1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
molecule keywords hypothetical protein MJ223
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
3W6KB 1S7OA 2HQRA 2FBKA 3WODF 1W5TA 2M1BA 5LHIA 4A5MA 1IRFA 5A2QK 5LRRA 3R0AA 2YR2A 2XAFA 1Z9CA 3WTWC 2HOEA 2VXZA 5ED4A 1FY7A 2JRTA 2ESHA 3D5LA 3BJOA 1I1GA 1QGPA 3JSOA 4G6DA 1O7LA 1TQPA 4HBLA 1CGPA 3ISPA 4HF0A 2DAOA 4GYGA 4QWQA 3JAMK 2MLKA 3J7AO 3WTTC 4OINF 1MDMA 2JPBA 2BYVE 4BHPA 3F8BA 1BM9A 2IA0A 2Z9OA 3FMRA 1DPRA 3FM3A 4CDGA 1MGTA 2ACJA 4EM2A 4NHJA 1U5TA 2RC4A 1UHWA 2PLYA 3D0SA 3GXOA 5JR3A 2BEOA 3P9KA 1S7AA 2A68F 3SQNA 2YPRA 2MD5A 3DQVC 1XB4A 1ON2A 2DLLA 2QYOA 3E6CC 4R79A 3DPLC 3KEQA 1BIBA 3GFIA 1FC3A 2P7CB 3WE2A 4ESBA 2W24A 5E8IA 2O03A 3TOBA 1H9GA 3HOTA 4A0YA 4HLXA 3IRRA 1J2XA 1YW8A 4OIOF 4K2EA 3QU3A 4UVCA 1YO5C 2GWRA 4G9YA 1BOAA 1D5VA 1U78A 5ICCA 4LB6B 4HZFA 1T38A 3REOA 2DI3A 4HX8A 4M9SA 3F21A 5JI6A 4EGYA 2K4BA 3TDUC 1ONVA 4OOIA 2F5CA 3E97A 3TQNA 1ZLKA 2PFBA 5DEQA 1XMAA 2LF7A 1LB2A 4P55A 2IT0A 1EV7A 3DKWA 2VC0A 4EJTA 1YYVA 2J5PA 1KU7A 4HX4A 3FXRA 2L54A 3PQJA 1W7PA 1R58A 5DD4A 2W85A 1UHMA 2PG4A 5LHGA 1IZ1A 3HTSB 5HLIA 5HS8A 1P2FA 4M72A 4ON0A 2WTEA 3WTUC 2Z33A 2A3SA 5FLXZ 4RGXA 4WWCA 2KIMA 1IN8A 1RUOA 1MZBA 1R5HA 1FT9A 4G7HF 2FA5A 2QLZA 3IWFA 3L09A 2W84A 3HRTA 2Z99A 5BQTA 3V8KA 2FMYA 4CICA 4NB5A 1YTYA 1J0RA 1SD7A 2NNYA 5H20A 2ZMEB 5LGTA 1I1SA 1WQ2A 2K27A 4GXOA 1W5SA 3F6VA 4O5VA 2OZUA 2E7XA 1FYKA 2NRAC 4ENKA 4BH9A 3CJNA 5FGMA 5FD5A 1WKMA 4LFUA 4M73A 4PDKA 1V3FA 2Y75A 4GGGA 2YSRA 4LK0F 4YFXF 3U2RA 1FYLA 3KCCA 3K0LA 4ASNA 3FMQA 4EGZA 4EJWA 2ZNZA 3F3XA 2DU9A 3FX3A 3NRVA 3P7NA 3Q9SA 3MFKA 1IN5A 3NQOA 4DQ2A 4O3MA 1P4WA 5AIPA 4MTEA 3ZP5A 1SMTA 5H6QA 1EH6A 1U6GA 3T0YA 5K5OA 5EEGA 4L5IA 3T5XA 4JK1X 2DPDA 2EFPA 4EM1A 3AAFA 1ZN2A 1HKTA 3DF8A 2YU3A 1ZRDA 2R7DA 4U0WA 3VODA 2A69F 5LHHA 2PI0A 4CXFA 4M6XA 3EUHA 1R5GA 2QQBA 1QZYA 2P4WA 4RS8A 4LMYA 4Z2YA 2PMUA 4IRHA 2FNPA 4YFKF 5D8KB 1G3WA 1BI0A 3K1PA 4OMZA 1EH7A 4EV0A 2V1UA 3VOEA 1FZPB 3R0JA 4PGGA 2JTVA 2V1XA 3ZQ7A 4EJOA 4M9XA 5E20A 4DNCA 4E70A 1J7KA 3TO6A 2VOOA 2G9WA 4KUMA 1T98A 5D6EA 1BI3A 3K1MA 1KU3A 4UNOA 3I54A 4R1HA 4I0BA 1TTYA 2XRNA 1QZZA 1Z6TA 2M30A 2CFXA 1RNLA 5K1YA 1FSEA 5E8GA 2G7UA 5HVQC 4A12A 4HYEA 2QQ9A 4UV8A 1W7PB 3I0TA 3FXUA 3G3ZA 1ZG3A 2FF4A 2ADUA 1T39A 1KA8A 3TDZC 3L2CA 3KLOA 4EJVA 5FD6A 3BPXA 1UB9A 2R7FA 4N9HA 4AIKA 4IHTA 2OA4A 2ESNA 2HR3A 2J5OA 4LLNA 1MD0A 4EJUA 2CSOA 4IXAA 4KNYA 3GFJA 1IN7A 4AIJA 4L5JA 3OV8A 4N0BA 1WRJA 5FB2A 3IL2A 4G7ZF 1YLFA 3DFGA 5DD8A 3E5QA 3J80Z 1DP7P 4I0AA 3BWGA 3KFWX 2IA1A 2KIFA 1B59A 3WTZA 1OR7A 3BOQA 5ICFA 2LNBA 3QP5A 3IKVA 1BN5A 2Q0OA 2FU4A 2LKPA 1T6SA 5DYMA 4M74A 5D4SA 3HRUA 1F4KA 4RAZA 3Q5FA 3IHUA 1C0WA 2QM3A 3Q9VA 2XROA 5E18F 3RKWA 1TBXA 1JXSA 4N9IA 4Q47A 2UWMA 1TLHB 3GFLA 1IF1A 3ELKA 1BC7C 1ULYA 1K78B 3KE2A 1SFXA 3TKYA 4L9TA 3J81K 1IRGA 2H09A 2HEOA 1R36A 1GXQA 2HS5A 1KU9A 3GLXA 1FBUA 4M9ZA 3ZMVA 3WU1B 3BY6A 2O61A 1KQ9A 2ELHA 1U2WA 2L02A 3QPTA 1QPMA 2RDPA 1XGNA 2XKPA 2P6TA 1O3SA 2A61A 4LLGF 3WTVC 4HF1A 4AVPA 1RIOH 2QWWA 3RJPA 4LG0A 4UUVA 1CF7B 3CUQC 5FFXA 3E6BA 2CO5A 3HUGA 1BBYA 4RB0A 3TO9A 4NQWA 2OAZA 5LLQA 4P9FA 1ZREA 1S29A 4KMFA 2FNAA 1TNTA 1DPUA 1TW2A 3M8FA 4I2OA 2H94A 3MAJA 2IA2A 2Y0MA 1VTNC 2XGXA 3GYHX 2JSCA 2VC1A 2A07F 2LSOA 5D6FA 2IVMA 4HW0A 5D5WB 1R00A 1S6LA 1B9NA 1LDKB 3O3KA 4HOBA 1F5TA 4OU0A 3DPTA 4BNCA 2HFHA 2MH2A 5D5XB 3MWMA 1LNWA 4TV7A 5FFZA 1J75A 1YIOA 2V6CA 4Y17A 1STZA 2P5LC 5J6XA 1IUYA 2XUBA 2RN7A 1F9NA 1XSXA 3U1DA 4U0VA 1KGSA 5HDNA 2IPQX 2UXNA 1R22A 1ZRCA 3H3UA 3MEXA 4YG2F 3HSEA 1XCBA 2WV0A 3RYPA 4BXUA 2E7WA 1GVJA 3KLNA 2HQNA 2DQRA 2MC3A 1KQ0A 1Y0UA 1LEAA 1I5ZA 3VEPA 1YFHA 1SFUA 1OMIA 4MEYF 2DK5A 3RIRA 3PFIA 1J5YA 1G3YA 5CVVA 2VT3A 3IKTA 4I98B 1HW1A 4EQQA 4P9UA 2W25A 3FM5A 3RKXA 3GUDA 2MA3A 2OD5A 1G4DA 5CLSA 4BHCA 4A5NA 5LGNA 2EV0A 1QQIA 4MGRA 2HYFA 3HTUA 1XN7A 4LG0B 4WCGA 2PQ8A 3SHFA 1HKSA 2OU2A 4HF2A 2FSWA 1HBXG 2ZCWA 3C18A 3ECOA 1Z1DA 5TRDA 3LFKA 5E17F 4HX7A 5L3BA 1FBSA 4M6YA 3ZN1A 1S3JA 3IWZA 1Z91A 4KMUX 4LB5A 5CVJA 4AWXB 3K69A 2VBZA 4GCVA 5DUIA 4IJAA 1O3RA 5DCMA 2BGCA 1Z7UA 4I01A 3LA3A 1REPC 1JE8A 1WSUA 1K78A 5D8LB 3R60A 4OIQF 2HWVA 4IVNA 2NYXA 3ABTA 4FHTA 3F72A 4KN4X 1PP8F 3BP8A 1SFEA 4XLNF 4IHSA 1ON1A 2GIVA 5KK1A 3I71A 3WGGA 3LQQA 5HS9A 4I09A 2XAQA 2EA2A 4CHUA 2O8XA 3F8NA 1TNSA 2K86A 3KETA 3ZMZA 1R23A 2MH9A 5BS6A 2EFQA 6PAXA 5ICEA 5F6FA 3OOPA 2HYGD 5JFRA 1FP2A 3HIFA 2L01A 2UZKA 1G3TA 2O3FA 3HRMA 3F6OA 1FPQA 4HQEA 4UXNA 4ZYGA 2XHKA 4RGUA 3B73A 2EV5A 3O2PE 1T0FA 2XVCA 2VT2A 3MZHA 2STWA 1FWZA 3V8JA 4UHTA 3O6BB 2ISYA 1HSJA 3CLOA 4H0EA 3E5XA 3EYYA 3C7JA 4MTDA 1UCRA 4ZYEA 3I64A 2Q8KA 2ZBKA 4RB3C 5HS7A 2QBYA 2HTJA 3B02A 2JZYA 5E1XA 4YFNF 5ILSA 1W7PD 3GFMA 3RPUA 3QPHA 4OMYA 2QQAA 5J8CA 3SZPA 3WTXC 5AIQA 2KIUA 5AONA 2HZTA 1XGSA 4P5OA 4WXCA 2GXGA 3FWEA 4CYDA 3G73A 4A6EA 1R1TA 2FOKA 4IF4A 2YX4A 4YIFA 3C1DA 3K9TA 3CUQB 2Z3YA 1HSTA 1HXDA 4IRGA 4L0YB 3LAPA 5DV5A 1USTA 1FNNA 1BI2A 3BDDA 1BC8C 4WK8F 1X3UA 2WWYA 3JAMZ 2BE5F 2EA4A 3RDIA 4G8XA 