1KU9A

X-ray structure of a methanococcus jannaschii dna-binding protein: implications for antibiotic resistance in staphylococcus aureus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
MIIMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKISEKILEALNDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
molecule keywords hypothetical protein MJ223
total genus 39
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku9A01
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ku9A02
1TLHB 1BI1A 1B1BA 2UWMA 5ICCA 1JXSA 1FWZA 5FFXA 4I09A 3KP4A 3JTGA 2OQRA 2DT5A 4KIFA 1X3UA 2OBPA 1XD7A 4XSZF 2VONA 2FBKA 5D8KB 3R0JA 2EK5A 5BMZA 1ODDA 4EM0B 2JT1A 3FXRA 5ED4A 2PLYA 2Z99A 1TQMA 4HLYA 2KIMA 5D6FA 3WG9A 1ZREA 4KMUX 2XGXA 4R1HA 3ERED 1HKSA 3SZTA 3WTUC 1FSEA 3IHUA 3EUHA 5AIPA 2W57A 1R23A 4HYEA 3TO9A 2IPQX 4HW0A 3RPUA 3K1PA 3GYHX 2QQ9A 3CUQB 4M9ZA 3GO5A 3ZMTA 2QLZA 1PDNC 4WWCA 1MKMA 4MTDA 3FM5A 4OIOF 1KU7A 3V7CA 1MGTA 1SD4A 1O3RA 1L3LA 2IT0A 1EH8A 2NYXA 4WK8F 1F5TA 3WE3A 5D5VB 5LBQA 3QOPA 1BM9A 4JBAA 3T1BA 2LKPA 5L3GA 2CYYA 2KIFA 4WXCA 2RNJA 1T98A 1MZBA 1HQCA 3JAMZ 1HSJA 4ZZLA 4HF1A 3CUQA 2OZ6A 4UUVA 1F1ZA 2NNNA 3P9IA 1FYKA 1O7FA 2RQPA 1BC8C 2V1XA 3FXUA 4H0EA 2MH9A 4RAZA 2WC2A 4M9XA 4UV9A 1ZYRF 2PI0A 2HWVA 1RUNA 5D4RA 3HSEA 1FLIA 3V4GA 2ZFWA 2A68F 2Q8KA 5L3CA 1R5GA 2KJBA 5DCMB 2HTJA 4OIQF 4P96A 5FB2A 2HS5A 3SR2C 3FMSA 3LA3A 4LG0B 1H0MA 3QU6A 2ZXJA 3VOEA 1FSHA 1IN8A 1F9NA 4CYDA 1A04A 3KLNA 2VODA 1M5IA 1STZA 4EJWA 2NAZA 1YS7A 3WODF 4FX0A 5L3FA 1FBUA 4ZYGA 2PJPA 2G9WA 4RGXA 1J2XA 4A0ZA 1J7KA 3I54A 5KK1A 1XN7A 6PAXA 3BDDA 2OU2A 3TO7A 4U7DA 1USSA 2DQLA 4KFCA 2RVCA 5CYVA 1U5TA 4S05A 1CGPA 3IC7A 3SZPA 4L18B 2P4WA 3HRMA 2E1CA 4MGRA 1YTYA 2Z5UA 3GZ6A 3WTWC 4AVPA 3L7WA 2HYGD 5HDNA 4N0BA 1UHMA 3HRUA 4B8XA 1D5VA 2LDUA 1ZRFA 1XSVA 1U6GA 3TOAA 1R1UA 3MFKA 3V8JA 1TW3A 3R60A 1G3SA 2XAHA 3K2ZA 5LEJA 1YG2A 5E8IA 4P55A 1EV7A 3BJ6A 3M7GA 3U9GA 3I53A 1WI9A 1IF1A 1IXCA 1FNNA 1ZG5A 5FO5A 2O6GE 5HS8A 2QM3A 3ZMUA 3KCCA 5FGMA 4ENKA 2EFOA 1O3TA 5LHGA 2F2EA 2HGCA 2ISYA 1MD0A 2YX7A 4I98B 2ESHA 3WGHA 1CF7A 2V1UA 1RUOA 4A0XA 3DQVC 4MQ9F 1BN5A 5IT3A 2BV6A 5EEGA 2XKOA 4ENMA 3Q9SA 2D2WA 2C6YA 1W7PD 4BNCA 4PGGA 3H92A 2EJRA 5F6FA 4NQWA 1KGSA 4K2EA 3QPTA 2MD5A 3K1NA 2Q0OA 2IA2A 2BYVE 3NEUA 3AAFA 2FF4A 1Z6TA 3KEOA 1WQ2A 2ZMEA 1W4MA 2FMYA 3IRRA 2K02A 4RB2C 5LGTA 5LLQA 5BOXA 3WTVC 3F8BA 3F21A 4EJOA 3J81Z 3KP5A 1ZHFA 4M6YA 5J8CA 1MJ9A 1I6XA 3V7RA 4IPAA 1B4AA 2QYOA 1XSXA 4KYWA 4L9VA 2F5CA 5HLGA 3MWMA 1K79A 2K4JA 1WSUA 1VTNC 2VOPA 1S6LA 1ZG3A 2XASA 4G6QA 1SFUA 1R1TA 1RI7A 5DD8A 1FYLA 1E2XA 1R5HA 1GXQA 2VE8A 4BHCA 3R6SA 1BI0A 3RJPA 4AIJA 3W6JB 4HX8A 5JR3A 3WTZA 3F6VA 2GQQA 1PP8F 1HSTA 2O03A 5E8GA 1FC3A 2A69F 2JZYA 2KIUA 5CVIA 1BJAA 2LF8A 1ZH5A 4TV7A 1HW2A 1XGOA 3V7SA 2QWWA 3SXYA 1H9TA 2D1VA 4L9JA 5CVRA 2NNYA 3E3VA 2HOEA 1B6AA 2VBXA 2DLLA 2YU3A 3ECOA 3F8MA 3G3ZA 4N9IA 2Q2EA 3SHFA 1MJBA 3ZQ7A 1QNTA 3CUOA 4IRHA 1AOYA 4P9FA 4XLNF 2V6CA 2X4HA 4RAYA 4IRGA 3R4KA 3E5XA 3FMQA 3F8CA 4A0YA 4BHPA 3REOA 1XCVA 1K6OA 1J75A 1KQ8A 4BQAA 2Y48A 4B09A 2EFQA 3IRQA 1LVAA 5LGUA 5F1RA 4I2OA 3ZMZA 4Q48A 2CW0F 2V1DA 3MZYA 3RTRA 2EB7A 4G7HF 2H09A 3E5UA 4G94A 3KLOA 1EH7A 2FA5A 3KZZA 3QAHA 4MNUA 3CLOA 1SFXA 3ECHA 1E17A 2W24A 4A6EA 5CVUA 1P4XA 1BBYA 3LAJA 3IL2A 2P6SA 2XUBA 2XROA 2K4BA 2RDPA 2EFPA 2IA0A 4EVIA 3VEPA 2TDXA 3GVAA 3DPLC 1SAXA 1J9IA 4HV6A 1HBXG 5E20A 1G3TA 2A61A 4Z2YA 3JW4A 2QZ8A 2L01A 4GYGA 2Z9OA 5D6EA 2VE9A 3RPQA 1S7OA 1Z91A 1O3QA 1SD5A 3ZMVA 4HF2A 3MCZA 3I71A 5LRSA 5LRRA 4G7OF 1IXSB 4NB5A 3EETA 1B9NA 3BP8A 1ZGJA 2W25A 3BWGA 3N97A 2NRAC 2A6HF 2DU9A 3Q9VA 5D5WB 2M87A 5D5XB 2VT2A 1U5TB 1T38A 2DTRA 3BPXA 5D8LB 2HEOA 2GXBA 1ZLJA 5HS7A 4A5MA 1U2WA 3MAJA 5DUIA 2VC1A 4LLGF 1DUXC 3L9FA 4A6DA 2UZKA 2H6BA 1DDNA 1HW1A 4PCQA 2KKOA 4KICA 3FXQA 5FLXK 2P5VA 1XGMA 2F5DA 4EMSA 4NHJA 4AD9A 2NS0A 1F4KA 1BOAA 4A12A 3CTAA 3WTSC 5HVQC 5BPDA 2MLKA 4YFXF 4WF2A 2A07F 2J5PA 2E7XA 5HDKA 3ABUA 2ZBKA 4HDUA 4ZYHA 4ESFA 3VFZA 2O8XA 1DPUA 1UFMA 4FX4A 2QVOA 2WV0A 2W85A 2RGVA 3WTXC 3O2PE 4LGWA 3GFMA 1IAWA 1JGSA 2MLGA 1R58A 5TRDA 1YYVA 4MQVA 3KP2A 2OD5A 1R22A 4YFKF 3GX4X 2LSOA 3GFIA 1XB4A 5ERIA 3E5QA 1R7JA 2VBWA 3GLXA 2MH2A 4LB6B 4HAMA 1YFHA 1ON1A 1LQ1A 5JHUA 3I59B 1Q1HA 4AIKA 1ONVA 1QBJA 1USTA 4L9TA 4UXNA 4R8HA 5HLIA 2HDCA 1GXPA 2QENA 4ENNA 2PN6A 3HOTA 2CQKA 3F3XA 5H6QA 2IP2A 2L02A 1XDUA 2PMUA 3K9TA 2AS5F 3IWFA 1I27A 4G8XA 3L09A 3M8FA 2MC3A 1G6NA 3ABTA 2CSOA 2GIVA 2FNAA 5J6XA 1FOKA 3RYRA 3F8NA 5LEKA 1BI2A 3ZMDA 3EDPA 3J80Z 3GFLA 3M8EA 1TW2A 1NHAA 4KNYA 4EGYA 5E1ZB 4CICA 3DPTA 5H20A 3IKTA 3BY6A 2BGCA 1JE8A 1J5YA 4OOIA 4FT8A 1OMIA 2O61A 5DYMA 5JVTA 2GAUA 4ZYDA 3IKVA 4ZYEA 3F6OA 3GW2A 5AIQA 3DF8A 4L0ZB 2DK8A 3GWZA 3T8RA 1IRGA 3K0LA 1EH6A 3FWEA 3HYIA 1P4WA 2EWNA 2FMLA 4OMZA 1U8RA 4U0WA 4EM1A 4M9SA 4YIIA 3R0AA 2FBIA 2ACJA 1QO0D 5E18F 2K86A 2P7VB 4BAYA 5LGNA 1DPRA 2R7DA 1FY7A 3WU0A 4MEXF 4WCGA 4A5NA 2OAZA 4GYIA 2IJLA 4DNCA 5BPIA 1UHWA 3GZ5A 2K27A 4EV0A 2B0LA 4CO8A 3C3WA 2M8EA 2VC0A 4GGGA 4O3MA 2OA4A 5K1YA 4LK1F 5DCMA 1FBQA 3KEQA 