1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
molecule keywords hypothetical protein MJ223
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
3SZPA 5BQTA 3COAC 3PQKA 4IRGA 1U2WA 2A3SA 3LFKA 3HOSA 1TQIA 4M72A 1J75A 4NB5A 1RUNA 2V79A 5E1WA 3GZ6A 2TDXA 5AIQA 2FQ3A 4BHCA 5HDGA 2K86A 5HS9A 2CO5A 5J8FA 3BJOA 5E8IA 3RPUA 3Q5FA 3TQNA 1ZN2A 4WXCA 5IT9Z 4IVNA 5FD5A 3FHZA 4ESBA 1J2XA 2HKOA 4IHSA 4HQEA 1P4AA 4JBAA 1J0RA 2D2WA 2VBZA 2DO7A 4HV6A 2UXXA 4OIQF 4OIRF 4FHTA 3D0SA 3L9FA 1HW1A 3P9IA 2JPBA 1QNTA 2CFXA 2EFWA 1IN8A 3G73A 1XSXA 1HXDA 2ZBKA 1Z9CA 3N4MA 2VOOA 5DYMA 2EK5A 2IVMA 1WKMA 1FX7A 1ON2A 3GFMA 1IZ1A 3BOQA 1LDJA 3BDDA 2MH2A 2HYFA 2F5FA 1UB9A 2IP2A 3GX4X 3ZMTA 3T0YA 1BI0A 2A6EF 4L0YB 3BWGA 2H6BA 4F7ZA 2IPQX 2CG4A 2O3FA 1TW2A 3ULQB 3TKYA 5IT9K 3GFLA 4EM0B 2L54A 2GIVA 2P6SA 5LGNA 1FLIA 2OZUA 1K78B 1YW7A 1Z6TA 1ZRFA 2K7LA 2EV6A 1MJAA 3DFGA 4JK1X 3JSOA 5E17F 4HX4A 2EA2A 3LQQA 2PN6A 2FE3A 5L3DA 1G4DA 1HSJA 1KU3A 1YS6A 2XHKA 4NQWA 2ETHA 4RAYA 4YFKF 4XSXF 1R5HA 2L02A 4OINF 5J8CA 5HVQC 1D8KA 2JTVA 3M8EA 1XD7A 3KZZA 3LSTA 3GFIA 2IW5A 4KDPA 1LDKB 3V7CA 4N0BA 2ISYA 1W4MA 3QRFF 1MGTA 1R00A 1WI9A 2L3DA 4MQVA 4MTDA 1YW9A 1IN6A 2E1CA 1L3LA 3JAMZ 3WG9A 1ULYA 1JGSA 4R1HA 3J80K 4DNCA 3VODA 1R36A 1SFUA 2NS0A 3K2ZA 3E6BA 3FMQA 1G3TA 5LHGA 1FBUA 2QM4A 2YX7A 1K6OA 2Z5UA 2P7VB 3HIFA 4LG0A 4ZYEA 2PQ8A 1KU7A 3F8BA 5ILUA 2RVCA 1DPRA 2G9WA 5FLXK 3H3UA 2DQRA 5BMZA 3MZYA 1XDUA 4R79A 3O3KA 3HSEA 4HA8A 4IRHA 5L3CA 2Y48A 3WTZA 3BPXA 3HUGA 2RC4A 1X3UA 3I58A 1JHHA 1LVAA 4I01A 1PUEE 1FBQA 4FT8A 2K4BA 5JFRA 3KP6A 3R60A 1NHAA 3CDHA 2XAJA 5TRDA 1Z6RA 2R7DA 3R0AA 5FB2A 4AD9A 4KIGA 2PMHA 2FBIA 3BROA 4ENMA 1I5ZA 2NNNA 3FZVA 2V6CA 3B02A 1HKSA 2RQPA 2XKOA 3CLOA 1BBYA 4CICA 4CHUA 1USSA 3NRVA 3HYIA 5L3GA 3DPTA 2ZMEA 1FBSA 2EWNA 3GXOA 1HSTA 4Y17A 1O7FA 3Q9SA 3QPHA 4RGRA 3F3XA 1FSHA 4U0WA 4RB0A 4AIHA 1LEBA 2MH9A 2PI0A 3MFKA 2E1NA 4G6QA 1UFMA 1IN5A 1D8JA 3TGNA 4I98B 3T8TA 2VBYA 2D45A 1PDNC 1SD5A 4CGZA 1UHMA 3TO9A 3VB2A 2H09A 2KJBA 4UXNA 5FD6A 1IUYA 4A5MA 3P7NA 1FYMA 3RYRA 2B0LA 4L9JA 1XDSA 4HAMA 1BOAA 1OYYA 4LMYA 2KJCA 5J6XA 2CW0F 4UNOA 1IAWA 4L9VA 4MGRA 4XLPF 3WGIA 2HZTA 4PGHA 3CTAA 4BXUA 5DCMB 2HQNA 2PLYA 4LLGF 3I71A 1REPC 1DP7P 3L00A 1IRFA 1CF7A 3HRTA 1WWXA 2F2EA 5D5XB 1KA8A 2O6GE 1C0WA 4HOBA 1KYWA 4O3MA 2Z33A 5K5RA 1MZBA 3L7WA 1EH8A 1Z91A 4IPAA 4QWQA 1YFHA 1MD0A 1R58A 4RB2C 4EJVA 2QBYB 5CVVA 1ZG5A 4AIKA 3I59B 3PQJA 3VFZA 4A6DA 1O3SA 2PFBA 3M8FA 2G7HA 1D3YA 5ICCA 2PMUA 1HKQA 3WGGA 4GCVA 4M73A 1KQ9A 5E1ZB 4E70A 1H9TA 4GXOA 3DQVC 1LJ9A 2Y0MA 1EH6A 5TJJA 1S29A 4MTEA 4MEYF 1ZAOA 3EQLF 3ELKA 1U6GA 3VOEA 3DKWA 2JZYA 1S7OA 2MA3A 5L3EA 3QU3A 1P4WA 3W6JB 4LB5A 2VODA 4RGSA 4U0VA 1BC8C 1IW7F 5CVUA 5DV5A 3KP4A 1XGOA 4Y15A 2XROA 2OU2A 2A07F 2G7UA 5DCFA 4ENNA 5A2QK 3R4KA 3GUDA 3RIRA 2ZJ2A 2Q0OA 4HX7A 2HEOA 3CUQB 4XBFA 1FT9A 3HHHA 5FGMA 4Y13A 2HTJA 5IT3A 2ZFWA 1YIOA 2PEXA 4U7DA 3T1BA 2PJPA 2L01A 5E1XA 1TLHB 2HDCA 5F1RA 3CJNA 1D5VA 2DPDA 2L4AA 2EV5A 2WTEA 2A69F 3F6VA 4CYDA 1W7PA 1RUOA 5LRRA 4HX8A 2XASA 3F23A 1FOKA 3K1PA 5D5UB 1LQ1A 2O03A 4MHGA 1IXRC 2P7CB 3QP6A 3T8RA 3WTWC 2IA1A 2HFHA 1XSDA 4YG2F 4YIFA 3ABTA 1LB2A 4XLNF 2XVCA 3TOBA 2Y75A 3JSPA 4OIOF 2VBWA 1T0FA 2K02A 3M7GA 4PDKA 2QVOA 3GF2A 4H0EA 2BBYA 2VE9A 1ODDA 5DD4A 2MLKA 2CWEA 2BV6A 3ECOA 2ZCWA 3P9CA 2FSWA 3ZN0A 1V4RA 1JE8A 2KIFA 4HLXA 2HTSA 4LD5A 1QZZA 3S2WA 3F22A 4L18B 4WK8F 3I4PA 4YFXF 3QPTA 4EJUA 1Q1HA 4MQ9F 4BQAA 1R1UA 2ELHA 1XCVA 2QQAA 2O0YA 3WE3A 2Q2EA 3JAMK 3EUHA 3MZHA 1T2KA 3MCZA 3LA2A 3I5UA 2P5KA 5D8KB 2XV4S 1F5TA 1S7AA 2JSCA 2VOPA 2FU4A 4G7OF 1SAXA 1R5GA 5JI6A 3C7JA 2K27A 4M6XA 2DT5A 1B1BA 4M9SA 2QQ9A 2J5PA 3KE2A 5HS8A 1OYWA 3RTRA 2KIMA 3FM5A 1O57A 4P55A 5LGUA 2UZKA 3E6CC 5LGTA 4L9TA 2HQRA 2HYGD 4ZYDA 3I53A 2BEOA 2CYYA 3F72A 3RI4A 1B6AA 2GQQA 4ENJA 3QP5A 3Q9VA 1W5SA 4RAZA 5D8LB 2GA1A 5D6EA 2M1BA 4HDVA 3DEUA 1G3SA 2W85A 3L2CA 1WQ2A 3RWRD 2X4HA 3ABUA 5LRSA 1QZYA 1J5YA 4P9FA 2GZWA 3FX3A 4ZZDA 4WX9A 5JHUA 4LK1F 5BPIA 2C6YA 5LEKA 2MBFA 1BN5A 4IJAA 1J59A 1JXSA 1ONVA 4M71A 3MWMA 1I1SA 5H6QA 4OMZA 3U2RA 3ZMSA 4N9IA 2STTA 4U7BA 2RKHA 3MEXA 2XUBA 3FWEA 1ZRDA 1E17A 3BP8A 4GGGA 1FZPB 1O3QA 2DLLA 2W84A 1SFEA 3KP5A 3DXJF 5EEGA 4KFCA 4CO8A 1HW5A 5L3BA 2OAZA 2A68F 4ON0A 3CUQA 3CUOA 1W7PB 4ZZLA 3ZN1A 2OQRA 1CGPA 2LKPA 1XGSA 4I02A 1B9MA 5ICGA 4I0AA 4LFUA 4KMUX 4GYIA 3ZMDA 4UVCA 4I7HA 1T6SA 4A2UA 3NEUA 1O3RA 1YS7A 2LDUA 3ISPA 3LQRA 5H20A 3KEQA 1ZARA 3LAPA 2FNAA 3ROUA 3LAJA 1U78A 4DQ2A 2M45A 4BHPA 2H94A 4Q5SF 2ZNYA 1W7PD 2ZXJA 4UVAA 1XB4A 4FX4A 2HR3A 6PAXA 1K7AA 3GFJA 3DP7A 3HTSB 4Q4ZF 4UHTA 2VC1A 5FFXA 3E97A 4UV9A 4BHBA 1FC3A 4B09A 3BY6A 3WU1B 3HTUA 1EH7A 5ERIA 4PZJA 4EGZA 4HYEA 3ZPLA 2STWA 3JTHA 1FPQA 2D1HA 3WODF 4NHJA 4RGUA 4GO1A 4O6JA 2RN7A 3SQNA 4KMFA 2E7WA 1K79A 4HBLA 5F64A 2DAOA 1ZG3A 2WV0A 3W6KB 3F8FA 2DPUA 1B9NA 2ZNZA 1G3WA 5D6FA 2BE5F 2RNJA 1H0MA 3ZQ7A 1E2XA 1AWCA 1F9NA 2XRNA 1OKRA 3RDIA 4LG0B 5AONA 1O3TA 2VONA 1BIBA 3IL2A 2ZO4A 1ZH5A 2X0LA 4CXFA 5F6FA 4EMSA 2DK8A 2LF8A 1EV7A 3AAFA 