2E1CA 2EFOA 3ECHA 4EVIA 3SZTA 3RKYA 3QP6A 2K7LA 1QNTA 2IP2A 2DBBA 1LVAA 2D1VA 4XBFA 4RB1A 1S8NA 5ILVA 5D4RA 5D5UB 4BYYA 4GO1A 4B09A 1G3SA 3HSFA 1QBJA 2XAGA 3M7GA 4BHBA 1IXSB 3TO7A 2EJRA 2L3DA 1H0MA 2XIGA 1Z6RA 2M45A 1RI7A 1B6AA 1JGSA 3W6JB 2VE9A 1JHHA 1FLIA 2P5VA 4QLCU 3I58A 1IXCA 3M8EA 3RYRA 3V7RA 2AS5F 2QENA 3LA2A 4RAYA 3EETA 4HA8A 5E1WA 2ZKZA 3R4KA 1E17A 3I4PA 1Z05A 3KP2A 5CJ9A 2M5WA 1YS6A 4CZZA 4PZJA 4IPAA 1RZ4A 3KP7A 1WI9A 3WTYC 1D3YA 4L9JA 2ZXJA 3S2WA 3GX4X 1LDJA 2ZMEA 4HDVA 1TQIA 4WF2A 2K4JA 1OKRA 2F5DA 2FBIA 1SD6A 4ENNA 3H92A 3N97A 2B0LA 1XSVA 2F5EA 1FSHA 5DDGA 4L18B 2PMHA 3GW2A 3BZ6A 1WWXA 4HDUA 4XRFA 5IT3A 3KP3A 3GF2A 4ETSA 5BMZA 1OPCA 4A2UA 3WTSC 4MNUA 1SMYF 4U0YA 1FYMA 5L3FA 3DV8A 2DW4A 3HYIA 3RTRA 1R1UA 4I7HA 3LQRA 4S04A 5H6RA 1V4RA 2V79A 2F2EA 5LBQA 1EH8A 2VOPA 1JHFA 3QAHA 3LAJA 3I5UA 3GEZA 2COMA 4IRIA 3E6DA 3I59B 4FT8A 2VN2A 1IW7F 2JT1A 1XCVA 3N4MA 2EFNA 2CQKA 4D0PA 4PCQA 3I53A 4U7DA 2ZO4A 3ERED 3V4GA 5L3EA 3PQKA 4ESJA 5IT9K 2GZWA 3HHGA 3V8LA 1E2XA 3KP5A 3FZVA 5CVIA 5KVRA 3V7CA 2LDUA 1K6OA 1MJAA 5J8FA 1PUEE 2HDCA 4HQMA 2OQGA 2MLGA 3HOSA 2KRFA 3KP4A 1SAXA 4G6QA 4UVBA 2LF8A 3QOPA 1ZARA 5A2QZ 1ZLJA 5LGUA 5HLHA 2X4HA 3MCZA 2FE3A 4HV6A 1LQ1A 1ZGAA 4GYIA 5BPIA 3GVAA 3E5UA 1MJ9A 4HLYA 3ABUA 1ODDA 3T8RA 1B4AA 2ZNYA 4LGWA 4F7ZA 2JPCA 3CDHA 3COAC 5F64A 2TDXA 1HW5A 1K79A 3K1NA 3ULQB 4O6JA 4G94A 3T8TA 3IC7A 3LSTA 2CGPA 4XSZF 2CWEA 2DT5A 2H6CA 1U3EM 3FHZA 2MBFA 1CF7A 3VB2A 3SXYA 2FQ3A 4BAYA 4P96A 4LD5A 2V1DA 1LDDA 1OYIA 5LRSA 3EDPA 4A0XA 2QVOA 5HLGA 4AD9A 1FP1D 3CTAA 1ZAOA 2O6GE 1ZHFA 2BBYA 1SD5A 2AXLA 3QRFF 4KIFA 2HTSA 4CGZA 5FLXK 2FMLA 1XSDA 1T2KA 1AOYA 5D5VB 2ZJ2A 4Q5SF 4MQVA 5L3DA 2IW5A 1BJAA 2YX7A 4PGHA 5E1ZB 5HDKA 2QM4A 2EV6A 3GO5A 2D1HA 1PDNC 2L4AA 3DXJF 3ZMSA 3TGNA 2FRHA 1FX7A 2GAUA 3WE3A 4Y15A 4KIBA 1IXRC 1TW3A 2CG4A 2GA1A 3FF5A 3R61A 3BJAA 2A5YB 3ROUA 1R7JA 2NNNA 2P8TA 1TQMA 2OQRA 3ZN0A 4ZZDA 4L9NA 3QU6A 2XAHA 3EYIA 2F5FA 1BI1A 4WXHA 2DPUA 3BROA 3HHHA 2FBHA 1HKQA 3F23A 4ENMA 1ZYRF 3VFZA 4ENJA 2PEXA 4JQFA 2ISZA 2WC2A 4CO8A 1BIAA 1FOKA 5K5QA 4KFCA 1ZGJA 5HOOA 1B9MA 2PJPA 1MKMA 2VE8A 2Z5UA 4WX9A 3JW4A 1Q1HA 2IJLA 3BPVA 4YIIA 4KN7X 3E3VA 2EK5A 3FXQA 2QZ8A 4KICA 1P4AA 2DTRA 2DQLA 4U88A 3SFZA 1O3TA 4AIHA 3RI4A 2RNJA 4RGRA 3KP6A 1U5TC 4Y13A 2W57A 3MQ0A 2KJBA 4L9VA 1G6NA 4FX4A 4JBAA 4RB2C 1I6XA 4A6DA 5CVUA 1NHAA 5BOXA 1SD4A 5L3CA 3CUQA 2XASA 2GXBA 1A04A 5DCFA 5JVTA 3JTGA 2Q2EA 4FX0A 1P6RA 3F22A 4LJZF 4S05A 2V9VA 2KJCA 2H27A 2VONA 1J9IA 4ESFA 1USSA 1HW2A 1YG2A 2P7VB 2PN6A 5IT9Z 2G7HA 1XDSA 1B1BA 3RWRD 4LLLA 2VODA 2EFWA 4I02A 5K5RA 5CVRA 3CUOA 2QBYB 2HKOA 3J80K 2C6YA 5LEJA 1DDNA 4LK1F 4Q48A 2K02A 2A6EF 5ICGA 2H6BA 3ZPLA 5TJJA 4HAMA 2D2WA 3L00A 4OIRF 3GZ5A 1GXPA 3E6MA 3F8CA 1J59A 1KQ8A 1PP7U 2EWNA 5BPDA 1IN6A 2XAJA 1U8RA 1OYWA 3ML6A 1XGMA 3WGHA 4MEXF 3ZMDA 4KYWA 2KKOA 3IRQA 1L3LA 4MHGA 2DK8A 2DO7A 3P9CA 4ZH4F 3F8MA 3DP7A 2X0LA 1H9TA 1XDUA 1U5TB 2P6SA 4EMSA 1L0OC 4ZZLA 2XKOA 1FBQA 5ILUA 2QUFA 2GQQA 1MDMB 2CW0F 1P4XA 3M9AA 2Y48A 1ZH5A 3ZMTA 1RUNA 1LEBA 4A0ZA 1YW9A 3LA7A 4KA4A 2CYYA 1KYZA 2OBPA 5HDGA 1XD7A 2P5KA 2RQPA 3WG9A 3C3WA 1QO0D 2E1NA 4KIGA 1IN4A 2EB7A 2STTA 1ZRFA 5DCMB 2L4MA 2RKHA 3FMSA 2RGVA 4UV9A 4EM0B 1F1ZA 3WU0A 3HSRA 3JSPA 3BJ6A 1XMKA 2HKXA 3EQLF 3KEOA 2VBXA 1D8KA 3M1EA 5EEHA 1ZG1A 1YS7A 3SR2C 2BV6A 4RGSA 1D8JA 1K7AA 5FO5A 4BQAA 3J81Z 2O0YA 3K2ZA 2R3SA 2RV8A 2M8EA 5F1RA 1MJBA 1IAWA 2FXAA 4HV5A 2VBWA 3F8FA 3P9IA 4KDPA 4B8XA 2XV4S 1UFMA 3H3ZA 1HQCA 2NAZA 2UXXA 4R8HA 3U9GA 4G7OF 3KZYA 3T1BA 3GZ6A 3CO6C 1KU2A 2OZ6A 3NEUA 4M71A 3HRSA 3R6SA 2HGCA 3ZMUA 2FEZA 3WGIA 2ZFWA 4OIPF 3LWFA 4UVAA 1I27A 2PBIA 5JHUA 3I59A 1GHCA 3L9FA 1YW7A 5ERIA 1YQAA 2GA2A 3JTHA 2IRFG 1KYWA 1O57A 1O7FA 4U7BA 1R1VA 2D45A 4L0ZB 1XGOA 4KT5C 3KZZA 1OYYA 5L3GA 1DUXC 2R9AA 4ZYDA 2DFIA 4MQ9F 2A6HF 4XLPF 3MZYA 2ETHA 3V7SA 3RPQA 3TOAA 1P92A 3L7WA 5CYVA 1AWCA 3DEUA 1M5IA 4WXDA 3CO7C 1LJ9A 1ZG5A 5DUKA 2VBYA 5LEKA 4ZYHA 1O3QA 2NS0A 2RVCA 3GWZA 1W4MA 2M87A 4Q4ZF 4XSXF
chains in the Genus database with same CATH superfamily
1NJIW 3W6KB 1ROPA 4DW0A 1S7OA 2KLOA 5C8YB 3T1YO 1VQ7I 3L71H 1D0ZA 1KBHA 2DA2A 2HQRA 2FBKA 3WODF 4BEHB 2IS2A 3K06A 3FIWA 2ZXIA 4PHZA 5KAIZ 1W5TA 2M1BA 3NWSA 5KHDA 5LHIA 2FTKA 4A5MA 2ICWG 4GKKB 4XONA 2KG7A 1IRFA 2IEKA 5A2QK 5LRRA 3RYCB 3R0AA 1X1DA 2LFRA 2YR2A 4BY7J 3BEHA 5B5EZ 1POGA 2K3FA 4LNUA 1IV8A 1CPYA 2XAFA 1Z9CA 3SYOA 5B66Z 3ZRXA 3WTWC 1O4XA 2JA5J 2E60A 4E7SA 2HOEA 3CXHF 3H1IH 3J80N 2QKSA 4QIWN 2DXIA 2VXZA 1R5ID 3A03A 5ED4A 2YUAA 3G4SV 1FY7A 2JGDB 1EZJA 5E79Z 1KD1W 1H38A 3G2BA 4XLEA 4Y3OA 1MBFA 4O4IB 2JRTA 4B43A 4K8XA 2ESHA 4LF9O 1GM9A 4RLFA 1M56B 1NVPB 1U9NA 2BE3A 2XPWA 4DBRA 3D5LA 3BJOA 2OIEA 4TV9A 1I1GA 2NVYJ 1QGPA 2X6YA 3M07A 3JSOA 1ETXA 2X1DA 2EZPA 4G6DA 3QTCA 1O7LA 1TQPA 4HBLA 4MFDA 3ISPA 1CGPA 3IAM2 2R92J 4QPKA 3AK2A 5J1UA 4HF0A 2HLDG 2KP6A 3ESWB 3HBLA 2DAOA 4DR4O 4GYGA 4QWQA 3JAMK 1P49A 2MLKA 4X1EA 2JVDA 1X2MA 4ZOLA 3J7AO 1OCCB 1XQ8A 3WTTC 3DBRB 4OINF 1MDMA 3LSGA 4JZ2A 3CEIA 2JQ7A 3FKIJ 