB 3FAVA 1MSDA 1CEZA 2WPDG 2KKWA 3ETGA 3JARB 4PA7A 5BR8B 1N0JA 1WA8B 4O4JA 2PY5A 2ARHA 4AHCA 2YIDA 2RDCA 2MW2B 2QM7A 3BAAA 2ZXWB 3X2QC 4PI0A 2QWOB 1BL8A 5ITZA 3LDEA 2HKOA 1L1FA 1N36O 5CA1B 1F23A 1U96A 2WLLB 2WLMA 4CH3A 4AILC 4JYAO 1QU7A 1K5SA 1MNGA 1FS0G 3G6EV 3MAQA 3ZIAG 2OCCC 3T1HB 1OHHG 4I50A 1P7BA 3ETDA 2A7WA 1XMOO 3H1KH 1QR8A 1IXMA 1HR0B 4IL6Z 3HKBA 4JTDB 4UCOA 1VQ7V 4XDKA 1SESA 3N2GB 4LF7O 3ZX6A 4B7EA 1AVMA 4KHPO 2A06H 3DGEA 3CMAV 3ZHSA 1N4CA 1EFRG 5B1BC 1Q5OA 1K9MW 4QE9A 4DR3B 4DR4B 2AHZA 1F7YA 4FK5C 2ZKOA 2IJKA 4QPJA 1SRYA 1NTZH 4N21A 3JCUZ 4X62B 2QWRB 5IJ9B 1H2NA 2Q73A 2X6BA 3FKSG 2F1MA 2LGQA 2EIMC 3AG4C 1AR5A 3E86A 3TJTA 3CD6V 5JCOA 3OMNB 2JGUA 3U0ZA 2V7QG 2P4VA 5LL6Y 3AG3C 1R1BA 3RGBA 3ZS8C 5JJEB 3UO2A 3B8MA 4BAYA 3ML0A 2GTSA 3J80N 1JFFA 1XEQA 1RP3B 1KECA 3K9SA 1QLNA 4GT1A 1VF5B 3FB7C 3CCJV 3BEHA 5LBQA 4J7ZA 5H2FZ 4MVRA 3CXCU 5IYBO 3JD4A 4FLTA 4JI0B 2R9RB 3RYIB 2WA4A 4I4TA 1WP8A 4YJ2A 2OTLV 2P6JA 1QQCA 2EINC 2PTMA 4HAMA 1S72V 3DC5A 4P2ZA 1W0JG 1PP9H 4LBEC 1FXKC 2HEPA 3SR2C 2EZOA 2K1EA 1M90W 4YHHB 2H94A 5KHHA 1VP7A 4QPKA 2B5UA 2A0LA 2KG7B 3QTCA 4YJ3A 5DN6G 4JI8B 3IGAC 3AG7A 2ZE7A 4G2KA 5B5EZ 5LYJB 4P30A 1PKXA 1VQLV 2RCVA 2EIJC 4CBCA 4PELA 2YS8A 5LMNO 1I5YA 4LF9B 4WFFA 3BVOA 5D5QA 1BS3A 5HFLA 4DUZO 3ETEA 1VQNV 4DV4B 4LF5B 4FM1A 3LSSA 3CS5A 1KYOF 4DUYB 4ZOLB 1M56C 2W6IG 2JK5C 3FB8C 4B08A 4NXMO 5IY5B 4JF3A 5DEDA 4WBNA 5LMUB 4X66O 5EBMC 1AI5A 5C8YA 3AG1C 1MZEA 3E8FA 3T4DA 1NH2D 3JSNA 4DR6B 2CDYA 3ABMC 1RPRA 2EX3A 1I94B 1HNWB 3ABKB 1V54C 2ZD9A 5B3SB 2CTWA 4EEQA 2AXTZ 2RN9A 3L75H 1FXKA 2BOBC 3VQXA 2WLIB 1IBMB 1Q82W 3P32A 4GZRB 1XUQA 3APOA 2A79B 2Q0OC 5LHGA 2YEVB 3IC9A 1OCRC 3TXSA 1MABG 2X6AA 3OD4A 1Y76B 5KMGB 1BE3H 4FZ1A 1EBOA 2YC0A 4ZHQB 2VQFO 5EYPA 1GH6A 2NLJC 4J41A 1SC5B 1SZTA 1L0LH 4LF4O 2BCCH 2H8PC 1K4CC 4QE7A 2NR5A 5FNVA 2WAMA 5HFMA 1BT8A 4JTAB 4YXWG 5BXZA 4QJFB 1SQPH 3D3QA 5KLVH
chains in the Genus database with same CATH topology
2DYRB 1YIJV 1Y4MA 4BW5A 4JYBA 4TSFG 3T4ZA 1B6QA 3AG1B 1NVPD 3ZJZA 1KQSU 3W7UA 2IU0A 2C2AA 3OGCC 3UKMA 5CBGA 4GX1A 4JTCB 4WCEV 2ZQMA 4X89A 4P9OA 2HR3A 1QR9A 1E79G 1NKDA 2JIZG 4UV8A 3ABMB 3CPWU 1YTFD 3CCUV 1R3JC 3E2EA 3LSQA 4FJCC 3SPGA 1DTOA 1V54B 4MVSA 2ZDIA 4MTFA 5C93A 1BHBA 5CBFA 4N23A 4RQFA 4QIWF 3VBBA 2DYSB 3NXSA 1DF4A 1AI7A 1G4YB 5H6QA 2XASA 2EIKB 3IC7A 4LCUC 4LP8A 3AG3B 2WLKA 3JD0A 1SETA 3ZMZA 4DXWA 4GX0A 1COWG 2EILC 2P90A 4PDRA 4PA6A 3P30A 4MVOA 1GKFA 2Y48A 4JPRA 1OCRB 1VQ9V 2XAQA 1VQ6V 4UUJC 3WFVA 3LUTB 4KP4A 5CMUA 4FIPC 2Y69B 1OCCC 2W0FC 4GCZA 2PI4A 1R6NA 3JCZA 1OCOB 3ABLB 2Q67A 5H6RA 3G71V 1AI4A 1K5QA 2IW5A 2JEUA 1YJWV 1M57B 2JDIG 1R3LC 5EC1C 3JD1A 2KB1A 5L3EA 3STLC 2EINB 2JEXA 3OAAG 4RUFA 1RM1C 3SPHA 5LHHA 1WLEA 3D3IA 4H37A 2FTKA 5H9CA 4FMTA 1JX9A 1FXHA 5CBHA 4CZZA 3DTUB 5B1AB 2WLHA 1AJQA 3AG2C 4P9PA 3CCLV 1VQOV 3A0RA 4F4LA 1YJNV 3SYQA 3OMAB 1F4NA 1R73A 4R6ZA 5J9PC 4I9WA 3VOUA 2WLJA 1K34A 3MHSC 3W7TA 1N8RW 1DLBA 1VQ5V 3ASOC 1THZA 2JJ2G 1VQPV 4UVCA 1GK9A 1AJNA 5L3CA 4JYCA 1PD3A 1ROPA 1E1QG 1QBZA 2UXXA 1FXVA 2X6CA 3FYEB 3K03A 1XL4A 2D3OW 1NJIW 1GM8A 3ZMTA 1YHQV 5IDJA 3CCEV 1M1KW 3ZRWB 3ABTA 4PA3A 2EBOA 1NQTA 2ITDC 3SYAA 1GTOA 3M99B 5EBLC 4PDLA 3ZN0A 4QNHB 3HPLC 2ITCC 4R8CA 4MS2A 2CK3G 4KFMA 2P7TC 3SYCA 3ZRWA 1JJ2U 2IJHA 1FFTB 4UV9A 4PA4A 1KKDA 2UXNA 1JQ0A 4BIZA 2R9IA 1OCZC 2QTOA 5LGUA 2HG5C 1Y66A 3ZMVA 1I5XA 2V1DA 4R50A 4R7CA 5IY5C 1VQ4V 4MTOA 1KC8W 3K3WA 4MTGA 2ZR3A 4PDMA 1QLEB 2DQ0A 2B1GA 3SPCA 3R65A 1OCCB 2IU3A 1PL0A 3STZC 1AROP 1CEZA 2QE7G 3ABUA 5CN0A 1H38A 4TT3G 2WPDG 3QO8A 3B8NA 3ETGA 4PA7A 4RQEA 3CCQV 4GX5A 4OXSA 1GM9A 1GMGA 4RUEA 3RBZA 3H01A 4JGSA 2QM7A 3ABKC 2WLNA 3LDDA 3WG7C 5B3SC 1E1RG 2ZXWB 3X2QC 2QM8A 2Z5UA 1BL8A 3JD3A 5L3BA 3CCRV 3ASNB 4BIUA 1H8HG 3E8BA 2NNUA 2YSUB 2OT5A 3LDEA 1RPOA 2HKOA 2QA4V 3W7WA 2B1IA 2ATKC 1L1FA 1PNMA 1P4RA 2P67A 3ZMSA 3OEEG 4Z1MG 1F23A 2WLLB 2WLMA 1R3IC 4ASUG 1BHAA 3ASOB 1K5SA 1JCHA 4X88A 1PNKA 1FS0G 3G6EV 3ZIAG 2AHYA 