1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
molecule keywords hypothetical protein MJ223
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
5ICEA 2O61A 4FT8A 3GFIA 1R5HA 2XHKA 4M9ZA 4PGGA 3RJPA 1P4AA 3V7CA 3ROUA 2NS0A 1BI0A 2MLKA 3RPQA 2IT0A 3ZMVA 4LLLA 4WWCA 1U78A 1FLIA 2PQ8A 1R5GA 3FMQA 1WRJA 4ZYDA 1YLFA 2CSOA 2F5CA 4M6XA 3CO6C 2CFXA 2FBHA 3ABUA 3FXRA 1ZN2A 5LHHA 4EGZA 4HV6A 5ILSA 1O3SA 1U5TB 2HTSA 2ZJ2A 4EJOA 3D0SA 1E17A 3ELKA 2CGPA 5L3CA 1W7PA 4UV8A 5D8KB 4P5OA 2A3SA 1KQ9A 4ZZLA 2VBYA 4P55A 3O2PE 3QRFF 1B1BA 1DDNA 2ISYA 4YIFA 4UV9A 1HW1A 1AOYA 3MAJA 3FX3A 4M9XA 1U2WA 2IA1A 4LK0F 1IUYA 3DFGA 1E2XA 2ETHA 2DBBA 1XSDA 4AIJA 2M30A 2HYGD 4A5NA 4A6EA 1X3UA 3BY6A 5DCMB 4HF2A 4OIRF 4L0YB 3TO9A 4NB5A 1I27A 1OKRA 3E6CC 4ZYEA 3WTSC 4GCVA 1KQ8A 1FYKA 1QQIA 2K4JA 5FB2A 4HX8A 2A6HF 2FU4A 2M5WA 2O3FA 4ZZDA 3WGHA 4RGUA 4HYEA 3R4KA 2GA2A 5DUIA 2Y75A 2HKXA 5HDGA 3T0YA 2ZNYA 1W7PB 2NAZA 1J7KA 2GXGA 4OINF 1XSXA 2P4WA 5HLGA 4G8XA 3E3VA 3HHGA 4JK1X 1B6AA 1Z1DA 3SHFA 1MGTA 1T6SA 1R23A 5ILVA 3DXJF 1TW2A 2ZMEA 3F8BA 3M1EA 2IA2A 1HXDA 2Q0OA 4HQEA 3ZN1A 3ZMSA 3PFIA 2M45A 2Z5UA 5F64A 1MD0A 1LVAA 1YW8A 4IHTA 2DQLA 3CUQB 1FWZA 3RKXA 3KEOA 3F8NA 1Z6RA 1XCVA 3GFLA 4FX4A 2L4AA 3CUQA 5L3DA 3RWRD 1YIOA 1WSUA 1W5TA 2MH9A 5FO5A 4GYIA 2DT5A 4G7HF 1O3QA 4L9NA 2HQNA 3K1MA 3V4GA 2H27A 2XROA 2HQRA 1F4KA 2RKHA 2A07F 2PEXA 4ENJA 3WTWC 3RPUA 3ZP5A 1OYYA 1J5YA 2ZCWA 2VONA 2IA0A 1LQ1A 3VODA 3T1BA 4GXOA 4EGYA 3DPLC 3S2WA 3WTUC 3ZMUA 3SZPA 3KLOA 2RQPA 4L0ZB 4F7ZA 1HQCA 1T2KA 3VB2A 5L3FA 3VFZA 1FOKA 1BJAA 3IRQA 4I0AA 1IRGA 1TLHB 1BC7C 2M1BA 3KEQA 4I98B 2EFNA 3L9FA 1GXQA 4CDGA 4YIIA 4WXHA 1F1ZA 3GFJA 2CQKA 4I7HA 4QLCU 2O8XA 1B4AA 1S8NA 2PBIA 2HDCA 1MJ9A 1KQ0A 5J6XA 3TGNA 4KFCA 2XKPA 4KN7X 4EM1A 1WWXA 1LNWA 5IT9K 1YW7A 1I5ZA 3E5XA 3I54A 1R58A 4KMFA 2RN7A 4Q5SF 3LSTA 2ESHA 4L9JA 1TNSA 2KKOA 2OZUA 2XVCA 3ZPLA 2XAHA 1G3YA 2FXAA 2JPBA 2CWEA 4M72A 3V7SA 4U7BA 1I1GA 3NQOA 2ZO4A 2KRFA 2IRFG 2KIUA 2K4BA 1XB4A 4IXAA 1MJAA 4LMYA 1JHHA 4ZYGA 4OOIA 3F3XA 2L02A 4G7OF 3QPHA 4BNCA 3K1NA 3HSFA 2V1UA 3JTGA 2D2WA 2L4MA 3E6BA 5H6RA 5BS6A 1YQAA 2JTVA 1SMTA 3TOAA 2P6TA 4CZZA 3HRMA 3F72A 5H20A 4IVNA 3GZ5A 2F2EA 2P6SA 2ISZA 4U0VA 4P9UA 4LFUA 4ENMA 1TBXA 3FZVA 5CYVA 5DD8A 3M7GA 1G4DA 1DPUA 2Z9OA 3L00A 4GO1A 1FYMA 2DK8A 1ZGJA 3GZ6A 2ESNA 3CTAA 3LA7A 4RGXA 3FHZA 4FX0A 3EYIA 2JZYA 3GEZA 3V8KA 4A0XA 2KJBA 1YS6A 3VEPA 1S29A 3AAFA 1KU2A 4LD5A 2GXBA 3G73A 3F8MA 3U2RA 1Q1HA 4IRIA 1YO5C 1BIAA 1UB9A 3J81Z 1SMYF 1DP7P 4A0ZA 2QM3A 5K5RA 3E6MA 4A2UA 3WTVC 4IF4A 2OQRA 3HIFA 4M73A 2KJCA 4OIOF 1XN7A 2LNBA 3F8CA 2OAZA 1ZG1A 1TW3A 2CG4A 1LDJA 2DK5A 3WU1B 2FBIA 3GX4X 2B0LA 4Q48A 4JQFA 1K78B 1SFXA 3HTSB 1IF1A 3QPTA 2DPDA 1I6XA 2E7WA 2MA3A 4ZH4F 4S05A 1S7AA 4L5JA 4U0WA 2ADUA 1HKTA 3KFWX 2IPQX 4KIBA 5E8IA 1TQPA 1ZARA 1OYIA 3BZ6A 2KIFA 3LA3A 1PP8F 3O6BB 2H6BA 3DEUA 2NYXA 3FXQA 1G3TA 5JR3A 2MH2A 4AIHA 4LLNA 1O7LA 3R0AA 4MGRA 1LB2A 4OIQF 4G6QA 4EJTA 4ASNA 2DQRA 2PG4A 5HS7A 4A0YA 3KP6A 4WK8F 1IZ1A 3FMRA 3GW2A 4OIPF 1U8RA 3GWZA 3KE2A 4HQMA 4Y15A 2FNPA 3F22A 2UXXA 5E17F 3B02A 1EH8A 2K02A 4ENKA 2HZTA 3MQ0A 1JHFA 2R9AA 3L7WA 4L9TA 3MZHA 4RB2C 3WGIA 3B73A 5AONA 5DEQA 4GGGA 3E6DA 3T8RA 2STWA 4D0PA 2QZ8A 3I59A 1FC3A 4HLXA 1U5TA 1JE8A 3TDZC 4ETSA 2UXNA 4OU0A 1IN5A 2XKOA 4Y13A 3E5QA 4HBLA 1ULYA 3JTHA 1PP7U 2FQ3A 3IWFA 3LFKA 3CUQC 3E97A 2A61A 1ODDA 2PI0A 4RB3C 2HFHA 1MDMB 4B09A 1ZYRF 4EV0A 2Q8KA 2GWRA 3FM3A 2LSOA 3M8EA 2Z3YA 1G6NA 2PLYA 4EMSA 3GXOA 1REPC 2H94A 2EK5A 3RYPA 3DPTA 3JAMZ 1ZLKA 3LA2A 2CYYA 3FWEA 3WE2A 3M9AA 3RI4A 4BYYA 5IT3A 2VC0A 1ZG3A 3SQNA 3ECOA 3F21A 3N97A 1MKMA 5LRSA 4HLYA 3K69A 5K1YA 5HOOA 4UUVA 2QQBA 4XBFA 3BJOA 2D45A 3IKVA 2F5FA 1DPRA 1YW9A 4I2OA 2OA4A 3WTXC 2GA1A 1MZBA 2VN2A 3ZMTA 2GZWA 4G6DA 2D1VA 1T38A 2MC3A 3EETA 3MFKA 3GFMA 3IKTA 4LLGF 3EDPA 1EH6A 5ICGA 2C6YA 4UVAA 5FLXZ 3KP2A 1BI2A 2VT3A 1ONVA 2X4HA 3ZQ7A 1Z91A 1HSTA 2RDPA 4N9HA 2EFQA 2VBXA 5ICFA 3LQRA 5LBQA 1T0FA 5FD5A 4P9FA 4AD9A 4K2EA 2G7HA 2YR2A 3TDUC 2PN6A 3GF2A 2Q2EA 3ZMZA 1CF7B 1IW7F 1FYLA 5FFXA 2DO7A 4PCQA 4ESJA 1O7FA 1EV7A 1P4XA 5JFRA 1GHCA 3N4MA 4RAYA 2L54A 2BEOA 1USTA 2XUBA 2MD5A 4WX9A 4RAZA 1B9MA 2W84A 3BROA 4BHCA 1GVJA 2P5KA 2Y48A 1FSHA 4ON0A 4LG0B 3EQLF 4ESFA 1I1SA 1OPCA 1JXSA 4MTEA 1Y0UA 2ZNZA 1H0MA 3PQKA 2W25A 1ZREA 4PGHA 4XLPF 1IXRC 1YYVA 2FMLA 4RGSA 1T39A 2DW4A 1QZYA 4MQ9F 4FHTA 1B59A 5ICCA 4YG2F 4WF2A 3SR2C 2F5EA 4KIGA 1ZRFA 2QQ9A 3CUOA 3ZN0A 3F23A 2RGVA 5LRRA 5J8CA 4KICA 1RUNA 4MTDA 2H6CA 3WE3A 3BDDA 1UHMA 5F6FA 5LLQA 1JGSA 4XSZF 3WG9A 3BJAA 2VOPA 2E1NA 1B9NA 4LK1F 1MJBA 4NQWA 4BAYA 3IWZA 1L0OC 3RDIA 5ERIA 3D5LA 5LHGA 2Z99A 3FXUA 3V7RA 1XMKA 4YFKF 5D6FA 5CVIA 2R7FA 2FEZA 1WI9A 2A5YB 3KP7A 2HTJA 3P9IA 3L09A 4LB5A 2R3SA 2XAQA 2GIVA 2FSWA 1FBQA 3WU0A 1IN8A 4DQ2A 3COAC 3BJ6A 2ZMEB 4XRFA 2XV4S 2D1HA 3K9TA 2HEOA 1PDNC 2M87A 1BBYA 1Z7UA 2EB7A 3KCCA 4XSXF 2IVMA 1K6OA 3ERED 5ED4A 3ZMDA 1LDDA 3Q9SA 1LEAA 2WWYA 3NEUA 5HS8A 4IHSA 2H09A 5F1RA 2E7XA 5DYMA 3CJNA 4A12A 5IT9Z 4KDPA 3M8FA 4KT5C 5D6EA 