5LMNO

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmnO00
2AGAA 5A2QN 3J81N 1F7YA 4YHHO 2DJVA 4JI6O 5IWAO 1D2DA 2VQFO 2ZKOA 4DV6O 4DV2O 2UXDO 4OPHA 4JI0O 1IBMO 4DV7O 4DUYO 1N32O 4X64O 5BR8O 1NS1A 1DK1A 4GKKO 5IT9N 1R6TA 2N74A 5BY1A 2E5LO 2UUBO 1XMOO 4LF5O 5LMNO 2LW7A 4LF7O 4X66O 1X59A 2FKXA 4LFAO 4OX9O 4JYAO 1FJGO 5LMUO 4DR7O 2F4VO 5LL6Y 2HHHO 3M8AA 4LFCO 4AQYO 4B3SO 4JI7O 4B3RO 1XNQO 4DR4O 4NXNO 1XNRO 1FYJA 4OPAA 2VQEO 4LFBO 4LF8O 3O65A 4A5UB 3F5TA 1IBKO 4DR1O 4LF9O 4DUZO 1N36O 1IBLO 3OTOO 4NXMO 4JI1O 3SDLA 4DV1O 4B3MO 1HNZO 4X65O 3JAMN 4JI5O 4GKJO 5H5NA 3T1HO 2UU9O 4KHPO 1A32A 1G1XB 4X62O 4DV0O 1N34O 5BXZA 4DR5O 3RT3C 1YZBA 2UXCO 2UUAO 1KUQA 4JI8O 2UXBO 4K0KO 2DOSA 1I94O 5FLXN 4DR3O 2UUCO 4LF4O 4JI4O 3J7AU 4YY3O 1AILA 1XEQA 3J80N 2Z0AA 4LF6O 1R1BA 4DR6O 4DV4O 4DV5O 1XMQO 1HNWO 4JI3O 1AB3A 4JI2O 4DR2O 2ZM6O 1N33O 4JV5O 1HNXO 4DV3O 1J5EO 3R66A 3T1YO 1FKAO 1HR0O 2JRIA 4B3TO
chains in the Genus database with same CATH superfamily
4FM1A 2F1MA 5IYBO 5IDJA 1HNZB 2DJVA 2R9IA 2ZKOA 1FXKA 3CWBH 1LUWA 5GONB 1H2LA 3CRQA 1J5EB 4QE9A 1VP7A 1NR1A 4FM0A 3L9DA 2E5LO 2X6CA 4IYIA 5CA3A 1S3JA 2B9ZA 1MA1A 2WLLB 1OCOB 1X59A 2CTQA 4DV5B 4DR7O 5JCOC 3M8AA 2X6AA 3G6BA 2WLIA 4DR4O 1F51A 4D6TH 3JALB 3WFVA 3D3QA 1COWG 2VQEO 4TWKA 1PD3A 2EINB 5LMNB 1OZ0A 3K04A 4JAVA 4A5UB 3CMEV 4LF9O 2RNBA 2EIKB 1Y6XA 5LGUA 2LW1A 3ZRSA 3MAQA 1QCEA 1G4YB 2EIKC 3H1KH 3CXCU 3CXHF 3BA9A 4PA7A 1I7FA 2DW4A 3K03A 1SQPH 1YI2V 4KUMA 1IBKB 4RQEA 4D7SA 3RYFA 4LF7B 1YF2A 1R3IC 4B3MB 3SGIA 4MVQA 3A2FA 3C90A 2UUCO 1BHBA 2RQ6A 4ASUG 3K57A 1FJGB 4DR6O 4TT3G 1BHAA 3LSQA 5CBHA 4X20A 4CH5A 2LQTA 3ICXA 4PDLA 2A3QA 3AG3C 4MW3A 1IBLB 5A2QN 4X1YA 1F7YA 4FIPC 4CS2A 3DXRB 5EBWC 4MTXA 1V55B 3JAKB 3STLC 2P06A 5B1BC 4JV5B 2JDIG 1IDSA 3L71H 5J2UA 1YITV 2CUGA 2IU0A 1FFXB 1R6TA 1WJZA 1PL0A 1WP7A 3ZHTA 4AILC 1H2GA 1OCZC 3JCZA 4DV6B 3AG1B 2WLJA 3AG2C 3H1IH 4YY3B 3ML0A 3AG1C 2DWDC 2HG5C 5KX5A 5K1PA 4W4LA 4O4IA 4FLWA 5TISZ 1RSOA 1M56B 2ZE6A 1W0JG 4HYOA 1SA0B 3NXSA 3HPLC 4MW8A 3KG2A 1Y76B 1K97A 4CH6A 1FYJA 3ZRWA 2E75B 3L74H 4K35A 1FFTB 4OX9B 4LFAB 3W7WA 4NVPA 5CA1B 3R65A 4L87A 1L1FA 2V7QG 4O4JB 3LNMB 4JAAA 1N34O 3FAVB 3JAWB 1OJHA 2JGDB 5C93A 2UUBB 5CBGA 2W0XA 1S0VA 1BGYH 2Z5UA 2EULA 2NN4A 1I94O 4LF4O 2ZD9A 1AILA 2ZE8A 4ZKIA 1R1BA 2P6JA 5C8YB 4NKGB 1HNWO 4Z2WA 4TV9B 1N4CA 4JI2O 1B6QA 2DWEC 3B40A 4Z1VA 5LOVB 2JRIA 4BR6A 3P3PA 3Q4HA 2Z3YA 4TUYB 4CZZA 4FLXA 1KYOF 2CAZC 2H94A 1YEWA 1AP5A 5LGNA 5JWPA 4OPHA 3BCCH 1BQZA 1XOUA 2ZQMA 2XAFA 1K92A 4WF9V 1NU1H 1I5YA 3SJCC 4I4TA 2DYRC 3S3XA 2JGUA 3UM7A 5JH7A 1TUBA 1ZSPA 4TQDA 4EFBA 2YEVB 4GCZA 2BTOA 1KBHA 2NLJC 1P7GA 4JYAO 1KQSU 1JOYA 2ODMA 2JS5A 4Z1MG 2YIBD 3UO2A 4EEQA 2IJHA 2E5LB 1EFRG 4GX0A 1XNRO 5EYPB 4J9YB 3H1LH 3SDLA 1VQ9V 3G80A 3E22A 2PTMA 2QGNA 1YJ9V 1PNKA 3I56V 1WPBA 2Y0PA 3N2GB 4DR4B 4DV0O 3M7MX 3QO5A 1ZUQA 1VQNV 2VQEB 4J80A 2ZXWC 4HZ3A 4JTDB 3BY6A 1KUQA 5GTIZ 1RM1C 4LF9B 3ABTA 5J2TA 4QPKA 3JASA 1YSCA 2C2AA 1QLEB 2ILMA 1ZAUA 2WA3A 1G6UA 1Y74B 4MT8A 1P84F 3K5OA 1WP8A 5B1NA 2QEXV 1CPYA 2DE0X 2UUCB 4DK0A 4X1IB 5KAIZ 3TCUA 5EIBC 3ZIAG 2FB5A 3IC7A 4FK5C 4DR6B 4PI2A 4IIJA 4X1KB 1QVFU 1YVWA 2Y69C 5IY5B 2Y4TA 3LDEA 3K5NA 4GT1A 1ENVA 2ADPA 5KHIA 4E4EA 2QWQB 1L0LH 1JX9A 4LF5O 2XAJA 3K0DA 2WLKA 1YJNV 3CSXA 3OMNB 4WBNB 3KKYA 2QKSA 4K8XA 2KQXA 2EJ7A 3ETGA 3JCUZ 4BIUA 4MTFA 3RYHB 3ZMTA 4DUZO 3BHPA 3OTOO 3T4ZA 4R50A 4GKJO 4X64B 2K1EA 3T1HO 2OYQA 2DMXA 1V54B 5ITZB 2NNUA 2LGQA 1XL6A 4FLZA 2QKCA 5A9GA 4H0LB 4J9ZB 4C7UA 4FLUA 1BSMA 3STZC 1TA8A 4DR3O 2PYLA 3OE7G 2Q8VA 4O2BB 3RYCA 4LNUA 3CCMV 4HNAA 1GRJA 2HJDA 1Z5VA 2ZCEA 4LFCB 1N34B 2A79B 4QIWF 3A0BZ 1TVKB 1AR4A 1QVGU 2YI9A 3IJ4A 2AHZA 2L6LA 4CC5A 2AW9A 3ASOB 1I94B 3O9OA 1FD9A 4LF4B 1ZLZA 3DC6A 1L8DA 3BPZA 3CCQV 4P2ZA 4P30A 2LGWA 4FVMA 4ZI7B 3HKDA 1HNWB 4JI0O 4OXSA 4J7JA 1IBMO 3ABLC 1MOFA 4CH4A 4FZ0A 5IE9A 2UUAB 4XDJA 1XQ8A 3HKBB 1GKFA 2OWOA 2HVJC 3L73H 4IGGA 2Y48A 1H8EG 4I0XA 4KXRA 3W7SA 4XDLA 1H2NA 4DV4B 3UT5B 5K1XA 3CRAA 5KHGA 2YICA 3HKCA 4NXNO 4G27B 5KLVH 3VQXA 3TGUH 4LF8O 1ZTEA 2XAHA 3JYCA 3BRCA 1Q81W 4DR1O 1N36O 1QR9A 4UCTA 4ZOLB 4MVMA 3U11A 2XHBA 3CB2A 3RYIA 4JI5O 1VQOV 1A32A 1KB9F 1XNRB 1AI4A 1H2MA 3AK2A 1SERA 3ETEA 1MMMA 