3U11A 2JPBA 1FFTB 3GLLA 4JF3A 2WAMA 2BYVE 1RRJA 4BHPA 2B1GA 3F8BA 1BM9A 2IA0A 2Z9OA 3IP4B 3FMRA 1DPRA 2MG4A 3ASNC 3AG7A 3FM3A 4CDGA 2ZQMA 1HDDC 1ZKGA 4K8ZA 1MGTA 2CUJA 3TETA 2LRDA 2I10A 4LF6B 2ACJA 2DMUA 1JFFB 2AHZA 2QWNB 3J7ZI 4X1IB 4NC6A 2HXIA 4EM2A 4NHJA 1U5TA 3HEFA 1N77A 2RC4A 1UHWA 3KX2A 4GKJB 1BR2A 3MKLA 4XRMA 4I6ZA 2PLYA 1KUQA 3ICXA 3D0SA 1V54C 3GXOA 4ZDPA 5JR3A 2DTZA 2YXHA 5HNHA 2OV7A 1B3QA 3RGBA 2BEOA 3PN1A 4UCRA 3SZGA 5IJ9B 2PY5A 5E3LA 2CUFA 3P9KA 1S7AA 2A68F 3SQNA 2YPRA 2MD5A 1JMKC 1P84F 5IJ0B 4DOZA 3DQVC 1XUQA 1XB4A 2M0MA 3KIOA 1ON2A 2GSMB 2DLLA 2XSDC 5KX5A 2QYOA 5D5PA 3E6CC 4R79A 1A36A 2DA7A 3DPLC 3KEQA 2HVKC 3QYEA 1OZ0A 1BIBA 1Q8IA 3GFIA 5GTHC 1LR1A 1H8EG 1TGOA 1FC3A 3BQYA 3VQXA 2P7CB 1Q6IA 5KHIA 3P3NA 2QQ8A 3ZRWA 3WE2A 4ESBA 4UY8I 1PL4A 2DA3A 4TQFA 2W24A 1P7BA 5E8IA 1QLNA 3SDLA 2O03A 1A32A 1S0VA 4XKVA 3TOBA 2KPMA 3RBZA 2WB1A 1IBLB 3O8HA 3LDEA 1K34A 2JEXA 3CCEV 1H9GA 2JMWA 4AUXA 4ABZA 2QTOA 2A6TA 2CK3G 2YICA 1UELB 3HOTA 4A0YA 4HLXA 3IRRA 1J2XA 4ZIBA 1G1XB 1YW8A 1PKXA 4OIOF 3B8NA 3HOUJ 4K2EA 4X1YB 1HP8A 1NH2D 3QU3A 4UVCA 1YO5C 1RP3B 2GWRA 3SYAA 4G9YA 3UM7A 1BOAA 1D5VA 3SDGA 1X1PA 4V19K 1U78A 1LFPA 5ICCA 4LB6B 1H2GA 4HZFA 1T38A 1FOYA 1QVTA 1FTZA 4QJFB 4ZYAA 3REOA 1V9PA 3CCSI 4E4EA 2DI3A 4CH6A 2P06A 1GUUA 1ZX3A 4HX8A 4M9SA 3CMYA 4CSWA 3F21A 1NT2B 3OFNG 2IGKA 2X1EA 4IO9F 1PNMA 2VQEB 1Z77A 1YITV 2OIGA 3SYTA 5IYDJ 5JI6A 1E3OC 3F7YC 3SJCC 4DR3B 2WLLA 3FXMA 1GVDA 1EFRG 3JRAA 3DC5A 4EGYA 4PA6A 2K4BA 5LMUB 1M90W 1WPXA 3ZQHA 4OAZA 2VS0A 3TDUC 1ONVA 4X20A 1WJDA 1E1QG 4OOIA 3MN2A 1SS3A 1Z67A 4HNVA 1NI8A 2KIQA 3S2HJ 5LYJA 2KQRA 3HPLC 2F5CA 4U7OA 1ORQC 1EN4A 4AU7A 3E97A 1MMGA 4FASD 1WB8A 5B1NA 3TQNA 3OM3B 1ZLKA 4HNAB 5LXTB 3GWOA 3OSGA 2GBYA 2PFBA 3OMAB 4FM2A 5DEQA 1Y74B 2F93B 1XMAA 2LF7A 1LB2A 4P55A 2IT0A 4H4KC 1YIJV 1EV7A 3PUFA 3VPRA 3HC7A 2AQEA 3DKWA 4B3TB 2VC0A 4M3EA 2GTAA 3VQWA 1YJWI 4U87A 4EJTA 2R7OA 1YYVA 2E34A 3DTKA 1VF5B 3CXCU 1YJNV 1MW7A 2XGCA 2J5PA 1M57C 1KU7A 4HX4A 3BPZA 2E19A 5FKOA 2X48A 1JKQC 1YOVB 2Q68A 2CW8A 5FPRA 3FXRA 2L54A 3B77A 2Q9LA 1B04A 2UXDB 2HVRA 3PQJA 1W7PA 2BOLA 1R58A 5DD4A 2ADQB 2OYQA 2VASA 2W85A 1UHMA 2PG4A 4XM3A 5LHGA 5M5XJ 1IZ1A 3L2VA 2JRIA 4XDKA 3HTSB 4O2AA 5HLIA 2E36A 5HS8A 5TISC 3KG2A 3LDCA 1P2FA 1XDCA 2ZE5A 2OCCH 4M72A 3ZQGA 2UXCO 2OJED 2JJ7A 4ON0A 3VYTB 1N8RW 2L2OA 2WTEA 4D7NA 3WTUC 3OTOO 4QSHA 4C2UA 1Q6UA 2L7FP 2Z33A 2A3SA 2CTPA 2HVJC 5FLXZ 5IDJA 4RGXA 4JI5O 3DTEA 4WWCA 1H2MA 4EATA 4X8AA 1XMOB 2KIMA 4CS2A 2KT0A 1IN8A 1SESA 1RUOA 2ZXHA 1MZBA 1R5HA 5FKNA 4TUYA 1MNGA 4DK0A 1FT9A 2VRZA 4G7HF 4O2BA 3OY9A 1EN6A 2FA5A 2QLZA 4J7ZA 2ZKOA 3RYHA 2WAQN 3IWFA 2NLJC 5TGTA 3A0RA 3L09A 2W84A 1FPOA 1NS1A 1XL4A 3VOUA 1G8XA 3HRTA 4J9YB 4NTYA 2Z99A 5BQTA 3RYFB 4FLYA 1RM1B 2Y31A 4MS2A 2DJNA 3V8KA 2FMYA 4CICA 4XK4A 3W6VA 3FB6C 3J81N 1K83J 1TUBB 4B4CA 1X3ZB 4NB5A 2EH3A 1WN7A 1ZR2A 3DWLE 1XNQO 2HEPA 1AJNA 2D3OW 2Q0OC 1YTYA 2JWTA 3C3SA 1J0RA 1Q81W 3E0JB 1SD7A 4DYQA 2NNYA 3ZHTA 5JJEB 1P9QC 5H20A 4CZCA 2W6IG 2M7AA 3JRIA 3DTUB 2ZMEB 2CH7B 2RJZA 1VF6C 5JCOC 1UJ8A 1NG6A 5LGTA 4YIRX 2CAZC 1MMSA 1Z5VA 1I1SA 1WQ2A 4ASUG 4JI4B 2K27A 1TT5B 4GXOA 4ZDLA 5EC1C 3HB3B 1ZL8B 2KDOA 4NDLA 1W5SA 2EX3A 4QE9A 1DU6A 3SJAC 1YSCA 4KT6A 3T4DA 3F6VA 2L6LA 4O5VA 2OZUA 4DW1A 2MABA 2JA7J 2BTQA 1R3LC 4D1QA 1W1WE 4OWRB 3ZQCA 1ZGWA 3BR1A 2E7XA 1FYKA 5B3SH 3T1YB 2NRAC 2NOJB 2L5QA 1K4DC 2X6AA 4ENKA 1WJAA 5KAFC 3A8TA 2VKEA 4MVQA 1Q82W 4BKXA 3OEEG 4BH9A 5KCMA 3CJNA 4F6EA 2LH9A 1OCOH 2RREA 2B63J 5FGMA 1P4RA 4H44B 1OR7C 1WKMA 4LFUA 5FD5A 2EJ7A 2LFBA 4M73A 4PDKA 2LKSA 3C90A 1V3FA 2Y75A 4GGGA 2YSRA 2K85A 4G12A 4LK0F 4YFXF 4CH4A 1COWG 2OF7A 1E3HA 4JI8O 4EEQA 1IBMO 3U2RA 1FYLA 1XNRO 1K73W 1P7JA 3KCCA 3HOWJ 4LFBB 1BHBA 2EZIA 3K0LA 4ASNA 4KISA 5LOVB 1GK9A 4FLXA 1K9MW 3M4OJ 5JVDA 3FMQA 2WA4A 2E75B 3NXSA 4EGZA 4EJWA 2EIMB 3UO2A 3CMEV 3AEIA 2ZNZA 3F3XA 2DU9A 4E4HA 1JUMA 1VZ0A 3FX3A 4KP4A 3AKZA 3LSHA 1RR8C 3NRVA 3P7NA 3W7SA 2OTJI 3HPHA 2ZXWB 3Q9SA 3MFKA 1IN5A 3NQOA 4DQ2A 4XIDA 5IWAO 1TWCJ 2CQQA 1LUJB 3JREA 3JRFA 2QDOA 2KISA 3E1SA 1P4WA 5AIPA 4MTEA 3ZP5A 2HVSA 4O3MA 2V4DA 3JALB 4K35A 4B7EA 3ZHRA 1HNZO 2W4SA 1JI8A 1SMTA 5H6QA 3VBBA 5EEAA 1EH6A 1Q43A 1TUBA 5DM6V 1U6GA 1EZVH 3T0YA 4BE2A 5K5OA 3CCQI 3L75H 2ZNIA 1MABG 4XKWA 2VIXA 4D7SA 2Q73A 3K4KA 4KHPO 3TXQA 5EEGA 4H37A 4L5IA 3T5XA 4GKKO 3ZS8C 4JK1X 2BXZA 4TQDA 2DPDA 2EFPA 2AW9A 3F7VC 4EM1A 4S0HB 1AROP 4LOCA 3MDSA 1YI2I 1N36O 4PDVA 2QJ1A 3AAFA 1ZN2A 2GOMA 5FL7G 5M5WJ 3OYNA 4BBSJ 2F4IA 1M57B 1HKTA 3DF8A 1IRZA 2WA3A 2ZCEA 2V9PA 2EQRA 5LA6B 3IGAC 4N21A 4HEA2 1R73A 2DA4A 4A3GJ 4PJLA 2CMPA 1K97A 2YU3A 5F1JA 1ZSPA 1ZRDA 2CU7A 3HKBB 1DK1A 2P7TC 1AP6A 4GCZA 4CH7A 2R7DA 4U0WA 3VODA 3I4NJ 4JI5B 1BQ0A 2BTQB 2CRGA 2CW7A 4JV5B 2A69F 5LHHA 4LWSB 2PI0A 4CXFA 1B6QA 4M6XA 3EUHA 1R5GA 2DMNA 2QQBA 3OYFA 1B8IB 2DYRB 3HKCB 2F95B 4B7KA 2ATKC 1QZYA 2HOAA 2P4WA 4RS8A 1LNQA 4LMYA 4PI2A 3UQ8A 5EGOA 4Z2YA 2F4MB 2PMUA 2UV1A 4IRHA 1HCRA 2Q0AA 2QCOA 3GTGJ 2G38A 2FNPA 2VI6A 5D8KB 2HDWA 2NS7A 4YFKF 1G3WA 