4FZ0A

Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low ph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
405
structure length
405
Chain Sequence
CFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 108
structure length 405
sequence length 405
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4fz0A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4fz0A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4fz0A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4fz0A02
4FZ1A 3IJ4A 4NTXA 4NYKA 3N27A 2QTSA 3S3XA 3S3WA 2FB5A 4NTYA 4FZ0A 4NTWA 2L35A 1WP8A 1WP7A
chains in the Genus database with same CATH superfamily
3VBBA 5J2TB 2OWOA 1K5QA 4JI1O 5LXTB 3AG4C 5H5NA 2L6LA 2GBOA 3JD4A 1IXMA 5J9PC 3BHPA 2ZQMA 4UV9A 3UQ8A 3AG3B 2OT5A 3HKDB 5IWAO 4J7ZA 4NXNB 3OGCC 2M6YA 3J80N 4AHCA 3OEEG 1B04A 2Y48A 4Q6GA 1HNWB 2ZXWC 1KUQA 1BGYH 3ABUA 2ZNJA 4DV0O 1NR1A 2XASA 3RVYA 1NH2D 4GX5A 4UCVA 1QQCA 5LOVB 2QM7A 1YJ9V 3TETA 1ZWIC 3CX5F 5DECA 4ZBMA 3CJHA 1H2GA 4QPJA 3SJQC 1XDCA 3DXRB 3JAMN 2R9AA 1XMQO 5LMNO 4LF5O 1MA1A 3AG2B 3RYHA 4KUMA 4NXMO 1MABG 2VRZA 1N0NA 4GT1A 2KQXA 3LNMB 4KXRA 1Y76A 2FKXA 3B40A 3OAAG 4IGGA 1M57B 4DR2O 1BZKA 2YIBD 3HKEB 3SPIA 1VQ9V 2DW4A 1VIBA 3GB7C 2UUAO 1NS1A 1PV0A 2BSKB 4N21A 3W7UA 5LMUO 1HR0O 3CD6V 1COWG 4F4LA 1PL4A 4DV7B 5IJ0B 4U3JA 1QLEC 1VQ7V 2N04A 2PY5A 1XNQO 5C8YB 3Q4HA 1GN4A 3ETDA 3JD1A 4H0LB 3OTOO 3D3IA 4EFBA 2EULA 4R7CA 5B1NA 4OX9O 2GTSA 4GX1A 4DR6B 1U97A 2Q9LA 3WB1A 3ZHVA 1G8MA 2ADPA 5CA1B 4TV9A 2E76B 1N33B 2BTQB 2CUGA 1R6KA 1MOFA 2EILB 3D36A 3AK2A 1V54C 2AGAA 2UUBO 4NTXA 1V9PA 1GM9A 2ILMA 4DW1A 2XT9A 2P06A 1S3JA 4JYCA 3CRRA 3SDLA 5KHKA 1TA8A 1I5XA 2A79B 3ICXA 3A2FA 4KFMA 2Q8VA 4EKWA 1VQOV 2UU9B 3TJTA 2C2AA 3JAWA 1HP8A 4K35A 2QKAA 4YY3B 1Q43A 4NXNO 1K34A 4FM2A 4PA3A 2H94A 2QTSA 4LCUC 5EBMC 1Z5WA 5BXZA 2XAJA 1HNWO 2Y0IA 2PZSA 5JVDB 2LW7A 2ZINA 3PN1A 1Y4MA 2AZ0A 1M9NA 5EIBC 3G4SV 4D7SA 3UKMA 4DR5B 1NT2B 5LHIA 2LFRA 1VMGA 4I0XB 4IIJB 3JD0A 1KQSU 4UV8A 4CH4A 3ASNC 1QHTA 4LF9B 1SS3A 3D36C 1J95A 3BPZA 5DM6V 3GWKC 3NR7A 3SJAC 3HKCA 2WLKA 5KUKA 2JS5A 4U7OA 1BMFG 2F93B 4LF8B 1DLBA 4EB6A 1KB9F 2JVDA 3K0DA 2AW9A 3T2MA 1VQPV 3R66A 5CA0A 2P67A 4O4IB 4P30A 4Z2WA 1S0VA 3L9DA 1BL8A 1YF2A 2ODMA 1V55C 2N74A 3FKSG 1P7GA 3DSQA 4DUYB 1ZAUA 1YTFB 1BQ0A 1OCCB 5IY5C 4DR3B 4DV7O 3QF7A 4B3RB 4B3TB 3JSLA 4LC1A 1IBMB 1ZUQA 1NJIW 1N32B 4ZI7A 1SQXH 1EN6A 2DWEC 1AI4A 1I08A 4JAVA 2HHHB 3R65A 4O2AA 2Q5ZA 1F51A 5BMVA 3ML0A 2YEVA 1WLEA 5L3EA 4DR6O 4TSFG 3ETQA 4LWSB 1S5HC 3JARA 1Y6XA 2Q73A 5LHHA 1N33O 5EYPA 1RSOA 2YDEA 2EIMC 3W7WA 3K5OA 1H2KA 2XAQA 2LW1A 4HBNA 4X64B 3BY6A 4JI2B 1E1RG 2QM8A 1FFTB 3B09A 3HR0A 2WLLA 5H6RA 4JTCB 4MT8A 2FMLA 2DYSC 1PNMA 3PJSK 5JJNB 1G1XB 3TGUH 1CEZA 3MAQA 4LNUB 1NKDA 1MZFA 1N34B 2A9HA 1VARA 1SF9A 1UFIA 1E79G 1Y67A 1SETA 3CS5A 5EC2C 4YY3O 5CBHA 5DN6G 5J2UB 3EVKA 4YJ3A 4H44B 2IM9A 1L0NH 5LYJA 2JJ2G 2HJDA 4JGSA 4TV8B 2IJHA 3ETGA 3D3QA 3IC9A 2XAHA 1M93A 4DR5O 1AI6A 3ZIAG 3FFQA 2YI9A 1VP7A 2RNBA 4R6ZA 4LF9O 2FL4A 3ZRSA 1G6UA 1ZL8B 4FK5C 2DN9A 1GM7A 3KKYA 4X1KB 1SESA 4I50B 1NR7A 4LF8O 4LFAB 2QWNB 2GSMB 1OCRC 1YTFD 4NKGB 3G80A 4ZOLB 2ADQB 1AROP 3BVOA 2LFSA 4PDLA 4GX0A 2DYRC 4FPPA 1WP8A 3LDCA 1EFRG 2EINB 3N27A 5B1BB 4DV2B 1Q82W 1D2DA 5KX5B 4DUYO 4TOIA 2KKWA 2XAGA 4MVRA 3JCUZ 1JR9A 4BW5A 3APQA 4DR3O 4DR4B 4HZ3A 4B3RO 4B3TO 5L3FA 1IBKB 1IBMO 1XNRB 2KG7B 5IYZB 1N32O 2EZPA 1JJOA 2QJ1A 2ZE6A 2EX3A 3ABLC 2CE4A 3TXQA 1FJGB 2PYJA 5B66Z 4PI0A 2BOBC 5LBQA 3RVZA 5JQGB 2QSAA 5EZYB 4PA6A 1GKFA 5LL6Y 1D5NA 3CCVV 3FD9A 1MSDA 2UXNA 1ROPA 4BW9A 2JEXA 3E2EA 3K04A 1KECA 2ZKOA 4JV5B 3AG4B 1Q90D 4JI2O 4Z1VA 3CMAV 3T1CA 4TQFA 2GHYA 4FMTA 2W0XA 3I56V 3ABTA 4DR1B 1EN5A 5EBWC 4J42A 1YIJV 1Y74B 3ABMC 3SYOA 5IDJA 3OEHG 1U96A 3ASOC 3DTUB 4LF4B 4DV4B 