1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein MJ223
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
2FBHA 1PUEE 4HX8A 4S04A 3J81Z 1O7LA 4XBFA 1XB4A 2J5PA 5J8CA 1W4MA 1FX7A 2ESHA 5E8GA 4AIHA 1FYMA 2XHKA 1IAWA 1K78A 2H6BA 2Z3YA 1FNNA 1IRFA 3IRQA 4L5JA 2VODA 1TW2A 2JPBA 2E7XA 4IRIA 3J80Z 2A07F 1HSTA 2VBYA 4FX0A 3HHGA 3ELKA 2ZNZA 3NQOA 1T98A 4BHPA 1HKTA 1KGSA 4MEXF 2K27A 4R79A 3HRTA 3HIFA 2LNBA 4G8XA 1QNTA 1ZLKA 3LQQA 2VT2A 4QLCU 2JPCA 4GXOA 2MD5A 3BWGA 4EJWA 1REPC 2IW5A 1CF7B 4B8XA 1WQ2A 2EA4A 5AIPA 3WU1B 1Y0UA 3KLNA 3V7SA 1BN5A 2B0LA 2H94A 5FFZA 1I1SA 3F21A 2D1HA 1W7PA 4M6XA 2KJBA 3WTSC 3GYHX 4HZFA 2PMHA 3I71A 4BXUA 1JGSA 3W6JB 4EM2A 3ABTA 2YSRA 4AVPA 3QU6A 2Q8KA 1V4RA 1IUYA 1F9NA 4HF2A 2G7UA 1KA8A 2WTEA 1TQMA 4BAYA 3JAMK 2HKOA 3HYIA 1ZLJA 1F5TA 3MCZA 1MZBA 4M73A 2P7VB 4IRGA 2CW0F 4HQMA 3HRUA 5LHGA 5CVJA 5DV5A 1MJAA 5D6FA 5EEGA 1IF1A 1OR7A 2F5DA 4ENKA 2CGPA 4L5IA 2NAZA 2M30A 2A6EF 1Q1HA 5D8LB 2RKHA 4UVCA 2MLKA 4LLNA 3V7CA 1O7FA 4XLPF 4KFCA 2HYGD 2BE5F 3RPQA 1FY7A 1K78B 1GXQA 5LRSA 1JHFA 3QAHA 5L3FA 4ZZLA 4DQ2A 3IL2A 2V79A 2XAFA 4HX4A 4ESBA 3LA3A 4RB0A 4OMYA 2H27A 4KYWA 2PMUA 1SD6A 3WTZA 1LVAA 2FMYA 4GYGA 3GX4X 3I0TA 2M87A 3R61A 1WKMA 2CYYA 3WE2A 1T2KA 3LFKA 4CO8A 4XLNF 4GO1A 3HHHA 1LEBA 1IXCA 2HWVA 2QQAA 4F7ZA 2R7FA 2HS5A 3PQKA 3MFKA 2COMA 5LLQA 2C6YA 5CVRA 4HDVA 4Y13A 3V7RA 1J75A 5F1RA 2RNJA 2OQRA 3ISPA 2DK5A 2DW4A 2DK8A 3C18A 3M8FA 2Y75A 3PFIA 5D6EA 2LF8A 2DO7A 3R0AA 1UCRA 2DAOA 4KIFA 1J5YA 4RGXA 4HDUA 3HOSA 1O3QA 2NRAC 1DP7P 1XSDA 2KIUA 2QLZA 5CYVA 3TDUC 1HSJA 2FEZA 3KZZA 1R7JA 4MGRA 4LGWA 2HEOA 2IT0A 1SMTA 2STWA 3ERED 5LGNA 5D5XB 1XSVA 3FZVA 2F2EA 3MQ0A 2XIGA 4EJTA 1XGNA 1I27A 2ADUA 3TO7A 4Y15A 1BIAA 3WTUC 3WE3A 4P96A 4S05A 3IKTA 4L9NA 2EFWA 5CJ9A 2XVCA 4NHJA 2ISYA 2VOPA 3KCCA 5DD4A 2K7LA 2PEXA 3GF2A 3I54A 1XGSA 1W7PD 1P2FA 3U9GA 3IWZA 2HGCA 1WI9A 4RB1A 2DQRA 5IT3A 2CFXA 2GA1A 3L9FA 3GZ5A 3W6KB 4TV7A 3U2RA 3MWMA 2FNPA 4HLXA 2HDCA 2O3FA 2CG4A 2ZJ2A 2JSCA 1USSA 2YU3A 5HLHA 3CJNA 4G7OF 2DTRA 5D4RA 2VBXA 3EETA 4LK0F 5LGTA 3ZMUA 3I64A 1R58A 1J2XA 1R00A 1DPUA 1P4WA 5BPDA 5E1WA 1FYLA 4RS8A 1ZG5A 2ISZA 1YO5C 2PLYA 4KDPA 1E17A 1STZA 5FD6A 3V8KA 3G3ZA 5LEKA 5CLSA 1FSEA 1G3WA 1U8RA 5E17F 4LMYA 1BJAA 4RB2C 3RPUA 1S3JA 1T6SA 1USTA 3L00A 3AAFA 3FM3A 1T39A 4JQFA 4ZZDA 1E2XA 5HS9A 2JRTA 2TDXA 4EM1A 5FLXK 3RTRA 2EFNA 3GXOA 3F8MA 5HS8A 1J9IA 3C1DA 3WGHA 5JVTA 3DPTA 2L4AA 1HBXG 5BMZA 4YFXF 1U5TC 4G6QA 2R9AA 4EM0B 1LQ1A 1UHMA 3GWZA 3NRVA 3KETA 1LDKB 4M71A 2BEOA 3V8LA 4OIQF 1U6GA 2VONA 2NS0A 4M9ZA 4H0EA 4GGGA 1R1VA 4A0ZA 4P9FA 3CO6C 2L01A 1KU3A 2Z5UA 1PP8F 4U7DA 2IJLA 3IC7A 2QWWA 4M74A 1PDNC 2EV6A 1QZZA 4KT5C 2BV6A 1A04A 1Z6RA 1ZGAA 2VE8A 2EV5A 4LLLA 3LA2A 3F8BA 3L09A 2QVOA 5J8FA 3LA7A 3IWFA 2W25A 3J7AO 1EH7A 5BOXA 3RI4A 4Q4ZF 2PN6A 5L3DA 2GQQA 1TLHB 3ZMTA 3KP6A 5IT9Z 4MQVA 4OIOF 2DQLA 1WSUA 2F5EA 3HTUA 3KP2A 1B59A 4IVNA 1Z6TA 2P4WA 5K5OA 3K1PA 3WGGA 1YW8A 2XASA 2KKOA 3DP7A 2HOEA 4EJOA 3I59B 4CZZA 3HRMA 4A5NA 3P9KA 4M9XA 1I1GA 4ESFA 3KLOA 4P5OA 3O2PE 1CGPA 4WCGA 3CUOA 3N97A 3FXQA 2K86A 3DQVC 3FHZA 1IZ1A 3QP5A 1BC8C 2MA3A 5FB2A 2EFQA 3T1BA 1QGPA 4FHTA 2O6GE 5D5VB 1P4AA 5FGMA 4XRFA 1YTYA 4UNOA 4L18B 2L3DA 2QENA 3F23A 4ZYGA 3CDHA 3EYYA 3HSEA 5E20A 1ZARA 3NEUA 3QPHA 3J80K 1R5HA 4N9HA 1YW9A 2WV0A 3BP8A 2Z33A 1OMIA 1XCBA 3Q5FA 5DYMA 1U5TA 3TQNA 3B73A 1ODDA 1Z1DA 1RI7A 5JHUA 2GWRA 2GXBA 5ILSA 1ZREA 1RZ4A 3B02A 1MKMA 4K2EA 4RGRA 4ZYHA 3N4MA 2FE3A 3RKWA 2FQ3A 2YR2A 2W57A 4MEYF 4KMUX 4G7ZF 2D45A 2V1DA 4O6JA 4RGUA 3FMQA 2RDPA 4WXHA 4I01A 2DBBA 2HFHA 5KVRA 2J5OA 5E18F 2UZKA 3K9TA 5L3CA 2HQNA 2FXAA 3H3UA 5AIQA 2A61A 4EJVA 4E70A 3CO7C 3E6BA 4G7HF 2W85A 4XSXF 3REOA 5D4SA 2XROA 4PZJA 1KQ8A 2YPRA 2RGVA 1XD7A 2HKXA 5LBQA 1LEAA 4NB5A 3RYRA 2DPUA 4EJUA 1KYZA 2P6SA 5LGUA 4OOIA 2ZMEB 5L3GA 1G6NA 4U7BA 4IRHA 3R4KA 3OOPA 4BYYA 1UHWA 4HBLA 3ECHA 1XMAA 4OIRF 1TQPA 1XGOA 3K1NA 3RIRA 1KU2A 4CICA 1HXDA 2DI3A 1ZH5A 4N0BA 4KN7X 3F8CA 5CVVA 4G6DA 3GO5A 3QP6A 1YLFA 4OU0A 2IA0A 2W84A 4ENJA 1FPQA 3E97A 4HF0A 1U5TB 2PBIA 5A2QZ 2XV4S 1F4KA 2H6CA 4BHBA 3GW2A 4M9SA 2H09A 3PQJA 4KNYA 3WTWC 4KICA 3IKVA 2F5CA 4P55A 4AIKA 2BGCA 3P9IA 1XDSA 3FX3A 3ECOA 3JTGA 2PJPA 2A3SA 3T5XA 1BI0A 2PI0A 2LDUA 2NYXA 1XMKA 1VTNC 5ILVA 2VBWA 4ENNA 3F8FA 6PAXA 5BQTA 2BBYA 5ED4A 4N9IA 4M72A 3HRSA 2XUBA 3DV8A 2V9VA 5HDNA 3K0LA 4AWXB 4YFKF 2QBYB 3ZQ7A 3SXYA 1RNLA 4HOBA 3G73A 1TBXA 1YIOA 5KK1A 3BOQA 5F64A 4UUVA 1R36A 1XCVA 3T8RA 3HOTA 1LDDA 1JE8A 5EEHA 4ASNA 3LQRA 2L54A 2L4MA 1SD4A 2CWEA 3C7JA 3F6OA 1ZGJA 5F6FA 5CVUA 5JFRA 3BDDA 3VODA 4EMSA 1QQIA 2XAGA 2K4BA 1IN8A 3LWFA 3M7GA 3MAJA 4LLGF 3Q9VA 1J0RA 3F72A 1ZHFA 1ZG3A 1EH6A 1G3TA 1LNWA 3WODF 5HOOA 3QPTA 1HW2A 3R6SA 1R22A 1BI3A 2MH9A 2OA4A 1AWCA 1R1UA 3E3VA 2JZYA 4O3MA 4OIPF 2QQBA 3TKYA 3SQNA 3GFLA 1QO0D 3ZN0A 4RAYA 5AONA 1FBUA 3IHUA 2RC4A 3DXJF 5JI6A 4Q48A 1RUNA 3EUHA 1OKRA 2QZ8A 4HQEA 4HX7A 3VOEA 1Z9CA 5ICEA 4UVAA 4LJZF 2EWNA 5LEJA 1RIOH 1XDUA 2QYOA 1WRJA 3BPXA 1U3EM 1HW1A 3FMRA 3JW4A 3SZTA 1IN6A 