3ZRVA

The high resolution structure of a dimeric hamp-dhp fusion displays asymmetry - a291f mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
108
structure length
108
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 46
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrvA00
4Q20A 1F51A 4MT8A 3ZCCA 5B1OA 3ZRVA 2FTKA 2C2AA 3ZRWB 3P32A 2LFSA 5IDJA 2P67A 4KP4A 3TK1A 4GCZA 3ZRXA 4BIZA 4FPPA 1IXMA 3D36A 3A0RA 4JAUA 2WWWA 4JYCA 4MTXA 4U7OA 5B1NA 3NXSA 2LFRA 4FMTA 4JAVA 4QPKA 3ZRWA 4JASA 2QM7A 3MD0A 4JYBA 4QPJA 4ZKIA 1JOYA 4LC1A 3DGEA 4GT1A 5C93A 2QM8A 4U7NA 4BIUA 4I5SA
chains in the Genus database with same CATH superfamily
1WJZA 5D5PA 4YJ2A 2EIKB 3SJBC 1MMMA 4TT3G 4NYKA 4WFAV 5FPRA 4H0LB 1AB3A 3L71H 2XHBA 3J7AU 4UCTA 1BSMA 3A0BZ 5LHIA 1O9GA 4LFCO 3RYCB 5B1BB 1OCOC 3SGIA 1IBMB 1Y76A 3DC5A 5IYDO 2ZDIA 2VQFB 1I7FA 2EILB 4UCUA 1NR1A 2HJFC 5KA6A 1KECA 1CEZA 4X1KA 5DECA 1H2NA 1P7BA 1Y74A 4WBNB 1VQLV 1SQFA 1TVKA 2Y69C 2VWJA 4PA4A 1E79G 1S5HC 4H33A 2QKAA 4MSWC 1FKAO 4I50A 2IJJA 2F43G 5B1OA 2X6CA 3ZMTA 1FXKC 2E75B 4FVMA 4JYAB 4FLYA 4KHPB 2UXBB 2JJ1G 2ZQMA 1B04A 1G1XB 4KL1A 3SYQA 5LP6C 2ZE8A 3RN4A 2QA4V 1GM9A 2QDOA 1HNXO 5LMUO 1XOUA 2BE3A 4BIUA 3SYCA 2LW7A 3CCUV 1K33A 3O65A 3L9DA 2CTQA 4GYCB 2IH1C 2EIKC 1E1RG 1UFIA 4GX0A 4AQYO 2F66C 1QBZA 2EJRA 3JARB 3LSSA 4YJ3A 4L8JA 2HKOA 4ZOLB 2ZR2A 4TV8B 1K4DC 2V7QG 4ZHQB 2BOBC 1MSWD 3CCRV 4FFKA 3I5DA 2JGDA 5B1BC 1RPOA 3K5LA 1ORQC 1NU1H 2M6YA 4GLXA 2UXCB 3CXHF 4BAYA 4DK0A 5KMGB 1ZTEA 4MVOA 2W6JG 5BY1A 3JSLA 3SYAA 2F4VO 1RFYA 1ENVA 3FX7A 4JV5B 4I55A 2QWQB 5CN0A 3HKCB 2L6LA 4X1IA 4PI2A 2F93B 4J42A 5IY5B 2QJ1A 4ASUG 1WB8A 1URFA 2BSKA 1VIBA 2JEUA 4MVUA 3ICXA 2RDCA 3QVNA 1HW7A 2X7RB 2DQ0A 2Q8VA 2Z3YA 4I0XB 5EYPA 3OGIB 4O4IA 3E8FA 1AR4A 3ABUA 5LGUA 1QU7A 2ADPA 2D2CB 1SQXH 4MTOA 4X62B 1FXVA 5B3SC 2GTAA 4LFBO 4YXWG 5JWPA 4LF4B 1YXBA 3IC7A 5IYZA 3JD3A 3ZHTA 1GM7A 4MT8A 3OTOB 4BIOA 5CA1A 4JI6O 4UB8Z 2WA3A 1NTZH 3ZHQA 1QHTA 2UU9B 3W7UA 2WWWA 4DV6B 1K92A 4JAVA 3J80N 4DK1A 4CH6A 3CRCA 4R8CA 4D7TA 1W59A 2EIMC 3CPWU 3OMIB 3AG7A 1XQ8A 2UXDO 3B8NA 2XTAA 2KG7A 2C2AA 1N4CA 1K9MW 2WLLB 2E5LO 3CC4V 3SJQC 4DR2B 4XDJA 3D36A 4P2ZA 3GVMA 1QCEA 3JALA 3ETEA 4IYIA 1VF5B 1AI7A 1JVMA 2VRZA 3CYOA 5LMNB 5IY5C 4DR3B 1JFFA 5C8YA 1IBKO 3L70H 2R72A 1F4MA 2CDYA 2Q4PA 1R6KA 5KA5A 4AILC 1M56C 1YHQV 3A0HZ 1S72V 4GX5A 3WG7C 1ZUQA 1R3LC 3JAWB 2ZXWB 1XMOB 3VOUA 2JS3A 4FJCC 2UUCB 2RQ6A 4J9YB 4OPHA 2Q0OC 2PUSA 2ITCC 4W4LA 4DRXB 3JD4A 4UVCA 1ZL8B 4D7SA 1S5LZ 4X9QA 5HFMA 4B3TB 4Q6GA 3T2MA 2P22C 3A2FA 3APOA 1NVPB 1AR1B 4OXSA 4JI4O 2Q69A 5B5EZ 1YEWA 5KHGA 3SR2C 4IGGA 3CSXA 1XL4A 4B3MB 1MA1A 4ZIBA 3OW2U 2E74B 4YHHB 1LR1A 1IBMO 2QR4A 4W4KA 3KCXA 4JI2B 4JTDB 1Y6XA 4X89A 3OUFA 5CB4B 1IVSA 3T1YB 3RYHA 3ZN1A 2VQFO 1JQ0A 5A9GA 4LP8A 1Y4MA 1PNMA 3UCSC 4H13B 1NVPD 3UQ8A 4G27B 3W7XA 2P7TC 4K3AA 5C93A 1NS1A 5KHKA 3BFRA 1DF5A 3RBZA 3EVKA 3BRCA 2CUGA 1Q86W 3UT5B 1BS3A 4MVSA 3HKEA 3ABLB 3CHXA 4BIZA 3FYIB 1IZ3A 4DW1A 4TWKA 1R1BA 3RWRD 4JYAO 4KHPO 5LYJB 3E8GA 2Q7EA 4GKJO 2NN4A 1VQ8V 4RO2A 2WSSG 2YEVB 4JZGA 3W7TA 1N34O 1QNMA 1N8RW 1RP3B 4MVRA 2P4KA 3C3TA 3R65A 4X65O 3OD4A 1P84F 3OMAB 1VF7A 2JRIA 1SESA 3GWKC 4DV2B 1HNXB 4WF9V 2BCCH 1LUVA 3CJHA 3JAMN 1BQ0A 1K5SA 1WLEA 1IX9A 2WLIB 4HNAA 1KBHA 3QNEA 3BA9A 4U3JA 3EFFK 4QIWF 1KKCA 4AQYB 4LH7A 1CXZB 1HP8A 1VQ4V 1SKVA 4UVAA 3RVYA 3ZBHA 2OYQA 1Q6HA 4YJ2B 2UXCO 3OR7C 2VQEO 3JD0A 1HR0B 2X0LA 1AVMA 1NH2B 5IT9N 4R50A 1I5XA 4B3RO 5CBHA 4KUMA 4JV5O 4TSFG 3DXRA 4PDMA 4LF8B 1GKFA 1Y76B 2W6IG 2XASA 1QVGU 3E86A 4FFBB 3FAVA 2ZIMA 2EIJB 5LA6A 4DW0A 4X1KB 1L8DA 2GTSA 1Y74B 3LDEA 2HJDA 1NH2D 3K5OA 3CRAA 1TVKB 3RT3C 2OTJV 3ZHRA 3LSQA 3BHPA 2KKWA 4I50B 4AI8A 2CE4A 4O4HA 1BZKA 4NXMO 4X62O 4U7NA 2FMLA 1G4YB 3G71V 1B06A 1R73A 3H01A 4NXNB 5JVDB 3P3PA 2PF4E 3LUTB 3MHHC 1OZ0A 3ABMB 3OTOO 4TUYA 2G38A 2FYUH 2N04A 4JAUA 1NJIW 5ITZA 1Q6IA 5JH7A 4X8AA 4O4LA 1TA8A 2GV9A 4LWSA 4JI6B 1YF2A 4GKKB 4X20A 1M93A 2LFSA 1YZBA 2OWOA 4YJ3B 3K9AA 3ZRVA 4N21A 4DO2A 1OCZB 2AZ2A 4DR2O 2ZINA 1F7YA 4QPJA 2AGAA 1YJWV 1FFTB 2UXDB 2JGDB 1FAFA 3OFNG 4PV1B 1KB9F 3FB8C 1OV9A 2E5LB 1GN2A 2H8PC 5LMNO 4DV5B 4RWUA 2EIJC 3U10A 4MTXA 3PJSK 5FNVA 4JASA 2K1EA 3SPJA 4CZZA 1M9NA 2WAMA 4Z1MG 4GZRB 1R3IC 3SPIA 2Y4TA 5BMVA 2ZCEA 4JI7B 4X1IB 3VQVA 3F5TA 2Y4UA 4I5SA 4HAMA 3ML0A 2P6JA 2IM9A 3BCCH 3ZMVA 2OIEA 3THOA 2BSKB 3LNNA 1H2MA 5GW7A 4FLZA 3JASA 2PYJA 1PL4A 2AW9A 3L74H 1H2GA 3CB2A 4LF7O 4DV7B 3ABMC 5EYPB 4H44B 1WA8A 3JD2A 4B3MO 1YJ9V 4YHHO 4JI4B 1Q82W 1XREA 4JI2O 2LQTA 3K5MA 4CS2A 5JJNB 1M90W 3T1YO 1EM1A 3QO8A 3QO7A 2D3OW 2WPDG 1O9HA 5CA1B 5IJ0B 2KB1A 1VMGA 1Y67A 2GHYA 1OCZC 1LUWA 1J5EB 4LNUA 5EIBD 1SS3A 2ZE7A 2ZE6A 1SQPH 3AG1B 3K59A 4XBFA 5CA3A 3T4DA 1GM8A 2VS0A 2QSAA 3G4SV 2Q6AA 1VQOV 3OT7A 2Y48A 2KG7B 2RNBA 2XAQA 3HKDA 2PTMA 1RM1C 2HG5C 2B9ZA 3OR6C 1JJ2U 1MG1A 4JI5O 1M57C 1BCCH 3JALB 1MZFA 3CRRA 2IW5A 1I08A 1YTFB 4X1YB 2YUAA 2F1MA 1GO3F 1JFFB 5C8YB 1H2LA 4PA6A 4TV9A 4GKJB 3CCQV 3D8CA 5KLVH 4FLUA 1WPBA 1N34B 4DV2O 1VQ7V 4P30A 2YDEA 4X65B 1RSOA 1IDSA 3AG4B 5H9CA 1N36O 2Y0IA 4O2AA 3CC2V 3AG2C 4MVZA 1OCRC 4UV9A 1VQKV 3HB3B 5B1AB 4Z2WA 1YTFD 3B77A 2QWPB 3E22A 3SYOA 4MVQA 1N0JA 2YSUB 1P7GA 4TQDA 1BHBA 1WAZA 2IH3C 1EZVH 5LL6Y 1NI8A 4H37A 2CGNA 2NLJC 1BHAA 2XAGA 