4FZ0A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low ph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
405
structure length
405
Chain Sequence
CFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acid-sensing ion channel 1
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
total genus 108
structure length 405
sequence length 405
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz0A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz0A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz0A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz0A02
4NTXA 3S3WA 2L35A 4FZ1A 4NTYA 2FB5A 3IJ4A 4FZ0A 4NTWA 4NYKA 1WP7A 3S3XA 2QTSA 1WP8A 3N27A
chains in the Genus database with same CATH superfamily
2ITDC 3UQ8A 1Q7YW 4QJFB 1FPOA 1KP2A 5IY5C 4DV4B 3D3IA 3AK1A 3ABLC 3ZHTA 5KHKA 3CCLV 3JD4A 4YJ3B 1JJOA 4DR6B 1XMOB 5JJJB 4QE7A 3FB7C 1MABG 3CRAA 3TK1A 3L74H 3FB6C 1VEWA 2RDCA 2QEXV 1E1RG 1SERA 5EYPB 3UO2A 2XAHA 3G67A 1QR9A 1VQOV 2A9HA 3OUFA 1ZAUA 1SQVH 4MW8A 5IDJA 3CJHA 4DUYO 3ICXA 3T1HB 4BIZA 4OPHA 5IWAO 3L73H 3A8TA 3KCYA 5EK0A 3ZHSA 5JJEB 2CTRA 2JRIA 4TOIA 1GKFA 3LDCA 1PKXA 2OCCB 3ZBHA 1R73A 4JI7O 4K3AA 3CCJV 3OFNG 2Q7EA 1SQQH 2DYRC 2XNDG 1Q81W 1TUBA 4O4IA 3SPJA 3Q4HB 3ABTA 4TV8A 2KB1A 3HB3B 4DK1A 4AQYO 2RCVA 1URFA 2Y0IA 2D3OW 4DV2O 1F7YA 2HHHB 1SQFA 4JI3B 3OW2U 1N36O 5GW7A 5CBGA 4X88A 2YXLA 3JAKA 1CPYA 2PY5A 1WB7A 4HBNA 3KG2A 4JYAB 1EZVH 2VS0A 5KX5B 1Y4MA 5LGNA 3T1CA 2YS8A 1KECA 1K4DC 1NT2B 1WPBA 4X66B 1YTFB 4EB6A 1HR0O 4JYYA 5JVDB 1GM7A 1J5EB 3APQA 3OEEG 2OT5A 2RMKB 4CBCA 2LQTA 3CRQA 4UVCA 3ZS8C 1R3KC 1VQ8V 3QG5A 1VF7A 4PHZA 3N2GA 2EINB 2ZIMA 1N33O 4GKKB 2HVKC 1KQSU 3OE7G 3CSXA 2W6IG 1XL4A 1M4UA 4NR1A 3JAWA 2DE0X 2QE7G 4CS3A 1JPXA 3CCUV 3SYAA 5LMUB 5LXTA 2WLLB 3QO8A 1MZEA 4U7NA 1OZ0A 2ADQB 1UFIA 4B7EA 1PP9H 2OCCC 5FL7G 3VBBA 1JA8A 3BAAA 3THOA 3H1LH 1YHQV 4U3JA 5KHGA 2ETNA 2FMLA 1H8HG 3O9OA 1VQ5V 1OCOC 3J80N 5KHJA 1G4YB 3CJHB 3DSQA 4LR3A 4LWSB 2Q68A 1KUQA 2A06H 3RT3C 5KHHA 4MSWC 4UCTA 2EIJB 1OV9A 1HNWO 2AXTZ 1XI1A 3E35A 1Y74A 2BTOA 3K04A 1OCZB 1YCIA 1SZTA 3E89A 3BVOA 3M8AA 1AR5A 3IAYA 4ASUG 4FLZA 2VWKA 5EZYA 4U3FH 1K33A 1WLEA 1GK9A 1Z2GA 1HWYA 2Q5ZA 1B6QA 4K0KB 3OUSA 4O4IB 3PN1A 4N23A 1LUWA 4CC5A 1I5YA 1KMIZ 3E22A 3SPHA 4B3TB 1H2LA 5E79Z 4G28B 1TA8A 2GUZA 1Q6IA 1SKVA 4JTCB 1NKDA 3JAKB 4KHPO 3B8NA 1QLNA 3RN4A 5BZBA 2EIKC 2HLDG 1I0HA 2EIMB 5IYCO 1H2SB 2EINC 2K1EA 2YIDA 1VQNV 1AI4A 5B1OA 4NVPA 2HP8A 4W4KA 5IYZB 2V4DA 1VIBA 3ASOB 3G4SV 3P3PA 5FLXN 1YSCA 3RYFB 4KL1A 4BWAA 4LH6A 4Z2WA 2CGNA 4DV1O 2XAJA 4JYBA 3SGIA 2XUMA 2XAQA 5LHHA 3BABA 1H2KA 5HFLA 2Q69A 2QGNA 3N2GB 1DGSA 5FNVA 2F4VB 4PDVA 3LNNA 1XHXA 1KD1W 3KCXA 3H1HH 3RBZA 2QKCA 4DK0A 2IU3A 2QWNB 5GONA 2DYSB 3ZN1A 3JAWB 2WLMA 4BW5A 2EULA 4LBEC 5LXTB 1WB8A 2EIJC 1NU1H 4XDKA 4KUMA 5BMVA 3K5LA 1OCZC 4L87A 1SESA 3D36A 5LMNO 4YXWG 5LL6Y 3SPIA 2CDYA 3JSLA 5CBFA 3T4ZA 1QNMA 2D2CB 4O4JA 4PI0A 4E2LA 4YIOA 1K3EA 2AHYA 3OMNB 1XNQB 2O57A 3OMAB 2UU9B 2ZE6A 4MS2A 1RSOA 3EXAA 1DF4A 2VWJA 1GM9A 5EBWC 1HNXO 1DTOA 2GTAA 1Q5OA 3RWRD 1XREA 2X6CA 4DV7B 4YHHO 2YXHA 4AQYB 4JTAB 1BMFG 4ZI7A 5EZYB 3JAMN 2EIMC 4DV2B 4P9PA 4QGPA 1PL4A 3ZMZA 4C7UA 4CH4A 2M7WA 1VQ7V 2JVDA 1IVSA 4RQFA 4RWUA 1ZL8A 1WPXA 1R6NA 3AG1C 1N36B 2UXBO 2JGDA 1JX9A 1CXZB 5L3CA 3ASOC 2GUZB 1Y66A 4YY3O 2AZ0A 4PJ0Z 3G80A 4FZ0A 3EFFK 1FXHA 2LFRA 1HR0B 3B77A 4ZOLA 1A32A 2XHBA 4NTXA 1S3JA 5HFMA 3M99B 1BSMA 4FVMA 2CH7A 3ZMVA 2DYSC 1GN3A 5TISZ 5CB4A 4FIPC 1N33B 1MZFA 2B1IA 2EJRA 4J9YB 1N34O 1FFTB 3TXSA 1NI8A 2QDOA 2PGGA 2IJIA 5FNVB 2P90A 3OR7C 4DV5O 5CN0A 2ZNIA 3CCSV 4W4LA 3H1JH 2Q6AA 3DGEA 5GONB 1IBLO 4FM1A 4O2AA 1QQCA 4IHJA 1NTKH 1P49A 4F4LA 3L9DA 2A3QA 5BMVB 4H13B 4JI1O 3E83A 4CH5A 1JR9A 5LYJB 3HKEA 2X0LA 5EC2C 1GM8A 5FPOA 1RM1B 5CA3A 1BL8A 1SETA 2VQEB 