1H2GA 2OCCC 3OEHG 2EZPA 1AR1B 1NBMG 3K06A 1OHHG 3K0GA 3E35A 4MVZA 1P7BA 3LNMB 2WLLA 3ETDA 2EJRA 1TUEB 1QR8A 4TWKA 1IXMA 1S3JA 2XAHA 2JJ1G 1BMFG 1F51A 2Q68A 4XDJA 4JTDB 1VQ7V 1OZ0A 4XDKA 1SESA 1LNQA 2GSMB 3E83A 1H8EG 3ZMUA 5GW7A 3EFFK 4WFAV 3DGEA 2Q69A 3CMAV 4J9YB 1EFRG 1QVGU 1V55B 3KG2A 2DYRC 5B1BC 3QO5A 4WF9V 1K9MW 4PA9A 2QKSA 4QE9A 3SYPA 2AHZA 1AI6A 1VQ8V 4FK5C 4MVQA 4UVAA 2IJKA 4QPJA 1SRYA 2DWEC 3B77A 5FL7G 4U7NA 3RW0A 4N21A 4EKWA 4E2LA 2XAJA 2ZDIC 5E1AC 4WFEA 1ORQC 1JVMA 2X6BA 3FKSG 3K04A 3OUFA 2EIMC 2XAGA 3AG4C 3E86A 3CD6V 2LFSA 2IJJA 1F4MA 1YJ9V 3LDCA 2LP7A 3OMNB 2IH3C 4JAVA 3X2QB 2PI5A 3K08A 2V7QG 2DW4A 1R6KA 2EIKC 3AG3C 3E89A 4RO2A 2GHYA 2IJIA 5LHIA 4MSWC 1J95A 1YTFB 3B8MA 5IYDO 1M9NA 4BAYA 3ML0A 2EILB 1XL6A 3I55V 3CCVV 1KECA 1QLNA 2OCCB 4GT1A 3FB7C 4MTXA 3T1CA 2F43G 3JD2A 3SPIA 3BEHA 3CCJV 5LBQA 2Y69C 4MVRA 4PDVA 2IH1C 4MVMA 3RVYA 3CXCU 1OCOC 5IYBO 3JD4A 4X8AA 4DO2A 2R9RB 1AJPA 4G28B 3ZRVA 4WFGA 2OTLV 2P6JA 4G27B 5LGNA 1Q86W 2DQ3A 2EINC 3AEIA 4JASA 4HAMA 4XBFA 1S72V 4I5SA 1QVFU 5DM6V 5LGTA 4GX2A 4P2ZA 3OUSA 1W0JG 4LBEC 1R3KC 1RM1B 4MW3A 1FXKC 3GWOA 3SYOA 2EZOA 3TK1A 3W7SA 2K1EA 5B1AC 1M90W 3OE7G 4J9ZB 2DWDC 5CA3A 1W2BU 5L3GA 3PJSK 3CC4V 2H94A 3AG2B 4ZKIA 4QPKA 5B1BB 2B5UA 1K3EA 1KP2A 2A0LA 3IFXA 3MD0A 3EHBB 3QO7A 4WFBV 2X0LA 5DN6G 1S0VA 1NH2B 4H33A 3IGAC 1MG1A 4G2KA 3E8GA 3CCSV 4P30A 5KUKA 4HZ3A 3FB5C 1PKXA 3OMIB 1VQLV 1KD1W 2EIMB 3AG4B 1K97A 3ZRXA 2X7RB 5B1NA 3F7VC 5EC2C 2EIJC 1ZWIC 2ZR2A 3ZRSA 4CBCA 4PELA 2BOCC 1MOFA 4HYOA 5KUMA 1HWYA 3K9AA 1I5YA 3ZCCA 2W6JG 4WFFA 5IYCO 3D36A 1JOYA 1CP9A 3CCMV 4FPPA 5HFLA 2Q6AA 3ETEA 1VQNV 3SPJA 3LSSA 5B1OA 3RVZA 1YSCA 1K73W 5L3DA 1M56C 4Q20A 2W6IG 3SJQC 2JK5C 1OCZB 3FB8C 1QLEC 3CP1A 4RAIA 4MW8A 1UJWB 3OW2U 5IY5B 1Q7YW 4JF3A 5L3FA 3CC7V 2Z3YA 2WWWA 2M7WA 5EBMC 1AI5A 3AG1C 2HLDG 1SERA 1K7DA 3E8FA 5KA5A 3T4DA 1ENVA 1NR7A 1NH2D 2XOKG 1YITV 1S77D 1VQMV 2XAFA 3ABMC 5EK0A 3I56V 1RPRA 3CMEV 1FXKB 2ZXWC 2HVKC 1S5HC 3W7XA 3ABKB 1PNLA 3WG7B 1V54C 2ZD9A 5B3SB 2HFEC 3ASNC 5KA6A 1MSWD 1GM7A 2DYSC 4UVBA 1NVPB 1FXKA 2BOBC 3OM3B 1EZJA 2MK3A 1VQKV 1Q81W 3CYOA 2WLIB 1K92A 4XDLA 1DF5A 4JAUA 1Q82W 3QNEA 3P32A 3K0DA 1W0KG 1JPXA 2A79B 2HVJC 3E8HA 5LHGA 2YEVB 3F7YC 4U7OA 1OCRC 2OTJV 1G8MA 2WLIA 1MABG 2X6AA 1GO3F 4L87A 2HJFC 1K8AW 1KP3A 3OFNG 1EBOA 2QEXV 3OR6C 2EIJB 2XNDG 4UXNA 2YEVA 3BY6A 3GB7C 3HB3B 3G4SV 3ABLC 3MHHC 3JYCA 3UM7A 4WFHA 1M57C 3CC2V 2NLJC 4MT8A 1K4DC 1SZTA 5BZBA 3T2MA 2H8PC 3F5WC 4ZBMA 1K4CC 3FYIB 5EBWC 4QE7A 1S76D 2A9HA 2WSSG 1CPYA 3TETA 4MVUA 3K79A 4KUMA 3TCUA 2LFRA 2WAMA 1M56B 3FB6C 4LC1A 5HFMA 1QCEA 1YI2V 1K33A 1V55C 1NR1A 3OR7C 4JTAB 4YXWG 3ZN1A 4QJFB 1WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MD0 A;  3NXS A;  3ZCC A;  4BIU A;  2WWW A;  1IXM A;  3D36 A;  3ZRV A;  1JOY A;  4FPP A;  4QPJ A;  1F51 A;  4MT8 A;  4JYB A;  4U7N A;  2P67 A;  4JAU A;  2C2A A;  4JAS A;  3P32 A;  5B1O A;  3ZRW A;  4I5S A;  4JYC A;  4BIZ A;  4U7O A;  2FTK A;  4FMT A;  3TK1 A;  4Q20 A;  2QM7 A;  2LFS A;  2LFR A;  4GT1 A;  4LC1 A;  4MTX A;  3ZRX A;  5B1N A;  3DGE A;  2QM8 A;  4JAV A;  4KP4 A;  5IDJ A;  3ZRW B;  5C93 A;  4ZKI A;  3A0R A;  4QPK A;  4GCZ A; 
#chains in the Genus database with same CATH topology
 2DYR B;  3L74 H;  4JI4 B;  3ZHT A;  1Y4M A;  4BW5 A;  4JYB A;  4IYH A;  1NVP D;  3ZJZ A;  5GON A;  4P9O A;  1QR9 A;  1E79 G;  1YTF D;  5IYZ A;  1NZ6 A;  1R3J C;  3E2E A;  1EZV H;  4X1K B;  4FJC C;  4J80 A;  2JRI A;  2ZIN A;  2P06 A;  3NXS A;  4CC5 A;  4JI5 O;  1N33 O;  4JV5 O;  2UXC B;  1Q90 D;  1SET A;  1OJH A;  4DXW A;  1VEW A;  2BTQ B;  4JI1 B;  4B3S B;  5J2U A;  3L73 H;  4J10 A;  1FFX A;  3IJ4 A;  3KCX A;  4DYL A;  2ZE8 A;  3JAS A;  1VQ6 V;  3G80 A;  5KAF Z;  4GCZ A;  2A3Q A;  1XNR O;  3ABL B;  1PPJ H;  1Z2G A;  4BWA A;  5JJJ B;  1K5Q A;  2JEU A;  1M57 B;  1R3L C;  3UQ8 A;  3J7A U;  4L8J A;  2KB1 A;  3OAA G;  1IVS A;  5LHH A;  1WLE A;  4H37 A;  5LA6 B;  3O65 A;  2WLH A;  