4N0BA 2QUFA 3V8LA 2RC4A 4L9VA 4EQQA 3C1DA 2O03A 5KVRA 5DV5A 2VBWA 3ML6A 1YFHA 2ZKZA 2QQAA 1H9TA 3KP5A 2QYOA 1UCRA 3G3ZA 5DD4A 1BC8C 4BHPA 3W6JB 2ZXJA 5KK1A 5LEKA 1R1UA 5K5OA 1IRFA 1WKMA 4EJWA 5BMZA 2HWVA 5HVQC 3WGGA 1FP1D 1FT9A 1FZPB 4MNUA 4H0EA 3CO7C 1C0WA 1OR7A 4R1HA 4QWQA 1K79A 2QWWA 3ABTA 1KU3A 4IJAA 1HW2A 1M5IA 2QM4A 1SD7A 3TO7A 2RV8A 3K1PA 2CW0F 3KETA 3KZYA 2IP2A 3H92A 1W5SA 1D5VA 4O5VA 4PDKA 1HSJA 2QVOA 1F5TA 2YU3A 4UNOA 4GYGA 1F9NA 4Y17A 3ISPA 3REOA 4KA4A 5CVVA 2YPRA 4NHJA 3GLXA 1R36A 2A69F 2PMHA 4JBAA 5E20A 2BGCA 1P2FA 1SFEA 3DV8A 3WTZA 1L3LA 1D8KA 3KZZA 1XGNA 3J81K 4M6YA 3IRRA 2PMUA 1IAWA 3QP5A 4M71A 2DU9A 1RIOH 1KU9A 4DNCA 3ULQB 1FP2A 2XASA 2YX7A 2DPUA 2V1XA 3IC7A 2ELHA 1D8JA 4CO8A 3F8FA 3H3ZA 5CJ9A 1WQ2A 1BIBA 3QU3A 2EV0A 3GVAA 3O3KA 1HBXG 1S3JA 5LGTA 1V3FA 3WTTC 1AWCA 4O6JA 3GYHX 2IW5A 3JAMK 3LQQA 3TKYA 3Q5FA 2JSCA 4WXDA 1QGPA 2MBFA 4G9YA 1TQMA 3J80Z 3I0TA 1G3SA 5CVRA 1XD7A 2Z33A 4UVCA 4A6DA 3W6KB 1QO0D 3HSRA 2WTEA 4TV7A 2FBKA 2K86A 2IJLA 1KA8A 3U9GA 2V79A 1YTYA 3I58A 2AS5F 1UHWA 1U3EM 4A5MA 3C18A 4HX4A 5LHIA 2P7CB 3DP7A 3DF8A 4ESBA 3IL2A 2XRNA 3GUDA 1S7OA 3KP3A 3MCZA 2PFBA 2M8EA 1PUEE 3PQJA 3HRSA 3IHUA 4EJVA 3HYIA 2HS5A 2FF4A 4HF0A 1LEBA 3CDHA 2EFWA 2A68F 4R8HA 2CO5A 1BI1A 1U5TC 4CICA 5LGUA 3I4PA 4L5IA 3V8JA 3FF5A 1BI3A 5FGMA 4RB0A 4MQVA 2BBYA 4HA8A 4BHBA 2VE9A 3SZTA 4LJZF 2EFOA 4G7ZF 2X0LA 2JPCA 2YX4A 3QU6A 3ECHA 5D4SA 2F5DA 3P9CA 3JSPA 4Q4ZF 5E8GA 3U1DA 5LGNA 2VOOA 3C3WA 2FOKA 4CXFA 1FSEA 1ON1A 3F6VA 1SD6A 4KYWA 1XGSA 1Z05A 3K2ZA 1XSVA 2RVCA 2P5VA 2OD5A 5CLSA 2VBZA 5H6QA 3OOPA 1BN5A 3QP6A 2QBYB 1OYWA 5A2QK 4BXUA 2FRHA 1Z6TA 2HR3A 1EH7A 2PJPA 1W7PD 2FMYA 2DLLA 4BH9A 4UVBA 4MEXF 5D5VB 1KU7A 2YSRA 3E5UA 2ZFWA 2TDXA 2LF8A 5DUKA 3I59B 1QZZA 1D3YA 5DDGA 4OMZA 4HZFA 2W85A 5AIQA 1HKSA 5DCMA 2V1DA 4L18B 3BPXA 2OU2A 1T98A 4R79A 1SAXA 2KIMA 5E1XA 4Z2YA 3LWFA 3K0LA 3LAPA 5HDNA 4HX7A 4PZJA 4IPAA 3LAJA 1IN4A 1K78A 1IN7A 2L3DA 5DCFA 4I0BA 5CVUA 2V9VA 3OV8A 3HOSA 3J80K 1ZRCA 1IXCA 1ZHFA 1ZAOA 3P9KA 2DAOA 1QPMA 1VTNC 1J2XA 4U0YA 1ZLJA 2G9WA 4KN4X 2HYFA 2W24A 3CLOA 1FX7A 1FBUA 4M9SA 2DI3A 1XDUA 3T5XA 5K5QA 1DUXC 4M74A 1ZRDA 4I02A 5BPDA 4ENNA 1ZGAA 4O3MA 3R0JA 5FLXK 2EJRA 5E18F 1J9IA 1G3WA 1P6RA 2P7VB 3QAHA 4N9IA 1NHAA 3RIRA 5E1ZB 3HSEA 4AIKA 2BE5F 1QNTA 1O57A 1OMIA 2EFPA 1FPQA 1UFMA 3C7JA 2NRAC 1J75A 4BQAA 5HS9A 2J5OA 3HHHA 2XGXA 2QBYA 1R22A 1RZ4A 1HW5A 3VOEA 1XDSA 2UWMA 3BPVA 4HOBA 4AVPA 1R1VA 1USSA 1TQIA 5BOXA 4EJUA 2XAJA 2L01A 1BM9A 1ON2A 5L3EA 2VXZA 1K7AA 4XLNF 5HLIA 3R6SA 1J0RA 5JVTA 4G94A 4HAMA 4LGWA 3SFZA 5LEJA 4IRHA 4HDVA 5ILUA 4CGZA 1MDMA 1SD5A 4Q47A 2DTRA 3EUHA 4E70A 5D5WB 1YS7A 1YG2A 2QLZA 2P8TA 4P96A 1P92A 2VODA 1FY7A 1O3TA 1IXSB 5EEHA 3MEXA 4YFXF 3TOBA 3NRVA 2NNNA 2VE8A 2EV5A 5TRDA 3HOTA 3FM5A 2ZBKA 3L2CA 1O3RA 3HTUA 2G7UA 4I01A 5BPIA 2GQQA 1FBSA 5D8LB 5D5UB 2EA2A 2DFIA 4HDUA 2W57A 3FMSA 1U6GA 4WCGA 1V4RA 3DKWA 2P5LC 4YFNF 5HDKA 4KNYA 3J7AO 1STZA 2K7LA 2BYVE 5FD6A 3HRUA 4MHGA 5JHUA 3I53A 2BV6A 3BOQA 4EM2A 4S04A 1CF7A 3TQNA 1SD4A 2XAFA 3BP8A 4LB6B 1A04A 1TNTA 4HF1A 5FFZA 1XCBA 4KMUX 1W4MA 2HOEA 2STTA 1IN6A 3BWGA 1RUOA 1HKQA 1S6LA 2R7DA 4HW0A 5HLHA 2FE3A 5AIPA 1TTYA 4U88A 2QENA 1XMAA 2OBPA 5J8FA 2XAGA 2FA5A 2O6GE 2A6EF 2COMA 2JT1A 4EM0B 3RYRA 1ZG5A 3T8TA 2NNYA 2AXLA 3RKYA 3RKWA 1H9GA 1RNLA 4AWXB 4CYDA 3H3UA 2VT2A 1LDKB 3P7NA 3TO6A 4CHUA 2FNAA 2EWNA 3DQVC 2EV6A 2GAUA 3I5UA 1SFUA 5BQTA 2OZ6A 1LJ9A 4HV5A 3R60A 1RI7A 1XGOA 1KYZA 4IRGA 5A2QZ 4KIFA 2Y0MA 2RNJA 6PAXA 2OQGA 4RB1A 4ZYHA 3GO5A 5EEGA 4U7DA 3I71A 4UXNA 4EVIA 2K27A 3R61A 3MWMA 5TJJA 5JI6A 1KYWA 3Q9VA 2J5PA 1BOAA 2HGCA 2UZKA 4OMYA 3EYYA 4B8XA 4LG0A 2V6CA 3HUGA 1R1TA 2WV0A 3F6OA 2LDUA 3KLNA 1ZH5A 3WODF 1XGMA 1R00A 1CGPA 3RTRA 2LKPA 1P4WA 1J59A 5E1WA 3KP4A 4RS8A 1Z9CA 2EA4A 3JSOA 2VC1A 4MEYF 1GXPA 3SXYA 2JRTA 1R7JA 5CVJA 3QOPA 4UHTA 1QBJA 5D4RA 2E1CA 2LF7A 5D5XB 2O0YA 5L3GA 4I09A 1KGSA 3WTYC 2HKOA 3MZYA 3I64A 3HRTA 4KUMA 3JW4A 4WXCA 5L3BA 4RGRA 1FNNA 2MLGA 2ACJA 2WC2A 2XIGA
chains in the Genus database with same CATH superfamily
1Y8QB 5ICEA 2O61A 4XL9A 2HJFC 3H1KH 1Q6HA 4FT8A 4W1UA 1ROPA 3AG1B 2V26A 3H9JA 3GFIA 1R5HA 1T8IA 4NXNB 5CB4B 2XHKA 5LMUO 4M9ZA 1TUBB 3HPLC 2B5UA 1VQOI 3PNTA 4PGGA 3RJPA 4ZTFA 2Y9ZA 1P4AA 1WJEA 3K7AJ 3BR6A 3ROUA 3V7CA 2NS0A 1BI0A 2ZNJA 1Q5OA 4PDRA 2YIBD 1X2MA 3DC5A 2MLKA 3RPQA 5BMVA 4PSWA 2IT0A 3ZMVA 4LLLA 3CCEI 4DV0B 2DJIA 4WWCA 2MG4A 1U78A 1FLIA 2PQ8A 3RYFB 1R5GA 2M8GX 2X6OA 3FMQA 1FJGB 1TAEA 4LNUA 1WRJA 4ZYDA 3IP4B 1YLFA 2CSOA 2F5CA 2R7QA 1IRZA 2EZLA 3SYPA 2CQQA 2XHBA 4M6XA 3CO6C 2CFXA 4LNUB 2FBHA 3OL4A 3HOUJ 1FFXA 1TT0A 3ABUA 1LUVA 1QLNA 5J3LA 4XRMA 2VI6A 3RFRA 3FXRA 1E0EA 3RYCA 3NAUA 3N2GB 1RPOA 2K1EA 5JJEB 2R4GA 2OCHA 4E7ZA 5E1AC 1KQSU 1ZN2A 4RUFA 5LHHA 1RRJA 4EGZA 2OJED 1MMMA 2HEPA 4N23A 3Q3SA 3BABA 3FISA 1WVRA 4BJ6C 1FXVA 2HLDG 4UCVA 4LF4O 4HV6A 5ILSA 1O3SA 1GKFA 3TCUA 1U5TB 1ZTRA 4YJ2B 3ETEA 4B7KA 2HTSA 2ZJ2A 4EJOA 1K7DA 3SPGA 4XN3A 3D0SA 4XRSG 1E17A 3ELKA 2CGPA 5L3CA 3J7YJ 2G38A 1S0VA 2EILH 