1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords hypothetical protein MJ223
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
3HSFA 2HFHA 2W24A 3BDDA 2HQNA 4BHPA 1ZGJA 3DV8A 1TQMA 3OV8A 3WTWC 3FMRA 2L54A 4N0BA 3KCCA 4JBAA 4N9IA 3QPHA 4U7DA 4EV0A 1WSUA 2EWNA 1STZA 4A5MA 3KP4A 3TO7A 1K78B 2E7WA 2RDPA 3KE2A 3L2CA 2OZ6A 5HS7A 3WTYC 4O5VA 5F1RA 1J0RA 2QM3A 3KP2A 4UVAA 5CVJA 1W7PB 2VBXA 1XN7A 1JHFA 2D2WA 1YW8A 3EYYA 1SFXA 3J7AO 3F21A 5ILSA 2HGCA 3E5QA 5JVTA 4EQQA 3TOAA 1G6NA 3GZ6A 4FT8A 4N9HA 2GAUA 3F8MA 3TDZC 4HF2A 3H3UA 2L4MA 2V79A 4B09A 4LLGF 4HQEA 3RJPA 4ZH4F 1EV7A 2Q2EA 2YX7A 3QP6A 1CGPA 2Q0OA 1FP1D 5FLXK 2EFWA 3LA7A 2YPRA 3ISPA 3QU3A 1LDDA 1MJAA 4I2OA 1WI9A 5DCMB 1Z6RA 5ED4A 1LVAA 4MGRA 3SZTA 4MTEA 2GQQA 1QGPA 3VEPA 3CJNA 5FFXA 2IA1A 4GO1A 1ODDA 3GVAA 2WTEA 3KP6A 3CO6C 2O0YA 2EV5A 2XAJA 2D1HA 1P4AA 2A5YB 1JXSA 2QENA 3LFKA 4Q4ZF 2OQRA 2FEZA 2ZKZA 4U7BA 1UB9A 3IWZA 3DFGA 1IXSB 4M6XA 2VOOA 1TLHB 1FSEA 4G6DA 3CLOA 1MZBA 4A5NA 5E1XA 3FM5A 3J81K 2GIVA 4WXDA 3LAJA 3DPLC 3NQOA 4EGZA 5HS8A 4AIKA 2XVCA 1FSHA 2JTVA 2FBHA 2FU4A 5BPDA 1HW1A 2M8EA 1ZG5A 4D0PA 2DPDA 3V7RA 4G8XA 2G9WA 3ZN0A 3R0JA 6PAXA 4BNCA 5E20A 1YS6A 4CO8A 1OR7A 1VTNC 4UUVA 1I1SA 2IW5A 2G7UA 2PFBA 3T1BA 1XCVA 5ICGA 2EFNA 2PLYA 2ZCWA 4H0EA 1U3EM 1ZREA 1R7JA 4ETSA 4ENKA 5ICEA 1FT9A 1J9IA 3RI4A 2K7LA 4QWQA 4XRFA 2QVOA 3I58A 1SD5A 4G9YA 5F6FA 1L3LA 4RGXA 3F8FA 2R3SA 4A6EA 3MFKA 1I6XA 1SMYF 1SD7A 3WTUC 5LGNA 1G3YA 5J8FA 2JRTA 4ZYGA 1W7PD 2PEXA 2XASA 4KDPA 1R1UA 2CGPA 2XUBA 3L7WA 3ZN1A 3QOPA 1TBXA 3WTSC 2H6BA 2CQKA 1U5TA 3RKYA 2ACJA 1J59A 2ELHA 2KJBA 1MGTA 5E1WA 3BOQA 2M30A 3F8CA 2DK5A 3ZMUA 1O3TA 3RPUA 2UXXA 4RB1A 3QP5A 4LG0A 2HEOA 4PGHA 3WTZA 1YTYA 1ZRDA 3GZ5A 2ZNZA 4GCVA 2B0LA 1BC7C 4M72A 2NNNA 4IRHA 3HOTA 3EDPA 3BWGA 4MQVA 4G7HF 4U0YA 2KIUA 3P9KA 3S2WA 2CW0F 2PN6A 3KP5A 4BHCA 2EV0A 4B8XA 3DQVC 3R61A 1AWCA 1IN7A 1S6LA 2A61A 3EUHA 5IT3A 1IN8A 2BV6A 3FMSA 5H20A 2Z33A 2QBYB 2OAZA 3I53A 1XB4A 2VE9A 2R7DA 1S29A 1D8JA 1HW5A 2YSRA 1HKTA 2LKPA 5E17F 4OIRF 1R1VA 1KQ8A 2DQLA 1ONVA 1LEBA 1FWZA 3E3VA 2XKPA 3H92A 2Z99A 2FOKA 2STTA 3REOA 3F6VA 3M8FA 3JTGA 1MKMA 2P4WA 4NB5A 2K86A 4IRGA 3RYRA 3F8BA 4JQFA 1L0OC 2H6CA 5LHHA 4MEXF 2P6SA 4RAZA 1LQ1A 3E6DA 1U8RA 1QZZA 1USSA 1TTYA 1ZARA 2GXBA 2F5DA 3SXYA 1TQPA 2HR3A 2NRAC 1KA8A 1H9TA 1J7KA 4L18B 2FRHA 4KT5C 2DTRA 1Z1DA 2MC3A 2KJCA 2XAFA 1FP2A 1E2XA 2W25A 2ISYA 2V9VA 2Q8KA 3IKTA 2JSCA 3QU6A 4EM1A 1YW7A 4F7ZA 4PGGA 5FFZA 1KYWA 1B9MA 1ZLKA 4KN4X 5EEGA 3KZZA 1YW9A 4BHBA 3CUQA 2DLLA 2ZBKA 2UZKA 3RIRA 2J5OA 5LBQA 2OZUA 1KU7A 4WWCA 3K9TA 2K4BA 1S3JA 5A2QK 1D5VA 2R7FA 3ZPLA 4HDVA 1B59A 2A6HF 5AONA 4KN7X 3L09A 3V8JA 3TQNA 2DT5A 3VFZA 1XCBA 2HWVA 3BJ6A 1W5SA 3IWFA 3E97A 3D5LA 5CYVA 2K27A 2COMA 1S8NA 1WRJA 1SD4A 2A69F 1U78A 3K0LA 4LK1F 3Q9SA 1QBJA 3I5UA 3P9IA 3PQJA 1SMTA 2A6EF 3ERED 1TNSA 2UXNA 4P9UA 1RIOH 2EA4A 1HXDA 2QM4A 5D8KB 3MEXA 2YU3A 2Y0MA 3MCZA 2P5LC 1G3SA 2R9AA 5HLIA 1XDUA 2DFIA 4KIGA 1BIAA 3RYPA 3KEQA 1YFHA 1K7AA 3R4KA 2OA4A 5TRDA 2MLGA 3M7GA 5DV5A 4L0YB 2RN7A 4FHTA 4PDKA 2DK8A 3SQNA 2MH9A 2K02A 2P7VB 4EM2A 4HV6A 1USTA 1IW7F 1DP7P 3T8TA 1JE8A 4EJTA 5D5UB 1OMIA 4ENJA 2P5KA 1XMKA 4DNCA 1ZGAA 3WU1B 1CF7A 3ZP5A 3B02A 4HAMA 2PBIA 2DQRA 4CDGA 3I4PA 2HDCA 2CG4A 2AS5F 1IUYA 2VT2A 2QYOA 4YFNF 1B9NA 1ZG3A 3BPXA 4Z2YA 3T8RA 4Q47A 1WQ2A 2HQRA 3U9GA 3U1DA 4YFKF 3M8EA 1O57A 1BI0A 1FOKA 3LQQA 2FXAA 3V7CA 2XAHA 3D0SA 4CZZA 2FE3A 4NQWA 2O8XA 1LEAA 4HDUA 1QO0D 1LNWA 1BI3A 5FO5A 2M45A 5KVRA 3V7SA 4CGZA 5LHIA 2ZFWA 3LAPA 1R36A 3PQKA 3DPTA 1FPQA 1F9NA 3ZMSA 5K5QA 4WF2A 2CFXA 5E1ZB 1P4XA 4HBLA 2RNJA 2HZTA 3I64A 5LGUA 1OYYA 3N97A 3GYHX 5H6QA 1GXPA 1U2WA 4TV7A 2X0LA 2EA2A 4HX7A 4RGSA 4LD5A 3V8LA 1Z7UA 4G6QA 1BJAA 2L01A 2QZ8A 3FM3A 3ZQ7A 4AIHA 3WE3A 1ZLJA 3WU0A 1YLFA 1W5TA 2STWA 4A0ZA 1ULYA 5L3DA 1BI1A 2MA3A 4LLNA 1GHCA 5DYMA 3I59A 1J5YA 4EJWA 3GX4X 2A3SA 3L9FA 4I98B 4P9FA 5D4SA 5D4RA 5A2QZ 2Z9OA 2D1VA 3K2ZA 1Y0UA 4AWXB 2DAOA 3TDUC 2DW4A 3QPTA 3J80K 5LRSA 3I71A 3KP3A 2JPCA 4CXFA 4UV9A 3G73A 2EK5A 5ILVA 4UV8A 4UHTA 2GA1A 3KLOA 4HLYA 1FBQA 1R00A 1G3WA 3PFIA 5KK1A 4HX8A 1RI7A 3GLXA 4L0ZB 4ZYEA 2PMUA 3KZYA 5CVVA 3FZVA 3MZYA 2HYFA 2XV4S 2NYXA 3GWZA 1XMAA 4AVPA 3MZHA 1R1TA 3WODF 1RNLA 2FBKA 4M74A 3TGNA 3AAFA 3GO5A 1XGMA 1D8KA 1MD0A 5FGMA 3F3XA 1Z6TA 3JAMK 2IVMA 5K5RA 2QQAA 3ZMVA 1XSVA 3LA2A 2A07F 5FD5A 3KETA 3C7JA 4EVIA 5LLQA 1HQCA 3HHGA 4ZYHA 2P6TA 1K79A 4EJVA 4S05A 1RUNA 1IZ1A 3HUGA 1LDKB 5ERIA 1WKMA 5BMZA 5IT9K 3RPQA 1XSXA 5HDGA 4P55A 5JHUA 4U0VA 3HRSA 3RKXA 3ABTA 2VXZA 1I27A 4IXAA 2DPUA 4GXOA 4KMFA 1B4AA 1LB2A 1FY7A 4L9JA 2ZO4A 5CJ9A 4I02A 2Z3YA 2DBBA 3F8NA 4BAYA 3QRFF 1BN5A 2VT3A 4KIFA 1OYIA 2ETHA 4Y13A 1T0FA 1OYWA 1X3UA 4LMYA 3E6BA 3FHZA 4PZJA 1K78A 2FF4A 4UNOA 4IF4A 4L9TA 3VOEA 5FLXZ 1Z9CA 2VN2A 2W57A 5HVQC 3NRVA 2ZXJA 2JPBA 4O6JA 1J2XA 2LF7A 2WC2A 3L00A 3WE2A 1W7PA 1R58A 3FWEA 4RAYA 5D5VB 1XDSA 4LGWA 4ZYDA 1BOAA 1R23A 2IRFG 3K1MA 4M9SA 2XRNA 1O7LA 5DUIA 2DI3A 4XSZF 1HSTA 3JW4A 3HSEA 4RB0A 3N4MA 5BOXA 4WX9A 2IP2A 