5LMNO

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmnO00
4LF8O 4DV4O 2UXDO 1HR0O 1N36O 2E5LO 4DV1O 2JRIA 2FKXA 1G1XB 4YY3O 5IWAO 4JI5O 4GKJO 2DOSA 4AQYO 4X64O 4K0KO 5FLXN 1D2DA 1R1BA 5LMNO 1FJGO 1I94O 1XMQO 1HNWO 4DUZO 4DV6O 1HNZO 2UUBO 1R6TA 2UU9O 1AILA 3M8AA 2ZKOA 2ZM6O 3SDLA 4A5UB 4OPAA 5LMUO 4DV3O 3OTOO 4B3TO 2LW7A 3RT3C 4JI0O 1N34O 1XEQA 5H5NA 1F7YA 4B3SO 1XNRO 4JYAO 2UXBO 1YZBA 2UXCO 4LF6O 1A32A 3JAMN 4DUYO 2AGAA 2DJVA 2VQEO 4JI4O 4JI8O 3J81N 1DK1A 4DR5O 1NS1A 4DR3O 4NXMO 4LF9O 1X59A 4NXNO 4DV0O 4JI2O 1N33O 1FYJA 1J5EO 4DV5O 4KHPO 4LF7O 1XMOO 4B3MO 4DR2O 2UUCO 4LFCO 1KUQA 4LFBO 4YHHO 4JI6O 4JI7O 4DR7O 4DV2O 4GKKO 1IBMO 2VQFO 3F5TA 4OPHA 1IBKO 4DR6O 1HNXO 3T1HO 5BXZA 4X65O 3R66A 2N74A 4X66O 1XNQO 2F4VO 4DR4O 1AB3A 5IT9N 4JI1O 2Z0AA 4DV7O 3T1YO 5LL6Y 2UUAO 4LF5O 1N32O 1FKAO 3J7AU 5A2QN 4JI3O 3O65A 4LF4O 4OX9O 4B3RO 5BY1A 4LFAO 4X62O 5BR8O 2HHHO 3J80N 4DR1O 1IBLO 4JV5O
chains in the Genus database with same CATH superfamily
2H3OA 3ZIAG 4RQFA 2LO1A 4I9WA 4MW3A 1EN5A 1M93A 4QE9A 2B9ZA 3B8NA 3ZX6A 1QVFU 3K03A 4CS4A 1H8HG 1J5EB 2P90A 2DYSC 2WLKA 3RN4A 4UCVA 1WB8A 1R73A 3C3TA 1P49A 2EIMC 2GTAA 5B66Z 2YICA 3SDLA 1QNMA 1XREA 5IJ0A 1YCIA 2ZDIA 1R3KC 2GUZA 3E35A 4PI2A 2EIKB 2YIDA 2JGDB 4LF6O 2EILC 1G6UA 5FPOA 1SERA 2YIBA 2OIGA 3LDDA 1FJGB 3FYEB 4HYOA 4X9QA 5CA3A 2CE4A 3WB2A 2Y0PA 2P67A 2AHZA 4OGQB 3ZHUA 5IJ9B 5JJNB 4LR3A 5J2UB 3CHXA 1IBMO 1AVMA 3QNEA 4H33A 2F4VB 4I4TA 5CN0A 4DRXA 1I08A 3JALB 4YIPA 2N74A 3UKMA 1NVPD 1L1FA 2P5OA 4LBEC 3ZHSA 1MMMA 1VF6C 1NR1A 4LF4B 4I50B 2Z0AA 3A2FA 4KUMA 5LL6Y 2FB5A 3QO8A 4JI3B 1L0NH 4GT1A 4I50A 3G4SV 4LFCB 5LBQA 4OX9O 1S5HC 1XL6A 1VEWA 2AZ0A 2YEVB 3CPWU 5LGTA 2VQFB 2CDYA 4J11A 2XAGA 1NU1H 1GAXA 4CH6A 3BRCA 4G28B 2IH1C 1M57C 4JGSA 4UVAA 3ZMSA 2B1GA 4DV6B 2YI9A 1QLEC 4P9OA 1URFA 1ZL8A 1F51A 2WLHA 3CRCA 3ZJZA 4CH3A 4HAMA 2IU0A 3QF7A 3HKDA 3H1IH 4MTXA 1WP7A 1ZAUA 5IYZB 5LGNA 2ZINA 4LFBB 2YS8A 1N8RW 2XAFA 4OXSA 1Y76A 2ZR2A 4A5UB 2QM8A 4KHPB 4F6RA 2RJZA 1XNRO 3RYCB 1YHQV 4K0KB 3B40A 2XASA 2A3QA 2IJIA 3W7UA 5EZYB 3IGAC 4DUZB 1NZ6A 3M7MX 1AI6A 3ML0A 1JPXA 3ABLC 1N33O 3CCLV 5IDJA 4DW0A 1RFYA 1SZTA 1TGOA 1YJNV 4BW5A 3RYCA 3H9VA 2JGDA 3AG7A 1US6A 2UU9B 1JX9A 4MSWC 1M1KW 3I56V 3G6EV 2HR3A 4UB8Z 3CCQV 5LYJA 2AW9A 3AG4C 4MT8A 2EILB 3HPLC 1H2SB 4FFBA 2RN9A 2WLMA 1VARA 3CCVV 2P06A 3ASOB 2OTJV 1BMFG 3CSXA 3E22B 3K3WA 4FJCC 4QPJA 4RUFA 3Q4HA 2CTRA 2JS5A 4J7JA 1T5EA 5IY5B 1LNQA 3HKBA 5EIBD 2WLLA 5BR8O 3K5MA 1CPYA 4AI8A 4YJ2A 4FLWA 4DR1O 1GN2A 3KZIZ 1K33A 2YI8A 3C90A 3L71H 1N36O 3HKEB 2YC0A 1KYOF 2KQXA 4BIOA 4JI8B 1WJZA 1QU7A 2A9HA 3SPJA 4X1YB 4AQYO 4P30A 3SYQA 2BTQB 5ITZB 2Q73A 4LP8A 4WFFA 3BA9A 2Q69A 5L3GA 3OTOB 1YSCA 2OCHA 1K9MW 2HFEC 1VQPV 2Q7HA 2UU9O 5JJEB 2ZNJA 4W4LA 3LSSA 2EIKC 4ICGA 1BT8A 2LW7A 1FD9A 1VQKV 5LGUA 1FXVA 3CCSV 2HG5C 4LH7A 3FFQA 2NN4A 3AG1C 2XHBA 2O57A 1HNZB 4LF6B 3HKCB 3L74H 3BPZA 3JD3A 1XQ8A 4HZ3A 3H1KH 5LP6B 3BHPA 2WAMA 1SQFA 2BTOA 4DV2O 1RPRA 4UV8A 2Q9LA 2DYRB 4U7OA 4DR6O 2BSKA 2KSDA 2EBOA 4X65O 3CB2A 3R66A 4W4KA 1S76D 4RQEA 4WFAV 4CH4A 3B4SA 2F43G 5KHKA 4DUYB 4O4HA 4MS2A 1U96A 1GK9A 4FFBB 1Q6UA 4IGGA 2YSUB 3WU2Z 2UXDO 1MA1A 4IT5A 2PI5A 2KG7A 2BOBC 2P4KA 2X6CA 2LP7A 2QR4A 1JR9A 4QNHB 5CA1A 2ILMA 3OR7C 4ASUG 5K1PA 2GUZB 3BAAA 5B1AB 1NH2D 3WG7B 3KG2A 1Q43A 1IBMB 2Y69C 1VF5B 3MD0A 3X2QC 5DECA 4F6EA 3TGUH 2VWJA 1BQZA 1I0HA 3B77A 1K92A 4JYAO 3DC6A 1IZ3A 3BEHA 4I0XB 1SS3A 4B7KA 1XMQB 3B8MA 3HKDB 3TETA 4NTYA 5KHJA 4JTDB 2Q6AA 4KL1A 1XL4A 2XUMA 1QLNA 4PI0A 1PP9H 5IWAB 2RCVA 1PNKA 3ZRVA 4TUYB 4NKGB 4YHHO 4JI7O 4JI1B 4XDJA 3G80A 1VF7A 5H6RA 4O2BB 1JJOA 1HNXO 3S3XA 3IC9A 4HNAB 1BZKA 3SJQC 4GKKB 3TCUA 4GX5A 3F7VC 1FKAO 4TQDA 3ABMB 1JFFA 2ZDIC 2VQEB 1OCRB 3ETEA 4X62O 5EYPA 5C8YB 1Q81W 3W7XA 4DV4O 3G67A 1OCCC 1JVMA 1THZA 3JSLA 2H8PC 1CP9A 1SC5B 4O4IB 2YUAA 1WPBA 2HJDA 4FZ1A 2ZIMA 1VQ8V 4JI2B 4ZOLB 2JK5C 4JASA 2QWPB 1OCZC 4JI6B 1FFXB 1IVSA 3RGBA 1N4CA 1F4NA 1R6TA 1RSOB 1VQNV 4H13B 1Z2GA 5LYJB 3ZHVA 4PDMA 3U10A 1H2MA 3CJHA 1YZBA 4YXWG 1ZUQA 4DV3B 2XAJA 4XBFA 1BS3A 4O4JA 4UB6Z 1N0NA 2UXXA 2UUBB 3OW2U 2R9IA 3MDSA 2KB1A 3CC7V 2ZCEA 1WP8A 5KX5A 2EJ7A 3ASNB 4ZKIA 4X62B 3UQ8A 5KHHA 5LA6B 2UUCO 1KUQA 3VOUA 3EFFK 3N2KB 