5LMNO

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmnO00
2AGAA 1A32A 4YHHO 4LF4O 2UXBO 4LF6O 1AB3A 5BY1A 1HNXO 4JI0O 4LF5O 4DR3O 1AILA 4DV2O 2N74A 1I94O 3F5TA 2FKXA 1R1BA 1D2DA 1XMQO 4DV3O 5FLXN 1FJGO 4B3MO 4B3TO 1N36O 2F4VO 4JI7O 4DV1O 4AQYO 1YZBA 4OPAA 4DUZO 4X66O 4B3RO 2VQEO 3RT3C 3J7AU 3JAMN 3M8AA 2ZM6O 4X65O 1J5EO 4LFAO 1G1XB 5IWAO 4DR7O 1HR0O 4X62O 4YY3O 1N34O 5A2QN 3O65A 5IT9N 4LF8O 5LMUO 4GKJO 4OPHA 4JV5O 4DR4O 2E5LO 3T1HO 4JI2O 4X64O 4JI3O 4JI5O 4JYAO 4GKKO 4NXNO 1XNRO 1N33O 1IBKO 2ZKOA 4LF9O 2UXCO 4JI1O 1XNQO 1XMOO 4KHPO 2VQFO 1R6TA 3J81N 1NS1A 5H5NA 2JRIA 4DR1O 5LMNO 3SDLA 2Z0AA 3R66A 5BR8O 2UXDO 2DJVA 2LW7A 4NXMO 1FYJA 1X59A 2DOSA 4K0KO 4A5UB 4DR5O 1IBMO 1F7YA 4DR6O 5LL6Y 3OTOO 3T1YO 1KUQA 1IBLO 4DV4O 4JI4O 4LF7O 4DV0O 4DV5O 4JI6O 4B3SO 1XEQA 4DV6O 4LFBO 4DR2O 2HHHO 1N32O 4OX9O 4DV7O 1HNWO 4DUYO 1HNZO 1DK1A 4JI8O 5BXZA 3J80N 2UU9O 2UUAO 2UUCO 4LFCO 2UUBO 1FKAO
chains in the Genus database with same CATH superfamily
2GTSA 2CDYA 4MW8A 2YXLA 1FPOA 1JQ0A 2XAJA 4GX0A 4QJFB 2P5OA 1NTZH 3I55V 4LWSB 5FPRA 2K1EA 5CB4A 1I5YA 4R50A 3DXRA 4KL1A 2DWEC 3JAWA 3B09A 4P30A 3JSLA 3EFFK 3J7AU 1WP7A 2YXYA 4GLXA 1VF7A 3E22A 3AG4C 3ZRVA 5HFLA 1SERA 4KP4A 4P2ZA 3N2GB 3AK2A 2DQ0A 1Q6UA 2XTAA 1FJGB 4XDKA 3CCJV 1AI6A 4U3FH 3A0BZ 3K57A 1S72V 1FFTB 5EBLC 4O2AA 3WB2A 4G28B 4AILC 1J95A 2OWOA 5J2UB 4QPKA 4X64O 4NXNB 4IIJA 4H13B 1IBKO 2GHYA 4BW9A 3OE7G 3SPHA 3CCSV 1KD1W 2Q4PA 4JV5B 2W6IG 2QWOB 4K35A 2XAGA 1GN2A 3GWOA 3ABMB 1N33B 5EC2C 4X1YA 2E3CA 1K73W 2EJ7A 1SQBH 3A0HZ 1THZA 2WLHA 4NTWA 4JI6O 3ZMSA 5KHJA 4DV6O 1IVSA 4RWUA 2XT9A 4JAUA 1MG1A 1UPGA 4BR6A 4JI8O 3HKBA 3ABUA 4NXMB 1GN6A 1GN3A 4O2BB 2BOCC 2Z3YA 5C93A 2Q7EA 4LF7B 3BRCA 2EIKC 5EBWC 4DO2A 4MTOA 1JMKC 1WN7A 5B3SB 4X1KA 3CRAA 3H1IH 2N74A 4G27B 4J7KA 5A9GA 1GAXA 4JYYA 1LNQA 3BA9A 1QBZA 5DM6V 3SYAA 1B06A 5CA1A 4W4LA 4LF4B 1Q3EA 4B3RO 2CE4A 1FXKA 3K9SA 3CYOA 1TGOA 2ZDIC 4B7KA 1XDCA 5LXTA 2P67A 2GUZB 1COWG 1PNLA 1YTFD 2DYRC 4MW3A 3ZEDA 1L0NH 5EIBD 3E2EA 3L70H 4FMTA 4X65B 1K8AW 1XMOO 3KKYA 4PV1B 3BVOA 1K33A 1QLEC 5LMUB 3HKEB 1IZ3A 3D36C 4F6EA 4JI2B 4QE9A 2WWWA 2H3OA 5IY5C 5GW7A 4WFBV 2QM8A 4DK0A 2EZOA 1ZX3A 4O4HA 2VQFB 3ZRWA 2Q9LA 3ICXA 4HNAA 4AHCA 1R73A 4YIOA 5JJNB 5IYZB 1YJNV 1WA8A 3LUTB 4YJ3A 5LHIA 1S76D 2UUAO 2P22C 1G8MA 2ITCC 3AG7A 2OCHA 1K3EA 4DR6B 1NTMH 2CK3G 2R9AA 1KMIZ 2B1IA 3BHPA 5BY1A 4J9ZB 4RUFA 4J11A 5H6QA 4LFBB 5H9CA 1RM1B 4DV7B 4XDLA 1FS0G 2ADQB 3IFXA 3M99B 4K3AA 1Q8IA 2CH7A 2PTMA 1WLEA 2ETNA 2OCCC 1FXVA 3CCMV 1KECA 4CS3A 3G71V 2IU0A 3LSSA 2C2AA 1BSMA 4U3JB 2ZIOA 3LSUA 5KMGA 4EEQA 2QKSA 2HVKC 3JATA 3CMAV 3LSQA 5AG2A 2R9RB 3OUFA 2P7TC 3OFNG 1BGYH 3GB7C 2XHBA 2CTQA 4JYAB 2QE7G 3A8TA 5KX5A 4UB6Z 2B9ZA 2WA3A 1H2GA 3CRMA 2GSMB 3UQ8A 4JASA 2ZNJA 4MVSA 5LA6A 1XNQO 2ZT9B 2GV9A 1P49A 3F7YC 2AXTZ 3QNEA 3CP1A 4O4IB 2Q0AA 4F6RB 2BSKA 4BWAA 2ADPA 1XUQA 5IJ9A 3ABMC 2CAZC 4MTXA 4JAAA 1XI1A 1M9NA 1Q90D 1SQVH 3OD4A 3K06A 4K0KO 2ZIMA 3ZHQA 1QLNA 2XOKG 1BQ0A 4DV0B 3OTOO 2Y48A 4FLVA 5KLVH 1BHBA 1DF5A 2ZE6A 2YIDA 4DR2O 3CC2V 1Y76B 3BCCH 1NI8A 1DK1A 1AR4A 4EB6B 5JVDA 3BY6A 3UT5B 5JH7B 2CGNA 5B3SC 4WFEA 4FFKA 4JZGA 4JI6B 1AROP 3T4DA 1AR1B 4LF5O 4DV6B 2V7QG 1TUBB 3CSXA 1YJWV 1D2DA 1PV0A 4JI8B 2LO1A 3ZMZA 1H2MA 4IHJB 3STZC 1M4UA 1Q5OA 3ZMUA 1VF5B 3JD3A 4DUZO 4IYHA 5F2VO 5IWAB 4WBNA 1J5EO 3B8NA 4RQEA 1SQPH 4ZOLA 3CCVV 2R9IA 4PDRA 3TK1A 2E5LB 2A3QA 3T1HB 3HKDA 1PNKA 2WLMA 3FB5C 1H2NA 4B3RB 2HKOA 2QSAA 2RQ6A 5B1AC 4NXNO 1RPRA 2UXCO 4UCSA 4X20B 3FB8C 4TV9A 2XAHA 1NTKH 5K1PA 4B08A 1P7GA 5B66Z 3LDDA 1SA0B 1NS1A 1QNMA 3AG4B 3JD1A 3F5WC 4N21A 1QQCA 3UO3A 5HFMA 4DR5B 2LW7A 4GX2A 2LQTA 4ZHQB 3IGAC 1Q86W 1R3LC 3G6EV 3BPZA 2F43G 2HFEC 2L6LA 3K5LA 1WB7A 2P90A 2Q5ZA 2NN4A 2CGOA 4LNUA 1XEQA 1VIBA 1WP8A 3SYPA 4PI0A 1S77D 3VQYA 3HPLC 1HNWO 1VQKV 2FL4A 2UU9O 3CE2A 3CRQA 3TGUH 4MVRA 1H2SB 1SS3A 1A32A 4I9QA 3L75H 4LR3A 1U96A 4RUEA 3AG2C 4CH6A 4ZBMA 4TQDA 1HW7A 1ZL8A 1KYOF 4D7TA 5CA0A 4B3TB 1RSOA 5FLXN 4MVZA 2UUAB 3JSNA 2IJHA 5TISZ 4J10A 1QVGU 4UFZA 3H1HH 3KZIZ 4GYCB 4O4JA 4UV9A 2PYLA 4I50A 3JARB 4L87A 5LOVB 2A0LA 4P9OA 1K97A 3P30A 1YSCA 1DGSA 2WPDG 4MVOA 1PM9A 4JI5O 1TVKB 2IM9A 1OV9A 1T5EA 1CXZB 5KHGA 1CEZA 2ZD9A 5LYJA 3ZIAG 