4FLUA 4O4JB 1M9NA 3LNMB 3TXQA 5IJ0A 3JD2A 4LF7B 1WJZA 4UFZA 1HNWB 1F4MA 2HFEC 1COWG 3AG2B 4UCRA 3SYCA 3FKSG 5JH7A 1R6TA 1B06A 4TQDA 1NTMH 2CTPA 3AG4B 4YJ3A 4MVRA 2IH1C 1S5LZ 3P3NA 4B3RB 1YJNV 3CEIA 3WB0A 5CBHA 4CH6A 3AK3A 3R65A 2X6AA 1JJ2U 1IZ3A 1MA1A 4D6TH 2CUGA 5KUMA 1QU7A 3K57A 3N2KA 3SPCA 3ZCCA 4ZI7B 2RQ6A 2FKXA 1K7DA 5D5PA 1ZL8B 2PUSA 4KHPB 2QR4A 2QTOA 4MVOA 1V55B 4CZZA 4LCUC 2H8PC 4UCVA 3ETDA 4Q6GA 4HNAB 4CS4A 2NLJC 1FFXA 1YITV 3F7YC 4NTYA 1GMGA 4ZOLB 3CC7V 3OGIB 1NH2B 2OYQA 4DV1B 1BS3A 4FLTA 4WFBV 2CH7B 2GV9A 2ZQMA 1IBMB 1SQGA 3BA9A 5F2VO 3L75H 1GN4A 4L8JA 1N0NA 2W0XA 2W6JG 3M7MX 4X20B 4OPAA 4FJCC 2CGOA 1THZA 1US6A 2YUAA 4I4TA 4DXWA 2JJ2G 5CA0A 1XEQA 4PA6A 4DW1A 2EJ7A 4JGSA 1RM1C 4LF4O 1ENVA 2UUAO 5KX5A 2UUCO 1P7GA 3CXHF 1N0JA 1TGOA 2P4KA 3AG2C 5B1BC 4ABMA 5LMNB 5H2FZ 5KA6A 5JVDA 3AG4C 5LGTA 3JCUZ 4IHJB 2F23A 5AG2A 5IT9N 1GTOA 4FZ1A 3HKEB 3UT5A 4WCEV 2WA4A 3CC2V 3ZHVA 4D7SA 3DC5A 5EIBC 4JI2O 4JI4O 4O4LA 5DEDA 5IJ0B 1Y76A 4HYOA 1M90W 2PTMA 1G8MA 3CCEV 1HNXB 2YSUB 5JH7B 4PDRA 2IM9A 1L0NH 4O2BB 4PELA 5JCOC 4YHHB 1V55C 1S77D 2WLLA 4U7OA 3LUTB 4I9QA 3F7VC 2IBZH 4DV6B 1PD3A 2UXBB 1PNMA 2Q0AA 2BOBC 2X6BA 3N2KB 1ZLZA 2ZE8A 2JDIG 4Z1MG 3MD0A 5DECA 4YY3B 4LWSA 2OTLV 1JVMA 2VRZA 4JAVA 4DR7B 2OIEA 5C93A 3MDSA 3K79A 4LC1A 2ITCC 2ZINA 4X65O 1AR4A 4J41A 3LSUA 5B1AB 2Q7HA 2ODMA 1FFXB 3JD3A 2P7TC 1W2BU 3A0HZ 1G1XB 2P6JA 1ZWIC 1D5AA 1OCOB 2JJ1G 1Q82W 2EILB 1I94O 1PNKA 1KKDA 1NR1A 3ZIAG 4A5UB 2DWEC 2HEPA 4FPPA 3JATA 1ZTEA 1AR1B 1N34B 2KG7A 2DOSA 1UJWB 1IBKO 3QO5A 3K9SA 3R66A 3VQWA 1YDXA 2OIGA 3CCRV 4Z1VA 1E1QG 4I4TB 4JI0O 4DV5B 5CA0B 1ROPA 4B08A 3HKCA 2OCHA 3AK2A 3BY6A 1IBLB 4K8XA 1YIJV 1CP9A 1YI2V 4G27B 2QM8A 1KP3A 1EZJA 3MHSC 5BR8O 1SRYA 3W7TA 2YDEA 3LSSA 3OR6C 4RO2A 3ZJZA 3W7UA 4K35A 4FLVA 1CEZA 3HPLC 3D3QA 5IYZA 1KBHA 1R3LC 5IJ9A 4XDLA 4UVAA 4MVUA 5LHGA 3RYFA 2YICA 2HJDA 3JYCA 3UT5B 4WFFA 3OTOO 4H0LB 3T2MA 2EIKB 2LW1A 3OAAG 1VQKV 4FFKA 4H44B 4O4LB 4MVMA 1EM1A 4CC6A 1Y76B 2NR5A 1ZX3A 2WLIA 4JYCA 1EFRG 3N27A 4DR1B 2XAGA 4GKJO 1PM9A 4J7ZA 1I7FA 4MTGA 2Z5UA 4AILC 2B9ZA 1RPOA 1B04A 5J9PC 5B1AC 4DV3B 5A2QN 5GTHZ 4PDLA 3WB1A 4MTOA 1FAFA 4AI8A 3APOA 4UXNA 3UKMA 3STLC 2EILC 1BHBA 2MK3A 3K06A 3NXSA 1XNRO 4RQEA 2UUBB 2R9IA 1S76D 3WU2Z 1XQ8A 1N32B 4GYCB 1IX9A 1GH6A 2FL4A 4I9WA 3FD9A 1S5JA 2BSKB 1Q6HA 2YI8A 4EFEA 1GN6A 1NS1A 1UPGA 4D7TA 4HZ3A 2F93B 3JATB 4MTXA 3VQVA 2LFSA 5KHIA 2KG7B 1K73W 3KKYA 4LF4B 3TJTA 2UUAB 3VOUA 4ZHQB 2UUCB 3CX5F 4PV1B 3OGCC 4B3MO 4LFCB 3CXCU 2P22C 4X64O 3HKCB 4NXNB 2ADPA 2EX3A 4IIJA 2ZM6O 2Q4PA 1BCCH 1JOYA 2DQ0A 2JS5A 1PV0A 1G6UA 5B66Z 4LF5O 1JQ0A 3AG1B 3GWKC 4WBNB 3ABKB 4FFBA 5BXZA 5IJ9B 4DR4B 2UXXA 4B3SB 2N04A 3MAQA 4ZBMA 3BHPA 2YEVA 3B2EE 4PDMA 1SA0A 4R8CA 4LFBO 4UVBA 2BTQA 5KAIZ 2QM7A 3IC7A 2LGQA 1T5EA 1R3JC 2WLIB 2JS3A 4MVQA 2QTSA 1ZUQA 4GUNA 1L8DA 4LFAO 2ZE7A 4X1KB 5LHIA 1SS3A 1H8EG 4FK5C 4JAUA 1NQTA 5B5EZ 1WN7A 2F43G 5LYJA 4QPJA 2X7RB 3OMIB 4DUYB 1VMGA 3ML0A 1GAXA 1LUVA 5IWAB 3K0GA 4JI8O 3CCVV 4X1IB 4JI7B 2Z0AA 4EEQA 1IXMA 1Y6XA 4DR3O 4J7JA 3BCCH 3A0BZ 2HR3A 4RUFA 4PA9A 2OWOA 2BE3A 4QPKA 1GRJA 3IGAC 1TUEB 3T1YO 1HNZO 4LF6O 1IBKB 4GT1A 4DUZO 2XAFA 2Q9LA 5C8YB 3RVYA 3ABKC 1VQPV 1WNSA 2WLHA 5L3FA 5L3DA 3G6BA 3H9VA 5JCOA 1VP7A 2PI5A 4IYIA 4UCOA 1XMOO 2A0LA 1LR1A 3K3WA 4FMTA 4HNAA 4JI5O 5BR8B 4JAAA 2ATKC 1WA8A 1X4TA 5H5NA 3E8GA 5H9CA 3CC4V 4IIJB 1KB9F 2KKWA 1KU9A 1PNLA 1Q3EA 2QSAA 2R9RB 1M57B 2JEUA 1AI6A 3CWBH 4FFBB 4JPRA 2ZE5A 4LNUB 5H6QA 1NVPB 5IYDO 3OTOB 2F95B 3T1HO 3L71H 2YEVB 1VQ9V 1LNQA 1WP8A 4X20A 1SA0B 1Z5VA 5EC1C 1YXBA 3CD6V 3I56V 2BTQB 4GKJB 2QM4A 2WLKA 2PZSA 1W0JG 2JIZG 3CYOA 2ILMA 1P4RA 1VF5B 3CRRA 5LOVB 4DV0O 1NH2D 3E8BA 1YVWA 4BAYA 5L3GA 3ABMB 3ZRWA 2HHHO 3STZC 3A2FA 2DQ3A 1H38A 3EVKA 4UUJC 4WFHA 1D5NA 3ZMSA 1QLEB 3ZRVA 1XNRB 2ARHA 