1H2SB 5JQGA 1M90W 2YXLA 1W7PA 2ZSHB 3S3NA 2KP6A 4UV8A 3ZQCA 2L9RA 3FKSG 3FXJA 1VEWA 3S3XA 1KONA 1WJFA 3A03A 5D8KB 5IYCJ 4P5OA 4MTGA 2CH0A 4DV3B 4JX4A 5TISZ 2A3SA 1KQ9A 3K08A 4ZZLA 4H37A 1G2HA 2VBYA 4XORA 4P55A 1YI2V 3O2PE 3CF5F 3SYTA 1SA0B 1K92A 3LSQA 3QRFF 1Y56A 1IUFA 2R5ZA 2X1DA 2V9PA 1B1BA 1DDNA 2ISYA 2WAQN 4YIFA 1PNKA 4UV9A 1HW1A 3K4KA 1B8IA 3J7ZI 1AOYA 3MAJA 5B1AC 3FX3A 2V1NA 4JP0A 4M9XA 3NARA 2AXTZ 2W0FC 2WPDG 2M2EA 2M7BA 4DJAA 4X64B 1ENHA 3D36A 3W2WA 1G4YB 3CC2V 2ME6A 3DC6A 1U2WA 1YJ9V 3K70D 4PA7A 3AL0C 3K58A 1JUMA 1TWGJ 4GYCB 2IA1A 4LK0F 1IUYA 3DFGA 2XF6A 2VQCA 1E2XA 2ETHA 4X20B 3DEEA 2DBBA 1XSDA 4PI2A 4AIJA 3JCUZ 1TT5B 2M30A 4LC1A 3CLQA 5JH7A 2HYGD 4A5NA 4A6EA 2XF7A 1X3UA 1Z0XA 4KXRA 1HLVA 3BY6A 5DCMB 4FLYA 4HF2A 4X65O 4OIRF 2WAEA 1OCZB 4L0YB 2OYQA 3K4LA 2ZDIC 2QSHX 3TO9A 2CH7A 4NB5A 3BRCA 3ZX6A 1X1PA 4AILC 2MABA 4DUYB 1I27A 2NOGA 1XREA 1OKRA 3E6CC 4ZYEA 2ZE8A 3WTSC 3UKMA 3BR5A 1LFPA 4GCVA 1KQ8A 3UT5A 3DTKA 4JOMA 2R5YA 3K5MA 3TK1A 1FYKA 4A3CJ 1NU1H 3WHCA 1CQTA 1QQIA 2OCCC 2YEVB 2YSUB 3ETGA 3ZHQA 4X89A 1XMQO 2VB6A 1DU6A 2Q9LA 2K4JA 3MMYB 5FB2A 4GT1A 2BXZA 4PELA 3ASOC 4HX8A 2A6HF 2FU4A 2M5WA 4F6RA 2M7AA 1NZ6A 2O3FA 3WG7C 1RM1B 4ZZDA 3OSFA 3DU6A 3EHBB 3WGHA 4RGUA 2UV1A 4DR7O 4HYEA 2OCCH 3R4KA 2GA2A 3PSFA 5DUIA 1NK3P 1G6UA 2Y75A 1Q86W 4LF5B 2HKXA 4Z6YA 1WZ2A 3K9SA 3BTIA 4AYBN 5HDGA 3D5SC 1F23A 1GMGA 4YXWG 3T0YA 2CTQA 1VF7A 1D5NA 2ZNYA 1W7PB 3IAM2 3ABLC 3A8TA 2NAZA 2XB0X 2ZXHA 2LOOA 5DTDA 1OJHA 1J7KA 4HSTA 3KG2A 2GXGA 4OINF 1XSXA 1BT8A 4I9WA 2P4WA 4DV6B 4NQWB 5HLGA 1BCCH 4G8XA 3E3VA 3HHGA 4JK1X 4C3IJ 1K5SA 1PP9H 3MHSC 1B6AA 3W3CA 1GH6A 1Z1DA 4EKWA 5LMNB 4BE0A 1BL8A 3SHFA 3QYFA 4MO7A 3HOZJ 1ENVA 1GM9A 1MGTA 1ZLZA 2E19A 1T6SA 5GTIC 1R23A 5ILVA 3JASB 5GADJ 5F0FA 2K9LA 3DXJF 2WLJA 4MFDA 4NXMB 1TW2A 5C3EJ 3H9QA 2AW9A 2ZMEA 3LSKA 1BE3H 3F8BA 3HJEA 3M1EA 4I55B 1T0FC 2IA2A 4XQFA 1HXDA 3JALB 2KDZA 3DKYA 2Q0OA 4HQEA 2WAFA 3ZN1A 3DGEA 3ZMSA 3H0GJ 2JJ7A 5CQEA 3PFIA 3LL7A 2M45A 3VSKA 2Z5UA 4BY7J 2OCEA 4FK5C 1NG7A 2JK3A 3O8HA 5F64A 4DYRA 1MD0A 1LVAA 1YW8A 2XGCA 4F3QA 4IHTA 2QWQB 2DQLA 3CUQB 1UG0A 1FWZA 3FXLA 4I99C 5CKTA 3RKXA 5C44J 1E3OC 3KEOA 3A0BC 3F8NA 3FBIB 1Z6RA 5H9CA 4BKXA 1XCVA 2Y4TA 3GFLA 4FX4A 1FOWA 1FXKC 1SQQH 2L4AA 3CUQA 5L3DA 1TGOA 3RWRD 1NK2P 3VQXA 1YIOA 2Z2SB 2FL4A 1WSUA 1W5TA 2MH9A 5FKKA 5FO5A 1F7YA 3ZHRA 1IXBA 2OTJV 4ZJZA 4GYIA 4ABMA 1YRNB 2DT5A 4G7HF 1O3QA 4L9NA 3SFIA 2BZTA 2HQNA 3K1MA 5F0CA 3V4GA 1BGYH 1D1BA 4LCUC 4QIWF 2CMPA 1U9NA 2XPUA 2HFEC 4OWRB 5BNGA 2H27A 1JI8A 4DYQA 2XROA 4G28B 1PD3A 2HQRA 1F4KA 1AI5A 3FYIB 2D5VA 5DM7F 2WLNA 1T95A 2RKHA 1MSDA 2A07F 2PEXA 1VQNI 2F4VB 4ZI7A 3AG1C 2PYJA 4ENJA 3AEIA 1QLEC 4RAFA 4PA4A 3WTWC 3RPUA 3L2RA 3ZP5A 2LKXA 1HOMA 1OYYA 4H44B 1LE8A 2LP0A 3CC7I 2WLKA 3EUAA 2EIJH 2PTMA 1U9OA 2IM9A 1J5YA 2ZCWA 1OR7C 3CMAI 1JT0A 2BOBC 1BJZA 2VONA 4X62B 2VQEB 4NNJA 5IYDO 1X58A 2IA0A 2RQQA 2ZFUA 3T1HB 4J9ZB 4LF5O 5F04A 1LQ1A 1WH7A 3VODA 2Y9YA 5J2TA 3T1BA 1TZLA 4GXOA 2E36A 4EGYA 1A5JA 2DQ0A 5GONB 5JVDA 4H0LB 3DPLC 3S2WA 5EGOB 3WTUC 3HKCA 3ZMUA 3CCMV 5KAFZ 4LF6B 3E7LA 1FMVA 2VJJA 3SZPA 3KLOA 2PUSA 5GTHZ 2RQPA 4GKKB 4L0ZB 4P2ZA 4F7ZA 1MABG 1ETXA 1HQCA 4IHJB 2H1KA 1JOYA 3DWLE 2EBOA 1T2KA 1IBKB 3VB2A 1SZTA 3K4CA 2JN6A 5L3FA 1HCRA 1FPOA 2LVSA 2IGKA 1WP8A 4YJ3B 2R5YB 3VFZA 4J00A 1FOKA 1N34B 1BJAA 1JKOC 2GUZA 3IRQA 4I0AA 1IRGA 1XX5A 1TLHB 1BC7C 1BR4A 2M1BA 2NVQJ 3KEQA 3SDBA 3SEQA 1O4XA 1K5QA 3LOCA 3A0RA 4O4JA 1DK1A 1GN6A 4I98B 2EFNA 2H8RA 1M4UA 2X6CA 3L9FA 2RNGA 1NR7A 4B3XA 1GXQA 3H5RA 4YIIA 4CDGA 1W0TA 4WXHA 5IYBJ 3L2VA 4HBNA 1F1ZA 3EPZA 4XLCA 2DXIA 3GFJA 2WA3A 3TW6A 3SJAC 4J42A 2CQKA 4I7HA 1HNXO 4KT6A 3JR9A 2DOAA 4QLCU 1GDTA 3L73H 3PFYA 5B3SB 2O8XA 1B4AA 3SJQC 4RLFA 1S8NA 5B5EC 4RQFA 3S14J 4JTAB 4CSWA 2PBIA 2HDCA 3RYHA 1MJ9A 1KQ0A 2JA5J 1Y67A 2KB1A 2DT7B 2X1CA 2QJ1A 4ZBMA 2VQLA 4MFEA 2Y31A 3TGNA 5J6XA 3MKWB 1Q3EA 2X6AA 2CU7A 2XB5A 3THOA 3B77A 3AG2C 1OISA 4KFCA 2HZDA 2XKPA 4PJNA 3RPUD 3P3NA 4KN7X 5GAEJ 4I5SA 3J7AY 4EM1A 1QNMA 1WWXA 4NC6A 4RAGA 1KZHA 3QNEA 1BHAA 1LNWA 5IT9K 5HFLA 1YW7A 3PSIA 2DWDC 5CA1A 5LP6B 1I5ZA 4DR2O 3E5XA 1FXKB 2K85A 2ATKC 1CXZB 3I54A 1R58A 1V55C 3OS1A 3HKDB 2XRLA 2OCCB 4LOCA 2ZKOA 1RESA 4KMFA 4XLFA 2A5WA 1HA8A 1VF6A 5CA1B 1MW7A 4FLUA 2X85A 5CA0B 1YIJV 2RN7A 3TBIA 3E86A 2ID6A 4Q5SF 1UJWB 1DGWY 1U0JA 3FK6A 1Y6XA 4BEHA 2CV1A 1VQ6V 2JDIG 3JASA 3LSTA 2ESHA 5E3NA 4BBSJ 2L7MP 5EC1C 4L9JA 4DRXA 1TNSA 2WWWA 3FD9A 2PX9A 2M34A 1R6KA 4AUXA 4X65B 2KKOA 1MBHA 2DOSA 3AG4C 5TISC 1W2BU 2OZUA 1NTMH 2RJZA 1E79G 2O5RA 3K03A 2W82A 2XVCA 4IL6Z 1K3EA 5GAHJ 3ZPLA 2ITDC 2XAHA 4F91B 5JH7B 1G3YA 3DBHB 2KL4A 5FLMJ 1PJRA 1KD1W 4XDLA 3I55I 5CBFA 2FXAA 4AVZA 2JPBA 3DKXA 2CWEA 4M72A 2Z16A 5JHFA 3V7SA 4U7BA 1I1GA 1K33A 4N21A 1HNWB 4K0KO 3NQOA 3AK1A 2CTWA 5B1AB 5EZHA 4JI6O 1F43A 4EEQA 2ZO4A 2KRFA 4XKWA 1Q82W 1MIJA 2DYSC 3G80A 3RYIA 4PD4F 1PV0A 3D8CA 2IRFG 1QZEA 2KIUA 4JAVA 2K4BA 3CJHA 1XB4A 4IXAA 1EM1A 5M3FJ 2A79B 1MJAA 4LMYA 5J40A 4B47A 3CCJI 2AZ2A 1JHHA 3S17J 4ZYGA 2BY2A 