3J81N 2JGDA 5BR8B 3M7MX 1F23A 5LMNO 1FAFA 4O4LA 5IYBO 5CBFA 2OIEA 1L0LH 3CC4V 2MK3A 1I5XA 2P4VA 3WB0A 3FAVB 1XNQB 2DYRB 3N2GA 3G80A 3QVNA 3AK1A 3U0ZA 5ITZB 4YJ2A 4K8ZA 3ZN1A 3ETEA 3BA8A 2FMLA 1ZAUA 1HWYA 1Y67A 1VP7A 1PD3A 2DYSB 2ILMA 2EINB 4XBFA 1AI5A 4FK5C 5EZYB 4N23A 2JS3A 2JK5C 1KKDA 5LP6A 3IC9A 3L72H 2UUCO 4K0KB 3E35A 3FB7C 4UCVA 3OTOB 3ABKB 2WLLB 4YHHO 3WU2Z 3U10A 5IY5B 2QWPB 3F5TA 1EZVH 2YEVB 4TUYA 4IT5A 1DF4A 3I5DA 1P7BA 1YZBA 1JJOA 2F93B 2VQEO 2DQ3A 3JD4A 4LF5B 5C8YA 1K34A 1JA8A 1ZUQA 4UB8Z 4WF9V 5IJ0B 1YTFB 3HKCA 2QEXV 2QKCA 3TJTA 4NKGB 5CBGA 3O65A 2XAQA 4R6ZA 5IT9N 1PL0A 2NLJC 1PL4A 4GKJO 3ZN0A 5FPOA 4DUZB 3OMAB 1Y74B 4JYAO 3STLC 3UCSC 4GKKO 3LNNA 1WJZA 5IE9A 2OCCB 3K03A 3G6BA 1J5EB 5CA3A 2WLNA 3JALB 1P84F 2PY5A 3D8CA 2YUAA 4UV8A 3FX7A 2DWDC 5DN6G 4BIOA 4DR1O 1GRJA 4H33A 4UXNA 2AW9A 3SDLA 4I4TB 1OZ0A 1XL4A 1NR1A 2UXCB 4QPJA 4JTAB 1SF9A 1IBLO 4DV0O 1FXHA 1RPOA 4LP8A 4B3SO 3SYQA 1BL8A 4E4EA 4TV8B 2QDOA 4I5SA 1Y66A 1YVWA 2PF4E 2W0XA 2YICA 1YITV 5KHKA 1WAZA 3KCYA 4LFCO 1M93A 2JJ1G 2H8PC 4PA3A 3D3QA 3TETA 2YDEA 1TAEA 3LDEA 2JS5A 3C3SA 1NR7A 5L3CA 1HNWB 4WFFA 3DC6A 3SPCA 3ZJZA 3EXAA 2UU9B 2YIAA 2Q0OC 3L9DA 4DRXA 3B2EE 4J9YB 4AQYO 1P4RA 4PA7A 3AG3C 3L71H 3T1CA 3CPWU 5IYZA 2HG5C 5J2TB 5IWAO 1N34B 1B04A 1N0JA 3OUSA 1MOFA 4UUJC 4KXRA 2XAFA 1O9GA 1R3IC 2W6JG 2E5LO 2BTQB 2EJRA 3T4ZA 3T1HO 2WLIA 1JPXA 2CUGA 3ZBHA 1U97A 3DXRB 4FM0A 3K58A 4D7SA 1XNRO 2B5UA 4IGGA 5JJEB 4JI1O 4B7EA 1EN4A 1YDXA 1S5JA 2RCVA 4H44B 1XREA 3MHSC 4X88A 3P32A 3S3XA 3L73H 3E22B 3ZRSA 3Q4HA 2X0LA 1W0KG 1B6QA 1VF6A 3K9AA 3P3PA 4JYCA 2ZE5A 1S0VA 1V55C 1NT2B 4JI5B 5L3BA 3RYFA 4DR5O 4O2AB 4UVBA 2LP7A 4GUNA 1R3KC 3ZHRA 4ZI7A 1FFXA 5LBQA 4DK1A 4DV5O 2DYSC 2EINC 3IJ4A 2QTSA 4LCUC 5B1AB 3D3IA 3JCZA 1LUWA 5LMNB 1Z5VA 5BMVA 4Z1VA 2X6CA 1PP9H 4CZZA 3ABKC 4P9PA 3RYCA 1KC8W 5JJJB 4O4IA 3QO7A 4F6RA 4X1YB 5JWPA 1HNXO 1PPJH 4JI0O 5K1XA 4DR3O 3RYHA 3VQWA 4I0XB 2M6YA 2A79B 4PI2A 3CXCU 2UUCB 4B3TO 2AHYA 3SPGA 2QTOA 4HAMA 1AJQA 1AR5A 3HKBB 4YHHB 4NR1A 3QF7A 4RAIA 5JCOA 2AHZA 2IU3A 1AI7A 2HLDG 4PD4F 3ASOC 2PI4A 4X1KB 3VOUA 5EIBC 4YY3O 3AG2B 1GM9A 1F4MA 1WPBA 5D5PA 2XASA 2L35A 2QWNB 1H8HG 3RN4A 2PGGA 2VQEB 3JASA 4PDLA 5JQGA 1G4YB 3BEHA 2KG7A 3ZHUA 5CA1B 2ZKOA 4LF9O 2GBOA 1LR1A 2IH3C 2IJIA 2EIJB 1L8DA 1SQQH 5LXTB 1F51A 3OR6C 3E86A 3RYIA 4GKJB 4UVCA 4LBEC 2JVDA 2Z0AA 1UFIA 5BR8O 2UXDO 4GKKB 1WNSA 1FYJA 2ATKC 4A5UB 4MVMA 2GDSA 2VWJA 2AZ0A 4DYLA 4JI4O 3PJSK 1CP9A 1Q6HA 3MAQA 1JCHA 3H01A 4F4LA 1YXBA 3FB6C 1JFFA 1BCCH 1MZEA 4DR1B 2HHHO 3KCXA 1WB8A 5J9PC 1OCOC 2Y0IA 1AJPA 4TWKA 4GX1A 5E1AC 1IURA 4KUMA 3ZMTA 1IBLB 5IYCO 4B3SB 2EULA 1NU1H 4GX5A 2JJ2G 4EFEA 1I94O 3JAKA 4O4HB 4JPRA 1R1BA 3ZRWB 1X4TA 4HNAB 3OEHG 2ITDC 4X8AA 4LFCB 1XHXA 4JI7O 1WA8B 1YJ9V 1QR9A 4OPAA 4MTFA 4BAYA 5L3GA 4Q20A 2CTWA 4FFBA 2LFRA 1VQ8V 2HVJC 2OT5A 4DR7O 1EFRG 4AQYB 1YI2V 4JZ2A 1NZ6A 1K5QA 3LDCA 1CPYA 4JI3O 2CH7B 1GK9A 4HZ3A 3FD9A 1DLBA 4CC5A 5EYPA 5KMGB 4WFAV 4PJ0Z 2YI9A 3JATB 5H5NA 1BT8A 1XILA 2WLJA 3CHXA 4ASUG 2DJVA 1K4DC 4U7OA 1XNRB 1XBLA 2WLKA 4JI1B 3E83A 4BIUA 1IBMO 2RMKB 5LL6Y 2YSUB 5LGUA 3T1YO 3TXQA 3AEIA 4G2KA 1EBOA 1MMMA 5LA6B 3A2FA 2DN9A 2EILB 3UO2A 5BZBA 1QCEA 4UCUA 1S5HC 2BSKB 4QE7A 5IJ9B 5EBMC 1M5IA 3OGCC 1Q43A 2UXBO 4DV5B 2AZ2A 4LF6O 1RP3B 2Z5UA 4I55B 2PUSA 4DV2O 3UKMA 2QWRB 1SC5B 3ZMVA 2DE0X 1ZTEA 2M7WA 1JVMA 2JEXA 5JVDB 2OTLV 2Q68A 4NB5A 1NJIW 5FNVA 1HNXB 2QGNA 2YC0A 4JI0B 4DR3B 3AG1B 4OXSA 1SRYA 1N34O 5LHHA 3MDSA 1JJ2U 1M56C 2Q69A 1H8EG 1R3JC 4LC1A 1V54C 3D36A 4OPHA 1Y6XA 4DR4O 1JX9A 1EM1A 4WFGA 1FXKC 3APOA 5GONA 1H38A 4PA9A 2F1MA 3B40A 2EIJC 2NR5A 5CMUA 3AG3B 3B77A 4HYOA 1TUEB 4YY3B 3LNMB 4WBNB 2D3OW 2XUMA 2JRIA 3RW0A 5H6RA 4ZOLB 4J7ZA 3IC7A 1EN5A 1H2KA 3H1KH 3ZS8C 3ETDA 4X1IB 4LF9B 3FFQA 1VQ7V 3OMIB 3IAYA 3K5NA 3OTFA 4QGPA 5B1OA 4NVPA 1L1FA 1AJNA 4LWSA 1HP8A 4TV9B 4DUYO 1HNZO 1Y74A 2QA4V 2UXDB 1SQXH 1I0HA 3CEIA 3FYIB 2A06H 2AGAA 4JI4B 4MVQA 1V55B 1K7DA 2D2CB 2E76B 1BMFG 2V4DA 1E79G 3UM7A 4UCTA 2HHHB 4QIWF 4I4TA 3HB3B 4MVUA 4LNUB 4PHZA 3N2KB 1YIJV 3RBZA 5J2UA 1NVPB 1NQTA 4DW0A 3X2QB 3OAAG 5JCOC 1K5SA 3CJHB 3EVKA 4XDJA 3L74H 4LH6A 5KHIA 3JAMN 4TV8A 1I94B 3M8AA 4H37A 3ASNB 2VWKA 2Q73A 4TT3G 3BABA 3SJAC 2P6JA 