4IHJB 3I5DA 1Y76B 3RWRD 4LF5B 5AG2A 1UPGA 1ORQC 3OEEG 1FPOA 3E89A 1COWG 5D5PA 5IYZA 3ZHRA 4FLVA 2XOKG 2RMKB 5EC2C 1MNGA 1Y6XA 2YXHA 4NB5A 4TUYA 4PA4A 1SQBH 4UVCA 4F6RB 4QIWF 4FPPA 1JMKC 1V55B 1MSDA 4D7SA 5L3FA 3OAAG 2N04A 4JV5O 1IXMA 3H01A 1HR0O 4AILC 3SPIA 2Y48A 4JI4B 5KHGA 3RYIB 3IAYA 1XUQA 1Y74B 2Z3YA 3OEHG 5J2TB 1LR1A 2YXLA 3P3PA 1ZLZA 1I94O 5DN6G 4LNUA 1KKCA 1XHZA 2IM9A 1WLEA 2QEXV 1U97A 3K79A 3M8AA 4GCZA 2ZKOA 2EIMB 3JD2A 4DV3O 3P32A 2WLJA 4K35A 3UT5A 5E79Z 1OCRC 2DYRC 2D2CB 4DR5O 3KCYA 5L3DA 3SYCA 3FKSG 5LP6C 2C2AA 1GN3A 2QM4A 3JYCA 3HR0A 2UXNA 1Z5VA 3HKBB 1XMOO 5IYCO 1YTFB 3OTFA 3ZRWB 1P7BA 2QA4V 1SZXA 5JCOC 3K08A 1SF9A 3MHSC 3KKYA 4E2LA 4U7NA 4ABMA 2IJKA 5H9CA 3WG7C 4B3MB 3JATA 1XOUA 3SJBC 3F7YC 2Y0IA 1E79G 2HKOA 3JASB 5LXTB 3VQWA 3FB5C 1OHHG 4AHCA 4NXMB 4DV7O 1Y66A 4MVZA 1R3LC 4UCTA 4B7EA 3T1YB 4CBCA 4QPKA 1JOYA 1O9HA 4BAYA 4R50A 1QVGU 4QGPA 1K97A 4X8AA 2WA4A 2OWOA 1KC8W 4WFHA 2JS3A 3CC2V 4EEQA 5C93A 1Q3EA 4KP4A 1N32B 1G1XB 4YY3O 3CEIA 2YIAA 2BOCC 2RNBA 1JFFB 4PA9A 1RP3B 1N0JA 1QQCA 4O4IA 4DV0B 1K7DA 3T4DA 4WBNB 1TUBA 3ABMC 2E75B 1NTKH 3K5NA 2XT9A 1Y67A 2ZM6O 2QTSA 2LQTA 4FLZA 3L73H 3AG1B 4PA6A 4YJ3A 3OTOO 1AP6A 5LMNB 4JYAB 1F7YA 1M4UA 2ZE5A 4AQYB 1B06A 4H44B 4JI4O 2A0LA 2ADQB 4DK1A 5IE9A 5FNVB 1KD1W 3K57A 4JZGA 3OT7A 1B3QA 1NR7A 4DV0O 5FNVA 2K1EA 5L3CA 2B1IA 4F4LA 4U3FH 3OMAB 1OZ0A 3E8FA 1TUEB 3JCZA 4JZ2A 1HNWB 4H37A 2GV9A 3JALA 4UV9A 2ZXWC 3SPCA 3AG3C 2F93B 1W2BU 4YJ2B 3JD0A 1JJ2U 1AB3A 4O4HB 2F1MA 4MVRA 3T4ZA 4LF5O 4MTGA 5CMUA 3GWKC 1VQ4V 3MHHC 3ETGA 1NQTA 1VF6A 3H1HH 3CJHB 4DV7B 3JSNA 1DLBA 4EFBA 4FLTA 2EZPA 1OCZB 1J95A 2KG7B 2Q8VA 1CXZB 2YIBD 3OGIB 3BVOA 1HDJA 4DR6B 1M9NA 3AG2B 4ZOLA 1SA0A 2EINC 1QHTA 2EIJC 1M90W 2W0FC 4TV8A 3CD6V 2HEPA 4FFKA 1Q5OA 5KUMA 4K0KO 1OCCB 2Y4UA 3F5WC 1D2DA 3JAKB 1X4TA 1IDSA 4B3TB 3ABKC 1K34A 3BABA 1R6KA 4P2ZA 4K8ZA 5EIBC 3K59A 4DR5B 3TK1A 2E5LB 4ZBMA 5B1BB 4I55B 2ZE6A 4EKWA 1NJIW 2XAQA 2OTLV 3RT3C 1KP3A 4FK5C 4MTFA 4BIUA 3RW0A 4UXNA 1RM1C 1P4RA 5IY5C 1SRYA 2AXTZ 3J81N 2X6BA 2JIZG 2OCCB 1M5IA 1VIBA 5C8YA 3T1CA 1I94B 1AR5A 1N34B 4MVQA 2P4VA 4X64B 1K4CC 5CA0A 4I9QA 4LFCO 2A7WA 1E1RG 4R8CA 1N36B 4GKKO 3W7TA 5LHGA 1EN6A 1QCEA 3F5TA 2EINB 2DWEC 4I7ZB 2MW2B 4X1IA 3P3NA 3ICXA 5FL7G 2XTAA 3QO5A 3N27A 3OM3B 2F4VO 4ZIBA 3CRMA 1AI4A 4JI1O 4TV9A 2F66C 2EIJB 1PL0A 2JJ2G 2HVKC 2JJ1G 4ZI7B 4EB6A 1IX9A 3WB0A 5L3EA 1D5AA 1GMGA 3APOA 4JTCB 1AROP 1R3IC 1S3JA 3H1LH 2CAZC 2A79B 3JATB 4DK0A 2ADPA 2ZM6B 1SQPH 3K06A 3LDEA 2FKXA 3QTCA 1RM1B 1XNQB 1NTZH 1KU9A 4WFEA 2DN9A 2QWRB 2QWNB 2ZR3A 4X1KA 3CMEV 1R1BA 3UO3A 3OD4A 3ZHQA 1VQ9V 4GKJB 1SA0B 3E86A 2UUBO 3UO2A 2JEUA 2QE7G 1VQ6V 1GH6A 2RQ6A 1Q6IA 4LCUC 5KA5A 5DEDA 1L8DA 2UXCO 2GTSA 4MVUA 3OMNB 4LFAB 3DC5A 3JARA 4PDLA 1UJWB 1YDXA 3JD1A 3CCRV 1YIJV 1K5QA 4J10A 1WNSA 1XBLA 4KFMA 4FM0A 2X0LA 1NI8A 3JAWA 1ENVA 1PV0A 2LFRA 5CB4B 3NXSA 3CYOA 1ZL8B 3CRRA 4YJ3B 5B1NA 3K58A 1AJNA 4JAAA 4LF7B 4OPHA 3EVKA 4HNAA 3VQYA 4JV5B 2JEXA 2PGGA 5KHIA 5BXZA 2Z5UA 1GTOA 5BMVA 1AJPA 1H2KA 4FIPC 5FPRA 4DV2B 4R7CA 3AEIA 1R6NA 5B3SC 1OCOC 2HHHO 4CC6A 4BR6A 3CS5A 2YDEA 2ZD9A 1QR8A 5KA6A 2WSSG 1K8AW 5IWAO 1W0JG 3ZHTA 3LNMB 4LWSA 1SQVH 2LW1A 4X64O 4ZI7A 3CXHF 1NTMH 2CGNA 5FLXN 3FB8C 2QSAA 2CGOA 5LMUB 1XMQO 1KBHA 1HNWO 3E8HA 4UCUA 4DRXB 4O4JB 3DXRA 1PD3A 3QG5A 1HR0B 3X2QB 3Q4HB 3BFRA 2GDSA 3N2KA 4MTOA 4NTXA 4JI0O 5H5NA 2ODMA 2BTQA 3K0DA 3CXCU 4GX2A 1XHXA 4BIZA 4JI8O 1AP5A 2QWQB 5J9PC 5IYDO 1NS1A 5KAIZ 1SQGA 3ZMUA 4I4TB 4G2KA 2A06H 1B04A 4X89A 1J5EO 1IBLB 4DV5O 4PDRA 1SKVA 5JJJB 5BR8B 3RVYA 4LF7O 4PV1B 2XAHA 5B3SB 2QKAA 2DE0X 3WB1A 5HFMA 4DR7O 1Y4MA 1M56B 2UXDB 3HKCA 4FM2A 1S5LZ 3ABUA 1Q6HA 5KMGB 3T1HO 1NKDA 1XDCA 3K5OA 1AR4A 3CRAA 4K8XA 1NVPB 2ZT9B 4PA3A 1QBZA 3THOA 1N32O 3K0GA 3EXAA 2Q4PA 4D6TH 1KP2A 3FAVA 4LFAO 1VMGA 3ASOC 1H2LA 3M99B 4QE7A 4O2BA 1HP8A 2B5UA 3STZC 2Q0OC 4JTAB 1PM9A 4DW1A 1I5XA 2E5LO 3GWOA 4LNUB 5EBMC 4GKJO 4HBNA 2DOSA 4LWSB 4UFZA 5GONB 4NVPA 3N2GB 3RYHB 1Q7YW 1LUVA 3E8BA 1HNZO 4DR7B 1RPOA 2IU3A 4X20B 2QKSA 3W7SA 3AK2A 3IFXA 4O2AA 3FD9A 2PZSA 2W6JG 3ZRSA 2YXYA 3ASNC 3QVNA 1XEQA 4JAUA 3MAQA 1TVKA 1YVWA 3K5LA 1EZVH 1H8EG 2KKWA 1AI7A 1Q82W 4O4LA 2ZE8A 4DV1B 4MW8A 4L87A 1OJHA 4DR3O 4JYBA 