1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
b'MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein MJ223
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
3EETA 1O3TA 2UZKA 1BJAA 3ZMUA 4EMSA 3F22A 3GYHX 3KP3A 2PMUA 1IN8A 4S04A 4I02A 1XSXA 3IHUA 4YFNF 2CFXA 5DCMB 4MGRA 2MA3A 4KNYA 1MJAA 3DV8A 1BI0A 3F72A 5ICCA 2XROA 1BC7C 4HYEA 3DFGA 4NQWA 2W57A 1ZREA 4L9NA 3VEPA 1ZRDA 1OYWA 2FXAA 3RKXA 1W7PB 4RB0A 4Y15A 5CLSA 1SD4A 5AIPA 2COMA 4JK1X 1WSUA 3ZMTA 2PG4A 1U5TC 3Q5FA 3I0TA 4F7ZA 4OOIA 5FLXK 3U2RA 1S29A 5HDKA 2RC4A 2M87A 4HQMA 2EA2A 1IN6A 4Q4ZF 2XGXA 1RZ4A 2O8XA 1U6GA 3GFMA 3TO7A 3LQQA 4G7HF 3GXOA 5K5QA 1B1BA 1BOAA 4PGHA 4IHSA 1HXDA 3HSEA 2PI0A 3JAMK 4OMYA 1STZA 3V8JA 2HS5A 2XKPA 1R5GA 3TO9A 1AOYA 4EJTA 4IXAA 3TDZC 3DQVC 3TGNA 1YIOA 1ZYRF 2A6EF 2A07F 1FSHA 4AIKA 2K7LA 5HOOA 5A2QZ 3GFLA 1BM9A 1FSEA 4GYGA 1O57A 2FNAA 4MNUA 1FYKA 4M72A 5CYVA 1OKRA 3FF5A 3BJOA 5F6FA 4Z2YA 4EJVA 1WQ2A 3DP7A 2A5YB 3C7JA 2NNYA 5E1XA 1R22A 1TNTA 4AD9A 1SD5A 1J5YA 1FC3A 1SMYF 1FBQA 2NAZA 3BY6A 4WXHA 1HW2A 4RB2C 3JTHA 1Z9CA 3KP5A 3IRQA 2E7WA 1YW7A 2XKOA 1YQAA 3FM3A 5ICGA 3C18A 5L3BA 4OIOF 4O5VA 2H09A 3C1DA 3RIRA 3RPQA 3GFJA 4CXFA 2JPCA 3J80Z 2F5EA 2IP2A 3RJPA 4CO8A 1FYMA 2QUFA 1BI2A 2HYFA 2EFOA 3HHGA 2PMHA 2KIFA 1E17A 5A2QK 1XCBA 4UXNA 2VBZA 1XMKA 3MZYA 1TLHB 2KJCA 2YX4A 3WE3A 1YYVA 3FWEA 1IZ1A 3KP4A 4KMUX 2DQRA 4RGSA 3WU1B 1LDKB 1LDDA 1W7PD 2MH2A 1J2XA 3KZZA 4CGZA 4A2UA 1W5TA 1L0OC 4G94A 3SXYA 4LB5A 4WXCA 2EFWA 1PP7U 2TDXA 2CG4A 4KDPA 2CQKA 2GQQA 4I09A 2EV6A 1XN7A 2OBPA 4BH9A 4KT5C 4U7BA 3KE2A 3I71A 3J80K 3RTRA 2MH9A 3DEUA 5DCMA 4B09A 3I59B 3GEZA 5J8CA 5FB2A 1TBXA 2JPBA 2Y0MA 2NS0A 3T5XA 2DPUA 1TTYA 4A0XA 1XCVA 4UNOA 1W7PA 2HZTA 2O61A 1IXCA 1SD6A 5JI6A 4MHGA 2V9VA 1KU3A 3NRVA 3SQNA 5HDNA 2KKOA 2DLLA 3E6MA 3NEUA 4G6DA 5TRDA 4CDGA 2Q8KA 1DDNA 1KQ0A 2ETHA 2OU2A 5TJJA 3GO5A 2FNPA 2AXLA 3HOSA 2LNBA 1HQCA 3FHZA 1RUNA 4HF1A 3I54A 1ZARA 2CW0F 1EV7A 3ROUA 4BHPA 4LD5A 3F6OA 2J5OA 3ABTA 3GUDA 4AIHA 3IRRA 1O7LA 1P4WA 1JHFA 1P92A 2D2WA 3F21A 4HLXA 3HUGA 1LDJA 3WTZA 2XVCA 1T2KA 1TQPA 4JQFA 5LGUA 1HW5A 5JVTA 1LJ9A 2XAGA 5LEKA 2OAZA 4I7HA 2GWRA 3COAC 4P96A 2Y75A 3S2WA 1KYWA 3T8TA 1F5TA 4ASNA 2DTRA 4LJZF 2BE5F 2VBWA 3K1PA 3ZN1A 4KIBA 1TQIA 4FT8A 5K1YA 3DF8A 5DUIA 3ZPLA 1T39A 2CO5A 4FX4A 3W6JB 3MZHA 4WWCA 4YFXF 3FMQA 3RYRA 1P4AA 5JR3A 4HA8A 4HZFA 3RI4A 2YU3A 1U3EM 3E97A 4O6JA 4WXDA 1ZG3A 1IW7F 4TV7A 2VT3A 3F8FA 2RDPA 3VODA 4Q47A 4ZYEA 2C6YA 1FZPB 2XAQA 3KCCA 2F5FA 3GZ6A 5BPDA 4KN7X 3B73A 3ZN0A 3N4MA 3ZMZA 4BAYA 3RYPA 4R8HA 5L3EA 3PQKA 4WK8F 5EEGA 3BPVA 4OIPF 2O6GE 1I27A 1U8RA 5DDGA 5D8LB 2VODA 1FOKA 1R36A 2IA0A 3JSPA 3BJAA 3HHHA 4E70A 3IKVA 3F8CA 2FF4A 4LMYA 2GIVA 5FD5A 3IWZA 2XV4S 1HSTA 1GXQA 3R4KA 3M9AA 1IAWA 3QPHA 1QNTA 3SZPA 4G7ZF 2FRHA 2DFIA 4M9ZA 2ACJA 1C0WA 1QQIA 2XAFA 4LB6B 2WWYA 1USSA 2HKXA 2QQBA 4B8XA 3V7RA 4L5IA 4IJAA 4RB1A 1ZN2A 2UXXA 1ODDA 3HRMA 2ESHA 2AS5F 2E1NA 3LSTA 5CVUA 2M45A 4U88A 5BOXA 3M8FA 5DEQA 4ZH4F 1FWZA 5FFZA 3E5UA 2Z5UA 1GHCA 5J8FA 2PEXA 2OD5A 2RNJA 2L3DA 3WTWC 1XSDA 5E18F 3P9IA 2O3FA 2FEZA 2HR3A 3E6DA 2K02A 2JZYA 2IT0A 3RKWA 5FO5A 5D4RA 4ZYHA 3KZYA 3R61A 1FPQA 2YX7A 1FNNA 1B4AA 3GZ5A 2V6CA 2WTEA 3IC7A 2VT2A 2L01A 4OIQF 1HW1A 3F8BA 3FXRA 5L3FA 1BI1A 4CHUA 2L4AA 3J7AO 4OU0A 2DK5A 1YG2A 3LA2A 1CF7A 1Z1DA 3ZQ7A 2DAOA 2DT5A 2D1HA 4EVIA 2FE3A 3QU3A 3GFIA 2JT1A 4CZZA 2H6CA 2IW5A 1ZRFA 4WF2A 1KQ9A 4EM1A 1B9NA 3QOPA 2GA1A 2ZNZA 1R23A 4IHTA 1W4MA 1U5TA 2QM4A 3LA7A 4IPAA 1HKQA 2QYOA 4XBFA 3FMRA 2K27A 4DNCA 4IF4A 1UCRA 1J75A 2IVMA 2NNNA 4ZZLA 2M8EA 1EH7A 2RKHA 3OOPA 1NHAA 2ZNYA 4EJOA 5FD6A 3CJNA 1YLFA 1Z05A 2GA2A 4XSZF 1IN4A 1U2WA 5DYMA 4XRFA 1FBSA 1HSJA 1MZBA 3MAJA 1I1SA 3V8LA 1OMIA 1UHWA 3CUQA 2DO7A 2EFQA 3WTYC 4XLNF 4P9UA 3LFKA 5L3CA 3R6SA 3FM5A 2HQRA 3RWRD 3GVAA 3JSOA 1XSVA 2XASA 4I2OA 5D6FA 1LQ1A 1J7KA 2HGCA 3BPXA 1IXRC 1QGPA 3KP2A 4KICA 1RIOH 5AIQA 2HKOA 1IF1A 1ZGJA 4OINF 1TW3A 1WKMA 3REOA 5LLQA 1OPCA 4ENKA 3QAHA 4BQAA 2XRNA 3RKYA 3ZMDA 4MTEA 1SFUA 4Y17A 4IRIA 2VOPA 1XGNA 2V1DA 4MTDA 2RN7A 1BIBA 1D8KA 2M1BA 2UWMA 4KYWA 3F8NA 3E6CC 1R1UA 1J59A 4KIFA 3TOAA 2VOOA 2GXGA 1SMTA 1HBXG 3SFZA 2FBKA 2EV5A 1M5IA 2H27A 1QZZA 5FFXA 4XSXF 2VE8A 5H20A 2VBYA 2KIMA 3FX3A 2IRFG 1B59A 2HQNA 1WWXA 5LRSA 2L4MA 1REPC 3DPLC 3M1EA 3WG9A 5IT9Z 4EQQA 3Q9VA 1K79A 4MQ9F 5J6XA 4L18B 4M74A 2NYXA 4LG0A 1DUXC 1RNLA 1IXSB 3RPUA 3V7CA 4M9SA 3DXJF 2PFBA 1QO0D 4EJUA 2ZO4A 1TNSA 1QBJA 2ZFWA 4L5JA 4UVAA 2LKPA 2FA5A 3CLOA 1PDNC 4L0ZB 1H9GA 4PGGA 4LFUA 3O2PE 4WX9A 4H0EA 3EDPA 1TQMA 3WTUC 4LLLA 2FOKA 2R7DA 2G7HA 2R3SA 4LLNA 1F9NA 1R58A 4I0AA 2MD5A 1BI3A 1P4XA 1R5HA 5BPIA 1GXPA 2F5DA 5K5OA 5IT9K 1O7FA 2YPRA 4ENJA 4UV8A 2HOEA 3H3UA 1VTNC 3ELKA 1UHMA 2MLGA 2GXBA 2DPDA 5CVVA 3ISPA 5ILUA 1WRJA 2CGPA 1KA8A 1LVAA 2QENA 2VN2A 3F6VA 2EB7A 2P7VB 3F8MA 3F23A 1YFHA 4M6XA 3EYIA 4G7OF 1G3SA 4CICA 1D3YA 2G9WA 3HSFA 2BV6A 1DPRA 3L9FA 4G9YA 1T98A 2QQAA 4R1HA 2L54A 5EEHA 4G6QA 2H94A 4UHTA 1KU2A 1XDSA 4GGGA 1CF7B 2O0YA 5ED4A 3ML6A 2XIGA 3GW2A 2P6SA 3U1DA 