1JCHA 1HR0O 1S3JA 2QTSA 4D6TH 5GONA 1NTKH 1KP3A 4EKWA 1V54B 2ADQB 3ZRSA 4EFEA 3JAKB 3APQA 1MSDA 2NNUA 4IHJA 1GMGA 4B08A 3ETDA 5JQGA 2VQEB 1AROP 4BW9A 2ILMA 1VF6C 3UO3A 2PZSA 1GH6A 2EILC 3GWOA 1VQPV 4CBCA 1FPOA 4JTCB 4B3RB 4LF8O 1U96A 3VQWA 4K8XA 2A7WA 3N2GA 2BTQA 4J7ZA 1T5EA 4JYYA 4XDLA 2AHYA 4AHCA 5IDJA 2H3OA 4GX2A 1KC8W 1KQSU 2QTOA 3WB2A 3QO5A 2RCVA 3P3NA 1Q7YW 1VEWA 1JPXA 4PDRA 5J2UA 4GT1A 3HKEB 4B7EA 1QQCA 1Z5WA 2DWEC 1N0NA 4PA3A 1B6QA 4J41A 4NXNO 2XOKG 5HFLA 5LP6A 2GUZA 3ETGA 3AG4C 2YIDA 1ROPA 3H1KH 4QPKA 4NXMB 4WFEA 4GUNA 3UKMA 3SJAC 2M7WA 1DGSA 2EULA 3H1IH 5B1AC 3T4ZA 1OJHA 3JSNA 3M8AA 5D5QA 3JATA 4KP4A 4YY3B 3CJHB 4GKKO 1B3QA 3A0RA 4LR3A 4EB6B 3QF7A 3OM3B 3G67A 4LH6A 3E8HA 1DLBA 3E89A 1JR9A 1PNKA 1YITV 4O4JB 3TGUH 2EINB 3K57A 3P30A 1H38A 3TJTA 2PYLA 2ODMA 1EBOA 3ZHVA 2IBZH 4B3SO 4U3FH 3FB6C 1PD3A 3CS5A 4DV5O 2QM4A 2YXHA 2EZPA 3SJCC 4LF5O 4NTYA 1YDXA 1AI6A 3K0DA 1M4UA 2QKSA 1YJNV 2R9AA 4I4TA 3Q4HA 3UO2A 4DR5B 3T1HO 2E76B 2FTKA 3DXRB 4JI7O 1JA8A 3JD1A 1TUBA 2XT9A 4UB6Z 3BABA 3ZJZA 4FK5C 3OUSA 5LA6B 3KKYA 1A32A 5BXZA 5B66Z 4IL6Z 2A9HA 2JGUA 2DYRB 4DV7O 3RYFA 1DK1A 5KX5A 1HNWO 2N74A 1HNZB 2EX3A 2QEXV 1JMKC 4I9WA 4O4HB 3L72H 5CA0A 2HLDG 2ITDC 4LF7B 3K06A 1IBLO 2DJVA 4DUZB 1N32O 1G8MA 1YIJV 1QLNA 1PPJH 1VQNV 1V55B 2WLMA 5EBLC 4TOIA 2DYSB 1QR8A 4CH4A 4TUYB 3WU2Z 4OX9O 1XUQA 4PELA 2X6AA 4ICGA 2EINC 1J5EO 4FLTA 5JH7B 5BR8B 1ZAUA 3FB5C 4X66B 4O4LB 4TQFA 4JI0O 4XDKA 3K5NA 1PKXA 2QGNA 4JF3A 5GTHZ 4X20B 4RUFA 2PI4A 5KMGA 2CH7A 1GAXA 2H94A 3OTFA 3U0ZA 3CD6V 1MZEA 2ZD9A 2JDIG 1SA0A 3B40A 1FD9A 2JS5A 4A5UB 3KG2A 2BOCC 1ZLZA 4IT5A 5LHGA 4DR7O 2QE7G 4HZ3A 1K73W 3B4SA 1VARA 3LNMB 4JI5B 5LHHA 5DEDA 3ZS8C 1MOFA 3ZHUA 1EN4A 1PP9H 2Q73A 2XAHA 4CS4A 2ZXWC 2JJ2G 3H1LH 1SETA 5FNVB 2PY5A 3ZHSA 3CCSV 3F5WC 2DYRC 5BMVB 2FL4A 3CCJV 1FFXA 3A8TA 3K03A 3CCMV 1N36B 3ZMZA 4NR1A 1XHZA 3JASB 3P32A 3H1HH 2XAFA 3SDLA 2DW4A 5J9PC 2Q67A 3CCEV 1XILA 4J11A 2W0XA 1FYJA 4PA9A 2ZKOA 2DOSA 1QLEB 4K0KB 1AP5A 1Q8IA 2AHZA 5L3FA 2KSDA 4KFMA 3BVOA 4QE9A 5FLXN 3R66A 2EJ7A 4RQEA 1KP2A 3J81N 4GX1A 1WB7A 3ZRXA 4FMTA 2WLLA 2QM7A 1EN6A 4JI3B 1AJQA 4LNUB 2DE0X 5JCOC 3CRMA 3ABLC 1JOYA 3VBBA 1MABG 4CH3A 1F51A 2MK3A 2LGWA 4DV0O 3X2QB 2A06H 1Q5OA 3AK3A 2Y0PA 2V4DA 1R6TA 4O2BA 1I94O 2LJ2A 2R70A 3BPZA 2YXYA 4FIPC 3JAWA 4LC1A 3N2KA 2CTPA 2FB5A 4DV1O 3ASNB 2NR5A 2WLNA 4L87A 2F95B 1SQBH 3L73H 1ZX3A 1THZA 4GCZA 2DN9A 4F4LA 1GK9A 4K35A 4YY3O 1RSOB 4JYBA 1V9PA 5KAIZ 4JGSA 3B8MA 2HHHO 1AJPA 4FM1A 1XHXA 2Q7HA 1EN5A 5IYBO 4I7ZB 4X88A 3EXAA 4NTWA 4UUJC 2UUAB 3LDCA 3CMEV 3F7YC 1QR9A 1HWYA 2A79B 1VQ9V 1Q3EA 2Q0AA 1NR7A 1R3KC 5L3EA 3E35A 5CB4A 3KZIZ 1W2BU 4DUYB 5GONB 3K58A 4HBNA 2HFEC 1CPYA 4QGPA 4IHJB 2MW2B 2B1IA 3TXSA 4B3SB 1XNRO 4UCSA 2ZDIC 5L3CA 4DR5O 4EEQA 4FM0A 4LF5B 5FL7G 2F23A 4JI8O 1UJWB 3W7WA 2BTQB 2X6BA 2EZOA 4I55B 3T1HB 3E2EA 2BTOA 3HKBA 4BR6A 3CC7V 5EZYA 1WPXA 1M1KW 3D3QA 2YEVA 3JYCA 3ASNC 5J2UB 2LFRA 1HNZO 3GB7C 3VQYA 1JJOA 1UPGA 1R3JC 2Q9LA 4NVPA 1HNWB 1RPRA 4DUZO 4O4IB 2LO1A 5EC2C 5LP6B 2GUZB 5IJ9A 3M99B 1XL6A 1IBLB 3ABKB 2YIBA 4UFZA 1N32B 1P4RA 5IYZB 5BR8O 2ARHA 1D2DA 3CRQA 4X66O 1FXHA 4OX9B 3JATB 2XNDG 5LXTA 1XEQA 2AXTZ 4J9ZB 4DR6B 4WFFA 4CC6A 5J2TA 1Z5VA 4JI0B 2YI9A 1WN7A 5LOVA 4PI0A 1AJNA 1H2KA 2A0LA 1YVWA 1GN4A 1CP9A 1OHHG 3U11A 5K1PA 1I0HA 2OIGA 4FFBA 3H9VA 1PL0A 4ZI7A 1VP7A 4DR7B 2ZM6O 1F23A 3ZRWA 5DN6G 2CTWA 3FKSG 4I4TB 2WA4A 3MDSA 3Q4HB 3CCLV 3T1CA 2QWRB 4RQFA 1EFRG 2OTLV 5CMUA 1TUBB 3ZCCA 3EHBB 1K5QA 1XMQO 3O9OA 1E1QG 4UCRA 4WFBV 5EIBC 2GSMB 5JVDA 2GDSA 1K7DA 1BL8A 3RYIA 5KUKA 3RYFB 5KX5B 4HYOA 3ABKC 4MVMA 5EC1C 3IC9A 2LP7A 1S76D 5CA0B 5B3SB 4K0KO 3DTUB 3PN1A 1VQ5V 1NQTA 5IE9A 2JVDA 5F2VO 3JCUZ 1Q6UA 5LGNA 4J80A 1KKDA 5L3BA 2RN9A 2E3CA 3CXCU 1Q81W 2QWNB 3AG1C 4DV4O 3AK1A 4JI3O 4ZBMA 3RYHB 3C3SA 4OGQB 2P67A 4BW5A 2EIMB 4IIJA 4MTFA 3RW0A 1KD1W 2Q5ZA 4UCVA 2CH7B 2ZE5A 3D36C 3OGCC 4MTGA 3K3WA 3ZIAG 5EBWC 4DV0B 1FJGB 1SA0B 3OMNB 1SC5B 3UM7A 4YIPA 1FXKA 1SQGA 2DQ3A 4OPAA 1IURA 1WNSA 2ZNJA 1I94B 1GN3A 1WP7A 4R7CA 1H8EG 1US6A 4C7UA 2YICA 4QNHB 3W7SA 1KUQA 1K8AW 2YC0A 1COWG 2DWDC 4DV1B 2ZT9B 4F6RA 1K3EA 1AI4A 1M56B 1Q90D 2HVJC 4JZ2A 5AG2A 1JX9A 3WG7B 2UXXA 2UUBB 2R9RB 5EK0A 1K97A 3TETA 4DR1O 1FFXB 3FFQA 2EBOA 2LW1A 2UUAO 3IAYA 3QTCA 4JYCA 2HEPA 3G6BA 2HHHB 3ETQA 4HNAB 4EFBA 4DYLA 2HVKC 4FZ0A 4LBEC 3SPHA 1S77D 3RFRA 1V54C 4U3JB 3STLC 4MW8A 3SPCA 3RYCA 4PDLA 4DR4B 4LF6O 2ATKC 3IJ4A 4DUYO 5IJ0A 4J7KA 4LF9O 1SZXA 4KXRA 1IXMA 1YSCA 4UCOA 1D5AA 3LSUA 1VF6A 2P06A 2P4VA 2CTRA 1KYOF 1GTOA 4PDVA 3F7VC 2Q68A 3K9SA 1N33B 1Y66A 4DXWA 2B1GA 4WBNA 1AI5A 1SQQH 1XNRB 1GRJA 4Q20A 1DF4A 4DV3O 1BQZA 2CAZC 2Q7GA 4YIOA 2IU3A 4JI1O 1G6UA 2HP8A 4FPPA 3D3IA 5A2QN 4JI8B 1D5NA 2IU0A 2JIZG 3ZN0A 3FAVB 3AG3B 3M7MX 4X1YA 1P49A 4RAIA 3BA8A 4CC5A 4O2BB 3CP1A 3I55V 1PV0A 3NR7A 2OCHA 3K04A 3K79A 5L3DA 4UXNA 3DC6A 3NXSA 4FZ1A 3N2KB 2CK3G 2RMKB 2ZR3A 4JAAA 3JARA 3OEEG 3KCYA 4ZOLA 1XNQB 4TV8A 4X64B 3CEIA 4PA7A 1I5YA 2CGOA 2IJIA 4ZHQA 3CMAV 5ITZB 5IWAB 4DR6O 4PHZA 4LFAB 1NT2B 3OEHG 4LWSB 1TGOA 3BAAA 3MHSC 4MS2A 4K8ZA 3QG5A 3JAKA 3CX5F 4JTAB 5KAFZ 3BY6A 4P9PA 1EZJA 1W0KG 4G2KA 1VQ6V 1XDCA 3C90A 3CCVV 4J10A 4LFCB 1Z2GA 1HDJA 2ZNIA 3HKCA 3E83A 3FD9A 4J7JA 3TCUA 1BMFG 5K1XA 1S5JA 5LBQA 4LCUC 5E1AC 