5JWPA

Crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYEEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title The facial triad in the alpha-ketoglutarate dependent oxygenase FIH: A role for sterics in linking substrate binding to O2 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 5jwpA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jwpA01
5JWPA 4AI8A 1H2MA 4NR1A 2YC0A 1MZFA 1H2LA 1IZ3A 3KCXA 2ILMA 2WA4A 3KCYA 2XUMA 1MZEA 3D8CA 4B7EA 4JAAA 4Z2WA 3P3NA 2Y0IA 1H2NA 2WA3A 4QU2A 3OD4A 4Z1VA 2YDEA 3P3PA 4BIOA 4B7KA 2W0XA 1YCIA 2CGNA 2CGOA 1H2KA
chains in the Genus database with same CATH superfamily
4F6EA 2W95A 4AEKA 1QNYA 1DQ1A 1SHWB 5ANNA 2VTXA 2HVJC 2VBPA 1EV12 4CTEA 1KFUL 3PVEA 4U36A 5A32A 1COV3 5FYYA 3K51A 3EMRA 2OPKA 5A3LA 1C8M2 4MVZA 5FP7A 3AG1C 3ZN4A 3HR0A 3ZHVA 4XUTA 1US6A 1GP5A 1L0LH 4LNVA 2XJSA 5FTTC 1KU9A 2ZINA 2RS51 2WINB 3JD71 2BWCA 1ULGA 1UPIA 2Q0AA 4JC1A 4KL1A 3ZHSA 3H50A 1PPJH 2WQZC 4WM7A 3OAAG 4UW3A 1FMD2 2Q7EA 3WD5A 1OJHA 5LBBA 2I2SA 1PM9A 4UW6A 3JARB 1CAVB 2PMWB 1YIPA 5CFCB 1GN3A 2RMKB 1H9PA 3ZMNA 4MW3A 3SPHA 1GN2A 1YJKA 1FPOA 4U7OA 1MS9A 2JRIA 3A7QA 4DXTA 5GZEA 1RUOA 2HWD1 4B3SB 4O2AA 1FI2A 4DR6O 3N9PA 4K9SA 4M0NA 1DGWA 3LDEA 1D2DA 3I54A 3MDSA 4FLUA 1WPXA 2AENA 1J84A 4IEOA 2DCTA 5EK0A 3VBHA 1TUBA 2X09A 4OI0A 2WWSA 3SR2C 2A0LA 4IXLA 1N36B 3IC9A 1GM9A 1OSGA 2W46A 1OPOA 4TXWA 1KGYA 1KJLA 2H6BA 3VBFC 3CB2A 3WFVA 3Q9OA 1SERA 1PK6B 5CBLA 4RQEA 3T3YA 1I5ZA 1Q56A 2A6WA 3O0XA 5A3TA 3IMNA 1NBMG 5JCOA 2W0FC 3ZDSA 1KQRA 4XBFA 5EZWA 4B08A 3AG2B 2XJRA 3I56V 1LECA 3HN1A 3AEIA 3N9MA 1JYCA 4Q4W1 1XYOA 2E31A 4TWTA 2X7RB 5C8CC 4YIPA 2XBO2 4QX0A 2Q67A 5CA0B 1P7GA 4EWEA 1LRHA 3OY8A 5FY8A 4RHV1 3ZEDA 3CXHF 5LOVA 1WP8A 3K06A 2E33A 1HKDA 4Y1XA 1V6MA 1FKAO 4IHJA 1C3HA 4GZ9A 1XJAA 1XNKA 4AVTA 4EN0A 1DU3D 4QXKA 4CPBA 3BHPA 4LFCB 3UCSC 1AL22 4LBNA 1RPRA 1QF3A 4ISRA 1ZYBA 5A6YA 3UKTA 2VXJA 3QOPA 5DQ0A 3ZYGA 4CDQA 5LK7B 4B3TB 5HXVA 3OBTA 2ID4A 3ALQA 3AZVA 3VBUA 5AFEA 4QIWF 1K3IA 4HYOA 4IEVA 2E75B 3CXCU 3Q4HB 4WFGA 5C93A 1IBMB 3IB3A 3WQ1A 1U96A 3WG7C 2Q1FA 3MAQA 3RVYA 1Y3TA 3PJQA 3C2UA 5DABA 2JGDA 1MABG 3KMHA 2Q5TA 1BEV3 1PVC3 1XI1A 3GZUC 1JA8A 3A4UA 4ZONA 5LGNA 4TUYA 1FPN3 2D6PA 2YC4A 4X65O 3ZPOA 4XQWA 5IYCO 4L8QA 3ELNA 2P17A 4WM7C 5BYNA 2X05A 1Q3EA 3RYFB 2RS13 4XQ4A 1IBKB 2D6NA 4JKKA 1LGCA 3H8RA 2DU0A 2UXXA 2H0BA 4WM8B 3MV11 3WDWA 3QBQA 3BU7A 2DU1A 3K3NA 2R071 2P4VA 5F3GA 1VQPV 4JTCB 1FATA 1NE6A 2ZHMA 4E4SA 1K92A 2J22A 3HNYM 1YHFA 2RS33 1Y7BA 1PD3A 3K46A 2DYSC 2DBNA 4Z1VA 3VBHC 2J42A 5FMOS 1W9TA 2WABA 5FZCA 2VW1A 3ZIXA 3FLRA 2RR13 3USSA 2YFZA 4P02B 4UW4A 5A9GA 3WB1A 3CBNA 4YZ4A 2ZQMA 3STZC 3RYPA 4X1YB 5FZKA 3PTYA 1WP7A 1RUI3 2P6HA 4JI2O 1QDCA 2Z79A 3OM3B 4PF5A 2LM3A 4HFSA 2QWQB 3IKWA 1L8DA 1G8WA 1N34O 3S3WA 5FCCA 5KC5A 3TYJA 1DP0A 5J3UA 5JCOC 1QJX2 1SQQH 3K4ZA 1ZVFA 3T09A 3VD5A 3WNMA 3ZFEB 1RSOA 1JUHA 1AI4A 2HLEA 5A3NA 1J5EO 3POBA 4DR1B 2VM9A 3T0DA 4TT3G 2UXBB 4NAMA 1R6KA 3CCQV 1KYOF 4DNYA 3WR0A 1R083 1WGPA 1W2BU 5GALA 5FY4A 1X7NA 3RZJA 5FWJA 4DV3B 4O4IA 2BUKA 3THPA 5FK7A 3ZIWA 4Q6GA 3M8AA 1LHWA 1OVPA 4I0BA 3FB6C 5E8AA 1DYOA 2GC2A 3NKTA 3EB7A 2XHKA 2FYUH 4YG6A 1O9HA 1FOD3 4UBGA 4M3CE 1GU3A 4E27A 2HP8A 5LP6A 4CDQC 4UCTA 4B3RB 1JH5A 3M7MX 3VBUC 4LF8O 2EALA 2JDUA 4GH4B 2WNVA 5EWSA 1IG3A 1JMKC 2N04A 2G4IA 4DR7O 2WAAA 4DRXB 3K03A 2OX0A 3AYCA 4JYYA 4X1KB 1TME3 4DUVA 3SHRA 4AG4A 2Y64A 1NI8A 4A4AA 1WNSA 2UXDO 3WVJA 1XQ8A 5LRRA 1PGSA 4B7EA 2Q0OC 3ABKB 3PJSK 2OA2A 1W2AX 1JYTA 4OGQB 2IUWA 3ZCCA 3T0AA 2YI8A 1QCEA 1OLME 1YFYA 2QSAA 4LNUA 1M5IA 4EEQA 3D4KA 5KMGA 5EJ3A 1MG1A 2GC1A 2Q7GA 5GTHZ 3OD0A 1HB4A 3EBRA 2IBZH 5AFBA 5BNOB 2YPDA 5L9BA 3IPVB 1SFPA 2XAGA 4FXKB 3SXWA 2CDYA 3LFMA 3AG3C 3ZX7A 1ULCA 1V6OA 1JHJA 1HQLA 3G7DA 4KU8A 2W94A 4N7UA 1JW6A 2VTXJ 4HXCA 4Y5TA 1RXFA 5FY9A 2OPWA 1SLTA 1RMU3 1W3XA 5BY1A 4AFBA 3SYQA 4QKDA 1ZREA 3RYIB 4NPMA 1BLZA 2MEV3 5LW9A 2ZGTA 2ARHA 2CL2A 3E8FA 5LXTB 5B1OA 1RHI1 4P00B 1GZWA 3CRRA 1SQBH 2RJZA 2UXCO 3DECA 2GZWA 1AR82 1QVGU 2ZMNA 4L87A 4AVCA 1XRUA 2EVXA 3H1JH 4GKJB 1IPKA 2F23A 3HNBM 4LKDA 3UL2A 4FBFA 4BR6A 2ZCWA 1RUJ1 4LFBO 3APOA 4LT5A 4E4ZA 3VZMA 1KXGA 5FL7G 4XDOA 4N53B 4UFIA 1HV1A 1QR9A 5B1BB 2LFSA 4D7SA 1BK1A 2JG8B 3BOPA 4LBEC 3MPPG 3RBZA 5JIAA 3V65A 2DYRC 3SCGA 4JRAA 3U10A 4HLTA 1PX3A 1RYYA 2UUAO 2WL1A 3DKQA 3THOA 3UQ8A 1LHOA 2DQ0A 1ZRCA 4M01A 5LP6C 4HKLA 2KA3A 3PU8A 3OE7G 1OT5A 3CS5A 3RVZA 3AZZA 3OGVA 5T5JA 2M7WA 3ZSJA 3NRUA 4NIHA 1B6QA 2QGNA 4XJUA 2RJ2A 4DV5O 1V6LA 4IESA 5B2GB 4A6SA 4OI1A 2TEPA 1PV0A 2ZX4A 2EIKB 5B3SC 2VD7A 2KG7B 4Z2AA 4RN5A 4HNAB 2W5FA 5LA1A 4P9XA 4MOAA 3SISA 3S5QA 5FZOB 1AR72 3PJYA 1FFXB 3N9QA 4W6WA 2BVVA 5FYVA 4DV1O 1H2GA 2EXHA 5E79Z 2VOXA 3BABA 3KD4A 1V6JA 3KV9A 2Y0OA 3SYPA 2YG0A 5CFCA 4IV3B 4QDQA 2NNUA 5F2SA 5LA6B 3ZMZA 4AVVA 4GB33 4LC1A 4PJ0Z 4HVRA 1KDMA 4XFCA 5LYJA 1DQ2A 1JZ7A 1KS4A 4BQ1A 3LEIA 3RN4A 1ONAA 5AC92 3RYKA 4R50A 2P3YA 2LALA 1OUSA 1UKRA 1D4M3 3KQ4B 3SC7X 4X8NA 1X8MA 3A2FA 1UZWA 1YF2A 2W08A 2YIBA 5EJZB 2W39A 1LOFA 2DDUA 4J80A 2R043 4LF5O 