3BZ6A 2F5CA 3P7NA 2K4JA 4HX7A 3WGHA 1R1TA 1XGMA 5DD4A 4LLGF 5D5UB 2RGVA 1Q1HA 3CTAA 4BHBA 1U5TB 1LEAA 4N9HA 2LDUA 1K7AA 2HTSA 3WODF 3M8EA 4Q5SF 1KGSA 1KU7A 1T38A 1QZYA 3QRFF 1L3LA 1V3FA 2IPQX 2UXNA 4KUMA 3T8RA 3BOQA 3FMSA 1D5VA 2R7FA 5LGNA 1O3SA 4ZZDA 4YIFA 1F4KA 1XMAA 2BEOA 2Y48A 2ZKZA 5LRRA 5HLHA 4AWXB 1ZLJA 4EM2A 1JGSA 4EJWA 2OQGA 3DPTA 1X3UA 2DQLA 3L09A 2OQRA 3R60A 2ZXJA 3BWGA 2ISYA 2ELHA 3I5UA 1PP8F 3CUQB 1QPMA 4CYDA 4YFKF 3WGIA 1S3JA 5F64A 1OYYA 4PDKA 3EUHA 2XAHA 1CGPA 3W6KB 3FXQA 2A68F 4L9JA 3L00A 4ESFA 2P5KA 5HLIA 1MJ9A 5JFRA 4RB3C 2PJPA 1ZLKA 3KEOA 3HSRA 3K9TA 2MC3A 1DPUA 3KP7A 1Z91A 2NRAC 2EJRA 1SFEA 3MFKA 3K0LA 3VOEA 4N0BA 3KETA 1T0FA 3E3VA 4A12A 3GF2A 4UVBA 1SAXA 2L02A 1FT9A 1S8NA 3E5XA 3EQLF 5BS6A 1FP1D 4UV9A 4AIJA 5HS8A 4BXUA 5CJ9A 1S7AA 4RGXA 4HV6A 3MCZA 3KP6A 5L3DA 1H9TA 3TQNA 1G3TA 2GZWA 1RI7A 5AONA 1I6XA 3P9CA 2P5LC 5BMZA 1MDMB 4KA4A 2W24A 1FX7A 1SFXA 3L7WA 5LGTA 1T6SA 3WTXC 1KYZA 4GCVA 4D0PA 5HVQC 2STTA 2DW4A 2ZMEB 1Z6TA 2Q2EA 2W85A 1IRFA 5K5RA 2R9AA 4ZYGA 1FY7A 1U78A 3H92A 2EWNA 2BGCA 3LWFA 1DP7P 3ZP5A 3D0SA 1ZAOA 4LG0B 1HKSA 2HEOA 1LB2A 3K1MA 1G3WA 4M73A 3E6BA 2P6TA 1PUEE 1GVJA 1HKTA 3O6BB 2W25A 4A5NA 3WTVC 2ZCWA 3HTUA 1USTA 5KVRA 3K1NA 1O3RA 2G7UA 1ON2A 5E8IA 3C3WA 3JAMZ 4RAYA 5CVIA 3VB2A 1F1ZA 2K86A 4BYYA 2DU9A 3ULQB 3KLNA 4L9VA 4I0BA 4QLCU 4MQVA 3K2ZA 3WE2A 3LQRA 4M71A 3BDDA 2V1XA 3D5LA 1G4DA 3CUOA 2JSCA 2ZBKA 1RUOA 3OV8A 3IWFA 5E20A 3U9GA 2DK8A 4L9TA 3MEXA 2D45A 1G6NA 2VBXA 5D5VB 3TDUC 4HBLA 3O3KA 2FMLA 3HRSA 3G3ZA 5D8KB 2RQPA 2WV0A 5D5WB 1XDUA 2D1VA 3ECOA 3KLOA 4NHJA 2PLYA 4HV5A 2IA2A 5E8GA 1AWCA 1P6RA 4IVNA 2IJLA 3IKTA 2PN6A 3T0YA 4YG2F 4Q48A 1KQ8A 4A0ZA 4U7DA 2KIUA 4A6EA 1EH6A 3HRUA 1B6AA 1P2FA 1MJBA 1ULYA 2HWVA 4L0YB 3GX4X 1ZG5A 2RV8A 3CUQC 4RGUA 4HF0A 2YR2A 4UVCA 1FBUA 4YIIA 3NQOA 1YW9A 3BP8A 2V79A 2KJBA 3QU6A 2ISZA 4NB5A 3I4PA 2OZ6A 2OZUA 3AAFA 2OA4A 3ECHA 4LK1F 1JE8A 4OIRF 2K4BA 4HQEA 2P8TA 1BC8C 2QBYB 3HTSB 2M30A 3TOBA 3J81Z 1UB9A 4PCQA 1LNWA 4RS8A 3FXUA 4HLYA 1YO5C 4MEXF 1KU9A 2KRFA 4ENMA 4JBAA 1XD7A 3CO6C 5DCFA 3V7SA 2X4HA 2HDCA 4GXOA 3WTTC 2Z99A 2P7CB 2A6HF 4P55A 2Q0OA 1MDMA 3JW4A 4HF2A 3TKYA 2YSRA 4GO1A 4MEYF 2LSOA 5LHGA 3T1BA 2ZMEA 1ZG1A 4O3MA 3DKWA 4IRHA 4A0YA 2VC1A 3HIFA 5LHHA 2FMYA 1K78A 1ZRCA 3SZTA 3KFWX 2VC0A 1J9IA 1J0RA 2DI3A 3M7GA 4HDUA 3N97A 4KIGA 1IUYA 2QWWA 1LEBA 1I5ZA 3J81K 4FHTA 1IN5A 4P9FA 3CDHA 5FGMA 1S7OA 3H3ZA 1K6OA 3GWZA 2QQ9A 4EGZA 1E2XA 1Z7UA 1BIAA 4A6DA 3P9KA 5LHIA 3HOTA 1R7JA 2V1UA 4M9XA 3V4GA 4ENNA 2FSWA 5H6RA 2P5VA 5IT3A 4N9IA 2PQ8A 1D8JA 2FBIA 5H6QA 4LK0F 4DQ2A 4UUVA 3LAPA 2WC2A 3L2CA 1EH8A 2VONA 2Z3YA 3BJ6A 2QVOA 1A04A 4U0YA 1MKMA 3R0AA 2J5PA 2M5WA 4OMZA 3K69A 4AVPA 5E1WA 5D5XB 4I98B 1WI9A 4P5OA 1JHHA 1YW8A 1G3YA 5BQTA 2QLZA 3GLXA 3PQJA 3E5QA 2O03A 2EA4A 1TW2A 1OR7A 2XAJA 1W5SA 5JHUA 3PFIA 5D4SA 4KFCA 2EV0A 1MGTA 2MLKA 4WCGA 1BN5A 3FZVA 4HAMA 3IL2A 1YTYA 4BHCA 4R79A 3R0JA 1H0MA 3B02A 4RAZA 5ERIA 2E1CA 2VE9A 2FBHA 1YS7A 6PAXA 5KK1A 2ADUA 4HOBA 3F3XA 2HFHA 3KEQA 1XGSA 2DBBA 4Y13A 4G8XA 3WTSC 3V8KA 3VFZA 4KMFA 3QP6A 4FX0A 2CWEA 3G73A 1ZHFA 1XB4A 3QP5A 5DUKA 1ZGAA 3JTGA 4IRGA 3SR2C 2ESNA 3ABUA 5LEJA 4ON0A 5E1ZB 2CSOA 1FP2A 1SD7A 1BBYA 1Y0UA 2VXZA 2QBYA 1R00A 3SHFA 2A3SA 4PZJA 1IRGA 3WU0A 2IA1A 2XUBA 2X0LA 3Q9SA 1O3QA 2LF8A 3EYYA 4EV0A 4M6YA 2Z33A 4I01A 4A5MA 4EM0B 1XGOA 2BYVE 2EK5A 1Z6RA 5E17F 1UFMA 3I53A 5HDGA 4S05A 5HS7A 2EFPA 3CO7C 2FQ3A 4HX4A 1MD0A 2PBIA 2BBYA 2MBFA 2GAUA 2HTJA 1ON1A 3MWMA 4HW0A 4ESJA 1I1GA 2B0LA 4U0VA 1FYLA 2XHKA 2H6BA 1R1VA 1B9MA 1OYIA 2RVCA 2HYGD 1JXSA 3QPTA 4HX8A 2EFNA 3I58A 5F1RA 2Z9OA 5HS9A 5ILVA 4XLPF 3LA3A 2FU4A 4QWQA 3MQ0A 2A69F 2P4WA 3BROA 5ICFA 2E7XA 5CVRA 2QM3A 2F2EA 2JRTA 3ZMVA 3ZMSA 3I59A 4RGRA 1ONVA 4LGWA 2A61A 1IN7A 4K2EA 4EGYA 3HYIA 1FLIA 1V4RA 4U0WA 3ERED 5DD8A 1ZH5A 3LAJA 5L3GA 5CVJA 2ZJ2A 2CYYA 4GYIA 5D6EA 4ETSA 5LBQA 2STWA 3I64A 4KN4X 2W84A 2LF7A 5HLGA 5ICEA 2QZ8A 4HDVA 3TO6A 3HRTA 5DV5A 5ILSA 1S6LA 1K78B 4BNCA 3WGGA 4ESBA 4ZYDA 2JTVA 1YS6A 5FLXZ 3RDIA
chains in the Genus database with same CATH superfamily
4FM0A 3JAKA 4M3EA 2LG4A 3OEHG 5GTHZ 3VQWA 5KHJA 2ADQB 2Q8VA 3AG4B 5C4JJ 3EETA 2YIBA 4FTHA 1O3TA 2WLIA 3BRCA 2MK3A 5H9CA 3ZBHA 2UZKA 2R92J 1BJAA 1Y8QB 5HLTA 1H38A 3ZMUA 2I10A 4EMSA 2PI4A 3F22A 3LSRA 1MMDA 2A79B 3GYHX 3KP3A 2IJIA 3CCLV 4OPAA 2PMUA 3LL7A 4ABMA 1IN8A 4S04A 1WJBA 3CJRB 4QPQA 4CC5A 2ME6A 4LF6O 2EX3A 1K4CC 2OCEA 1TWFJ 2IGKA 2HVJC 1YJWI 3AG1B 4I02A 4RBOA 4BE0A 3CESA 1Y39A 1W36C 1X3WB 5CBGA 1XSXA 3CCYA 4B3TO 5HODA 1QR9A 3IHUA 4YFNF 4CH4A 4TOIA 1K5SA 3O9OA 2CFXA 4X65O 5DCMB 4ABZA 2B9SA 4L8JA 1DP3A 1YJ9V 4MGRA 1AA7A 2MA3A 4KNYA 1MJAA 1SVLA 2M7BA 1FD9A 1VQOI 3DV8A 4IIJB 4TV9B 1ORKA 2PI5A 2W0XA 3GCMA 1BI0A 3F72A 3OL3A 4DK1A 5ICCA 2XROA 4X64B 3GTKJ 4LIUA 1BC7C 2X6OA 1RRJA 2HOAA 2I5UA 3FXLA 2DE0X 4R50A 5KA6A 2XF6A 2YS9A 4HYEA 3DFGA 3OMNB 4YY3B 4NQWA 2W57A 1ZREA 4GKKB 4L9NA 3VEPA 2IBZH 1YSCA 4MVUA 1ZRDA 1OYWA 2DJVA 2FXAA 2HVQA 1K4SA 3RKXA 4RO2A 3H1LH 3H9JA 4H37A 4LF9B 1XL4A 1P9QC 