3W2WA 1BI0A 3K1PA 4OMZA 3OYEA 2EIMC 2E1MB 2WWWA 1EH7A 1XX5A 4EV0A 3K4JA 3CCMI 2V1UA 3VOEA 3C3TA 4H0LB 3U0ZA 1FZPB 5JJJB 3R0JA 2DDBA 2IBDA 1K92A 4PGGA 1LE8A 2JTVA 1OCZB 2V1XA 3ZQ7A 1XILA 3D8CA 3T2MA 3ZGKA 1PJRA 4EJOA 3FHNA 1UHSA 4M9XA 1EM1A 2YC0A 2X9DA 5B1AB 4JI4O 5E20A 2R5ZA 2JS5A 4DNCA 5FROA 4E70A 3B6AA 4X62B 4NUBA 4MSWC 3PIPF 1YJ9I 1R6KA 1J7KA 1VQPV 4IL6C 4DV7O 3AG3H 3H1KH 2DN0A 5EZGA 3GB7C 3TO6A 2K9PA 3BR3A 4BY1J 1N78A 1H2SB 4AYBA 2VOOA 2C2AA 2N05A 2G9WA 4KUMA 4TV8A 5E3MA 2DFHA 1T98A 4XOPA 5D6EA 1BI3A 2NR5A 2QA4V 3K1MA 1KU3A 4IKFA 3JARB 4IT5A 2A0LA 4J42A 2PJRB 4UNOA 3I54A 4R1HA 1W2BU 4I0BA 2CV1A 1PPJH 1TTYA 3ASOH 1SEUA 1BOBA 1F43A 4LFAB 2FD5A 2XRNA 1I94B 1QZZA 1X58A 1Z6TA 4PFOA 1ZQ3P 1XPXA 2UUAO 5GONB 2M30A 2CFXA 3RCOA 2OCCC 1RNLA 5K1YA 4RO2A 4UB6Z 3SYPA 1P7IA 1FSEA 4F6RB 5E8GA 2G7UA 4FLWA 3ZEDA 5HVQC 1HDJA 3JCUZ 4A12A 4HYEA 2QQ9A 3BZCA 1AI4A 4TWKA 2ZC2A 4UV8A 2MYSA 4YHHB 1VNDA 1W7PB 1S5HC 3EHBB 3I0TA 1ENVA 1JUSA 3FXUA 4FTHA 3CYOA 3G3ZA 4RAGA 4BQNA 1ZG3A 3S15J 4KHPB 4B47A 2FF4A 2X6OA 2ADUA 2JDIG 2LP7A 2RNBA 1NTCA 4B08A 3ABLH 3W7TA 2A5WA 1T39A 3J7AY 1QR9A 2DYSC 1KA8A 1E3PA 2ODMA 3S16J 2PYLA 3TDZC 1V55H 4BDZA 3QO8A 3L2CA 2H1KA 3KLOA 1VQNV 4EJVA 3S32A 4I50B 1HNZB 3QQAA 2AZ2A 2IBZH 5FD6A 3BPXA 3S17J 1UB9A 2WA0A 2Z2SB 4Q6GA 2R7FA 4N9HA 5HODA 2XC7A 4AIKA 4IHTA 3LDDA 4NNJA 5LFAA 3ZRWB 2OA4A 4F92B 5IP7J 1A6QA 1RSOA 3K5NA 2GOXB 2ESNA 2HR3A 1IX9A 3H0GJ 2VUMJ 2J5OA 3AG3C 4GYCB 3DXRB 4Z1MG 3K9SA 4LLNA 1MD0A 5LYJB 1JKRC 2HQ5A 4YJ2B 2PF4E 4EJUA 2CSOA 2V6EA 4KITB 2LKXA 3A0BZ 1VQPI 3K0DA 4D6TH 4IXAA 4KNYA 4J7JA 4BACA 3ZJZA 3CX5F 1WJEA 3BLYA 3GFJA 1IN7A 1SQGA 1V55C 3CCEI 1XMOO 1Y6XA 3S3XA 4AIJA 3M99B 3ETDA 4B1RA 3CJTB 4L5JA 4PDMA 3H36A 3OV8A 4N0BA 1WRJA 4BWAA 2TRTA 1W36C 4LIUA 1MZFA 4DUYB 5LMNB 5FB2A 1CQTA 1GV2A 3VSLA 4XRSG 3IL2A 4G7ZF 9ANTA 4UB8Z 2XT9A 1YLFA 2ZT9B 2F4OB 3DFGA 3WU2Z 4CBCA 4WFBV 1JFFA 5DD8A 3E5QA 4UUSA 3J80Z 1DP7P 4RAFA 2O9LA 4DV6B 1BCCH 1Z2GA 4BQQA 4F55A 4I0AA 3S14J 3BWGA 3KFWX 3Q4HA 4ITVA 3L2QA 2IA1A 1I50J 1IV6A 1SQVH 2KIFA 2VQGA 3OYIA 1OCTC 4UCOA 3WFVA 4CH3A 1B59A 5GW7A 5E3NA 3WTZA 1OR7A 2NXNB 3BG9A 1IO2A 3BOQA 2X7RB 5ICFA 4AYBN 4GUNA 5IYCO 2CGOA 4LF6O 1AR1B 4DJAA 2HI3A 2LNBA 1TWFJ 2QA4I 4DUYO 3QP5A 2Q8VA 2CFOA 2AHQA 3K2AA 2JGUA 3IKVA 1I3AA 4FE7A 3E8HA 4ZOLB 1BN5A 2Q0OA 2FU4A 2LKPA 3FDYA 1ZL8A 3QF7A 1T6SA 3W7UA 5DYMA 4IHJB 4M74A 5D4SA 3SFIA 3PFYA 2KZGA 1A31A 1VQ5V 3HRUA 2EINC 5B1AC 3WB1A 1JA8A 3CCRV 2Y0IA 1JTXA 1F4KA 5C4XJ 2EPFA 5IY5H 2R70A 4JI1B 4GT1A 2W0FC 3T4ZA 3DSQA 4LF4B 3KPHA 4AVZA 1G6UA 3DKXA 4RAZA 4XICA 3Q5FA 3IHUA 2YI9A 1C0WA 5EG0A 2QM3A 3Q9VA 2X6XA 1VF9A 3V42A 3CMMA 3RKWA 3G1OA 5E18F 1TBXA 1SAUA 2HZDA 3CRCA 1EN5A 2LTPA 1JXSA 4N9IA 4Q47A 4BGDA 4E7JA 1BR1A 2UWMA 2DE0X 2HJFC 1TLHB 2M4GA 3GFLA 3JRGA 1IF1A 2LGQA 4MVSA 3JR9A 2AGAA 3ELKA 1BC7C 1ULYA 3UR3C 3I56I 1K78B 3LUTB 3KE2A 1SFXA 1YJWV 2IS4A 2KFDA 3TKYA 2CUGA 2JUGA 1WAZA 2VJ4A 4BE0A 1LUVA 3RYHB 4L9TA 4PUSA 3J81K 1IRGA 1DGRM 2H09A 4X20B 4EB6B 1KMIZ 4BEHA 2HEOA 1R36A 1S76D 4XOTA 1H89C 1GH6A 2XSJC 2E5NA 1GXQA 2HS5A 1N34O 3L9DA 2CUEA 4YIOA 1LKXA 4DYCA 4ZBMA 2X6WA 1JQ0A 4DK1A 3N2KB 4TV9B 2UU9B 3LOCA 3FAVA 1NR7A 3CJQB 1KU9A 3GLXA 1FBUA 4M9ZA 1BW5A 5F2VO 4M3FA 3ABMC 3ZMVA 3WU1B 3BY6A 2O61A 4TT3G 1KQ9A 2ELHA 5F0FA 3DC6A 2W48A 2CTQA 2F6CA 1U2WA 4J9ZB 1QU7A 2L02A 3QPTA 3JD3A 1QPMA 4DUZB 2RDPA 5LMNO 4JI7O 2F66C 2DA1A 3QPSA 1BL8A 2GV9A 3E8GA 3WG7B 1VQ6V 1XGNA 1HNWB 5KHKA 3CC2V 3OGCC 3PIOF 5DS9A 2XKPA 2E5LB 4K0KO 2P6TA 3ZRGA 3THOA 4X64O 3HKEA 5H2FC 1VQ9V 1Y8RB 3ZCOA 1O3SA 2A61A 4LLGF 3WTVC 4HF1A 4N23A 4AVPA 1RIOH 1IBKB 2QWWA 1D1BA 3RJPA 2XB0X 4D9JA 4LG0A 3E89A 3L73H 2WSSG 4W4KA 4GFBA 4UUVA 3PL8A 1CF7B 2F5VA 5GTHZ 3CUQC 2K1EA 5EG0B 3GTKJ 3A2FA 2DFEA 1NVPD 3FBNB 5EYPB 5FFXA 5IPAA 2VQCA 3E6BA 2CO5A 3HUGA 1BBYA 2RNGA 4DR7B 1OCZH 4RB0A 3TO9A 4NQWA 3EFFK 2LLKA 2OAZA 3CP8A 2Z16A 4P9FA 5LLQA 1GO3F 3X2QB 4RLQA 2DQ0A 3D5RC 1ZREA 1S29A 3OYJA 4KMFA 4O4LA 1JT6A 2FNAA 2KG7B 1TNTA 1YJNI 1DPUA 2A3QA 1QHTA 3TXSA 3T1HO 4DR6O 1TW2A 2LGWA 3M8FA 2QM7A 4BIOA 2MD0A 4MW3A 2KB1A 3G6EV 4LP8A 4I2OA 1RC9A 2H94A 1HDPA 2IA2A 3MAJA 3A01A 1N75A 1XHXA 2Y0MA 2HPIA 1VTNC 3TP3A 1UPGA 2Z0AA 2ZE8A 5C8YA 4DR5O 2XGXA 5IYCJ 2Q7EA 3GYHX 1NH2B 3PJRA 4P1WA 4BQOA 3FKJA 3OW2U 5CN0A 3K4MA 2OCEA 2LYCA 2JSCA 2VC1A 5J3LA 1VQOI 1X19A 3ZQLA 2A07F 2LSOA 3BG5A 5CPRB 3KZIZ 4HZ3A 4EEFG 5D6FA 3SYQA 2HDDA 3K57A 1FJLA 2IVMA 4NXNB 4HW0A 1YX5A 1R00A 2M9HA 5D5WB 1Y76B 2BHZA 1S5JA 4XDLA 4A3IJ 1NTMH 1S6LA 1WLEA 4DR2B 1B9NA 3HKZA 2DJIA 2FYUH 4I55A 1R6RA 1LDKB 3O3KA 4HOBA 2VLAA 4BE1A 1F5TA 1XEQA 4R8CA 3TJTA 4OU0A 1YEWA 3BR5A 3M7MX 5CQGA 1UZCA 2YU9J 1BHAA 3CC2I 3SEZA 1Y56A 2K9QA 2VQFO 3CC7V 1ETQA 3DPTA 4BNCA 2CQ7A 2IS1A 1QVFU 2G0EA 2HFHA 2XF7A 2MH2A 2H8RA 2IJHA 5D5XB 3AK1A 3M8AA 3WB0A 4DRXB 3MWMA 1LNWA 4BUPA 3G4SI 4P2ZA 1I3QJ 2AZ0A 4TV7A 5FFZA 1SRYA 3JRHA 1J75A 3MHSC 5E79C 1YIOA 3S3NA 2V6CA 1VQ4I 1FXKA 1FIPA 4J80A 3OYDA 3MAQA 2O8KA 4B3SB 4Y17A 2KSDA 1STZA 4FE4A 3ONQA 2P5LC 3CCVV 3JRBA 1ORKA 4JI2B 