1ULYA 1YS6A 2G7HA 1HW5A 4LJZF 4DQ2A 1U78A 5ICEA 1QZZA 3PQKA 3BOQA 4QWQA 3WGIA 1PP7U 2HTSA 2HQNA 4AIHA 2A3SA 4RB0A 2DK5A 2L4MA 2X0LA 3QU3A 1XDSA 3LFKA 3LAPA 3ZN1A 1FP2A 4U88A 3T0YA 2EA4A 1KU2A 2W84A 1IN5A 3J80K 4HV5A 2QQBA 2P5LC 3HIFA 4QLCU 2XAQA 4RB3C 3IWZA 4JQFA 4IHTA 1OKRA 5FD6A 3HSFA 3QP6A 2GZWA 4UVBA 3RKWA 2ISZA 4EQQA 1ZAOA 1V3FA 2PBIA 2YR2A 2Y0MA 4UNOA 1MJAA 5AONA 1RZ4A 3D5LA 3CO6C 1YIOA 3LQQA 1O3SA 2J5OA 3VODA 5E1WA 2FQ3A 1J59A 3BJOA 2M1BA 1W7PA 1H9GA 2DPDA 1R00A 1FT9A 5E1XA 1G3WA 3BPVA 2BEOA 1L0OC 2LNBA 1IXRC 1FX7A 3K69A 3KP7A 2R7FA 1FZPB 1I5ZA 4GXOA 4ESJA 5K5QA 2LF7A 4Q4ZF 1MDMA 3GXOA 3ZN0A 4OIRF 4XLPF 3E6CC 2H27A 1KYWA 3HOSA 4E70A 4HZFA 1YW7A 1KQ9A 3HHGA 2VN2A 4MHGA 3WU1B 2ZMEB 3RYPA 3RDIA 1WKMA 2FSWA 3I58A 1OYYA 2BE5F 3CO7C 3J7AO 2XKPA 3JSPA 5JFRA 3LA2A 4OINF 1S3JA 1HKTA 2FNPA 4RGRA 3FHZA 4LLNA 2HR3A 3COAC 3WE2A 5DV5A 3HSRA 1KU9A 4M73A 2CG4A 3MEXA 1B59A 1MDMB 3CDHA 4M74A 5FD5A 4IJAA 2DW4A 4UV8A 1LDDA 1LNWA 4IVNA 4MTEA 5K5RA 3GF2A 2EV6A 2O0YA 1XGSA 1YW9A 4XSXF 2GA1A 2MA3A 3BJAA 4ON0A 3BROA 2XAJA 5BS6A 3O3KA 3E97A 4HLXA 4S04A 4I0AA 5H6RA 5FFZA 3JTHA 2JPCA 1BIBA 2ESNA 3B73A 2L4AA 2P6TA 3OV8A 2H6CA 2FOKA 1ZLKA 2V9VA 3TQNA 2HYFA 1TQIA 1JHHA 1D8KA 1IN7A 3NQOA 2EA2A 2UXNA 3KETA 4KMFA 4WX9A 5DEQA 5DUKA 2RN7A 2VT3A 4RB1A 1OR7A 4Y13A 5DD4A 1TNTA 2JPBA 2CO5A 3I0TA 1SFEA 1U5TC 2Z3YA 1D8JA 1KQ0A 4CZZA 2FRHA 4GO1A 3DV8A 1OYIA 4IXAA 4YFNF 3DKWA 2JTVA 1O57A 3HRTA 4KN4X 2DAOA 2ELHA 2Y75A 3OOPA 3ML6A 3RI4A 1LB2A 1LDKB 2M30A 2YPRA 1SMTA 1ZARA 2P5KA 4Y15A 1Z05A 1SD7A 3V8LA 1LJ9A 2ZJ2A 3JSOA 3NRVA 5ILVA 4LG0A 2MBFA 2KJCA 3F23A 4KT5C 1XMKA 4HQEA 1V4RA 5CVVA 2XV4S 1LDJA 3TOBA 2A6EF 2YSRA 3DFGA 1O7LA 3EYIA 1Z6RA 4L5JA 3KZYA 2PFBA 4UVAA 1S7AA 2R9AA 3D0SA 2KRFA 3MQ0A 2PQ8A 3N4MA 4CXFA 5D4SA 2RV8A 4LLLA 1TNSA 3C7JA 4CGZA 2ZCWA 4EM2A 1T6SA 4LK0F 5HLHA 3ZPLA 4M71A 4WXDA 2PEXA 2COMA 3O6BB 1Z1DA 1LEAA 2QBYA 5CVJA 4M72A 3P9KA 1HKQA 2EFNA 3C18A 1K78B 3CUQC 5L3BA 3ISPA 4UVCA 5E17F 4BHBA 1IN6A 4L0YB 2F5FA 5F64A 4BXUA 2D45A 3HRSA 2HKOA 2STTA 5HS9A 2GXGA 4Y17A 3Q5FA 5A2QZ 1JHFA 5ILSA 4YG2F 1BIAA 1K7AA 2FEZA 1T39A 2L3DA 1I1SA 4KDPA 5HDGA 2DFIA 4HQMA 4PZJA 4ZZDA 4LFUA 3ZP5A 2IRFG 4XRFA 3WTTC 2XRNA 3TDZC 2Z33A 2HQRA 4LMYA 3ROUA 5ICFA 1P6RA 4KA4A 1R1VA 2DPUA 3RKXA 3EYYA 4U7BA 1OYWA 2ZNYA 2DQRA 3TDUC 3ULQB 3GUDA 4CDGA 3WTYC 3P7NA 4KUMA 5DCFA 3KE2A 4IRIA 2RKHA 3K1MA 2XIGA 1C0WA 1U3EM 5JI6A 2XAFA 1B9MA 3L00A 2QQAA 3KP6A 4I0BA 4UHTA 4HA8A 4BYYA 1FYMA 5CLSA 1PUEE 1IUYA 1QZYA 2ZNZA 4A2UA 3LQRA 4ESBA 4I7HA 2FU4A 4G6DA 2RC4A 2DO7A 4O6JA 3W6KB 2M5WA 4O5VA 2VBZA 3F8FA 4N9HA 2PMHA 1J0RA 2HZTA 4YIFA 3HTUA 4WXHA 3QRFF 4LB5A 3U2RA 3ZMSA 1TQPA 2VXZA 1ZRDA 3LA7A 2HFHA 2PG4A 3BZ6A 2JSCA 3F22A 3I5UA 5IT9Z 1IW7F 4ZH4F 1W5TA 2ZO4A 3LSTA 3L2CA 3E6BA 1XCBA 4U0VA 1UB9A 1ZGAA 5IT9K 3RKYA 4HX7A 3DXJF 1XSDA 4EJVA 4RS8A 2ZKZA 5D5UB 1D3YA 4I02A 4EGZA 5FLXZ 2STWA 5L3EA 1YQAA 4HOBA 4HX4A 1SD6A 1K78A 4KIGA 4ENJA 3PQJA 4HDVA 1IRFA 1T0FA 1WRJA 3JAMK 3M9AA 5BQTA 1T2KA 3FMRA 2ADUA 1P2FA 2FXAA 5HOOA 4FHTA 2QUFA 2IVMA 1REPC 3FF5A 4ETSA 1YLFA 3G73A 5DDGA 5L3DA 3CJNA 3B02A 2VBYA 1BI3A 3TKYA 4JK1X 2E7WA 1IZ1A 4OU0A 3RWRD 1OPCA 4U0YA 2G7UA 2EV0A 1KYZA 2DBBA 5K5OA 1QGPA 1FP1D 4L5IA 1RNLA 5CJ9A 2FBHA 1S29A 4KIBA 4BH9A 4IHSA 4EJUA 2WWYA 1KA8A 3GFJA 5ILUA 1ZRCA 5KVRA 3RIRA 2GWRA 1G4DA 2GA2A 1P4AA 2HKXA 4HF0A 1XGNA 3SQNA 3LWFA 1IN4A 5EEHA 2L54A 4XBFA 4G7ZF 4HBLA 2EV5A 3E6DA 1G3YA 3TGNA 3FX3A 2UXXA 3PFIA 2V79A 2EFWA 4GCVA 2JRTA 1QPMA 2H94A 3R61A 2AXLA 2K7LA 1HXDA 2OZUA 3VB2A 1CF7B 2BBYA 1UCRA 3J81K 3S2WA 3T5XA 4D0PA 4AWXB 1FPQA 4F7ZA 4MEYF 4PDKA 5LHHA 3I59A 4G9YA 4PGHA 2CWEA 3DP7A 3HHHA 5ICGA 4Q47A 2ETHA 1TTYA 1XMAA 4KN7X 1I1GA 3MZHA 3F72A 3H3UA 4I01A 1W7PB 2O3FA 3I4PA 3T8TA 2XVCA 4OIPF 1GHCA 4EJTA 3ELKA 3P9CA 3V8KA 4L9NA 5LHIA 1Z7UA 4RGUA 2E1NA 5A2QK 2IW5A 2XAGA 1ON2A 3KFWX 4CHUA 1KU3A 1P92A 3TO6A 4ASNA 1FBSA 3SFZA 1AWCA 3U1DA 2CGPA 1ZG1A 1YW8A 1RIOH 3EQLF 3FM3A 2D1HA 2A5YB 4OMYA 3HTSB 2FE3A 2IA1A 2P7CB 3I64A 1QQIA 1BC7C 1TBXA 2QM4A 2P8TA 2CFXA 3C1DA 2OQGA 1R36A 4Q5SF 1ZN2A 2DI3A 2WTEA 1GVJA 3WGGA 1S8NA 1WWXA 4IF4A 4M6XA 5J8FA 2YX4A 1Z9CA 3E6MA 4RGSA 3HUGA 3DEUA 3FZVA 1YO5C 2QBYB 2F5EA 1SMYF 2R3SA 4P5OA 4LD5A 1W5SA 3QPHA 4P9UA 1DP7P 3M1EA 1Y0UA 2VOOA 5TJJA 2XHKA 4R79A 3GEZA 2M45A 3H3ZA 3KP3A 3QP5A 1LEBA
chains in the Genus database with same CATH superfamily