4OOIA 3BTJA 5HODA 3F3XA 2QSGX 2CTRA 2CGNA 2WY8Q 3C2HA 2L02A 2ZR2A 4G7OF 2EIMH 3QPHA 3SPIA 4BNCA 3K1NA 4DV2B 1VQLV 3HSFA 2ZIOA 2V1UA 1I08A 5LFAA 1VMGA 2D2WA 2L4MA 3E6BA 3JTGA 3K04A 4JZ2A 5H6RA 4DV3O 2YUAA 5BS6A 4X64O 2X9DA 1Z21A 4UCRA 1YQAA 2JTVA 1SMTA 4IYHA 2IGMA 2GBYA 3GTQJ 1AI7A 2OUMA 3CCUV 5EZGA 2XF5A 4XLAA 1T33A 2E3CA 4YY3O 5KHDA 3TOAA 2P6TA 4CZZA 3TP0A 2IGNA 3HRMA 2YXHA 3F72A 3O9OA 5H20A 4IVNA 3SGIA 4LP8A 3GZ5A 2DDBA 2L35A 1A32A 2F2EA 5LA6A 2XSDC 2JRIA 4Z2WA 1RETA 2P6SA 2ISZA 1JKQC 3H1JH 3F5TA 4U0VA 1HDJA 4P9UA 4B7EA 2NLJC 1Z77A 3UR3C 1IXMA 4LFUA 4F92B 4PFOA 4ENMA 5LYJA 3T1YB 1H2GA 2HVRA 1FTTA 1SQBH 1TBXA 2LFSA 3FZVA 1ZX3A 4HG2A 3CHXA 2Y69H 5CYVA 1YITV 5DD8A 3M7GA 2MW8A 4MIMA 4QPQA 3IC9A 2I10A 4B3TO 4GX0A 1QU7A 4A3EJ 3ABKH 5HFMA 1VQ7V 2AO9A 1G4DA 1DPUA 4QE7A 4FIPC 3RZDJ 2GUZB 3AG1H 2Z9OA 1UZCA 2LRDA 4XMYA 5FPOA 3L00A 2ZXWB 2WV1A 1BMFG 3BEHA 3HC7A 3CRCA 4GO1A 4X8AA 1FYMA 2DK8A 2WAQA 4E4EA 2EBIA 1ZGJA 3ZQGA 5E79C 4LR3A 4XICA 3K5NA 1JQ0A 2V7QG 1UG2A 3OYEA 3GZ6A 4PJLA 3SPCA 2ESNA 3CTAA 4DW6A 4DR4O 3CSXA 3LA7A 3OYHA 4PDMA 2KRHA 1JGGA 2E5ZA 1XL4A 4YJ2A 4RGXA 2CRGA 3CCUI 3FHZA 4FX0A 1QR9A 3RKQA 2DYSB 1SVMA 2V4DA 3AG4B 5CB4A 3EYIA 1Y76A 4Y4RA 2B1IA 2JZYA 3GEZA 4J01A 2GIZA 3O8GA 3V8KA 4A0XA 3VBBA 1Q81W 4MS2A 2KJBA 3MN2A 1AILA 4XDKA 1YS6A 4JASA 3CCQV 3VEPA 3E2EA 1S29A 2BY3A 1KU2A 4LD5A 5EJCA 3Q0UA 3AAFA 4BXFA 1B72A 3G73A 2GXBA 3H01A 4AU7A 2ZM6O 3F8MA 2M7WA 4DV6O 4XNFA 3ZQIA 5B3SH 3OS0A 3U2RA 4FVMA 1A36A 1Q1HA 3T1HO 3G4SV 4IRIA 2VQFO 3CCJV 4TT3G 3K5OA 3ZRWA 1YO5C 2AHQA 4RLQA 4XLEA 2NOJB 1SC5B 1ETKA 3OYMA 3JAKB 1BIAA 1W59A 3F5WC 4TUYA 1UB9A 2QQ8A 4WFHA 3J81Z 2HDDA 1SMYF 3AG2B 1M9NA 3JAKA 1DP7P 3AL0B 3GZNB 1MNDA 4U3JA 2BTOA 4A0ZA 4UUSB 2NVTJ 2XPVA 3U11A 3L72H 4BACA 2QM3A 5K5RA 4BIOA 4O2AA 5BR8B 2KG7A 1FD9A 2UUBO 3E6MA 1S5LZ 4A2UA 1P7JA 3B6CA 4ITVA 3WTVC 4WFAV 4IF4A 4G6TB 3K3WA 2L2OA 1FS0G 1BW5A 4CBCA 1I0HA 2OQRA 3HIFA 4M73A 1TVKB 2KJCA 2DA5A 3FXKA 2E5NA 4PSXA 1BOBA 4OIOF 1XN7A 4FQGA 4FM1A 2VRZA 1WJCA 2LNBA 3G6EI 2EILC 4OXSA 3F8CA 2OAZA 3NWTA 3TGUH 4CC6A 3GBGA 1ZG1A 4A5UB 4B3RO 1TW3A 2CG4A 3CCLI 4LIUA 2AHZA 4OPAA 1LDJA 5A9GA 2B9ZA 2DK5A 4B1RA 5F27A 3VYUB 3WU1B 2EIJC 2FBIA 1YHQV 1Q7YW 5JJJB 3K4JA 4ZC3A 3WG7H 3GX4X 1LKXA 1EF4A 3PN1A 2ID3A 5GTHC 1ZWIC 3ASNC 3GWKC 4G27B 5EYPB 2OWOA 3W7SA 3LNQA 1YCIA 2B0LA 4EEFG 4FMTA 3IGAC 2DMTA 4Q48A 4JQFA 3ZXSA 1K78B 3OTOO 1A6IA 1SFXA 1QVFU 3CYOA 2HPIA 3HTSB 1IF1A 3QPTA 4DR2B 4ZYAA 2COBA 1A35A 4BUPA 2DPDA 1I6XA 2E7WA 2MA3A 5FKOA 4ZH4F 3K70C 2HHHO 2V4JC 3M07A 1MNMC 4S05A 1S7AA 5GONA 4BE1A 4L5JA 1RSOB 4U0WA 4DOZA 2ADUA 1HKTA 3S1RJ 1OCOB 3KFWX 2JGDA 3HKBB 1D0XA 2IPQX 4UUJC 4KIBA 4X20A 4N4OB 5E8IA 1B3QA 3H1IH 1TQPA 1ZARA 4CCNA 1OYIA 1SQVH 1Y1VJ 3BZ6A 1SZXA 2UU9B 4FJCC 5KHGA 2KIFA 2MW2B 1SC7A 1HNXB 1UJ8A 3LA3A 1PP8F 3ZRWB 3O6BB 2H6BA 2JUCA 1N32B 4TSFG 3UM7A 1PM9A 1VQ5I 3GMEA 2DMXA 4J11A 4YIRX 2WA0A 3H36A 2AZ0A 1MBEA 2WSSG 3M7MX 2JA6J 3ZCCA 3DEUA 2A9HA 1U96A 3JARB 2FQ4A 2NYXA 1MZEA 3FXQA 2TRTA 1ZTEA 3P3PA 1G3TA 5JR3A 3JRIA 2MH2A 4PK4A 1NTZH 4XN0A 4AIHA 2UXDO 2Y0SA 4LLNA 1ETWA 1O7LA 3R0AA 3CQZJ 4HEA2 1D5AA 4TV8B 4FFKA 4MGRA 2HVKC 1Y66A 1LB2A 2F4IA 4OIQF 4G6QA 4RBOA 1XUQA 4P1WA 4EJTA 1BL0A 4B3AA 1SEUA 1SRYA 3GB7C 1W0UA 4TV8A 4ASNA 2DQRA 4V19K 2NXNB 2PG4A 5HS7A 4A0YA 3OM3B 4DR1O 4GX2A 4U7OA 2QTSA 5M5XJ 4I76A 3KP6A 1S9HA 4WK8F 1AP6A 1IZ1A 3FMRA 4WFBV 2E75B 2F4OB 2K3FA 4HNVA 2Y0IA 2PI5A 1K4DC 1Y74B 3GW2A 1XNQO 4OIPF 1Z2GA 1LUWA 1U8RA 3AG3B 1OJLA 2KQRA 1EA3A 3GWZA 3KE2A 3OYIA 3CC7V 4FLVA 3KYCB 3H5NA 4HQMA 4B48A 4Y15A 3ZR8X 2FNPA 3EFFK 3F22A 2EZIA 3B8NA 5CMUA 4TOIA 2UXXA 5E17F 3B02A 3CRRA 1J95A 1EH8A 2K02A 4GFBA 1VQNV 3GTLJ 4ENKA 2HZTA 3K4MA 4IHYA 3MQ0A 1KP2A 4F93B 1O9HA 4A3FJ 2IS2A 4TUYB 3BR3A 3ASNB 1BQ0A 3NR7A 1JHFA 5IYDJ 2EINC 1GN3A 2R9AA 2WLHA 3L7WA 4L9TA 2N05A 1GVDA 3MZHA 4X1EA 2EINB 4PJ0C 1WJAA 4RB2C 4NC7A 1Q43A 2IBDA 3D1NI 3WGIA 1Z67A 2GBOA 4AQYB 5IP9J 2GV9A 1BQZA 1ETVA 3B73A 5AONA 2NNUA 2HYJA 4GGGA 5DEQA 2ZM6B 3BZCA 4HNAA 1PL4A 1EBOA 2XOKG 3E6DA 3ETQA 5EGOA 1JKRC 5KAIZ 2E1MB 3T8RA 2STWA 2DYRB 5A2QN 1PVEA 4IQ4A 1DTOA 1V9PA 2OV7A 4D0PA 1TVKA 2QZ8A 3I59A 1FC3A 3OYGA 1QHGA 4HLXA 5KNLA 1U5TA 1JE8A 4B43A 1ACIA 3PUBA 3TDZC 3BA8A 3G1MA 4ETSA 4DK1A 1OCCH 2ZMEC 1Y6IA 5KX5A 4AM3A 2B7EA 1PL0A 5KA6A 2LBFA 2UXNA 1FOXA 1NBMG 4OU0A 1IN5A 2Y2ZA 2QWNB 2K5CA 1M56C 2A0LA 3LNNA 1QHHD 2GOXB 1N75A 3DCFA 3WHBA 4TWKA 2MK3A 1VQPI 1KP3A 1LFBA 2XKOA 4Y13A 5B1AH 1KC8W 3CF2A 3E5QA 1R71A 4KL1A 4HBLA 1ULYA 2HNHA 4G2KA 4F55A 4DYLA 2QM8A 3JTHA 2YS8A 1PP7U 2FQ3A 2E76B 3IWFA 2NVYJ 3CUQC 3ABLH 3A4CA 3LFKA 3H3VK 1IDSA 3L9DA 4PV1B 3E97A 5B3SC 1Z5WA 1X4TA 3HDDA 2A61A 2YUSA 2FUG2 1ODDA 2O7OA 4XK4A 2M9HA 2H3OA 3EXAA 2PI0A 3SJCC 4XOTA 4RB3C 2HFHA 4IHVA 2H1LA 1MDMB 2A3QA 4AHCA 1ORKA 2JUGA 4B09A 3I3LA 1PKXA 3L1PA 1ZYRF 3OIOA 4EV0A 2NVXJ 2RMKB 3SYCA 4BIZA 1TUBA 2L6LA 5DN6G 2DJNA 2Q8KA 2Q7HA 2GWRA 3FM3A 5LA6B 2LSOA 1I5YA 2QM4A 1T08B 5E79Z 1LUJB 3M8EA 2Z3YA 1G6NA 4RM3A 1VF5B 1R5ID 2JK5C 1HP8A 3N27A 1Q1VA 3H9GA 