3CCUV 5IJ9B 3J7AU 2ZXWB 1N34O 1XHZA 4AI8A 1K73W 4RO2A 3OT7A 2CH7B 1IZ3A 2UUCB 1QVGU 1THZA 3HB3B 4JASA 5CA3A 4G2KA 4BAYA 2E3CA 4FLUA 1QR9A 1AB3A 4WFEA 1IXBA 3B8MA 3RBZA 2V7QG 1OJHA 3OR6C 3ZJZA 1VQNV 4JI5B 4UCSA 2VQFB 1H8HG 2RQ6A 5KHJA 3JASA 1AP6A 3K59A 3RW0A 3KG2A 5CBGA 2Q69A 1K92A 3HPLC 4IYIA 4E4EA 1JFFB 2GUZA 2QDOA 4UB6Z 4O4JB 3O65A 2OTLV 1Q6UA 2JGUA 3CCJV 1TUBA 2VQEB 1OZ0A 1WAZA 4LFAO 2WLIB 2DMXA 4IYHA 4O2BB 4JYAB 1EZVH 2WWWA 3RWRD 2QE7G 4ZHQB 3HKBB 1VF7A 4QNHB 4XDJA 5LP6A 4O4HA 1VQ4V 3E8GA 4CC6A 3X2QC 2YXLA 4HYOA 4H37A 5LGNA 4DV2O 1HNXB 4I9WA 4X20B 2YUAA 4FVMA 4J7JA 1P49A 3CHXA 3M8AA 1QU7A 2PGGA 4DR4O 4PHZA 4KHPB 1R6TA 4JZ2A 3OM3B 4G27B 1IBKO 2Q0OC 1XNRO 2QM4A 1K8AW 1L0LH 4J41A 3OD4A 1FJGO 2IH1C 1WPXA 4DR7B 3C3TA 3OGIB 4PDVA 4GCZA 3T1HB 4JPRA 5IYCO 1F7YA 2G38A 1RP3B 1F4MA 3STLC 3K5NA 2ITCC 1NTZH 2BE3A 3JATB 2EBOA 4MTOA 3N2GB 2B1GA 4JV5O 1Q6IA 2P7TC 2EIKB 4U3JB 3AK1A 3H1HH 3ABKC 2KSDA 4IHJA 1SZTA 3FB7C 4WBNB 1NZ6A 1W0KG 2Q4PA 1GRJA 5LP6C 4DR1O 3I55V 3G6EV 1W59A 2NN4A 4JI4B 3TXSA 1NVPB 3Q4HB 1YEWA 3P32A 1R3IC 3CCSV 2X0LA 4TQDA 4LF4O 4DV4O 1M56B 3JD3A 4U7NA 2JDIG 4PI2A 2RN9A 2UUCO 1N0JA 5JJJB 5FPOA 5KMGB 1BCCH 5GTHZ 4GKJB 1H2SB 1WA8A 1Q5OA 1XBLA 5B1AC 4X65B 4JYYA 3ZRWB 4JTAB 1IURA 1I94B 1PD3A 1NBMG 4JI5O 2VQFO 2QEXV 3OMIB 3CB2A 1NU1H 2Y69C 1JJ2U 3CXHF 3AG1C 1VQLV 3JALA 3IAYA 2A3QA 4I55A 3BA9A 4I4TA 1SQQH 5B3SB 1HNZB 4CS2A 1W2BU 2VQEO 3SYCA 1GTOA 5HFLA 1B6QA 3ZMVA 1QBZA 3A0BZ 1O9HA 4YJ2B 1FXVA 4JYAO 3K3WA 3WG7B 3MDSA 2NNUA 3E8HA 2GTAA 3STZC 5CB4A 4LR3A 3CCMV 2FB5A 5FNVB 1Y66A 2L35A 1DF4A 5BR8O 3THOA 3SYQA 4YIOA 1EM1A 1CXZB 1KBHA 5J2TA 1VQ5V 2E74B 4R8CA 3UM7A 1SRYA 4DK0A 4KHPO 3BFRA 2X6BA 4GLXA 4MTXA 1YJNV 3CSXA 2CTRA 2PTMA 1WNSA 3HKDA 2WA4A 3E83A 4H33A 3ZX6A 3KZIZ 3TCUA 2ZE5A 3T1HO 1OCOC 1N36O 4RUFA 2JEUA 4X1YA 3K5LA 2F1MA 3QG5A 5LOVA 1NVPD 5H6QA 2PI5A 3ETEA 4BWAA 5BZBA 2P90A 2ZM6B 5CN0A 3P30A 2YSUB 2ZIMA 2ZE8A 5IT9N 2Q68A 3M7MX 1NI8A 1ZTEA 3DXRA 4LFBB 1QNMA 1GAXA 4F6RB 4TUYB 3QO8A 2YXYA 3BEHA 4MW3A 4JI4O 3JD2A 4DV3B 3T1YB 3CRQA 3W7XA 4X88A 4P9OA 2NLJC 1FYJA 4GUNA 3HKEA 3N2KB 4RUEA 1FFXB 2BSKA 5EYPB 3ZEDA 4K8XA 2DOSA 3RYIB 4GKJO 4U3FH 2QA4V 5IJ0A 2A06H 1AR4A 4X65O 2CTPA 1I94O 4CS4A 4GKKB 2Z5UA 3H1LH 5E1AC 5C8YA 4IT5A 2F95B 4W4LA 4YHHB 3CC4V 1AR5A 3CCRV 3B77A 3B2EE 3W7SA 2IJJA 3H9VA 4A5UB 1LR1A 3P3PA 4GYCB 4B3SB 2GV9A 1HNZO 3LSQA 4FLTA 4CH6A 2VS0A 4JTDB 5CA1A 3AG2C 3GWOA 2BTQA 1FXHA 4JI8B 1QVFU 2XUMA 3FAVB 3SGIA 2EJRA 2EJ7A 3VQYA 1M57C 2BOCC 2UXXA 4L8JA 2AHYA 2EIJB 2RMKB 4RQFA 1AP5A 4J7KA 5KA6A 2IJKA 1CP9A 4FM1A 3D8CA 1GN6A 2YC0A 4ZIBA 4XDKA 3QVNA 1HWYA 1KP2A 4BR6A 3JAKB 3OTFA 3SJCC 5CBFA 2Q6AA 1QLNA 2OIEA 3ZMSA 1X59A 2Q7GA 5GONB 1RM1B 2PI4A 1XREA 5AG2A 2QKSA 5JVDA 1N8RW 3RYFA 1BSMA 4GX2A 2JRIA 4O4LB 2PUSA 1NQTA 1W0JG 3ABMB 2WPDG 4IIJA 4I0XA 2ZM6O 2EILC 2Y0PA 1I7FA 2UU9O 1WJZA 1KMIZ 3ZRVA 1R1BA 5LA6A 1RPOA 3ZCCA 4LFBO 4FIPC 1KYOF 4TT3G 4LBEC 1HW7A 2X6AA 3OE7G 4MVMA 4ZKIA 2ITDC 3CRMA 4DV3O 3T1YO 5L3GA 3UT5B 1XL4A 2AZ2A 2E5LB 3ZRXA 1K4CC 2OCCC 2IJIA 4MVUA 2JGDB 2XHBA 2ATKC 1K7DA 4O4IA 4I7ZB 2YICA 1K97A 5LHGA 3ZHSA 4FFBB 3CRCA 3UO2A 4D7TA 4FJCC 4RWUA 3AEIA 2OTJV 1PM9A 1SERA 4QE9A 4CS3A 3CEIA 4B08A 2QWOB 1JOYA 1FXKB 4GKKO 2ZD9A 4PA7A 1TVKA 3ZHUA 1WB7A 1ZSPA 2LO1A 3LDEA 4EFEA 3QNEA 2CGOA 4UVBA 5KUMA 3H1JH 3OMNB 1Z2GA 2VWJA 4B3SO 2AXTZ 2OCHA 4X66B 4UUJC 2YIAA 2V1DA 3E22B 4JI8O 1S77D 1DF5A 4YIPA 1PL0A 4HNAB 5B5EZ 5C93A 4WCEV 3G6BA 4FFKA 5L3BA 4PA4A 2QWQB 4NTWA 2Y4TA 1JVMA 3E35A 1SA0A 3A0HZ 4DO2A 3L73H 4WF9V 4B3MB 3WB0A 2KB1A 4I5SA 2R9IA 3E89A 1KKCA 1OCZB 3L71H 2HHHO 3OUSA 3U0ZA 2GUZB 1S5JA 1JMKC 3CCEV 1OCCC 5LGUA 1AI5A 1D5AA 4LNUA 4P9PA 4X1IB 4FZ0A 1TUBB 5D5QA 4GZRB 1E1QG 1XHXA 2PYLA 3H1IH 4B7EA 5J2UA 1DGSA 1AILA 1F23A 4MTFA 1X4TA 1US6A 4X64O 