2BEOA 5LGTA 1KU9A 2TDXA 4O3MA 3MWMA 4KIBA 4HZFA 4GYIA 4OIQF 5ICFA 2RV8A 5DDGA 2M1BA 2NNYA 1JGSA 2CWEA 4XSXF 3JSOA 3WGIA 5DCMA 3J81Z 3CDHA 2IT0A 4A6DA 1IN5A 1KQ9A 4WK8F 3FX3A 1F1ZA 4HYEA 2P5VA 1HKQA 2PG4A 3RKWA 1ZRCA 4FX4A 2C6YA 3HHHA 4M6YA 1KU3A 5DD8A 1BI2A 4UXNA 5K1YA 3JSPA 1IRFA 2E1CA 1FNNA 1HSJA 5AIPA 1DUXC 3CUOA 4YG2F 2BBYA 3WGGA 3Q5FA 1FZPB 2ESNA 2ZMEB 4L5IA 2LDUA 4G7ZF 2GA2A 1SD6A 4CYDA 1O3RA 3G3ZA 2O6GE 1LJ9A 1UHWA 2VBYA 2EV6A 4RGRA 3GF2A 2Y48A 2V6CA 2EB7A 4OMYA 4RB3C 2V1DA 3OOPA 1ZRFA 1J75A 2MBFA 2P8TA 2AXLA 1O3SA 1F5TA 1ZH5A 1BBYA 2CSOA 1ZAOA 4P96A 4OINF 4E70A 1O7FA 3GFIA 2F2EA 1C0WA 2XAQA 3FXUA 1Z91A 3B73A 2H09A 4HX4A 1ON1A 3HRTA 2ESHA 2IPQX 2LF8A 1SAXA 4Y17A 4EJOA 3Q9VA 3FXRA 3LWFA 2JZYA 1D3YA 3O3KA 5F64A 2YR2A 5EEHA 2FNPA 3GFMA 4XLPF 4Q5SF 2EJRA 4LFUA 2QUFA 3SR2C 4AIJA 1ZYRF 3WG9A 2F5CA 3LA3A 2KIMA 1DDNA 1U5TB 2IA0A 3LQRA 3IRQA 4RGUA 1DPUA 2VE8A 3IC7A 2PQ8A 3KLNA 3DEUA 4U88A 5HDKA 1QPMA 3SHFA 1H0MA 4IHSA 3H3ZA 1T98A 3WTXC 3F6OA 5E8GA 2HOEA 5LEKA 4LG0B 2BGCA 5L3FA 3JTHA 4KICA 1FYKA 2IA2A 3COAC 2Z5UA 3ROUA 2BYVE 3R0AA 3BZ6A 4BYYA 2F5FA 2MH2A 4HF0A 4YIIA 1BM9A 2H27A 3BJOA 4R1HA 2VONA 3WTTC 4CHUA 1H9GA 1G4DA 1HKSA 5D6FA 4QLCU 1KQ0A 2F5EA 4JK1X 1P6RA 4R79A 5BS6A 4ZZLA 1UHMA 3GEZA 2ZNYA 3IL2A 2PJPA 1R5GA 3ABUA 2XGXA 3IKVA 3SZPA 5E18F 4YFXF 1T6SA 1NHAA 4R8HA 4EGYA 1MDMB 2V1UA 2FSWA 2RGVA 1IN6A 2MD5A 3KFWX 1UCRA 1QQIA 1ZN2A 1XGOA 1FYMA 2QBYA 2V1XA 1S7AA 1Z05A 4HW0A 1I5ZA 1YG2A 3T0YA 2XHKA 3HTUA 1R22A 5DCFA 2JT1A 4WCGA 1A04A 4K2EA 1KYZA 4XLNF 1PDNC 4I0BA 2QWWA 2KKOA 1YIOA 3HTSB 4I0AA 2VODA 2P7CB 4M9ZA 3R6SA 4G7OF 2O3FA 4WXHA 3VB2A 2XKOA 5JI6A 4BH9A 2O03A 4LK0F 2XAGA 2NAZA 4HOBA 1KU2A 1I1GA 3ECHA 3ECOA 3DP7A 4A0XA 1EH7A 1PP8F 5D5XB 1T39A 4RS8A 2RC4A 2QQ9A 4BQAA 2OU2A 3TO6A 4M71A 5L3EA 3CUQB 2DU9A 1ON2A 1YS7A 4XBFA 2X4HA 2FQ3A 3F23A 3V4GA 3KP7A 5LHGA 2ZMEA 1XGSA 1Q1HA 3TOBA 1V3FA 1GXQA 3V8KA 2VBWA 2UWMA 1TW3A 3K1NA 3TO9A 4UVCA 4ENNA 5CVIA 4L9NA 4ESBA 1PUEE 3ZMDA 4RB2C 3GW2A 4IJAA 4WXCA 5H6RA 2EFOA 5FB2A 1IXRC 4MNUA 3RTRA 4P5OA 3ZMTA 4LB6B 3GXOA 3ML6A 4HQMA 5JFRA 4YIFA 5HLHA 2HTSA 3FXQA 1FYLA 4M9XA 1QNTA 4UVBA 3I54A 1K6OA 1IF1A 3EQLF 3C18A 4I09A 5JR3A 3RDIA 1FX7A 1MJ9A 3GUDA 3EETA 1IXCA 2KIFA 2QQBA 4ENMA 3FF5A 1RUOA 2GXGA 2L02A 2NS0A 1OKRA 3W6JB 3IRRA 5J8CA 3MAJA 3P7NA 4ZZDA 3P9CA 3M1EA 1IN4A 4OMZA 1JHHA 4GYGA 3HOSA 1RZ4A 4ESJA 3ULQB 1V4RA 5ILUA 2CYYA 1BC8C 3VODA 5DUKA 3BP8A 3E5UA 5BPIA 4BXUA 2EFPA 5E8IA 2IJLA 4OIOF 1SFUA 3E6CC 2E1NA 1GVJA 4OU0A 2LNBA 4KYWA 2PI0A 4S04A 2YX4A 5K5OA 5HLGA 2HKXA 3BPVA 3IHUA 2XIGA 2J5PA 3BY6A 4EJUA 1OPCA 3DXJF 5HS9A 3NEUA 3CTAA 4MEYF 1XSDA 2MLKA 4A0YA 3WGHA 3GFLA 1WWXA 1TQIA 1CF7B 5BQTA 2HTJA 5LEJA 5HOOA 1AOYA 1P2FA 2L4AA 3CO7C 4NHJA 2QLZA 5D5WB 1EH6A 4OIPF 5CLSA 1YO5C 3K69A 4ESFA 1ZHFA 3R60A 2FA5A 2HYGD 3HRMA 5DEQA 4ASNA 1XD7A 4CICA 2DO7A 3LSTA 1U5TC 5CVRA 3HSRA 3FMQA 4LLLA 4GGGA 1F4KA 2WV0A 1T38A 1BIBA 1SFEA 1REPC 2E7XA 2W84A 1HBXG 2ISZA 1W4MA 4IPAA 1O3QA 4HV5A 4DQ2A 3F72A 1MDMA 4ON0A 5TJJA 5CVUA 4L5JA 2WWYA 2A68F 4HLXA 4IRIA 3E5XA 1UFMA 2GZWA 2L3DA 5L3BA 3GFJA 4A12A 4KNYA 2D45A 1ZG1A 1MJBA 4LB5A 4AD9A 5D8LB 3QAHA 5J6XA 4G94A 1U6GA 2H94A 4MQ9F 1FBSA 1TW2A 1TNTA 3I59B 3O6BB 3J80Z 5L3GA 3MQ0A 3M9AA 3RWRD 1E17A 2HS5A 2CO5A 1YQAA 5L3CA 3SFZA 2VOPA 1S7OA 2HKOA 4PCQA 5D6EA 3KEOA 5FD6A 4U0WA 5HDNA 1LDJA 2OBPA 4I01A 2FNAA 1T2KA 2OD5A 4KA4A 3ELKA 2W85A 4MTDA 1KGSA 2RVCA 4KUMA 3I0TA 2Y75A 3BJAA 3ZMZA 1B1BA 2BE5F 4KMUX 3EYIA 2KRFA 1HW2A 3JAMZ 1B6AA 2VC1A 3TKYA 2FMLA 5AIQA 1EH8A 3HRUA 4LJZF 3U2RA 3BROA 3C3WA 1P92A 2LSOA 1M5IA 4KFCA 1QZYA 5LRRA 1FC3A 5DD4A 1R5HA 2G7HA 3WTVC 2OQGA 3DF8A 3E6MA 2FBIA 4A2UA 2O61A 5IT9Z 1P4WA 2K4JA 2EFQA 2FMYA 2RKHA 1FBUA 4IVNA 3O2PE 4L9VA 4IHTA 3DKWA 3F22A 3HIFA 3CUQC 3W6KB 2ADUA 1FLIA 3T5XA 1G3TA 1IRGA 1IAWA 1PP7U 2XROA 4HF1A 4Y15A 2M5WA 4HA8A 4FX0A 3K1PA 4MHGA 1YYVA 1XGNA 1DPRA 2RQPA 3HYIA 4Q48A 2ZJ2A 4I7HA 4EMSA 2VBZA 2GWRA 5ICCA 2PMHA 2M87A 4OOIA 4EM0B 2VC0A 3C1DA 4M73A
chains in the Genus database with same CATH superfamily
3HSFA 2HFHA 3W7UA 2W24A 3BDDA 2HQNA 4BHPA 3HDDA 1ZGJA 3DV8A 2KDZA 2LW7A 4I55A 1TQMA 3BCAA 3OV8A 5B1AH 1I50J 3WTWC 1VQLI 1VP7A 3CCMI 2QCOA 3FMRA 3L2RA 2L54A 3H1KH 2QQ8A 2A7WA 4JAVA 1QBZA 1NS1A 3A01B 2IS6A 3DXRB 2VQFO 4JV5O 4BE2A 1OV9A 4N0BA 2VL8A 4JV5B 3KCCA 4ZHQB 5KLVH 3UNGC 4JBAA 4N9IA 4RAFA 3E7LA 3QPHA 4U7DA 2Y0PA 2COBA 1FJGB 4DR2O 3CCYA 3FK7A 1J5EO 4EV0A 1DF4A 1WSUA 4GKKO 2EWNA 1STZA 4A5MA 2CDYA 2VPLA 3PL8A 3E22B 4DR2B 4KP4A 1J5EB 4GKKB 3BTIA 4QSHA 2Q69A 3KP4A 3TO7A 1K78B 4AYBN 4NTXA 2E7WA 2F93B 2RDPA 3SYTA 4H13B 3TXSA 3KE2A 3L2CA 3TETA 1RPWA 1E3HA 2QWOB 2OZ6A 1Y4MA 4N21A 5HS7A 1FTTA 5KHHA 3WTYC 4J10A 4O5VA 2BOLA 3MDSA 4OXSA 3A02A 4FASD 1LE8B 1IBLO 2M4KA 5F1RA 4CYCA 3ETEA 1J0RA 3EFFK 1IO2A 3K4BA 1IBLB 2Y9YA 2QM3A 1XTAA 3KP2A 4ZI7A 2VUMJ 4B48A 4BWAA 3SJQC 3NARA 4UVAA 5DEDA 3S3MA 2G0EA 1VFCA 1QU7A 5CVJA 1VQ7I 2EIJB 4IQ4A 1W7PB 1Z5WA 1N36O 3SJMA 2EIKB 1Y6XA 1KONA 3FFQA 2VBXA 1CEZA 1XN7A 1JHFA 5KHIA 4FM1A 