3LDDA 3L75H 2JK5C 2R9IA 3AG3C 1L0NH 2ZM6B 3ASOB 1K4CC 4I0XA 2HR3A 1M5IA 3DSQA 4UVBA 3HKBB 2UXBO 2A3QA 2RJZA 4JPRA 5EZYB 1ZSPA 3RGBA 2QKCA 3RVZA 1XMQB 1IXBA 2K9PA 5LGTA 2JEXA 2DMXA 3N27A 5BZBA 1KU9A 3ABTA 1V55C 2DYSC 5B1NA 5LMUB 3K08A 5EBMC 1NBMG 1SERA 4ZKIA 2P90A 1SZTA 2PGGA 1WA8B 2WLJA 5IJ9B 4EB6A 2GBOA 4WFHA 5CBGA 4O4JA 1BT8A 4F6EA 1PM9A 1SQVH 3SPGA 1U97A 5JJEB 4FLVA 2VWKA 4RUEA 4U7OA 5E79Z 3OAAG 4BWAA 5LXTB 4DV4B 5L3GA 3CE2A 1DTOA 3ZX6A 3ZEDA 4FM2A 4PD4F 1H8HG 3FB7C 2XAJA 3CWBH 5J2TB 3H1JH 1TUEB 3S3XA 2ETNA 4E4EA 3HPLC 2QWOB 1AP6A 2N05A 3B2EE 5LOVB 2IJKA 4N23A 1FJGO 1NTMH 3K0GA 2YIBD 3ZMUA 3TK1A 2Z0AA 2V1DA 3JCZA 3HKDB 5FPOA 2F4VB 1LNQA 3MD0A 3ASOC 1ZWIC 4QE7A 2PI5A 3AK2A 3STZC 2YS8A 5IYCO 1AILA 3B09A 1J95A 1TAEA 4ZI7B 4NTXA 5H6RA 1AR5A 5TISZ 3WB0A 3ZRWB 4DRXA 4TV9B 4G28B 2UUBO 4QJFB 1PNLA 1ZL8A 2OCCB 2B5UA 2IJHA 3IFXA 5KHJA 3TXQA 3OE7G 2AZ0A 1K34A 4O2AB 3FYEB 4Z1VA 1YI2V 4LF4O 1OCCB 3SYPA 4PJ0Z 4DR1B 5CBFA 4FLWA 4B7KA 4E2LA 1QLEC 1FS0G 1X59A 3RYIB 3I56V 2YIAA 1R6NA 4DR4O 4LFBB 3E22B 1BE3H 3G80A 4CS3A 2YI8A 2WLKA 2UU9O 1NZ6A 4DV6O 4R6ZA 4WCEV 1GN6A 1XBLA 4FLXA 3VQXA 1SRYA 4LF6B 5KHIA 5H6QA 1VQMV 2WLHA 4LF9B 1X4TA 1N33O 2LGQA 5JQGB 2UXNA 4I9QA 4NKGB 1OCOB 1L0LH 1MNGA 5KHHA 3UT5A 3BEHA 4IYHA 3IGAC 4UV8A 2OT5A 5JCOA 3X2QC 3WFVA 1WP8A 1XI1A 3N2GB 4DV3B 2KQXA 1H2SB 4WFGA 2O57A 4IIJB 5LYJA 4JI1B 4DR3O 3WB1A 2P5OA 1RM1B 2Y69B 2W0FC 4NB5A 4ABMA 4MW3A 1IBKB 5H2FZ 5KUMA 3HR0A 1M57B 1BGYH 1FXKB 1Q43A 1QVFU 1XMOO 2QM8A 3ZMSA 2OCCC 1YCIA 1SF9A 2YXLA 2UUCO 3MAQA 1W0JG 1F4NA 2L35A 5GTIZ 1NKDA 2FKXA 2WLIA 2ZIOA 5JJJB 1S0VA 5H5NA 4CH5A 3AEIA 3E8BA 1L1FA 2Z5UA 1XNQO 5DM6V 4F6RB 4X64O 3S3WA 4B3TO 1OCCC 2XUMA 3G6EV 5IWAO 4P9OA 4LFAO 1KMIZ 3AG2B 1OCRB 3DGEA
chains in the Genus database with same CATH topology
1QR8A 2EIJB 2EIKB 3UM7A 1FXKA 2DQ3A 4PELA 2X6AA 3LDEA 4TT3G 2EINC 1NH2D 4WFAV 4R7CA 2OTJV 3FB5C 1H8EG 3LSQA 4QNHB 4XDKA 3W7SA 1K8AW 1PKXA 5LHIA 1COWG 2DWDC 4JF3A 5B1BB 4RUFA 2PI4A 1K3EA 1OCOC 1AI4A 1M56B 2HVJC 2H94A 4U7NA 1G4YB 3G71V 1JX9A 1R73A 3WG7B 3CD6V 3H01A 2UXXA 2ZD9A 5IYDO 2ZDIA 3LUTB 2R9RB 5EK0A 3MHHC 2EILB 1K97A 2JDIG 3TETA 1OZ0A 3ABMB 3KG2A 1NR1A 2BOCC 2EBOA 2HJFC 5KA6A 1KECA 1CEZA 4JAUA 4JYCA 5LHGA 1P7BA 1NJIW 2QE7G 1VQLV 4HZ3A 2HVKC 4X8AA 4LBEC 3SPHA 1K73W 1S77D 3LNMB 1V54C 2Y69C 5LHHA 4PA4A 1MOFA 1E79G 1S5HC 4H33A 4MW8A 3SPCA 4MSWC 3STLC 2IJJA 2F43G 2XAHA 2ZXWC 5B1OA 2JJ2G 2X6CA 4PDLA 2ATKC 1SETA 3ZMTA 1FXKC 2LFSA 3CCSV 3K9AA 3F5WC 1IXMA 2JJ1G 2ZQMA 1YSCA 3ZRVA 2DYRC 4N21A 4DO2A 1OCZB 3SYQA 3CCJV 2QA4V 1GTOA 4PDVA 3F7VC 4QPJA 1GM9A 2Q68A 1YJWV 1FFTB 1Y66A 3K03A 4DXWA 3CCMV 3OFNG 2B1GA 1AI5A 3ZMZA 4BIUA 4Q20A 3SYCA 3FB8C 1DF4A 2H8PC 3CCUV 1K33A 3P32A 2IU3A 2XAFA 2DW4A 5J9PC 2Q67A 4FPPA 3CCEV 3D3IA 2EIJC 2IH1C 4MTXA 2EIKC 3PJSK 1E1RG 4GX0A 2IU0A 1QBZA 2EJRA 4PA9A 4JASA 3LSSA 2JIZG 2K1EA 3ZN0A 3SPJA 4CZZA 3AG3B 1M9NA 2HKOA 2WAMA 4Z1MG 2ZR2A 1QLEB 1R3IC 3SPIA 1K4DC 2AHZA 2V7QG 5L3FA 4KFMA 4I5SA 4QE9A 2BOBC 4RAIA 4HAMA 1MSWD 3CCRV 3ML0A 3CP1A 2P6JA 3I55V 4RQEA 1KP2A 5B1BC 3ZMVA 1RPOA 4GX1A 3K04A 3ZRXA 1ORQC 3K79A 5L3DA 4UXNA 5GW7A 4BAYA 3NXSA 4FMTA 2WLLA 2QM7A 2CK3G 1H2GA 1AJQA 4MVOA 2ZR3A 2W6JG 3ABMC 3ABLC 1JOYA 3SYAA 3OEEG 3VBBA 1MABG 1ENVA 1F51A 2MK3A 3X2QB 3JD2A 4PA7A 1I5YA 5CN0A 2IJIA 3CMAV 1YJ9V 5IY5B 1Q82W 4ASUG 3OEHG 3MHSC 4MS2A 1M90W 4JTAB 2JEUA 3QO7A 3QO8A 4FIPC 2WPDG 4MVUA 2D3OW 4LC1A 3BY6A 4P9PA 2KB1A 2X7RB 2DQ0A 2GHYA 3ASNB 1OCZC 2Z3YA 2WLNA 4L87A 1EZJA 1W0KG 4G2KA 1VQ6V 1THZA 3E8FA 3AG1B 4GCZA 3ABUA 5LGUA 3CCVV 4XBFA 5CA3A 4MTOA 3T4DA 1GM8A 4F4LA 3E83A 1FXVA 1GK9A 5B3SC 3G4SV 2Q6AA 1VQOV 4JYBA 3TCUA 4YXWG 4JGSA 2Y48A 3B8MA 1AJPA 1BMFG 5EBLC 2XAQA 3IC7A 3JD3A 1RM1C 5LBQA 4LCUC 2HG5C 5IYBO 4X88A 1GM7A 5E1AC 3LDDA 3OR6C 1JJ2U 4MT8A 2JK5C 2R9IA 1MG1A 3AG3C 4UUJC 3LDCA 1M57C 3ASOB 1K4CC 2IW5A 3CMEV 3F7YC 1QR9A 1HWYA 2A79B 1YTFB 1VQ9V 3W7UA 2WWWA 1NR7A 1R3KC 1K92A 4JAVA 2HR3A 1GO3F 5L3EA 3E35A 4R8CA 4UVBA 4PA6A 3CCQV 1W2BU 4JPRA 2EIMC 1VQ7V 4P30A 3CPWU 3RVZA 3OMIB 2HFEC 3AG4B 1CPYA 3B8NA 5H9CA 5LGTA 2C2AA 1K9MW 2B1IA 2JEXA 3CC2V 2WLLB 2ZDIC 3AG2C 4MVZA 5BZBA 3CC4V 3SJQC 1OCRC 4UV9A 5L3CA 1VQKV 3ABTA 1V55C 4XDJA 2DYSC 3D36A 3HB3B 5FL7G 5B1NA 4P2ZA 5B1AB 1QCEA 3K08A 5EBMC 1NBMG 3ETEA 1YTFD 3B77A 1SERA 4ZKIA 1UJWB 1AI7A 3W7WA 2P90A 1JVMA 2X6BA 3SYOA 2EZOA 4MVQA 1SZTA 2YSUB 3CYOA 2WLJA 5IY5C 1BHBA 2IH3C 3E2EA 4WFHA 5CBGA 4H37A 1F4MA 2NLJC 3CC7V 1BHAA 2XAGA 1JCHA 1WPXA 1R6KA 3OMNB 1S3JA 5KA5A 3SPGA 1M1KW 2YEVA 1KP3A 4EKWA 1M56C 1V54B 1YHQV 1S72V 4GX5A 3ZRSA 3JYCA 3ASNC 4RUEA 4U7OA 3WG7C 2NNUA 1GMGA 1R3LC 2LFRA 3ETDA 3OAAG 1AROP 2ZXWB 3GB7C 3VOUA 5L3GA 1R3JC 4FJCC 1DTOA 2EILC 3GWOA 1VQPV 4J9YB 4CBCA 1H8HG 3FB7C 4JTCB 2XAJA 1RPRA 1TUEB 2ITCC 3HPLC 5EC2C 3JD4A 4UVCA 2IJKA 4N23A 4XDLA 5HFMA 3K0GA 2AHYA 3M99B 5IDJA 1XL6A 3ZMUA 3TK1A 3ABKB 3T2MA 4GX2A 1KC8W 1KQSU 2QTOA 1NVPB 1P4RA 2V1DA 1AR1B 3JCZA 4OXSA 3QO5A 1LNQA 2Q69A 3MD0A 3ASOC 1ZWIC 1Q7YW 4QE7A 1JPXA 4PDRA 2PI5A 1FXHA 3STZC 4GT1A 1XL4A 2XNDG 5IYCO 3OW2U 1J95A 4J9ZB 4WFFA 5H6RA 2DWEC 4PA3A 3ZRWB 4JTDB 1B6QA 4X89A 3OUFA 4G28B 2XOKG 5HFLA 4QJFB 1PNLA 3ZN1A 3ETGA 2OCCB 3AG4C 1ROPA 1JQ0A 1AJNA 4QPKA 2B5UA 1Y4MA 2IJHA 4LP8A 3IFXA 4WFEA 1PNMA 3OE7G 3UKMA 1NVPD 4G27B 