1YI2V 4LP8A 4TV8A 3H1KH 1S5LZ 4LH7A 4ASUG 4F6EA 4UCTA 2UXDB 3A0RA 3P3NA 4LF6B 1VF6A 4CH5A 4DW0A 5EC1C 1M4UA 1R3LC 2HLDG 1HDJA 1ZL8A 4QGPA 1MSWD 4WFBV 2HEPA 2FYUH 2HVKC 2WLMA 4R50A 3S3XA 5HFMA 5JH7B 2EZOA 4X1KA 1I5YA 3RYCA 3FX7A 1WP7A 3IFXA 2E5LO 4G28B 4CH3A 2ZCEA 5KAFZ 3AG7A 2IU0A 4MVOA 4MVZA 2B9ZA 3CCQV 1BT8A 1FPOA 3SPGA 1P4RA 1M5IA 1A32A 4DRXA 2Y69B 5KX5A 2CTQA 4K3AA 1GN3A 4FLYA 1TAEA 5EK0A 4NVPA 2IW5A 2Y4UA 2KG7A 5IYZA 3CP1A 2HKOA 1VEWA 3DC5A 4XBFA 1VF6C 5IE9A 5JQGA 4HAMA 5EZYA 5FLXN 1QLEB 5GW7A 4X66O 4BIOA 4ICGA 4YXWG 1GO3F 1DTOA 1DK1A 5A2QN 5IYBO 1YITV 2ZT9B 4AILC 3CJHB 3KCYA 5F2VO 5KAIZ 2WLNA 5IYDO 3CYOA 2YIDA 1XEQA 4B3MO 2DE0X 4OXSA 3CWBH 1Y74A 3RYHB 5B1BC 5TISZ 3H01A 4TWKA 1UJWB 2JJ1G 5BY1A 5ITZA 3ZMUA 4MTGA 1Y76B 2GDSA 4QIWF 1K4DC 1OCOB 1V54B 5IJ9A 4LFCB 3BRCA 2A0LA 4RAIA 3LUTB 1FAFA 1MG1A 3FYIB 3K03A 2CH7A 3SPCA 2D3OW 4J9YB 5CMUA 2QGNA 4MVQA 3E8FA 2UXBB 1BE3H 3SYPA 4DK1A 1XI1A 1RFYA 1JPXA 2XNDG 3AK3A 3ZMZA 3K9SA 4J80A 2RJZA 4PDMA 2UXDO 3TK1A 1QCEA 3LNNA 3E8BA 2Q0AA 4LF6O 2ZNIA 1Q6HA 3ZMTA 1JFFA 2CAZC 1GMGA 4PELA 1PP9H 4O4JA 4W4KA 1FS0G 3VQXA 3LSSA 4NB5A 4DV6B 2DWDC 2HR3A 4TV9B 5L3CA 3FB8C 1LUWA 3B4SA 2WLIA 2RCVA 5KA5A 2K9PA 4O2BA 3ASNB 4ZHQA 5JWPA 3HKBA 4X1YB 2YIBA 3L70H 2UXCB 1NTMH 4WFHA 4PD4F 2DQ0A 4X20A 4JZGA 4Q20A 2BTOA 3W7TA 1EBOA 4P2ZA 4QE7A 2LQTA 2P5OA 3QO5A 1SQPH 3JAWB 1VQKV 1V55B 4UCOA 4BIUA 5B1OA 3CPWU 4N23A 5IY5B 3DGEA 1M1KW 1GH6A 4JAUA 3WB2A 2R9RB 3EFFK 3B8NA 4UCUA 2CDYA 2F43G 1HNXO 3E86A 2QR4A 1KKDA 3JATA 2JS3A 4K8ZA 3N2GA 4FLWA 4JI0B 2Q7HA 3G67A 5LXTA 4UCRA 3APOA 5KHGA 4UVAA 4WBNA 2LJ2A 3HKCB 4J11A 4KP4A 2EIMB 3U10A 2P4KA 3MHSC 2XOKG 3ZHQA 4DR7O 4EB6B 4PDRA 2WAMA 4UFZA 4C7UA 3A8TA 3K79A 2HG5C 4LFCO 5CA0B 2YI8A 1B06A 4LH6A 4OGQB 1TUEB 2WA3A 1H2NA 3RT3C 3BAAA 1YSCA 2DYSB 2O57A 3ZS8C 5KMGA 4BIZA 3F5WC 1H38A 3RFRA 2A7WA 2UXBO 4DV1B 1SQFA 5JCOA 2P6JA 4PA9A 1YDXA 3ZHTA 1OHHG 3ZRWA 1FD9A 3EXAA 5EIBD 2QWPB 4ZI7B 4PV1B 4O2AB 2HP8A 2OCCB 4DYLA 5BMVB 1WN7A 2YEVB 2EIKC 1XMOB 3IC7A 2HFEC 4J10A 1N4CA 2ARHA 3OMAB 4DV6O 3JARB 5KLVH 2LGWA 2F66C 1YVWA 3AG3C 1RSOB 3K06A 4YJ2A 5FPRA 2FTKA 4B7KA 1ZLZA 1M56C 1K9MW 4JI7B 1Q8IA 4UXNA 3BA8A 3RYFB 1FKAO 5FNVA 3LSUA 2UXCO 2YXHA 4E2LA 2WLLB 4DUZB 4J9ZB 4UVCA 3J81N 1S72V 1JCHA 1MMMA 1OCRB 3C3SA 3MD0A 3JSNA 3SR2C 5JCOC 2DYRB 4JYBA 1YCIA 5LA6B 2QTOA 3ZBHA 1SC5B 4Z1MG 1TGOA 3I5DA 1K5SA 4YJ3B 3FB6C 4CC5A 5LYJB 1QR8A 5B3SC 5H2FZ 1AR1B 4JI6B 3GVMA 1OV9A 1SQVH 3L72H 3ABLB 1MZEA 4OPHA 4JI0O 2H3OA 1B3QA 3CC7V 1SZXA 1S76D 4AQYB 3WG7C 2F23A 2ZDIA 1Z5VA 1KP3A 2Z3YA 4MSWC 4LF7B 4F6RA 4TUYA 2X7RB 2AHZA 1TVKB 1PNLA 1AJNA 3OFNG 2ETNA 4CZZA 4X62B 1IX9A 1XL6A 1XUQA 2ZIOA 3N2KA 4DV5B 4FLVA 2CGNA 2CK3G 1FFXA 3K08A 2D2CB 1AJPA 2DQ3A 5K1PA 3RYIA 5H9CA 4DV1O 1NTKH 3ASOB 3VQVA 1R73A 1BS3A 1GN2A 1AI7A 1XOUA 4DXWA 1KU9A 2WSSG 1SA0B 1AJQA 2IH3C 4JAAA 3S3WA 3NXSA 4NTYA 4I9QA 1AVMA 1J5EB 1YZBA 5LGTA 2PF4E 1BHBA 3SPHA 2BCCH 4NYKA 1GM8A 4L87A 2HJFC 2ZDIC 1XMOO 4X89A 3KCXA 1VQMV 1PPJH 1VQ8V 5A9GA 1SQGA 1CPYA 1G4YB 3QTCA 1YHQV 1IBLB 2OYQA 2W6JG 1PNKA 3FAVA 1IVSA 3QO7A 2W0FC 2WLHA 3K9AA 4KL1A 2LP7A 3FB5C 3CC2V 4JI7O 4MW8A 1YXBA 1K3EA 2IU3A 4FLZA 1JQ0A 4DUZO 4QPKA 1URFA 3K58A 3LDDA 3EHBB 4YHHO 2MW2B 1VF5B 3K0GA 1L8DA 2WLJA 3L74H 1RPRA 3OW2U 3JAKA 1PKXA 4LWSA 1YJWV 3MHHC 3X2QB 4X9QA 2ZE7A 2YS8A 3RYCB 2JK5C 1SQBH 3C90A 2P22C 3FYEB 5GONA 2ZR2A 3JYCA 3ZHRA 1WB8A 2V4DA 3IGAC 1L1FA 4JI6O 1XQ8A 1EZJA 2OIGA 5D5PA 4O4LA 2E75B 4IL6Z 3JASB 2H8PC 4DRXB 1F4NA 3WU2Z 1K33A 1JA8A 4NR1A 1H2LA 4AQYO 1BQZA 1KC8W 3ZN1A 4LF7O 3CMEV 1O9GA 4JI3B 2F4VB 2N05A 5K1XA 1H2MA 1ENVA 1UPGA 2EIJC 3O9OA 3UT5A 3IJ4A 2XAFA 2Q7EA 4X62O 2B5UA 2JGDA 2VWKA 1GK9A 3ABKB 4MVSA 5LP6B 4DV5O 3F7YC 4O4HB 1ZX3A 4FFBA 1Q3EA 3K5MA 4K0KB 3RN4A 3BABA 3SPJA 1VQ6V 3UO3A 2DJVA 1EN4A 