3PM1A 1HR0B 4XIDA 1W7PB 2VL8A 4RB0A 4Y15A 4Q6GA 1Z2GA 4C3JJ 3OT7A 1OHHG 5JH7A 2GBYA 2IXSA 5CLSA 1SD4A 1CQTA 1F43A 5AIPA 2COMA 4JK1X 1WSUA 1KB9F 1ZX3A 3E83A 3ZMTA 5FROA 2JS5A 2PG4A 4DGWB 4H33A 3CCEV 4DIQA 4BE2A 5JLXA 1U5TC 1LFUP 1MW7A 4X89A 3CHXA 3Q5FA 4KXRA 2PJRA 3I0TA 1OQYA 4F7ZA 2KSDA 4OOIA 1U97A 2BOLA 4I9WA 3FKSG 5FLXK 1P4RA 4TT3G 1RETA 1S29A 4NC8A 3U2RA 2DYRB 2WA3A 5HDKA 3HKEB 2IBDA 2BY1A 2RC4A 2M87A 4HQMA 2EA2A 5J1YA 5DM7F 2R5ZA 3QG5A 4PA7A 4JI0B 2UXDB 1IN6A 4Q4ZF 2TRTA 1RZ4A 1VNDA 1U6GA 2O8XA 2XGXA 3H1CA 3J7ZI 1LUVA 2Q7GA 3GFMA 3ASNH 3TO7A 4G27B 3TXSA 4MT8A 3CCUI 4O2AA 1R4MB 1R3JC 3K06A 1I94B 2CUFA 5J47A 3I55V 3LQQA 3EFFK 2R4GA 4G7HF 3T4ZA 4RUEA 3CXHF 3ESWB 3GXOA 3HGGA 5E79Z 4EATA 5K5QA 1B1BA 4M3BA 5J2UA 5F0FA 1BOAA 4PGHA 4IHSA 4F91B 2XF7A 1JA8A 2VQGA 1R6TA 1HXDA 3HSEA 1B8IB 2PI0A 5IYZA 3JAMK 3QYFA 4OMYA 3PFYA 1URFA 3UO2A 1STZA 3V8JA 1RESA 2HS5A 1US6A 1RPRA 2LFBA 1R5GA 2XKPA 3K4JA 2M0MA 4OAYA 3TO9A 3IFXA 4LH7A 4PI0A 4UFZA 1AOYA 1H2LA 4ZYAA 1TZLA 3K2AA 2X1EA 3UT5B 4EJTA 4DUZB 4K0KO 3H1HH 4IXAA 3TDZC 3DQVC 1K8AW 3KCXA 3HR0A 3TGNA 5KX5A 2FKXA 4U3JA 2QEXV 1YIOA 1ZYRF 2A6EF 3AG2B 5E1AC 2F4VB 2P81A 1I7FA 2DA2A 4D6TH 2LKSA 4JI1B 2E3CA 2NR5A 3IV5A 2A07F 4RM2A 1IBMO 1JT0A 1FSHA 1N25A 4AIKA 1K73W 2K7LA 5HOOA 2AXTZ 3ZS8C 4BW9A 4F6EA 2LC2A 5JJJB 2UXCB 2K5CA 3LSHA 2IM9A 3BCBA 4FE7A 5A2QZ 3GFLA 4DV1O 1BM9A 3BR6A 2YEVA 2IS2A 1FSEA 4V2FA 3OR1C 4GYGA 3SYTA 4PDLA 4BBRJ 1O57A 2FNAA 1RM1B 4MNUA 4BL0B 3OYIA 2F6CA 4I50A 1FYKA 3A2FA 2KLOA 4M72A 4XQFA 5CYVA 3FXOA 1J5EB 1OKRA 3FF5A 4DV3O 3KIOA 3HC7A 2DDAA 3BJOA 1BQ0A 5F6FA 2EINC 4GLXA 3HKCB 4Z2YA 4EJVA 1WQ2A 1VEWA 2G38A 1VQ7V 1RC9A 4DYQA 4TQFA 1SFKA 3DP7A 2A5YB 1SQXH 3C7JA 3JD1A 2NNYA 5E1XA 2LH9A 1R22A 1KD1W 1TNTA 3BZKA 2DYSH 4AD9A 5CA0B 1SD5A 2JUGA 1J5YA 1FC3A 2W6IG 4ITVA 1SMYF 3VYUB 2BVLA 5DTDA 5J4YA 1VQPI 4BW5A 2QGUA 1FBQA 1JTXA 2DMQA 2NAZA 2WB1A 2DDBA 3BY6A 2IJHA 2JEXA 3D3QA 4WXHA 4DR7O 2M8GX 1ETQA 1UFIA 1HW2A 2ID6A 4JP0A 4RB2C 1PKXA 2WAQN 3JTHA 1Z9CA 3KP5A 3SPGA 1PM9A 3S32A 3IRQA 4IZZA 2E7WA 5H2FZ 1YW7A 1G6UA 3UCSC 1XTAA 2XKOA 2XHBA 3N2GB 1YQAA 3FM3A 5ICGA 5IYCJ 3GTMJ 3C18A 5L3BA 3BR3A 5CBFA 5IP7J 2ZQMA 2K3PA 1JJ8C 1X1DA 5J1RA 3CXCU 3E1SA 4OIOF 4O5VA 1EJ9A 1WH5A 1X1PA 4FLWA 2H09A 3WB2A 3ZIAG 3C1DA 1VQMV 1Y76A 2ZM6O 3TJTA 3HOXJ 3LMMA 2FUG2 2HVSA 2QTSA 5EIBD 5LP6C 4BQOA 3ZQCA 3KCYA 4TV8A 1VQ5V 3RCOA 3RIRA 3RPQA 5DM6F 2BTQB 2E5LB 3GFJA 4BIUA 4DYRA 1T95A 4CXFA 4MVQA 2JPCA 3J80Z 3SJMA 4IQJA 2F5EA 2BSKB 3WB0A 2IP2A 3RJPA 1OZ0A 3ZXSA 4CO8A 1G8MA 3NWSA 1BJZA 2JVHA 1FYMA 2QUFA 1BI2A 2HYFA 2EFOA 4RQEA 4KL1A 3HHGA 1AHDP 2PMHA 2KIFA 4GRIA 2Q68A 1E17A 3LUTB 1SS3A 1HW7A 4XOTA 2P4VA 5A2QK 3W6VA 4CS4A 3CCRV 5HFMA 1XCBA 3SYOA 3P5JA 3C90A 4UXNA 4FMTA 4F52A 4LBEC 2VBZA 2CFOA 4UCSA 1XHXA 4C2UA 1XMKA 1V55H 1TLHB 3MZYA 1XMOB 2VQLA 2EIKH 2NS8A 5B1BH 2C2AA 1PUFB 5CBHA 2KJCA 2JJ1G 2UUZA 3F0CA 2YIAA 2YX4A 3WE3A 3QO5A 1YYVA 2ITDC 5IP6A 2R7ZJ 2Q0OC 3DLLF 2JDIG 3FWEA 4ASUG 1IZ1A 2GLOA 2GTAA 1R6KA 3KP4A 4KMUX 1UAAA 3UQ8A 3JSNA 3S14J 1F4NA 2X48A 3GBGA 5GW7A 5LMUO 2DQRA 2WLKA 2K9QA 4RGSA 1MBKA 2X6AA 3W7UA 2L9NA 3GZNB 4M3DA 1MMAA 4IEJA 3WU1B 2A7WA 3GTOJ 4XKBA 1LDKB 3R65A 4LFCB 1LDDA 2ZMEC 1W7PD 2MH2A 2R0QC 3K5OA 1J2XA 3KZZA 3VYSB 1TUEB 4CGZA 4A2UA 3ML0A 4NTWA 4J11A 1W5TA 4PJJA 4F55A 1L0OC 1X4TA 4G94A 3UKMA 3SXYA 4LB5A 2YXYA 3M7MX 2DMTA 3S1NJ 2AGAA 2RQQA 3H5RA 3BG6A 1YITI 4I0XA 4WXCA 2EFWA 1PP7U 2TDXA 2CG4A 1SKVA 3GMEA 4WBNB 5IE9A 4KDPA 1Q90D 1Q8IA 4AC0A 2CQKA 1K33A 1GK9A 2GQQA 2CU7A 4JX5A 1SETA 4I09A 2EV6A 3EVKA 4ZTJA 1YJ9I 2WAQA 3G2BA 5TISC 1XN7A 2OBPA 1NTZH 3HB9A 2JEUA 3BABA 4LWSA 2QKCA 1TWGJ 3JATB 4BH9A 2IS6A 4W4LA 4KT5C 2JA8J 1YDXA 2FB5A 3AG4C 4CSWA 2ZDIA 5GTIZ 2UU9B 4U7BA 3KE2A 3I71A 2ZKOA 3J80K 3RTRA 4D7MA 1HA8A 2W6JG 1HNWB 4IL6Z 2MH9A 3DEUA 5DCMA 3H1IH 1TWHJ 4B09A 2ATKC 2L7ZA 4EEFG 3CMEV 1E0EA 1VMGA 1BR1A 3G1OA 3I59B 1JFFA 3GEZA 2XTAA 4TV9A 3JALA 1HOMA 1S5HC 1P7JA 2HVKC 1GM8A 1VQ6V 4XONA 2EILH 5J8CA 1KP3A 5FB2A 1TBXA 2RREA 3Q4HA 5KHHA 5IWAO 2JPBA 4B1RA 3PN1A 1Q5OA 4O4JB 3ZQHA 2Y0MA 2NS0A 1GLNA 3T5XA 1AI6A 5FKNA 2DPUA 1BL8A 1TTYA 4A0XA 1B06A 2HQ5A 3CCEI 4PDVA 1XCVA 5EEAA 4UNOA 1WNSA 1W7PA 2HZTA 1M57C 2O61A 2OJED 2HXOA 1IXCA 1SD6A 4FETA 5JI6A 4FFBA 4MHGA 2JA6J 3K04A 1WJFA 2LGQA 1M93A 4RAFA 2QWPB 5EZGA 2QSFX 3CCQI 1KECA 1Y6XA 2HDDA 2EH3A 1IBLO 1NVPB 2BOBC 2WLJA 3WHCA 2V9VA 1KU3A 3B6AA 1R6RA 2Y0SN 2VQFB 3PNYA 3SPIA 1XMQO 1I5XA 3NRVA 3J7AY 4M3FA 1G4YB 1GKFA 3LSMA 5EBMC 3I55I 2LO1A 3K0DA 3SQNA 5HDNA 2O5RA 2EIMC 4PHZA 2KKOA 4X6AJ 4YEJA 4UUTA 4LNUA 3RFRA 1TL8A 2DLLA 4K35A 5JJNB 5F04A 5CMUA 4CS3A 4V19K 2A3QA 1TWCJ 3E6MA 3NEUA 3HKEA 4IYIA 4K8XA 4G6DA 5TRDA 1IZ3A 4J9ZB 1UG0A 1S77D 3B09A 4CDGA 4PFPA 2N74A 2Q8KA 2GBOA 1DDNA 2MGQA 3FFQA 1KQ0A 2ETHA 3GTQJ 3CD6V 2OU2A 2FQ4A 1I3AA 5TJJA 2DYSB 4J19A 5J1UA 3GO5A 2FNPA 1Y8RB 2AXLA 3SEQA 2QF7A 1R9TJ 3JAKB 2EZIA 4MW3A 5B3SC 3HOSA 2LNBA 1HQCA 1VZ0A 2HJDA 2QEXI 2QE7G 3FHZA 1RUNA 4GDFA 4HF1A 3I54A 1ZARA 1B8IA 5EYPA 2CQXA 4LF7O 2CW0F 5KHGA 3DPUA 2YSUB 