2N05A 3KZIZ 2G38A 3ZN0A 2LP7A 4JYAO 3SDLA 4X89A 1PPJH 3RYHB 4BW9A 1B3QA 3EHBB 4F6RA 1EN4A 5B1BB 1V54B 4X66O 3RYCB 3I5DA 4O2BA 2HJFC 1N4CA 2DMXA 1RP3B 2Z3YA 2FYUH 3CRMA 5EBMC 5JJNB 4WFEA 3U11A 4DW0A 3OEHG 5DM6V 3JD0A 4GX1A 3OD4A 3CE2A 1K8AW 3JSNA 4TWKA 3IJ4A 3TCUA 4X62O 3JARA 2N74A 3C90A 4NTWA 1M57C 5D5QA 4B3MB 1Q6UA 1NR7A 3U0ZA 1SQBH 3L70H 4X64B 4AHCA 5LMUO 2JK5C 2LW7A 1WA8B 4LF5B 2KSDA 3DXRA 3NR7A 4TV9A 4H37A 4ICGA 3FFQA 3K03A 2EBOA 3CCQV 3ASNB 1SC5B 5KUKA 5DN6G 4LFBB 1S0VA 2UXDO 1RFYA 3QNEA 3W7XA 3ABMC 4EKWA 3BRCA 3FX7A 1QLEC 2QWOB 2DN9A 2UXNA 4NYKA 1VF6C 4UB6Z 4X9QA 4LFAB 2WAMA 4JZ2A 1H2MA 2ZR3A 1L0LH 3BEHA 1K9MW 4GX2A 1BZKA 2XT9A 2VQFO 4FM0A 4J9ZB 1V54C 4B3TO 4NXMO 2RJZA 2PF4E 2LGWA 3ZRWB 3FAVB 5K1XA 2NNUA 4XDJA 1AROP 4LF9O 2GTSA 4P9OA 5J2UA 1MSWD 1FJGO 1Z5WA 4QE9A 1VQ6V 2YI9A 3H1KH 2AGAA 3VQYA 1FXKA 3HKDB 2LO1A 4R7CA 3FB8C 4MT8A 4F6RB 2QWQB 3FYIB 4Q20A 3SR2C 3UM7A 3ZRSA 4UV8A 3UCSC 1YTFD 4DR5O 4RUEA 3IFXA 3K59A 1M1KW 4P2ZA 1S5HC 2Y48A 4O4HA 1JCHA 3T1YB 4LF6B 5B1NA 1NZ6A 1HW7A 4DUZB 3W7SA 3B40A 4KFMA 1YJWV 1V9PA 1HP8A 3S3WA 1WAZA 2ZT9B 2EZOA 3FB5C 1QR8A 3K0DA 3JARB 2F4VO 2PYJA 1OHHG 4FLXA 2YXYA 4JI5B 2L6LA 3ASNC 3TETA 4I7ZB 5IE9A 2Q0OC 3UO3A 3CMAV 5JQGB 2P06A 4TSFG 1K34A 2QKSA 3ETQA 1SF9A 4QIWF 4GX5A 1TVKA 3QTCA 2AHZA 4TT3G 2WA3A 3DXRB 4OXSA 1M93A 2BSKA 2GDSA 4XBFA 4TV9B 3D8CA 4EFBA 4IYHA 2WWWA 4X8AA 1DLBA 1JMKC 5LA6B 1P84F 4TUYA 5GTIZ 1KC8W 4LF8O 1SZXA 1XNQO 3SYQA 4MVSA 1Q86W 2E5LO 3PJSK 2UU9O 3J81N 1M5IA 2CK3G 4E4EA 2F1MA 4X1YA 4FLWA 4ZHQA 4WF9V 1AI5A 1FKAO 3ZEDA 3CCMV 4JZGA 3S3XA 4DV0B 5LP6A 4DV7O 2UXCO 3E86A 3MHHC 3QO7A 4IT5A 3DTUB 4KP4A 2CTWA 4JI1B 4WBNA 1NTZH 4GZRB 3U10A 4DR2O 2H94A 4GCZA 4YJ2B 5J2UB 4KXRA 3E8HA 5KMGA 5H6RA 2XTAA 2M6YA 4GX0A 4JASA 2YIBA 2WLNA 4MW3A 1FXKB 1AJNA 4UB8Z 2IJKA 2RN9A 1HDJA 1MSDA 2PYLA 4UV9A 3CP1A 1S72V 2ZDIC 1QBZA 4F6EA 4X1KA 3K08A 2V7QG 4BR6A 3GWOA 5KLVH 1K92A 4I50B 4O4HB 4UCUA 4X62B 3OT7A 3O65A 3LSQA 4NKGB 2FB5A 2E76B 2LJ2A 3L72H 3X2QB 3HKBA 1R3IC 2YIBD 5CMUA 2JEXA 1DK1A 5LBQA 1K4CC 4X1IA 2MW2B 2GHYA 1M56B 3QF7A 2HKOA 2QWRB 1TVKB 5EBLC 1VQMV 2Q67A 2P4VA 2BOCC 1IXBA 2E3CA 5FPRA 4IGGA 2UXDB 1VARA 2YIAA 4K8ZA 2VQEO 4LF7O 3OM3B 4TUYB 1EBOA 3SJCC 1XL6A 5C8YA 2GSMB 2ZCEA 5KAFZ 4J80A 4R50A 1XMQO 4X1YB 3ZMTA 3CS5A 3K5OA 4B3RO 3ZRXA 1YJ9V 2VQFB 1TUBB 5BY1A 1NJIW 2KQXA 4TV8B 5LP6B 4NXMB 1FXKC 3SYPA 5B3SB 1I5XA 4LF9B 4JF3A 4UCSA 3K5MA 2V1DA 2OTJV 3C3TA 1AP5A 1FJGB 3AG3B 4LNUA 1K97A 1AVMA 3AG7A 2Y4TA 4JI2B 2IH3C 4JI4B 4CS2A 3W7WA 4FLYA 4G2KA 4ZIBA 5KMGB 4TQFA 4QNHB 1MOFA 2CTQA 1MNGA 4DRXA 4DR5B 4EB6B 3FYEB 3LDDA 3X2QC 1QVFU 2R72A 2YC0A 5J2TA 4JV5O 1TAEA 1F23A 5LOVA 1EN6A 1F51A 3WG7B 1IBMO 2CAZC 4B7KA 4OX9O 1F4NA 1O9HA 3P32A 1NVPD 1M56C 2Q8VA 1BGYH 3BA8A 2WPDG 3B09A 2CE4A 2ZNJA 1VF6A 4J10A 3JD1A 5KA5A 3HKBB 3I55V 1YEWA 1OCCB 3BPZA 3RYHA 3H1IH 4X65B 3TGUH 1JFFA 2E75B 1VQ4V 3RYCA 1O9GA 4JI6O 4U3JB 2PI4A 1J95A 1OJHA 1YZBA 1K5QA 2RNBA 2WLJA 1I94B 4H33A 1SQXH 1BE3H 3RFRA 2C2AA 1U96A 2WSSG 4LF8B 5LP6C 2A79B 2E5LB 1OCRB 5IYBO 1ORQC 1MG1A 5B3SC 3F5WC 4DO2A 4DYLA 4LP8A 4DV4O 1Y74B 4JI0B 2QA4V 3AG3C 3GVMA 1AP6A 1RPRA 3ETEA 1MMMA 2DW4A 1GN2A 2DWDC 1XUQA 4R6ZA 2UXCB 4DR6O 3QVNA 2AW9A 3BFRA 4YIPA 3RVZA 1XHZA 4DV6O 3E22B 4DR2B 4I0XA 5L3EA 5EIBD 2P5OA 1AILA 3JASA 2JGUA 2NN4A 5K1PA 2ZD9A 3WG7C 2Y69B 3ZHRA 4DR7O 1P7BA 1FXVA 2DJVA 1L1FA 5CA1A 1N8RW 4J7KA 3B4SA 4LH7A 4DRXB 2L35A 4MTFA 2R70A 3RYIA 3CRCA 3SPGA 1KYOF 1W0KG 1OCCC 3VQXA 5J2TB 4OGQB 3J7AU 2XOKG 5A9GA 1BHAA 1K5SA 1AB3A 4RAIA 3FAVA 3A0RA 3JALA 2EZPA 3RGBA 1Y67A 3SJBC 3CPWU 4JI3O 3SJAC 4PI2A 1IURA 4N21A 2ZR2A 1OCRC 3GB7C 4JTDB 3HKDA 5ITZA 2IJJA 1BQZA 1VQLV 5JWPA 1JFFB 1AJPA 3G71V 2AZ2A 1QHTA 4ZKIA 1U97A 3JCZA 2P67A 3K5NA 1FYJA 2QKAA 1J5EO 4I5SA 4I55A 4IL6Z 4CH3A 1Q43A 1BQ0A 2IW5A 4BIOA 