4DR4O 2D2WA 2Q67A 1YW8A 3SPJA 1UJWB 2AHYA 2DQ0A 4A3LJ 3FB6C 3IJ4A 3EYYA 4DR4B 5KX5A 1SFXA 4TQFA 4LFCO 4CUGA 3OYMA 3HOWJ 3D36A 4LFCB 1VQMV 2LY2A 3J7AO 5KMGA 2LREA 3IV5A 3F21A 2IS4A 4HSRA 3OYDA 5ILSA 1EFRG 4O4HA 2FJ1A 2XPUA 2HGCA 3LSQA 3E5QA 2ZSIB 5JVTA 4EQQA 4WFFA 3TOAA 2EULA 3ZCOA 3BLYA 3OIOA 1G6NA 3EUAA 3GZ6A 1Q3EA 4FT8A 1PPJH 1K4CC 4DR5O 1NG7A 4N9HA 1WP7A 2GAUA 3CMEV 4DR5B 4BY1J 3BA8A 3F8MA 3TDZC 3DC6A 4JGSA 4IZZA 4HF2A 1SQVH 3H3UA 2L4MA 2V79A 1TWAJ 4B09A 1I0HA 3H35A 3CCQV 4LLGF 4DV0B 4NUBA 4HQEA 5LL6Y 3RJPA 4ZH4F 1EV7A 1N36B 1LFPA 3OSFA 2OCCH 5TGTA 3A2KA 4AILC 5FRNA 2Q2EA 2YX7A 3QP6A 3TP0A 3D1NI 2Q0OA 1CGPA 1FP1D 5FLXK 1X4OA 3AG1H 3IAS2 1OZ0A 2CH7B 2EFWA 5KHDA 4R8CA 4DR3O 1X1BA 2DMUA 1XPXA 5E79Z 4DR3B 3LA7A 2IS1A 2YPRA 3BC8A 3ISPA 3CESA 1JUPA 1LDDA 1MJAA 3QU3A 4I2OA 2PJRA 1JJOA 4AYBA 2L9RA 2MD0A 1WI9A 1XOUA 3NWTA 4PHZA 4F93B 5DCMB 5LYJB 5JLXA 1Z6RA 2E2JJ 5ED4A 3RVZA 1LVAA 2GLOA 2DFEA 1LUWA 2X48A 4MGRA 3M4OJ 4GX1A 4FM2A 2KRHA 3SZTA 4MTEA 1VARA 3LSHA 1H2KA 1QR8A 2GQQA 1QGPA 1A31A 3SYAA 1HR0O 3VEPA 2LY1A 1HR0B 5JQGA 3HKDA 3CCJV 3CLQA 3CJNA 2CW7A 5FFXA 2W0XA 1RESA 2LOOA 3SJBC 2IA1A 3SDGA 4GO1A 2A6TA 4MLOA 2ZQMA 1ODDA 4U3FH 3GVAA 2WTEA 1Z3YA 2HU9A 3KP6A 2XC7A 2JA7J 1Z2GA 5B5EZ 1N34B 1WJEA 3CO6C 2O0YA 2DA3A 1AKHB 3ZHVA 3CS5A 4FETA 1LPQA 4I76A 4JYAO 2EV5A 3E2EA 3D36C 3O9OA 2XAJA 3K06A 2D1HA 3K2AA 1P4AA 2A5YB 2KRCA 1BS3A 3G71V 1JXSA 1PNMA 2QENA 5K7HA 3H9QA 3LFKA 1U8BA 1GKFA 1BR2A 4Q4ZF 3ABLC 2X1CA 1MG1A 3E89A 1BJZA 2GTAA 2L9NA 1T95A 2OQRA 2FEZA 2ZKZA 4U7BA 1VQ8I 4WBNA 1BHBA 2YC0A 2M0CA 4XK4A 1UB9A 3IWZA 4LF7B 3DFGA 2Q7HA 4O4IA 1IXSB 4M6XA 1XREA 2VOOA 4KL1A 1H89C 1TLHB 1FSEA 4G6DA 2NN4A 3D5RC 3CLOA 1MZBA 4A5NA 2VI6A 5C44J 3UKGA 3P30A 5DM6F 1LVKA 2DA4A 1JKPC 5E1XA 1YF2A 3FM5A 2Q0OC 1HP8A 3J81K 3OYNA 1QVUA 2GIVA 4WXDA 3LAJA 1JFFA 3STLC 4EFBA 1AJNA 5IWAO 3DPLC 3NQOA 4G6TB 3J7ZI 4D1QA 4EGZA 3I5DA 5HS8A 2MW8A 1PNLA 2OCEA 4AIKA 1N32O 3JRAA 3G1OA 3CMAV 1N32B 2WBMA 1JKOC 1MMSA 2YDEA 1YZBA 2XVCA 3C3SA 1FSHA 2JTVA 4LF9O 1V54H 1GLNA 2FBHA 4QGPA 2F6CA 3CJTB 3F7VC 2FU4A 5BPDA 2EINB 4RWUA 4RQEA 1HW1A 2M8EA 4PFOA 1WLEA 4ZKIA 1ZG5A 4PDVA 2QEXV 4D0PA 2DPDA 2YXHA 2FX0A 3V7RA 4G8XA 1VZ0A 2G9WA 2NVYJ 1Y8RB 1UPGA 1OLTA 2B9ZA 1WJFA 5KA6A 1Z7LA 3R0JA 3ZN0A 3SFIA 6PAXA 3EUKL 3GTOJ 1K3EA 4NVPA 4WFBV 3PUBA 3QVNA 3S1RJ 4BNCA 4J9ZB 4LF5B 3RYIB 5E20A 1YS6A 4CO8A 3D3IA 3O8GA 3UT5A 2DJVA 1YOVB 3OIQA 1N77A 1R6TA 1YVWA 4UUJC 3THOA 1SQPH 1OR7A 1VTNC 2UV1A 5CA1A 1CQTA 2ZXWC 3QF7A 2Y2ZA 3S14J 4UUVA 1WJBA 2R7ZJ 4MW3A 1KKDA 1VNDA 4ABZA 1I1SA 2FYUH 2IW5A 2QSHX 3CRCA 4FFBB 2G7UA 3CSXA 2A3QA 1FTZA 5EG0B 1PYVA 2B63J 2PFBA 1FXKA 2P6JA 4ZBMA 5JJJB 4XM3A 1R6KA 1Q86W 3T1BA 1XCVA 4PD4F 1B72A 5ICGA 4IYIA 2EFNA 1A36A 1AI7A 4UCRA 4HNVA 2PLYA 2OT5A 2ZCWA 1AU7A 1K73W 4H44B 2Y30A 3IP4B 2XHBA 3Q0UA 1Y1VJ 1J95A 3OIPA 2JWTA 4H0EA 3MAQA 5F04A 3QYBA 4XLFA 1U3EM 1ZREA 1FXHA 1YHQI 2F4OB 2M3AA 1T8IA 2JEUA 4OAZA 2Y69C 4W4KA 5EBMC 5EZYA 3VOUA 1R7JA 4ETSA 4ENKA 2OTLI 1IZ3A 1TWCJ 5ICEA 2OIEA 1ZWIC 2CUJA 4D7NA 5K7FA 1FT9A 1J9IA 3K58A 2VJIA 4F3QA 3RI4A 4JX5A 2K7LA 1NK2P 2KLOA 2ZM6O 4QWQA 1KBHA 3O65A 4IX7A 1L8DA 2F66C 3FKSG 4I50A 4R7CA 1D2DA 5J4YA 4XRFA 1AI4A 1BW5A 1AJPA 2BHZA 2K9MA 2QVOA 4X65B 3BR0A 3I58A 3HGYA 1SD5A 4RDUA 4G9YA 4CC5A 2DOSA 2UUAO 2L7MP 4U7OA 2UUAB 1WH7A 1K34A 5F6FA 2OF7A 3S1NJ 1R3IC 2Y0IA 4NR1A 1LFBA 3ZQLA 4RGXA 1P7JA 1L3LA 4FM0A 3WG7C 4RLFA 5KAFZ 3L2VA 4E7SA 3F8FA 5K7ZA 2M8GX 2R3SA 4A6EA 3MFKA 1NH3A 1AI6A 4UUSB 1I6XA 4J00A 1B3QA 3H0DA 1QLEB 1FOXA 3PO2J 2HFEC 1YJNV 1SMYF 1SD7A 4GT1A 1ZL8B 3WTUC 3TP3A 1OR7C 5LGNA 1VQKV 4YXWG 4BBRJ 3I4MJ 1A32A 2XAUA 4HNTA 1PJRA 4O4JB 1G3YA 5J8FA 1VQOI 1SFOJ 2JRTA 2M0MA 2Y31A 4XMYA 4ZYGA 5EGOA 1BE3H 4ICGA 4ZTJA 1W7PD 5FNVA 2PEXA 2XASA 4KDPA 1JUSA 3OMYA 1R1UA 3TBIA 4BE1A 1IV8A 2CGPA 2ODMA 1FMVA 4BW5A 1M1EB 3JARA 2NVTJ 5CBGA 3HPLC 2XUBA 4DV7O 2JQ7A 3ABKB 1QLNA 4CSWA 5F2VO 3BR1A 3EPZA 4DV3O 4DV7B 5C4XJ 1OCZB 4DV3B 3HKEA 1U96A 4YRVA 2BTQB 3HKCB 2QSGX 3L7WA 3EHBB 3ZN1A 3QOPA 5BR8B 1TBXA 3WTSC 4JYYA 4A3MJ 3CMYA 9ANTA 2P90A 2QWNB 2H6BA 2ID6A 4JI5O 4B47A 1WJZA 3UR3C 2CQKA 4XR6A 1U5TA 3RYFA 3JAWA 5KHGA 4JI5B 3A0BC 3L73H 3RKYA 3FKJA 4A3DJ 2NR5A 2ACJA 4S0HB 3LNQA 1J59A 2ELHA 1BMFG 2N04A 1PV0A 4M3EA 5F1JA 4H33A 4BIOA 5IJ0B 1HCRA 2KJBA 1MGTA 5CQGA 1NR1A 4K0KB 5E1WA 1IDYA 3BOQA 1MH3A 2V9PA 1V55B 4YEJA 4P30A 1IGNA 2Y0SA 2WLKA 2MYSA 2M30A 3MHHC 4NC6A 3KG2A 2HI3A 1Q81W 1GH6A 3F8CA 2CAZC 3E83A 1SC7A 3CYOA 4MVOA 4LWSA 2DK5A 3ZMUA 2XGCA 5C3EJ 1F4MA 4X1KB 1KD1W 5CA0A 5GTHC 4CCOA 1WP8A 1O3TA 2D3OW 4BL0B 2VWKA 2QA4V 3RPUA 2DCEA 3CF5F 3H1CA 2UXXA 2ELJA 2JJ1G 2YXLA 5CA3A 4K8XA 4RB1A 3QP5A 3RN4A 2CQ7A 2CQQA 4XOTA 4LG0A 1BT8A 1CPYA 3UO3A 2YIDA 1NJIW 2FOWA 4C3IJ 4XN0A 3CJQB 4I0XA 2HEOA 4X89A 4I99C 4WFAV 4A93J 3GCMA 2UUCO 4PGHA 2YXYA 3WTZA 3HKBA 2UUCB 4GKJB 1JJ2U 3PJSK 1YTYA 3K9SA 1RC9A 3ZBHA 1WPXA 4JI1O 2A79B 1Q5OA 4J01A 3RFRA 4E7LA 4JI1B 1ZRDA 3GZ5A 4A3CJ 2CUEA 2IJKA 3OTFA 3B09A 2ZNZA 3OAAG 1IRXA 4AM3A 4DV5O 4GCVA 2B0LA 1BC7C 3KCYA 1KC8W 