2VN2A 2NNYA 1P4XA 3SZPA 4B09A 3R0JA 3I59A 4EGZA 3BPVA 2NNNA 3VFZA 1S6LA 4L0ZB 3L7WA 3ZPLA 1B9NA 4HV6A 4A6EA 4ON0A 2YX7A 3HSRA 2XAJA 2HQRA 2FMLA 1ON1A 5HDKA 4UHTA 2MH2A 3GFMA 3KFWX 5D8KB 5L3BA 1J59A 4RB3C 2K02A 4IJAA 3EQLF 4MHGA 2XAQA 2VE9A 4ZYEA 2PG4A 1W5TA 3E6DA 1F1ZA 1SD5A 3K1MA 2GZWA 1YYVA 4L9VA 3U1DA 2KIMA 5ICGA 3BJAA 5E8IA 4JK1X 4A0YA 3ZMSA 2MLGA 1ZRDA 1OYYA 3WGIA 4FT8A 2CSOA 4Y17A 1WWXA 3C3WA 2ZKZA 3T0YA 1R5GA 5H6QA 4LB6B 4R8HA 3TOBA 3MEXA 4HA8A 2DT5A 4GYIA 2VXZA 3I58A 2IPQX 4MQ9F 2RV8A 1SFUA 2GA2A 1DUXC 2QM4A 1TTYA 2HYFA 4I0BA 4MTEA 1ZYRF 1O57A 1HKQA 4HW0A 4OMZA 2P8TA 1LDJA 2ETHA 5ICCA 1FWZA 3F6VA 4CXFA 5LHHA 5DUIA 3TO6A 3DFGA 2M8EA 2UWMA 2GAUA 3GFJA 3K2ZA 1EV7A 4FX4A 4WXCA 3TDZC 1FT9A 2X4HA 4KIBA 4RGSA 3I53A 5FFXA 2CO5A 4P9UA 1H9GA 3HSFA 2Q0OA 3IRRA 2FBKA 1D8KA 5IT9K 2QM3A 2P7CB 2XGXA 1MDMB 4G94A 3VB2A 2UXNA 4BHCA 3EDPA 1GHCA 5LHIA 1YG2A 4OINF 5HDGA 4IHSA 2VC0A 5K5QA 3TGNA 2O61A 5L3EA 4XSZF 2RN7A 2WC2A 2D2WA 2OZ6A 4IPAA 2IRFG 1Z7UA 3M8EA 3FF5A 1HW5A 3SHFA 2O0YA 2A6HF 3TO9A 1IXSB 4LK1F 3J81K 2ZMEA 3ZMVA 2V6CA 2X0LA 3CUQB 2CQKA 2R3SA 2HR3A 2EV0A 3ZMDA 4QWQA 1XN7A 2ZO4A 3BJOA 3GLXA 4LB5A 3Q9SA 3T8TA 2EK5A 1P92A 1IN4A 4LG0A 1S8NA 2VC1A 1I6XA 4U0YA 5J6XA 1HQCA 3OV8A 2Y48A 5FO5A 1ON2A 5D5UB 4O5VA 4A0XA 4CGZA 3BJ6A 2KRFA 3CTAA 1B9MA 3KE2A 3RYPA 3H92A 4ZH4F 1FYKA 2QUFA 3EYIA 3S2WA 2Y0MA 2K4JA 1O3TA 3WTXC 2FSWA 4UVBA 1H0MA 2G7HA 4L9JA 2F5FA 2OQGA 1BI2A 2W24A 2P5VA 5H6RA 1FP1D 3JAMZ 3H3ZA 4KIGA 3JSPA 2STTA 1T38A 4ENMA 1OPCA 4GCVA 1JHHA 1IN5A 2E7WA 4KA4A 2GIVA 4A5MA 4PCQA 1JXSA 1ONVA 2QBYA 2IA1A 4ESJA 2LF7A 2JTVA 4PDKA 2M5WA 4I7HA 5HVQC 2QQ9A 3FM5A 1U78A 4A2UA 3BZ6A 3I5UA 4WWCA 2FNAA 4HLYA 4I09A 1QBJA 3ULQB 2MBFA 2G9WA 4AD9A 2E1CA 5ERIA 2R7DA 3QRFF 2DFIA 1FP2A 5DUKA 2IA2A 1YFHA 1YW7A 3GZ6A 1G4DA 2LKPA 3MZHA 4A12A 3ZP5A 4IXAA 5DD8A 4EQQA 1XGMA 3WTTC 1D3YA 3KZYA 1KU7A 2RQPA 4LG0B 4CDGA 4YG2F 3HTSB 3E6CC 2IP2A 3BY6A 1D5VA 4LFUA 1MJBA 3SR2C 4U88A 2HZTA 4JBAA 1G3SA 3VEPA 3WG9A 4AIJA 1K6OA 1IRGA 4HAMA 1HKSA 3P9CA 1UFMA 5TRDA 3GVAA 1TNSA 2VT3A 5A2QK 3FXUA 4MTDA 2A5YB 1W7PB 1R23A 3RDIA 2D1VA 3FMSA 1K79A 1M5IA 1YQAA 1XSXA 3D0SA 4ETSA 3CUQC 4M6YA 2Z99A 4I0AA 4IF4A 1FZPB 1TW3A 2FA5A 3I4PA 5LRRA 1FOKA 3GUDA 2UXXA 2YX4A 1KU9A 1I5ZA 1DDNA 3KEQA 5TJJA 3KP7A 2EA2A 3ROUA 5HLIA 1BBYA 1AOYA 1QPMA 2ZBKA 4U0WA 4YIIA 5HS7A 5DCFA 2XRNA 1BM9A 4BH9A 1FLIA 3QU3A 2OD5A 4EVIA 5DDGA 3L2CA 1J7KA 3DPLC 3E5QA 2O8XA 2LSOA 2V1XA 1V3FA 2P5KA 3JSOA 3E5UA 3KP3A 1KQ0A 5DCMA 2XKPA 4DNCA 4G9YA 2GXGA 2MC3A 1H9TA 2AS5F 3SFZA 2M1BA 2FF4A 2AXLA 4I02A 5E1XA 3DKWA 3RJPA 1SFXA 2PQ8A 1K7AA 4Q47A 3WTVC 1LJ9A 3KEOA 4UXNA 2ELHA 4PGGA 2OAZA 4IHTA 3DF8A 1B1BA 2HTJA 4CYDA 1GXPA 2DU9A 2XAHA 1L3LA 4WF2A 4UV9A 3R60A 4KN4X 1OYIA 2A69F 4L0YB 1S7OA 3LAJA 1TNTA 1GVJA 3ABUA 4WK8F 1SFEA 1SMYF 1BOAA 3ML6A 4A6DA 5K1YA 4BQAA 5ILUA 1C0WA 1ZRFA 2KIFA 1KQ9A 3COAC 2ZNYA 1FBQA 1D8JA 3V4GA 4RAZA 2FOKA 4ZYDA 2OBPA 2Q2EA 5HLGA 3D5LA 2HTSA 3HUGA 2VOOA 2ZCWA 1IW7F 2DPDA 4PGHA 1YS7A 2Z9OA 1SD7A 3E6MA 1FSHA 5FLXZ 1MDMA 3KP5A 1TQIA 5FD5A 4EGYA 3O6BB 1Z05A 1O3SA 3E5XA 1MD0A 5JR3A 1S29A 1FBSA 4HV5A 3KP4A 3QOPA 1SAXA 4MNUA 2ZFWA 4I98B 1IN7A 3O3KA 3GFIA 2EFPA 2KJCA 4I2OA 5BS6A 2OZUA 5DCMB 1P6RA 4HYEA 1L0OC 3P7NA 3RWRD 1MGTA 5ICFA 1DPRA 3CUQA 2IVMA 3ZN1A 3F8NA 3LSTA 4U0VA 3ZMZA 4WXDA 1FC3A 3WU0A 2O03A 2DLLA 1O3RA 2ACJA 1MJ9A 1X3UA 3LAPA 2WWYA 3MZYA 3CLOA 3K69A 4NQWA 3TOAA 2EJRA 3WTYC 5D5WB 2M45A 1LB2A 5K5RA 3FXRA 5DEQA 4EV0A 1CF7A 1T0FA 3JTHA 4BNCA 2FBIA 3M1EA 4KMFA 3RKYA 1IXRC 3RKXA 2P6TA 2BYVE 2FU4A 1R1TA 2ZXJA 4KUMA 3GEZA 1ZN2A 2EB7A 4R1HA 4D0PA 2FRHA 1ZG1A 2ESNA 1NHAA 1YS6A 1B4AA 5E1ZB 1KYWA 3DEUA 2OU2A 1BC7C 5CVIA 1ZAOA 2L02A 3BROA 1PP7U 3M9AA 1B6AA 4YFNF 2V1UA 5H20A 1RUOA 1G3YA 3FWEA 4Q5SF 2P5LC 4LD5A 1ULYA 2XKOA 1BIBA 1W5SA 2EFOA 1UB9A 1BI1A 1U2WA 4L9TA 1QZYA 1EH8A 1Z91A 2RVCA 1ZRCA 2JT1A 2E1NA 4UV8A 4YIFA 2PFBA 4HF1A 2A68F 5BPIA 2VBZA 3F22A 1OYWA 1S7AA 3V8JA 3F3XA 4CHUA 4WX9A 4Z2YA
chains in the Genus database with same CATH superfamily
3M3YJ 2FBHA 2WADA 2NOGA 1K4DC 4CCKA 3OYLA 4HX8A 3CCMI 1PUEE 4QIWN 2GHYA 5EGOA 4S04A 3J81Z 2HHHO 1MSEC 1O7LA 2CV0A 2MW2B 4ZIBA 1N32B 4XBFA 1XB4A 2J5PA 5J8CA 1HCRA 2E2IJ 1WB8A 1X2NA 3E35A 4NC6A 1W4MA 3NXSA 3H9GA 2Q6AA 1FX7A 2HNHA 3MDSA 1ZTRA 3OGIB 4PK4A 2ESHA 3HKZA 5E8GA 4AIHA 3L2WA 1FYMA 1SC5B 1G2HA 2XHKA 1XEQA 4LF9B 1IAWA 1K78A 2VKHA 1YIJI 4ZDPA 1MZFA 2K40A 4C2TA 3RFRA 3ZQFA 1WA8A 2H6BA 2Z3YA 1FNNA 1IRFA 1VP7A 3IRQA 2R7TA 4L5JA 2E1OA 3FHNA 3G1LA 1TW2A 2Z1DA 2JPBA 2E7XA 1VQ8I 2VODA 4G2KA 4U3FH 5KHJA 4XNFA 4IRIA 2E75B 4TV8A 3J80Z 2I10A 1US6A 2A07F 2PJRB 1BQ0A 3HJEA 1HSTA 2VBYA 4FX0A 1NG7A 4I6ZA 1ZK8A 3HHGA 1GKFA 2EIKH 4NQWB 3ELKA 3JCUZ 2JA6J 2ZNZA 5JLWA 3NQOA 3OT7A 2MD0A 2VJJA 5F04A 1T98A 4BHPA 1HKTA 1KGSA 4MEXF 2OTJV 2K27A 2AZ2A 4R79A 1BQZA 4ZKIA 1EZJA 1B72B 1TA8A 1U9OA 3HRTA 3HIFA 5IOZA 2NVXJ 3A0RA 3TETA 4AQYO 2ME0A 4DR5B 1J5EB 2GBYA 3JD1A 1XMOO 2LNBA 4G8XA 2CJJA 1QNTA 1ZLKA 4XLHA 3LQQA 2VT2A 4QLCU 1Z7LA 4B3RB 5HNHA 2JPCA 