3MLKA 3MUY1 1QH6A 3NW4A 2VQUA 3DYOA 4CUAA 4Y22B 4Q4X3 5DZEA 1XOYA 2ZA9A 3CJHB 4G3YC 1OCRC 5KX5B 4NN0A 4NUBA 4AHZA 4NB5A 1PO13 2VCBA 4MADA 4D94A 1E5IA 4FM2A 4XTPA 3ON7A 4H7LA 3ASOC 1L1FA 2D6LX 3AMHA 4J9YB 1RUD1 4D7YA 1KB9F 3B8MA 5FXWA 4OPHA 4Y26A 1GOHA 4GCZA 3NNJA 1QOOA 3FB7C 4X8AA 3PIGA 3FMGA 4DV6O 1I5XA 5CA0A 3K9SA 4LO5B 5JPMB 1VP6A 4UXNA 3W9AA 5E16A 1Y74B 3D3QA 1RXGA 5FLHA 3WNLA 1T5EA 3E1F1 3ZN1A 4M3CB 3K57A 4YSFA 2SBAA 1R091 1KECA 3D36A 2ES3A 1OFSA 3QH6A 4QPJA 3CL1A 4WZFA 2PHDA 5IVBA 1EN5A 1ZNPA 4DW0A 2NYYA 5JOXA 2TUNA 1YJNV 5LASA 4BW9A 5EJ1B 1F4NA 1GWMA 5LK5A 2UUCO 3BAAA 4QWNA 4RYDA 2D97A 1GMMA 1VQKV 4ORFA 4YARA 2XLAA 3S7IA 2WFF2 2ZGNA 1X8EA 5J7MA 5ERLA 4XXAA 3WLUA 3Q4HA 1PM7A 5DPNA 3WUDA 1P84F 5FMCA 4DXSA 5C70A 2HYXA 4JI5O 3H1KH 1PNLA 1JU4A 4GYCB 1GFF2 4ZIBA 2BTQB 5IWFA 4O4HA 1NKGA 3VDCA 3H3LA 3IWZA 2A73B 4D3WA 2RQ6A 3RJRA 2LS6A 3HIFA 3VBSB 2CWSA 1O59A 4TLFA 3A23A 2LW8A 5HCBA 1R3KC 5CFCC 1CIWA 4I50B 2YPJA 4AFMA 4MGYE 3P1IA 1IXMA 3I8TA 1BMFG 3WF4A 4WM8A 3UGFA 4DR6B 2R061 3UT5A 2GN7A 3RZZA 3SCHA 2HJIA 1HRV1 3BVOA 3CE2A 2UXNA 3LOBA 2R7EB 2DURA 2QKSA 5EXOA 5FLJA 1ZBA2 2P3JA 2ZIMA 4Q4V3 5EQUA 1RINA 1W8NA 4TN7A 2R1DA 3RWNA 3SYOA 2VCCA 1LOFC 1XQNA 2HWB3 1JZ6A 5DAQA 3N7MA 2FMLA 4QX7A 3IDBB 3UJQA 2E9QA 3AG4B 3DTUB 4X1YA 1PK6C 5A33B 2GNTA 1GP4A 1XBFA 1PGL1 3J80N 4LXLA 4TZDA 4ITCA 1PM4A 3B9IA 1IG0A 1UY4A 3AKPA 1BZWA 1U5IA 4RO2A 3ETEA 3IC7A 5JSRA 2XGXA 1BBT2 2BFUL 2R0HA 3EO6A 1CVNA 1WA8A 2HWC1 3AP9A 4IEUA 3O1OA 2XNDG 5CB7A 4XDQA 2ZHLA 3AG2C 3ZO0B 4JI0O 1SLIA 4NMIA 1OCOB 4F6RB 2VZSA 2UYBA 1AI7A 1W0OA 3OBZA 1N1SA 1AL0G 3BIWE 3WNKA 4ES9A 4MGZE 3ZFFA 4LFAO 4HETA 1W6MB 2GUZB 1Q86W 2E5LO 1LOGA 5FY1A 1QJY2 4WCEV 5CMUA 2XJQA 3OUIA 3THCA 1Y9MA 3UT0A 4JCKA 3BY6A 3WG4A 3GJAA 3D36C 1L7LA 5A7NA 2QTOA 2P6CA 4AEMA 4LIUA 1DTOA 4I01A 1F5FA 1UOJA 2Y60A 5JMOA 3CU7A 4JKLA 4C1WA 5IW0A 1VQ9V 3ZYIB 4HN1A 4GH4A 5ACA1 2O1QA 1NLSA 4B1LA 2A3WA 1WKYA 5T5OA 2P3IA 4DRXA 5BMVB 1P49A 1POV1 2GMEA 1UNBA 1WPBA 4X1KA 3PNAA 2PHLA 1O4YA 2C6SA 2YIAA 4H14A 1REEA 3L71H 4X65B 2PLV3 3OMAB 1S0EA 2WNUB 1S0VA 2OWOA 2FL4A 4CCMA 1QEXA 3JQXA 2PAKA 2OTJV 4ARXA 1Q5OA 1W0PA 5DDJ2 4LLOA 4GAZA 2VUDA 2RNBA 2CE4A 2P37A 4WM8C 4FSJA 4YW7A 4MGKE 3F5WC 3FL7A 4QX1A 4JI8O 5T5PA 5BNOA 3I97A 5DAXA 5GONB 1L7QA 3CWBH 1POV0 2Z0AA 5HV0A 5KA6A 3VKOA 3QACA 4AVAA 3CRCA 2BCCH 1L0NH 2YXHA 2HWE2 3J9SA 1KJRA 5CBGA 3M99B 4UUJC 3CP1A 1QR8A 2WT0A 1EPWA 1EV13 4AQ6A 3RYIA 4HSJA 4JI2B 2NLRA 3PUHA 3RGBA 5A7OA 1KFXL 3KHBA 1N34B 5LXTA 2IM9A 5GKAC 1C8M3 3JB8A 2R49A 1MR5A 1IGOA 4AQYO 2HFEC 1OI6A 4CEYB 1IPJA 3L74H 4EN9B 2WYSA 3OT7A 4EV0A 4IL7A 2YBPA 4ZBMA 2Y69B 1RM1B 1FMD3 5LEJA 3BEHA 4QHZA 2VZRA 4MX3A 1GYKA 2C2AA 3F7VC 5L7OB 3CX5F 2GP5A 4UVBA 4N53A 3ZFFC 3RW0A 2YZ4A 1DHKB 3H7JA 3LB9A 2RCVA 1NTKH 2JG8A 2FKXA 4J41A 1FAFA 5IYYA 5B4XA 2OZJA 5IT6A 2GP3A 2DVGA 4XDPA 3G6JB 4Q26A 4GQ7A 2A7AA 4C90A 1YYNA 2Y8KA 2ZHNA 3VKNA 4H55A 2GDFA 4DUXA 3WUCA 5BNQA 2UURA 5KUMA 4I55B 5FFOC 5F1RA 2KR2A 2QEXV 3WDTA 1WLEA 1H38A 4YY3O 4EB6B 4EWAA 4IT5A 1AR61 1JOPA 4GH4C 2Z2SB 4GXLA 2Y4UA 2XH6A 2RM21 2ZGRA 4DR7B 3RYRA 4RQPB 3DYMA 4QB1A 1OHFA 1K8AW 3ES4A 5K7PA 1NTMH 4FPGA 3N2GB 3OPZA 4GD4A 4NOTA 1N8RW 3G6EV 2KG7A 2ILMA 1J1LA 2A79B 1Q8QA 3M1HA 1KEXA 1C5IA 4CH5A 3JASB 3K3OA 4R7CA 4OULA 5FAXA 5FZOA 1FFXA 3ABKC 1NLQA 2ET1A 4KWLA 2XBO3 2WSVA 3D82A 4WZCA 1PZ8A 4HVOA 4AQTA 2QQIA 1JZ2A 3I2OA 1VF6A 2SLIA 3C7GA 1EP0A 3AYEA 2P7TC 2RS52 4IV3A 1XNQB 4OMDA 3JD72 3RFRA 2HKXA 4D6TH 5LA6A 2GC0A 4GJZA 1YQ5A 5BNOC 1DYKA 3CRAA 1W6PB 3C7HA 3SCFA 2E63A 4LBOA 1H8VA 3JUUA 2JDYA 3O9OA 3LIHA 1G6UA 1AL23 4WFHA 1E5RA 4KGQA 3FBMA 1NZ6A 4LMFA 4QGPA 4XC9A 3WQ7A 2RDNA 3Q8AA 2ADEA 1LTEA 3NV2A 2IXKA 2HWD2 3BYWA 4AI2A 5KXCA 2XB6C 3OD4A 4CH6A 1JFFA 5JIUA 3CCJV 2WZR1 5F32A 1L3JA 4IE5A 5FY5A 2HHHO 3POYA 4XIKA 1VBD2 1KKCA 4X20A 2UXCB 1T2XA 3JATB 5JI9A 4Y22A 4J10A 5CB4A 2DYCA 4FK5C 3CJHA 1GNZA 5KX5A 1JODA 5IVCA 2HJFC 5BXXA 1CX1A 2EICA 4BQXA 2RDRA 4E2GA 1S72V 3B00A 2XOKG 5C7GA 1EPZA 4LFBB 1QOSA 1DZTA 3KGLA 3INAA 2FZ2A 3KQRA 4NHKA 2OCCB 2R9IA 3IGAC 5K9YA 1QQP1 4N53C 2CDOA 5FYHA 5HV4A 4WF9V 3B02A 2JG8C 3WW4A 5L9VA 4UVAA 3I3QA 3B5LB 1YHQV 4NTWA 5H9PA 4IE6A 5FNVB 3M7AA 3MV01 2UUAB 4LA2A 3P30A 4Q4W2 3ZJZA 1W8FA 2ORZA 4SLIA 3V0AB 4M3CA 4DIQA 1MZFA 3CC4V 3C7OA 2D3OW 4FM0A 5A3MA 1W6NB 1YJLA 2OIGA 3OEEG 2XVLA 5IYZB 4RHV2 2P2KA 2Q8EA 4JF3A 1RUF1 2Y33A 1LUWA 2BOJA 5FLXN 5C8WA 4DV5B 5K0UB 1VRH1 4I0XA 3LE0A 4PA7A 1MZ6A 5CZKA 2EIKC 4FPLA 3LNNA 3HQRA 1IVSA 1IBLO 2DUPA 1H9WA 1QJX3 4JQRA 5JAXA 3H1WA 2XL9A 2OTLV 1RUG1 4COZA 1OV9A 3T4ZA 3LDBA 3DUIA 2DVAA 4DV1B 2D3SA 4P30A 1K9MW 3RI8A 4GKYA 1QXJA 4XUNA 3VBSA 1JHNA 4U7NA 1TNRA 2WO2A 2A75A 4JI1O 2PUSA 1YQCA 3GZEA 1HQNA 2ZDIA 4B29A 1VF6C 5F5AA 1GRJA 4GMP3 4IV3C 4W4LA 2WNOA 1IKQA 3A0RA 3BALA 2IXLA 2ZKOA 3NXSA 2KSDA 4PBOA 4RA0A 1DF5A 4DV2O 3AMQA 5A3UA 3N2KB 1YLLA 1NR7A 4IETA 1M1KW 3LKJA 5IK5A 2CH7B 1SLBA 4Y1YA 3J4UH 2BGOA 5JCTA 2DTYA 4FLXA 5G04L 3MF9A 1H4HA 2R072 4JTNA 4D69A 2JEUA 4LF5B 4I3PA 1F2NA 3K48A 5A70A 1W3VA 1AJOA 4CYDA 1D0HA 2B46X 2LROA 