1ZUQA 1TLHB 1BI1A 1ETVA 2ZQMA 4NBQA 1I3QJ 4IKFA 1XUQA 1YI2V 4DV0O 1B1BA 2UWMA 3MVPA 5ICCA 2ZE5A 3SPJA 3L1PA 1JXSA 4N23A 1ORKA 1WP7A 1FWZA 2ID3A 3PUBA 5FFXA 1M93A 1KD1W 2F4VB 4I09A 1VF6A 3M8JA 3DSQA 3KP4A 3JTGA 2OQRA 2DT5A 4KIFA 1X3UA 2OBPA 4DOZA 4WFGA 3JAWA 5LYJA 4U87A 2HVQA 2HP8A 1GVDA 1XD7A 4XSZF 1GT0C 5IYBO 4H4KC 1U9OA 2VONA 4N21A 2QR4A 2ZJQF 2FBKA 3K10A 2QM8A 2IS2A 1TWAJ 2WADA 1DLBA 4DV1B 1XMQB 1XMXA 3QYEA 5D8KB 2CTPA 3OSFA 3R0JA 2ILMA 2EK5A 3N2KA 5JCOC 3RVZA 3QPSA 5BMZA 3H01A 1ODDA 2DOFA 1YITI 4EM0B 4LFBB 4M3BA 2JT1A 4NTWA 1F7YA 3FXRA 3LL7A 5ED4A 2PLYA 3WFVA 3CP1A 3IAS2 3RYIA 2RNBA 2Z99A 1H89C 1TQMA 3LSPA 4G27B 4IHYA 4HLYA 2H8RA 4A3GJ 4RA2A 3K70C 1V5FA 2KIMA 2QJ1A 5D6FA 3ZRWA 4E7KA 4CUGA 3W3CA 3WG9A 4DBRA 1ZREA 3E8BA 4LFCB 3CJRB 4KMUX 2XGXA 2DJNA 1IXMA 5EYPA 2WLNA 3JRFA 4R1HA 3TP3A 4C3IJ 1XMOO 2WA0A 3S15J 4UCUA 3ERED 2X6WA 1SQPH 5C8YB 1HKSA 3OTOB 3SZTA 3WTUC 4B3XA 4KITB 1FSEA 3IHUA 3OIPA 4RQEA 2KQXA 1D0XA 3QYBA 2E1MC 3EUHA 3AG4C 5AIPA 2W57A 1R23A 2M34A 2PZSA 5EIBC 4HYEA 1WNSA 4IL6C 1WJEA 3G1OA 1BMFG 1KB9F 3TO9A 2EULA 2IPQX 1Y74A 3SDLA 4HW0A 3RPUA 1KC8W 3K1PA 1S7EA 4X62B 2ODMA 3FBIB 5KMGA 1FKAO 2NVTJ 4PUSA 5D5QA 2UV1A 1E1RG 3GYHX 2QQ9A 3CUQB 3A2FA 2XPWA 1S76D 2LY2A 3H35A 3GO5A 4M9ZA 2V6EA 3ZMTA 2LC2A 2QLZA 2GOMA 1PDNC 2ZINA 4WWCA 3AG2B 1QVUA 3BTLA 1SA0B 1MKMA 4MTDA 3FM5A 2L7FP 1AR5A 5TISZ 5IJ0B 3CS5A 1UJWB 4OIOF 1GM7A 1KU7A 3V7CA 1VQLV 2MD0A 2CRGA 1MGTA 1SD4A 4JI4B 1O3RA 1L3LA 2IT0A 1EH8A 4EEQA 1PUFB 3WB0A 3TL4X 3S8PA 4DR5B 2R9IA 3OYLA 2IXSA 2R7XA 2NYXA 3BCCH 4WK8F 5GW7A 1F5TA 4ZTJA 3WE3A 2R92J 1N36O 4XM3A 1K3EA 5D5VB 1ZLZA 2BXZA 5LBQA 5DM7F 3L9DA 1WA8B 4KHPO 4A3FJ 3QOPA 3PO2J 1B3QA 2LTPA 1Y76B 2XUMA 1FJLA 1BM9A 4JBAA 3PNTA 3T1BA 2LK2A 1EN5A 2LKPA 5GPAA 5L3GA 2GDSA 2CU7A 5JVDB 2CYYA 2KIFA 3N05A 4WXCA 2RNJA 3GTKJ 1XQ8A 3RW0A 1T98A 4X1EA 2NN4A 4DR3O 1MZBA 4B1RA 3CDLA 5CA1A 4DUZB 1HQCA 2JVHA 2PX9A 3JAMZ 1HSJA 4ZZLA 4HF1A 4GRIA 3FKIJ 3HKDB 4LCUC 1NQTA 4NC6A 3CUQA 1ZELA 2OZ6A 4A3JJ 4ZTFA 1XC5A 4UUVA 2V7QG 3OUFA 5FROA 1K61A 3UKGA 4JTAB 3C3TA 2HI3A 3JR9A 1F1ZA 2OCHA 4E4EA 4B47A 2PMZN 3L71H 1J09A 4Y33A 3HGYA 2NNNA 3P9IA 3ABLC 1FYKA 2Q69A 4FLWA 1O7FA 2RQPA 3LDEA 4ZKIA 3ZHTA 3CPWU 1BC8C 3EUKL 2V1XA 3FXUA 4H0EA 5E3MA 1IURA 3BQZA 3O8HA 1IBMO 4I50B 3WHCA 4DR6O 2MH9A 2EJ7A 4D5CA 4JV5B 3OY9A 4RAZA 2R5ZB 2WC2A 3OYEA 3G6EI 4A3MJ 4M9XA 1Y1WJ 3H1IH 5E79Z 2DT7B 3FB7C 3C2GA 4UV9A 2IEKA 5HNHA 1ZYRF 2D5VA 1HC8A 4K8XA 2PI0A 3SJQC 2HWVA 2VQCA 4P30A 5BMVA 1Q43A 5JH7B 2KMUA 1N8RW 1RUNA 1VQKI 1UMQA 3AG2H 1Q90D 4DV3B 1XX5A 2Y31A 2OTJI 4LWSB 1UG0A 1R4MB 3G1MA 5D4RA 3CCQI 1H2LA 1FMVA 3G67A 5A9GA 2QEXV 1TWGJ 3HSEA 1HA8A 5GTHZ 3RT3C 2F4VO 2CV1A 1FLIA 3JD1A 3V4GA 2ZFWA 2A68F 2Q8KA 5L3CA 1R5GA 2KJBA 2YICA 4LF9O 1D0ZA 3VYRB 2VWKA 2BZTA 4U7OA 1L1FA 5DCMB 3SPCA 1FXKB 2HTJA 2KZGA 4QNHB 4UB6C 3ZHUA 4OIQF 2I10A 1YRNB 5J9PC 1R6NA 2YIBD 4FISA 1XOUA 4FQGA 3DPUA 3OMIB 4NDLA 4GT1A 4GX5A 4NYKA 5BZBA 2EPFA 1ENHA 4P96A 5IOZA 5FB2A 2YEVB 1YTFD 3K7AJ 2HS5A 1L0NH 2Y69C 2CQQA 1M90W 3SR2C 1LUVA 1K34A 1QU3A 1TVKB 3FMSA 1TGOA 3K04A 2VKEA 1PKXA 2BHZA 3QO5A 3E0JB 3LA3A 3PSIA 4LG0B 2LFRA 1H0MA 3QU6A 3KZIC 4HNVA 4DBQA 2PYLA 4BUPA 1QU7A 3G1LA 1YRNA 1IX9A 4YHHO 3S3WA 4E7LA 2EIMB 2ZXJA 3VOEA 1FSHA 2ELKA 1RSOA 1IJWC 3H9JA 1LKXA 4CS2A 1IN8A 2L35A 2DA4A 4MW3A 1F9NA 3OE7G 4CYDA 5CA3A 1SETA 2CTQA 1THZA 1A04A 3CHXA 4UCRA 4YY3B 3KLNA 3OMYA 3J7ZI 2VODA 2HXOA 4XKBA 1M5IA 3RBZA 1STZA 4WFHA 2H1KA 4EJWA 1VQMV 2NAZA 1HLVA 1YS7A 1MNMC 4OPAA 1FXHA 4MTOA 3WODF 4FX0A 4MVMA 1FFTB 4DR7B 1D5NA 2VQFB 2JSPA 5L3FA 4Y3OA 1FBUA 2EINH 4ZYGA 2EIKB 2PJPA 1MOFA 3EHBB 5KAIC 3JALB 1TUEB 4XLHA 2G9WA 1GMGA 4RGXA 2IU0A 1R73A 4Z1MG 1J2XA 4A0ZA 1S5LC 3RYFA 1J7KA 2P81A 1ORQC 4A3DJ 3MKYB 5IDJA 4AQYB 3I54A 5GPCA 1K83J 5KK1A 3B6CA 2ZCEA 2QF7A 1P9QC 4H44B 3HL2A 1XN7A 6PAXA 1NVPB 1RETA 3BDDA 2HLDG 2UUBB 4OGQB 1BL0A 1I94O 4QTRA 2OU2A 3TO7A 4U7DA 3OEHG 4DR2B 4LF5O 2K9QA 4A3KJ 3K0DA 1USSA 1YJ9V 2DQLA 1EF4A 4KFCA 2RVCA 5CYVA 3KYLA 1U5TA 5GTIC 1ZR2A 1P84F 2F43G 2YIAA 3BZKA 4S05A 1N32B 3HJEA 3TP0A 4RBOA 3AKZA 4P9PA 4UCOA 1MW7A 3WG7B 1CGPA 1F4MA 3IC7A 2DN0A 3A0HC 2OCCB 3IGAC 3PUFA 4B48A 4NUBA 3HPGA 3SZPA 3QG5A 4L18B 1YF2A 1UELB 2P4WA 1VI0A 4FE7A 3OYCA 2YUAA 4LG3A 3ASNB 3HRMA 2E1CA 4MGRA 1CEZA 3ASNC 3RPUD 3R65A 2UUAB 2CUZA 2MSYA 1YTYA 5J1UA 3CRCA 1K6YA 4PJ0C 2Z5UA 3GZ6A 1HNXO 3WTWC 2CGOA 4AVPA 3P3NA 1ERDA 3L7WA 4JX4A 2ZR3A 2CTWA 2HYGD 3BCBA 5HDNA 4N0BA 1XI1A 2IM9A 5LOVA 1NK2P 4DV4O 3HC7A 4M3EA 1SZTA 3A0BZ 3TW6A 1UHMA 2DMPA 3HRUA 1W36D 2DJVA 4B8XA 1D5VA 1B06A 1WVRA 2VQLA 2W0FC 2LDUA 1ZRFA 1VQ8I 3AK2A 1XSVA 3WU2Z 1U6GA 4LF7O 1SC5B 2GUZB 3JCZA 4FLXA 2EILC 2FYUH 4XRSA 3TOAA 2QA4V 2D3OW 1R1UA 2JVGA 1T08B 4RLFA 3MFKA 3V8JA 1E3HA 1GM9A 3VQWA 1TW3A 3R60A 1AKHA 1G3SA 3CCYA 1QVFU 2XAHA 3K2ZA 5LEJA 3EXAA 3RFRA 3ZXSA 4RAGA 4HEA2 1JKQC 1Y74B 1BW6A 1ZTRA 3BR5A 3HG9A 2ITDC 1YG2A 1BOBA 4LITA 2K5CA 2V1NA 5CKTA 5E8IA 1VNDA 4P55A 3WHBA 3CMAI 4PSXA 1SRYA 1B04A 4DR4B 3BEHA 1EV7A 4LH7A 3BJ6A 3M7GA 4X1YB 3DLAA 3IAM2 1MZEA 2P6JA 2ZDIC 2ICWG 3U9GA 4LF9B 4LOCA 4BW5A 3I53A 2F93B 4XOPA 2BSKB 3D1NI 1WI9A 1IF1A 1MSWD 1IXCA 5J47A 3T2MA 4ANJA 5J2UA 5M3MJ 3OGIB 1FNNA 2JRIA 1ZG5A 3W7XA 2L5QA 2F66C 5FO5A 1Z77A 2O6GE 4HPQA 5HS8A 3CCEV 2QM3A 5LL6Y 1D2DA 4RUEA 1WAZA 3ZMUA 3E2EA 3KCCA 5FGMA 4ENKA 3A02A 2EFOA 1WGXA 1IDYA 1O3TA 3KIOA 5JVDA 2E19A 5LHGA 1VQ4I 2F2EA 2MFZA 2HGCA 2ISYA 2WAQA 4E4HA 1MD0A 3ZS8C 3CP2A 3BG6A 2YX7A 5CA1B 3FDYA 2ESHA 2X1DA 4I98B 3OMNB 1IBMB 3WGHA 1CF7A 3B8NA 4JPRA 2V1UA 2JEXA 2ZSIB 1RUOA 1YEWA 1ZX3A 2Q7GA 5KUMA 3ASNH 3OS1A 4A0XA 4CC5A 5C8YA 3OS0A 2ZE7A 1BW5A 5B66Z 5IWAO 3DQVC 2PMZA 4TWKA 4CH6A 4MQ9F 3CC7V 4XN3A 4CCMA 1BN5A 4B3RO 5JJJB 2IGOA 5IT3A 2BV6A 5LXTA 2DYRC 5EEGA 4WFAV 4LF8B 1HR0O 5LP6A 