4RS8A 1ZGJA 1WSUA 4KUMA 5DEQA 1Y0UA 5DCMA 1IN4A 4KT5C 5FFZA 3V8JA 4A12A 2XAFA 2MLGA 4EM2A 3ZMUA 4BNCA 1FWZA 1SMYF 5CYVA 2CSOA 1P2FA 2RV8A 5HDNA 2Z99A 3HOTA 3LWFA 2P5VA 2IA0A 2YU3A 4G8XA 5CJ9A 3OV8A 4UV8A 5ILVA 1Z05A 4G94A 2KRFA 1S6LA 2DQLA 2IJLA 3IKTA 2EFNA 2FRHA 4LGWA 1XMAA 3R6SA 1OPCA 4RB3C 4YFNF 1HW2A 3L09A 4MNUA 4XSZF 1TW3A 2L4MA 5HS7A 5LEJA 1G3YA 5D4RA 3F8NA 4HQMA 2P4WA 4OU0A 1J7KA 3TDZC 2JT1A 2UXNA 4P5OA 1GXPA 3KLNA 1K78A 3FM3A 4A5NA 1ZYRF 2MC3A 4EQQA 4Q48A 2EFPA 4KIFA 3H3ZA 1YW8A 5KVRA 1J9IA 1MDMA 2XAHA 1ZLKA 2PBIA 2HOEA 2AXLA 3RKXA 4B8XA 1KQ8A 4AIJA 3WGHA 3C18A 4M9XA 5EEHA 1XSVA 2XGXA 1MDMB 4RB1A 3GYHX 2YR2A 1FNNA 5ILSA 5CLSA 5LBQA 2FEZA 1BIAA 1S3JA 3JTGA 2IA2A 5E20A 3F8CA 1YLFA 2P5LC 2ESNA 2K4JA 3HSRA 4A0XA 1R22A 3RPQA 4HF2A 1MJBA 2KKOA 2R3SA 2QZ8A 4KN7X 4PGGA 3CO7C 2YSRA 4G7HF 2MD5A 4ESJA 2A61A 3GW2A 2M87A 1P6RA 3LA3A 4ZH4F 1FSEA 3N97A 2QQBA 1DDNA 3ZMZA 3FXQA 5H6RA 1STZA 2QBYA 2P8TA 1QPMA 2V1DA 1TNTA 1SD4A 1BJAA 4GYGA 3I0TA 4S05A 2LF7A 2O8XA 1YQAA 4I09A 1B4AA 1LNWA 2QUFA 4MEXF 5AIPA 3I54A 4IXAA 4M9ZA 1TBXA 1ZGAA 5KK1A 4M74A 3RJPA 3DV8A 1T98A 4KYWA 3ML6A 3C3WA 1IRGA 4P96A 1XN7A 3MAJA 3FMRA 3NQOA 1B59A 1CF7B 2JPCA 2A5YB 5FLXZ 2FA5A 5D5WB 2QWWA 4CDGA 4L9NA 1U5TB 1F4KA 3WTYC 1T38A 3K1NA 2DI3A 1ZHFA 4EJOA 3M1EA 4KICA 3TDUC 2F5DA 4K2EA 1OMIA 3WTXC 5ICEA 3J81K 1G6NA 3J80Z 4EJWA 1TQPA 1RZ4A 4R8HA 2Z3YA 3R61A 2QENA 3PFIA 1UHWA 3WU0A 3BZ6A 1BI2A 1YO5C 5CVJA 2OQGA 3I59A 3KP3A 3JW4A 4AWXB 2UWMA 3V8LA 2RDPA 1LEAA 4ETSA 3J7AO 4I2OA 5FO5A 3F6OA 4P9UA 1IXCA 4UUVA 3E6DA 3R0JA 3O6BB 2Z9OA 4OMYA 3HHGA 3O2PE 3CUQC 3IKVA 1SD7A 5A2QZ 1UCRA 1YTYA 4EVIA 1KGSA 2XKPA 4LJZF 1Z7UA 4XRFA 3TO6A 3RKWA 3DF8A 1RI7A 1AOYA 1USTA 4HF1A 1R23A 2GA2A 3F21A 4BYYA 5L3FA 3HSFA 1ON1A 2NRAC 2VE8A 1FP1D 2V1UA 3H92A 4WWCA 2LSOA 2NAZA 3RKYA 1WRJA 4HV5A 1U3EM 1OR7A 1FYKA 4N9HA 3J81Z 2OD5A 3TOAA 1PP8F 5CVIA 1ZLJA 1BI3A 5JVTA 2CQKA 5E8GA 2WWYA 2ESHA 2E7XA 5D4SA 4HW0A 1BI1A 3GWZA 5HLHA 2AS5F 2VN2A 3IRRA 2FBKA 2NYXA 5ED4A 4EGYA 2XAGA 2ZMEB 3EETA 1MKMA 5ICFA 1U5TA 3M9AA 4KN4X 1V3FA 3WTVC 5DDGA 5HLGA 3OOPA 2EA4A 3WTSC 4Z2YA 3IWZA 2XIGA 5DUIA 1ZREA 3SR2C 1GXQA 4L5JA 2RGVA 5E18F 1QO0D 3QOPA 1FYLA 2HS5A 1XGMA 4L0ZB 1KYZA 3E5XA 5HLIA 3GEZA 4G6DA 4JQFA 3QU6A 3E5UA 2FMYA 4CZZA 2ISZA 3SFZA 1FP2A 1LDDA 3ERED 3GZ5A 1GHCA 2W24A 1DPUA 4EJTA 3EYYA 5JR3A 1RNLA 4QLCU 3SZTA 2VT3A 4EM1A 2EFQA 2ZKZA 3V7SA 5LHIA 1S8NA 2QM3A 5BPDA 3V7RA 2GXGA 1I27A 3BPVA 4KIBA 4PCQA 5BOXA 2DU9A 3ZP5A 1A04A 3ZMVA 1TNSA 1TTYA 4HLYA 2PG4A 3G3ZA 4WXDA 5D5VB 3HRMA 2ACJA 4AVPA 1SMTA 1R1TA 1PP7U 1R7JA 2DTRA 4O5VA 5LHHA 1L0OC 2M30A 2QLZA 2GAUA 1XMKA 2EV0A 3KP7A 3BJ6A 1BC7C 1P4XA 3IRQA 4HF0A 1M5IA 2VXZA 3P9KA 3CO6C 1U8RA 1I1GA 4M6YA 2FXAA 1W5TA 2DFIA 2YPRA 4G7ZF 2DBBA 1I6XA 5BS6A 1IN7A 5HOOA 4L5IA 1QBJA 2HGCA 1JHFA 1DUXC 3KLOA 3FXRA 4U88A 3C1DA 4A6EA 4OOIA 2H27A 3U9GA 1GVJA 3ECHA 3KETA 2NNYA 1SD6A 1HBXG 2DW4A 1KU2A 2KIUA 2VBXA 1XGNA 3FF5A 3IWFA 3BJAA 2J5OA 4G9YA 2F5EA 1MJ9A 1BM9A 4ZYHA 2R7FA 2QYOA 2VC0A 2VT2A 2XAQA 1VTNC 3K1MA 1QGPA 3FMSA 1ZRCA 2BYVE 1FY7A 2Q8KA 3D5LA 2V1XA 3GO5A 3T5XA 2BGCA 2M8EA 5K5QA 3F8MA 2W25A 3I64A 1QQIA 4ENKA 2WC2A 3GLXA 4KNYA 3E5QA 1KQ0A 2F5CA 2CGPA 1YG2A 1SFXA 2FBHA 1RIOH 1P92A 4UVBA 3WE2A 4ZYGA 5HDKA 4LB6B 4S04A 3KEOA 4BH9A 2FF4A 2HWVA 2EB7A 2R9AA 3WTTC 3HRSA 4LLLA 4U0YA 2M5WA 2FOKA 3TO7A 2V9VA 3B73A 4BAYA 3REOA 4RGXA 3KFWX 1H9GA 1XCBA 3DPLC 2HKXA 1TQMA 2A6HF 2DK5A 2W57A 4IF4A 4YIIA 3EYIA 5DD8A 3VEPA 3SXYA 4HDUA 4FX0A 3E6MA 2IT0A 3V4GA 2P6TA 4A0ZA 4WXHA 2ADUA 3FXUA 2OZ6A 3K9TA 4ASNA 1HQCA 2EFOA 3HRUA 2EJRA 1ZG1A 3QAHA 5CVRA 4IRIA 1T39A 4LLNA 1R1VA 5DUKA 1Z1DA 3RYPA 2GXBA 1U5TC 2IRFG 4EV0A 3LA7A 3GVAA 3K69A 1HKTA 2FMLA 4D0PA 2LNBA 2JRTA 2OBPA 4KA4A 4WCGA 2D1VA 2COMA 2FNPA 2YX4A 1O7LA 2H6CA 3KCCA 3IC7A 3U1DA 3WTUC 4I0BA 4ESFA 3E3VA 5K5OA 3IHUA 2GWRA 4TV7A 4LK0F 2O61A 3SHFA 3MQ0A 1OYIA 4HZFA 3KZYA 4IHTA 1F1ZA 3K0LA 4A0YA 3V8KA 2OA4A 4Q47A 1YYVA 1IXSB 4OIPF 4WF2A 1KU9A 5K1YA 3KP2A 3EDPA 5LLQA 1IF1A
chains in the Genus database with same CATH superfamily
3JATB 2G38A 2JVHA 4X66O 3NXSA 2F6CA 3SZPA 5BQTA 3DBHB 1SA0A 4JI4O 2AZ0A 1K5QA 1ORKA 1LKXA 1GM7A 4H4KC 2R4GA 4DR2O 5EC2C 4JI8B 4LFCO 1FOXA 4C7UA 3JD0A 3COAC 3I9V2 4MFEA 3ONQA 4CSWA 3PQKA 4IRGA 4NC6A 1JT6A 3LSQA 4Z2WA 3JRFA 1U2WA 4JPRA 2JRMA 5ITZA 5JJEB 4ZDPA 2A3SA 3LFKA 2JIZG 3HOSA 5J47A 1TQIA 3RZDJ 3HKDB 4M72A 1J75A 2DWDC 5B5EZ 4NB5A 5TGTA 1RUNA 2V79A 5J2UA 3AG2C 4WFFA 4XMYA 2EINC 5E1WA 3VDXA 1HP8A 2OIGA 3OMNB 1DU6A 1RKWA 5EC1C 3GZ6A 2LJ2A 3OYGA 2OTLV 5EG0A 3OYDA 2TDXA 5AIQA 3OS2A 2IJIA 2EINH 2IM9A 3CC4V 2FQ3A 4BHCA 4NXNO 5HDGA 3FKIJ 1WA8A 2K86A 3S16J 4FZ1A 1RSOB 5HS9A 2JS3A 2CO5A 1JJ6C 5J40A 5J8FA 2ZSHB 3BJOA 4Y3OA 1BGYH 1GN3A 1R6KA 3RYFA 2A05A 4DV2O 3BQZA 3TMOA 2VWJA 4IHYA 3G1LA 5E8IA 3RPUA 3Q5FA 4DR5O 1VQ8I 3OTFA 2VQHA 4RDUA 5KHIA 4G2KA 1I6HJ 3TQNA 4FLYA 1ZN2A 4XKVA 1B72B 4WXCA 3A03A 4V2FA 4BEHB 5IT9Z 4YHHB 3VOUA 3X2QB 4DV0O 2UU9O 3I55V 4IVNA 3FAVA 5FD5A 3HKCB 3OYBA 5E3NA 3FHZA 4ESBA 1DTOA 2BE3A 