1VBB2 3JD0A 1LGNA 3I4IA 3MIEA 3U4XA 2EJRA 4FFBA 1YTFD 3FX3A 3LPGA 3HB3B 4WFEA 2JDMA 2D6OX 5A33A 4YPJA 1VR3A 1WCDJ 2P67A 5JQGA 5GM0A 5I0UA 3UV9A 1BVP1 2WLLA 3CSXA 3ZXLA 2DUOA 2QQJA 1WW6A 2EAAA 2W52A 3SYCA 5JLVA 4MGQA 2QKDA 4CRQA 3I49A 3P3NA 3VZKA 4JASA 4DV6B 2IFWA 5C8YB 1GNYA 2NLJC 1PIV1 3WXPA 4ZS3A 3ABTA 2BOIA 2ZMKA 4FFGA 5F7UA 4GWNA 3KB5A 2WSSG 1QHTA 3ILNA 3PDQA 3GWKC 3AK0A 1YJ9V 1IQDC 1UY3A 1W6MA 2GUZA 1V70A 3ACFA 2KB1A 1D2QA 3X29B 4CCDA 2A6VA 3ZSMA 4X62O 4XVHA 1OD5A 1TMF1 1JYIA 4PT6A 2K2SA 5BXZA 2DCYA 1YTFB 4GKKB 1HDKA 4DRVA 5JH7B 1UX6A 1BVVA 2XJUA 4IIJB 1Q90D 2UUCB 2K1EA 1QHDA 3JAMN 1YIJV 2WT1A 4YIOA 2BGPA 4PQ9A 2F66C 4AGGA 4FFHA 1IHMA 4IEPA 4ZU7A 3SPIA 3P32A 2VOKA 3A21A 4YJ3B 1EYBA 1HQWA 1UKGA 3GB7C 2MEV1 2IJIA 3O0WA 5K1PA 2OIIA 3RJ2X 2JEXA 1GAXA 5E6HA 2RHPA 4FMTA 1AR83 3VGIA 5FRAA 3AC0A 3ASNB 3WDXA 3BN6A 5DUVA 4FPHA 2VUJA 4P2ZA 2ZE8A 3SPCA 4KHPO 4LA3A 3CCLV 2V09A 3HD8B 1OFNA 2WA4A 1K7DA 1TEIA 4AFAA 1CPMA 3WNOA 3MO4A 3OTOO 2PHRA 3VBSC 3GJBA 3SQOA 1I94O 2CDPA 4LTAA 4EWDA 2ZDIC 1NLRA 1LEDA 2A5ZA 2NMNA 4Z07A 4X88A 1OA2A 4GMP0 1NU1H 5I91A 4I02A 2JWPA 1BGYH 1J58A 5EYPB 3UM7A 4YW1A 5FQ0B 1QH7A 3E6CC 1FXZA 1AX1A 2Y6LA 3ZHQA 3JYCA 4ASLA 1O4ZA 2YICA 5CISA 3RMXA 2W87A 3AB0A 4DV0B 1G9FA 1MEC1 1M90W 2X5IA 2R1BA 2DN9A 3I2DA 3HKCB 4NWWA 5K1XA 1E1QG 1JZ5A 2VOVA 3AG4C 1JMUB 3EQEA 2VZTA 2OUHA 2KM2A 3LUTB 1XYPA 1ULOA 5C9AB 1PX4A 2ZABA 5EZYB 3CMAV 2EXKA 3ZMOA 3N7LA 1HV0A 5A7PA 3I55V 3ZDVA 1BQZA 4WBNA 1AR73 5F3EA 3KCCA 1W28A 4XMIA 1UY2A 1OCOC 1BHBA 1RHI2 3RZKA 5F6KA 2DQ3A 5A7QA 4LFAB 2WBKA 3POJA 4YVWA 1S55A 1LHNA 1S2BA 5C3SA 1STMA 1J3RA 1NX9A 3AK3A 1H2MA 3OEHG 1QLEB 3VDBA 1RUJ2 2N7GA 3K9AA 2RMU1 4FZ1A 3VBFB 1WMDA 5AC93 5B1NA 2ZXWB 1IKPA 3PUAA 4LWSB 3CF6E 2F43G 4LBLA 4MLOA 3T1LA 4UT5A 2BQPA 2VZQA 4EN6B 2EF6A 5H6QA 5FZMA 1JI6A 1CZTA 4LF4O 1BT8A 3ZRSA 1K4CC 1W2NA 3BPZA 3C7EA 4RQPA 4LKSA 5CKMA 2J7MA 2AEYA 4WVZA 2XG3A 3POFA 5M0TA 1D0GA 3N2GA 5C8CB 4L92A 4MXWB 3W7SA 1VAVA 3K04A 2NZ9A 2AZ5A 3HKDB 1CR7A 4K8FA 2ZCEA 1KMIZ 2DFCA 3JASA 2P1BA 5DXDA 3AP5A 3ZHRA 3K79A 1TA8A 1R6NA 3TJTA 5LHHA 5I8SA 1CD3G 4U2AA 3CQOA 1QIQA 4EN7B 4BE3A 3TCUA 1LESA 4LFCO 3LSSA 1UMHA 4CZSA 3ECQA 1F5JA 1UZZA 4X8PA 1LULA 1RTVA 4JI8B 1ULFA 2E74B 1BMV1 1CP9A 4DB5A 3OPWA 5A32B 2ZGOA 5I0RA 3B01A 1GR3A 1SEFA 1KP2A 3GZTB 1D5AA 3G4SV 1K42A 1EUUA 3SLIA 4PBPA 4NRQA 3NMBA 1RUH1 3WSOA 3WW1A 2ZMLA 1VBC2 4CU9A 4OUMA 2X5IC 2D5HA 3KSCA 1AILA 2WFF3 3LSUA 3FN9A 5LBQA 1KQSU 5KXDA 2PGGA 4WM7B 3BTXA 4UFLA 2RG4A 1BHGA 4YG3A 3RYCA 3EXUA 4XZPA 3PVBB 2A3YA 2ADPA 3ZYHA 4OQ9A 2MW2B 2YU1A 4RGKA 4UVCA 1ZAUA 4KP4A 3B3QE 4OCTA 4YW2A 4MVTA 1NOVA 1NE4A 3PVNA 3JSNA 3OYWB 5HFLA 3B94A 2BBAA 3ZYRA 1GWLA 1URXA 1YRZA 4YVWC 3JAKB 3K5LA 2GU9A 4NHYA 4PI0A 1TUBB 1G6NA 3MIDA 4KG8A 4OFGA 2V7QG 1S4CA 1V6NA 2Q8DA 1RUD2 2A3QA 5FNVA 4CPBD 3ZKUA 5DZFA 2WLJA 1OVSA 3H3ZA 4AI8A 4N9IA 4RL7A 1ZTEA 4DEQA 2WZPP 3AP6A 4FPKA 5CNAA 3CYOA 5CYYA 1UPSA 1ZBA3 4YY3B 1XNBA 5LEKA 1W6NA 2R16A 5EPAA 1G86A 5IYZA 2D6MA 5KBFA 4KUMA 2PI4A 2XJTA 3ZX6A 4CP1A 2IVIB 5FZ4A 3SH4A 4Q4V1 2Y6KA 4RQPC 5K0UA 2J1AA 1QGLA 3H9VA 1R092 3S6PA 3NV1A 4P5HA 1MSDA 1RC6A 4PIYA 2JDHA 1XU2A 2HEVF 4HMZA 4QPIB 4DUYO 3OY8B 4WBBA 1AB3A 5FPBA 4MVRA 3KT4A 5LOVB 1XEQA 2FTKA 4RD7A 1SLLA 1BBT3 5GZGA 3MGUA 4COYA 4AEJA 1W2UA 3S3XA 4IHJB 1XE0A 1KITA 3E8BA 2QCSB 2WLMA 4PA6A 3N4MA 5IJ0B 4DV3O 1S2KA 2ZE7A 5F3CA 2O8OA 3OF1A 1M9NA 4XE9A 1DCSA 2P4KA 5FZ1A 3PUIA 3AZXA 4XF9A 5FZAA 5IK4A 5IDJA 2F1MA 4RQFA 3NJXA 4HAMA 5J2UB 4UCOA 1UZVA 5E1RA 4E2SA 2JICA 3L75H 3VBUB 4CCOA 1QJY3 1QU0A 3M4FA 4QU1A 1CGPA 2YC0A 1YNAA 3JBG1 1EFRG 4ABMA 1LOBA 2EILB 1DGWX 4JDOA 2HEPA 3R65A 3APQA 2JX9A 4TUYB 1P4RA 3IDAA 4BQ3A 2OQ7A 2R062 2BVBA 4I9WA 3WNPA 1N3QA 2GHYA 1SACA 1R73A 1HRV2 4Q1PA 4L11A 3AJZA 1DF4A 1ASJ1 1GLHA 5EC1C 4BM8A 5JXJA 2JS5A 4AGVA 1X82A 3OCPA 3SGIA 1SRYA 4M3CF 5FY0A 1K34A 4P08A 1ZZ6A 2B4KA 2WAOA 2YDEA 2FBEA 1MVQA 2RJKA 2J1TA 2ZGSA 3BODA 3IMMA 4LUKA 2IW5A 5CA1A 2XDVA 5KA5A 3UGGA 3MZHA 2JDPA 5DDJ3 3ETPA 1RITA 3JSLA 1PGL2 4XABA 4IE7A 3RWRD 2HBUA 2OCCC 4ZY9A 2BBVA 2X8KA 1CPYA 2LW7A 2WN3A 2DWDC 2RE9A 3AP4A 5E89A 4Q27A 3NJYA 4AI3A 5A6XA 2HWC2 3MPBA 3ZYBA 3F7YC 5A1AA 4M4PA 2QQLA 2TBVA 3B9CA 4Z92B 4PDRA 5FYZA 1EN4A 2QR4A 4BAYA 4BXFA 3K5NA 2QJ1A 3O1VA 3ZSEA 3TB0A 5FP4A 1V9U1 2WLIA 2HWE3 2K0GA 5GTIZ 2JDAA 3JD4A 2D5FA 4GT1A 1I9RA 3MIHA 1GNHA 5C3RA 5FJHA 5FZ0A 1UZ0A 3AG7A 1OF3A 5K0UC 4BIOA 1AR91 4Q0QA 4KWJA 4I3GA 1I5YA 1AVMA 2CNAA 1QJU3 4YJ3A 4IGOA 2IU0A 1GUIA 1X9TA 3AX4A 1IBLB 1M56B 1A6CA 2OW4A 4MUVA 4GWJA 3K3WA 2FMDA 1JUIA 3OUHA 3IT8A 4A3XA 5C5TA 1M93A 5FBJA 5ACA2 4NAOA 3LFIA 4EKWA 1LAJA 1UY0A 2J1EA 3G67A 3ZXJA 1VRBA 2E3CA 4GX0A 1DQ0A 2PYJA 4XCBA 2EINB 2X53S 4YM0A 2ZE6A 3VKFC 1N33O 3DPRA 3HR9A 1TNFA 2ZKLA 3E83A 5FMBA 2RVAA 3USUB 2BNNA 2JG9B 4BDVB 4XF1A 4DV2B 2Y34A 2WNVB 4FPOB 2DOSA 4CBCA 5EYPA 4BOWA 4DY3A 3ICXA 5FQ0A 1Z7S1 4XCAA 2A1XA 1YVWA 4EYUA 2ZAAA 4YZ3A 1KDKA 1VEWA 4V2WA 4B3MO 4MTGA 2PQQA 2FCVA 2AC1A 4MTOA 5HCAA 2CAVA 2F4LA 4FPYA 3LOIA 4MVMA 1Y76B 2ZM6O 1Y4MA 1YEWA 3LDDA 3NWKA 3D3IA 2ZBJA 