5JWPA

Crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYEEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title The facial triad in the alpha-ketoglutarate dependent oxygenase FIH: A role for sterics in linking substrate binding to O2 activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 5jwpA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jwpA01
3KCXA 2WA4A 5JWPA 1MZEA 3OD4A 2CGOA 4B7KA 2YC0A 2ILMA 1H2KA 1H2LA 1H2MA 2XUMA 4QU2A 3D8CA 4Z1VA 2Y0IA 2YDEA 3KCYA 4Z2WA 1IZ3A 1MZFA 3P3PA 4BIOA 2CGNA 4NR1A 3P3NA 4JAAA 1H2NA 4B7EA 1YCIA 4AI8A 2WA3A 2W0XA
chains in the Genus database with same CATH superfamily
1XNQB 4JYYA 1JS9A 1UX6A 3SYOA 5HCBA 2WNVB 3ZVXA 1J59A 5FYMA 3KHCA 3CRMA 5LHHA 5FUNA 1IX9A 4MADA 2OZ6A 3CCLV 3VZJA 4MW8A 2G9FA 1AYM1 2PMWB 3FLTA 1HV0A 2DJVA 4K8FA 2BBAA 2P22C 1K42A 1WMFA 4P00B 4UB6Z 1CAVB 2K9PA 3BHPA 1GFF2 3CJIB 3AVRA 5EFUA 2PAKA 1W2UA 5JPNB 1WBFA 5IJ0B 5A33B 1WP8A 3I3BA 2WO7A 5K0UC 2YEVB 2QQLA 3BI3A 1VQLV 2ZNIA 1OD5A 3B40A 1ZAUA 5JMCA 4GB31 5DUVA 1BZWA 4ABMA 1ND3C 1JYCA 3VKMA 2GP5A 2WWWA 1TZOA 1VRBA 3C7FA 1J58A 1SQ4A 1DGWA 1YITV 5JPMB 3I4IA 5C71A 5FJHA 3AG1B 4H37A 4FFFA 4BM8A 3IDAA 3J8F3 2ZOEB 3T09A 1H6YA 4QQLA 1IURA 2H3OA 5JH7B 4IETA 1H2SB 5AFEA 2YIAA 3JBG2 4DO2A 2VO5A 2HJIA 2ZACA 3WU2Z 2VZ1A 1NTKH 3W21A 4Y4RA 4CDXA 2J1UA 5JCOA 5G05L 2IXIA 2BDRA 2GMMA 1CX4A 2PYLA 3TN91 1JOJA 2IXJA 4XBQA 1MZEA 4QD2A 4CP2A 1JUIA 1H1IA 5FJKA 1BQZA 3FLRA 1KFUL 2WLKA 1QJX3 4META 2CAVA 3VD9A 4DB5A 4KQ7A 2ERFA 4CP0A 3VD3A 4DPNA 3E5UA 3NO8A 2XOMA 4FFGA 5FLIA 4CDWA 4KWUA 1HNXB 1UMZA 5FYIA 4A7KA 4XIOA 4JI8B 1RUF2 4OI1A 2HWF2 4YVWA 3MIHA 1FMD2 4XCBA 1LTEA 2UXDB 3O0XA 4X1KB 1JZ5A 2ZKOA 4WFEA 1NE4A 4XBFA 1AL22 5A32B 4P9JA 4UCUA 1RUG1 4LBMA 4NHKA 3POEA 4XFBA 3EXAA 2R072 3LSQA 3UT0A 2JDMA 3PJYA 1RJ7A 2VM9A 1MR5A 3E89A 4D6QA 5JCTA 2EBOA 3CEIA 3VZLA 3VDDB 3MW2A 1VB2A 2M6YA 3KV9A 1V6OA 4PDLA 1QQCA 1PIV1 3HKCB 2PA7A 3NWKA 1YLLA 3APBA 3O1UA 1I1EA 1K92A 1QXPA 5B1BC 1NCQB 5CBFA 1HR0O 1VF6C 4Q0UA 3ZSEA 1BSMA 1SZXA 5A3UA 4UW6A 5BPXA 4AL9A 4AHWA 1K73W 2XNDG 3THCA 1PO22 4V2VA 3EXUA 4BQXA 1KUQA 1W8NA 1KEXA 4F8AA 3SQOA 2DOSA 1ASJ2 1ZSPA 3TB0A 3SPHA 5EQUA 1DF5A 3H50A 2YDEA 5FXVA 2DVAA 4JHTA 4NHYA 1FAFA 4W8JA 1HNZB 1RUC2 5F3CA 2PHUA 2YUEA 2DUPA 2VUJA 3K4AA 4XC9A 3FX7A 2BGOA 4O9EA 4JGZA 1JODA 3LA3A 3OD0A 1S3JA 5LP6C 2ZDIA 3O9OA 4QKNA 2ZX1A 3G7DA 3UESA 4YM1A 2RE9A 4GKJO 3VBFB 3KHBA 2X53S 1I3HA 4HONA 1POV3 2WDBA 1H8TC 1F4AA 2XL9A 4CUBA 1W8ZA 4K40A 1OQDA 2HG5C 3D36C 3VHOA 2RR12 2Y6FA 5A7WB 4QX1A 4FFKA 4E4EA 4PA9A 1F7YA 1QDOA 3LAGA 4U3JA 4P9WA 4UV9A 5JJJB 3R0RA 1UU5A 2JE9A 3NNFA 1O4TA 4TYSA 1D2SA 5F3GA 3LSUA 4EJRA 4DR4B 3ZMNA 1C5HA 4QXCA 3LDEA 3MF6A 4SLIA 4FLXA 2I2SA 4CCKA 3C90A 4EN7B 1BQPA 1LEDA 3HKBA 3ZYPA 3AMHA 1SF9A 5D21A 2W52A 3KS7A 4IHJA 5KC5A 1LESA 2A6WA 1TMF1 5CFCC 4IL7A 2LTNA 4HOOA 4CU9A 4RFT0 5FO8B 3ZIAG 2ZX4A 1V6MA 3X29B 3IKWA 4I3PA 3MIBA 1PVXA 1OOPA 1ZL8B 1I0HA 5FBZA 3O14A 3P6BA 3JAKB 4XZUG 5A3NA 4GUNA 5FZ3A 4DRXA 4UYBA 1LOFA 4X88A 2RVAA 5CKMA 4CUCA 1TEIA 3P5BA 2QKAA 2KQXA 4LF5B 2ARAA 5KXBA 1MQTA 1UY3A 5ANNA 2IU0A 4MXWB 1M57B 1S55A 2N74A 1NH2D 2P7TC 4N43C 2A6VA 3RZLA 2QDRA 1IZ3A 2L6LA 5JI7A 2HWC1 5CB4A 5L36A 2GTSA 1WA8A 2CUGA 1PZ8A 3ASOC 4QNHB 2BWAA 4QX7A 1RM1B 3OY8B 1AB3A 1VQOV 2E6VA 5J48A 1O5LA 3OBAA 4YG0A 4FAHA 4CEYC 3U4SA 2BFUL 3I59A 1ENVA 4I0AA 1XNCA 2CGNA 3OUIA 4TTGA 3ST7A 2QQKA 5A7PA 3HMYA 3SYQA 3DKWA 2F6BA 5K1PA 4QGNA 2UWBA 5FP4A 4EZ4A 2BYVE 4NUBA 1RUE2 2N04A 2VCBA 2XQRA 4IYIA 3OGCC 4I9QA 1XNTA 3GHNA 1OF3A 2D6LX 2VR4A 1RUI3 4IXLA 3IDBB 2AENA 1HW5A 2HFEC 3VB9A 5GLWA 4NWWA 2V7QG 1VBA1 1FX5A 3UNPA 4B4QA 1VEWA 1AYN1 3KMHA 1WPBA 1PO11 4C91A 4I55A 3USUA 2D98A 3MHSC 4IGQA 4RYDA 3RMYA 4J7JA 2VQAA 2ZHMA 2HVJC 5AVPA 3KV6A 3ACHA 5JIUA 4GX5A 4D3WA 3OUFA 2WS92 3WVJA 4DR1B 2WT1A 1RYYA 1N4CA 2DYCA 3KVAA 3MZHA 3T4HB 4PF5A 3OPZA 5CEHA 3L9JT 2CTRA 2UXBO 4G9SB 1UPGA 5I93A 3SPGA 5IY5C 3NKTA 3DV8A 5BNNC 2P6JA 4MUVA 4MHRA 3A23A 2QQVA 4IEVA 1S76D 4GIQA 1YJ9V 3IPVA 3WW3A 5LBCA 1MS0A 1US2A 1FFTB 2ZMLA 1R082 5EYPA 4RS5C 4J80A 4JV5B 5FR3A 3TAYA 3W5NA 3RYCB 2Q67A 3E6CC 1JA8A 1QOTA 4U2AA 4IE7A 2Z42A 4QPWA 5ACA1 1PGSA 1FNYA 1KBHA 1KXGA 1Y9MA 4LFAO 4AFAA 5K0UB 2JICA 4ONUA 4BQ3A 5LMNO 1W0JG 2DN9A 3ZYIB 1IPKA 4QX5A 4LE4A 1ND3B 1CN1A 1DF0A 2KB1A 1X36A 1PK6B 4P08A 1C57A 5FWJA 4CXXA 4QQ2A 2C4XA 2B5UA 2LGQA 4B4RA 4M3CE 4EKWA 2JJ2G 1H9WA 4RHV1 2W47A 3T3YA 1Q5OA 4MTFA 2FMYA 4CTEA 4JYCA 3OBRA 1WPXA 5A6XA 3I8TA 5M0TA 1VPHA 2NN4A 2R0HA 4LUKA 3Q4HA 3WG7B 1BHAA 3I56V 1VQNV 2XHKA 4BAYA 5C70A 1EP0A 4LHSA 3VD5A 1K3IA 4BLJA 1OCOB 4YJ3A 1BK1A 4BA6A 5D2AA 5DG1A 3ZR5A 1BEV2 4AWDA 3N9PA 3T08A 2WFF3 1W8WA 4B3NA 3FMGA 2E26A 4N7IA 4XBNA 1OA2A 2DVFA 5FPUA 1HN1A 3FYIB 2WLIA 5LA6B 4I0WB 2VW2A 3K9SA 1C8M1 1Y43B 1H38A 4AQTA 1FD9A 4DUYO 2D3RA 1N1TA 5JVDB 1KU9A 4UCOA 1PVC1 2RDCA 1UU4A 5BMVA 2JRIA 2RN9A 1V54C 1JYNA 3WHTA 1OKOA 4LE3A 4Q4W3 3KT4A 2BVVA 4NRMA 2CE4A 1RUD2 4GB32 4UAPA 5BYNA 1JJ2U 1BK0A 2WFPA 3RWKX 1WW5A 4DUZO 5CFDA 4Y1YA 4KBZA 3DN7A 3BOWA 1C4RA 2HHHO 2XH6A 