3IC9A 4JI4O 4WFGA 4U3JA 4ZHQA 5LA6A 3HKEA 1JCHA 5EZYA 3K08A 1AB3A 3OTFA 2QDOA 4DR2O 3S3WA 1GH6A 3ZRVA 1LR1A 2CGNA 2M6YA 4JZGA 3T1YO 4J42A 1KU9A 1FKAO 4RAIA 1R6NA 4B3TO 1YXBA 1SS3A 3LUTB 1CP9A 1R3LC 1KP2A 4LP8A 4DRXB 4GYCB 4JASA 3RN4A 1I5XA 4X62B 4DV7O 4DR5B 1N32O 1K9MW 3FFQA 2KG7A 3K5MA 2OCCC 4QE7A 2JEUA 3MD0A 5B5EZ 3TETA 4X89A 4FPPA 5CN0A 3LDCA 3ETDA 1E1RG 3AK3A 1GN6A 1VQMV 4OGQB 2EIJB 3D8CA 3UKMA 1U96A 2PGGA 1NTKH 1WB7A 1SZXA 4RWUA 1NT2B 4I50A 4JI7O 5KAFZ 4O4LB 2QR4A 3OEHG 2Q6AA 4LF5B 3A0RA 4IL6Z 3ABMB 2ZR2A 1CXZB 3E89A 4Q20A 2QM4A 4X20B 3CJHB 3ZJZA 4NXMO 4JI1O 4DV1O 4JPRA 3BEHA 4KL1A 1IX9A 1OCOC 4X1YB 2R9RB 1V9PA 5EC2C 3SJQC 1PKXA 5JQGB 4FFKA 3K59A 3FB6C 1WAZA 4DUZB 5DN6G 2BSKA 3OTOB 5J2UB 4FLTA 2BOCC 4YJ2A 1M93A 3LSUA 4EKWA 1SQVH 2EINC 3QVNA 4GKJB 3ZMUA 3T1HB 4K3AA 3HB3B 1AR5A 4X88A 4EB6A 1O9HA 1AR1B 1ZL8A 5FNVB 1HR0O 2IM9A 4O4IB 1S5HC 2Q7EA 4I7ZB 3KCYA 5LBQA 3ZRXA 3ZMSA 4F6EA 5IJ9A 4JI6O 2B1IA 2YI8A 3EVKA 2UXDO 4G28B 3OM3B 1TGOA 3H01A 3CYOA 1GN4A 4UB8Z 1N8RW 3K9SA 3P32A 5KHKA 1H38A 5IT9N 1NBMG 5GONA 3OAAG 3VBBA 2RN9A 1S5JA 1NQTA 1OV9A 4H13B 1IBMB 2DQ3A 4F6RB 1VQPV 5J9PC 5LP6B 4JTCB 5LMUO 1V55C 1GK9A 2HHHO 2JJ1G 4DO2A 2WLLA 3OR6C 1DTOA 1F4MA 4UV9A 3DGEA 3LNNA 1K3EA 1XDCA 4TOIA 4PDRA 5JCOA 2XTAA 3SYCA 2HJFC 5DM6V 2QJ1A 1OCRB 4UCUA 4LR3A 5D5PA 4PD4F 5GTHZ 2Q73A 4DV2B 2YIAA 3ZN1A 3QTCA 3JALA 2CH7A 3APOA 5FL7G 4QNHB 4NTWA 2EBOA 1VMGA 2H3OA 5EC1C 1BS3A 3F5WC 4J10A 4NXNB 1ORQC 3CCLV 5EBMC 3WB2A 1VF6C 3IAYA 3OMIB 4LF8B 2UXCO 1M56C 1K5QA 4DR1B 1N36B 2BCCH 3FB5C 2G38A 3SPGA 2QM8A 1GO3F 4U7NA 2DOSA 4JI5B 5FPOA 4JAUA 3L72H 1AP6A 1TUBB 4WCEV 5CBFA 1JVMA 4UCSA 5CB4B 3K3WA 3CRMA 1JR9A 1VQ7V 2LO1A 5EBLC 2K9PA 3BABA 2E3CA 2F95B 2DQ0A 2JJ2G 3J81N 4JI4B 4HBNA 3OMAB 4BW5A 2FL4A 5IWAO 4H33A 1SZTA 2QKAA 4NB5A 1AI5A 2Y4UA 1Q82W 5BMVB 4P9OA 1BQ0A 4DR2B 1XREA 1J95A 3DXRA 3RWRD 2YXYA 3E22B 4B3TB 3DSQA 4H37A 3CPWU 4O4HB 1XMOO 3FB7C 3THOA 1M1KW 4KFMA 1FFXA 1XUQA 4DV7B 4CBCA 2ZR3A 4E2LA 2ITCC 2WPDG 3E8BA 2KB1A 5IJ0B 3ABKB 1XNQO 5KHJA 2ETNA 1S77D 2A06H 2N04A 4LFBO 2CTPA 2QM7A 1WNSA 3OR7C 1VF6A 3E86A 1G8MA 1PNMA 3CD6V 1Y76A 2Q4PA 4N21A 1Y67A 3TK1A 1GTOA 4JI7B 1G1XB 1HDJA 3MHHC 3QO8A 1DF4A 3RFRA 1YTFB 4O4JA 4UXNA 5H9CA 3T2MA 3WB0A 4NXMB 1PNLA 4JI1B 4DV1B 3N27A 1IXMA 4JZ2A 4BAYA 2GTAA 4XBFA 4DR7B 2BTQA 2YIBA 2AZ0A 2EZOA 4BIOA 4JI3O 2LP7A 4PHZA 4YJ3B 2PI5A 2P22C 1XBLA 4I55B 3KCXA 1S5LZ 5F2VO 1BL8A 3VQVA 4LH7A 2DYSB 4UVBA 5C8YA 4F4LA 3AK1A 4YHHO 2A0LA 2DYSC 5B3SB 4ABMA 4R6ZA 1JFFA 1WA8A 3B09A 3SPHA 2Q68A 3MDSA 1W0KG 3RBZA 4DUYO 2F93B 1QLEC 2ATKC 3JARB 3W7XA 4TUYA 1HR0B 4MVUA 3DC5A 4FFBA 2N74A 2UXNA 2IJIA 4JF3A 4JI6B 5B1AB 3FKSG 1H2KA 2GBOA 3VQWA 1B3QA 3AEIA 4TV8B 3W7TA 2YEVA 2RJZA 1YTFD 4B3SO 3TJTA 4GX2A 1R3JC 2WWWA 4J11A 4B3RO 2UXXA 2VRZA 5IYZB 4HNAB 2HVKC 1KD1W 2CTWA 3CCUV 5JVDB 5IY5C 5LYJA 3MHSC 5DECA 4GLXA 3F5TA 4YIPA 1VQKV 4J7ZA 1Y66A 1Q5OA 1HNZO 1Q43A 1AJQA 2HHHB 2F43G 3OFNG 5H5NA 1S76D 4KHPO 5E79Z 1SQGA 2PYJA 3U10A 3RT3C 1AJPA 3IGAC 3QF7A 3VQYA 5KA6A 5LHGA 3GVMA 5LHHA 3L70H 2IW5A 1X4TA 1AVMA 3N2GA 3D36C 5FPRA 3GWKC 3SPCA 4IHJB 3J80N 4MVOA 3CRCA 2H8PC 4MVRA 5LXTA 4DV5O 3CC7V 3JATA 1THZA 2UXCB 1NZ6A 3CHXA 2ZM6O 2YDEA 1E79G 1R3KC 2LJ2A 1MNGA 1V54C 3SPJA 5L3EA 2AGAA 3T1CA 3RVZA 1YDXA 2CTRA 1Y74A 2IU3A 4U3FH 4B08A 1AI7A 3HKCB 4PELA 3E2EA 2VQFO 1K4CC 2GSMB 2HLDG 4Q6GA 3M99B 2HP8A 3LSSA 2Q9LA 5BR8O 2ADQB 2FMLA 4X8AA 4GKKO 3T4DA 1NH2B 5IWAB 3H1HH 2EJRA 1HP8A 4LF7O 4FLVA 4X66O 1FPOA 3ASOC 3KZIZ 1K73W 3OD4A 1JPXA 4DK1A 1I08A 3WU2Z 2VS0A 1VQ6V 4XDKA 1FJGO 2ZNJA 4JI2B 1TAEA 1IXBA 1D5NA 3A0HZ 4ZHQB 1E1QG 4H44B 4WBNA 3FYIB 2B5UA 4UVAA 1GM9A 3O65A 2WLNA 1IBLO 3UO3A 1PM9A 3ASNB 4UFZA 3A8TA 4JTAB 4X65O 3JAMN 1Q86W 3PN1A 4ICGA 3I5DA 1PP9H 1XNQB 3SYOA 1M90W 5CA0B 3RYHA 4UV8A 1JMKC 4O2AB 4ZIBA 4LFBB 1JJOA 3E35A 3X2QB 1VARA 4K0KO 4BIZA 1M5IA 3OW2U 1AJNA 1QNMA 4UCVA 4JYAB 2P4KA 2KG7B 5FLXN 2YXLA 4YY3O 2EIMB 4LF6O 4B7KA 5ITZA 2XASA 3ZCCA 1M9NA 2EIMC 1B04A 2WLHA 1AROP 4PA9A 1NVPB 4O2BA 2QE7G 1NH2D 1FXKB 3LDDA 3H9VA 1KP3A 1P4RA 1W59A 1OCCB 1URFA 2CDYA 1ROPA 1OCCC 1TVKA 3B8NA 1WPXA 4L8JA 1F23A 3G67A 1VF5B 4JI3B 2OCHA 4DV0B 4MTGA 2ZDIC 2P5OA 3CEIA 3FX7A 3IFXA 5KHHA 4ZI7A 1RP3B 3E83A 1SQBH 