4JI1B 4ABMA 1RM1C 2R70A 2QWRB 2MK3A 1FXKA 3T4DA 4I50A 1IDSA 4FLXA 1J5EO 5IWAB 1R3JC 2HVJC 2IBZH 4ZOLA 5ITZB 3T4ZA 4XDLA 3SJBC 5B1AB 1R6NA 3CRAA 5GTIZ 4FM0A 3VOUA 4DV0B 2LGQA 5KHHA 4OPAA 1I0HA 1BHAA 3JCZA 2XTAA 1IBLO 3E22A 5FL7G 3AG1B 2RDCA 1P7BA 4EEQA 4HNAA 3CCLV 2CTWA 3G71V 1LNQA 1XILA 4IHJB 2NR5A 3UCSC 1XMQB 2K1EA 2Q67A 5LMNB 4LF5B 4NXMB 3ZN0A 1NH2B 2R72A 3OR7C 1WPBA 3DC6A 5DEDA 2JIZG 2X6CA 4D6TH 4DR2B 1Q86W 4X1IA 1Q7YW 1FXKC 4X8AA 1KD1W 2UUAB 4CBCA 3RGBA 5LMUB 2QKCA 1HR0B 3OUFA 4UB8Z 2W6IG 1WA8B 1T5EA 4WFGA 1Q81W 1M90W 3F5TA 3CE2A 1R3KC 4JF3A 1MNGA 3L75H 4H13B 2B1IA 2ZR3A 4WFFA 4QJFB 1H8EG 2EINC 5L3DA 5BR8B 1XNQB 3U11A 1ORQC 3WFVA 3K57A 5E79Z 3OTOB 3JALB 1P84F 1JX9A 2M7WA 4I55B 3BCCH 3M99B 4OX9B 3CXCU 5EBLC 4I4TB 4PJ0Z 3VQWA 4FZ1A 4MS2A 5JH7A 4JI3O 4RQEA 2P4VA 2F4VO 5JJEB 3F7VC 1OCZC 5KHIA 1LUVA 1N36B 2UUBB 5CB4B 2Z0AA 3SYAA 1SKVA 4K0KO 4WFAV
chains in the Genus database with same CATH topology
4FZ1A 3IJ4A 4NTXA 4NYKA 3N27A 2QTSA 3S3XA 3S3WA 2FB5A 4NTYA 4FZ0A 4NTWA 2L35A 1WP8A 1WP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ1 A;  3IJ4 A;  4NTX A;  4NYK A;  3N27 A;  2QTS A;  3S3X A;  3S3W A;  2FB5 A;  4NTY A;  4FZ0 A;  4NTW A;  2L35 A;  1WP8 A;  1WP7 A; 
#chains in the Genus database with same CATH topology
 3VBB A;  5J2T B;  2OWO A;  1K5Q A;  4JI1 O;  5LXT B;  3AG4 C;  5H5N A;  2L6L A;  2GBO A;  3JD4 A;  1IXM A;  5J9P C;  3BHP A;  2ZQM A;  4UV9 A;  3UQ8 A;  3AG3 B;  2OT5 A;  3HKD B;  5IWA O;  4J7Z A;  4NXN B;  3OGC C;  2M6Y A;  3J80 N;  4AHC A;  3OEE G;  1B04 A;  2Y48 A;  4Q6G A;  1HNW B;  2ZXW C;  1KUQ A;  1BGY H;  3ABU A;  2ZNJ A;  4DV0 O;  1NR1 A;  2XAS A;  3RVY A;  1NH2 D;  4GX5 A;  4UCV A;  1QQC A;  5LOV B;  2QM7 A;  1YJ9 V;  3TET A;  1ZWI C;  3CX5 F;  5DEC A;  4ZBM A;  3CJH A;  1H2G A;  4QPJ A;  3SJQ C;  1XDC A;  3DXR B;  3JAM N;  2R9A A;  1XMQ O;  5LMN O;  4LF5 O;  1MA1 A;  3AG2 B;  3RYH A;  4KUM A;  4NXM O;  1MAB G;  2VRZ A;  1N0N A;  4GT1 A;  2KQX A;  3LNM B;  4KXR A;  1Y76 A;  2FKX A;  3B40 A;  3OAA G;  4IGG A;  1M57 B;  4DR2 O;  1BZK A;  2YIB D;  3HKE B;  3SPI A;  1VQ9 V;  2DW4 A;  1VIB A;  3GB7 C;  2UUA O;  1NS1 A;  1PV0 A;  2BSK B;  4N21 A;  3W7U A;  5LMU O;  1HR0 O;  3CD6 V;  1COW G;  4F4L A;  1PL4 A;  4DV7 B;  5IJ0 B;  4U3J A;  1QLE C;  1VQ7 V;  2N04 A;  2PY5 A;  1XNQ O;  5C8Y B;  3Q4H A;  1GN4 A;  3ETD A;  3JD1 A;  4H0L B;  3OTO O;  3D3I A;  4EFB A;  2EUL A;  4R7C A;  5B1N A;  4OX9 O;  2GTS A;  4GX1 A;  4DR6 B;  1U97 A;  2Q9L A;  3WB1 A;  3ZHV A;  1G8M A;  2ADP A;  5CA1 B;  4TV9 A;  2E76 B;  1N33 B;  2BTQ B;  2CUG A;  1R6K A;  1MOF A;  2EIL B;  3D36 A;  3AK2 A;  1V54 C;  2AGA A;  2UUB O;  4NTX A;  1V9P A;  1GM9 A;  2ILM A;  4DW1 A;  2XT9 A;  2P06 A;  1S3J A;  4JYC A;  3CRR A;  3SDL A;  5KHK A;  1TA8 A;  1I5X A;  2A79 B;  3ICX A;  3A2F A;  4KFM A;  2Q8V A;  4EKW A;  1VQO V;  2UU9 B;  3TJT A;  2C2A A;  3JAW A;  1HP8 A;  4K35 A;  2QKA A;  4YY3 B;  1Q43 A;  4NXN O;  1K34 A;  4FM2 A;  4PA3 A;  2H94 A;  2QTS A;  4LCU C;  5EBM C;  1Z5W A;  5BXZ A;  2XAJ A;  1HNW O;  2Y0I A;  2PZS A;  5JVD B;  2LW7 A;  2ZIN A;  3PN1 A;  1Y4M A;  2AZ0 A;  1M9N A;  5EIB C;  3G4S V;  4D7S A;  3UKM A;  4DR5 B;  1NT2 B;  5LHI A;  2LFR A;  1VMG A;  4I0X B;  4IIJ B;  3JD0 A;  1KQS U;  4UV8 A;  4CH4 A;  3ASN C;  1QHT A;  4LF9 B;  1SS3 A;  3D36 C;  1J95 A;  3BPZ A;  5DM6 V;  3GWK C;  3NR7 A;  3SJA C;  3HKC A;  2WLK A;  5KUK A;  2JS5 A;  4U7O A;  1BMF G;  2F93 B;  4LF8 B;  1DLB A;  4EB6 A;  1KB9 F;  2JVD A;  3K0D A;  2AW9 A;  3T2M A;  1VQP V;  3R66 A;  5CA0 A;  2P67 A;  4O4I B;  4P30 A;  4Z2W A;  1S0V A;  3L9D A;  1BL8 A;  1YF2 A;  2ODM A;  1V55 C;  2N74 A;  3FKS G;  1P7G A;  3DSQ A;  4DUY B;  1ZAU A;  1YTF B;  1BQ0 A;  1OCC B;  5IY5 C;  4DR3 B;  