4JI7B 2E75B 2A9HA 1W0JG 2B1GA 5CA0B 2P4KA 1RSOB 5IYDO 2JEUA 3DGEA 5KA5A 2Y4UA 1LUVA 3ABLB 1SESA 5KUMA 1BS3A 4JGSA 1VQPV 4DR7B 4O4JB 2HEPA 1GTOA 1R6TA 4GZRB 4I50B 2F95B 3ZHVA 1SKVA 3K0GA 3SPJA 4O2BA 3ASOB 4FLUA 4JI3B 2YS8A 2Y4TA 1VARA 4J80A 1BE3H 2Q7GA 1IXBA 3H1LH 5J2TA 2X6BA 2EILC 4NTXA 1BQZA 1SZTA 3SYCA 3CMEV 4KFMA 1VQ5V 2PI5A 1OCZB 2BTQA 4CH3A 2WSSG 5LYJB 3H9VA 2JGDB 4IYIA 3OR7C 1IBMB 2UUBO 4O4LB 1BHAA 4Q6GA 3T1YB 1AP6A 2EZPA 3SR2C 3GVMA 4JTCB 2GUZA 3E8FA 1ORQC 5IDJA 5KAFZ 1Z2GA 2FTKA 4YJ2B 2QM7A 1XMQO 1NH2B 2HP8A 3CRRA 1OCCB 4J41A 5CN0A 4DV1O 2RN9A 4QNHB 2F66C 1KU9A 5L3EA 2UXBB 5LP6B 4LF6B 1OCOB 3AG1C 2JDIG 2QM4A 1MZFA 4IL6Z 1YF2A 5KAIZ 4DV2B 2N04A 4LFAO 2VRZA 3HKEA 4I9WA 4LF8B 1HR0O 4X62O 5E79Z 1OJHA 1YHQV 1GMGA 3BFRA 2YI8A 5EC1C 3SJQC 2IBZH 3CCQV 4Z1MG 5GTHZ 5B1BC 1NVPD 4MSWC 1QHTA 2DMXA 3K5OA 4TUYB 3ZHTA 2YIBA 3JCUZ 2W0FC 2ZXWB 4I0XA 3EHBB 1PKXA 4PA4A 4KHPO 3WG7C 2N05A 5C8YB 1N4CA 3HKCB 4ICGA 1M57B 2ZE8A 1HDJA 4DR4B 2G38A 4JYBA 3R66A 1K9MW 4C7UA 2Q6AA 4X89A 1GO3F 3SYOA 1XHZA 2DOSA 5CB4B 3CCRV 1F7YA 3CC7V 3JAWB 1F4NA 4DV4O 1GN4A 2O57A 2KB1A 2IH1C 5GTIZ 4OX9O 2CTRA 1XQ8A 1FD9A 4PDMA 4UVAA 2PYJA 4U3JA 1ZLZA 4Z2WA 3K5MA 5KUKA 2Y69B 3I56V 2V1DA 3K04A 1VQNV 4ABMA 1AB3A 4IIJB 1MSWD 1IDSA 2BOBC 5LHGA 4DUYB 4FVMA 1HNZB 4DV3O 3X2QC 3NR7A 1SQGA 1N36O 3JYCA 4JAVA 1VQLV 3CB2A 1OCRC 2KQXA 1K4CC 4TQFA 4FM1A 5KHHA 3RT3C 3G4SV 3ASNC 1NKDA 5EK0A 1N0NA 3ZX6A 1KP3A 2HJFC 3ML0A 1DTOA 4JTDB 1G1XB 3CXHF 3ZHSA 2RDCA 3N27A 1R6KA 1XL6A 3S3WA 3CCLV 2ZR2A 4BIZA 5CBHA 3O9OA 1NH2D 1EN6A 3ABLC 4LH7A 3CRCA 3H1JH 4DRXB 4FM2A 3OW2U 3OM3B 4W4KA 3VQVA 3CX5F 3JD0A 2R72A 1R6NA 1ROPA 1Y76A 4CS4A 4BW5A 2RNBA 4EB6A 1B3QA 3UT5A 1YEWA 3TXSA 5JH7A 1VMGA 3E89A 5DEDA 3W7UA 1VQMV 1VQOV 4R7CA 3DSQA 1IXMA 1ZSPA 1V9PA 4GCZA 1TA8A 1X59A 1M56B 2ZNIA 3U11A 1V54B 2R70A 2WLIB 1TUBA 1OCZC 3ZRXA 1FXKB 4UCRA 3ETQA 2WAMA 4IHJA 1N32O 3Q4HB 1QVFU 2BTOA 2X6AA 2A7WA 2ZR3A 2ZINA 1Q81W 3W7TA 5FL7G 3RYFB 4FZ0A 1URFA 2QR4A 4TOIA 4ZI7B 1FFXB 1MSDA 1OCCC 2IW5A 1O9HA 5B5EZ 4X9QA 2Q7HA 2LW1A 1ENVA 4B3MO 2F4VO 5LP6C 4CH5A 2UUBB 1EZJA 5BMVB 2LGQA 2HR3A 4JF3A 4X66O 4X20A 3NXSA 4AI8A 3W7XA 2PZSA 1W2BU 3RYCB 1SA0A 2EIMB 2ZM6O 1XMQB 1Q7YW 3DTUB 3RVYA 5A2QN 4DV1B 3RYHB 2Q8VA 4X64B 4ZHQA 1MABG 3FYEB 1BZKA 2MW2B 4J42A 5L3DA 3A0RA 2ZXWC 5LGTA 1IBKB 4YJ3B 4EKWA 4I55A 2YXHA 2CTPA 1QR8A 2QWQB 4LFAB 3E8BA 4CS2A 1Y4MA 1M57C 1HR0B 4X62B 1ZWIC 3QG5A 1M90W 1SZXA 4WCEV 3G67A 2EX3A 2LGWA 4YIPA 1K92A 4CH4A 4FLWA 1Q6IA 3K79A 1JOYA 5LGNA 2JGUA 3C90A 3K3WA 3CCUV 3SJCC 1IX9A 3JASB 5JQGB 4KHPB 1QU7A 2KG7B 3K08A 3WB1A 2DW4A 1S3JA 3WFVA 3CS5A 2JIZG 1YCIA 2YIBD 2Y69C 4E2LA 3R65A 3J80N 3RYIB 1M1KW 1Z5WA 1FKAO 4U7NA 5D5QA 5KX5B 4I7ZB 3B4SA 3JARA 4DV4B 4J7JA 5LOVA 1N8RW 2ZCEA 1AILA 2GTAA 2FKXA 4OX9B 3T2MA 1GM8A 3B8MA 4L8JA 2FB5A 1FJGO 1JFFB 2K9PA 3FKSG 4X1IA 1W59A 4DW1A 1AP5A 1H2LA 2P06A 1TVKA 3CD6V 2UXNA 2QKAA 3OMNB 1WPXA 1XOUA 1RFYA 2ZDIA 4DV3B 3VBBA 1PNMA 3K59A 1N36B 3JAKB 4LF8O 4FPPA 1KQSU 3W7SA 3QO5A 2Q67A 4RQFA 4JV5O 3FAVA 3KG2A 3AK3A 4K8XA 4GT1A 1XMOB 5ITZA 3SGIA 3OEEG 4FLTA 4MS2A 1N33O 3RFRA 3N2KA 2ZQMA 5EZYA 2OYQA 3HR0A 4FFBB 4UCOA 3E8HA 4WFHA 1US6A 1GH6A 2WA4A 3DC5A 3CJHA 2Y0PA 3MHHC 3P3NA 2VS0A 2WLLA 3ABTA 4NXMO 1OHHG 3APQA 2KSDA 4PELA 4HBNA 1D5NA 2ZE7A 4FLYA 3SJBC 3F7VC 1RM1C 1NBMG 1KBHA 1KUQA 1E1QG 5B1BB 4LF7O 2ODMA 1UJWB 5H2FZ 3CWBH 4DXWA 1VF6C 5EYPB 2YEVA 2LFSA 1MA1A 3OGIB 4MT8A 3WG7B 3ZCCA 4OGQB 1G6UA 1JR9A 3THOA 2OTJV 4CC6A 3C3TA 2UXXA 3HKDB 1I08A 5IJ0A 4LF4O 4FLXA 3GWKC 3QTCA 2RJZA 3QO8A 2LJ2A 1VEWA 4ZIBA 1N32B 5KA6A 2BCCH 4TSFG 2NNUA 2EIKB 4ZKIA 1MNGA 1SQFA 3ETGA 1AI4A 2QJ1A 4EFBA 2H94A 2OIGA 4CBCA 2ARHA 4RO2A 3RWRD 3E8GA 2EIMC 3JALA 5DECA 3MD0A 1E1RG 5B1NA 3BAAA 4X65O 3SPIA 1Q82W 4B3MB 2EBOA 2F4VB 2X7RB 1GM7A 5LMUO 3K0DA 4X66B 4JI2O 3W7WA 4MTGA 1GKFA 3JD2A 3OT7A 4FZ1A 2ZM6B 1OCRB 2BE3A 5FNVB 2F23A 2VQFO 1VQ9V 1KB9F 2HJDA 4NYKA 3VQXA 1ZL8B 1KKCA 4FLZA 1S5LZ 1D5AA 1QLEB 4FJCC 3CCEV 2KKWA 2XNDG 4D6TH 4FIPC 4NTYA 2E74B 4DR6O 2IJKA 1KP2A 4R8CA 3TCUA 5GONB 3RGBA 4PA6A 4DR2B 4YXWG 5L3FA 3RVZA 2FYUH 1I7FA 4LFBO 4H0LB 4DV7O 2IJJA 1SETA 3PN1A 5BXZA 1AVMA 4PDVA 1VQ4V 1VQ6V
chains in the Genus database with same CATH topology