2VS0 A;  4P9P A;  1JA8 A;  1VQO V;  2UXD B;  4K0K O;  5J9P C;  3VOU A;  3CRC A;  4TUY B;  3W7T A;  2RNB A;  2OIG A;  1YDX A;  1VQP V;  1AJN A;  1WB7 A;  5L3C A;  4JYC A;  1PD3 A;  1ROP A;  1E1Q G;  1TVK B;  2UXX A;  3JAT B;  3KCY A;  4YY3 B;  4NXN O;  1IXB A;  3JAM N;  5LOV A;  1PM9 A;  1TGO A;  1FPO A;  1FAF A;  3ZMT A;  1M1K W;  1VF6 A;  3ABT A;  4ZIB A;  3TGU H;  1GTO A;  4OX9 O;  4PDL A;  2ITC C;  4R8C A;  1JJO A;  4O2A A;  4D7T A;  3P3N A;  4JI2 B;  3A8T A;  3ZRW A;  1Y67 A;  1FFT B;  2LW1 A;  5CA0 B;  4UV9 A;  2UXN A;  3FAV B;  4NKG B;  4E4E A;  5LGU A;  3ZMV A;  3HKE A;  1M5I A;  3C3S A;  2ZR3 A;  2P4K A;  2ZM6 O;  2DQ0 A;  2Y0I A;  2YXH A;  2IU3 A;  4DR2 O;  2CTR A;  4O4J B;  3ABU A;  1H38 A;  1H2K A;  1VF7 A;  3P3P A;  1HNZ B;  3QO8 A;  4LNU B;  1XMQ O;  4RQE A;  4JI6 O;  4OXS A;  1BQ0 A;  2BSK A;  1GMG A;  5A2Q N;  5ITZ B;  1XNQ B;  3LDD A;  1J5E O;  2UXB B;  2QM8 A;  2BTO A;  5L3B A;  3CCR V;  3E8B A;  2NNU A;  2CTQ A;  1DK1 A;  1GN2 A;  1SQV H;  2P67 A;  2FL4 A;  3ZMS A;  3OEE G;  4DRX B;  4I50 B;  4Z1M G;  3A0H Z;  3BA9 A;  3ASO B;  5BY1 A;  1JCH A;  1PNK A;  3K59 A;  2E5L O;  1H2G A;  4GKK O;  1WJZ A;  3C3T A;  3DSQ A;  3LNM B;  1MZF A;  1Q6U A;  2YIA A;  1TA8 A;  3HKB B;  4TWK A;  3CRR A;  2XAH A;  2JJ1 G;  3EVK A;  4XDJ A;  4FZ0 A;  5TIS Z;  4DR5 O;  3L9D A;  2F4V O;  3CJH A;  3ZMU A;  2XHB A;  5GW7 A;  3CSX A;  4JYA B;  4JI3 O;  4X1Y A;  3QO5 A;  4PA9 A;  2QKS A;  2GV9 A;  1VQ8 V;  2UU9 O;  4DV6 O;  1O9G A;  2O57 A;  1KBH A;  4EKW A;  1XMO B;  5E1A C;  2Y4T A;  3HKC A;  2QM4 A;  3K04 A;  3OUF A;  4QGP A;  1IBK O;  3D36 C;  2VQE O;  4B3R O;  1FJG O;  1YF2 A;  4JAV A;  3X2Q B;  4LF7 B;  2YIB D;  3DC6 A;  3BRC A;  2PZS A;  1JFF B;  3E89 A;  5LHI A;  1YTF B;  5IYD O;  2V4D A;  4FLU A;  2FB5 A;  4FVM A;  4LF8 O;  2OCC B;  4MTX A;  3T1C A;  3CRM A;  3JD2 A;  4FFK A;  3SPI A;  2CGO A;  3RVY A;  3H1I H;  3RYF A;  4DO2 A;  3ZHV A;  3SJA C;  4G27 B;  4DV5 O;  5E79 Z;  3AEI A;  4B3T O;  2ZE5 A;  4CS3 A;  4DR7 O;  1NTM H;  4ICG A;  3SGI A;  1RM1 B;  4MW3 A;  3GWO A;  3TK1 A;  4YJ3 B;  1WNS A;  3OE7 G;  1N32 O;  2AZ2 A;  3H9V A;  5CA3 A;  5L3G A;  4JZ2 A;  5B1B B;  1K3E A;  2Q7H A;  3IFX A;  4PHZ A;  3EHB B;  3WB1 A;  4I0X A;  1S0V A;  3HKD A;  5KX5 A;  4H33 A;  3CCS V;  4X64 O;  3BFR A;  4FFB A;  3O9O A;  2EIM B;  3AG4 B;  5KHI A;  2X7R B;  5B1N A;  3F7V C;  5EC2 C;  3RWR D;  3ZRS A;  4HYO A;  1HWY A;  3ZCC A;  1KB9 F;  2W6J G;  4W4K A;  5IYC O;  3D36 A;  5JH7 A;  3BHP A;  5LXT A;  3SPJ A;  3WU2 Z;  2R72 A;  3RYH A;  3K58 A;  2ETN A;  5GTI Z;  1M4U A;  4WBN B;  1KMI Z;  4Q20 A;  1OCZ B;  5C8Y B;  2LQT A;  4MW8 A;  1W59 A;  4X1I A;  1SQB H;  5LMN B;  1D5A A;  3RN4 A;  5BMV A;  4Z1V A;  1ENV A;  1NR7 A;  2XAF A;  4DUZ B;  2Q9L A;  3CME V;  1FXK B;  2ZXW C;  2HVK C;  2JS5 A;  5JJN B;  2PGG A;  3WG7 B;  2G38 A;  2HFE C;  3L72 H;  1SQG A;  3M8A A;  1MSW D;  1GM7 A;  2DYS C;  1VQK V;  1IDS A;  2JS3 A;  4F6R A;  1Q81 W;  4NXM B;  3TXQ A;  4NB5 A;  1K92 A;  4XDL A;  1DF5 A;  1XQ8 A;  4JAU A;  4LWS A;  1JR9 A;  2QDO A;  1JPX A;  3H1H H;  3E8H A;  3L71 H;  4TV9 A;  4X66 B;  4U7O A;  1I08 A;  4NTX A;  2F95 B;  5EYP B;  2HJF C;  3U11 A;  4OPH A;  2EIJ B;  4FM2 A;  4IIJ A;  5BR8 O;  1XI1 A;  1BZK A;  3CXH F;  1B3Q A;  3MHH C;  1URF A;  5FNV B;  3J81 N;  4MT8 A;  4EB6 A;  3B09 A;  1KKC A;  5EBW C;  4DV3 O;  2A9H A;  3UCS C;  3TET A;  1H2L A;  1CXZ B;  4KUM A;  2Q7G A;  1M56 B;  1K33 A;  3OR7 C;  3A2F A;  3JAL A;  3ZN1 A;  5GON B;  3ZED A;  4Z2W A;  4TSF G;  3T4Z A;  1FYJ A;  5IYZ B;  1B6Q A;  3AG1 B;  3T1H O;  2C2A A;  5CBG A;  4GX1 A;  2ZIO A;  3U10 A;  2VQF B;  4TQD A;  2HR3 A;  1NKD A;  3ABM B;  2GTA A;  2QGN A;  3CPW U;  4LF4 B;  1O9H A;  4IHJ A;  3CCU V;  1B06 A;  4H44 B;  1WA8 A;  5A9G A;  3LSQ A;  1V54 B;  4MVS A;  1HDJ A;  4MTF A;  1BHB A;  5CBF A;  1IUR A;  3Q4H A;  1BSM A;  3VBB A;  1FFX B;  1AI7 A;  