1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein MJ223
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
4YFKF 2TDXA 1BM9A 3FMSA 1S29A 1TQMA 3L2CA 3R0AA 3J81K 1G3YA 2Q8KA 5AIPA 2RN7A 5CVIA 1B4AA 3WTSC 4EM1A 1PP7U 1T38A 4E70A 1J0RA 3M8EA 1W7PD 2E7XA 4XSZF 1RIOH 4AVPA 4NQWA 3JW4A 5HLIA 4HQEA 3NEUA 3REOA 1XB4A 1TQPA 1U2WA 1XMKA 3V8LA 5ICGA 1ZRFA 4M9XA 5JI6A 5A2QZ 1STZA 1USTA 4EJWA 2A6EF 4IRGA 3F22A 4OOIA 3RYPA 1SD5A 4UHTA 4OIPF 3LA7A 4YIFA 4RGRA 2QQBA 2HFHA 3K1NA 2ZMEA 3TOBA 3ZPLA 5ILVA 4UVCA 1QZYA 2FOKA 4Q48A 1JHFA 4CO8A 3ZMDA 2KIUA 2L02A 2EA2A 1XN7A 2ZMEB 1IF1A 3KE2A 3MZHA 3NQOA 2DW4A 1J7KA 3Q9SA 3ECOA 3MEXA 2J5PA 3V8KA 2ZFWA 2ZNYA 4OINF 2PMUA 2OBPA 2IPQX 3HRUA 4XSXF 3HRTA 1GHCA 3ERED 1T39A 1Z7UA 4B09A 1PP8F 5E18F 4I2OA 5HLHA 1IUYA 2V1DA 4ESFA 2P7VB 4ZYEA 2HGCA 3HOSA 1YIOA 1ZG1A 4YFXF 1J2XA 2J5OA 4S04A 3WGGA 1AWCA 2VOOA 2PMHA 2VBXA 3W6JB 2WTEA 4G7HF 3G3ZA 3VOEA 4B8XA 4U88A 2DI3A 4RGSA 3HTSB 2OQGA 5D5UB 4UNOA 5L3DA 4M74A 1UB9A 3O6BB 3LWFA 2Q0OA 1WKMA 1FYLA 3M8FA 1R00A 4HW0A 1RUOA 4MEXF 2G9WA 1YW9A 2RKHA 5JHUA 2W25A 4XRFA 4U0WA 3J7AO 4KICA 5D8LB 1REPC 3ELKA 3WU1B 5CVRA 5FFZA 2VBWA 2A5YB 4N0BA 1DP7P 1TBXA 3K1PA 1NHAA 1Z6RA 1W4MA 2VOPA 4BYYA 3IKVA 4HX4A 3K69A 4PGHA 5F64A 3R4KA 2FA5A 2RQPA 3FZVA 3HHHA 3ISPA 4I02A 3ZMZA 4KYWA 3ZP5A 2HS5A 5DDGA 4EGYA 4YIIA 3GYHX 4HDVA 1V4RA 2FXAA 4EJTA 1G6NA 2PQ8A 3GXOA 2W24A 3FXRA 1FSHA 3J81Z 1U6GA 4U7BA 2RC4A 4G7OF 1O3RA 4OMYA 4ESBA 2XAGA 2DPDA 2CSOA 2IT0A 1R5GA 1P4AA 2K7LA 5ICEA 2KKOA 3WTUC 1KQ8A 3I4PA 4BHPA 3DKWA 3V7RA 4JQFA 4OIQF 3JSPA 1KU2A 1B1BA 2M45A 3ZN0A 1TQIA 1WQ2A 3DF8A 2FNPA 2ACJA 5CVUA 2JT1A 1XD7A 5DYMA 5FO5A 4BQAA 2FBHA 4KDPA 1FBSA 2ZCWA 3I0TA 2F2EA 2NAZA 2ISYA 3ECHA 1O57A 4A0XA 4PCQA 1O3TA 3C7JA 1O3SA 1V3FA 5DD4A 1P92A 5FFXA 1R1UA 3FWEA 4F7ZA 2VC1A 1LDDA 1FP1D 2Y75A 1HW5A 2Z5UA 2YPRA 1MJ9A 5JVTA 1RI7A 2V9VA 4U0VA 1ULYA 3KETA 1W7PA 3ROUA 2F5CA 3WODF 1LEBA 2A3SA 3ML6A 4G7ZF 1T0FA 3CO6C 3KP3A 1G3WA 4L5JA 1Z9CA 1XSVA 2W84A 4I09A 4ENMA 5L3BA 5LLQA 4CGZA 3CDHA 3JTGA 1HQCA 2GIVA 5HVQC 1W7PB 2O3FA 1K78A 5BQTA 2O03A 2WC2A 3WU0A 2MLKA 4D0PA 4GXOA 1GXPA 3IC7A 1FZPB 1Z05A 1PDNC 3P9IA 2QQAA 4A6DA 5D5WB 4PDKA 3IL2A 1DPUA 6PAXA 1TW2A 1K78B 4KIFA 1P6RA 1U3EM 5DCFA 3DV8A 5LRRA 1ZARA 1OYYA 1FY7A 3I53A 2QM4A 2NS0A 1XGOA 5BPIA 3F72A 4LK1F 4NHJA 2FRHA 2JSCA 2XAFA 1IN8A 4L5IA 2XUBA 4KNYA 4DQ2A 3FHZA 2P5KA 4EMSA 1T98A 2EWNA 3FMRA 3OV8A 5E8IA 5ICCA 3R60A 3GFJA 3EYYA 4KMUX 1KQ0A 2Y48A 2O6GE 1KA8A 4WF2A 5K5RA 4UV8A 5HOOA 5ICFA 2UZKA 1RNLA 1U8RA 1ZHFA 4HX7A 1ZGAA 1I1GA 1IZ1A 3T0YA 4MTDA 2UWMA 1USSA 2M30A 5L3GA 2L3DA 4HV5A 2NYXA 1S3JA 4HYEA 3T1BA 1SFEA 5CVVA 4WCGA 5CYVA 4LD5A 2D45A 3WTTC 1ZLJA 3KLNA 2VN2A 5FGMA 2KIFA 3QOPA 4BH9A 3KP6A 3WTVC 3V7SA 5J6XA 2X0LA 2ZNZA 4M72A 2IA1A 5CLSA 4FX4A 2K02A 3BROA 1BOAA 2GWRA 4MNUA 3HSFA 2LKPA 5ED4A 2PBIA 2PI0A 2KRFA 4ZYDA 1OKRA 4MQVA 3EYIA 3LQRA 1P2FA 2Q2EA 3O3KA 2OD5A 3WTZA 5KK1A 1MD0A 3VODA 1MZBA 2Z3YA 3DXJF 3WG9A 4IPAA 4L9VA 4UVBA 4UV9A 4IF4A 4KN7X 1QNTA 3DPTA 1IXCA 2ISZA 4M6XA 5LHGA 3W6KB 3GW2A 1LVAA 3I64A 2VC0A 1HSJA 1FBUA 2V1UA 2H94A 3FM5A 4EGZA 3M1EA 4YG2F 1XDSA 3RI4A 3HHGA 2GXBA 4A5MA 1GVJA 2P7CB 2H27A 2LSOA 2PN6A 3EQLF 4HF0A 4U0YA 2HKXA 2LF8A 2M1BA 1SD4A 3MZYA 4IVNA 1G3TA 1ZRDA 4BHBA 2XGXA 5DD8A 3HRMA 3LQQA 1PUEE 5LGUA 3WTXC 4H0EA 4MQ9F 1CF7A 4IRIA 4UVAA 1YO5C 4R79A 3BWGA 2VBZA 2ETHA 4MGRA 4M9SA 1MKMA 1ZRCA 1XGMA 2HKOA 1FBQA 1B6AA 3P7NA 2STTA 2QM3A 4WWCA 3T8TA 1UFMA 2CWEA 2IA0A 3LA2A 2CGPA 3JSOA 1CF7B 1G3SA 3TOAA 3NRVA 3LSTA 3F23A 2EA4A 4UXNA 1DUXC 1R58A 4DNCA 2G7HA 5BPDA 1ZAOA 3L7WA 3I71A 5TJJA 2XASA 2IRFG 4G6QA 3U9GA 1BJAA 3QU6A 2XAJA 4G6DA 2D1HA 1S6LA 4ENNA 3I54A 4KUMA 1WWXA 4M6YA 3K9TA 3GZ5A 3T5XA 4Y15A 3H92A 3BJOA 1YFHA 3KZZA 1R23A 4JK1X 2COMA 4MTEA 2HQRA 4YFNF 4RAZA 2HOEA 5K5QA 5KVRA 2K27A 1SMYF 5DCMA 1LB2A 3V4GA 3ZQ7A 4I0BA 2KJBA 4ZZLA 2DLLA 1HW1A 2ZXJA 5D5VB 4TV7A 1Z91A 4JBAA 2P6TA 5DCMB 4HAMA 2HQNA 3BZ6A 5E1XA 2DO7A 4HF2A 3MAJA 4RB1A 3TO6A 1S7OA 1R1TA 3SQNA 2ESHA 1H9GA 3T8RA 1ZLKA 5HLGA 4G94A 3J80K 4KN4X 2NRAC 4WXDA 3KP7A 1WI9A 4LG0A 1SFXA 5HDGA 4HV6A 4RB2C 2GXGA 5JR3A 3BY6A 2Z99A 3C1DA 4IHSA 4A2UA 5FLXK 3COAC 1I5ZA 4LG0B 1ZYRF 1ZG3A 2VBYA 3F8BA 4P9FA 2HZTA 5E1WA 4ETSA 2FNAA 4WXHA 2RDPA 1BBYA 3BPVA 5E8GA 1O7FA 2IVMA 3HRSA 4XLPF 3GVAA 3F8CA 1F9NA 3JTHA 3HOTA 3Q9VA 3B02A 5L3EA 3VEPA 2QENA 2M87A 3LAPA 3KP4A 5L3CA 2BEOA 2NNNA 1KU3A 2HDCA 3AAFA 2DK8A 4HDUA 5LHIA 2JPBA 4HOBA 3SZTA 3P9KA 1LNWA 1K6OA 4M9ZA 1FX7A 4GO1A 2MLGA 4LLGF 4CXFA 3ABUA 3E6DA 5TRDA 4Q5SF 2DAOA 3KP5A 3RTRA 2FBKA 2O0YA 3RJPA 2G7UA 1MDMA 2HTSA 4MEYF 4EJVA 1TTYA 1J75A 1TNSA 3G73A 3BDDA 3WTWC 3ULQB 2IA2A 1MDMB 3C18A 3ZMSA 1D8KA 3HSEA 1Z1DA 2X4HA 2STWA 1I6XA 4I01A 1IN6A 2FMLA 3BP8A 3IWZA 1EV7A 2EV0A 3SXYA 4QWQA 1G4DA 3HSRA 1Q1HA 2D2WA 3KEQA 2JZYA 1KGSA 5A2QK 1QGPA 2B0LA 2P4WA 3QPTA 1YS7A 1U5TC 2GQQA 1FPQA 2ZJ2A 3E6MA 4LJZF 3IWFA 3QP6A 2IP2A 2XIGA 1FWZA 3IRQA 2OU2A 1KU9A 1OYIA 1WRJA 2K4JA 2BV6A 1BC7C 4ZYGA 1O3QA 2DQRA 1KYZA 3D0SA 4AWXB 2UXNA 