1AR93 1AR83 4C0HA 3RGBA 1IPJA 3GWKC 3H1YA 4OPHA 3CJHB 4W6WA 4X20B 4BU2A 4MVOA 4BK5A 5FYBA 4L8JA 2R9RB 4NHLA 5D5PA 5AC92 1YJWV 4I0XA 5FO9B 4WFBV 1IGOA 5F6KA 1QU7A 4P9LA 1DP0A 1GWKA 3Q8BA 5L3DA 5DAQA 2R1DA 5T52A 3I55V 1FPN1 4DR2O 3CRAA 1PL4A 4AVVA 4LCUC 2B9VA 4RQPA 5C4WC 4WM7B 1P7GA 3U10A 2JIZG 3NVCA 1H2NA 2RS51 2W94A 3GJAA 4NWVA 4CCNA 1NCRB 3PN1A 5B1BB 4Q4Y1 5LXTB 5KA6A 4K35A 1R73A 4ARYA 4LWSB 1BE3H 3WQ7A 4NHMA 1GUIA 5LGNA 1D4M3 3BRCA 3BUCA 5FPLA 1M93A 2UXNA 2A79B 1VQ6V 3A21A 1JYXA 3NJZA 4WVZA 4FOQA 3ES4A 2P90A 4MGYE 1DCSA 5A1FA 1BZKA 2GNTA 2R063 4FO9A 3VQVA 2EXIA 3ACFA 2VVDA 1XE0A 5JQGB 4BQ2A 1NX9A 1TNFA 3M7MX 5JZGA 3CB2A 2EIDA 2JDAA 1VRH2 4QQHA 3WP3A 5KHJA 2TEPA 4AI0A 4UCTA 4M01A 5BZBA 3N9LA 2OQ7A 2ZT9B 3MLKA 1S5HC 5LP6B 5J37A 5J96B 2YBSA 4CPBD 5BXZA 1GMMA 4AVAA 4NXNO 1H8TB 2OW4A 5IW0A 5GZFA 3OJBA 5H9QA 1PNKA 2R16A 1YI9A 5CBGA 1NQJA 4B3SB 3HAGA 4XQ4A 1ONAA 3TXQA 3UO3A 2A9HA 5SV8A 4O4HA 2JJ1G 4CH5A 5T55A 1SQBH 4CDQA 4OI0A 4J25A 4IV3A 5EC2C 2YIDA 2KG7A 4COWA 1ZNPA 3WP5A 2LJ2A 1JYTA 1B3QA 1L3JA 4CA9A 5KMGA 2JXAA 5HCAA 4NAMA 3E35A 3NRUA 4B3TO 3ZO0B 2Y60A 3FBYA 3FJSA 3AJYA 1OCZC 1OI6A 4O9GA 3UT5A 3POSA 1X4TA 4JI2B 4Q6GA 2BJSA 2VWJA 4BIZA 2F66C 4D6SA 2VOWA 1K33A 3UJQA 3LDRA 4Q4V1 5IK7A 3SJQC 1IHMA 3RYKA 3ATGA 4OHXA 4E4DX 5APAA 3DXRB 1TAEA 1UYYA 3KZIZ 5J09A 1BBT2 4GKKB 3MHZA 1MG1A 2LP7A 4DNYA 2D44A 2RS33 1VBC1 5IE9A 2UUCB 3IMNA 2Q8CA 3KWVA 4I3GA 5FY9A 4YW7A 3MPBA 4DK1A 4D7TA 2BPA2 3E1F1 3ABKB 2B9UA 4E8CA 3SKJE 3N2GB 2WSUA 3I97A 2VTXA 2WC2A 4IEWA 1LODA 4P9PA 5IK8A 3AZXA 2JX9A 2PLV1 1HW7A 3O65A 3WB1A 2G1MA 1WZXA 4GULA 4UW3A 3ALQA 3TCUA 3IZOA 1YQCA 4GWJA 4DV3O 4CDUC 4GLXA 2Y48A 1RUH3 4FMTA 1KD7A 2EX3A 4HXCA 1I7FA 4BIFA 2PHXA 1BT8A 4DW1A 3B8NA 3T1MA 4ZU5A 2QFEA 1W28A 3K3WA 2CGPA 3B77A 2Q73A 4LP8A 5FP8A 1Q8IA 1IXBA 1XXNA 1J3PA 2QDNA 4QX0A 1SESA 5LL6Y 5CMUA 2RM22 5KUKA 5KHKA 2V4VA 2YU1A 4MTOA 1DFQA 3AMQA 4FI9A 4P9XA 4UFHA 1RC6A 3TRSB 3I2JA 2HWB1 2LS6A 1WCQA 3NSTA 3CHXA 1U12A 3ABMC 3QO8A 1GM9A 2BSKB 3EHKA 4EN8B 1IBMB 4P9OA 1UFIA 1UMHA 4IQPA 1UXXX 5K9YA 1YI2V 4E2GA 4LH7A 2KXLA 2QQJA 5KX5A 2RCVA 4GX1A 4K8XA 2JDIG 2HVKC 3N35A 4F6RA 3BCWA 1M5IA 4QPIB 1O3TA 4QT6A 2BOJA 4EFEA 4LQRA 1QH7A 4LXLA 1UOFA 4NVPA 1O9HA 1NKGA 4NJ4A 3CX5F 4JI1B 2QTOA 4I4TB 2XXZA 5F2SA 4FPHA 3VDCA 2WL1A 1SQXH 5FKBA 2VW1A 4AVBA 4BLIA 1VQ8V 4I9WA 3WG1A 3VHNA 4C1XA 1JW6A 2ADPA 4IGPA 1RVF3 2VQEO 3ORJA 4A44A 1YF2A 5BNNB 5FL7G 3WW4A 4FVMA 5I8YA 1RJ8A 2NPIA 3FWEA 1GNYA 1P4RA 1VE0A 3UM7A 3FAVA 2QKDA 5B1NA 1RUG3 4XHXA 1FV2A 1FNZA 1UZYA 2P67A 4IV1C 4LIVA 4FTSA 5I8TA 1SFYA 2GN7A 4Y22B 2NR5A 1EFRG 1PGL2 2HWD3 1QF3A 4DRRA 2XTAA 4NR1A 1W6QB 1M56C 2F4VO 1I94O 1GP4A 3FHIB 1L1FA 3M4FA 1JOYA 5F5IA 4J9YB 3WF1A 4OLLA 1GM8A 3JB8A 4RL7A 4XQDA 4LO7A 1KS5A 4TQFA 2Z4FA 1PIV3 4BK4A 1XNQO 1G4YB 2HBTA 5DZFA 2ODMA 3Q8EA 3TOJA 1PO12 1TUBB 4LBJA 4QPGA 4FM1A 4YY3B 1O3QA 5E88A 4R4ZA 2E7QA 2OQ6A 5LRRA 4UBHA 5FZDA 4LO5B 3LF7A 2SLIA 3SYPA 3NL1A 3CRCA 1QWRA 2ZJCA 1K12A 3LNMB 2GNBA 3C2UA 3B01A 1ZM1A 2Y34A 1W0KG 3WCRA 4XUPA 1HB3A 1ND2A 3K4DA 3VL8A 3NNGA 3RWRD 5A2QN 1RHI1 1N0JA 1VIBA 4EWDA 1AI4A 2OS2A 1DZTA 3BODA 1DIWA 4ASUG 4MLOA 1F23A 4DOUA 2D6MA 2WKKA 2JB4A 2BW8A 1NU1H 4JGSA 2EA7A 3U4XA 5IYYA 2Y8KA 4CEWA 3A0HZ 4MT8A 2BOIA 5CA3A 1ENSA 1T6GC 2FCVA 2WZR2 5J2UA 1AF9A 5HFMA 2X5IB 2W91A 1B35C 1NXMA 3RYFB 1FXVA 1KS4A 1HRI1 4ZHQA 1QJY2 3ZXLA 4LFBB 1H9PA 2HKXA 4E4HA 2H94A 5CVRA 3PDQA 5DDJ2 3D3AA 1SLIA 4X8PA 2P1BA 3CP1A 1W9WA 4HT1T 1D7PM 2Y6HA 2VNGA 2VH9A 3FHQA 1IG0A 5LK7B 3D5OA 1S0BA 1F4MA 4ISQA 3FB8C 4ASKA 3LSSA 3KF3A 1QJZA 1VF6A 5B1AC 5IVEA 1XQNA 3MV01 4YARA 4BISA 1H2GA 4JPRA 4WV8A 1W99A 1TMF3 2VZOA 3V0AA 2HWE2 4JTCB 1W9YA 3JD1A 4K3AA 1GRJA 4I30A 2FCTA 3TEZA 4QAWA 1XDCA 5F5AA 4MOAA 3RRDA 1SLTA 2I45A 4GQ7A 5FNVB 5A70A 5C4WB 1J1TA 4LTAA 1R1A2 1Y76A 1NQDA 1FXKC 3ZOIA 3JASA 2DWEC 3PL0A 2JJ6A 4NPMA 2HLDG 1UY4A 4H44B 3V64A 1RB8G 3G67A 4FPJA 1I9RA 4YFZA 3E8HA 3WT3A 3OYWA 1ULDA 4YVSB 3B00A 4MVSA 4FZ0A 3UYJA 2HWC3 4JI8O 3B4SA 4D94A 1RMU1 4QXBA 3D36A 3LA7A 2UXDO 4RA0A 2Y0OA 1JZ8A 1N1VA 1WB8A 2VW0A 3HB3B 1NZCA 4MX3A 2WWUA 4MVMA 3ASNC 3B09A 4PI2A 3PJQA 2YC0A 3RSJA 3ZMVA 4HNAB 2WNUB 4CCCA 3E97A 4LNUA 3URFA 2JDYA 4J7KA 3CC7V 2E74B 1ZZ8A 3JD3A 5EZWA 1XE7A 2YMZA 2ZGOA 5LBBA 3OPTA 5CFCA 5CADA 4M3CA 4YZ3A 3DPRC 3OGGA 1VBA3 3GBWA 1QBZA 5B66Z 3D0JA 4AQYB 3N9QA 4XTPA 1AYN3 2QZ2A 1Q86W 2WAAA 3WNMA 2MW2B 4KXRA 3PMEA 3OT7A 4HPKB 4RR3B 3VBHC 1AL23 3CF6E 1L0LH 4COZA 1AR63 4LA2A 1OT5A 3VKLA 4DMIA 4BYYA 2VZQA 1XU2A 1OCRC 1WW4A 1KQRA 4N43A 1OMIA 5A3MA 1YXBA 1EAH1 1NLSA 4XYXA 2CU5A 3LIGA 1N3OA 1RSOB 1HNZO 4W4LA 1VQ4V 1CAWB 4PIYA 4PDWA 2VQFB 2EJRA 4MGTA 5JOWA 2OCHA 2Z79A 2Y69C 4CP9B 1QDCA 3LQCA 3ZN1A 3SJBC 3JD72 3AZZA 5FZ6A 3WNPA 4CEYA 4LBQA 3VZOA 4PLMA 1YZBA 3VBOC 2LUWA 1BHGA 5CB7A 5FMDA 1FAYA 2BTQB 2D3PA 1YTFB 1SQQH 3VHRA 3SYCA 1E1QG 1GYKA 3EJKA 2Z69A 4HL0A 1RUJ3 1WLTA 2GSMB 2Y4UA 5ACA3 3AYDA 3ZFEB 2RJ2A 5FZHA 3WX5A 3IB3A 1W6NB 1DK1A 2XWBB 4QB6A 5T54A 5CA1B 2OIEA 2E32A 1WCKA 1PO23 3RJ2X 3VQXA 4UOJA 1EN5A 4FOYA 1SKVA 4DR4O 4DV1O 