1DF5A 4NXNO 2VWKA 3OR6C 1Q90D 4X1YA 4GUNA 2W0XA 3JAWB 4YHHB 1WB7A 1MSWD 3K9SA 3B2EE 2NNUA 3AG4B 1IBKO 2CTQA 4IHJA 4I5SA 1AI5A 3T1YO 3LUTB 5CA1B 2QJ1A 3AK1A 5A2QN 1WAZA 3SYAA 2AHYA 3ETDA 4LF8B 3G6BA 5LXTA 4GZRB 4TV8B 4X65B 1IBLO 2HHHB 1P7GA 3OUFA 1ZX3A 1GN6A 2OT5A 4FLUA 3SPGA 2X7RB 5LOVB 3L70H 1KKDA 4Q6GA 3A8TA 3IJ4A 4GX1A 3TXSA 4JI0B 1FXKB 3CC4V 1W59A 2M7WA 1CEZA 3RYFA 5F2VO 2BSKB 1SQQH 4NYKA 5B1BC 1AILA 3GVMA 5B1OA 5KMGA 1FXKC 2JGUA 4IIJA 3ZS8C 3T2MA 1N34O 3HB3B 1Y74A 2UXBO 2P6JA 1OV9A 5J2TA 1ZTEA 4LH6A 5B5EZ 3FB6C 3TJTA 2LGWA 1DTOA 1KQSU 4X1IB 1GM7A 4ZHQB 4B08A 2VS0A 1VP7A 3ZRXA 4RO2A 1X59A 2IBZH 1DF4A 3I55V 4Z1MG 1H2NA 4WFBV 1YJWV 3RYHA 3SYPA 2BCCH 2Y4TA 4EB6B 4DO2A 4DYLA 2OCCC 1YI2V 1JCHA 3APQA 1TVKB 2NLJC 4XDLA 4TQFA 2WA3A 3OFNG 5CBFA 3K04A 4JI6O 3U0ZA 2R9AA 1F23A 1KMIZ 3IC7A 1XMOB 1S72V 1LUWA 3CRQA 4WCEV 2F95B 4DR1B 1UFIA 2QTOA 3ZMZA 1VQOV 3L9DA 3OMIB 4N23A 4J7KA 5H2FZ 3SGIA 3J7AU 5BZBA 4JI3O 1PKXA 1SETA 1TAEA 2IJJA 2X6AA 1S77D 4NTWA 1WN7A 1EN4A 3E22A 4DV4B 4PA7A 5BY1A 1MG1A 3A0HZ 1Z5WA 3ZCCA 2N05A 2IH3C 2P22C 5JVDB 2EZOA 4LF8O 3JAKA 1M57B 1SQXH 4JF3A 1EZJA 4I0XA 2WWWA 2H94A 1H2GA 5H6QA 4JYCA 5IYBO 2ATKC 2CTPA 2UXCB 1JA8A 3QO7A 2FTKA 2EX3A 3E2EA 4J9ZB 3JASA 1L0LH 2Q7GA 2WLIB 1OCOB 5KX5B 4R6ZA 4DUZO 1G4YB 2GHYA 4YY3B 1F4MA 4U3JB 3UCSC 2PY5A 4D7TA 4J7ZA 3D3IA 2OYQA 3JARB 2L6LA 5JH7A 4PELA 4BW9A 2ZXWB 4B3SO 5KUKA 5KLVH 4PJ0Z 1W0KG 1FAFA 2QKCA 2AGAA 3B09A 5IJ0B 2ZE7A 2PYLA 3SJAC 3G71V 3E83A 4NXMO 5EZYA 1AR1B 3DTUB 5EYPB 4BWAA 4JI2O 1S0VA 1BL8A 1K5SA 1ZSPA 4N21A 3JD4A 5CA0B 5JWPA 3RYIA 1QR9A 4CH5A 1M56C 2Q7EA 3DSQA 2OIEA 4WF9V 3U11A 2UUAB 5TISZ 2UUCB 1RSOA 2HVJC 4PD4F 4X66O 5GONA 4JYYA 4H0LB 1BSMA 5IT9N 4UCSA 4TOIA 3FYIB 5EK0A 4C7UA 2V1DA 3E8GA 2QWOB 4IL6Z 5CBHA 1K73W 2Q0AA 4X66B 1NT2B 2DQ3A 3DXRB 1AJQA 2EULA 1V55C 3JCUZ 4KXRA 3N2GA 2E74B 5L3BA 3D8CA 1V54B 3AK3A 4DV1O 3D36A 2YEVA 1P84F 4JI5O 5J2UA 3S3WA 4K3AA 3STLC 3VQXA 5EC1C 1MOFA 2RDCA 5GTHZ 2UXBB 1PPJH 1EBOA 1FJGO 1XI1A 5CBGA 4LF9B 2Q68A 1WA8A 1JQ0A 4JPRA 3WFVA 4DV6O 2PUSA 3ZN0A 3CX5F 4TWKA 2CUGA 3OGCC 3OUSA 4J9YB 2WLLB 1K3EA 3BA8A 4YIOA 2ZIOA 4B3TO 4GLXA 3OE7G 4FM1A 4B3SB 3BCCH 3R65A 2W6IG 4IIJB 2VQEO 5JQGA 5CB4A 2NR5A 1V9PA 2AZ2A 1YEWA 3D36C 4U3JA 1XILA 5KAFZ 2F23A 2WLIA 4TSFG 3LNNA 4P9PA 3TXQA 2QM7A 5LOVA 4DR2O 1YTFD 5LP6A 1VQMV 2XNDG 3CP1A 1WPXA 3W7WA 3LSUA 4I55A 1HW7A 2HLDG 1BGYH 1BE3H 1GM9A 3SYOA 3VBBA 3RYFB 3UT5B 2JVDA 5LHHA 3ZMTA 4FLYA 3L75H 1YXBA 2V7QG 4DR2B 4QJFB 4B3RO 2EJRA 5D5QA 4X20A 3CCJV 1VQ7V 4RWUA 2DWDC 5GTIZ 2GSMB 1VQLV 4NXNB 3DGEA 1FFXA 1Q8IA 1IURA 4O4LB 4E4EA 4UVBA 2DQ0A 4IYHA 2JRIA 2LFSA 2VRZA 3CCUV 4IYIA 4X1KB 1DGSA 2HP8A 1GKFA 1B6QA 1BHAA 4FLXA 3AG2C 2PI4A 2ZQMA 5LMNO 4O2AB 4L8JA 3ZBHA 1O9GA 3L72H 4X88A 4WFGA 1FXHA 5JVDA 4ZHQA 1FFTB 1SESA 3SJCC 5IJ9A 3CWBH 5HFLA 1GO3F 5LA6A 2R70A 1G8MA 2ETNA 2CH7A 3P30A 2JDIG 1KB9F 4JI5B 1PNLA 2Q5ZA 2R72A 3LDCA 3UM7A 3ABKB 1S5JA 2BE3A 4XDKA 1EM1A 2ITDC 4UUJC 4FMTA 3ABLB 4UCOA 1QLEB 4KHPO 5EBLC 1BCCH 4RUEA 4G27B 3GB7C 2D3OW 2CH7B 1I7FA 5A9GA 4LFBO 2P7TC 1BQ0A 1NBMG 3HKEA 4JI7B 1GM8A 1EFRG 2CTWA 2L35A 3PN1A 3RBZA 2DYSB 3O9OA 5BMVB 1TA8A 5K1XA 1K4DC 3A0BZ 4FVMA 3T1HB 5JQGB 1MZEA 4CS2A 3FAVB 2DW4A 1XNQO 2ARHA 4B3RB 4WBNA 1NH2B 4DR4O 1YF2A 3LSQA 3NR7A 2UUAO 1FXKA 3ZN1A 4PHZA 3O65A 1ROPA 1GRJA 4DR4B 1FS0G 2E3CA 4GYCB 3ZEDA 4CS3A 4DV5B 4JAVA 1IBKB 4GX0A 5DM6V 5EBWC 2QDOA 1GN4A 4NR1A 3FX7A 4Q20A 3SPHA 3SR2C 4Z1VA 4MVMA 2PYJA 3ABTA 1KECA 2GBOA 4RAIA 1H38A 2WPDG 3ZMVA 2R9RB 5JH7B 3CCMV 3A0RA 1HNXB 2PTMA 1N33B 4CC5A 1MABG 2FYUH 4Z2WA 4DR3B 1Q86W 2K9PA 1YITV 4J41A 2PF4E 5GW7A 4OPAA 5LMUO 2Y69B 4J80A 4TV9B 2WLNA 2FMLA 3ZRWA 1R3JC 4MVSA 4PDVA 1A32A 3VQVA 3JAMN 5LHIA 4DUYO 2V4DA 2DJVA 1V54C 3BY6A 4TT3G 1IXBA 1DK1A 2G38A 3C3SA 3H1JH 3PJSK 3RVZA 4LF9O 1WA8B 2E76B 2IW5A 1FYJA 1PL4A 3AG3B 2CK3G 3D3QA 3EHBB 2ITCC 5JCOA 2LGQA 3ETQA 3CCEV 2ZNIA 1HWYA 4LC1A 4B3MO 3K9AA 1MZFA 4J42A 1VQ5V 1BHBA 1YJ9V 3KCXA 1I5YA 2VQFO 2MK3A 1ZWIC 5E1AC 2IJHA 3RFRA 4EFEA 4CZZA 1D5NA 1TUBB 3CMAV 4OX9B 2FL4A 5ITZA 1E1QG 2DMXA 3CE2A 3FB7C 2LJ2A 2Q67A 4LF4O 4DXWA 4MVOA 2QGNA 2M6YA 4UCRA 4FZ0A 5B1AC 3J80N 1XNRB 1PNMA 2HJFC
chains in the Genus database with same CATH topology