4DV7 O;  3QF7 A;  4B3R B;  4B3T B;  3JSL A;  4LC1 A;  1IBM B;  1ZUQ A;  1NJI W;  1N32 B;  4ZI7 A;  1SQX H;  1EN6 A;  2DWE C;  1AI4 A;  1I08 A;  4JAV A;  2HHH B;  3R65 A;  4O2A A;  2Q5Z A;  1F51 A;  5BMV A;  3ML0 A;  2YEV A;  1WLE A;  5L3E A;  4DR6 O;  4TSF G;  3ETQ A;  4LWS B;  1S5H C;  3JAR A;  1Y6X A;  2Q73 A;  5LHH A;  1N33 O;  5EYP A;  1RSO A;  2YDE A;  2EIM C;  3W7W A;  3K5O A;  1H2K A;  2XAQ A;  2LW1 A;  4HBN A;  4X64 B;  3BY6 A;  4JI2 B;  1E1R G;  2QM8 A;  1FFT B;  3B09 A;  3HR0 A;  2WLL A;  5H6R A;  4JTC B;  4MT8 A;  2FML A;  2DYS C;  1PNM A;  3PJS K;  5JJN B;  1G1X B;  3TGU H;  1CEZ A;  3MAQ A;  4LNU B;  1NKD A;  1MZF A;  1N34 B;  2A9H A;  1VAR A;  1SF9 A;  1UFI A;  1E79 G;  1Y67 A;  1SET A;  3CS5 A;  5EC2 C;  4YY3 O;  5CBH A;  5DN6 G;  5J2U B;  3EVK A;  4YJ3 A;  4H44 B;  2IM9 A;  1L0N H;  5LYJ A;  2JJ2 G;  2HJD A;  4JGS A;  4TV8 B;  2IJH A;  3ETG A;  3D3Q A;  3IC9 A;  2XAH A;  1M93 A;  4DR5 O;  1AI6 A;  3ZIA G;  3FFQ A;  2YI9 A;  1VP7 A;  2RNB A;  4R6Z A;  4LF9 O;  2FL4 A;  3ZRS A;  1G6U A;  1ZL8 B;  4FK5 C;  2DN9 A;  1GM7 A;  3KKY A;  4X1K B;  1SES A;  4I50 B;  1NR7 A;  4LF8 O;  4LFA B;  2QWN B;  2GSM B;  1OCR C;  1YTF D;  4NKG B;  3G80 A;  4ZOL B;  2ADQ B;  1ARO P;  3BVO A;  2LFS A;  4PDL A;  4GX0 A;  2DYR C;  4FPP A;  1WP8 A;  3LDC A;  1EFR G;  2EIN B;  3N27 A;  5B1B B;  4DV2 B;  1Q82 W;  1D2D A;  5KX5 B;  4DUY O;  4TOI A;  2KKW A;  2XAG A;  4MVR A;  3JCU Z;  1JR9 A;  4BW5 A;  3APQ A;  4DR3 O;  4DR4 B;  4HZ3 A;  4B3R O;  4B3T O;  5L3F A;  1IBK B;  1IBM O;  1XNR B;  2KG7 B;  5IYZ B;  1N32 O;  2EZP A;  1JJO A;  2QJ1 A;  2ZE6 A;  2EX3 A;  3ABL C;  2CE4 A;  3TXQ A;  1FJG B;  2PYJ A;  5B66 Z;  4PI0 A;  2BOB C;  5LBQ A;  3RVZ A;  5JQG B;  2QSA A;  5EZY B;  4PA6 A;  1GKF A;  5LL6 Y;  1D5N A;  3CCV V;  3FD9 A;  1MSD A;  2UXN A;  1ROP A;  4BW9 A;  2JEX A;  3E2E A;  3K04 A;  1KEC A;  2ZKO A;  4JV5 B;  3AG4 B;  1Q90 D;  4JI2 O;  4Z1V A;  3CMA V;  3T1C A;  4TQF A;  2GHY A;  4FMT A;  2W0X A;  3I56 V;  3ABT A;  4DR1 B;  1EN5 A;  5EBW C;  4J42 A;  1YIJ V;  1Y74 B;  3ABM C;  3SYO A;  5IDJ A;  3OEH G;  1U96 A;  3ASO C;  3DTU B;  4LF4 B;  4DV4 B;  3CCU V;  5IJ9 B;  3J7A U;  2ZXW B;  1N34 O;  1XHZ A;  4AI8 A;  1K73 W;  4RO2 A;  3OT7 A;  2CH7 B;  1IZ3 A;  2UUC B;  1QVG U;  1THZ A;  3HB3 B;  4JAS A;  5CA3 A;  4G2K A;  4BAY A;  2E3C A;  4FLU A;  1QR9 A;  1AB3 A;  4WFE A;  1IXB A;  3B8M A;  3RBZ A;  2V7Q G;  1OJH A;  3OR6 C;  3ZJZ A;  1VQN V;  4JI5 B;  4UCS A;  2VQF B;  1H8H G;  2RQ6 A;  5KHJ A;  3JAS A;  1AP6 A;  3K59 A;  3RW0 A;  3KG2 A;  5CBG A;  2Q69 A;  1K92 A;  3HPL C;  4IYI A;  4E4E A;  1JFF B;  2GUZ A;  2QDO A;  4UB6 Z;  4O4J B;  3O65 A;  2OTL V;  1Q6U A;  2JGU A;  3CCJ V;  1TUB A;  2VQE B;  1OZ0 A;  1WAZ A;  4LFA O;  2WLI B;  2DMX A;  4IYH A;  4O2B B;  4JYA B;  1EZV H;  2WWW A;  3RWR D;  2QE7 G;  4ZHQ B;  3HKB B;  1VF7 A;  4QNH B;  4XDJ A;  5LP6 A;  4O4H A;  1VQ4 V;  3E8G A;  4CC6 A;  3X2Q C;  2YXL A;  4HYO A;  4H37 A;  5LGN A;  4DV2 O;  1HNX B;  4I9W A;  4X20 B;  2YUA A;  4FVM A;  4J7J A;  1P49 A;  3CHX A;  3M8A A;  1QU7 A;  2PGG A;  4DR4 O;  4PHZ A;  4KHP B;  1R6T A;  4JZ2 A;  3OM3 B;  4G27 B;  1IBK O;  2Q0O C;  1XNR O;  2QM4 A;  1K8A W;  1L0L H;  4J41 A;  3OD4 A;  1FJG O;  2IH1 C;  1WPX A;  4DR7 B;  3C3T A;  3OGI B;  4PDV A;  4GCZ A;  3T1H B;  4JPR A;  5IYC O;  1F7Y A;  2G38 A;  1RP3 B;  1F4M A;  3STL C;  3K5N A;  2ITC C;  1NTZ H;  2BE3 A;  3JAT B;  2EBO A;  4MTO A;  3N2G B;  2B1G A;  4JV5 O;  1Q6I A;  2P7T C;  2EIK B;  4U3J B;  3AK1 A;  3H1H H;  3ABK C;  2KSD A;  4IHJ A;  1SZT A;  3FB7 C;  4WBN B;  1NZ6 A;  1W0K G;  2Q4P A;  1GRJ A;  5LP6 C;  4DR1 O;  3I55 V;  3G6E V;  1W59 A;  2NN4 A;  4JI4 B;  3TXS A;  1NVP B;  3Q4H B;  1YEW A;  3P32 