1BW5A 1VQ9V 3HJEA 1EV7A 3H01A 3A03A 3ZR8X 3NARA 3OWTA 3ROUA 4XLHA 2JA7J 3TBIA 1QLEB 4BHPA 1AU7A 4LD5A 4A3JJ 1JGGA 3OGCC 3CRAA 3HG9A 3UT5A 3F6OA 4NXMB 4WFEA 2J5OA 1OR7C 2AQEA 3ABTA 3JD4A 3OGIB 4YHHB 4AQYO 3LDCA 5J2TB 3DBRB 3GUDA 1A35A 3H3VK 1OCOC 2WLMA 2P67A 1X2MA 4CBCA 1BHBA 4IHJA 4AIHA 3IRRA 1DGSA 3FB6C 1AR4A 1XNRB 1O7LA 1P4WA 1JHFA 4HG2A 1P92A 3VBBA 1IC8A 2D2WA 1X3ZB 3LSSA 3F21A 1AR5A 4HLXA 3DLAA 2KRCA 2FX0A 3ERMA 3BPZA 4DBQA 5JCOC 2LJ2A 2Y69C 3HUGA 1LDJA 3WTZA 2XVCA 1T2KA 1VQ7I 4P9PA 1RR7A 1FJLA 2E71A 4BGDA 3ZRXA 1P7BA 1QQCA 5J40A 1MSEC 1TQPA 4NQWB 5GTHC 1ENHA 4JQFA 2DA3A 1Y1VJ 5LGUA 2EBOA 2K9MA 1GMGA 2XDVA 1HW5A 5JVTA 1LJ9A 2XAGA 3VDXA 5LEKA 2E74B 3K4LA 2OAZA 1Q6IA 4I7HA 3WG7B 2GWRA 4DV0B 1MBEA 3JCZA 1V55B 4PSXA 3HKCA 3COAC 4OPHA 4P96A 2EIKB 2Y75A 3S2WA 4XLFA 1KYWA 5LA6B 1SQVH 4CCMA 3K58A 3T8TA 1MABG 2UUCO 1F5TA 1ZAUA 2VUMJ 1N78A 2Q7HA 3VWBA 4ASNA 2DTRA 3OYCA 1I39A 3L2UA 4LJZF 2WA0A 5B1AC 2ZJPF 3CWBH 1ZGWA 2BE5F 2AQFA 4PDRA 2VBWA 2O57A 3B8NA 1VQMI 1Q43A 3K1PA 3ZN1A 4X1IB 2PJRB 4YJ3B 1N34B 4Z1MG 4KIBA 2E1MB 1VQ5I 1R1BA 3MD2A 1RKTA 3WHBA 1XBLA 3OYHA 1TQIA 4ZI7A 4FT8A 3OTOB 1W0UA 2F48A 1Q6UA 1N8RW 2CE4A 1HP8A 2VQEO 5AG2A 1E79G 2R5ZB 5K1YA 3F7YC 2Y31A 3DF8A 2R7TA 1YX5A 1WPBA 5EBLC 5DUIA 3ZPLA 2CQ7A 1ZWIC 4FPPA 2GIZA 4FZ1A 2BXYA 1T39A 2CO5A 4O2AB 3E8BA 4HPQA 4FX4A 2MD0A 5FL7G 3X2QB 1X2NA 4I9QA 3W6JB 3MZHA 4WWCA 4PSWA 1GDTA 2BTQA 5J2UB 4YFXF 3L1PA 3FMQA 3S3MA 3JD3A 3RYRA 5LOVA 3CCRI 3MN2A 1P4AA 4UCVA 4JI1O 1NQTA 1PD3A 2BCCH 2JS3A 4QPKA 1LE8B 1N36O 4ANJA 5JR3A 2ZJRF 2DN9A 4HA8A 4G12A 3NR7A 3KYLA 1XDCA 4HZFA 3RI4A 3PO3J 3B77A 4DR3O 4KJZA 3DSQA 4OX9O 1OCCH 2YU3A 3HM5A 3CCMI 4X1KA 1U3EM 3E97A 4O6JA 3ZHRA 1X58A 5F0CA 4WXDA 4K3AA 1Y0NA 5KX5B 1YJNV 4AM3A 5BXZA 4C2MJ 1WGXA 1ZG3A 1KQSU 1IW7F 1ETXA 4TV7A 4FLYA 3FIWA 4XLCA 1SEUA 2VT3A 2ZSHB 2MYSA 4C3HJ 2IU3A 3F8FA 2RDPA 3VODA 4A3CJ 2EILB 4Q47A 1QHTA 1HNZO 4ZYEA 1KONA 3J7AU 2JGUA 1Y6IA 5B1OA 2Y9ZA 2C6YA 2B7EA 2A05A 4C2TA 4DV7B 3CF2A 3S1RJ 1FZPB 2XAQA 3L75H 3KCCA 2R72A 2F5FA 3J81N 3W2WA 2RN9A 3GZ6A 5BPDA 4BR6A 1YI2V 3L9DA 3ZX6A 4KN7X 1Z5VA 2XGEA 2A06H 1TA8A 1BQZA 5E79C 3CJQB 4E2LA 2LK2A 1OCTC 3B73A 3ZN0A 4GX5A 3TK1A 2HPMA 2EIMH 4GT1A 4DV4B 4FM2A 2DOEA 3N4MA 3DU5A 1CPYA 5KHKA 1WPXA 4GX1A 2PY5A 3ZMZA 4BAYA 3BG7A 3C2HA 4UB8Z 3RYPA 4R8HA 3I3LA 1MNDA 5L3EA 1EZVH 3SJCC 3PQKA 4BEHA 4WK8F 2M2EA 5EEGA 3IP4B 3SFIA 3LSKA 2JA5J 3BPVA 4OIPF 2K9PA 2KDZA 3MDSA 2O6GE 1U9NA 2LMDA 3OIPA 4WBNA 1NVPD 1ETKA 2P06A 4NXMO 1I27A 1U8RA 5DDGA 1DGWY 5B3SH 4UY8I 5D8LB 2VODA 1FOKA 4IGGA 3CMEI 1R36A 2IA0A 3K6GA 3JSPA 4IT5A 3BJAA 2OCCH 3C2GA 2F1MA 2M3AA 2ZT9B 1VQLV 3ZRSA 3HHHA 4E70A 5C8YA 4J41A 3IKVA 1K4DC 3JCUZ 3F8CA 5IPAA 5K7HA 4QIWF 1U8BA 1VQ6I 2AXTC 2HP8A 1ROPA 4E7HA 2FF4A 3GLLA 4LMYA 2GIVA 3EPZA 5FD5A 1R5ID 3IWZA 1XNQO 2XV4S 1HSTA 2L9RA 2NOGA 1FKAO 1MNGA 1GXQA 3R4KA 2VPLA 1DTOA 2KMUA 3ABLH 4GX0A 4XM3A 3J80N 4NXNB 1GUUA 1X4OA 3M9AA 3ZQGA 3A1YA 1IAWA 3QPHA 4BUPA 1JKOC 2NVTJ 5CPRB 1IXMA 1QNTA 1W59A 2RQ6A 3IGAC 3SZPA 1XX5A 4G7ZF 4ZDLA 3S1MJ 1IDZA 3D36C 1M56C 2FRHA 2R93J 5JQGA 2Y4UA 2DFIA 3BQZA 4M9ZA 3M3YJ 5LXTA 4DR5O 1KBHA 2ACJA 1C0WA 3RQIA 4O4JA 1QQIA 2ZJQF 1HNXO 2BVMA 2XAFA 4LB6B 2WWYA 1USSA 2LP7A 2HKXA 2QQBA 3DU6A 4B8XA 1G59A 3DWLE 3FXKA 2K9SA 2Y69H 2PTMA 4JOMA 3KYCB 2JUCA 5K1PA 4YIRX 1E3HA 3V7RA 5KAIZ 4L5IA 4IJAA 2O9LA 1HWYA 3N2KA 4DV6O 3L2RA 1WCMJ 4NTXA 4FLTA 4QNHB 3K9SA 4DK0A 3FD9A 4C30A 4J7JA 3CMYA 3VYTB 3CSXA 4KT6A 3OS1A 1S76D 2ZB9A 1GV2A 4GYCB 2P5OA 1WJDA 1R71A 4RB1A 5BZBA 1ETWA 2CJJA 4XN0A 1ZN2A 2UXXA 4A3MJ 1N0NA 5H2FC 4E7SA 2A9HA 1TVKA 1WJCA 1ODDA 4Q20A 5F2VO 4DR6B 3P3PA 3HRMA 2AZ0A 3DTUB 2ESHA 1BSMA 3RN4A 2AS5F 1D2DA 2E1NA 3LSTA 3QO7A 3OTFA 5IJ9A 2JSPA 1IBKO 3FXJA 5CVUA 5B1NA 3ABMC 1FOXA 1P7GA 1ZL8A 5CKTA 2M45A 3IC9A 4U88A 5BOXA 4BXXJ 4JI4O 3M8FA 5DEQA 4IX7A 4ZH4F 2WWWA 1PPJH 1F36A 1FWZA 5FFZA 1ZSPA 4HBNA 3E5UA 2RNGA 2Z5UA 4JI3O 4JV5O 2EIJC 2F4OB 1IRZA 1GHCA 5J8FA 4IHXA 2PEXA 2XSJC 1QLNA 4DR4O 2KFDA 3OY9A 1VQ9I 2NXNB 2W00A 1S7EA 2ELKA 3HKZN 2OD5A 3G4SI 1BW6A 2AW9A 2RNJA 4C3IJ 2CTRA 2F5VA 2L3DA 3WTWC 1XSDA 4BBSJ 4JYAO 4FE4A 2P6JA 2ZNJA 3AG3C 3SZGA 5E18F 3DC6A 4I0XB 3T4DA 4B3MB 3P9IA 4L5EA 2GUZA 1QU3A 2O3FA 3CP2A 2DT6A 2FEZA 1WP7A 2HR3A 3E6DA 1Z5WA 2K02A 4E7JA 1UELB 3BCAA 3IUOA 4O2BA 2JZYA 1X1AA 3GWOA 3CPWU 5F1JA 2IT0A 3E2EA 3QQAA 1QVUA 3RKWA 2QKLB 5DS9A 5FO5A 1F51A 1KP2A 3TL4X 5D4RA 4BACA 2RCVA 4JTCB 3JAWB 4LWSB 4PA9A 4ZYHA 3K4MA 4IKFA 3SYAA 3KZYA 4X62O 4YRVA 3LNQA 3OMYA 1FPQA 3R61A 2YX7A 5IY5H 1B4AA 1FNNA 1N33B 1K6YA 2V6CA 3GZ5A 3TXQA 5J2TA 5CA3A 1NH2B 2ETNA 3Q0UA 2WTEA 1FJGB 4GKJO 1Y66A 5IJ0A 4F92B 1T5EA 3IC7A 2VT2A 2L01A 4OIQF 1NKDA 1HW1A 2B5UA 3F8BA 1OCRH 3PL8A 5IYDJ 3E35A 2JRMA 1NS1A 4DW0A 3BR0A 3FXRA 5L3FA 1XI1A 4X8AA 1JFFB 1WB8A 3JALB 1BI1A 2VPRA 4H4KC 4CHUA 2L4AA 2WAMA 3J7AO 1KKDA 4OU0A 1NZ6A 2PMZN 1VARA 2DK5A 4KFMA 1YG2A 3JSLA 3LA2A 3Q4HB 1G1XB 2JQ7A 1R4NB 1OCCB 1CF7A 5KHIA 5M5XJ 1IJWC 1Z1DA 3ZQ7A 1B3QA 2DAOA 2DT5A 2HEPA 2D1HA 3QYBA 2Y4TA 4R8CA 3ETEA 4AU7A 4EVIA 