4U7NA 1J2XA 3QVNA 3ZRVA 2E5ZA 2Y30A 1MSEC 2Y0IA 4B3RO 4B3RB 2HKOA 4IHSA 2VKEA 1UZCA 3P3NA 1LUJB 4HQEA 1P4AA 4BBSJ 4JBAA 4RAGA 4DYQA 5JJJB 4RM3A 1YVWA 3RW0A 1MNEA 1J0RA 2ZJPF 4CH3A 2BW3B 4JX5A 3J80N 3HPGA 5E79Z 3SYOA 2D2WA 2VBZA 2DO7A 4PSWA 2HU9A 1X2NA 4AQYB 1IURA 2L5QA 4I50A 4HV6A 1N4CA 2M3AA 3PJSK 1HCRA 2UXXA 4OIQF 3MAQA 4OIRF 4OX9O 4FHTA 3AK1A 3D0SA 1AKHA 1RPRA 3L9FA 2P6JA 1HW1A 2NS8A 3P9IA 1K61A 3QQAA 2X6BA 2JPBA 2A06H 2M7BA 2B9ZA 2EILC 2KDOA 1QNTA 1LUWA 3ZRSA 2CFXA 1ZGWA 4MVRA 2EFWA 1IN8A 3G73A 2Y31A 1XSXA 1HXDA 2ZBKA 1Z9CA 3N4MA 3OAAG 4ANJA 3K70C 3EFFK 3DTKA 4KFMA 4DV7B 2VOOA 5DYMA 2EK5A 2IVMA 4FFKA 2HVQA 5B1AH 1WKMA 1FX7A 5FJ8J 1ON2A 4JOMA 3LNQA 3GFMA 1JT0A 2HOAA 5IYCO 2QF7A 1IZ1A 3BOQA 1LDJA 3BDDA 1BW6A 4BKXA 2LC2A 3HOVJ 2F4MB 4CC6A 2MH2A 3HKDA 1H2KA 2HYFA 2F5FA 1UB9A 2PTMA 4DK0A 2CV2A 2IP2A 5IOYA 3GX4X 3QOEA 3MKZA 3ZMTA 3T0YA 3C2GA 1BI0A 1VQ9V 3ZRGA 4LF8O 2ME0A 2EZOA 2KZVA 3JAKA 1RR8C 2A6EF 5FRNA 4L0YB 3BWGA 3PIOF 2H6BA 2QKLB 3ABMB 1XILA 4F7ZA 1Y66A 2C2AA 2IPQX 1ZQ3P 4GX2A 2CG4A 3WHCA 2O3FA 1TW2A 1YRNB 3APOA 1RSOA 1FPOA 2BVLA 3ZOBA 3HPLC 1U8BA 2OC6A 1PNMA 2IEKA 3FYIB 4UCRA 3HKZA 3VSKA 2KB1A 3ULQB 1UFIA 1IV6A 4DW0A 1XNRO 4GRIA 2L0KA 2LVSA 4BW5A 3TKYA 4J9ZB 2Z0AA 3TEDA 3JD2A 1NTZH 2OIEA 4J42A 1XMOO 2HVSA 3I5DA 3BG5A 3U11A 5IT9K 3AG1B 3EHBB 3GFLA 4EM0B 4FASD 2VB6A 3THOA 3ZHTA 5J2TA 3HGYA 2WA4A 3M4OJ 4O4IA 4LIVA 2L54A 3IH3A 3IH2A 3EPZA 4UUSB 4O4HA 4ZOLB 3WB2A 2X6YA 2GIVA 5F2VO 2P6SA 3LSPA 2GOMA 5LGNA 3DTIA 1FLIA 1JKOC 3F7VC 5B66Z 4E7KA 4RQEA 4UCVA 4DV0B 2OZUA 1K78B 1S72V 4PA7A 1YW7A 4YHHO 1Z6TA 2IBZH 2YC0A 3AL0B 1WHUA 1ZRFA 1P4RA 2K7LA 2EV6A 3ERMA 2L7ZA 1MJAA 3DFGA 4JK1X 4P1WA 2FYUH 3JSOA 5E17F 4HX4A 2BSKB 3F5TA 4DR5B 2EA2A 2UXCO 3LQQA 1WJAA 2PN6A 2FE3A 3OE7G 5L3DA 1HSJA 1KU3A 3DU6A 1YS6A 2XHKA 4NQWA 4XKBA 1G4DA 2ETHA 4RAYA 4YFKF 5M3MJ 1X59A 2LFSA 3CJHB 4ZI7A 1HNZB 4YIPA 1EBOA 4XSXF 1R5HA 2VUMJ 2L02A 1IJWC 3DBLB 4OINF 1EFRG 3BQYA 5J8CA 3K4KA 1AB3A 1RPOA 1Y67A 5HVQC 3LSMA 4BUPA 4PA4A 1D8KA 5CA0A 1BE3H 5HODA 2QM7A 3LNMB 2HG5C 3P5JA 2JTVA 3M8EA 3OYAA 1ROPA 1XD7A 3KZIZ 2JGDB 2QWNB 3ZQLA 3KZZA 3WG7H 3LSTA 3D3IA 3Q4HA 3GFIA 2PJRB 1U97A 4I99C 2IW5A 1H2SB 2WLMA 4KDPA 4UUTA 2CUGA 2F23A 2XGEA 1WI3A 4X1YB 4AHCA 1LDKB 2QSGX 3V7CA 1HF0A 1ORQC 4N0BA 2ISYA 3AK2A 2LKSA 2HOSA 5KA6A 1VI0A 5IYBO 2VI6A 4DR2B 1W4MA 2ZC2A 3UO2A 5IYDO 3HGGA 4L5EA 3RKQA 3QRFF 1FTZA 4IHJA 3K5NA 1IV8A 1NVPD 5CN0A 4X66B 1MGTA 1OCRB 1ZAUA 1NH2D 1R00A 1WI9A 2L3DA 4MQVA 1B3QA 2L9RA 4YIOA 3BZCA 4KITB 5KAFC 2F5VA 4MTDA 1YRNA 1YW9A 1R6RA 3CS5A 1IN6A 2E1CA 2MFZA 3C3SA 1L3LA 2ARHA 1J5EB 2VQEO 3JAMZ 3WG9A 4DUYO 1ULYA 1HNXO 2CW8A 1JGSA 2JGDA 4R1HA 2XPWA 3BR3A 3BTJA 3J80K 3W6VA 4DNCA 3S17J 2K3FA 3VODA 1LNQA 1VQMV 5K7HA 3HOWJ 1X3WB 3S2DJ 3O8HA 1R36A 4X89A 4ZBMA 1IBLB 4YXWG 1SFUA 2K9SA 3KEYA 2NS0A 5M5YJ 4NC7A 4X1KB 3QWLA 2EBOA 5F0HA 1LE8B 3K2ZA 3E6BA 4BJ6C 4YIRX 3FMQA 4PDMA 1G3TA 5LHGA 1FBUA 1OCTC 1OR7C 1R6TA 2QM4A 2EZKA 2YX7A 5GPCA 1OCCH 1K6OA 2Z5UA 1D1BA 2P7VB 1OISA 2CQ7A 1R9TJ 4OGQB 3ZJZA 4LF7O 1WPBA 1QVFU 3ABLH 5IJ0B 3HIFA 2M0CA 3LOCA 4LG0A 3VQVA 4ZYEA 1TWGJ 4WBNB 2PQ8A 1KU7A 1BL0A 2IGKA 3W7WA 1VQ6V 3F8BA 5ILUA 2E71A 4I0XA 1D0ZA 4IZZA 2R7SA 2RVCA 2QKMB 1DPRA 2G9WA 2ITCC 5FLXK 4O4JB 2KQXA 2E19A 5EZHA 5HNHA 1VQ5I 5DN6G 3H3UA 3JD1A 1V54C 2DQRA 5BMZA 3MZYA 1XDUA 1JR9A 3OY9A 1AKHB 3AG4C 4R79A 3OIPA 1Y74B 3O3KA 2XTAA 4DW6A 3HSEA 2H1LA 5CA1B 4HA8A 4L87A 4IRHA 4IHXA 2VWKA 5L3CA 3OS0A 5EZYB 2Y48A 3BPXA 3HUGA 2RC4A 3WTZA 1QPIA 2PMZA 2QDOA 1X3UA 3ETGA 5EBLC 5LP6C 3I58A 1XPXA 3ZEDA 1JHHA 1LVAA 1NTKH 1FXKB 1US6A 3B4SA 4LBEC 2VQEB 4FK5C 4I01A 3FHNA 1PUEE 4DUZO 1JMKC 1FBQA 1TWFJ 1VQMI 4FT8A 2K4BA 5JFRA 1HNWO 1TWAJ 1SKVA 3STLC 3KP6A 3R60A 2OCEA 2DOFA 1NHAA 3CDHA 3MHSC 4U3FH 2XAJA 1S76D 5HFMA 3OT7A 1G8XA 4B3MB 5GP9A 2Y0SN 5TRDA 1Z6RA 4LF8B 1B8IA 2E2IJ 2GSMB 3K06A 3U1KA 5D5QA 3H36A 5GW7A 4UUSA 2R7DA 4O4HB 3R0AA 5FB2A 2ZM6O 2ZR3A 4AD9A 4B43A 3E35A 4KIGA 2PMHA 1BR4A 1BMFG 2FBIA 1OJHA 5GTIZ 2BVMA 2ZJQF 1AU7A 4DV5B 3BROA 2BY0A 1I5ZA 2NNNA 3RPUD 3CMEI 4ENMA 3FZVA 2A79B 3K0GA 1X1AA 1ETYA 2V6CA 4UB6Z 3B02A 4QNHB 1HKSA 5FL7G 1S7EA 2CTQA 4IYIA 2RQPA 1SAUA 4DOZA 2XGCA 2XKOA 3CLOA 1BBYA 2KDZA 2M0MA 3UCSC 4LFAO 2KSDA 4CICA 2IS2A 2COBA 3E8BA 1XHZA 1RPWA 2GBYA 4CHUA 2LTPA 2VPLA 1USSA 3HBLA 1SETA 4ZI7B 3JRHA 1OCCC 1S5HC 5BMVB 5JJNB 3NRVA 2BOBC 3CRQA 3HYIA 2YDEA 4LFBB 4GKJO 3VBBA 3NWTA 5L3GA 3DPTA 1M57C 4HSTA 2ZMEA 1Y39A 4MT8A 3K4CA 3BR0A 3SYCA 1FBSA 1JA8A 4U3JB 2R7QA 2EWNA 3FYEB 3GXOA 3LNNA 2Z1DA 3L75H 2JA6J 2ID3A 4HEA2 5F0FA 5DS9A 2JA5J 3B09A 1HSTA 4Y17A 1O7FA 3Q9SA 3QPHA 3MD2A 1YI2I 4RGRA 3F3XA 1FSHA 4U0WA 2JDIG 4D5FA 4BIZA 3CCVV 1WJZA 5CBFA 4RB0A 4AIHA 3ZQIA 1LEBA 4II2A 5C8YA 2MH9A 4H44B 1G1XB 3EVKA 3AL0C 2PI0A 3K9SA 3MFKA 3H1IH 4CS3A 2PI4A 2E1NA 3W7TA 3K2AA 4I5SA 5BZBA 4D7SA 1NJIW 4G6QA 1UFMA 1IN5A 1V9PA 4J10A 2K9NA 3SFIA 1MZEA 1D8JA 4Z6YA 2UXBO 2E1OA 3TGNA 4QJFB 4I98B 3HKEB 1RETA 2PYLA 5IWAO 3T8TA 2R7RA 2VBYA 4I76A 5CPRB 5F0CA 1SERA 4C30A 1BR1A 2D45A 2WAQN 