4LF8O 4DV4O 2UXDO 1HR0O 1N36O 2E5LO 4DV1O 2JRIA 2FKXA 1G1XB 4YY3O 5IWAO 4JI5O 4GKJO 2DOSA 4AQYO 4X64O 4K0KO 5FLXN 1D2DA 1R1BA 5LMNO 1FJGO 1I94O 1XMQO 1HNWO 4DUZO 4DV6O 1HNZO 2UUBO 1R6TA 2UU9O 1AILA 3M8AA 2ZKOA 2ZM6O 3SDLA 4A5UB 4OPAA 5LMUO 4DV3O 3OTOO 4B3TO 2LW7A 3RT3C 4JI0O 1N34O 1XEQA 5H5NA 1F7YA 4B3SO 1XNRO 4JYAO 2UXBO 1YZBA 2UXCO 4LF6O 1A32A 3JAMN 4DUYO 2AGAA 2DJVA 2VQEO 4JI4O 4JI8O 3J81N 1DK1A 4DR5O 1NS1A 4DR3O 4NXMO 4LF9O 1X59A 4NXNO 4DV0O 4JI2O 1N33O 1FYJA 1J5EO 4DV5O 4KHPO 4LF7O 1XMOO 4B3MO 4DR2O 2UUCO 4LFCO 1KUQA 4LFBO 4YHHO 4JI6O 4JI7O 4DR7O 4DV2O 4GKKO 1IBMO 2VQFO 3F5TA 4OPHA 1IBKO 4DR6O 1HNXO 3T1HO 5BXZA 4X65O 3R66A 2N74A 4X66O 1XNQO 2F4VO 4DR4O 1AB3A 5IT9N 4JI1O 2Z0AA 4DV7O 3T1YO 5LL6Y 2UUAO 4LF5O 1N32O 1FKAO 3J7AU 5A2QN 4JI3O 3O65A 4LF4O 4OX9O 4B3RO 5BY1A 4LFAO 4X62O 5BR8O 2HHHO 3J80N 4DR1O 1IBLO 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 O;  4DV4 O;  2UXD O;  1HR0 O;  1N36 O;  2E5L O;  4DV1 O;  2JRI A;  2FKX A;  1G1X B;  4YY3 O;  5IWA O;  4JI5 O;  4GKJ O;  2DOS A;  4AQY O;  4X64 O;  4K0K O;  5FLX N;  1D2D A;  1R1B A;  5LMN O;  1FJG O;  1I94 O;  1XMQ O;  1HNW O;  4DUZ O;  4DV6 O;  1HNZ O;  2UUB O;  1R6T A;  2UU9 O;  1AIL A;  3M8A A;  2ZKO A;  2ZM6 O;  3SDL A;  4A5U B;  4OPA A;  5LMU O;  4DV3 O;  3OTO O;  4B3T O;  2LW7 A;  3RT3 C;  4JI0 O;  1N34 O;  1XEQ A;  5H5N A;  1F7Y A;  4B3S O;  1XNR O;  4JYA O;  2UXB O;  1YZB A;  2UXC O;  4LF6 O;  1A32 A;  3JAM N;  4DUY O;  2AGA A;  2DJV A;  2VQE O;  4JI4 O;  4JI8 O;  3J81 N;  1DK1 A;  4DR5 O;  1NS1 A;  4DR3 O;  4NXM O;  4LF9 O;  1X59 A;  4NXN O;  4DV0 O;  4JI2 O;  1N33 O;  1FYJ A;  1J5E O;  4DV5 O;  4KHP O;  4LF7 O;  1XMO O;  4B3M O;  4DR2 O;  2UUC O;  4LFC O;  1KUQ A;  4LFB O;  4YHH O;  4JI6 O;  4JI7 O;  4DR7 O;  4DV2 O;  4GKK O;  1IBM O;  2VQF O;  3F5T A;  4OPH A;  1IBK O;  4DR6 O;  1HNX O;  3T1H O;  5BXZ A;  4X65 O;  3R66 A;  2N74 A;  4X66 O;  1XNQ O;  2F4V O;  4DR4 O;  1AB3 A;  5IT9 N;  4JI1 O;  2Z0A A;  4DV7 O;  3T1Y O;  5LL6 Y;  2UUA O;  4LF5 O;  1N32 O;  1FKA O;  3J7A U;  5A2Q N;  4JI3 O;  3O65 A;  4LF4 O;  4OX9 O;  4B3R O;  5BY1 A;  4LFA O;  4X62 O;  5BR8 O;  2HHH O;  3J80 N;  4DR1 O;  1IBL O;  4JV5 O; 
#chains in the Genus database with same CATH topology
 2H3O A;  3ZIA G;  4RQF A;  2LO1 A;  4I9W A;  4MW3 A;  1EN5 A;  1M93 A;  4QE9 A;  2B9Z A;  3B8N A;  3ZX6 A;  1QVF U;  3K03 A;  4CS4 A;  1H8H G;  1J5E B;  2P90 A;  2DYS C;  2WLK A;  3RN4 A;  4UCV A;  1WB8 A;  1R73 A;  3C3T A;  1P49 A;  2EIM C;  2GTA A;  5B66 Z;  2YIC A;  3SDL A;  1QNM A;  1XRE A;  5IJ0 A;  1YCI A;  2ZDI A;  1R3K C;  2GUZ A;  3E35 A;  4PI2 A;  2EIK B;  2YID A;  2JGD B;  4LF6 O;  2EIL C;  1G6U A;  5FPO A;  1SER A;  2YIB A;  2OIG A;  3LDD A;  1FJG B;  3FYE B;  4HYO A;  4X9Q A;  5CA3 A;  2CE4 A;  3WB2 A;  2Y0P A;  2P67 A;  2AHZ A;  4OGQ B;  3ZHU A;  5IJ9 B;  5JJN B;  4LR3 A;  5J2U B;  3CHX A;  1IBM O;  1AVM A;  3QNE A;  4H33 A;  2F4V B;  4I4T A;  5CN0 A;  4DRX A;  1I08 A;  3JAL B;  4YIP A;  2N74 A;  3UKM A;  1NVP D;  1L1F A;  2P5O A;  4LBE C;  3ZHS A;  1MMM A;  1VF6 C;  1NR1 A;  4LF4 B;  4I50 B;  2Z0A A;  3A2F A;  4KUM A;  5LL6 Y;  2FB5 A;  3QO8 A;  4JI3 B;  1L0N H;  4GT1 A;  4I50 A;  3G4S V;  4LFC B;  5LBQ A;  4OX9 O;  1S5H C;  1XL6 A;  1VEW A;  2AZ0 A;  2YEV B;  3CPW U;  5LGT A;  2VQF B;  2CDY A;  4J11 A;  2XAG A;  1NU1 H;  1GAX A;  4CH6 A;  3BRC A;  4G28 B;  2IH1 C;  1M57 C;  4JGS A;  4UVA A;  3ZMS A;  2B1G A;  4DV6 B;  2YI9 A;  1QLE C;  4P9O A;  1URF A;  1ZL8 A;  1F51 A;  2WLH A;  3CRC A;  3ZJZ A;  4CH3 A;  4HAM A;  2IU0 A;  3QF7 A;  3HKD A;  3H1I H;  4MTX A;  1WP7 A;  1ZAU A;  5IYZ B;  5LGN A;  2ZIN A;  4LFB B;  2YS8 A;  1N8R W;  2XAF A;  4OXS A;  1Y76 A;  2ZR2 A;  4A5U B;  2QM8 A;  4KHP B;  4F6R A;  2RJZ A;  1XNR O;  3RYC B;  1YHQ V;  4K0K B;  3B40 A;  2XAS A;  2A3Q A;  2IJI A;  3W7U A;  5EZY B;  3IGA C;  4DUZ B;  1NZ6 A;  3M7M X;  1AI6 A;  3ML0 A;  1JPX A;  3ABL C;  1N33 O;  3CCL V;  5IDJ A;  4DW0 A;  1RFY A;  1SZT A;  1TGO A;  1YJN V;  4BW5 A;  3RYC A;  3H9V A;  2JGD A;  3AG7 A;  1US6 A;  2UU9 B;  1JX9 A;  4MSW C;  1M1K W;  3I56 V;  3G6E V;  2HR3 A;  4UB8 Z;  3CCQ V;  5LYJ A;  2AW9 A;  3AG4 