2AGAA 1A32A 4YHHO 4LF4O 2UXBO 4LF6O 1AB3A 5BY1A 1HNXO 4JI0O 4LF5O 4DR3O 1AILA 4DV2O 2N74A 1I94O 3F5TA 2FKXA 1R1BA 1D2DA 1XMQO 4DV3O 5FLXN 1FJGO 4B3MO 4B3TO 1N36O 2F4VO 4JI7O 4DV1O 4AQYO 1YZBA 4OPAA 4DUZO 4X66O 4B3RO 2VQEO 3RT3C 3J7AU 3JAMN 3M8AA 2ZM6O 4X65O 1J5EO 4LFAO 1G1XB 5IWAO 4DR7O 1HR0O 4X62O 4YY3O 1N34O 5A2QN 3O65A 5IT9N 4LF8O 5LMUO 4GKJO 4OPHA 4JV5O 4DR4O 2E5LO 3T1HO 4JI2O 4X64O 4JI3O 4JI5O 4JYAO 4GKKO 4NXNO 1XNRO 1N33O 1IBKO 2ZKOA 4LF9O 2UXCO 4JI1O 1XNQO 1XMOO 4KHPO 2VQFO 1R6TA 3J81N 1NS1A 5H5NA 2JRIA 4DR1O 5LMNO 3SDLA 2Z0AA 3R66A 5BR8O 2UXDO 2DJVA 2LW7A 4NXMO 1FYJA 1X59A 2DOSA 4K0KO 4A5UB 4DR5O 1IBMO 1F7YA 4DR6O 5LL6Y 3OTOO 3T1YO 1KUQA 1IBLO 4DV4O 4JI4O 4LF7O 4DV0O 4DV5O 4JI6O 4B3SO 1XEQA 4DV6O 4LFBO 4DR2O 2HHHO 1N32O 4OX9O 4DV7O 1HNWO 4DUYO 1HNZO 1DK1A 4JI8O 5BXZA 3J80N 2UU9O 2UUAO 2UUCO 4LFCO 2UUBO 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  1A32 A;  4YHH O;  4LF4 O;  2UXB O;  4LF6 O;  1AB3 A;  5BY1 A;  1HNX O;  4JI0 O;  4LF5 O;  4DR3 O;  1AIL A;  4DV2 O;  2N74 A;  1I94 O;  3F5T A;  2FKX A;  1R1B A;  1D2D A;  1XMQ O;  4DV3 O;  5FLX N;  1FJG O;  4B3M O;  4B3T O;  1N36 O;  2F4V O;  4JI7 O;  4DV1 O;  4AQY O;  1YZB A;  4OPA A;  4DUZ O;  4X66 O;  4B3R O;  2VQE O;  3RT3 C;  3J7A U;  3JAM N;  3M8A A;  2ZM6 O;  4X65 O;  1J5E O;  4LFA O;  1G1X B;  5IWA O;  4DR7 O;  1HR0 O;  4X62 O;  4YY3 O;  1N34 O;  5A2Q N;  3O65 A;  5IT9 N;  4LF8 O;  5LMU O;  4GKJ O;  4OPH A;  4JV5 O;  4DR4 O;  2E5L O;  3T1H O;  4JI2 O;  4X64 O;  4JI3 O;  4JI5 O;  4JYA O;  4GKK O;  4NXN O;  1XNR O;  1N33 O;  1IBK O;  2ZKO A;  4LF9 O;  2UXC O;  4JI1 O;  1XNQ O;  1XMO O;  4KHP O;  2VQF O;  1R6T A;  3J81 N;  1NS1 A;  5H5N A;  2JRI A;  4DR1 O;  5LMN O;  3SDL A;  2Z0A A;  3R66 A;  5BR8 O;  2UXD O;  2DJV A;  2LW7 A;  4NXM O;  1FYJ A;  1X59 A;  2DOS A;  4K0K O;  4A5U B;  4DR5 O;  1IBM O;  1F7Y A;  4DR6 O;  5LL6 Y;  3OTO O;  3T1Y O;  1KUQ A;  1IBL O;  4DV4 O;  4JI4 O;  4LF7 O;  4DV0 O;  4DV5 O;  4JI6 O;  4B3S O;  1XEQ A;  4DV6 O;  4LFB O;  4DR2 O;  2HHH O;  1N32 O;  4OX9 O;  4DV7 O;  1HNW O;  4DUY O;  1HNZ O;  1DK1 A;  4JI8 O;  5BXZ A;  3J80 N;  2UU9 O;  2UUA O;  2UUC O;  4LFC O;  2UUB O;  1FKA O; 
#chains in the Genus database with same CATH topology
 2GTS A;  2CDY A;  4MW8 A;  2YXL A;  1FPO A;  1JQ0 A;  2XAJ A;  4GX0 A;  4QJF B;  2P5O A;  1NTZ H;  3I55 V;  4LWS B;  5FPR A;  2K1E A;  5CB4 A;  1I5Y A;  4R50 A;  3DXR A;  4KL1 A;  2DWE C;  3JAW A;  3B09 A;  4P30 A;  3JSL A;  3EFF K;  3J7A U;  1WP7 A;  2YXY A;  4GLX A;  1VF7 A;  3E22 A;  3AG4 C;  3ZRV A;  5HFL A;  1SER A;  4KP4 A;  4P2Z A;  3N2G B;  3AK2 A;  2DQ0 A;  1Q6U A;  2XTA A;  1FJG B;  4XDK A;  3CCJ V;  1AI6 A;  4U3F H;  3A0B Z;  3K57 A;  1S72 V;  1FFT B;  5EBL C;  4O2A A;  3WB2 A;  4G28 B;  4AIL C;  1J95 A;  2OWO A;  5J2U B;  4QPK A;  4X64 O;  4NXN B;  4IIJ A;  4H13 B;  1IBK O;  2GHY A;  4BW9 A;  3OE7 G;  3SPH A;  3CCS V;  1KD1 W;  2Q4P A;  4JV5 B;  2W6I G;  2QWO B;  4K35 A;  2XAG A;  1GN2 A;  3GWO A;  3ABM B;  1N33 B;  5EC2 C;  4X1Y A;  2E3C A;  1K73 W;  2EJ7 A;  1SQB H;  3A0H Z;  1THZ A;  2WLH A;  4NTW A;  4JI6 O;  3ZMS A;  5KHJ A;  4DV6 O;  1IVS A;  4RWU A;  2XT9 A;  4JAU A;  1MG1 A;  1UPG A;  4BR6 A;  4JI8 O;  3HKB A;  3ABU A;  4NXM B;  1GN6 A;  1GN3 A;  4O2B B;  2BOC C;  2Z3Y A;  5C93 A;  2Q7E A;  4LF7 B;  3BRC A;  2EIK C;  5EBW C;  4DO2 A;  4MTO A;  1JMK C;  1WN7 A;  5B3S B;  4X1K A;  3CRA A;  3H1I H;  2N74 A;  4G27 B;  4J7K A;  5A9G A;  1GAX A;  4JYY A;  1LNQ A;  3BA9 A;  1QBZ A;  5DM6 V;  3SYA A;  1B06 A;  5CA1 A;  4W4L A;  4LF4 B;  1Q3E A;  4B3R O;  2CE4 A;  1FXK A;  3K9S A;  3CYO A;  1TGO A;  2ZDI C;  4B7K A;  1XDC A;  5LXT A;  2P67 A;  2GUZ B;  1COW G;  1PNL A;  1YTF D;  2DYR C;  4MW3 A;  3ZED A;  1L0N H;  5EIB D;  3E2E A;  3L70 H;  4FMT A;  4X65 B;  1K8A W;  1XMO O;  3KKY A;  4PV1 B;  3BVO A;  1K33 A;  1QLE C;  5LMU B;  3HKE B;  1IZ3 A;  3D36 C;  4F6E A;  4JI2 B;  4QE9 A;  2WWW A;  2H3O A;  5IY5 C;  5GW7 A;  4WFB V;  2QM8 A;  4DK0 A;  2EZO A;  1ZX3 A;  4O4H A;  2VQF B;  3ZRW A;  2Q9L A;  3ICX A;  4HNA A;  4AHC A;  1R73 A;  4YIO A;  5JJN B;  5IYZ B;  1YJN V;  1WA8 A;  3LUT B;  4YJ3 A;  5LHI A;  