1WJDA 3CCRV 2XKOA 4XDJA 5E3OA 4ENMA 4XNFA 3Q9SA 1EFRG 1COWG 4G2KA 5KAIZ 2D2WA 2C6YA 1W7PD 2XAUA 2Q9LA 4BNCA 5IT9N 4O4IB 2L9RA 4PV1B 4PGGA 2A7WA 4B43A 3H92A 2EJRA 2XOKG 3OL3A 4O2BA 4IOAF 5F6FA 3A0RA 4NQWA 1IXBA 3FK6A 2VASA 2NNUA 4B3MB 1KGSA 1MH3A 4FJCC 4QIWN 3Q4HA 1J5EB 5KNLA 4K2EA 1XNQO 3QPTA 2MD5A 1XTAA 2R7OA 3K1NA 2Q0OA 1UG2A 1LFUP 3DEEA 4BDZA 2BTOA 1OCOC 2IA2A 2BYVE 3GCMA 3NEUA 2EBIA 5J1RA 2MYSA 3AAFA 2FF4A 1W0KG 4JGSA 3K58A 1Z6TA 3MHHC 1AI7A 3KEOA 1I5YA 1WQ2A 2R7SA 3AK1A 2ZMEA 1L0LH 1W4MA 2FMYA 3G71I 3APOA 2KL4A 2IGNA 2K02A 3IRRA 1SQBH 3A0HZ 1XILA 1PVEA 2M0CA 4RB2C 5LGTA 3W7WA 1JA8A 1UFIA 2XTAA 1F36A 4GUNA 2EIJH 3U1KA 2R4GA 2KP6A 1MNEA 5KMGB 3BAAA 5A2QN 1JT0A 1JPXA 1NJIW 5LLQA 5BOXA 3WTVC 3F8BA 4E2LA 1WJFA 1M1KW 1N32O 3F21A 2E2HJ 1ZWIC 2HPIA 1P49A 2ME6A 2DYSB 3K4CA 4EJOA 3J81Z 3KP5A 1ZHFA 4PJJA 3U21A 3ABMC 3E22B 4M6YA 5J8CA 1MJ9A 2CH7A 1I6XA 4M3FA 1Y67A 2XF7A 2DYSH 3GBGA 4E7IA 2BXYA 1DGRM 1P7JA 3CCJV 4XKVA 2R9RB 3V7RA 3QODA 2VQGA 2Q6AA 3DWLE 4IPAA 1B4AA 2QYOA 2W6IG 1S72V 1XSXA 1K9MW 4AQYO 4KYWA 4L9VA 4UY8I 2F5CA 5HLGA 3MWMA 1PNMA 1AB3A 3CMEV 1HCRA 1K79A 2K4JA 1IGNA 2FTKA 1WSUA 4JI8B 4BBSJ 2HQAA 2VXDA 1JKRC 2V7FA 3RZDJ 1VTNC 3SPGA 5GAEJ 2OT5A 4IIJB 2VOPA 2F23A 1S6LA 1ZG3A 2XASA 2QDOA 4JX6A 4FLZA 1A35A 4G6QA 2YSUB 1KECA 3ZCCA 3SGIA 1SFUA 2DMUA 2MW2B 1R1TA 5EBMC 4UCVA 1RI7A 5DD8A 1FYLA 3E8HA 3J80N 2CW7A 2LBFA 2FB5A 1E2XA 3C2HA 4EFEA 4RWUA 5CQGA 1VQOI 1R5HA 1GXQA 2W7NA 3STZC 2VE8A 1YIJI 2R7QA 3ABKH 4BHCA 3R6SA 1BI0A 3RJPA 1S9HA 4BE2A 1S72I 4AIJA 3W6JB 4HX8A 5JR3A 4KJZA 3WTZA 4W4KA 4M3GA 3KEYA 2UXBO 3F6VA 1NBMG 1T5EA 2GQQA 3LSHA 3SEZA 1PP8F 2ZM6O 1EJ9A 1H2NA 1HSTA 4FETA 3ETDA 1R71A 1H2MA 2O03A 3CQZJ 2L7ZA 5E8GA 3IJ4A 4H0LB 1FC3A 3ONQA 2A69F 4ZBMA 2NVXJ 3SYAA 3RYHB 2NOJB 4X1IB 4DR1O 2PI5A 2XF5A 2EILH 2JZYA 2KIUA 4ZOLB 1O9HA 4KT6A 1RPRA 2WLMA 1Q7YW 4MO7A 5CVIA 4RO2A 2WV1A 1BJAA 2LF8A 5BNGA 1ZH5A 3W7TA 2CK3G 4TV7A 3OYFA 1XGOA 3V7SA 1HW2A 2Q68A 3STLC 3SYOA 2QWWA 2VB6A 3BR6A 3SXYA 5JVGF 1JKOC 1Z67A 1H9TA 4UB6Z 2D1VA 3F5TA 3OT7A 2UUBO 4JF3A 4DXWA 3GWKC 2LP0A 2VJ5A 4L9JA 3BG7A 2B7EA 3GTPJ 3K5LA 2A06H 2KQRA 2LYCA 4GKKO 5TGTA 5CVRA 3JRHA 2DOAA 2DMTA 4UUTA 2NNYA 1Z5WA 3L75H 3E3VA 2HOEA 4LWSA 5IYZA 3M8AA 1Y56A 2EZHA 3KYCB 3CD6V 3JD2A 1LE8B 1B6AA 2QWOB 2VBXA 4NKGB 1O4XA 3UO2A 1X4OA 1FMWA 2DLLA 1KP3A 3FAVB 2M8GX 2YU3A 1F23A 1YIJV 2BW3B 3ECOA 3OIQA 4BQQA 3ABKC 5B1OA 3F8MA 3CMAV 2Q4PA 1EM1A 5B3SC 4CSWA 2PF4E 3G3ZA 3FB8C 1N77A 4N9IA 2Q2EA 4G12A 2MW8A 1CP9A 4D6TH 3N27A 3SHFA 4YIRX 4II2A 1MJBA 3ZQ7A 3OS2A 3VQYA 2EH3A 2WB1A 1RPOA 1QNTA 2YS9A 1ZL8B 4D7SA 4JI6O 3CUOA 1V55B 3S3MA 1X1DA 1J95A 4IRHA 3QO8A 1AOYA 1VQMI 3H9VA 5FKKA 3QQAA 2W1OA 4P9FA 3MKLA 3U11A 1Y6XA 4HNUA 5C44J 4PDLA 4XLNF 4A3BJ 4FFBA 2DODA 2V6CA 2X4HA 4RAYA 3OYMA 4JZ2A 4BXFA 1XS9A 3HKDA 2DFFA 4IRGA 3IFXA 3R4KA 2N74A 3E5XA 2VJJA 3FMQA 5IPAA 4DW6A 3J7AY 2V9KA 4J42A 3OL4A 4DR3B 3F8CA 3M1CA 4BY1J 4A0YA 4BHPA 2EIMH 3REOA 2QSHX 4X1KB 4X89A 1XCVA 3AG2C 2WLJA 1K6OA 1LNQA 2HEPA 1MABG 4ABMA 5IJ9B 2WAFA 1J75A 1PM9A 3ZEDA 4O4LB 1KQ8A 2HFEC 1Q5OA 4BQAA 5IWAB 4G28B 2Y48A 2DOSA 3GMEA 4B09A 1SEUA 2EFQA 1R6KA 4TOIA 4ASUG 3K79A 3IRQA 1Y76A 4PA7A 2F1MA 1LVAA 3DU5A 1S77D 1NTCA 1A6IA 2DA2A 3B6AA 4DW0A 2Q0OC 1X4TA 1F4NA 1X58A 5KLVH 3SDGA 5GAHJ 2ZD9A 5LGUA 5F1RA 4I2OA 4YJ3A 4Z1VA 2A3QA 4ABZA 3D5SC 4UUSB 2OCEA 3ZMZA 4X88A 4Q48A 2R7RA 2V4JC 5E79C 2CW0F 1ETXA 4GYCB 4QPOA 2KG7B 2V1DA 1GRJA 5EJCA 3EVKA 2ZMEC 3MZYA 3RTRA 2EB7A 4G7HF 2RMKB 2H09A 3UM7A 1SA0A 2F4MB 3E5UA 4G94A 1OCOH 1WHUA 1PJRA 5LP6B 3FKJA 2K85A 2QGNA 1RP3B 1OJLA 4LIUA 4GZRB 3KLOA 1EH7A 2FA5A 5EIBD 1IO2A 3HKZA 1HNZO 3KZZA 4AYBN 3I4MJ 3CCLI 2F6CA 3QAHA 2PUSA 1U9NA 3UQ8A 4MNUA 1SZXA 2YIBA 4DV6O 1M56B 3CLOA 4ZI7B 1Q81W 1SFXA 3HB9A 2PGGA 3BFRA 3CCSI 3ECHA 1E17A 3ZHQA 5EEAA 2W24A 4A6EA 2RNGA 5CVUA 2XB5A 1M4UA 1P4XA 1BBYA 5EDNA 3LAJA 3OWTA 1DK1A 4L8JA 3IL2A 4UCSA 4L5EA 1AI4A 2DYRH 5CA0A 1MSDA 4PD4F 1KP2A 4JI7B 3C2BA 5M5WJ 3OYJA 3FHNA 2A05A 3DKXA 4V2FA 2P6SA 3BTJA 1JJ8C 3CRQA 2UUCO 5M5YJ 1GV5A 4NC7A 2XUBA 1AI5A 3T4ZA 4X6AJ 3F0CA 2Q67A 1VZ0A 1ZQ3P 3H5NA 4NXMB 3ZQQA 4RDUA 3FK7A 2XROA 2K4BA 2KISA 2Q8VA 3F5WC 2YUSA 2RDPA 2ECCA 1Y8QB 2EFPA 2IA0A 2KZVA 3VEPA 4EVIA 3CCMI 2TDXA 5FPRA 3GVAA 5JHFA 4A3CJ 3DPLC 3VQVA 2BSKA 1EN4A 4A3EJ 4XR6A 3W2WA 1SAXA 2GXAA 3BG5A 1J9IA 1X1CA 3VYSB 2Q0AA 3HPHA 3HOVJ 4LH6A 2G38A 1G2HA 1E1QG 3K9SA 4HV6A 1HBXG 5E3LA 5E20A 2NLJC 3VWBA 1G3TA 2Y0SA 3KCXA 2A61A 4Z2YA 5ITZB 4DV2B 2HYJA 3JW4A 4B3SO 2QZ8A 2L01A 4GYGA 2ZJPF 2Z9OA 1KUQA 2ETNA 4ZOLA 5D6EA 2AXTZ 2VE9A 3S1QJ 3HPLC 4X1IA 2VQFO 1WP8A 3RYCA 2EZOA 3RPQA 3CCQV 2LO1A 4C30A 5EGOB 3U10A 2Y69B 4FLUA 3L2RA 2DQ3A 4X20B 4HNAA 1VQ9V 1S7OA 1Z91A 3RQ4A 2A5WA 3DLLF 1O3QA 1N0NA 4XDKA 1RFYA 3PIOF 4TSFG 3QOEA 1SD5A 1A5JA 5J4VA 2ATKC 4OAYA 3ZMVA 4HF2A 2E5LB 3FYIB 1VFCA 1MSEC 4HZ3A 3X2QC 2FJ1A 4YIOA 1HP8A 2LGWA 4UUJC 3MCZA 2LBFB 4RLQA 2RN9A 3I71A 5LRSA 1KYOF 1Q82W 5LRRA 4G7OF 2LOOA 1IXSB 1FPOA 3H1CA 4NB5A 3EETA 1B9NA 3AEIA 3AG3C 5D5PA 1VQPV 3HGGA 2YI9A 1TWCJ 2KKWA 5B1NA 3BP8A 1ZGJA 2W25A 3BWGA 3FXMA 