5J6XA 1IUYA 2WLKA 1WI3A 1R71A 5B66C 1T56A 2NVTJ 2XUBA 2RN7A 4H13B 3E35A 1F9NA 1XSXA 3U1DA 4U0VA 1KGSA 5HDNA 3CCJI 2QSFX 2IPQX 3HKZN 4HYOA 1VQ9I 4UUTA 3WHCA 3JAKA 2UXNA 1R22A 2JK3A 1ZRCA 3H3UA 3K59A 2VQLA 3RKQA 1MMMA 2M4KA 3MEXA 2ZJQF 1NTKH 3BHPA 3A0HZ 2HVQA 4NXMB 3ABKB 3B09A 3K5LA 2M8GX 1WGXA 3K70D 4YG2F 2JVHA 3K4NA 3HSEA 5EYRA 1XCBA 3VQVA 2BSKB 2WV0A 1W0JG 1BMFG 3MKZA 4XR6A 3RYPA 3FD9A 4PDRA 3AFHA 2E7WA 4BXUA 2BZTA 1WPBA 3W2VA 4DV4B 2L9NA 4RMNA 1VMGA 1GVJA 1WH7A 4LFAO 3GZNB 3KLNA 4L8JA 5DN6G 3JSLA 2HQNA 2DQRA 2XGEA 2BW3A 3KEYA 4M3BA 2EBOA 2MC3A 4BJ5C 5FNVA 1KQ0A 1Y0UA 4RWUA 1LEAA 1I5ZA 3VEPA 1YFHA 1SFUA 1MBJA 1OMIA 4MEYF 1R9TJ 1N0JA 2DK5A 1GM7A 3HGGA 1NK3P 1IJWC 1Y4MA 3RIRA 3PFIA 3STZC 3ZIAG 1J5EB 1X4OA 4X89A 1J5YA 3DLLF 4G27B 4A3DJ 1G3YA 3S1NJ 2IGOA 5CVVA 5FPOA 2VT3A 1T33A 4I98B 1HW1A 3IKTA 2YI8A 3TK1A 4EQQA 4P9UA 2QKCA 2W25A 2IH1C 3FM5A 2HHHB 2LP0A 3RKXA 4LF5B 3GUDA 4HSTA 3D5SC 2MA3A 5B1BC 2OD5A 2VL8A 1G4DA 5CLSA 3BG6A 4BHCA 4A5NA 2PMZN 4Y33A 5LGNA 2EV0A 1QQIA 2EIMH 2HYFA 4MGRA 1H2KA 3S3WA 4X6AJ 2ZJPF 3VQYA 3CLQA 3HTUA 5IY5C 2UUAB 3PO3J 1LE8B 3KCYA 3LNQA 5J2UB 3BABA 1XN7A 4JX6A 1PUFA 2GBOA 4X1KA 2L7MP 5CB4A 3OS1A 4LG0B 4WCGA 2O7OA 2PQ8A 3SHFA 1HKSA 2XOKG 4X9QA 4JI6B 5IYZB 4WFEA 3UO3A 2OU2A 2FSWA 1MMNA 3PNYA 1HBXG 4HF2A 4YJ3A 2VQFB 4ZDOA 3ZOBA 4F91B 3VWBA 2CTRA 4CCMA 3SPGA 2ZCWA 2ZFUA 5EDNA 1YTFD 3UCSC 4F52A 3SYCA 3HKEB 2R7UA 3C18A 2PX9A 2F23A 1UG0A 3OYMA 2PGGA 3SJQC 1D0XA 1Z3YA 3VDXA 1BE3H 3OUSA 3ECOA 1Z1DA 1URFA 4ZHQA 4DV3O 5TRDA 1CXZB 3H01A 3LFKA 1F7YA 1XTAA 5E17F 4HX7A 4A3FJ 2MC4A 1NR1A 2ZDIA 1EA3A 5L3BA 1AR5A 2HJDA 2Z1DA 1FBSA 2HYJA 3LSIA 2CTWA 4I0XB 4M6YA 1ETVA 1YE9A 3ZN1A 3CZ6A 3K4BA 1S3JA 3B4SA 1UFIA 3IWZA 3TCUA 5CA3A 1Z91A 4KMUX 3FYIB 2ZM6O 4LB5A 1FYJA 3AG2C 3GWKC 5CVJA 1GMGA 4XLAA 4AC0A 4AWXB 3L74H 3LSQA 2PMZA 3VSKA 2XPVA 3K69A 2M34A 4RM2A 2VBZA 4GCVA 4DZJA 1VP7A 4DR5B 3WG7C 4NXMO 3EXAA 5DUIA 4IJAA 5A2QN 3LNMB 1MSEC 4Z6YA 1O3RA 2ZXWC 5DCMA 2BGCA 1Z7UA 4I01A 1Z7LA 3LA3A 4Y7NJ 2DOSA 3H1LH 3ZBHA 2UXBB 1YRNB 1REPC 3I4MJ 2EINB 2DOEA 5CBGA 1UAAA 2PTMA 4GDFA 2ZB9A 1JE8A 1J5EO 5DEDA 1WSUA 1G4YB 3K03A 3OE7G 5CBFA 5JH7A 2HOSA 1K78A 4QNHB 2W1OA 3W3CA 1WCMJ 4DR7O 5D8LB 1XMQB 3R60A 4OIQF 2HWVA 4IVNA 3QPLA 2V7QG 2ZINA 5KMGB 2NYXA 3ABTA 4FHTA 3F72A 4KN4X 3CCRI 1PP8F 3BP8A 5C93A 1MMDA 1PYVA 1SFEA 3G71V 1JR9A 5KHJA 1U96A 4XLNF 4P9PA 5BMVA 1X59A 4IHSA 5BR8O 1ON1A 2QF7A 3JAMN 2QKLB 4MVOA 1VQNI 2JJ2G 2GIVA 3BR6A 1DGSA 2O57A 2ZXWH 4QPOA 4IHJA 3BTCA 1WJFA 3H3VK 1DU0A 4PJ0Z 4G2KA 4MT8A 2QWQB 5IT9N 1HR0B 4ZC3A 3RW0A 4XKBA 3ETEA 3OEHG 5KK1A 3I71A 2L7KA 3WGGA 3LQQA 4U3JA 5HS9A 1RKWA 2XAQA 4I09A 2EA2A 2QM8A 4DV0O 4JI7B 1SQFA 1XOUA 4LF8B 2ZJRF 4I76A 5F0HA 4CHUA 3FK6A 2O8XA 3A4CA 3F8NA 1TNSA 4G28B 3QYBA 1S77D 3JD0A 3P30A 4NKGB 2K86A 2V7FA 3Q4HB 5TISZ 3ZQFA 2RQ6A 4OX9O 3KETA 5IYBJ 1TVKA 2WLIA 4Y52J 3ZMZA 2R7RA 2FUG2 3OGIB 3WG7H 4JGSA 1R23A 2MH9A 1VEWA 1RESA 5BS6A 2EFQA 2XPUA 5EIBD 6PAXA 5ICEA 2A7WA 1R6TA 3ASNH 4CUGA 1R49A 5F6FA 4EKWA 3OOPA 3AG2H 1Q6HA 4U3JB 2A06H 2HYGD 1T95A 5JFRA 3OMIB 1J95A 1MBHA 1FP2A 4BL0B 3OYLA 1QHHD 3B8MA 3HIFA 4LF8O 5CA1A 2L01A 2UZKA 1WJBA 1NH3A 3U21A 1G3TA 2O3FA 1F4NA 3C2HA 3F6OA 3HRMA 1I08A 2MSYA 1VQKV 4DR1B 3DKYA 4GZRB 3ETGA 2R93J 1FPQA 5CKTA 4HQEA 1TUEB 4YJ2A 4UXNA 4ZYGA 2XHKA 5IP6A 3JD1A 2L9SA 4RGUA 4AI8A 3B73A 1X1CA 3K6GA 2EV5A 1U0JA 4J11A 3O2PE 1T0FA 1M93A 4UUJC 2EIKB 4JI1O 3TMOA 2QWOB 4ZKIA 3Q0WA 1SVMA 2DQ3A 1Q90D 2N04A 2XVCA 1K33A 3OUFA 1KC8W 1X3WB 2D5VA 2ETNA 4ZI7B 2VT2A 3A0HC 5JH7B 5FRMA 5CA0A 3MZHA 2STWA 3HB9A 1FWZA 4LG3A 3V8JA 3NR7A 4JTDB 3CP2A 4UCSA 4UHTA 1V55B 3O6BB 5AG2A 2E5LO 1JVMA 2ISYA 1B06A 1HSJA 2X85A 2OCCB 3CLOA 2ARHA 3IH2A 1Y67A 4IGGA 4JP0A 4TSFG 1KYOF 4H0EA 2YEVA 3E5XA 3EYYA 4ANJA 2OTLI 4L87A 4DUZO 3C7JA 3SJMA 3IV5A 2LG4A 5C4JJ 1YTFB 4MTDA 4M3GA 4LH6A 5F08A 4RQFA 3RN4A 2X6BA 1UCRA 4ZYEA 3I64A 3E2EA 2Q8KA 2KQXA 4CC5A 2ZBKA 4CH5A 4GKJO 2W82A 2FX0A 4RB3C 3CCVI 3CCSV 5HS7A 2UU9O 2ZR3A 2HXOA 2DMTA 2QBYA 2DWEC 2HTJA 2HG5C 2BXYA 2JZYA 3B02A 5E1XA 1AI6A 1WNSA 4YFNF 4L5EA 1W7PD 5ILSA 3A2KA 1JCHA 3RT3C 3GFMA 4OX9B 1V5EA 4HNUA 2Y9YA 5B3SC 4BS9A 2KRCA 2ZNJA 1GRJA 2YS9A 1HNXO 1FMVA 2Q7GA 5GAHJ 3RPUA 4FCYA 1N4CA 3OWTA 2HU9A 3DEEA 3QPHA 4OMYA 2EIJC 4KXRA 2QQAA 4XLCA 5J8CA 3SZPA 4AIDA 3WTXC 5AIQA 4YJ3B 1IURA 3S3MA 4FLZA 1THZA 2KIUA 2LBFA 5AONA 1NK2P 2HZTA 1CP9A 2RN9A 3J7YJ 3OYAA 3UKGA 3CCYA 1PUFB 1XGSA 2NNUA 3BA9A 4P5OA 5CA0B 4WXCA 2M7WA 4OPHA 2GXGA 3FWEA 3TW7A 4CYDA 2M0CA 2YIDA 2ID6A 1MA1A 3EPZA 2Q2EB 2V4JC 1VFCA 2IH3C 4JI6O 3G73A 4W97A 3H1HH 4A6EA 1QZEA 5JVGF 1SKVA 3L2WA 4FJCC 1RPRA 4LIVA 2N74A 1R1TA 2FOKA 3BTIA 4IF4A 2YX4A 1B72A 1FEXA 5B1OA 1GN3A 3SGIA 4YIFA 3C1DA 3K9TA 1JKPC 3CUQB 1SF9A 2QSAA 3CS5A 4LCUC 4E6KG 1OCPA 3CD6I 1K7DA 4DV5B 1XMQO 2DMPA 2Z3YA 1FAFA 4RDUA 1HSTA 1NTZH 4XRSA 3F5WC 2RDCA 2DYSH 3GTLJ 3D3QA 4QTRA 1HXDA 1Y6IA 5CA1B 2E5ZA 5B1AH 4NR1A 4IRGA 2XDVA 1I5YA 4L0YB 3CRMA 3EUKL 1HWYA 2XF5A 4JYKA 3QOEA 1ENHA 3OTFA 1OCRH 4DR1O 3LAPA 1RPOA 5DV5A 5JLXA 4DV0B 3I3LA 