2QTOA 2UUBO 5KUKA 3WG7B 4WFBV 2WLIB 3WG7C 2ZIMA 2XT9A 1KKDA 4DUYB 1GAXA 2BSKB 3G6EV 1BMFG 5IYDO 5LL6Y 3JD1A 3AG4B 3FB8C 5B1OA 2W6IG 4PJ0Z 1EN6A 4MSWC 1WB8A 4OPAA 3AG4C 3UT5A 4KP4A 2B1GA 3ZBHA 1U97A 3BA8A 4UCOA 1ZL8B 2MW2B 1IVSA 2JIZG 3DTUB 3E8HA 1M57B 4B3SB 1NVPD 3RYFB 4B3RB 2EIJC 1LUVA 5IJ9B 2PF4E 3N2KA 2P90A 4ZOLA 2OTLV 3JD4A 2DN9A 3E8GA 4BW9A 3ABMC 2VWJA 4GZRB 3J7AU 2PUSA 4B7EA 1XEQA 2Z0AA 4DW1A 4KHPB 4JYCA 1MZFA 4YIOA 3H1JH 1EZJA 2VWKA 5LGTA 1RPOA 2QWNB 4PA3A 1KKCA 2ZDIA 2L35A 5EK0A 4MS2A 5IYCO 4GX5A 1H2SB 1ZWIC 3OT7A 4WFHA 2ZM6B 2QWOB 3B2EE 3U0ZA 4CS3A 4UVCA 1DK1A 4DRXA 3CX5F 2CH7B 4LWSA 2ZE5A 4FM2A 1Z2GA 5KX5B 1SF9A 2FYUH 4LC1A 3ETQA 1RSOB 2VQFB 4DR3B 2GUZA 2X6BA 5KMGA 1NTMH 1T5EA 2E74B 1UFIA 1YJWV 2WAMA 3SYQA 3ZRWB 2RCVA 3ZHRA 2JEXA 5BR8B 4GKKB 3F7YC 2JK5C 3P30A 1XHZA 3B4SA 1OHHG 4LBEC 1BT8A 1EN4A 3CCSV 2IBZH 4X66B 3BVOA 2BOBC 5KA5A 2GV9A 4O4LA 2YUAA 1MABG 4JI0B 1DLBA 1Y4MA 5L3DA 2XAGA 2UU9O 1SESA 1R6KA 2IJKA 2QWPB 5LP6C 2A9HA 3CJHA 3AG3B 1YZBA 4GUNA 2HEPA 2P7TC 2YSUB 2M7WA 3UQ8A 3K5LA 1LNQA 3APQA 2YIDA 3E8FA 1JQ0A 1OCRC 4X65B 2PY5A 5B1BB 4HAMA 2F23A 5JQGA 1SRYA 1XMQO 3Q4HB 1UPGA 4RO2A 2O57A 2R72A 4DYLA 4J7KA 2W0FC 1OCZB 4K0KB 3AG2B 2E76B 2LFSA 4MTOA 1QR8A 1XI1A 2QSAA 4ZBMA 3ZS8C 1VQ8V 4LF6B 4I4TB 3ABUA 1EM1A 5FNVA 5JH7B 4RUEA 1QQCA 1JJ2U 4YXWG 4NR1A 4U7OA 3SR2C 4IYHA 4X64O 3ZHSA 1NS1A 2QA4V 1QHTA 1SQQH 1EZVH 4QJFB 4MVZA 5H2FZ 1SC5B 2AXTZ 1MG1A 1Q3EA 1WN7A 1Q7YW 2FKXA 2HFEC 2X7RB 3VOUA 3SYPA 3ZMZA 2D3OW 3CRRA 2F4VO 1NTZH 1KECA 3AG7A 3JD3A 1KC8W 4LFCO 3F7VC 2YXHA 3T1YB 1VQ5V 5DEDA 2ZNIA 2BTQB 1RPRA 4FZ1A 1IZ3A 4AHCA 4F6RA 1MSWD 5LP6A 2IH3C 3JAKA 1GM8A 4G2KA 1SQXH 4J41A 2YS8A 5B66Z 4WFFA 3SYAA 4I9QA 5E1AC 3RVYA 3P3NA 1P7BA 3QNEA 1IURA 4GX1A 1N32B 2Q0OC 5J2TB 3JASB 3L75H 5BXZA 4N23A 2Y0IA 4UUJC 3CCJV 5BZBA 3CCRV 2NR5A 1JFFB 1I0HA 1WA8B 1XHXA 2UUAO 1XILA 3ABKC 2Q7GA 1D5AA 1QBZA 4JI8O 4UCRA 2UXBO 1FAFA 3FYEB 4FMTA 2AZ2A 2CK3G 1P49A 1SA0A 4FFBB 4PDVA 5CMUA 3QO7A 4DV4O 2DYRB 3EHBB 2ZT9B 1NI8A 4JGSA 3K06A 4NTYA 1N33O 2V1DA 4MVSA 4DV3O 5CA1A 1HNXO 2OIEA 3R66A 4TQFA 4IIJB 1K5SA 4DXWA 2W6JG 4P9PA 3ZN0A 2MK3A 5CB4A 1UJWB 4PA4A 3WB1A 1N0NA 1L0NH 3FAVA 2FTKA 3JAWA 1K4DC 2JGDA 2PZSA 1GM7A 1GMGA 2Q7HA 4X9QA 5LYJB 4PI0A 1RFYA 1S72V 4BWAA 4I9WA 2R9AA 5BMVA 1K7DA 4QGPA 1EBOA 1EN5A 3JSLA 4LCUC 4CC6A 3TXQA 1NJIW 3JD2A 2EZPA 4TV9A 3QG5A 2EX3A 5LOVA 3CS5A 2BE3A 5B3SC 3OEEG 2ZXWB 3CCVV 4O4HA 2KKWA 2A7WA 4AQYO 1SETA 1RM1B 3NR7A 1VQLV 1CEZA 5LXTB 5IJ0A 1VF7A 3JATB 2F66C 1GN2A 3RW0A 2UXDB 3ZHUA 5B1AC 1NR7A 2GHYA 3CCEV 3CMAV 2XNDG 4X62O 4NTXA 4DR5O 3RYCB 2OTJV 4LNUB 4WFEA 3K0GA 4AI8A 1Q90D 2JS3A 2IJJA 2WA4A 4PA6A 3B8MA 5LMUB 2UU9B 1Q6HA 2WSSG 2Y69B 1MSDA 5EYPA 2HKOA 1BZKA 2GDSA 4FJCC 1XL4A 2LFRA 1FXVA 1J5EO 3HKDB 3TXSA 1PL4A 2R70A 5LHIA 4RUFA 5JJNB 5L3GA 3CP1A 1D2DA 4CH3A 1R73A 4QPJA 4YJ3A 1DF5A 3K9AA 4I55A 1XMQB 1TUEB 3BAAA 4D7TA 4PV1B 5AG2A 4I0XB 3B77A 1VIBA 1KMIZ 1SKVA 5L3FA 3JARA 5LMNO 3BFRA 1O9GA 1M4UA 1AI6A 3G4SV 1Z5WA 1NKDA 4WFAV 2X0LA 3CC4V 4X1IA 5EIBD 5GW7A 5H6QA 2ZINA 4IT5A 4TV8A 3RYIB 1PPJH 4PDMA 1VEWA 2ARHA 3HR0A 1IBKO 4X1KA 1YCIA 1Q8IA 2RDCA 1SQFA 4B3MO 1K33A 5IYZA 2F4VB 5KUMA 3K79A 5HFLA 1US6A 2ZIOA 5HFMA 1Q6UA 5JVDA 1H8HG 1JA8A 1QU7A 2GTSA 5L3CA 3OGIB 3D3IA 4RQFA 2EILB 4TSFG 4U3JB 1XMOB 5LA6B 3ZHQA 2EILC 3EXAA 3HKEB 2XOKG 5EZYB 1HWYA 1PV0A 2QWRB 3OGCC 3ABLB 5JJEB 1BCCH 3D36A 3ASNC 3ZMVA 2XUMA 2RMKB 3OUSA 2IH1C 2XAQA 4JV5O 2OT5A 4IHJA 4JI8B 2UXBB 4DW0A 3PJSK 3X2QC 4W4KA 2YC0A 4JYYA 2CE4A 4DV6O 4DV2O 4LH6A 2OIGA 2Q67A 2ZE7A 1N33B 1YIJV 1HNXB 4DV3B 4R8CA 3C3SA 3UCSC 1WLEA 1B06A 3G71V 3JD0A 2Q5ZA 5BY1A 3OUFA 2Q0AA 3K58A 2V4DA 1FXHA 1FXKC 1K34A 2LW7A 3N2KB 4I50B 2AHYA 1W2BU 1QLNA 4OX9O 4I5SA 1VQ4V 4LFAO 1HW7A 3JSNA 3SPIA 2QTSA 2CGOA 4JYBA 1N0JA 2ITDC 2JVDA 4NYKA 3SJAC 1BE3H 1GN3A 4YHHB 4FLYA 1MZEA 1FS0G 4UB6Z 3W7UA 1DGSA 3GB7C 4K8ZA 4AQYB 3HKBA 4YJ2B 3CE2A 3RGBA 3EFFK 3I55V 2P67A 3GWOA 1YHQV 3ZEDA 3FD9A 2N05A 1Q6IA 3ZHVA 4CS4A 1K8AW 3CC2V 4R7CA 4EB6B 1F4NA 2PI4A 3ZX6A 5CA0A 4LWSB 4O2AA 3C3TA 5D5QA 2HR3A 2KSDA 2P4VA 5H6RA 2GUZB 2OCCB 5KMGB 5JJJB 1ZX3A 1M57C 2WLMA 2D2CB 5L3BA 2Q69A 4EFEA 3SJBC
chains in the Genus database with same CATH topology