3TWIA 4JZ2A 1GKFA 2W1UA 5C33A 1Y9GA 4EJRA 2D2CB 4X64B 5BY5A 3FBYA 1YQ6A 1KRIA 1D2SA 4OHYA 2ITCC 4LNUB 4DR3O 3MLJA 2WLKA 5KMGB 5C9AA 1ALYA 2W9XA 2VW0A 1ENVA 5EZYA 5ITZA 3U78A 3E89A 3WW3A 4LORA 3ABUA 1LUVA 1HR0O 4UF0A 3ZM8A 5CIRA 3KWVA 2N74A 5H9RA 2FDKA 4YRDA 1GK9A 4MYEA 5I8TA 2E76B 4META 4I0AA 3ILRA 1K4DC 4CDWA 5KWRA 3I3BA 4XPVA 2UWCA 2GMPA 2H8PC 4EN8B 1SA0B 3WP5A 2E7AA 1OC1A 4JYBA 2RS53 3JD73 3KGZA 4AK3A 4XZUG 2ZT9B 1W0KG 1MS0A 3SH3A 4X62B 4D6QA 1ULEA 2JE9A 5GLTA 2BOCC 3T08A 4E8DA 4P5YA 4W6XA 2J1RA 4MSWC 1GZWB 1JZ4A 1GN6A 3LQCA 3Q8BA 1IX9A 3U75A 4DMIA 3RZGA 1NQTA 1FJGB 1BXHA 4YWAA 3VN4A 3SJQC 1OCRB 2UY9A 5HCHA 1UU5A 1R3LC 4MH0E 5H6RA 2HWD3 2CK3G 1G9CA 2Q4PA 4FQZA 3GM8A 3ASOB 4BXSV 5CKQA 1FXKB 3CC7V 1UWWA 1VBD3 4P9JA 1RPOA 1SCSA 3AFGA 3S5AA 1YQ2A 4MO3M 1PZ9A 2VC9A 1BQPA 1AR62 4MXWA 2QWOB 1PP9H 3ASNC 4BISA 4LBMA 5LMNO 3WDYA 2RM22 4AI1A 4BQ2A 1XYNA 3DC6A 3DEMA 5L3DA 1WA4A 4FT8A 1ROPA 1I94B 3J7AU 4NO4A 4E4DX 4DR5O 1CZSA 2DFBA 2WS91 3T1YO 3DPRC 2F93B 4KWKA 1NR1A 1KP3A 5LBCA 3UNPA 4BQ4A 1J95A 4I09A 4UFZA 5FO7B 2XPJA 4FOVA 4CCLA 3VBRA 1YXBA 5FUPA 4UW5A 4CS2A 2QQMA 3PN1A 4Q4W3 1ENRA 3FFQA 3T2OA 2QJVA 5IAVA 4HANA 5BZBA 5JR7B 1W9YA 4RHV3 3KV5A 1JS9A 1AROP 1AYM1 3OSDA 2NPIA 5L3CA 4LCUC 2YIBD 4BQWA 3H1IH 2GBOA 1XXNA 1ZZ8A 4A45A 4XAAA 5IWAO 3M3EA 2Z4FA 4MZUA 1PKXA 4LO7A 1TG7A 2TNFA 2EZOA 3MBWA 2VG9A 2YI9A 3QVNA 4KGGA 4DQAA 4K1ZA 2VE1A 5A3PA 5C9AC 2XWJB 3N27A 2GNBA 3BFRA 2YV8A 1SFYA 4KWUA 3W5NA 5FJKA 1AXKA 2YYOA 2YMZA 2VWKA 4FIPC 2WZR2 1H1MA 4JKMA 2ADQB 5JXHA 4JAUA 3TEXA 2HWF1 2IZWA 5LYJB 1QJX1 3OG2A 4CDWC 1YI2V 4CCEA 1XE8A 4NIGA 1WCQA 5F37A 4W8JA 3OYWA 4XYXA 1SDDB 3VDDB 4RGGA 4URTA 3ZHUA 2JDIG 2O57A 2WUHA 2F4PA 4CP2A 4CUBA 2VNOA 3JAKA 4RUFA 1XOUA 1WUVA 3B40A 4JPRA 4UFKA 1QLEC 4H0LB 3JAWB 2BJSA 2X29A 5EBWC 1Z0HA 2ZXWC 1GM7A 4BW5A 3ES1A 1QQP2 4B4RA 1IZ3A 2W1WA 3UYJA 4Z8BA 3ORJA 1NG0A 5FZGA 1OA3A 3SITA 2FDHA 3KKYA 1DDLA 2R073 4LF4B 1PNFA 4UWDA 4GZRB 3M3QA 4H3WA 1QQCA 4LP8A 2PYLA 2LJ2A 1VBB3 2YUEA 4A3ZA 2XTAA 2QDRA 4WVVA 3HKEB 1NCQB 2EXIA 3J8F1 2V73A 2Y6GA 4AHXA 4YJ2A 2JDNA 1ZZBA 4N43B 1RUF2 5C71A 4QPIA 4V1PA 2XLGA 3GBFA 3I5DA 1XMQO 3JQWA 4XAEA 3POWA 4WV8A 4XUOA 4QXBA 1HW7A 2WWUA 5FP8A 4LEJA 1LENA 1Y43B 2QZ3A 3UKNA 1WN7A 5TSWA 3GWOA 2B5UA 3EHBB 2P5BA 1XNCA 1VRH2 5IJ0A 5JSPA 3T4DA 5JOWA 1LB2A 1HIXA 1QJEA 1SQVH 3ZMSA 4D8MA 3IBMA 1NZCA 1QJFA 2D93A 3LEGA 5J2UA 3ACHA 3RYHA 3M3CA 1RUG2 1EBOA 3VBRC 1PNGA 1Q6HA 3WDUA 1OCCB 3J81N 3U14A 4UI9L 3WCRA 1GKBA 5FMDA 4FAHA 5SV5A 1NQJA 4O9EA 3ZVXA 3KCYA 4BU2A 5KXEA 3VBBA 2ETNA 4IERA 4ZS2A 4QXCA 4XOGA 4XTMA 3K4DA 3EJKA 2PHTA 2JB8A 3C3TA 1TUEB 1OBNA 1HB3A 4O4HB 1DLCA 3RPQA 1F31A 3ZRWB 4DR2O 1W8OA 1RUE1 2VECA 2JVDA 3KS7A 1YDXA 3B7MA 2QKCA 1IURA 4MTFA 4P9WA 3D5OA 5JDBA 3FYIB 1WLCA 1X36A 1W9WA 4LF7B 4ICGA 1THZA 1HB2A 3O1UA 4ZZ8A 1JJOA 5FK8A 2B39A 2WO3A 3FKSG 4IGPA 3UT5B 3H42B 4L99A 2BDRA 3CHXA 3IAYA 3I3MA 3HN3A 5CBFA 4JTDB 1S5JA 2PF4E 1VAKA 1ZRRA 2AHZA 3JD1A 4XQDA 4YVSB 3PTRB 3H1HH 4XJAA 4JAVA 4QQHA 3MHZA 1VMFA 5EYYA 1JJ2U 4NIAA 2IH3C 5IATA 2EBOA 3GCWA 2C9KA 5KHHA 1XHZA 2EZPA 5LBEA 3AVRA 1HJFA 5CVRA 2RDQA 1EZJA 4DXRA 2VZ3A 1RB8G 1QWRA 3VB9A 1XL6A 4F8AA 3N9LA 1PIV2 2C0ZA 3NKGA 2LP7A 4QM9A 2GTSA 3O14A 1UW8A 1D7PM 4ZHQA 4QHOA 1FS0G 1APNA 1VIWB 2AZ2A 5DAPA 5ANQA 1OQ1A 1OQDA 1WA8B 1AYN1 3FE5A 3GZAA 5D8AA 4NWVA 1JCHA 4HSLA 1N32O 3V56A 3FLTA 3RNSA 4D6RA 2ERFA 2VQEO 1TMF2 5JXGA 2NP0A 4JV4A 3ZXKA 1FNZA 4DUYB 1GOFA 4QPIC 4YNIA 1SLAA 2PHXA 4AHCA 3ZFFB 1XB9A 1F23A 4OUSA 2KKWA 2W92A 1W03A 1GICA 3ILFA 1K73W 2XWBB 4P14A 4ASUG 2CWMA 5CG9A 2YROA 1NXD1 2YFUA 1AZDA 3HPLC 4KXRA 3FHIB 4QDSA 1RHI3 5FPRA 2ZNIA 2RDSA 3VHNA 2VULA 2PXJA 4UB8Z 2WNEA 4XMAA 4EZHA 1HRI1 1SDWA 2IXIA 4DXWA 2GDSA 1GOGA 2VMDA 1JYVA 1FYJA 2JG9A 3USUA 4G9SB 2JIJA 4AFCA 1RUJ3 1W9SA 1E1RG 3CCRV 3HBKA 3POSA 4L9BA 3WF0A 3VLBB 1H30A 3K5MA 2VZVA 5CADA 2EILC 4QE9A 3FZ3A 1O3QA 3AJYA 5KHJA 4BHPA 4LF9O 1GZ9A 2CTRA 4J1WA 1SQ4A 1TZOA 1OZ0A 3MEPA 3LDCA 5B1AC 1KD1W 1Y76A 1ZRDA 3ATGA 1AR5A 5F5IA 2FQPA 2B45X 4PDLA 3LIGA 3HEIA 1C4RA 4N90A 4A44A 1OURA 4CCKA 2UWBA 1MEC2 3TN91 1AF9A 4JQTA 4FM1A 4CVUA 2Q1ZB 1O91A 4OXSA 4QXHA 5IE9A 5T5LA 2G38A 4AQSA 2W1SA 1SMVA 2ODMA 4OVEA 4EFEA 4IW3A 2FCUA 1XNQO 1QBZA 3J7LA 3HBZA 4W4KA 2EIJB 3C7FA 4LHSA 3ZXFA 3GBGA 2W6IG 3O0VA 4MGTA 1ZA7A 4CZZA 1F9KA 5AVAA 1SA0A 3TRSB 4OHZA 4A7ZA 3ASIA 4COUA 1LU1A 1CAXA 1AXYA 3U1XA 3PUQA 1CZVA 4CSWA 1B35B 4FPJA 1LGBA 5LBFA 3OOXA 3HQXA 3O1TA 1E57A 3H8OA 4OHXA 4JI6B 4J7KA 1VBC3 2VJXA 3O1PA 5I93A 2YBKA 2ARBA 1EZVH 3FAVB 5D8AC 5FPUA 1SETA 3R66A 1VMJA 1N0JA 2DUQA 5FOBB 2EA7A 3ZS8C 2PHWA 3KV4A 1R1A1 2RMU2 4IUGA 1V0AA 2H94A 1ND2B 1HDJA 1FXKA 1UQXA 4G4FA 3T1CA 4J25A 1M56C 3IDEA 4F3JA 2A70A 4PD4F 5DEDA 3VZJA 4R8HA 3B2EE 4J11A 1AI5A 2Q6AA 4DO2A 1BZKA 4HN0A 1DK1A 3HT1A 4CXWA 3MIGA 4J7ZA 2W2IA 2WLNA 3O65A 1H2KA 3DXRB 1IQAA 2Q8VA 3N35A 2KD7A 1IPSA 5EIBC 4MG2A 1N33B 5EV7A 2EINC 2JB4A 5FYBA 4NXNO 5K8SA 1I6XA 2VZOA 3TOJA 2Q1MA 4MW8A 3ML0A 4FZ0A 1I0HA 3FLPA 2ZAHA 5FDBA 3K77A 3WP4A 3UO3A 4I9QA 5LA9A 2AUYA 2JG9C 3G6BA 3E8GA 