1W2BU 3K5MA 4TV9B 1BVP1 1LRHA 4JC1A 1ASJ3 1PHMA 2XJQA 2RJLA 4EWAA 2DWRA 3VN4A 3SYAA 1VBE1 1C1LA 1NZIA 1MACA 1VQ7V 1Y74A 3FLPA 3GCWA 5EJZB 4AG4A 5CA0A 3TJTA 5LMUB 1Q8QA 2JDHA 2Q8DA 2XVLA 1P7BA 5KA5A 1ZZ9A 2VVEA 4RGAA 4WM8B 4RHV3 4DXZA 3EFFK 4N53A 1HRV1 1YI7A 2GMEA 4OI2A 1UOBA 5FK8A 1A8DA 2NLJC 2PF4E 5G04L 3ZMOA 4QKDA 2J42A 1G6NA 4BJ0A 2WR9A 4LA3A 2RQ6A 3BTAA 4E27A 3RI9A 3BAAA 3GGLA 4LF5O 4JF3A 1GM7A 2QSAA 1D0GA 4CDXC 2ORXA 4ZZ5A 4YYOA 4LKEA 5JCOC 4GMP3 2RV9A 1WJZA 3PIJA 3BIWE 5EJ3A 4Q4X1 4PA3A 4BR6A 1Y9GA 4EN6B 4LJHA 2P3YA 4RS5A 1VAVA 4YM3A 2LROA 2W08A 1O7FA 3I2IA 4PT6A 3BIEA 4DV2O 3IMMA 4KGQA 3RYIB 2QM4A 1C8M3 4X62B 1WLEA 3WG4A 3J80N 5FYVA 3K46A 2Q8VA 2D3SA 3BCCH 1UOJA 3L9DA 4AQSA 3LKJA 3I5DA 4ZU4A 4UV8A 4DYLA 5E89A 4HBNA 4LEJA 1H2MA 4DV4B 3TNPB 5JXHA 2FQPA 2A1XA 1W8HA 2QQIA 1NR1A 5GONB 5C3QA 1R091 4YVWC 2EIMB 5JJEB 3M2MA 2K2SA 3JD0A 3W5MA 3IAYA 3ENRA 4EZHA 4IV1B 4AFDA 2MNGA 4E8DA 4W4KA 4DV0B 3VBBA 4LBNA 5CZKA 3KQ4B 2YBKA 2DUOA 3DYPA 4IEXA 1IQDC 1Q3EA 4CCMA 3J8F1 1A34A 3T30A 4CP1A 2V4DA 3JAWA 1DQ2A 4UVBA 1W9FA 2QVSB 1LENA 2FCUA 3INAA 3P32A 1YRZA 1CAUB 1SQPH 3T1LA 4J1XA 5FKCA 1F5FA 2Q68A 4TUYA 1K5MA 5J2TB 1TVGA 5LBEA 4PBOA 3AKQA 3ZRWA 3HQRA 3RPQA 2CK3G 2W1QA 3BN6A 1L7RA 4DR1O 4XUQA 4FFBA 4RQFA 2RS12 5F9TA 4MG2A 1FV3A 4ET7A 2JDNA 4KG0A 2ZHNA 2PQQA 3H1HH 2QTWB 4UVCA 3P30A 5JXIA 4X89A 3AZYA 4EB6B 4PV1B 5T5JA 4Q0SA 2HBUA 5AG2A 4JV5O 3ZHSA 1LULA 1JH5A 3B7MA 1CPMA 4DV7B 1VAKA 2Q6AA 3HKEB 3KZ4C 3LEIA 1QQP1 5FPVA 2RJZA 4FM0A 2UURA 5CU1A 4X6RB 3ZMZA 5C9AA 3L71H 3RYPA 4INDA 3F5WC 5J1XA 4D7SA 1W6PB 4Q29A 1OLRA 1OVPA 1ZZ7A 2WNOA 2WLQA 4Y5SA 4FOVA 2WS93 5GZCA 1LOAA 2GSYA 4JI3B 3QACA 3CPWU 4CZSA 4O2AA 3JAMN 4H2AA 3HKDA 1GZWA 2D2CB 4X1IA 3CS5A 4QGMA 4R9BA 4YHHB 1YC61 4UB8Z 3ZRXA 2GZWA 5FYHA 1W6OB 1SC5B 3IJ4A 2OZJA 4WBNA 1GR3A 1H8VA 3DF0A 3JATA 4ZOLB 2RMU1 1P8JA 5JI9A 2UWCA 2VCCA 5IWAB 4Q27A 2E7AA 2ZIOA 4BWOA 1EUTA 2AH2A 3WOGA 2A7AA 3EQEA 1S0CA 1NYWA 4LFCB 4QHOA 1UPSA 2EICA 1QXJA 2AXTZ 2OTLV 1Y4WA 1NVPB 1VBC3 1OOPC 2B45X 1FXKB 2G19A 4CSWA 2JEUA 4SBVA 1ZZCA 2VZTA 3IN9A 2R9IA 1WP7A 1LOFC 5FPOA 4Z2WA 1SERA 4O4IB 1XILA 1FYUA 1KECA 2HEYF 1VQKV 2ZAAA 1MQTC 2R49A 1ENXA 3THDA 4PCRA 4HKWA 2V09A 4LF6O 4KU8A 2VOXA 2B1IA 1D4VB 2VY0A 2VZSA 1NUKA 1AI5A 5F2WA 4QQPA 1SCSA 1DGWX 4BE3A 2R7EB 4EFBA 5CG8A 2AW9A 5FZFA 2J1TA 2QQUA 5FUPA 1R1BA 3LA2A 3J7LA 3FB5C 5IDJA 1LJ7A 4XJUA 1K5QA 1SS3A 4XF1A 1PMIA 3ZXAC 4OQ8A 1NZ6A 2P4VA 3ACIA 5BNPB 4CCJA 2HWB3 2PGGA 5FXXA 4AFBA 1LUWA 4Q20A 2QQWA 1QLNA 5F6LB 2ARCA 3UO2A 1QHTA 1QNMA 5F3IA 3AMMA 4B7EA 4WZCA 2HP8A 2WA4A 5LBFA 1LHUA 3DPRB 3DKQA 2VXRA 5FZ8A 3TNQA 4PF1A 1AX0A 3HOBA 1V55C 2BTOA 4PDRA 1CVNA 1GTOA 2OT5A 1QNWA 2ZE7A 3MIFA 1HJFA 3H1MA 3I49A 4R52A 2A3WA 4FLYA 4GJYA 1FXZA 4XJAA 3QNEA 3OMAB 2ZBJA 2QWPB 2XHBA 3LPFA 4MVUA 3ABLB 2AEZA 1YFXA 4CU8A 4DEQA 4DW0A 1RMU2 2OXBA 2RDRA 5DN6G 1W39A 2J1EA 3ML0A 2ETNA 2ADEA 4CDUA 3PTRB 1GOHA 3FL7A 3ACLA 3FC0A 1TGOA 1KP3A 4KWJA 4BPZA 4UFMA 3IIIA 3WCSA 1M06G 2MEV1 1I5PA 3ZRVA 4Q26A 4RGKA 1N34O 3A2FA 5JMOA 4D69A 3E2EA 1AHSA 2HLEA 3J9SA 5D1IA 5KLVH 3J7AU 1CAXA 3VDBA 1S0EA 1Y9QA 5B2GB 4CS2A 3TETA 5JUVA 4RGGA 3MFCA 2N7GA 2R042 3C3TA 1ZBE1 2Y6GA 2Q4SA 4BIOA 2ZGSA 1Y7BA 4JI7B 3UGFA 2ZXWC 3KGZA 1GQPA 1BCXA 1PPJH 1G6UA 1RUI1 5C3OA 5DUWA 1B6QA 1PM9A 1JMKC 4KWKA 3S7IA 3B3QE 3HD8B 3J7HA 1AP6A 1VRH3 3PUSA 3H9VA 4MGSA 4JI2O 4AE2A 2ZQMA 2JDZA 5D8AC 2OPWA 2ZXQA 3VBRC 5GM0A 4XF4A 4ATEA 5A1LA 4CCLA 4HVRA 2BE3A 1YVWA 4XF3A 3X2QC 2AZ2A 4GKKO 3E22A 4LF4B 4WVMA 3MPPG 4Z07A 1YQ8A 3M70A 1OH3A 2WZPP 2UUCO 2Y6JA 1XOYA 1YNAA 4DV6B 3WW2A 1RHI3 2ZEWA 3ZHQA 3F95A 3LSEA 5ABJA 2VRZA 1OURA 1FFXA 5FP7A 1K34A 4YZ4A 3Q9OA 4AVTA 5IVBA 1ZX3A 3PU8A 1AROP 3KCXA 2IFRA 4FLVA 2ZR2A 2Y6LA 2VXJA 5IYZA 4CCEA 2WQ4A 1W2TA 1H1AA 2VULA 5E16A 3DXTA 3N27A 3G6EV 2ET1A 4DUVA 2WLNA 4FLUA 5IVJA 4YGEA 1Q56A 5A6QA 4TT3G 4IGGA 2CTQA 1SZBA 3N9NA 1HRI3 2PN5A 4CDWB 2B7YA 3WP6A 3MBWA 1CX1A 1W6MA 4JGYC 3CLPA 1XL4A 1SDWA 4CU6A 2ZGPA 2GUZA 3F5TA 5B4NA 1CIYA 5CFDC 4YVWB 1THZA 2F4PA 4FQ4A 1LU2A 3AG2C 1GQHA 1DBNA 3S0MA 1NA1A 5IWFA 4XAAA 5J36A 3H0OA 5FZOB 4QKFA 4YRDA 1C3HA 4LF8O 4XBLA 2KSDA 2XAGA 1OPMA 1KC8W 5H9RA 1DGSA 3U14A 4YM0A 2ATKC 3ZFFA 2CY6A 4AQ2A 4YWAA 1G1XB 3ECQA 4DV5B 1K8AW 1YDXA 4IE5A 5JXGA 1W2NA 4K8ZA 4Q1PA 3V0BA 4DR5B 1CONA 2X05A 4MVQA 2PHLA 4RO2A 1WLCA 1B04A 4YGCA 3JU9A 4GKYA 4JI1O 1ULFA 4FVVA 2FKXA 5B1OA 3LOIA 3KQRA 4X66B 2CDOA 1QJU2 2OKXA 3FN9A 1DLCA 1ULEA 1WA4A 3AG3C 5FYSA 4QXHA 2QDOA 5FWEA 2IJHA 4YGDA 1WAZA 1Q43A 1GN2A 2FDIA 4C0BA 4GXLA 1YXWA 3AMNA 1B35A 3M3OA 1NI8A 4BHPA 5HBAA 2JS3A 4FLTA 4BMEA 3E5QA 3LNNA 5BUVA 3N36A 2DYRC 1CPNA 5I8SA 4Q4W1 2WZ8A 3WFVA 4LBLA 3OGJA 4YW5A 1IOAA 3FFQA 3SJCC 2VQUA 3ZLIA 3THTA 1XNAA 3CNAA 1SHWB 4GYCB 2AYHA 1GOGA 3ZXEA 3PUAA 4JGZB 3B9IA 1AR81 3T1CA 5DAPA 5CN0A 3ZFGC 4K0KB 4QKBA 3RBZA 1YEWA 1GO3F 3POWA 3BKZA 3CE2A 5H9SA 3J8F2 3ZXDA 3FUOA 4UCSA 1ST8A 3ZHVA 3ZBHA 1ACCA 3K4ZA 3NV2A 2D6OX 4BZ4A 1LGNA 1ZA4A 1AR1B 4LHNA 2DFBA 4C1WA 3OG2A 2P5OA 1S5JA 4U3JB 2WZEA 4CDQC 2O1QA 4NIIA 3UKMA 2BV4A 5A3WA 