C;  4MT8 A;  2EIL B;  3HPL C;  1H2S B;  4FFB A;  2RN9 A;  2WLM A;  1VAR A;  3CCV V;  2P06 A;  3ASO B;  2OTJ V;  1BMF G;  3CSX A;  3E22 B;  3K3W A;  4FJC C;  4QPJ A;  4RUF A;  3Q4H A;  2CTR A;  2JS5 A;  4J7J A;  1T5E A;  5IY5 B;  1LNQ A;  3HKB A;  5EIB D;  2WLL A;  5BR8 O;  3K5M A;  1CPY A;  4AI8 A;  4YJ2 A;  4FLW A;  4DR1 O;  1GN2 A;  3KZI Z;  1K33 A;  2YI8 A;  3C90 A;  3L71 H;  1N36 O;  3HKE B;  2YC0 A;  1KYO F;  2KQX A;  4BIO A;  4JI8 B;  1WJZ A;  1QU7 A;  2A9H A;  3SPJ A;  4X1Y B;  4AQY O;  4P30 A;  3SYQ A;  2BTQ B;  5ITZ B;  2Q73 A;  4LP8 A;  4WFF A;  3BA9 A;  2Q69 A;  5L3G A;  3OTO B;  1YSC A;  2OCH A;  1K9M W;  2HFE C;  1VQP V;  2Q7H A;  2UU9 O;  5JJE B;  2ZNJ A;  4W4L A;  3LSS A;  2EIK C;  4ICG A;  1BT8 A;  2LW7 A;  1FD9 A;  1VQK V;  5LGU A;  1FXV A;  3CCS V;  2HG5 C;  4LH7 A;  3FFQ A;  2NN4 A;  3AG1 C;  2XHB A;  2O57 A;  1HNZ B;  4LF6 B;  3HKC B;  3L74 H;  3BPZ A;  3JD3 A;  1XQ8 A;  4HZ3 A;  3H1K H;  5LP6 B;  3BHP A;  2WAM A;  1SQF A;  2BTO A;  4DV2 O;  1RPR A;  4UV8 A;  2Q9L A;  2DYR B;  4U7O A;  4DR6 O;  2BSK A;  2KSD A;  2EBO A;  4X65 O;  3CB2 A;  3R66 A;  4W4K A;  1S76 D;  4RQE A;  4WFA V;  4CH4 A;  3B4S A;  2F43 G;  5KHK A;  4DUY B;  4O4H A;  4MS2 A;  1U96 A;  1GK9 A;  4FFB B;  1Q6U A;  4IGG A;  2YSU B;  3WU2 Z;  2UXD O;  1MA1 A;  4IT5 A;  2PI5 A;  2KG7 A;  2BOB C;  2P4K A;  2X6C A;  2LP7 A;  2QR4 A;  1JR9 A;  4QNH B;  5CA1 A;  2ILM A;  3OR7 C;  4ASU G;  5K1P A;  2GUZ B;  3BAA A;  5B1A B;  1NH2 D;  3WG7 B;  3KG2 A;  1Q43 A;  1IBM B;  2Y69 C;  1VF5 B;  3MD0 A;  3X2Q C;  5DEC A;  4F6E A;  3TGU H;  2VWJ A;  1BQZ A;  1I0H A;  3B77 A;  1K92 A;  4JYA O;  3DC6 A;  1IZ3 A;  3BEH A;  4I0X B;  1SS3 A;  4B7K A;  1XMQ B;  3B8M A;  3HKD B;  3TET A;  4NTY A;  5KHJ A;  4JTD B;  2Q6A A;  4KL1 A;  1XL4 A;  2XUM A;  1QLN A;  4PI0 A;  1PP9 H;  5IWA B;  2RCV A;  1PNK A;  3ZRV A;  4TUY B;  4NKG B;  4YHH O;  4JI7 O;  4JI1 B;  4XDJ A;  3G80 A;  1VF7 A;  5H6R A;  4O2B B;  1JJO A;  1HNX O;  3S3X A;  3IC9 A;  4HNA B;  1BZK A;  3SJQ C;  4GKK B;  3TCU A;  4GX5 A;  3F7V C;  1FKA O;  4TQD A;  3ABM B;  1JFF A;  2ZDI C;  2VQE B;  1OCR B;  3ETE A;  4X62 O;  5EYP A;  5C8Y B;  1Q81 W;  3W7X A;  4DV4 O;  3G67 A;  1OCC C;  1JVM A;  1THZ A;  3JSL A;  2H8P C;  1CP9 A;  1SC5 B;  4O4I B;  2YUA A;  1WPB A;  2HJD A;  4FZ1 A;  2ZIM A;  1VQ8 V;  4JI2 B;  4ZOL B;  2JK5 C;  4JAS A;  2QWP B;  1OCZ C;  4JI6 B;  1FFX B;  1IVS A;  3RGB A;  1N4C A;  1F4N A;  1R6T A;  1RSO B;  1VQN V;  4H13 B;  1Z2G A;  5LYJ B;  3ZHV A;  4PDM A;  3U10 A;  1H2M A;  3CJH A;  1YZB A;  4YXW G;  1ZUQ A;  4DV3 B;  2XAJ A;  4XBF A;  1BS3 A;  4O4J A;  4UB6 Z;  1N0N A;  2UXX A;  2UUB B;  3OW2 U;  2R9I A;  3MDS A;  2KB1 A;  3CC7 V;  2ZCE A;  1WP8 A;  5KX5 A;  2EJ7 A;  3ASN B;  4ZKI A;  4X62 B;  3UQ8 A;  5KHH A;  5LA6 B;  2UUC O;  1KUQ A;  3VOU A;  3EFF K;  3N2K B;  4IHJ B;  3I5D A;  1Y76 B;  3RWR D;  4LF5 B;  5AG2 A;  1UPG A;  1ORQ C;  3OEE G;  1FPO A;  3E89 A;  1COW G;  5D5P A;  5IYZ A;  3ZHR A;  4FLV A;  2XOK G;  2RMK B;  5EC2 C;  1MNG A;  1Y6X A;  2YXH A;  4NB5 A;  4TUY A;  4PA4 A;  1SQB H;  4UVC A;  4F6R B;  4QIW F;  4FPP A;  1JMK C;  1V55 B;  1MSD A;  4D7S A;  5L3F A;  3OAA G;  2N04 A;  4JV5 O;  1IXM A;  3H01 A;  1HR0 O;  4AIL C;  3SPI A;  2Y48 A;  4JI4 B;  5KHG A;  3RYI B;  3IAY A;  1XUQ A;  1Y74 B;  2Z3Y A;  3OEH G;  5J2T B;  1LR1 A;  2YXL A;  3P3P A;  1ZLZ A;  1I94 O;  5DN6 G;  4LNU A;  1KKC A;  1XHZ A;  2IM9 A;  1WLE A;  2QEX V;  1U97 A;  3K79 A;  3M8A A;  4GCZ A;  2ZKO A;  2EIM B;  3JD2 A;  4DV3 O;  3P32 A;  2WLJ A;  4K35 A;  3UT5 A;  5E79 Z;  1OCR C;  2DYR C;  2D2C B;  4DR5 O;  3KCY A;  5L3D A;  3SYC A;  3FKS G;  5LP6 C;  2C2A A;  1GN3 A;  2QM4 A;  3JYC A;  3HR0 A;  2UXN A;  1Z5V A;  3HKB B;  1XMO O;  5IYC O;  1YTF B;  3OTF A;  3ZRW B;  1P7B A;  2QA4 V;  1SZX A;  5JCO C;  3K08 A;  1SF9 A;  3MHS C;  3KKY A;  4E2L A;  4U7N A;  4ABM A;  2IJK A;  5H9C A;  3WG7 C;  4B3M B;  3JAT A;  1XOU A;  3SJB C;  3F7Y C;  2Y0I A;  1E79 G;  2HKO A;  3JAS B;  5LXT B;  3VQW A;  3FB5 C;  1OHH G;  4AHC A;  4NXM B;  4DV7 O;  1Y66 A;  4MVZ A;  1R3L C;  4UCT A;  4B7E A;  3T1Y B;  4CBC A;  4QPK A;  1JOY A;  1O9H A;  4BAY