4X9QA 2IVJA 2WNVC 1E79G 4OPAA 1RUD3 1NT2B 4FTBA 3PIJA 4YHHO 1QXRA 2Y48A 1C1FA 5T55A 4LPLA 1DLBA 5FYMA 5LL6Y 4B3MB 1ZUQA 1RVF1 3IZOA 3AZYA 4KFMA 3CC2V 1PMHX 1RUC1 5F5QA 1TVKA 1YJWV 1VQ5V 2ZM6B 1W8HA 3X2QC 1WB8A 1BMV2 4CUCA 4MGSA 3ABMC 5FZ8A 3PMEA 3ETGA 2ZPXA 2ZTNA 1A8DA 1OH4A 2DJVA 1R093 5L36A 3H1YA 2FCTA 4P9GA 5CN0A 1EUTA 1NY71 4DR3B 2C24A 5KR7A 4KI5M 4AILC 3NSTA 1RUH2 3KHCA 4NXMO 3DGEA 5IY5C 2K9ZA 1UZYA 1O9GA 2GNDA 1HR0B 2BEOA 2IJJA 1Y67A 2R70A 1N1VA 1ENXA 4DXZA 5KAFZ 4XFFA 5AG2A 3OR6C 3MHSC 2FZ1A 2GALA 1QNWA 2EULA 5BR8O 4ZXEA 1P7BA 4PCRA 2KXLA 3CIHA 2DWRA 4HK8A 4ZI7A 3VDDA 2ZXQA 3NJZA 1XMOO 4R9CA 3JXSA 1YFUA 4K35A 1H2LA 2WR9A 4H7MA 2AGSA 4J1XA 2V4VA 3IJ4A 3CPWU 1ACCA 1JFFB 3U4SA 2L35A 4XFHA 2FB5A 4BIUA 1VF5B 3JAWA 2Q68A 3U0ZA 4X20B 3HQUA 3ABZA 4I2OA 3MF6A 1NZIA 4K7JA 1Q6IA 2P6JA 5CB4B 3GDBA 2FMYA 2YS8A 2ZX1A 1HXS1 5F2WA 2WYFA 1LJ7A 2R9RB 3GVMA 1W05A 2F6BA 3J26N 2R063 4PI2A 4XJ8A 2VCMA 4LBQB 1KKDA 1PHMA 1HRV3 2ZGLA 1ZBE2 5TISZ 3D6EA 1FXKC 2VMEA 4NRMA 4ASKA 1LHUA 1EAH1 3HKEA 2QDNA 1NCQA 2HVKC 1NQDA 3H8XA 1XHXA 2B1IA 5LMNB 4DR4O 4N43A 5FUIA 5CA6A 1M57B 4DR5B 2VMCA 4D6SA 3SJAC 5JMCA 3T1YB 3CKHA 2ZR2A 1NCRB 5I8YA 2ADDA 4U3JB 4YW3A 1PO21 3SJBC 4GKKO 2ATFA 2QE7G 1N3PA 2HWC3 5FUNA 5LB6A 3CZJA 4HL0A 1ENSA 5IFTA 4CP9B 4PIZA 2UU9O 1K97A 2J1SA 1XNTA 4QPYA 4XF0A 1DGRN 1VBE1 2HH9A 1GZTA 4I0XB 1YC61 1ZL8A 2QDOA 4AQ2A 2QVSB 3B8NA 5CAZA 1X50A 3CEIA 4JYAB 3ZKYA 1CAUA 1GQHA 1WMEA 3K58A 2YHJA 4JGYB 2B42B 4UFMA 1ENQA 3NNGA 4DK0A 5IWAB 5FY7A 2Q9LA 4C7UA 3RQ0A 3OB8A 4HZ3A 3ZRWA 5LMUO 4OMCA 2EIMB 1VB4A 3JBG2 3BVCA 3P3PA 1W2OA 4MSVA 3NQHA 4UOJA 2WC2A 5LHGA 3D0JA 2FD8A 2C1FA 1WD4A 1EY2A 1V54B 1WCUA 5L3GA 1XBLA 4PDVA 4K3AA 1KC8W 4DS0A 3M8LA 5ACA3 3ITQA 3BGAA 4XDJA 3AKQA 1K12A 4YW6A 3VQXA 1ASJ2 2ETEA 1BKZA 2RV9A 3T1MA 1SQFA 4QD2A 1POV3 3VHRA 2P06A 5A1FA 2QA4V 2GMMA 3ZMTA 3I7DA 3H0OA 1MZEA 1O7FA 4YVSA 1VBA1 3FD9A 3VDDC 5J37A 2WSUA 4CP0A 1S0GA 3VKMA 4X1IA 4X66B 3ZOIA 1F8VA 4DV0O 4DEVA 3MD0A 4F7ZA 4RSUA 1HNZB 4AAPA 3W7UA 2OT5A 4DYLA 1ZZ9A 4Q4Y2 4YZ5A 3AM2A 2ZHKA 1Q8IA 3R0RA 3WNNA 3CCUV 5FLIA 4FFBB 1MS1A 5CFDB 5JQGB 5F2VO 3OFNG 4XFIA 5FMOL 2WLLB 1CN1A 4XILA 5IFPA 5E1AC 2Z69A 4E4EA 3WP3A 2F4VO 1UU4A 4CCCA 2WIIB 5D5QA 2XONA 4Y20A 3E22A 3ZXDA 3I3DA 4CDUB 2DCZA 3FB8C 2G1MA 1NCQC 4AYUA 3T2QA 1V9U2 1BJQA 5EHDA 1XMQB 3WCSA 4N43C 4LF6O 3TAYA 5A3WA 4XDKA 1XSRA 4A7YA 1VALA 2QZ2A 4A42A 4GWIA 2LGWA 1AR92 1S5LZ 2VO5A 4LQRA 4CDXA 2WN2A 3KF3A 5C6CA 4B4PA 1LHVA 3AKTA 1FT9A 2BTVC 1JN2P 3I2KA 3ZSLA 5IJ9A 3DGTA 5FKBA 5FBZA 4PDWB 5GLZA 2Q4SA 3PVOA 1Z78A 4C8DA 2Z5UA 1LCLA 3FHAA 5FWEA 1OCCC 1B3QA 2X0LA 2LTNA 5JVVA 4FPFA 2DCKA 3UK9A 1ZX5A 3QLQA 3ZBHA 2G19A 2D40A 3M70A 3V64A 1WAZA 3GGLA 1NAEA 4C1XA 4QB2A 2P4EA 2LFRA 4JI3O 1R1BA 4Q1RA 1QU7A 2WO1A 4K1YA 2AHYA 1I5PA 3UESA 3H01A 5FYIA 4DR2B 1XNRO 3ZSKA 1CPNA 2W0XA 3RZHA 3WF1A 2M6YA 1NJIW 2YIDA 1PMIA 4HPKB 4FAGA 1Z7S2 2JKXA 1FAYA 5KXBA 3QTCA 2DBIA 1E5HA 3GBWA 4FFKA 1UU6A 3MFCA 1DQ6A 5FXVA 2WLPA 2GH2A 1VBD1 2VH9A 1AR63 2IXHA 3WU2Z 4COWA 5EP9A 1AHSA 2A9HA 2RM23 2EX3A 1VQ8V 3SNMA 3MW2A 4FLYA 1V9PA 4N23A 4QGMA 2XQRA 1YCIA 4EZ4A 3ZMVA 4YVSC 3SH5A 1QOTA 5EYXA 4AVSA 3VZOA 4NVPA 1K33A 2JGUA 4WVMB 4XXPA 4N8MA 5J98B 4F4LA 3ZXAC 4XETA 4AL9A 3SKVA 3MI8A 3ZN6B 4NIDA 4I5SA 2X5IB 4BA6A 4HG6B 1FD9A 4H13B 4TOIA 2JJ6A 1VAMA 3JCUZ 2VZUA 5JOYA 1B35A 1GQGA 2ZJCA 1QJU2 2JJ1G 3R4DB 1I08A 4Y1ZA 3LNMB 4PLOA 1CJPA 1COV1 2E7QA 3LDRA 4AI0A 3FAVA 1GMGA 3UJOA 1N32B 4WBNB 5FPAA 4TWKA 3AL5A 1MS8A 3ROUA 2VQEB 2VMGA 4IEQA 5A80A 1JPXA 1HN1A 1QKQA 1BK0A 2EXJA 1OKOA 4LE4A 3RRDA 1ND2A 5JR2A 4DK1A 1GZCA 5JI7A 2VMIA 2J1UA 4YVWB 1GO3F 3I59A 5FZ3A 2CTQA 1NA1B 4A5UB 2WZR3 2XVGA 1CONA 3EHKA 3QO7A 1AX0A 4CDXC 2N05A 3FHQA 3DXRA 5APAA 2NR5A 3R05A 3DKWA 4Z82A 3S57A 5EBLC 1FX5A 1F4HA 1XC6A 1W06A 1XNAA 1QXPA 4LITA 3ACGA 1U0AA 3PMSA 1VQMV 4Q20A 1W8WA 1PGW1 4NIIA 3IAPA 4DV7O 4JGZA 4OUEA 4UBHA 1HNWO 1X59A 3RWKX 4YFWA 4A6OA 3SMHA 1W04A 4YXWG 4LO4B 2XMLA 3O12A 2NM1A 2WS92 1AJKA 1YFWA 1QQP3 3LA7A 4RUEA 2DTWA 5HBAA 4LF9B 3FFZA 4NHXA 4B4QA 2AREA 1OF4A 2E26A 1UXZA 4MV2A 3TBDA 1URFA 4R9AA 3WG2A 3MUZ1 2JD4A 3ZN5A 2ZE5A 4QX5A 2QBXA 4GALA 1AR4A 2K46A 1VBB1 4Z1MG 1AYM2 1Y6XA 4HVQA 4OHWA 1RUF3 2ARCA 2HLDG 4IDZA 4AEDA 4LIVA 3G80A 5LRSA 4XURA 4JDNA 4IE4A 3LPFA 4Q0PA 3JALA 3S30A 1QNMA 1JU3A 3QG5A 5KHGA 1VRH3 4JRLA 5CKNA 5LHIA 2ET7A 4CH3A 5DUUA 5IVJA 4H37A 2BFUS 2ARAA 4YW5A 2PN5A 2EIJC 4AW7A 4QT6A 3VKLA 4XBLA 1RGSA 1LOAA 1Q8VA 3L9JT 1CAWB 3LA3A 2D7FA 4QNHB 1RUG3 5H9CA 3OMNB 3FJSA 1S77D 3VBOB 3L2YA 2HWF2 2BWAA 1MOFA 4LULA 1E5SA 3SJCC 1T6GC 1W90A 2CUGA 2XJVA 1B35C 3J7NA 3TXSA 3RYCB 1FYUA 3WEZA 2Q8CA 2AW9A 1ZM1A 1X33A 3EYPA 1UYZA 3ZPYA 2PA7A 2Y4TA 3PHMA 5BNNA 5L3BA 1JXNA 3WG1A 2JS3A 5EC2C 1SG3A 1BYHA 1BEV1 1PVC1 1V6IA 4LBQA 4RGAA 2JIGA 2VBDA 1ND2C 1DIWA 4COVA 1FPN1 1MQTA 3CCMV 1G8MA 3AK1A 2IJKA 3VDAA 3APBA 5KLVH 1C28A 1O3RA 1K5SA 2CYFA 3MLLA 4K8RB 3B69A 4NTYA 2RS11 3KCXA 2L9LA 3K4AA 1WBLA 2VL4A 1REDA 3ZIAG 4H33A 4PV1B 1KD7A 3CO2A 4AOCA 2G9GA 4K8XA 3J8F2 5FPZA 4NXNB 3L70H 5GLWA 4BJ0A 