4OHVA 4COVA 2Q0AA 3CCUV 1ZRCA 5FZ9A 3PTYA 3TBDA 1X9PA 3FE5A 4A41A 2B42B 1JMUB 4E2SA 3HKBB 4BXSV 1SFPA 2JENA 4COUA 1LHVA 1EAH3 4XIKA 2GV9A 3FD9A 2YI9A 1ZWIC 3JCZA 3OEBA 2JG8A 2FB5A 2IU3A 3M8AA 2VJXA 5FY7A 5FOBB 1QJX2 1JHJA 4IHJB 5BNOC 3T4DA 1G9DA 4XJ8A 2E76B 3OEEG 1QHDA 1Q7YW 3HBZA 4J6GA 4LHKA 4LBQD 1GMGA 1KMIZ 4DZGA 3VUOA 5T5LA 1SETA 1EV12 5LEKA 3K5OA 3W7SA 3MO4A 2PHDA 3LDDA 1OOPB 3VKOA 3VHPA 4AEDC 2R061 4XMIA 4B1MA 5FO7B 1FXHA 1DG6A 3ZMTA 2QM8A 2GDSA 3K5NA 1AR71 1G86A 5KUMA 3G4SV 3OB8A 4LKDA 3S7EA 4G28B 4KHPB 1PMHX 4KH9A 3WQBA 3ZM8A 4U7NA 3FUQA 2KKWA 3WB2A 1MQTB 1ROPA 4LFBO 2W9XA 3RZHA 4HSLA 4AFMA 4MGIE 2DTWA 2EIKB 2QWRB 1ZRIA 4OVEA 1IS5A 2XMLA 1DU3D 4L2NA 5CB4B 1ZUQA 1WA8B 2OCCB 3U07A 2PYTA 1VBE3 1G9FA 2VZVA 2XAFA 3SNMA 1NG0A 3VD4A 5J3UA 4BXFA 4UCVA 4CCOA 1WWYA 2VPVA 3I59B 5KAFZ 1QR9A 2JDUA 4FPYA 3VBHA 3M3QA 1SLAA 3HN1A 2QUOA 1WLWA 3RVHA 2AGSA 3MGUA 1O6UA 3I3DA 2DW4A 5EP9A 4YW1A 5IJ9A 2RG4A 4XAEA 4H7MA 3LEKA 1JZ6A 4KNCA 4EWEA 1HB1A 1F2NA 3BOPA 4OMCA 4YG6A 2VNRA 3MAQA 5BXXA 1MVQA 4C90A 1XNBA 2PI4A 2JG9B 3Q8AA 3I2HA 5DDJ3 1MEC2 2HKOA 1S2EA 4Q4X3 1UYXA 2B5HA 3VBOA 1TVKA 2X8KA 5CKQA 1S77D 2K46A 5L3FA 4DR6B 3SCHA 2XBO1 1HV1A 4Q0VA 2RS31 1SA0B 4LITA 5EPAA 3MHHC 4I55B 4ZBMA 3USUB 4LOSA 1G9BA 2J1AA 1HQNA 1W9SA 4JZRA 1EUUA 2YROA 4PIXA 1W8UA 3CEWA 3O1VA 4JTDB 4I02A 4CUAA 3ZMUA 4IW3A 2KR2A 2ARHA 1CP9A 1COV2 4UT5A 3ITQA 2CDPA 1BMV1 3APOA 2G38A 1QOSA 3EVKA 3CQOA 2X10A 1R093 5B3SC 4LK6A 4DO0A 2WLJA 2WWJA 1Z7S1 4F7ZA 2IZWA 4X8AA 3E6BA 1RUH1 4QU2A 4AZZA 4RN5A 3OTOO 3IPVB 2YSUB 1HB4A 2ZE5A 5EYPB 2AZ5A 4XVHA 3N7JA 3QOPA 5LA1A 1UYZA 1GNZA 3S30A 3A7QA 2I07B 3I54A 5FPZA 4N9HA 1GOFA 5FQ0A 2H8PC 2BNOA 1AXKA 3K3OA 4NO4A 1GN6A 2K0GA 1S0VA 3WB0A 2JDKA 4TV8A 1ENRA 3EO6A 4B7KA 4A3ZA 4AGGA 2PELA 2UXCO 1O8PA 5FY5A 2EIGA 1NLQA 1QEXA 1HXS2 3K79A 1Q90D 1SBFA 4E4SA 3ZDVA 3DYOA 5GTIZ 1MNGA 2VQFO 2ATFA 3ZX7A 5TISZ 2BU9A 3H3UA 1TME1 2W87A 2DQ0A 4W50A 4QPGC 3QG5A 5CA6A 1RXGA 3ME2A 1PD3A 5C33A 5IJRA 4K3UA 5FYCA 1ZRFA 1OPOA 4FXGB 2XAJA 2JE8A 3UJOA 4FP3A 3WNLA 3AKPA 3Q4HB 1XNRB 3ABTA 1DGRN 1ND2C 1QQP3 4X8NA 2DQ3A 5DXDA 5B4XA 2DCKA 3T0AA 3DC6A 1L0NH 1RVF1 2ZMKA 4YJ3B 1WMXA 2UUBB 3UQ8A 2QKCA 3VQYA 3T1HO 3WNXA 2JDPA 2IM9A 2DBIA 1CR7A 4Y26A 2EINC 4CVUA 3I3EA 1WMEA 4OHZA 3D6EA 1REEA 2L9LA 4Z82A 2YI8A 5KR7A 2WYSA 4PLNA 4DINB 1KGYA 3QH7A 1QCEA 3DYMA 2WLIB 5F7UA 1NY71 1OLQA 4CEWC 2NZ9A 1JJOA 1UF2C 2HWD1 4I50A 3ZHTA 2H0BA 2GC1A 1S72V 1WLDA 4TLGA 1F4NA 3C7EA 3LDCA 5BMVB 3JD73 2B46X 4XPVA 3NAPA 5JLVA 3ZYJB 4KMQA 4A6SA 3K59A 2RMU3 4ZKTB 3SISA 4MGZE 5FZAA 5CFDB 4P2ZA 3C3VA 3CO2A 3MI8A 1NTMH 3LOBA 4AHYA 2Q7HA 2B4KA 1WB7A 4MYEA 1ALYA 5FBJA 5T3NA 1WCDJ 1OFNA 3C3SA 3G6JB 1BJQA 2ADDA 2P6CA 1JBCA 2JS5A 2ILMA 4PA4A 2DU1A 2Z5WA 2XAQA 1ORQC 5IYDO 2QJVA 4ZXEA 2FDFA 2VUAA 4IIJA 3NJYA 2YXHA 1PM4A 4I0XB 3CIHA 1VJ2A 1JHNA 4BW5A 2W95A 1NT0A 3KT1A 3IM0A 4LIUA 4X62O 2VZUA 2EALA 2VUCA 4RQPB 2WN2A 2IW5A 3ZPYA 3THOA 2XKPA 5EXOA 2MHFA 1HQWA 4JCKA 5L3CA 1XHXA 5L3GA 1ZRDA 2P37A 1VBD1 2ZKLA 5TSWA 3CXCU 3E8GA 1J3RA 5FZCA 3L72H 1T5EA 3PIGA 2CL2A 3KV4A 2OYQA 1SZTA 2O8QA 3N4MA 3I7DA 4B3MB 3HNYM 4UF0A 4XACA 2ZNJA 1H8HG 5FMBA 2FDJA 1V9U2 1JFFA 5JZGB 4IESA 1XMQB 5DQ0A 2NYYA 2WNUA 4F83A 1GV9A 2EIBA 2NP0A 2QCSB 4GMP0 5HCHA 4JI5B 2IJIA 5KXDA 1ZBA2 5BR8B 5JIAA 5IYBO 1TNRA 1HQLA 4E2QA 1SQGA 2C26A 3V65A 1IDSA 2FD8A 2P3KA 2A3QA 3HT2A 2FDGA 1UU6A 1I5ZA 2AUYA 3VZKA 2BZDA 2R72A 1E79G 3W7WA 1DGLA 4UI9L 4O4HB 1OH4A 4CDQB 5JSPA 3A8TA 4YG3A 4X6QB 3U78A 2XKOA 4IV3B 2D5FA 2KG7B 3SEEA 5HI0A 5E79Z 3IBMA 4W6XA 4YGBA 5KMGB 5IT6A 5FZIA 2ETEA 2YC4A 5LMNB 2WFF2 1J5EB 4NXMB 1T2XA 3OM3B 1X50A 1AX1A 4DV7O 4AEMA 3UT5B 5DPNA 2FYUH 3JBG1 4PDWC 2WNVC 4JAVA 2A5ZA 1KRIA 1S4CA 4GT1A 3N3HA 2E31A 2MEV3 4JAUA 2OPKA 3ZSLA 5FMOS 4Q4W2 2ID4A 4YLZA 3SXWA 4R50A 4JI3O 3L75H 4W6YA 2RS13 4DR7B 1WGPA 5K4LA 2YXYA 3VBSA 1LB2A 1JOPA 4XFFA 1D0HA 4Q5OA 3U37A 5FZBA 3T2OA 3U75A 2A6YA 4D6RA 1AR92 2CWSA 4MS2A 5JAXA 3R4DB 3CJIC 4M4PA 3H8RA 1VBB2 4XDKA 1ZBE3 1YCIA 1OUXA 2AHZA 5CA1A 5LGUA 4O2BA 4ZY9A 2P34A 5DECA 1GZ9A 4IEQA 4UBGA 4J1WA 3AVSA 3WUDA 2JD9A 3WUCA 5IWAO 2QTSA 1UIJA 3QVNA 4A2UA 1Y4MA 5C8CA 2W2IA 1CWPA 2Z0AA 3C7HA 3TEYA 1L7QA 2GC0A 1LU1A 1J95A 4QQOA 2IXCA 1RUF1 5FUIA 1TA8A 2HWF1 1O9GA 5GJ6A 4NIHA 1FMD1 3A0KA 4DUYB 2W0FC 5C6CA 4LFCO 1APNA 4N53C 5LA2A 1AL21 3H8OA 5C8WA 1AR61 3AG1C 3NW4A 3ZN6A 4HK8A 5KHIA 4GWNA 1AXZA 2R071 4JASA 1XNKA 3FHAA 1W06A 1FOD2 2HHHB 3BA8A 2VG9A 4JYAO 3TXSA 1D4M2 3RVZA 3SCFA 1C1FA 2GP3A 4KUMA 3RMXA 2OIIA 3JQXA 4HSJA 1O3RA 4CUGA 3SKVA 3WG3A 1RUNA 4FTBA 4YZ5A 4YW4A 2VE1A 2G9GA 4MSVA 3UCSC 4LO4B 5FMCA 2D6NA 1JYIA 5KX5B 3AEIA 2E5LO 4GCZA 1WW7A 5FZGA 3HNBM 4BIUA 1RUJ1 4F6RB 4PI0A 4Y1VA 2SBAA 2O0OA 3NKGA 2XWJB 2CTWA 2FBEA 1GH6A 1IKQA 1J1LA 1MS5A 1C8NA 4N8MA 5L3BA 4J41A 2F17A 1BGYH 3MIDA 4N90A 2VMGA 3QH6A 2Q5TA 1PO21 1URXA 5F32A 2XLFA 2BRTA 2M7WA 1ASJ1 3AP4A 5H6QA 3MICA 5B3SB 2BNMA 4JZ2A 3S57A 2WABA 2UU9B 4B8EA 5CG9A 3FAVB 1RUC1 2ZAHA 3B5LB 5D8AA 2W6JG 1ENQA 3VBRA 3ZYGA 1YIJV 4R9DA 2ZM6O 1N1YA 2FMDA 5FY0A 5IAVA 2J1RA 3CXHF 