1Z3XA 1Q82W 1QVTA 2FE3A 3QU3A 1K34A 3GFIA 3ZEDA 4Y33A 4FFBB 4H0LB 1W1WE 2PZSA 2CV1A 1WA8A 3DTEA 2JT1A 4CZZA 2H6CA 4PUSA 2W82A 2IW5A 1AI7A 2MW2B 3G80A 5LA6A 5JLWA 5CB4B 3K4BA 4V2GA 1ZRFA 4WF2A 2XGDA 3CE2A 3THOA 1KQ9A 2GSMB 4TWKA 4EM1A 4J01A 1I6HJ 4QJFB 2WLLB 1B9NA 3QOPA 2GA1A 5GAHJ 2ZNZA 4X64O 1UJWB 5GTIC 4LFAB 1R23A 4X1IA 4IHTA 1W4MA 1U5TA 2QM4A 1Y74B 4O4HB 4YJ3A 3LA7A 4YY3O 2NVQJ 3WG7C 4GKKO 2QWNB 2E60A 4IPAA 1HKQA 2QYOA 4XBFA 3FMRA 3B40A 3E8GA 4LNUB 1BOBA 4MSWC 3CCQV 4LF9O 1M1KW 2K27A 4DNCA 2CAZC 4CCLA 3FKJA 4IF4A 1HR0O 1WHUA 1UCRA 1J75A 2F93B 3BT9A 5GP9A 2VRZA 1UJ8A 4DR2B 2IVMA 2KZGA 4B4CA 2NNNA 3S8PA 1U0JA 3VPRA 1FFXA 2B63J 1B6QA 4F93B 4B08A 5C93A 4ZZLA 2M8EA 2QSAA 3FX7A 4JASA 1EH7A 2RKHA 3OOPA 2XC7A 1NHAA 5KHDA 1TWAJ 1YJNI 3P32A 2ZNYA 2VKDA 4EJOA 3ZQIA 3HOVJ 1SESA 3JD0A 2OCCB 3ASOC 5EYPB 5H5NA 3O8HA 3A0BZ 4DJAA 5FD6A 1LE8A 1YEWA 3CJNA 1IUFA 3I5DA 4NC6A 1YLFA 1Z05A 2GA2A 4XSZF 1NK3P 5JVDA 2BTOA 1IN4A 2CUEA 1S0VA 1U2WA 2KQRA 3DXRA 5DYMA 4QTRA 4XRFA 1MOFA 2B1IA 3RT3C 1FBSA 1HSJA 1MZBA 2M4GA 1LUJB 1D5NA 1FXVA 1SQGA 4JI0O 3MAJA 4FVMA 1OJLA 2UXDO 1YI2I 2AO9A 3AL0B 2JA2A 1FXKB 1VF5B 4DV5O 4DR1B 2CV2A 1I1SA 3V8LA 1KYOF 2VWJA 1I94O 3RW0A 4IHJB 1OMIA 1Q3EA 2OWOA 1UHWA 3HL2A 3CUQA 2DO7A 1K7DA 4J00A 4BJ5C 4FASD 1WAZA 4YIOA 4DV1B 3KPHA 2EFQA 3WTYC 2IGOA 2LGWA 4O4IB 4NKGB 4XLNF 4JZ2A 4PDMA 2F23A 2IU0A 2MG4A 3HUGB 4P9UA 3LFKA 3FXMA 5L3CA 1ORQC 3R6SA 3OIQA 2YUAA 3FM5A 2V9PA 4K8ZA 1OCZH 2E76B 3OSGA 2Q69A 1BHAA 2RNBA 1H2MA 2HQRA 4A69C 2IJKA 2DMXA 3RWRD 1V54C 3GVAA 2LRDA 3M07A 3JSOA 2JJ7A 1XSVA 4DUZO 5M5WJ 2XASA 4D9JA 4I2OA 2HJFC 2HPIA 4BQNA 5D6FA 3A01A 1LQ1A 1J7KA 2HGCA 3BPXA 1IXRC 2F4VO 1QGPA 4LFBO 3KP2A 2BY3A 4KICA 5M3MJ 1VQLI 1GRJA 2QSGX 1RIOH 2HU9A 2GV9A 2ZXWB 5AIQA 3LSIA 2DA1A 2HKOA 3K0GA 3K03A 3ABKH 5LD2C 4JX4A 1ZK8A 1IF1A 2N04A 1CP9A 1ZGJA 2UXCO 4OINF 3E22B 2YI9A 5FNVA 4FFKA 1SANA 1ZUQA 4RA2A 1ETVA 1TW3A 1WKMA 4AILC 3REOA 2X1DA 2F43G 2LFRA 2NVUB 5LLQA 1OPCA 4ENKA 2Q6AA 3QAHA 3AG3H 4BQAA 1L8DA 4B7KA 2XRNA 3RKYA 3ZMDA 4RLFA 4MTEA 4A5UB 2V4JC 1SFUA 2Q4PA 4ZI7B 4Y17A 3RBZA 3S3OA 3R66A 1WH7A 1NU1H 4CS2A 4IRIA 1J5EO 2VOPA 4RUFA 1XGNA 2BW3B 2V1DA 3IAYA 4Y3OA 3VSLA 2YXHA 5B66Z 1ZTRA 2XB5A 1TP4A 3OR6C 4MTDA 3IAM2 2X6BA 1I50J 2RN7A 4EB6A 2ZXHA 4B3SB 1BIBA 1D8KA 1M90W 2M1BA 5C3EJ 4B43A 3GB7C 3BA8A 5LMNB 5LP6A 2UWMA 1KUQA 4CYCA 4KYWA 1Z21A 3F8NA 1GN3A 2LQTA 3E6CC 4JZGA 4PA4A 4HSTA 2H1KA 5LOVB 4KITB 1R1UA 2CW8A 3QOEA 1J59A 1R3LC 4KIFA 2EPFA 3SEZA 3EXAA 2EQRA 3TOAA 2GXGA 1SMTA 2KL4A 2VOOA 3ZOBA 1HBXG 2LW1A 3C3SA 3SFZA 5IY5B 4IO9F 3D5SC 1LFPA 3HPGA 2QCOA 3D8CA 4D7SA 5EZYA 5EG0B 1VFCA 1BA5A 4X1KB 1GN6A 2FBKA 2OF7A 1JKRC 2EV5A 1IV8A 1FTTA 1OCRB 3IH2A 2DMUA 3CLQA 3H0GJ 2QKSA 3KZIZ 2YU9J 1BS3A 3LSJA 3TW7A 4AIDA 3CRCA 1NH2D 4TUYA 3MKLA 1M5IA 3OE7G 2H27A 4NC7A 2VASA 1W0TA 1QZZA 1EA3A 2W1OA 2ILMA 4U7NA 2E19A 1G2HA 3TCUA 2E5LO 3FBNB 5FFXA 3LSUA 2D3OW 2FYUH 3ICXA 3U10A 3CCMV 1RSOA 2IGMA 2EBIA 4XSXF 2VE8A 5H20A 2DOFA 2H8WA 3W2VA 1WZ2A 2Y9YA 2VBYA 2H8PC 5LYJB 2KIMA 3FX3A 2IRFG 3RYFB 2UUAB 4LF5B 1B59A 4A3GJ 5GAEJ 2HQNA 2KP6A 5EGOB 1IG7A 3W7TA 3SJAC 1WWXA 5LRSA 2L4MA 3DEEA 4DW6A 1H2KA 4B7EA 3RYCA 1REPC 3HBLA 3CRMA 5FKKA 3DPLC 4LF8B 3LFUA 2IH1C 3M1EA 1H88C 1EF4A 3HPHA 3A0HZ 3GWKC 1OFCX 3WG9A 4BEHB 1L0NH 2B1GA 5IT9Z 3E89A 3S3XA 4XORA 2QSHX 1XMOO 3CDLA 4EQQA 3Q9VA 1GM7A 2E1OA 1K79A 2M7WA 2BZTA 2EZHA 3S1QJ 3CC4V 4MQ9F 5J6XA 4L18B 4BS9A 4M74A 3FK7A 2DTZA 4PFOA 3JRBA 2NYXA 4LG0A 2XGCA 1DUXC 4JF3A 4OXSA 5C8YB 3JAWA 4FLZA 4ZBMA 4IQ4A 1YIJI 1RNLA 3K4KA 3ASNB 5EIBC 1POGA 3HPLC 4ZJZA 1IXSB 2BY0A 2R7UA 3CJHB 5A9GA 3QWLA 4DYCA 3RPUA 3ZJZA 2CUGA 4LFCO 3BTCA 3V7CA 2KDOA 3BR5A 4M9SA 4HSRA 1AR1B 1N32B 4DV2O 3DXJF 2PFBA 1XUQA 2JVGA 1QO0D 2DJIA 4EJUA 3OS2A 2ZO4A 1TNSA 4KHPB 1QBJA 2CS3A 2D2CB 4Z1VA 1XHZA 4DOZA 3A2KA 3W7SA 1JUSA 2ZFWA 2VJIA 4N21A 5JQGB 2BY2A 4L5JA 4D7NA 4ZIBA 5LXTB 3OR2C 1YXBA 3JRAA 4UB8C 4UVAA 2LKPA 3AG1C 1SFOJ 4P1WA 2FA5A 2IAIA 2R7RA 1D5YA 1VP7A 5FLXN 2ZNIA 3CLOA 1PDNC 4RQFA 4L0ZB 3GTPJ 1H9GA 1V5GA 1WLEA 4PGGA 5KMGA 4LFUA 3O2PE 4WX9A 3AEIA 3N2KB 1QU7A 1IBLB 2UU9O 4H0EA 1FYJA 4QPOA 3W3CA 4P2ZA 1V54H 1HNWO 3EDPA 1TQMA 3WTUC 4Z6YA 4LLLA 2K85A 5F0HA 2R5YA 3L72H 2QWOB 5CB4A 2L9VA 3JCUC 4M3GA 1AI5A 4XNFA 2EINH 2FOKA 4JYBA 2R7DA 1TVKB 2WLLA 3SPJA 1A6QA 2A6TA 5DM6V 2G7HA 1OCZB 2R3SA 4LLNA 3DC5A 1F9NA 1R58A 3O65A 3QPLA 1HDJA 4I0AA 5IJ9B 2MD5A 1Y74A 1BI3A 1P4XA 1R5HA 3FYEB 3WU2Z 3JAMN 5BPIA 1XPXA 4F6RB 1ZL8B 3HOZJ 1GXPA 3OIOA 1EZJA 3T2MA 2F5DA 2DCEA 5K5OA 5GADJ 2GHYA 5IT9K 1N4CA 1O7FA 2YPRA 3N27A 1QBZA 1SC7A 4GZRB 4N4OB 4RAGA 5BR8B 3DEWA 3ABKB 3KG2A 2CW7A 4ENJA 5EBWC 1W0KG 2R9IA 3K59A 4NUBA 2NVYJ 1E1QG 4PJMA 4WFBV 4UV8A 1QZEA 2HOEA 1AI4A 3H3UA 1VTNC 2X51A 2E75B 3ELKA 1UHMA 3CMMA 2LVSA 2MLGA 3VSKA 2Q2EB 2GXBA 2IJJA 2JGDA 5CN0A 2ELJA 2DPDA 5KAIC 2VQFO 1XG1A 3I56I 2GUZB 5CVVA 4H13B 2GM4A 5FPOA 4QPJA 3ISPA 5ILUA 1WRJA 4C9YA 3K70D 4I76A 4A3IJ 2CGPA 2DYRC 1BR4A 2I8DA 5EYRA 3DBHB 3S15J 4U3FH 5IOZA 1WJ5A 2DWEC 2FD5A 1PNLA 4O2BB 1JPXA 