4CE8A 1S0JA 4YGBA 2VY0A 1MPXA 1VQNV 1NCRA 4DV4O 5JVDB 1R1ZA 5D21A 4U3JA 2RS31 5J2TA 1Q8SA 4QJFB 4HBNA 3HAGA 4JGZC 4YHHB 1ZRFA 5GJ6A 3ABLB 2XHBA 4R6ZA 4ONUA 4CP9A 3UETA 2OUJA 5BNPB 2YGLA 2RR11 3H1MA 4PJYA 1HB1A 1PIV3 2H6CA 3OPTA 2MK3A 1I3HA 1RUI1 4ZU5A 1JOJA 4JGYA 2VQAA 4IEYA 1UFIA 3E35A 3OUSA 1IS6A 4E2QA 2ZEXA 1TMF3 3RDIA 1UYXA 4PHZA 1OOPB 2X6AA 1AXZA 4NXMB 1OLMA 3VL9A 2UWAA 1CIYA 4EFBA 4AEDC 1OCZC 4UXAA 2Q73A 1M06G 2QKAA 1RUE2 3KT7A 2W3JA 5IK7A 3AMNA 2ZEWA 3HOBA 2WRAA 5EBMC 1HX6A 4K21A 3A0BZ 1F15A 1O5LA 3ZFGA 2E7TA 1K5JA 5BR8B 4TSVA 2I07B 2YY1A 2VQFO 1UX7A 1R081 1AUYA 3T1HB 1POQA 1H8TA 1XMOB 1RFYA 3VV1A 1BSMA 4K0KO 5B5EZ 2ZKNA 2JK5C 2ZOEB 4BLIA 4Q8KA 1FOD1 5FZ9A 2W6JG 1AR1B 4ZKIA 3DF0A 1WLDA 4CUGA 3NR7A 3SDLA 3KZ4C 1Y4WA 1U97A 3RG0A 5HFMA 2ZX3A 5CFDA 2BNMA 4X64O 1H0BA 3AMMA 1GBGA 5BNNC 4KQ7A 1WBFA 1Y66A 3OUFA 5FREA 1U12A 1YIFA 3VHOA 2QNKA 4ZOLB 1TME1 1A78A 2WLHA 1TVGA 3N9OA 4QB6A 1OXCA 1N47A 4W4ZA 5KUKA 5DUXA 4BIZA 5CA1B 1MQTC 1W39A 5IVVA 5DAVA 4QMAA 4CDUA 3VD3A 5F9TA 4LO6B 2WZEA 4I7ZB 1MEC3 2GN3A 4FI9A 2CTVA 4DR4B 5DG2A 1DGRA 4JDMA 2BOBC 4UFHA 1RL3A 2YEVB 1YSCA 1AYN2 1M57C 3A0KA 5IVYA 1UY1A 2B7YA 1YI7A 2E6VA 1UJWB 1Y9QA 3DXTA 4PA9A 2XUMA 1CXZB 5T52A 2Z5WA 5FR3A 3VL8A 1CX4A 5KAIZ 3AYDA 3MDPA 3WG3A 1A8MA 1NCRC 5ABJB 4QPGB 2WLIB 3POIA 4PDWA 4R9BA 4A7KA 1FJGO 5FPVA 4XJZA 1IOAA 2UU9B 3D0SA 1YITV 2Y0IA 2OVUA 1MA1A 3K0GA 4ZZ5A 4FLWA 1RMU1 2CGPA 2HEYF 3K75B 3LA2A 5JJEB 3NNFA 2MHFA 3ZR5A 5LY2A 3GALA 5FPOA 1PZ7A 2GV9A 2AEZA 3JU9A 1UPGA 2LW1A 1HRI2 2VNVA 2C5DA 4JGYC 2XT9A 2P22C 1FFTB 4O4JB 3JARA 1O4TA 1CAVA 5LMUB 1AP6A 3WHTA 1VBC1 2H0VA 2OCHA 3POGA 5T3NA 2RMU3 4ARYA 2X10A 4HPKA 4FXGB 2EIMC 4XFBA 1SQPH 1ZLZA 3A0HZ 3BA9A 3CNAA 3CLPA 3BCCH 3DPRB 1V54C 1LODA 3ACIA 4AFDA 1LU2A 1ODNA 5FZ7A 2HG5C 4EE2A 5FPXA 3ZFGC 1LOCA 5GZFA 1TAEA 2X6CA 2BERA 3URFA 2XXZA 3IN9A 4CS3A 1H8TC 2QQOA 3TN92 5H9QA 1ULPA 5A6ZA 2QTSA 3IIAA 2AR6A 4QM8A 1NKDA 2VVDA 4BYYA 4DZGA 5KHIA 4BZ4A 2BE3A 1PK6A 3AMPA 3RMYA 3IFXA 4WVMA 2OIEA 4HKWA 5IVFA 3ZN6A 4DW1A 4FPPA 3HKBB 1NXMA 5L3FA 3SEPA 1AI6A 4QKFA 4UCSA 2BGCA 1Q82W 2DV9A 3SEEA 2JE7A 1UYPA 4QE7A 2CAUA 2GSYA 3MYXA 4IEXA 5CFDC 2WA3A 1CJDA 1YQ8A 2F4VB 5ITZB 3LDKA 3TEYA 1VB2A 4UF0B 1XSQA 1VF7A 1UYYA 3U11A 2B1GA 5FYCA 4MHUA 3CDZB 4CDUC 2X6BA 4CDWB 4IL6Z 4KH9A 1CWPA 4PIXA 4YG0A 1RUH3 4AHWA 2Q8OA 4BCUA 4LF6B 4AR2A 1S5HC 2GTAA 2A3XA 4WVWA 2DWEC 3D8CA 2CU5A 3NAPB 4L8JA 3WV6A 2HBTA 2CY6A 2Y6HA 4CC5A 2R6QA 3O1SA 5LCWL 4N21A 1NA1A 2ZGMA 4ATEA 1R1A2 4LK6A 3ZMUA 1I7FA 2VZ1A 4IQPA 2QQKA 2R72A 3FB5C 1BL8A 2ZGPA 3SPGA 4GB31 2DVBA 3KLSA 1XNDA 4PDWC 4UAPA 3S7EA 3L72H 5FO9B 1YXWA 3W59A 4BQ5A 4KU7A 2WDBA 4TLGA 1LEMA 1FXHA 1D4M1 1R3JC 4ZXKA 4HK9A 4KBZA 4GKXA 3OBRA 1LNQA 1DG6A 3HNMA 1HW5A 1YFXA 1UOFA 4JI3B 4RS5B 1HP8A 1MACA 4Y1VA 4P9PA 2R041 4YM2A 3KM5A 1BS3A 2DVDA 4BK4A 1XNRB 3CJXA 5JJNB 4IEWA 5JOZA 1B04A 3KVBA 3RYFA 4C0BA 2BYVE 5L19A 4Q4X1 1VJ2A 5A7WB 2D44A 3TETA 1BQ0A 2PY5A 4M00A 4AE2A 4QPWA 1XU1A 1OLRA 1ZBE3 3E97A 5FZ6A 1PO11 4Z2WA 1F35A 3VOUA 5LA0A 3JB4C 2B5HA 3OGJA 1V55B 1RVF2 4LOTA 3ZYJB 1RUC2 2VQ0A 2V5YA 1R64A 3WZ1A 3UKVA 4JTAB 1HWYA 1YWKA 3VBRB 4R4XA 1W8UA 1SQGA 1AJNA 2PQSA 4AI9A 4BH9A 2NN4A 1NY72 4O2BB 5IHRA 3K5OA 1O8SA 2W91A 4L2NA 5C3OA 1Z5VA 1J3PA 1LOEA 1SZXA 3QNEA 2D6KA 4AZZA 3FWEA 1XILA 4QQOA 1CAWA 3ZXGA 2OKXA 5KC6A 3VBOA 4CCNA 2NN8A 4DOUA 3GXUA 4IE0A 4V2VA 5FOJB 4E8CA 1LR5A 4QAWA 1K5MB 2O8QA 1ZRIA 4P9LA 2QQUA 3ZFEA 4UV9A 5J9PC 3RSJA 1GP6A 1AVBA 2Q30A 1XL4A 1JYNA 2LO1A 1V6KA 3TNPB 3QCWA 3O1RA 2OS2A 1GQPA 4TQFA 3T2MA 4ES8A 4LF7O 5JWPA 2ZEZA 3JBG3 3BU0A 5IJRA 4UCVA 5IK8A 2QWPB 3MIBA 4ZU4A 3C90A 1HXS2 1S1AA 4PF1A 1JOBA 2UUBO 5GZDA 5C4WB 4QHBA 4W50A 1NA1C 1SFNA 1WW4A 4GULA 1OQEA 4LUMA 1ASJ3 3K08A 2VUCA 4PA4A 1EAH2 3OR7C 2WZ8A 4ASMB 4LR3A 5CBHA 2JJ2G 2R32A 1EM1A 1SS3A 5T54A 5LGUA 2B8MA 2XJPA 5JVDA 4DV7B 2PAMA 1HNWB 1KUQA 1WMFA 4LKFA 1IS3A 3LSDA 3GF6A 4Q4Y3 1UAIA 2V72A 1L7RA 1DBNA 1W8TA 4M0HA 3AL6A 5J36A 2A71A 1BCCH 5BNPA 1XPWA 1W6OB 4XHXA 2HWB1 2YU2A 2RDCA 4YJ2B 4P9OA 3OTFA 4YM3A 4OX9O 1PO22 1VLNA 2A6YA 1N4CA 1WCSA 2ARXA 4Y3OA 1PNMA 2BTOA 1US2A 3N3HA 1HJGA 3JD2A 2K9PA 1ST8A 3UKMA 1VBE2 4PLNA 4IYIA 3OUJA 2VXRA 5CU1A 2PTMA 3IPVA 1V9U3 1HN0A 2VOWA 4QDRA 4AWDA 4PA3A 4UV8A 1OOPA 4XDLA 4PELA 3WDVA 3AKSA 3T4HB 2WO7A 2AACA 3H8UA 2JD9A 3RYHB 4K8ZA 4JYCA 3L2HA 1VQLV 3A22A 1B06A 4QX2A 3E8HA 3LCPA 3LSEA 3I2JA 1AR93 4Q29A 2OZ6A 1U5ZA 3FX7A 3OEAA 5CG8A 5GLUA 4DY5A 1QDOA 4JZGA 4X89A 2G9FA 5BV6A 2ZZQA 5JZGB 5FO8B 4RR3B 5JJJB 4UYBA 2WKKA 1S76D 2VGDA 5ISLA 2XVKA 3F95A 3DSQA 3THTA 4QX3A 1FV3A 3A0NA 2G9ZA 3VBOC 4FLTA 4YYOA 3DN7A 1DLLA 5B1AB 2V4DA 1J5EB 3ZFEC 4JV5O 1VBA2 2E53A 5FV3A 1WLTA 1M4WA 3MW4A 2V1DA 1SZTA 2V4AA 1S0FA 3SKJE 1RJ7A 2L6LA 4LHLA 5EIYB 1F7YA 5H2FZ 2QE3A 3GHMA 2IFRA 4ZOLA 1AJPA 4GWMA 4NHLA 1Z7S3 4FLZA 5F3IA 2PLV1 3PL0A 4R8CA 3M2MA 4QGLA 2Y26A 3I2GA 5J48A 4X6QB 3F2ZA 3WNXA 4QU2A 4K6BA 3NVCA 3K59A 1OHHG 4CU7A 2YEVA 2CGOA 4LF8B 3N7KA 3K2OA 3H7YA 4MT8A 2CV6A 2EAKA 1O3SA 1YO8A 4Y24A 5EIBD 3N7JA 4DV4B 1W59A 1BHAA 5ABJA 5DECA 4ZHQB 