1S76 D;  2UUA O;  2P22 C;  1G8M A;  2ITC C;  3AG7 A;  2OCH A;  1K3E A;  4DR6 B;  1NTM H;  2CK3 G;  2R9A A;  1KMI Z;  2B1I A;  3BHP A;  5BY1 A;  4J9Z B;  4RUF A;  4J11 A;  5H6Q A;  4LFB B;  5H9C A;  1RM1 B;  4DV7 B;  4XDL A;  1FS0 G;  2ADQ B;  3IFX A;  3M99 B;  4K3A A;  1Q8I A;  2CH7 A;  2PTM A;  1WLE A;  2ETN A;  2OCC C;  1FXV A;  3CCM V;  1KEC A;  4CS3 A;  3G71 V;  2IU0 A;  3LSS A;  2C2A A;  1BSM A;  4U3J B;  2ZIO A;  3LSU A;  5KMG A;  4EEQ A;  2QKS A;  2HVK C;  3JAT A;  3CMA V;  3LSQ A;  5AG2 A;  2R9R B;  3OUF A;  2P7T C;  3OFN G;  1BGY H;  3GB7 C;  2XHB A;  2CTQ A;  4JYA B;  2QE7 G;  3A8T A;  5KX5 A;  4UB6 Z;  2B9Z A;  2WA3 A;  1H2G A;  3CRM A;  2GSM B;  3UQ8 A;  4JAS A;  2ZNJ A;  4MVS A;  5LA6 A;  1XNQ O;  2ZT9 B;  2GV9 A;  1P49 A;  3F7Y C;  2AXT Z;  3QNE A;  3CP1 A;  4O4I B;  2Q0A A;  4F6R B;  2BSK A;  4BWA A;  2ADP A;  1XUQ A;  5IJ9 A;  3ABM C;  2CAZ C;  4MTX A;  4JAA A;  1XI1 A;  1M9N A;  1Q90 D;  1SQV H;  3OD4 A;  3K06 A;  4K0K O;  2ZIM A;  3ZHQ A;  1QLN A;  2XOK G;  1BQ0 A;  4DV0 B;  3OTO O;  2Y48 A;  4FLV A;  5KLV H;  1BHB A;  1DF5 A;  2ZE6 A;  2YID A;  4DR2 O;  3CC2 V;  1Y76 B;  3BCC H;  1NI8 A;  1DK1 A;  1AR4 A;  4EB6 B;  5JVD A;  3BY6 A;  3UT5 B;  5JH7 B;  2CGN A;  5B3S C;  4WFE A;  4FFK A;  4JZG A;  4JI6 B;  1ARO P;  3T4D A;  1AR1 B;  4LF5 O;  4DV6 B;  2V7Q G;  1TUB B;  3CSX A;  1YJW V;  1D2D A;  1PV0 A;  4JI8 B;  2LO1 A;  3ZMZ A;  1H2M A;  4IHJ B;  3STZ C;  1M4U A;  1Q5O A;  3ZMU A;  1VF5 B;  3JD3 A;  4DUZ O;  4IYH A;  5F2V O;  5IWA B;  4WBN A;  1J5E O;  3B8N A;  4RQE A;  1SQP H;  4ZOL A;  3CCV V;  2R9I A;  4PDR A;  3TK1 A;  2E5L B;  2A3Q A;  3T1H B;  3HKD A;  1PNK A;  2WLM A;  3FB5 C;  1H2N A;  4B3R B;  2HKO A;  2QSA A;  2RQ6 A;  5B1A C;  4NXN O;  1RPR A;  2UXC O;  4UCS A;  4X20 B;  3FB8 C;  4TV9 A;  2XAH A;  1NTK H;  5K1P A;  4B08 A;  1P7G A;  5B66 Z;  3LDD A;  1SA0 B;  1NS1 A;  1QNM A;  3AG4 B;  3JD1 A;  3F5W C;  4N21 A;  1QQC A;  3UO3 A;  5HFM A;  4DR5 B;  2LW7 A;  4GX2 A;  2LQT A;  4ZHQ B;  3IGA C;  1Q86 W;  1R3L C;  3G6E V;  3BPZ A;  2F43 G;  2HFE C;  2L6L A;  3K5L A;  1WB7 A;  2P90 A;  2Q5Z A;  2NN4 A;  2CGO A;  4LNU A;  1XEQ A;  1VIB A;  1WP8 A;  3SYP A;  4PI0 A;  1S77 D;  3VQY A;  3HPL C;  1HNW O;  1VQK V;  2FL4 A;  2UU9 O;  3CE2 A;  3CRQ A;  3TGU H;  4MVR A;  1H2S B;  1SS3 A;  1A32 A;  4I9Q A;  3L75 H;  4LR3 A;  1U96 A;  4RUE A;  3AG2 C;  4CH6 A;  4ZBM A;  4TQD A;  1HW7 A;  1ZL8 A;  1KYO F;  4D7T A;  5CA0 A;  4B3T B;  1RSO A;  5FLX N;  4MVZ A;  2UUA B;  3JSN A;  2IJH A;  5TIS Z;  4J10 A;  1QVG U;  4UFZ A;  3H1H H;  3KZI Z;  4GYC B;  4O4J A;  4UV9 A;  2PYL A;  4I50 A;  3JAR B;  4L87 A;  5LOV B;  2A0L A;  4P9O A;  1K97 A;  3P30 A;  1YSC A;  1DGS A;  2WPD G;  4MVO A;  1PM9 A;  4JI5 O;  1TVK B;  2IM9 A;  1OV9 A;  1T5E A;  1CXZ B;  5KHG A;  1CEZ A;  2ZD9 A;  5LYJ A;  3ZIA G;  3J81 N;  2JGD A;  5BR8 B;  3M7M X;  1F23 A;  5LMN O;  1FAF A;  4O4L A;  5IYB O;  5CBF A;  2OIE A;  1L0L H;  3CC4 V;  2MK3 A;  1I5X A;  2P4V A;  3WB0 A;  3FAV B;  1XNQ B;  2DYR B;  3N2G A;  3G80 A;  3QVN A;  3AK1 A;  3U0Z A;  5ITZ B;  4YJ2 A;  4K8Z A;  3ZN1 A;  3ETE A;  3BA8 A;  2FML A;  1ZAU A;  1HWY A;  1Y67 A;  1VP7 A;  1PD3 A;  2DYS B;  2ILM A;  2EIN B;  4XBF A;  1AI5 A;  4FK5 C;  5EZY B;  4N23 A;  2JS3 A;  2JK5 C;  1KKD A;  5LP6 A;  3IC9 A;  3L72 H;  2UUC O;  4K0K B;  3E35 A;  3FB7 C;  4UCV A;  3OTO B;  3ABK B;  2WLL B;  4YHH O;  3WU2 Z;  3U10 A;  5IY5 B;  2QWP B;  3F5T A;  1EZV H;  2YEV B;  4TUY A;  4IT5 A;  1DF4 A;  3I5D A;  1P7B A;  1YZB A;  1JJO A;  2F93 B;  2VQE O;  2DQ3 A;  3JD4 A;  4LF5 B;  5C8Y A;  1K34 A;  1JA8 A;  1ZUQ A;  4UB8 Z;  4WF9 V;  5IJ0 B;  1YTF B;  3HKC A;  2QEX V;  2QKC A;  3TJT A;  4NKG B;  5CBG A;  3O65 A;  2XAQ A;  4R6Z A;  5IT9 N;  1PL0 A;  2NLJ C;  1PL4 A;  4GKJ O;  3ZN0 A;  5FPO A;  4DUZ B;  3OMA B;  1Y74 B;  4JYA O;  3STL C;  3UCS C;  4GKK O;  3LNN A;  1WJZ A;  5IE9 A;  2OCC B;  3K03 A;  3G6B A;  1J5E B;  5CA3 A;  2WLN A;  3JAL B;  1P84 F;  2PY5 A;  3D8C A;  2YUA A;  4UV8 A;  3FX7 A;  2DWD C;  5DN6 G;  4BIO A;  4DR1 O;  1GRJ A;  4H33 A;  4UXN A;  2AW9 A;  3SDL A;  4I4T B;  1OZ0 A;  1XL4 A;  1NR1 A;  2UXC B;  4QPJ A;  4JTA B;  1SF9 A;  1IBL O;  4DV0 O;  1FXH A;  1RPO A;  4LP8 A;  4B3S O;  3SYQ A;  1BL8 A;  4E4E A;  4TV8 B;  2QDO A;  4I5S A;  1Y66 A;  1YVW A;  2PF4 E;  2W0X A;  2YIC A;  1YIT V;  5KHK A;  1WAZ A;  3KCY A;  4LFC O;  1M93 A;  2JJ1 G;  2H8P C;  4PA3 A;  3D3Q A;  3TET A;  2YDE A;  1TAE A;  3LDE A;  2JS5 A;  3C3S A;  1NR7 A;  5L3C A;  1HNW B;  4WFF A;  3DC6 A;  3SPC A;  3ZJZ A;  3EXA A;  2UU9 B;  2YIA A;  2Q0O C;  3L9D A;  4DRX A;  3B2E E;  4J9Y B;  4AQY O;  1P4R A;  4PA7 A;  3AG3 C;  3L71 H;  3T1C A;  3CPW U;  5IYZ A;  2HG5 C;  5J2T B;  5IWA O;  1N34 B;  1B04 A;  1N0J A;  3OUS A;  1MOF A;  4UUJ C;  4KXR A;  2XAF A;  1O9G A;  1R3I C;  2W6J G;  2E5L O;  2BTQ B;  2EJR A;  3T4Z A;  3T1H O;  2WLI A;  1JPX A;  2CUG A;  3ZBH A;  1U97 A;  3DXR B;  4FM0 A;  3K58 A;  4D7S A;  1XNR O;  2B5U A;  4IGG A;  5JJE B;  4JI1 O;  4B7E A;  1EN4 A;  1YDX A;  1S5J A;  2RCV A;  4H44 B;  1XRE A;  3MHS C;  4X88 A;  3P32 A;  3S3X A;  3L73 H;  3E22 B;  3ZRS A;  3Q4H A;  2X0L A;  1W0K G;  1B6Q A;  1VF6 A;  3K9A A;  3P3P A;  4JYC A;  2ZE5 A;  1S0V A;  1V55 C;  1NT2 B;  4JI5 B;  5L3B A;  3RYF A;  4DR5 O;  4O2A B;  4UVB A;  2LP7 A;  4GUN A;  1R3K C;  3ZHR A;  4ZI7 A;  1FFX A;  5LBQ A;  4DK1 A;  4DV5 O;  2DYS C;  2EIN C;  3IJ4 A;  2QTS A;  4LCU C;  5B1A B;  3D3I A;  3JCZ A;  1LUW A;  5LMN B;  1Z5V A;  5BMV A;  4Z1V A;  2X6C A;  1PP9 H;  4CZZ A;  3ABK C;  4P9P A;  3RYC A;  1KC8 W;  5JJJ B;  4O4I A;  3QO7 A;  4F6R A;  4X1Y B;  5JWP A;  1HNX O;  1PPJ H;  4JI0 O;  5K1X A;  4DR3 O;  3RYH A;  3VQW A;  4I0X B;  2M6Y A;  2A79 B;  4PI2 A;  3CXC U;  2UUC B;  4B3T O;  2AHY A;  3SPG A;  2QTO A;  4HAM A;  1AJQ A;  1AR5 A;  3HKB B;  4YHH B;  4NR1 A;  3QF7 A;  4RAI A;  5JCO A;  2AHZ A;  2IU3 A;  1AI7 A;  2HLD G;  4PD4 F;  3ASO C;  2PI4 A;  4X1K B;  3VOU A;  5EIB C;  4YY3 O;  3AG2 B;  1GM9 A;  1F4M A;  1WPB A;  5D5P A;  2XAS A;  2L35 A;  2QWN B;  1H8H G;  3RN4 A;  2PGG A;  2VQE B;  3JAS A;  4PDL A;  5JQG A;  1G4Y B;  3BEH A;  2KG7 A;  3ZHU A;  5CA1 B;  2ZKO A;  4LF9 O;  2GBO A;  1LR1 A;  2IH3 C;  2IJI A;  2EIJ B;  1L8D A;  1SQQ H;  5LXT B;  1F51 A;  3OR6 C;  3E86 A;  3RYI A;  4GKJ B;  4UVC A;  4LBE C;  2JVD A;  2Z0A A;  1UFI A;  5BR8 O;  2UXD O;  4GKK B;  1WNS A;  1FYJ A;  2ATK C;  4A5U B;  4MVM A;  2GDS A;  2VWJ A;  2AZ0 A;  4DYL A;  4JI4 O;  3PJS K;  1CP9 A;  1Q6H A;  3MAQ A;  1JCH A;  3H01 A;  4F4L A;  1YXB A;  3FB6 C;  1JFF A;  1BCC H;  1MZE A;  4DR1 B;  2HHH O;  3KCX A;  1WB8 A;  5J9P C;  1OCO C;  2Y0I A;  1AJP A;  4TWK A;  4GX1 A;  5E1A C;  1IUR A;  4KUM A;  3ZMT A;  1IBL B;  5IYC O;  4B3S B;  2EUL A;  1NU1 H;  4GX5 A;  2JJ2 G;  4EFE A;  1I94 O;  3JAK A;  4O4H B;  4JPR A;  1R1B A;  3ZRW B;  1X4T A;  4HNA B;  3OEH G;  2ITD C;  4X8A A;  4LFC B;  1XHX A;  4JI7 O;  1WA8 B;  1YJ9 V;  1QR9 A;  4OPA A;  4MTF A;  4BAY A;  5L3G A;  4Q20 A;  2CTW A;  4FFB A;  2LFR A;  1VQ8 V;  2HVJ C;  2OT5 A;  4DR7 O;  1EFR G;  4AQY B;  1YI2 V;  4JZ2 A;  1NZ6 A;  1K5Q A;  3LDC A;  1CPY A;  4JI3 O;  2CH7 B;  1GK9 A;  4HZ3 A;  3FD9 A;  1DLB A;  4CC5 A;  5EYP A;  5KMG B;  4WFA V;  4PJ0 Z;  2YI9 A;  3JAT B;  5H5N A;  1BT8 A;  1XIL A;  2WLJ A;  3CHX A;  4ASU G;  2DJV A;  1K4D C;  4U7O A;  1XNR B;  1XBL A;  2WLK A;  4JI1 B;  3E83 A;  4BIU A;  1IBM O;  2RMK B;  5LL6 Y;  2YSU B;  5LGU A;  3T1Y O;  3TXQ A;  3AEI A;  4G2K A;  1EBO A;  1MMM A;  5LA6 B;  3A2F A;  2DN9 A;  2EIL B;  3UO2 A;  5BZB A;  1QCE A;  4UCU A;  1S5H C;  2BSK B;  4QE7 A;  5IJ9 B;  5EBM C;  1M5I A;  3OGC C;  1Q43 A;  2UXB O;  4DV5 B;  2AZ2 A;  4LF6 O;  1RP3 B;  2Z5U A;  4I55 B;  2PUS A;  4DV2 O;  3UKM A;  2QWR B;  1SC5 B;  3ZMV A;  2DE0 X;  1ZTE A;  2M7W A;  1JVM A;  2JEX A;  5JVD B;  2OTL V;  2Q68 A;  4NB5 A;  1NJI W;  5FNV A;  1HNX B;  2QGN A;  2YC0 A;  4JI0 B;  4DR3 B;  3AG1 B;  4OXS A;  1SRY A;  1N34 O;  5LHH A;  3MDS A;  1JJ2 U;  1M56 C;  2Q69 A;  1H8E G;  1R3J C;  4LC1 A;  1V54 C;  3D36 A;  4OPH A;  1Y6X A;  4DR4 O;  1JX9 A;  1EM1 A;  4WFG A;  1FXK C;  3APO A;  5GON A;  1H38 A;  4PA9 A;  2F1M A;  3B40 A;  2EIJ C;  2NR5 A;  5CMU A;  3AG3 B;  3B77 A;  4HYO A;  1TUE B;  4YY3 B;  3LNM B;  4WBN B;  2D3O W;  2XUM A;  2JRI A;  3RW0 A;  5H6R A;  