A;  1R3I C;  3CCS V;  2X0L A;  4TQD A;  4LF4 O;  4DV4 O;  1M56 B;  3JD3 A;  4U7N A;  2JDI G;  4PI2 A;  2RN9 A;  2UUC O;  1N0J A;  5JJJ B;  5FPO A;  5KMG B;  1BCC H;  5GTH Z;  4GKJ B;  1H2S B;  1WA8 A;  1Q5O A;  1XBL A;  5B1A C;  4X65 B;  4JYY A;  3ZRW B;  4JTA B;  1IUR A;  1I94 B;  1PD3 A;  1NBM G;  4JI5 O;  2VQF O;  2QEX V;  3OMI B;  3CB2 A;  1NU1 H;  2Y69 C;  1JJ2 U;  3CXH F;  3AG1 C;  1VQL V;  3JAL A;  3IAY A;  2A3Q A;  4I55 A;  3BA9 A;  4I4T A;  1SQQ H;  5B3S B;  1HNZ B;  4CS2 A;  1W2B U;  2VQE O;  3SYC A;  1GTO A;  5HFL A;  1B6Q A;  3ZMV A;  1QBZ A;  3A0B Z;  1O9H A;  4YJ2 B;  1FXV A;  4JYA O;  3K3W A;  3WG7 B;  3MDS A;  2NNU A;  3E8H A;  2GTA A;  3STZ C;  5CB4 A;  4LR3 A;  3CCM V;  2FB5 A;  5FNV B;  1Y66 A;  2L35 A;  1DF4 A;  5BR8 O;  3THO A;  3SYQ A;  4YIO A;  1EM1 A;  1CXZ B;  1KBH A;  5J2T A;  1VQ5 V;  2E74 B;  4R8C A;  3UM7 A;  1SRY A;  4DK0 A;  4KHP O;  3BFR A;  2X6B A;  4GLX A;  4MTX A;  1YJN V;  3CSX A;  2CTR A;  2PTM A;  1WNS A;  3HKD A;  2WA4 A;  3E83 A;  4H33 A;  3ZX6 A;  3KZI Z;  3TCU A;  2ZE5 A;  3T1H O;  1OCO C;  1N36 O;  4RUF A;  2JEU A;  4X1Y A;  3K5L A;  2F1M A;  3QG5 A;  5LOV A;  1NVP D;  5H6Q A;  2PI5 A;  3ETE A;  4BWA A;  5BZB A;  2P90 A;  2ZM6 B;  5CN0 A;  3P30 A;  2YSU B;  2ZIM A;  2ZE8 A;  5IT9 N;  2Q68 A;  3M7M X;  1NI8 A;  1ZTE A;  3DXR A;  4LFB B;  1QNM A;  1GAX A;  4F6R B;  4TUY B;  3QO8 A;  2YXY A;  3BEH A;  4MW3 A;  4JI4 O;  3JD2 A;  4DV3 B;  3T1Y B;  3CRQ A;  3W7X A;  4X88 A;  4P9O A;  2NLJ C;  1FYJ A;  4GUN A;  3HKE A;  3N2K B;  4RUE A;  1FFX B;  2BSK A;  5EYP B;  3ZED A;  4K8X A;  2DOS A;  3RYI B;  4GKJ O;  4U3F H;  2QA4 V;  5IJ0 A;  2A06 H;  1AR4 A;  4X65 O;  2CTP A;  1I94 O;  4CS4 A;  4GKK B;  2Z5U A;  3H1L H;  5E1A C;  5C8Y A;  4IT5 A;  2F95 B;  4W4L A;  4YHH B;  3CC4 V;  1AR5 A;  3CCR V;  3B77 A;  3B2E E;  3W7S A;  2IJJ A;  3H9V A;  4A5U B;  1LR1 A;  3P3P A;  4GYC B;  4B3S B;  2GV9 A;  1HNZ O;  3LSQ A;  4FLT A;  4CH6 A;  2VS0 A;  4JTD B;  5CA1 A;  3AG2 C;  3GWO A;  2BTQ A;  1FXH A;  4JI8 B;  1QVF U;  2XUM A;  3FAV B;  3SGI A;  2EJR A;  2EJ7 A;  3VQY A;  1M57 C;  2BOC C;  2UXX A;  4L8J A;  2AHY A;  2EIJ B;  2RMK B;  4RQF A;  1AP5 A;  4J7K A;  5KA6 A;  2IJK A;  1CP9 A;  4FM1 A;  3D8C A;  1GN6 A;  2YC0 A;  4ZIB A;  4XDK A;  3QVN A;  1HWY A;  1KP2 A;  4BR6 A;  3JAK B;  3OTF A;  3SJC C;  5CBF A;  2Q6A A;  1QLN A;  2OIE A;  3ZMS A;  1X59 A;  2Q7G A;  5GON B;  1RM1 B;  2PI4 A;  1XRE A;  5AG2 A;  2QKS A;  5JVD A;  1N8R W;  3RYF A;  1BSM A;  4GX2 A;  2JRI A;  4O4L B;  2PUS A;  1NQT A;  1W0J G;  3ABM B;  2WPD G;  4IIJ A;  4I0X A;  2ZM6 O;  2EIL C;  2Y0P A;  1I7F A;  2UU9 O;  1WJZ A;  1KMI Z;  3ZRV A;  1R1B A;  5LA6 A;  1RPO A;  3ZCC A;  4LFB O;  4FIP C;  1KYO F;  4TT3 G;  4LBE C;  1HW7 A;  2X6A A;  3OE7 G;  4MVM A;  4ZKI A;  2ITD C;  3CRM A;  4DV3 O;  3T1Y O;  5L3G A;  3UT5 B;  1XL4 A;  2AZ2 A;  2E5L B;  3ZRX A;  1K4C C;  2OCC C;  2IJI A;  4MVU A;  2JGD B;  2XHB A;  2ATK C;  1K7D A;  4O4I A;  4I7Z B;  2YIC A;  1K97 A;  5LHG A;  3ZHS A;  4FFB B;  3CRC A;  3UO2 A;  4D7T A;  4FJC C;  4RWU A;  3AEI A;  2OTJ V;  1PM9 A;  1SER A;  4QE9 A;  4CS3 A;  3CEI A;  4B08 A;  2QWO B;  1JOY A;  1FXK B;  4GKK O;  2ZD9 A;  4PA7 A;  1TVK A;  3ZHU A;  1WB7 A;  1ZSP A;  2LO1 A;  3LDE A;  4EFE A;  3QNE A;  2CGO A;  4UVB A;  5KUM A;  3H1J H;  3OMN B;  1Z2G A;  2VWJ A;  4B3S O;  2AXT Z;  2OCH A;  4X66 B;  4UUJ C;  2YIA A;  2V1D A;  3E22 B;  4JI8 O;  1S77 D;  1DF5 A;  4YIP A;  1PL0 A;  4HNA B;  5B5E Z;  5C93 A;  4WCE V;  3G6B A;  4FFK A;  5L3B A;  4PA4 A;  2QWQ B;  4NTW A;  2Y4T A;  1JVM A;  3E35 A;  1SA0 A;  3A0H Z;  4DO2 A;  3L73 H;  4WF9 V;  4B3M B;  3WB0 A;  2KB1 A;  4I5S A;  2R9I A;  3E89 A;  1KKC A;  1OCZ B;  3L71 H;  2HHH