2AGAA 5A2QN 3J81N 1F7YA 4YHHO 2DJVA 4JI6O 5IWAO 1D2DA 2VQFO 2ZKOA 4DV6O 4DV2O 2UXDO 4OPHA 4JI0O 1IBMO 4DV7O 4DUYO 1N32O 4X64O 5BR8O 1NS1A 1DK1A 4GKKO 5IT9N 1R6TA 2N74A 5BY1A 2E5LO 2UUBO 1XMOO 4LF5O 5LMNO 2LW7A 4LF7O 4X66O 1X59A 2FKXA 4LFAO 4OX9O 4JYAO 1FJGO 5LMUO 4DR7O 2F4VO 5LL6Y 2HHHO 3M8AA 4LFCO 4AQYO 4B3SO 4JI7O 4B3RO 1XNQO 4DR4O 4NXNO 1XNRO 1FYJA 4OPAA 2VQEO 4LFBO 4LF8O 3O65A 4A5UB 3F5TA 1IBKO 4DR1O 4LF9O 4DUZO 1N36O 1IBLO 3OTOO 4NXMO 4JI1O 3SDLA 4DV1O 4B3MO 1HNZO 4X65O 3JAMN 4JI5O 4GKJO 5H5NA 3T1HO 2UU9O 4KHPO 1A32A 1G1XB 4X62O 4DV0O 1N34O 5BXZA 4DR5O 3RT3C 1YZBA 2UXCO 2UUAO 1KUQA 4JI8O 2UXBO 4K0KO 2DOSA 1I94O 5FLXN 4DR3O 2UUCO 4LF4O 4JI4O 3J7AU 4YY3O 1AILA 1XEQA 3J80N 2Z0AA 4LF6O 1R1BA 4DR6O 4DV4O 4DV5O 1XMQO 1HNWO 4JI3O 1AB3A 4JI2O 4DR2O 2ZM6O 1N33O 4JV5O 1HNXO 4DV3O 1J5EO 3R66A 3T1YO 1FKAO 1HR0O 2JRIA 4B3TO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  5A2Q N;  3J81 N;  1F7Y A;  4YHH O;  2DJV A;  4JI6 O;  5IWA O;  1D2D A;  2VQF O;  2ZKO A;  4DV6 O;  4DV2 O;  2UXD O;  4OPH A;  4JI0 O;  1IBM O;  4DV7 O;  4DUY O;  1N32 O;  4X64 O;  5BR8 O;  1NS1 A;  1DK1 A;  4GKK O;  5IT9 N;  1R6T A;  2N74 A;  5BY1 A;  2E5L O;  2UUB O;  1XMO O;  4LF5 O;  5LMN O;  2LW7 A;  4LF7 O;  4X66 O;  1X59 A;  2FKX A;  4LFA O;  4OX9 O;  4JYA O;  1FJG O;  5LMU O;  4DR7 O;  2F4V O;  5LL6 Y;  2HHH O;  3M8A A;  4LFC O;  4AQY O;  4B3S O;  4JI7 O;  4B3R O;  1XNQ O;  4DR4 O;  4NXN O;  1XNR O;  1FYJ A;  4OPA A;  2VQE O;  4LFB O;  4LF8 O;  3O65 A;  4A5U B;  3F5T A;  1IBK O;  4DR1 O;  4LF9 O;  4DUZ O;  1N36 O;  1IBL O;  3OTO O;  4NXM O;  4JI1 O;  3SDL A;  4DV1 O;  4B3M O;  1HNZ O;  4X65 O;  3JAM N;  4JI5 O;  4GKJ O;  5H5N A;  3T1H O;  2UU9 O;  4KHP O;  1A32 A;  1G1X B;  4X62 O;  4DV0 O;  1N34 O;  5BXZ A;  4DR5 O;  3RT3 C;  1YZB A;  2UXC O;  2UUA O;  1KUQ A;  4JI8 O;  2UXB O;  4K0K O;  2DOS A;  1I94 O;  5FLX N;  4DR3 O;  2UUC O;  4LF4 O;  4JI4 O;  3J7A U;  4YY3 O;  1AIL A;  1XEQ A;  3J80 N;  2Z0A A;  4LF6 O;  1R1B A;  4DR6 O;  4DV4 O;  4DV5 O;  1XMQ O;  1HNW O;  4JI3 O;  1AB3 A;  4JI2 O;  4DR2 O;  2ZM6 O;  1N33 O;  4JV5 O;  1HNX O;  4DV3 O;  1J5E O;  3R66 A;  3T1Y O;  1FKA O;  1HR0 O;  2JRI A;  4B3T O; 
#chains in the Genus database with same CATH topology
 4FM1 A;  2F1M A;  5IYB O;  5IDJ A;  1HNZ B;  2DJV A;  2R9I A;  2ZKO A;  1FXK A;  3CWB H;  1LUW A;  5GON B;  1H2L A;  3CRQ A;  1J5E B;  4QE9 A;  1VP7 A;  1NR1 A;  4FM0 A;  3L9D A;  2E5L O;  2X6C A;  4IYI A;  5CA3 A;  1S3J A;  2B9Z A;  1MA1 A;  2WLL B;  1OCO B;  1X59 A;  2CTQ A;  4DV5 B;  4DR7 O;  5JCO C;  3M8A A;  2X6A A;  3G6B A;  2WLI A;  4DR4 O;  1F51 A;  4D6T H;  3JAL B;  3WFV A;  3D3Q A;  1COW G;  2VQE O;  4TWK A;  1PD3 A;  2EIN B;  5LMN B;  1OZ0 A;  3K04 A;  4JAV A;  4A5U B;  3CME V;  4LF9 O;  2RNB A;  2EIK B;  1Y6X A;  5LGU A;  2LW1 A;  3ZRS A;  3MAQ A;  1QCE A;  1G4Y B;  2EIK C;  3H1K H;  3CXC U;  3CXH F;  3BA9 A;  4PA7 A;  1I7F A;  2DW4 A;  3K03 A;  1SQP H;  1YI2 V;  4KUM A;  1IBK B;  4RQE A;  4D7S A;  3RYF A;  4LF7 B;  1YF2 A;  1R3I C;  4B3M B;  3SGI A;  4MVQ A;  3A2F A;  3C90 A;  2UUC O;  1BHB A;  2RQ6 A;  4ASU G;  3K57 A;  1FJG B;  4DR6 O;  4TT3 G;  1BHA A;  3LSQ A;  5CBH A;  4X20 A;  4CH5 A;  2LQT A;  3ICX A;  4PDL A;  2A3Q A;  3AG3 C;  4MW3 A;  1IBL B;  5A2Q N;  4X1Y A;  1F7Y A;  4FIP C;  4CS2 A;  3DXR B;  5EBW C;  4MTX A;  1V55 B;  3JAK B;  3STL C;  2P06 A;  5B1B C;  4JV5 B;  2JDI G;  1IDS A;  3L71 H;  5J2U A;  1YIT V;  2CUG A;  2IU0 A;  1FFX B;  1R6T A;  1WJZ A;  1PL0 A;  1WP7 A;  3ZHT A;  4AIL C;  1H2G A;  1OCZ C;  3JCZ A;  4DV6 B;  3AG1 B;  2WLJ A;  3AG2 C;  3H1I H;  4YY3 B;  3ML0 A;  3AG1 C;  2DWD C;  2HG5 C;  5KX5 A;  5K1P A;  4W4L A;  4O4I A;  4FLW A;  5TIS Z;  1RSO A;  1M56 B;  2ZE6 A;  1W0J G;  4HYO A;  1SA0 B;  3NXS A;  3HPL C;  4MW8 A;  3KG2 A;  1Y76 B;  1K97 A;  4CH6 A;  1FYJ A;  3ZRW A;  2E75 B;  3L74 H;  4K35 A;  1FFT B;  4OX9 B;  4LFA B;  3W7W A;  4NVP A;  5CA1 B;  3R65 A;  4L87 A;  1L1F A;  2V7Q G;  4O4J B;  3LNM B;  4JAA A;  1N34 O;  3FAV B;  3JAW B;  1OJH A;  2JGD B;  5C93 A;  2UUB B;  5CBG A;  2W0X A;  1S0V A;  1BGY H;  2Z5U A;  2EUL A;  2NN4 A;  1I94 O;  4LF4 O;  2ZD9 A;  1AIL A;  