1G4Y B;  2EIK B;  4HBN A;  3JAS B;  5KAI Z;  1COW G;  2Y48 A;  3DXR A;  2L35 A;  5FPO A;  1OCR B;  1VQ9 V;  1SF9 A;  1N34 O;  3UT5 A;  5CMU A;  4FIP C;  4X62 O;  2Y69 B;  3OTF A;  4LFA O;  2E75 B;  1OCO B;  5H6R A;  1AI4 A;  2IW5 A;  2JDI G;  1LUV A;  4CS2 A;  2JGD A;  4JI5 B;  1N33 B;  2L6L A;  1XHZ A;  1JX9 A;  1FXH A;  1YXB A;  5B1A B;  3RYC A;  1ZTE A;  2OYQ A;  3I5D A;  4F4L A;  1YJN V;  3BCC H;  3OMA B;  4KL1 A;  1XIL A;  2XUM A;  1AR4 A;  2PF4 E;  1K34 A;  3MHS C;  1VAR A;  5LOV B;  1DLB A;  1L8D A;  1VQ5 V;  2JJ2 G;  3GWK C;  4UVC A;  3N27 A;  4O4L A;  1FXV A;  2X6C A;  1NJI W;  4O2A B;  1GM8 A;  1YHQ V;  4B3M O;  3ZRW B;  4H13 B;  4DK0 A;  3D8C A;  1NQT A;  3SYA A;  5EBL C;  1Y74 A;  3HPL C;  2CK3 G;  4KFM A;  3HKE B;  2E76 B;  1ZAU A;  4K0K B;  3F5T A;  4YHH O;  2R9I A;  4DR1 B;  3IAY A;  2QTO A;  3K57 A;  3MDS A;  1I5X A;  2XTA A;  5IY5 C;  4JI8 O;  3FFQ A;  1S5L Z;  1QLE B;  2RMK B;  2BSK B;  4NXN B;  1PL0 A;  3STZ C;  2XT9 A;  2QE7 G;  3OT7 A;  3S3X A;  4GX5 A;  1I0H A;  4OX9 B;  4RUE A;  2UUA O;  4LFB O;  3ABK C;  1IZ3 A;  2WLN A;  5B3S C;  1FD9 A;  1E1R G;  4IYI A;  2QR4 A;  2Q4P A;  3BPZ A;  2Z5U A;  3JD3 A;  2YI8 A;  4J42 A;  3WB0 A;  3ASN B;  5JVD A;  2OT5 A;  4JZG A;  2QA4 V;  2ODM A;  1P7G A;  2ATK C;  4NTW A;  1P4R A;  4U3J A;  3UO3 A;  5KHK A;  2ZM6 B;  4DUY O;  1Q8I A;  2VWJ A;  4DR2 B;  4K8X A;  4EFE A;  4J7K A;  4ASU G;  1TUB A;  1M93 A;  2AHY A;  1MA1 A;  4JI6 B;  1AR1 B;  3K06 A;  3E35 A;  5LMU O;  1SKV A;  2YIC A;  1J5E B;  2YIB A;  4DR6 O;  4LFC B;  1L0N H;  2Q68 A;  2Z0A A;  3CJH B;  5J2T A;  1HNW O;  4X20 A;  1OZ0 A;  5IJ0 A;  1H8E G;  2RJZ A;  4TOI A;  2Q69 A;  4J9Y B;  1GAX A;  1QVG U;  1V55 B;  1IBM O;  2DYR C;  2E5L B;  4OPA A;  4IGG A;  3HKC B;  4ZI7 A;  2DMX A;  4MVQ A;  3T1Y O;  5FL7 G;  4E2L A;  2ZDI C;  2PYJ A;  1S5J A;  4WFE A;  1ORQ C;  1IX9 A;  3ICX A;  4CH6 A;  4AQY O;  2DN9 A;  2LFS A;  4DV7 O;  3APQ A;  4DR5 B;  3LDC A;  2LP7 A;  2IH3 C;  2PI5 A;  1XRE A;  2PYL A;  2DW4 A;  4DV2 O;  2QWQ B;  4RO2 A;  4MSW C;  1VMG A;  5JQG A;  1M9N A;  2EIL B;  2GUZ A;  4DV6 B;  3I55 V;  2VRZ A;  3RYF B;  3CCV V;  4JI4 O;  3BA8 A;  4O4H A;  4I55 A;  4O4I A;  2IH1 C;  2PUS A;  3AK3 A;  3WB2 A;  1IBK B;  3KZI Z;  2VQE B;  1BCC H;  2AW9 A;  2Y4U A;  4B3R B;  5CB4 A;  3ZRV A;  2Q8V A;  1WP7 A;  1Q86 W;  2NN4 A;  2ILM A;  4I5S A;  1QVF U;  4YIP A;  4GX2 A;  5LGT A;  3OUS A;  1BGY H;  4NVP A;  1N0N A;  3SYO A;  3W7S A;  5K1X A;  4I0X B;  2DWD C;  3HKD B;  5KX5 B;  4FLV A;  1LR1 A;  4D6T H;  3CC4 V;  3AG2 B;  4ZKI A;  4LF8 B;  2F66 C;  3MD0 A;  1I7F A;  3N2K A;  3JSL A;  3QO7 A;  2X0L A;  4FFB B;  4WFB V;  4FLY A;  2WA3 A;  1NH2 B;  1MG1 A;  3E8G A;  5KUK A;  1RSO A;  4HZ3 A;  3FD9 A;  3FB5 C;  4Q6G A;  3OMI B;  4DV5 B;  5IWA O;  2UUB O;  4B3T B;  2UUC O;  3ETQ A;  3ZRX A;  4DK1 A;  5LXT B;  4DV1 O;  1ZWI C;  2ZE6 A;  2BOC C;  1PL4 A;  3RYH B;  3E22 A;  5KUM A;  4CH5 A;  4DW1 A;  1N32 B;  1JOY A;  1CP9 A;  3CCM V;  4FPP A;  1ZSP A;  1HP8 A;  2Q6A A;  4GKJ O;  3RVZ A;  1YSC A;  3QG5 A;  4LF6 O;  2UXD O;  5L3D A;  3SJQ C;  1XOU A;  4X1I B;  1XHX A;  1N36 B;  4PJ0 Z;  2LGW A;  1Y6X A;  3CB2 A;  3OW2 U;  4X64 B;  5BMV B;  1Q7Y W;  3CE2 A;  3CC7 V;  4JI7 O;  2Z3Y A;  2WWW A;  3KKY A;  2M7W A;  2IM9 A;  2HLD G;  1SER A;  4YY3 O;  1EN6 A;  1LUW A;  4UCR A;  2DOS A;  2D2C B;  1YIT V;  4H0L B;  1VQM V;  2Y0P A;  2OWO A;  5EK0 A;  3I56 V;  4FLW A;  1G1X B;  3W7X A;  4F6R B;  1PNL A;  2LJ2 A;  2HHH O;  1D2D A;  4LWS B;  2QWP B;  3QVN A;  5LP6 C;  1ZL8 A;  4UVB A;  1NVP B;  4TV9 B;  4KHP B;  1EZJ A;  1NU1 H;  2MK3 A;  2QJ1 A;  3CYO A;  3VQW A;  3QNE A;  1AP6 A;  1NI8 A;  2CTP A;  1HNX O;  4IIJ B;  3F7Y C;  1IBL O;  2ADQ B;  3ZHQ A;  2OTJ V;  2KSD A;  1G8M A;  1GO3 F;  4L87 A;  3B4S A;  1K8A W;  1KP3 A;  4I4T B;  4EB6 B;  3OFN G;  2W0X A;  4YJ2 B;  2XND G;  3G6B A;  1HW7 A;  3BY6 A;  3G4S V;  