4DV2B 1NU1H 1SC7A 1D5YA 1WJ5A 3AG4H 4ITVA 1PDNC 4CBCA 1SD5A 4UCSA 3CCQV 4MTXA 4NXMO 2L7FP 4CGZA 1UHMA 5IY5H 2HI3A 4TUYB 4PJMA 3TO9A 3VB2A 1A5JA 1ENVA 4MW3A 2H09A 1SZTA 2KJBA 3H9VA 4EB6A 1XS9A 4UXNA 2P5OA 2HHHO 5FD6A 3BCCH 1IBMB 1IUYA 3OS1A 2JA2A 3HC7A 3LSJA 3P7NA 2BW3A 4A5MA 5TISZ 3PNVA 5LP6A 4DV3B 5K7FA 2ZE7A 3S93A 1FYMA 1NBMG 3IH4A 3RYRA 3PO2J 2B0LA 4L9JA 4BXXJ 4XLAA 3WU2Z 4IHJB 4FLZA 4DYCA 4YJ3A 4LF9O 1AP6A 1XDSA 4MVZA 2IS1A 3CDIA 4A3JJ 3UO3A 4JI1O 1K83J 1Y8QB 2DFEA 3A4CA 4HAMA 3FD9A 5B1BC 1BOAA 3T2MA 4C2MJ 1W36C 3S3WA 4GT1A 1OYYA 4JYBA 3BCBA 1JUSA 2ZQMA 3S14J 4LMYA 5LOVA 4IQJA 2OCCH 1HDPA 2KJCA 5J6XA 2CW0F 2GUZB 4UNOA 1IAWA 4L9VA 3E8FA 4MGRA 4XLPF 3WGIA 2HZTA 3CE2A 2DOSA 3SPCA 3CPWU 4PGHA 1ACIA 3CTAA 4BXUA 2AXTZ 3VYTB 4DR7B 3JAMN 5DCMB 2RNBA 2HQNA 2PLYA 4CH6A 1RC9A 2Y69H 4LLGF 3I71A 4Y33A 4AQYO 1REPC 5JLWA 3DTUB 1DP7P 2VIXA 4E4EA 3GZNB 5GADJ 1AR4A 4NTYA 3M3YJ 2HQAA 3L00A 1KKCA 1IRFA 5JQGB 4GKKO 1CF7A 3HRTA 2BY1A 3B6CA 1WWXA 2F2EA 2LG4A 5D5XB 1VQ7V 2UUBB 1KA8A 4LWSA 2O6GE 2QKSA 3F0CA 3FB6C 3JRCA 3CF2A 1C0WA 1QA6A 2YIBA 4H33A 3W7XA 2JUCA 2LYCA 1KYWA 4HOBA 4FLUA 5J1YA 1VQNI 3H1JH 1X2MA 2KRCA 3A8TA 3TCUA 2VKDA 4O3MA 1H2NA 2M7WA 2Z33A 5AG2A 5K5RA 4X64O 1MZBA 3L7WA 1EH8A 1Z91A 3KPHA 2OUMA 4IPAA 4QWQA 4CH7A 3FB5C 3H1HH 3HKEA 3RFRA 1Y56A 1YFHA 3H0GJ 4OXSA 2DA5A 3UNGC 3CMAI 1MD0A 2R70A 3AG4B 1R58A 1WFXA 4BXFA 2F4OB 2K3PA 4RB2C 1A35A 1WN7A 4B7KA 5IJ0A 2X6WA 4EJVA 2V1NA 2QBYB 5CVVA 1Y76A 4IL6Z 1WCMJ 1ZG5A 2ZNIA 4AIKA 1VEWA 3I59B 5LMUO 1KD1W 3PQJA 3VFZA 4A6DA 2B9SA 1Y76B 4CCKA 5FLXN 2ATKC 2R7OA 1O3SA 2PFBA 4NXNB 4E7IA 2DFHA 2PY5A 2VQCA 4X1YA 2IXSA 1OCRC 4JI0B 3M8FA 5B3SH 3CD6V 1NH2B 2X9DA 2G7HA 1D3YA 5ICCA 2DMTA 2PMUA 2VQFB 1HKQA 3EUHC 3VYUB 4C3HJ 5J1UA 2R92J 2CTPA 3OSGA 2QJ1A 4IYHA 2MW2B 4BE0A 3N27A 3OEHG 3WGGA 2Q8VA 4LCUC 3OYLA 4GCVA 3CYOA 4AI8A 2OTLI 3BR1A 1TVKB 2DN9A 4M73A 2JWTA 1KQ9A 4CS4A 5E1ZB 2JA7J 2AHZA 5H5NA 4FLWA 4E70A 2R5ZB 3D36A 5JHFA 1H9TA 4XM3A 2CDYA 4O2AA 1V55C 4GXOA 1QNMA 2PGGA 3DQVC 1YHQI 4C2TA 2ZE8A 3ZIAG 1LJ9A 4A3LJ 2N05A 3QF7A 1VNDA 3UKMA 3CMAV 1OZ0A 1KP2A 1T8IA 2Y0MA 1VQLV 1VQOV 4B3TO 1EH6A 3ZHUA 3OFNG 1YJNV 5IPAA 1IUFA 3LFUA 5TJJA 3JALB 1S29A 2CUZA 1R71A 3K04A 3EUKL 4MTEA 4MEYF 1ZAOA 3EQLF 3ZQHA 1DQUA 2E76B 3SEZA 4B44A 3JARA 4A3MJ 3A01A 4HRIA 2YI8A 3ELKA 1U6GA 3SYPA 3CCVI 3VOEA 2OTJV 1QR9A 1VQ5V 2YUSA 3DKWA 4X65O 1QHGA 1VF9A 2JZYA 2E5LB 2KZGA 2EILH 2JN6A 4FLVA 1S7OA 2MA3A 5L3EA 3RVYA 1R4MB 2X1DA 3DLAA 3QU3A 1WJDA 1SQGA 1P4WA 3W6JB 1N32B 1M57B 3OM3B 1I3AA 3A02A 4LB5A 2VODA 3JD3A 4RGSA 4U0VA 1B8IB 1DGSA 1BC8C 1IW7F 4FE7A 2LRDA 5CVUA 5DV5A 4E6KG 4A3EJ 1IC8A 1AHDP 3KP4A 1ERDA 1XDCA 3FIWA 1IGNA 1K97A 4NQWB 3IFXA 4QGPA 1XGOA 5K1XA 4Y15A 5LP6B 1YI2V 1TP4A 1VARA 2Y69C 1JUPA 2XROA 3H0DA 1FXKC 1D0XA 3JASB 2JK5C 2OU2A 2LOOA 5CBGA 1G59A 4ZJZA 2ZE5A 3CP2A 4CZCA 2XPUA 1T08B 2VJ4A 3CLQA 3KIOA 2A07F 3G4SV 2G7UA 5E3MA 4A3KJ 3H3VK 2YSUB 5DCFA 2D5VA 4ENNA 1BL8A 5A2QK 3OR7C 3R4KA 1WJEA 3CCJV 1PVEA 3GUDA 3NWSA 5DECA 2CMPA 4PA6A 3RYCA 3PNYA 1Q82W 4JI6O 1M56C 1VQ7I 2E1MB 3RIRA 2DDBA 2ZJ2A 2OYQA 3STZC 3FX7A 3QTCA 3WG7C 2Q0OA 4HX7A 2HEOA 1O9HA 3CUQB 4MTGA 4DRXA 1HLVA 4XBFA 2E60A 5GAGJ 1W0TA 1D0YA 1IX9A 2BCCH 4DXWA 5CKTA 3HOUJ 5C93A 1FT9A 4DR1O 4CCOA 3HHHA 5FGMA 2H8RA 2JVDA 2BOLA 4Y13A 3BRCA 5E1AC 2HTJA 1H2GA 4FLTA 2JGUA 2VJIA 3OOUA 5IT3A 2ZFWA 4DW1A 1YIOA 2PEXA 4U7DA 4W4LA 1FOYA 1P7BA 1ZSPA 3T1BA 1VQ4I 1TAEA 2F66C 4PD4F 1YX5A 1EKEA 4F52A 2BTOA 2PJPA 4GLXA 5EDNA 2L01A 5E1XA 1TLHB 2HDCA 1UPGA 2B5UA 4KL1A 3RYIB 2BHZA 5B66C 5F1RA 4XKCA 3Q3SA 1XBLA 2MD0A 1DLBA 5IYBJ 3CJNA 2FD5A 4XOTA 4M6VA 3ZQGA 2DPDA 2HPMA 2L4AA 2EV5A 2WTEA 1D5VA 1JJOA 4RM2A 1MNGA 2L9VA 2A69F 3F6VA 4DBRA 2Y4TA 4RQFA 2GTAA 4CYDA 1W7PA 1RESA 1IDYA 1RUOA 2IAIA 4CCJA 4QTRA 3I55I 1V55H 1J09A 2E2JJ 5LRRA 4FTHA 4I7ZB 4HX8A 2DT6A 2XASA 4PUSA 1GTOA 3F23A 3B8MA 4DZJA 1FOKA 3K1PA 4FCYA 5EGOB 4E7SA 3ABLC 1YEWA 1U9NA 5D5UB 1LQ1A 4JAUA 5FNVA 3QO7A 2O03A 1Y1WJ 2ZKOA 3A1YA 3OYHA 4MHGA 2VPRA 1NH3A 2ADQB 4JV5B 2Q4PA 3CC7I 3LSUA 1FD9A 3LSHA 1IXRC 2P7CB 3QP6A 3T8RA 3WTWC 1A31A 2IA1A 4ZIBA 2EIKB 2HFHA 2NNUA 2B63J 1XSDA 4WCEV 4DZPA 1ZL8A 4MLOA 2UUBO 3K4LA 2DE0X 4YG2F 3OMIB 4YIFA 5IT9N 3ABTA 3HL2A 1LB2A 4IHVA 4XLNF 3MD0A 2XVCA 3TOBA 4QIWF 4MFDA 1XREA 4D1QA 2Y75A 3JSPA 4OIOF 4K0KB 1BZKA 2ZINA 2VBWA 5GTHC 1T0FA 4IHWA 1IBKO 2K02A 3BCAA 3M7GA 1OCOB 4PDKA 2P4VA 3E22B 2D3OW 1P7GA 3GB7C 1MW7A 2QVOA 2ZXHA 3GF2A 2FJ1A 4J19A 1OCZB 4AU7A 4H0EA 3GTJJ 2BBYA 3MVPA 1ODDA 5DD4A 2VE9A 5K7ZA 1X1BA 5CA1A 1D1CA 2MLKA 2CWEA 2M8GX 3C2BA 2BV6A 4OAYA 1TUBA 1Q6IA 4EB6B 2G0EA 3ECOA 2YEVA 2ZCWA 3P9CA 4CH4A 1AI4A 3CC4I 3GTLJ 1YJ9V 4O4LA 2VQGA 2ZIOA 2FSWA 3ZN0A 4JI1B 3FISA 1YHQV 1O4XA 4BQQA 5B1BB 1XL4A 1GM8A 2WLLA 5KHJA 4NYKA 1QVUA 2HXOA 1V4RA 4F4LA 1S9HA 3BFRA 2EQRA 1E3OC 3CEIA 2GLOA 4X20A 3RVZA 1JE8A 2PMZN 2KIFA 3JATA 5BR8B 1BHBA 4HLXA 2HTSA 1Z3YA 5EBMC 1N34O 4XRSG 2GM4A 4LD5A 2RQ6A 1QZZA 3HKZN 1E1RG 4EFEA 4C3JJ 3GTKJ 3S2WA 3F22A 4L18B 4WK8F 1Z0XA 3I4PA 1F51A 3WHBA 3CWBH 3UT5A 