4GXOA 2MD5A 3BWGA 1SQBH 4KFMA 4EJWA 2JA7J 3FX7A 1REPC 2KP6A 2IW5A 3OYDA 3HG9A 1CF7B 4JI0O 4ZDOA 4B8XA 4CS4A 4O2AB 3Q3SA 1YJ9V 1ITYA 2DA4A 1WQ2A 2EA4A 5AIPA 2QKCA 2XOKG 3WU1B 5LOVB 1JT0A 1E79G 4XDKA 4YIOA 1OZ0A 5LYJB 1RP3B 2MYSA 3Q0VA 3HOZJ 4FFKA 1Y0UA 4MT8A 3KLNA 2WY8Q 3V7SA 4B4CA 1YJNI 1IG7A 4DUYO 3S1QJ 4QIWF 1BN5A 4LFBB 2B0LA 3AG4H 2H94A 4D7NA 4KISA 2JIZG 5FFZA 2CUEA 4CSWA 1I1SA 3F21A 3E22B 5HFMA 5KAFZ 4TOIA 2CUZA 2D1HA 1W7PA 3O8GA 4M6XA 3S3MA 1VQOV 4RAIA 2KJBA 5IY5H 3QWLA 2VQFB 3JAMN 4OPAA 4DV2O 1S5HC 5FPOA 2HVSA 4P1WA 3LSPA 4JAAA 1XREA 3WTSC 5BNGA 1T33A 3GYHX 5M3FJ 4HZFA 2CV2A 3CC7I 1M4UA 4MW8A 5J2UB 1U0JA 2PMHA 1RM1B 3ZQCA 3UKGA 3I71A 2R5YA 3UO3A 1DGWY 4BXUA 3AG2B 2BHZA 1QVFU 2K3PA 3FKSG 1JGSA 1UHSA 3U21A 3W6JB 4EM2A 3ABTA 1YRNB 2YSRA 3K79A 4WFBV 1SERA 4AVPA 3E2EA 3QF7A 2V9KA 3QU6A 2Q8KA 2E1MB 5EYPB 4IEJA 1OCZB 1V4RA 2N04A 1IUYA 1F9NA 2JUGA 1R9TJ 2OCCB 4HF2A 2G7UA 4L5EA 1R6NA 1KA8A 1OCPA 2WTEA 1DU6A 3A2FA 4BWAA 2LGQA 3CDLA 1VZ0A 3DU6A 3PIPF 2RREA 1TQMA 1I5XA 1X59A 2AGAA 3JARB 3RGBA 4BAYA 3JAMK 2HKOA 2GM4A 5GTHC 1WNSA 1X2MA 2WAFA 3HYIA 1E3HA 2NN4A 1ZLJA 4MTXA 1F5TA 3MCZA 1Z0XA 1MZBA 4M73A 2P7VB 4IRGA 2IAIA 4Z6YA 2CW0F 3SYCA 4KHPB 2R9IA 2DFEA 5GAHJ 1NTZH 1Q6UA 4LH6A 4HQMA 4B3SB 2OF7A 3HRUA 3NWTA 5LHGA 5CVJA 4F92B 4PI0A 5DV5A 2UU9B 2E71A 3CRRA 1MH4A 4PV1B 1MJAA 3BTJA 1RETA 5D6FA 2YUSA 5EEGA 4A3JJ 1IF1A 3GTJJ 2PYLA 1OR7A 1YZBA 1B3QA 2F5DA 4CA0A 4ENKA 3RYCA 3CCMV 3C90A 2CGPA 4L5IA 4TWKA 3WB1A 2M8GX 3DLAA 4QPKA 2NAZA 2UUCB 2M30A 2Q0AA 1S5JA 4XICA 5KHHA 2A6EF 5GTIC 2LG4A 2DMTA 1Q1HA 4DV2B 3CCUI 5CQGA 3S14J 2VKEA 3RVZA 1ETVA 5D8LB 2RKHA 5GAGJ 2GTSA 2JDIG 3GWKC 1HF0A 4UVCA 5EGOB 4PJJA 3BRCA 2MLKA 2BOBC 3HEFA 3PUBA 4LLNA 3OAAG 3DSQA 1YJWI 3B09A 4X8AA 3CCJI 4J7KA 3JRHA 3SYOA 4IKFA 1YIJV 3V7CA 1O7FA 1XG1A 2FJ1A 4XLPF 4KFCA 1IXMA 3EUKL 4BL0B 2HYGD 2KDOA 5E3MA 4K8ZA 2BE5F 3KIOA 4FE7A 1JPXA 2JS5A 3RPQA 1FY7A 3IAYA 3OS1A 2X6CA 4E4EA 1K78B 1Q90D 1GXQA 5LRSA 4B3RO 5IP9J 2XUMA 3K06A 5CN0A 1WJFA 2EPFA 1JHFA 4K0KO 3VBBA 4QNHB 4KP4A 3QAHA 1OCRB 5L3FA 5E79C 4FASD 4ZZLA 3OR7C 4DQ2A 3E1SA 2ITCC 3GLLA 2E5ZA 3IL2A 3AK1A 4YJ2A 4TV8B 2CK3G 2JRMA 4JI3B 2V79A 1X4OA 2XAFA 4HX4A 2QF7A 3LA3A 4XLEA 4ESBA 4RB0A 3TW7A 4OMYA 3H9VA 1X4TA 3SPGA 5A9GA 2X48A 3EXAA 2BY2A 2H27A 2AXTZ 3GTQJ 3T2MA 4EATA 2IS1A 4KYWA 1RPWA 5KA6A 3W2AA 2HOTA 1EKEA 2PMUA 3JD3A 2R4GA 3HOWJ 1SD6A 3WTZA 2JEXA 2IGOA 3BQYA 2Y0PA 4XR6A 5LP6B 1LVAA 2D5VA 4EB6B 1FIPA 3WG7H 3RCOA 2PF4E 4GKJO 3C3SA 2FMYA 4BJ5C 4GYGA 3GX4X 3I0TA 2M87A 3HOXJ 4FM2A 3R61A 1WKMA 2CYYA 4DJAA 5B1AB 4LCUC 1YJNV 2ID3A 4X62B 3WE2A 1T2KA 3RZDJ 5FKOA 3ASNC 4K35A 3LFKA 4CO8A 4F3QA 3FXLA 4XLNF 2L5QA 5TISC 1HWYA 4UCOA 4GO1A 3HHHA 1LEBA 2V7QG 1IXCA 2O8KA 1TT0A 2HWVA 2QQAA 4F7ZA 5C93A 2R7FA 1N36O 3LFUA 2HS5A 4I5SA 4LF6O 2KHMA 1Q82W 3PQKA 1P7IA 3H5NA 4RDUA 3MFKA 2UXBO 2ZJRF 3CC7V 2EILC 5FLMJ 1AHDP 5DEDA 1Y67A 2COMA 2Y31A 1NU1H 3HC7A 3CWBH 5LLQA 1IBKO 2C6YA 5CVRA 4HDVA 1A32A 2BSKA 5CMUA 2MFZA 3LOCA 4Y13A 1W1WE 2CH0A 2L9SA 3V7RA 1J75A 4II2A 1BS3A 2NLJC 3VOUA 5F1RA 2RNJA 2OQRA 4HEA2 4YIRX 4GDFA 2DN9A 3P5JA 2LKSA 3ISPA 3UQ8A 4X64O 2BCCH 5LFAA 2CMPA 2DK5A 2AHZA 3BQZA 4IHJA 2DW4A 2DK8A 1YX5A 2R5YB 4J9YB 4TQFA 4A3FJ 3C18A 3BFRA 3M8FA 3I4MJ 4DR7B 5JLXA 2EIJH 2Q69A 2BVLA 3JALA 3Q0WA 2Y75A 3PFIA 5D6EA 2LF8A 2DO7A 4E7LA 1PVEA 2Y2ZA 3R0AA 2L7ZA 4DV6O 1UCRA 2DAOA 2OCEA 4C2UA 1AJQA 4Z2WA 2OTLI 4JX6A 1E0EA 4M3BA 4KIFA 4GFBA 5FRMA 2R7XA 4FVMA 1J5YA 2DA1A 3FIWA 1KKCA 3B8NA 4RGXA 4YJ3B 4O4IB 1YEWA 4DV7O 3OYJA 5F27A 1N75A 4HDUA 2HVRA 3HOSA 1O3QA 4FPPA 2E5LO 2NRAC 2KRCA 1DP7P 4DRXA 1WJZA 1YF2A 1XSDA 4EEQA 2KIUA 2QLZA 1H2GA 5CYVA 3MZ8A 1CP9A 3TDUC 1HSJA 2FEZA 1RR7A 3KZZA 4XKVA 1R7JA 1R3IC 1N36B 3VSLA 1YI2I 4YY3B 3CCUV 4FLUA 4MGRA 3OMNB 5DM7F 2HJFC 3RYCB 4CUGA 4HPQA 4LGWA 2DODA 3S32A 3RYHB 3H01A 2HEOA 3K0GA 2X6XA 4UUSA 3K70C 1BA5A 1NQTA 2QWOB 2UUZA 5BMVA 2IT0A 1SMTA 2STWA 1HP8A 1YJWV 3ERED 3ABMH 5LGNA 4DV1B 5D5XB 2HXIA 1XSVA 3FZVA 3G6BA 1XQ8A 2F2EA 2FD5A 3MQ0A 2XDVA 2XIGA 4TV9A 5CKTA 3H0DA 4EJTA 1BZKA 1XGNA 1I27A 3KZIC 1RR8C 2WA4A 2VL8A 3L73H 2ADUA 4MVRA 2JA2A 3SJMA 2E19A 3TO7A 4I99C 4Y15A 2Y4TA 5LMUB 1BIAA 2UUAO 3WTUC 2VQLA 2JQ7A 4LF5O 5FROA 1ZUQA 2Q67A 2HZDA 2CTQA 4UB8C 3WE3A 4JOMA 5EG0A 4BR6A 4P96A 2HVJC 2B1GA 4XLCA 2LQTA 1IUFA 1ETQA 4S05A 3IKTA 5D5QA 4A3MJ 1MMMA 1WGXA 4L9NA 3OYKA 2A0LA 2EFWA 5EZGA 4BE2A 5JCOA 4E7IA 5CJ9A 4DV7B 4LFCO 4YJ2B 2XVCA 4LNUA 4NHJA 1MH3A 2ISYA 2HFEC 2ZIOA 5CA3A 4J19A 4LF8O 2GUZA 2VOPA 3KCCA 5DD4A 4L87A 4CCNA 2DOFA 2K7LA 2PEXA 1JQ0A 3GF2A 5ITZA 1RM1C 3I54A 1IBMO 1XGSA 4AC0A 1HLVA 2R7SA 1W7PD 3GTGJ 1DLBA 1ZL8A 1P2FA 3ZHUA 3U9GA 3IWZA 1QRYA 5KHIA 4X66B 2HGCA 4MFDA 4ZHQA 4WX9A 2LP7A 3A0BZ 3B77A 1WI9A 2ZSHB 5EJCA 1GAXA 1OCZC 4RB1A 4AU7A 2DQRA 3IFXA 2OCCC 5IT3A 2OC6A 2CFXA 2GA1A 3BT9A 3L9FA 4PSWA 3E7LA 3GZ5A 3IUOA 1Q6IA 2DMQA 3E8HA 3H1IH 2OWOA 3W6KB 4RLQA 4TV7A 4DR6O 2DA2A 3DWLE 1WJEA 2Z2SB 3U2RA 2LGWA 3MWMA 1MOFA 5J3LA 2FNPA 1K34A 2YIBD 1EA3A 2K3FA 4HLXA 2HDCA 2W00A 2O3FA 5DM6F 3SJBC 