1USTA 1FNNA 4FISA 1BI2A 2CS3A 3BDDA 1SQPH 1BC8C 4DV6O 4WK8F 3K70C 2YXYA 1XMXA 2UUBO 4ICGA 5EC2C 1GV5A 3CB2A 5JLWA 2AQFA 3BR2A 2JRMA 1X3UA 3ABLB 3LNNA 2WWYA 4GRIA 3MHHC 1TZLA 3JAMZ 2BE5F 2R0QC 2EA4A 4I4TB 3RDIA 1RM1C 1IBLO 4G8XA 1ETWA 2E1CA 2EFOA 2QGNA 2Y69B 1ZUQA 2WLMA 2LD5A 4DYLA 1QHGA 1D1AA 4UB8C 1BR4A 2XRLA 2YEVB 5KA5A 3ECHA 5GTIZ 4EVIA 1KECA 5IP9J 1WH5A 3H9GA 3SZTA 1IXMA 3RKYA 1WJ5A 2K7LA 2IP2A 1QNTA 2DBBA 1LVAA 2ELJA 3QP6A 1ZR4A 1F23A 2LVSA 3H9QA 4DR4B 2D1VA 5IE9A 3TEDA 1R4MB 2YIBA 3JAWA 1CEZA 5J40A 4XBFA 4RB1A 1N36B 1S8NA 4ZI7A 5ILVA 5D5UB 5D4RA 4BYYA 4GO1A 4B09A 1G3SA 3HSFA 3S93A 1QBJA 1R3IC 4JYAO 3K79A 1T0FC 2XAGA 3M7GA 1SA0A 4BHBA 5DM6F 4LFCB 3SPCA 5JQGA 1DF4A 1IXSB 1JJ6C 3TO7A 2Q67A 1D0YA 3BCAA 2EJRA 2L3DA 1H0MA 2EINH 2XAUA 4U3FH 2XIGA 4BW5A 5KMGA 1Z6RA 5J4YA 2M45A 5D5QA 1Y39A 3I55V 1RI7A 2JUCA 4B44A 1B6AA 1JGSA 1US6A 4WFGA 1PNLA 3W6JB 4NTWA 2VE9A 4P9OA 1JHHA 4IOAF 1FLIA 2P5VA 5E1AC 2VWJA 4QLCU 2BY2A 3I58A 1TA8A 1IXCA 2DN9A 2DA6A 5IWAB 3CD6V 3C2BA 1VQKI 2YDEA 3JALA 3M8EA 3RYRA 3L72H 1BL0A 3V7RA 4MVZA 2AS5F 4YXWG 4C30A 4Z1VA 2LJ2A 3ABMH 2K40A 2R7QA 2ZIOA 2QENA 1R3JC 2MW8A 4JASA 1LFBA 3ERMA 1WVRA 3LA2A 4YRVA 2ZM6B 2M2EA 4RAYA 3EETA 2GDSA 4HA8A 3L1PA 5E1WA 1EF4A 4IL6Z 2K9LA 3OMNB 2FOWA 3BQZA 1KP3A 1TAEA 1ZWIC 1AILA 1N33O 5B3SB 5FLMJ 2ZKZA 3K9AA 3R4KA 1YF2A 2WLNA 1PD3A 1E17A 4R6ZA 4Y4RA 3STLC 3G1LA 1Z05A 1FIAA 2V1NA 1KONA 3I4PA 3KP2A 1QPIA 4JI8B 4FM1A 4AHCA 5CJ9A 1WPKA 2M5WA 4DO2A 1YS6A 3A01B 4CZZA 2F43G 5H5NA 1K6YA 4PZJA 3S1QJ 1V54B 4IPAA 3GTJJ 3IFXA 4B3AA 1RZ4A 3DU5A 1RPWA 1FFXB 1Z0XA 3KP7A 3S3OA 3O65A 4ZHQB 5BY1A 5LP6B 1K8AW 4A3MJ 5BR8B 1WI9A 2V26A 3WTYC 4IQJA 1D3YA 4OPAA 4L9JA 1QVGU 5KHGA 4FK5C 5CBHA 2UUCB 2D2CB 4FZ0A 1FD9A 2LMDA 1YHQV 2WLJA 2KL4A 2ZXJA 3S2WA 3GX4X 2ITCC 5BMVB 1LDJA 2ZMEA 4HDVA 2CH7A 1ERDA 2WBMA 5CB4B 2DOAA 1TQIA 1VQLI 1VQ8I 3GTOJ 1IDZA 3HKDA 5J2UA 3D1NI 4WF2A 4M6VA 3E22B 3APQA 2BVMA 2K4JA 4RA2A 2R7SA 5LP6C 1OKRA 1PM9A 4N4OB 5JJNB 2F5DA 2FBIA 5B1BB 3OS0A 1SD6A 4E7HA 4ENNA 2UXBO 1Z21A 3H92A 3CMAV 2CDYA 3N97A 2B0LA 1XSVA 4HBNA 5KHHA 3GBGA 1JOYA 2XF6A 1Y1VJ 3S1RJ 2NVUB 2PI4A 2F5EA 1FSHA 2QGUA 1DGWY 1I6HJ 4UFZA 5K1PA 5DDGA 4IQ4A 2IU3A 4L18B 1YRNA 2PMHA 3GW2A 4B3RO 2E2HJ 3PNVA 2JS3A 1YX3A 1G8MA 3DGEA 2WAQA 4PFPA 4TUYB 3UKMA 2XHBA 1K4TA 1FOWA 1Y66A 1AU7A 4X64B 4D5CA 2DWDC 3BZ6A 3RPUD 4K0KB 1WWXA 3H0DA 4HDUA 3OT7A 2M6YA 3WU2C 3SPIA 1HNWO 4OXSA 4IX7A 1FMWA 4XRFA 5IT3A 1WHUA 4E7ZA 2ZE6A 3FAVB 1LVKA 2KZVA 3GF2A 3KP3A 4ETSA 1OPCA 5BMZA 4A2UA 3WTSC 4PV1B 4MNUA 3IJ4A 4I0XA 4RUEA 1L1FA 4BW9A 1QCEA 3K04A 3FKSG 4IIJB 5KNLA 1SMYF 3KCXA 1N32B 4U0YA 2E1MC 5L3FA 3DV8A 1FYMA 2P4KA 3N2GA 2LW7A 4N4NB 2DW4A 3BA8A 1SZTA 1VQMI 2R72A 1L8DA 1OCOB 2WV1A 1FKAO 3GTMJ 4QE7A 5GAEJ 3HYIA 2BHYA 4MVUA 3RZOJ 3PSFA 4MO7A 1TP4A 4BIZA 3RTRA 2Q5ZA 3BG3A 1AHDP 4BDYA 5IYZA 1E1RG 4B3SO 2UXDO 2Y69C 1R1UA 4I7HA 1FXVA 3BVOA 3K0GA 5LD2C 2AXTZ 3LQRA 3F5TA 2EZLA 3DTIA 4O4JB 2HHHO 2YS8A 3MD0A 4S04A 1H8AC 1KP2A 5H6RA 1V4RA 2Y69H 4JYAB 2V79A 3UT5A 2F2EA 5LBQA 1A5JA 3TL4X 1EH8A 5FKLA 4O4HA 1A35A 2VOPA 1BW6A 1JHFA 3QAHA 3LAJA 1X4TA 3I5UA 4XLHA 2R7XA 4FZ1A 3OYCA 4WFAV 4UCTA 3GEZA 2JSPA 1FJGO 5IOZA 2COMA 2KDZA 1XS9A 4IRIA 2P22C 3E6DA 4XQFA 4Q20A 3I59B 4FT8A 4JI3O 2VN2A 1HA8A 1IW7F 4LFBO 4XN3A 2JT1A 1XCVA 3N4MA 2WLLB 2EFNA 2CQKA 2K5CA 3K7AJ 1UMQA 1IDYA 4PCQA 4D0PA 3D3IA 3EVKA 4R7CA 4RQEA 2LY1A 4EFEA 3I53A 4U7DA 4I5SA 3RQIA 4PSXA 2ZO4A 3S1MJ 3ASNB 3ERED 5FNVB 3V4GA 2CQNA 4W1UA 4HPQA 1IZ3A 1F51A 4UUSB 3ZXSA 2DCEA 4CCNA 3S2DJ 3W7XA 2DYSB 2UUBB 2NS8A 1U9OA 2ECCA 1GN4A 1M1KW 5L3EA 3DBLB 3OIPA 3PQKA 4F4LA 4J01A 4ESJA 1T8IA 3CPWU 2GTSA 1JGGA 2GZWA 5IT9K 3ZR8X 3CRQA 3FB7C 4FLTA 4A5UB 3HHGA 3BCBA 3V8LA 3PSIA 4FFBA 2H1LA 3T1HB 4X1YA 2A79B 3ABMB 1E2XA 2R5YB 2HNHA 2DT6A 4BR6A 5C44J 5KAIC 1Q5OA 1SFOJ 1N34B 3N05A 2AXTC 3P5JA 1S5LZ 4JX5A 3JAKB 4DYRA 1TWHJ 4U7NA 2ZDIC 3CF2A 3AG1C 5H2FZ 4PA4A 3K08A 3KP5A 3B2EE 3FZVA 5B5EC 5CVIA 3PM1A 4DV5O 3MZ8A 3CCLV 3VYRB 5KVRA 1QLEC 1FTTA 3V7CA 1SANA 4JTCB 5LL6Y 2LDUA 1K6OA 1MJAA 5KAFZ 5J8FA 1PUEE 4F93B 3MVPA 3J7AU 2HDCA 2ZIMA 2COBA 2DMXA 3UT5B 1D5YA 1SQQH 4HQMA 3HUGB 2OQGA 1QQCA 1VF6A 2JEUA 3RZDJ 2XTAA 2P6JA 1FXKB 3U1KA 2MLGA 4II2A 3HOSA 2KRFA 3KP4A 2YIBD 1SAXA 4FM0A 2X1CA 4G6QA 3QODA 4UVBA 3GTPJ 3F9KA 2FB5A 5KX5B 2LF8A 1D2DA 1VQMV 4CCKA 3RQ4A 3QOPA 3Q0VA 1WP7A 4JOMA 3AG4C 3I5DA 4I9WA 5EBMC 1ZARA 4AQYO 5A2QZ 3NWTA 5DTDA 1ZLJA 3CMEI 1F4MA 3QNEA 4XDJA 2LR8A 2R5YA 3AG2B 1QBZA 4D5FA 5LGUA 1ETKA 2HQAA 1Y1WJ 1L0NH 5HLHA 3ABLC 1ZK8A 4JI0B 1I0HA 3FISA 3FFQA 3CCMV 2X4HA 4B3MO 3MCZA 2FE3A 1Q1VA 4HV6A 4I7ZB 2RQQA 1RR7A 3H5NA 2PI5A 1LQ1A 1ZGAA 4GYIA 1BA5A 5BPIA 4F6RA 5EZYA 4QGPA 1MBEA 2IGMA 3GVAA 2GUZA 5FLXN 3E5UA 1H2LA 4YHHO 3CESA 1MJ9A 2GHYA 1HF0A 4HLYA 4FPPA 5JWPA 3ABUA 4NTXA 3H5RA 1ODDA 4LH7A 3IH3A 1KKCA 3T8RA 1OCRB 1MSDA 3AG4H 1SZXA 3JARA 3ZRVA 1B4AA 2ZNYA 5EIBC 1TWGJ 4LGWA 1X2NA 4F7ZA 1JX9A 5JCOA 4D7MA 2EIKH 5CMUA 2JPCA 3MKYB 3ML0A 3CDHA 3COAC 2QSGX 2W00A 5F64A 1GM8A 4B3TO 3FK7A 2E71A 2TDXA 4QIWF 