3W7XA 2A0LA 2M7WA 1OHHG 1CP9A 2P7TC 5C93A 1K34A 3FYEB 5B1AC 1YI2V 3T4ZA 1DF5A 3RBZA 1OCCB 3SYPA 1Q86W 5CBFA 4MVSA 4E2LA 1QLEC 1PL0A 1FS0G 4KP4A 3ABLB 3I56V 4BIZA 1R6NA 3FYIB 1F23A 4TWKA 3A0RA 3ZRWA 5DN6G 3FKSG 3OM3B 2WLKA 3E8HA 1DLBA 4R6ZA 3E89A 4WCEV 1PNKA 3E8GA 3CCLV 3T1CA 1YITV 2EINB 1SRYA 3P30A 1EFRG 4RQFA 1VQ8V 2OTLV 4RO2A 2WSSG 2YEVB 5CMUA 5H6QA 3W7TA 2WLHA 1VQMV 1H38A 3ZCCA 1N8RW 3EHBB 1K5QA 4MVRA 1E1QG 3R65A 4WFBV 1EBOA 3OMAB 2UXNA 1SESA 2GSMB 1OCOB 3FB6C 1K7DA 1PD3A 1BL8A 3BEHA 3IGAC 4UV8A 4WF9V 2EZPA 2OT5A 3X2QC 3WFVA 5KUKA 3ABKC 4HYOA 1AI6A 3K0DA 1K5SA 1WLEA 4MVMA 2QKSA 1YJNV 2WLIB 5EC1C 3QNEA 2LP7A 4WFGA 1S76D 5B3SB 3DTUB 2FTKA 3EFFK 4QIWF 1VQ5V 1NQTA 3JD1A 5LGNA 1RM1B 2Y69B 1KKDA 5L3BA 2W0FC 3ZJZA 1VQ4V 4MW3A 4UVAA 3RVYA 5KUMA 4FK5C 3OUSA 3CXCU 1Q81W 1M57B 3OR7C 1FXKB 3AG1C 1QVFU 2QM8A 3ZMSA 2OCCC 3JD0A 2X0LA 2A9HA 1W0JG 1F4NA 1NH2B 2DYRB 1NKDA 4R50A 1I5XA 4ZBMA 5CBHA 2WLIA 2QEXV 1S0VA 4KUMA 2P67A 4BW5A 3AEIA 3E8BA 2EIMB 4I9WA 4MTFA 3RW0A 1KD1W 1L1FA 2Z5UA 4TSFG 2HLDG 5DM6V 2ITDC 1OCCC 3K06A 3G6EV 4PDMA 3OGCC 4P9OA 4MTGA 1GKFA 3K3WA 1G8MA 2W6IG 1YIJV 1QLNA 3AG2B 3ZIAG 2XASA 1QVGU 5EBWC 1OCRB 3DGEA 1VQNV 3E86A 1V55B 2WLMA 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q20 A;  1F51 A;  4MT8 A;  3ZCC A;  5B1O A;  3ZRV A;  2FTK A;  2C2A A;  3ZRW B;  3P32 A;  2LFS A;  5IDJ A;  2P67 A;  4KP4 A;  3TK1 A;  4GCZ A;  3ZRX A;  4BIZ A;  4FPP A;  1IXM A;  3D36 A;  3A0R A;  4JAU A;  2WWW A;  4JYC A;  4MTX A;  4U7O A;  5B1N A;  3NXS A;  2LFR A;  4FMT A;  4JAV A;  4QPK A;  3ZRW A;  4JAS A;  2QM7 A;  3MD0 A;  4JYB A;  4QPJ A;  4ZKI A;  1JOY A;  4LC1 A;  3DGE A;  4GT1 A;  5C93 A;  2QM8 A;  4U7N A;  4BIU A;  4I5S A; 
#chains in the Genus database with same CATH topology
 1WJZ A;  5D5P A;  4YJ2 A;  2EIK B;  3SJB C;  1MMM A;  4TT3 G;  4NYK A;  4WFA V;  5FPR A;  4H0L B;  1AB3 A;  3L71 H;  2XHB A;  3J7A U;  4UCT A;  1BSM A;  3A0B Z;  5LHI A;  1O9G A;  4LFC O;  3RYC B;  5B1B B;  1OCO C;  3SGI A;  1IBM B;  1Y76 A;  3DC5 A;  5IYD O;  2ZDI A;  2VQF B;  1I7F A;  2EIL B;  4UCU A;  1NR1 A;  2HJF C;  5KA6 A;  1KEC A;  1CEZ A;  4X1K A;  5DEC A;  1H2N A;  1P7B A;  1Y74 A;  4WBN B;  1VQL V;  1SQF A;  1TVK A;  2Y69 C;  2VWJ A;  4PA4 A;  1E79 G;  1S5H C;  4H33 A;  2QKA A;  4MSW C;  1FKA O;  4I50 A;  2IJJ A;  2F43 G;  5B1O A;  2X6C A;  3ZMT A;  1FXK C;  2E75 B;  4FVM A;  4JYA B;  4FLY A;  4KHP B;  2UXB B;  2JJ1 G;  2ZQM A;  1B04 A;  1G1X B;  4KL1 A;  3SYQ A;  5LP6 C;  2ZE8 A;  3RN4 A;  2QA4 V;  1GM9 A;  2QDO A;  1HNX O;  5LMU O;  1XOU A;  2BE3 A;  4BIU A;  3SYC A;  2LW7 A;  3CCU V;  1K33 A;  3O65 A;  3L9D A;  2CTQ A;  4GYC B;  2IH1 C;  2EIK C;  1E1R G;  1UFI A;  4GX0 A;  4AQY O;  2F66 C;  1QBZ A;  2EJR A;  3JAR B;  3LSS A;  4YJ3 A;  4L8J A;  2HKO A;  4ZOL B;  2ZR2 A;  4TV8 B;  1K4D C;  2V7Q G;  4ZHQ B;  2BOB C;  1MSW D;  3CCR V;  4FFK A;  3I5D A;  2JGD A;  5B1B C;  1RPO A;  3K5L A;  1ORQ C;  1NU1 H;  2M6Y A;  4GLX A;  2UXC B;  3CXH F;  4BAY A;  4DK0 A;  5KMG B;  1ZTE A;  4MVO A;  2W6J G;  5BY1 A;  3JSL A;  3SYA A;  2F4V O;  1RFY A;  1ENV A;  3FX7 A;  4JV5 B;  4I55 A;  2QWQ B;  5CN0 A;  3HKC B;  2L6L A;  4X1I A;  4PI2 A;  2F93 B;  4J42 A;  5IY5 B;  2QJ1 A;  4ASU G;  1WB8 A;  1URF A;  2BSK A;  1VIB A;  2JEU A;  4MVU A;  3ICX A;  2RDC A;  3QVN A;  1HW7 A;  2X7R B;  2DQ0 A;  2Q8V A;  2Z3Y A;  4I0X B;  5EYP A;  3OGI B;  4O4I A;  3E8F A;  1AR4 A;  3ABU A;  5LGU A;  1QU7 A;  2ADP A;  2D2C B;  1SQX H;  4MTO A;  4X62 B;  1FXV A;  5B3S C;  2GTA A;  4LFB O;  4YXW G;  5JWP A;  4LF4 B;  1YXB A;  3IC7 A;  5IYZ A;  3JD3 A;  3ZHT A;  1GM7 A;  4MT8 A;  3OTO B;  4BIO A;  5CA1 A;  4JI6 O;  4UB8 Z;  2WA3 A;  1NTZ H;  3ZHQ A;  1QHT A;  2UU9 B;  3W7U A;  2WWW A;  4DV6 B;  1K92 A;  4JAV A;  3J80 N;  4DK1 A;  4CH6 A;  3CRC A;  4R8C A;  4D7T A;  1W59 A;  2EIM C;  3CPW U;  3OMI B;  3AG7 A;  1XQ8 A;  2UXD O;  3B8N A;  2XTA A;  2KG7 A;  2C2A A;  1N4C A;  1K9M W;  2WLL B;  2E5L O;  3CC4 V;  3SJQ C;  4DR2 B;  4XDJ A;  3D36 A;  4P2Z A;  3GVM A;  1QCE A;  3JAL A;  3ETE A;  4IYI A;  1VF5 B;  1AI7 A;  1JVM A;  2VRZ A;  3CYO A;  5LMN B;  5IY5 C;  4DR3 B;  1JFF A;  5C8Y A;  1IBK O;  3L70 H;  2R72 A;  1F4M A;  2CDY A;  2Q4P A;  1R6K A;  5KA5 A;  4AIL C;  1M56 C;  1YHQ V;  3A0H Z;  1S72 V;  4GX5 A;  3WG7 C;  1ZUQ A;  1R3L C;  3JAW B;  2ZXW B;  1XMO B;  3VOU A;  2JS3 A;  4FJC C;  2UUC B;  2RQ6 A;  4J9Y B;  4OPH A;  2Q0O C;  2PUS A;  2ITC C;  4W4L A;  4DRX B;  3JD4 A;  4UVC A;  1ZL8 B;  4D7S A;  1S5L Z;  4X9Q A;  5HFM A;  4B3T B;  4Q6G A;  3T2M A;  2P22 C;  3A2F A;  3APO A;  1NVP B;  1AR1 B;  4OXS A;  4JI4 O;  2Q69 A;  5B5E Z;  1YEW A;  5KHG A;  3SR2 C;  4IGG A;  3CSX A;  1XL4 A;  4B3M B;  1MA1 A;  4ZIB A;  3OW2 U;  2E74 B;  4YHH B;  1LR1 A;  1IBM O;  2QR4 A;  4W4K A;  3KCX A;  4JI2 B;  4JTD B;  1Y6X A;  4X89 A;  3OUF A;  5CB4 B;  1IVS A;  3T1Y B;  3RYH A;  3ZN1 A;  2VQF O;  1JQ0 A;  5A9G A;  4LP8 A;  1Y4M A;  1PNM A;  3UCS C;  4H13 B;  1NVP D;  3UQ8 A;  4G27 B;  3W7X A;  2P7T C;  4K3A A;  5C93 A;  1NS1 A;  5KHK A;  3BFR A;  1DF5 A;  3RBZ A;  3EVK A;  3BRC A;  2CUG A;  1Q86 W;  3UT5 B;  1BS3 A;  4MVS A;  3HKE A;  3ABL B;  3CHX A;  4BIZ A;  3FYI B;  1IZ3 A;  4DW1 