2JA5J 2CG4A 3L2QA 3G1MA 2ZJ2A 4A3DJ 4OAZA 3A0HZ 3HOYJ 2JSCA 3F5TA 3JRDA 1USSA 3K04A 2YU3A 2ID6A 5LA6A 5HLHA 2KRHA 1QU3A 2ZR3A 2PI5A 3BC8A 1E3PA 4IYIA 3CJNA 3G6EV 2DA3A 2YIAA 3OIOA 2YEVA 2X6BA 2MG4A 4J41A 4G7OF 2DTRA 5K7HA 5KX5A 5D4RA 2VBXA 2XB0X 4ZI7A 4HNTA 3EETA 3L9DA 5CA1A 2LK2A 3OGCC 2EQRA 4LK0F 5LGTA 1NK3P 4GYCB 3OR2C 1BR2A 4LFCB 3CF5F 4TUYA 3ZMUA 4M3DA 1ROPA 3I64A 4A69C 3T1HO 1R58A 3OL3A 1J2XA 1R00A 2L0KA 1EF4A 1AI5A 5C8YA 4JV5O 3E8BA 1DPUA 1NTKH 1P4WA 5BPDA 5E1WA 1FYLA 3ZHSA 3K4CA 4G6TB 4RS8A 1ZG5A 2ISZA 4LWSA 2K9QA 3IAS2 3LNNA 4B3TO 3T1CA 1Z5WA 3T1YB 2OTLV 4LC1A 1YO5C 3HL2A 4J01A 4A3CJ 3JALB 1HR0O 2ICWG 2PLYA 4KDPA 3ZBHA 5LMNO 1YITI 2WSSG 1XTAA 3LSKA 3CCLI 3SYQA 2R5ZA 1PL4A 3S15J 3JYCA 2KB1A 1E17A 1STZA 1HDPA 5FD6A 1MNMC 2IBDA 3V8KA 3OUFA 4YXWG 3GTLJ 3RZOJ 3JD2A 3G3ZA 5LEKA 2W7NA 2VQCA 3APOA 3BABA 1JOYA 5CLSA 1M1KW 2LY2A 3DBHB 1RSOA 1FSEA 2BXYA 1G3WA 3G80A 4WFEA 1U8RA 5FLXN 5E17F 4LMYA 1EN6A 1F36A 2QWRB 2AQFA 1BJAA 4GX0A 3HKCA 4Y3OA 4DRXB 2GOMA 3VYUB 4RB2C 5CB4A 3RPUA 4BJ6C 4ZJZA 4W97A 1Y6IA 1IXBA 4X88A 3ZCCA 4AILC 1S3JA 2EJ7A 2JSPA 1T6SA 2ELKA 1USTA 2O5RA 3M4OJ 1F4NA 2Q7HA 4OGQB 5C3EJ 1M90W 2BE3A 2QWNB 3L00A 3S2DJ 3GCMA 3AAFA 1HNXO 5E1AC 3JAKB 3ZQGA 3CQZJ 3FM3A 3CCEI 3I55V 2F23A 2VXDA 2DA6A 4UUSB 1T39A 1Q3EA 2VASA 4JQFA 2EZOA 3OEHG 5BMVB 4ZZDA 1E2XA 2JGUA 3Q4HB 5HS9A 5LP6C 2JRTA 2TDXA 2Q1ZB 1VQ6I 1AJPA 4EM1A 5FLXK 3SYAA 3RTRA 2VWKA 2EFNA 5HODA 3GXOA 4TV9B 4B3MO 4LITA 3CP2A 3F8MA 5B1AC 5HS8A 4CCLA 3UO2A 1RC9A 1J9IA 4CH5A 2CV1A 2ZXIA 4CH7A 1GH6A 3CMAI 3SFIA 2KL4A 2FOWA 2XC7A 4R8CA 3C1DA 4MW3A 3WGHA 5JVTA 3BTIA 3QG5A 2PI4A 2LTPA 3DPTA 1SA0A 2L4AA 1HBXG 4B7KA 3K58A 4XL9A 5BXZA 4FETA 1Z67A 1SQGA 2A79B 5J4VA 2ITDC 5BMZA 3OR6C 4CC5A 4YFXF 1SS3A 1U5TC 3CF2A 1SFKA 1I94O 4DO2A 1CXZB 4G6QA 4YELA 4JI4B 2R9AA 2W6IG 3KEYA 3A4CA 2DT6A 4JYBA 4EM0B 2CAZC 1LQ1A 3PNVA 1H8HG 1UHMA 3GWZA 3NRVA 1PV0A 2A3QA 2UV1A 2IJJA 4PA7A 1JT6A 1VF9A 3ERMA 1N4CA 1A31A 2NVYJ 4LNUB 5AG2A 3JR9A 3KETA 5IDJA 2ILMA 1P7JA 3JD4A 3J7ZI 1LDKB 4M71A 1MW7A 4IIJA 3N05A 2BEOA 3V8LA 1ZL8B 3UKMA 1ORQC 4DR4B 4OIQF 4PJ0C 4ZHQB 3JSNA 2X7RB 5CBHA 1U6GA 2VONA 4HSTA 4BE1A 1PKXA 3FYIB 3GB7C 4CS2A 2KISA 2NS0A 4MFEA 4M9ZA 4H0EA 1IDSA 4H37A 4GGGA 1R5ID 1R1VA 2DA5A 3BG5A 2M6YA 3AG7A 3X2QH 2A7WA 1SF9A 4A0ZA 5F08A 4AYBN 1Z21A 1WJDA 4C3IJ 4L8JA 2EINH 4P9FA 3OMYA 4MO7A 2R7ZJ 4DV4B 2PY5A 3DTKA 2M7AA 2QQ8A 3BG9A 3O8HA 3IC9A 3CO6C 3B40A 3LSIA 3D5RC 2YI8A 1W5CC 2L01A 4C3JJ 1B72A 4PELA 2R9RB 3CD6V 1BW6A 1XI1A 3VDXA 1YHQV 3ABKB 1IBLO 3CS5A 4HBNA 2ECBA 1JJ2U 2O7OA 5LA6B 1SZXA 5JVDB 3PSIA 4QPQA 2N8GA 3DGEA 4JYCA 1VQNV 2Y69C 2CW8A 1KU3A 3HM5A 1RKTA 3JASA 3CC4I 2Z5UA 3HPGA 2QKMB 3OS2A 2YEVB 1PP8F 4U7DA 1B06A 4ZOLA 1I94B 3K4BA 2IJLA 5KX5B 3IC7A 4XK4A 2QWWA 2A06H 3SPIA 4ZI7B 1Z3YA 3AK3A 4M74A 1PDNC 1XPXA 2CU7A 1BOBA 1VMGA 3AG3B 2EV6A 4TUYB 3LSHA 2M4KA 3ASOH 5M5XJ 5LYJA 2VQEO 4BS9A 2B9ZA 1UAAA 1YITV 1QZZA 4KT5C 3ZRGA 2BV6A 2KG7A 1A04A 1Z6RA 1ZGAA 2VE8A 4LP8A 2ZM6O 4LWSB 1HNWO 1QHGA 4FZ1A 1T95A 4E7ZA 1HW7A 3E22A 3LNQA 3CMEV 1TWFJ 3TP0A 3HKDA 3ZRXA 2EV5A 1TUEB 4LLLA 5B66C 4Y7NJ 3LA2A 3VYRB 3CCVI 3F8BA 4RQFA 3L09A 3E86A 3QYFA 4IL6Z 5IP6A 1G8MA 2QVOA 2EZPA 5J8FA 4PHZA 3LA7A 3IWFA 3ZRSA 1CEZA 1IDYA 2W25A 1EH7A 5BOXA 3J7AO 3RI4A 1RSOB 3JCUC 2PN6A 4Q4ZF 1JKPC 1YRNA 4ITVA 4II3A 5L3DA 1VFCA 1BMFG 4R50A 2GQQA 1TLHB 1Q5OA 4X1KA 3A8TA 3OYNA 3MD2A 3ZMTA 3KP6A 2IJHA 5IT9Z 3HKCB 3FAVA 3KCXA 4MQVA 4ZDLA 5CB4B 1K83J 2X1EA 2K85A 2M7BA 3H5RA 4OIOF 3CCEV 1NI8A 2DQLA 1SQPH 5JJEB 1WSUA 3AL0C 2F5EA 3HTUA 3U0ZA 3FXKA 1FJGO 3KP2A 1B59A 4IVNA 1PUFB 3L2RA 1TUBA 2M34A 4BW9A 1Z6TA 2P4WA 1VQ6V 2PYJA 4EEFG 5K5OA 3K1PA 3FKIJ 4JI6B 3CB2A 2XT9A 1G4YB 5HFLA 3WGGA 1YW8A 3LDEA 2LFRA 2XASA 3DXRA 4JI7O 2GSMB 3FK6A 3ASNB 2KKOA 1IV8A 3K4NA 1NJIW 3QYEA 3OYGA 1MBFA 1GM9A 3QO8A 3DP7A 2HOEA 4EJOA 3I59B 4E7HA 1WPKA 4CZZA 5KUKA 3HRMA 4A5NA 3K9SA 3P9KA 1XUQA 2CQXA 4M9XA 2WLLA 1I1GA 4C30A 5EEAA 1W36D 1SQVH 2MSYA 3EUAA 4ESFA 2IS6A 1AI6A 4JYAB 2EILB 3KLOA 4DR2O 4P5OA 2YC0A 3BAAA 3I4NJ 1WJBA 2F5VA 3O2PE 2E2HJ 2WV1A 4JI2B 3CZ6A 5K7FA 1TWAJ 1UG2A 1I5YA 1CGPA 1SA0B 4V19K 1MBEA 2P5OA 2HOSA 3CJHA 4DR3O 1WPBA 4WCGA 1D5YA 5IYBJ 5IWAO 1XMQB 3CUOA 4IOAF 1VEWA 5FKMA 3N97A 3FXQA 4FIPC 4OX9O 2K86A 3DQVC 3FHZA 1VF5B 3ABLC 3FB7C 2UXCO 5KHGA 1ZSPA 1IZ1A 2L2OA 3QP5A 3JRBA 2RCVA 2WA3A 1ZGWA 2LY9A 2MA3A 2EFQA 5KCMA 5FB2A 1BC8C 5KA5A 1GM8A 2COBA 3JREA 1K4TA 5H5NA 3S3WA 4PD4F 5E3LA 3CCQI 3P3NA 4IIJB 4EFEA 3T1BA 1QGPA 1NK2P 1IVSA 1SANA 4FHTA 1VF7A 2GV9A 3GTKJ 4RWUA 1JTYA 4FM0A 3CJRB 3UT5B 2O6GE 5D5VB 1P4AA 3BR1A 3J80N 2X1CA 5FGMA 1S5LZ 4AYBA 1P7BA 2YXHA 2L9NA 4XRFA 3NAUA 1YTYA 4UNOA 3BR3A 4J00A 1GT0C 3T4DA 4O4HA 4GKKB 2A6TA 4QE7A 1H2SB 4L18B 2L3DA 2QENA 4BEHA 2D3OW 4JP0A 5KAIC 3F23A 3RYIA 5EBLC 4LR3A 3LSSA 2W4SA 3P32A 4PDLA 1VI0A 4JZGA 4PDMA 4HNAA 1KB9F 3K59A 2YS8A 3OE7G 4ZYGA 2F93B 3DC5A 4JI1B 3CDHA 4BIOA 2K9NA 2QJ1A 1LVKA 3EYYA 3FBNB 3IAM2 3HSEA 3ZQQA 1VQKI 1IRZA 1HOMA 1AR4A 2B1IA 3C2GA 2P4VA 2TRTA 1MBKA 1K61A 4AM3A 