4S05A 5AIQA 2YU3A 3PQJA 1GXQA 1B59A 3KLOA 2QZ8A 3TKYA 1VTNC 3VB2A 4P5OA 2RGVA 3PQKA 4Z2YA 2DBBA 2HTJA 5CJ9A 3H3ZA 2DQLA 3HIFA 3FF5A 1HXDA 1LEAA 3TO9A 5F1RA 2E1NA 4LFUA 2PJPA 1Y0UA 3DP7A 1MJAA 5ILSA 4XLNF 4RAYA 5FD5A 5J8FA 1EH7A 3RIRA 1K79A 3J80Z 1OPCA 4GGGA 2MD5A 3L00A 2K86A 5EEHA 5K1YA 3RWRD 4HF1A 1ZH5A 5IT9K 3F6OA 2IJLA 2XAQA 1XCBA 3IHUA 2EK5A 3RKYA 1UHWA 4K2EA 3CJNA 2LDUA 1BC8C 3SR2C 1HKSA 3KCCA 3WTYC 1XSXA 5L3FA 2L4MA 2JTVA 3CUQC 4ZZDA 4GYGA 5FLXZ 3CUOA 4P9UA 1HKQA 4R8HA 3LA3A 2DT5A 4EQQA 4A6EA 2XHKA 2MH2A 4BAYA 2OA4A 3SFZA 2A69F 3KFWX 2Z33A 4MHGA 3GEZA 5LHHA 4N9IA 1LDKB 3F8MA 1K7AA 2E7WA 1ZN2A 2FBIA 1BIAA 1LQ1A 1FP2A 4I98B 4KFCA 3WE3A 3QPHA 4G9YA 2GA1A 1QBJA 2XKPA 2ESNA 4KIBA 1EH6A 3WGHA 3K0LA 3DPLC 4HBLA 1OR7A 1YLFA 4G8XA 3TDUC 1J9IA 1U5TA 3IKTA 1YS6A 2FSWA 4KIGA 3PFIA 2AXLA 3LAJA 4L0ZB 5D4SA 1HW2A 4A0YA 2EV6A 5J8CA 1FOKA 1OMIA 2JRTA 3C3WA 5HS8A 2XVCA 4LB6B 2QVOA 2R3SA 1U5TB 3FM3A 3EDPA 4O3MA 2RV8A 1R7JA 1S7AA 2O61A 3BOQA 1IAWA 3E5UA 4LB5A 2OAZA 5E20A 1IN5A 2K4BA 3MCZA 2LNBA 1YTYA 5H6RA 3TGNA 5ILUA 5D8KB 4HLYA 4PZJA 2FQ3A 3E6CC 2QWWA 3BJAA 4ENJA 5IT3A 1ZG5A 4IRHA 1XSDA 2A07F 5JFRA 1XGSA 3F6VA 1D5VA 4RGXA 3RKXA 4LGWA 1IXRC 2DPUA 1R22A 1MJBA 2V1XA 3B73A 1R1VA 2P8TA 3GWZA 3JAMK 2H6BA 3BJ6A 1O7LA 5DUKA 2ZBKA 2YR2A 1I1SA 3BPXA 1W5SA 4FHTA 2W57A 3L09A 2CQKA 2YX4A 2MH9A 1IRFA 4L9JA 5EEGA 1L3LA 3M9AA 1BI3A 2L54A 4RB3C 2ADUA 2EFQA 3WE2A 1T2KA 1YQAA 3CUQA 3FXQA 2PLYA 3GX4X 2L01A 4ZYHA 2EFWA 1F1ZA 2HYGD 3OOPA 2R9AA 2XRNA 2C6YA 1FC3A 3R0JA 5LRSA 5D6EA 3RYRA 1HSTA 1XDUA 3CUQB 4UUVA 2BGCA 3GF2A 2M5WA 1JHHA 1WSUA 1AOYA 3GFLA 3GUDA 1J5YA 2AS5F 1B9NA 2GAUA 2VONA 3N4MA 4N9HA 3VFZA 3QP5A 1FYKA 1I27A 2WWYA 1LDJA 1XMAA 3MFKA 3EETA 2A61A 2EFPA 1FYMA 1F4KA 1B9MA 3CTAA 2ZO4A 1D8JA 3U1DA 2HEOA 4EJOA 2EV5A 3F3XA 4KA4A 1SAXA 3CLOA 1BI1A 4CZZA 1JGSA 3QRFF 3RKWA 2D1VA 4WK8F 5IT9Z 2ELHA 2W85A 4KT5C 4M71A 3HUGA 2WV0A 3LFKA 2P6SA 3FMQA 3GFMA 4O6JA 4CHUA 4EM0B 2BBYA 1BN5A 4EM2A 4LK0F 4OU0A 2A68F 3TDZC 3V7CA 2PG4A 1EH8A 2VODA 4WX9A 4OIOF 4ENKA 1U78A 2DTRA 5D6FA 2GZWA 4CYDA 3WGIA 5HDNA 2ZKZA 1SD6A 2F5FA 2P5LC 2H6CA 5LEKA 3TO7A 1T6SA 3QU3A 4PGGA 2QQ9A 4NB5A 2QUFA 1ON2A 4A12A 3MWMA 3KP2A 1E2XA 5BMZA 4ESJA 1ZGJA 3N97A 3F21A 2CG4A 3ZMVA 1IN4A 3IRRA 3K1MA 1QQIA 2P5VA 4GCVA 1UHMA 1KQ9A 4ASNA 2XKOA 4HX8A 3GZ6A 2EB7A 2Z9OA 3FXUA 5E1ZB 1J59A 2V6CA 2MC3A 4CICA 2VT3A 2OZUA 4L18B 1H0MA 3D5LA 2V79A 3L9FA 4CDGA 1P4XA 4FX0A 5F6FA 4OMZA 4BNCA 3MQ0A 5D4RA 3E3VA 5BS6A 4EV0A 4Y17A 1QO0D 2CW0F 1MGTA 2HR3A 3HTUA 1RUNA 3ABTA 5HS7A 4QLCU 2R7FA 4P55A 4P96A 5BOXA 2YSRA 4I7HA 5FB2A 1LJ9A 2OZ6A 1SMTA 2QLZA 1FSEA 1SD7A 1UCRA 2MA3A 5HS9A 4L9NA 4R1HA 4Y13A 2QBYA 1ODDA 4FT8A 4GYIA 5FD6A 4HQMA 3JAMZ 1IRGA 3R6SA 4RB0A 4RS8A 3F8NA 2CFXA 1R5HA 4LLLA 1DDNA 3O2PE 5H20A 2CYYA 1C0WA 4ON0A 4O5VA 3Q5FA 1XGNA 5DUIA 2QBYB 2M8EA 4BXUA 2RNJA 1HKTA 2R7DA 2PFBA 1QPMA 3I5UA 3DQVC 1ON1A 1FLIA 4Q47A 2VE9A 1BI0A 2YX7A 3E6BA 5LBQA 2FMYA 4M73A 5LGNA 1A04A 2OQRA 1BI2A 2VT2A 2HYFA 1YW8A 1W5TA 1BIBA 2BYVE 3H3UA 1X3UA 2PEXA 3SHFA 1M5IA 1TNTA 4A0ZA 1KYWA 4WXCA 3GFIA 2KIMA 4HLXA 4OIRF 4Q4ZF 1IN7A 1FNNA 3KEOA 1XCVA 5LGTA 2A6HF 4LMYA 1ZREA 1L0OC 4ZH4F 2E1CA 1TLHB 3I59A 5DEQA 4HA8A 1QZZA 5D5XB 2DFIA 5LEJA 4RGUA 3V8JA 4IJAA 3ZMTA 1ONVA 2VE8A 1P4WA 2XROA 2MBFA 3I59B 3DEUA 1FT9A 1R36A 1D3YA 1RZ4A 2HWVA 3GLXA 2QYOA 3QAHA 2FF4A 2O8XA 1SFUA 2DK5A 3S2WA 5E17F 4HZFA 2EFOA 2L4AA 3GO5A 1JXSA 3M7GA 5ERIA 2DU9A 3HYIA 2LF7A 3FX3A 4KMFA 3DFGA 3RPUA 4XBFA 1YW7A 4LLNA 2F5DA 1E17A 4IHTA 5H6QA 3E5XA 3CO7C 3SZPA 5HDKA 3EUHA 4BHCA 4L9TA 1OYWA 4AD9A 1IW7F 2H09A 2CO5A 4EVIA 4A5NA 2NNYA 1H9TA 4L0YB 3I58A 2FU4A 3TQNA 2RVCA 2VXZA 4EJUA 2KJCA 2FEZA 3K2ZA 1IXSB 1YYVA 1YG2A 1HBXG 5CVJA 3R61A 2FE3A 5AONA 2IW5A 3E97A 2UXXA 1DPRA 4AIJA 2F5EA 4I0AA 2GA2A 3E5QA 4U7DA 1JE8A 3RPQA 2Y0MA 1F5TA 2XAHA 2BE5F 1CGPA 4AIHA 4IXAA 5K5OA 2EJRA 2XV4S 3ZN1A 3U2RA 1Z6TA 1TW3A 2EFNA 5DV5A 1S8NA 3P9CA 4AIKA 3F8FA 2JPCA 3ZMUA 3KZYA 3RDIA 1KU7A
chains in the Genus database with same CATH superfamily
3QWLA 4YFKF 2TDXA 1BM9A 1BT8A 3DTKA 3FMSA 3PJSK 4EKWA 1S29A 4D5FA 1TQMA 3L2CA 5IOZA 1FXKC 3R0AA 3VYUB 2FUG2 4IOAF 1EN6A 1S5LZ 4Q20A 3TXSA 5B3SC 3J81K 1G3YA 2Q8KA 1WH5A 5AIPA 1GN4A 3H36A 3FX7A 4CCLA 1H2LA 2RN7A 4XLHA 5CVIA 5IYZA 2ZINA 1B4AA 1BQ0A 1ROPA 1QNMA 1N8RW 3WTSC 3A0RA 4EM1A 1IUFA 1PP7U 4XM3A 1AR4A 3CJRB 3E1SA 1GTOA 2JUGA 2VQFO 1T38A 3HKZN 1LFUP 3AG1H 5DECA 3K5NA 1K6YA 3DBRB 3BA8A 4BE1A 2LGWA 4E70A 5KUKA 2IJJA 1NT2B 1J0RA 4QIWN 3M8EA 2RN9A 3BVOA 4J10A 4W4LA 2X1DA 4K8ZA 4TV8A 4XOTA 3VBBA 1W7PD 2E7XA 2ODMA 2Q0OC 1I39A 4XSZF 4XIDA 3D36C 2JA7J 2E71A 2XDVA 1OJHA 1QRYA 5IYZB 1WJDA 1RIOH 4JI5O 2XPWA 1IG7A 1JUMA 4AVPA 2I8DA 2IGNA 3PJRA 4NQWA 3JW4A 3OEHG 4B3MO 5HLIA 4HQEA 1FJGO 2KSDA 4UB6C 3NEUA 4HPQA 3REOA 1XB4A 3CXHF 4KP4A 4QPKA 1PL4A 3GMEA 1TQPA 1U2WA 1AROP 1QCEA 2ZNJA 1WPKA 2H1KA 4TV8B 1XMKA 3V8LA 5ICGA 1ZRFA 4QIWF 3RGBA 1B8IA 4M9XA 3D3QA 3K04A 5JI6A 3AG2B 4HYOA 3S3WA 2KRHA 1MH4A 2BOCC 5A2QZ 1XBLA 1STZA 1USTA 4XKWA 1R6KA 