2ZE8 A;  4ZKI A;  1R1B A;  2P6J A;  5C8Y B;  4NKG B;  1HNW O;  4Z2W A;  4TV9 B;  1N4C A;  4JI2 O;  1B6Q A;  2DWE C;  3B40 A;  4Z1V A;  5LOV B;  2JRI A;  4BR6 A;  3P3P A;  3Q4H A;  2Z3Y A;  4TUY B;  4CZZ A;  4FLX A;  1KYO F;  2CAZ C;  2H94 A;  1YEW A;  1AP5 A;  5LGN A;  5JWP A;  4OPH A;  3BCC H;  1BQZ A;  1XOU A;  2ZQM A;  2XAF A;  1K92 A;  4WF9 V;  1NU1 H;  1I5Y A;  3SJC C;  4I4T A;  2DYR C;  3S3X A;  2JGU A;  3UM7 A;  5JH7 A;  1TUB A;  1ZSP A;  4TQD A;  4EFB A;  2YEV B;  4GCZ A;  2BTO A;  1KBH A;  2NLJ C;  1P7G A;  4JYA O;  1KQS U;  1JOY A;  2ODM A;  2JS5 A;  4Z1M G;  2YIB D;  3UO2 A;  4EEQ A;  2IJH A;  2E5L B;  1EFR G;  4GX0 A;  1XNR O;  5EYP B;  4J9Y B;  3H1L H;  3SDL A;  1VQ9 V;  3G80 A;  3E22 A;  2PTM A;  2QGN A;  1YJ9 V;  1PNK A;  3I56 V;  1WPB A;  2Y0P A;  3N2G B;  4DR4 B;  4DV0 O;  3M7M X;  3QO5 A;  1ZUQ A;  1VQN V;  2VQE B;  4J80 A;  2ZXW C;  4HZ3 A;  4JTD B;  3BY6 A;  1KUQ A;  5GTI Z;  1RM1 C;  4LF9 B;  3ABT A;  5J2T A;  4QPK A;  3JAS A;  1YSC A;  2C2A A;  1QLE B;  2ILM A;  1ZAU A;  2WA3 A;  1G6U A;  1Y74 B;  4MT8 A;  1P84 F;  3K5O A;  1WP8 A;  5B1N A;  2QEX V;  1CPY A;  2DE0 X;  2UUC B;  4DK0 A;  4X1I B;  5KAI Z;  3TCU A;  5EIB C;  3ZIA G;  2FB5 A;  3IC7 A;  4FK5 C;  4DR6 B;  4PI2 A;  4IIJ A;  4X1K B;  1QVF U;  1YVW A;  2Y69 C;  5IY5 B;  2Y4T A;  3LDE A;  3K5N A;  4GT1 A;  1ENV A;  2ADP A;  5KHI A;  4E4E A;  2QWQ B;  1L0L H;  1JX9 A;  4LF5 O;  2XAJ A;  3K0D A;  2WLK A;  1YJN V;  3CSX A;  3OMN B;  4WBN B;  3KKY A;  2QKS A;  4K8X A;  2KQX A;  2EJ7 A;  3ETG A;  3JCU Z;  4BIU A;  4MTF A;  3RYH B;  3ZMT A;  4DUZ O;  3BHP A;  3OTO O;  3T4Z A;  4R50 A;  4GKJ O;  4X64 B;  2K1E A;  3T1H O;  2OYQ A;  2DMX A;  1V54 B;  5ITZ B;  2NNU A;  2LGQ A;  1XL6 A;  4FLZ A;  2QKC A;  5A9G A;  4H0L B;  4J9Z B;  4C7U A;  4FLU A;  1BSM A;  3STZ C;  1TA8 A;  4DR3 O;  2PYL A;  3OE7 G;  2Q8V A;  4O2B B;  3RYC A;  4LNU A;  3CCM V;  4HNA A;  1GRJ A;  2HJD A;  1Z5V A;  2ZCE A;  4LFC B;  1N34 B;  2A79 B;  4QIW F;  3A0B Z;  1TVK B;  1AR4 A;  1QVG U;  2YI9 A;  3IJ4 A;  2AHZ A;  2L6L A;  4CC5 A;  2AW9 A;  3ASO B;  1I94 B;  3O9O A;  1FD9 A;  4LF4 B;  1ZLZ A;  3DC6 A;  1L8D A;  3BPZ A;  3CCQ V;  4P2Z A;  4P30 A;  2LGW A;  4FVM A;  4ZI7 B;  3HKD A;  1HNW B;  4JI0 O;  4OXS A;  4J7J A;  1IBM O;  3ABL C;  1MOF A;  4CH4 A;  4FZ0 A;  5IE9 A;  2UUA B;  4XDJ A;  1XQ8 A;  3HKB B;  1GKF A;  2OWO A;  2HVJ C;  3L73 H;  4IGG A;  2Y48 A;  1H8E G;  4I0X A;  4KXR A;  3W7S A;  4XDL A;  1H2N A;  4DV4 B;  3UT5 B;  5K1X A;  3CRA A;  5KHG A;  2YIC A;  3HKC A;  4NXN O;  4G27 B;  5KLV H;  3VQX A;  3TGU H;  4LF8 O;  1ZTE A;  2XAH A;  3JYC A;  3BRC A;  1Q81 W;  4DR1 O;  1N36 O;  1QR9 A;  4UCT A;  4ZOL B;  4MVM A;  3U11 A;  2XHB A;  3CB2 A;  3RYI A;  4JI5 O;  1VQO V;  1A32 A;  1KB9 F;  1XNR B;  1AI4 A;  1H2M A;  3AK2 A;  1SER A;  3ETE A;  1MMM A;  3IC9 A;  4JI4 O;  4WFG A;  4U3J A;  4ZHQ A;  5LA6 A;  3HKE A;  1JCH A;  5EZY A;  3K08 A;  1AB3 A;  3OTF A;  2QDO A;  4DR2 O;  3S3W A;  1GH6 A;  3ZRV A;  1LR1 A;  2CGN A;  2M6Y A;  4JZG A;  3T1Y O;  4J42 A;  1KU9 A;  1FKA O;  4RAI A;  1R6N A;  4B3T O;  1YXB A;  1SS3 A;  3LUT B;  1CP9 A;  1R3L C;  1KP2 A;  4LP8 A;  4DRX B;  4GYC B;  4JAS A;  3RN4 A;  1I5X A;  4X62 B;  4DV7 O;  4DR5 B;  1N32 O;  1K9M W;  3FFQ A;  2KG7 A;  3K5M A;  2OCC C;  4QE7 A;  2JEU A;  3MD0 A;  5B5E Z;  3TET A;  4X89 A;  4FPP A;  5CN0 A;  3LDC A;  3ETD A;  1E1R G;  3AK3 A;  1GN6 A;  1VQM V;  4OGQ B;  2EIJ B;  3D8C A;  3UKM A;  1U96 A;  2PGG A;  1NTK H;  1WB7 A;  1SZX A;  4RWU A;  1NT2 B;  4I50 A;  4JI7 O;  5KAF Z;  4O4L B;  2QR4 A;  3OEH G;  2Q6A A;  4LF5 B;  3A0R A;  4IL6 Z;  3ABM B;  2ZR2 A;  1CXZ B;  3E89 A;  4Q20 A;  2QM4 A;  4X20 B;  3CJH B;  3ZJZ A;  4NXM O;  4JI1 O;  4DV1 O;  4JPR A;  3BEH A;  4KL1 A;  1IX9 A;  1OCO C;  4X1Y B;  2R9R B;  1V9P A;  5EC2 C;  3SJQ C;  1PKX A;  5JQG B;  4FFK A;  3K59 A;  3FB6 C;  1WAZ A;  4DUZ B;  5DN6 G;  2BSK A;  3OTO B;  5J2U B;  4FLT A;  2BOC C;  4YJ2 A;  1M93 A;  3LSU A;  4EKW A;  1SQV H;  2EIN C;  3QVN A;  4GKJ B;  3ZMU A;  3T1H B;  4K3A A;  3HB3 B;  1AR5 A;  4X88 A;  4EB6 A;  1O9H A;  1AR1 B;  1ZL8 A;  5FNV B;  1HR0 O;  2IM9 A;  4O4I B;  