3HKBA 5E20A 1XOUA 1BT8A 5LP6A 3W7SA 1ZARA 5C4JJ 2DOEA 3NEUA 3QPHA 1R5HA 4N9HA 3W3CA 3J80K 4F52A 3OY9A 1APLC 5EIBD 1MSWD 1B8IB 3JASB 3O65A 1Q43A 2DJVA 1YW9A 1K4SA 2ZNJA 5GW7A 2Q5ZA 3TJTA 1ZR2A 5IWAB 4JTDB 5BR8O 4DV3O 2WLIA 4ZOLB 2HHHB 1Q8IA 4I50A 2DMPA 2DJIA 4B1RA 2WV0A 1M56C 3BP8A 3H1KH 3MKYB 2Z33A 1JJOA 1NS1A 1MMNA 2ZE6A 4B7EA 4JI8O 3ZXSA 4GRIA 1QR9A 3ML0A 3IH3A 1S77D 3QVNA 5D5PA 2LBFB 1OMIA 1XCBA 5J4YA 2OT5A 3Q5FA 5DYMA 1QU7A 4PJNA 2QM8A 3HPLC 3TCUA 3CRMA 3CCVV 4LF5B 2KG7B 1U5TA 2XGDA 4H4KC 2VUMJ 2P90A 4YHHO 3TQNA 5C4XJ 1SVOA 3B73A 2GOXB 1BE3H 5DM6V 1ODDA 2NVUB 3HKDB 3UR3C 1Z1DA 4CBCA 4ZYAA 1RI7A 5JHUA 2GWRA 1XMXA 1GVDA 2E36A 9ANTA 3VQXA 1WP7A 2GXBA 5ILSA 3ZHVA 1UPGA 2JVHA 1ZREA 1F43A 1RZ4A 1WVRA 1BSMA 3OYIA 3KYDB 1BR4A 1KONA 4UUTA 3QPLA 2R7QA 4D1QA 2MK3A 2NVQJ 1TT5B 2CUJA 2WPDG 3STZC 3B02A 5JCOC 1MKMA 4K2EA 1POGA 2AXTC 3K10A 4RGRA 4XLFA 2Q4PA 4X1KB 4ZYHA 3N4MA 1MSDA 3A2KA 2FE3A 3FAVB 3AK2A 4AQYB 3RKWA 2KDZA 4WFFA 1R6RA 2FQ3A 4NBQA 1TWCJ 2YR2A 4NNJA 2DDBA 5J1RA 1EZVH 3B4SA 1XMOB 5GONA 2W57A 3CRCA 3BR2A 4MEYF 4KMUX 4G28B 4G7ZF 4JI5O 3GTOJ 1TUBB 3W7XA 3CC2I 4YJ3A 3I9V2 2D45A 1FJLA 4BQNA 4O4IA 2V1DA 3BTLA 3AG1B 4O6JA 4RGUA 3FMQA 1SVMA 3TL4X 2GTAA 4MVMA 4DZPA 4JI0B 4D5FA 3DXRB 1UJ8A 2RDPA 1ETXA 4JF3A 1X4PA 4XKWA 4WXHA 3SEQA 1FMWA 1I3AA 4I01A 2HG5C 3E83A 2DBBA 3FDYA 2LLKA 4FLVA 2KQXA 2HFHA 4QTRA 2ZE8A 1NBMG 1PL0A 1W2BU 3D3IA 2L9RA 5KVRA 1K33A 3ETGA 2J5OA 3CJTB 4IHXA 3LSQA 5E18F 4RM2A 4DUYB 2WLLB 4MS2A 2UZKA 3K9TA 1WI3A 5L3CA 1GV2A 1MBJA 3B2EE 3H1HH 2HQNA 5CPRB 2FXAA 3H3UA 2K9PA 1N0JA 2YXYA 3RYHA 5KHDA 3ABKC 1LPQA 5AIQA 2A61A 3LSGA 4EJVA 1BW5A 5EZYA 1IJWC 1RESA 4E70A 5JJJB 3CJHB 4B48A 2DFFA 2CTRA 2JVDA 5CA0A 3CO7C 3E6BA 4G7HF 2W85A 1OJLA 2BTQB 1E3OC 3K5NA 2JJ1G 4XSXF 3REOA 5D4SA 3PNTA 1WP8A 1NTCA 2XROA 2P0WA 4PZJA 4LBEC 1KQ8A 2YPRA 5GPCA 3D1NI 3AG2H 5FRNA 1PM9A 1QLEC 4FK5C 2RGVA 1XD7A 4MTGA 1H38A 2A05A 2HKXA 4NXNO 3AG3C 2DYRB 1VQ8V 2DOAA 3AFHA 5F2VO 4BACA 1P4RA 1K73W 5LBQA 2I5UA 2Q7EA 1LEAA 1OCZH 4I76A 5LD2C 1AILA 4NB5A 1MA1A 5EC1C 4LOCA 2UUBO 3RYRA 2DPUA 1VQ9I 3VSKA 2OCCH 3N27A 4WBNB 5ITZB 3FXJA 4EJUA 3I5DA 3JD0A 4Y4RA 4WFHA 4BQOA 1VQ5I 4JI5B 1KYZA 2P6SA 1H2KA 1KMIZ 3ZIAG 5LGUA 1F23A 1S76D 2KT0A 4OOIA 4UCRA 1N34B 3EUHC 2KFDA 2ZMEB 1JVMA 3DTUB 1D0YA 2VKDA 5L3GA 4O4HB 1G6NA 4U7BA 4IRHA 2CGNA 5M5YJ 4RUEA 3ICXA 4BEHB 3R4KA 3SDBA 3OOPA 3RYIB 1H88C 4BYYA 3ETDA 5GPAA 2ELJA 1UHWA 2HDDA 4LH7A 5J1UA 2EZIA 4HBLA 5EBWC 1KD1W 5C44J 2WLKA 4HNAB 1X1AA 4BKXA 1ZTEA 2XGCA 3ECHA 1W59A 2WAMA 4V2GA 1EN5A 3OYMA 1XMAA 4P9PA 2BVMA 4OIRF 2QA4I 1R49A 1OQYA 3HKBB 1TQPA 3F9KA 1X19A 4H13B 2DMUA 1XGOA 3C3TA 3K1NA 4B08A 3RIRA 2IJKA 3KPHA 1V5GA 1H2NA 1V55B 1WLEA 4FLWA 2HLDG 1KU2A 2P67A 2WBMA 4CICA 3A01A 1HXDA 1GN6A 1U97A 2CH7A 2DI3A 1ZH5A 4N0BA 2WLIB 4I50B 1NG6A 4KN7X 1GN4A 3F8CA 2PMZN 5CVVA 4G6DA 2QWPB 3GO5A 4QGPA 3QP6A 2F43G 1YLFA 4OU0A 4B3AA 2IA0A 1MIJA 3N2GA 2W84A 4ENJA 3B6CA 1FPQA 1JFFA 1TP4A 4AIDA 4N23A 3E97A 4BIZA 4IGGA 2GBOA 4HF0A 1L8DA 2KZVA 1U5TB 2PBIA 2ZB9A 5A2QZ 2XV4S 2QEXI 5GTHZ 4K0KB 1F4KA 2H6CA 4BDYA 1VQMI 4BHBA 1NT2B 1YCIA 4E4HA 2ZXHA 3GW2A 4M9SA 2H09A 1VQNI 3PQJA 2DQ0A 1OCRH 4KNYA 2GDSA 5B5EZ 3K57A 3WTWC 3S17J 3WHBA 4KICA 2EIKC 3IKVA 5B1BC 2F5CA 2NS8A 4P55A 4AIKA 1BL0A 2BGCA 2HDWA 3MVPA 3P9IA 2A5WA 3K6GA 4XM3A 2B63J 3LUTB 5IYDO 1XDSA 4BE0A 2EZKA 3FX3A 2X6YA 2NNUA 3IJ4A 3SDGA 4HZ3A 3VPRA 4I7ZB 3ECOA 3JTGA 4Z1MG 2PJPA 2A3SA 3T5XA 2IGNA 4X65O 3KYLA 3CC2V 1BI0A 3A0BC 3KYCB 2NOJB 5GTIZ 3OYAA 2PI0A 2LDUA 1AP5A 3IH2A 2ZE5A 2NYXA 4NDLA 1XMKA 5GONB 1VTNC 2LRDA 5ILVA 3E8FA 2VBWA 4J7JA 3WFVA 2ADPA 4GKJB 1RPRA 1YVWA 3CMYA 2N74A 2LO1A 4ENNA 3F8FA 4JTCB 6PAXA 4P30A 3QQAA 5BQTA 2BBYA 5B1AH 3CSXA 1IGNA 5ED4A 3P3PA 4N9IA 2IU0A 4M72A 3HRSA 1JA8A 1NH2D 4BY1J 2XUBA 1SRYA 3QO5A 2Y69B 3AG4C 3ZHRA 5B3SC 3DV8A 2YI9A 2V9VA 3R65A 3S16J 5HDNA 2BOCC 4LF6B 3K0LA 4AWXB 4YFKF 2QBYB 1R3JC 4GCZA 5E79Z 3SPCA 2UXBB 1FAFA 4HSRA 1QCEA 3IV5A 1Q7YW 3ZQ7A 3SXYA 4KJZA 2VPRA 3S8PA 2FB5A 5IY5C 1IBKB 3SJAC 2AZ0A 2HOAA 1WJAA 3DTEA 3CCJV 1RNLA 3Q4HA 2OJED 4HOBA 4YEJA 5EZYB 3L75H 1SVLA 1QVUA 3G73A 1TBXA 1YIOA 2LMDA 5CA0B 5KK1A 3BOQA 5F64A 4UUVA 4X64B 2F4VO 1R36A 1JCHA 1XCVA 1AB3A 3QOEA 2WLHA 1MABG 4DXWA 3T8RA 2X85A 2DJNA 3HOTA 3RYFA 3W6VA 1LDDA 1JE8A 5FKKA 4A3LJ 4LF7O 4DW0A 1ZAUA 3GMEA 5EEHA 2RJZA 2ZDIC 4ASNA 3LQRA 1YOVB 4MTFA 2L54A 4OXSA 4IX7A 3CE2A 4DV6B 4O4JB 3H1JH 2L4MA 3MN2A 1SD4A 2CWEA 3C7JA 3F6OA 4A3GJ 1BL8A 3K08A 4B44A 1ZGJA 2QWQB 5IJ9A 5F6FA 3GBGA 2R93J 1XX5A 2AQEA 2Y30A 5CVUA 2R7UA 3OYBA 4C2MJ 5JFRA 3BDDA 3VODA 3JRCA 2ZT9B 1Q6HA 3F7YC 4EMSA 2WWWA 2E5LB 4DZJA 1QQIA 1VQPI 2XAGA 3VYTB 2MGQA 2K4BA 1IN8A 3LWFA 3HB3B 2VLAA 4M6VA 3M7GA 3MAJA 3AL0B 4LLGF 2QM7A 2PZSA 3Q9VA 5IOYA 2KMUA 2BY0A 1J0RA 3WHCA 1D2DA 1HNZO 5J2TB 3F72A 4HNVA 2Y69H 1ERDA 1ZHFA 1ZG3A 1EH6A 1SQFA 4GX2A 1G3TA 1W0UA 3STLC 5GADJ 5KHKA 1LNWA 4F93B 2P4KA 2Q8VA 3FB5C 2AW9A 4DK0A 4H0LB 4J10A 3WODF 4J80A 2IS4A 5HOOA 3QPTA 4R7CA 2NS7A 3K03A 1HW2A 3GTPJ 3BA8A 3R6SA 4BW5A 3BEHA 1R22A 