1KA8A 2ZC2A 2PUSA 1LVAA 1IGNA 2L7FP 1BE3H 2WSSG 2QENA 1QPIA 2VN2A 3F6VA 4IOAF 1NI8A 2JWTA 2JVDA 3G4SV 2EB7A 2P7VB 3F8MA 3TMOA 3F23A 1YFHA 4M6XA 4G28B 2X9DA 3EYIA 2VXDA 4G7OF 1G3SA 1FXKA 2E34A 4CICA 2P90A 1D3YA 4E7KA 4UCUA 5J9PC 2G9WA 4CUGA 1I5YA 2WY8Q 3HSFA 1GT0C 2BV6A 3J7YJ 3JYCA 4X66B 1R49A 1Z3YA 5IJ0B 1K4TA 1KC8W 1DPRA 1RFYA 3AG7A 3L9FA 4G9YA 1T98A 2QQAA 3FBIB 4R1HA 1BL0A 4XLAA 2HOTA 3JASB 4JYCA 2L54A 5EEHA 4G6QA 2IH3C 2H94A 4O4IA 1Q81W 1FAFA 1XMXA 2MABA 4UHTA 3HKDA 1KU2A 4I55B 4QIWN 3CDIA 4PELA 1NTCA 1XDSA 4GGGA 2O0YA 1I3QJ 4W1UA 5ED4A 1CF7B 3ML6A 4Y4RA 1Y1WJ 2CV0A 1Q6HA 2JJ2G 3AG2C 2XIGA 3OMIB 4PI2A 4ZOLA 3FISA 4IHYA 1SVMA 3GW2A 2P6SA 4M6VA 4BKXA 1TC3C 1GO3F 2F4IA 5IYDO 4JI8B 1E3PA 4BE1A 3U1DA 3BZ6A 1FTZA 1MNEA 2R7OA 3OYJA 5KUKA 3K4CA 1WA8B 2WLHA 2ZINA 5FLMJ 4XLEA 2F5CA 3P7NA 3PIOF 5D5PA 5B1BB 4JI2B 1XNRO 4DZJA 1GM9A 2K4JA 4HX7A 1MBHA 1T8IA 2DA5A 3WGHA 2Y0SA 2KB1A 3M1CA 3E22A 2DMNA 1R1TA 4KISA 1XGMA 1RM1C 5DD4A 1LR1A 2OPTA 4LLGF 5D5UB 2M0CA 2RGVA 1MMSA 1GN2A 1EN5A 2HHHB 2QM8A 3HZJA 4N23A 1Q1HA 3CTAA 2DA7A 4BHBA 1U5TB 1B04A 1LEAA 1IO2A 4N9HA 2LDUA 4A3BJ 4A3KJ 1SQBH 4DYLA 2VQEB 4DUYB 1K7AA 1ZTEA 4GX2A 4FQGA 2HTSA 3WODF 4I6ZA 3M8EA 4Q5SF 3CP1A 1MZFA 1KGSA 4S0HB 1KU7A 4UCTA 1YZBA 4CCKA 1T38A 3LNMB 2EULA 1QZYA 2BW3A 2WA4A 3QRFF 1L3LA 2F66C 1V3FA 2ZE6A 3RVZA 1A36A 3RVYA 4DV0O 1EN4A 2E35A 1Q7YW 1MBGA 5A2QN 2WADA 3K5NA 1WB7A 5JVGF 2IPQX 2UXNA 1FFXB 4KUMA 3T8RA 4XKCA 5KCMA 3AG4H 3BOQA 2E2HJ 2NNUA 2ODMA 3OR7C 3FMSA 1LVKA 1D5VA 2L5QA 2ECBA 4JI7B 3N05A 4II3A 5BNGA 3FB5C 2R7FA 1FPOA 5LGNA 1O3SA 3SGIA 4LF4B 4ZZDA 5IYBJ 3I4MJ 2X6XA 2ZXIA 4D5CA 4YIFA 3IH3A 1XMAA 2BEOA 4XMYA 4E6KG 1F4KA 1N34O 2Y48A 3S2DJ 2ZKZA 2YS8A 2HG5C 5JVDB 5LRRA 3ZRVA 5DN6G 5HLHA 3OTOO 3CP8A 2DFHA 4AWXB 5EG0A 3DXRB 3RYIB 4P30A 1ZLJA 2OCHA 4EM2A 3HOYJ 1JGSA 1H8EG 4EJWA 2OQGA 3DPTA 3ZHQA 1X3UA 2ID3A 4NYKA 4JTDB 2R7QA 2DQLA 4AUXA 3L09A 2OQRA 3R60A 2ZXJA 3BWGA 3HEFA 2LY9A 2ISYA 4MIMA 4G2KA 2PF4E 2ELHA 3I5UA 1PP8F 3G6BA 2UXBB 3CUQB 1QPMA 4CYDA 1VF6A 4YFKF 2CTQA 3WGIA 1S3JA 3CMAV 5F64A 3UM7A 2ITCC 2UUBB 1OYYA 4PDKA 2OC6A 3EUHA 2XAHA 3LOCA 4PJ0Z 2KKWA 3B6CA 1CGPA 3W6KB 2COBA 2XUMA 3FXQA 2RJZA 5LFAA 2JK5C 5LYJA 3RYFA 2A68F 4CH5A 2CDYA 1J09A 4J9YB 4L9JA 5EGOA 2GTSA 4J10A 3L00A 4ESFA 4LP8A 3SPCA 2P5KA 2H3OA 2W4SA 5CQEA 3CC4I 1VF7A 5HLIA 3JD2A 1VQ4V 4A3DJ 2EZLA 2Y0PA 3PUFA 3A01B 1DQUA 2DN0A 3BG9A 1YRNB 1MJ9A 3A0BC 1JKPC 1L0LH 4FM1A 4AHCA 3TETA 4C7UA 1ERDA 3DTIA 4PA6A 1LKXA 3TP0A 5JFRA 4RB3C 2E5ZA 1R3KC 1SQPH 2EINB 4MW8A 2M6YA 2PJPA 3B2EE 1ZLKA 1XEQA 3KEOA 1UHSA 4LIVA 2N8GA 3HSRA 3S93A 3K9TA 3L2VA 2MC3A 1DPUA 2DJNA 5FKLA 5FNVB 4DV7O 3KP7A 2Q7EA 2VIXA 3F5WC 1Z91A 3FHNA 2NRAC 1RR8C 3L74H 2X7RB 4BXFA 2Q1ZB 2EJRA 1SFEA 4CCNA 1S72V 3MFKA 2VS0A 3K0LA 4RDUA 2NOJB 3EUKL 1QNMA 3VOEA 4N0BA 3HGYA 1T0FA 3KETA 4IHVA 2Q0AA 3C2BA 3CJHA 3AK2A 3G6EV 5HNHA 3E3VA 4A12A 3GF2A 3TW6A 4MVSA 4UVBA 1SAXA 3QYEA 2L02A 1A5JA 1FT9A 4E7ZA 1S8NA 1X59A 4LG3A 4B3RB 5EZHA 2KISA 3BTLA 3CC2I 1JMKC 4EB6B 5JWPA 1AP5A 3E5XA 3EQLF 3IAS2 5BS6A 1WVRA 5KLVH 5LP6B 1MBFA 1LNQA 1OCOH 4CYCB 2CH0A 3T1HB 1FP1D 4UV9A 4AIJA 5HS8A 2L35A 3K57A 3ASNC 1SQQH 3CS5A 1YITV 5EC2C 4BXUA 1LPQA 4FJCC 5CJ9A 1S7AA 2CUJA 4RGXA 2ZR2A 3OM3B 1FMWA 3B8MA 4HV6A 4CCOA 1EBOA 4JGSA 3MCZA 3ZHVA 3KP6A 4FCYA 1DLBA 5EZYB 5L3DA 2DWDC 1FOWA 3A4CA 1H9TA 2V1NA 3A02A 3MD0A 3RSNA 3AG2H 1Y4MA 3P30A 4YXWG 2CGNA 3LSPA 1Z77A 3TQNA 1XC5A 3VQYA 3T1YB 4NXNO 2HXIA 3H9QA 4TUYB 1W36D 2GOXB 1G3TA 1Z67A 2QTOA 3OYFA 2GZWA 3PNTA 4XOPA 2QA4I 3M4OJ 4FLVA 4JPRA 4UB6Z 4NBQA 4ZKIA 1RI7A 4ZHQA 5BMVA 5AONA 1I6XA 3TP3A 2ARHA 4XKVA 1RSOB 1K5QA 4JI5B 5B66C 3P9CA 3OYAA 2P5LC 2AHQA 1M9NA 2P7TC 1BR2A 2VWKA 2K40A 2RAEA 5BMZA 3ETDA 4F6RA 4HNTA 5B1AH 1MDMB 2KG7B 4JI6B 4KA4A 2W24A 1FX7A 2V4DA 1Z0XA 1MG1A 1U96A 3PSIA 4IOCF 1P49A 4J7ZA 1KMIZ 1SFXA 3L7WA 2HQAA 5LGTA 3RYCB 1T6SA 3WTXC 4A93J 4AI8A 1Y56A 1T08B 1KYZA 5HFLA 4GCVA 4D0PA 4J42A 2DT7B 4D1QA 5HVQC 5TGTA 2DW4A 2STTA 5EK0A 2ZMEB 2RMKB 3OW2U 1Z6TA 1YTFB 2YUSA 4R6ZA 1FFTB 2FTKA 3NWTA 3SDBA 3UNGC 4R7CA 2WAFA 2Q2EA 4TQDA 3APQA 2W85A 2M4KA 4DR6O 1IRFA 5K5RA 2R9AA 4ZYGA 1DGRM 1MBJA 1FY7A 2JN6A 1U78A 2CTPA 2G0EA 4O4LB 4CH7A 4DW1A 3CZ6A 2XF5A 3H92A 2EWNA 1MMNA 2BGCA 1LFBA 3LWFA 1DP7P 1V9PA 3MHSC 3RGBA 5KAFZ 3PO2J 3BG5A 2JK3A 1OJHA 4LF6B 3ZP5A 1OISA 3D0SA 1R3IC 2LD5A 5B5EZ 9ANTA 1ZAOA 4LG0B 5JJEB 4B3TB 1HKSA 2JMWA 1WPKA 2HEOA 1LB2A 2DYSC 2ADPA 3K1MA 2OTJV 2W48A 4GKJB 4X65B 1G3WA 4M73A 1VQNI 3E6BA 2P6TA 3PNVA 4FISA 2NVXJ 1PUEE 2CH7A 1YHQI 1GVJA 1N75A 4XICA 1HKTA 1NK2P 2KIQA 1ZLZA 3O6BB 4JYKA 2W25A 2YICA 1WJAA 4A5NA 3WTVC 3H1KH 4WFAV 2ZCWA 1AKHB 5FKOA 5C4XJ 5GPCA 1HCRA 3GTJJ 1SA0B 3HTUA 3JASA 4EFEA 3CC7V 1USTA 4B3MO 4LOCA 5KVRA 1QLEC 1YIJV 1E3OC 4PJNA 3K1NA 3FK6A 1ENVA 4MVZA 3A0HC 1O3RA 2G7UA 5FPRA 1ON2A 1OCPA 5E8IA 4I55A 4HZ3A 3C3WA 2LOOA 2GDSA 3JAMZ 4JAVA 3BTIA 5EF6A 4RAYA 3SYCA 4AYBN 5E3MA 1ITYA 5CVIA 2HLDG 2ZE5A 3RYHA 3S3WA 3VB2A 5KMGB 3H9VA 1F1ZA 2K86A 1FIPA 1M57B 1N33O 2F4MB 3DBLB 4BYYA 4FZ0A 2DU9A 3D5RC 