4EJWA 2QWQB 2A6EF 4IRGA 2EIMH 1N33O 3E35A 4PJLA 1P9QC 2EZHA 4NQWB 2XPVA 3F22A 1EM1A 2WAQA 2YIDA 4DR3O 4OOIA 3RYPA 3OYDA 2B5UA 1IBKB 1SD5A 2B63J 4UHTA 4OIPF 1U96A 2QR4A 2DMTA 3LA7A 4YIFA 4MVSA 4WFEA 3H5AA 4RGRA 4IL6Z 3OYLA 4D5CA 4MVMA 2DT6A 2QQBA 1IXMA 5M3FJ 5LA6A 2ICWG 2HFHA 1B8IB 2DOEA 3K1NA 2ZMEA 3TOBA 2V1NA 3MKLA 1BSMA 2YIAA 2NVTJ 2BW3A 1LE8A 1SZTA 3ZPLA 2EILB 2AXTC 1SRYA 2EBOA 5ILVA 2P06A 1RPRA 4H44B 4UVCA 4PJNA 1QZYA 4J7ZA 2X6XA 2VJJA 4XR6A 2FOKA 4BEHA 3E83A 4XLEA 3AG1B 2QKMB 4Q48A 4DV1O 3HPHA 1JHFA 1AR1B 4CO8A 2L2OA 3ZMDA 2KIUA 2L02A 2UV1A 2ATKC 2CTQA 4JASA 2EA2A 5LA6B 3VOUA 2BVMA 2UUCO 1XN7A 4MVRA 3LSGA 2PYJA 1R3IC 2ZMEB 4RM3A 1IF1A 5C4JJ 1PNLA 4GZRB 4YIOA 2BW3B 3KE2A 1LE8B 1B3QA 3MZHA 2DA2A 4PV1B 4HNUA 3RYCA 3DCFA 2UU9O 4X88A 1PUFA 3BG5A 4XKCA 1JGGA 4BBSJ 2ZE6A 1G1XB 1YJWI 4PJJA 3OTOO 1ETYA 4BEHB 4DV6B 1N25A 2P81A 2PGGA 4U3FH 1UJWB 1VQLI 3NQOA 2OIEA 3A0BC 2DW4A 4LIVA 2XOKG 4KFMA 2WA0A 1VQNI 1J7KA 2OTJV 2WAFA 3Q9SA 1KC8W 1GUUA 2M0MA 3ECOA 4MFEA 3JRIA 1H2SB 3MEXA 3NAUA 3F5WC 2J5PA 3V8KA 2ZFWA 4A93J 2L7FP 3CYOA 2KQRA 2ZNYA 3MKYB 4OINF 2MK3A 3RYCB 3UR3C 1FYJA 2PMUA 3CLQA 2OBPA 1PUFB 5C4XJ 1A5JA 3HPLC 2EIMB 2IH1C 2IPQX 4NXNO 3HRUA 4LITA 4XSXF 4PI2A 4GLXA 4J19A 2DDAA 3CMMA 3HRTA 2MABA 3ERED 1GHCA 1VFCA 2EPFA 1T39A 3IAYA 1OJLA 1Z7UA 5DM6V 3L2WA 2X6OA 5IYDJ 4B09A 3E22A 3AG3B 1PP8F 5E18F 2DE0X 2LGQA 5CPRB 4I2OA 5HLHA 1ENHA 1S77D 4FFKA 3D5RC 1IUYA 4XORA 1M9NA 2V1DA 3N2KA 3H1JH 4ESFA 2P7VB 1S9HA 4Q6GA 2EZIA 3SEQA 4ZYEA 1XPXA 1JR9A 2HOAA 1GDTA 2AZ2A 4E7JA 1NTZH 5EK0A 4GCZA 2HGCA 3H9QA 1YSCA 2EIKH 1VQMV 3A8TA 3HKBA 3BT9A 3LNQA 3HOSA 5F0HA 1GT0C 1YIOA 4A3JJ 5DM7F 1ZG1A 2LO1A 4YFXF 1J2XA 3BG7A 4GDFA 3ZHVA 3IH3A 3VYTB 1J95A 2J5OA 2KKWA 3E22B 4PDRA 2MW8A 4NVPA 4S04A 1IGNA 3S16J 2QKCA 3WGGA 4BJ5C 2VXDA 1AWCA 2VOOA 1H2NA 1RPOA 2PMHA 2PUSA 3N2KB 4IGGA 2WB1A 1KZHA 3PL8A 4IHWA 2VBXA 4B3SB 1JJOA 4UY8I 5EG0A 4DV4O 3W6JB 5K7HA 2WTEA 1R6RA 5F08A 5K7FA 4G7HF 5E3NA 3OYFA 2DXIA 1LNQA 3G3ZA 2FD5A 3VOEA 2R72A 3HKBB 2BHYA 2A3QA 2KZVA 4AUXA 1T8IA 4B8XA 1E0EA 4PSWA 4U88A 2DI3A 4QPOA 1MZEA 2Y9ZA 1T5EA 2DFEA 1AP5A 4RGSA 1FJLA 5KA5A 3HTSB 4M3DA 1MMDA 1JA8A 1XNRB 2CUFA 3I4MJ 2IJHA 3CCUI 3LNNA 2OQGA 5D5UB 4UNOA 1WAZA 5L3DA 3CMEV 3S93A 4M74A 1M1EB 1UB9A 4A3CJ 4X89A 3O6BB 3LWFA 2Q0OA 1X59A 2JIZG 5HFLA 1WKMA 4JX6A 1FYLA 5GP9A 5EG0B 3W2AA 1BJZA 3D36A 4P9OA 1A32A 3F5TA 3CRMA 1VEWA 4DBQA 5E79C 3M8FA 4I55A 1R00A 3HGGA 4HW0A 3I55I 5CMUA 3MKZA 1LKXA 4DV7O 1RUOA 1IJWC 4MEXF 5GTHZ 2G9WA 1LR1A 3JREA 3TW7A 3ZX6A 2AHYA 1YW9A 3L2RA 2L6LA 4BDZA 2RKHA 3O8HA 5JHUA 2W25A 3BTCA 3MDSA 1YTFB 2GIZA 4XRFA 3M1CA 3U11A 1WZ2A 2XRLA 1FS0G 4U0WA 4X1KA 3J7AO 4JAAA 3M99B 1AU7A 2DA6A 4KICA 4YIRX 5D8LB 2VKEA 3P30A 3P5JA 1S5JA 3PNYA 1REPC 3ELKA 3HB3B 1S0VA 5B1AC 4B3TB 3WU1B 4I55B 2UXBO 5CVRA 5FFZA 2L35A 2VBWA 5IYDO 5CKTA 2A5YB 4JYBA 3SGIA 1Y6IA 2E5ZA 1TAEA 4JI7B 4FTHA 2ME0A 4N0BA 1DP7P 2RJZA 4ICGA 2ECBA 4I6ZA 2R92J 3QO7A 1PVEA 1TBXA 3K1PA 1N75A 1MNEA 1NHAA 1Z6RA 4X1KB 2F23A 2PF4E 2Y9YA 4S0HB 1W4MA 4FZ1A 5FKOA 3AK2A 4PA7A 2VOPA 4DUZO 4BYYA 1SVMA 3IKVA 4HX4A 2YXHA 4CH6A 1OCZH 2E5NA 3K69A 3WHBA 4PGHA 2VQEO 5F64A 3R4KA 2FA5A 3DC5A 2WLHA 1P49A 2RQPA 3OS1A 4GKKB 1Z0XA 3FZVA 3HHHA 3ISPA 4I02A 3ZMZA 4KYWA 1QA6A 3TGUH 1MZFA 1XNQO 3ZP5A 2HS5A 5KNLA 1EZVH 1MW7A 1M1KW 3K4BA 3L2UA 5JWPA 3CEIA 5DDGA 1YJ9I 2D3OW 4EGYA 1NJIW 4YIIA 4PA9A 1MSEC 1NVPB 3GYHX 4HDVA 5LXTA 1X2MA 1V4RA 3HOVJ 3HKEA 2FXAA 4EJTA 4UB8Z 1G6NA 1UZCA 3S3NA 2PQ8A 3GXOA 2A79B 3ASNC 3ZBHA 5CBHA 2W24A 4AIDA 3BC8A 1YHQI 1NH3A 1N0JA 1XREA 2A06H 3FXRA 1FSHA 4B4CA 3ABLH 2NS7A 3J81Z 4BIOA 1U0JA 2CQ7A 1U6GA 3IP4B 2RC4A 4U7BA 2HOSA 3S1NJ 4G7OF 2WB1N 5EC1C 4YRVA 1O3RA 1BOBA 1HLVA 3HL2A 1DU0A 2OF7A 4OMYA 3CCRV 4YHHO 1HR0O 2JWTA 3SJBC 5B1BC 2LMDA 4ESBA 1JOYA 4E4HA 2XAGA 3SYQA 1BGYH 5LXTB 3CCEV 2DPDA 3HKEB 2HJDA 2GHYA 1J09A 3JCZA 2CSOA 3VQXA 4DR4O 2O9LA 2ZD9A 2IT0A 1R5GA 4FFBA 3HKDA 1Y1VJ 1P4AA 3E8FA 4PHZA 2K7LA 5ICEA 2KKOA 2LH9A 2NVUB 1TC3C 4FM2A 4CS3A 1MMNA 1GM8A 3WTUC 1NTMH 2JUCA 2JVHA 1W59A 1KQ8A 3GWOA 3I4PA 2HXIA 4BHPA 5BR8B 2UXDO 3DKWA 3V7RA 4JQFA 4OIQF 4FMTA 2ZXWC 1N34O 4QPQA 2LTPA 5KAIC 3OYAA 1FEXA 3JSPA 1QU3A 1KU2A 1B1BA 2M45A 3ZN0A 1TQIA 2JGDA 1MSWD 3ZQQA 2F1MA 1WQ2A 3QODA 4ZKIA 1IV8A 4IYIA 2KPMA 3DF8A 2FNPA 2ACJA 5CVUA 1F23A 2JT1A 1XD7A 5DYMA 1S76D 3GTPJ 1XHZA 4J9YB 3LUTB 5FO5A 3EPZA 3S8PA 4FFBB 3BR2A 3H1LH 3HKDB 4BQAA 3L71H 3OE7G 2FBHA 4KDPA 1FBSA 2ZCWA 3I0TA 3OYMA 3DTIA 2F2EA 1P84F 3CF2A 4FCYA 3GTOJ 3P3NA 2NAZA 4MTFA 1WVRA 1DGSA 4DYRA 2ISYA 3ECHA 5GAGJ 5CBFA 4BQOA 1O57A 2LG4A 1YITI 4A0XA 4H33A 2E1OA 2PI5A 4FK5C 1QLEC 4PCQA 1O3TA 2AQEA 2DA4A 5H2FC 3C7JA 1O3SA 2B1IA 2KZGA 2JGDB 3MHHC 1V3FA 3T1YB 2HHHB 3SJCC 2VIXA 3MN2A 5DD4A 1OCRC 1P92A 5FFXA 1BW5A 1R1UA 1VF6C 1Y76A 4G28B 1GM9A 3FWEA 1BL0A 1PNMA 2YUSA 3BLYA 2DCEA 4F7ZA 2Y0IA 2ITCC 4J01A 2VC1A 2R7VA 3ZJZA 2GOMA 1LDDA 1FP1D 3D1NI 2Y75A 1HW5A 4FE7A 2Z5UA 2F48A 5CBGA 2OWOA 1O9GA 1IC8A 2YPRA 2QKAA 3RVZA 1YX3A 1NKDA 3J80N 4JYAB 1MJ9A 5KHDA 5JVTA 1W36D 