A;  4TWK A;  1R1B A;  3RWR D;  4JYA O;  4KHP O;  5LYJ B;  3E8G A;  2Q7E A;  4GKJ O;  2NN4 A;  1VQ8 V;  4RO2 A;  2WSS G;  2YEV B;  4JZG A;  3W7T A;  1N34 O;  1QNM A;  1N8R W;  1RP3 B;  4MVR A;  2P4K A;  3C3T A;  3R65 A;  4X65 O;  3OD4 A;  1P84 F;  3OMA B;  1VF7 A;  2JRI A;  1SES A;  3GWK C;  4DV2 B;  1HNX B;  4WF9 V;  2BCC H;  1LUV A;  3CJH A;  3JAM N;  1BQ0 A;  1K5S A;  1WLE A;  1IX9 A;  2WLI B;  4HNA A;  1KBH A;  3QNE A;  3BA9 A;  4U3J A;  3EFF K;  4QIW F;  1KKC A;  4AQY B;  4LH7 A;  1CXZ B;  1HP8 A;  1VQ4 V;  1SKV A;  4UVA A;  3RVY A;  3ZBH A;  2OYQ A;  1Q6H A;  4YJ2 B;  2UXC O;  3OR7 C;  2VQE O;  3JD0 A;  1HR0 B;  2X0L A;  1AVM A;  1NH2 B;  5IT9 N;  4R50 A;  1I5X A;  4B3R O;  5CBH A;  4KUM A;  4JV5 O;  4TSF G;  3DXR A;  4PDM A;  4LF8 B;  1GKF A;  1Y76 B;  2W6I G;  2XAS A;  1QVG U;  3E86 A;  4FFB B;  3FAV A;  2ZIM A;  2EIJ B;  5LA6 A;  4DW0 A;  4X1K B;  1L8D A;  2GTS A;  1Y74 B;  3LDE A;  2HJD A;  1NH2 D;  3K5O A;  3CRA A;  1TVK B;  3RT3 C;  2OTJ V;  3ZHR A;  3LSQ A;  3BHP A;  2KKW A;  4I50 B;  4AI8 A;  2CE4 A;  4O4H A;  1BZK A;  4NXM O;  4X62 O;  4U7N A;  2FML A;  1G4Y B;  3G71 V;  1B06 A;  1R73 A;  3H01 A;  4NXN B;  5JVD B;  3P3P A;  2PF4 E;  3LUT B;  3MHH C;  1OZ0 A;  3ABM B;  3OTO O;  4TUY A;  2G38 A;  2FYU H;  2N04 A;  4JAU A;  1NJI W;  5ITZ A;  1Q6I A;  5JH7 A;  4X8A A;  4O4L A;  1TA8 A;  2GV9 A;  4LWS A;  4JI6 B;  1YF2 A;  4GKK B;  4X20 A;  1M93 A;  2LFS A;  1YZB A;  2OWO A;  4YJ3 B;  3K9A A;  3ZRV A;  4N21 A;  4DO2 A;  1OCZ B;  2AZ2 A;  4DR2 O;  2ZIN A;  1F7Y A;  4QPJ A;  2AGA A;  1YJW V;  1FFT B;  2UXD B;  2JGD B;  1FAF A;  3OFN G;  4PV1 B;  1KB9 F;  3FB8 C;  1OV9 A;  2E5L B;  1GN2 A;  2H8P C;  5LMN O;  4DV5 B;  4RWU A;  2EIJ C;  3U10 A;  4MTX A;  3PJS K;  5FNV A;  4JAS A;  2K1E A;  3SPJ A;  4CZZ A;  1M9N A;  2WAM A;  4Z1M G;  4GZR B;  1R3I C;  3SPI A;  2Y4T A;  5BMV A;  2ZCE A;  4JI7 B;  4X1I B;  3VQV A;  3F5T A;  2Y4U A;  4I5S A;  4HAM A;  3ML0 A;  2P6J A;  2IM9 A;  3BCC H;  3ZMV A;  2OIE A;  3THO A;  2BSK B;  3LNN A;  1H2M A;  5GW7 A;  4FLZ A;  3JAS A;  2PYJ A;  1PL4 A;  2AW9 A;  3L74 H;  1H2G A;  3CB2 A;  4LF7 O;  4DV7 B;  3ABM C;  5EYP B;  4H44 B;  1WA8 A;  3JD2 A;  4B3M O;  1YJ9 V;  4YHH O;  4JI4 B;  1Q82 W;  1XRE A;  4JI2 O;  2LQT A;  3K5M A;  4CS2 A;  5JJN B;  1M90 W;  3T1Y O;  1EM1 A;  3QO8 A;  3QO7 A;  2D3O W;  2WPD G;  1O9H A;  5CA1 B;  5IJ0 B;  2KB1 A;  1VMG A;  1Y67 A;  2GHY A;  1OCZ C;  1LUW A;  1J5E B;  4LNU A;  5EIB D;  1SS3 A;  2ZE7 A;  2ZE6 A;  1SQP H;  3AG1 B;  3K59 A;  4XBF A;  5CA3 A;  3T4D A;  1GM8 A;  2VS0 A;  2QSA A;  3G4S V;  2Q6A A;  1VQO V;  3OT7 A;  2Y48 A;  2KG7 B;  2RNB A;  2XAQ A;  3HKD A;  2PTM A;  1RM1 C;  2HG5 C;  2B9Z A;  3OR6 C;  1JJ2 U;  1MG1 A;  4JI5 O;  1M57 C;  1BCC H;  3JAL B;  1MZF A;  3CRR A;  2IW5 A;  1I08 A;  1YTF B;  4X1Y B;  2YUA A;  2F1M A;  1GO3 F;  1JFF B;  5C8Y B;  1H2L A;  4PA6 A;  4TV9 A;  4GKJ B;  3CCQ V;  3D8C A;  5KLV H;  4FLU A;  1WPB A;  1N34 B;  4DV2 O;  1VQ7 V;  4P30 A;  2YDE A;  4X65 B;  1RSO A;  1IDS A;  3AG4 B;  5H9C A;  1N36 O;  2Y0I A;  4O2A A;  3CC2 V;  3AG2 C;  4MVZ A;  1OCR C;  4UV9 A;  1VQK V;  3HB3 B;  5B1A B;  4Z2W A;  1YTF D;  3B77 A;  2QWP B;  3E22 A;  3SYO A;  4MVQ A;  1N0J A;  2YSU B;  1P7G A;  4TQD A;  1BHB A;  1WAZ A;  2IH3 C;  1EZV H;  5LL6 Y;  1NI8 A;  4H37 A;  2CGN A;  2NLJ C;  1BHA A;  2XAG A;  1JCH A;  1HR0 O;  1S3J A;  2QTS A;  4D6T H;  5GON A;  1NTK H;  1KP3 A;  4EKW A;  1V54 B;  2ADQ B;  3ZRS A;  4EFE A;  3JAK B;  3APQ A;  1MSD A;  2NNU A;  4IHJ A;  1GMG A;  4B08 A;  3ETD A;  5JQG A;  2VQE B;  1ARO P;  4BW9 A;  2ILM A;  1VF6 C;  3UO3 A;  2PZS A;  1GH6 A;  2EIL C;  3GWO A;  1VQP V;  4CBC A;  1FPO A;  4JTC B;  4B3R B;  4LF8 O;  1U96 A;  3VQW A;  4K8X A;  2A7W A;  3N2G A;  2BTQ A;  4J7Z A;  1T5E A;  4JYY A;  4XDL A;  2AHY A;  4AHC A;  5IDJ A;  2H3O A;  4GX2 A;  1KC8 W;  1KQS U;  2QTO A;  3WB2 A;  3QO5 A;  2RCV A;  3P3N A;  1Q7Y W;  1VEW A;  1JPX A;  4PDR A;  5J2U A;  4GT1 A;  3HKE B;  4B7E A;  1QQC A;  1Z5W A;  2DWE C;  1N0N A;  4PA3 A;  1B6Q A;  4J41 A;  4NXN O;  2XOK G;  5HFL A;  5LP6 A;  2GUZ A;  3ETG A;  3AG4 C;  2YID A;  1ROP A;  3H1K H;  4QPK A;  4NXM B;  4WFE A;  4GUN A;  3UKM A;  3SJA C;  2M7W A;  1DGS A;  2EUL A;  3H1I H;  5B1A C;  3T4Z A;  1OJH A;  3JSN A;  3M8A A;  5D5Q A;  3JAT A;  4KP4 A;  4YY3 B;  3CJH B;  4GKK O;  1B3Q A;  3A0R A;  4LR3 A;  4EB6 B;  3QF7 A;  3OM3 B;  3G67 A;  4LH6 A;  3E8H A;  1DLB A;  3E89 A;  1JR9 A;  1PNK A;  1YIT V;  4O4J B;  3TGU H;  2EIN B;  3K57 A;  3P30 A;  1H38 A;  3TJT A;  2PYL A;  2ODM A;  1EBO A;  3ZHV A;  2IBZ H;  4B3S O;  4U3F H;  3FB6 C;  1PD3 A;  3CS5 A;  4DV5 O;  2QM4 A;  2YXH A;  2EZP A;  3SJC C;  4LF5 O;  4NTY A;  1YDX A;  1AI6 A;  3K0D A;  1M4U A;  2QKS A;  1YJN V;  2R9A A;  4I4T A;  3Q4H A;  3UO2 A;  4DR5 B;  3T1H O;  2E76 B;  2FTK A;  3DXR B;  4JI7 O;  1JA8 A;  3JD1 A;  1TUB A;  2XT9 A;  4UB6 Z;  3BAB A;  3ZJZ A;  4FK5 C;  3OUS A;  5LA6 B;  3KKY A;  1A32 A;  5BXZ A;  5B66 Z;  4IL6 Z;  2A9H A;  2JGU A;  2DYR B;  4DV7 O;  3RYF A;  1DK1 A;  5KX5 A;  1HNW O;  2N74 A;  1HNZ B;  2EX3 A;  2QEX V;  1JMK C;  4I9W A;  4O4H B;  3L72 H;  5CA0 A;  2HLD G;  2ITD C;  4LF7 B;  