1UJWB 4YFXF 3N2KA 4PDLA 4JI0O 1T0FC 1VQNV 1ETWA 2DQ0A 3Q0WA 3QPTA 4EJUA 3FK6A 3G1OA 1PM9A 2LFRA 3RT3C 4JX6A 2F43G 4J7JA 2EIJC 1Q1HA 5F1JA 4MQ9F 2Y0SA 4BQAA 1R1UA 2QA4I 4DRXB 1MNMC 4XN0A 2XRLA 4S0HB 4D6TH 1VMGA 5EK0A 2ELHA 1XCVA 3S32A 1Q81W 1JX9A 2QQAA 2O0YA 4LG3A 3WE3A 2VKHA 1M90W 2F95B 1I39A 2Q2EA 3JAMK 2JJ1G 2QKAA 2Q73A 3EUHA 1Q43A 3MZHA 2X1EA 3D3QA 1T2KA 2DN0A 2WY8Q 1E0EA 4MTOA 3MCZA 3CCEI 1ZUQA 2NOJB 3LA2A 1ZTRA 3I5UA 1X3ZB 4A69C 4OWRB 5KHDA 2PF4E 3CJHA 5FLVA 3OMAB 1QU3A 4MIMA 1SQXH 2P5KA 2ADPA 5D8KB 1AR1B 1N33O 2RMKB 2DODA 2XV4S 3V42A 1F5TA 1S7AA 4XLHA 4KXRA 3IGAC 2JSCA 2VOPA 2LD5A 4DR3O 3CRMA 2FU4A 4F92B 3BEHA 4G7OF 5HFLA 1YJWV 3F9KA 1SAXA 3CC2I 2XNDG 1YXBA 1R5GA 3E7LA 3ZHVA 4JYAO 5JI6A 3C7JA 2K27A 2N04A 4M6XA 1JTYA 2DT5A 1B1BA 3C3TA 3CCUI 4M9SA 3KCXA 4PA9A 2QQ9A 2J5PA 3KE2A 4DYLA 4YEJA 5HS8A 4AIDA 4F93B 1OYWA 2LGQA 4XONA 1XG1A 3CZ6A 3RTRA 2XSDC 2VRZA 2KIMA 2JMWA 3CXHF 3FM5A 3G6EV 1O57A 4P55A 5GAEJ 5LGUA 2UZKA 2EIMC 3BA8A 4U3JA 3E6CC 5LXTA 1VQ8V 4L9TA 4C3IJ 5LGTA 2HQRA 1VQ9I 2JQ7A 4WFAV 3T1HO 2UUCO 2HYGD 3ESWB 4PJ0Z 1SFKA 2I8DA 1E79G 5K1PA 4ZYDA 2KG7B 3FXOA 4W4KA 3I53A 2BEOA 1URFA 3MZ8A 4NTWA 2CYYA 1YSCA 3JD4A 1CXZB 3F72A 3RI4A 2W6JG 3TXSA 1B6AA 2GQQA 4ENJA 4IL6C 3JAWA 3QP5A 1GDTA 4MVUA 3OYIA 2R9RB 2QE7G 2E74B 3Q9VA 2AGAA 2WSSG 4O2AB 5LA6A 1YJNI 4XIDA 5C8YB 1W5SA 3F5WC 4RAZA 4HNUA 2JS5A 3FBNB 4DO2A 1ZTEA 2HHHB 4FQGA 4JX4A 3FB8C 4DV1B 3TL4X 1MMDA 2WAQA 5D8LB 2NVXJ 1RFYA 2K1EA 2P81A 2QTOA 2GA1A 4UCUA 3RYHB 2E35A 4TQFA 4LNUA 4O4JA 3H5AA 4IX7A 2N74A 4BS9A 3D5RC 2K9PA 5LMNO 5D6EA 2DOAA 2M1BA 4HDVA 1HW7A 1YJ9I 2JEXA 3DEUA 2EINB 2Q9LA 4AYBA 1G3SA 2W85A 3L2CA 4H13B 4P9PA 2V4JC 1Z77A 5IJ9B 3SJBC 1WQ2A 2QEXI 1NI8A 3RWRD 3OUFA 1TWCJ 5EGOA 2DDAA 3ABUA 2KFDA 2X4HA 4J00A 3CD6I 3OUSA 5LRSA 1QZYA 3MDSA 1XNQB 4TV9A 1J5YA 4P9FA 3AG2B 4JYCA 2GZWA 1GN6A 2WA3A 3FX3A 2HDDA 1WH7A 1IDZA 2CU7A 2IJHA 4ZZDA 4WX9A 5JHUA 4LK1F 3K3WA 3K5LA 1UELB 5BPIA 2BY3A 1QLEC 3B40A 4UB8Z 3SPIA 2C6YA 1DGWY 3G4SI 5LEKA 3HOZJ 2E2HJ 1R3LC 2MBFA 1BN5A 3L2QA 4IJAA 4E7HA 5EZGA 3AG1H 1V54B 1J59A 3E8GA 4EEFG 2VL8A 1JXSA 1U9OA 1ONVA 1K8AW 3Q0VA 3LUTB 4XN3A 2CQNA 2EZIA 2E36A 4M71A 1YIJI 2P0WA 3MWMA 1I1SA 5BMVA 1K4DC 1F43A 5H6QA 4OMZA 1MBGA 3U2RA 3ZMSA 5LYJB 1VF5B 1VQPV 4N9IA 1HWYA 3S1NJ 4JZGA 2STTA 4U7BA 1JGGA 3CB2A 2UXDO 2RKHA 4YRVA 1TL8A 3BAAA 1N32O 1X1CA 1AJPA 5JH7B 3DLLF 2WLJA 4B4CA 4D7MA 3MEXA 2XUBA 3FWEA 2YS9A 4TV8A 1CQTA 4XLEA 4MW8A 2UUAB 3MKWB 4IOCF 5B1BH 1ZRDA 3BR5A 2DJVA 2K85A 1E17A 4HNAB 1LVKA 2ODMA 3BP8A 4GGGA 2FX0A 1WZ2A 1FZPB 2ZXIA 1M9NA 1O3QA 2DLLA 4DIQA 4G12A 2W84A 3RQ4A 2W4SA 3CCLI 4TWKA 4CCLA 1SFEA 1EF4A 3R66A 4FETA 3KP5A 3DXJF 1XC5A 2DA4A 5EEGA 4F91B 5EIBC 3C90A 1WA8B 4JAVA 2ZM6B 2ZCEA 4KFCA 5F08A 3CRRA 4CO8A 1FJGO 1HW5A 5L3BA 3A0BZ 2OAZA 3KYDB 1XUQA 4B3MO 2A68F 2I10A 3CUQA 4ON0A 3OYKA 4M3DA 2AXTC 3CUOA 1W7PB 1V5GA 2VASA 3ZN1A 4ZZLA 1IXMA 1GMGA 1TT0A 2A5WA 1B72A 1K34A 3ASNC 4C9YA 2OQRA 2WLLB 4RA2A 3UR3C 2CUEA 2ZFUA 1CGPA 2VQFO 1VF6C 1Y6XA 2LKPA 1XGSA 3ASNH 3U10A 3ZCOA 1FFXA 4ZHQB 4JI5B 2CTRA 4I02A 2ZXWC 3OTOB 3AG7A 1B9MA 1YTFB 3LDEA 1L1FA 5ICGA 3CMMA 3MKYB 4I0AA 4LFUA 1GRJA 4WFHA 4KMUX 2ZE6A 4GYIA 3ZMDA 1WPXA 4UVCA 4I7HA 3HM5A 2VQLA 1T6SA 4A2UA 5IOZA 4KT6A 3W2AA 2WLHA 2W1OA 3BG7A 3FDYA 2YICA 2FL4A 5M3FJ 2UXCB 2MK3A 1COWG 1I94B 3NEUA 3IUOA 3TW7A 3K4BA 1O3RA 4LH7A 2F4VB 1YS7A 2LDUA 4QSHA 5J4YA 5LD2C 3ISPA 1K4SA 3BZKA 1WP8A 2ZJRF 3LQRA 5H20A 2Q7GA 3KEQA 2W82A 5KLVH 4X6AJ 2QGUA 1ZARA 1EN5A 1I5YA 3LAPA 1G6UA 2CH7A 2FNAA 2EULA 3ROUA 3LAJA 1U78A 2Y2ZA 2F93B 3SPGA 3PUBA 4NUBA 5FKMA 4DQ2A 5GTIC 2M45A 4MVOA 1Y0NA 1N75A 4XOPA 3FXMA 4BHPA 2H94A 4Q5SF 3H5RA 2ZNYA 4N4NB 4IIJB 1W7PD 2TRTA 3PFYA 3PM1A 3P3PA 4PELA 2ZXJA 3C2HA 2DMNA 2EZHA 2OPTA 4UVAA 2Y9ZA 2EILB 2ETNA 1XTAA 5KCMA 2YEVB 1S0VA 2XDVA 4XORA 3QPSA 1AR5A 1XB4A 2HDWA 3CMYA 4FX4A 4WFBV 2HR3A 6PAXA 4K3AA 1X19A 4DR7O 3AKZA 2H1KA 1NR7A 1K7AA 1DF5A 4K0KO 3GFJA 3DP7A 3HTSB 4Q4ZF 4UHTA 2VC1A 5FFXA 3CRAA 3E97A 4BU2A 1P7JA 4CUGA 4JF3A 1WJBA 4KJZA 1T56A 4BY7J 4UV9A 4BHBA 4YELA 3PL8A 1Y8RB 1QCEA 4J7ZA 3IAS2 3RGBA 1FFTB 5DM6F 1FC3A 2QSFX 5B3SB 1S5LC 4JI7O 2RJZA 4B09A 2AQFA 1X58A 3BY6A 4JI2B 4B1RA 3WU1B 3ZBHA 1JQ0A 1QQCA 2BTQA 4IOAF 1CPYA 4TOIA 1YITV 3D36C 1THZA 1I3QJ 3HTUA 4XQFA 4JP0A 1EH7A 5ERIA 2CJJA 1PL4A 1QLNA 2Q7HA 4PZJA 4EGZA 4HYEA 1SVLA 3ZPLA 1JKPC 1GH6A 2ELJA 4HNAA 4XICA 2FB5A 2STWA 1AILA 2CE4A 2P22C 4DV3O 3JTHA 4DYRA 1FPQA 1EN4A 2D1HA 3WODF 3OMYA 2IU3A 3L70H 3M7MX 4NHJA 4RGUA 4GO1A 2Q0AA 2DFFA 3S8PA 4O6JA 5E3LA 2RN7A 1XQ8A 1SC5B 1Z5VA 1H38A 2JJ7A 4WF9V 3SQNA 4KMFA 1S5JA 2E7WA 2HJFC 3L2WA 1MBKA 1K79A 4HBLA 2VS0A 5F64A 1V54H 2DMQA 4WFEA 2UV1A 2DAOA 2Z16A 3U21A 1ZG3A 2WV0A 4B48A 3K4JA 3CP1A 3E1SA 5A9GA 3W6KB 3KKYA 3F8FA 2CV1A 1YIJV 4OX9B 4FLXA 2HNHA 3DXRB 1DGRM 4N4OB 2DPUA 3E86A 4BEHA 1B9NA 1CP9A 2Q5ZA 2OTJI 2ZNZA 2EJ7A 3RYIA 1G3WA 5D6FA 1SFOJ 3B8NA 2BE5F 2RNJA 2ZIMA 3ETDA 1H0MA 3ZQ7A 3ZRXA 1Z67A 1E2XA 4AVZA 5KAFZ 2FTKA 3FBIB 3GCMA 3PJRA 3H9QA 1AWCA 1F9NA 1Y4MA 2XRNA 1LFUP 1OKRA 