1BI3A 2K1EA 2PMZA 2B9SA 3SYPA 1A35A 3AG1C 1XDCA 3A01B 2CH7B 4E2LA 2MH9A 4DV0O 4LFAO 2OA4A 4BXFA 4ANJA 4GT1A 2JJ7A 1AWCA 2QSGX 1M93A 3RQIA 1PPJH 2Q0OC 1R1UA 3E3VA 1S7EA 4N4NB 2UUAB 2JZYA 1FOXA 2N05A 4O3MA 3ZEDA 5JVDA 4I4TA 3N2GB 1JGGA 3MKLA 4OIPF 1X1BA 1ZKGA 1AVMA 3ZHQA 2JWTA 2DMXA 1SKVA 1JFFB 5BY1A 1HDJA 1TC3C 2QQBA 1PD3A 3SGIA 3TKYA 3SQNA 2R0QC 3GFLA 1MSFC 2F66C 3BZKA 4JYYA 1QO0D 3ZN0A 4MVZA 1PP9H 2F1MA 4RAYA 2VS0A 3JCZA 5AONA 1FBUA 2X1DA 3ABLB 3GTMJ 3IHUA 2RC4A 1GV5A 2FUG2 4BQQA 2O57A 4AI8A 3DXJF 5JI6A 1D0XA 3CMMA 5E3NA 2DYSC 2V1NA 3CCSI 4PJLA 3GZNB 1KQSU 4F4LA 1TZLA 4LF8B 4X20B 3MMYB 3H9QA 1D1CA 4Q48A 2PGGA 2YSUB 2HEPA 3IGAC 1L0NH 1XILA 1G8XA 2DXIA 1QA6A 3H5AA 2QTOA 3K5OA 1MMAA 1RUNA 1VARA 1MNGA 3K7AJ 2V7FA 2E34A 3EUHA 2B5UA 1OKRA 4FCYA 2DYRC 1WH7A 2QZ8A 2LJ2A 4HQEA 1FMVA 2L6LA 4NXMO 4HX7A 4Z1VA 3WG7C 5F1JA 3VOEA 2V6EA 1SQXH 4RO2A 4DGWB 1Z9CA 5ICEA 3G4SI 4UVAA 4LJZF 4V2FA 4DR6B 1ETWA 2EWNA 4QPJA 2EH3A 5DS9A 5LEJA 2ZMEC 1RIOH 1HA8A 3CHXA 1YI2V 1SQQH 2WA0A 3CJQB 1OCCB 1XDUA 1AI4A 4XIDA 5KLVH 2QYOA 4I9QA 1WRJA 1MG1A 2OCHA 3WU2C 3BZCA 3BPXA 1U3EM 1VQ7I 1HW1A 1PUFA 4D6TH 3BR5A 3RT3C 1AKHA 1QLNA 4WCEV 3FMRA 4LF4O 2YU9J 4DUZO 3JW4A 3K4JA 4CH3A 3SZTA 1IN6A 2ZXWB 2VN2A 4IZZA 2NNYA 1M56B 2W6JG 2L9VA 5IYZB 1R4NB 1T8IA 1P4XA 3SZPA 1PJRA 3EVKA 4B09A 2V26A 3R0JA 3I59A 2QKLB 4MVQA 4ASUG 4EGZA 3ABLH 1XNQO 3BPVA 2NNNA 1WHUA 2ODMA 3K5LA 2LVSA 3T1HB 3VFZA 1S6LA 4XORA 1V55C 4L0ZB 3RKQA 4JV5B 3QTCA 1LKXA 3L7WA 3ZPLA 1VIBA 1B9NA 4KT6A 4CZCA 3G2BA 4HV6A 2EIJC 4B3TB 1FXKC 2BXZA 1WJ5A 2RNBA 4A6EA 2CS3A 2YXLA 3RYFB 3VQYA 1IO2A 4XMYA 5H9CA 1I3QJ 3LSMA 4ON0A 1P7GA 1HR0B 5E3OA 5LMNB 2YX7A 3HSRA 4DW6A 2XAJA 5J9PC 2HQRA 3F0CA 4HNUA 2IGKA 4NXMB 2FMLA 4D9JA 1WB7A 4PFPA 1ON1A 5HDKA 2Z16A 3AKZA 1MNEA 2TCTA 4UCTA 4UHTA 1VQPV 2MH2A 4XN3A 2FTKA 4BIUA 3PIOF 4CH4A 3OYFA 4BDZA 5IJ9B 3GFMA 3KFWX 5CQEA 5D8KB 4JX4A 5L3BA 5K7ZA 4XQFA 1J59A 2ZCEA 4RB3C 2K02A 4IJAA 3EQLF 4MHGA 1NKDA 5KUMA 2XAQA 5EK0A 4NVPA 2VE9A 3ZQLA 2R7RA 2VJ4A 4ZYEA 3PO3J 2ZC2A 2PG4A 4NYKA 2F4OB 3S1RJ 4QJFB 4CCJA 1J5EO 1B6QA 1W5TA 3E6DA 1F1ZA 1SD5A 3K1MA 4FZ0A 3VQVA 3UT5A 2JUCA 1KUQA 2GZWA 4A93J 1Y4MA 3MHSC 1HNXB 4P2ZA 1ENHA 1YYVA 4DYLA 4L9VA 4ZC3A 3U1DA 5CBGA 2KIMA 5ICGA 2FYUH 3HKEA 1RFYA 4E6KG 3BJAA 3I56I 1D5NA 5E8IA 4JK1X 2NVTJ 4A0YA 2YICA 3ZMSA 1YTFB 1LUWA 1FYJA 4RLFA 2MLGA 2K5CA 2DTZA 1ZRDA 4PI2A 4C7UA 1Y8QB 2PUSA 1OYYA 1X1PA 3CDIA 2HP8A 2P7TC 4N21A 3WGIA 4UB6Z 4B3MB 4NC8A 5GAEJ 4FT8A 3K9AA 2CSOA 4Y17A 4XOTA 1URFA 2IJIA 4CS3A 3C3WA 1WWXA 2ZKZA 3T0YA 1R5GA 1MMGA 2IXSA 5H6QA 1NH3A 4LB6B 2R70A 4R8HA 1K5SA 3TOBA 3FISA 2MW8A 2K9MA 3MEXA 1V54B 3OEEG 4I4TB 4HA8A 3QPSA 2DT5A 4F91B 1P49A 1B8IA 1GK9A 4GYIA 1ZX3A 1N77A 2DE0X 2CTWA 2VXZA 2EIMB 5JWPA 1ETOA 3H35A 3OSGA 3OD4A 3APQA 1RKWA 2AHYA 4BJTA 3DEWA 2LFBA 2IPQX 3I58A 4ABZA 3S1MJ 4MQ9F 2ZSIB 3LL7A 3ZR8X 1QLEB 2CGOA 2HJDA 2RV8A 4U7OA 4X89A 1SFUA 2GA2A 1DUXC 2VPLA 1OV9A 2LBFA 2QM4A 2VI6A 4NTWA 4N4OB 2ZDIA 1BJZA 4J11A 1TTYA 2HYFA 3PUFA 4I0BA 1B04A 4A5UB 4MTEA 4CYCB 2QSHX 2X6OA 1ZYRF 1O57A 3NARA 1G6UA 3FB6C 3CCLV 1HKQA 4HW0A 2H8RA 4OMZA 2P8TA 2KKWA 1LDJA 2ETHA 1TGOA 5EYRA 5ICCA 1DTOA 3ZQIA 3HZJA 2YIDA 2WAQN 4EKWA 4FLZA 3CRQA 1FWZA 1RPOA 5FKLA 3LDDA 3F6VA 1R6TA 4CXFA 3PN1A 2L7KA 3H1CA 5LHHA 2XSDC 1MZEA 1VF6C 1S5LC 5DUIA 1N8RW 3H0GJ 3TO6A 4F55A 3DFGA 3LMMA 2M8EA 2X51A 1DU0A 4CCMA 2UWMA 4HYOA 1AA7A 2IS2A 2GAUA 1SFOJ 1FOYA 3GFJA 3BR6A 4D5CA 2GLOA 4HRIA 3W7UA 1VQ7V 5IT9N 1YJ9I 5FPRA 4I55A 3K2ZA 4RAFA 3M8AA 1W0TA 4NR1A 1A6QA 1EV7A 1Y0NA 3J7AY 2HQ5A 4FX4A 4WXCA 3SZGA 3TDZC 3G71I 4W4KA 1IBLB 1FT9A 2X4HA 4KIBA 5TGTA 1SEUA 2X6WA 2FL4A 1ZELA 3ABKH 4RGSA 2Y9ZA 5IP7J 4U3JA 1AKHB 5FKNA 2NXNB 4NTYA 3I53A 4RBOA 2RDCA 1Q86W 5FFXA 2LP0A 2CO5A 4P9UA 3FKJA 2ZD9A 4ZTFA 1Y66A 1TVKA 3AEIA 3HUGB 1N32O 1Y74B 2KIQA 1H9GA 3HSFA 2Q0OA 3IRRA 1SAUA 1Y8RB 1O9GA 4ZTJA 3I3LA 3CMAV 2FBKA 2WAEA 3R66A 2VWJA 1D8KA 3RBZA 2QCOA 4JX5A 2QM3A 5IT9K 2P7CB 4LF9O 1XNRO 2VQEB 2XGXA 2M0MA 4JYAO 2P81A 1MDMB 4G94A 3AG3H 2Z0AA 2ZKOA 2XF7A 3VB2A 5IE9A 2H3OA 2UXNA 4FLYA 4BHCA 1XBLA 4FJCC 2ZFUA 1DGSA 3EDPA 2ZM6B 1GHCA 3SDLA 1HNWB 2BW3A 2HVQA 4K3AA 1V5EA 1VQLI 5LHIA 1YG2A 4CCOA 4OINF 1KYOF 5HDGA 3ZX6A 5KAFC 4S0HB 4O2BA 4EB6A 2WLNA 4IHWA 1K5QA 5B1BB 4IHSA 2EIKB 2VC0A 5K5QA 4A3EJ 3J81N 2Y0SN 3TGNA 2O61A 5L3EA 1Z77A 5KNLA 4XSZF 2BTQA 2WB1N 2RN7A 2WC2A 2QSAA 3D36C 1JKQC 4FM1A 1WFXA 1H2MA 2D2WA 4XDLA 2OZ6A 2LOOA 2HI3A 2MABA 2Q9LA 4RQEA 2EBIA 2FX0A 4IPAA 1M1EB 2IRFG 1LUVA 4DR5O 1PNMA 1Z7UA 1Q81W 1L0LH 3M8EA 3K4KA 3FF5A 4FTHA 1HW5A 2VKVA 1JX9A 3SHFA 1X1CA 2O0YA 1Y76A 4WBNA 2BY3A 1ENVA 3MHHC 2A6HF 1D1BA 4OAYA 3CP1A 3I56V 2QR4A 2F95B 4M3FA 3TO9A 1IXSB 5CBFA 1IC8A 3OIPA 4A3BJ 4LK1F 4XOPA 3J81K 3FBIB 5JJNB 2X6AA 2ZMEA 2XPUA 3TW6A 3BVOA 5J47A 2W82A 3ZMVA 2YUAA 4JI7B 1SESA 3HKEB 3JAWA 1NVPD 2V6CA 4C3HJ 2X0LA 1QQCA 3CUQB 3ASNH 4K8XA 1MBHA 3ESWB 4D7MA 1JTXA 1DQUA 1K92A 2Q7GA 1R6KA 2CQKA 5FLVA 3PL8A 3AG4B 4RM3A 2R3SA 2HR3A 1FPOA 4D7SA 5B3SB 1JR9A 2EV0A 4M3GA 1I6HJ 1XHZA 4LFBO 