3K06 A;  1IBL O;  2DJV A;  4DUZ B;  1N32 O;  1G8M A;  1YIJ V;  1QLN A;  1PPJ H;  1VQN V;  1V55 B;  2WLM A;  5EBL C;  4TOI A;  2DYS B;  1QR8 A;  4CH4 A;  4TUY B;  3WU2 Z;  4OX9 O;  1XUQ A;  4PEL A;  2X6A A;  4ICG A;  2EIN C;  1J5E O;  4FLT A;  5JH7 B;  5BR8 B;  1ZAU A;  3FB5 C;  4X66 B;  4O4L B;  4TQF A;  4JI0 O;  4XDK A;  3K5N A;  1PKX A;  2QGN A;  4JF3 A;  5GTH Z;  4X20 B;  4RUF A;  2PI4 A;  5KMG A;  2CH7 A;  1GAX A;  2H94 A;  3OTF A;  3U0Z A;  3CD6 V;  1MZE A;  2ZD9 A;  2JDI G;  1SA0 A;  3B40 A;  1FD9 A;  2JS5 A;  4A5U B;  3KG2 A;  2BOC C;  1ZLZ A;  4IT5 A;  5LHG A;  4DR7 O;  2QE7 G;  4HZ3 A;  1K73 W;  3B4S A;  1VAR A;  3LNM B;  4JI5 B;  5LHH A;  5DED A;  3ZS8 C;  1MOF A;  3ZHU A;  1EN4 A;  1PP9 H;  2Q73 A;  2XAH A;  4CS4 A;  2ZXW C;  2JJ2 G;  3H1L H;  1SET A;  5FNV B;  2PY5 A;  3ZHS A;  3CCS V;  3F5W C;  2DYR C;  5BMV B;  2FL4 A;  3CCJ V;  1FFX A;  3A8T A;  3K03 A;  3CCM V;  1N36 B;  3ZMZ A;  4NR1 A;  1XHZ A;  3JAS B;  3P32 A;  3H1H H;  2XAF A;  3SDL A;  2DW4 A;  5J9P C;  2Q67 A;  3CCE V;  1XIL A;  4J11 A;  2W0X A;  1FYJ A;  4PA9 A;  2ZKO A;  2DOS A;  1QLE B;  4K0K B;  1AP5 A;  1Q8I A;  2AHZ A;  5L3F A;  2KSD A;  4KFM A;  3BVO A;  4QE9 A;  5FLX N;  3R66 A;  2EJ7 A;  4RQE A;  1KP2 A;  3J81 N;  4GX1 A;  1WB7 A;  3ZRX A;  4FMT A;  2WLL A;  2QM7 A;  1EN6 A;  4JI3 B;  1AJQ A;  4LNU B;  2DE0 X;  5JCO C;  3CRM A;  3ABL C;  1JOY A;  3VBB A;  1MAB G;  4CH3 A;  1F51 A;  2MK3 A;  2LGW A;  4DV0 O;  3X2Q B;  2A06 H;  1Q5O A;  3AK3 A;  2Y0P A;  2V4D A;  1R6T A;  4O2B A;  1I94 O;  2LJ2 A;  2R70 A;  3BPZ A;  2YXY A;  4FIP C;  3JAW A;  4LC1 A;  3N2K A;  2CTP A;  2FB5 A;  4DV1 O;  3ASN B;  2NR5 A;  2WLN A;  4L87 A;  2F95 B;  1SQB H;  3L73 H;  1ZX3 A;  1THZ A;  4GCZ A;  2DN9 A;  4F4L A;  1GK9 A;  4K35 A;  4YY3 O;  1RSO B;  4JYB A;  1V9P A;  5KAI Z;  4JGS A;  3B8M A;  2HHH O;  1AJP A;  4FM1 A;  1XHX A;  2Q7H A;  1EN5 A;  5IYB O;  4I7Z B;  4X88 A;  3EXA A;  4NTW A;  4UUJ C;  2UUA B;  3LDC A;  3CME V;  3F7Y C;  1QR9 A;  1HWY A;  2A79 B;  1VQ9 V;  1Q3E A;  2Q0A A;  1NR7 A;  1R3K C;  5L3E A;  3E35 A;  5CB4 A;  3KZI Z;  1W2B U;  4DUY B;  5GON B;  3K58 A;  4HBN A;  2HFE C;  1CPY A;  4QGP A;  4IHJ B;  2MW2 B;  2B1I A;  3TXS A;  4B3S B;  1XNR O;  4UCS A;  2ZDI C;  5L3C A;  4DR5 O;  4EEQ A;  4FM0 A;  4LF5 B;  5FL7 G;  2F23 A;  4JI8 O;  1UJW B;  3W7W A;  2BTQ B;  2X6B A;  2EZO A;  4I55 B;  3T1H B;  3E2E A;  2BTO A;  3HKB A;  4BR6 A;  3CC7 V;  5EZY A;  1WPX A;  1M1K W;  3D3Q A;  2YEV A;  3JYC A;  3ASN C;  5J2U B;  2LFR A;  1HNZ O;  3GB7 C;  3VQY A;  1JJO A;  1UPG A;  1R3J C;  2Q9L A;  4NVP A;  1HNW B;  1RPR A;  4DUZ O;  4O4I B;  2LO1 A;  5EC2 C;  5LP6 B;  2GUZ B;  5IJ9 A;  3M99 B;  1XL6 A;  1IBL B;  3ABK B;  2YIB A;  4UFZ A;  1N32 B;  1P4R A;  5IYZ B;  5BR8 O;  2ARH A;  1D2D A;  3CRQ A;  4X66 O;  1FXH A;  4OX9 B;  3JAT B;  2XND G;  5LXT A;  1XEQ A;  2AXT Z;  4J9Z B;  4DR6 B;  4WFF A;  4CC6 A;  5J2T A;  1Z5V A;  4JI0 B;  2YI9 A;  1WN7 A;  5LOV A;  4PI0 A;  1AJN A;  1H2K A;  2A0L A;  1YVW A;  1GN4 A;  1CP9 A;  1OHH G;  3U11 A;  5K1P A;  1I0H A;  2OIG A;  4FFB A;  3H9V A;  1PL0 A;  4ZI7 A;  1VP7 A;  4DR7 B;  2ZM6 O;  1F23 A;  3ZRW A;  5DN6 G;  2CTW A;  3FKS G;  4I4T B;  2WA4 A;  3MDS A;  3Q4H B;  3CCL V;  3T1C A;  2QWR B;  4RQF A;  1EFR G;  2OTL V;  5CMU A;  1TUB B;  3ZCC A;  3EHB B;  1K5Q A;  1XMQ O;  3O9O A;  1E1Q G;  4UCR A;  4WFB V;  5EIB C;  2GSM B;  5JVD A;  2GDS A;  1K7D A;  1BL8 A;  3RYI A;  5KUK A;  3RYF B;  5KX5 B;  4HYO A;  3ABK C;  4MVM A;  5EC1 C;  3IC9 A;  2LP7 A;  1S76 D;  5CA0 B;  5B3S B;  4K0K O;  3DTU B;  3PN1 A;  1VQ5 V;  1NQT A;  5IE9 A;  2JVD A;  5F2V O;  3JCU Z;  1Q6U A;  5LGN A;  4J80 A;  1KKD A;  5L3B A;  2RN9 A;  2E3C A;  3CXC U;  1Q81 W;  2QWN B;  3AG1 C;  4DV4 O;  3AK1 A;  4JI3 O;  4ZBM A;  3RYH B;  3C3S A;  4OGQ B;  2P67 A;  4BW5 A;  2EIM B;  4IIJ A;  4MTF A;  3RW0 A;  1KD1 W;  2Q5Z A;  4UCV A;  2CH7 B;  2ZE5 A;  3D36 C;  3OGC C;  4MTG A;  3K3W A;  3ZIA G;  5EBW C;  4DV0 B;  1FJG B;  1SA0 B;  3OMN B;  1SC5 B;  3UM7 A;  4YIP A;  1FXK A;  1SQG A;  2DQ3 A;  4OPA A;  1IUR A;  1WNS A;  2ZNJ A;  1I94 B;  1GN3 A;  1WP7 A;  4R7C A;  1H8E G;  1US6 A;  4C7U A;  2YIC A;  4QNH B;  3W7S A;  1KUQ A;  1K8A W;  2YC0 A;  1COW G;  2DWD C;  4DV1 B;  2ZT9 B;  4F6R A;  1K3E A;  1AI4 A;  1M56 B;  1Q90 D;  2HVJ C;  4JZ2 A;  5AG2 A;  1JX9 A;  3WG7 B;  2UXX A;  2UUB B;  2R9R B;  5EK0 A;  1K97 A;  3TET A;  4DR1 O;  1FFX B;  3FFQ A;  2EBO A;  2LW1 A;  2UUA O;  3IAY A;  3QTC A;  4JYC A;  2HEP A;  3G6B A;  2HHH B;  3ETQ A;  4HNA B;  4EFB A;  4DYL A;  2HVK C;  4FZ0 A;  4LBE C;  3SPH A;  1S77 D;  3RFR A;  1V54 C;  4U3J B;  3STL C;  4MW8 A;  3SPC A;  3RYC A;  4PDL A;  4DR4 B;  4LF6 O;  2ATK C;  3IJ4 A;  4DUY O;  5IJ0 A;  4J7K A;  4LF9 O;  1SZX A;  4KXR A;  1IXM A;  1YSC A;  4UCO A;  1D5A A;  3LSU A;  1VF6 A;  2P06 A;  2P4V A;  2CTR A;  1KYO F;  1GTO A;  4PDV A;  3F7V C;  2Q68 A;  3K9S A;  1N33 B;  1Y66 A;  4DXW A;  2B1G A;  4WBN A;  1AI5 A;  1SQQ H;  1XNR B;  1GRJ A;  4Q20 A;  1DF4 A;  4DV3 O;  1BQZ A;  2CAZ C;  2Q7G A;  4YIO A;  2IU3 A;  4JI1 O;  1G6U A;  2HP8 A;  4FPP A;  3D3I A;  5A2Q N;  4JI8 B;  1D5N A;  2IU0 A;  2JIZ G;  3ZN0 A;  3FAV B;  