4ZOL B;  4J7Z A;  3IC7 A;  1EN5 A;  1H2K A;  3H1K H;  3ZS8 C;  3ETD A;  4X1I B;  4LF9 B;  3FFQ A;  1VQ7 V;  3OMI B;  3IAY A;  3K5N A;  3OTF A;  4QGP A;  5B1O A;  4NVP A;  1L1F A;  1AJN A;  4LWS A;  1HP8 A;  4TV9 B;  4DUY O;  1HNZ O;  1Y74 A;  2QA4 V;  2UXD B;  1SQX H;  1I0H A;  3CEI A;  3FYI B;  2A06 H;  2AGA A;  4JI4 B;  4MVQ A;  1V55 B;  1K7D A;  2D2C B;  2E76 B;  1BMF G;  2V4D A;  1E79 G;  3UM7 A;  4UCT A;  2HHH B;  4QIW F;  4I4T A;  3HB3 B;  4MVU A;  4LNU B;  4PHZ A;  3N2K B;  1YIJ V;  3RBZ A;  5J2U A;  1NVP B;  1NQT A;  4DW0 A;  3X2Q B;  3OAA G;  5JCO C;  1K5S A;  3CJH B;  3EVK A;  4XDJ A;  3L74 H;  4LH6 A;  5KHI A;  3JAM N;  4TV8 A;  1I94 B;  3M8A A;  4H37 A;  3ASN B;  2VWK A;  2Q73 A;  4TT3 G;  3BAB A;  3SJA C;  2P6J A;  4JI7 B;  2E75 B;  2A9H A;  1W0J G;  2B1G A;  5CA0 B;  2P4K A;  1RSO B;  5IYD O;  2JEU A;  3DGE A;  5KA5 A;  2Y4U A;  1LUV A;  3ABL B;  1SES A;  5KUM A;  1BS3 A;  4JGS A;  1VQP V;  4DR7 B;  4O4J B;  2HEP A;  1GTO A;  1R6T A;  4GZR B;  4I50 B;  2F95 B;  3ZHV A;  1SKV A;  3K0G A;  3SPJ A;  4O2B A;  3ASO B;  4FLU A;  4JI3 B;  2YS8 A;  2Y4T A;  1VAR A;  4J80 A;  1BE3 H;  2Q7G A;  1IXB A;  3H1L H;  5J2T A;  2X6B A;  2EIL C;  4NTX A;  1BQZ A;  1SZT A;  3SYC A;  3CME V;  4KFM A;  1VQ5 V;  2PI5 A;  1OCZ B;  2BTQ A;  4CH3 A;  2WSS G;  5LYJ B;  3H9V A;  2JGD B;  4IYI A;  3OR7 C;  1IBM B;  2UUB O;  4O4L B;  1BHA A;  4Q6G A;  3T1Y B;  1AP6 A;  2EZP A;  3SR2 C;  3GVM A;  4JTC B;  2GUZ A;  3E8F A;  1ORQ C;  5IDJ A;  5KAF Z;  1Z2G A;  2FTK A;  4YJ2 B;  2QM7 A;  1XMQ O;  1NH2 B;  2HP8 A;  3CRR A;  1OCC B;  4J41 A;  5CN0 A;  4DV1 O;  2RN9 A;  4QNH B;  2F66 C;  1KU9 A;  5L3E A;  2UXB B;  5LP6 B;  4LF6 B;  1OCO B;  3AG1 C;  2JDI G;  2QM4 A;  1MZF A;  4IL6 Z;  1YF2 A;  5KAI Z;  4DV2 B;  2N04 A;  4LFA O;  2VRZ A;  3HKE A;  4I9W A;  4LF8 B;  1HR0 O;  4X62 O;  5E79 Z;  1OJH A;  1YHQ V;  1GMG A;  3BFR A;  2YI8 A;  5EC1 C;  3SJQ C;  2IBZ H;  3CCQ V;  4Z1M G;  5GTH Z;  5B1B C;  1NVP D;  4MSW C;  1QHT A;  2DMX A;  3K5O A;  4TUY B;  3ZHT A;  2YIB A;  3JCU Z;  2W0F C;  2ZXW B;  4I0X A;  3EHB B;  1PKX A;  4PA4 A;  4KHP O;  3WG7 C;  2N05 A;  5C8Y B;  1N4C A;  3HKC B;  4ICG A;  1M57 B;  2ZE8 A;  1HDJ A;  4DR4 B;  2G38 A;  4JYB A;  3R66 A;  1K9M W;  4C7U A;  2Q6A A;  4X89 A;  1GO3 F;  3SYO A;  1XHZ A;  2DOS A;  5CB4 B;  3CCR V;  1F7Y A;  3CC7 V;  3JAW B;  1F4N A;  4DV4 O;  1GN4 A;  2O57 A;  2KB1 A;  2IH1 C;  5GTI Z;  4OX9 O;  2CTR A;  1XQ8 A;  1FD9 A;  4PDM A;  4UVA A;  2PYJ A;  4U3J A;  1ZLZ A;  4Z2W A;  3K5M A;  5KUK A;  2Y69 B;  3I56 V;  2V1D A;  3K04 A;  1VQN V;  4ABM A;  1AB3 A;  4IIJ B;  1MSW D;  1IDS A;  2BOB C;  5LHG A;  4DUY B;  4FVM A;  1HNZ B;  4DV3 O;  3X2Q C;  3NR7 A;  1SQG A;  1N36 O;  3JYC A;  4JAV A;  1VQL V;  3CB2 A;  1OCR C;  2KQX A;  1K4C C;  4TQF A;  4FM1 A;  5KHH A;  3RT3 C;  3G4S V;  3ASN C;  1NKD A;  5EK0 A;  1N0N A;  3ZX6 A;  1KP3 A;  2HJF C;  3ML0 A;  1DTO A;  4JTD B;  1G1X B;  3CXH F;  3ZHS A;  2RDC A;  3N27 A;  1R6K A;  1XL6 A;  3S3W A;  3CCL V;  2ZR2 A;  4BIZ A;  5CBH A;  3O9O A;  1NH2 D;  1EN6 A;  3ABL C;  4LH7 A;  3CRC A;  3H1J H;  4DRX B;  4FM2 A;  3OW2 U;  3OM3 B;  4W4K A;  3VQV A;  3CX5 F;  3JD0 A;  2R72 A;  1R6N A;  1ROP A;  1Y76 A;  4CS4 A;  4BW5 A;  2RNB A;  4EB6 A;  1B3Q A;  3UT5 A;  1YEW A;  3TXS A;  5JH7 A;  1VMG A;  3E89 A;  5DED A;  3W7U A;  1VQM V;  1VQO V;  4R7C A;  3DSQ A;  1IXM A;  1ZSP A;  1V9P A;  4GCZ A;  1TA8 A;  1X59 A;  1M56 B;  2ZNI A;  3U11 A;  1V54 B;  2R70 A;  2WLI B;  1TUB A;  1OCZ C;  3ZRX A;  1FXK B;  4UCR A;  3ETQ A;  2WAM A;  4IHJ A;  1N32 O;  3Q4H B;  1QVF U;  2BTO A;  2X6A A;  2A7W A;  2ZR3 A;  2ZIN A;  1Q81 W;  3W7T A;  5FL7 G;  3RYF B;  4FZ0 A;  1URF A;  2QR4 A;  4TOI A;  4ZI7 B;  1FFX B;  1MSD A;  1OCC C;  2IW5 A;  1O9H A;  5B5E Z;  4X9Q A;  2Q7H A;  2LW1 A;  1ENV A;  4B3M O;  2F4V O;  5LP6 C;  4CH5 A;  2UUB B;  1EZJ A;  5BMV B;  2LGQ A;  2HR3 A;  4JF3 A;  4X66 O;  4X20 A;  3NXS A;  4AI8 A;  3W7X A;  2PZS A;  1W2B U;  3RYC B;  1SA0 A;  2EIM B;  2ZM6 O;  1XMQ B;  1Q7Y W;  3DTU B;  3RVY A;  5A2Q N;  4DV1 B;  3RYH B;  2Q8V A;  4X64 B;  4ZHQ A;  1MAB G;  3FYE B;  1BZK A;  2MW2 B;  4J42 