4IQ4A 4O4LB 3OTOO 1UG0A 3ZMDA 4QWQA 1BHBA 1XN7A 2ZO4A 4UFZA 4DR2B 3CC4V 4ABMA 3OOUA 1OCCC 5B66Z 3D3QA 5IY5B 4Q6GA 2EILH 3G67A 3BJOA 3GLXA 4LB5A 4UCSA 2VQFO 4YHHB 2AHQA 3CXHF 2JA8J 2VIXA 3Q9SA 2WLMA 3T8TA 3TXSA 3OYCA 2EK5A 4DR3B 1UMQA 1P92A 4AVZA 1IN4A 3BHPA 2QE7G 3JATB 3QYBA 4LG0A 1S8NA 2VC1A 5B1BH 5LXTA 4DR1O 3RPUD 3SPJA 2ZXWC 2KPMA 2EULA 3O9OA 3W7WA 1I6XA 1JUSA 3DC6A 3U11A 4OX9B 4U0YA 1FXKA 5J6XA 1QHHD 1HQCA 4B3XA 4RAGA 4CH6A 3OV8A 2UXCB 2LD5A 2DMNA 2Y48A 3DKYA 3TEDA 4Y52J 3CEIA 5IJ0A 5FO5A 1G59A 2BOLA 2UXDO 1Q1VA 1N0NA 4B47A 2WAQA 3L1PA 1ON2A 2PX9A 5D5UB 2LY1A 1R71A 4O5VA 4X1YB 2HXOA 3H1LH 1COWG 2DA7A 4A0XA 3EHBB 1QVGU 1KKDA 2LW7A 4CGZA 3BJ6A 2KRFA 3CTAA 1X58A 1B9MA 1F4MA 2VRZA 4J7ZA 3UNGC 3X2QC 3KE2A 3RYPA 1GO3F 3ETEA 4IYHA 4KHPO 3H9JA 4I9WA 2EINC 3JSLA 4FFBA 4B3SO 3H92A 1DGRM 4ZH4F 4PA9A 3EPZA 3ZRWA 3G71V 2W0XA 2KQRA 4XKBA 3JRAA 1FYKA 2UU9O 2QUFA 3EYIA 3S2WA 3OFNG 2Y0MA 2K4JA 4XDJA 1O3TA 2JJ2G 1P9QC 3OTOB 3JRIA 2IH1C 3WTXC 5B3SH 2FSWA 2XF5A 3OTFA 4I55B 4UVBA 4FLTA 1YSCA 1V9PA 5H2FZ 1H0MA 2UUCO 3ZGKA 2G7HA 1JMKC 4ZBMA 4L9JA 2F5FA 2OQGA 2DWEC 3HDDA 1BR1A 1BI2A 1FXVA 2W24A 2M0CA 2P5VA 1OCOC 2LREA 3L74H 4U3JB 1OHHG 5H6RA 1FP1D 2OYQA 3JAMZ 1H8AC 4DR1B 2ZQMA 2OIEA 3H3ZA 4DV3B 4KIGA 3JSPA 5BR8B 2STTA 2LH9A 1TVKB 2HU9A 1T38A 2LR8A 1QVTA 3BCCH 4ENMA 2AO9A 1A36A 1ZWIC 4PFOA 1OPCA 4JI8B 4GCVA 4LIVA 1JHHA 2LKXA 3ASOC 1IV6A 3LSJA 1VQLV 1IN5A 1V5FA 2E7WA 3FXOA 4B43A 4KA4A 1ACIA 1NR1A 2C2AA 2UXDB 2GIVA 3HBLA 4PCQA 4A5MA 3K4LA 1JXSA 3RSNA 2YIBA 2R72A 1ONVA 2X9DA 2LW1A 2QBYA 1FFTB 5JQGA 2IA1A 1ZLZA 3UM7A 3U10A 3CXCU 2E5NA 4ESJA 3CRAA 2LF7A 1DF4A 1D0ZA 2BW3B 4PUSA 4X0GA 3S2HJ 2JTVA 4UCVA 3L72H 4PDKA 4OWRB 2Y0SA 2M5WA 4I7HA 3A03A 5HVQC 3DLLF 1GTOA 2ARHA 4O2BB 2O9LA 1V54C 4OPHA 2DYSB 2QQ9A 2WB1A 4JI3O 5KAIZ 1W36C 3FM5A 4DW1A 3VYSB 5B5EC 2H8PC 1U78A 2IM9A 4A2UA 2LC2A 4NTXA 2VJ5A 4XLAA 3K70D 2EIMC 3BZ6A 3I5UA 4WWCA 2FNAA 4BY7J 4HLYA 2E3CA 2JRIA 3CCQV 4GUNA 1X1DA 4I09A 3RQ4A 1QBJA 1UJWB 3ULQB 2MBFA 2G9WA 4PA4A 1HC8A 4AD9A 2E1CA 4DOZA 1WJCA 4GX1A 2EZHA 3FXMA 4DIQA 1WN7A 1VF6A 5ERIA 2R7DA 5J1YA 3QRFF 4CC6A 3ZQHA 3WG7B 3HGYA 3A1YA 1G1XB 2XPVA 1Y76B 3OM3B 4YIPA 1J95A 5JH7A 2K9SA 4DYRA 1HDDC 1IBMB 2DFIA 1EFRG 1AROP 2JN6A 1FP2A 2P6JA 5J40A 5DUKA 2IA2A 1YFHA 3ZHTA 4X62O 2JMWA 1YW7A 3AG1H 3JAWB 3GZ6A 1G4DA 2LKPA 1VQKV 1FD9A 1FOWA 1OLTA 3L71H 5K1XA 1A6IA 2B7EA 3W2VA 1AP6A 1QHTA 1M57B 4IHYA 4MLOA 3F7VC 5J2TA 2L7MP 3MZHA 3M8JA 2OUMA 1PYVA 3ZP5A 4A12A 2XSJC 4IXAA 1WA8B 5DD8A 2BY1A 4EQQA 2W48A 2D2CB 3VWBA 1PNKA 3NR7A 1U96A 1NH2B 3KX2A 1XGMA 5GP9A 3WTTC 2E35A 5HLTA 1D3YA 3KZYA 2PTMA 2R7OA 1KU7A 2RQPA 2DYSH 4LG0B 2CTPA 3FFQA 5LXTB 4MIMA 4CDGA 4C9YA 4YG2F 2EIJB 2RAEA 3HTSB 4DR7O 1IZ3A 1FXKB 3E6CC 2QGNA 1OISA 2CFOA 1DF5A 1S9HA 2IP2A 5EIBC 4NXNB 3BY6A 1D5VA 5IJ0B 4LFUA 3OR1C 4DBRA 2V4DA 2JGDA 3MKZA 1MJBA 2DYRH 5A2QN 3SR2C 3S3NA 2M4GA 2UUBB 4J9ZB 1T08B 4U88A 2HZTA 4JBAA 1M9NA 1SETA 2R7VA 4BGDA 3PO2J 3LDCA 1GDTA 4TT3G 1SZTA 3D36A 1G3SA 5KMGA 1X3WB 3VEPA 1I08A 3WG9A 1LNQA 4GX5A 4AIJA 1SC7A 1S72I 1JI8A 1LR1A 3SJQC 4JAVA 4TQDA 1K6OA 4Y33A 2HVKC 1GLNA 4FFBB 4X20A 4F6EA 5K1PA 4F6RA 1IRGA 4HAMA 3ZRWB 4UY8I 1HKSA 3P9CA 3OWTA 4FE4A 1WPXA 3CX5F 1UFMA 3ZOBA 5TRDA 3PFYA 4YY3O 3GVAA 3THOA 1TNSA 3T4ZA 1I7FA 5IPAA 4QE9A 1T56A 4XN0A 4XRSG 2VT3A 5A2QK 3FXUA 2GIZA 4MSWC 4FLXA 2E60A 3SPHA 2CUFA 3ABMB 4MTDA 3WB2A 5EF6A 2A5YB 1W7PB 1NTMH 1R23A 4DV1O 2F4IA 3RDIA 3DPUA 2D1VA 3BR0A 1OCTC 5FL7G 3G6EI 3RW0A 3MD0A 1MMSA 1VNDA 2CQ7A 2CDYA 1FS0G 5EC2C 1LE8A 2XB5A 3BG3A 5FNVA 3FMSA 3ZRVA 1V55H 4QPOA 4IHVA 1F7YA 1K79A 1AU7A 1M5IA 1YQAA 1OFCX 1XSXA 3D0SA 4ETSA 2XGEA 1TL8A 1ZQ3P 5EDNA 1FJGB 1IDZA 3CUQC 5LMUO 2P06A 3A0HC 1MBGA 4M6YA 3E89A 2Z99A 1XC5A 4I0AA 3L2UA 4IF4A 1FZPB 1FTTA 3CESA 1TAEA 1TW3A 2FA5A 3I4PA 1Z2GA 3Q0UA 5JQGB 5LRRA 1NZ6A 4IT5A 4MTOA 1FOKA 3GUDA 3L70H 4PSXA 3SJCC 2UXXA 2YX4A 2KSDA 5IYZA 3CPWU 4E7JA 1KU9A 1I5ZA 2JS3A 1AR1B 1DDNA 2FQ4A 3KEQA 5TJJA 3KP7A 1QBZA 4PA6A 2EA2A 1E1QG 1H8EG 2GXAA 3ROUA 5HLIA 3JRFA 1H89C 1BBYA 3HOVJ 4PA3A 1AOYA 1QPMA 4BBRJ 2ZBKA 4U0WA 4YIIA 3DEEA 5HS7A 4IQJA 1D5AA 2VQHA 3BLYA 2LFSA 4Q20A 3ZS8C 4X66O 3FYEB 4G12A 1KC8W 2XRLA 5DCFA 4DBQA 2XRNA 3OYEA 1P84F 1VQ9V 1VQ5V 1BM9A 3JRGA 4X65B 2JK5C 4U7NA 2QKSA 4BH9A 2WLJA 1FIAA 2KZGA 1FLIA 3MAQA 2M2EA 1GRJA 1TWHJ 2OD5A 3QU3A 4EVIA 5DDGA 5JH7B 1R3LC 3L2CA 2ZJQF 2V9PA 1UZCA 3I55I 1R1BA 1Y6XA 1J7KA 3DPLC 3OUSA 4JZ2A 3N2KA 1T0FC 2QGUA 2O8XA 3E5QA 5B1OA 2RQQA 3HB9A 2LSOA 2XF6A 2V1XA 3D5SC 1V3FA 2ZJPF 3H36A 1O9HA 2IGMA 2P5KA 2JEUA 4JAUA 5TISZ 3JSOA 4H44B 1GM7A 2QA4V 1J09A 3E5UA 3L2VA 3SYTA 3KP3A 4E7SA 1MNDA 3M07A 1KQ0A 3HPHA 5DCMA 1YE9A 2RN9A 3ETQA 2XKPA 1EJ9A 3OIQA 4DNCA 1ORKA 4G9YA 3SEZA 1FFXA 4X1IA 2GXGA 2MC3A 2DWDC 1H9TA 4MVUA 4R6ZA 2AS5F 4TSFG 3SFZA 3OW2U 5JHFA 4XKCA 1Z5VA 4AUXA 1THZA 2M1BA 2VJIA 1JUPA 2FF4A 2AXLA 2OV7A 1VQ4I 2I8DA 4I02A 5IYCO 5E1XA 3DKWA 4U87A 1JUMA 2EZLA 3RJPA 1SFXA 2PQ8A 1K7AA 2BTOA 2ZINA 2HQAA 4H33A 1Y39A 4X9QA 4Q47A 2F4VB 3WTVC 1D1AA 1LJ9A 3KEOA 3AG2C 