1RI7A 2V9VA 3ZRGA 3BCBA 4U0VA 3B09A 3UCSC 1ULYA 5CB4A 4DR1O 4JI0B 4GKJO 4D7MA 3KETA 4JI8O 3D3IA 1W7PA 5E3LA 1RPWA 4LF9O 3BR3A 3ROUA 2F93B 2F5CA 3WODF 2K1EA 3JYCA 1LEBA 2RQQA 1Y76B 2F5VA 3PIPF 4Y52J 4GFBA 1Z5VA 1UG2A 1JTYA 2FQ4A 1JUSA 2A3SA 3OR7C 4N23A 2WAEA 2R7RA 3SPIA 3ML6A 2X1CA 3FXOA 1WJ5A 4G7ZF 1T0FA 2IS1A 3CO6C 3KP3A 2MYSA 3JRDA 4Y4RA 1G3WA 4L5JA 1Z9CA 1XMQB 1B04A 1XSVA 2W84A 3LSJA 3OYIA 3ML0A 4I09A 1UMQA 2ZJPF 4ENMA 5L3BA 3T1YO 5LLQA 2Q69A 2ADPA 5M3MJ 3CDHA 4CGZA 5GONA 3JTGA 1HQCA 5CB4B 4OX9B 3GLLA 2GIVA 5HVQC 4R6ZA 2ZM6O 3PFYA 1W7PB 4YIPA 3OYNA 4O2BA 4K0KB 2O3FA 1K78A 1VQ7I 5BQTA 1E3HA 4O4JB 4CA0A 5FLXN 1H89C 1XHXA 3ABKC 2K3PA 4XLAA 3RZOJ 5JJJB 1X2NA 1KBHA 1YJWV 4MO7A 4A3BJ 2GBYA 2O03A 2WC2A 3WU0A 1TGOA 2QKSA 4CS4A 1FTTA 1RP3B 2JS5A 2MLKA 2MW2B 1OR7C 4KT6A 4D0PA 4JTCB 1GVDA 2KLOA 3CPWU 1VQNV 2KHMA 3CC7I 4GXOA 4TWKA 3WB1A 3HOWJ 2ZXIA 3APQA 1GXPA 4DJAA 3IC7A 1FZPB 4WCEV 1YCIA 1Z05A 3DKYA 1IBKO 1PDNC 1R6NA 1AHDP 1T95A 3P9IA 2QQAA 4A6DA 5D5WB 4PDKA 3IL2A 1DPUA 2K9NA 1LUWA 5B66Z 3BPZA 1YX5A 6PAXA 4WFBV 4O2BB 1TW2A 1K78B 4KIFA 1P6RA 1RM1C 4BY7J 1U3EM 1VQ9V 5DCFA 1OCOH 4A3LJ 1SZXA 3DV8A 5LRRA 1YI2I 3H0GJ 1ZARA 2LD5A 3TETA 1OYYA 1GN3A 1FY7A 3OGIB 3I53A 1WPXA 5B5EZ 4BKXA 1FFXB 2QM4A 2AZ0A 3LDDA 4EB6B 1M57C 2ELJA 3H9VA 3W7SA 3A0HZ 4N4OB 2YI9A 2NS0A 1XGOA 3E0JB 5AG2A 5CN0A 5KHKA 4X62O 4LFAO 1WJEA 5EF6A 2BVLA 5BPIA 1ENVA 2ME6A 2ZQMA 2XB5A 3F72A 2XGEA 3Q0WA 4LK1F 5IP7J 4M6VA 4NHJA 2FRHA 2JSCA 2XAFA 3OYCA 2IJKA 2KIQA 3N2GA 3OAAG 4RWUA 3U10A 3ZIAG 1IN8A 4L5IA 3CSXA 1KKDA 2XUBA 5DTDA 4KNYA 3GTKJ 4DQ2A 2X1EA 3FHZA 4K8XA 2NVQJ 1NK3P 3K4NA 2EULA 2P5KA 4DV6O 1HDJA 1DP3A 2VL8A 1N78A 3L1PA 2B7EA 4EMSA 4HRIA 1T98A 1VARA 4LCUC 3ZOBA 3CJHA 2EWNA 4ABZA 2Q67A 3FMRA 3T4ZA 3OV8A 4EATA 5E8IA 1Q6UA 5ICCA 2ZKOA 3R60A 1Q82W 3GFJA 1G6UA 2E36A 3EYYA 4KMUX 5IPAA 1KQ0A 2Y48A 2O6GE 4DOZA 3UNGC 3N2GB 1P7IA 1KA8A 4U87A 5EBLC 4CH3A 3QPSA 2ID3A 1Q6IA 1WB7A 5J9PC 1W5CC 1DGWY 4WF2A 4J11A 5K5RA 1E1QG 4JAUA 4DRXB 2BOLA 4UV8A 4JI6B 2IBZH 5HOOA 3ASNB 3S1RJ 3IAS2 2DYSH 1FIPA 5ICFA 3MMYB 1APLC 2UZKA 3BG3A 4XOPA 1B72A 2HVSA 1RNLA 5JCOA 3ZHSA 5IY5B 3S2DJ 3CJHB 1YVWA 1U8RA 1ZHFA 2OC6A 3JCUZ 2BXYA 5J47A 1JTXA 2ZSIB 3I3LA 1HOMA 4HX7A 1ZGAA 5B1BB 1OCOB 2QSHX 1WJBA 1I1GA 4BE0A 2R9IA 1ERDA 2HOTA 5JJEB 3OYEA 1IZ1A 3AK1A 3VSLA 3HKZA 4RM2A 1MBGA 3U1KA 2JN6A 3T0YA 4MTDA 2UWMA 1ETQA 1B72B 4F3QA 1USSA 2M30A 5L3GA 3SYTA 2CU7A 1XMXA 3AL0C 1O9HA 3OW2U 5EBMC 2R7ZJ 1HNWO 1N32O 1BW6A 2L3DA 4EFEA 2X85A 4HV5A 2NYXA 1S3JA 2K5CA 2ZE7A 1F7YA 4JI2B 4HYEA 3T1BA 1SFEA 2XB0X 5CVVA 3CS5A 4WCGA 3ETEA 3CZ6A 5CYVA 4NC7A 2JEXA 2WPDG 4B3SO 4LD5A 2D45A 1THZA 4QE7A 3TBIA 3WTTC 3ABMC 3OYBA 1ZLJA 3KLNA 3VDXA 2UUAO 2VN2A 1FXHA 2RQ6A 2RAEA 3K03A 5FGMA 3AG4B 4IO9F 2KIFA 2NNUA 2MG4A 3WB2A 4FLTA 3QOPA 4PJ0Z 5LP6C 4BH9A 1W36C 2F4VO 1XNRO 4A3MJ 1YDXA 3KP6A 3WTVC 3V7SA 2OUMA 4NBQA 5J6XA 2DOFA 1QLEB 2JJ2G 2X0LA 1IVSA 2ZNZA 4M72A 2BCCH 2IA1A 5CLSA 5IOYA 3JRFA 4FX4A 1VMGA 1G8XA 2K02A 2P4KA 1BCCH 4NYKA 5HODA 3ZHQA 2KDOA 3C2GA 4X66O 3BROA 1BOAA 3ZEDA 2GWRA 2LY1A 4YY3O 4GX0A 2YU9J 4UCOA 4DO2A 3VYSB 5EYRA 2NVYJ 5GTIC 4MNUA 4CH4A 4DK0A 1GAXA 4RAFA 4NC8A 4HZ3A 3WU2Z 3UO3A 2IU3A 1AI6A 2Q8VA 2L7KA 4GT1A 3HSFA 2LKPA 5ED4A 2WLJA 2PBIA 2PI0A 2QQ8A 3CD6I 2DQ0A 2KRFA 3GVMA 1VQ6I 1W0KG 4ZYDA 4BJTA 4I9QA 4HNVA 2DN0A 1WJCA 1OKRA 5KLVH 4MQVA 3SDBA 3LMMA 4LF7O 3EYIA 3W6VA 2HI3A 2VQLA 3LQRA 4A3EJ 3BQYA 1LUJB 3DLLF 1P2FA 4LC1A 4AQYO 2EX3A 4JV5O 2Q2EA 3O3KA 4JI3O 2WLKA 1FTZA 1YHQV 2CQQA 1YE9A 2BTOA 1IBMO 2OD5A 2L9RA 5KK1A 3WTZA 1SVOA 3OS0A 1GO3F 1D5AA 1MD0A 3AG2H 3VODA 2XTAA 3KZIZ 5JJNB 3G1OA 4PSXA 3GTMJ 1QZEA 2Y4UA 1MZBA 4D7NA 5IJ9A 2Z3YA 3DXJF 3JD2A 3WG9A 4IPAA 4L9VA 1KP3A 4UVBA 3LSRA 3CJTB 1R73A 4UV9A 3OIOA 3B6AA 4QGPA 5EC2C 4IF4A 1A36A 4KN7X 1FOXA 1QNTA 4CH5A 3DPTA 1IXCA 2Q2EB 2EZOA 4QTRA 2BY1A 4LF5B 2ISZA 2NVXJ 2ZT9B 3J7YJ 3CESA 4M6XA 4DIQA 5LHGA 1XMOB 3W6KB 4F91B 4RBOA 2L0KA 3GW2A 1FOYA 2R93J 1VQPV 2EILH 1LVAA 4IX7A 3O9OA 3I64A 2VC0A 1HSJA 1NU1H 5IJ9B 1EKEA 1FBUA 1ZTEA 2V4JC 2Q7HA 2V1UA 1KB9F 2R7SA 1RRJA 4XDJA 2Z1DA 3BTJA 2HEPA 3KCXA 3ICXA 2H94A 2DMNA 3H5NA 1RM1B 3FM5A 4EGZA 2HQ5A 2IBDA 3W7TA 3M1EA 4YG2F 2YICA 2M7AA 1XDSA 2CS3A 2EZLA 2OTLV 2OCCC 3WG7C 3RI4A 2EINC 4DR7O 4PA6A 5F2VO 3HHGA 4I76A 3SJMA 1SF9A 4Y7NJ 1URFA 2EZPA 5LMNO 1NH2B 5TGTA 1FKAO 2P90A 2GXBA 2UUBO 3SFIA 4A5MA 2N05A 1GVJA 2P7CB 1H2GA 2H27A 2JDIG 2LSOA 2PN6A 3EQLF 3JRGA 2R7TA 2KB1A 4K3AA 2JVDA 2FX0A 3PO2J 2RDCA 1IZ3A 1X1PA 1PKXA 3OT7A 3CF5F 3OWTA 1BMFG 2P22C 4TUYA 4TV9A 5F04A 1GLNA 4HF0A 3JSLA 4JI4B 2E5LO 4X64O 2LY9A 4U0YA 2HKXA 4XKBA 3PIOF 1X1DA 3A2KA 5KAFZ 2XC7A 3CCMV 3ZQGA 2UXCO 4J80A 4LH7A 1F36A 5FL7G 5KA6A 2LF8A 2M1BA 2RCVA 5IT9N 4IQ4A 5IYCJ 4DV2O 2X48A 3NR7A 3DGEA 1SD4A 2WAMA 5BR8O 3C2BA 3MZYA 4IVNA 3CWBH 1K7DA 4B47A 1JT0A 1L8DA 3P32A 2Q4PA 2M4GA 4LIUA 4XRMA 4PDVA 4XDKA 2QTSA 1G3TA 1ZRDA 3HXLA 2Q7GA 3TCUA 4BHBA 3CCQI 3TK1A 4PDMA 4TV9B 4TUYB 3GWKC 2XGXA 4NXMO 2YC0A 2OV7A 2QF7A 3HRMA 3LQQA 5DD8A 1PUEE 2JGUA 2RNBA 