3AG3 B;  3M7M X;  4X1Y A;  1P49 A;  4RAI A;  3BA8 A;  4CC5 A;  4O2B B;  3CP1 A;  3I55 V;  1PV0 A;  3NR7 A;  2OCH A;  3K04 A;  3K79 A;  5L3D A;  4UXN A;  3DC6 A;  3NXS A;  4FZ1 A;  3N2K B;  2CK3 G;  2RMK B;  2ZR3 A;  4JAA A;  3JAR A;  3OEE G;  3KCY A;  4ZOL A;  1XNQ B;  4TV8 A;  4X64 B;  3CEI A;  4PA7 A;  1I5Y A;  2CGO A;  2IJI A;  4ZHQ A;  3CMA V;  5ITZ B;  5IWA B;  4DR6 O;  4PHZ A;  4LFA B;  1NT2 B;  3OEH G;  4LWS B;  1TGO A;  3BAA A;  3MHS C;  4MS2 A;  4K8Z A;  3QG5 A;  3JAK A;  3CX5 F;  4JTA B;  5KAF Z;  3BY6 A;  4P9P A;  1EZJ A;  1W0K G;  4G2K A;  1VQ6 V;  1XDC A;  3C90 A;  3CCV V;  4J10 A;  4LFC B;  1Z2G A;  1HDJ A;  2ZNI A;  3HKC A;  3E83 A;  3FD9 A;  4J7J A;  3TCU A;  1BMF G;  5K1X A;  1S5J A;  5LBQ A;  4LCU C;  5E1A C;  3LDD A;  3L75 H;  2JK5 C;  2R9I A;  3AG3 C;  1L0N H;  2ZM6 B;  3ASO B;  1K4C C;  4I0X A;  2HR3 A;  1M5I A;  3DSQ A;  4UVB A;  3HKB B;  2UXB O;  2A3Q A;  2RJZ A;  4JPR A;  5EZY B;  1ZSP A;  3RGB A;  2QKC A;  3RVZ A;  1XMQ B;  1IXB A;  2K9P A;  5LGT A;  2JEX A;  2DMX A;  3N27 A;  5BZB A;  1KU9 A;  3ABT A;  1V55 C;  2DYS C;  5B1N A;  5LMU B;  3K08 A;  5EBM C;  1NBM G;  1SER A;  4ZKI A;  2P90 A;  1SZT A;  2PGG A;  1WA8 B;  2WLJ A;  5IJ9 B;  4EB6 A;  2GBO A;  4WFH A;  5CBG A;  4O4J A;  1BT8 A;  4F6E A;  1PM9 A;  1SQV H;  3SPG A;  1U97 A;  5JJE B;  4FLV A;  2VWK A;  4RUE A;  4U7O A;  5E79 Z;  3OAA G;  4BWA A;  5LXT B;  4DV4 B;  5L3G A;  3CE2 A;  1DTO A;  3ZX6 A;  3ZED A;  4FM2 A;  4PD4 F;  1H8H G;  3FB7 C;  2XAJ A;  3CWB H;  5J2T B;  3H1J H;  1TUE B;  3S3X A;  2ETN A;  4E4E A;  3HPL C;  2QWO B;  1AP6 A;  2N05 A;  3B2E E;  5LOV B;  2IJK A;  4N23 A;  1FJG O;  1NTM H;  3K0G A;  2YIB D;  3ZMU A;  3TK1 A;  2Z0A A;  2V1D A;  3JCZ A;  3HKD B;  5FPO A;  2F4V B;  1LNQ A;  3MD0 A;  3ASO C;  1ZWI C;  4QE7 A;  2PI5 A;  3AK2 A;  3STZ C;  2YS8 A;  5IYC O;  1AIL A;  3B09 A;  1J95 A;  1TAE A;  4ZI7 B;  4NTX A;  5H6R A;  1AR5 A;  5TIS Z;  3WB0 A;  3ZRW B;  4DRX A;  4TV9 B;  4G28 B;  2UUB O;  4QJF B;  1PNL A;  1ZL8 A;  2OCC B;  2B5U A;  2IJH A;  3IFX A;  5KHJ A;  3TXQ A;  3OE7 G;  2AZ0 A;  1K34 A;  4O2A B;  3FYE B;  4Z1V A;  1YI2 V;  4LF4 O;  1OCC B;  3SYP A;  4PJ0 Z;  4DR1 B;  5CBF A;  4FLW A;  4B7K A;  4E2L A;  1QLE C;  1FS0 G;  1X59 A;  3RYI B;  3I56 V;  2YIA A;  1R6N A;  4DR4 O;  4LFB B;  3E22 B;  1BE3 H;  3G80 A;  4CS3 A;  2YI8 A;  2WLK A;  2UU9 O;  1NZ6 A;  4DV6 O;  4R6Z A;  4WCE V;  1GN6 A;  1XBL A;  4FLX A;  3VQX A;  1SRY A;  4LF6 B;  5KHI A;  5H6Q A;  1VQM V;  2WLH A;  4LF9 B;  1X4T A;  1N33 O;  2LGQ A;  5JQG B;  2UXN A;  4I9Q A;  4NKG B;  1OCO B;  1L0L H;  1MNG A;  5KHH A;  3UT5 A;  3BEH A;  4IYH A;  3IGA C;  4UV8 A;  2OT5 A;  5JCO A;  3X2Q C;  3WFV A;  1WP8 A;  1XI1 A;  3N2G B;  4DV3 B;  2KQX A;  1H2S B;  4WFG A;  2O57 A;  4IIJ B;  5LYJ A;  4JI1 B;  4DR3 O;  3WB1 A;  2P5O A;  1RM1 B;  2Y69 B;  2W0F C;  4NB5 A;  4ABM A;  4MW3 A;  1IBK B;  5H2F Z;  5KUM A;  3HR0 A;  1M57 B;  1BGY H;  1FXK B;  1Q43 A;  1QVF U;  1XMO O;  2QM8 A;  3ZMS A;  2OCC C;  1YCI A;  1SF9 A;  2YXL A;  2UUC O;  3MAQ A;  1W0J G;  1F4N A;  2L35 A;  5GTI Z;  1NKD A;  2FKX A;  2WLI A;  2ZIO A;  5JJJ B;  1S0V A;  5H5N A;  4CH5 A;  3AEI A;  3E8B A;  1L1F A;  2Z5U A;  1XNQ O;  5DM6 V;  4F6R B;  4X64 O;  3S3W A;  4B3T O;  1OCC C;  2XUM A;  3G6E V;  5IWA O;  4P9O A;  4LFA O;  1KMI Z;  3AG2 B;  1OCR B;  3DGE A; 
#chains in the Genus database with same CATH homology
 1QR8 A;  2EIJ B;  2EIK B;  3UM7 A;  1FXK A;  2DQ3 A;  4PEL A;  2X6A A;  3LDE A;  4TT3 G;  2EIN C;  1NH2 D;  4WFA V;  4R7C A;  2OTJ V;  3FB5 C;  1H8E G;  3LSQ A;  4QNH B;  4XDK A;  3W7S A;  1K8A W;  1PKX A;  5LHI A;  1COW G;  2DWD C;  4JF3 A;  5B1B B;  4RUF A;  2PI4 A;  1K3E A;  1OCO C;  1AI4 A;  1M56 B;  2HVJ C;  2H94 A;  4U7N A;  1G4Y B;  3G71 V;  1JX9 A;  1R73 A;  3WG7 B;  3CD6 V;  3H01 A;  2UXX A;  2ZD9 A;  5IYD O;  2ZDI A;  3LUT B;  2R9R B;  5EK0 A;  3MHH C;  2EIL B;  1K97 A;  2JDI G;  3TET A;  1OZ0 A;  3ABM B;  3KG2 A;  1NR1 A;  2BOC C;  2EBO A;  2HJF C;  5KA6 A;  1KEC A;  1CEZ A;  4JAU A;  4JYC A;  5LHG A;  1P7B A;  1NJI W;  2QE7 G;  1VQL V;  4HZ3 A;  2HVK C;  4X8A A;  4LBE C;  3SPH A;  1K73 W;  1S77 D;  3LNM B;  1V54 C;  2Y69 C;  5LHH A;  4PA4 A;  1MOF A;  1E79 G;  1S5H C;  4H33 A;  4MW8 A;  3SPC A;  4MSW C;  3STL C;  2IJJ A;  2F43 G;  2XAH A;  2ZXW C;  5B1O A;  2JJ2 G;  2X6C A;  4PDL A;  2ATK C;  1SET A;  3ZMT A;  1FXK C;  2LFS A;  3CCS V;  3K9A A;  3F5W C;  1IXM A;  2JJ1 G;  2ZQM A;  1YSC A;  3ZRV A;  2DYR C;  4N21 A;  4DO2 A;  1OCZ B;  3SYQ A;  3CCJ V;  2QA4 V;  1GTO A;  4PDV A;  3F7V C;  4QPJ A;  1GM9 A;  2Q68 A;  1YJW V;  1FFT B;  1Y66 A;  3K03 A;  4DXW A;  3CCM V;  3OFN G;  2B1G A;  1AI5 A;  3ZMZ A;  4BIU A;  4Q20 A;  3SYC A;  3FB8 C;  1DF4 A;  2H8P C;  3CCU V;  1K33 A;  3P32 A;  2IU3 A;  2XAF A;  2DW4 A;  5J9P C;  2Q67 A;  4FPP A;  3CCE V;  3D3I A;  2EIJ C;  2IH1 C;  4MTX A;  2EIK C;  3PJS K;  1E1R G;  4GX0 A;  2IU0 A;  1QBZ A;  2EJR A;  4PA9 A;  4JAS A;  3LSS A;  2JIZ G;  2K1E A;  3ZN0 A;  3SPJ A;  4CZZ A;  3AG3 B;  1M9N A;  2HKO A;  2WAM A;  4Z1M G;  2ZR2 A;  1QLE B;  1R3I C;  3SPI A;  1K4D C;  2AHZ A;  2V7Q G;  5L3F A;  4KFM A;  4I5S A;  4QE9 A;  2BOB C;  4RAI