4QPGA 3WOGA 1A32A 3OGCC 2R0FA 4LHKA 4QKNA 4GLXA 4URAA 4FTSA 4JI6O 2BRTA 2BU9A 5D8AB 4HNAA 4LH7A 1WW5A 5IVEA 3RZLA 3ABLC 4I30A 5FZHA 3KVAA 1MMMA 2UXDB 2OT7A 3OMIB 1VQ6V 5BNPC 1IS4A 1F4AA 2ZACA 2IXCA 3UGHA 3VD4A 1EV11 2JEMA 3C3SA 4E4HA 2QQWA 2E51A 4JI4O 2EIGA 4FOWA 4FCAA 4OLLA 2WFPA 1C8M1 4O4JA 1OMIA 5H5NA 4ISQA 2GH8A 4XBQA 2WAMA 1S0CA 1O3TA 1WW7A 2UYAA 4OZOA 1OOPC 4MXVA 2EIDA 2DW4A 2BP6A 4YGDA 5J09A 3IDCB 3NL1A 4L97A 4BMBA 2XAFA 3Q8EA 1H2SB 1VMHA 3GCXA 4YZ2A 1FMD1 2ZX2A 1ND3B 1Q6UA 1WZXA 4YM1A 1TGOA 4CS4A 1JBCA 3H1LH 2YXSA 4FP3A 5C3QA 2VQFB 2I74A 3CCVV 4TV9B 1IDSA 2FDJA 3BA8A 3AXDA 4X6RB 2JECA 3P6BA 4S2FA 4K0KB 1ZZCA 2IWGB 2QQVA 1J1TA 3L73H 1NYWA 4CH4A 1SPPB 4LLFA 3LZZA 3X2QB 3HKBA 3ABMB 3J7HA 4HOOA 2E32A 2XL7A 1WMXA 2WS93 4R4ZA 2Y38A 1SKVA 1GV9A 1WA6X 4Q0VA 3AYAA 1JX9A 5IY5B 4LBKA 1W0NA 1CESA 4NE9A 5B1BC 5DN2A 4FVMA 4GUNA 2P5OA 1TE1B 5FP3A 3ZYFA 4M4RA 1PL0A 3TGUH 4XJWA 1SBEA 2RN9A 5F6LB 5BUVA 4NTXA 3WT3A 1DZRA 1UCXA 2JDKA 2FDFA 1QVFU 1HNXO 1OPMA 3NV3A 1Y74A 4G2KA 1MVEA 1AYM3 4BWOA 2Y6JA 4EROA 1COV2 3LEKA 1IXBA 1ZWIC 3LF7A 4BQYA 4DUWA 1UOGA 4OYUA 3EVKA 2AZ0A 3B4SA 2BZDA 5D5PA 2ZNJA 3ZRXA 1VPHA 1CAXB 3NAPA 2ENRA 4XJ9A 2XBO1 3O5SA 3QO5A 3BTYA 1F51A 2MNGA 1B09A 4MTXA 3PURA 3N9NA 1Z2GA 1R3IC 1GANA 1REFA 3SYAA 1H6YA 3DCQA 4JI7O 2ZZJA 3ZRVA 5ABJC 4QPGC 2WPDG 5HPOA 5HXMA 4MS2A 2QM4A 4KNCA 4UCRA 1AL21 4A41A 2HWF3 3ME2A 3TXQA 5LA2A 3P5BA 1U5XA 4O4LB 1DF0A 2BTQA 4OZXA 1XREA 1MS5A 3K0DA 5T50A 3RVHA 3OJBA 2O14A 4O65A 4RS5A 2QWNB 2DMXA 3ENRA 5DZGA 4LHNA 1PGW2 4B3NA 2Q69A 3SPJA 1ZA4A 2Y6FA 1IS5A 1UMIA 2VPVA 3VQVA 2H3OA 5A7WA 3HPNA 2XQXA 4CEWB 4I50A 4J42A 4P9YA 4GIQA 3CRQA 1PL4A 4NKGB 1YZBA 5I0DA 4DUZO 4JTOA 4DINB 3AFKA 3MHHC 2Y0PA 4LR4A 1G4YB 4FJCC 1JZ3A 2QM7A 3ACLA 1AX2A 2AGAA 5IUQA 3GHNA 4NJ4A 4RFRB 3D3AA 1W9FA 4O9GA 3AVSA 5EFUA 3PUSA 4LOSA 3J8F3 3JCZA 1WCKA 2PZSA 4FFFA 4U3FH 4LKEA 3DC5A 4O2BA 2ZS6B 3OBAA 1S3JA 4WFFA 4IV1B 5SV8A 2A6XA 1JYWA 1DQ5A 1Q81W 2RJLA 2VVEA 1TVKB 2JKBA 3BOWA 3VHPA 4JYAO 2D3RA 4MVSA 4FOQA 2HYKA 2WJSA 1SCRA 1S0IA 5FKCA 4XEZA 2XLFA 2QQNA 1N1YA 2CHHA 3A8TA 3CJIB 3QH7A 4W65A 1BE3H 3I2IA 2NMOA 4E9KA 2P90A 1K5MA 2PYTA 3N36A 2JE8A 4MHRA 4ZKTB 2FHRA 4IEZA 2GAUA 4F6RA 1G9AA 5A3OA 4AF9A 4TV8B 4Y4RA 5C3PA 2ZGQA 2MPFA 2A06H 4OI4A 4JZRA 3LWCA 2XKPA 3TEZA 4YGEA 2WLQA 1LNSA 4Y4YA 4OQ8A 3TK1A 4LE3A 4ZI7B 3NNLA 4MVQA 5L9RA 3NAPC 1K3EA 5C4WA 1RUE3 1BEV2 1WD3A 1PVC2 4X66O 3WINE 1Q7YW 1HNZO 3W58A 4GMP1 4YLZA 3KZIZ 4UB6Z 1FPN2 4DFSA 3R4SA 4NRPA 2YSUB 2ZR3A 1OUXA 4C0HA 1N0NA 2O0OA 5FZDA 4G27B 4CXYA 4IGGA 4JI5B 4Q2FA 1R6TA 2RS12 2VR4A 3W7WA 5BMVA 4BMEA 2W47A 2YXYA 4DRRA 1ORQC 2VAUA 2VS0A 5HI0A 3PLQA 3MFAA 2WNUA 2FDIA 1Q8PA 1QY4A 3FYEB 3NNMA 1XE7A 4LH6A 3T4VA 4B8EA 4RS5C 2PI5A 3CRMA 1W6OA 1UL9A 3AP7A 3FC0A 3KF5A 3VZNA 3OGIB 2RS32 1O5UA 2VNRA 1W2TA 4ET7A 1W6QB 4GX5A 1T6BX 1VARA 5DN6G 3POEA 3OGSA 2RR12 4R52A 4O7XA 1V55C 4K40A 5GONA 1LKNA 3CZUA 1RUI2 1J3QA 3RI9A 2XHNA 4F83A 2D98A 3R4UA 3KV6A 1S2EA 2JDZA 1AYN3 2D3PA 2EJ7A 3NV4A 5CEHA 3S0MA 3B77A 3AG1B 1QLNA 1GSLA 2VQTA 3H3UA 4BB3A 1ZL8B 2HJDA 4INDA 5JZGA 2VZPA 4RR3A 1CAUB 2PFWA 2VWJA 1VP7A 2BSKB 3L9DA 4LO8A 1V00A 1FXVA 5LGTA 3ZHTA 4E2LA 4CEYA 3WP6A 1U5YA 3E5XA 4QGNA 1O6UA 3VUOA 1R082 1OH3A 4CA9A 2CSGA 3BUCA 4JI0B 1K5MC 4J6GA 3IM0A 1DQ4A 3NJVA 1A3KA 3NO8A 2VMFA 2VBBA 4LBJA 4B3SO 4CU6A 2YXLA 1HRI3 1S0DA 4TQDA 1FOD2 3F5TA 3ST7A 5L7OA 1UXXX 4RFT0 2UY8A 2E5LB 3BRCA 5LY1A 1AR81 2Q5ZA 2Z42A 3TNQA 4Y33A 4S2HA 4CCJA 5GZCA 3KG2A 3IIIA 5J1XA 2VNGA 3VQWA 1N36O 2CTWA 2UUBB 4XHBA 2QWRB 3JD3A 1UOBA 4L0PA 3DYPA 4X1IB 5C4WC 3PU3A 3AK2A 1C1LA 1TME2 5K4LA 4I55A 4I4TB 3BI3A 2GNMA 5FP9A 4H44B 4EB6A 3W5MA 1GWKA 4PLMA 2XR4A 2DE0X 3W7XA 3TN93 4PQQA 2JENA 1ZSPA 3ZN0A 4A2UA 2W68A 4NYKA 5GLVA 1ZZ7A 1S0BA 4K3UA 3ZR6A 1W99A 2C4XA 5DUWA 3ETQA 1DFQA 1TQ5A 4FQ4A 2ZX0A 5A7SA 3DL3A 2A7WA 2W1QA 3CMEV 4Y20B 3V0BB 3E22B 2WNUC 4GA9A 3ZXEA 4OI2A 2DVFA 5FYSA 2ZGKA 2B9VA 4OX9B 5JXIA 4XF4A 2KQXA 2IC1A 4FFIA 1OA4A 3OGRA 2EIEA 1SESA 4KG0A 2LQTA 4CC6A 1M4UA 3BTAA 5FZIA 2Z3YA 3WF3A 4NR1A 3QF7A 1RMU2 4CDXB 2IH1C 5FIXA 2QFEA 1C8NA 4B3TO 2MEV2 1W6PA 1AR71 5HCFA 4GX2A 1HLCA 5IJ9B 3E6DA 4FVVA 3LEMA 4O61A 1G9BA 1SZBA 3LGRA 3WG7B 5IYBO 1IBMO 3ETDA 4JHTA 1ND3A 3HJRA 3C3VA 4UCUA 1VQ7V 1R1A3 3ZYPA 1AJQA 1QMJA 4TV9A 5A6QA 2VUAA 5JZGC 4RR3C 1H1AA 2ATKC 1FNYA 3E86A 3T0BA 1Q43A 2AXTZ 3OGGA 2WWWA 5D2AA 4CXXA 4AQYB 3JATA 4ZHNA 5AC91 1JVMA 5A1LA 1IBKO 5FYTA 4CEYC 2C26A 3U07A 1SPPA 1I1EA 4DO0A 1VMGA 1SQXH 1H4GA 4JV5B 4C91A 1PMJX 4O2AB 3THDA 3B09A 3WQ0A 2Y69C 1RM1C 4KMQA 4PDMA 3HMYA 2BPA2 5FPLA 2VVFA 2DYSB 4HZFA 1CEZA 3T30A 1H8HG 3EXAA 1G1XB 5L7OC 2QTWB 5A2QN 2JIZG 1VQOV 3VBHB 1JYXA 1US3A 3MIFA 2ORXA 4LJHA 1NTZH 1RUNA 2YGMA 2HR3A 5L3EA 1VIBA 1RVF3 2P34A 1ZBE1 2VRZA 1NH2D 1RUC3 1GTOA 4BWAA 3E6BA 2XOMA 3MW3A 3V0AA 4ZPIA 4LK7A 4Q0SA 1MNGA 3GNEA 3HWJA 4FOYA 2GSMB 3W7TA 5FZLA 1NVPD 3CMGA 2YBSA 1DGLA 1C57A 3H9AA 5F8PA 1MS3A 3DXUA 3KT1A 3RT3C 4BIFA 3CEWA 1K5QA 2R9AA 1MS4A 3DV8A 4AXOA 1JOYA 2VCAA 1LR1A 2WQ8A 4DR1O 1KBHA 1KS5A 2UXBO 5LZ6A 4RAIA 2PELA 