2ZCEA 2IXSA 1WHUA 5JHFA 3WB0A 5LGUA 3ZGKA 3KYLA 3WTXC 1PL0A 3G71V 3MZ8A 1F51A 3AG3H 4H0EA 4MQ9F 3BABA 1D0XA 1CF7A 4UVAA 4IRIA 2IAIA 1YO5C 1HR0B 1WLEA 3CCVI 3H9JA 5IE9A 2P67A 4R79A 2W7NA 2ADQB 3BWGA 3FISA 1E1RG 2VBZA 2ETHA 4MGRA 3RSNA 4BS9A 1PV0A 4KL1A 2LY2A 4M9SA 1MKMA 1ZRCA 2Q68A 1Z77A 2HHHO 2JK5C 1VQ7V 2YIBA 1XGMA 4CUGA 3CDIA 2HKOA 3K4CA 2A7WA 4D7SA 3UQ8A 3OMYA 4WBNA 1FBQA 1B6AA 3P7NA 1WJFA 2STTA 2QM3A 4WWCA 1QQCA 3HJEA 5D5QA 4DUYB 3DXRA 3T8TA 1UFMA 2CWEA 2IA0A 3LA2A 4XN0A 3C2HA 4XRSA 3JSOA 1CF7B 2CGPA 1G3SA 1GN6A 2F4IA 2HP8A 3TOAA 1OZ0A 1YIJI 4D9JA 3O65A 1J5EB 1AB3A 3NRVA 3LSTA 5J1YA 1SA0A 3HOUJ 1V55C 4A3DJ 3F23A 1SQXH 2AGAA 2Y4TA 3CC2I 4GX5A 5LP6A 1WPBA 2EA4A 1ETWA 2PMZA 2GUZA 2IGOA 4GRIA 1Z7LA 2I5UA 1RC9A 4UXNA 1VIBA 2WADA 1IV6A 1DUXC 2EQRA 1Y74A 1R58A 4QPJA 1TT5B 5JLXA 4XKVA 1F4MA 4WBNB 4C2UA 4DNCA 3DXRB 1P7BA 4LFCB 1X58A 2G7HA 4BL0B 3ABMB 5BPDA 1ZAOA 2CMPA 2H8RA 3DTEA 1X4OA 3I71A 3L7WA 5TJJA 4CC6A 2DWDC 3FBNB 1SA0B 1V54C 2BTQA 2XASA 5B3SH 1EN5A 2QWPB 2DA5A 2IRFG 3S15J 4G6QA 5LP6B 2GUZB 2AHZA 5A9GA 1VQKI 3U9GA 3K9AA 2LFSA 4UCRA 2ZSHB 1BJAA 3QU6A 4QSHA 2XAJA 4BWAA 3ERMA 2DJNA 1R1BA 4G6DA 3U21A 4Z6YA 2QEXV 2D1HA 3FXKA 1S6LA 1Y74B 4ENNA 2DMUA 5IP9J 2GV9A 1L1FA 1HNZO 3IH4A 4YELA 2CV2A 3I54A 4KUMA 3OR6C 2IU0A 3FKIJ 1WWXA 1RESA 1ETVA 2M9HA 3VPRA 5EBWC 4M6YA 3K9TA 3GZ5A 3T5XA 3G6EI 4Y15A 2D2CB 1G59A 1CQTA 3B77A 3CRQA 3OM3B 3RYIA 3H92A 3TP3A 3APOA 2BTQB 4FQGA 2PY5A 5KCMA 3BJOA 1BQZA 1YFHA 2EIJC 3KZZA 1HNXO 2K40A 4BBRJ 1R23A 3FB5C 4JK1X 4C3JJ 2COMA 4MTEA 1LFPA 3EHBB 4N4NB 2HQRA 4YFNF 1OCCC 3K5OA 5EDNA 4RAZA 2HOEA 5K5QA 5KVRA 4M3EA 1YJNI 5IJ0A 4RLFA 1J5EO 4KHPO 2M7BA 1GV5A 2K27A 1SMYF 3RPUD 4LF8O 2VKVA 5DCMA 2W4SA 3FFQA 5J2UA 3RYIB 1XDCA 1LB2A 1TZLA 2Y0SA 1FXKA 3V4GA 4LOCA 2VASA 4AU7A 3DTUB 3ZQ7A 4I0BA 1AVMA 3L70H 4FIPC 4LF6B 3K58A 2KJBA 1DLBA 4ZZLA 4I99C 5CA3A 1X3WB 2DLLA 1HW1A 2ZXJA 1RR7A 5D5VB 2QCOA 4PJMA 4TV7A 3RQ4A 2L9NA 4E7IA 4FPPA 3STZC 3K5LA 4DR6O 1Z91A 3ABLC 1T56A 4JBAA 2M4KA 4ZI7A 5IJ0B 4FLVA 1H2MA 3QOEA 3HOZJ 5H9CA 4B3RB 4PA3A 1U97A 2P6TA 2KL4A 5DCMB 4DW6A 4DZPA 1IX9A 4X1IA 4DV0B 5J2UB 4HAMA 2HQNA 3PSIA 3E89A 2ITDC 2HYJA 1FXKB 4C3HJ 4DV3B 1R4NB 3BZ6A 1RKTA 5E1XA 2YS8A 3FB8C 5B3SB 2DO7A 1D0ZA 3BR5A 2QE7G 3G67A 4HF2A 1SFOJ 1DF4A 2DMXA 3MAJA 4RB1A 3TO6A 4B44A 1DQUA 1S7OA 1S5LC 3A02A 3DU6A 1R1TA 1UAAA 3SQNA 3ZQLA 1Q3EA 2ESHA 3SYCA 1H9GA 3T8RA 2UUZA 3DEEA 3T1CA 1AI4A 4ZI7B 1ZLKA 5HLGA 2ZR3A 2QGUA 1D1BA 2LBFA 4XN3A 4G94A 3J80K 1S5HC 1S72I 4B43A 4X1IB 3JAMN 4FLUA 4MTGA 4KN4X 3M3YJ 1I6HJ 1SC5B 2GSMB 2E35A 1OCPA 3H35A 3OIPA 2NRAC 2EINB 4OAZA 3B8MA 1IBLO 2CQXA 2FOWA 4WXDA 2COBA 1JKPC 4KITB 1H8EG 1YOVB 2PMZN 3VQYA 1MBKA 1KONA 4UFZA 1AKHA 3KP7A 1WI9A 1ORQC 4F55A 1MBEA 3HKCA 1VI0A 4LG0A 2V6EA 3CCLV 3KIOA 2E1MC 4D7TA 1IURA 4BW9A 3PNTA 1GMGA 1SFXA 4NKGB 5HNHA 4B3AA 4GUNA 3ZRXA 5HDGA 3Q0VA 2LBFB 2HU9A 4HV6A 3HOXJ 3MAQA 4JPRA 4RB2C 2GXGA 3S3OA 4LNUB 2KP6A 2VJ4A 5JR3A 5DS9A 3THOA 2N8GA 3OMNB 4DV5O 3VWBA 3BY6A 3JSNA 1I94O 2JJ7A 2E34A 1ZKGA 2DDBA 2Z99A 1R3LC 3PNVA 3S2HJ 3C1DA 5E3MA 4A2UA 4IHSA 1AKHB 1Y67A 4A3FJ 2EBIA 3KYDB 1JT6A 5F0CA 3COAC 5FLXK 1AJQA 1WH7A 2JA2A 1I5ZA 3PSFA 1TT0A 4ZYAA 5LFAA 5H5NA 2R5ZA 3HKCB 2Y0PA 4WFGA 4LG0B 3HM5A 1ZYRF 5FLMJ 4G27B 4Z2WA 4X65O 1ZG3A 2VBYA 3F8BA 2LLKA 2LJ2A 3ASOC 1CXZB 4JI2O 4ZDOA 4FVMA 1MABG 3QO5A 4P9FA 4MVQA 1U9OA 4NDLA 3ZHRA 2WA4A 2E2HJ 5FLVA 2IS6A 1K4DC 2HZTA 3K4JA 5E1WA 2VWKA 1PNKA 4ETSA 1KQSU 2QA4I 2CUZA 3LL7A 5FRMA 2FNAA 5C3EJ 2CW7A 2JEUA 4LF4O 1MNDA 3BTLA 3N05A 4WXHA 2LFRA 1Z2GA 2RDPA 4IL6C 2XGDA 4M3GA 4NNJA 4NTWA 1BBYA 3BPVA 5E8GA 2VPLA 4XQFA 2W0XA 1O7FA 4Y3OA 2R5ZB 2IVMA 1VQOI 2D5VA 3HRSA 3RQIA 1VQ4I 2WLMA 4XLPF 1MNGA 3GVAA 5IWAO 2E74B 3BZKA 3CRRA 3F8CA 2Q1ZB 1F9NA 3ZQIA 1HDDC 2YXLA 3M7MX 3JTHA 1VQ8I 4E4EA 4ZIBA 2LC2A 3HOTA 4P2ZA 3AFHA 3Q9VA 2CGNA 2ZE5A 2Y0SN 1KMIZ 4W4KA 3T1HO 2L9SA 1BS3A 4F6RA 2VPRA 3B02A 2ZR2A 5L3EA 4J9ZB 5IDJA 2ZFUA 1X1CA 1FAFA 4B3XA 3VEPA 4FLWA 1OCTC 2QENA 5FRNA 5EJCA 2M7WA 4J42A 5GPCA 1EZJA 2M87A 5TISZ 2VQFB 1D2DA 4UUJC 1V55B 3LAPA 1Q6HA 4MS2A 1MMSA 3KP4A 5L3CA 3BA9A 1WFXA 1M93A 3L9DA 4B7EA 2K9PA 3HG9A 4H4KC 2HFEC 2BEOA 3ZS8C 2NNNA 1KU3A 4IEJA 4PD4F 2VUMJ 2ZDIC 2HDCA 3AAFA 2DK8A 4HDUA 2TRTA 4JI5B 5LHIA 2JPBA 4HOBA 3SZTA 3P9KA 4WFHA 4F6RB 3FB7C 1LNWA 5F27A 3TMOA 1K6OA 2DFFA 4B3MB 3IUOA 3JRBA 4ZC3A 2WLIA 1FJGB 4M9ZA 1FX7A 3SPJA 4GO1A 2MLGA 4LLGF 5CQEA 4CXFA 1NK2P 2GBOA 4I7ZB 4ZHQA 3ABUA 3E6DA 1HP8A 1XC5A 3WHCA 5TRDA 4BDYA 4Q5SF 2DAOA 1AA7A 1DF5A 4J7JA 2KFDA 4UCTA 3SDLA 2P5OA 2EJ7A 3JR9A 3KP5A 1W0TA 3I55V 5LYJA 1TUBA 3RTRA 1R71A 1Y66A 2N74A 2FBKA 1ZGWA 3H1IH 2O0YA 3GTQJ 3RJPA 3JATA 5EGOA 2CK3G 4AC0A 1N33B 1Q90D 2G7UA 2HNHA 1MDMA 2HTSA 4BACA 4YJ3A 3IFXA 4MEYF 2CUEA 1ZR4A 2KQXA 1MG1A 2WLIB 4EJVA 1PYVA 2NLJC 1TTYA 5HLTA 1TNSA 1J75A 1PD3A 1XMOO 1R4MB 2GTAA 2V9PA 2MGQA 4ZHQB 5M5XJ 3CMYA 2X6BA 2EIJB 3HPGA 3G73A 3PN1A 4G12A 3CX5F 1ZL8A 4BR6A 1TA8A 5B1AH 4BXFA 5IP6A 1OCCB 3UKMA 3CCQV 3ZRWA 3FIWA 1TUBB 4TQDA 3BDDA 1HF0A 5LYJB 2L5QA 3W7UA 