A;  4HAM A;  1MSW D;  3CCR V;  3ML0 A;  3CP1 A;  2P6J A;  3I55 V;  4RQE A;  1KP2 A;  5B1B C;  3ZMV A;  1RPO A;  4GX1 A;  3K04 A;  3ZRX A;  1ORQ C;  3K79 A;  5L3D A;  4UXN A;  5GW7 A;  4BAY A;  3NXS A;  4FMT A;  2WLL A;  2QM7 A;  2CK3 G;  1H2G A;  1AJQ A;  4MVO A;  2ZR3 A;  2W6J G;  3ABM C;  3ABL C;  1JOY A;  3SYA A;  3OEE G;  3VBB A;  1MAB G;  1ENV A;  1F51 A;  2MK3 A;  3X2Q B;  3JD2 A;  4PA7 A;  1I5Y A;  5CN0 A;  2IJI A;  3CMA V;  1YJ9 V;  5IY5 B;  1Q82 W;  4ASU G;  3OEH G;  3MHS C;  4MS2 A;  1M90 W;  4JTA B;  2JEU A;  3QO7 A;  3QO8 A;  4FIP C;  2WPD G;  4MVU A;  2D3O W;  4LC1 A;  3BY6 A;  4P9P A;  2KB1 A;  2X7R B;  2DQ0 A;  2GHY A;  3ASN B;  1OCZ C;  2Z3Y A;  2WLN A;  4L87 A;  1EZJ A;  1W0K G;  4G2K A;  1VQ6 V;  1THZ A;  3E8F A;  3AG1 B;  4GCZ A;  3ABU A;  5LGU A;  3CCV V;  4XBF A;  5CA3 A;  4MTO A;  3T4D A;  1GM8 A;  4F4L A;  3E83 A;  1FXV A;  1GK9 A;  5B3S C;  3G4S V;  2Q6A A;  1VQO V;  4JYB A;  3TCU A;  4YXW G;  4JGS A;  2Y48 A;  3B8M A;  1AJP A;  1BMF G;  5EBL C;  2XAQ A;  3IC7 A;  3JD3 A;  1RM1 C;  5LBQ A;  4LCU C;  2HG5 C;  5IYB O;  4X88 A;  1GM7 A;  5E1A C;  3LDD A;  3OR6 C;  1JJ2 U;  4MT8 A;  2JK5 C;  2R9I A;  1MG1 A;  3AG3 C;  4UUJ C;  3LDC A;  1M57 C;  3ASO B;  1K4C C;  2IW5 A;  3CME V;  3F7Y C;  1QR9 A;  1HWY A;  2A79 B;  1YTF B;  1VQ9 V;  3W7U A;  2WWW A;  1NR7 A;  1R3K C;  1K92 A;  4JAV A;  2HR3 A;  1GO3 F;  5L3E A;  3E35 A;  4R8C A;  4UVB A;  4PA6 A;  3CCQ V;  1W2B U;  4JPR A;  2EIM C;  1VQ7 V;  4P30 A;  3CPW U;  3RVZ A;  3OMI B;  2HFE C;  3AG4 B;  1CPY A;  3B8N A;  5H9C A;  5LGT A;  2C2A A;  1K9M W;  2B1I A;  2JEX A;  3CC2 V;  2WLL B;  2ZDI C;  3AG2 C;  4MVZ A;  5BZB A;  3CC4 V;  3SJQ C;  1OCR C;  4UV9 A;  5L3C A;  1VQK V;  3ABT A;  1V55 C;  4XDJ A;  2DYS C;  3D36 A;  3HB3 B;  5FL7 G;  5B1N A;  4P2Z A;  5B1A B;  1QCE A;  3K08 A;  5EBM C;  1NBM G;  3ETE A;  1YTF D;  3B77 A;  1SER A;  4ZKI A;  1UJW B;  1AI7 A;  3W7W A;  2P90 A;  1JVM A;  2X6B A;  3SYO A;  2EZO A;  4MVQ A;  1SZT A;  2YSU B;  3CYO A;  2WLJ A;  5IY5 C;  1BHB A;  2IH3 C;  3E2E A;  4WFH A;  5CBG A;  4H37 A;  1F4M A;  2NLJ C;  3CC7 V;  1BHA A;  2XAG A;  1JCH A;  1WPX A;  1R6K A;  3OMN B;  1S3J A;  5KA5 A;  3SPG A;  1M1K W;  2YEV A;  1KP3 A;  4EKW A;  1M56 C;  1V54 B;  1YHQ V;  1S72 V;  4GX5 A;  3ZRS A;  3JYC A;  3ASN C;  4RUE A;  4U7O A;  3WG7 C;  2NNU A;  1GMG A;  1R3L C;  2LFR A;  3ETD A;  3OAA G;  1ARO P;  2ZXW B;  3GB7 C;  3VOU A;  5L3G A;  1R3J C;  4FJC C;  1DTO A;  2EIL C;  3GWO A;  1VQP V;  4J9Y B;  4CBC A;  1H8H G;  3FB7 C;  4JTC B;  2XAJ A;  1RPR A;  1TUE B;  2ITC C;  3HPL C;  5EC2 C;  3JD4 A;  4UVC A;  2IJK A;  4N23 A;  4XDL A;  5HFM A;  3K0G A;  2AHY A;  3M99 B;  5IDJ A;  1XL6 A;  3ZMU A;  3TK1 A;  3ABK B;  3T2M A;  4GX2 A;  1KC8 W;  1KQS U;  2QTO A;  1NVP B;  1P4R A;  2V1D A;  1AR1 B;  3JCZ A;  4OXS A;  3QO5 A;  1LNQ A;  2Q69 A;  3MD0 A;  3ASO C;  1ZWI C;  1Q7Y W;  4QE7 A;  1JPX A;  4PDR A;  2PI5 A;  1FXH A;  3STZ C;  4GT1 A;  1XL4 A;  2XND G;  5IYC O;  3OW2 U;  1J95 A;  4J9Z B;  4WFF A;  5H6R A;  2DWE C;  4PA3 A;  3ZRW B;  4JTD B;  1B6Q A;  4X89 A;  3OUF A;  4G28 B;  2XOK G;  5HFL A;  4QJF B;  1PNL A;  3ZN1 A;  3ETG A;  2OCC B;  3AG4 C;  1ROP A;  1JQ0 A;  1AJN A;  4QPK A;  2B5U A;  1Y4M A;  2IJH A;  4LP8 A;  3IFX A;  4WFE A;  1PNM A;  3OE7 G;  3UKM A;  1NVP D;  4G27 B;  3W7X A;  2A0L A;  2M7W A;  1OHH G;  1CP9 A;  2P7T C;  5C93 A;  1K34 A;  3FYE B;  5B1A C;  1YI2 V;  3T4Z A;  1DF5 A;  3RBZ A;  1OCC B;  3SYP A;  1Q86 W;  5CBF A;  4MVS A;  4E2L A;  1QLE C;  1PL0 A;  1FS0 G;  4KP4 A;  3ABL B;  3I56 V;  4BIZ A;  1R6N A;  3FYI B;  1F23 A;  4TWK A;  3A0R A;  3ZRW A;  5DN6 G;  3FKS G;  3OM3 B;  2WLK A;  3E8H A;  1DLB A;  4R6Z A;  3E89 A;  4WCE V;  1PNK A;  3E8G A;  3CCL V;  3T1C A;  1YIT V;  2EIN B;  1SRY A;  3P30 A;  1EFR G;  4RQF A;  1VQ8 V;  2OTL V;  4RO2 A;  2WSS G;  2YEV B;  5CMU A;  5H6Q A;  3W7T A;  2WLH A;  1VQM V;  1H38 A;  3ZCC A;  1N8R W;  3EHB B;  1K5Q A;  4MVR A;  1E1Q G;  3R65 A;  4WFB V;  1EBO A;  3OMA B;  2UXN A;  1SES A;  2GSM B;  1OCO B;  3FB6 C;  1K7D A;  1PD3 A;  1BL8 A;  3BEH A;  3IGA C;  4UV8 A;  4WF9 V;  2EZP A;  2OT5 A;  3X2Q C;  3WFV A;  5KUK A;  3ABK C;  4HYO A;  1AI6 A;  3K0D A;  1K5S A;  1WLE A;  4MVM A;  2QKS A;  1YJN V;  2WLI B;  5EC1 C;  3QNE A;  2LP7 A;  4WFG A;  1S76 D;  5B3S B;  3DTU B;  2FTK A;  3EFF K;  4QIW F;  1VQ5 V;  1NQT A;  3JD1 A;  5LGN A;  1RM1 B;  2Y69 B;  1KKD A;  5L3B A;  2W0F C;  3ZJZ A;  1VQ4 V;  4MW3 A;  4UVA A;  3RVY A;  5KUM A;  4FK5 C;  3OUS A;  3CXC U;  1Q81 W;  1M57 B;  3OR7 C;  1FXK B;  3AG1 C;  1QVF U;  2QM8 A;  3ZMS A;  2OCC C;  3JD0 A;  2X0L A;  2A9H A;  1W0J G;  1F4N A;  1NH2 B;  2DYR B;  1NKD A;  4R50 A;  1I5X A;  4ZBM A;  5CBH A;  2WLI A;  2QEX V;  1S0V A;  4KUM A;  2P67 A;  4BW5 A;  3AEI A;  3E8B A;  2EIM B;  4I9W A;  4MTF A;  3RW0 A;  1KD1 W;  1L1F A;  2Z5U A;  4TSF G;  2HLD G;  5DM6 V;  2ITD C;  1OCC C;  3K06 A;  3G6E V;  4PDM A;  3OGC C;  4P9O A;  4MTG A;  1GKF A;  3K3W A;  1G8M A;  2W6I G;  1YIJ V;  1QLN A;  3AG2 B;  3ZIA G;  2XAS A;  1QVG U;  5EBW C;  1OCR B;  3DGE A;  1VQN V;  3E86 A;  1V55 B;  2WLM A;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...