2PLYA 4EMSA 2WLLA 5JVGF 2P90A 2JA8J 1PPJH 3GXOA 1QVTA 4N4NB 3VSLA 4S0HB 1REPC 1K4CC 3AG3C 4J10A 2H94A 3JD1A 4DV4O 4GX5A 2XNDG 1Q6IA 4MSWC 2EK5A 3RYPA 4AYBA 4DXWA 3DPTA 4PUSA 1YSCA 4LF4B 5EG0A 1OCOH 3JAMZ 1ZLKA 2CAZC 3LA2A 3JRFA 2LFRA 1AR1B 4V2FA 1IC8A 4F52A 4UB6Z 2DE0X 2CYYA 2G0EA 3FWEA 3VPRA 3GLLA 3WE2A 2YIAA 3M9AA 3RI4A 4BYYA 5IT3A 1FTZA 2OT5A 2VC0A 2R7WA 2KG7B 2P06A 1ZG3A 2AQFA 1KKCA 1D5YA 3SQNA 3ECOA 3BZKA 3F21A 3N97A 2NVUB 5C4XJ 1L8DA 1MKMA 3L75H 5LRSA 4RA2A 1AJPA 3OYKA 2C2AA 3D36C 1VQPV 4I50B 4JI3O 4HLYA 2CS3A 1NH3A 4A3LJ 1FJGO 5KHHA 2QF7A 3K69A 5K1YA 2KKWA 4CCJA 1I94B 4DIQA 5HOOA 1FJLA 4UUVA 3ABMC 2QQBA 2Y0PA 4XBFA 3ZS8C 3OMIB 4LFCB 3BJOA 1KMIZ 1YRNA 3CCQI 4LH7A 1N32O 2D45A 2UXDB 3K57A 3IKVA 1YXBA 4WF9V 4QTRA 1N25A 4JI5O 2F5FA 1LPQA 1DPRA 4DBRA 1Y74A 3BAAA 2DT6A 3A1YA 3HKDA 1YW9A 4I2OA 2OA4A 3WTXC 2R7TA 3FB6C 3HKZN 2GA1A 4DUZO 4DV7B 1RR8C 2FJ1A 1W0KG 3HM5A 4NXMO 2VQGA 4R6ZA 3K10A 1MZBA 3V42A 1L1FA 1J5EB 1Y4MA 5FKLA 4KITB 3OYAA 4C2MJ 1QHTA 1M56B 1QQCA 1SKVA 2VN2A 3ZMTA 1S5JA 1WPBA 3B6AA 1VP7A 1HC8A 2GZWA 3JATA 1ZUQA 3WU2Z 4NTXA 1VQ8V 4G6DA 2XGDA 4LF8O 2HQAA 1VF6C 2ZIMA 1G1XB 2D1VA 2CUJA 1RFYA 1VQ7I 1T38A 1MNGA 1IRXA 2K9SA 2MC3A 3EETA 2F93B 2RQ6A 3MFKA 4O2AB 3K0GA 3DPUA 3U0ZA 5HNFA 3JRHA 2HOAA 1YITI 3ZCOA 3GFMA 3B8MA 2QSFX 3SYQA 4RDUA 3IKTA 4QGPA 5EEAA 4D1QA 3WFVA 1B06A 1KBHA 3ZRGA 3OEEG 3SJBC 2L7FP 4LF9B 4LLGF 2HP8A 3HB3B 3OR7C 5C8YB 3I9V2 3EDPA 1EH6A 5ICGA 4L8JA 5CQGA 2C6YA 4IYIA 3GVMA 1GLNA 1GN4A 1AI4A 2E2JJ 1MSWD 4UVAA 4CCMA 1QU3A 2JEXA 3HGGA 4BQOA 5FLXZ 1R49A 3KP2A 2IJKA 2ZE7A 1BI2A 4J7JA 2IXSA 1QRYA 2DOFA 2VT3A 1R3KC 1ONVA 3OYDA 4I6ZA 2X4HA 1HNZB 3ZQ7A 1I39A 1Z91A 4FFBA 1HSTA 2RDPA 4N9HA 1NVPD 2LY9A 5GPCA 2EZPA 1PUFB 2EFQA 4F6RB 4DV1B 4NYKA 3BR0A 2Q67A 2VBXA 2Q73A 1YZBA 5GW7A 1VQLI 4GUNA 5ICFA 1FIPA 3LQRA 3BHPA 3OUFA 4I0XB 1Y0NA 3HZJA 2R7ZJ 1G59A 1XEQA 1JVMA 1D2DA 4OX9B 2K3PA 4A3KJ 2Q0OC 1FIAA 2HJDA 3QYEA 4B44A 1N36B 5LBQA 1T0FA 5FD5A 2M3AA 5CBHA 1RC9A 2PY5A 3HKCB 2DTZA 2Y69B 4P9FA 4AD9A 3GTOJ 2A06H 1DQUA 2GTSA 4YIPA 2DFHA 5J1RA 4YRVA 3TMOA 1XS9A 2YU9J 4X66B 2L9VA 4IEJA 3OY9A 4K2EA 2G7HA 3QWLA 4D7SA 4E6KG 2UU9O 2YR2A 3TDUC 3CRMA 3QG5A 3RW0A 1T56A 2PN6A 3GF2A 2Q2EA 3HKZA 2NS8A 3ZMZA 1CF7B 5LXTA 1IW7F 2UUAO 2EH3A 5LD2C 3E0JB 5FFXA 1FYLA 3O65A 4WBNB 4DUZB 1D0YA 2I8DA 2VKVA 5J1UA 3I4MJ 5IJ0A 2BE3A 2BY0A 3C90A 1TWFJ 2KZVA 2DO7A 4UUTA 3EUHC 3QF7A 4PCQA 1THZA 3BFRA 2F6CA 4ESJA 4ICGA 1O7FA 1EV7A 1P4XA 1UHSA 3VWBA 2QE7G 3CESA 1QA6A 1BW6A 4R8CA 5JFRA 2LREA 1VQ6I 3GTPJ 1GHCA 2XSJC 2E2HJ 1MMSA 3N4MA 4RAYA 5FPRA 2VWJA 3A01B 4NXNO 2L54A 2VWKA 2LW7A 2BEOA 4I4TB 4MVQA 5KHJA 1USTA 1NS1A 3RSNA 1N78A 4GLXA 1P7BA 2M0CA 1Y76B 1YE9A 3TW7A 2N04A 2XUBA 1R73A 2MD5A 3BC8A 1X4OA 3K4BA 3CCLV 3CCYA 3A0HC 3RZOJ 1TP4A 1UELB 4WX9A 4LF9O 5IY5H 4RAZA 1QVUA 1B9MA 1K4SA 3QO5A 4IT5A 2W84A 2VUMJ 2Q8VA 3BROA 1NTCA 1GVJA 2DOEA 4BHCA 2PJRA 3CZ6A 3CJHB 2P5KA 4AI8A 2VQEO 1BHBA 2L5QA 3OMYA 4GKJO 4DBQA 1EZVH 5C4JJ 3T4ZA 1SFOJ 2PGGA 1PUFA 2Y48A 1FSHA 2B9SA 4ON0A 3N05A 4UCUA 4LG0B 3EQLF 2KISA 3JD2A 4ESFA 1I1SA 1OPCA 3KEYA 4IIJA 5IT9N 1R4MB 3KYLA 4Y52J 1JXSA 5FRNA 3L71H 4MTEA 1DU0A 3ZEDA 3ZHTA 5EC2C 1W36D 1D1CA 1Y0UA 2ZNZA 1H0MA 1JJ8C 3PQKA 3FFQA 2W25A 1OLTA 4DRXB 1ZREA 2CUGA 4PGHA 5B1NA 2F95B 4XLPF 1IXRC 1YYVA 1RSOA 4BW9A 1SF9A 5DM6F 3CX5F 2FMLA 4RGSA 3HGYA 1T39A 2ZJPF 2DW4A 1COWG 1I50J 3OYJA 3LNMB 1QZYA 4MQ9F 1ZK8A 4FHTA 2QWRB 3KPHA 3G4SI 1IZ3A 1B59A 5ICCA 1GT0C 4RO2A 4YG2F 1TA8A 4WF2A 9ANTA 3I4NJ 3TXSA 3SR2C 2F5EA 4KIGA 3AG4H 4M3FA 1ZRFA 1GO3F 4K0KB 3MD2A 2ETNA 2QQ9A 3CUOA 3ZN0A 4IZZA 3F23A 2IH3C 2RGVA 4XR6A 5KHKA 5LRRA 3BG7A 1I3AA 5B1BH 2ZXWC 4B4CA 5JQGB 5FLXN 2KIQA 1L0NH 5J8CA 2Z0AA 3HKEA 3JYCA 5H5NA 4KICA 3BG6A 3CCSI 1XG1A 1OCPA 1RUNA 2RNBA 4MTDA 2Q0AA 2H6CA 3WE3A 3BDDA 3K9AA 4GZRB 4MVZA 4JI3B 4JI7B 1UHMA 2DA2A 5F6FA 3S1QJ 3OSGA 1TL8A 4X1YA 5LLQA 1JGSA 2DA4A 4XSZF 5EF6A 5BZBA 2E2IJ 3WG9A 5FLVA 3BJAA 2ADPA 2VOPA 2JWTA 2N74A 2IJJA 4LFCO 1IBLB 3U10A 3SJMA 1K73W 2E1NA 3GWOA 5CN0A 3RVYA 5J2UB 4OPHA 2BTQB 3FX7A 1B9NA 4LK1F 2JA2A 4ZHQB 1SERA 1MJBA 2UXBO 1DGRM 2HI3A 5HLTA 2Y30A 1K61A 4NQWA 4BAYA 3Q4HA 3IWZA 3VOUA 4X9QA 4DR4B 1SQPH 4X1IB 2X6WA 1L0OC 1KUQA 4PDLA 3RDIA 5ERIA 3D5LA 2AHYA 4NBQA 1XNQB 5LHGA 1YVWA 4I0XA 1MMDA 1FYJA 2Z99A 3FXUA 1VQ8I 1SQFA 3V7RA 1XMKA 4DO2A 4DW1A 4YFKF 5D6FA 4HYOA 2OF7A 2R7FA 5CVIA 3S1NJ 4DW0A 2FEZA 3PNVA 1WI9A 3JREA 5IYZA 4Y3OA 3UQ8A 2A5YB 3KP7A 1RPRA 2GHYA 5J47A 3PNYA 2HTJA 4O4IA 3P9IA 3H0DA 1YTFD 3L09A 2CQNA 4LB5A 2R3SA 3T1YO 2XAQA 4YJ3A 4F4LA 2GIVA 4DZPA 1P7IA 4RAIA 1KECA 2FSWA 3OS2A 2FX0A 2P4VA 1X3WB 1FBQA 5EG0B 3WU0A 2CV0A 1IN8A 3OOUA 4DQ2A 1IV6A 2HQ5A 4XKCA 3COAC 3BJ6A 2VKDA 2ZMEB 3QPSA 4XRFA 2LD5A 3QTCA 1HNWO 1RM1C 2XV4S 3JALA 3STZC 5J9PC 2D1HA 2YEVA 3HOWJ 2E5LO 3LSUA 4OAYA 3ICXA 3K9TA 2UXCB 4JYKA 5IOYA 1Y1WJ 1PDNC 2M87A 2HEOA 1AVMA 1BBYA 2E74B 1Z7UA 2EB7A 3KCCA 2DYRC 3KZIC 3S8PA 3SYOA 1OCZH 4DV4B 4XSXF 4JI8B 4UB8Z 3JRBA 2IVMA 3IUOA 4KJZA 3OYNA 1K6OA 3ERED 2X1EA 3CP2A 5ED4A 2RCVA 5GTIZ 4FZ1A 