3MMYB 5CA3A 1W0JG 2A3QA 3RDIA 4LG0B 2UU9B 3ZQFA 4ZDLA 5AONA 2Q69A 3LDDA 1O3TA 2GBOA 3I3LA 4LP8A 3OR2C 4JTDB 2VONA 1BIBA 1NKDA 3IL2A 1V5EA 4F3QA 3G71V 3FKSG 1XNRB 2XF6A 2ZO4A 3K4NA 3HOXJ 1ZH5A 1GN4A 2JEUA 3WB1A 1FJLA 3MN2A 1BA5A 5F27A 2X0LA 3FFQA 3GWOA 1XEQA 4CXFA 2FKXA 4LF5O 1WH5A 3SYAA 4V19K 2MSYA 1LPQA 5F6FA 5D5PA 4LFBO 4EMSA 2DYSB 3QPLA 2DK8A 2LF8A 1JJ2U 2R7WA 1EV7A 1N8RW 1MMAA 3JALA 4X88A 4R8CA 1ITYA 3AAFA 1R3IC 1SA0B 2D2CB 3ZXSA 4RS8A 1GVDA 2QM8A 1BQ0A 1ZGJA 3UT5B 3H01A 2DA7A 1WSUA 4KUMA 3SPHA 5DEQA 3ZX6A 1Y0UA 1Z7LA 5DCMA 2BXYA 1IN4A 2V9KA 2WAFA 3K6GA 4KT5C 5FFZA 4YJ2A 4DV5O 3V8JA 2L2OA 1KC8W 2X85A 3CCQI 4A12A 4K8XA 2XAFA 2MLGA 4CS2A 1PYVA 2P06A 3IC9A 2PJRA 4PDVA 3QO8A 5LOVB 4EM2A 1AA7A 3ZMUA 2CH0A 4M3EA 2AQEA 4JI2O 3BC8A 4BNCA 4LFCB 4JI8O 1FWZA 1SMYF 5CYVA 2YXHA 2OCCC 2CSOA 1P2FA 3LL7A 5IYDJ 4LF4B 2KHMA 2RV8A 3GTGJ 3AK3A 5HDNA 4Z1MG 2Z99A 2L7KA 2XB0X 3HOTA 4QPOA 3A0HC 3PUFA 1Z5WA 4FPPA 3TETA 2O57A 1QU7A 1VQPI 3LWFA 1SVMA 3TK1A 3SPJA 3CJQB 2P5VA 2O7OA 1AI6A 2IA0A 4P2ZA 2V9PA 2YU3A 4G8XA 5CJ9A 2YUAA 1P9QC 5JQGA 2R7TA 3OV8A 4UV8A 5KMGB 5ILVA 1Z05A 1CEZA 2XAUA 4G94A 2KRFA 1S6LA 1SANA 2DQLA 2IJLA 5J4VA 2EFNA 3IKTA 2FRHA 1SS3A 1YF2A 2GUZA 4X0GA 4TUYA 2IGNA 3CHXA 2WY7Q 1WB8A 1PL0A 3HR0A 3JCUZ 2K9QA 4LGWA 3HKBB 3R65A 1XMAA 3S2HJ 3R6SA 1W1WE 2Y0PA 1OPCA 2KISA 3JRDA 4RB3C 4YFNF 1VQKI 1R3KC 2EIKH 3ETEA 5KAIZ 2NLJC 4BW9A 1D5AA 3JCZA 4ZYAA 2W7NA 5KHHA 4A3BJ 1HDDC 1HW2A 4II3A 3L09A 3QYFA 3BABA 4MNUA 4TSFG 1FYJA 4ZTJA 4XSZF 1MH4A 2R7ZJ 4JASA 1R5ID 3OYJA 1TW3A 2L4MA 3CCRI 5HS7A 3H9JA 4DV6O 5LEJA 2DYSH 1G3YA 2CV0A 4NKGB 1GN2A 2WBMA 4N21A 1WP7A 4QPJA 5D4RA 3OIQA 3F8NA 2X1CA 3L72H 5JVDB 4HQMA 3ZHRA 2OWOA 2P4WA 4OU0A 1SQQH 1J7KA 3TDZC 5EZYA 4NTXA 1IBLO 4LOCA 1K9MW 2CTWA 3BG3A 1L0NH 2JT1A 2UXNA 4P5OA 2X6AA 4JI5O 4LFAB 1K4TA 3H1KH 2LLKA 4PI2A 5IP9J 1OCOC 4UCTA 2DYRC 4CC5A 1GXPA 3OL4A 4DUYB 1HNXB 3KLNA 2YS8A 1Q7YW 1NR1A 3ICXA 1H2MA 1K78A 3FM3A 1AI7A 2KIQA 5EYRA 4A5NA 1PUFB 1NG7A 1I0HA 1ZYRF 3RSNA 2MC3A 4AUXA 3IV5A 4ICGA 1Y1VJ 4Q48A 4EQQA 1G2HA 4DBQA 1BJZA 2WLIA 1GT0C 1KYOF 4XK4A 2EFPA 5B1AC 1IVSA 2PI5A 4KIFA 2IH3C 3H1CA 2NR5A 3H3ZA 1XHXA 1YW8A 2L35A 2W6IG 5KVRA 1J9IA 5EG0B 3EXAA 3K5OA 2EZPA 2LQTA 4KISA 1MDMA 2ZDIC 4BQNA 3K08A 1NVPB 2XAHA 4B3SB 3CP8A 1ZLKA 1E3HA 5FKLA 5DTDA 3CX5F 2PBIA 2HOEA 3H35A 1IXBA 2AXLA 4B7EA 3RKXA 2QA4V 4GX5A 1VIBA 4PJJA 4A3IJ 1YCIA 4DUZB 4DR4B 2BSKA 4GUNA 4B8XA 1KQ8A 4AIJA 1NK2P 2X6XA 5M5XJ 1XL6A 5C3EJ 3DEEA 3Q4HB 4HZ3A 3WGHA 9ANTA 3JYCA 3C18A 3JRGA 5CB4A 4XKWA 1LFBA 4I9WA 4ABMA 3IAYA 4U7OA 4M9XA 3B2EE 3QNEA 2Y4UA 2MGQA 2RAEA 5EEHA 2P7TC 5B1NA 1XI1A 1HNZO 4BIOA 5A2QN 4BL0B 5FPOA 1GLNA 3OYEA 3QO5A 3ZRWA 1EZVH 1I50J 3S15J 1F4MA 1XSVA 2XGXA 1T5EA 4NR1A 3ZHSA 1N78A 5J2TB 1MDMB 3O65A 4DV6B 5DEDA 4RB1A 3GYHX 1HOMA 2YR2A 3B77A 2M9HA 1RP3B 1FNNA 2XB5A 2R9IA 4XDKA 5ILSA 3CJRB 2DQ3A 4EEQA 1Q86W 5CLSA 4QIWN 2LR8A 5J2UB 5LBQA 2FEZA 3DKYA 1W0KG 1BIAA 1ZLZA 1I94O 3AG3B 1RM1B 2PYJA 4BY1J 1GUUA 1S3JA 1YJWI 2HVRA 2QGNA 4E2LA 3RYCB 3JTGA 2OCHA 1IDSA 2IA2A 3HEFA 3ZHQA 1FS0G 5E20A 3F8CA 5CB4B 1YLFA 2KQRA 2P5LC 3ZS8C 3E2EA 2BHYA 3OGIB 1R49A 4FMTA 4H37A 5CA0B 2ESNA 2OT5A 2ECBA 4E7LA 3L1PA 1PD3A 4Y4RA 2DMXA 3A0RA 1WPKA 2K4JA 3HSRA 1H88C 2FUG2 4MO7A 3ABKC 4A0XA 1PKXA 1NTMH 2A9HA 4PI0A 1R22A 3RPQA 1D5NA 4HF2A 3BTCA 4B3XA 2DYRB 4BJTA 4UY8I 1MOFA 3BR2A 1MJBA 2EIMB 2KKOA 5FKOA 2R3SA 3FB7C 1QVGU 2Q1ZB 2QZ8A 3S3MA 3GMEA 3IJ4A 3S3XA 4KN7X 1FIAA 1POGA 2YSRA 4PGGA 3CO7C 4X1KA 3VQXA 4EKWA 2KL4A 1LE8A 3NR7A 1IRZA 2M2EA 3OR6C 4G7HF 1TZLA 3PO3J 5LL6Y 2AHYA 1Z3XA 2MD5A 2QSHX 3HOYJ 4RAFA 1JI8A 4J80A 4DV1O 3U0ZA 4ESJA 5JCOA 3SDBA 4B08A 1UHSA 2A61A 3GW2A 1P84F 2M87A 3W2WA 3JARB 1P6RA 2ZD9A 2QWRB 1ETVA 4NC8A 1PPJH 3LA3A 4ZH4F 4I0XB 1FSEA 3N97A 2E75B 4HPQA 1WJFA 2QQBA 3JAWB 3S1QJ 1WJCA 1DDNA 3ZMZA 1MBEA 1MH3A 3FXQA 5KA5A 1RRJA 4CCMA 2ZNJA 5H6RA 1STZA 2K40A 1RKTA 2B7EA 2P8TA 4U87A 2QBYA 4DV7O 2UUAO 3OYNA 1QPMA 1TUEB 3CSXA 3B6AA 2V1DA 4PSXA 2LO1A 2E34A 2LH9A 4CA0A 4D7NA 3JRAA 2QWPB 1KP3A 3ZR8X 1F36A 1SD4A 1TNTA 2AO9A 5B5EC 1MA1A 3AG1C 3QYEA 1H8HG 5DM6V 3W7UA 3CC2V 1BJAA 4LF5B 4GYGA 3S3OA 3BVOA 3I0TA 4QPQA 4RBOA 2Q0OC 4S05A 2V26A 3DC5A 2LF7A 3SZGA 2ZT9B 3CCUV 4JYAB 5IE9A 5JCOC 1KUQA 3PSFA 2O8XA 5KX5B 1YQAA 4I09A 3NAUA 3PSIA 2CW7A 3FXLA 1YTFD 2DYSC 4RUEA 3N05A 1B4AA 2IBDA 4AM3A 3M8JA 1SZXA 1UG2A 3DBRB 3HJEA 1LNWA 1MIJA 4F55A 2QUFA 4MEXF 5AIPA 3L74H 5JWPA 1N33B 3I54A 4IXAA 4M9ZA 1R6NA 4KHPO 1O9GA 1TBXA 2FQ4A 2Q6AA 4M3GA 4I9QA 5EEAA 1NG6A 2CFOA 2OJED 4E4HA 1ZGAA 4OAZA 3CCJI 1K3EA 3JASA 5KK1A 3K79A 1XMOB 1F4NA 2HJDA 2RREA 5CQEA 5CQGA 2HEPA 1Y6IA 4M74A 3DV8A 3RJPA 1T98A 3ZRWB 3DCFA 4MVQA 1FXKA 4RUFA 4RO2A 1SQPH 4JAAA 4ASUG 2PZSA 2CQQA 4KYWA 2N8GA 3ML6A 2XT9A 3C3WA 1OCRH 1EZJA 3SGIA 2P90A 2WB1N 4NDLA 2PUSA 1IRGA 4P96A 1XN7A 2OF7A 1E1QG 3MAJA 3FMRA 3NQOA 1B59A 3TP0A 4LF4O 2RN9A 1CF7B 2JPCA 2A5YB 5FLXZ 3HKBA 4GZRB 2FA5A 1H89C 5D5WB 4AYBN 3N2KB 2QWOB 4F6EA 3SDGA 2NVQJ 2QWWA 3ETQA 2BZTA 4CDGA 4L9NA 4DV4B 1U5TB 1F4KA 4JGSA 3WTYC 