A;  4R50 A;  1QVG U;  4QGP A;  1K97 A;  4X8A A;  2WA4 A;  2OWO A;  1KC8 W;  4WFH A;  2JS3 A;  3CC2 V;  4EEQ A;  5C93 A;  1Q3E A;  4KP4 A;  1N32 B;  1G1X B;  4YY3 O;  3CEI A;  2YIA A;  2BOC C;  2RNB A;  1JFF B;  4PA9 A;  1RP3 B;  1N0J A;  1QQC A;  4O4I A;  4DV0 B;  1K7D A;  3T4D A;  4WBN B;  1TUB A;  3ABM C;  2E75 B;  1NTK H;  3K5N A;  2XT9 A;  1Y67 A;  2ZM6 O;  2QTS A;  2LQT A;  4FLZ A;  3L73 H;  3AG1 B;  4PA6 A;  4YJ3 A;  3OTO O;  1AP6 A;  5LMN B;  4JYA B;  1F7Y A;  1M4U A;  2ZE5 A;  4AQY B;  1B06 A;  4H44 B;  4JI4 O;  2A0L A;  2ADQ B;  4DK1 A;  5IE9 A;  5FNV B;  1KD1 W;  3K57 A;  4JZG A;  3OT7 A;  1B3Q A;  1NR7 A;  4DV0 O;  5FNV A;  2K1E A;  5L3C A;  2B1I A;  4F4L A;  4U3F H;  3OMA B;  1OZ0 A;  3E8F A;  1TUE B;  3JCZ A;  4JZ2 A;  1HNW B;  4H37 A;  2GV9 A;  3JAL A;  4UV9 A;  2ZXW C;  3SPC A;  3AG3 C;  2F93 B;  1W2B U;  4YJ2 B;  3JD0 A;  1JJ2 U;  1AB3 A;  4O4H B;  2F1M A;  4MVR A;  3T4Z A;  4LF5 O;  4MTG A;  5CMU A;  3GWK C;  1VQ4 V;  3MHH C;  3ETG A;  1NQT A;  1VF6 A;  3H1H H;  3CJH B;  4DV7 B;  3JSN A;  1DLB A;  4EFB A;  4FLT A;  2EZP A;  1OCZ B;  1J95 A;  2KG7 B;  2Q8V A;  1CXZ B;  2YIB D;  3OGI B;  3BVO A;  1HDJ A;  4DR6 B;  1M9N A;  3AG2 B;  4ZOL A;  1SA0 A;  2EIN C;  1QHT A;  2EIJ C;  1M90 W;  2W0F C;  4TV8 A;  3CD6 V;  2HEP A;  4FFK A;  1Q5O A;  5KUM A;  4K0K O;  1OCC B;  2Y4U A;  3F5W C;  1D2D A;  3JAK B;  1X4T A;  1IDS A;  4B3T B;  3ABK C;  1K34 A;  3BAB A;  1R6K A;  4P2Z A;  4K8Z A;  5EIB C;  3K59 A;  4DR5 B;  3TK1 A;  2E5L B;  4ZBM A;  5B1B B;  4I55 B;  2ZE6 A;  4EKW A;  1NJI W;  2XAQ A;  2OTL V;  3RT3 C;  1KP3 A;  4FK5 C;  4MTF A;  4BIU A;  3RW0 A;  4UXN A;  1RM1 C;  1P4R A;  5IY5 C;  1SRY A;  2AXT Z;  3J81 N;  2X6B A;  2JIZ G;  2OCC B;  1M5I A;  1VIB A;  5C8Y A;  3T1C A;  1I94 B;  1AR5 A;  1N34 B;  4MVQ A;  2P4V A;  4X64 B;  1K4C C;  5CA0 A;  4I9Q A;  4LFC O;  2A7W A;  1E1R G;  4R8C A;  1N36 B;  4GKK O;  3W7T A;  5LHG A;  1EN6 A;  1QCE A;  3F5T A;  2EIN B;  2DWE C;  4I7Z B;  2MW2 B;  4X1I A;  3P3N A;  3ICX A;  5FL7 G;  2XTA A;  3QO5 A;  3N27 A;  3OM3 B;  2F4V O;  4ZIB A;  3CRM A;  1AI4 A;  4JI1 O;  4TV9 A;  2F66 C;  2EIJ B;  1PL0 A;  2JJ2 G;  2HVK C;  2JJ1 G;  4ZI7 B;  4EB6 A;  1IX9 A;  3WB0 A;  5L3E A;  1D5A A;  1GMG A;  3APO A;  4JTC B;  1ARO P;  1R3I C;  1S3J A;  3H1L H;  2CAZ C;  2A79 B;  3JAT B;  4DK0 A;  2ADP A;  2ZM6 B;  1SQP H;  3K06 A;  3LDE A;  2FKX A;  3QTC A;  1RM1 B;  1XNQ B;  1NTZ H;  1KU9 A;  4WFE A;  2DN9 A;  2QWR B;  2QWN B;  2ZR3 A;  4X1K A;  3CME V;  1R1B A;  3UO3 A;  3OD4 A;  3ZHQ A;  1VQ9 V;  4GKJ B;  1SA0 B;  3E86 A;  2UUB O;  3UO2 A;  2JEU A;  2QE7 G;  1VQ6 V;  1GH6 A;  2RQ6 A;  1Q6I A;  4LCU C;  5KA5 A;  5DED A;  1L8D A;  2UXC O;  2GTS A;  4MVU A;  3OMN B;  4LFA B;  3DC5 A;  3JAR A;  4PDL A;  1UJW B;  1YDX A;  3JD1 A;  3CCR V;  1YIJ V;  1K5Q A;  4J10 A;  1WNS A;  1XBL A;  4KFM A;  4FM0 A;  2X0L A;  1NI8 A;  3JAW A;  1ENV A;  1PV0 A;  2LFR A;  5CB4 B;  3NXS A;  3CYO A;  1ZL8 B;  3CRR A;  4YJ3 B;  5B1N A;  3K58 A;  1AJN A;  4JAA A;  4LF7 B;  4OPH A;  3EVK A;  4HNA A;  3VQY A;  4JV5 B;  2JEX A;  2PGG A;  5KHI A;  5BXZ A;  2Z5U A;  1GTO A;  5BMV A;  1AJP A;  1H2K A;  4FIP C;  5FPR A;  4DV2 B;  4R7C A;  3AEI A;  1R6N A;  5B3S C;  1OCO C;  2HHH O;  4CC6 A;  4BR6 A;  3CS5 A;  2YDE A;  2ZD9 A;  1QR8 A;  5KA6 A;  2WSS G;  1K8A W;  5IWA O;  1W0J G;  3ZHT A;  3LNM B;  4LWS A;  1SQV H;  2LW1 A;  4X64 O;  4ZI7 A;  3CXH F;  1NTM H;  2CGN A;  5FLX N;  3FB8 C;  2QSA A;  2CGO A;  5LMU B;  1XMQ O;  1KBH A;  1HNW O;  3E8H A;  4UCU A;  4DRX B;  4O4J B;  3DXR A;  1PD3 A;  3QG5 A;  1HR0 B;  3X2Q B;  3Q4H B;  3BFR A;  2GDS A;  3N2K A;  4MTO A;  4NTX A;  4JI0 O;  5H5N A;  2ODM A;  2BTQ A;  3K0D A;  3CXC U;  4GX2 A;  1XHX A;  4BIZ A;  4JI8 O;  1AP5 A;  2QWQ B;  5J9P C;  5IYD O;  1NS1 A;  5KAI Z;  1SQG A;  3ZMU A;  4I4T B;  4G2K A;  2A06 H;  1B04 A;  4X89 A;  1J5E O;  1IBL B;  4DV5 O;  4PDR A;  1SKV A;  5JJJ B;  5BR8 B;  3RVY A;  4LF7 O;  4PV1 B;  2XAH A;  5B3S B;  2QKA A;  2DE0 X;  3WB1 A;  5HFM A;  4DR7 O;  1Y4M A;  1M56 B;  2UXD B;  3HKC A;  4FM2 A;  1S5L Z;  3ABU A;  1Q6H A;  5KMG B;  3T1H O;  1NKD A;  1XDC A;  3K5O A;  