1S5H C;  2Q7E A;  4I7Z B;  3KCY A;  5LBQ A;  3ZRX A;  3ZMS A;  4F6E A;  5IJ9 A;  4JI6 O;  2B1I A;  2YI8 A;  3EVK A;  2UXD O;  4G28 B;  3OM3 B;  1TGO A;  3H01 A;  3CYO A;  1GN4 A;  4UB8 Z;  1N8R W;  3K9S A;  3P32 A;  5KHK A;  1H38 A;  5IT9 N;  1NBM G;  5GON A;  3OAA G;  3VBB A;  2RN9 A;  1S5J A;  1NQT A;  1OV9 A;  4H13 B;  1IBM B;  2DQ3 A;  4F6R B;  1VQP V;  5J9P C;  5LP6 B;  4JTC B;  5LMU O;  1V55 C;  1GK9 A;  2HHH O;  2JJ1 G;  4DO2 A;  2WLL A;  3OR6 C;  1DTO A;  1F4M A;  4UV9 A;  3DGE A;  3LNN A;  1K3E A;  1XDC A;  4TOI A;  4PDR A;  5JCO A;  2XTA A;  3SYC A;  2HJF C;  5DM6 V;  2QJ1 A;  1OCR B;  4UCU A;  4LR3 A;  5D5P A;  4PD4 F;  5GTH Z;  2Q73 A;  4DV2 B;  2YIA A;  3ZN1 A;  3QTC A;  3JAL A;  2CH7 A;  3APO A;  5FL7 G;  4QNH B;  4NTW A;  2EBO A;  1VMG A;  2H3O A;  5EC1 C;  1BS3 A;  3F5W C;  4J10 A;  4NXN B;  1ORQ C;  3CCL V;  5EBM C;  3WB2 A;  1VF6 C;  3IAY A;  3OMI B;  4LF8 B;  2UXC O;  1M56 C;  1K5Q A;  4DR1 B;  1N36 B;  2BCC H;  3FB5 C;  2G38 A;  3SPG A;  2QM8 A;  1GO3 F;  4U7N A;  2DOS A;  4JI5 B;  5FPO A;  4JAU A;  3L72 H;  1AP6 A;  1TUB B;  4WCE V;  5CBF A;  1JVM A;  4UCS A;  5CB4 B;  3K3W A;  3CRM A;  1JR9 A;  1VQ7 V;  2LO1 A;  5EBL C;  2K9P A;  3BAB A;  2E3C A;  2F95 B;  2DQ0 A;  2JJ2 G;  3J81 N;  4JI4 B;  4HBN A;  3OMA B;  4BW5 A;  2FL4 A;  5IWA O;  4H33 A;  1SZT A;  2QKA A;  4NB5 A;  1AI5 A;  2Y4U A;  1Q82 W;  5BMV B;  4P9O A;  1BQ0 A;  4DR2 B;  1XRE A;  1J95 A;  3DXR A;  3RWR D;  2YXY A;  3E22 B;  4B3T B;  3DSQ A;  4H37 A;  3CPW U;  4O4H B;  1XMO O;  3FB7 C;  3THO A;  1M1K W;  4KFM A;  1FFX A;  1XUQ A;  4DV7 B;  4CBC A;  2ZR3 A;  4E2L A;  2ITC C;  2WPD G;  3E8B A;  2KB1 A;  5IJ0 B;  3ABK B;  1XNQ O;  5KHJ A;  2ETN A;  1S77 D;  2A06 H;  2N04 A;  4LFB O;  2CTP A;  2QM7 A;  1WNS A;  3OR7 C;  1VF6 A;  3E86 A;  1G8M A;  1PNM A;  3CD6 V;  1Y76 A;  2Q4P A;  4N21 A;  1Y67 A;  3TK1 A;  1GTO A;  4JI7 B;  1G1X B;  1HDJ A;  3MHH C;  3QO8 A;  1DF4 A;  3RFR A;  1YTF B;  4O4J A;  4UXN A;  5H9C A;  3T2M A;  3WB0 A;  4NXM B;  1PNL A;  4JI1 B;  4DV1 B;  3N27 A;  1IXM A;  4JZ2 A;  4BAY A;  2GTA A;  4XBF A;  4DR7 B;  2BTQ A;  2YIB A;  2AZ0 A;  2EZO A;  4BIO A;  4JI3 O;  2LP7 A;  4PHZ A;  4YJ3 B;  2PI5 A;  2P22 C;  1XBL A;  4I55 B;  3KCX A;  1S5L Z;  5F2V O;  1BL8 A;  3VQV A;  4LH7 A;  2DYS B;  4UVB A;  5C8Y A;  4F4L A;  3AK1 A;  4YHH O;  2A0L A;  2DYS C;  5B3S B;  4ABM A;  4R6Z A;  1JFF A;  1WA8 A;  3B09 A;  3SPH A;  2Q68 A;  3MDS A;  1W0K G;  3RBZ A;  4DUY O;  2F93 B;  1QLE C;  2ATK C;  3JAR B;  3W7X A;  4TUY A;  1HR0 B;  4MVU A;  3DC5 A;  4FFB A;  2N74 A;  2UXN A;  2IJI A;  4JF3 A;  4JI6 B;  5B1A B;  3FKS G;  1H2K A;  2GBO A;  3VQW A;  1B3Q A;  3AEI A;  4TV8 B;  3W7T A;  2YEV A;  2RJZ A;  1YTF D;  4B3S O;  3TJT A;  4GX2 A;  1R3J C;  2WWW A;  4J11 A;  4B3R O;  2UXX A;  2VRZ A;  5IYZ B;  4HNA B;  2HVK C;  1KD1 W;  2CTW A;  3CCU V;  5JVD B;  5IY5 C;  5LYJ A;  3MHS C;  5DEC A;  4GLX A;  3F5T A;  4YIP A;  1VQK V;  4J7Z A;  1Y66 A;  1Q5O A;  1HNZ O;  1Q43 A;  1AJQ A;  2HHH B;  2F43 G;  3OFN G;  5H5N A;  1S76 D;  4KHP O;  5E79 Z;  1SQG A;  2PYJ A;  3U10 A;  3RT3 C;  1AJP A;  3IGA C;  3QF7 A;  3VQY A;  5KA6 A;  5LHG A;  3GVM A;  5LHH A;  3L70 H;  2IW5 A;  1X4T A;  1AVM A;  3N2G A;  3D36 C;  5FPR A;  3GWK C;  3SPC A;  4IHJ B;  3J80 N;  4MVO A;  3CRC A;  2H8P C;  4MVR A;  5LXT A;  4DV5 O;  3CC7 V;  3JAT A;  1THZ A;  2UXC B;  1NZ6 A;  3CHX A;  2ZM6 O;  2YDE A;  1E79 G;  1R3K C;  2LJ2 A;  1MNG A;  1V54 C;  3SPJ A;  5L3E A;  2AGA A;  3T1C A;  3RVZ A;  1YDX A;  2CTR A;  1Y74 A;  2IU3 A;  4U3F H;  4B08 A;  1AI7 A;  3HKC B;  4PEL A;  3E2E A;  2VQF O;  1K4C C;  2GSM B;  2HLD G;  4Q6G A;  3M99 B;  2HP8 A;  3LSS A;  2Q9L A;  5BR8 O;  2ADQ B;  2FML A;  4X8A A;  4GKK O;  3T4D A;  1NH2 B;  5IWA B;  3H1H H;  2EJR A;  1HP8 A;  4LF7 O;  4FLV A;  4X66 O;  1FPO A;  3ASO C;  3KZI Z;  1K73 W;  3OD4 A;  1JPX A;  4DK1 A;  1I08 A;  3WU2 Z;  2VS0 A;  1VQ6 V;  4XDK A;  1FJG O;  2ZNJ A;  4JI2 B;  1TAE A;  1IXB A;  1D5N A;  3A0H Z;  4ZHQ B;  1E1Q G;  4H44 B;  4WBN A;  3FYI B;  2B5U A;  4UVA A;  1GM9 A;  3O65 A;  2WLN A;  1IBL O;  3UO3 A;  1PM9 A;  3ASN B;  4UFZ A;  3A8T A;  4JTA