4WBNA 3DTEA 1T38A 3BG6A 3K1NA 5EBWC 1UG0A 5B1AB 2DI3A 3APQA 1ZHFA 4EJOA 4XR6A 4A3GJ 3AFHA 4DR6O 3M1EA 4KICA 3QG5A 4ZC3A 2W0FC 1FXHA 2CGOA 4PFPA 4FM2A 2H8WA 3TDUC 3IP4B 1DU0A 3L71H 2R5ZA 2F5DA 1MMMA 2A6TA 1SQFA 4J9YB 4CH5A 3H5NA 2CUFA 4K2EA 1OMIA 4D9JA 1D1AA 5ICEA 3J81K 3WTXC 1I5XA 5GONA 3T1HB 2ZB9A 2O9LA 2Q68A 1G6NA 1S77D 2P67A 3ASNB 3BA9A 3LSRA 3J80Z 4NVPA 4EJWA 1VQKV 4CYCA 4B47A 3HZJA 3DWLE 1TQPA 1RZ4A 2K5CA 2NVUB 4HNTA 1MSFC 3S1MJ 1NQTA 2MABA 2M6YA 1BQZA 1TA8A 4BDYA 4R8HA 1NT2B 4O4IB 2Z3YA 4RAIA 1ZKGA 3R61A 2QENA 3GLLA 1UHWA 3PFIA 2LMDA 3BZ6A 1X1PA 4XLCA 1BI2A 3WU0A 3WU2C 1BT8A 2ZXWB 3F7YC 1PNLA 3WB0A 1YO5C 3SYQA 4HSRA 1GV5A 3H1LH 2WAEA 2NVTJ 5CVJA 2V4DA 1K7DA 2RCVA 3A0BC 2OQGA 5JLXA 3I59A 1MSDA 1FMVA 1Q6HA 3KP3A 4YY3O 2WLIB 1X1DA 3JW4A 4AWXB 2UWMA 4Y52J 2XC7A 3UM7A 4DR3B 2R7XA 3V8LA 2RDPA 2E3CA 2QWQB 3ABMH 2DMUA 4EATA 1PNKA 1LEAA 3FKJA 3DU5A 1L8DA 3ABLB 4ETSA 2M7AA 2H8PC 4Q6GA 5ITZB 1A6QA 4TT3G 2CRGA 4H0LB 2LREA 2M4GA 3J7AO 1ZL8B 3UKGA 4A3FJ 1H8EG 1FKAO 3GTPJ 1H8AC 4PK4A 5FO5A 4I2OA 2YU9J 1G8MA 1LR1A 3F6OA 4P9UA 2EPFA 3HG9A 2NN4A 2XUMA 3AG3C 2ZR2A 2Q7EA 1RM1C 3ABKH 1IXCA 4ZOLA 2W48A 4UUVA 4YJ3B 2OV7A 2F4VO 3E6DA 2EX3A 1NZ6A 3OW2U 1NTCA 3R0JA 2E5NA 1QHTA 3O6BB 2XSJC 2W00A 2NXNB 2Z9OA 4OMYA 2ZDIA 2LBFB 3HHGA 3O2PE 3SYTA 3SJCC 3CUQC 3TW6A 3P32A 3S3NA 5LA6B 3CQZJ 3IKVA 3E8HA 2VJ5A 2LBFA 1SD7A 1UCRA 5A2QZ 5CBHA 2O5RA 1K73W 5LYJA 1YTYA 2P4KA 2YIDA 3E83A 3E22A 1H2LA 2ZMEC 3ML0A 4I55A 1BS3A 2YI9A 4EVIA 2B1IA 1KGSA 2XKPA 2JSPA 3OTOO 3I56V 4LJZF 1Z7UA 4XRFA 3TO6A 2GHYA 2QEXV 3RKWA 3SDLA 5LXTB 3DF8A 1GAXA 1AP5A 1RI7A 3MKLA 3K03A 4XNFA 2JUGA 4I4TB 1N34B 1VP7A 1AOYA 3KCYA 4LITA 5EYPB 3T4ZA 5BR8O 4JI6B 3CMEV 4Y7NJ 1W36D 2JA8J 4J7KA 1KQSU 1USTA 4E7ZA 1SF9A 3RYFB 4FM1A 4HF1A 3NARA 5GAHJ 4X8AA 3PIPF 1R23A 1EM1A 4P30A 3RN4A 2GA2A 1MMSA 2A0LA 4BBRJ 2XGDA 3G80A 3F21A 1U96A 3K59A 4BYYA 2EIMH 5L3FA 3HSFA 1ON1A 3J7YJ 2NRAC 3J7AY 1M93A 2CUJA 1QR8A 2VE8A 3FXJA 4FVMA 1FP1D 1OQYA 2DA2A 2V1UA 1FOWA 3H92A 2WWWA 4WWCA 4PDRA 1XOUA 4JI4B 4LF6O 1Z21A 4G28B 1Q6UA 4PV1B 2EBIA 1QVTA 2GTSA 2R5YB 1B04A 2CQXA 3ZQQA 2LSOA 1JJ8C 1X4OA 2NAZA 5F04A 4UB6C 5E3OA 2AHQA 1KB9F 3T1CA 3M99B 3D8CA 3FXKA 1BW5A 3BR6A 3G6BA 3CC7V 5IYZA 1W2BU 3RKYA 1WRJA 4HV5A 3LDCA 3X2QC 1GO3F 1HC8A 1U3EM 1GKFA 1OR7A 2YIAA 1FYKA 4N9HA 1JVMA 1KECA 3J81Z 4Q20A 3X2QH 1B6QA 4I50B 3K57A 2L9SA 2IS4A 4J01A 2Y9YA 1LUVA 1YOVB 1ZX3A 1XMQB 3ASOB 3I56I 3EUAA 3CDLA 4GFBA 3K0DA 4J11A 1B06A 3CCSI 4R6ZA 4XDLA 4W1UA 2OD5A 1F7YA 4D5CA 5IY5B 3ABKB 1M1EB 1MBJA 3TOAA 4LIUA 1PP8F 3BPZA 5CVIA 2DA6A 1ZLJA 1BI3A 5JVTA 5IP6A 1N77A 3ZCCA 3K58A 4PJ0C 1DK1A 2CQKA 3HUGB 3RCOA 5E8GA 2WWYA 3CXCU 1X4TA 2LY2A 4K8ZA 2ESHA 1Q5OA 4LC1A 1K6YA 5H9CA 2R93J 2E7XA 4G27B 4PJNA 5J3LA 4X20B 1PP9H 1KMIZ 5D4SA 4HW0A 4XL9A 1BI1A 2QQ8A 3J7ZI 3K70D 4X1EA 3GWZA 1QZEA 3M1CA 4FE4A 1ZELA 2HQ5A 5HLHA 1PUFA 2BOCC 2AS5F 3JSNA 1FEXA 2VN2A 3IRRA 2FBKA 2NYXA 2DTZA 2ICWG 3KX2A 4HG2A 3TP3A 5ED4A 4EGYA 2XAGA 1FFXB 1NS1A 4MVMA 3IAM2 4ZHQA 3HB9A 4DGWB 2ZMEB 1PV0A 4I4TA 4GCZA 2DXIA 4D7TA 2WPDG 4B3TB 2XF5A 3EETA 1MKMA 5ICFA 4NNJA 2CS3A 2ECCA 3FK7A 4IO9F 1U5TA 2KG7A 1D2DA 1FAFA 1HDJA 3M9AA 4KN4X 3CF5F 4JI3O 4Z1VA 1V3FA 1AROP 3WTVC 5GTHZ 5DDGA 1T95A 3DGEA 5HLGA 5LMNB 3OOPA 2IGMA 5FPRA 2GIZA 2EA4A 3LSKA 3BT9A 3HPHA 1G4YB 3WTSC 4Z2YA 3IWZA 2XIGA 5B1OA 1M4UA 5DUIA 1ZREA 3SR2C 1FJGB 1GXQA 1ETOA 4L5JA 1MG1A 1A36A 2RGVA 5E18F 3FAVB 1OFCX 1ETQA 1QO0D 3KYCB 3RBZA 3QOPA 1FYLA 3RYHA 4X62B 3JREA 2HS5A 2B1GA 4BWAA 3RQIA 5KAIC 1XGMA 4L0ZB 1KYZA 1OCPA 2X6OA 3E5XA 1Q8IA 5HLTA 2HFEC 4P9OA 5HLIA 3JSLA 4IQ4A 3GEZA 3JCUC 4G6DA 4JYYA 4PA3A 1V55B 1MZFA 4JQFA 3T4DA 3T1YO 3QU6A 4GDFA 3E5UA 2FMYA 4CZZA 1APLC 2KP6A 1TT5B 4JZ2A 4EFBA 2ISZA 3L73H 3CCLV 3K9AA 3ASOH 3SFZA 2UUCB 1FP2A 1LDDA 1R3JC 2R7VA 1I7FA 4V2GA 5BNGA 3ERED 3GZ5A 2WA0A 1W5CC 1GHCA 1BCCH 1W0UA 1Z2GA 2W24A 3G71I 1DPUA 4TV9B 4EJTA 1I08A 1SQBH 3TJTA 4ABZA 4W97A 2UXDB 4X64B 1VZ0A 3EYYA 3GBGA 3N2GB 5IDJA 1YDXA 2Q2EB 2NVYJ 3CJTB 4FFBA 3A0HZ 5JR3A 3OWTA 5GPAA 1RNLA 1QBZA 3OD4A 4UCOA 1JUMA 4CYCB 3AG3H 4QLCU 1AJNA 3HDDA 5LFAA 2CGNA 3SZTA 2VLAA 2VT3A 1RR7A 3KZIC 2EFQA 2M4KA 2ZKZA 4JYKA 3V7SA 1QHHD 4EM1A 3JRIA 5IY5C 5LHIA 1N0JA 5KUKA 3VPRA 1S8NA 4WFGA 2YXYA 2QM3A 2I5UA 2HYJA 3W2VA 2ZXWH 5BPDA 2GDSA 3V7RA 3I4NJ 4YY3B 2GXGA 1I27A 3A01B 3DC6A 4X65B 3BPVA 3I4MJ 5CMUA 1KBHA 1IO2A 4KIBA 2V6EA 4GYCB 4PCQA 4BGDA 2WV1A 5BOXA 5FLMJ 2DU9A 3ZP5A 1A04A 5FKKA 1JCHA 4QE7A 3ZMVA 1EA3A 1TNSA 1TTYA 2Q67A 5EJCA 4HLYA 1EN6A 2IU0A 1FMWA 2PG4A 3DPUA 3G3ZA 1ZK8A 4WXDA 2DYRH 3P30A 3AEIA 5D5VB 3HRMA 3W3CA 2ACJA 5BY1A 4O2BA 1XNQO 4AVPA 1SMTA 4LF6B 2WLKA 3OEEG 1LFPA 1WVRA 1R1TA 2F1MA 1JKRC 2F4IA 2JVGA 1PP7U 3K10A 3QYBA 1R7JA 2KT0A 1KKDA 2LW1A 1YX3A 1GM9A 2V7QG 3CRCA 2DTRA 5KX5A 2CAZC 2DOEA 4O5VA 5LHHA 5J9PC 1M56B 1TVKA 2E1MC 1L0OC 1X4PA 2GOXB 4DR6B 2M30A 4LF9B 1IZ3A 1TGOA 2QLZA 3DXRA 2GAUA 1XMKA 2EV0A 3VSLA 1N36O 3KP7A 3LSIA 3J81N 3BJ6A 3DEWA 1BC7C 1P4XA 4BE2A 3IRQA 1DP3A 1VQLI 1OJLA 1OHHG 1UMQA 1HR0B 4HF0A 5C44J 