2M4GA 1QR8A 3ZMDA 1LDDA 2ME0A 2VLAA 1SQGA 2WLIA 3JAWB 3A2FA 5JCOA 5JCOC 2HU9A 2MD0A 4RUEA 1AR5A 3Q9SA 1CPYA 1LEAA 3K2AA 3RT3C 2WWYA 4ABZA 3NEUA 4K35A 5HS8A 4IHSA 3HUGB 2H09A 3BR2A 3MDSA 2DN0A 5FKMA 5F1RA 2E7XA 4JI5B 5DYMA 1Q8IA 3OMAB 3CJNA 4O4LB 4BQQA 1YX5A 5JLWA 1LFUP 5J1YA 1H2LA 3CPWU 4A12A 5IT9Z 1CEZA 4KDPA 1XMXA 3M8FA 4KT5C 2W6IG 2F4MB 3A0BZ 2JRMA 4MTFA 5D6EA 2DDAA 4N0BA 2GSMB 2QUFA 2UUCO 5K7HA 5IOZA 3V8LA 2RC4A 3P5JA 2LP7A 4C7UA 4D7NA 4TQFA 4L9VA 4C3HJ 5IYBO 2BW3A 4EQQA 2WADA 1NI8A 1TUEB 4PHZA 3WB2A 4DV7O 2OTLV 1VIBA 3C1DA 1MSEC 3IJ4A 3GTKJ 2O03A 5KVRA 4HNAB 5DV5A 2VBWA 1E3PA 1MMNA 3ML6A 1YFHA 2LMDA 1V55H 4E7JA 5J2TB 2ZKZA 1N0JA 2QQAA 2CTPA 1JUSA 3LSRA 4MVOA 5LMUB 3ZHSA 5IP6A 4B3MB 1LVKA 1H9TA 1V55B 3KP5A 2QYOA 4W4KA 1UCRA 3G3ZA 3ZRSA 3IH4A 5KA5A 1W0JG 2ECCA 5DD4A 1BC8C 4AQYO 1NJIW 3SDLA 4BHPA 3JARA 2IAIA 4BU2A 4ZDLA 1XNRB 2F4VO 1BA5A 3W6JB 1Q6UA 2ZXJA 2WAMA 2L9SA 1M1EB 1N36O 1MSFC 4C2TA 1MBJA 1MMAA 1YJ9I 5KK1A 5LEKA 3RCOA 1R1UA 5K5OA 4YEJA 4BY1J 4IQJA 1IRFA 1WKMA 4JI1O 1H38A 4EJWA 5KAFC 5BMZA 2HWVA 2VS0A 3OUSA 4P30A 3FK7A 5HVQC 1BS3A 4A93J 3WGGA 1FP1D 1KB9F 3FB8C 1FT9A 2QCOA 4M3DA 1FZPB 4MNUA 4H0EA 3CO7C 1C0WA 1OR7A 4E7SA 3G71I 4R1HA 4QWQA 1K79A 2QWWA 3X2QH 1XPXA 3HB9A 2GM4A 3ABTA 1KU3A 5BY1A 3HG9A 1I94O 4IJAA 1HW2A 1M5IA 3D5RC 1SD7A 1Z7LA 2RV8A 3K1PA 1ZKGA 2LR8A 2CW0F 2W1OA 3TO7A 2ZE6A 5CBGA 1V5GA 2E1MC 1SETA 4O4IB 1EJ9A 3KETA 3LSGA 3HEFA 3KZYA 1SA0A 4MVMA 3PIPF 4MT8A 5M3MJ 4CH7A 4IOAF 5FNVB 3RN4A 4DV5O 2IP2A 4I55A 1XQ8A 1GM7A 3H92A 2RN9A 1W5SA 1JT6A 1X1AA 4JI7O 1D5VA 1F36A 2F5VA 4O5VA 3DBRB 1HF0A 4IHXA 4PDKA 1HSJA 1ETYA 4PFPA 2QVOA 4C30A 2X51A 3OYBA 1F5TA 3A0HZ 2YU3A 3DSQA 3DTUB 1HR0O 1TC3C 2QKLB 4UNOA 2A6TA 4GYGA 3CMAV 1OCRC 1IDZA 3H1LH 3RYFA 1NG6A 4BL0B 3F7YC 1F9NA 1R4NB 3F9KA 4Y7NJ 4BS9A 2UUCB 2PZSA 4KFMA 4LF7O 3A2KA 5B66Z 4Y17A 4E7HA 4WFEA 3ISPA 2X6BA 4EFBA 3D3IA 3REOA 4KA4A 5CVVA 3CJTB 3KKYA 2YPRA 4FCYA 2WB1A 1VQKV 4JYYA 1J09A 4NHJA 3ZQQA 2WLIB 2KLOA 3GLXA 2ZJRF 1FMWA 1MMGA 1R36A 1ERDA 1AROP 2IJIA 5GPAA 3VQWA 2A69F 2R7OA 1DF5A 2AXTC 2PMHA 4FM0A 4JI2B 4JBAA 5E20A 3C2BA 2BGCA 2WY7Q 1P2FA 4LG3A 1SFEA 4BJTA 3DV8A 3WTZA 5BXZA 3BCBA 3G67A 4UY8I 3OTOB 3QQAA 4PJJA 1V5FA 1L3LA 2FTKA 4ZIBA 1D8KA 1BR1A 1XGNA 3KZZA 3OIPA 3VYSB 2FD5A 3J81K 3HOXJ 4JYAB 1ZELA 3AG7A 3JCUC 4M6YA 5DM6V 3IRRA 3C3TA 3UO2A 2HVQA 5B1BC 3BPZA 4DR6B 2JVGA 2HG5C 2R5ZB 3QYBA 4IL6C 3R65A 5FJ8J 5LP6A 2XTAA 1HNZO 2IEKA 2PMUA 3W7UA 1X19A 4LFBO 1YDXA 2YDEA 3CB2A 4BBRJ 4PA3A 1VQ5V 4H4KC 3LDDA 1IAWA 5EK0A 1N33O 2EIKB 1DF4A 3MVPA 4TQDA 3QP5A 3TJTA 2VJIA 3JRAA 1URFA 4MW3A 1NH2B 4M71A 2GLOA 4EB6B 2DU9A 1RIOH 3HPHA 4RMNA 2IH1C 2WBMA 3U1KA 1KYOF 1KU9A 1S7EA 2P4KA 3NWSA 3ABMH 1NR1A 4DNCA 3ULQB 4DYCA 3LSPA 3UKGA 2A7WA 2YIBA 1FP2A 5IJ9B 5FROA 1R6TA 3L70H 2XASA 4CCOA 3ZRVA 2YX7A 2DPUA 2BSKA 2EZOA 1N77A 2V1XA 4J7KA 2QGUA 4DR5B 2JVDA 3RYCB 3HKBA 4GX1A 3IC7A 5EZYA 2ELHA 2W7NA 1D8JA 1PYVA 3F8FA 4CO8A 3ETDA 1BZKA 3H3ZA 2DMUA 5CJ9A 1WQ2A 3MKZA 1WCMJ 1XOUA 3UNGC 1BIBA 2M0MA 3QU3A 2KT0A 2WLLB 4QIWN 1MBFA 2EV0A 3GVAA 3O3KA 2R72A 1HBXG 3OL3A 4O2BA 1S3JA 5LGTA 2LBFB 3K5LA 1V3FA 3QPLA 3WTTC 4FLWA 1AWCA 2E35A 4O6JA 1ZR4A 1JFFB 4Q20A 5K1XA 2E71A 2VXDA 2IW5A 3JAMK 3JRCA 3GYHX 1YHQI 5D5PA 3LQQA 1N0NA 3FHNA 3TKYA 4JX6A 3Q5FA 2BCCH 3CJRB 2QM7A 3FKIJ 2JSCA 2KSDA 2KMUA 2JS5A 3G6EV 4E4HA 4WXDA 1QGPA 1WA8A 5EIBC 1OCTC 2DA7A 2MBFA 3OD4A 4JGSA 1ZL8A 4DR3O 3T2MA 4G9YA 1TQMA 3J80Z 2LTPA 2YXYA 4DGWB 4JF3A 1OCZC 3I0TA 1IGNA 1X1BA 2P5OA 4QPJA 5IP7J 1G3SA 5CVRA 2PI4A 3AK3A 1K4TA 1XD7A 2EULA 2LGWA 3AG2H 2Z33A 4UVCA 3KYDB 4IX7A 2F1MA 3PL8A 4A6DA 4X1KA 3GTJJ 5JWPA 3L2WA 3M1CA 1GRJA 3W6KB 5F0HA 1QO0D 3HSRA 1OV9A 4H33A 2WTEA 3ZJZA 4TV7A 1X2NA 2YI8A 3E89A 3FYEB 2DMNA 2FBKA 4NVPA 2K86A 1X1CA 2B1GA 1Y8RB 2PMZA 3S32A 2JJ1G 2K9PA 2IJLA 4Q6GA 3JD3A 3J7AU 1KA8A 3U9GA 5BR8O 1SS3A 3C2GA 1K6YA 4KHPB 2V79A 1AA7A 3BQZA 2X6YA 1YTYA 2VJ5A 3I58A 2HDWA 2AS5F 2JQ7A 4WBNA 1Q90D 1UHWA 1U3EM 2BVMA 2ZJQF 4A5MA 2B63J 4K8XA 3CC2I 1XHXA 1IV8A 3DEWA 3ZGKA 1WLEA 5KMGB 1TWAJ 5TGTA 2P6JA 5EIBD 3OYCA 2BSKB 3HXLA 3A02A 2K40A 1Z5VA 2KHMA 3C18A 4HX4A 5LHIA 2P7CB 2R9RB 3CWBH 3DP7A 2IU0A 3DTEA 3TL4X 4X62O 3DF8A 4ESBA 3IL2A 1P7GA 2XRNA 3GUDA 1IJWC 3DXRA 1RP3B 4A3JJ 3JSNA 4BIUA 1YI2I 1VQ9I 4D9JA 2HOTA 1EN6A 1S7OA 3KP3A 3MCZA 3JD4A 2QWOB 3UO3A 2PFBA 2M8EA 2UUZA 3BTLA 3PQJA 1PUEE 5FRMA 3TP3A 2QR4A 2CW8A 2JVHA 1K83J 3HRSA 3IHUA 4EJVA 3HYIA 2M6YA 2HS5A 3CMEI 4J7ZA 1UAAA 2FF4A 4HF0A 2CUFA 1LEBA 3CDHA 2W0XA 4QPKA 4RM2A 2EFWA 4NTYA 4P9OA 1XL6A 5IWAO 5CPRB 2A68F 4R8HA 1AR4A 1AJQA 2IS6A 4CS2A 2CO5A 4DR1B 3UCSC 1BI1A 1U5TC 4CICA 2I5UA 4A69C 3S2DJ 2LFBA 1WA8B 3PUFA 4BJ5C 5LGUA 3I4PA 2CDYA 4L5IA 3V8JA 4NKGB 4LH6A 3FF5A 3RBZA 1LE8B 3OR2C 1BI3A 1IVSA 4D7TA 1A6QA 4JYCA 1S5LC 1GM8A 5FGMA 4RB0A 4M3GA 4MQVA 2BTQA 1APLC 2BBYA 4HA8A 3HOVJ 4BHBA 3RVZA 3G1LA 4ZI7B 3P32A 1VNDA 2VE9A 4E2LA 4PA9A 1GN2A 3SYAA 4H13B 4DR3B 3BA9A 3S93A 3K59A 3APQA 4X1KB 3ERMA 3CE2A 3SZTA 3QODA 4U7NA 4LJZF 3CCVV 3HPGA 4LIVA 4A3GJ 3HBLA 2EFOA 