O;  3OUS A;  3U0Z A;  2GUZ B;  1S5J A;  1JMK C;  3CCE V;  1OCC C;  5LGU A;  1AI5 A;  1D5A A;  4LNU A;  4P9P A;  4X1I B;  4FZ0 A;  1TUB B;  5D5Q A;  4GZR B;  1E1Q G;  1XHX A;  2PYL A;  3H1I H;  4B7E A;  5J2U A;  1DGS A;  1AIL A;  1F23 A;  4MTF A;  1X4T A;  1US6 A;  4X64 O;  1YI2 V;  4LP8 A;  4TV8 A;  3H1K H;  1S5L Z;  4LH7 A;  4ASU G;  4F6E A;  4UCT A;  2UXD B;  3A0R A;  3P3N A;  4LF6 B;  1VF6 A;  4CH5 A;  4DW0 A;  5EC1 C;  1M4U A;  1R3L C;  2HLD G;  1HDJ A;  1ZL8 A;  4QGP A;  1MSW D;  4WFB V;  2HEP A;  2FYU H;  2HVK C;  2WLM A;  4R50 A;  3S3X A;  5HFM A;  5JH7 B;  2EZO A;  4X1K A;  1I5Y A;  3RYC A;  3FX7 A;  1WP7 A;  3IFX A;  2E5L O;  4G28 B;  4CH3 A;  2ZCE A;  5KAF Z;  3AG7 A;  2IU0 A;  4MVO A;  4MVZ A;  2B9Z A;  3CCQ V;  1BT8 A;  1FPO A;  3SPG A;  1P4R A;  1M5I A;  1A32 A;  4DRX A;  2Y69 B;  5KX5 A;  2CTQ A;  4K3A A;  1GN3 A;  4FLY A;  1TAE A;  5EK0 A;  4NVP A;  2IW5 A;  2Y4U A;  2KG7 A;  5IYZ A;  3CP1 A;  2HKO A;  1VEW A;  3DC5 A;  4XBF A;  1VF6 C;  5IE9 A;  5JQG A;  4HAM A;  5EZY A;  5FLX N;  1QLE B;  5GW7 A;  4X66 O;  4BIO A;  4ICG A;  4YXW G;  1GO3 F;  1DTO A;  1DK1 A;  5A2Q N;  5IYB O;  1YIT V;  2ZT9 B;  4AIL C;  3CJH B;  3KCY A;  5F2V O;  5KAI Z;  2WLN A;  5IYD O;  3CYO A;  2YID A;  1XEQ A;  4B3M O;  2DE0 X;  4OXS A;  3CWB H;  1Y74 A;  3RYH B;  5B1B C;  5TIS Z;  3H01 A;  4TWK A;  1UJW B;  2JJ1 G;  5BY1 A;  5ITZ A;  3ZMU A;  4MTG A;  1Y76 B;  2GDS A;  4QIW F;  1K4D C;  1OCO B;  1V54 B;  5IJ9 A;  4LFC B;  3BRC A;  2A0L A;  4RAI A;  3LUT B;  1FAF A;  1MG1 A;  3FYI B;  3K03 A;  2CH7 A;  3SPC A;  2D3O W;  4J9Y B;  5CMU A;  2QGN A;  4MVQ A;  3E8F A;  2UXB B;  1BE3 H;  3SYP A;  4DK1 A;  1XI1 A;  1RFY A;  1JPX A;  2XND G;  3AK3 A;  3ZMZ A;  3K9S A;  4J80 A;  2RJZ A;  4PDM A;  2UXD O;  3TK1 A;  1QCE A;  3LNN A;  3E8B A;  2Q0A A;  4LF6 O;  2ZNI A;  1Q6H A;  3ZMT A;  1JFF A;  2CAZ C;  1GMG A;  4PEL A;  1PP9 H;  4O4J A;  4W4K A;  1FS0 G;  3VQX A;  3LSS A;  4NB5 A;  4DV6 B;  2DWD C;  2HR3 A;  4TV9 B;  5L3C A;  3FB8 C;  1LUW A;  3B4S A;  2WLI A;  2RCV A;  5KA5 A;  2K9P A;  4O2B A;  3ASN B;  4ZHQ A;  5JWP A;  3HKB A;  4X1Y B;  2YIB A;  3L70 H;  2UXC B;  1NTM H;  4WFH A;  4PD4 F;  2DQ0 A;  4X20 A;  4JZG A;  4Q20 A;  2BTO A;  3W7T A;  1EBO A;  4P2Z A;  4QE7 A;  2LQT A;  2P5O A;  3QO5 A;  1SQP H;  3JAW B;  1VQK V;  1V55 B;  4UCO A;  4BIU A;  5B1O A;  3CPW U;  4N23 A;  5IY5 B;  3DGE A;  1M1K W;  1GH6 A;  4JAU A;  3WB2 A;  2R9R B;  3EFF K;  3B8N A;  4UCU A;  2CDY A;  2F43 G;  1HNX O;  3E86 A;  2QR4 A;  1KKD A;  3JAT A;  2JS3 A;  4K8Z A;  3N2G A;  4FLW A;  4JI0 B;  2Q7H A;  3G67 A;  5LXT A;  4UCR A;  3APO A;  5KHG A;  4UVA A;  4WBN A;  2LJ2 A;  3HKC B;  4J11 A;  4KP4 A;  2EIM B;  3U10 A;  2P4K A;  3MHS C;  2XOK G;  3ZHQ A;  4DR7 O;  4EB6 B;  4PDR A;  2WAM A;  4UFZ A;  4C7U A;  3A8T A;  3K79 A;  2HG5 C;  4LFC O;  5CA0 B;  2YI8 A;  1B06 A;  4LH6 A;  4OGQ B;  1TUE B;  2WA3 A;  1H2N A;  3RT3 C;  3BAA A;  1YSC A;  2DYS B;  2O57 A;  3ZS8 C;  5KMG A;  4BIZ A;  3F5W C;  1H38 A;  3RFR A;  2A7W A;  2UXB O;  4DV1 B;  1SQF A;  5JCO A;  2P6J A;  4PA9 A;  1YDX A;  3ZHT A;  1OHH G;  3ZRW A;  1FD9 A;  3EXA A;  5EIB D;  2QWP B;  4ZI7 B;  4PV1 B;  4O2A B;  2HP8 A;  2OCC B;  4DYL A;  5BMV B;  1WN7 A;  2YEV B;  2EIK C;  1XMO B;  3IC7 A;  2HFE C;  4J10 A;  1N4C A;  2ARH A;  3OMA B;  4DV6 O;  3JAR B;  5KLV H;  2LGW A;  2F66 C;  1YVW A;  3AG3 C;  1RSO B;  3K06 A;  4YJ2 A;  5FPR A;  2FTK A;  4B7K A;  1ZLZ A;  1M56 C;  1K9M W;  4JI7 B;  1Q8I A;  4UXN A;  3BA8 A;  3RYF B;  1FKA O;  5FNV A;  3LSU A;  2UXC O;  2YXH A;  4E2L A;  2WLL B;  4DUZ B;  4J9Z B;  4UVC A;  3J81 N;  1S72 V;  1JCH A;  1MMM A;  1OCR B;  3C3S A;  3MD0 A;  3JSN A;  3SR2 C;  5JCO C;  2DYR B;  4JYB A;  1YCI A;  