2ADP A;  3OTO O;  1SQX H;  1K4D C;  1V9P A;  1XNQ O;  1YCI A;  5BZB A;  3JAL B;  4UB8 Z;  1CPY A;  4MVU A;  3K79 A;  3JAK A;  1QCE A;  1US6 A;  4NYK A;  1YI2 V;  2Q7E A;  1QNM A;  4TQF A;  2CE4 A;  4CS4 A;  3CRA A;  4IHJ B;  5JCO C;  3W7U A;  2IU0 A;  3UKM A;  4JTC B;  5KHG A;  4UV8 A;  3Q4H B;  4O2B A;  4LNU A;  2CH7 A;  2LO1 A;  2CUG A;  3ZHU A;  4DV3 B;  3G67 A;  4BIO A;  4RQF A;  1SZX A;  1H2S B;  2DYS B;  2F93 B;  4QIW F;  1DF4 A;  3SJC C;  1QHT A;  3DXR B;  2XAS A;  4LP8 A;  3AG3 B;  2WLK A;  4F6E A;  3ZMZ A;  4GX0 A;  2OCH A;  2P90 A;  4PDR A;  3SDL A;  1RFY A;  3UT5 B;  5LP6 A;  1BQZ A;  3P30 A;  1FKA O;  4MVO A;  4UB6 Z;  4DRX A;  4UUJ C;  3LUT B;  4KP4 A;  1OCC C;  2W0F C;  2PI4 A;  3M7M X;  1R6N A;  2JGD B;  5AG2 A;  2ZIM A;  1WPB A;  3G71 V;  1YJW V;  4DV0 O;  5EC1 C;  2F23 A;  3JD1 A;  1YVW A;  3STL C;  3RYC B;  2EIN B;  4RUF A;  1RM1 C;  1DGS A;  3D3I A;  3JAW A;  5H9C A;  4FMT A;  4OGQ B;  5GTH Z;  4CZZ A;  3LNN A;  1Q3E A;  3CCL V;  4X65 O;  1N34 B;  4R6Z A;  4O4L B;  4HNA A;  1GN6 A;  2WLJ A;  4UCS A;  1EM1 A;  4LFA B;  2E74 B;  1N8R W;  1GK9 A;  1MMM A;  1QBZ A;  5B66 Z;  1Y74 B;  2RQ6 A;  5D5P A;  2D3O W;  3AK2 A;  5IDJ A;  3CCE V;  4PA3 A;  2EBO A;  3M99 B;  4QNH B;  3RFR A;  4MS2 A;  1SA0 A;  2P7T C;  3SYC A;  1JJ2 U;  2IJH A;  4PA4 A;  1Z5W A;  1AB3 A;  1JQ0 A;  4BIZ A;  1OCZ C;  4FLX A;  2HG5 C;  4K8Z A;  1Y66 A;  3B40 A;  2V1D A;  2IBZ H;  4R7C A;  1VQ4 V;  4MTO A;  1KC8 W;  4KXR A;  3SPC A;  1X4T A;  3H1J H;  3R66 A;  1G6U A;  1OV9 A;  1ARO P;  3A0B Z;  5CN0 A;  4TV8 A;  4TT3 G;  4B3M B;  5EZY A;  4AI8 A;  3B8N A;  3CCQ V;  4LR3 A;  1Q6H A;  1GM9 A;  3RBZ A;  5JVD B;  3H01 A;  4JGS A;  3WG7 C;  3JAR A;  4U3J B;  1R6T A;  2QKA A;  1HR0 O;  4BIU A;  1H8H G;  2YSU B;  1RPO A;  3W7W A;  1TUB B;  2B1I A;  5J2U B;  1PNM A;  4CC6 A;  3HR0 A;  3QF7 A;  4J11 A;  1R3I C;  1BHA A;  1ZLZ A;  4K35 A;  4X88 A;  3GVM A;  2HJD A;  4GYC B;  3CWB H;  3OEH G;  2EZP A;  4DR3 O;  4DR4 O;  1NBM G;  1VIB A;  3K0G A;  5CA1 A;  4MVZ A;  5EIB D;  1YEW A;  2WLL A;  5J2T B;  2EJR A;  1TUE B;  2UUA B;  1JMK C;  4LFB B;  1EN4 A;  4X20 B;  1T5E A;  5IJ0 B;  4JAA A;  1S3J A;  3CEI A;  1BMF G;  1F51 A;  1NS1 A;  4D7S A;  1SQF A;  4DW0 A;  2ZNI A;  4JV5 B;  1LNQ A;  2GSM B;  3E83 A;  4ZI7 B;  4FLZ A;  1EN5 A;  3EFF K;  4WFA V;  4FM0 A;  3KG2 A;  1YZB A;  3N2G A;  4WF9 V;  1Q6I A;  2DJV A;  2KQX A;  1WB8 A;  3SYP A;  1AI6 A;  2EJ7 A;  4UVA A;  3PN1 A;  2DE0 X;  3CRQ A;  5IT9 N;  2DWE C;  3B77 A;  1XBL A;  3OGI B;  4U7N A;  3RW0 A;  2XAJ A;  3K5L A;  2JVD A;  1XNR B;  1JVM A;  2GDS A;  1UFI A;  3AK1 A;  2XAG A;  4JI0 O;  2IJJ A;  1GN3 A;  1F4M A;  3S3W A;  1YJ9 V;  2HP8 A;  2K9P A;  5IJ9 A;  4B7K A;  5JQG B;  1NTK H;  4YIO A;  3K08 A;  2R70 A;  2GUZ B;  1R6K A;  2EIK C;  2ZT9 B;  2GHY A;  2IJI A;  4I9Q A;  4O4H B;  1J95 A;  4I55 B;  4O4I B;  1XL6 A;  3T1Y B;  1P84 F;  2QWN B;  5CB4 B;  2F43 G;  4AQY B;  2Y69 C;  1XDC A;  4MVM A;  4PDV A;  1OCO C;  4X8A A;  1AJP A;  4DV7 B;  4G28 B;  4WFG A;  3H1L H;  5LGN A;  2DQ3 A;  4JAS A;  1AP5 A;  4XBF A;  5DEC A;  5DM6 V;  4DV2 B;  1R3K C;  3RYI A;  3ZBH A;  3N2K B;  5B1A C;  3THO A;  4LF9 O;  4J9Z B;  1W2B U;  4RWU A;  2YUA A;  3PJS K;  4DV4 O;  4LF5 O;  1RSO B;  1KP2 A;  2Q0A A;  2AGA A;  1VF6 C;  2KG7 A;  2N04 A;  3E22 B;  5KHJ A;  1KD1 W;  4UCT A;  4A5U B;  4UCU A;  1XMQ B;  1K97 A;  5LYJ A;  2ZR2 A;  1MOF A;  4GUN A;  3K9A A;  3FX7 A;  2YXL A;  1I94 O;  5B1O A;  2CAZ C;  4PD4 F;  1TAE A;  4X1Y B;  1K73 W;  3CHX A;  2Q5Z A;  4NR1 A;  2YDE A;  1QLE C;  3CP1 A;  4RAI A;  1UJW B;  5H5N A;  2B9Z A;  3VQY A;  5IWA B;  2UUB B;  5L3F A;  2UUC B;  4GKK B;  4ZOL A;  4DV1 B;  4UFZ A;  1K7D A;  2QKC A;  5KA5 A;  3EXA A;  2XOK G;  1S77 D;  3ZHR A;  1ZL8 B;  1PV0 A;  2H3O A;  1U97 A;  4GKJ B;  1S5H C;  2FKX A;  2ZCE A;  5F2V O;  3ASN C;  5KA6 A;  2F4V B;  4LF6 B;  2M6Y A;  2E3C