4G7ZF 1PNLA 2QSAA 5IDJA 2M4KA 4ZDOA 3EUKL 3CCEV 2X0LA 3MKLA 3VQYA 2Q6AA 2JPCA 2QKMB 2YX4A 5IJ9A 3QU6A 3ECHA 2CUEA 3RQ4A 5B5EZ 5BMVB 5D4SA 3DTIA 2F5DA 3P9CA 3PJRA 2R7SA 3E8GA 1E1QG 2YIDA 3OE7G 2LH9A 1PNMA 2BOCC 2EIMC 3JSPA 4DR6O 4Q4ZF 5E8GA 2L9NA 3U1DA 1RPWA 1OCCB 5LGNA 1AKHA 2EIJB 3FXOA 2LKSA 4DZJA 2VOOA 3QO7A 4C9YA 2Y0SN 3Q0WA 3JD0A 3C3WA 5IJ0B 4J41A 5IY5C 2FOKA 4JI4O 2VJ4A 1LR1A 1AU7A 4CXFA 1SQXH 4DR5O 1FSEA 2LYCA 1ON1A 2EZKA 1UMQA 3ASOB 3F6VA 1SD6A 2IS4A 2FKXA 3C3SA 1JFFA 3CC4V 4KYWA 3W7XA 3E1SA 2P7TC 1XGSA 1SAUA 1QCEA 1FEXA 3OR6C 4JI1B 4FASD 1Z05A 3RYHB 3E22B 3K2ZA 2CQ7A 2Y4UA 2ZSIB 1L0LH 1VARA 1XSVA 2RVCA 4JYAO 3DU5A 2P5VA 2OD5A 3I55V 2ELKA 2NS7A 2DWEC 2KPMA 5CLSA 2VBZA 4CCLA 2ZDIA 3ZOBA 4B3SO 5H6QA 1OHHG 3ZHVA 3OOPA 1BN5A 3QP6A 2QBYB 2QGNA 2JJ2G 1IBKO 2K9MA 1N33B 5B66C 1OYWA 1IO2A 5A2QK 4FLXA 1WPKA 4ZDPA 4BXUA 1WB8A 1H8EG 2H8PC 2ECBA 2FRHA 1XDCA 1I3QJ 1Z6TA 2DMQA 2HR3A 4IGGA 4F6EA 1EH7A 2PJPA 4J9YB 4ZTJA 2FOWA 1JPXA 4JZGA 3OW2U 1D0ZA 1W7PD 1K34A 4ZOLA 4WCEV 2FMYA 4U3FH 1AI6A 4PI0A 2DLLA 3BG3A 3PM1A 4BH9A 1S76D 4BEHB 4QE9A 2P81A 4UVBA 4AIDA 2EZHA 3AFHA 4MEXF 1YIJI 5D5VB 1KU7A 4MTXA 3SEZA 2YSRA 3E5UA 4EB6A 2ZFWA 4J80A 2HXOA 3LFUA 2TDXA 4E7LA 3KCYA 2QEXV 1X3ZB 2X7RB 4MVSA 4FM2A 1HR0B 2BW3B 1MH4A 3E22A 4GKKO 3K0DA 3N2KA 2VPRA 2LF8A 2W48A 4WFFA 4CC5A 4K8ZA 4JV5B 5DUKA 3G1OA 2JGUA 3I59B 3CMYA 4LF7B 2K9NA 1QZZA 5F08A 4BQNA 1D3YA 1M57B 1JJ2U 2P22C 4NUBA 4NDLA 1VQ9V 2AGAA 5DDGA 4Z1MG 4UUSA 4OMZA 5LOVA 3BLYA 3K79A 1FOYA 4HZFA 3A01A 3OIQA 2F43G 2W85A 5AIQA 2OPTA 5K7FA 1YEWA 1HKSA 5DCMA 2V1DA 4L18B 2EIMB 5GAGJ 3OTFA 1MNEA 1RKWA 1X4PA 3BPXA 4MVRA 5LYJB 2OC6A 2OIEA 2OU2A 1JJ6C 1T98A 4BR6A 4CUGA 1QPIA 2LW1A 1MH3A 4TV9B 3WB0A 4R79A 4BGDA 3BTCA 2Z1DA 2O9LA 1Y39A 1E1RG 4O4JB 1QBZA 4PJ0Z 2KZGA 2BY1A 1SAXA 2KIMA 3ZQLA 3SZGA 5E1XA 4QJFB 1XILA 3KCXA 4Z2YA 3LWFA 3QO8A 2X48A 1G8XA 5KAIC 2DN9A 1DLBA 2CJJA 3K0LA 1YJNI 1RR7A 3LAPA 2Q69A 2QKAA 3IFXA 1BSMA 5HDNA 4XKVA 5E3OA 4MVUA 1IG7A 1S72I 2YI9A 2ZC2A 4CH3A 1R6RA 3ESWB 4HX7A 4JX5A 4PZJA 1H89C 4FZ0A 2O8KA 3W7WA 4IPAA 5J2UA 2Q1ZB 3LAJA 1MA1A 1IN4A 5M5WJ 1YF2A 3MAQA 1SVLA 1V5EA 1K78A 3E8HA 4UFZA 4ASUG 1IN7A 1P9QC 2L3DA 4XM3A 4XIDA 1WNSA 3MD0A 1ZR2A 2QTOA 3CCMI 2Q7EA 3SPJA 2X6XA 4II2A 1WJBA 5DCFA 4I0BA 3W7TA 5CVUA 4LFBB 1CP9A 2V9VA 1B72B 2LO1A 4CYCA 3OV8A 2KFDA 2EIKH 3HOSA 1H2MA 3T4DA 2DJVA 3SDGA 3J80K 1ZRCA 1IXCA 1FXKA 1ZHFA 1ZAOA 2EIKC 2Q5ZA 3P9KA 3B2EE 4JI6B 2DAOA 3M3YJ 1GK9A 1QPMA 2L0KA 1J2XA 1VTNC 2IGOA 2HOSA 4G12A 2IBZH 2GOMA 4U0YA 1XMOO 1ZLJA 2G9WA 4DV5B 4KN4X 2HYFA 2W24A 3CLOA 5C8YA 4JI0O 1FX7A 4O4HA 1IBMB 1FBUA 4M9SA 2DI3A 1XDUA 5LXTB 4MTOA 2ZB9A 3T5XA 1ETQA 2DODA 1BR2A 2TCTA 5K5QA 1YX3A 5FL7G 3AK2A 4U3JB 4BDZA 2HPMA 4PJMA 1DUXC 4YY3B 4M74A 3U21A 4UCSA 1ZRDA 4I02A 2YC0A 1WI3A 5BPDA 1J5EO 4XKBA 3X2QB 3P30A 4ENNA 1ZGAA 4O3MA 3IH2A 3I5DA 3R0JA 2OTJI 5FLXK 3FIWA 3GCMA 2EJRA 4YIOA 4A3IJ 5E18F 2V7FA 4M3BA 1J9IA 1M1KW 1G3WA 1P6RA 5B1BB 3WB1A 2P7VB 3QAHA 4KHPO 4N9IA 4LF8B 1NHAA 1W1WE 3RIRA 5KUKA 5E1ZB 1K9MW 3HSEA 1HW7A 4MLOA 2R7VA 2YICA 2UUAB 1LNQA 1O9GA 2ICWG 3LSIA 4AIKA 2ZINA 2BE5F 4FPPA 1QNTA 1H88C 1SVOA 1Z3XA 1O57A 1OMIA 1N8RW 2EFPA 2QA4I 1FPQA 3BT9A 4JTDB 1UFMA 2VKEA 3C7JA 4X0GA 1J75A 2NRAC 4BQAA 1H8HG 2E1OA 1JJOA 4LFAO 5HS9A 5LP6C 1HDDC 2J5OA 3L74H 4KP4A 2QKSA 4ZOLB 3HHHA 1JMKC 2XGXA 5IYZB 2QBYA 3PIOF 3OWTA 3S3OA 5FNVA 4CS4A 2V9KA 1SANA 2CUZA 1R3LC 2JA7J 2FYUH 4R50A 2HVJC 2LC2A 3LSJA 1R22A 1F4MA 5K1PA 1WN7A 3W6VA 1RZ4A 2P67A 2R7XA 1HW5A 3VOEA 4LWSB 4V2GA 3TETA 3VYTB 1XDSA 2UWMA 3BPVA 3FAVA 5ITZB 5KMGA 4X66O 1MZFA 3S3MA 1VZ0A 1SFKA 4HOBA 4AVPA 1WPXA 2RREA 2QDOA 4WFGA 1F4NA 3EVKA 5EBLC 4DV1O 3QVNA 3JRGA 2R70A 2ARHA 1R1VA 4X6AJ 2Q4PA 2ZT9B 3AKZA 3FAVB 5ITZA 1USSA 2E5LB 3B4SA 1TQIA 5BOXA 4EJUA 2XAJA 4GKJB 5E3MA 1EN4A 2LQTA 3STLC 2L01A 3E35A 1K8AW 1VQKI 3CD6V 3BCAA 1OCOC 1BM9A 1MBGA 2VQFB 3ZQFA 3E83A 2CGOA 3LDCA 1DGSA 3E8FA 1YJWV 5C93A 1H2NA 2YS9A 1ON2A 2ZE5A 2CE4A 1WJZA 5L3EA 2KRCA 2EPFA 2XAUA 3T1CA 1GTOA 2VXZA 3CMMA 4CA0A 3K06A 3JAMN 3JAWA 1K7AA 4IHWA 5LOVB 3RQIA 4XLNF 2O57A 2LJ2A 1GUUA 1AB3A 4BDYA 3DLAA 4XLHA 4C3JJ 1UPGA 5HLIA 3R6SA 2MFZA 4XONA 4EATA 1J0RA 3F7VC 4JV5O 1IDYA 4D5CA 5JVTA 3LMMA 3OAAG 3BG5A 2K9QA 5EYPA 2ZXWH 3M8JA 4FETA 3R66A 3BCCH 5B1OA 1M57C 2LLKA 1I6HJ 2L7ZA 3KIOA 5K7ZA 3H5AA 4G94A 3G6BA 2BHYA 2QWPB 4XRSA 4HAMA 2R93J 3LSSA 4FFBB 1M93A 3X2QC 5E3LA 4Z1VA 4LGWA 3SFZA 5LEJA 2W6JG 3ABKB 3OR1C 4DV2O 2PF4E 4IRHA 4HDVA 5ILUA 2R7RA 4CGZA 4D5FA 1MDMA 1U97A 5IWAB 3ABKC 5GP9A 1YJNV 1SD5A 4Q47A 2DTRA 1I7FA 3JCZA 2JGDB 2UUBB 3CJQB 3EUHA 4E70A 4KISA 2XUMA 1B6QA 3D3QA 4B3TB 4J19A 3G71V 4DV0O 4LBEC 1EKEA 5D5WB 1W36C 1YS7A 1YG2A 2QLZA 3CCRV 2DCEA 2MSYA 3ZQHA 2P8TA 1JCHA 3F0CA 3B40A 4OAZA 4P96A 2LG4A 2Q2EB 1H2KA 1T5EA 1AHDP 4JTCB 1F51A 1P92A 1WJDA 2VODA 5DEDA 3ZIAG 4CCKA 1FY7A 5H2FZ 2IU3A 1NT2B 2VQHA 1TWCJ 2DYRH 2IS1A 4I7ZB 1O3TA 4E7IA 3APOA 1IXSB 5EEHA 3CRQA 3IH3A 3MEXA 4YFXF 3H9VA 3TOBA 3CCRI 3NRVA 2NN4A 2JMWA 3J81N 2NNNA 2DA1A 2VE8A 2EV5A 3Q0VA 5TRDA 