4K35A 2K3FA 3N97A 2NRAC 3KZIZ 4JTCB 2A6HF 2DU9A 4IGGA 1FAFA 1PYVA 3Q9VA 4F6RA 1A31A 3QO7A 3RGBA 1QHGA 3LSJA 5D5WB 1VEWA 5EC1C 3D36C 4MVZA 4ZDOA 2E34A 3BPZA 2M87A 4FK5C 1T95A 4QE7A 5D5XB 3S1RJ 2B1IA 3CJHB 4UFZA 2VT2A 1U5TB 1T38A 4I76A 1CPYA 1OCRC 1K73W 2DTRA 1ZR4A 1I08A 3A4CA 5KAFZ 3BPXA 5D8LB 4D9JA 2HEOA 1PPJH 4B7KA 1I5XA 2GXBA 1OISA 1ZLJA 4X65O 5HS7A 2QKSA 3EUHC 4Q20A 4FMTA 1BT8A 4A5MA 4ZJZA 3P3PA 1X2NA 3W6VA 5LA6B 1U2WA 1BR2A 2W48A 3MAJA 1FOWA 2QKMB 2HJDA 5DUIA 2VC1A 4TUYB 4LLGF 1DUXC 2QTOA 5J2TB 3E35A 1DP3A 1QR9A 3L9FA 4A6DA 2UZKA 1YE9A 2LLKA 2HDDA 2H6BA 1OCZH 1S5LZ 1BE3H 4IL6Z 1DDNA 4V19K 3K06A 2AZ0A 5FLXN 3GTOJ 3CSXA 3DBHB 4JYBA 1HW1A 2K9LA 1N0JA 2EINB 3SJMA 2P4VA 3CD6I 3FB5C 2KT0A 3OM3B 5LMNB 4PCQA 3K2AA 2KKOA 3LUTB 4KICA 3FXQA 1IV8A 1NU1H 1I0HA 4DJAA 4S0HB 5FLXK 2P5VA 2X1CA 1Q6UA 1JUMA 4QIWF 1XGMA 1K33A 4CCOA 3C90A 3ETEA 2F5DA 5FL7G 4NXMO 4CC6A 4M6VA 4CYCB 1TUBB 1NH2D 4N4NB 4EMSA 1N4CA 2M7WA 1RM1C 4BQNA 4NHJA 4AD9A 2NS0A 3CCJI 4GFBA 1G8XA 4RM2A 1F4KA 1BOAA 2E2JJ 4YIPA 3HKEB 2JS3A 4A12A 4O2BB 1SERA 3CTAA 3WTSC 1W0TA 5HVQC 2QWQB 4IO9F 4X0GA 5BPDA 1YOVB 2MLKA 3SZGA 4YFXF 2JEUA 4LNUA 4EKWA 5JWPA 4WF2A 1BQZA 2A07F 2J5PA 2E7XA 3ESWB 5HDKA 1FFXB 3ABUA 4XKCA 2ZBKA 5K7ZA 4ZYHA 4HDUA 3OTFA 2Q7EA 4E7SA 4ESFA 2VJIA 3GTJJ 3CCVI 3VFZA 2O8XA 4JI6B 1G1XB 2CFOA 3LSQA 3OD4A 2HZDA 1NTZH 4J41A 1DPUA 1UFMA 4BJTA 1YZBA 3K5MA 4FX4A 1OV9A 3N2GA 2QVOA 3AL0B 3CWBH 1XNRO 5GTHC 1IZ3A 1YVWA 1KQSU 3K3WA 1YDXA 2WV0A 5FNVB 1IUFA 2RGVA 2W85A 5IOYA 3WTXC 4DRXA 4DYRA 2EIMC 3O2PE 1W0UA 1BJZA 4LGWA 3GFMA 1IAWA 2UXCO 1LUWA 1JGSA 1WPXA 3K4JA 2QTSA 2MLGA 2BOCC 2WA3A 5DN6G 1JMKC 2TCTA 1R58A 5TRDA 2DFEA 2XGDA 3IH4A 1YYVA 4AVZA 1T56A 4MQVA 4BIOA 4LFAO 3KP2A 1EN6A 5IY5C 1R3IC 2OD5A 1R22A 3HBLA 4YFKF 1POGA 2QE7G 3HR0A 3GX4X 2LSOA 2HVSA 1ZSPA 1X59A 3K59A 1ROPA 2IU3A 3GFIA 1XB4A 2P06A 3B09A 5ERIA 3E5QA 3S2HJ 4X62O 5M5XJ 1R7JA 2VBWA 2FQ4A 3GLXA 5LMUB 4O4HA 2MH2A 2AXTC 4LB6B 1EBOA 1VF6C 4JAAA 1OCRH 3JREA 4HAMA 1YFHA 1KMIZ 1ON1A 1GK9A 4F6EA 3CMYA 1LQ1A 2XPUA 2LY1A 1LPQA 5JHUA 3I59B 3HB3B 1OR7C 3JAKB 1Q1HA 3OR7C 4AIKA 2R7UA 5B1AC 1ONVA 2QWPB 5B1AB 1QBJA 5FKLA 1USTA 2L7MP 1TC3C 4YY3O 4L9TA 4UXNA 5K7FA 4R8HA 5HLIA 2BTQA 2RJZA 2HDCA 3F7VC 3DXRB 4MIMA 3OYAA 1GXPA 1XREA 2DJIA 1GN4A 2QENA 4ENNA 2PN6A 4XL9A 2CQKA 3F3XA 3HOTA 3E8GA 5H6QA 2IP2A 1IRZA 2L02A 1XDUA 2PMUA 3K9TA 4QPJA 2AS5F 5FJ8J 4QGPA 1LFBA 4XORA 3BG3A 3IWFA 1BGYH 3LSUA 1D1BA 1NK3P 2V26A 2A79B 1I27A 1MBJA 3ZR8X 4PELA 1QQCA 2LRDA 5BXZA 5C4XJ 3H9QA 3NR7A 3S2DJ 3HKBB 4A5UB 2BHYA 2OUMA 2P90A 2VQEO 4F92B 1NR1A 4G8XA 2Q7HA 3L09A 3M8FA 4WF9V 4RQFA 1KBHA 2MC3A 3VOUA 2X85A 3BA8A 1G6NA 1XHXA 4PI2A 2JQ7A 5DECA 2CV0A 2M7BA 3ASOB 1N33B 3ABTA 2CSOA 2GIVA 2MG4A 1LR1A 2FNAA 1Y4MA 1Z5VA 3PJRA 1QHHD 1Y0NA 3FXJA 5J6XA 3RYRA 3F8NA 5GAGJ 1FOKA 5LEKA 4XLAA 2GM4A 1BI2A 4I55A 3ZRVA 5LMNO 3ZMDA 2VI6A 1Z2GA 4EB6A 2LD5A 5LOVB 4DR2O 3EDPA 1DGWY 4RAIA 3LOCA 3GFLA 3M8EA 1TW2A 3J80Z 1P7BA 1PP9H 2ZXWC 1NHAA 2ZXWB 1Q8IA 2E74B 2WLIB 4BL0B 1FOXA 1NKDA 4DV3O 4KNYA 4EGYA 5CBFA 5CMUA 4J19A 4AI8A 5E1ZB 4CICA 4J00A 3DPTA 5H20A 4AYBA 5C3EJ 1K4TA 3OOUA 1WB8A 3MHSC 4ZHQB 3IKTA 1GN6A 1YITV 1H38A 3BY6A 2R0QC 4MT8A 2KLOA 3L2VA 2BGCA 1JE8A 2M7AA 1EKEA 3RYHA 1J5YA 1BL8A 1PL0A 5CBHA 4DR5O 1JT6A 1R5ID 1IV6A 1O9GA 4OOIA 1IBKB 4FT8A 2E5ZA 1OMIA 2O61A 5DYMA 5JVTA 1JJ6C 2GAUA 5FRMA 2QSAA 4ZC3A 4ZYDA 4IHWA 1R9TJ 1Y6IA 3IKVA 2WSSG 5H9CA 1XHZA 2KRCA 4ZYEA 4TV8B 3LFUA 3F6OA 3GW2A 5AIQA 3TCUA 3E83A 4JYKA 3FB6C 4J7KA 1N78A 3H0DA 3DF8A 4L0ZB 2R7ZJ 2DK8A 3GWZA 3T8RA 1IRGA 2Y4TA 3DEWA 3OAAG 1EA3A 2M4KA 3OSGA 3K0LA 4FM2A 4IHVA 1AILA 1EH6A 3FWEA 2Y9ZA 1NH3A 1B72B 3I55I 2DE0X 3IP4B 4HSTA 1TT5B 1P4WA 3HYIA 5KA6A 2HOAA 2L7KA 2HG5C 3K57A 2EWNA 3W2AA 4BEHA 4E7JA 2DWEC 3T1HO 5IE9A 2O57A 2CV2A 2B1GA 2FMLA 4OMZA 2IS4A 1U8RA 4QPQA 1B8IA 1X19A 2QWNB 5F0HA 4BEHB 2X6BA 4U0WA 1RRJA 4EM1A 2QSFX 4M9SA 4CH3A 1GLNA 1QLEB 3MZ8A 4AIDA 2IJKA 2JGUA 4YIIA 4YJ2A 3ZRXA 3AG4H 3R0AA 2JA2A 2FBIA 2LJ2A 1YXBA 2F48A 2ACJA 1QO0D 2NS8A 2AHQA 5E18F 2K86A 5E3NA 1B72A 1R3KC 3W7SA 2PJRB 3JATB 4DR7O 2P7VB 3CX5F 4BAYA 5LGNA 3AG4B 5JCOA 1DPRA 2HXIA 1GKFA 1IBLB 2R7DA 3JARA 3S1MJ 3E7LA 3QF7A 1FY7A 4WFEA 3E89A 3W2VA 2BOLA 3HKZN 3WU0A 4WCGA 4MEXF 4BJ5C 1AVMA 4A5NA 1FXKC 1OCOB 2OAZA 4D1QA 4XDLA 2AW9A 3C3SA 1D1CA 4Y4RA 4GYIA 4JYAO 4QPKA 3A1YA 2IJLA 4DNCA 5BPIA 2G0EA 2E36A 1GO3F 4LF5B 2B5UA 3KG2A 1I3AA 1UHWA 2HPMA 3GZ5A 2K27A 3S3NA 3NWTA 2JA8J 2WY7Q 4EV0A 1MNGA 2B0LA 4CO8A 1X3ZB 1MG1A 3C3WA 3LSRA 2M8EA 2VC0A 3MMYB 2IJJA 4GGGA 4O3MA 2OA4A 5K1YA 4IHJB 4A93J 2MGQA 1AHDP 3FX7A 2X9DA 3JASB 3H1HH 4LK1F 1K4SA 5DCMA 4X65B 1FBQA 4DK0A 3S32A 2UUCB 3KEQA 3CEIA 4XLFA 3FXLA 1PL4A 1OQYA 1ULYA 4MW8A 5B1BC 1ENVA 3ICXA 4JI3O 1SKVA 4IT5A 1YS6A 2G7HA 2W00A 3CDIA 1H2SB 1HW5A 4NR1A 4O4LA 4LJZF 4DQ2A 1MNDA 1QZEA 1U78A 4I55B 5ICEA 4RM3A 2LQTA 1K5QA 1QZZA 3SFIA 3PQKA 3BOQA 4QWQA 3WGIA 4FTHA 1PP7U 3V42A 2HTSA 1Z7LA 2HQNA 3THOA 1VQ5V 4AIHA 4DV2O 3D36A 4P9OA 4Y7NJ 4C2TA 4XKWA 3HKBA 3GWOA 3K0GA 2FX0A 4B3MO 2A3SA 4PDRA 4RB0A 2WBMA 3RYCB 2R5ZA 2DK5A 