4M72A 2NNNA 4IRHA 4YJ3A 4YELA 3HOTA 3AG4C 4JI8O 3EDPA 3BWGA 1OCRB 2HLDG 3QO7A 4MQVA 2JDIG 4NQWB 2EZPA 5D5PA 3TL4X 4U0YA 4G7HF 2KIUA 3P9KA 2VKHA 3S2WA 3CDLA 1I3QJ 2DWEC 2CW0F 2PN6A 3ZQHA 3BA9A 3KP5A 4AQYO 4BHCA 4PA6A 2P06A 2EV0A 2O57A 4DRXA 4B8XA 4Z1MG 2LKSA 1S72I 3DQVC 3R61A 1AWCA 4PI0A 1L0LH 4XLHA 3SGIA 1IN7A 3TCUA 4U3JB 4O2AB 1S6LA 4IQJA 4BJTA 2A61A 3EUHA 1R4MB 5IT3A 1PVEA 3BCCH 1IN8A 2BV6A 2NXNB 3FMSA 5H20A 5IOYA 2BXZA 4IHXA 3ASNB 2Z33A 3E8FA 1ETQA 4C2TA 4BACA 3MKYB 1T08B 2QBYB 2OAZA 3I53A 1XB4A 2VE9A 2A06H 2UXCO 2R7DA 1S29A 2VQLA 1SAUA 1HW5A 1D8JA 2LJ2A 2WAMA 2YSRA 4BKXA 5CN0A 1Y76A 3JALB 2UXCB 4YIPA 3SPGA 3CMMA 3G6EI 1HKTA 3K08A 4HBNA 2LKPA 5E17F 4K0KO 2D5VA 2FKXA 1BZKA 3BG5A 4CCMA 4OIRF 3WHCA 1R1VA 4FZ0A 4XL9A 1KQ8A 2DQLA 1ONVA 1LEBA 1FWZA 3E3VA 2XKPA 3VYTB 3BZKA 2Z99A 3H92A 2KSDA 2FOKA 2WWWA 4X1YB 2STTA 3DU5A 4PSWA 3F6VA 3M8FA 2H8WA 3REOA 3JTGA 1GM7A 3J7AU 1MBGA 3H3VK 2ZB9A 2UUBO 1MOFA 4F6RB 1MKMA 2RDCA 3ZRWB 5J2TB 2P4WA 2UUBB 1EZVH 4NB5A 2K86A 4IRGA 3RYRA 2CH7A 2GUZB 1DU6A 3F8BA 5J1YA 4JQFA 1MBKA 1L0OC 3BZCA 4RBOA 1RSOB 3L2WA 3ZHTA 2H6CA 1P4RA 1VQ9I 1VF6A 5LHHA 1BCCH 2GTSA 4XRMA 1MMGA 4MEXF 2ADQB 3CCUV 1W36D 2P6SA 1I3AA 4RAZA 4J80A 4JI6O 4TV9B 1LQ1A 3SEQA 3BR3A 3ZOBA 3E6DA 1U8RA 4LIVA 1OCCB 4JI6B 5CBHA 1QZZA 1USSA 1TTYA 4FMTA 1ZARA 2JS3A 2GXBA 3OY9A 3EUHC 2F5DA 1X4PA 2IJJA 3GTMJ 4DR7O 2GHYA 3SXYA 4UCOA 1TQPA 4DR7B 3CCVV 2RNBA 5FROA 2HR3A 2NRAC 1KA8A 2DYRB 4OWRB 4P1WA 4C3HJ 1R71A 1H9TA 3HR0A 2Q7GA 1J7KA 1COWG 4IIJA 2CRGA 4GRIA 1S0VA 4DJAA 4L18B 3VBBA 4CCKA 1JUMA 2FRHA 4XLAA 3SYPA 3BPZA 2CQNA 4KT5C 2X51A 4RAGA 3T2MA 2DTRA 1OCOH 1S76D 1Z1DA 2DA2A 3JCUC 2MC3A 5KNLA 2KJCA 2FQ4A 2XB5A 4J11A 2XB0X 3JD3A 2XAFA 1FP2A 1E2XA 3H9GA 4FLYA 2W25A 5GW7A 2ISYA 2V9VA 2P81A 4CS3A 2Q8KA 4C2MJ 4PDLA 2YICA 3IKTA 3OYIA 4LNUA 1VQNV 3SPHA 2E74B 2JSCA 5EIBD 3CXCU 3QU6A 1NK3P 4EM1A 1YW7A 4F7ZA 4DYQA 3K4KA 2ELKA 4ZYAA 3N2GB 1MZEA 2M7AA 1X59A 4UCTA 4PGGA 5FFZA 4I4TB 3L1PA 4E7JA 1KYWA 1HA8A 5JHFA 1B9MA 3ZQFA 1ZLKA 3WHBA 3UQ8A 2DWDC 2VPRA 3IH4A 3HC7A 4KN4X 4PELA 4X0GA 2GOXB 5EEGA 3KZZA 3ZGKA 1YW9A 4BHBA 3RT3C 4CH6A 2DT7B 3CUQA 1VQPV 2WLNA 3RYCB 2DLLA 2ZBKA 1VF6C 2AHZA 4J19A 3M07A 2UZKA 3RIRA 2UXDO 2J5OA 2ZNIA 1L1FA 3CC4I 5LBQA 1N0NA 2OZUA 3K4MA 1KU7A 2UXDB 5EZGA 2YI8A 2EZOA 1D5YA 3ERMA 4WWCA 3K9TA 3B4SA 2K4BA 1SETA 2YIBD 4DR6O 4BUPA 1ZSPA 1R6RA 2DYSB 2HPIA 3HBLA 4DR6B 1Q6UA 1Y8QB 4FK5C 2FB5A 2R7RA 3HKZN 2OTJV 2UU9O 3WG7H 1S3JA 5BNGA 5A2QK 1D5VA 2EIMC 2UU9B 2ZFUA 5E3MA 1GUUA 1EJ9A 3CJHA 2WLLA 3K70C 3ABMB 2R7FA 3ZPLA 1E79G 4O2BB 3BR6A 4HDVA 4BS9A 3S15J 1B59A 2LFRA 1M1KW 2A6HF 5AONA 2ZE5A 1M4UA 3HB3B 4KN7X 3L09A 3ESWB 5DECA 1I94O 3V8JA 2K9QA 4W1UA 1I94B 4LCUC 3TQNA 1GN4A 4JYBA 4FFBA 3S1MJ 3RZOJ 2QR4A 3S3WA 1XMOO 1MSFC 2DT5A 3VFZA 2OIGA 1IX9A 2NVXJ 4I7ZB 1XCBA 1SQGA 4LF6O 2HWVA 3BJ6A 3W2VA 1W5SA 3IWFA 3E97A 4LF6B 3D5LA 4CBCA 5CYVA 1ZUQA 2K27A 5CPRB 5IYBJ 3PSFA 5B3SC 3RQ4A 2COMA 4E4HA 4DV2O 3E35A 1S8NA 2M4GA 3L2UA 5EF6A 4DV2B 1WRJA 1SD4A 5LXTB 4LIUA 2A69F 1U78A 2QSAA 2NS7A 3K0LA 2I10A 2V1NA 3KYCB 1VEWA 3CCSI 4LK1F 3T1YO 1NH2B 4RA2A 2BVMA 3Q9SA 2YIAA 4DV1B 1QBJA 2FUG2 2K5CA 3DTKA 3I5UA 3P9IA 3PQJA 3MKWB 1XS9A 3OYCA 2KG7A 1ZGWA 2WA4A 1SMTA 3DKYA 5C93A 2A6EF 2KZVA 3ERED 4J42A 3G1MA 1TNSA 1YRNB 4DZJA 2UXNA 4P9UA 1RIOH 3APQA 4DUZB 2EINC 1HXDA 2EA4A 5M5YJ 5FPRA 2QM4A 5D8KB 2O9LA 1QQCA 5J2UB 3CC2V 2LRDA 4MVRA 3P3PA 4TUYA 4ASUG 4LFAO 4M3BA 3MEXA 2YU3A 2Y0MA 3AKZA 1MBFA 5KHKA 3SYCA 4PA4A 3JRBA 5B1AB 4PJLA 3MCZA 2P5LC 1G3SA 4FIPC 2ATKC 5IYBO 4IL6C 2R9AA 1FXVA 5HLIA 2M2EA 1XDUA 2EBOA 1CP9A 5KA5A 1FOWA 2QM8A 2DFIA 5GTIC 4KIGA 2KFDA 1BIAA 2Q0AA 3OFNG 2BY0A 3VYRB 5CB4B 3RYPA 3CCEV 1YIJV 3KEQA 1YFHA 2KL4A 5F0HA 1K7AA 4BR6A 1VQ6V 1X19A 1RM1B 1Q1VA 3R4KA 2OA4A 1EZJA 4C9YA 5TRDA 4W4LA 3ZHRA 1IRZA 1W36C 3PJRA 1ZK8A 2MLGA 3M7GA 2DODA 5DV5A 4L0YB 1YEWA 3JAKA 2RN7A 1WNSA 3CE2A 4B08A 4FHTA 2YEVB 1IV6A 3H01A 3DU6A 5JVGF 2ZIMA 4BDZA 4PDKA 3SDLA 5H2FC 1P9QC 3ASOC 2DK8A 4C2UA 2BTQA 2OUMA 1MSDA 3HKCA 3K03A 2HJFC 2DOEA 4PA3A 3SQNA 2MH9A 3L2QA 2K02A 2P7VB 4EM2A 1F43A 2F48A 2VQFB 1MZFA 1AROP 1SEUA 4E6KG 1QVGU 2YS8A 4HV6A 2IEKA 5GPAA 3SPCA 4A3FJ 3NXSA 5LOVA 2BY2A 1USTA 2CQXA 5C8YB 1IW7F 4CH7A 1DP7P 5IJ0A 3QODA 3OR7C 2VJJA 3T8TA 2XTAA 5B66C 2E1MB 3SZGA 3S16J 3G4SI 1JE8A 4EJTA 5D5UB 1OMIA 2L5QA 2HXIA 4ENJA 1D5NA 1K4DC 3PNTA 4IGGA 2AQFA 3LDEA 2P5KA 3DLLF 1I7FA 1XMKA 3W7SA 4DNCA 3H5NA 4ZOLB 3CMAI 3ZHSA 2K9LA 3MZ8A 1R9TJ 2X85A 3KYDB 1ZGAA 4U87A 3WU1B 1CF7A 3KKYA 3VSKA 3ZRVA 4KHPO 4HNUA 3B02A 4HAMA 3ZP5A 5FL7G 5BMVA 2PI5A 4TSFG 1X1PA 1ZTRA 5JH7B 5ITZA 1LUJB 3T1HO 2PBIA 3DBHB 2QEXI 2CTPA 2DQ3A 2DQRA 2MK3A 4CDGA 1LNQA 3CHXA 2PMZA 3I4PA 4J7JA 2HDCA 3ZEDA 2CG4A 3WFVA 1WJDA 3I9V2 3LDDA 4NNJA 2AS5F 2CUFA 4NYKA 4B7EA 1IUYA 3SJAC 2VT2A 2DA5A 2QYOA 1UJ8A 4YJ2B 4I5SA 4YFNF 3HEFA 1GTOA 1AP6A 1B9NA 1ZG3A 3BPXA 3QNEA 2QKLB 4Z2YA 4Q47A 3T8RA 1WQ2A 3MD0A 2HQRA 2EZKA 2OCCB 3A0BZ 2R5ZA 2R9RB 1HNWO 3U9GA 5FKOA 1IDSA 3K04A 4MVQA 2UXBO 4B1RA 3U1DA 3AG1B 4YFKF 3ZS8C 