3JATB 2QKLB 5EGOB 3WTWC 2B9SA 3ULQB 1ZQ3P 2YEVA 1Y8RB 3AG7A 1KECA 1I50J 3OY9A 4U3JA 2BZTA 2IA2A 2DT7B 3C18A 1MDMB 2XGCA 3ZMSA 4YJ3B 3LOCA 1SQBH 1D8KA 4IZZA 2PTMA 3HSEA 1Z1DA 4UCUA 3G4SI 2XNDG 5LD2C 2X4HA 3QQAA 5C44J 2STWA 1I6XA 3LSPA 3OEEG 2FYUH 3ZXSA 2HLDG 4O4JA 1JKRC 4I01A 5KHGA 1ZL8B 1IN6A 3VQVA 1NG6A 2L9VA 2UUCB 4XRSG 2K9QA 1TUEB 4ZDPA 2DYSC 1NTKH 2K9SA 3ZRWB 2LP7A 2FMLA 3BP8A 4JAVA 3IWZA 4RO2A 1EV7A 3BEHA 2YEVB 4MTOA 2EV0A 5IYCO 2UU9B 3SXYA 2CUGA 2DYRC 4D1QA 4U3JB 1LVKA 4QWQA 4BQNA 3HSRA 1G4DA 1Q1HA 2IJIA 4U7OA 3RYHA 3W3CA 3OTOB 3HZJA 2O8KA 4H13B 2FJ1A 1N36B 2D2WA 1E3OC 1Q43A 2DOSA 1VQ6V 5B1OA 3DBLB 3KEQA 2JZYA 4E7HA 3FYEB 4XDLA 4EEQA 1IDYA 1ZWIC 1KGSA 5A2QK 3L2QA 3ZHUA 3E86A 1DK1A 3ZQHA 2R9RB 1DTOA 1QGPA 3UM7A 1KYOF 1I3AA 4MW8A 5FNVA 4X9QA 1B06A 5HNFA 2B0LA 2P4WA 1K5SA 1ZLZA 1VQLV 1AI7A 2OT5A 1RR8C 1R49A 3QPTA 3X2QC 1POGA 1YS7A 3ASNH 1Y1WJ 4TSFG 3GB7C 1FFXA 4NXNB 5IY5H 1U5TC 4Y33A 4C2MJ 1XILA 2QSAA 3RYHB 1O4XA 1XL4A 2M2EA 2GQQA 1FPQA 5GTHC 2ZJ2A 3E6MA 4LJZF 1Y8QB 2GDSA 1JMKC 3IWFA 1FFTB 2OCEA 2IP2A 2XIGA 3KPHA 3QP6A 4P30A 2ZNIA 1FWZA 3IRQA 2OU2A 1KU9A 1SETA 3TEDA 1OYIA 4FLZA 1WRJA 2BY2A 2K4JA 5B1BH 3SYOA 2BV6A 2Y69C 1BC7C 3BCCH 3K3WA 4ZYGA 5B1AB 1JKQC 1ZX3A 5FNVB 1Q81W 4XONA 5E3OA 1O3QA 2HQAA 2DQRA 1JVMA 2DQ3A 4L8JA 3M8AA 1KYZA 2KISA 2L7ZA 1SQQH 3D0SA 3SYAA 4AWXB 2UXNA 4DYQA 4S05A 1K5QA 4HBNA 3SZGA 4MT8A 3IH2A 4CCOA 5AIQA 2YU3A 2M3AA 3H3VK 3PQJA 1GXQA 1BHBA 1B59A 3KLOA 1W0UA 2QZ8A 4PK4A 2LYCA 4M3BA 1MMGA 4NC6A 3TKYA 1HNZB 3J7ZI 2ZXWH 1V9PA 5KX5A 1VTNC 2KRCA 2JA6J 3VB2A 3OUFA 4FETA 1IO2A 1L0LH 1W0JG 2CJJA 2OTJI 3L73H 1XOUA 4P5OA 4HEA2 4DZJA 3ASOB 2RGVA 4DRXA 4UUTA 1AJNA 3PQKA 4Z2YA 2DBBA 3G1MA 3K70D 3AG4H 2E75B 2HTJA 3FD9A 4DV4B 1NBMG 5FPOA 4C2TA 1V5GA 3MVPA 1JFFA 4E6KG 1G4YB 1SESA 5CJ9A 3H3ZA 1UHSA 2DQLA 1BR4A 4UB6Z 3SJQC 4LFCO 3E8HA 1Z67A 5JVGF 1SEUA 5BMVA 5KX5B 4OWRB 3OUSA 2HVKC 3K6GA 2NXNB 2W48A 3HIFA 2G0EA 2DN9A 2DMPA 5J40A 1JJ6C 4JF3A 4AHCA 1OCRH 1SQVH 3FF5A 1HXDA 1ACIA 3ETDA 1LEAA 2M34A 3TO9A 4RQEA 4O2AA 3IC9A 1YTFD 2VKDA 1L0NH 2B9ZA 4AILC 4HG2A 2AQFA 5F1RA 1ITYA 2JJ1G 3ONQA 2ZXHA 1N4CA 4UB8C 1E79G 2E1NA 2CE4A 2ZDIA 4I5SA 4LFUA 1D1AA 1JFFB 4F4LA 2PJPA 3CCUV 2JMWA 3OD4A 2ELKA 1Y0UA 3DP7A 5DN6G 5BMVB 1IXBA 1MJAA 4ANJA 4DV7B 1VQMI 4L87A 3PUBA 2LREA 2H3OA 4MTXA 2K3FA 5ILSA 4XLNF 4RAYA 5FD5A 5J8FA 1EJ9A 1ZK8A 1EH7A 3RIRA 1M4UA 5IYBJ 1K79A 4TT3G 3J80Z 1SC7A 1W2BU 3S17J 1OPCA 2HVJC 4GGGA 3F7YC 1XX5A 2MD5A 3CCYA 3L00A 2K86A 5EEHA 5K1YA 2AXTZ 2Q6AA 3KCYA 3RWRD 1HC8A 4HF1A 2HDWA 3UO2A 1ZH5A 5IT9K 3F6OA 3G80A 4GX1A 2IJLA 2XAQA 3OTFA 1XCBA 2NOGA 2X6AA 3IHUA 2ETNA 2EK5A 3ZQCA 3RVYA 1WI3A 3RKYA 3PM1A 2ZXWB 3H1CA 1UHWA 3MD0A 2KG7A 4BUPA 5KHIA 4K2EA 3AG1C 3CJNA 2LDUA 1BC8C 3SR2C 4LF6O 1S7EA 1VF6A 1HKSA 3ABKH 3S3MA 3KCCA 4ASUG 3WTYC 3ZHTA 3CMEI 1XSXA 5L3FA 2YXYA 2L4MA 2JTVA 3CUQC 1B6QA 2F95B 2QGNA 3A2FA 4DUZB 1I08A 4ZZDA 4GYGA 5FLXZ 2C2AA 3CUOA 4GYCB 1MBHA 2X6YA 1R6TA 1NVPD 5D5PA 2VQEB 4X20A 3SYPA 4P9UA 1QHTA 1HKQA 4W1UA 4R8HA 3LA3A 3A0BZ 3CP8A 5C8YA 2DT5A 4EQQA 4I9WA 1VF5B 2CH0A 2CW8A 2M0CA 2KG7B 1K8AW 3BZCA 2XHKA 4A6EA 2MH2A 4FM0A 5LOVA 4BAYA 1K92A 2OA4A 3SFZA 3O8GA 1Z3YA 2A69F 3KFWX 2Z33A 1AR5A 1OCRB 4MHGA 3GEZA 2NS8A 3JRAA 2WWWA 4II2A 4DXWA 4YJ2A 5A2QN 1XNQB 1JJ8C 4O4IA 3VYRB 4MLOA 5LHHA 1XG1A 4N9IA 4PDLA 4CH7A 1LDKB 2LVSA 3F8MA 1K7AA 3OMAB 1V5FA 2E7WA 1ZN2A 2FBIA 4JGSA 1BIAA 2HZDA 2EIMC 1LQ1A 1OISA 2V7QG 3RFRA 4X20B 5JQGA 1NR7A 4CSWA 1X4PA 1FP2A 3DWLE 4I98B 4KFCA 3GTGJ 3WE3A 1VF7A 3UKGA 1NZ6A 5C8YB 2QSFX 1YJ9V 3QPHA 2BSKA 4G9YA 4EB6A 5LOVB 2ZIMA 2GA1A 3NWTA 2RNGA 1QBJA 4AVZA 5IY5C 4E7ZA 4II3A 2KMUA 2XKPA 2CGOA 4GX2A 1VQOV 4YJ2B 2ESNA 4JZGA 1M56C 2CTWA 4KIBA 4XNFA 4O4IB 2Q7EA 4RQFA 2BY3A 4ZOLA 1EH6A 4FM1A 1PP9H 4YHHB 3WGHA 5J4YA 1Z3XA 3K0LA 1GKFA 3DPLC 4HBLA 4CCJA 2F6CA 4NUBA 1OR7A 5EZGA 1WJAA 1YLFA 4G8XA 3CE2A 3CP2A 5FKLA 3TDUC 1J9IA 3J7AY 4I0XA 1U5TA 3ZQFA 3QYEA 3IKTA 5B1NA 5JQGB 4JI7O 1FMWA 4DR4B 3M4OJ 4TOIA 3T2MA 1YS6A 2BSKB 3OGCC 4DYLA 2FSWA 4KIGA 1DGRM 1A35A 3PFIA 3ETQA 4OGQB 1QVTA 3SPHA 4R7CA 3M8JA 2JA5J 3ABKB 2UXDB 4RUFA 2M6YA 3JD4A 2AXLA 3LAJA 4ZOLB 1N34B 3MKWB 4L0ZB 3A03A 4A69C 5D4SA 1HW2A 1BHAA 5FJ8J 2DFHA 4A0YA 2EV6A 5J8CA 1FOKA 2ID6A 1OMIA 2JRTA 3C3WA 2F4MB 5HS8A 1GK9A 3X2QB 2XVCA 4LB6B 4GKKO 2QVOA 2R3SA 4I0XB 1U5TB 1FIAA 3FM3A 1VNDA 2GOXB 3CCSI 1SS3A 3LNMB 3EDPA 1HDPA 2E19A 1TWAJ 2P4VA 1JKOC 2Y30A 4O3MA 2RV8A 1WNSA 3W7XA 1R7JA 1IDSA 1S7AA 5DM6F 2O61A 1WA8A 3LDEA 3BOQA 4JX5A 3S14J 5B66C 1IAWA 2QJ1A 4YXWG 4QE9A 3Q3SA 2VQHA 2Y69B 2A05A 3K79A 4FZ0A 3E5UA 4LB5A 2OAZA 5E20A 1MA1A 4K35A 5KUMA 3E2EA 1IN5A 2K4BA 4IOCF 4MSWC 3CCRI 1GN2A 3K70C 5E79Z 3MCZA 2LNBA 5BNGA 3FBIB 4RAGA 1YTYA 1JQ0A 5H6RA 1VP7A 1M57B 2CH7A 3CCEI 3TGNA 5B5EC 2ZJQF 4I4TB 1XQ8A 5ILUA 2I10A 5D8KB 4FASD 1QPIA 2Q73A 4HLYA 3A0HC 1WA8B 3M07A 2FQ3A 4PZJA 2LQTA 4A5UB 1YF2A 2IS2A 3E6CC 2QWWA 3BJAA 1X1AA 4ENJA 2FTKA 2BXZA 3RYFA 2IGKA 2XSJC 4JZ2A 5IT3A 3MHSC 1ZG5A 4IRHA 1XSDA 2A07F 5JFRA 4GKJB 1XGSA 3F6VA 1D5VA 