4V2GA 1HW5A 2ZR2A 2BTOA 1K79A 2W6JG 3PJSK 1KQSU 3K1NA 3ULQB 4O6JA 4G94A 3CCQV 1YI2V 4CS3A 5HFLA 5FJ8J 4NQWB 3IC7A 3T8TA 3LSTA 4BU2A 3JRCA 1VQ4V 2CGPA 2BCCH 2YIAA 4XSZF 1NBMG 2ILMA 3BTLA 2CWEA 2KMUA 2R5ZB 5A9GA 3TGUH 1YDXA 3JCZA 1KKDA 2DT5A 2H6CA 2IAIA 1T08B 2ZMEC 1U3EM 2CV2A 3FHZA 3E22A 2B5UA 4O4IA 2MBFA 3I9V2 1CF7A 3FYEB 1Q7YW 3AG1H 3VB2A 1F36A 2RAEA 4I9QA 3SXYA 2FQ3A 4BAYA 2E2JJ 1OV9A 4P96A 4UCVA 4LD5A 5H9CA 2R7TA 2UUZA 2QKMB 2V1DA 3HJEA 3TW6A 1LDDA 1MH4A 3MMYB 4PJ0C 2QEXI 2EILC 4JAUA 3DU6A 1OYIA 4IOCF 5LRSA 5M3MJ 5EGOB 2EIKC 3BCCH 4LF7B 3A1YA 4PK4A 3ZCCA 4A3LJ 1B8IA 1PNKA 4LWSA 2NOGA 2DODA 3DCFA 3S8PA 3N2GB 3EDPA 5HFMA 2OC6A 2FQ4A 3O8GA 4A0XA 2LFSA 1VQ8V 2QVOA 5HLGA 4AD9A 1FP1D 3HKBA 1TL8A 1WJCA 1EBOA 5J1YA 3CTAA 1VQOV 1I7FA 1Y0NA 1ZAOA 1YITI 2O6GE 3CJHA 3G80A 4IYHA 1ZHFA 3DLAA 4WFHA 5GPCA 3K5OA 4C7UA 1GAXA 4YELA 2LREA 2BBYA 1SD5A 5HLTA 2GUZB 1X4PA 2AXLA 5IYBO 3W2AA 1YJ9V 1EKEA 5EZYB 3N2KA 1OFCX 1R3KC 4MIMA 5J2TB 1BGYH 2XB5A 3QRFF 4KIFA 2HTSA 5F27A 1OCOC 4AQYB 3HGYA 3CWBH 2VB6A 4A3JJ 4CGZA 5FLXK 3OSFA 4EB6A 2FMLA 3W7WA 1ZAUA 2F1MA 3CCUV 1XSDA 1Z3XA 1T2KA 1AOYA 2EZOA 5D5VB 3CRRA 4JAVA 3LSSA 1NKDA 4K3AA 1N33B 1AB3A 1DLBA 2ZJ2A 1PP9H 1PVEA 2LO1A 4Q5SF 3OD4A 4A69C 4MQVA 5L3DA 2IW5A 3KKYA 4LF4O 1BJAA 1S9HA 2YX7A 1OJLA 5F04A 4PGHA 2R9IA 2ME0A 5E1ZB 5HDKA 4IHYA 2QM4A 2E74B 2H3OA 3GO5A 2EV6A 2B7EA 2D1HA 1R6NA 1OCZC 2R9RB 3B40A 2KRHA 3BZKA 1PDNC 3OL4A 1PL0A 3JCUC 2QE7G 2EILH 3HKDB 2ZE7A 1N32O 1MSWD 1A6IA 2L4AA 3G67A 4CC6A 3DXJF 3L2UA 1GN2A 4LR3A 1SA0B 2H8WA 1MNDA 3TGNA 3ZMSA 1E0EA 5GADJ 1QLEB 5ITZA 2NVXJ 3OIQA 3L2RA 4QPQA 2FRHA 1FX7A 2GAUA 3WE3A 5B1BH 1I5XA 4LF5O 4FQGA 2E35A 2VKVA 4KIBA 4Y15A 1SVLA 3QO5A 4C3IJ 4I50A 1IXRC 4KJZA 2NVQJ 4J10A 3T1CA 1TW3A 3KYDB 4YEJA 1FFXA 2CG4A 2GA1A 1WJZA 4CCOA 3FF5A 2XROA 1FXKC 1K5QA 3E8FA 4PA7A 1BJZA 1SFKA 4LITA 3R61A 2WY7Q 3BJAA 2A5YB 5CQEA 1AJQA 3ROUA 1R7JA 4E7IA 1VQ5I 4J19A 2NNNA 2P8TA 4JX4A 1TQMA 4J7KA 2OQRA 1O9HA 1N0NA 3ZN0A 4FFBB 4ZZDA 4PELA 4L9NA 4PJMA 1XNRB 4DZPA 4DGWB 1IBMB 4PSWA 1HC8A 1IVSA 3BFRA 1V54H 3QU6A 2XAHA 2L0KA 3EYIA 3GVMA 3R65A 2WAEA 3HM5A 3OS2A 4JYCA 2F5FA 1V5GA 1XI1A 5K7ZA 3SJBC 1BI1A 5GONA 4WXHA 1QU3A 2DPUA 2QTSA 2A9HA 3K10A 4WCEV 5EJCA 1MG1A 3BROA 2X6CA 3ASOC 4ABMA 1VF7A 3HHHA 4R50A 1FJGB 2PJRA 2FBHA 1HKQA 3HPGA 3F23A 2I5UA 1DTOA 2B1IA 3P32A 4NVPA 4ENMA 4YY3B 2BOBC 4X0GA 3FB8C 1M9NA 3DEWA 2DOFA 2M7BA 3LSMA 2Y9ZA 3TP0A 1ZYRF 3FBIB 3HDDA 4TV8B 3VFZA 4ENJA 1G2HA 4AILC 4G6TB 3C2GA 3RYIB 3CP1A 4ZTFA 3LSJA 1QRYA 4XKCA 2OWOA 2PEXA 4JQFA 2VJ5A 5C3EJ 2ISZA 2LY2A 2WC2A 4CO8A 3DXRA 3ABKH 4O4HB 1BIAA 1FOKA 4MLOA 5K5QA 4KFCA 4CYCA 4MW8A 1RSOB 1ZGJA 3JATB 5HOOA 4GX2A 2Y4UA 3IH4A 4EFBA 5JQGB 3FXOA 1B9MA 2PJPA 1MKMA 2AHYA 3ZX6A 3I55I 4O4JA 2L7ZA 5IOYA 2UUCO 2V9KA 2VE8A 2WLHA 1M56C 3ABKC 2Z5UA 2W7NA 4LBEC 4WX9A 1J09A 3JW4A 3RYFA 3CMAI 1Q1HA 2IJLA 4CS4A 5JHFA 3BPVA 1K4SA 1APLC 1R1BA 2DMQA 2EZKA 4YIIA 4J00A 1SERA 4KN7X 1UJWB 2F4VB 3E3VA 2GM4A 2Y30A 2EK5A 4O2BB 5BXZA 3FXQA 3WB2A 2QZ8A 1Q3EA 3D36C 1NG7A 3LSKA 1P4AA 2DTRA 3EUHC 4KICA 2QKAA 3K4LA 4DV2O 1IRXA 4FFKA 2DQLA 3KYCB 4U88A 3SFZA 2VKHA 1MNEA 4HG2A 1AKHB 1OQYA 1O3TA 5FRNA 4FMTA 1GTOA 2P4VA 3QVNA 3LL7A 3CQZJ 4AIHA 3RI4A 2RNJA 1OHHG 1AVMA 2EZHA 4MFEA 4RGRA 1PV0A 1QA6A 4GX5A 2CUZA 2P81A 3GMEA 1I94O 3KP6A 4JPRA 2LY9A 3H35A 1JTYA 1U5TC 4Y13A 2W57A 5M5YJ 2JVGA 3HG9A 3MQ0A 2KJBA 4L9VA 3UNGC 4IIJA 4MTFA 4O2AB 1W36D 2QWRB 4AM3A 1HNXB 1G6NA 1G59A 3LFUA 4IEJA 1T5EA 1AI5A 3BAAA 4H33A 5K7HA 4FX4A 4JBAA 1LUWA 2F4VO 3PNTA 2UXCB 4RB2C 4HRIA 2P5OA 5FKMA 5HNFA 1I6XA 4P30A 3ZHQA 2VQHA 1OLTA 4A6DA 3BG7A 4BBRJ 5J4VA 3CCUI 5CVUA 1AKHA 2HPMA 1X1BA 3FXJA 5GTIC 3MD2A 4E7KA 4CA0A 1NHAA 5BOXA 1FS0G 1AA7A 1SD4A 2R4GA 2HOTA 5L3CA 1KB9F 5E3OA 3BRCA 1ZTEA 4M3DA 3CUQA 2B9SA 2XASA 2GXBA 1A04A 5DCFA 1B72B 3K5MA 2OTLV 1JJ8C 4JI2O 5JVTA 5FKKA 3JTGA 4ZTJA 3AK3A 3JYCA 3ZHVA 2Q2EA 3JASB 4FX0A 1P6RA 4DV1O 2K9SA 3F22A 3CHXA 5KLVH 4LJZF 5LXTA 1FOXA 4HNAA 1R4NB 4S05A 4XNFA 4CYCB 4LC1A 2V9VA 1AP5A 1IXBA 2OPTA 2M3AA 2KJCA 3HL2A 4E7LA 2Y0SN 2HFEC 2H27A 2VONA 2K9MA 1J9IA 3G1MA 1USSA 4ESFA 3KZIC 4A3EJ 1YG2A 1HW2A 2P7VB 1QNMA 4MTGA 4OGQB 4CCJA 1RETA 2LC2A 2PN6A 2I8DA 2LBFB 2X51A 2R7WA 3HOYJ 4IHVA 2G7HA 1H88C 5IT9Z 1XDSA 1E79G 1IDSA 1B1BA 3CC4I 4NXNO 4JV5O 3RWRD 5GPAA 2CH0A 4LLLA 1JUPA 1ETYA 3LMMA 2VODA 4MVMA 5LP6A 3HKCA 2EFWA 3K58A 1GLNA 2YUSA 4I02A 4KFMA 2IS6A 4GX1A 3CC7I 3E86A 3B6CA 5K5RA 3GCMA 3OYKA 5CVRA 3CUOA 3MKWB 1LFUP 2BY1A 3SPHA 1S72I 1YZBA 1MIJA 1TC3C 4IHWA 2QBYB 3OR6C 4XL9A 2WAFA 1W0TA 2HKOA 1MBGA 1OCRC 1TVKB 2WLIB 3J80K 3HR0A 5LA6A 3OTOB 2C6YA 5J9PC 4X65B 1VQ7V 4XMYA 2K9NA 5LEJA 1DDNA 1SQXH 4LK1F 4Q48A 2IGNA 2K02A 2A6EF 4RM3A 4NC7A 5ICGA 2H6BA 4A3KJ 2CGNA 2E76B 3ZPLA 2JA6J 1YXBA 4GX0A 2JN6A 3RFRA 5TJJA 2MW2B 4HAMA 2D2WA 2VKDA 3L00A 3IAS2 4OIRF 1QR8A 2Y0SA 3GZ5A 1GXPA 3E6MA 4XLFA 3F8CA 4MTOA 2PZSA 2BVLA 2FJ1A 4JI0O 1J59A 3APOA 3LSPA 2MGQA 4DR6B 2JA2A 1KQ8A 1ACIA 4ZJZA 3G6EI 2DT7B 2IJJA 1PP7U 2EWNA 2Q6AA 4IZZA 1SC5B 4JYYA 1LPQA 5KUKA 