2L4MA 2X0LA 3QU3A 1Y66A 1XDSA 1F51A 3L2UA 3SJBC 3D3QA 4D7TA 1Q3EA 3BT9A 3LFKA 3LAPA 1R6TA 3ZN1A 1VQKV 1FP2A 4U88A 3CJQB 3R66A 1V54H 2N8GA 1VQ9I 2ZIOA 4W97A 3T0YA 4AU7A 4X64B 2RAEA 2XGEA 2EA4A 5EG0B 2F95B 2R5YB 1P4RA 2BVLA 2ZC2A 1WCMJ 2NVUB 1KU2A 1MBGA 4G6TB 3LDDA 2W84A 4F91B 2ADQB 3HOUJ 1AJQA 1G4YB 2I8DA 3PM1A 1IN5A 3J80K 2QCOA 2Y9YA 2K3PA 4HV5A 3K03A 2GHYA 2QQBA 1FOYA 2BY1A 2P5LC 4MVRA 3GLLA 4C2MJ 4O4HB 3A0BC 1VQPI 4GKKB 2F4IA 3K4KA 1D0YA 3HIFA 3M4OJ 4DV4B 2CUJA 5CB4B 4QLCU 2CMPA 1D5YA 4GX1A 3SDBA 2KDZA 4OAZA 4I6ZA 2VJ4A 1IBKO 2QKCA 2XAQA 4F3QA 1H2KA 4RB3C 3IWZA 4JQFA 1D1AA 2HNHA 3TJTA 1I94B 5B5EZ 5KX5A 4LF7B 3Q0UA 4IHTA 5F04A 3VQXA 1MA1A 1WLEA 2Q1ZB 5JJNB 4I7ZB 4A3IJ 1OKRA 5FD6A 2X1EA 1FS0G 3HSFA 4PA6A 3QP6A 4ZI7A 1DF5A 2GZWA 2XDVA 1YX5A 4UVBA 2ZFUA 3RKWA 2ISZA 1SAUA 4EQQA 1ZAOA 2ZXHA 4JP0A 1FXVA 2TRTA 2V9PA 1V3FA 2PBIA 2XPVA 2YR2A 1QCEA 1M1EB 2JGDA 1K97A 4QE9A 2QA4I 2Y0MA 4UNOA 3GTGJ 1MJAA 4F4LA 4M3DA 4XONA 5AONA 4JI4O 1HNWO 1SQVH 1RZ4A 5FLVA 5AG2A 2HDWA 3D5LA 3FXOA 3ABKB 1Z0XA 1AROP 1VIBA 2N05A 1TZLA 2LKSA 3OW2U 3K5NA 3CO6C 1LVKA 2CUFA 1YIOA 3LQQA 2K9SA 1O3SA 4LF4O 2J5OA 4B44A 3VODA 5E1WA 3CB2A 5B5EC 3CC2V 2BCCH 4DV5O 1HDJA 2FQ3A 1M57C 4CH7A 3A01A 1J59A 1M57B 1LFPA 3CZ6A 1NI8A 3BJOA 3AFHA 3ZX6A 3PN1A 4MVSA 2FUG2 2VIXA 3CXCU 2M1BA 1W7PA 1M56C 3BTIA 1H9GA 1R4NB 2WAQN 2DPDA 1R00A 3H1LH 3JSNA 1FT9A 5E1XA 4JI1B 1G3WA 1NTKH 1YJNV 3CCVV 2VPLA 5IY5B 4D7NA 3BPVA 4XQFA 2BEOA 3BR0A 1VP7A 1L0OC 2LNBA 5BY1A 1MBFA 2GBOA 3JRGA 4BR6A 1IXRC 1FX7A 3K69A 3NWSA 3KP7A 3CCUI 3K4NA 2R7FA 2WY8Q 1R3JC 4NTXA 1FZPB 4FZ0A 1I5ZA 1YX3A 4GXOA 4ESJA 3CC2I 1SQQH 2UUAO 4TUYA 4K0KB 3F9KA 5KHGA 4J7ZA 2ELJA 4BXXJ 2GOXB 1JGGA 2JA7J 4FFBB 2QKAA 5K5QA 1OCCB 3H36A 3CCSV 4O2AA 1NVPD 1A36A 2FD5A 5JQGB 2LF7A 2HVRA 2GBYA 4Q4ZF 4XLCA 1V5GA 5H2FZ 1MDMA 3GXOA 3WB2A 3ZN0A 4OIRF 1SC7A 4TV8A 3CCLV 4XLPF 3E6CC 4HG2A 3OEEG 2H27A 5JLXA 4O4JA 1KYWA 5GADJ 4DV6B 5F2VO 4HSRA 4BU2A 4E70A 2CQXA 2M2EA 4HZFA 3LSIA 3MN2A 5LFAA 3HOSA 2X6XA 3LSGA 1IDZA 1GM8A 1K4DC 1YW7A 3CCUV 1KQ9A 2WAEA 4FLVA 3E1SA 3HHGA 3CMEI 1TAEA 2DYRB 1V55H 5CPRB 4FCYA 3NARA 3CCMV 2H8WA 2VN2A 4MHGA 3WU1B 1UAAA 2ZMEB 2Z0AA 3I56V 5K7HA 3RYPA 3DGEA 1ZK8A 1WKMA 4BY7J 3RDIA 3M99B 4H33A 1G6UA 4B3TB 2FSWA 3I58A 1RR7A 1OYYA 3QPLA 2BE5F 3CO7C 2QSGX 3J7AO 3OR6C 2XKPA 3JSPA 4WBNA 1SQXH 3EPZA 5JFRA 3PJSK 3JAMN 4JI8O 3LA2A 4OINF 1S3JA 1JOYA 2QWRB 5BR8O 1HKTA 3BQYA 2GTSA 4EATA 3AK3A 4UCTA 2FNPA 4RGRA 1NT2B 1XDCA 3RQIA 1FYJA 5IP7J 1GN2A 3FHZA 4W4LA 5EK0A 1SQGA 4LLNA 2C2AA 4OPHA 3I56I 4NNJA 2HR3A 3COAC 3CYOA 3RKQA 4I4TB 2JWTA 1BHBA 3WE2A 5DV5A 1Q1VA 3BR3A 2WA4A 3HSRA 1IRXA 5IY5H 2XNDG 3I5DA 2LKXA 1LUJB 4UB8Z 1GV2A 1KU9A 4WFFA 1B8IB 2XF6A 4M73A 1GN3A 2CG4A 2LP7A 3ERMA 4IYHA 3MEXA 1B59A 3CLQA 3CRMA 3ZHVA 4EFBA 3OGCC 4LFBO 1MDMB 3CDHA 4PSWA 4M74A 2OIGA 2QM7A 1MMNA 5ITZA 4J7JA 2OWOA 1FXKA 2X51A 3B8MA 4Z6YA 3L74H 4F93B 5FD5A 4IJAA 1VARA 3D8CA 3S3XA 2IBDA 2IGMA 1PNKA 1R1BA 2DW4A 2VPRA 4UV8A 1LDDA 4U3FH 3ABLB 2UXDO 3Q0VA 1X2MA 3CE2A 1LNWA 4IVNA 1AA7A 4MTEA 1N36B 5K5RA 3FFQA 3LSSA 1QVGU 2JS5A 4PI0A 2LG4A 3ABLH 4DUYO 3GF2A 2EV6A 3CC7I 3AG7A 1D5AA 3ZJZA 4DYCA 2O0YA 4N4OB 1XGSA 2VQHA 3AG1C 1JKPC 1QA6A 1YW9A 4XSXF 2QKLB 4P2ZA 2GA1A 2XT9A 1KONA 2MA3A 2NVYJ 3BJAA 3BROA 4ON0A 1YTFB 2XAJA 5FKNA 3IV5A 2JVDA 5BS6A 3HEFA 1BA5A 3WG7H 3JD0A 3GB7C 2L2OA 3O3KA 2GV9A 3RCOA 1DF4A 3L72H 5J4YA 4I4TA 4PA3A 4AC0A 2RREA 1MMDA 1ETYA 2DFHA 3RZOJ 3E97A 2BY0A 2DMNA 4HLXA 4S04A 1FIPA 2UXDB 1R49A 4I0AA 5TISC 3VYTB 5H6RA 3L70H 5FFZA 2CQNA 3JTHA 3K4BA 4ITVA 2JPCA 1MIJA 1BIBA 1WJCA 2ESNA 3B73A 1AKHB 5HFLA 3X2QB 2L4AA 2P6TA 2HJFC 3DU6A 3OV8A 4I0XA 1SQFA 5LMUO 4IOCF 4EB6B 1XMOB 2E71A 3JSLA 2H6CA 1ITYA 2FOKA 2V9VA 1ZLKA 4DK1A 3TQNA 1K8AW 5HLTA 2ZT9B 2AZ2A 1RKWA 2HYFA 4JI1O 1TQIA 1ETKA 4XN0A 5DS9A 1JHHA 1D8KA 2L0KA 1IN7A 3NQOA 1KZHA 2ZJRF 1HWYA 3ML0A 1H8EG 1V5EA 2EA2A 4CH5A 2BVMA 2WB1N 1K4CC 2UXNA 3QWLA 3KETA 1AP6A 1PNLA 2KB1A 3DKYA 3GTLJ 3TETA 4KMFA 1T0FC 2BOBC 4WX9A 4YHHB 1M9NA 5DEQA 1X3WB 5DUKA 1URFA 4KXRA 2RN7A 1SFOJ 1IDSA 2DYSC 5CBGA 3W7UA 2ZB9A 5KX5B 1X4PA 2VT3A 3L2QA 4BIZA 5B3SH 3H0GJ 1PUFA 3JD3A 1TL8A 1YHQV 5KAFC 4LF6B 2IBZH 2XC7A 1E3OC 1HF0A 4PHZA 3VPRA 4C7UA 3QVNA 4PFOA 5C4JJ 5KHIA 2UXBB 4RB1A 2JA6J 3HM5A 1OR7A 2DCEA 5EZYA 1WH7A 3OYKA 3S17J 2BY2A 3T4DA 1SS3A 2EIJC 5EYRA 4Y13A 5DD4A 1AJNA 1TNTA 2EIJB 3MDSA 1U96A 3WG7C 2JPBA 3ASOH 2YI8A 2CO5A 3I0TA 1SFEA 4NXNB 2EINC 5J3LA 1U5TC 2Z3YA 1JVMA 2P67A 5FPOA 5F0FA 1XPXA 1VQ5I 1D8JA 1KQ0A 3CCEI 1QPIA 4MTGA 1VQ6V 2M3AA 4CZZA 3ABMH 1MMSA 5EG0A 2JN6A 2CTRA 2FRHA 3EFFK 4GO1A 3DV8A 2OTJV 3BZCA 2LMDA 4GLXA 1V55C 1OYIA 4IXAA 4YFNF 3ABMB 3HXLA 3Q0WA 3DKWA 4C3HJ 2XSJC 1MMGA 2KPMA 2JTVA 5IYCJ 1O57A 2BTQB 3TXSA 4J01A 3S93A 5J1YA 2ZR2A 1BR4A 3LNQA 3HRTA 1QBZA 1Y8RB 4KN4X 2DA7A 2DAOA 3LMMA 5EZHA 2Q73A 3K5OA 4DRXB 4X66B 2ELHA 2Y75A 2N04A 4BGDA 5GP9A 3B40A 2IH3C 2B63J 3OOPA 4DR1B 2Y30A 3MKZA 1LE8A 2Y0PA 3KKYA 3OR2C 5IYZB 3EUAA 3ML6A 2EZKA 3WU2C 3G4SV 3L2WA 2OCCC 2R72A 4ZDLA 4P1WA 1LDKB 2M30A 4BDYA 2KIQA 1SMTA 1ZARA 2YPRA 2P5KA 1LB2A 3AL0C 