4CS2A 2JRIA 4DR1B 3OR1C 4JI8B 1Z21A 4RGXA 1LFBA 3ABMH 3RKXA 4LF9B 4LGWA 4PA4A 2CH7B 1QVFU 1IXRC 2DPUA 3TJTA 1R22A 1MJBA 2V1XA 2W82A 2EIKC 4UCSA 3G4SV 1SFKA 2XT9A 3B73A 3I56I 3BRCA 1I3QJ 3NARA 1R1VA 3W2WA 2P8TA 3GWZA 3JAMK 2H6BA 3RYFB 2R70A 3G6BA 3BJ6A 4P9PA 3EUKL 3B2EE 1O7LA 4DR2B 2PI4A 5GAHJ 5DUKA 2ZBKA 2YR2A 3K57A 4ZTFA 1I1SA 2H1LA 2ZM6B 1K34A 3J7AU 3OYJA 1P4RA 2OIGA 3KEYA 1SANA 3BPXA 2Z16A 4E7SA 1W5SA 4FHTA 4AYBN 3FK7A 4OPAA 4LFBB 2W1OA 1R3JC 4FISA 1RETA 4EEFG 1H38A 2W57A 2N04A 1K4SA 4ITVA 3L09A 3DKXA 3B4SA 2CQKA 2YX4A 4B08A 3KX2A 2VQGA 4RLQA 2YDEA 3SPCA 3PUFA 2MH9A 1IRFA 4C9YA 1JUPA 2WY7Q 3JCUC 1ETKA 4G2KA 3JRCA 4L9JA 5EEGA 1EN4A 5K7ZA 1L3LA 3M9AA 4XLCA 1BI3A 2Q5ZA 5FROA 1IDZA 2L54A 3H1HH 1EF4A 1MH3A 1TP4A 4RB3C 2BOBC 2F66C 2ADUA 2EFQA 3BG6A 1ZTRA 3WE2A 4JP0A 3CC7V 1T2KA 4BIUA 1YQAA 3CUQA 1N0NA 1WB8A 4RUEA 1S72V 3UT5A 3QPLA 1U9NA 3FXQA 1LPQA 4IHYA 3AL0B 2PZSA 4JYAO 2PLYA 3SDGA 1EFRG 3GX4X 1QU7A 5JLWA 2ZIOA 4JI0O 3K9SA 2L01A 4ZYHA 2IGMA 1F1ZA 2EFWA 2HYGD 3OOPA 1WP8A 2R9AA 1FD9A 3BHPA 4JI1B 1MBFA 2XRNA 4B3TO 2DTZA 2C6YA 2QWRB 1FC3A 1D0YA 2XF5A 3R0JA 4X62B 1YI2V 5LRSA 4LFAB 3LSHA 4BY1J 2W6IG 4KXRA 4ZBMA 5D6EA 2AO9A 4BGDA 3RYRA 1HW7A 1HSTA 4B1RA 3AK3A 1XDUA 1K4CC 3TW6A 4NTYA 4BU2A 4DYCA 3H5RA 1XMQO 3CUQB 2Y2ZA 3UT5B 4UUVA 4QNHB 2NN4A 1D1CA 2H8WA 4IHVA 1Y6XA 2BGCA 3GF2A 1UPGA 1N36O 4OX9O 2M5WA 2JSPA 3QG5A 4O4HA 2MSYA 1JHHA 4PJ0C 1WSUA 1AOYA 3FKJA 3GFLA 3GUDA 1W1WE 1J5YA 2AS5F 2DOAA 2F4OB 4CCMA 1B9NA 1XTAA 4K0KO 5KAIZ 4XL9A 2GAUA 2VONA 3N4MA 4N9HA 3VFZA 1BZKA 1P7GA 3QP5A 1FYKA 2OCCH 3WG7H 2E2JJ 4I50A 2EINH 1I27A 2WWYA 1LDJA 3HOYJ 2F43G 4R8CA 3S1QJ 1XMAA 3MFKA 3CXCU 3EETA 2A61A 3HC7A 1G2HA 1OCZC 3HR0A 3I9V2 3BR6A 4LF5O 3WU2C 1VQ9I 1SQGA 2EFPA 1H8HG 1FYMA 4MVOA 1F4KA 1B9MA 4O4HB 5EIBD 3CTAA 2E60A 4R50A 2ZO4A 2CTRA 1D8JA 3U1DA 1NI8A 3B40A 2HEOA 2AHQA 4KISA 3CRCA 4OPHA 1ORKA 5H2FZ 4X0GA 4EJOA 1CEZA 2EV5A 3F3XA 4DK1A 1M56B 4RA2A 4KA4A 4I50B 1SAXA 3CLOA 4MIMA 3G1LA 4ZTJA 2P6JA 4JTAB 1SERA 4DR5B 3QVNA 3GTJJ 3VQWA 3J81N 3GZNB 5EZHA 1BI1A 1HCRA 3BR0A 4CZZA 2IEKA 3CMAI 3S3XA 3I5DA 1JGSA 2ZE8A 5J3LA 4BXXJ 3QRFF 3KZIC 2IH3C 3K4LA 3BTIA 3RKWA 3HBLA 1MOFA 2D1VA 1T33A 4WK8F 3RKQA 3OSFA 2ELHA 5IT9Z 2W85A 2GTSA 3BCAA 3ETGA 2CUJA 3AKZA 4KT5C 1HNWB 4M71A 1N32B 5K1XA 3HUGA 2VWJA 2WV0A 3LFKA 4HNTA 2P6SA 3FMQA 1Q86W 3FK6A 1COWG 3GFMA 4O6JA 3IV5A 4CHUA 4EM0B 2K85A 2Q0AA 1K3EA 2CRGA 2YSUB 4C7UA 2WAQN 3K10A 1LUVA 2BBYA 1TWHJ 4QJFB 1A31A 1BN5A 5M5YJ 2UUAB 4EM2A 1SVLA 4AI8A 4PFOA 2ILMA 4H0LB 3JD1A 5BY1A 4LK0F 4OU0A 2A68F 3G2BA 3TDZC 2F4VB 4PFPA 1I0HA 5JVDA 2NOJB 2X6WA 3HUGB 2OCCB 3WG7B 3V7CA 1D5YA 2PG4A 1EH8A 4BW5A 1UG0A 4JI6O 4PI0A 5K1PA 2VODA 3LSMA 4J41A 4X66B 4WX9A 2GXAA 4CBCA 4OIOF 4ENKA 1U78A 2XUMA 2WBMA 2DTRA 4YY3B 5D6FA 1V55H 5EEAA 3CJQB 2GZWA 3D5SC 4CYDA 2LRDA 3WGIA 1WJZA 2IS4A 2W00A 1T0FC 5HDNA 4IIJA 2ZKZA 3CC4I 1SD6A 4WFFA 4WFAV 2F5FA 2P5LC 1BR1A 2O5RA 1MNMC 2H6CA 2YS9A 4LH6A 2Z2SB 4X1YA 5JVDB 5F0FA 2QSGX 5LEKA 3TO7A 2LK2A 2OJED 4ZJZA 1K97A 3H01A 3H1KH 3JD0A 4CZCA 2FB5A 4MVZA 2XF7A 5EYPA 1XL6A 3SJAC 1T6SA 2TCTA 4XLFA 5KAFC 4A3KJ 2CDYA 3IGAC 3QNEA 3BG9A 3FXMA 3QU3A 5LMUB 4LF7B 3CD6V 4PGGA 1V54H 1PPJH 2QQ9A 2KT0A 1XEQA 4NB5A 1X4TA 2Q9LA 5BXZA 4AQYB 4JV5B 2QUFA 1ON2A 2EIKB 4A12A 4IIJB 3MWMA 3KP2A 4LBEC 4JI3B 1E2XA 2EH3A 3F7VC 3C90A 5BMZA 3CCJI 4LP8A 1IBMB 2BHZA 4L5EA 4ESJA 1ZGJA 3N97A 4DGWB 3F21A 1U8BA 1I5YA 2G38A 2CG4A 1UELB 3ZMVA 1F43A 1BR2A 4X1YB 3SPGA 1IN4A 2VS0A 3DU5A 3QYFA 3IRRA 4XICA 5FKNA 3K1MA 1QQIA 5LL6Y 2A5WA 3D8CA 4JYKA 4X1EA 2B1GA 5EYPB 1Y56A 2A9HA 4BIZA 2P5VA 3HDDA 4DW0A 3PO3J 4GCVA 3RCOA 1SKVA 1UHMA 1Z5WA 1KQ9A 3EXAA 4ASNA 2XKOA 2EIJH 2A0LA 4HX8A 3CRAA 1OLTA 3GZ6A 3QO8A 2EB7A 1F4NA 4Z1VA 4HSTA 2Z9OA 3FXUA 5E1ZB 1I7FA 1NH2D 1OCCH 1AP6A 3HB9A 1J59A 3FXLA 1FXVA 2V6CA 2MC3A 1QVUA 1JI8A 4CICA 2VT3A 2OZUA 4CCKA 1WP7A 2HXOA 4L18B 1H0MA 2WV1A 3D5LA 2V79A 2R5YA 3L9FA 5E1AC 3SEZA 4CDGA 2R7OA 3KYCB 4E7KA 2BE3A 1P4XA 4M3FA 4IYHA 3LSQA 1TWFJ 3FDYA 4FX0A 3TXQA 5F6FA 4XK4A 1R9TJ 2ECCA 3B8NA 2YUAA 3ZCCA 4E7LA 4OMZA 4BNCA 3K06A 4LNUA 3MQ0A 4C3IJ 2LW7A 5D4RA 4MFDA 3CCSV 4DR7B 1FOWA 1Q1VA 5LMNB 3E3VA 5BS6A 1ZAUA 3DLAA 4YEJA 2DODA 4EV0A 3DPUA 1AI5A 4Y17A 2UUBB 1EA3A 1ZSPA 3FAVA 1SQFA 1QO0D 1MSFC 3OYGA 4PUSA 2OPTA 3OIQA 2CW0F 1MGTA 2HR3A 3HTUA 3Q0UA 2R5YB 1RUNA 4NR1A 5HFMA 3TL4X 3H0DA 3ABTA 5HS7A 3L74H 4QLCU 2R7FA 4P55A 4P96A 1VQ5I 1OCOC 1TWGJ 1V54B 2QDOA 3VSKA 5BOXA 2YSRA 4X64B 2E5LB 3OL4A 4I7HA 2HPMA 1NR1A 2UXCB 5EIBC 3CMAV 5FB2A 3A4CA 1SAUA 5F1JA 1LJ9A 2V7FA 2OZ6A 3FAVB 3K0GA 1G8MA 5JCOC 3NWSA 1SMTA 1OHHG 4DV2B 2QLZA 1KD1W 3ZRSA 5GADJ 4AM3A 1FSEA 1SD7A 1VQPI 1UCRA 1K33A 2E76B 2MA3A 2V26A 2X7RB 4H37A 5HS9A 4L9NA 4IHJA 4R1HA 1TVKA 4F52A 4Y13A 1XS9A 4A3GJ 4NXMB 2GLOA 2QBYA 1ODDA 4FT8A 4GYIA 1OCZB 5FD6A 4HQMA 3JAMZ 1IRGA 3JAWA 5KHJA 3EUHC 3R6SA 2VLAA 2VI6A 1NTCA 2XAUA 1K4TA 2OTLI 2DMQA 2XSDC 4NTXA 4IHXA 4RB0A 5FKKA 1N77A 3MD2A 1CPYA 4PELA 4RS8A 3F8NA 4OXSA 3I56V 3K4MA 1R5ID 3AG4C 2DWEC 1T08B 2V9KA 2CFXA 3IJ4A 