A;  5FLX N;  3OM3 B;  1D5N A;  4J7J A;  4DR1 O;  1ZUQ A;  4GLX A;  4JI7 B;  4JI3 B;  3K0D A;  1W0K G;  2HVJ C;  4LH6 A;  2UU9 B;  1UPG A;  2CGN A;  1Q43 A;  2WLI A;  3NR7 A;  2QEX V;  3OR6 C;  1AIL A;  4UXN A;  2YEV A;  3HB3 B;  3GB7 C;  3ABL C;  3JYC A;  3UM7 A;  1FJG B;  4PI2 A;  2EUL A;  4WFH A;  1M57 C;  3CC2 V;  2HHH B;  1Y76 A;  4LH7 A;  5KMG A;  3JAK B;  2N05 A;  3T2M A;  3F5W C;  4ZHQ A;  3K5M A;  4ZBM A;  3FYI B;  3RT3 C;  4BR6 A;  1SQQ H;  1S76 D;  3K5N A;  2WSS G;  4C7U A;  3C90 A;  5JWP A;  3TCU A;  2LFR A;  3FB6 C;  4LC1 A;  1V55 C;  1NR1 A;  1HNX B;  2UXC O;  1WPX A;  1IBL B;  1H2M A;  1YIJ V;  4JI1 O;  4B3S O;  4O2B B;  2CH7 B;  4BW9 A;  1KQS U;  3OGC C;  4WCE V;  2ZQM A;  4PV1 B;  4X89 A;  4I7Z B;  4UCV A;  3OTO B;  2JIZ G;  3BAB A;  2YI9 A;  4IT5 A;  4DR7 B;  4LFC O;  4ABM A;  4K3A A;  1GN4 A;  5JH7 B;  3SPG A;  1DTO A;  2ZNJ A;  2YXY A;  2ZDI A;  3VQV A;  5C93 A;  4N23 A;  1ZX3 A;  5LP6 B;  5H6Q A;  2VWK A;  3IC7 A;  4LCU C;  3JD0 A;  4X1K A;  2EIL C;  2GBO A;  4PA6 A;  5K1P A;  5EIB C;  1GKF A;  1WN7 A;  4JPR A;  2XAQ A;  3WFV A;  1P49 A;  2BTQ A;  2QTS A;  3JCZ A;  2Q67 A;  3JAW B;  5L3E A;  2JEX A;  2FML A;  2OIE A;  3SPH A;  4CH4 A;  2FTK A;  5CBH A;  3CX5 F;  4HNA B;  2LW7 A;  3DTU B;  1AJQ A;  1Z5V A;  3AG2 C;  1KUQ A;  4JI2 O;  3A0R A;  3SYQ A;  1F4N A;  1R73 A;  5LA6 A;  4I9W A;  2BE3 A;  2P5O A;  1WAZ A;  3ASO C;  1SS3 A;  3LSU A;  1THZ A;  4DV0 B;  4NTY A;  4W4L A;  3FYE B;  3K03 A;  4TUY A;  1XL4 A;  2N74 A;  1A32 A;  3K5O A;  1SA0 B;  4EFB A;  1HNZ O;  4U3F H;  1GRJ A;  2ITD C;  1TVK A;  5FPR A;  3JAT A;  3ZN0 A;  4JYY A;  4X65 B;  2P22 C;  5IE9 A;  2UXB O;  2QSA A;  1B04 A;  1KU9 A;  1KKD A;  4X9Q A;  3L70 H;  2AZ0 A;  4TV8 B;  3SJB C;  4R50 A;  2FYU H;  5EZY B;  3K3W A;  4MTG A;  4PDM A;  1X59 A;  2R9A A;  5CA0 A;  2B1G A;  1NT2 B;  3R65 A;  3B2E E;  1OCC B;  3FAV A;  1MSD A;  1CEZ A;  2WPD G;  2KKW A;  3ETG A;  3JAR B;  4PA7 A;  5BR8 B;  1N0J A;  1WA8 B;  4O4J A;  2PY5 A;  2ARH A;  4AHC A;  2YID A;  2RDC A;  2MW2 B;  2QM7 A;  3BAA A;  2ZXW B;  3X2Q C;  4PI0 A;  2QWO B;  1BL8 A;  5ITZ A;  3LDE A;  2HKO A;  1L1F A;  1N36 O;  5CA1 B;  1F23 A;  1U96 A;  2WLL B;  2WLM A;  4CH3 A;  4AIL C;  4JYA O;  1QU7 A;  1K5S A;  1MNG A;  1FS0 G;  3G6E V;  3MAQ A;  3ZIA G;  2OCC C;  3T1H B;  1OHH G;  4I50 A;  1P7B A;  3ETD A;  2A7W A;  1XMO O;  3H1K H;  1QR8 A;  1IXM A;  1HR0 B;  4IL6 Z;  3HKB A;  4JTD B;  4UCO A;  1VQ7 V;  4XDK A;  1SES A;  3N2G B;  4LF7 O;  3ZX6 A;  4B7E A;  1AVM A;  4KHP O;  2A06 H;  3DGE A;  3CMA V;  3ZHS A;  1N4C A;  1EFR G;  5B1B C;  1Q5O A;  1K9M W;  4QE9 A;  4DR3 B;  4DR4 B;  2AHZ A;  1F7Y A;  4FK5 C;  2ZKO A;  2IJK A;  4QPJ A;  1SRY A;  1NTZ H;  4N21 A;  3JCU Z;  4X62 B;  2QWR B;  5IJ9 B;  1H2N A;  2Q73 A;  2X6B A;  3FKS G;  2F1M A;  2LGQ A;  2EIM C;  3AG4 C;  1AR5 A;  3E86 A;  3TJT A;  3CD6 V;  5JCO A;  3OMN B;  2JGU A;  3U0Z A;  2V7Q G;  2P4V A;  5LL6 Y;  3AG3 C;  1R1B A;  3RGB A;  3ZS8 C;  5JJE B;  3UO2 A;  3B8M A;  4BAY A;  3ML0 A;  2GTS A;  3J80 N;  1JFF A;  1XEQ A;  1RP3 B;  1KEC A;  3K9S A;  1QLN A;  4GT1 A;  1VF5 B;  3FB7 C;  3CCJ V;  3BEH A;  5LBQ A;  4J7Z A;  5H2F Z;  4MVR A;  3CXC U;  5IYB O;  3JD4 A;  4FLT A;  4JI0 B;  2R9R B;  3RYI B;  2WA4 A;  4I4T A;  1WP8 A;  4YJ2 A;  2OTL V;  2P6J A;  1QQC A;  2EIN C;  2PTM A;  4HAM A;  1S72 V;  3DC5 A;  4P2Z A;  1W0J G;  1PP9 H;  4LBE C;  1FXK C;  2HEP A;  3SR2 C;  2EZO A;  2K1E A;  1M90 W;  4YHH B;  2H94 A;  5KHH A;  1VP7 A;  4QPK A;  2B5U A;  2A0L A;  2KG7 B;  3QTC A;  4YJ3 A;  5DN6 G;  4JI8 B;  3IGA C;  3AG7 A;  2ZE7 A;  4G2K A;  5B5E Z;  5LYJ B;  4P30 A;  1PKX A;  1VQL V;  2RCV A;  2EIJ C;  4CBC A;  4PEL A;  2YS8 A;  5LMN O;  1I5Y A;  4LF9 B;  4WFF A;  3BVO A;  5D5Q A;  1BS3 A;  5HFL A;  4DUZ O;  3ETE A;  1VQN V;  4DV4 B;  4LF5 B;  4FM1 A;  3LSS A;  3CS5 A;  1KYO F;  4DUY B;  4ZOL B;  1M56 C;  2W6I G;  2JK5 