5LA6 B;  2QTO A;  3ZBH A;  1SC5 B;  4Z1M G;  1TGO A;  3I5D A;  1K5S A;  4YJ3 B;  3FB6 C;  4CC5 A;  5LYJ B;  1QR8 A;  5B3S C;  5H2F Z;  1AR1 B;  4JI6 B;  3GVM A;  1OV9 A;  1SQV H;  3L72 H;  3ABL B;  1MZE A;  4OPH A;  4JI0 O;  2H3O A;  1B3Q A;  3CC7 V;  1SZX A;  1S76 D;  4AQY B;  3WG7 C;  2F23 A;  2ZDI A;  1Z5V A;  1KP3 A;  2Z3Y A;  4MSW C;  4LF7 B;  4F6R A;  4TUY A;  2X7R B;  2AHZ A;  1TVK B;  1PNL A;  1AJN A;  3OFN G;  2ETN A;  4CZZ A;  4X62 B;  1IX9 A;  1XL6 A;  1XUQ A;  2ZIO A;  3N2K A;  4DV5 B;  4FLV A;  2CGN A;  2CK3 G;  1FFX A;  3K08 A;  2D2C B;  1AJP A;  2DQ3 A;  5K1P A;  3RYI A;  5H9C A;  4DV1 O;  1NTK H;  3ASO B;  3VQV A;  1R73 A;  1BS3 A;  1GN2 A;  1AI7 A;  1XOU A;  4DXW A;  1KU9 A;  2WSS G;  1SA0 B;  1AJQ A;  2IH3 C;  4JAA A;  3S3W A;  3NXS A;  4NTY A;  4I9Q A;  1AVM A;  1J5E B;  1YZB A;  5LGT A;  2PF4 E;  1BHB A;  3SPH A;  2BCC H;  4NYK A;  1GM8 A;  4L87 A;  2HJF C;  2ZDI C;  1XMO O;  4X89 A;  3KCX A;  1VQM V;  1PPJ H;  1VQ8 V;  5A9G A;  1SQG A;  1CPY A;  1G4Y B;  3QTC A;  1YHQ V;  1IBL B;  2OYQ A;  2W6J G;  1PNK A;  3FAV A;  1IVS A;  3QO7 A;  2W0F C;  2WLH A;  3K9A A;  4KL1 A;  2LP7 A;  3FB5 C;  3CC2 V;  4JI7 O;  4MW8 A;  1YXB A;  1K3E A;  2IU3 A;  4FLZ A;  1JQ0 A;  4DUZ O;  4QPK A;  1URF A;  3K58 A;  3LDD A;  3EHB B;  4YHH O;  2MW2 B;  1VF5 B;  3K0G A;  1L8D A;  2WLJ A;  3L74 H;  1RPR A;  3OW2 U;  3JAK A;  1PKX A;  4LWS A;  1YJW V;  3MHH C;  3X2Q B;  4X9Q A;  2ZE7 A;  2YS8 A;  3RYC B;  2JK5 C;  1SQB H;  3C90 A;  2P22 C;  3FYE B;  5GON A;  2ZR2 A;  3JYC A;  3ZHR A;  1WB8 A;  2V4D A;  3IGA C;  1L1F A;  4JI6 O;  1XQ8 A;  1EZJ A;  2OIG A;  5D5P A;  4O4L A;  2E75 B;  4IL6 Z;  3JAS B;  2H8P C;  4DRX B;  1F4N A;  3WU2 Z;  1K33 A;  1JA8 A;  4NR1 A;  1H2L A;  4AQY O;  1BQZ A;  1KC8 W;  3ZN1 A;  4LF7 O;  3CME V;  1O9G A;  4JI3 B;  2F4V B;  2N05 A;  5K1X A;  1H2M A;  1ENV A;  1UPG A;  2EIJ C;  3O9O A;  3UT5 A;  3IJ4 A;  2XAF A;  2Q7E A;  4X62 O;  2B5U A;  2JGD A;  2VWK A;  1GK9 A;  3ABK B;  4MVS A;  5LP6 B;  4DV5 O;  3F7Y C;  4O4H B;  1ZX3 A;  4FFB A;  1Q3E A;  3K5M A;  4K0K B;  3RN4 A;  3BAB A;  3SPJ A;  1VQ6 V;  3UO3 A;  2DJV A;  1EN4 A;  4JI1 B;  4ABM A;  1RM1 C;  2R70 A;  2QWR B;  2MK3 A;  1FXK A;  3T4D A;  4I50 A;  1IDS A;  4FLX A;  1J5E O;  5IWA B;  1R3J C;  2HVJ C;  2IBZ H;  4ZOL A;  5ITZ B;  3T4Z A;  4XDL A;  3SJB C;  5B1A B;  1R6N A;  3CRA A;  5GTI Z;  4FM0 A;  3VOU A;  4DV0 B;  2LGQ A;  5KHH A;  4OPA A;  1I0H A;  1BHA A;  3JCZ A;  2XTA A;  1IBL O;  3E22 A;  5FL7 G;  3AG1 B;  2RDC A;  1P7B A;  4EEQ A;  4HNA A;  3CCL V;  2CTW A;  3G71 V;  1LNQ A;  1XIL A;  4IHJ B;  2NR5 A;  3UCS C;  1XMQ B;  2K1E A;  2Q67 A;  5LMN B;  4LF5 B;  4NXM B;  3ZN0 A;  1NH2 B;  2R72 A;  3OR7 C;  1WPB A;  3DC6 A;  5DED A;  2JIZ G;  2X6C A;  4D6T H;  4DR2 B;  1Q86 W;  4X1I A;  1Q7Y W;  1FXK C;  4X8A A;  1KD1 W;  2UUA B;  4CBC A;  3RGB A;  5LMU B;  2QKC A;  1HR0 B;  3OUF A;  4UB8 Z;  2W6I G;  1WA8 B;  1T5E A;  4WFG A;  1Q81 W;  1M90 W;  3F5T A;  3CE2 A;  1R3K C;  4JF3 A;  1MNG A;  3L75 H;  4H13 B;  2B1I A;  2ZR3 A;  4WFF A;  4QJF B;  1H8E G;  2EIN C;  5L3D A;  5BR8 B;  1XNQ B;  3U11 A;  1ORQ C;  3WFV A;  3K57 A;  5E79 Z;  3OTO B;  3JAL B;  1P84 F;  1JX9 A;  2M7W A;  4I55 B;  3BCC H;  3M99 B;  4OX9 B;  3CXC U;  5EBL C;  4I4T B;  4PJ0 Z;  3VQW A;  4FZ1 A;  4MS2 A;  5JH7 A;  4JI3 O;  4RQE A;  2P4V A;  2F4V O;  5JJE B;  3F7V C;  1OCZ C;  5KHI A;  1LUV A;  1N36 B;  2UUB B;  5CB4 B;  2Z0A A;  3SYA A;  1SKV A;  4K0K O;  4WFA V; 
#chains in the Genus database with same CATH homology
 4FZ1 A;  3IJ4 A;  4NTX A;  4NYK A;  3N27 A;  2QTS A;  3S3X A;  3S3W A;  2FB5 A;  4NTY A;  4FZ0 A;  4NTW A;  2L35 A;  1WP8 A;  1WP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...