4FLXA 1R5HA 4LLLA 1DDNA 1YRNA 2CV0A 3O2PE 2Z0AA 5H20A 4FE4A 3K0DA 1RKWA 2CYYA 1C0WA 4FJCC 4ON0A 4IHJB 2O7OA 2PX9A 4O5VA 5FKMA 4DBRA 1TVKB 3Q5FA 2P7TC 5BZBA 3CCVV 1XGNA 2MFZA 2ZJRF 1JPXA 2YIBD 2HVQA 5CQGA 2K9LA 5DUIA 2QBYB 3C3SA 4DV1B 3TP0A 2VB6A 2M8EA 4BXUA 3JAWB 2ZC2A 4MVUA 5GTIZ 2QM8A 2RNJA 1HKTA 4TQFA 2R7DA 3JRHA 3RZDJ 3LSSA 2PFBA 4RDUA 1QPMA 2VQCA 3BQZA 3CCMI 1WN7A 2JRMA 2CAZC 3ASOH 4JX4A 4F93B 3ABLB 4CC5A 1YRNB 4LG3A 2LP0A 3I5UA 3OR2C 3DQVC 4FLYA 1ON1A 4JI4O 1BL8A 3K5MA 1FLIA 3JASA 3F0CA 1E3PA 3DSQA 1YIJV 2DJVA 4Q47A 4WF9V 2JVGA 4J00A 3CHXA 1TWCJ 3L72H 4X8AA 2VE9A 4D6TH 1YITV 2EZKA 3CC2V 1BI0A 4B7KA 3FHNA 1NG7A 3DEWA 4V19K 1JJ2U 3G71I 2YX7A 3E6BA 1Y39A 5LBQA 2FMYA 1H88C 4I4TA 4V2FA 3A01A 1YZBA 2X6CA 2LKXA 4J7KA 4M73A 3W2VA 2L7MP 3S32A 3EVKA 3K2AA 1A6QA 5LGNA 4DR2O 1A04A 3JASB 2DA1A 2OQRA 1BI2A 2LR8A 2RREA 4P1WA 1RFYA 2VT2A 4U7NA 2HYFA 4ABMA 2CQNA 3CP1A 4ZDLA 1YW8A 3U0ZA 2LW1A 1W5TA 1BIBA 2BYVE 1AILA 3H3UA 2HG5C 1X3UA 1VZ0A 4A3IJ 3Q4HA 2PEXA 3SHFA 4LFBO 2E3CA 3OFNG 4JOMA 3JALA 1VQKV 4HNAA 1M5IA 2H8PC 2AW9A 2CV1A 1TNTA 1QLNA 3FKSG 3E8GA 1K9MW 2JA8J 2E1MB 4A0ZA 4DR3B 3I4NJ 4JYCA 3A01B 2WY8Q 2MD0A 1R3KC 3OYKA 1KYWA 1QHGA 4UCVA 4WXCA 3GFIA 1HNXB 2HJFC 2KIMA 4XMYA 2PJRA 4OAYA 2GM4A 2CTPA 1WGXA 3CB2A 2X51A 4HLXA 5GONB 4OIRF 4Q4ZF 5CA1A 4DUYO 1IN7A 1FNNA 3CDLA 3KEOA 2DJIA 1XCVA 3G6EV 2OCHA 5LGTA 1US6A 4JTDB 3ZCOA 1HWYA 2A6HF 3HGYA 4LMYA 4BE2A 1ZREA 1L0OC 4CCNA 3Q4HB 4ZH4F 5J1UA 4KHPB 2W6JG 4LF8B 2E1CA 3JALB 1NQTA 4HNAB 2IM9A 1TLHB 3I59A 1ETXA 5DEQA 1KKCA 2A6TA 3AEIA 4EFBA 3GCMA 4HA8A 3OYHA 1VF9A 1QZZA 5D5XB 1YJNV 4JI1O 4Z1MG 1KP2A 2R7WA 4HSRA 2PJRB 4B48A 3W7WA 5J2TA 5CA1B 2DFIA 1UFIA 4DR6B 3OL3A 3LSUA 5J1RA 1RSOA 5LEJA 3FYIB 2JQ7A 4RGUA 3V8JA 1UJ8A 2QEXI 4IJAA 3ZMTA 1ONVA 2VE8A 1P4WA 2KDZA 2XROA 2MBFA 2R0QC 2R7XA 2FKXA 3BFRA 3I59B 3QYBA 3DEUA 1Y0NA 2R7UA 4DW1A 3K59A 3C3TA 1FT9A 1R36A 3F9KA 4O2AB 2VJ5A 1D3YA 1RZ4A 2HWVA 5JH7A 1KUQA 3GLXA 2QYOA 3ZR8X 3QAHA 3E8BA 2FF4A 2XPUA 3AG2C 4G6TB 2O8XA 1SFUA 1K61A 2E2IJ 2ARHA 5J2TB 3RT3C 1GV2A 2DK5A 4C30A 3R66A 3S2WA 2VJIA 5E17F 1MMMA 4HZFA 3A1YA 2EFOA 1X3ZB 1RSOB 2WLNA 3B6CA 1M90W 2L4AA 4UUSA 2W0FC 3GO5A 3DBHB 1JXSA 5TISC 3LSIA 2LOOA 3M7GA 1YEWA 2QTOA 1IBLB 5ERIA 2DU9A 4IQJA 5JH7B 3HYIA 1FPOA 5FPRA 5KHHA 3E7LA 4IKFA 5J4VA 2LF7A 1OV9A 3QF7A 1ETOA 3FX3A 2M8GX 3OSGA 4KMFA 4V2GA 2EILC 3OS2A 5C93A 1IRZA 1Y4MA 3DFGA 3RPUA 4XBFA 1YW7A 3V42A 4LLNA 2F5DA 4KJZA 1E17A 1CP9A 2DYRH 4IHTA 2UXBB 2R4GA 5H6QA 3BR1A 1TL8A 4BJ6C 1D5NA 1K83J 2JK3A 2LKSA 3E5XA 3CO7C 5ITZA 4UUSB 4DR5O 3SZPA 5HDKA 1NS1A 2DA3A 2VRZA 4DV5B 3FXJA 1I94B 2P0WA 3EUHA 2ZB9A 1BE3H 1ZUQA 4BHCA 3JAKA 3L2VA 5GAEJ 2HVRA 4L9TA 3CC4V 4BQQA 2ZMEC 1QR9A 1OYWA 1MMAA 4AD9A 3RW0A 2OYQA 1IW7F 2H09A 3EUAA 2CO5A 2DA7A 3X2QH 4EVIA 3LFUA 4A5NA 4CYCA 3QTCA 2Y31A 4B3RO 2LFBA 4X65B 2NNYA 1H8AC 3N27A 1H9TA 3NXSA 1OFCX 4DV0O 4F92B 1K73W 4L0YB 3I58A 1V5EA 2FU4A 2RVCA 3LSKA 3TQNA 2WLLA 5ITZB 5EZYA 4DV3O 4IT5A 1A6IA 3K7AJ 2VXZA 3H9GA 4EJUA 2KJCA 2FEZA 3K2ZA 3R65A 3HEFA 3JAKB 2XF6A 4LF4B 2Y69H 3IAM2 3CCJV 1QHHD 1P7JA 1X19A 3RBZA 1IXSB 2QWNB 2HDDA 1FMVA 1YYVA 4MW3A 4N21A 2MC4A 1YXBA 5GPAA 4CYCB 1I5XA 1PJRA 1YG2A 1HBXG 5IWAB 2QA4V 3BAAA 3ZRVA 5CVJA 3R61A 2RMKB 2K9MA 2FE3A 2X9DA 2WSSG 4AYBA 2JS3A 5AONA 1GH6A 2IW5A 3E97A 4RMNA 1QBZA 2WLLB 2UXXA 3CCLI 1DPRA 1PM9A 3JD3A 5EZYB 4AIJA 2F5EA 4I0AA 3JARA 2QM7A 2GA2A 5KMGA 2HPIA 3E5QA 4O4LA 3T1HB 1VQ4V 3T4DA 1GRJA 3AG3C 1BA5A 4U7DA 1DU6A 1XUQA 2QWOB 1MIJA 3GTLJ 5DEDA 5CA0A 2DYSB 4W97A 2WA3A 1JE8A 3RPQA 2Y0MA 3GBGA 5M5WJ 1VQ8V 3RN4A 1XI1A 3P3PA 2PYLA 1F5TA 2XAHA 1H2KA 9ANTA 2BE5F 1CGPA 4AIHA 2DYRB 3DC6A 2CFOA 4LR3A 2YI8A 1GM7A 1Q5OA 3OMIB 1ZELA 4IXAA 5K5OA 1JX9A 3LDCA 3FB6C 3K08A 4LWSA 4F6EA 5IYBO 2EJRA 3JARB 1JCHA 5KMGB 3KKYA 4O4LB 1ZR2A 5LMUO 5GW7A 2XV4S 3CQZJ 1X1BA 1OQYA 3ZN1A 3U2RA 1Z6TA 1TW3A 2EFNA 5DV5A 2FL4A 2XHBA 1SQPH 5CA0B 1WCMJ 1S8NA 2VKHA 3ESWB 3K4KA 1IRXA 3P9CA 1HA8A 4X6AJ 2BY0A 3OOUA 1MBJA 1MSDA 3L75H 3STLC 4AIKA 3KG2A 3S1MJ 4RAIA 2NR5A 1QVGU 3F8FA 2JPCA 1Q8IA 4LWSB 3ZMUA 3EFFK 4JYYA 4E2LA 3KZYA 1VQ5V 1AJPA 2V4DA 3WFVA 2O57A 1Q7YW 3RDIA 1QR8A 1KU7A 1EBOA 2R7QA
chains in the Genus database with same CATH topology
4YFKF 2TDXA 1BM9A 3FMSA 1S29A 1TQMA 3L2CA 3R0AA 3J81K 1G3YA 2Q8KA 5AIPA 2RN7A 5CVIA 5IYZA 2ZINA 1B4AA 3WTSC 4EM1A 1PP7U 1T38A 3K5NA 3BA8A 4E70A 1NT2B 1J0RA 3M8EA 4K8ZA 4TV8A 1W7PD 2E7XA 4XSZF 5IYZB 1RIOH 4AVPA 4NQWA 3JW4A 5HLIA 4HQEA 3NEUA 3REOA 1XB4A 1TQPA 1U2WA 2ZNJA 4TV8B 1XMKA 3V8LA 5ICGA 1ZRFA 3RGBA 4M9XA 5JI6A 5A2QZ 1STZA 1USTA 4EJWA 2A6EF 4IRGA 3F22A 4OOIA 3RYPA 1IBKB 1SD5A 4UHTA 4OIPF 3LA7A 4YIFA 4RGRA 2QQBA 5LA6A 2HFHA 3K1NA 2ZMEA 3TOBA 2YIAA 3ZPLA 5ILVA 4UVCA 1QZYA 2FOKA 4Q48A 1JHFA 4CO8A 3ZMDA 2KIUA 2L02A 5LA6B 2EA2A 2PYJA 1XN7A 2ZMEB 1IF1A 3KE2A 3RYCA 3MZHA 4DV6B 2PGGA 3NQOA 2DW4A 1J7KA 3Q9SA 3ECOA 1H2SB 3MEXA 2J5PA 3V8KA 2ZFWA 2ZNYA 3RYCB 4OINF 2PMUA 2OBPA 2IPQX 3HRUA 4XSXF 4PI2A 4GLXA 3HRTA 1GHCA 3ERED 1T39A 3IAYA 1Z7UA 4B09A 3E22A 1PP8F 5E18F