3ETGA 4LMFA 2CH7A 4K1ZA 2W68A 4XUNA 4A4AA 4FPCA 4LT5A 1JU4A 4EN0A 4P9GA 2W3JA 2EAKA 2ZEZA 1PNFA 3RZKA 4L11A 1QXRA 1SACA 2YG0A 3ZSKA 3K2OA 3AYAA 3OEAA 2W1SA 3MIGA 1ZLZA 2IWGB 4JV4A 2RDSA 3VDDC 1K5MC 1A6CA 3ZKYA 4JYBA 1AYM2 4OHYA 4GMP1 4I01A 3ABZA 1GBGA 1KKDA 5A7NA 4QPGB 4MGQA 4DEVA 2CTPA 5A1AA 2VUDA 1LOCA 5L19A 1XSQA 4ZHNA 2HEWF 1H0BA 2ZX0A 2B9ZA 2KA3A 3O1OA 3LWCA 5DM6V 3OD4A 1O59A 2E75B 3POFA 1D5AA 1H1MA 2ES3A 1ND2B 3WDYA 4JGYA 3LEGA 4U36A 5A7OA 5BNQA 2NMNA 3A22A 2XVGA 2N05A 4FT8A 5JWPA 1NQTA 2WQZC 4P9IA 3VV1A 3JCUZ 3H7YA 1DLLA 1H8EG 3C8XA 2QM7A 3NMBA 2EINB 1YHQV 4ES8A 5C9AC 3JUUA 4RFRB 4AI3A 2OT7A 1E5SA 1G9CA 3PU3A 2CNAA 4CC5A 2YHJA 1D2DA 1DTOA 4CEWB 4UVAA 1OQ1A 4IEPA 3VBFC 5K7PA 5JOYA 1OF4A 1LAJA 3RYHA 4FFIA 1LOGA 2WN3A 5J2UB 2WT0A 2V72A 4XJWA 1DDLA 3PVNA 1GNHA 2ZZJA 1SQVH 3FB7C 4Y1ZA 1UY0A 4EEQA 1JN2P 5LATA 1US3A 4ZHQB 4URTA 5IYCO 3SHRA 1WCSA 4BB3A 4LF4O 3JQWA 3WF0A 3POIA 3TN92 2F95B 1W04A 1K4CC 3SLIA 5C5UA 3BTYA 1DQ4A 1ZZ6A 3ABUA 3WG2A 3IT8A 4YW6A 1LNQA 1XSRA 1U5YA 1RUE1 4UW5A 2R043 1KJRA 4TXWA 5HXVA 3ZXJA 3JCIA 2G9ZA 3V0AB 5C8YA 2WJSA 1ZX5A 2ET7A 5DZGA 4O4JB 4L97A 4YW2A 4X9QA 2IXLA 2QBXA 1UOGA 3POGA 1AR73 3IIAA 1X33A 1Y76B 1T6BX 2ZABA 4RSUA 2NQYA 3JASB 5D5QA 2D6KA 1S0FA 4CH6A 3GJBA 2XJVA 3WW1A 5A3TA 3ZFGA 1RUG2 4OZXA 5LOVA 4FAGA 1WA6X 4ASLA 2VBDA 3OYWB 3WEZA 2IFWA 4XW3A 1N0NA 4MV2A 1B09A 1M57C 3OFNG 3MIEA 2WS91 1LNSA 2W1WA 4YFWA 2YV8A 2Y0IA 4AVSA 2VD7A 3AM2A 4FFHA 3ZPOA 4LF9B 1B06A 1IKPA 3OUHA 3DUIA 3POBA 1RM1C 3SR2C 4YJ2A 1MS1A 3HQUA 1CEZA 5A6ZA 3AP7A 5A9GA 4JKMA 2WAOA 4XURA 1PIV2 2A73B 2P4KA 1PZ9A 4E4ZA 3BEHA 2DCZA 2ZEYA 1E1RG 5IUQA 4K21A 3O1MA 4OX9B 4LNUB 2VCMA 1CXZB 4LO8A 5ANQA 2UXXA 2W6IG 4KU7A 4DR5O 2OVUA 3NXSA 5FZ0A 3SH3A 1XMOO 1PNGA 5FRAA 1U5XA 2ZIMA 2JGDB 5BNOA 4PJYA 4QM9A 2ENRA 3UKVA 1TQ5A 2JECA 3KV5A 1YFUA 5CFCB 4M3CB 3E8BA 4QMAA 5KHHA 1KP2A 2EJ7A 3OGRA 4RAIA 1VQ9V 1S0JA 4AEDA 4ZI7A 3JARA 4JKLA 1SEFA 3GZUC 4XETA 3A0RA 2XBO3 1COWG 4C8DA 2F4VB 1JPXA 1I94B 2AREA 4YM2A 1DQ6A 3LB9A 4FIPC 4JX0A 3ZR6A 4HZ3A 1YSCA 1R3KC 2GNMA 4A6OA 2B1GA 3QCWA 4N43B 1A78A 2EXKA 3M99B 1LKNA 2ZGQA 2C9KA 3I2FA 4PDWB 3E86A 2WO3A 3ASOB 2XG3A 4HFSA 1JYWA 2FMLA 1Z7S3 2VMFA 2XT9A 4JI0O 4R9AA 4BQ1A 5J98B 2CAUA 2WLLA 4K0KO 1OLME 4LBQB 3K08A 3HNMA 4CEYB 3S5AA 1UL9A 2A06H 2WSVA 3EHBB 4A7YA 4FM2A 1BEV1 2D40A 1SRYA 3ZSJA 1REFA 1SMVA 3N7KA 4JTOA 3WSOA 4X1YB 4AQ6A 1QJU3 1VALA 4ZONA 2QWNB 1FATA 3OPWA 4XE9A 5A7QA 4ZS2A 4I0BA 4N21A 3W9AA 2F43G 1S0IA 4X64B 4R7CA 1LECA 2DVBA 2D3OW 2Q7GA 4AGVA 1TMF2 2PI5A 2PFWA 4PIZA 3MUZ1 1M1KW 1MMMA 2GC2A 3G80A 1AJQA 2CV6A 2W0XA 1RUD1 1Q8SA 5HFLA 1F15A 4LORA 4IE6A 1Y74B 5CA0B 3L2HA 2AR6A 3IC9A 2OUJA 1TME3 1PK6C 1UIKA 2DCTA 1VQ5V 4N53B 4QU1A 3MW4A 1RIRA 4OI4A 4V1PA 1Y66A 5A80A 2YYOA 3LGRA 1POQA 4OUSA 3S3WA 2OYZA 2GH8A 1MS3A 5LHIA 4Y33A 3AB0A 1OCCC 1R3IC 2UU8A 4MXVA 3O12A 5AC91 3CMEV 5FK7A 1FJGB 2HWC2 3AK3A 1GKFA 1LHNA 3EMRA 1F9KA 5FYTA 4KHPO 3WG7C 5FY4A 1XI1A 3HJRA 5IY5B 3K3NA 2QE3A 4NIGA 4D6TH 5ABJC 3JSNA 4H14A 1OCOC 3T1YB 3K75B 3SH4A 5LHGA 2BTVC 3O0WA 4RS5B 3UGGA 4GX2A 2V4AA 4EROA 3N2KA 2E33A 1XEQA 4PD4F 4YIPA 1OHFA 4LNVA 3MEPA 3QLQA 3B9CA 2ZX3A 4MH0E 5DAXA 2ZCWA 3OBTA 4GH4A 2PHFA 1A8MA 2CTVA 4B4PA 1YQ5A 2JB8A 3K0GA 3BU0A 4Y4YA 2ITDC 1UWWA 2XUEA 2IH3C 3POJA 1EV13 2J7MA 4ES9A 3TYJA 3VBUA 1XBLA 1CQ9A 3ZX6A 3U1XA 1VBA2 3ZN4A 4YZ1A 4OGQB 3D3IA 3CDZB 1UJWB 3NJXA 1BKZA 1AYN2 1VRH1 3KT7A 5L7OA 4QDRA 3JD2A 1NA1C 5LYJA 1JVMA 4PBPA 3B2EE 1VAMA 5EBWC 4AHZA 1BVVA 5FZOA 5EV7A 1AR62 2LQTA 2XR4A 1V9PA 5CISA 1ZREA 1NKDA 3JD4A 3JAWB 1BCCH 3ZEDA 2B39A 4DR6O 3ZFFC 1JI6A 1R6TA 5JVVA 4QGLA 3F7YC 3H1KH 3LDBA 5EZYA 3ICXA 2AACA 1YJLA 3IWZA 3DCQA 4AOCA 4TUYB 1K5MB 2RMKB 4WM7C 4IEUA 3ZRWB 4JI4B 1QVFU 1JX9A 3ES1A 4C7UA 3H1WA 1OQEA 1DQ0A 1QLEC 3OGVA 4FFBB 4PELA 1BMFG 5IVVA 1W8FA 3RNSA 4AEKA 1VBD3 1NCRC 3ASIA 2H6BA 1VF7A 1RUJ2 2OWOA 3POYA 4QJFB 4UUJC 5JOXA 3JALA 1UPIA 1XPWA 3TEWA 1W90A 2CYFA 5ACA2 5LW9A 2VNOA 5HCFA 4QM8A 1V54B 4XJ9A 4NPLA 3WDUA 4E9KA 2H6CA 4WVVA 1MEC3 2WT2A 5BY1A 5H5NA 2ZE6A 1MSWD 2JE7A 3MD0A 2DYSC 1BBT1 3UGHA 4FK5C 1W3VA 3GBGA 5DAWA 2VGDA 3GWOA 1SBEA 4K20A 5C9AB 5GTHZ 3CCRV 4S2FA 4FPKA 3E5XA 1GN4A 2PHRA 4RHV2 1K3EA 4Z1MG 2RDQA 1QIQA 4YSFA 3JSLA 5FY8A 1Y67A 5L3EA 3AFGA 2EIJC 2QR4A 2P17A 1COV3 4O2AB 2XAHA 2YU2A 1OKQA 5ERLA 3HKDB 1GZWB 2NNUA 4OUEA 1TE1B 4X1IB 3K0DA 1VLNA 4MTXA 4AI9A 4K6BA 4CXWA 1R3LC 3OR6C 3FB6C 2ZHLA 4WBNB 4DR3B 1Y3TA 1N36B 3HPLC 1AVBA 4Y20A 3JATB 2Z2SB 3NV4A 4XMAA 2Q8EA 1XNRO 1MVEA 4DV1B 2YPJA 4EQVA 5ITZA 3M3EA 1M90W 1HNXO 2ZGMA 2EZOA 4K7JA 5FYZA 2RM21 1C8M2 3K77A 3JBG3 4JQRA 2UUBO 2JG8C 3VKFC 5KWRA 4NYKA 2YPDA 3IDEA 1PVC2 5B5EZ 3STZC 1L7LA 2D7FA 3DGEA 2PHTA 3AZVA 4EN9B 4IGOA 2O8OA 1HXS3 2ZTNA 2YFUA 1EZJA 3OCPA 3IC7A 2ZGTA 2PAMA 1OD3A 2A0LA 3CYOA 2X0LA 5LBQA 4ATFA 1SDDB 3D3QA 3P1IA 1YTFD 3NNMA 2GMPA 2AZ0A 2XUMA 2XOKG 1K9MW 4S2GA 4NHXA 3NJVA 2JIGA 2P5BA 1UAIA 4GZRB 1UD1A 1JZ7A 2WO2A 1KB9F 4LR3A 4MW3A 3ABKC 2EILC 4RUEA 2XVKA 3CRRA 1NE6A 4IL6Z 1W0OA 5I0DA 4BQ4A 4Y1XA 4WFFA 2G4IA 4KGGA 2BQPA 3J7NA 3JYCA 