3JRDA 3HOTA 5IY5B 1P4RA 3FM5A 4A3MJ 3W2AA 3MHHC 2ZBKA 1WHUA 3L2CA 1O3RA 1VFCA 4GCZA 1VI0A 3HTUA 2G7UA 2XGEA 4II3A 3VYRB 4HRIA 5IPAA 3LUTB 4I01A 3ZHUA 4X1YB 5BPIA 5JJNB 2UXCO 2GQQA 3OYFA 1FBSA 5D8LB 2EX3A 1ZL8B 5D5UB 2DMPA 4DR7B 4P9PA 1POGA 2EA2A 4B3RB 2DFIA 3FBNB 4ZKIA 2MYSA 4HDUA 2VPLA 2WLMA 4HNUA 2W57A 4NR1A 3J80N 4OX9O 2ZQMA 2LK2A 4QPOA 3FMSA 4CZCA 4HSRA 1U6GA 1VF9A 2CV2A 3FKJA 4JPRA 4L87A 4JAUA 3ASOH 5JLXA 1DP3A 4WCGA 3ABLB 4I4TA 3FB7C 5AG2A 1V4RA 3DKWA 2P5LC 4XDJA 4YFNF 4FE4A 3CXHF 4MW8A 2XDVA 3L2QA 2V6EA 5HDKA 2XT9A 4YHHB 2Q7GA 4KNYA 3CP1A 3M8AA 3J7AO 1R3JC 1STZA 2D2CB 3HR0A 2K7LA 4XOPA 1YJWI 3LSHA 5FKNA 3LDEA 1WJ5A 4O4LA 5EDNA 4D7MA 3CD6I 2BYVE 5FD6A 3HRUA 5J4YA 2EJ7A 4B3SB 4MHGA 5JHUA 2CQXA 3I53A 1P49A 4RQEA 2BV6A 3BOQA 4JYBA 2ADQB 5LL6Y 4EM2A 1RKTA 4S04A 2R92J 1CF7A 4IIJB 1XBLA 4D6TH 3TQNA 1XHZA 1NTKH 3FDYA 3OGIB 1S77D 3N2KB 1OZ0A 1OQYA 1SD4A 4C2UA 4A3BJ 2D3OW 2XAFA 3BP8A 1JA8A 1X59A 1OCRB 2Q68A 4B08A 2CW7A 4LWSA 4LB6B 3H1CA 1A04A 1TNTA 1VQOV 1FAFA 1AP5A 3BVOA 4HF1A 2OIGA 5FFZA 1XCBA 4HZ3A 4FLTA 2BOLA 4CH5A 2PYLA 4KMUX 4JI0B 1W4MA 2RDCA 4CH4A 3CDLA 2HOEA 2A05A 1R3IC 5F1JA 2F66C 2DQ3A 3IAYA 1XNRO 2STTA 1TWHJ 1GAXA 1IN6A 3BWGA 1H8AC 3H1HH 1RUOA 3S3WA 1HKQA 1S6LA 2R7DA 2JEUA 4FTHA 3ASNH 4FISA 4HW0A 5HLHA 3I56I 4BE2A 1S5HC 1JUPA 3M4OJ 2FE3A 5AIPA 3NXSA 1TTYA 4U88A 2QA4V 2UXBB 4QSHA 3CDIA 1MBKA 2BXYA 2QENA 1XMAA 2OBPA 5J8FA 2XAGA 2FA5A 2OTLI 2O6GE 2A6EF 2COMA 1MOFA 3S1MJ 3UT5B 2JT1A 4EM0B 3CCVI 2MGQA 4JI4B 1HDPA 3RYRA 3S2HJ 1ZG5A 1I5XA 2GDSA 3IV5A 2GTAA 2DYSH 4YELA 3T8TA 2R0QC 2NNYA 4IO9F 2AXLA 3RKYA 3RKWA 2DFEA 4GRIA 1V54C 5KHIA 3OEHG 1H9GA 1X1DA 1YOVB 5CA3A 3CXCU 1RNLA 1GV5A 1V54B 1WAZA 5IYCO 4X1IA 4AWXB 1IX9A 2ZR3A 5LMNO 4CYDA 1B8IB 3H3UA 1Z3YA 3OMNB 3PJSK 2VT2A 1KKDA 1WH5A 2AQEA 1V54H 1LDKB 4ZHQA 2LY1A 3P7NA 1US6A 4UB6C 3TO6A 3AG3H 2FNAA 4CHUA 4GDFA 2EWNA 4OGQB 3DQVC 4CYCB 3QOEA 2EV6A 2GAUA 3I5UA 1SFUA 1MG1A 3CP8A 5BQTA 2EQRA 2OZ6A 4QNHB 1LJ9A 4HV5A 4JAAA 2ZNIA 2P0WA 3R60A 2LGQA 1QLEB 3CS5A 3CMEV 1RI7A 1XGOA 5EZYB 3BG9A 5D5QA 1VQMV 5F2VO 4FE7A 1KYZA 2HHHB 2VIXA 2VKHA 4IRGA 5A2QZ 1G8MA 4IHJA 4R7CA 3H35A 3KX2A 5HNHA 4JI8O 1WGXA 4BXXJ 3ABMB 5CA0A 4KIFA 4AC0A 1N4CA 3CCSV 2BVLA 2XPWA 3MKYB 1AKHB 2Y0MA 2ELJA 1ZSPA 2ILMA 2RNJA 3JATB 1WFXA 2ITCC 4K3AA 3TEDA 6PAXA 3DBLB 1XI1A 2OQGA 4RB1A 4B3MO 3GTGJ 4M3EA 1YTFB 4BW5A 3W2VA 1UFIA 1IBLO 2VASA 3JSLA 3G2BA 4ZYHA 3GO5A 5EEGA 4IOCF 1VQ4V 4U7DA 1S72V 3I71A 4UXNA 3ML0A 2HXIA 1FFXB 1D1AA 4CS3A 2H8WA 4RWUA 1IBMO 4EVIA 3VDXA 3DXRB 3LSMA 1JTYA 2EINH 2K27A 1P84F 3OYLA 4I50A 2JIZG 4PA6A 2E60A 1EZJA 2E34A 2WB1N 5EYRA 1XMQB 3R61A 3RGBA 4EFEA 1ZQ3P 3MWMA 5TJJA 3CRAA 5JI6A 1ITYA 5KX5B 1KYWA 3Q9VA 2J5PA 3WU2C 1BOAA 2ZD9A 1A31A 2HGCA 2UZKA 1EN5A 2ZXIA 1JX9A 1OCCC 2WA4A 4OMYA 1VQ4I 2CK3G 4DK0A 3HL2A 3EYYA 1NQTA 4B8XA 3IAS2 5DECA 4LFAB 4LG0A 4W4LA 1FKAO 1NH2D 2V6CA 3S16J 1R1BA 1ZGWA 3HUGA 1R1TA 2F48A 3TXQA 5DS9A 2WV0A 4NC8A 3F6OA 4HNTA 2LDUA 3KLNA 5EBWC 1ZH5A 3WODF 2PJRB 1WP7A 1XGMA 5IE9A 1R00A 4E7KA 2RAEA 1CGPA 1AJNA 1ZAUA 3RTRA 3BR1A 3FB5C 2N8GA 3KZIZ 5J4VA 2XC7A 2LKPA 2LY2A 2DA3A 1P4WA 2EILB 4UB8C 1J59A 4JI2O 1XC5A 4Y33A 1JR9A 3FXMA 2JSPA 4LF6O 5E1WA 3KP4A 4HPQA 4UCOA 3ZRXA 4RS8A 2KDOA 1W5CC 5M5YJ 1Z9CA 2QKCA 1VQMI 3M99B 4DUYO 2GXAA 3VQVA 4FLZA 2QEXI 5KCMA 2EA4A 4U87A 4L5EA 4BWAA 3JSOA 1ETOA 2VC1A 4MEYF 1JTXA 2MC4A 1N34O 1GXPA 3SXYA 3OT7A 2JRTA 3HOYJ 4IKFA 2VL8A 4X88A 3K6GA 5JVDB 3N2GA 4ANJA 2KQXA 2CFOA 1R7JA 3K4NA 1U8BA 1B04A 1K97A 2CH7B 2JS3A 3WG7B 2R7UA 5CVJA 3QOPA 4NTWA 3ZBHA 4UHTA 2Y69C 3B09A 4I9QA 2DA6A 4YHHO 1EFRG 1QBJA 3L2UA 1XTAA 5D4RA 1JKPC 3ONQA 1XMOB 3DLLF 1NVPB 2E1CA 2LF7A 4PDVA 1R9TJ 2NR5A 3GTMJ 4O4HB 4TV9A 5D5XB 2O0YA 1OCRH 1OFCX 3BQYA 4LITA 2ZCEA 3OFNG 3RYIB 4O2BB 4M6VA 2W4SA 5L3GA 4I09A 1FXHA 1WB7A 1KGSA 3WTYC 1IURA 2HKOA 2W00A 3MZYA 2IJHA 1NKDA 2R9IA 3I64A 1GV2A 4CH6A 2HVSA 1FFTB 5KLVH 2PMZN 3HRTA 4KUMA 4A3DJ 2ODMA 3JW4A 4W97A 3PO3J 3HKEB 3SPHA 3S15J 1ORQC 1SESA 3MZ8A 5H2FC 4WXCA 4UCTA 5L3BA 5KUMA 1HWYA 2FB5A 1E3HA 3I56V 4RGRA 3CC4I 1R6NA 2F23A 3Q4HB 5EBMC 2L7KA 3CEIA 2BHZA 2DFFA 3E8BA 3PO2J 3OGCC 1QVGU 1FNNA 2MLGA 2ACJA 2WC2A 2XIGA
chains in the Genus database with same CATH topology
5ICEA 2O61A 4FT8A 3GFIA 1R5HA 4NXNB 5CB4B 2XHKA 4M9ZA 1TUBB 4PGGA 3RJPA 1P4AA 3V7CA 3ROUA 2ZNJA 2NS0A 1BI0A 1Q5OA 2YIBD 2MLKA 3RPQA 5BMVA 2IT0A 3ZMVA 4LLLA 4DV0B 4WWCA 1U78A 1FLIA 2PQ8A 3RYFB 1R5GA 3FMQA 1FJGB 1TAEA 4LNUA 1WRJA 4ZYDA 1YLFA 2CSOA 2F5CA 2XHBA 4M6XA 3CO6C 2CFXA 4LNUB 2FBHA 1FFXA 3ABUA 3RFRA 3FXRA 3RYCA 3N2GB 5JJEB 1ZN2A 5LHHA 4EGZA 2HEPA 3BABA 4UCVA 4HV6A 5ILSA 1O3SA 1U5TB 4YJ2B 2HTSA 2ZJ2A 4EJOA 3D0SA 1E17A 3ELKA 2CGPA 5L3CA 1H2SB 5JQGA 2YXLA 1W7PA 4UV8A 5D8KB 4P5OA 4DV3B 2A3SA 1KQ9A 4ZZLA 2VBYA 4P55A 3O2PE 1SA0B 3QRFF 1B1BA 1DDNA 2ISYA 4YIFA 4UV9A 1HW1A 1AOYA 3MAJA 3FX3A 4M9XA 4X64B 1U2WA 3K58A 4GYCB 2IA1A 4LK0F 1IUYA 3DFGA 1E2XA 2ETHA 4X20B 2DBBA 1XSDA 4PI2A 4AIJA 2M30A 5JH7A 2HYGD 4A5NA 4A6EA 1X3UA 3BY6A 5DCMB 4FLYA 4HF2A 4OIRF 2OYQA 4L0YB