4O4LA 3Q8CA 5H9SA 5I0SA 4GB32 3OEBA 2PHFA 3RZMA 3M3OA 1RIRA 2F17A 4JI4B 2WFF1 1Z5WA 2XASA 1DZQA 1H6XA 3I59B 1NH2B 1W8ZA 2CAZC 2DF7A 3I2FA 2P3KA 4CDQB 1D4M2 1WB7A 4QKBA 4AAXA 4Q0UA 2XUEA 1NVPB 4B3RO 4CEWA 4SBVA 5FXZA 3VZLA 1W0JG 3UO2A 4I0WB 4DPNA 1SC5B 4Q5OA 3N2KA 1HXS3 2R042 4BLJA 1NS1A 4TTGA 2CH7A 4Q4X2 4JVAA 3RS6A 4D0QA 2JGDB 4KBBA 3O1MA 1ND3C 3B93A 2OXBA 2VMHA 4JGZB 4B1MA 1H8EG 1J59A 2NQYA 3M3IA 1PO12 2ZEYA 1RP3B 4FO9A 1EAH3 5FZFA 2HHHB 1GM8A 1D5NA 2AH2A 3BCWA 3WF2A 3AKRA 4NROA 3G71V 2F95B 4IV1A 3U37A 2XAQA 1NUKA 4RWUA 2C9AA 1ZBA1 1MZ5A 4WFAV 3CJIA 5DM6V 5LATA 1YUDA 4Q4Y1 2OYZA 4H2AA 1PO23 3AG3B 4AEDB 3AZWA 1DGSA 1ULDA 1OKQA 4MGIE 5JPNB 1UIKA 1VE0A 1OCZB 4LBQD 5C8YA 4TV8A 3JALB 2WWJA 4N9HA 2VOTA 1VBE3 1HNXB 2ZGUA 5F5CA 3WX5A 1BBT1 1NT0A 5DG1A 1H2NA 3W21A 2B9UA 1X4TA 3OW2U 4QQ2A 3T1HO 4Q8LA 4R9DA 4YW4A 2CGNA 2VW2A 3T2TA 4QPKA 1UIJA 1J83A 1UD1A 2JXAA 4HONA 2QQPA 4IYHA 4TSFG 4NPLA 2OQ6A 5JH7A 2BV4A 2VTFA 4P9IA 4QX8A 3Q8FA 1UO9A 4JI7B 4IIJA 1BCXA 3FUOA 1D4VB 4QQPA 2WQ4A 2QUOA 1RSOB 4AVBA 1QJY1 4NPRA 4GKJO 1G9DA 1RJ8A 5JSOA 1SBFA 5BPXA 5B4NA 1X9PA 3QD6A 2QM8A 2WT2A 3AXEA 3QO8A 1N1TA 4XUPA 5BNNB 5IYDO 3E5QA 4XACA 3CCSV 2LGQA 1G7YA 1UMZA 4XFGA 4Y5Z0 4FTEA 2Q7HA 1OLQA 4FLVA 1H1IA 1Q8OA 4BPZA 3E2EA 4O4IB 4D7TA 1UN1A 2DYRB 1WLWA 1MQTB 3WY6A 4FP2A 3LSQA 2ZD9A 1VBA3 1PVXA 3WW2A 3W20A 1SF9A 3R6SA 4JI1B 2VU9A 4J9ZB 4J7JA 2LRPA 4HT1T 4UFJA 5LP6B 5F39A 3LD8A 3ZLIA 4XBNA 3BKZA 5C5UA 4BK5A 1W6QA 1GH6A 4Q4V2 5CA3A 2IXJA 4CEWC 1C5HA 2BW8A 2YC2A 5L73A 4DUZB 1ZX3A 4XW3A 1JTZX 2HWB2 4G28B 2XKOA 2XAJA 2ITDC 2A6ZA 5FXXA 4K20A 5E88A 5DAWA 5J2TB 4WFBV 5B3SB 5DDJ1 5G05L 4XF3A 2FDGA 3BIEA 3VD7A 3I2HA 2OYQA 3T2PA 2IJHA 1YI9A 4FPEA 1DYPA 5DMYA 2V5DA 3VQYA 1XDCA 2XAHA 1PNKA 3IAQA 1UF2C 3HKCA 3C8XA 2D43A 1CQ9A 2UU8A 4JX0A 4HKOA 4IV1C 4N7IA 4XIOA 2BSKA 5FZEA 1QJZA 2HWE1 4FPCA 3CD6V 2CTPA 3CJIC 1ODMA 4IGQA 5I0TA 1F4MA 5FZBA 4OHVA 4JAAA 3JZVA 2YB7A 2ZIOA 1QJU1 4JGSA 3LAGA 4MVUA 5IAXA 3GYDA 3E5UA 4ATFA 1GN4A 1COWG 4GX1A 1N3OA 3ZFGB 5B66Z 3EFFK 3FUQA 1FV2A 5GW7A 4JHZA 4GJYA 5J96B 3TEWA 1JQ0A 3WB0A 1H8TB 1JR9A 3MICA 1WWYA 4S2DA 1O8PA 3VBFA 1JZ8A 3J7MA 2B9ZA 2I45A 4YZ1A 4LWSA 3STLC 1MSWD 2PHUA 4I4TA 2PLV2 4XFAA 5JUVA 5IT9N 2LUWA 3I3EA 1P8JA 3BTZA 3O7OA 2GC3A 2EIBA 3WB2A 2HEWF 4QQLA 5LWBA 3VD9A 4CU8A 4XUQA 1SLCA 1A34A 1AP5A 3HT2A 3BB6A 1SBDA 3HVDA 5C8CA 2J1VA 3CCEV 1K45A 4KHPB 5AVPA 4YGCA 3WHUA 1VQ4V 3HKDA 2PAEA 3V0BA 2IU3A 4S2GA 4B7KA 4TYSA 3OTOB 2HKOA 2DCJA 3WQBA 3JCIA 5FYUA 2R30A 4MVOA 1WJZA 2YUAA 4AGRA 4Y1UA 4AHYA 1OD3A 4NHMA 1XUQA 2AYHA 3BPSA 4YFZA 5KHKA 4EQVA 1EN6A 5D1IA 2BNOA 4W6YA 4Y5SA
chains in the Genus database with same CATH topology
5GZDA 4AEKA 5C4WB 3AMQA 4QHBA 1QNYA 1DQ1A 1NA1C 3ZXFA 1SFNA 1WW4A 3GBGA 3O0VA 1YLLA 4GULA 4IETA 1F9KA 3LKJA 5IK5A 1OQEA 5AVAA 1SLBA 1OTJA 1EV12 4CTEA 1KFUL 4LUMA 4Y1YA 1ASJ3 3J4UH 3TRSB 4OHZA 3PVEA 5JCTA 2DTYA 4U36A 4A7ZA 5A32A 1COV3 3ASIA 4COUA 1EAH2 1LU1A 1CAXA 1AXYA 3K51A 2OPKA 4ASMB 5A3LA 3MF9A 1H4HA 2R072 4JTNA 2R32A 1C8M2 1B35B 4D69A 5T54A 4I3PA 3ZN4A 1F2NA 2B8MA 3K48A 4FPJA 1LGBA 1AJOA 4CYDA 2XJPA 1D0HA 2B46X 1VBB2 3HQXA 2PAMA 1E57A 4FFAA 1LGNA 4LNVA 4OHXA 2XJSA 5FTTC 1WMFA 2RS51 2WINB 3I4IA 3JD71 2BWCA 3MIEA 1ULGA 1IS3A 1UPIA 1VBC3 3LSDA 3GF6A 4Q4Y3 3U4XA 5I93A 1UAIA 2Q0AA 3FX3A 4JC1A 2ARBA 4KL1A 1DBNA 2D6OX 5D8AC 5A33A 1VR3A 3H50A 1WCDJ 5GM0A 5I0UA 2WQZC 4M0HA 4WM7A 3UV9A 4UW3A 1OIJA 2DUQA 1OIIA 5FOBB 5J36A 1BVP1 2A71A 2EA7A 1FMD2 2PHWA 5BNPA 1W6OB 4XHXA 1R1A1 2HWB1 3WD5A 2RMU2 2I2SA 4UW6A 3ZXLA 1CAVB 1YIPA 2DUOA 5CFCB 1ND2B 3OTFA 4YM3A 1PO22 1H9PA 3ZMNA 1VLNA 2A6YA 4G4FA 1WCSA 2ARXA 1WW6A 1YJKA 2EAAA 2W52A 5JLVA 1MS9A 3IDEA 4F3JA 5GZEA 4C8RA 2A70A 1RUOA 2HWD1 3VZJA 4R8HA 3N3HA 1GY9A 1FI2A 2QKDA 1VBE2 4CRQA 4PLNA 3P3NA 3VZKA 4HN0A 4K9SA 4M0NA 2IFWA 2VXRA 1DGWA 3HT1A 1PIV1 3MIGA 3WXPA 5CU1A 3I54A 2PTMA 2OG5A 2ZMKA 3IPVA 1V9U3 2VOWA 4AWDA 4GWNA 3KB5A 1H2KA 1OOPA 1IQAA 2AENA 3ILNA 3WDVA 3N35A 4IEOA 3AKSA 3AK0A 2DCTA 1W6MA 3H8UA 5EV7A 1V70A 3VBHA 3L2HA 1D2QA 3X29B 4OI0A 5K8SA 1I6XA 2A6VA 2WWSA 3LCPA 3LSEA 3TOJA 3ZSMA 4IXLA 1AR93 2Q1MA 1OD5A 4Q29A 2OZ6A 3FLPA 1TMF1 1OSGA 5FDBA 2ZAHA 1JYIA 1OPOA 1U5ZA 2K2SA 3WP4A 2DCYA 1KJLA 2AUYA 2H6BA 5GLUA 2JG9C 5CG8A 4DY5A 3VBFC 1HDKA 1QDOA 2WNVC 4DRVA 3Q9OA 2G9FA 1RUD3 1PK6B 1UX6A 5CBLA 5BV6A 2ZZQA 4FTBA 5JZGB 1BVVA 2XJUA 5FO8B 4RR3B 1QXRA 1I5ZA 1QHDA 1Q56A 2WKKA 2WT1A 2A6WA 2VGDA 3O0XA 4PQ9A 1C1FA 4AGGA 2XVKA 1IHMA 4IEPA 4ZU7A 3THTA 5T55A 3IMNA 5J92A 2VOKA 1EYBA 1FV3A 3A0NA 1RVF1 1HQWA 1UKGA 3AZYA 3VBOC 4YYOA 3ZDSA 1KQRA 5EZWA 2MEV1 1RUC1 3O0WA 5F5QA 3DN7A 1DLLA 2OIIA 2XJRA 3RJ2X 4CVYA 1LECA 3HN1A 2RHPA 1AR83 1JYCA 1BMV2 3VGIA 4Q4W1 3PMEA 5FRAA 3ZFEC 1VBA2 2E53A 1GVGA 1XYOA 2ZPXA 4TWTA 2ZTNA 3WDXA 1A8DA 1WLTA 5DUVA 4FPHA 1M4WA 2XBO2 3MW4A 5C8CC 2VUJA 1R093 1S0FA 1RJ7A 4LA3A 5L36A 3H1YA 4P9GA 3HD8B 2V09A 4LHLA 1NY71 1LRHA 4EWEA 3OY8A 1OFNA 2WA4A 4RHV1 1TEIA 4AFAA 3NSTA 4BHIA 1CPMA 1RUH2 2QE3A 2PHRA 3GHMA 2IFRA 3VBSC 1HKDA 4Y1XA 1V6MA 2K9ZA 1UZYA 4NHLA 4GWMA 1Z7S3