B;  4X65 O;  3JAM N;  1Q86 W;  3PN1 A;  4ICG A;  3I5D A;  1PP9 H;  1XNQ B;  3SYO A;  1M90 W;  5CA0 B;  3RYH A;  4UV8 A;  1JMK C;  4O2A B;  4ZIB A;  4LFB B;  1JJO A;  3E35 A;  3X2Q B;  1VAR A;  4K0K O;  4BIZ A;  1M5I A;  3OW2 U;  1AJN A;  1QNM A;  4UCV A;  4JYA B;  2P4K A;  2KG7 B;  5FLX N;  2YXL A;  4YY3 O;  2EIM B;  4LF6 O;  4B7K A;  5ITZ A;  2XAS A;  3ZCC A;  1M9N A;  2EIM C;  1B04 A;  2WLH A;  1ARO P;  4PA9 A;  1NVP B;  4O2B A;  2QE7 G;  1NH2 D;  1FXK B;  3LDD A;  3H9V A;  1KP3 A;  1P4R A;  1W59 A;  1OCC B;  1URF A;  2CDY A;  1ROP A;  1OCC C;  1TVK A;  3B8N A;  1WPX A;  4L8J A;  1F23 A;  3G67 A;  1VF5 B;  4JI3 B;  2OCH A;  4DV0 B;  4MTG A;  2ZDI C;  2P5O A;  3CEI A;  3FX7 A;  3IFX A;  5KHH A;  4ZI7 A;  1RP3 B;  3E83 A;  1SQB H;  2QTO A;  2UUB O;  5KUK A;  3WG7 B;  4WFB V;  2WLI B;  3WG7 C;  2ZIM A;  2XT9 A;  1KKD A;  4DUY B;  1GAX A;  2BSK B;  3G6E V;  1BMF G;  5IYD O;  5LL6 Y;  3JD1 A;  3AG4 B;  3FB8 C;  5B1O A;  2W6I G;  4PJ0 Z;  1EN6 A;  4MSW C;  1WB8 A;  4OPA A;  3AG4 C;  3UT5 A;  4KP4 A;  2B1G A;  3ZBH A;  1U97 A;  3BA8 A;  4UCO A;  1ZL8 B;  2MW2 B;  1IVS A;  2JIZ G;  3DTU B;  3E8H A;  1M57 B;  4B3S B;  1NVP D;  3RYF B;  4B3R B;  2EIJ C;  1LUV A;  5IJ9 B;  2PF4 E;  3N2K A;  2P90 A;  4ZOL A;  2OTL V;  3JD4 A;  2DN9 A;  3E8G A;  4BW9 A;  3ABM C;  2VWJ A;  4GZR B;  3J7A U;  2PUS A;  4B7E A;  1XEQ A;  2Z0A A;  4DW1 A;  4KHP B;  4JYC A;  1MZF A;  4YIO A;  3H1J H;  1EZJ A;  2VWK A;  5LGT A;  1RPO A;  2QWN B;  4PA3 A;  1KKC A;  2ZDI A;  2L35 A;  5EK0 A;  4MS2 A;  5IYC O;  4GX5 A;  1H2S B;  1ZWI C;  3OT7 A;  4WFH A;  2ZM6 B;  2QWO B;  3B2E E;  3U0Z A;  4CS3 A;  4UVC A;  1DK1 A;  4DRX A;  3CX5 F;  2CH7 B;  4LWS A;  2ZE5 A;  4FM2 A;  1Z2G A;  5KX5 B;  1SF9 A;  2FYU H;  4LC1 A;  3ETQ A;  1RSO B;  2VQF B;  4DR3 B;  2GUZ A;  2X6B A;  5KMG A;  1NTM H;  1T5E A;  2E74 B;  1UFI A;  1YJW V;  2WAM A;  3SYQ A;  3ZRW B;  2RCV A;  3ZHR A;  2JEX A;  5BR8 B;  4GKK B;  3F7Y C;  2JK5 C;  3P30 A;  1XHZ A;  3B4S A;  1OHH G;  4LBE C;  1BT8 A;  1EN4 A;  3CCS V;  2IBZ H;  4X66 B;  3BVO A;  2BOB C;  5KA5 A;  2GV9 A;  4O4L A;  2YUA A;  1MAB G;  4JI0 B;  1DLB A;  1Y4M A;  5L3D A;  2XAG A;  2UU9 O;  1SES A;  1R6K A;  2IJK A;  2QWP B;  5LP6 C;  2A9H A;  3CJH A;  3AG3 B;  1YZB A;  4GUN A;  2HEP A;  2P7T C;  2YSU B;  2M7W A;  3UQ8 A;  3K5L A;  1LNQ A;  3APQ A;  2YID A;  3E8F A;  1JQ0 A;  1OCR C;  4X65 B;  2PY5 A;  5B1B B;  4HAM A;  2F23 A;  5JQG A;  1SRY A;  1XMQ O;  3Q4H B;  1UPG A;  4RO2 A;  2O57 A;  2R72 A;  4DYL A;  4J7K A;  2W0F C;  1OCZ B;  4K0K B;  3AG2 B;  2E76 B;  2LFS A;  4MTO A;  1QR8 A;  1XI1 A;  2QSA A;  4ZBM A;  3ZS8 C;  1VQ8 V;  4LF6 B;  4I4T B;  3ABU A;  1EM1 A;  5FNV A;  5JH7 B;  4RUE A;  1QQC A;  1JJ2 U;  4YXW G;  4NR1 A;  4U7O A;  3SR2 C;  4IYH A;  4X64 O;  3ZHS A;  1NS1 A;  2QA4 V;  1QHT A;  1SQQ H;  1EZV H;  4QJF B;  4MVZ A;  5H2F Z;  1SC5 B;  2AXT Z;  1MG1 A;  1Q3E A;  1WN7 A;  1Q7Y W;  2FKX A;  2HFE C;  2X7R B;  3VOU A;  3SYP A;  3ZMZ A;  2D3O W;  3CRR A;  2F4V O;  1NTZ H;  1KEC A;  3AG7 A;  3JD3 A;  1KC8 W;  4LFC O;  3F7V C;  2YXH A;  3T1Y B;  1VQ5 V;  5DED A;  2ZNI A;  2BTQ B;  1RPR A;  4FZ1 A;  1IZ3 A;  4AHC A;  4F6R A;  1MSW D;  5LP6 A;  2IH3 C;  3JAK A;  1GM8 A;  4G2K A;  1SQX H;  4J41 A;  2YS8 A;  5B66 Z;  4WFF A;  3SYA A;  4I9Q A;  5E1A C;  3RVY A;  3P3N A;  1P7B A;  3QNE A;  1IUR A;  4GX1 A;  1N32 B;  2Q0O C;  5J2T B;  3JAS B;  3L75 H;  5BXZ A;  4N23 A;  2Y0I A;  4UUJ C;  3CCJ V;  5BZB A;  3CCR V;  2NR5 A;  1JFF B;  1I0H A;  1WA8 B;  1XHX A;  2UUA O;  1XIL A;  3ABK C;  2Q7G A;  1D5A A;  1QBZ A;  4JI8 O;  4UCR A;  2UXB O;  1FAF A;  3FYE B;  4FMT A;  2AZ2 A;  2CK3 G;  1P49 A;  1SA0 A;  4FFB B;  4PDV A;  5CMU A;  3QO7 A;  4DV4 O;  2DYR B;  3EHB B;  2ZT9 B;  1NI8 A;  4JGS A;  3K06 A;  4NTY A;  1N33 O;  2V1D A;  4MVS A;  4DV3 O;  5CA1 A;  1HNX O;  2OIE A;  3R66 A;  4TQF A;  4IIJ B;  1K5S A;  4DXW A;  2W6J G;  4P9P A;  3ZN0 A;  2MK3 A;  5CB4 A;  1UJW B;  4PA4 A;  3WB1 A;  1N0N A;  1L0N H;  3FAV A;  2FTK A;  3JAW A;  1K4D C;  2JGD A;  2PZS A;  1GM7 A;  1GMG A;  2Q7H A;  4X9Q A;  5LYJ B;  4PI0 A;  1RFY A;  1S72 V;  4BWA A;  4I9W A;  2R9A A;  