1KKCA 3K9AA 2BCCH 1XOUA 1XBLA 3E8FA 1RSOB 3OTFA 1XMQB 1XILA 3ZHUA 1QVGU 4GKKO 2Y4UA 2ZDIA 2Q73A 1YF2A 4DR1O 5E1AC 3CHXA 2ZXWB 2IJHA 5JQGA 2Y69C 1IDSA 3ABUA 3SYOA 2ZM6B 2E74B 3ZMUA 2HG5C 5L3BA 1H2GA 1PL0A 4MVZA 2H3OA 5EYPA 4BIUA 1EN5A 5IY5B 4DV3O 3T4DA 4HAMA 1DF5A 4I0XB 3ABLB 2JGDB 2B1GA 3ETGA 3DC6A 4WFAV 2R9AA 2QWPB 4GLXA 3JASB 4J11A 5LA6A 1AI7A 1I08A 1Q90D 2HVJC 2W0FC 4PA3A 3F5TA 1QCEA 2UUBO 3K58A 1Q8IA 1GO3F 5CA1B 3RW0A 1WP7A 1R6KA 3E2EA 4PA4A 4P30A 1N32O 4JV5B 2IU0A 3CB2A 3ZHQA 2ZIOA 3RYIB 3Q4HA 1FS0G 3B8MA 2A7WA 2FTKA 4OX9B 3IC9A 3LDEA 3P30A 3WFVA 3HR0A 5CB4B 2GBOA 4K0KO 1ZSPA 1R1BA 4PD4F 2Y0PA 3D36C 3CMEV 3JALB 1FD9A 1X59A 4YJ2A 1W59A 2DYRB 2ZKOA 2F66C 2QJ1A 3G6EV 4JI8B 4LFCO 3H01A 3SJQC 4WFGA 4J42A 5LGUA 4NXNO 1NBMG 4JI6B 1BT8A 1SQPH 4O2AB 5ITZB 3WB2A 1XDCA 4DR3B 2XASA 3ZX6A 1E79G 3AEIA 1D2DA 2B5UA 4NB5A 2K9PA 4PA7A 1H2NA 2ZXWC 4FM2A 1AJQA 3C3SA 4DR4O 4I50A 4B3SO 4I55B 1HNZB 2Q7GA
chains in the Genus database with same CATH topology
4NTXA 3S3WA 2L35A 4FZ1A 4NTYA 2FB5A 3IJ4A 4FZ0A 4NTWA 4NYKA 1WP7A 3S3XA 2QTSA 1WP8A 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTX A;  3S3W A;  2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  3IJ4 A;  4FZ0 A;  4NTW A;  4NYK A;  1WP7 A;  3S3X A;  2QTS A;  1WP8 A;  3N27 A; 
#chains in the Genus database with same CATH topology
 2ITD C;  3UQ8 A;  1Q7Y W;  4QJF B;  1FPO A;  1KP2 A;  5IY5 C;  4DV4 B;  3D3I A;  3AK1 A;  3ABL C;  3ZHT A;  5KHK A;  3CCL V;  3JD4 A;  4YJ3 B;  1JJO A;  4DR6 B;  1XMO B;  5JJJ B;  4QE7 A;  3FB7 C;  1MAB G;  3CRA A;  3TK1 A;  3L74 H;  3FB6 C;  1VEW A;  2RDC A;  2QEX V;  1E1R G;  1SER A;  5EYP B;  3UO2 A;  2XAH A;  3G67 A;  1QR9 A;  1VQO V;  2A9H A;  3OUF A;  1ZAU A;  1SQV H;  4MW8 A;  5IDJ A;  3CJH A;  4DUY O;  3ICX A;  3T1H B;  4BIZ A;  4OPH A;  5IWA O;  3L73 H;  3A8T A;  3KCY A;  5EK0 A;  3ZHS A;  5JJE B;  2CTR A;  2JRI A;  4TOI A;  1GKF A;  3LDC A;  1PKX A;  2OCC B;  3ZBH A;  1R73 A;  4JI7 O;  4K3A A;  3CCJ V;  3OFN G;  2Q7E A;  1SQQ H;  2DYR C;  2XND G;  1Q81 W;  1TUB A;  4O4I A;  3SPJ A;  3Q4H B;  3ABT A;  4TV8 A;  2KB1 A;  3HB3 B;  4DK1 A;  4AQY O;  2RCV A;  1URF A;  2Y0I A;  2D3O W;  4DV2 O;  1F7Y A;  2HHH B;  1SQF A;  4JI3 B;  3OW2 U;  1N36 O;  5GW7 A;  5CBG A;  4X88 A;  2YXL A;  3JAK A;  1CPY A;  2PY5 A;  1WB7 A;  4HBN A;  3KG2 A;  4JYA B;  1EZV H;  2VS0 A;  5KX5 B;  1Y4M A;  5LGN A;  3T1C A;  2YS8 A;  1KEC A;  1K4D C;  1NT2 B;  1WPB A;  4X66 B;  1YTF B;  4EB6 A;  1HR0 O;  4JYY A;  5JVD B;  1GM7 A;  1J5E B;  3APQ A;  3OEE G;  2OT5 A;  2RMK B;  4CBC A;  2LQT A;  3CRQ A;  4UVC A;  3ZS8 C;  1R3K C;  1VQ8 V;  3QG5 A;  1VF7 A;  4PHZ A;  3N2G A;  2EIN B;  2ZIM A;  1N33 O;  4GKK B;  2HVK C;  1KQS U;  3OE7 G;  3CSX A;  2W6I G;  1XL4 A;  1M4U A;  4NR1 A;  3JAW A;  2DE0 X;  2QE7 G;  4CS3 A;  1JPX A;  3CCU V;  3SYA A;  5LMU B;  5LXT A;  2WLL B;  3QO8 A;  1MZE A;  4U7N A;  1OZ0 A;  2ADQ B;  1UFI A;  4B7E A;  1PP9 H;  2OCC C;  5FL7 G;  3VBB A;  1JA8 A;  3BAA A;  3THO A;  3H1L H;  1YHQ V;  4U3J A;  5KHG A;  2ETN A;  2FML A;  1H8H G;  3O9O A;  1VQ5 V;  1OCO C;  3J80 N;  5KHJ A;  1G4Y B;  3CJH B;  3DSQ A;  4LR3 A;  4LWS B;  2Q68 A;  1KUQ A;  2A06 H;  3RT3 C;  5KHH A;  4MSW C;  4UCT A;  2EIJ B;  1OV9 A;  1HNW O;  2AXT Z;  1XI1 A;  3E35 A;  1Y74 A;  2BTO A;  3K04 A;  1OCZ B;  1YCI A;  1SZT A;  3E89 A;  3BVO A;  3M8A A;  1AR5 A;  3IAY A;  4ASU G;  4FLZ A;  2VWK A;  5EZY A;  4U3F H;  1K33 A;  1WLE A;  1GK9 A;  1Z2G A;  1HWY A;  2Q5Z A;  1B6Q A;  4K0K B;  3OUS A;  4O4I B;  3PN1 A;  4N23 A;  1LUW A;  4CC5 A;  1I5Y A;  1KMI Z;  3E22 A;  3SPH A;  4B3T B;  1H2L A;  5E79 Z;  4G28 B;  1TA8 A;  2GUZ A;  1Q6I A;  1SKV A;  4JTC B;  1NKD A;  3JAK B;  4KHP O;  3B8N A;  1QLN A;  3RN4 A;  5BZB A;  2EIK C;  