1SEUA 1M5IA 4MSWC 1VQ4V 1QRYA 3M8AA 1HR0O 3OYCA 2WB1A 3CCMI 2VXZA 5C4XJ 1N36B 1YZBA 2MW8A 4KP4A 3VQWA 4B3AA 5DM7F 3P9KA 3SEQA 3CO6C 3BTLA 2HP8A 4G6TB 1U8RA 5LMUB 1KONA 1I1GA 4M6YA 2FXAA 1W5TA 4DK1A 2DFIA 3H9GA 3M07A 2YPRA 4G7ZF 2DBBA 2GXAA 1ZWIC 3A2KA 3JR9A 3SJQC 1QLEB 1I6XA 5BS6A 1IN7A 5HOOA 3G6EI 4C2UA 4L5IA 1QBJA 1AJQA 4JTAB 2RQQA 2HXIA 4GX0A 2HGCA 1JHFA 1W59A 2UXBB 3L2VA 2CH7B 1DUXC 2QR4A 3KLOA 1L0LH 2YXLA 3FXRA 4U88A 2XF7A 2Y69B 5GONB 4F6RB 4FZ0A 2RNGA 3C1DA 3RZOJ 4A6EA 2XOKG 4OOIA 2H27A 1ETKA 4LH6A 3U9GA 2WAMA 1IBKB 4FFBB 1GVJA 2R5YA 1MBHA 2NOGA 4PFOA 1VQ6I 2VXDA 4TQDA 3GVMA 2DA1A 2LKXA 3ASOC 3ECHA 4GKKB 1SVOA 4OPAA 3O9OA 3KETA 2IGOA 2NNYA 1SD6A 1HBXG 2DW4A 3TBIA 2A7WA 5BXZA 3K5MA 5IP7J 1KU2A 4ZDOA 2EIJH 5FKNA 1ZR4A 3OYMA 2KIUA 3UQ8A 4RLQA 3KYLA 3CCEV 1MMGA 3WG7B 1N0NA 4BJ5C 2VBXA 4GX1A 2F48A 4RMNA 2HZDA 1KZHA 3SJMA 1Q90D 4IIJA 4GKJB 1MABG 1TUBB 1XGNA 4N23A 1S5LZ 3JAKB 2BTQB 1U0JA 1K5SA 3CESA 4FIPC 2K9MA 2M34A 1IG7A 2O8KA 2HLDG 4O4LB 4ZKIA 3FF5A 1UJ8A 3IWFA 3BJAA 4BDZA 2AW9A 3GTMJ 2ILMA 5E79C 2J5OA 4I6ZA 4G9YA 1SQVH 2QSAA 2FOWA 2AZ2A 2XHBA 3VYRB 2F5EA 3E0JB 3OGCC 3T1YB 1MJ9A 1JKQC 3BG9A 3ZGKA 1BM9A 2HVKC 3DSQA 5C4JJ 3L2RA 3SJAC 3W7SA 2W0XA 2R7FA 4ZYHA 2QYOA 2VC0A 2VT2A 2XAQA 3OIOA 5J1RA 5KNLA 3A2FA 2ME6A 1VTNC 4M3FA 1BSMA 2L6LA 4X1IA 4DV4O 5B3SC 2L9NA 4X62O 1IBMO 1IRXA 4JTCB 3LMMA 1YITI 1FXVA 3K1MA 2UUZA 1QGPA 2R0QC 4R7CA 5IWAB 1NK3P 2XPVA 3FMSA 1ZRCA 2BYVE 1FY7A 2VJJA 3D5LA 2Q8KA 1JTXA 2V1XA 1EJ9A 3GO5A 3T5XA 2BGCA 2M8EA 1JFFB 3BHPA 1ETXA 5K5QA 2LGWA 4NXMB 4BIUA 5EYPA 1XX5A 3F8MA 2W25A 3VWBA 3E89A 2KRHA 3I64A 2IS6A 2QCOA 2V7FA 1GK9A 1OCCB 5IYZB 1QQIA 4LR3A 3KG2A 4OPHA 4ENKA 5KMGA 2WC2A 3GLXA 4KNYA 2MC4A 1HA8A 3AG2H 2MYSA 3E5QA 2JRIA 3G2BA 1KQ0A 2F5CA 1VFCA 2CGPA 5FNVB 3Q0UA 3LSSA 2K9LA 3MHHC 2PX9A 2EIJB 1J95A 1YG2A 1SFXA 5EF6A 2EH3A 2JK3A 1UAAA 4F6RA 2FBHA 1RIOH 4FM0A 3CCRV 4J41A 1P92A 4A5UB 4KHPB 4UVBA 3WE2A 4ZYGA 5HDKA 4IEJA 4A3DJ 2EIKC 4E7JA 1K92A 3ABMC 3D5SC 1V5FA 4UFZA 4BR6A 4LB6B 2ID6A 4S04A 4HBNA 1JFFA 2X48A 4CCNA 3KEOA 4BH9A 2FF4A 2HWVA 3HB3B 2EB7A 1T33A 2IH1C 2R9AA 4RWUA 1OLTA 3WTTC 3HRSA 4LLLA 2LW7A 4XRSA 4YJ2B 4U0YA 2M5WA 1R73A 2FOKA 3TO7A 5JVDA 2V9VA 3B73A 4BAYA 1OCZC 3REOA 3GTQJ 5KHKA 4RGXA 3O8GA 4I55B 2QKCA 4JV5O 3KFWX 2IJJA 5JH7A 1H9GA 1F23A 3PN1A 3G67A 1XCBA 5H2FZ 2HVJC 3DPLC 1MNDA 3D1NI 1MSWD 2HKXA 1Q1VA 2LFBA 1TQMA 1PJRA 1VQOI 2RDCA 2QTSA 4PHZA 2A6HF 2DJNA 2DK5A 2E5LO 2EZLA 1BHAA 2W57A 4IF4A 1P7IA 4YIIA 4DJAA 3EYIA 1AVMA 4X9QA 1R4NB 5DD8A 3SXYA 3VEPA 5IYCJ 2DT7B 4HDUA 1E3PA 2MG4A 4FX0A 4XRMA 4QPKA 1XMXA 3OYFA 3VQYA 1J5EO 2ZSIB 3E6MA 2HOTA 4DR4O 2IT0A 1A6IA 3V4GA 2P6TA 1VF7A 4LWSB 4PJLA 4A0ZA 4JI7B 2JJ2G 4L8JA 2ELKA 2L7MP 4WXHA 2ADUA 4MTFA 3FXUA 3QODA 2OZ6A 4X1IB 4B3SO 4QE9A 3BTIA 3K9TA 1HQCA 4ASNA 5H2FC 2IJKA 4IT5A 1FTTA 2EFOA 3GTOJ 3LSGA 1P49A 2BXZA 2DCEA 3HRUA 2EJRA 1WNSA 2X7RB 1WAZA 1ZG1A 3QAHA 5CVRA 4IRIA 1N25A 2GV9A 1T39A 4LLNA 1WB7A 5EIBD 4DR1B 2VKVA 1MMNA 1R1VA 5DUKA 2X6CA 2KMUA 1Z1DA 3RYPA 4JI3B 2GXBA 2WADA 1A32A 4FJCC 1HNWB 1U5TC 2IRFG 4EV0A 3LA7A 3GVAA 3K69A 3GWKC 1HKTA 1TWHJ 3HKCA 4NBQA 5HNFA 4HNVA 2FMLA 4D0PA 2LNBA 3TGUH 2R7UA 2OCCB 2JRTA 3OR1C 2X51A 2H3OA 2OBPA 4KA4A 4WCGA 1JPXA 2D1VA 2COMA 1SRYA 1FIPA 2DWEC 1Y74A 4UB8C 3L9DA 3N2GA 3OL3A 2FNPA 5JVGF 4O2BB 2YIBD 2LP0A 1DF4A 2DMPA 3ZQCA 4AILC 3DKXA 4BQOA 1VF6A 4K35A 2YX4A 2Z2SB 2DJIA 5FROA 1O7LA 2H6CA 1MBFA 3KCCA 3IC7A 2BY2A 3WFVA 5TISC 3U1DA 1ZR2A 2R72A 3G1MA 4R50A 3WTUC 1SESA 4XDJA 5KHGA 4FISA 4I0BA 1YE9A 3TXQA 4ESFA 1GV2A 2KKWA 1Q3EA 3E3VA 3HXLA 3IHUA 5K5OA 4IGGA 4UUJC 5IJ9A 1BOBA 2GWRA 3OSFA 1OCOH 2HPIA 3K7AJ 4TV7A 4LF7B 4ZTFA 4BE1A 4LK0F 4MVSA 1S72I 3BLYA 3PNTA 5KUMA 2O61A 2DA3A 3MQ0A 4RLFA 3SHFA 1OYIA 2LK2A 4HZFA 3VYSB 2CK3G 1ENHA 2LP7A 2TCTA 4A3CJ 3KZYA 1K33A 4LNUB 1WGXA 4TV8B 1AI5A 5FRMA 4IHTA 3CCMV 1F1ZA 3K0LA 4A0YA 3V8KA 4AC0A 1XMQO 2OA4A 4BACA 4HYOA 4XLFA 1M1KW 4MS2A 4IKFA 4Q47A 1YYVA 3S1RJ 1IXSB 2KLOA 4A93J 4OIPF 1OV9A 2NS7A 3CCYA 4WF2A 1KU9A 1JOYA 4M3BA 1OCZH 1TC3C 2ITDC 3L2UA 1BR2A 1R1BA 2KPMA 5M5WJ 5K1YA 3KP2A 1K4CC 2WLNA 2LY9A 3EDPA 2LY1A 3K4MA 3JRBA 3J7AU 5LLQA 1IF1A 3CCSV 1WLEA
chains in the Genus database with same CATH topology
3JATB 3SZPA 5BQTA 1SA0A 4JI8B 3COAC 3PQKA 4IRGA 1U2WA 5JJEB 2A3SA 3LFKA 3HOSA 1TQIA 3HKDB 4M72A 1J75A 4NB5A 1RUNA 2V79A 5J2UA 5E1WA 3GZ6A 2IM9A 2TDXA 5AIQA 2FQ3A 4BHCA 5HDGA 2K86A 5HS9A 2CO5A 5J8FA 3BJOA 3RYFA 2VWJA 5E8IA 3RPUA 3Q5FA 3OTFA 5KHIA 3TQNA 4FLYA 1ZN2A 4WXCA 5IT9Z 4YHHB 4IVNA 5FD5A 3HKCB 3FHZA 4ESBA 1J2XA 4B3RB 2HKOA 4IHSA 4HQEA 1P4AA 4JBAA 5JJJB 1J0RA 4CH3A 2D2WA 2VBZA 2DO7A 4AQYB 4I50A 4HV6A 2UXXA 4OIQF 3MAQA 4OIRF 4FHTA 3D0SA 3L9FA 5ITZA 1HW1A 3P9IA 2JPBA 1QNTA 2CFXA 2EFWA 1IN8A 3G73A 1XSXA 1HXDA 2ZBKA 1Z9CA 3N4MA 4DV7B 2VOOA 5DYMA 2EK5A 2IVMA 4IHJA 1WKMA 1FX7A 1ON2A 3GFMA 1IZ1A 3BOQA 1LDJA 3BDDA 4CC6A 2MH2A 3HKDA 2HYFA 2F5FA 1UB9A 2PTMA 4DK0A 2IP2A 3GX4X 3ZMTA 3T0YA 1BI0A 3JAKA 2A6EF 4L0YB 3BWGA 2H6BA 4F7ZA 2IPQX 2CG4A 2O3FA 1TW2A 1RSOA 4UCRA