2UXBB 5LP6B 4BIUA 1GT0C 3M8EA 3N2KB 2R7SA 4F4LA 4DV6O 1OCZC 1NTMH 1O57A 2ZD9A 4JI7O 2JK5C 1BI0A 1FOKA 3LQQA 4DV6B 4ANJA 4JI7B 2FXAA 1Z67A 2HZDA 3V7CA 2DN9A 1NTKH 2XAHA 1HC8A 3D0SA 4CZZA 1IC8A 2FE3A 4NQWA 2O8XA 5M5XJ 3SYQA 3OTOO 3H5AA 1LEAA 4HDUA 1QO0D 2GM4A 1O9GA 3DSQA 2Y4TA 2ME6A 1LNWA 2R7OA 1BI3A 2A0LA 5IPAA 3M8AA 2K40A 4HPQA 5DM6V 5FO5A 3OYAA 1XL4A 2IU0A 3I55V 5FJ8J 3LSRA 1CXZB 5EYPB 4K3AA 4Q20A 1V55C 4NTWA 4KFMA 2M45A 2E60A 3E1SA 2E2HJ 4IHJA 2MFZA 5KVRA 3V7SA 5H9CA 2DXIA 4TOIA 4CGZA 1MMDA 2JRMA 4Z2WA 1I39A 3OR1C 2I8DA 2CU7A 2GOMA 2ZFWA 5LHIA 1FFXB 2JK3A 3R65A 5KAIC 1N75A 3B77A 1SESA 3OYBA 3LAPA 3FAVA 2WSSG 4GUNA 4F52A 1VQ4V 3P5JA 1R36A 1KB9F 3PQKA 3DPTA 5F0CA 3DGEA 3JSNA 3PNVA 2ZE8A 2GBOA 2ZSHB 1YXBA 3G1LA 1FPQA 1F9NA 1PUFB 4NDLA 3GWKC 3ICXA 3JALA 3ZMSA 3HM5A 5K5QA 3CB2A 4WF2A 3FXKA 2CFXA 5E1ZB 1P4XA 3G2BA 4HBLA 4B3SB 3IAYA 2X6CA 1A35A 2BW3B 2RNJA 2HZTA 4B3XA 2CV1A 4G28B 2H1LA 3I64A 5EZHA 3RQIA 3NR7A 5LGUA 3ZRXA 1YJNI 2MC4A 1LR1A 3BT9A 1OYYA 4X1YA 3N97A 3TJTA 4JYAB 1VQKI 1M90W 2KKWA 4ZDPA 3GVMA 3GYHX 5H6QA 1GXPA 1U2WA 2DJNA 4TV7A 3OYHA 1RPRA 2X0LA 1XUQA 2XOKG 5BY1A 1TC3C 1HOMA 3ZJZA 2EA2A 3H0GJ 3AL0B 4EB6A 4GKJO 3A03A 2DJIA 4HX7A 1FS0G 1OCRC 3S3XA 3P3NA 1V54B 4RGSA 4LD5A 3K79A 3K9AA 3OW2U 1AR5A 5J1UA 3V8LA 4AVZA 1Z7UA 1MMNA 4HG2A 4G6QA 1BJAA 2L01A 2QZ8A 4PJMA 1TVKB 3OMIB 3VQVA 3K3WA 3FM3A 5LFAA 3FD9A 3TW7A 1Y74B 1K5QA 2OV7A 3ZQ7A 4AIHA 1GO3F 1AB3A 3WE3A 1ZLJA 3WU0A 3JR9A 3CCRI 3BTCA 4F91B 5FKNA 1SFKA 1YLFA 4C30A 1W5TA 1IJWC 2STWA 1WAZA 2X6BA 1VQLV 1EA3A 3F9KA 2RAEA 4IHYA 1SQXH 5IWAB 3CCMV 4A0ZA 1ULYA 5L3DA 4DYLA 4B3TO 2VQHA 1TP4A 1BI1A 2MA3A 3LMMA 1QHHD 2E19A 4XORA 4CA0A 4LLNA 2LO1A 3B6CA 1GHCA 5DYMA 5GONB 4B3TB 3VYSB 1GM9A 3QOEA 5IY5H 2LBFB 5IP6A 3I59A 1K61A 3L9DA 3W6VA 1J5YA 2DMQA 2WY7Q 2KZGA 2EIMH 4EJWA 2R5YA 2OCHA 3H1IH 3L72H 3P32A 1NH2D 4LF9B 1GAXA 3VQWA 3GX4X 4FE4A 2BCCH 2V4DA 1ETVA 2A3SA 2KIQA 1D1CA 3JD2A 4DIQA 3RYHB 3L9FA 4I98B 4P9FA 3OL4A 5TISC 5D4SA 5D4RA 5A2QZ 3HJEA 1FEXA 3ZRSA 2Z9OA 2D1VA 1G6UA 3PIOF 3K2ZA 1MNGA 1Y0UA 3OWTA 4HNAB 3OMNB 4AU7A 3BCBA 1VMGA 5HLTA 3CXHF 4MTFA 4DXWA 4AWXB 2DAOA 3NAUA 3W2WA 1O4XA 3TDUC 2QWRB 4B3RO 5B1BC 4PK4A 2DW4A 3QPTA 3J80K 1JMKC 3AK1A 3ETGA 3WB1A 2DA7A 4IHWA 1QHGA 5LRSA 5FLMJ 3GTQJ 1H2NA 3I71A 5B3SH 3KP3A 4Q6GA 2JEXA 2JPCA 4V19K 2K85A 4CCNA 5FPOA 4DW0A 4CXFA 4UV9A 4TT3G 5EC1C 4BBSJ 3G73A 2EK5A 5ILVA 3LUTB 4B3AA 3K0DA 4UV8A 4UHTA 1ZLZA 2WLIA 2DMNA 1ZKGA 2GA1A 3KLOA 5D5QA 1ETKA 1DLBA 1FBQA 1R00A 1G3WA 4HLYA 2JA8J 3T4DA 3PFIA 2GSMB 3K7AJ 2RQ6A 5KK1A 2V9KA 4HX8A 1H2LA 3S8PA 1RI7A 3GLXA 3Q0VA 4IOCF 1O9HA 1QHTA 3Q4HB 3RBZA 1OCCC 4ZC3A 4L0ZB 1B04A 4JPRA 2ZXHA 2UUZA 4KJZA 4DOZA 1YITI 1DF5A 1SS3A 2KPMA 2RREA 4ZYEA 2PMUA 3KZYA 3LOCA 4P9PA 5CVVA 3FZVA 1Y67A 4KISA 3MZYA 3CRQA 3BAAA 2Y0SN 1ETOA 3NWSA 2HYFA 3OSGA 2XV4S 1H88C 2NYXA 3GWZA 1PL4A 3D8CA 2QDOA 1B8IB 2ZM6B 2VJ5A 5CBFA 3VQYA 2DYRC 1XMAA 4AVPA 2KISA 3MZHA 5LA6B 1R1TA 1XNRO 3N05A 2KQXA 2KT0A 2K1EA 5KUKA 4FLXA 1XNRB 2K9NA 1MNDA 1APLC 1ZTEA 3FXMA 3WODF 3BQZA 4D5FA 2RCVA 1RNLA 2FBKA 4M74A 3TGNA 3CZ6A 3GO5A 1XGMA 4BY7J 3AAFA 5LD2C 3PM1A 2JJ2G 3ETQA 2CS3A 1Q6HA 2MABA 3C2GA 5JVDA 1D8KA 1MBJA 4O4LB 1Y56A 4BJ6C 1MD0A 3OS0A 4XLEA 1E3PA 3HL2A 2EQRA 1V5FA 5FGMA 3DBLB 1K7DA 3F3XA 3FKIJ 4FE7A 1X3ZB 3I56V 1Z6TA 2B9SA 3JAMK 2VKEA 2IVMA 3JASA 2Y9ZA 5K5RA 2QQAA 3ZMVA 2LG4A 1WZ2A 2DE0X 1XSVA 1K33A 3BTLA 3LA2A 2CV0A 1W0KG 1YTFB 5J47A 1FIAA 3BR5A 3F5TA 3J7AY 4CH5A 2XGDA 2A07F 2M9HA 3ASOH 5FD5A 2W6IG 1GV2A 3KETA 3C7JA 1WA8B 3QO5A 5A2QN 4EVIA 3VYUB 4GCZA 5LLQA 4X20B 1HQCA 1SA0A 1Q82W 5EEAA 5IYZB 2P7TC 3HHGA 5IDJA 1NVPB 4ZYHA 2P6TA 1K79A 1AI5A 2PYLA 2PZSA 2JN6A 4EJVA 4E7KA 2ZJQF 1TUBB 3FYIB 3ZHUA 3A0HZ 2JS5A 4LH6A 1JT0A 4S05A 4OAYA 1RUNA 5KMGB 1JX9A 1IZ1A 3GTGJ 2PGGA 1SVLA 1WI3A 3HUGA 1LDKB 3MD2A 4UB8C 2B1GA 4BEHB 4F6EA 3S32A 1RKWA 5ERIA 2QKMB 1WKMA 4XRSA 5M3FJ 5BMZA 5IT9K 3RPQA 1XSXA 5HDGA 2AZ0A 1FAFA 4P55A 5JHUA 4X1IA 4I55B 4U0VA 3BHPA 3S2HJ 4LP8A 3HRSA 4X1EA 1NTZH 2BSKA 2Q8VA 1X1CA 3RKXA 4XLCA 3S2DJ 1GK9A 3ABTA 1X4TA 2DMXA 2ETNA 2VXZA 4FVMA 4JZ2A 1RPOA 1I27A 3IAM2 3IH2A 4IXAA 1EN6A 2DPUA 3ABMC 4B3MO 1KKCA 1J09A 1MBEA 4GXOA 5GAHJ 4KMFA 1B4AA 5J3LA 3CCVI 4L87A 1KQSU 1X2MA 3G67A 4TV8A 1WJ5A 2LR8A 3FX7A 4HEA2 4BQNA 3OL3A 2CTRA 1VQ5I 3S93A 1LB2A 1FY7A 3HOZJ 1W5CC 2LMDA 1WB8A 3K59A 4L9JA 2L7ZA 2FTKA 2ZO4A 1POGA 5CJ9A 4I02A 2Z3YA 1YI2V 1FKAO 3CRMA 2I5UA 1K83J 4MO7A 1V5GA 2DBBA 3F8NA 2JMWA 1X1DA 2YEVA 4BAYA 3QRFF 2PF4E 4OX9B 2W00A 2CTQA 3DTUB 1BN5A 3ONQA 4A3EJ 2WAQA 2VT3A 4CH4A 2ID3A 3A01A 1ZQ3P 3DXRA 4J7KA 3X2QC 4KIFA 1OYIA 2ETHA 3VSLA 4Y13A 1T0FA 4ZHQA 1G1XB 4L5EA 1VQNI 4QPOA 3AG3B 5IE9A 5CKTA 2B5UA 3APOA 2LGWA 1OYWA 1X3UA 4CYCB 4Y52J 2QTOA 4IYHA 1OCTC 3A8TA 1WPBA 4RUEA 3FXJA 4DBRA 4MTXA 3WB2A 4LMYA 3E22A 3E6BA 4EEFG 1NG6A 4B43A 3FHZA 1G8MA 1H8HG 2CH0A 2Q9LA 1D0ZA 1JTXA 4PZJA 5E79C 1OFCX 4DV5B 4IL6Z 1N8RW 4XKCA 3HB9A 1K78A 2TRTA 3OYLA 3HOUJ 4A3GJ 4JI8B 5GTIZ 2FF4A 4NC8A 4UNOA 3JCZA 4X9QA 3B2EE 3E8BA 4IF4A 2CMPA 4L9TA 