4UB8C 3K9AA 4MSWC 4JI0O 3SYPA 2L9NA 1VF7A 3ETGA 2X7RB 3PIPF 4Y15A 4JI7O 4JI5B 1RSOB 4A3LJ 4I9WA 1RM1B 3RSNA 4MLOA 1Z05A 1SD7A 3KYDB 5F08A 1N34O 3V8LA 3A8TA 1LJ9A 5IYDO 2PJRA 3JATA 2ZJ2A 1KKCA 3JSOA 3NRVA 3MKWB 2E35A 5ILVA 3VBBA 4LG0A 2VRZA 1VQ8V 4NVPA 5KHHA 4AUXA 2MBFA 2KJCA 3ZOBA 5EF6A 2QGUA 2ZXIA 1ETWA 2E5NA 4IQ4A 2A9HA 3OMAB 3D3IA 4YJ2B 4WFBV 3FD9A 4X20A 4PDVA 3N2GB 3F23A 1WZ2A 4KT5C 3E8FA 1XMKA 4HQEA 1V4RA 5CVVA 3OYGA 2XV4S 2EILB 4MS2A 1LDJA 5H5NA 1GTOA 4GKJO 2Y2ZA 3TOBA 4BE0A 2K9PA 2KSDA 1RPWA 2A6EF 2Z2SB 2EIKC 3DC6A 5CB4A 1RC9A 2YSRA 3I3LA 3DFGA 3DTEA 1O7LA 3EYIA 5HODA 5GTIZ 3G71V 1Z6RA 2M0MA 4DUYB 4L5JA 3KZYA 2IGKA 4LBEC 3UKMA 5IJ9A 1IBLO 2PFBA 4UVAA 2ZDIA 1S7AA 3HOYJ 2R9AA 3ETQA 3T1YO 4OX9B 2WLLA 4R7CA 1A6QA 4AILC 3D0SA 1XG1A 4JTDB 5K1XA 2KRFA 3MQ0A 4JYYA 4IIJA 4PDMA 1W59A 2AQEA 4CYCA 3SPIA 4FLYA 1Y39A 2PQ8A 3N4MA 4CCKA 4CXFA 1UJ8A 3H1JH 5D4SA 2RV8A 2HHHO 4I9QA 4LLLA 1TNSA 5J40A 3C7JA 4CGZA 2ZCWA 4EM2A 1T6SA 3K6GA 4LK0F 5FLMJ 1YI2I 1HNXB 4E7ZA 2R7VA 4TV9B 4HYOA 1WH5A 5HLHA 1JQ0A 1AR1B 3JRDA 4GDFA 1VQ4V 2P0WA 3H5RA 4M71A 3ZPLA 4WXDA 4DYLA 4DV7B 2PEXA 2E75B 2COMA 3O65A 3DCFA 2KDOA 1WPKA 4WCEV 1HNZB 2XB0X 2ZE8A 3SJCC 2X48A 3BR2A 3O6BB 3E22A 2E60A 4FVMA 1Z1DA 5K1PA 3TBIA 3JRIA 2JJ2G 1LEAA 3VYUB 1R6RA 2QBYA 2IH1C 5CVJA 2DMQA 2NS7A 1W36C 2ARHA 1FEXA 4M72A 5EBLC 1VQ7V 3P9KA 5FKOA 4LF4B 3ASOC 4DR4O 1MH4A 1HKQA 2EFNA 3ZQHA 4E6KG 2HQ5A 3C18A 1K78B 2AHYA 1L8DA 5FRNA 3OUSA 4GX0A 5GONB 3OYIA 3JASA 3VSLA 3CUQC 4WBNB 5L3BA 4LF6O 3ISPA 3JALA 3QTCA 4UVCA 4E7HA 3K08A 4XLEA 2ZE6A 1FTZA 2VKVA 5E17F 2LGQA 4BHBA 1IN6A 5LD2C 4L0YB 4YEJA 2F5FA 2VLAA 2WLHA 3BA9A 1MZFA 5F64A 4BXUA 2D45A 5EGOA 3HRSA 2HKOA 4J10A 2STTA 5HS9A 2IS6A 1VQNV 2WWWA 2ZNIA 4CCLA 1N75A 2GXGA 1EZVH 4FM1A 4Y17A 3UT5B 4BIUA 1OCPA 3Q5FA 3G2BA 3TGUH 5A2QZ 5HNFA 1S0VA 4H13B 2CGNA 3IAYA 1JCHA 4O2AB 2MK3A 3Q4HB 3NXSA 3JARB 4K0KO 1I6HJ 2JRMA 1HOMA 1PD3A 3I4NJ 3HOXJ 4RUFA 5DTDA 5EC2C 3DBLB 1JHFA 1N33O 3ZQFA 5ILSA 2GLOA 1ZAUA 5HFMA 4YG2F 1ETOA 3ZHSA 4JI2B 1BIAA 3ZBHA 1BCCH 1K7AA 4B3RB 2FEZA 3TW7A 1YJWI 3G80A 4X1KA 2KFDA 2MC4A 4JASA 1T39A 4DV0B 2L3DA 2COBA 4JAUA 4F52A 1HR0B 1I1SA 3TK1A 1X1AA 4KDPA 5HDGA 2YEVA 2EZIA 2A6TA 4TQDA 2PYJA 2DFIA 4HQMA 5KHDA 3GTQJ 4GX2A 4TV9A 1H88C 4PZJA 4ZYAA 2UUZA 4LFUA 2OPTA 1I50J 4ZZDA 3ZP5A 1CQTA 1UPGA 5F0CA 5FKMA 4XRMA 2IRFG 4J80A 2OTLV 1AJPA 5KUKA 4XRFA 2K40A 4C9YA 2P7TC 3CRAA 1NZ6A 1Q6HA 3WTTC 2YXYA 2B9SA 3PL8A 3DXRA 2P5OA 2XRNA 2DWDC 3TDZC 2Z33A 1TA8A 2HQRA 3KPHA 4LMYA 3ROUA 1XMQO 2XGCA 5ICFA 4XIDA 1JI8A 2ZNJA 1BQ0A 4K3AA 3JAKA 1JTXA 1P6RA 1R1VA 1UZCA 2X6OA 3A01B 4KA4A 2DPUA 2LY9A 3K4MA 3RKXA 3S16J 2RDCA 2W6JG 3MD0A 3EYYA 4U7BA 1DU6A 4LP8A 2LFBA 1OYWA 3OYHA 1Z3XA 2ZNYA 4JI5O 2DQRA 2A0LA 2UXCB 5F27A 3OFNG 3ZRWB 3TDUC 3ULQB 1NG7A 3GUDA 4CDGA 3WTYC 3RVYA 3TXQA 5JJEB 1H8HG 1FJGB 3P7NA 5J2UB 1GAXA 4KUMA 5CA0B 5DCFA 2JGDB 1W1WE 1QR8A 3L73H 2JUCA 3DBRB 4CCNA 4DYQA 3KE2A 4IRIA 2IAIA 2RKHA 1BZKA 1Q6IA 4I0XB 1SF9A 4X1YA 3K1MA 2XIGA 1U8BA 1C0WA 5H2FC 4B4CA 1GUUA 4X66O 1U3EM 4ZHQA 1CXZB 1V54B 3M7MX 1VQ6I 5JI6A 1V54C 3BVOA 1QVTA 2XAFA 4LF8O 1G8MA 2WLIA 4FASD 1TWFJ 1WJAA 2DA6A 3DTKA 5EZGA 1AU7A 4PJLA 1B9MA 2VUMJ 2YXLA 3L00A 4AM3A 2EIKH 4BWAA 4FIPC 3UCSC 2QQAA 1WI3A 4CA0A 2YC0A 3KP6A 4I0BA 4UHTA 2HVKC 1E3PA 2KHMA 4B3AA 1SVLA 1X1PA 4CZCA 4HA8A 4BYYA 3JAWB 5LYJB 1FYMA 4DV1O 5CLSA 1H8AC 2W0XA 1PUEE 2EZLA 2M9HA 4DZPA 4NXNO 1IUYA 2OJED 5KHKA 2CUEA 1QZYA 2ZNZA 5IP9J 3CXHF 3HZJA 4BS9A 4LNUB 3MAQA 4KISA 4A2UA 3LQRA 2BE3A 4FFKA 1BR1A 4ESBA 3CP8A 4I7HA 3BC8A 2FU4A 4UUSA 1OCTC 1HW7A 2DA5A 4G6DA 2VQEB 2RC4A 2DO7A 3FXKA 2DOEA 2M5WA 4O6JA 5B1BH 3W6KB 1WA8A 4O5VA 2VBZA 2EZPA 2Y0IA 4GCZA 3M07A 2CW8A 4J9YB 3PFYA 1TUBA 3S1NJ 3F8FA 4J9ZB 2X6YA 2XSDC 4N9HA 5B1BB 2PMHA 1J0RA 1OFCX 3A03A 2HZTA 4YIFA 4PJ0Z 3HTUA 2JJ7A 4WXHA 3QRFF 2OCCH 4LB5A 1U0JA 3U2RA 1Y1VJ 5DM6V 2QEXI 4NTYA 2JA5J 4B08A 3ZMSA 1TQPA 4FE4A 5M3FJ 2M6YA 4XICA 3KCYA 3LDCA 2VXZA 1JR9A 5KHJA 3PSFA 3CJHA 2DA1A 5KCMA 1ZRDA 2W4SA 3LA7A 1HDDC 2YS8A 2HFHA 2DXIA 2PG4A 2B9ZA 1MBEA 3RN4A 3BZ6A 4BW9A 2JSCA 3J7YJ 1N34B 3F22A 3I5UA 5IT9Z 1MSFC 3T1CA 1AI6A 1IW7F 2E2IJ 1TT0A 4ZH4F 1AR4A 3DTIA 3LSMA 3H3VK 3X2QH 1WJZA 1W5TA 2ZO4A 3LSTA 3L2CA 4H37A 4JAVA 4R8CA 3H9GA 1BS3A 3E86A 3KX2A 3E6BA 1YJNI 3O9OA 4R50A 4DUZO 2ID6A 4DO2A 2PY5A 1H2GA 3ZQIA 2Q5ZA 1XCBA 2LR8A 4U0VA 1UB9A 2DQ0A 1ZGAA 3ZHRA 5IT9K 4QJFB 3GZNB 4MVQA 3RYFB 2NR5A 1YCIA 3RKYA 4TT3G 2YXHA 1WB7A 2LW1A 1XEQA 4HX7A 3DXJF 1T8IA 1XSDA 2ZKOA 4CS4A 2Q2EB 4DV7O 4EJVA 3CC4I 4RS8A 2Y69H 5FNVA 2ZKZA 3CMMA 1MBKA 2V4DA 5DEDA 1Q86W 2CH0A 5D5UB 3DC5A 1D3YA 4BACA 4I02A 2AHZA 4EGZA 2K9MA 1BSMA 3OTOO 2E1OA 4JI2O 5FLXZ 3FAVA 2STWA 1XNRB 2RQQA 4NC8A 2DDBA 5L3EA 1YQAA 4HOBA 4HX4A 4CBCA 4YELA 1FJGO 1SD6A 1K78A 1AP5A 4KIGA 2VKHA 4ENJA 1JTYA 3T1HB 3PQJA 4LIVA 3BCAA 4HDVA 1OLTA 1US6A 2GTAA 3H1KH 2L9SA 4O4JB 2HHHB 1RKTA 1IRFA 3VSKA 1VF5B 1T0FA 1F43A 1WRJA 3JAMK 4XOTA 4C3JJ 2LVSA 3PNVA 1VQ7I 1FTTA 3M9AA 4HNTA 2R7WA 1OHHG 2HVJC 5BQTA 1T2KA 2FOWA 5JQGA 3J81N 1APLC 1QLNA 3FMRA 1JX9A 2ADUA 1P2FA 2FXAA 5HOOA 