C;  3FB8 C;  4B08 A;  4NXM O;  5IY5 B;  4JF3 A;  5DED A;  4WBN A;  5LMU B;  4X66 O;  5EBM C;  1AI5 A;  5C8Y A;  3AG1 C;  1MZE A;  3E8F A;  3T4D A;  1NH2 D;  3JSN A;  4DR6 B;  2CDY A;  3ABM C;  1RPR A;  2EX3 A;  1I94 B;  1HNW B;  3ABK B;  1V54 C;  2ZD9 A;  5B3S B;  2CTW A;  4EEQ A;  2AXT Z;  2RN9 A;  3L75 H;  1FXK A;  2BOB C;  3VQX A;  2WLI B;  1IBM B;  1Q82 W;  3P32 A;  4GZR B;  1XUQ A;  3APO A;  2A79 B;  2Q0O C;  5LHG A;  2YEV B;  3IC9 A;  1OCR C;  3TXS A;  1MAB G;  2X6A A;  3OD4 A;  1Y76 B;  5KMG B;  1BE3 H;  4FZ1 A;  1EBO A;  2YC0 A;  4ZHQ B;  2VQF O;  5EYP A;  1GH6 A;  2NLJ C;  4J41 A;  1SC5 B;  1SZT A;  1L0L H;  4LF4 O;  2BCC H;  2H8P C;  1K4C C;  4QE7 A;  2NR5 A;  5FNV A;  2WAM A;  5HFM A;  1BT8 A;  4JTA B;  4YXW G;  5BXZ A;  4QJF B;  1SQP H;  3D3Q A;  5KLV H; 
#chains in the Genus database with same CATH homology
 2DYR B;  1YIJ V;  1Y4M A;  4BW5 A;  4JYB A;  4TSF G;  3T4Z A;  1B6Q A;  3AG1 B;  1NVP D;  3ZJZ A;  1KQS U;  3W7U A;  2IU0 A;  2C2A A;  3OGC C;  3UKM A;  5CBG A;  4GX1 A;  4JTC B;  4WCE V;  2ZQM A;  4X89 A;  4P9O A;  2HR3 A;  1QR9 A;  1E79 G;  1NKD A;  2JIZ G;  4UV8 A;  3ABM B;  3CPW U;  1YTF D;  3CCU V;  1R3J C;  3E2E A;  3LSQ A;  4FJC C;  3SPG A;  1DTO A;  1V54 B;  4MVS A;  2ZDI A;  4MTF A;  5C93 A;  1BHB A;  5CBF A;  4N23 A;  4RQF A;  4QIW F;  3VBB A;  2DYS B;  3NXS A;  1DF4 A;  1AI7 A;  1G4Y B;  5H6Q A;  2XAS A;  2EIK B;  3IC7 A;  4LCU C;  4LP8 A;  3AG3 B;  2WLK A;  3JD0 A;  1SET A;  3ZMZ A;  4DXW A;  4GX0 A;  1COW G;  2EIL C;  2P90 A;  4PDR A;  4PA6 A;  3P30 A;  4MVO A;  1GKF A;  2Y48 A;  4JPR A;  1OCR B;  1VQ9 V;  2XAQ A;  1VQ6 V;  4UUJ C;  3WFV A;  3LUT B;  4KP4 A;  5CMU A;  4FIP C;  2Y69 B;  1OCC C;  2W0F C;  4GCZ A;  2PI4 A;  1R6N A;  3JCZ A;  1OCO B;  3ABL B;  2Q67 A;  5H6R A;  3G71 V;  1AI4 A;  1K5Q A;  2IW5 A;  2JEU A;  1YJW V;  1M57 B;  2JDI G;  1R3L C;  5EC1 C;  3JD1 A;  2KB1 A;  5L3E A;  3STL C;  2EIN B;  2JEX A;  3OAA G;  4RUF A;  1RM1 C;  3SPH A;  5LHH A;  1WLE A;  3D3I A;  4H37 A;  2FTK A;  5H9C A;  4FMT A;  1JX9 A;  1FXH A;  5CBH A;  4CZZ A;  3DTU B;  5B1A B;  2WLH A;  1AJQ A;  3AG2 C;  4P9P A;  3CCL V;  1VQO V;  3A0R A;  4F4L A;  1YJN V;  3SYQ A;  3OMA B;  1F4N A;  1R73 A;  4R6Z A;  5J9P C;  4I9W A;  3VOU A;  2WLJ A;  1K34 A;  3MHS C;  3W7T A;  1N8R W;  1DLB A;  1VQ5 V;  3ASO C;  1THZ A;  2JJ2 G;  1VQP V;  4UVC A;  1GK9 A;  1AJN A;  5L3C A;  4JYC A;  1PD3 A;  1ROP A;  1E1Q G;  1QBZ A;  2UXX A;  1FXV A;  2X6C A;  3FYE B;  3K03 A;  1XL4 A;  2D3O W;  1NJI W;  1GM8 A;  3ZMT A;  1YHQ V;  5IDJ A;  3CCE V;  1M1K W;  3ZRW B;  3ABT A;  4PA3 A;  2EBO A;  1NQT A;  2ITD C;  3SYA A;  1GTO A;  3M99 B;  5EBL C;  4PDL A;  3ZN0 A;  4QNH B;  3HPL C;  2ITC C;  4R8C A;  4MS2 A;  2CK3 G;  4KFM A;  2P7T C;  3SYC A;  3ZRW A;  1JJ2 U;  2IJH A;  1FFT B;  4UV9 A;  4PA4 A;  1KKD A;  2UXN A;  1JQ0 A;  4BIZ A;  2R9I A;  1OCZ C;  2QTO A;  5LGU A;  2HG5 C;  1Y66 A;  3ZMV A;  1I5X A;  2V1D A;  4R50 A;  4R7C A;  5IY5 C;  1VQ4 V;  4MTO A;  1KC8 W;  3K3W A;  4MTG A;  2ZR3 A;  4PDM A;  1QLE B;  2DQ0 A;  2B1G A;  3SPC A;  3R65 A;  1OCC B;  2IU3 A;  1PL0 A;  3STZ C;  1ARO P;  1CEZ A;  2QE7 G;  3ABU A;  5CN0 A;  1H38 A;  4TT3 G;  2WPD G;  3QO8 A;  3B8N A;  3ETG A;  4PA7 A;  4RQE A;  3CCQ V;  4GX5 A;  4OXS A;  1GM9 A;  1GMG A;  4RUE A;  3RBZ A;  3H01 A;  4JGS A;  2QM7 A;  3ABK C;  2WLN A;  3LDD A;  3WG7 C;  5B3S C;  1E1R G;  2ZXW B;  3X2Q C;  2QM8 A;  2Z5U A;  1BL8 A;  3JD3 A;  5L3B A;  3CCR V;  3ASN B;  4BIU A;  1H8H G;  3E8B A;  2NNU A;  2YSU B;  2OT5 A;  3LDE A;  1RPO A;  2HKO A;  2QA4 V;  3W7W A;  2B1I A;  2ATK C;  1L1F A;  1PNM A;  1P4R A;  2P67 A;  3ZMS A;  3OEE G;  4Z1M G;  1F23 A;  2WLL B;  2WLM A;  1R3I C;  4ASU G;  1BHA A;  3ASO B;  1K5S A;  1JCH A;  4X88 A;  1PNK A;  1FS0 G;  3G6E V;  3ZIA G;  2AHY A;  1H2G A;  2OCC C;  3OEH G;  2EZP A;  1AR1 B;  1NBM G;  3K06 A;  1OHH G;  3K0G A;  3E35 A;  4MVZ A;  1P7B A;  3LNM B;  2WLL A;  3ETD A;  2EJR A;  1TUE B;  1QR8 A;  4TWK A;  1IXM A;  1S3J A;  2XAH A;  2JJ1 G;  1BMF G;  1F51 A;  2Q68 A;  4XDJ A;  4JTD B;  1VQ7 V;  1OZ0 A;  4XDK A;  1SES A;  1LNQ A;  2GSM B;  3E83 A;  1H8E G;  3ZMU A;  5GW7 A;  3EFF K;  4WFA V;  3DGE A;  2Q69 A;  3CMA V;  4J9Y B;  1EFR G;  1QVG U;  1V55 B;  3KG2 A;  2DYR C;  5B1B C;  3QO5 A;  4WF9 V;  1K9M W;  4PA9 A;  2QKS A;  4QE9 A;  3SYP A;  2AHZ A;  1AI6 A;  1VQ8 V;  4FK5 C;  4MVQ A;  4UVA A;  2IJK A;  4QPJ A;  1SRY A;  2DWE C;  3B77 A;  5FL7 G;  4U7N A;  3RW0 A;  4N21 A;  4EKW A;  4E2L A;  2XAJ A;  2ZDI C;  5E1A C;  4WFE A;  1ORQ C;  1JVM A;  2X6B A;  3FKS G;  3K04 A;  3OUF A;  2EIM C;  2XAG A;  3AG4 C;  3E86 A;  3CD6 V;  2LFS A;  2IJJ A;  1F4M A;  1YJ9 V;  3LDC A;  2LP7 A;  3OMN B;  2IH3 C;  4JAV A;  3X2Q B;  2PI5 A;  3K08 A;  2V7Q G;  2DW4 A;  1R6K A;  2EIK C;  3AG3 C;  3E89 A;  4RO2 A;  2GHY A;  2IJI A;  5LHI A;  4MSW C;  1J95 A;  1YTF B;  3B8M A;  5IYD O;  1M9N A;  4BAY A;  3ML0 A;  2EIL B;  1XL6 A;  3I55 V;  3CCV V;  1KEC A;  1QLN A;  2OCC B;  4GT1 A;  3FB7 C;  4MTX A;  3T1C A;  2F43 G;  3JD2 A;  3SPI A;  3BEH A;  3CCJ V;  5LBQ A;  2Y69 C;  4MVR A;  4PDV A;  2IH1 C;  4MVM A;  3RVY A;  3CXC U;  1OCO C;  5IYB O;  3JD4 A;  4X8A A;  4DO2 A;  2R9R B;  1AJP A;  4G28 B;  3ZRV A;  4WFG A;  2OTL V;  2P6J A;  4G27 B;  5LGN A;  1Q86 W;  2DQ3 A;  2EIN C;  3AEI A;  4JAS A;  4HAM A;  4XBF A;  1S72 V;  4I5S A;  1QVF U;  5DM6 V;  5LGT A;  4GX2 A;  4P2Z A;  3OUS A;  1W0J G;  4LBE C;  1R3K C;  1RM1 B;  4MW3 A;  1FXK C;  3GWO A;  3SYO A;  2EZO A;  3TK1 A;  3W7S A;  2K1E A;  5B1A C;  1M90 W;  3OE7 G;  4J9Z B;  2DWD C;  5CA3 A;  1W2B U;  5L3G A;  3PJS K;  3CC4 V;  2H94 A;  3AG2 B;  4ZKI A;  4QPK A;  5B1B B;  2B5U A;  1K3E A;  1KP2 A;  2A0L A;  3IFX A;  3MD0 A;  3EHB B;  3QO7 A;  4WFB V;  2X0L A;  5DN6 G;  1S0V A;  1NH2 B;  4H33 A;  3IGA C;  1MG1 A;  4G2K A;  3E8G A;  3CCS V;  4P30 A;  5KUK A;  4HZ3 A;  3FB5 C;  1PKX A;  3OMI B;  1VQL V;  1KD1 W;  2EIM B;  3AG4 B;  1K97 A;  3ZRX A;  2X7R B;  5B1N A;  3F7V C;  5EC2 C;  2EIJ C;  1ZWI C;  2ZR2 A;  3ZRS A;  4CBC A;  4PEL A;  2BOC C;  1MOF A;  4HYO A;  5KUM A;  1HWY A;  3K9A A;  1I5Y A;  3ZCC A;  2W6J G;  4WFF A;  5IYC O;  3D36 A;  1JOY A;  1CP9 A;  3CCM V;  4FPP A;  5HFL A;  2Q6A A;  3ETE A;  1VQN V;  3SPJ A;  3LSS A;  5B1O A;  3RVZ A;  1YSC A;  1K73 W;  5L3D A;  1M56 C;  4Q20 A;  2W6I G;  3SJQ C;  2JK5 C;  1OCZ B;  3FB8 C;  1QLE C;  3CP1 A;  4RAI A;  4MW8 A;  1UJW B;  3OW2 U;  5IY5 B;  1Q7Y W;  4JF3 A;  5L3F A;  3CC7 V;  2Z3Y A;  2WWW A;  2M7W A;  5EBM C;  1AI5 A;  3AG1 C;  2HLD G;  1SER A;  1K7D A;  3E8F A;  5KA5 A;  3T4D A;  1ENV A;  1NR7 A;  1NH2 D;  2XOK G;  1YIT V;  1S77 D;  1VQM V;  2XAF A;  3ABM C;  5EK0 A;  3I56 V;  1RPR A;  3CME V;  1FXK B;  2ZXW C;  2HVK C;  1S5H C;  3W7X A;  3ABK B;  1PNL A;  3WG7 B;  1V54 C;  2ZD9 A;  5B3S B;  2HFE C;  3ASN C;  5KA6 A;  1MSW D;  1GM7 A;  2DYS C;  4UVB A;  1NVP B;  1FXK A;  2BOB C;  3OM3 B;  1EZJ A;  2MK3 A;  1VQK V;  1Q81 W;  3CYO A;  2WLI B;  1K92 A;  4XDL A;  1DF5 A;  4JAU A;  1Q82 W;  3QNE A;  3P32 A;  3K0D A;  1W0K G;  1JPX A;  2A79 B;  2HVJ C;  3E8H A;  5LHG A;  2YEV B;  3F7Y C;  4U7O A;  1OCR C;  2OTJ V;  1G8M A;  2WLI A;  1MAB G;  2X6A A;  1GO3 F;  4L87 A;  2HJF C;  1K8A W;  1KP3 A;  3OFN G;  1EBO A;  2QEX V;  3OR6 C;  2EIJ B;  2XND G;  4UXN A;  2YEV A;  3BY6 A;  3GB7 C;  3HB3 B;  3G4S V;  3ABL C;  3MHH C;  3JYC A;  3UM7 A;  4WFH A;  1M57 C;  3CC2 V;  2NLJ C;  4MT8 A;  1K4D C;  1SZT A;  5BZB A;  3T2M A;  2H8P C;  3F5W C;  4ZBM A;  1K4C C;  3FYI B;  5EBW C;  4QE7 A;  1S76 D;  2A9H A;  2WSS G;  1CPY A;  3TET A;  4MVU A;  3K79 A;  4KUM A;  3TCU A;  2LFR A;  2WAM A;  1M56 B;  3FB6 C;  4LC1 A;  5HFM A;  1QCE A;  1YI2 V;  1K33 A;  1V55 C;  1NR1 A;  3OR7 C;  4JTA B;  4YXW G;  3ZN1 A;  4QJF B;  1WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...