4DV2B 1XYPA 1JCHA 3ZDSA 1GK9A 1FPN2 3ZXGA 3L73H 1RUF3 3M3CA 4GKXA 1WW6A 2HWF3 1FMD3 1DLBA 4KBBA 1SPPA 2WNEA 5IVCA 2A6XA 1SLBA 1IG3A 4XDLA 1H6XA 3AP9A 2RS52 1DF4A 3K51A 1URFA 4XTMA 3B94A 1HDKA 4ZKIA 4I09A 4Q4Y2 3V56A 2DDUA 4UXAA 4DXSA 2MK3A 3SPIA 2UY8A 2V73A 3PJSK 3OW2U 2XJPA 4D8MA 2R073 1PGL1 1OCZB 4PA6A 3SMHA 1W03A 1ULOA 1AUYA 3GZEA 4JHZA 4WVWA 2OX0A 4MVZA 2WNVA 3ROUA 1UKGA 5A7SA 3WNNA 2Q1MA 2GBOA 2BWCA 3RZMA 1D5NA 3OBZA 1XRUA 5F8PA 2JG9A 1LR5A 1VMHA 4FPGA 3Q8FA 4EE2A 2LW7A 2YS8A 3ZYHA 4LULA 1O5UA 4CC6A 1SA0A 2HEVF 1MSDA 1CAVA 4FPPA 2XDVA 3GVMA 5GALA 4OULA 1IBLB 3CJIA 3W7XA 4B3MO 4QPIC 5E1AC 4Q0PA 4FPOB 5IJ0A 2DVGA 1NH2B 1JTZX 2WO1A 4ORFA 5A33A 3O1SA 1XMQO 3FX3A 3PUIA 5EC1C 2YEVA 3KLSA 3SITA 4P14A 5I0RA 2DFCA 4CDUB 4JI5O 1FT9A 4CS4A 1YQ6A 2FHRA 2VZ3A 3W7TA 3EYPA 5BR8O 2Y38A 1RUC3 1QH6A 3RN4A 1OXCA 1ZA7A 3ILFA 1UZ0A 2YIBA 4HYOA 1VP6A 5FOJB 5FMOL 2ZINA 4YW3A 3ZS8C 1O4ZA 5EBMC 3N7MA 1X59A 5IFTA 5LA0A 1CAXB 2RR13 3B93A 4QX8A 3HWJA 5JH7A 3AZWA 3ILRA 2WZR1 2V5DA 3RZZA 4JRLA 5AVAA 3ABMB 4X65B 4M00A 1IS3A 1GN3A 4A42A 1J5EO 4NXMO 4Q4V2 3WF3A 4S2DA 1QJY1 3AKSA 3D4KA 1V9U3 2GC3A 5DDJ1 5LWBA 5FPBA 5CBLA 5CBHA 1YIPA 4OUMA 3R66A 3M3IA 1VBC2 1NJIW 2C6SA 2F1MA 5IAXA 1V0AA 4GZ9A 2X29A 4KFMA 1ZBA3 4HKLA 4YXWG 1OSGA 4JVAA 2OA2A 2XB6C 3VDAA 2ZEXA 1OCCB 3E22B 4O4LB 1SLCA 4WVMB 2HWE1 4Z2AA 2YXLA 2PLV2 1AP5A 4DR7O 4FBFA 4UFZA 2P3JA 5GZDA 2E3CA 3CCMV 3TEXA 5ABJB 4H7LA 1FFXB 1R1A1 5CAZA 1RPOA 2C9AA 4X1KA 1FS0G 1G8MA 3SC7X 2LFRA 5J7MA 4XF9A 3WXPA 3DTUB 5IYZB 5JOZA 5A32A 1DYKA 3PURA 4AR2A 4QB1A 4J11A 1UO9A 2C1FA 1I08A 1M56B 5LEJA 2PQSA 5C3RA 3KKYA 2WINB 4K1YA 2HWB2 3IDCB 1RUOA 2X5IC 4BQYA 4DQAA 3VDDA 1W6MB 3NAPC 3WDTA 1Y6XA 1M9NA 3NNLA 1STMA 2GUZB 3ZCCA 1HN0A 4LF6B 2VOKA 3L74H 1Z2GA 2OUHA 2P06A 3RYRA 1ZYBA 3HKCA 5I0UA 4UFKA 3UKNA 2P6HA 1NA1B 2RJKA 1RUE3 4LLOA 1SQFA 1P49A 1NCQA 2MPFA 4Y5TA 5C7GA 4XDOA 4WZFA 3W59A 3A0NA 1VBB3 2JIJA 4Y24A 2XHNA 2AHYA 5L9RA 3HN3A 1GZTA 2JKBA 4I7ZB 4ICGA 1QR8A 5DAVA 3ZFFB 5T5PA 3T2MA 3RZGA 4QX2A 4NKGB 2C5DA 5FAXA 3H8XA 4NAOA 4JRAA 1NVPD 3V0BB 4BW9A 5HXMA 4AYUA 5GZGA 5FZEA 3CCEV 3BGAA 3IAQA 2BOCC 2YGMA 1QLEB 4XILA 3OUJA 4URAA 4QHBA 3LFIA 4QPYA 2DF7A 2BEOA 3I2OA 3WF2A 4XXAA 4NE9A 1OLMA 2A6ZA 1IS4A 3LFMA 3LPGA 2CAZC 4RQEA 3HR9A 3VBFA 3ZHUA 4YVSC 2PYJA 3ETQA 2UU9O 1FOD3 3GZAA 4N23A 4XFHA 1N32B 4RUFA 4IYHA 3SH5A 1B35B 2IH1C 5A7WA 4I2OA 4L87A 4IDZA 3JD71 4LO6B 2DYSB 2D6PA 3GB7C 4JI6B 5E6HA 5E1RA 3WQ0A 2O57A 1R083 3MDSA 3HT1A 3RQ0A 5ISLA 3RVYA 5DG2A 2WNUC 1WNSA 4UCRA 4XFGA 5B1AB 3SPJA 3PNAA 4PJ0Z 1XREA 4O61A 1Q8PA 4O65A 1X8EA 1MOFA 2ZS6B 1EN6A 1OBNA 4DIQA 4DUWA 2EIJB 2XJRA 3QF7A 3J4UH 1V00A 3VGIA 5IVYA 4IUGA 3UL2A 2ITCC 2ZD9A 2V5YA 4DRVA 1IXMA 1N34B 3OGIB 4CH3A 3SPCA 2R30A 4MTGA 4AVCA 3ZSMA 2BGCA 3T4ZA 1ZL8A 2Q9LA 1UX7A 2ARBA 4NRPA 3JAKA 4FOWA 1RHI2 4BQWA 2FZ2A 4RR3C 1SLLA 5DUXA 4NN0A 4Y1UA 1HP8A 3GNEA 1PKXA 2WUHA 3WR0A 1V6JA 4FTEA 3WLUA 2VECA 4MXWA 2KD7A 3ON7A 2JG8B 4NTWA 3AP6A 3DEMA 4LOTA 3SCGA 1EN4A 3QO7A 1XOUA 3RG0A 2XJTA 1DGRA 3OY8A 3KG2A 1LHOA 2H0VA 5FPRA 3ASNB 1HRI2 1BEV3 1AYM3 2E9QA 5FLJA 1V6NA 4AGRA 4AXOA 2YZ4A 4HN0A 2HJDA 3CC2V 2FTKA 5LASA 3PUQA 3VBSC 4MHUA 4R4XA 1YHFA 3I2GA 1DQ5A 3BB6A 1HB2A 5IFPA 4M0NA 2HYKA 1QJEA 3ZFEC 4LHLA 4J7ZA 3LE0A 2EILB 4R8CA 2JWPA 1Z0HA 1C28A 1HLCA 3K06A 1Q8VA 2QNKA 4HVQA 1RUD3 4GB33 2WLHA 3K03A 5C8CC 3ZYRA 2C24A 3HVDA 3WP4A 3MDPA 4DXTA 4TZDA 2VAUA 2GAUA 5T5OA 4XXPA 3VBHB 2R32A 1V6KA 5LB6A 4WM8C 2ZGKA 1VIWB 5IJ9B 4QIWF 3QO5A 1GZCA 4Z92B 1OCRB 3BPSA 4KI5M 1ODMA 1W0PA 1R64A 3JZVA 3NQHA 3R4SA 3W58A 1U97A 5AC93 3OAAG 4ZPIA 5K1XA 2LO1A 1VMGA 2ARXA 1KQSU 2Q5ZA 4I5SA 4NTXA 1GLHA 3ZXKA 2UUAB 3VLBB 2DTYA 1MABG 1CJDA 1RP3B 4JZGA 1V6IA 2Y69B 1VQPV 4GD4A 1CJPA 4AI2A 4LF8B 1FKAO 2BP6A 2GN3A 1A32A 3VBOB 1TVKB 2QQMA 2ZGUA 3TN93 3ACGA 4B3SO 1NT2B 1Q6IA 3HQXA 3LDKA 3D0SA 3LUTB 2RS11 3ZN0A 5I91A 3AK1A 3I2KA 4LF9O 3CMAV 3KSCA 3RYCA 4GWMA 4JDMA 4WCEV 3ZN5A 3UV9A 3KD4A 1EBOA 1YWKA 3WDWA 1XJAA 1CZVA 3WF4A 5C3PA 3TK1A 1CZSA 4AF9A 1K5SA 3O1RA 3R6SA 1PNMA 5K0UA 2IXKA 1K97A 3J26N 4OX9O 1KYOF 3JB4C 3D82A 1ND3A 3N7LA 4MO3M 1PK6A 3SJAC 2WAMA 4XUOA 4IE4A 5JSOA 2EIMC 4DY3A 4XF0A 3GDBA 1VP7A 2DUQA 2D93A 4MSWC 4UFLA 4DK0A 1W2AX 3ZYFA 4ZZ8A 2IJKA 1QVGU 4FZ1A 4QXKA 1XB9A 1IVSA 3E83A 4DS0A 5DUUA 5FQ0B 4ARXA 1LOEA 1EAH2 3H3LA 4GAZA 2WQ8A 2DVDA 4R8HA 3L2YA 3FBMA 2XLGA 4TV8B 1XQ8A 1DHKB 1N33B 2VMEA 4CDXB 1GSLA 3CU7A 2X6AA 3HBKA 5C3SA 3OMNB 4XOGA 5H9CA 4XDJA 4W65A 2BNNA 4B3RB 1XU1A 1YO8A 2DCJA 5EBLC 3PVOA 4XFCA 1ZVFA 4G2KA 4PA7A 4BOWA 4XFAA 5LA6A 4LC1A 4QWNA 4CBCA 3I3MA 2FDKA 1NOVA 1OZ0A 1JXNA 2EXJA 2RHPA 2VMDA 4CCDA 2W39A 1XE8A 4HVOA 3VKNA 2ZKNA 1NR7A 5JVDA 2FL4A 2DURA 1UN1A 4BQ5A 5EJ1B 1BBT3 4XJZA 4F4LA 4OZOA 5DZEA 1VBE2 1AI6A 2VBBA 4ITCA 2VCAA 2Q0OC 3BVCA 4X64O 2EIEA 1HNWB 1W8OA 3CMGA 1XNDA 3MW3A 4AK3A 4EV0A 1NBMG 4RWUA 2WPDG 1HRV2 2QWOB 3OGSA 2PAEA 5FXZA 2R1BA 3WZ1A 1IBMO 2Q69A 4LF7B 5F2VO 3DL3A 3U11A 3CJHA 4X20A 3OTFA 3WV6A 3APQA 1VF5B 4I50B 5FYYA 2WRAA 1F8VA 3BVOA 3PVBB 4NMIA 5C5TA 1AXYA 1RITA 4F3JA 4OCTA 4XUTA 