5BMV A;  1K7D A;  4QGP A;  1EBO A;  1EN5 A;  3JSL A;  4LCU C;  4CC6 A;  3TXQ A;  1NJI W;  3JD2 A;  2EZP A;  4TV9 A;  3QG5 A;  2EX3 A;  5LOV A;  3CS5 A;  2BE3 A;  5B3S C;  3OEE G;  2ZXW B;  3CCV V;  4O4H A;  2KKW A;  2A7W A;  4AQY O;  1SET A;  1RM1 B;  3NR7 A;  1VQL V;  1CEZ A;  5LXT B;  5IJ0 A;  1VF7 A;  3JAT B;  2F66 C;  1GN2 A;  3RW0 A;  2UXD B;  3ZHU A;  5B1A C;  1NR7 A;  2GHY A;  3CCE V;  3CMA V;  2XND G;  4X62 O;  4NTX A;  4DR5 O;  3RYC B;  2OTJ V;  4LNU B;  4WFE A;  3K0G A;  4AI8 A;  1Q90 D;  2JS3 A;  2IJJ A;  2WA4 A;  4PA6 A;  3B8M A;  5LMU B;  2UU9 B;  1Q6H A;  2WSS G;  2Y69 B;  1MSD A;  5EYP A;  2HKO A;  1BZK A;  2GDS A;  4FJC C;  1XL4 A;  2LFR A;  1FXV A;  1J5E O;  3HKD B;  3TXS A;  1PL4 A;  2R70 A;  5LHI A;  4RUF A;  5JJN B;  5L3G A;  3CP1 A;  1D2D A;  4CH3 A;  1R73 A;  4QPJ A;  4YJ3 A;  1DF5 A;  3K9A A;  4I55 A;  1XMQ B;  1TUE B;  3BAA A;  4D7T A;  4PV1 B;  5AG2 A;  4I0X B;  3B77 A;  1VIB A;  1KMI Z;  1SKV A;  5L3F A;  3JAR A;  5LMN O;  3BFR A;  1O9G A;  1M4U A;  1AI6 A;  3G4S V;  1Z5W A;  1NKD A;  4WFA V;  2X0L A;  3CC4 V;  4X1I A;  5EIB D;  5GW7 A;  5H6Q A;  2ZIN A;  4IT5 A;  4TV8 A;  3RYI B;  1PPJ H;  4PDM A;  1VEW A;  2ARH A;  3HR0 A;  1IBK O;  4X1K A;  1YCI A;  1Q8I A;  2RDC A;  1SQF A;  4B3M O;  1K33 A;  5IYZ A;  2F4V B;  5KUM A;  3K79 A;  5HFL A;  1US6 A;  2ZIO A;  5HFM A;  1Q6U A;  5JVD A;  1H8H G;  1JA8 A;  1QU7 A;  2GTS A;  5L3C A;  3OGI B;  3D3I A;  4RQF A;  2EIL B;  4TSF G;  4U3J B;  1XMO B;  5LA6 B;  3ZHQ A;  2EIL C;  3EXA A;  3HKE B;  2XOK G;  5EZY B;  1HWY A;  1PV0 A;  2QWR B;  3OGC C;  3ABL B;  5JJE B;  1BCC H;  3D36 A;  3ASN C;  3ZMV A;  2XUM A;  2RMK B;  3OUS A;  2IH1 C;  2XAQ A;  4JV5 O;  2OT5 A;  4IHJ A;  4JI8 B;  2UXB B;  4DW0 A;  3PJS K;  3X2Q C;  4W4K A;  2YC0 A;  4JYY A;  2CE4 A;  4DV6 O;  4DV2 O;  4LH6 A;  2OIG A;  2Q67 A;  2ZE7 A;  1N33 B;  1YIJ V;  1HNX B;  4DV3 B;  4R8C A;  3C3S A;  3UCS C;  1WLE A;  1B06 A;  3G71 V;  3JD0 A;  2Q5Z A;  5BY1 A;  3OUF A;  2Q0A A;  3K58 A;  2V4D A;  1FXH A;  1FXK C;  1K34 A;  2LW7 A;  3N2K B;  4I50 B;  2AHY A;  1W2B U;  1QLN A;  4OX9 O;  4I5S A;  1VQ4 V;  4LFA O;  1HW7 A;  3JSN A;  3SPI A;  2QTS A;  2CGO A;  4JYB A;  1N0J A;  2ITD C;  2JVD A;  4NYK A;  3SJA C;  1BE3 H;  1GN3 A;  4YHH B;  4FLY A;  1MZE A;  1FS0 G;  4UB6 Z;  3W7U A;  1DGS A;  3GB7 C;  4K8Z A;  4AQY B;  3HKB A;  4YJ2 B;  3CE2 A;  3RGB A;  3EFF K;  3I55 V;  2P67 A;  3GWO A;  1YHQ V;  3ZED A;  3FD9 A;  2N05 A;  1Q6I A;  3ZHV A;  4CS4 A;  1K8A W;  3CC2 V;  4R7C A;  4EB6 B;  1F4N A;  2PI4 A;  3ZX6 A;  5CA0 A;  4LWS B;  4O2A A;  3C3T A;  5D5Q A;  2HR3 A;  2KSD A;  2P4V A;  5H6R A;  2GUZ B;  2OCC B;  5KMG B;  5JJJ B;  1ZX3 A;  1M57 C;  2WLM A;  2D2C B;  5L3B A;  2Q69 A;  4EFE A;  3SJB C; 
#chains in the Genus database with same CATH homology
 2AGA A;  5A2Q N;  3J81 N;  1F7Y A;  4YHH O;  2DJV A;  4JI6 O;  5IWA O;  1D2D A;  2VQF O;  2ZKO A;  4DV6 O;  4DV2 O;  2UXD O;  4OPH A;  4JI0 O;  1IBM O;  4DV7 O;  4DUY O;  1N32 O;  4X64 O;  5BR8 O;  1NS1 A;  1DK1 A;  4GKK O;  5IT9 N;  1R6T A;  2N74 A;  5BY1 A;  2E5L O;  2UUB O;  1XMO O;  4LF5 O;  5LMN O;  2LW7 A;  4LF7 O;  4X66 O;  1X59 A;  2FKX A;  4LFA O;  4OX9 O;  4JYA O;  1FJG O;  5LMU O;  4DR7 O;  2F4V O;  5LL6 Y;  2HHH O;  3M8A A;  4LFC O;  4AQY O;  4B3S O;  4JI7 O;  4B3R O;  1XNQ O;  4DR4 O;  4NXN O;  1XNR O;  1FYJ A;  4OPA A;  2VQE O;  4LFB O;  4LF8 O;  3O65 A;  4A5U B;  3F5T A;  1IBK O;  4DR1 O;  4LF9 O;  4DUZ O;  1N36 O;  1IBL O;  3OTO O;  4NXM O;  4JI1 O;  3SDL A;  4DV1 O;  4B3M O;  1HNZ O;  4X65 O;  3JAM N;  4JI5 O;  4GKJ O;  5H5N A;  3T1H O;  2UU9 O;  4KHP O;  1A32 A;  1G1X B;  4X62 O;  4DV0 O;  1N34 O;  5BXZ A;  4DR5 O;  3RT3 C;  1YZB A;  2UXC O;  2UUA O;  1KUQ A;  4JI8 O;  2UXB O;  4K0K O;  2DOS A;  1I94 O;  5FLX N;  4DR3 O;  2UUC O;  4LF4 O;  4JI4 O;  3J7A U;  4YY3 O;  1AIL A;  1XEQ A;  3J80 N;  2Z0A A;  4LF6 O;  1R1B A;  4DR6 O;  4DV4 O;  4DV5 O;  1XMQ O;  1HNW O;  4JI3 O;  1AB3 A;  4JI2 O;  4DR2 O;  2ZM6 O;  1N33 O;  4JV5 O;  1HNX O;  4DV3 O;  1J5E O;  3R66 A;  3T1Y O;  1FKA O;  1HR0 O;  2JRI A;  4B3T O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...