3A4CA 4RO2A 3VOEA 4PJJA 1NTCA 5FLXZ 1Z9CA 2GV9A 4E7IA 3FB8C 4AQYB 1LE8A 3MHSC 2VN2A 1B06A 2IH3C 2E75B 4ABMA 2X6XA 3Q3SA 2ZJRF 1P7BA 2W57A 5HVQC 4O4HB 2L0KA 3NRVA 2E3CA 1Z5VA 2EILC 4YHHO 2ZXJA 2JPBA 2QF7A 1J2XA 3PUFA 4O6JA 2LF7A 4TWKA 2WC2A 1K6YA 3L00A 3WE2A 1AR4A 4H4KC 5J9PC 1W7PA 1DK1A 3OD4A 2BOBC 3AG2C 2OTJI 5HFLA 1R58A 3FWEA 4RAYA 5EYRA 2HDWA 5D5VB 2R93J 1XDSA 4LGWA 1NT2B 1US6A 4YJ2A 2LC2A 3AG7A 2Z0AA 4ZYDA 4UY8I 2OTLV 2PI4A 1BOAA 1R23A 2MW2B 2NLJC 4LR3A 3UKMA 3JATA 2OYQA 4D9JA 2IRFG 4MTGA 3K1MA 1ITYA 2LQTA 2IGNA 3M7MX 3CD6I 2Q2EB 4M9SA 3G6BA 2OC6A 1RRJA 1OJLA 2XRNA 1H2SB 1O7LA 4G27B 2XF6A 2BXYA 3EVKA 5B66Z 3KZIC 5DUIA 3S3NA 1P7GA 4K35A 4Y3OA 4QPJA 4NXMO 2DI3A 4XSZF 3ABLH 4NXMB 2VLAA 2PJRB 4XKWA 4PV1B 1YIJI 1HSTA 3JW4A 3CP8A 3HSEA 4GDFA 2F95B 1T0FC 4AIDA 4RB0A 2IBZH 1ZAUA 3N4MA 3K57A 4QNHB 5BOXA 4LITA 3KPHA 4WX9A 1F36A 2R7VA 1TA8A 2IP2A 2BEOA 5LGTA 2JIZG 3JCUZ 1KU9A 4I9WA 5JQGB 3HKDB 1QU3A 5JCOA 5KCMA 2TDXA 4O3MA 3MWMA 4KIBA 3JRHA 2E1MC 1RFYA 1DTOA 4DYCA 2ECCA 4HZFA 4LBEC 4GYIA 2DT6A 4OIQF 2JUCA 2OWOA 5ICFA 2RV8A 2X6WA 5DDGA 4M3DA 2JGUA 2M1BA 2W1OA 4A3KJ 2C2AA 1W2BU 3K5LA 3OR2C 4UB6C 3JRFA 2NNYA 1JGSA 3D3QA 2CWEA 2WB1A 4XSXF 2X7RB 3BG3A 3JSOA 3PFYA 4PUSA 3WGIA 2Z2SB 5DCMA 1XHXA 3FK6A 3J81Z 5LYJA 3CDHA 4KITB 4A6DA 2IT0A 5E3OA 1OCOB 1IN5A 1KQ9A 4X66O 3C2BA 4X66B 1P7IA 5FRMA 4LG3A 2DFHA 1ZX3A 3DWLE 1YX5A 2RQQA 4WK8F 3FX3A 3V42A 1OISA 5HODA 1Q43A 1F1ZA 1XDCA 3LFUA 3FB5C 4HYEA 2A9HA 2YUSA 2EIJC 2P5VA 4WBNB 2EIKC 4MIMA 1HKQA 3BTJA 4MFEA 3PO3J 2RMKB 4O4IB 3AFHA 3L75H 2PG4A 1JTYA 3RKWA 2R7QA 1ZRCA 4FX4A 3DC5A 2C6YA 3HHHA 4M6YA 1KU3A 1AKHA 4Z6YA 4RQFA 1JJ8C 5H5NA 5FLXN 2N8GA 2E5ZA 3H5RA 5DD8A 3ZQGA 1BI2A 4UXNA 5K1YA 3JSPA 1QPIA 4UUTA 3DTEA 2HXOA 1IRFA 3GBGA 2AQEA 2ZXWH 3CCEI 3OOUA 1FNNA 5B1BH 2E1CA 1PKXA 3JATB 3C2HA 1JFFB 3MKZA 1YJ9V 1HSJA 3JRIA 5AIPA 1DUXC 4EEQA 1JA8A 4QPQA 3H1LH 4JZGA 1HLVA 3CUOA 4YG2F 2VQEO 4X64O 1N25A 4I9QA 2VQEB 4X64B 1A5JA 2XPVA 2BBYA 3WGGA 3Q5FA 1GN6A 3EXAA 2QGUA 4G2KA 4RAIA 3M99B 1FZPB 2RNGA 4N4NB 1AVMA 1MH4A 4E4EA 1F4NA 1TWFJ 2ESNA 4BE0A 5KAIZ 2ZMEB 4L5IA 2LDUA 2WA0A 4G7ZF 4D7TA 4LF4O 2GA2A 1IUFA 4IHVA 1ERDA 3L70H 4KXRA 4XDJA 4LF4B 2Q68A 5JCOC 4A3IJ 1SD6A 3WU2C 4ZTFA 2F1MA 4DR1O 3LSJA 4M3FA 3PIPF 1YTFD 4CYDA 4XIDA 3JRDA 4DR1B 1O3RA 3WG7B 1TZLA 3G3ZA 3OE7G 1FD9A 4BXXJ 2JVDA 1OJHA 2ARHA 2JGDB 4WFEA 3HG9A 4BDYA 1LJ9A 2O6GE 4EATA 3UT5B 3VPRA 2LD5A 1TL8A 5K1XA 1TT0A 1PD3A 2YI9A 1UHWA 2VBYA 2EV6A 4QIWF 4RGRA 3GF2A 1B6QA 2Y48A 3S1QJ 4FQGA 2XUMA 2V6CA 2DYRH 4IOAF 4B7KA 3VWBA 5EBLC 1NVPD 2EB7A 3OGCC 2H8RA 2M34A 4H37A 2P22C 4CCJA 3H36A 4M3GA 3OYEA 4OMYA 4RB3C 3K4LA 2V1DA 1FXKB 1Z21A 3FBIB 5IYCJ 4LH7A 1WN7A 1SQBH 3OOPA 4UFZA 2ZKOA 1W0JG 4GYCB 4OPHA 2WADA 1D5AA 4RM3A 1W0UA 1ZRFA 1J75A 2MBFA 2P8TA 3RYIA 2E5LO 2AXLA 1O3SA 1GN2A 2E5LB 5GAEJ 3A1YA 3J81N 1F5TA 4FLTA 1ZH5A 5HNHA 3OYGA 2B1IA 1BBYA 3LSGA 1M57B 2CSOA 3ZX6A 1S72V 2ILMA 1ZAOA 2K9SA 4P96A 4XOPA 4OINF 5FKLA 4E70A 3JRCA 4FZ1A 5EZYB 1O7FA 3A0HC 3T4ZA 3GFIA 2F2EA 5EG0A 1VQMI 1XMOB 1C0WA 2XAQA 1PL0A 4XDKA 1FYJA 4XRSG 3FXUA 3BQYA 1Z91A 2LY9A 4LC1A 1XILA 1WHUA 3B73A 2TCTA 4LF8O 2H09A 3T1CA 4HX4A 3JYCA 4LF8B 1IDZA 4A3BJ 2CFOA 1UG2A 1ON1A 4MSWC 3BEHA 4R6ZA 3HRTA 5IYCO 1X1AA 2ESHA 1VF7A 4MFDA 2IPQX 1G8XA 2LF8A 3W3CA 3ZRGA 1SAXA 3G6EV 4Y17A 3CMEI 1FJGO 4EJOA 3GLLA 3OS2A 3Q9VA 3B40A 3FXRA 5TISZ 2V7FA 1WGXA 3LWFA 2ITDC 4JAAA 3HOXJ 3CCQI 3T1YB 2E71A 2JZYA 4MVUA 2MGQA 2ZJPF 1D3YA 3QWLA 2O5RA 3O3KA 4MVMA 5B1OA 1IURA 3D5SC 1OCPA 2D2CB 5F64A 5M3MJ 2YR2A 1JR9A 1EKEA 5EEHA 5BXZA 2FNPA 2HVRA 3GFMA 4XLPF 4Q5SF 1RR8C 2N05A 2EJRA 4LFAB 2MSYA 5FNVB 4LFUA 3UM7A 2Z16A 3E86A 2PMZN 2E2IJ 2ZE6A 2QUFA 3QO8A 3SR2C 2W4SA 3JARB 1UG0A 2HJDA 4WCEV 4XN3A 4AIJA 1MW7A 1ZYRF 2L7KA 4QE7A 1I08A 3RW0A 1XBLA 3PNYA 4UUSA 3CCJI 3HKEB 3WG9A 1VQ9V 3MVPA 2F5CA 1VI0A 1I5XA 3B8NA 1JGGA 4N23A 2R7TA 1ZL8A 4FCYA 3LA3A 1MSEC 2IH1C 3BVOA 3OM3B 2KIMA 3KIOA 1TUEB 4O4JA 1UAAA 2AXTC 1DDNA 1Y66A 1U5TB 2IA0A 2L9VA 5DM7F 3LQRA 3JAWB 4R50A 3RYFB 3CC7V 3IRQA 2ADPA 2H8PC 3X2QH 1Q90D 4RGUA 2L2OA 2W0FC 5BZBA 1SVOA 2HEPA 1T5EA 4XKVA 2VE8A 3IC7A 2PQ8A 4A69C 1ZR2A 1DPUA 5EK0A 5IYDJ 1NQTA 3KLNA 3G71I 1Y0NA 1H2MA 3DEUA 4U88A 5HDKA 2ICWG 2Y4UA 3FB7C 2Y69H 1YX3A 4X6AJ 2YIBA 1QPMA 4PA9A 3SHFA 3CDIA 1H0MA 4LWSB 4DW1A 4D7SA 5E1AC 3LSMA 3AG4H 4MVSA 3LSIA 2DTZA 4IHSA 2LFSA 5CA0B 2PX9A 5DN6G 3H3ZA 1T98A 3WTXC 1P49A 3F6OA 2QKCA 4KT6A 5E8GA 3G4SV 3CX5F 2HOEA 4N4OB 2KP6A 5F0FA 5LEKA 4LG0B 3DEWA 2AGAA 1FPOA 1BQ0A 1R6NA 4I0XB 2BGCA 4EFEA 5L3FA 3JTHA 3KX2A 4KICA 3RSNA 1FYKA 1GMGA 2IA2A 3COAC 2EILH 1WH5A 3HKBB 2E1OA 2Z5UA 2VQCA 1U0JA 3ROUA 2BYVE 1MABG 1R3LC 3R0AA 1RR7A 1YJWV 3BZ6A 1MSWD 1D1BA 5IYDO 1BL0A 3AG2H 2JA5J 2Q5ZA 4X1KA 1S5JA 5B1NA 1S5HC 4BYYA 2F5FA 4G12A 5EIBC 3VDXA 1QR9A 3FXLA 2KQRA 5HNFA 1DP3A 2CE4A 2MH2A 4KHPB 3T1HB 1QLEC 4DK1A 4YJ3B 4HF0A 4YIIA 1BM9A 2HVJC 2RJZA 2X6OA 5AG2A 3ZCCA 1Z0XA 2H27A 1WB7A 3CC4V 5IT9N 3BJOA 4HSTA 1KYOF 1QNMA 4R1HA 3S17J 2X9DA 2Q6AA 2AZ2A 2VONA 1JPXA 3WTTC 1SZTA 4CHUA 