3NAPB 3BTXA 3SDLA 3ZHRA 3CZJA 4GX0A 2XPJA 5EYXA 1PV0A 1TUEB 4WM7A 3K5LA 1NS1A 3RZJA 5FCCA 4Q4X2 3OUSA 2VU9A 4AILC 1FJGO 1ODNA 1NCRA 3W20A 3O0VA 4HK9A 4V2WA 2RM23 3AKRA 5HPOA 5LXTA 4WF9V 3MF9A 3WNKA 4LWSA 1ZZBA 4O7XA 5EIYB 3D8CA 4P5YA 3FFZA 3ZXFA 3T1YO 1OHHG 2QZ3A 4IIJB 1ZTEA 2D5HA 4CYDA 3ZKUA 2IBZH 2ZGLA 1IBKB 3VQWA 1HKDA 3IFXA 4A45A 5L73A 4O4JA 4FPEA 1KJLA 3H3ZA 2XLAA 2XASA 1MZFA 3T0BA 3RJRA 3NNJA 1W59A 2W1UA 5JQGA 1R092 4FLWA 4MGKE 2YUAA 1SBDA 4TWTA 1YFYA 3T2PA 5I0TA 2VC9A 1GWMA 2BVBA 5LP6A 1D2QA 4H3WA 2PZSA 1DZQA 4UW4A 4K8RB 1H8TA 4HZFA 2X7RB 1L8DA 3NV1A 2VS0A 3CJXA 5EK0A 3CCSV 2D97A 1CZTA 1AL0G 1Q6UA 4YY3O 4MVTA 3M7AA 3ZIXA 1HX6A 3H1IH 2AEYA 2VZPA 1EPWA 1WD4A 4A7ZA 3N9MA 2VVFA 4UF0B 3M8LA 5IATA 1BHBA 1TG7A 1JFFB 1UQXA 3S3XA 3N9OA 1YYNA 1U0AA 2DV9A 5SV5A 4Y3OA 5CIRA 2Q1FA 1E5IA 3TGUH 1GP6A 3JXSA 5LZ6A 2ZE8A 5IHRA 1XYNA 4L92A 1LR1A 1W3XA 4ISRA 5BNPC 4QE7A 2JGDA 4TLFA 1Q6HA 4JI4O 2BUKA 3E8FA 2P4EA 2R041 3OTOB 1DZRA 2D43A 4LK7A 3H8UA 3BABA 4DFSA 2WA3A 2Y0PA 4H0LB 4NB5A 1UNBA 3DXRA 3GXUA 2VNVA 4J42A 1X82A 1QQP2 1PM7A 1UW8A 2XJUA 3GZTB 4DRXB 1PO13 5FDBA 1V70A 2LM3A 3BY6A 4L9BA 4LH6A 2Y64A 5JXJA 4IEYA 1ZRRA 2W46A 1AJNA 2EF6A 4BMBA 2UXCB 1DQ1A 3N2GA 5FZ1A 3ABLC 2LW8A 5FTTC 4AI8A 3IAPA 5FPAA 4KP4A 2GH2A 5GLZA 1HDJA 3LD8A 1R6NA 4L8QA 3PVEA 5LY1A 5FZ7A 1SCRA 4U7OA 4QHZA 1S2KA 1P84F 4OPAA 2YIBD 3OMIB 1O8SA 4J10A 3K9AA 1K7DA 2RMU2 4R6ZA 4AHCA 3VBSB 4X1YA 2QJ1A 3J7MA 1LOBA 2TNFA 3ETPA 1PP9H 4GA9A 1QGLA 4KL1A 4WFHA 5FP3A 2WZR3 4DR3O 2R6QA 1N36O 3S5QA 1UCXA 5HV0A 1H30A 3T1HB 1XHZA 4O2BB 3OOXA 4UFJA 1JU3A 2VMIA 1NTZH 1AJPA 1QJY3 5KBFA 4Z1VA 3J81N 1QJFA 2BSKA 1UXZA 5LCWL 1V55B 3K58A 4XDPA 5C8CB 1GANA 1U5ZA 1QMJA 3ZMSA 5FLHA 1DYPA 4Z8BA 5JR7B 2YC2A 4Q8KA 1WBLA 1RFYA 4KWLA 1YJKA 4UXNA 4QPIA 3F2ZA 3ZN6B 5KXEA 3C7OA 3C7GA 4IERA 2HWE3 2GNDA 2W5FA 2HJFC 1MS8A 4G3YC 3RFRA 4H13B 3E6DA 5L9BA 3HR0A 4I4TA 1F4HA 3AYEA 3ELNA 2EZPA 3RW0A 4FLZA 3KCCA 5FLXN 1FYJA 5FP9A 4TSFG 1R1A3 2K1EA 1POV0 2A71A 2HYXA 1HR0B 1EPZA 1Q8OA 1OA4A 5BNNA 3O7OA 2P2KA 1M4UA 4XZPA 3CL1A 2VOVA 3A4UA 3U0ZA 1CIWA 3T2QA 3RDIA 3OR7C 2LALA 4Y5Z0 1XYOA 5FZLA 1QJU1 4L0PA 2VL4A 4Y22A 4AQYO 4BCUA 3TWIA 2Y4TA 3VOUA 3GYDA 1UY1A 3RS6A 1W0NA 2E7TA 3CWBH 1OFSA 4GH4C 2DMXA 1W6QA 4R9CA 1PVC3 4WFGA 3AL6A 4N7UA 2RNBA 3CSXA 1CGPA 2ZXWB 1KITA 3OSDA 4CDWC 3VBUC 3LEMA 2DCYA 1AR4A 4GKJB 2YGLA 1W8TA 3CZUA 4XCAA 3VZMA 5I0SA 2QWQB 3BFRA 2E63A 5D8AB 5FYUA 3VBRB 2F23A 1EZVH 4A5UB 5L7OC 1TUBA 4TOIA 3KM5A 3WY6A 3KGLA 2CH7B 2UY9A 1AX2A 1J3QA 2PY5A 2QQPA 3X2QB 1PMJX 5FZMA 1N47A 1O3SA 2E51A 4HAMA 3S6PA 3WD5A 2VQTA 3GHMA 3FZ3A 2BERA 4TSVA 1MA1A 4NIDA 1FPN3 3H9AA 2IUWA 2IC1A 5IVFA 1IBLO 1LHWA 3CCQV 1E5RA 4UWDA 5FZKA 4B08A 2CSGA 1JR9A 3WNOA 1HWYA 4CH4A 3DECA 1VMFA 4WFAV 3PLQA 2MEV2 2RS53 5CYYA 1MZ5A 4AI1A 2Q30A 3ILNA 2A75A 4D7YA 4B1LA 4CZZA 2EAAA 5DABA 4Q4Y3 1BQ0A 3STLC 4P02B 2JVDA 3AK0A 2L35A 4CS3A 5EWSA 2NM1A 1XL6A 4QDSA 2ZA9A 4ZU7A 1PX4A 5KXCA 5LMUO 4QPKA 3THPA 2FZ1A 1QJX1 2TUNA 3DC5A 1PZ7A 3AYCA 3AJZA 1G7YA 1ZBE2 2C2AA 2OIGA 1YFWA 2X5IA 2UYBA 1J84A 1WD3A 4JGYB 1M4WA 1RUI2 3RYFA 3AL5A 4PQQA 1EV11 2PUSA 1AR5A 3USSA 4H55A 2XGXA 3G6BA 2CWMA 1GICA 2J1VA 2F93B 3MFAA 3AG2B 1LEMA 2WLPA 3AC0A 2Z3YA 5HV4A 1E57A 3MV11 4X65O 4TQDA 2Q8OA 4JGZC 2VMHA 5GKAC 2ZDIC 1JYVA 1H2LA 1ULGA 3AG7A 1PGW1 3FKSG 5IK4A 5T50A 3MUY1 3RYHB 1CPYA 2ZCEA 4JAAA 3CCJV 1IQAA 1Q82W 1QY4A 4OHWA 3RI8A 3A0BZ 3K57A 1I6XA 1YIFA 4A3XA 5F39A 1G8WA 1GU3A 3AXEA 3R05A 3AXDA 2VMCA 3AG4C 5FNVA 2BGPA 2ZHKA 5C4WA 4LKSA 3WINE 3I2DA 3DGTA 1BXHA 2J22A 5FY1A 5CKNA 4Q8LA 3K48A 4PHZA 1J83A 1PX3A 3AG3B 3B8MA 4DV4O 4P30A 4YVSA 4FXKB 1RPRA 3QBQA 4P5HA 1YUDA 4XHBA 1KDKA 4NIAA 2PXJA 4QX3A 1N3PA 1US6A 5C8YB 2XL7A 5A6YA 1QNYA 2BFUS 4DV0O 4Q4V3 4JDNA 4NTYA 2IJJA 3AMPA 5KC6A 1F35A 1MS4A 5K8SA 2DYRB 2BBVA 1O91A 3FYEB 1MEC1 2NMOA 5EIBD 1AJOA 1JZ2A 3AKTA 2WBKA 3RWNA 3H1JH 4JTAB 5F5QA 2JEXA 1S0DA 3O1PA 2WIIB 3GCXA 1NXD1 5F3EA 4HNAA 5GW7A 1PNLA 4H33A 1JQ0A 1IPSA 1RL3A 4JYAB 4IEZA 2I74A 3ZFGB 2LW1A 1RXFA 2UXBB 5LOVB 4QDQA 1AI7A 3HPNA 2PLV3 1UY2A 2EIKC 1Q81W 1POV1 2QEXV 4E2LA 1COV1 3EBRA 5DMYA 4NPRA 1VQMV 2X6BA 1R1ZA 4AW7A 2WLMA 2E5LB 4BWAA 2OCCC 4QE9A 5GZEA 2KM2A 1AJKA 1Z5VA 4CXYA 1BYHA 4YJ2B 5F5CA 4LR4A 4HG6B 1H2KA 5F1RA 2ZMNA 2J1SA 5GLVA 2ZR3A 1U5IA 4FJCC 4HPKA 4LFAB 4G4FA 4RR3A 4MVRA 1RGSA 3ZJZA 3DXUA 5JSRA 4Q1RA 3QTCA 1UKRA 2ZGNA 3BA9A 4LPLA 4ZXKA 1GWLA 1SFNA 2PHWA 3UK9A 4HKOA 4M0HA 1KD1W 1X9TA 1MZ6A 2QGNA 2IVJA 5BNOB 2EXHA 3H7JA 4PDMA 4HETA 3BPZA 1VB4A 3P3NA 1RSOA 4F6EA 2TBVA 4XQWA 4OXSA 1CAWA 1QKQA 1EYBA 2VTXJ 4GALA 2ZM6B 4CRQA 4UFIA 1C5IA 4CP9A 1EY2A 2JG9C 2VTFA 1PL0A 4LLFA 4AEDB 3L70H 4ZI7B 3JARB 2CHHA 3CD6V 3BALA 1HXS1 1GQGA 4IT5A 5LA9A 4CU7A 5A3PA 4TN7A 2EVXA 2BCCH 4U3FH 3SGIA 2BTQA 1N8RW 1JOBA 1OC1A 1LCLA 1N32O 4N9IA 2W92A 3CRQA 1AR82 3OE7G 2DU0A 1XC6A 4YHHO 3ZFEA 1QOOA 1HIXA 3F7VC 1W2OA 4JDOA 2HR3A 1V6LA 1W6NA 3UETA 1OVSA 5FPXA 4JI6O 4FPLA 2ADQB 4PLOA 5FIXA 3PHMA 4QPJA 2O14A 4TV9A 4D0QA 2OTJV 2GTAA 3KVBA 3LZZA 4YZ2A 2WLLB 1YQ2A 2PTMA 1KDMA 2JD4A 3T4VA 4TWKA 