1AR4 A;  3CRA A;  4K8X A;  1NVP B;  2ZT9 B;  4PA3 A;  1QBZ A;  3THO A;  1N32 O;  3K0G A;  3EXA A;  2Q4P A;  4D6T H;  1KP2 A;  3FAV A;  4LFA O;  1VMG A;  3ASO C;  1H2L A;  3M99 B;  4QE7 A;  4O2B A;  1HP8 A;  2B5U A;  3STZ C;  2Q0O C;  4JTA B;  1PM9 A;  4DW1 A;  1I5X A;  2E5L O;  3GWO A;  4LNU B;  5EBM C;  4GKJ O;  4HBN A;  2DOS A;  4LWS B;  4UFZ A;  5GON B;  4NVP A;  3N2G B;  3RYH B;  1Q7Y W;  1LUV A;  3E8B A;  1HNZ O;  4DR7 B;  1RPO A;  2IU3 A;  4X20 B;  2QKS A;  3W7S A;  3AK2 A;  3IFX A;  4O2A A;  3FD9 A;  2PZS A;  2W6J G;  3ZRS A;  2YXY A;  3ASN C;  3QVN A;  1XEQ A;  4JAU A;  3MAQ A;  1TVK A;  1YVW A;  3K5L A;  1EZV H;  1H8E G;  2KKW A;  1AI7 A;  1Q82 W;  4O4L A;  2ZE8 A;  4DV1 B;  4MW8 A;  4L87 A;  1OJH A;  4DR3 O;  4JYB A;  1DF5 A;  4NXN O;  2VWK A;  3OR6 C;  1Q90 D;  4X1Y A;  4GUN A;  2W0X A;  3JAW B;  4YHH B;  1WB7 A;  1MSW D;  3K9S A;  3B2E E;  2NNU A;  3AG4 B;  1IBK O;  2CTQ A;  4IHJ A;  4I5S A;  1AI5 A;  3T1Y O;  3LUT B;  5CA1 B;  2QJ1 A;  3AK1 A;  5A2Q N;  1WAZ A;  3SYA A;  2AHY A;  3ETD A;  4LF8 B;  3G6B A;  5LXT A;  4GZR B;  4TV8 B;  4X65 B;  1IBL O;  2HHH B;  1P7G A;  3OUF A;  1ZX3 A;  1GN6 A;  2OT5 A;  4FLU A;  3SPG A;  2X7R B;  5LOV B;  3L70 H;  1KKD A;  4Q6G A;  3A8T A;  3IJ4 A;  4GX1 A;  3TXS A;  4JI0 B;  1FXK B;  3CC4 V;  1W59 A;  2M7W A;  1CEZ A;  3RYF A;  5F2V O;  2BSK B;  1SQQ H;  4NYK A;  5B1B C;  1AIL A;  3GVM A;  5B1O A;  5KMG A;  1FXK C;  2JGU A;  4IIJ A;  3ZS8 C;  3T2M A;  1N34 O;  3HB3 B;  1Y74 A;  2UXB O;  2P6J A;  1OV9 A;  5J2T A;  1ZTE A;  4LH6 A;  5B5E Z;  3FB6 C;  3TJT A;  2LGW A;  1DTO A;  1KQS U;  4X1I B;  1GM7 A;  4ZHQ B;  4B08 A;  2VS0 A;  1VP7 A;  3ZRX A;  4RO2 A;  1X59 A;  2IBZ H;  1DF4 A;  3I55 V;  4Z1M G;  1H2N A;  4WFB V;  1YJW V;  3RYH A;  3SYP A;  2BCC H;  2Y4T A;  4EB6 B;  4DO2 A;  4DYL A;  2OCC C;  1YI2 V;  1JCH A;  3APQ A;  1TVK B;  2NLJ C;  4XDL A;  4TQF A;  2WA3 A;  3OFN G;  5CBF A;  3K04 A;  4JI6 O;  3U0Z A;  2R9A A;  1F23 A;  1KMI Z;  3IC7 A;  1XMO B;  1S72 V;  1LUW A;  3CRQ A;  4WCE V;  2F95 B;  4DR1 B;  1UFI A;  2QTO A;  3ZMZ A;  1VQO V;  3L9D A;  3OMI B;  4N23 A;  4J7K A;  5H2F Z;  3SGI A;  3J7A U;  5BZB A;  4JI3 O;  1PKX A;  1SET A;  1TAE A;  2IJJ A;  2X6A A;  1S77 D;  4NTW A;  1WN7 A;  1EN4 A;  3E22 A;  4DV4 B;  4PA7 A;  5BY1 A;  1MG1 A;  3A0H Z;  1Z5W A;  3ZCC A;  2N05 A;  2IH3 C;  2P22 C;  5JVD B;  2EZO A;  4LF8 O;  3JAK A;  1M57 B;  1SQX H;  4JF3 A;  1EZJ A;  4I0X A;  2WWW A;  2H94 A;  1H2G A;  5H6Q A;  4JYC A;  5IYB O;  2ATK C;  2CTP A;  2UXC B;  1JA8 A;  3QO7 A;  2FTK A;  2EX3 A;  3E2E A;  4J9Z B;  3JAS A;  1L0L H;  2Q7G A;  2WLI B;  1OCO B;  5KX5 B;  4R6Z A;  4DUZ O;  1G4Y B;  2GHY A;  4YY3 B;  1F4M A;  4U3J B;  3UCS C;  2PY5 A;  4D7T A;  4J7Z A;  3D3I A;  2OYQ A;  3JAR B;  2L6L A;  5JH7 A;  4PEL A;  4BW9 A;  2ZXW B;  4B3S O;  5KUK A;  5KLV H;  4PJ0 Z;  1W0K G;  1FAF A;  2QKC A;  2AGA A;  3B09 A;  5IJ0 B;  2ZE7 A;  2PYL A;  3SJA C;  3G71 V;  3E83 A;  4NXM O;  5EZY A;  1AR1 B;  3DTU B;  5EYP B;  4BWA A;  4JI2 O;  1S0V A;  1BL8 A;  1K5S A;  1ZSP A;  4N21 A;  3JD4 A;  5CA0 B;  5JWP A;  3RYI A;  1QR9 A;  4CH5 A;  1M56 C;  2Q7E A;  3DSQ A;  2OIE A;  4WF9 V;  3U11 A;  2UUA B;  5TIS Z;  2UUC B;  1RSO A;  2HVJ C;  4PD4 F;  4X66 O;  5GON A;  4JYY A;  4H0L B;  1BSM A;  5IT9 N;  4UCS A;  4TOI A;  3FYI B;  5EK0 A;  4C7U A;  2V1D A;  3E8G A;  2QWO B;  4IL6 Z;  5CBH A;  1K73 W;  2Q0A A;  4X66 B;  1NT2 B;  2DQ3 A;  3DXR B;  1AJQ A;  2EUL A;  1V55 C;  3JCU Z;  4KXR A;  3N2G A;  2E74 B;  5L3B A;  3D8C A;  1V54 B;  3AK3 A;  4DV1 O;  3D36 A;  2YEV A;  1P84 F;  4JI5 O;  5J2U A;  3S3W A;  4K3A A;  3STL C;  3VQX A;  5EC1 C;  1MOF A;  2RDC A;  5GTH Z;  2UXB B;  1PPJ H;  1EBO A;  1FJG O;  1XI1 A;  5CBG A;  4LF9 B;  2Q68 A;  1WA8 A;  1JQ0 A;  4JPR A;  3WFV A;  4DV6 O;  2PUS A;  3ZN0 A;  3CX5 F;  4TWK A;  2CUG A;  3OGC C;  3OUS A;  4J9Y B;  2WLL B;  1K3E A;  3BA8 A;  4YIO A;  2ZIO A;  4B3T O;  4GLX A;  3OE7 G;  4FM1 A;  4B3S B;  3BCC H;  3R65 A;  2W6I G;  4IIJ B;  2VQE O;  5JQG A;  5CB4 A;  2NR5 A;  1V9P A;  2AZ2 A;  1YEW A;  3D36 C;  4U3J A;  1XIL A;  5KAF Z;  2F23 A;  2WLI A;  4TSF G;  3LNN A;  4P9P