2HLD G;  1I0H A;  2EIM B;  5IYC O;  1H2S B;  2EIN C;  2K1E A;  2YID A;  1VQN V;  1AI4 A;  5B1O A;  4NVP A;  2HP8 A;  4W4K A;  5IYZ B;  2V4D A;  1VIB A;  3ASO B;  3G4S V;  3P3P A;  5FLX N;  1YSC A;  3RYF B;  4KL1 A;  4BWA A;  4LH6 A;  4Z2W A;  2CGN A;  4DV1 O;  2XAJ A;  4JYB A;  3SGI A;  2XUM A;  2XAQ A;  5LHH A;  3BAB A;  1H2K A;  5HFL A;  2Q69 A;  2QGN A;  3N2G B;  1DGS A;  5FNV A;  2F4V B;  4PDV A;  3LNN A;  1XHX A;  1KD1 W;  3KCX A;  3H1H H;  3RBZ A;  2QKC A;  4DK0 A;  2IU3 A;  2QWN B;  5GON A;  2DYS B;  3ZN1 A;  3JAW B;  2WLM A;  4BW5 A;  2EUL A;  4LBE C;  5LXT B;  1WB8 A;  2EIJ C;  1NU1 H;  4XDK A;  4KUM A;  5BMV A;  3K5L A;  1OCZ C;  4L87 A;  1SES A;  3D36 A;  5LMN O;  4YXW G;  5LL6 Y;  3SPI A;  2CDY A;  3JSL A;  5CBF A;  3T4Z A;  1QNM A;  2D2C B;  4O4J A;  4PI0 A;  4E2L A;  4YIO A;  1K3E A;  2AHY A;  3OMN B;  1XNQ B;  2O57 A;  3OMA B;  2UU9 B;  2ZE6 A;  4MS2 A;  1RSO A;  3EXA A;  1DF4 A;  2VWJ A;  1GM9 A;  5EBW C;  1HNX O;  1DTO A;  2GTA A;  1Q5O A;  3RWR D;  1XRE A;  2X6C A;  4DV7 B;  4YHH O;  2YXH A;  4AQY B;  4JTA B;  1BMF G;  4ZI7 A;  5EZY B;  3JAM N;  2EIM C;  4DV2 B;  4P9P A;  4QGP A;  1PL4 A;  3ZMZ A;  4C7U A;  4CH4 A;  2M7W A;  1VQ7 V;  2JVD A;  1IVS A;  4RQF A;  4RWU A;  1ZL8 A;  1WPX A;  1R6N A;  3AG1 C;  1N36 B;  2UXB O;  2JGD A;  1JX9 A;  1CXZ B;  5L3C A;  3ASO C;  2GUZ B;  1Y66 A;  4YY3 O;  2AZ0 A;  4PJ0 Z;  3G80 A;  4FZ0 A;  3EFF K;  1FXH A;  2LFR A;  1HR0 B;  3B77 A;  4ZOL A;  1A32 A;  2XHB A;  4NTX A;  1S3J A;  5HFM A;  3M99 B;  1BSM A;  4FVM A;  2CH7 A;  3ZMV A;  2DYS C;  1GN3 A;  5TIS Z;  5CB4 A;  4FIP C;  1N33 B;  1MZF A;  2B1I A;  2EJR A;  4J9Y B;  1N34 O;  1FFT B;  3TXS A;  1NI8 A;  2QDO A;  2PGG A;  2IJI A;  5FNV B;  2P90 A;  3OR7 C;  4DV5 O;  5CN0 A;  2ZNI A;  3CCS V;  4W4L A;  3H1J H;  2Q6A A;  3DGE A;  5GON B;  1IBL O;  4FM1 A;  4O2A A;  1QQC A;  4IHJ A;  1NTK H;  1P49 A;  4F4L A;  3L9D A;  2A3Q A;  5BMV B;  4H13 B;  4JI1 O;  3E83 A;  4CH5 A;  1JR9 A;  5LYJ B;  3HKE A;  2X0L A;  5EC2 C;  1GM8 A;  5FPO A;  1RM1 B;  5CA3 A;  1BL8 A;  1SET A;  2VQE B;  4FLU A;  4O4J B;  1M9N A;  3LNM B;  3TXQ A;  5IJ0 A;  3JD2 A;  4LF7 B;  1WJZ A;  4UFZ A;  1HNW B;  1F4M A;  2HFE C;  1COW G;  3AG2 B;  4UCR A;  3SYC A;  3FKS G;  5JH7 A;  1R6T A;  1B06 A;  4TQD A;  1NTM H;  2CTP A;  3AG4 B;  4YJ3 A;  4MVR A;  2IH1 C;  1S5L Z;  3P3N A;  4B3R B;  1YJN V;  3CEI A;  3WB0 A;  5CBH A;  4CH6 A;  3AK3 A;  3R65 A;  2X6A A;  1JJ2 U;  1IZ3 A;  1MA1 A;  4D6T H;  2CUG A;  5KUM A;  1QU7 A;  3K57 A;  3N2K A;  3SPC A;  3ZCC A;  4ZI7 B;  2RQ6 A;  2FKX A;  1K7D A;  5D5P A;  1ZL8 B;  2PUS A;  4KHP B;  2QR4 A;  2QTO A;  4MVO A;  1V55 B;  4CZZ A;  4LCU C;  2H8P C;  4UCV A;  3ETD A;  4Q6G A;  4HNA B;  4CS4 A;  2NLJ C;  1FFX A;  1YIT V;  3F7Y C;  4NTY A;  1GMG A;  4ZOL B;  3CC7 V;  3OGI B;  1NH2 B;  2OYQ A;  4DV1 B;  1BS3 A;  4FLT A;  4WFB V;  2CH7 B;  2GV9 A;  2ZQM A;  1IBM B;  1SQG A;  3BA9 A;  5F2V O;  3L75 H;  1GN4 A;  4L8J A;  1N0N A;  2W0X A;  2W6J G;  3M7M X;  4X20 B;  4OPA A;  4FJC C;  2CGO A;  1THZ A;  1US6 A;  2YUA A;  4I4T A;  4DXW A;  2JJ2 G;  5CA0 A;  1XEQ A;  4PA6 A;  4DW1 A;  2EJ7 A;  4JGS A;  1RM1 C;  4LF4 O;  1ENV A;  2UUA O;  5KX5 A;  2UUC O;  1P7G A;  3CXH F;  1N0J A;  1TGO A;  2P4K A;  3AG2 C;  5B1B C;  4ABM A;  5LMN B;  5H2F Z;  5KA6 A;  5JVD A;  3AG4 C;  5LGT A;  3JCU Z;  4IHJ B;  2F23 A;  5AG2 A;  5IT9 N;  1GTO A;  4FZ1 A;  3HKE B;  3UT5 A;  4WCE V;  2WA4 A;  3CC2 V;  3ZHV A;  4D7S A;  3DC5 A;  5EIB C;  4JI2 O;  4JI4 O;  4O4L A;  5DED A;  5IJ0 B;  1Y76 A;  4HYO A;  1M90 W;  2PTM A;  1G8M A;  3CCE V;  1HNX B;  2YSU B;  5JH7 B;  4PDR A;  2IM9 A;  1L0N H;  4O2B B;  4PEL A;  5JCO C;  4YHH B;  1V55 C;  1S77 D;  2WLL A;  4U7O A;  3LUT B;  4I9Q A;  