1AR5A 3T1YO 3BG6A 3HGGA 4UXNA 4NKGB 3S93A 2QEXV 2ELHA 2DDAA 2DN0A 4PGGA 2OAZA 2DQ3A 1VQMV 4LF7B 4A3IJ 2BZTA 2E1MC 4IHTA 2JGDB 1FKAO 1S72V 3P30A 4G27B 3DF8A 1JJ8C 2Q68A 4WF9V 1B1BA 2HTJA 3PSFA 4CYDA 1GXPA 2H1KA 3DU5A 4M3EA 3K4MA 2DU9A 2M7WA 2XAHA 2CW7A 4DV5O 1Y56A 5KMGB 1L3LA 2RQ6A 4WF2A 3FD9A 2JVGA 1U9NA 4FQGA 4LIUA 2YDEA 4UV9A 3R60A 4KN4X 4IO9F 4W1UA 1WAZA 5F0CA 1OYIA 1QNMA 4CYCA 3OL4A 2A69F 2LYCA 1XL6A 5LL6Y 4UCUA 1BHAA 3TGUH 4F6RB 3M7MX 3ONQA 4L0YB 2QSFX 3S1NJ 1S7OA 4O4JA 1QPIA 4X6AJ 3HR0A 3LAJA 1HNZB 4BUPA 3CD6I 3NWSA 1TNTA 1YHQI 1GVJA 3ABUA 4WK8F 2Y4UA 3GVMA 1CPYA 1SFEA 1SMYF 1BOAA 3ML6A 2G38A 4A6DA 3IP4B 2BSKB 2ZR2A 5K1YA 4BQAA 2CQQA 5ILUA 1C0WA 3W7TA 1ZRFA 4FISA 4HG2A 1W0JG 1KBHA 2KIFA 3KZIZ 1KQ9A 4PDVA 1LE8B 5FNVB 4IHJB 2RMKB 2F4MB 3COAC 4LFAB 4DV0B 2ZNYA 1XNRB 1FBQA 4UB6C 3KG2A 3BPZA 2H8WA 3BCBA 5F0FA 3CYOA 5IYBO 1D8JA 4UB8Z 3V42A 1NR7A 3V4GA 4RAZA 2FOKA 2E2JJ 1KECA 4ZYDA 1PNLA 2OBPA 2RNGA 1M57C 2Q2EA 3TMOA 4QSHA 3D5LA 5HLGA 2HTSA 3CMEI 2ZIMA 1DK1A 1E1RG 4PDRA 2VB6A 4JI4O 1H2LA 1IX9A 3HUGA 2VOOA 1EN4A 1GMGA 1OCRC 1Y74A 2ZCWA 1IW7F 3CCRI 4PGHA 1YS7A 2DPDA 2YS9A 2Z9OA 1JKRC 4DV5B 3S3XA 4RMNA 1CQTA 1SD7A 1R4MB 3E6MA 1K8AW 1K6YA 2R92J 1FSHA 3TXQA 3K3WA 5FLXZ 2QTSA 1MDMA 5HNFA 1GN3A 3KP5A 2L35A 1TQIA 5FD5A 4EGYA 4DR4O 4GLXA 1YXBA 2JK3A 3O6BB 4NC7A 3OMIB 4GZRB 1Z05A 2A9HA 1LFPA 1O3SA 1T5EA 3E5XA 3QNEA 5IYDJ 3C2BA 1N34O 5M5WJ 1MD0A 4I0XB 3X2QB 2QDOA 4PJMA 5JR3A 3M99B 4A3KJ 1S29A 3PJSK 2EINB 1AJNA 3EFFK 1FBSA 1WH5A 4HV5A 3KP4A 2DOSA 2WY7Q 3QOPA 4WFGA 4IL6C 1YDXA 3C2HA 3VQWA 4DV4O 1SAXA 4MNUA 4MVOA 1IRXA 2ZFWA 3JAKA 4I98B 4JGSA 1IN7A 1ETYA 1N25A 2KLOA 1K3EA 3CLQA 5DTDA 3W2WA 3BA9A 3N2KB 3KCYA 1ZR4A 1DP3A 3O3KA 2L7FP 4FMTA 2IU3A 3WB0A 4XRMA 1JJ6C 1I39A 4BXXJ 4KXRA 1OCCH 3GFIA 4JTAB 2EFPA 3OSFA 2FKXA 1OCOB 2KJCA 5EG0B 4I0XA 4I2OA 5FJ8J 1BGYH 5BS6A 2OZUA 1GN2A 5DCMB 2XPWA 1VQ4V 4LF4B 1P6RA 1XHXA 4DUZB 1FFXB 3PJRA 2CQNA 2Y9YA 1L0OC 1GUUA 4HYEA 3BCAA 4X1IB 2EX3A 3GWOA 1Z3XA 3P7NA 3TBIA 2ZXWH 3ABMC 1MGTA 3LNMB 3RWRD 5ICFA 1K4CC 3ASOB 1DPRA 1EBOA 3UCSC 3CUQA 2IVMA 4KL1A 3BTCA 5BZBA 1XNQB 3G1OA 2HPIA 3ZN1A 2E76B 3A02A 2XAUA 1KP2A 3OMAB 1N33O 3F8NA 2GUZB 3PNYA 3LSTA 4U0VA 3IH4A 4O4LA 1LFBA 1MMDA 2VQGA 4WXDA 3ZMZA 1FC3A 2W0FC 1QZEA 3HKZN 3HXLA 3WU0A 2O03A 2DLLA 1YX3A 4KITB 1O3RA 2ACJA 2DCEA 2EBOA 2HYJA 1R73A 1MJ9A 3DKXA 1FTZA 5B1NA 5DN6G 1EM1A 1X3UA 1Y1VJ 2DT7B 2M9HA 3BG7A 2V4JC 3MKWB 2ETNA 3LAPA 2WWYA 2PJRA 4RA2A 4IOCF 1ETKA 4YRVA 1A5JA 3MZYA 1F51A 3CLOA 3JATA 3CCSV 3K69A 4NQWA 3TOAA 4J42A 2EJRA 3DTIA 1LUJB 1K97A 4MVSA 4WFAV 3WTYC 2DFHA 4XONA 1Y1WJ 1U8BA 2F48A 4E7KA 1WCMJ 3TP3A 2IBZH 3U1KA 3H3VK 1L1FA 4DYQA 3FK7A 2CUGA 1N78A 3WU2Z 1TWGJ 5D5WB 4JYKA 3OYHA 2F6CA 2R7WA 4X1YA 2M45A 4AHCA 1W0KG 2NR5A 3TK1A 4DYCA 1LB2A 3F5WC 5K5RA 2OTJI 3FXRA 5DEQA 2ATKC 3QO7A 1OCOH 4JI6O 3G4SV 1OR7C 3HOUJ 4EV0A 1CF7A 3K0DA 1T0FA 3RVYA 4O2AA 3JTHA 2H1LA 4BNCA 5CA1B 3B6AA 2FBIA 3M1EA 5LOVA 2Y0IA 4KMFA 2ECCA 3QODA 3RKYA 2ADQB 1IXRC 3RKXA 2OIGA 2P6TA 3B8MA 2BYVE 2FU4A 2E74B 1N33B 5C8YB 1JKOC 1O4XA 4RUFA 1K9MW 1R1TA 2ZXJA 4KUMA 3GEZA 1ZN2A 2EB7A 3E8GA 4R1HA 1NVPB 4D0PA 2FRHA 3K5MA 5IYCJ 3OS0A 1QR8A 4JI2O 3ZCOA 3ZJZA 1ZG1A 3CCRV 5M3MJ 2ESNA 4P9OA 4DK1A 4X1EA 2R5ZB 1NHAA 2K9LA 2OPTA 3J7YJ 1R3KC 3RN4A 1XL4A 1YS6A 1B4AA 1V54H 1X3ZB 2Q2EB 5E1ZB 2Q73A 4JASA 5J2UA 1XMQO 2MC4A 1UFIA 1KYWA 5JVGF 4LG3A 3DBRB 3DEUA 1IURA 2OU2A 1BC7C 2XNDG 3DBLB 5EBMC 2EIMH 1VQOI 5CVIA 1ZAOA 2L02A 3BROA 1S0VA 5DECA 2HPMA 2G0EA 3CP8A 1PP7U 3D8CA 3M9AA 1XS9A 1FEXA 1B6AA 4UUJC 4YFNF 3DCFA 2V1UA 5EYPA 4BBSJ 5H20A 3S3OA 2BHYA 3KKYA 1RUOA 2ZE7A 4PJ0Z 1G3YA 3FWEA 4Q5SF 2CE4A 2CRGA 2P5LC 2ZNIA 1I50J 3JARA 1YTFD 3J7AU 4LD5A 1KZHA 4XRSA 3FB8C 1OJHA 2IH3C 4W4LA 1LFUP 1ULYA 2XHBA 1UELB 2XKOA 1KP3A 1BIBA 1W5SA 2EFOA 1FXHA 4GKKO 1AI7A 1I0HA 4NUBA 1UB9A 2IEKA 2QKAA 2XTAA 1BI1A 1U2WA 4L9TA 1K7DA 4D7TA 4EFBA 1QZYA 1EH8A 1Z91A 2RVCA 1ZRCA 2JT1A 2E1NA 2M3AA 4UV8A 4YIFA 2PFBA 3LSRA 4HF1A 3E0JB 1BCCH 2A68F 5BPIA 2VBZA 4JPRA 4JI1O 3F22A 1OYWA 5EZHA 2ME6A 1RRJA 2P22C 1WZ2A 1S7AA 5H2FC 4ICGA 5F0HA 3K2AA 3V8JA 3CCYA 3F3XA 4BU2A 4CHUA 3LSUA 2W1OA 3M1CA 3PM1A 4Z2YA
chains in the Genus database with same CATH topology
2FBHA 4B08A 1PUEE 4HX8A 4S04A 3J81Z 1O7LA 4ZIBA 1N32B 4XBFA 1XB4A 2J5PA 5J8CA 1W4MA 1FX7A 2ESHA 5E8GA 4AIHA 1FYMA 4LF9B 1XNRB 4JYAB 2XHKA 1IAWA 1K78A 3RFRA 2H6BA 2Z3YA 1FNNA 1IRFA 3IRQA 4L5JA 2VODA 4TQDA 1TW2A 2JPBA 2E7XA 5KHJA 4IRIA 4TV8A 3J80Z 2A07F 1HSTA 2VBYA 4FX0A 3HHGA 3ELKA 2ZNZA 3NQOA 1T98A 4BHPA 1HKTA 1KGSA 4MEXF 2K27A 4R79A 1TA8A 3HRTA 3HIFA 4DR5B 2LNBA 4G8XA 1QNTA 1ZLKA 3LQQA 2VT2A 4QLCU 4B3RB 2JPCA 4GXOA 2MD5A 3BWGA 4EJWA 1REPC 2IW5A 1CF7B 4CS4A 4B8XA 4O2AB 1WQ2A 2EA4A 5AIPA 5LOVB 3WU1B 5LYJB 1Y0UA 3KLNA 3V7SA 4LFBB 1BN5A 2B0LA 2H94A 5FFZA 3E22B 1I1SA 3F21A 4TOIA 2D1HA 1W7PA 4M6XA 2KJBA 2VQFB 5FPOA 3WTSC 3GYHX 1M4UA 5J2UB 4HZFA 2PMHA 3I71A 4BXUA 1JGSA 3W6JB 4EM2A 3ABTA 2YSRA 4AVPA 3QF7A 3QU6A 2Q8KA 5EYPB 1V4RA 1IUYA 1F9NA 4HF2A 2G7UA 1KA8A 3A2FA