A;  3TXQ A;  2QM7 A;  5LOV A;  4DR2 O;  1YTF D;  5LP6 A;  1VQM V;  2XND G;  3CP1 A;  1WPX A;  3W7W A;  3LSU A;  4I55 A;  1HW7 A;  2HLD G;  1BGY H;  1BE3 H;  1GM9 A;  3SYO A;  3VBB A;  3RYF B;  3UT5 B;  2JVD A;  5LHH A;  3ZMT A;  4FLY A;  3L75 H;  1YXB A;  2V7Q G;  4DR2 B;  4QJF B;  4B3R O;  2EJR A;  5D5Q A;  4X20 A;  3CCJ V;  1VQ7 V;  4RWU A;  2DWD C;  5GTI Z;  2GSM B;  1VQL V;  4NXN B;  3DGE A;  1FFX A;  1Q8I A;  1IUR A;  4O4L B;  4E4E A;  4UVB A;  2DQ0 A;  4IYH A;  2JRI A;  2LFS A;  2VRZ A;  3CCU V;  4IYI A;  4X1K B;  1DGS A;  2HP8 A;  1GKF A;  1B6Q A;  1BHA A;  4FLX A;  3AG2 C;  2PI4 A;  2ZQM A;  5LMN O;  4O2A B;  4L8J A;  3ZBH A;  1O9G A;  3L72 H;  4X88 A;  4WFG A;  1FXH A;  5JVD A;  4ZHQ A;  1FFT B;  1SES A;  3SJC C;  5IJ9 A;  3CWB H;  5HFL A;  1GO3 F;  5LA6 A;  2R70 A;  1G8M A;  2ETN A;  2CH7 A;  3P30 A;  2JDI G;  1KB9 F;  4JI5 B;  1PNL A;  2Q5Z A;  2R72 A;  3LDC A;  3UM7 A;  3ABK B;  1S5J A;  2BE3 A;  4XDK A;  1EM1 A;  2ITD C;  4UUJ C;  4FMT A;  3ABL B;  4UCO A;  1QLE B;  4KHP O;  5EBL C;  1BCC H;  4RUE A;  4G27 B;  3GB7 C;  2D3O W;  2CH7 B;  1I7F A;  5A9G A;  4LFB O;  2P7T C;  1BQ0 A;  1NBM G;  3HKE A;  4JI7 B;  1GM8 A;  1EFR G;  2CTW A;  2L35 A;  3PN1 A;  3RBZ A;  2DYS B;  3O9O A;  5BMV B;  1TA8 A;  5K1X A;  1K4D C;  3A0B Z;  4FVM A;  3T1H B;  5JQG B;  1MZE A;  4CS2 A;  3FAV B;  2DW4 A;  1XNQ O;  2ARH A;  4B3R B;  4WBN A;  1NH2 B;  4DR4 O;  1YF2 A;  3LSQ A;  3NR7 A;  2UUA O;  1FXK A;  3ZN1 A;  4PHZ A;  3O65 A;  1ROP A;  1GRJ A;  4DR4 B;  1FS0 G;  2E3C A;  4GYC B;  3ZED A;  4CS3 A;  4DV5 B;  4JAV A;  1IBK B;  4GX0 A;  5DM6 V;  5EBW C;  2QDO A;  1GN4 A;  4NR1 A;  3FX7 A;  4Q20 A;  3SPH A;  3SR2 C;  4Z1V A;  4MVM A;  2PYJ A;  3ABT A;  1KEC A;  2GBO A;  4RAI A;  1H38 A;  2WPD G;  3ZMV A;  2R9R B;  5JH7 B;  3CCM V;  3A0R A;  1HNX B;  2PTM A;  1N33 B;  4CC5 A;  1MAB G;  2FYU H;  4Z2W A;  4DR3 B;  1Q86 W;  2K9P A;  1YIT V;  4J41 A;  2PF4 E;  5GW7 A;  4OPA A;  5LMU O;  2Y69 B;  4J80 A;  4TV9 B;  2WLN A;  2FML A;  3ZRW A;  1R3J C;  4MVS A;  4PDV A;  1A32 A;  3VQV A;  3JAM N;  5LHI A;  4DUY O;  2V4D A;  2DJV A;  1V54 C;  3BY6 A;  4TT3 G;  1IXB A;  1DK1 A;  2G38 A;  3C3S A;  3H1J H;  3PJS K;  3RVZ A;  4LF9 O;  1WA8 B;  2E76 B;  2IW5 A;  1FYJ A;  1PL4 A;  3AG3 B;  2CK3 G;  3D3Q A;  3EHB B;  2ITC C;  5JCO A;  2LGQ A;  3ETQ A;  3CCE V;  2ZNI A;  1HWY A;  4LC1 A;  4B3M O;  3K9A A;  1MZF A;  4J42 A;  1VQ5 V;  1BHB A;  1YJ9 V;  3KCX A;  1I5Y A;  2VQF O;  2MK3 A;  1ZWI C;  5E1A C;  2IJH A;  3RFR A;  4EFE A;  4CZZ A;  1D5N A;  1TUB B;  3CMA V;  4OX9 B;  2FL4 A;  5ITZ A;  1E1Q G;  2DMX A;  3CE2 A;  3FB7 C;  2LJ2 A;  2Q67 A;  4LF4 O;  4DXW A;  4MVO A;  2QGN A;  2M6Y A;  4UCR A;  4FZ0 A;  5B1A C;  3J80 N;  1XNR B;  1PNM A;  2HJF C; 
#chains in the Genus database with same CATH homology
 4LF8 O;  4DV4 O;  2UXD O;  1HR0 O;  1N36 O;  2E5L O;  4DV1 O;  2JRI A;  2FKX A;  1G1X B;  4YY3 O;  5IWA O;  4JI5 O;  4GKJ O;  2DOS A;  4AQY O;  4X64 O;  4K0K O;  5FLX N;  1D2D A;  1R1B A;  5LMN O;  1FJG O;  1I94 O;  1XMQ O;  1HNW O;  4DUZ O;  4DV6 O;  1HNZ O;  2UUB O;  1R6T A;  2UU9 O;  1AIL A;  3M8A A;  2ZKO A;  2ZM6 O;  3SDL A;  4A5U B;  4OPA A;  5LMU O;  4DV3 O;  3OTO O;  4B3T O;  2LW7 A;  3RT3 C;  4JI0 O;  1N34 O;  1XEQ A;  5H5N A;  1F7Y A;  4B3S O;  1XNR O;  4JYA O;  2UXB O;  1YZB A;  2UXC O;  4LF6 O;  1A32 A;  3JAM N;  4DUY O;  2AGA A;  2DJV A;  2VQE O;  4JI4 O;  4JI8 O;  3J81 N;  1DK1 A;  4DR5 O;  1NS1 A;  4DR3 O;  4NXM O;  4LF9 O;  1X59 A;  4NXN O;  4DV0 O;  4JI2 O;  1N33 O;  1FYJ A;  1J5E O;  4DV5 O;  4KHP O;  4LF7 O;  1XMO O;  4B3M O;  4DR2 O;  2UUC O;  4LFC O;  1KUQ A;  4LFB O;  4YHH O;  4JI6 O;  4JI7 O;  4DR7 O;  4DV2 O;  4GKK O;  1IBM O;  2VQF O;  3F5T A;  4OPH A;  1IBK O;  4DR6 O;  1HNX O;  3T1H O;  5BXZ A;  4X65 O;  3R66 A;  2N74 A;  4X66 O;  1XNQ O;  2F4V O;  4DR4 O;  1AB3 A;  5IT9 N;  4JI1 O;  2Z0A A;  4DV7 O;  3T1Y O;  5LL6 Y;  2UUA O;  4LF5 O;  1N32 O;  1FKA O;  3J7A U;  5A2Q N;  4JI3 O;  3O65 A;  4LF4 O;  4OX9 O;  4B3R O;  5BY1 A;  4LFA O;  4X62 O;  5BR8 O;  2HHH O;  3J80 N;  4DR1 O;  1IBL O;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...