4QB2A 2YXSA 3WHUA 4XDQA 1WMDA 2EULA 4JKKA 1GAXA 4WM8A 1XBFA 2XJSA 4NRQA 1OA3A 4IEOA 2ORZA 3KB5A 1GKBA 2Q1ZB 4M4RA 4OYUA 4XFIA 2GDFA 1WCUA 3AFKA 1W05A 3WQ1A 3B69A 4HMZA 2Z5UA 4DUZB 1I5XA 2YICA 4W4ZA 1X8MA 1UYPA 2VWKA 2JKXA 3KCYA 3BYWA 1BLZA 4ASMB 4OFGA 4FQZA 2RDNA 2JK5C 1XUQA 3CBNA 2VOTA 2YB7A 4PQ9A 5GLTA 3H42B 3AX4A 1SG3A 2YBPA 5FV3A 2R062 5FZ4A 2ZGRA 3MLLA 2V1DA 1AR72 5BY5A 2VQ0A 4AHXA 3RYIA 5CNAA 1OV9A 4DR2B 2VZRA 4GWIA 4AFCA 4B29A 2WSSG 4BH9A 3G71V 3VL9A 3CC4V 4FCAA 3MYXA 2DWDC 2AC1A 4O4LA 3H01A 1KFXL 3OEHG 3W7UA 3ZRSA 1OJHA 5LY2A 2BOBC 3R4UA 4PDVA 1Z5WA 2ZZQA 2LRPA 4NROA 4LBOA 4JTNA 4JQTA 3T0DA 5GONA 3VD7A 1LGCA 4YPJA 5DEDA 5IT9N 2A70A 3CKHA 3BU7A 4IV1A 3M1HA 3N2KB 5AFBA 4DXRA 1IS6A 4QGPA 4AAXA 2ZX2A 5FFOC 2GALA 2YY1A 4S2HA 4LBEC 4GH4B 3Q8CA 4FP2A 1F51A 1NAEA 2A3XA 2RR11 1VARA 4Q2FA 4LKFA 5A3LA 1VR3A 1UZVA 2QQOA 1F5JA 3ZYBA 2DBNA 3QD6A 1CAUA 4MZUA 5H6RA 3VBUB 2NLRA 3PUHA 2A7WA 3ZIWA 3HEIA 1JUHA 5J2TA 4NXNB 2QE7G 4EYUA 1NLRA 1YJNV 1EM1A 1V9U1 2XONA 3R65A 3OF1A 2LGWA 5L9VA 3SEPA 2K9ZA 2XBO2 2RS32 2UUAO 4COYA 5L7OB 2WYFA 5LYJB 1AILA 1R3JC 3NR7A 1NCQC 3AK2A 3PMSA 1Z78A 1ZBA1 4BDVB 4LUMA 5FXWA 4XEZA 4K9SA 3HIFA 1HJGA 2P3IA 2R0FA 3BTZA 5EHDA 5BV6A 4L99A 1N3QA 5C93A 2VBPA 4P9YA 4EB6A 2YFZA 4DY5A 4FPFA 2B8MA 1BMV2 4ZS3A 2IVIB 5EZYB 4B3TB 4YNIA 4RD7A 3O1TA 3HKEA 1Z7S2 1AVMA 1XMOB 4RQPC 2GHYA 3LCPA 1UZZA 1RUH2 4LBKA 1KKCA 4JI7O 4CE8A 1WN7A 1GP5A 4AEJA 2HH9A 2WFF1 2FDHA 1X7NA 1W6PA 3DSQA 5J9PC 2C0ZA 3ETDA 2JGUA 3H1LH 1H4GA 1DYOA 3CCVV 3JALB 1RMU3 2JEMA 4WBBA 1OUSA 1S2BA 3ETEA 1N1SA 1UZWA 5FREA 4ZIBA 1R6KA 3AP5A 5JJNB 2CGOA 2X09A 2Q4PA 2Y33A 2QQNA 3B02A 2NN8A 1W6OA 2CDYA 1O4YA 2QA4V 1WUVA 3P3PA 1LGBA 5KAIZ 4ZOLA 5F37A 1G9AA 5JZGC 1RINA 4OQ9A 1VMJA 2Q7EA 1TME2 1MPXA 4HN1A 1AR91 4DV6O 5LK5A 2GU9A 1I5YA 1N33O 4DV3B 4JI0B 4Q0QA 4DUXA 2R9AA 3GF6A 1VBB1 2DE0X 2QKSA 4FSJA 5JDBA 4B3RO 3O5SA 1CD3G 1S1AA 4XABA 1AZDA 3AG4B 2ZPXA 4HLTA 4G27B 1RVF2 1FXKA 4IV3C 4Y20B 5EYYA 1UMIA 2A3YA 5ITZB 3RT3C 3GM8A 1FI2A 4O4IA 1REDA 5GLUA 3WDVA 2LFSA 2UYAA 1S0GA 1ULPA 1K45A 1S5LZ 1NY72 1W9TA 3KF5A 3GALA 4M3CF 4J9ZB 3MLJA 2HWD2 1HNWO 2R70A 5H9PA 1FOD1 1ULCA 1QU0A 2X6CA 1D4M1 1LUVA 2UWAA 1BS3A 1A3KA 4KG8A 4IE0A 4LF7O 1K4DC 1JZ3A 2WWSA 5EIBC 4OMDA 1E5HA 3EB7A 1F31A 5JR2A 1R081 1MS9A 4YIOA 5A3OA 1RTVA 4DV5O 1CESA 3I3QA 3WDXA 2Y26A 3GBFA 4HANA 3T2TA 5E8AA 5H2FZ 2Y6KA 2F4LA 2VQEB 2E53A 1FPOA 5BNPA 3LSDA 1WKYA 3NV3A 4CPBA 1K5JA 1PGW2 3IGAC 5DN2A 4NOTA 4X66O 4AAPA 3DPRA 3UKTA 2HEPA 2IXHA 5KHGA 3K04A 5LRSA 1BL8A 2AGAA 1SPPB 1JZ4A 4DXWA 1HRV3 1IBKO 1U96A 4GJZA 2XQXA 3VZNA 3LIHA 5LGTA 1H4HA 1VBD2 5IK5A
chains in the Genus database with same CATH topology
4XXPA 3VBHB 1FAYA 1UX6A 2R32A 2D3PA 2P34A 5HCBA 1GZ9A 2WNVB 4IEQA 3VHRA 3ZVXA 1GYKA 4UBGA 1V6KA 2Z69A 3EJKA 4HL0A 1J59A 1RUJ3 4J1WA 4WM8C 2ZGKA 3WUDA 1WLTA 1VIWB 3WUCA 1UIJA 4A2UA 1GZCA 5ACA3 3AYDA 3ZFEB 4Z92B 5C8CA 1W0PA 2OZ6A 3JZVA 3WX5A 3VZJA 3R4SA 1W6NB 3W58A 5AC93 2GC0A 1LU1A 4OJ8A 2XWBB 4QQOA 2G9FA 2IXCA 1AYM1 1RUF1 5T54A 3FLTA 1HV0A 2HWF1 4K8FA 2ARXA 1WCKA 5GJ6A 1PO23 3RJ2X 1FMD1 3A0KA 4FOYA 1GLHA 3ZXKA 3VLBB 2DTYA 5C6CA 1CJDA 1APNA 4N53C 1WMFA 1BVP1 1LRHA 1AL21 1V6IA 4JC1A 1ASJ3 1CAVB 1CJPA 5C8WA 1AR61 1PHMA 2XJQA 4AI2A 2RJLA 4EWAA 2DWRA 1GFF2 3CJIB 1GVGA 3VN4A 3NW4A 3ZN6A 1VBE1 1C1LA 1MACA 2GN3A 5EFUA 2PAKA 4HK8A 3VBOB 3FLPA 2ZGUA 4AG4A 5KHIA 4GWNA 1W2UA 3TN93 5JPNB 1AXZA 1WBFA 2R071 3V15A 1Q8QA 1XNKA 2XVLA 2VVEA 1ZZ9A 4RGAA 4WM8B 5A33B 3HQXA 4RHV3 1FOD2 4DXZA 4N53A 2VG9A 3D0SA 5K0UC 1HRV1 1YI7A 2RS11 5I91A 1D4M2 2GMEA 4OI2A 1A8DA 1OD5A 3SCFA 3KSCA 5JMCA 4GB31 1C1FA 4GWMA 4JDMA 5DUVA 3ZMOA 1G6NA 1BZWA 3RMXA 3ZN5A 2OIIA 3JQXA 4HSJA 3UV9A 1ND3C 3KD4A 1JYCA 3VKMA 1YWKA 3WDWA 1O3RA 3WG3A 1RUNA 4FTBA 4LA3A 4AF9A 4YZ5A 4YW4A 4M2FA 1J58A 2G9GA 1SQ4A 4MSVA 1DGWA 3BTAA 4E27A 4LO4B 3I4IA 5JPMB 3R6SA 3RI9A 5K0UA 2D6NA 2IXKA 1JYIA 1WW7A 3J26N 1RUJ1 4Y1VA 2SBAA 3JB4C 2O0OA 3NKGA 4BM8A 1D0GA 2XWJB 3J8F3 2ZOEB 4CDXC 4QQLA 3D82A 1ND3A 2FBEA 3N7LA 4YYOA 4FFAA 1IKQA 1J1LA 1MS5A 4GMP3 1C8NA 1PK6A 3BIWE 5EJ3A 4Q4X1 4EN6B 3MIDA 4IETA 4N90A 5JSOA 5AFEA 2VMGA 3JBG2 1VAVA 4RS5A 4DY3A 3QH6A 4YM3A 4XF0A 2Q5TA 1PO21 2W08A 1O7FA 1URXA 2DUQA 2HJIA 2ZACA 2D93A 2XLFA 4KGQA 1C8M3 1ASJ1 3AP4A 4CDXA 3MICA 2BNMA 3WG4A 4QXKA 4DS0A 5DUUA 5FQ0B 1LOEA 2IXIA 4B8EA 1EAH2 2D3SA 5CG9A 2DVDA 4AQSA 1RUC1 2ZAHA 3B5LB 5D8AA 3LKJA 2GMMA 1CX4A 1ENQA 3TN91 3VBRA 1Y0ZA 3L2YA 3FBMA 2XLGA 4R8HA 3ZYGA 4M2GA 1JOJA 4ZU4A 4R9DA 2IXJA 4XBQA 1MZEA 4QD2A 1N1YA 1DHKB 2FMDA 4CP2A 1JUIA 1H1IA 5E89A 4HBNA 4LEJA 4K1ZA 4CDXB 1H2MA 2W68A 1KFUL 3FLRA 3TNPB 1GSLA 3CU7A 2FQPA 1QJX3 4META 4XOGA 2CAVA 4DB5A 4KQ7A 2ERFA 4CP0A 4W65A 2BNNA 4FPCA 1XU1A 4DPNA 4LT5A 1R091 4EN0A 4P9GA 4YVWC 3E5UA 2EAKA 1PNFA 2K2SA 3M2MA 4L11A 3NO8A 1QXRA 3ENRA 5FLIA 1SACA 4IV1B 4AFDA 3ZSKA 2MNGA 1YO8A 2DCJA 4CDWA 3SWTA 3AYAA 4LBNA 3PVOA 3MIGA 4XFCA 1ZVFA 1UMZA 4BGMA 2IWGB 2DUOA 4JV4A 4A7KA 4BOWA 3VDDC 4XFAA 4IEXA 1Q3EA 1K5MC 4XIOA 1A6CA 1NOVA 3J8F1 1JXNA 2EXJA 1AYM2 1RUF2 4CP1A 1DQ2A 2RHPA