A;  5L3D A;  3A0R A;  2ZXW C;  5LGT A;  1IBK B;  4YJ3 B;  4EKW A;  4I55 A;  2YXH A;  2CTP A;  1QR8 A;  2QWQ B;  4LFA B;  3E8B A;  4CS2 A;  1Y4M A;  1M57 C;  1HR0 B;  4X62 B;  1ZWI C;  3QG5 A;  1M90 W;  1SZX A;  4WCE V;  3G67 A;  2EX3 A;  2LGW A;  4YIP A;  1K92 A;  4CH4 A;  4FLW A;  1Q6I A;  3K79 A;  1JOY A;  5LGN A;  2JGU A;  3C90 A;  3K3W A;  3CCU V;  3SJC C;  1IX9 A;  3JAS B;  5JQG B;  4KHP B;  1QU7 A;  2KG7 B;  3K08 A;  3WB1 A;  2DW4 A;  1S3J A;  3WFV A;  3CS5 A;  2JIZ G;  1YCI A;  2YIB D;  2Y69 C;  4E2L A;  3R65 A;  3J80 N;  3RYI B;  1M1K W;  1Z5W A;  1FKA O;  4U7N A;  5D5Q A;  5KX5 B;  4I7Z B;  3B4S A;  3JAR A;  4DV4 B;  4J7J A;  5LOV A;  1N8R W;  2ZCE A;  1AIL A;  2GTA A;  2FKX A;  4OX9 B;  3T2M A;  1GM8 A;  3B8M A;  4L8J A;  2FB5 A;  1FJG O;  1JFF B;  2K9P A;  3FKS G;  4X1I A;  1W59 A;  4DW1 A;  1AP5 A;  1H2L A;  2P06 A;  1TVK A;  3CD6 V;  2UXN A;  2QKA A;  3OMN B;  1WPX A;  1XOU A;  1RFY A;  2ZDI A;  4DV3 B;  3VBB A;  1PNM A;  3K59 A;  1N36 B;  3JAK B;  4LF8 O;  4FPP A;  1KQS U;  3W7S A;  3QO5 A;  2Q67 A;  4RQF A;  4JV5 O;  3FAV A;  3KG2 A;  3AK3 A;  4K8X A;  4GT1 A;  1XMO B;  5ITZ A;  3SGI A;  3OEE G;  4FLT A;  4MS2 A;  1N33 O;  3RFR A;  3N2K A;  2ZQM A;  5EZY A;  2OYQ A;  3HR0 A;  4FFB B;  4UCO A;  3E8H A;  4WFH A;  1US6 A;  1GH6 A;  2WA4 A;  3DC5 A;  3CJH A;  2Y0P A;  3MHH C;  3P3N A;  2VS0 A;  2WLL A;  3ABT A;  4NXM O;  1OHH G;  3APQ A;  2KSD A;  4PEL A;  4HBN A;  1D5N A;  2ZE7 A;  4FLY A;  3SJB C;  3F7V C;  1RM1 C;  1NBM G;  1KBH A;  1KUQ A;  1E1Q G;  5B1B B;  4LF7 O;  2ODM A;  1UJW B;  5H2F Z;  3CWB H;  4DXW A;  1VF6 C;  5EYP B;  2YEV A;  2LFS A;  1MA1 A;  3OGI B;  4MT8 A;  3WG7 B;  3ZCC A;  4OGQ B;  1G6U A;  1JR9 A;  3THO A;  2OTJ V;  4CC6 A;  3C3T A;  2UXX A;  3HKD B;  1I08 A;  5IJ0 A;  4LF4 O;  4FLX A;  3GWK C;  3QTC A;  2RJZ A;  3QO8 A;  2LJ2 A;  1VEW A;  4ZIB A;  1N32 B;  5KA6 A;  2BCC H;  4TSF G;  2NNU A;  2EIK B;  4ZKI A;  1MNG A;  1SQF A;  3ETG A;  1AI4 A;  2QJ1 A;  4EFB A;  2H94 A;  2OIG A;  4CBC A;  2ARH A;  4RO2 A;  3RWR D;  3E8G A;  2EIM C;  3JAL A;  5DEC A;  3MD0 A;  1E1R G;  5B1N A;  3BAA A;  4X65 O;  3SPI A;  1Q82 W;  4B3M B;  2EBO A;  2F4V B;  2X7R B;  1GM7 A;  5LMU O;  3K0D A;  4X66 B;  4JI2 O;  3W7W A;  4MTG A;  1GKF A;  3JD2 A;  3OT7 A;  4FZ1 A;  2ZM6 B;  1OCR B;  2BE3 A;  5FNV B;  2F23 A;  2VQF O;  1VQ9 V;  1KB9 F;  2HJD A;  4NYK A;  3VQX A;  1ZL8 B;  1KKC A;  4FLZ A;  1S5L Z;  1D5A A;  1QLE B;  4FJC C;  3CCE V;  2KKW A;  2XND G;  4D6T H;  4FIP C;  4NTY A;  2E74 B;  4DR6 O;  2IJK A;  1KP2 A;  4R8C A;  3TCU A;  5GON B;  3RGB A;  4PA6 A;  4DR2 B;  4YXW G;  5L3F A;  3RVZ A;  2FYU H;  1I7F A;  4LFB O;  4H0L B;  4DV7 O;  2IJJ A;  1SET A;  3PN1 A;  5BXZ A;  1AVM A;  4PDV A;  1VQ4 V;  1VQ6 V; 
#chains in the Genus database with same CATH homology
 2AGA A;  1A32 A;  4YHH O;  4LF4 O;  2UXB O;  4LF6 O;  1AB3 A;  5BY1 A;  1HNX O;  4JI0 O;  4LF5 O;  4DR3 O;  1AIL A;  4DV2 O;  2N74 A;  1I94 O;  3F5T A;  2FKX A;  1R1B A;  1D2D A;  1XMQ O;  4DV3 O;  5FLX N;  1FJG O;  4B3M O;  4B3T O;  1N36 O;  2F4V O;  4JI7 O;  4DV1 O;  4AQY O;  1YZB A;  4OPA A;  4DUZ O;  4X66 O;  4B3R O;  2VQE O;  3RT3 C;  3J7A U;  3JAM N;  3M8A A;  2ZM6 O;  4X65 O;  1J5E O;  4LFA O;  1G1X B;  5IWA O;  4DR7 O;  1HR0 O;  4X62 O;  4YY3 O;  1N34 O;  5A2Q N;  3O65 A;  5IT9 N;  4LF8 O;  5LMU O;  4GKJ O;  4OPH A;  4JV5 O;  4DR4 O;  2E5L O;  3T1H O;  4JI2 O;  4X64 O;  4JI3 O;  4JI5 O;  4JYA O;  4GKK O;  4NXN O;  1XNR O;  1N33 O;  1IBK O;  2ZKO A;  4LF9 O;  2UXC O;  4JI1 O;  1XNQ O;  1XMO O;  4KHP O;  2VQF O;  1R6T A;  3J81 N;  1NS1 A;  5H5N A;  2JRI A;  4DR1 O;  5LMN O;  3SDL A;  2Z0A A;  3R66 A;  5BR8 O;  2UXD O;  2DJV A;  2LW7 A;  4NXM O;  1FYJ A;  1X59 A;  2DOS A;  4K0K O;  4A5U B;  4DR5 O;  1IBM O;  1F7Y A;  4DR6 O;  5LL6 Y;  3OTO O;  3T1Y O;  1KUQ A;  1IBL O;  4DV4 O;  4JI4 O;  4LF7 O;  4DV0 O;  4DV5 O;  4JI6 O;  4B3S O;  1XEQ A;  4DV6 O;  4LFB O;  4DR2 O;  2HHH O;  1N32 O;  4OX9 O;  4DV7 O;  1HNW O;  4DUY O;  1HNZ O;  1DK1 A;  4JI8 O;  5BXZ A;  3J80 N;  2UU9 O;  2UUA O;  2UUC O;  4LFC O;  2UUB O;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...