3F7V C;  2IBZ H;  4DV6 B;  1PD3 A;  2UXB B;  1PNM A;  2Q0A A;  2BOB C;  2X6B A;  3N2K B;  1ZLZ A;  2ZE8 A;  2JDI G;  4Z1M G;  3MD0 A;  5DEC A;  4YY3 B;  4LWS A;  2OTL V;  1JVM A;  2VRZ A;  4JAV A;  4DR7 B;  2OIE A;  5C93 A;  3MDS A;  3K79 A;  4LC1 A;  2ITC C;  2ZIN A;  4X65 O;  1AR4 A;  4J41 A;  3LSU A;  5B1A B;  2Q7H A;  2ODM A;  1FFX B;  3JD3 A;  2P7T C;  1W2B U;  3A0H Z;  1G1X B;  2P6J A;  1ZWI C;  1D5A A;  1OCO B;  2JJ1 G;  1Q82 W;  2EIL B;  1I94 O;  1PNK A;  1KKD A;  1NR1 A;  3ZIA G;  4A5U B;  2DWE C;  2HEP A;  4FPP A;  3JAT A;  1ZTE A;  1AR1 B;  1N34 B;  2KG7 A;  2DOS A;  1UJW B;  1IBK O;  3QO5 A;  3K9S A;  3R66 A;  3VQW A;  1YDX A;  2OIG A;  3CCR V;  4Z1V A;  1E1Q G;  4I4T B;  4JI0 O;  4DV5 B;  5CA0 B;  1ROP A;  4B08 A;  3HKC A;  2OCH A;  3AK2 A;  3BY6 A;  1IBL B;  4K8X A;  1YIJ V;  1CP9 A;  1YI2 V;  4G27 B;  2QM8 A;  1KP3 A;  1EZJ A;  3MHS C;  5BR8 O;  1SRY A;  3W7T A;  2YDE A;  3LSS A;  3OR6 C;  4RO2 A;  3ZJZ A;  3W7U A;  4K35 A;  4FLV A;  1CEZ A;  3HPL C;  3D3Q A;  5IYZ A;  1KBH A;  1R3L C;  5IJ9 A;  4XDL A;  4UVA A;  4MVU A;  5LHG A;  3RYF A;  2YIC A;  2HJD A;  3JYC A;  3UT5 B;  4WFF A;  3OTO O;  4H0L B;  3T2M A;  2EIK B;  2LW1 A;  3OAA G;  1VQK V;  4FFK A;  4H44 B;  4O4L B;  4MVM A;  1EM1 A;  4CC6 A;  1Y76 B;  2NR5 A;  1ZX3 A;  2WLI A;  4JYC A;  1EFR G;  3N27 A;  4DR1 B;  2XAG A;  4GKJ O;  1PM9 A;  4J7Z A;  1I7F A;  4MTG A;  2Z5U A;  4AIL C;  2B9Z A;  1RPO A;  1B04 A;  5J9P C;  5B1A C;  4DV3 B;  5A2Q N;  5GTH Z;  4PDL A;  3WB1 A;  4MTO A;  1FAF A;  4AI8 A;  3APO A;  4UXN A;  3UKM A;  3STL C;  2EIL C;  1BHB A;  2MK3 A;  3K06 A;  3NXS A;  1XNR O;  4RQE A;  2UUB B;  2R9I A;  1S76 D;  3WU2 Z;  1XQ8 A;  1N32 B;  4GYC B;  1IX9 A;  1GH6 A;  2FL4 A;  4I9W A;  3FD9 A;  1S5J A;  2BSK B;  1Q6H A;  2YI8 A;  4EFE A;  1GN6 A;  1NS1 A;  1UPG A;  4D7T A;  4HZ3 A;  2F93 B;  3JAT B;  4MTX A;  3VQV A;  2LFS A;  5KHI A;  2KG7 B;  1K73 W;  3KKY A;  4LF4 B;  3TJT A;  2UUA B;  3VOU A;  4ZHQ B;  2UUC B;  3CX5 F;  4PV1 B;  3OGC C;  4B3M O;  4LFC B;  3CXC U;  2P22 C;  4X64 O;  3HKC B;  4NXN B;  2ADP A;  2EX3 A;  4IIJ A;  2ZM6 O;  2Q4P A;  1BCC H;  1JOY A;  2DQ0 A;  2JS5 A;  1PV0 A;  1G6U A;  5B66 Z;  4LF5 O;  1JQ0 A;  3AG1 B;  3GWK C;  4WBN B;  3ABK B;  4FFB A;  5BXZ A;  5IJ9 B;  4DR4 B;  2UXX A;  4B3S B;  2N04 A;  3MAQ A;  4ZBM A;  3BHP A;  2YEV A;  3B2E E;  4PDM A;  1SA0 A;  4R8C A;  4LFB O;  4UVB A;  2BTQ A;  5KAI Z;  2QM7 A;  3IC7 A;  2LGQ A;  1T5E A;  1R3J C;  2WLI B;  2JS3 A;  4MVQ A;  2QTS A;  1ZUQ A;  4GUN A;  1L8D A;  4LFA O;  2ZE7 A;  4X1K B;  5LHI A;  1SS3 A;  1H8E G;  4FK5 C;  4JAU A;  1NQT A;  5B5E Z;  1WN7 A;  2F43 G;  5LYJ A;  4QPJ A;  2X7R B;  3OMI B;  4DUY B;  1VMG A;  3ML0 A;  1GAX A;  1LUV A;  5IWA B;  3K0G A;  4JI8 O;  3CCV V;  4X1I B;  4JI7 B;  2Z0A A;  4EEQ A;  1IXM A;  1Y6X A;  4DR3 O;  4J7J A;  3BCC H;  3A0B Z;  2HR3 A;  4RUF A;  4PA9 A;  2OWO A;  2BE3 A;  4QPK A;  1GRJ A;  3IGA C;  1TUE B;  3T1Y O;  1HNZ O;  4LF6 O;  1IBK B;  4GT1 A;  4DUZ O;  2XAF A;  2Q9L A;  5C8Y B;  3RVY A;  3ABK C;  1VQP V;  1WNS A;  2WLH A;  5L3F A;  5L3D A;  3G6B A;  3H9V A;  5JCO A;  1VP7 A;  2PI5 A;  4IYI A;  4UCO A;  1XMO O;  2A0L A;  1LR1 A;  3K3W A;  4FMT A;  4HNA A;  4JI5 O;  5BR8 B;  4JAA A;  2ATK C;  1WA8 A;  1X4T A;  5H5N A;  3E8G A;  5H9C A;  3CC4 V;  4IIJ B;  1KB9 F;  2KKW A;  1KU9 A;  1PNL A;  1Q3E A;  2QSA A;  2R9R B;  1M57 B;  2JEU A;  1AI6 A;  3CWB H;  4FFB B;  4JPR A;  2ZE5 A;  4LNU B;  5H6Q A;  1NVP B;  5IYD O;  3OTO B;  2F95 B;  3T1H O;  3L71 H;  2YEV B;  1VQ9 V;  1LNQ A;  1WP8 A;  4X20 A;  1SA0 B;  1Z5V A;  5EC1 C;  1YXB A;  3CD6 V;  3I56 V;  2BTQ B;  4GKJ B;  2QM4 A;  2WLK A;  2PZS A;  1W0J G;  2JIZ G;  3CYO A;  2ILM A;  1P4R A;  1VF5 B;  3CRR A;  5LOV B;  4DV0 O;  1NH2 D;  3E8B A;  1YVW A;  4BAY A;  5L3G A;  3ABM B;  3ZRW A;  2HHH O;  3STZ C;  3A2F A;  2DQ3 A;  1H38 A;  3EVK A;  4UUJ C;  4WFH A;  1D5N A;  3ZMS A;  1QLE B;  3ZRV A;  1XNR B;  2ARH A;  2N05 A;  3KZI Z;  2G38 A;  3ZN0 A;  2LP7 A;  4JYA O;  3SDL A;  4X89 A;  1PPJ H;  3RYH B;  4BW9 A;  1B3Q A;  3EHB B;  4F6R A;  1EN4 A;  5B1B B;  1V54 B;  4X66 O;  3RYC B;  3I5D A;  4O2B A;  2HJF C;  1N4C A;  2DMX A;  1RP3 B;  2Z3Y A;  2FYU H;  3CRM A;  5EBM C;  5JJN B;  4WFE A;  3U11 A;  4DW0 A;  3OEH G;  5DM6 V;  3JD0 A;  4GX1 A;  3OD4 A;  3CE2 A;  1K8A W;  3JSN A;  4TWK A;  3IJ4 A;  3TCU A;  4X62 O;  3JAR A;  2N74 A;  3C90 A;  4NTW A;  1M57 C;  5D5Q A;  4B3M B;  1Q6U A;  1NR7 A;  3U0Z A;  1SQB H;  3L70 H;  4X64 B;  4AHC A;  5LMU O;  2JK5 C;  2LW7 A;  1WA8 B;  4LF5 B;  2KSD A;  3DXR A;  3NR7 A;  4TV9 A;  4H37 A;  4ICG A;  3FFQ A;  3K03 A;  2EBO A;  3CCQ V;  3ASN B;  1SC5 B;  5KUK A;  5DN6 G;  4LFB B;  1S0V A;  2UXD O;  1RFY A;  3QNE A;  3W7X A;  3ABM C;  4EKW A;  3BRC A;  3FX7 A;  1QLE C;  2QWO B;  2DN9 A;  2UXN A;  4NYK A;  1VF6 C;  4UB6 Z;  4X9Q A;  4LFA B;  2WAM A;  4JZ2 A;  1H2M A;  2ZR3 A;  1L0L H;  3BEH A;  1K9M W;  4GX2 A;  1BZK A;  2XT9 A;  2VQF O;  4FM0 A;  4J9Z B;  1V54 C;  4B3T O;  4NXM O;  2RJZ A;  2PF4 E;  2LGW A;  3ZRW B;  3FAV B;  5K1X A;  2NNU A;  4XDJ A;  1ARO P;  4LF9 O;  2GTS A;  4P9O A;  5J2U A;  1MSW D;  1FJG O;  1Z5W A;  4QE9 A;  1VQ6 V;  2YI9 A;  3H1K H;  2AGA A;  3VQY A;  1FXK A;  3HKD B;  2LO1 A;  4R7C A;  3FB8 C;  4MT8 A;  4F6R B;  2QWQ B;  3FYI B;  4Q20 A;  3SR2 C;  3UM7 A;  3ZRS A;  4UV8 A;  3UCS C;  1YTF D;  4DR5 O;  4RUE A;  3IFX A;  3K59 A;  1M1K W;  4P2Z A;  1S5H C;  2Y48 A;  4O4H A;  1JCH A;  3T1Y B;  4LF6 B;  5B1N A;  1NZ6 A;  1HW7 A;  4DUZ B;  3W7S A;  3B40 A;  4KFM A;  1YJW V;  1V9P A;  1HP8 A;  3S3W A;  1WAZ A;  2ZT9 B;  2EZO A;  3FB5 C;  1QR8 A;  3K0D A;  3JAR B;  2F4V O;  2PYJ A;  1OHH G;  4FLX A;  2YXY A;  4JI5 B;  2L6L A;  3ASN C;  3TET A;  4I7Z B;  5IE9 A;  2Q0O C;  3UO3 A;  3CMA V;  5JQG B;  2P06 A;  4TSF G;  1K34 A;  2QKS A;  3ETQ A;  1SF9 A;  4QIW F;  4GX5 A;  1TVK A;  3QTC A;  2AHZ A;  4TT3 G;  2WA3 A;  3DXR B;  4OXS A;  1M93 A;  2BSK A;  2GDS A;  4XBF A;  4TV9 B;  3D8C A;  4EFB A;  4IYH A;  2WWW A;  4X8A A;  1DLB A;  1JMK C;  5LA6 B;  1P84 F;  4TUY A;  5GTI Z;  1KC8 W;  4LF8 O;  1SZX A;  1XNQ O;  3SYQ A;  4MVS A;  1Q86 W;  2E5L O;  3PJS K;  2UU9 O;  3J81 N;  1M5I A;  2CK3 G;  4E4E A;  2F1M A;  4X1Y A;  4FLW A;  4ZHQ A;  4WF9 V;  1AI5 A;  1FKA O;  3ZED A;  3CCM V;  4JZG A;  3S3X A;  4DV0 B;  5LP6 A;  4DV7 O;  2UXC O;  3E86 A;  3MHH C;  3QO7 A;  4IT5 A;  3DTU B;  4KP4 A;  2CTW A;  4JI1 B;  4WBN A;  1NTZ H;  4GZR B;  3U10 A;  4DR2 O;  2H94 A;  4GCZ A;  4YJ2 B;  5J2U B;  4KXR A;  3E8H A;  5KMG A;  5H6R A;  2XTA A;  2M6Y A;  4GX0 A;  4JAS A;  2YIB A;  2WLN A;  4MW3 A;  1FXK B;  1AJN A;  4UB8 Z;  2IJK A;  2RN9 A;  1HDJ A;  1MSD A;  2PYL A;  4UV9 A;  3CP1 A;  1S72 V;  2ZDI C;  1QBZ A;  4F6E A;  4X1K A;  3K08 A;  2V7Q G;  4BR6 A;  3GWO A;  5KLV H;  1K92 A;  4I50 B;  4O4H B;  4UCU A;  4X62 B;  3OT7 A;  3O65 A;  3LSQ A;  4NKG B;  2FB5 A;  2E76 B;  2LJ2 A;  3L72 H;  3X2Q B;  3HKB A;  1R3I C;  2YIB D;  5CMU A;  2JEX A;  1DK1 A;  5LBQ A;  1K4C C;  4X1I A;  2MW2 B;  2GHY A;  1M56 B;  3QF7 A;  2HKO A;  2QWR B;  1TVK B;  5EBL C;  1VQM V;  2Q67 A;  2P4V A;  2BOC C;  1IXB A;  2E3C A;  5FPR A;  4IGG A;  2UXD B;  1VAR A;  2YIA A;  4K8Z A;  2VQE O;  4LF7 O;  3OM3 B;  4TUY B;  1EBO A;  3SJC C;  1XL6 A;  5C8Y A;  2GSM B;  2ZCE A;  5KAF Z;  4J80 A;  4R50 A;  1XMQ O;  4X1Y B;  3ZMT A;  3CS5 A;  3K5O A;  4B3R O;  3ZRX A;  1YJ9 V;  2VQF B;  1TUB B;  5BY1 A;  1NJI W;  2KQX A;  4TV8 B;  5LP6 B;  4NXM B;  1FXK C;  3SYP A;  5B3S B;  