4X1YA 4XDKA 1FJGO 3ULQB 1AJPA 2R5YB 1N77A 1IX9A 1XQ8A 2K9NA 3KLNA 4L87A 1Q86W 4XL9A 4L9VA 5KNLA 1EFRG 1V5FA 2L7MP 2LLKA 4I0BA 4MQVA 4QLCU 3K2ZA 3JRGA 3DGEA 3OEEG 1AP6A 1IURA 4BDZA 2LBFB 3WE2A 4UCRA 3NXSA 3LQRA 2V6EA 2X1CA 4ZDPA 1S5LZ 4M71A 4IL6C 3W7WA 4NNJA 2EIMB 3BDDA 2V1XA 2DXIA 3U11A 1V55C 3RKQA 3D5LA 2EIKC 5B1BC 3G71I 1FEXA 4H44B 3KEYA 1G4DA 2ZFUA 4ICGA 1YE9A 1WN7A 3CUOA 3V42A 2JSCA 2ZBKA 1RUOA 3OV8A 3IWFA 1JUPA 1S9HA 2M9HA 5GONA 5E20A 3HKZA 3U9GA 2DK8A 2XNDG 3MHHC 3W7XA 4L9TA 1K92A 1D0XA 3S16J 2BE3A 3G67A 2JGDB 1D0ZA 2E1MC 3MEXA 3OYMA 1HC8A 2WB1N 1S5JA 5B3SB 2ZR3A 2D45A 2QKMB 1G6NA 2VBXA 4D5FA 5D5VB 5EDNA 2EZOA 4LFAO 3TDUC 2L0KA 4XRSA 4HRIA 3OSFA 4HBLA 5ITZB 3O3KA 2FJ1A 2FMLA 2IS4A 1SAUA 4JX6A 1M1EB 4K0KB 1PVEA 3G3ZA 3HRSA 5D8KB 2BHZA 2W7NA 1DU0A 2RQPA 3CMAI 2WV0A 5D5WB 3L70H 4DV5B 1XDUA 3RYIA 2D1VA 3ECOA 4XDLA 2MW8A 3ABLB 3X2QC 3QPSA 2YDEA 2ZSIB 3KLOA 5DEDA 2R7XA 4DR2O 1MZEA 2VI6A 1IBMB 3I56V 4NHJA 2PLYA 1X1CA 3M8AA 4HV5A 2IA2A 5E8GA 1AWCA 1P6RA 1IDSA 4IVNA 2R7WA 1OCOB 4BIOA 4BY1J 3FAVB 4IHWA 5IOYA 2ME0A 2NN4A 2IJLA 1VQ4I 3IKTA 1BGYH 1XL6A 2K1EA 3K3WA 2PN6A 3T0YA 5FJ8J 3CCVV 2V9KA 2QJ1A 4XN3A 4YG2F 4Q48A 1KQ8A 2PMZA 4A0ZA 2DMPA 2KIUA 3BLYA 4UUSB 2XPUA 4U7DA 2Q9LA 1IXBA 2Y69B 3LNNA 5M3FJ 4MO7A 1P7IA 4A6EA 2XSDC 1EH6A 3HRUA 5C44J 3HKDB 3LSQA 1B6AA 1ETYA 1P2FA 1MJBA 4X1EA 4GUNA 1ULYA 3OD4A 4DV3B 4AYBA 4LFBB 1DF4A 2HWVA 4ZOLB 2CUZA 4L0YB 1EN6A 3GX4X 3ABMH 3UKGA 3MAQA 1ZG5A 5BY1A 1BZKA 2RV8A 1YRNA 3CUQC 2EILC 4IYHA 3OS0A 4RGUA 4DR1O 1T33A 5K1XA 1NH3A 1S72I 4HF0A 2VQCA 3H35A 2EIJH 3BA9A 3BR1A 4ZC3A 2YR2A 4UVCA 4BDYA 5E3NA 1FBUA 3G6EI 2Y0IA 4DR7B 1ZELA 4YIIA 3NQOA 3BG3A 1MSDA 1A31A 3OYDA 1YW9A 3BP8A 3ZRWB 2H8RA 2V79A 5B1AB 2KJBA 3BAAA 3KYDB 2O7OA 1MMGA 3K79A 3OAAG 4EEQA 2AHZA 1QR8A 3QU6A 2ZE7A 1Q1VA 2DODA 1N0JA 1XS9A 3B4SA 2ISZA 2KQXA 3CCSV 4I4TA 4BQQA 4JAUA 5FLVA 4X20B 2P0WA 3FB8C 3OYGA 3GVMA 4WFGA 3H5NA 1T56A 1X19A 2ZM6B 4NB5A 1KKCA 3I4PA 2VJ5A 1E1RG 2OZ6A 2OZUA 3ZHSA 3AAFA 3PJSK 2Y2ZA 4QE7A 4JTAB 2OA4A 3ECHA 1BT8A 4J7KA 1G8XA 1PJRA 1XOUA 3K10A 4PD4F 4LK1F 4YJ2B 2CQQA 1YTFD 2Q67A 1JE8A 1WP8A 1MIJA 4OIRF 4Y52J 2K4BA 2V26A 5F08A 4HQEA 3BEHA 2P8TA 3ZCCA 1GN4A 1BC8C 2QBYB 3HTSB 2M30A 3JARA 4XDJA 3RZDJ 3TOBA 3J81Z 3PIPF 2NLJC 5FRMA 1UB9A 4MVRA 2QDOA 2V7FA 3L71H 1K97A 4PCQA 2E2IJ 3ZHUA 2LKXA 3VOUA 3JRDA 3E8HA 1LNWA 4RS8A 3ZCOA 3FXUA 4HLYA 2CTWA 1YO5C 4MEXF 1KU9A 1WI3A 2KRFA 4ENMA 2RDCA 5IYBO 1ETOA 3RPUD 2XOKG 2XAUA 4JBAA 3CYOA 1QVGU 2PYLA 1XD7A 3CO6C 3PSFA 5DCFA 4B3SO 2LP0A 3KKYA 5LMNO 3V7SA 3ETGA 4U7OA 2X4HA 1GVDA 2E36A 2DOSA 4HNAA 2O8KA 3DTKA 3WU2C 1K3EA 2HDCA 4GXOA 2JRIA 2WLNA 1QHHD 3WTTC 2YIDA 2Z99A 3BQYA 2P7CB 5FRNA 1NR1A 3CCJV 2M7AA 2A6HF 4P55A 4A3LJ 1NBMG 2Q0OA 5LMUB 1X1BA 1MDMA 2KG7A 1JVMA 3JW4A 3OL4A 4HF2A 4HNUA 1XREA 3TKYA 2Z0AA 4OGQB 2YSRA 3OUFA 4X0GA 1VIBA 3G1LA 4GO1A 4MEYF 2LSOA 3LDDA 1GTOA 5LHGA 2FOWA 3WG7H 3T1BA 2B9ZA 2EJ7A 2CGOA 1EKEA 1COWG 1VQ8V 1I0HA 2XPWA 2ZMEA 1ZG1A 1GH6A 1IDYA 1QHGA 4W4KA 4LC1A 3QF7A 3S17J 1JOYA 4O3MA 2OTJI 3W2AA 3OYNA 3MVPA 3DCFA 2BHYA 3DKWA 4O4LA 1RKWA 4FK5C 1LUWA 4BWAA 4IRHA 4A0YA 1MNMC 2VC1A 3HIFA 2QGNA 2ZIMA 3BCCH 1PYVA 4I7ZB 5LHHA 4MTFA 4PA3A 2FMYA 1K78A 3H1JH 3CRQA 2LR8A 4N4NB 4PJLA 1APLC 1ZRCA 3SZTA 2L6LA 4LF5O 3KFWX 3FDYA 1YCIA 4TSFG 2UUAO 3CC7I 1WJEA 3AFHA 3ASOH 1ZQ3P 2VC0A 3CCLI 1J9IA 1J0RA 4QSHA 1VQKV 2R7SA 1AB3A 2DI3A 2E5NA 3K4NA 2GXAA 1UG2A 4LF8O 3SDLA 3ZGKA 3AK1A 3M7GA 4HDUA 3N97A 1QVFU 3STZC 4KIGA 4PJ0C 1IUYA 1YF2A 2QWWA 1BMFG 3A8TA 1TT0A 2DQ3A 1XILA 1LEBA 4XK4A 3X2QH 2OIGA 1I5ZA 1FMVA 2DFFA 3SDGA 2Z2SB 1IN5A 4FHTA 3J81K 1AKHA 1SA0A 5IWAB 4P9FA 2LREA 1NT2B 3CDHA 5FGMA 3A0RA 1S7OA 3H3ZA 3O8GA 1K6OA 3GWZA 2QQ9A 1R73A 4EGZA 3QO8A 1M56B 1E2XA 3F9KA 3M99B 4NDLA 4BJ6C 1JQ0A 1Z7UA 4Z2WA 3OYKA 4RLQA 2ZDIC 3TEDA 1BIAA 4A6DA 3P9KA 5LHIA 2V7QG 3K9AA 4UUJC 5CA1B 1MH3A 1R7JA 3HOTA 3CC2V 3BHPA 3CQZJ 2HNHA 1MMMA 2GOMA 5IDJA 3E0JB 3Q0WA 1JTYA 3SYPA 4LH6A 2Z1DA 1WFXA 4IIJA 2VB6A 1W5CC 2V1UA 2XB0X 4M9XA 1UPGA 2PX9A 3QVNA 3VQVA 1MA1A 1N32O 3V4GA 4LR3A 4ENNA 2FSWA 2D5VA 1XMQB 1J95A 5H6RA 4DRXB 2ZCEA 2P5VA 5KA5A 2WAEA 1OCCC 3IJ4A 1JT6A 2PYJA 2CQNA 1PL0A 5IT3A 4KHPO 4N9IA 4MTGA 3LSGA 2PQ8A 1H2SB 4CH6A 2LBFA 2FBIA 1D8JA 4ZHQB 5BMVB 2H1LA 1CXZB 1YX3A 4Y7NJ 2HFEC 5H6QA 2OIEA 4MVMA 4LK0F 4DQ2A 4UUVA 3LAPA 2WC2A 3ONQA 3L2CA 2LYCA 2PGGA 3ABMB 1EH8A 2VONA 2ICWG 3CRRA 2BOCC 1H2GA 3BC8A 4E7IA 1GAXA 1B72B 1SVOA 2Z3YA 3BJ6A 2R7VA 2QA4V 4XRSG 3D1NI 2QVOA 1THZA 3UR3C 2EIJB 4EKWA 1A04A 2MSYA 1OV9A 1O9GA 4U0YA 3NAUA 1MKMA 2DFEA 1A6IA 3R0AA 1QRYA 2J5PA 2M5WA 4LF7B 3E7LA 4OMZA 3K7AJ 2OV7A 3K69A 1JCHA 4RWUA 1U9OA 4P9OA 4FIPC 4AVPA 3AG3B 3CEIA 5KUMA 3CX5F 2Y30A 1HDDC 1NG6A 5E1WA 4B44A 1PNMA 1UMQA 4I98B 1WI9A 5D5XB 1M4UA 1TUBB 3TGUH 3SPHA 4P5OA 2HOSA 2IEKA 1JHHA 1YW8A 2VJ4A 1TT5B 4MS2A 1G3YA 4NTYA 1I08A 4X88A 4OWRB 3CCVI 2K9LA 5BQTA 1K61A 3CF5F 3APOA 4O4HA 4F4LA 4ZDOA 4FLUA 4AQYB 3HKBB 1JX9A 1OLTA 3DKXA 5ITZA 3OFNG 2QLZA 3GLXA 1ZR4A 3D3IA 3PQJA 4UB6C 3E5QA 2O03A 4A3EJ 2EA4A 1AJNA 1TW2A 5BR8O 1OR7A 2XAJA 1NR7A 1W5SA 3IH4A 5JHUA 2CH7B 2QR4A 3E8FA 3S3NA 3PFIA 2OTLV 3G1MA 5D4SA 4KFCA 2EV0A 1MGTA 2VKHA 1PL4A 2OCCC 3C3TA 2HI3A 2MLKA 4WCGA 2DQ0A 2WLIB 3FAVA 3JRIA 4YIPA 5E3LA 1L1FA 4I5SA 3OMAB 4OAZA 4RAIA 5LL6Y 3ZQQA 3Q3SA 1DU6A 1QCEA 1BN5A 4E4HA 3BVOA 4J80A 3FZVA 4UUSA 2QM7A 1AJQA 1PV0A 4I99C 4HYOA 5JCOA 4G6TB 4HAMA 2L7KA 1VQNV 3IL2A 1YTYA 4II2A 4BHCA 3ABLC 3K5LA 4R79A 3T1CA 5GPAA 1YHQV 1WJZA 3AL0C 2LW7A 1FXKC 3R0JA 5D5QA 2VJJA 1H0MA 2HDWA 3OUSA 3B02A 4DZPA 4WCEV 2Q5ZA 3RYHB 4RAZA 3WB1A 1D1AA 4YHHO 5ERIA 3MKZA 2ECCA 2NS7A 3PUBA 5KAFC 2E1CA 2VE9A 1AILA 2VKEA 2LFSA 4X1YB 1F7YA 2UUCB 4WF9V 1YOVB 2FBHA 4X66O 1YS7A 3CCSI 2Q73A 6PAXA 2ZD9A 5KK1A 5B5EC 2ADUA 4HOBA 1H2NA 4B3AA 4PK4A 3OOUA 1DF5A 3HDDA 3F3XA 3EHBB 2HFHA 1YJWV 1SZTA 3ZRWA 1KZHA 3KEQA 1XGSA 2DBBA 4Y13A 3VQXA 3H9GA 4XKWA 4G8XA 4DBRA 3V8KA 3VFZA 2XPVA 3WTSC 2FL4A 4DXWA 4GCZA 2CMPA 4KMFA 1W2BU 3QP6A 2LTPA 4CZCA 1VQOV 3JRCA 3HB3B 1D0YA 4FX0A 3QTCA 1YVWA 2CWEA 3G73A 5JH7B 1ZHFA 1XB4A 3QP5A 5DUKA 2KZVA 2IS1A 1SZXA 3MKYB 1ZGAA 2ZXWC 3L73H 4X20A 4JI8O 2DA6A 3JTGA 3HOWJ 2QWQB 4IRGA 3SR2C 2QKAA 3STLC 2ESNA 3RZOJ 3K70C 1ZR2A 1FOYA 1A32A 3ABUA 4LCUC 2N05A 2WPDG 5GONB 5CA0A 2VQHA 4BJTA 3PJRA 5LEJA 1FXHA 4JI2O 3ZQLA 4ZTFA 4CA0A 1Z7LA 4ON0A 5E1ZB 4YJ2A 1HDPA 2CSOA 1RPOA 1FP2A 1SD7A 1X4PA 2BXZA 2X85A 4RM3A 2ZIOA 1N36B 3SYQA 1JJ6C 1PP9H 1BBYA 1Y0UA 2VXZA 1H8HG 1SRYA 4WFHA 3G71V 2HHHO 3FB7C 2OYQA 4DR3B 3ASOB 2QBYA 1R00A 3M8JA 1O4XA 1JI8A 4OX9B 3SHFA 3N2GA 4DUYO 2VLAA 2A3SA 2VKVA 4PZJA 3FKIJ 5IP9J 3MKWB 1SF9A 1D1BA 1IRGA 3EUAA 3WU0A 5M5YJ 2IA1A 2X6CA 2R70A 3UO3A 4MLOA 2XUBA 3HXLA 3JRFA 2F95B 4PV1B 3WFVA 3U0ZA 3CCJI 3H0DA 3AG1H 2X0LA 3Q9SA 2KHMA 3JR9A 4GFBA 2YC0A 1O3QA 2LF8A 1S5LC 1HNZB 3F7VC 1NG7A 3QNEA 5J4VA 3EYYA 4EV0A 3U1KA 4M6YA 1D1CA 4YELA 2Z33A 4BY7J 4I01A 4A5MA 2BSKA 1JKQC 2CRGA 5IYZB 3SJBC 4JI7O 4EM0B 4W97A 1XGOA 2BYVE 2EK5A 1Z6RA 5E17F 1VQ8I 3BFRA 5IY5C 1NJIW 1UFMA 3CCUV 1SQFA 2YXLA 4LF4O 2L9SA 2AHYA 3F5TA 3BTJA 2A5WA 3I53A 5HDGA 4RMNA 4S05A 5HNFA 3L2QA 4CC6A 5HS7A 2WV1A 1JJOA 1OCRC 3GTGJ 2KRHA 3BR2A 4U3JB 2MC4A 2EFPA 3OYBA 4BIZA 3CO7C 1V54B 2FQ3A 2OUMA 5JHFA 2EZPA 4HX4A 1MD0A 5TISZ 2PBIA 3MZ8A 2P22C 1AROP 1VF6C 2BBYA 2MBFA 1D5AA 1HLVA 2GAUA 2HTJA 1ON1A 3MWMA 1PUFA 2Z16A 4HW0A 3L2WA 2W0FC 3E86A 3EUHC 4U87A 1VQKI 2UXBO 4XRMA 2P4KA 3MMYB 4ESJA 1TGOA 1I1GA 2YEVB 2B0LA 3CB2A 3AKZA 3VYRB 4B3XA 4U0VA 1FYLA 2UUBO 2XHKA 2H6BA 2LY1A 1R1VA 5GAGJ 4I50B 1B9MA 1OYIA 1NTKH 1W0JG 2XRLA 4B47A 2ZE8A 4DV2B 2RVCA 2HYGD 3H36A 2IGNA 2DYRH 4BU2A 1XNQB 1JXSA 2DA4A 4I4TB 3QPTA 3ZQFA 2WY7Q 4HX8A 4FLXA 2EFNA 3QODA 1P84F 1MH4A 4DV4O 1H8AC 3I58A 5F1RA 2Z9OA 5HS9A 5ILVA 4MTXA 3RQ4A 4XLPF 2YI8A 1PNKA 4NVPA 1RPWA 1VI0A 4MFDA 3LA3A 4JYYA 1RP3B 1V5EA 1JR9A 2AZ2A 2FU4A 1TAEA 4QWQA 4DR5B 5J3LA 3KX2A 1IV6A 3K5MA 5F27A 5FKMA 4HEA2 3MQ0A 4KP4A 1HNXB 2A69F 3D36A 2TCTA 2P4WA 3BROA 3JRHA 4WFFA 5EC1C 2HYJA 1SERA 5ICFA 3JATA 1T0FC 3JARB 2JIZG 1MSWD 2HVRA 3GTLJ 4DV6B 2E7XA 5CVRA 4E4EA 4NR1A 2QM3A 4X9QA 2F2EA 5CA1A 3H5AA 3I4NJ 4D7TA 5IT9N 3CJTB 1VQPV 4JAAA 2JRTA 5CQGA 3ZMVA 3ZMSA 4CH3A 2E2JJ 3HOUJ 1HF0A 1Y76B 4A3FJ 2UV1A 1UZCA 3I59A 1JJ2U 2EZKA 4TV8B 4RGRA 1K9MW 2CK3G 1F23A 1MSFC 4B3RO 2X6WA 3Q0VA 5E3OA 4DRXA 1IRXA 2M34A 5IYCO 1ONVA 2YIBD 1VF9A 4LGWA 3K08A 2A61A 3DKYA 3FYIB 1IBKB 1IN7A 4K2EA 5EJCA 3BZCA 4HNAB 4EGYA 4F3QA 3T1HO 4DO2A 3HYIA 3SJQC 1FLIA 4JI4B 1EM1A 1ACIA 1V4RA 1QA6A 4LITA 4U0WA 3ERED 1Y67A 5DD8A 4JI3B 1ZH5A 2DOAA 3LAJA 4JV5B 5L3GA 2X6YA 5CVJA 1R6NA 2L2OA 3ZHTA 4EFBA 1O9HA 4QE9A 4DR4B 1ZKGA 1B72A 2ZJ2A 2CYYA 4GYIA 4B48A 4HNVA 3S2HJ 5D6EA 1IVSA 3OYLA 4ETSA 4AVZA 1FIAA 5LBQA 2STWA 2XT9A 3I64A 2KPMA 4KN4X 3U21A 4JYAB 1CEZA 2WBMA 5K7FA 3ZRGA 2ZXWH 1OCZC 3T1YO 3CD6I 2W84A 4MFEA 1H89C 2HZDA 2OT5A 1GV5A 2LF7A 4UCOA 2LY2A 1K83J 5HLGA 1F4MA 2R9RB 5ICEA 4CCJA 2QZ8A 4XR6A 4HDVA 2OTLI 2KT0A 1FS0G 3TO6A 1TUBA 3HRTA 4MTOA 5DV5A 3AK3A 4JI5O 5ILSA 1S6LA 3KZIC 1SC5B 2QQ8A 3ETQA 5K7ZA 2MFZA 1K78B 1BCCH 1NTMH 3LDEA 3P3NA 4MVOA 4X62B 4BNCA 3WGGA 3OYEA 4QGPA 1AVMA 4JI6O 3ABKC 4ESBA 4ZYDA 1DK1A 3HKBA 5DECA 3JREA 2A0LA 4E7LA 2JTVA 3I9V2 1YS6A 2QWRB 2K3FA 5FLXZ 1JUMA 3RDIA
chains in the Genus database with same CATH topology
4FM0A 3JAKA 3VQWA 5KHJA 3EETA 2YIBA 1O3TA 3BRCA 2UZKA 1BJAA 3ZMUA 4EMSA 3F22A 3GYHX 3KP3A 2PMUA 1IN8A 4S04A 4CC5A 2EX3A 4I02A 1XSXA 3IHUA 4YFNF 4CH4A 4TOIA 2CFXA 5DCMB 4L8JA 4MGRA 2MA3A 4KNYA 4IIJB 1MJAA 3DV8A 4TV9B 1BI0A 3F72A 4DK1A 5ICCA 2XROA 4X64B 1BC7C 4HYEA 4YY3B 3DFGA 4NQWA 2W57A 1ZREA 4GKKB 4L9NA 3VEPA 1ZRDA 1OYWA 2FXAA 3RKXA 4LF9B 1HR0B 1W7PB 4RB0A 4Y15A 4Q6GA 5JH7A 5CLSA 1SD4A 5AIPA 2COMA 4JK1X 1WSUA 3ZMTA 2JS5A 2PG4A 1U5TC 3CHXA 3Q5FA 3I0TA 4F7ZA 4OOIA 5FLXK 3U2RA 1S29A 5HDKA 3HKEB 3QG5A 2RC4A 2M87A 4HQMA 2EA2A 4JI0B 2UXDB 1IN6A 4Q4ZF 2XGXA 1RZ4A 2O8XA 1U6GA 2Q7GA 4O4HB 3GFMA 3TO7A 4O2AA 1I94B 3LQQA 4G7HF 3GXOA 5K5QA 1B1BA 5J2UA 1BOAA 4PGHA 4IHSA 1HXDA 3HSEA 2PI0A 5IYZA 3JAMK 4OMYA 1STZA 3V8JA 2HS5A 2XKPA 1R5GA 3TO9A 4LH7A 4PI0A 4UFZA 1AOYA 3UT5B<