4FHTA 2R7TA 5IYBJ 1DGSA 4JX5A 3B2EE 2ZM6B 2ADPA 3CJTB 4JZGA 4II3A 2QUFA 2JMWA 2NVQJ 2IVMA 1REPC 3P30A 3FF5A 4ETSA 1YLFA 1TVKA 3G73A 1XL6A 4JOMA 4MFDA 2ZIMA 5DDGA 5L3DA 1S5HC 3OYDA 1VF9A 2DDAA 3CJNA 3B02A 1E0EA 4KFMA 2VBYA 1X1BA 2O7OA 1BI3A 1Z21A 5CQEA 3TKYA 1SESA 3JCUZ 4JK1X 3TEDA 3LNNA 2E7WA 2ECBA 1IZ1A 1NS1A 4OU0A 4IZZA 3S3OA 3GTMJ 3RWRD 1I7FA 3CC4V 2PI4A 3F7YC 5J2TA 3SJAC 1IG7A 1HDPA 1OPCA 2JIZG 1WPBA 4U0YA 3UO3A 1KKDA 2BY3A 2YU9J 2K1EA 1TP4A 3K70D 4CH4A 2G7UA 1V9PA 2EV0A 4KP4A 2UU9B 5LA6A 2E1MB 2NOGA 2CH7B 1KYZA 2DBBA 2EQRA 4ZDPA 5K5OA 1YJWV 1QGPA 2OYQA 4PJMA 3OYBA 4JI0B 4R6ZA 2W82A 1FP1D 4FPPA 1MMAA 4JI3B 3QYFA 1JUSA 5JH7A 4KL1A 4L5IA 2Z1DA 4W1UA 1RNLA 2I5UA 3AG1H 4L87A 2DMXA 4ZIBA 4X8AA 5BMVB 2AGAA 2LREA 5CJ9A 3B77A 2FBHA 2P4KA 1VQOV 1S29A 1J5EO 1XNQB 2ITCC 2MABA 4Z2WA 2IS1A 2VL8A 3LNMB 4DV5B 4U3JB 1RR8C 4KHPB 5B1AH 4MTFA 4J11A 4IEJA 4PFPA 4KIBA 3WB1A 4BKXA 2AQFA 4BH9A 4IHSA 4A69C 4EJUA 2EX3A 2WWYA 4MVUA 4I50A 3OIOA 3Q3SA 4DIQA 2DTZA 2Y4UA 1KA8A 1BHAA 3IH3A 3BTCA 3GFJA 1FIAA 5ILUA 3JRCA 2DT6A 3ZQLA 1OCCC 4JV5O 4RMNA 1ZRCA 5KVRA 4PA4A 3CESA 2OTLI 2DA3A 3RIRA 2GWRA 1G4DA 1FD9A 2GA2A 1P4AA 2OF7A 2E3CA 5KA5A 3HOWJ 2HKXA 4HF0A 2JUGA 1XGNA 2H1LA 2NXNB 3SQNA 3RI4A 3IUOA 3LWFA 4X64O 1IN4A 5EEHA 1WFXA 4NQWB 3ZQCA 4PA9A 4YRVA 3GVMA 1JUPA 1T33A 3ZRGA 1OCCH 1GH6A 2CAZC 2L54A 4XBFA 4BQOA 4G7ZF 3DTUB 1N25A 1WJ5A 4RAFA 4IHXA 2RCVA 3I9V2 4HBLA 1TWHJ 2EV5A 3BR1A 3E6DA 3FIWA 1Z3YA 4MFEA 3M3YJ 1G3YA 3TGNA 1K7DA 3FX3A 2KG7A 4I5SA 2UXXA 4HNAB 2LW7A 3PFIA 1XL4A 3SPHA 3G6EV 4YXWG 5LP6C 2V79A 3SYCA 2EFWA 4GCVA 2JRTA 2M4GA 3BHPA 1QPMA 2HOTA 1NG6A 2H94A 3R61A 4X9QA 4JYCA 3UR3C 2WLKA 1B6QA 3IH2A 2VWJA 4CS3A 2L6LA 2AXLA 2K7LA 1SVMA 1IVSA 2XRLA 4D7MA 1HXDA 3AG3B 4Q6GA 2XHBA 4Y52J 1ZTEA 1DQUA 5CN0A 4IQJA 4JYAB 2OZUA 2YDEA 3VB2A 1CF7B 2BBYA 2DN9A 5E1AC 4PJNA 1UCRA 2RQ6A 3J81K 2F5VA 4D5FA 3B4SA 4O4IA 3S2WA 3I55V 4V2GA 3T5XA 5IJ0A 4D0PA 4AWXB 1FPQA 4F7ZA 4MEYF 4PDKA 5LHHA 2IJIA 3ZRSA 3I59A 1SANA 1VQNI 4G9YA 4PGHA 1VQLI 3AG1B 2CWEA 3DP7A 4K8ZA 3HHHA 5B66C 5ICGA 1JJ2U 2E76B 5LXTB 2CJJA 4Q47A 3ZGKA 1QLEC 1DTOA 2ETHA 4DR6B 3JRAA 1JFFA 1TTYA 1OCRB 1OCZB 4IYIA 9ANTA 2O9LA 1OCZC 2CUGA 3UNGC 3JRBA 1XMAA 2GIZA 4KN7X 3CCRI 1I1GA 4DZJA 3MZHA 2R93J 1VMGA 2JDIG 3P32A 4TQFA 3F72A 3H3UA 4I01A 5DM6F 1W7PB 2O3FA 4XRSG 3I4PA 3T8TA 2XVCA 4OIPF 1GHCA 5JLWA 1ZKGA 3ELKA 4EJTA 1E79G 1WN7A 4C2UA 1XBLA 2GSMB 1WJBA 4BJ6C 4BE1A 3JCUC 3P9CA 1PV0A 4IHJA 1SVOA 3V8KA 1JFFB 2BW3A 4L9NA 4BBRJ 5LHIA 1Z7UA 4RGUA 1W5CC 2E1NA 5A2QK 2CE4A 2IW5A 1YHQI 1NTMH 3JD4A 5EYPB 4LFCO 2XAGA 1ON2A 1W2BU 2K9NA 3KFWX 3OR1C 2X6CA 3BG9A 4CHUA 1KU3A 1P92A 3TO6A 1FFXA 4ASNA 2LH9A 1FBSA 3SFZA 4OWRB 2JJ1G 4I99C 3VDXA 3ZQGA 2GUZA 5EBWC 1AWCA 3RYIB 1MMMA 2O5RA 3T1YB 4MTXA 4OX9O 3J7AU 3HKEA 2H3OA 2Z16A 1IC8A 3U1DA 1HNWB 2X6AA 3S14J 2CGPA 3A2KA 2PTMA 1ZG1A 3CRRA 3N2KB 2D2CB 2WAMA 4YJ3B 1YW8A 2H8PC 2OC6A 1YJ9I 3IC9A 2JK3A 1RIOH 1QNMA 3K4LA 3FKSG 3EQLF 3FM3A 4B7EA 2D1HA 5F1JA 1K92A 2A5YB 2QQ8A 3U0ZA 3HTSB 4OMYA 3UT5A 2FE3A 2IA1A 2ZXWH 2P7CB 1ACIA 4DW1A 3AG3H 2FKXA 3BLYA 5C93A 3BRCA 3ZIAG 2CS3A 3PO3J 3I64A 4IX7A 2E5LO 4LFAB 2UU9O 2VS0A 1QQIA 1BC7C 3FBNB 3G4SI 1TBXA 4OXSA 3LSKA 3HOZJ 1QHTA 1S5JA 1YSCA 3P5JA 2QM4A 2VKDA 3NAUA 3JYCA 2P8TA 3ZCOA 2P22C 2CFXA 3C1DA 2OQGA 1R36A 1A32A 4Q5SF 1ZN2A 3HDDA 2F4OB 1UHSA 2DI3A 2WTEA 2OIEA 4CCJA 1GVJA 5GONA 3WGGA 4ICGA 1S8NA 1WWXA 3H5AA 4IF4A 4M6XA 1G59A 5J8FA 4MVOA 1DU0A 5IYDJ 1P7GA 4EEFG 3OYNA 2YX4A 4HRIA 1Z9CA 3E6MA 4XMYA 4B3TO 4B3SB 4RGSA 2Y0SN 3HUGA 3TMOA 3MD2A 1U97A 3DEUA 2R5YA 4FLTA 3FZVA 3HKCB 1W0JG 4U7NA 1YO5C 4LR3A 2ZSHB 4QSHA 2QBYB 2CDYA 2F5EA 1SMYF 2HOSA 1ZL8A 2R3SA 1GDTA 4FZ1A 4AHCA 2IJHA 3O8GA 5BR8B 1SFKA 2HU9A 2EBOA 2FL4A 4P5OA 3QNEA 4LD5A 5IP6A 1W5SA 4FM0A 3CF5F 3QPHA 4U3JA 4P9UA 1JJOA 1DP7P 3CF2A 1QRYA 2L9VA 2OV7A 2R70A 3M1EA 1Y0UA 4F55A 3FYEB 2VOOA 4F6RB 1I39A 5B3SB 2KRHA 1NH2B 1OJHA 2CQ7A 2O8KA 4GKJB 1MBHA 3PNYA 4XK4A 5TJJA 1R3LC 2YIDA 2XHKA 3HKCA 3SYQA 2WPDG 1K5SA 4R79A 3GEZA 4HBNA 3APQA 2M45A 5EZYB 1NR7A 3H3ZA 5IYCO 2AO9A 4LC1A 2ME0A 3KP3A 4PK4A 4DGWB 1ZGWA 1EZJA 1OZ0A 3HUGB 3QP5A 3G6BA 2JK5C 1RESA 1LEBA 2WLLB 1P7IA 3BABA 1ETQA 2LFSA 3SEQA 3SYTA 3FISA 3D5RC
chains in the Genus database with same CATH topology
1TLHB 1BI1A 1B1BA 2UWMA 5ICCA 1JXSA 1FWZA 2F4VB 5FFXA 1M93A 4I09A 3DSQA 3KP4A 3JTGA 2OQRA 2DT5A 4KIFA 1X3UA 2OBPA 3JAWA 5LYJA 1XD7A 4XSZF 2VONA 2FBKA 4DV1B 1XMQB 5D8KB 3N2KA 5JCOC 3R0JA 2EK5A 5BMZA 1ODDA 4EM0B 4LFBB 2JT1A 3FXRA 5ED4A 2PLYA 3RYIA 2Z99A 1TQMA 4HLYA 2QJ1A 2KIMA 5D6FA 3WG9A 1ZREA 4LFCB 4KMUX 2XGXA 5EYPA 4R1HA 4UCUA 3ERED 5C8YB 1HKSA 3OTOB 3SZTA 3WTUC 1FSEA 3IHUA 3EUHA 5AIPA 2W57A 1R23A 2PZSA 5EIBC 4HYEA 1WNSA 3TO9A 2IPQX 4HW0A 3RPUA 3K1PA 4X62B 5KMGA 5D5QA 3A2FA 3GYHX 2QQ9A 3CUQB 4M9ZA 3GO5A 3ZMTA 2QLZA 1PDNC 2ZINA 4WWCA 1SA0B 1MKMA 4MTDA 3FM5A 5IJ0B 4OIOF 1KU7A 3V7CA 1MGTA 1SD4A 4JI4B 1O3RA 1L3LA 2IT0A 1EH8A 4EEQA 3WB0A 4DR5B 2NYXA 4WK8F 1F5TA 3WE3A 5D5VB 5LBQA 3QOPA 1BM9A 4JBAA 3T1BA 2LKPA 5L3GA 2CYYA 2KIFA 4WXCA 2RNJA 1XQ8A 1T98A 1MZBA 5CA1A