1I5X A;  4LF9 B;  4JF3 A;  4UCS A;  3K5M A;  2V1D A;  2OTJ V;  3C3T A;  1AP5 A;  1FJG B;  3AG3 B;  4LNU A;  1K97 A;  1AVM A;  3AG7 A;  2Y4T A;  4JI2 B;  2IH3 C;  4JI4 B;  4CS2 A;  3W7W A;  4FLY A;  4G2K A;  4ZIB A;  5KMG B;  4TQF A;  4QNH B;  1MOF A;  2CTQ A;  1MNG A;  4DRX A;  4DR5 B;  4EB6 B;  3FYE B;  3LDD A;  3X2Q C;  1QVF U;  2R72 A;  2YC0 A;  5J2T A;  4JV5 O;  1TAE A;  1F23 A;  5LOV A;  1EN6 A;  1F51 A;  3WG7 B;  1IBM O;  2CAZ C;  4B7K A;  4OX9 O;  1F4N A;  1O9H A;  3P32 A;  1NVP D;  1M56 C;  2Q8V A;  1BGY H;  3BA8 A;  2WPD G;  3B09 A;  2CE4 A;  2ZNJ A;  1VF6 A;  4J10 A;  3JD1 A;  5KA5 A;  3HKB B;  3I55 V;  1YEW A;  1OCC B;  3BPZ A;  3RYH A;  3H1I H;  4X65 B;  3TGU H;  1JFF A;  2E75 B;  1VQ4 V;  3RYC A;  1O9G A;  4JI6 O;  4U3J B;  2PI4 A;  1J95 A;  1OJH A;  1YZB A;  1K5Q A;  2RNB A;  2WLJ A;  1I94 B;  4H33 A;  1SQX H;  1BE3 H;  3RFR A;  2C2A A;  1U96 A;  2WSS G;  4LF8 B;  5LP6 C;  2A79 B;  2E5L B;  1OCR B;  5IYB O;  1ORQ C;  1MG1 A;  5B3S C;  3F5W C;  4DO2 A;  4DYL A;  4LP8 A;  4DV4 O;  1Y74 B;  4JI0 B;  2QA4 V;  3AG3 C;  3GVM A;  1AP6 A;  1RPR A;  3ETE A;  1MMM A;  2DW4 A;  1GN2 A;  2DWD C;  1XUQ A;  4R6Z A;  2UXC B;  4DR6 O;  3QVN A;  2AW9 A;  3BFR A;  4YIP A;  3RVZ A;  1XHZ A;  4DV6 O;  3E22 B;  4DR2 B;  4I0X A;  5L3E A;  5EIB D;  2P5O A;  1AIL A;  3JAS A;  2JGU A;  2NN4 A;  5K1P A;  2ZD9 A;  3WG7 C;  2Y69 B;  3ZHR A;  4DR7 O;  1P7B A;  1FXV A;  2DJV A;  1L1F A;  5CA1 A;  1N8R W;  4J7K A;  3B4S A;  4LH7 A;  4DRX B;  2L35 A;  4MTF A;  2R70 A;  3RYI A;  3CRC A;  3SPG A;  1KYO F;  1W0K G;  1OCC C;  3VQX A;  5J2T B;  4OGQ B;  3J7A U;  2XOK G;  5A9G A;  1BHA A;  1K5S A;  1AB3 A;  4RAI A;  3FAV A;  3A0R A;  3JAL A;  2EZP A;  3RGB A;  1Y67 A;  3SJB C;  3CPW U;  4JI3 O;  3SJA C;  4PI2 A;  1IUR A;  4N21 A;  2ZR2 A;  1OCR C;  3GB7 C;  4JTD B;  3HKD A;  5ITZ A;  2IJJ A;  1BQZ A;  1VQL V;  5JWP A;  1JFF B;  1AJP A;  3G71 V;  2AZ2 A;  1QHT A;  4ZKI A;  1U97 A;  3JCZ A;  2P67 A;  3K5N A;  1FYJ A;  2QKA A;  1J5E O;  4I5S A;  4I55 A;  4IL6 Z;  4CH3 A;  1Q43 A;  1BQ0 A;  2IW5 A;  4BIO A;  1KKC A;  3K9A A;  2BCC H;  1XOU A;  1XBL A;  3E8F A;  1RSO B;  3OTF A;  1XMQ B;  1XIL A;  3ZHU A;  1QVG U;  4GKK O;  2Y4U A;  2ZDI A;  2Q73 A;  1YF2 A;  4DR1 O;  5E1A C;  3CHX A;  2ZXW B;  2IJH A;  5JQG A;  2Y69 C;  1IDS A;  3ABU A;  3SYO A;  2ZM6 B;  2E74 B;  3ZMU A;  2HG5 C;  5L3B A;  1H2G A;  1PL0 A;  4MVZ A;  2H3O A;  5EYP A;  4BIU A;  1EN5 A;  5IY5 B;  4DV3 O;  3T4D A;  4HAM A;  1DF5 A;  4I0X B;  3ABL B;  2JGD B;  2B1G A;  3ETG A;  3DC6 A;  4WFA V;  2R9A A;  2QWP B;  4GLX A;  3JAS B;  4J11 A;  5LA6 A;  1AI7 A;  1I08 A;  1Q90 D;  2HVJ C;  2W0F C;  4PA3 A;  3F5T A;  1QCE A;  2UUB O;  3K58 A;  1Q8I A;  1GO3 F;  5CA1 B;  3RW0 A;  1WP7 A;  1R6K A;  3E2E A;  4PA4 A;  4P30 A;  1N32 O;  4JV5 B;  2IU0 A;  3CB2 A;  3ZHQ A;  2ZIO A;  3RYI B;  3Q4H A;  1FS0 G;  3B8M A;  2A7W A;  2FTK A;  4OX9 B;  3IC9 A;  3LDE A;  3P30 A;  3WFV A;  3HR0 A;  5CB4 B;  2GBO A;  4K0K O;  1ZSP A;  1R1B A;  4PD4 F;  2Y0P A;  3D36 C;  3CME V;  3JAL B;  1FD9 A;  1X59 A;  4YJ2 A;  1W59 A;  2DYR B;  2ZKO A;  2F66 C;  2QJ1 A;  3G6E V;  4JI8 B;  4LFC O;  3H01 A;  3SJQ C;  4WFG A;  4J42 A;  5LGU A;  4NXN O;  1NBM G;  4JI6 B;  1BT8 A;  1SQP H;  4O2A B;  5ITZ B;  3WB2 A;  1XDC A;  4DR3 B;  2XAS A;  3ZX6 A;  1E79 G;  3AEI A;  1D2D A;  2B5U A;  4NB5 A;  2K9P A;  4PA7 A;  1H2N A;  2ZXW C;  4FM2 A;  1AJQ A;  3C3S A;  4DR4 O;  4I50 A;  4B3S O;  4I55 B;  1HNZ B;  2Q7G A; 
#chains in the Genus database with same CATH homology
 4NTX A;  3S3W A;  2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  3IJ4 A;  4FZ0 A;  4NTW A;  4NYK A;  1WP7 A;  3S3X A;  2QTS A;  1WP8 A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...