4UB8Z 3JD0A 1H9GA 2ZR2A 1XI1A 1FMWA 1G4DA 1IXBA 4TQDA 1P84F 4DRXB 5GPCA 4I6ZA 1HNWB 1TT5B 1HKSA 3ABKC 2M7BA 5D6FA 4CS2A 2FL4A 4XQFA 4QLCU 1Y1WJ 1KQ0A 2F5EA 3FISA 4JK1X 3OYKA 1P6RA 5FKKA 4R79A 5IP7J 5BS6A 1TGOA 3OGIB 4ZZLA 4MT8A 1UHMA 3GEZA 2EX3A 2ZNYA 4NBQA 2MG4A 3IL2A 2PJPA 3OTOB 1R5GA 2BZTA 3ABUA 3LNNA 2XGXA 5GTHZ 2WLMA 1JJ6C 1BHAA 2DOAA 3DTIA 3TW6A 3IKVA 1HNXO 3SZPA 5E18F 4YFXF 1Y76B 1T6SA 3BR2A 1HNXB 1NHAA 3TXQA 2HQ5A 2Q4PA 4R8HA 4EGYA 1MDMB 2V1UA 5IJ9B 2FSWA 3TGUH 4U3JA 4O2AA 2RGVA 4IEJA 1Y39A 2XRLA 2PTMA 1IN6A 2MD5A 2W7NA 1UCRA 1QQIA 1ZN2A 2LVSA 3KFWX 1R73A 1SZXA 2EIJH 2Q1ZB 3VQXA 5JJEB 1X3WB 3MKLA 1XGOA 2EIKH 2ECBA 2FD5A 2AO9A 1IBMO 1S9HA 1U97A 2Q73A 3QG5A 1IBMB 1FYMA 4DV0O 2KHMA 3KCXA 2QBYA 3RGBA 2V1XA 3CCSV 1S7AA 3KYLA 1Z05A 2R7UA 1BR4A 1F51A 4HW0A 4JTCB 1I5ZA 2XSDC 1S77D 1WJAA 2NOGA 1A6IA 1YG2A 3T0YA 3K4CA 2ITCC 2VIXA 2XHKA 1R22A 3HTUA 2IBDA 1XMXA 2HNHA 2JT1A 5DCFA 4WCGA 1KP3A 2X6AA 4MVZA 1XEQA 3QTCA 3CCLV 2HOAA 1A04A 4YY3O 1EM1A 3I56I 4YY3B 4K2EA 3H1JH 4C3JJ 1D0XA 4X62O 3QQAA 1KYZA 4XLNF 1PDNC 3AG3C 1ENHA 4I0BA 2QWWA 4X62B 4JI2O 2RN9A 2KKOA 4RMNA 1H38A 4JI2B 5JWPA 1YIOA 4QIWN 4F6RA 3JSLA 1DGWY 5J2TA 3ZRWA 3AK2A 1X2NA 4CCLA 1ROPA 1XNQO 3C3TA 4B3SO 1XNQB 3HTSB 1E1QG 2ZC2A 4NC7A 3MN2A 1ORQC 2GXAA 4I0AA 2VODA 1ETXA 3LDCA 2P7CB 4DK0A 2EH3A 4CH3A 1DU0A 1M93A 2WLHA 1NI8A 4M9ZA 2NVUB 3R6SA 2GUZA 5IY5B 1N34O 2NS8A 4B4CA 1IXMA 4G7OF 2EIMB 2IGMA 3L74H 2VKVA 2O3FA 4DGWB 1FJLA 4WXHA 3VB2A 1YDXA 2XKOA 2VQGA 1RSOA 2QE7G 1MA1A 2P4KA 4IIJB 1ORKA 1BA5A 4JI4O 1WCMJ 5JI6A 4DV4O 4JI4B 2F5VA 3DEEA 3ZQQA 4DV4B 4BH9A 1QCEA 2O03A 3CRAA 4TV9A 3Q0WA 4LK0F 1SQFA 4II2A 3SDBA 1QZEA 2XAGA 2NAZA 3QYFA 4QE9A 4ZDLA 1AA7A 4XNFA 4HOBA 1KU2A 1HWYA 1I5YA 4JTAB 1H8EG 4LF7O 3ASNC 1I1GA 3KZIZ 2OPTA 3K5OA 3W7TA 3ECHA 1T56A 2NOJB 3ECOA 3U1KA 2G38A 4LNUB 4GX0A 3DP7A 4A0XA 1N4CA 2ZINA 1EH7A 4LOCA 1PP8F 5D5XB 4U7NA 1T39A 5B3SB 4D5CA 4RS8A 2CUZA 1JOYA 1A6QA 3JD1A 1HDDC 1JT6A 1SVMA 2RC4A 2QQ9A 4BQAA 4FJCC 2QA4I 2L9SA 2OU2A 3TO6A 4M71A 5L3EA 2CTWA 1S5LC 2CJJA 3CUQB 2DU9A 1ON2A 4FFKA 1OQYA 3M1CA 1YS7A 1YI2I 2LYCA 3IH3A 3S3OA 1L0NH 4XBFA 3AK3A 4IT5A 3LL7A 1IBKO 2X4HA 1M56B 3CWBH 4UB6Z 1IBKB 3A0RA 2FQ3A 3HXLA 3F23A 3V4GA 3KP7A 1RKTA 2ZMEA 5LHGA 2YSUB 2CGOA 4WFHA 4OGQB 3BG9A 2DDBA 5C4JJ 1XGSA 3N2GA 4X88A 1Q1HA 1UELB 3TOBA 1Y6IA 4I4TA 1V3FA 4ZIBA 4AHCA 1VQ7V 1GXQA 3GTLJ 4DO2A 2QKSA 4PJ0C 3V8KA 1PM9A 3HPHA 2VBWA 2UWMA 1TW3A 2YS9A 1GDTA 1UMQA 3DPUA 2JGDA 4UCSA 3HZJA 2WLLB 4BGDA 3K1NA 1ZR4A 2CK3G 3CF2A 4BU2A 3E0JB 3CJHB 3RYCA 1N0JA 1HDJA 3TO9A 4UVCA 2ZCEA 4ENNA 2F4VO 5DTDA 2IJIA 2F4VB 2VXDA 5CVIA 4L9NA 2LK2A 1OCOC 4ESBA 5IOZA 1PUEE 2R4GA 1BQZA 2YU9J 2EINH 3ZMDA 4RB2C 3K6GA 4P9OA 1QRYA 3GW2A 4JF3A 2IAIA 4IJAA 1D1AA 4PI2A 4M6VA 4WXCA 5H6RA 5E3LA 2BTOA 2EZLA 2EFOA 5FB2A 1E3OC 1IXRC 3M8JA 3ZR8X 4MNUA 3RTRA 1HDPA 1AP5A 1EN4A 1SKVA 4P5OA 3ZMTA 3E8HA 4LB6B 4C7UA 3IC9A 3N27A 3GXOA 2E5NA 3RPUD 3SYOA 3ML6A 4HQMA 5JFRA 3OS1A 4V2GA 1ENVA 1LUVA 3ASOB 4FLUA 4YIFA 4O2BA 2HHHO 1YSCA 3RVYA 5HLHA 2HTSA 1WJCA 3FXQA 1FYLA 4M9XA 2HHHB 1QNTA 2JVGA 4UVBA 3I54A 1K6OA 2P5OA 1IF1A 1E1RG 3EQLF 3C18A 4I09A 2V4JC 5JR3A 1AILA 4Y7NJ 3RDIA 3BABA 3WU2Z 4J7ZA 1FX7A 1MJ9A 3GUDA 3EETA 2KG7B 1LFUP 5CA1B 2X6YA 4DBQA 1FFTB 2WAQN 1IXCA 1I6HJ 3GZNB 2QM7A 2KIFA 4XDLA 4X65O 2QQBA 4ENMA 3FF5A 1RUOA 3HOYJ 2GXGA 4DZPA 2L02A 5CMUA 2JA2A 2NS0A 4JYCA 2ZMEC 3F0CA 1OKRA 3H9JA 3W6JB 3IRRA 5J8CA 3MAJA 4J9YB 4TUYB 2XDVA 3P7NA 1Q8IA 4PDRA 3O8HA 3ZXSA 3J7YJ 1OHHG 5LXTA 2ZNJA 1BL8A 5LMNO 1MNEA 2BVLA 4ZZDA 2DMTA 3P9CA 2IM9A 3W7XA 3M1EA 1NU1H 5LMNB 1IN4A 4OMZA 1JHHA 4E7ZA 4GYGA 3HOSA 2HOTA 1RZ4A 4ESJA 3ULQB 2EJ7A 1IG7A 1V4RA 2XGEA 2AW9A 5ILUA 1BOBA 1YRNA 2CYYA 1BC8C 3VODA 5DUKA 4CZCA 3BP8A 4BQQA 4A3JJ 3E5UA 1R5ID 5HFMA 1G4YB 1K9MW 1DGRM 1MNMC 5BPIA 2YUAA 4BXUA 5J2UA 1H8AC 1THZA 1QVFU 1H2GA 1MMMA 2VRZA 2EFPA 3RCOA 3CCUI 5E8IA 1FXKC 4NKGB 2IJLA 4OIOF 2DYSC 1Z77A 2DA1A 1NR7A 1SFUA 1VQ8V 3A2FA 2H1KA 1JCHA 3OT7A 3JAKB 4MW8A 1XQ8A 3E6CC 2E1NA 1K4SA 3F5WC 1GVJA 1V5EA 4ITVA 3PN1A 1HNZO 4OU0A 2XNDG 2LNBA 3HOVJ 4KYWA 4GX5A 1HNZB 2X1EA 2PI0A 2HOSA 3W7WA 4S04A 4RUFA 4GLXA 5BR8O 2YX4A 4B3MB 1G59A 2JUGA 2PUSA 2XF5A 3CCRV 4L8JA 4HRIA 3ZIAG 1M57C 1MBHA 2W82A 2VJ4A 5CB4A 4ZJZA 5K5OA 5HLGA 2ME0A 4FLVA 2WAEA 3HPGA 4JYKA 4XKBA 1JKQC 2DFFA 1EBOA 5EDNA 2HKXA 3BPVA 3IHUA 1KMIZ 5LOVB 2R7XA 2P4VA 1EF4A 2XIGA 2J5PA 3BY6A 4EJUA 2WAFA 2IS2A 1D0YA 2JRIA 2LLKA 1Q6IA 1OPCA 1GV5A 3DXJF 5HS9A 1K97A 1YJ9I 3NEUA 5CQEA 2DDAA 3CTAA 3ABKH 4MEYF 3FIWA 1XSDA 1XX5A 2MLKA 1BSMA 3LSSA 2IU3A 1OCZH 1FOYA 4A0YA 1K92A 4B3RB 3WGHA 3GFLA 1SERA 2B7EA 1WWXA 2F23A 1TQIA 4FISA 4NTYA 1VF9A 1CF7B 5BQTA 4Z1VA 2HTJA 3ZQIA 5BMVB 2K3PA 5ITZB 4JP0A 5E3NA 4GFBA 4ZI7B 5LEJA 5C8YA 5HOOA 3H1HH 2HVKC 1ACIA 1AOYA 1XMQO 1P2FA 2L4AA 4HZ3A 3F7YC 3K0GA 1XMQB 3CO7C 4PSXA 4NHJA 3OEHG 4QPKA 2QLZA 1W0TA 5D5WB 2QTSA 1EH6A 1V55H 2EBIA 2WB1N 4OIPF 2VS0A 3BG7A 2XSJC 3OYJA 1VQPI 4ZOLA 5CLSA 2QKAA 5KX5B 4FTHA 4D6TH 2AXTZ 1YCIA 1YO5C 2CGNA 3K69A 4ESFA 1ZHFA 4BQOA 