5BPDA 1IN6A 5F0CA 5GAGJ 4V2FA 2XAJA 1U8RA 1OYWA 3ML6A 2EIJB 5ITZB 1BT8A 4WBNB 1XGMA 2W0XA 4HNTA 4X66B 1SC7A 3WGHA 4MEXF 2Y2ZA 2ID3A 3ZMDA 5FLVA 3FB5C 2XNDG 4KYWA 2IXSA 2KKOA 3OYHA 4D7TA 4C9YA 1MOFA 3IRQA 1L3LA 4MHGA 4KL1A 1YIJI 5J1RA 2L9RA 2ELKA 1JJOA 4JZGA 2DK8A 2DO7A 4WBNA 2GIZA 3P9CA 1ITYA 2QSHX 4ZH4F 3F8MA 4QPJA 1SQBH 3QWLA 3DP7A 4BJTA 3E8BA 2LQTA 2X0LA 1GT0C 2ITDC 3JAWB 1X1AA 5JVDB 3SDBA 1H9TA 4JAAA 2WADA 2PYJA 2QEXV 5LOVA 2IM9A 1XDUA 2AO9A 1IG7A 2O5RA 1NQTA 2OT5A 1AR4A 2MFZA 2EBIA 2WY8Q 4PA9A 5KA6A 2E3CA 1U5TB 4DR3O 2P6SA 1JKOC 3CE2A 3ZQQA 2NN4A 3PUBA 1YHQI 4EMSA 1L0OC 2LOOA 1IUFA 5BZBA 4I4TA 4IYIA 5K7FA 3BT9A 2TCTA 3F0CA 4ZZLA 4FLVA 3OYBA 3CJRB 1D5AA 2XKOA 1FBQA 1MNMC 3CJHB 1VQLV 5ILUA 3HXLA 1ZLZA 2QR4A 4LF7O 1NU1H 2JK5C 3Q3SA 2QUFA 1M4UA 1S7EA 5DM7F 2YSUB 1RFYA 2WB1N 4WFFA 4B3MB 1JPXA 4II3A 3ASOB 2GQQA 2FL4A 2E1OA 2CW0F 1MDMB 5GP9A 3G6BA 2QWPB 2IJIA 1U97A 1P4XA 3M8JA 3M9AA 2Y48A 2EULA 2DFFA 4JYBA 1K3EA 1DF5A 3JRDA 1H8HG 2F48A 3AL0C 1MZEA 4MVRA 1ZH5A 5EYPA 2ECBA 3ZMTA 2XGDA 3X2QH 1XNQB 4DV3B 1MSFC 1S72V 2BOCC 1RUNA 1WZ2A 2VJIA 5BNGA 3AG3B 1LEBA 4TOIA 4A0ZA 1YW9A 3LA7A 4C3JJ 4KA4A 2CYYA 1KYZA 4A3BJ 1W59A 4PJNA 1BSMA 3AG1B 4B3XA 1Y74A 2OBPA 1M1EB 4BXFA 1HOMA 4XN0A 2JJ1G 5HDGA 3DPUA 1ZELA 3JASA 4E2LA 1XD7A 2P5KA 3HOXJ 2L9VA 2GXAA 2RQPA 5LMUO 2HP8A 3WG9A 3C3WA 3OL3A 2YXLA 5EF6A 4DBQA 1QO0D 2E1NA 3H1JH 4KIGA 2KHMA 3RVYA 1IN4A 2EB7A 3A0BC 2STTA 3P3PA 3TBIA 3ZRSA 3RYCA 3QG5A 4DV1B 4DIQA 3H9VA 1UG2A 3SEQA 1ZRFA 2LW1A 4NC8A 3OOUA 2L4MA 2RKHA 5DCMB 1K4CC 5KUMA 1BQZA 3FMSA 1OCCC 3OR1C 3OYGA 2RGVA 3JD4A 4UV9A 3WHBA 4EM0B 3EUAA 3PO2J 1WFXA 1VARA 1F1ZA 3WU0A 3HSRA 2FKXA 3LSRA 4BXXJ 3ZQIA 1D5NA 3AG4B 3JSPA 3BJ6A 1XMKA 4X65O 2HKXA 4CCLA 3EQLF 3KEOA 2CV0A 1TT0A 1GKFA 4NBQA 3OAAG 3G71I 4NYKA 2VBXA 5J47A 3JSNA 4PI0A 1D8KA 3LSUA 1U8BA 2CJJA 2RMKB 2Y0PA 2ZSIB 3M1EA 3Q0UA 4C2MJ 5EEHA 2B9ZA 1ZG1A 1YS7A 2BSKA 3SR2C 5K1XA 2DDAA 4A3CJ 1SVOA 4PD4F 2BV6A 4RGSA 1D8JA 1S5LC 1K7AA 4FETA 1HR0O 4XORA 3HOVJ 4BIUA 5FO5A 1XG1A 3A02A 4BQAA 4DV4O 3J81Z 1VQ6I 2O0YA 3K2ZA 5M3FJ 3FX7A 1XL6A 2R3SA 2RV8A 2A05A 3E83A 4WF9V 2VPRA 3OIOA 3QYFA 3AL0B 2M8EA 5F1RA 2OTJV 4B48A 1MJBA 3QO7A 2ADPA 4X1KB 1IAWA 2VJJA 2FXAA 4HV5A 1OISA 4J41A 2VBWA 2BY0A 3F8FA 2JIZG 2WPDG 3M1CA 2IJKA 4FVMA 2ZSHB 1JT0A 1ZTRA 4X66O 3CDLA 1VI0A 4PDLA 1HLVA 1W0KG 4X62O 3FXLA 1VIBA 3JATA 3P9IA 1GDTA 5IY5B 4KDPA 4B8XA 2R7VA 2XV4S 3M3YJ 2KKWA 4LF9B 2EIJH 1MH3A 3X2QC 4Z2WA 2Q7HA 4DW6A 5EBWC 1K61A 1AJPA 3OR7C 1W0UA 2VQEO 3IAYA 3RYIA 1WB7A 5EZHA 3OMYA 4UB6C 4RUFA 2L35A 3E7LA 1OJHA 1UFMA 2VPLA 3H3ZA 1HW7A 1HQCA 2VXDA 3NARA 2NAZA 2UXXA 4R8HA 3U9GA 5IJ9A 2N8GA 2VWKA 3CCJV 3CRAA 4G7OF 4UCUA 3KZYA 2LK2A 5IYDO 1D1CA 2Q1ZB 2R7ZJ 1I39A 1MBKA 1BS3A 1V5FA 3T1BA 3GZ6A 1YVWA 2ME6A 3CO6C 1KU2A 2BW3B 3BC8A 1O9GA 1Y76A 3GTQJ 3CCLI 3K4CA 2PUSA 4PA3A 1DP3A 1WA8B 2OZ6A 3NEUA 3O9OA 3N27A 2CQXA 4M71A 3HRSA 3R6SA 4X1IA 1BZKA 3R66A 1WA8A 2HGCA 2DYRC 2BY3A 4JTAB 4BJ6C 3L70H 4DR2O 1OCCH 3SPJA 2ZD9A 3ZMUA 4JI3B 1H2NA 3I56V 2FEZA 3WGIA 1WP8A 2ZFWA 1KZHA 4OIPF 3CC4V 3LWFA 3U10A 1N25A 1XC5A 1Y8QB 2MK3A 3HOZJ 3OR2C 4UVAA 1I27A 4RBOA 4DV2B 4DXWA 2PBIA 4F3QA 5JHUA 2P67A 4OAYA 3I59A 1YCIA 1GHCA 1RKTA 1L0LH 3CSXA 4PJJA 3L9FA 3D36A 1YW7A 5ERIA 4FLUA 1YQAA 4O4LB 2GA2A 1SETA 3JTHA 4DV7B 1W5CC 2IRFG 3DBHB 1KYWA 1O57A 5EBLC 3ZHUA 3ZHSA 3IC9A 1O7FA 4U7BA 1R1VA 2D45A 3VYUB 4L0ZB 3BR0A 1GN6A 3FXKA 2OCHA 1K5SA 1XGOA 3JD2A 3H1CA 4KT5C 3KZZA 2Y4TA 1OYYA 1TWAJ 4I99C 5L3GA 1DUXC 3BTJA 2H8PC 2RCVA 2R9AA 1XREA 4ZYDA 2DFIA 2JGDA 2Q69A 4DRXA 4MQ9F 2A6HF 1P7GA 4LFCO 4IHXA 3CDIA 4XLPF 1IGNA 5DECA 3MZYA 3KYLA 2JA8J 4X88A 5IJ0A 2CE4A 2ETHA 1EJ9A 4YIPA 3V7SA 3RPQA 3IUOA 3NAUA 4HSRA 3TOAA 4LNUB 1P92A 4YY3O 3L7WA 3ETQA 2OUMA 2EILB 2P0WA 4A93J 5CYVA 1QVUA 1AWCA 2XUMA 3DEUA 3RSNA 4I55B 4MTXA 2DYRH 4W4LA 1M5IA 1IBKO 4RAIA 2IU0A 3RVZA 1XHZA 4WXDA 4GLXA 3CO7C 1LJ9A 2P90A 2Q4PA 4C2TA 2E2IJ 1Z5WA 1Q86W 1JJ2U 3HZJA 1ZG5A 4FIPC 4C3HJ 5DUKA 5J2TA 5EK0A 2VBYA 5LEKA 1DQUA 4ZYHA 2GLOA 2DJVA 1AI7A 1IC8A 2K3PA 3CF5F 1ETOA 1O3QA 1XBLA 3H9JA 2NS0A 2RVCA 3GWZA 2DA5A 1W4MA 2M87A 4XSXF 1MMAA 3VYSB 3H5AA 4Q4ZF 1NZ6A 4B3RB 3K3WA 1FXHA
chains in the Genus database with same CATH topology
3W6KB 5C8YB 1S7OA 2HQRA 2FBKA 3WODF 3MAQA 4PHZA 1W5TA 2M1BA 5LHIA 4A5MA 4GKKB 1IRFA 5A2QK 5LRRA 3RYCB 3R0AA 2YR2A 4LNUA 2XAFA 1Z9CA 3WTWC 2HOEA 2VXZA 5ED4A 1FY7A 4O4IB 2JRTA 4K8XA 2ESHA 3D5LA 3BJOA 4TV9A 1I1GA 1QGPA 3JSOA 5EYPB 4G6DA 3QTCA 1O7LA 1TQPA 4HBLA 1CGPA 3ISPA 4HF0A 2DAOA 4GYGA 4QWQA 3JAMK 1P49A 2MLKA 2JVDA 4ZOLA 3J7AO 1XQ8A 3WTTC 4OINF 1MDMA 3U11A 2JPBA 2BYVE 4BHPA 3F8BA 1BM9A 2IA0A 2Z9OA 3FMRA 1DPRA 3FM3A 4CDGA 4K8ZA 1MGTA 4LF6B 2ACJA 1JFFB 4X1IB 4EM2A 4NHJA 1U5TA 2RC4A 1UHWA 4GKJB 2PLYA 3ICXA 3D0SA 3GXOA 5JR3A 3RGBA 2BEOA 3PN1A 4UCRA 2PY5A 5IJ9B 3P9KA 1S7AA 2A68F 3SQNA 2YPRA 2MD5A 1JMKC 5IJ0B 3DQVC 1XB4A 1ON2A 2DLLA 5KX5A 2QYOA 5D5PA 3E6CC 4R79A 3DPLC 3KEQA 1BIBA 1Q8IA 3GFIA 1TGOA 3VQXA 5KHIA 1FC3A 2P7CB 3WE2A 4ESBA 4TQFA 2W24A 5E8IA 2O03A 3TOBA