2R5ZB 4GZRB 4DUYO 3R60A 2KMUA 2FA5A 5EJCA 3ZQCA 4RLQA 4DUYB 2HYGD 5B1AC 5JH7A 5GAGJ 2R72A 3HRMA 3K70D 4Y33A 5DEQA 4ASNA 3ABLB 4YHHB 5J40A 3FXOA 2HYJA 2QSFX 1XD7A 1G2HA 1JVMA 2M7WA 1YE9A 5B5EC 3GTKJ 1WFXA 2NVQJ 4QJFB 4CICA 2R70A 4QTRA 2DO7A 5H2FZ 2V26A 2V7QG 2XT9A 3JREA 3LSTA 3U0ZA 1YHQV 2PY5A 3GTPJ 1U5TC 5CVRA 1YITV 2IGKA 5F08A 3TMOA 3RZDJ 4AUXA 2R92J 1F23A 2N74A 1RM1C 2E35A 4JAUA 3HSRA 3STZC 3FMQA 4LLLA 3AG3H 3H9VA 2QWPB 4F92B 2PYJA 4GGGA 1F4KA 2WV0A 1TAEA 3JD4A 5LP6A 1T38A 1XC5A 2E34A 2WA3A 3GWOA 4IHJB 3IFXA 1K4TA 3N2KA 1BIBA 1ZELA 3PSIA 3U21A 1TWGJ 1KP2A 1F7YA 4IKFA 1NBMG 4X8AA 3CP1A 2HVSA 5K1PA 1UHSA 1SFEA 2GIZA 1OCRH 1K5SA 1GN3A 3FAVB 1REPC 1HF0A 2WY8Q 5A9GA 1GRJA 2E7XA 2R9IA 2Q7EA 2DN0A 2L7FP 4BXFA 2W84A 2R7WA 1HBXG 2A05A 4JX4A 4W97A 2ISZA 2WPDG 1W4MA 1N78A 4LFBO 3OEEG 2LKXA 2BY1A 4JOMA 1MIJA 4IPAA 4LFBB 1O3QA 5EYPA 3UO2A 1JI8A 4PJNA 4HV5A 4DQ2A 3F72A 5JLWA 1SQQH 5DS9A 1MDMA 5IJ9A 4LF5O 2IXSA 1GVDA 3DLAA 4ON0A 5TJJA 4ZDOA 3CRRA 1Q7YW 1ETWA 5J1RA 1VQOV 5CVUA 4L5JA 2WWYA 3M3YJ 3DCFA 2A68F 1FFXA 3ASNH 4HLXA 4IRIA 2QGNA 3E5XA 1UFMA 3LSKA 3WB0A 2GZWA 2ZXWB 2L3DA 4B44A 1BR1A 5B1BB 5L3BA 4A5UB 2P0WA 3OR6C 3QPLA 3IGAC 1KECA 1R1BA 4UCUA 3GFJA 2DMPA 3CC2I 3W2AA 3JRGA 4A12A 1NZ6A 1BGYH 4EB6B 1PUFA 3CEIA 4V2FA 4KNYA 3I4NJ 1V9PA 2D45A 1ZG1A 1MJBA 2R0QC 4D7MA 5F27A 2WV1A 1T33A 2BW3A 4LB5A 2JVHA 4AD9A 1M9NA 1AJQA 3SPIA 1R3JC 1PNKA 4CS4A 5D8LB 2O7OA 2X1DA 3QYEA 3QAHA 3GB7C 2OCCC 5J6XA 4G94A 4BIZA 2QWQB 1U6GA 4OPAA 4BW9A 1KZHA 1LKXA 2H94A 3AG1C 1Z3XA 1QVTA 5M5WJ 5LP6C 1KUQA 1WPKA 4JTDB 4AI8A 3CC7I 5LMUO 1VQ6I 3TK1A 4EKWA 4MQ9F 4FLWA 1FBSA 2ZDIA 1TW2A 2GBYA 5LMUB 3CPWU 4K8ZA 1EN5A 2LW1A 1S7EA 1TNTA 3I59B 3O6BB 3J80Z 2L6LA 2R5YB 2M6YA 2HDDA 5L3GA 1DQUA 4FPPA 1VQ5V 3GMEA 1N33O 1TVKA 1N33B 1QA6A 3MQ0A 1Y74A 4J41A 3G80A 4II3A 2K9PA 3CP2A 3M9AA 3RWRD 1E17A 2HS5A 4E2LA 1WVRA 1AR1B 1U9NA 3DKXA 1OCCH 1RETA 2CO5A 1YQAA 5L3CA 3SFZA 3AEIA 2VOPA 3HGGA 3KEYA 4AC0A 5GP9A 2ZE7A 3LSUA 4OX9O 2NNUA 3CJRB 2LTPA 2VASA 1S7OA 2ZR3A 2HKOA 3MMYB 4WFGA 4PCQA 1TWHJ 2K3FA 2ZT9B 3L71H 4PA7A 5D6EA 3K10A 3KEOA 5FD6A 2QJ1A 5GONA 1XHZA 4U0WA 5HDNA 2CUGA 1LDJA 4P2ZA 1IVSA 2LBFA 1XG1A 2EPFA 2OBPA 4I01A 2Z1DA 2O8KA 2H3OA 2IGOA 2FNAA 1T2KA 2ZXIA 1R3KC 2OD5A 1SANA 3TEDA 1SF9A 2CV2A 3RYHA 2WLJA 1YJWI 5JJNB 4KA4A 2HG5C 3BFRA 5KAFC 3ELKA 2VWJA 2W85A 4MTDA 3RKQA 1PP9H 4XONA 3OUFA 1KGSA 2XF7A 2KB1A 1W59A 1B72B 4CC6A 4JX6A 2RVCA 4KUMA 2WLIB 3FHNA 3I0TA 2Y75A 3OYFA 1GM8A 4HNAA 5FLVA 2GDSA 3BJAA 2AHQA 3ML0A 3LSPA 2VB6A 3IUOA 4PDMA 4MS2A 2P67A 2EZIA 3ZMZA 3FYEB 3LNMB 2DOFA 4Y4RA 2JSPA 1E0EA 2W6JG 1B1BA 2JJ7A 3K5MA 4GX2A 4RM2A 2BE5F 4KMUX 3EYIA 2KRFA 4IO9F 1RP3B 1HW2A 3JAMZ 1B6AA 2ZDIC 2VC1A 3K5NA 3TKYA 3AL0C 2FMLA 2BY3A 1VIBA 3C90A 5AIQA 3SEZA 1EH8A 5IY5C 3HRUA 4I50B 1V54C 4LJZF 3U2RA 1AHDP 2F4IA 3BROA 3C3WA 1P92A 2DA6A 4BJ5C 2BHYA 4JASA 5KUMA 1JQ0A 1U9OA 2LSOA 1DGSA 1HW7A 2W48A 2F43G 3CD6V 3Q4HA 2CW8A 1M5IA 5JVDB 4KFCA 1UFIA 2HPMA 1MMAA 5EBWC 1QZYA 5LRRA 4XICA 2LGQA 1FC3A 3ZHQA 3JAMN 5DD4A 3U11A 1R5HA 2G7HA 3WTVC 1URFA 3I55I 2DYSH 2OQGA 3DF8A 1FIPA 3E6MA 1S5LZ 2BOCC 3JASB 3BRCA 4JI3O 3J80N 2FBIA 4A2UA 1B8IA 1W1WE 2L35A 4WF9V 3QPSA 4E7HA 2O61A 4DYRA 4JI3B 5LA6A 5IT9Z 4MTOA 1P4WA 2V6EA 3ABMH 3DBRB 3E8GA 2K4JA 3X2QB 2EFQA 2FMYA 5EGOB 2RKHA 3FDYA 2KDOA 4FLZA 2E76B 1FBUA 4YIRX 5FKMA 2IJHA 4IVNA 3O2PE 4L9VA 1VQ4I 4IHTA 1SA0B 1BW6A 3DKWA 3F22A 4O4LA 4DV1O 3OUSA 3HIFA 2F4MB 1X58A 3CUQC 1R49A 3W6KB 4YIOA 2XPWA 2ADUA 4PJ0Z 2Y69B 1FLIA 5EC2C 3K4NA 3T5XA 2LFBA 1G3TA 1IRGA 4DW6A 1IAWA 3AG4B 1PP7U 1M56C 4DUZO 3B8MA 3HUGB 3I3LA 4F55A 5IP9J 3CCLI 5J4VA 3ETDA 2XROA 2E36A 4HF1A 2OJED 3K4JA 4Y15A 2JA6J 3B6AA 2EZHA 2M5WA 4HA8A 1R4NB 1WA8A 2BE3A 4FX0A 4X1IB 4UCVA 1SRYA 3U10A 3K1PA 4MHGA 1YYVA 3SJCC 1XGNA 3UCSC 4X20A 2A5WA 1DPRA 2RQPA 3HYIA 4Q48A 2BSKB 2ZIOA 1SC5B 5IYZA 5KHJA 2ZJ2A 2EILB 2VKDA 2HQAA 4I7HA 4EMSA 5GADJ 4HYOA 1ETYA 2GWRA 2VBZA 3CQZJ 1TUBA 4NXNO 5ICCA 4JI0O 3HKZA 3GTJJ 2LH9A 3BG6A 1VF5B 4H0LB 2PMHA 4NXNB 2M87A 1K8AW 4JI0B 4OOIA 4EM0B 3FBNB 3AG2B 2HP8A 2LP7A 3OMAB 3R66A 1JKRC 1NKDA 4TV8B 2HVQA 1XL6A 4BEHA 4PFPA 2VC0A 3C1DA 2LP0A 4M73A 1UZCA
chains in the Genus database with same CATH topology
3HSFA 2HFHA 2W24A 3BDDA 2HQNA 4BHPA 1ZGJA 3DV8A 4I55A 1TQMA 3OV8A 3WTWC 3FMRA 2L54A 4N0BA 4JV5B 3KCCA 4ZHQB 4JBAA 4N9IA 3QPHA 4U7DA 4EV0A 1WSUA 2EWNA 1STZA 4A5MA 3E22B 4DR2B 1J5EB 4GKKB 3KP4A 3TO7A 1K78B 2E7WA 2F93B 2RDPA 3KE2A 3L2CA 2OZ6A 5HS7A 3WTYC 4O5VA 5F1RA 1J0RA 1IBLB 4ZI7A 2QM3A 3KP2A 4BWAA 4UVAA 5CVJA 1Z5WA 1W7PB 3FFQA 2VBXA 1XN7A 1JHFA 5KHIA 4FM1A 2D2WA 1YW8A 4DR4B 3EYYA 5KX5A 1SFXA 4TQFA 4LFCB 3J7AO 3F21A 5ILSA 4O4HA 2HGCA 3E5QA 5JVTA 4EQQA 3TOAA 1G6NA 3GZ6A 1Q3EA 4FT8A 4N9HA 2GAUA 4DR5B 3BA8A 3F8MA 3TDZC 4HF2A 3H3UA 2L4MA 2V79A 4B09A 4DV0B 4LLGF 4HQEA 3RJPA 4ZH4F 1EV7A 1N36B 4AILC 2Q2EA 2YX7A 3QP6A 1CGPA 2Q0OA 1FP1D 5FLXK 2EFWA 4DR3B 3LA7A 2YPRA 3ISPA 3QU3A 1LDDA 1MJAA 4I2OA 1JJOA 1WI9A 4PHZA 5DCMB 5LYJB 1Z6RA 5ED4A 1LVAA 4MGRA 4FM2A 3SZTA 4MTEA</