5JWPA

Crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYEEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The facial triad in the alpha-ketoglutarate dependent oxygenase FIH: A role for sterics in linking substrate binding to O2 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 5jwpA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jwpA01
1YCIA 2Y0IA 5JWPA 1MZEA 3OD4A 4BIOA 1IZ3A 1H2KA 3D8CA 3P3NA 1H2NA 4Z2WA 2YDEA 4JAAA 2ILMA 4B7EA 1H2MA 3KCYA 2CGOA 4Z1VA 1H2LA 4QU2A 4B7KA 2CGNA 3P3PA 3KCXA 1MZFA 2WA4A 4AI8A 2WA3A 2YC0A 2W0XA 2XUMA 4NR1A
chains in the Genus database with same CATH superfamily
1VRH1 5KLVH 3WB2A 1MQTC 2ZGTA 4K9SA 2E6VA 4GH4B 5FZ7A 3RYFB 1B09A 3NWKA 5F5QA 2DCYA 4XMAA 2ZDIC 1ENRA 2W5FA 3CZUA 3ZN1A 1XQ8A 3GJAA 5JMOA 4AI9A 4CP1A 5A33A 1UZVA 1OA4A 1Y67A 1V6LA 1PM7A 1FS0G 2I07B 4CCKA 4YG3A 4A6OA 5DAWA 1LHVA 4D7YA 3VDDC 4YZ1A 2WBKA 3KV5A 4A3ZA 2PHUA 4DUZO 4DUVA 4FM1A 3SYAA 4WVWA 1PNLA 4EV0A 4QT6A 4W4ZA 4H3WA 4PF5A 4Y1YA 3RNSA 3S30A 3UT0A 4Q4Y2 4LQRA 4AEKA 1CAUA 1VQLV 4SLIA 2JG9B 3ASOC 2OYQA 3FJSA 1AILA 1ST8A 1PO22 2GMEA 1JW6A 3A0KA 3TCUA 1OVPA 3W58A 2W92A 5BNOB 2JWPA 5H9SA 2A7AA 2R063 3NMBA 3CMAV 3ETDA 4CBCA 4RR3C 2JG9C 4NAOA 4OULA 2MEV1 4JKMA 4E2SA 2DYRC 3T3YA 1W8OA 1UOFA 1V9U1 3HBKA 2RJLA 1MVEA 2EIKC 1IS5A 4LOSA 3WFVA 4P2ZA 5CFCC 3ZMSA 1T6GC 2OCCC 4PIZA 1CD3G 4LFAO 3CJHA 1W6NB 4I30A 2R72A 4CC6A 4WZCA 4O65A 1Y66A 1A78A 2JGUA 2O57A 1ZBE1 3WY6A 4JI6O 2K2SA 1LNSA 1WGPA 4EROA 3WUCA 4YW3A 5FK8A 1TMF3 3ZFGB 2EZPA 4DV6O 3E2EA 5FZ4A 1RUD1 4UFIA 3TN93 1BLZA 3WUDA 2JKBA 1Z78A 3SPCA 4YM2A 1W06A 3VBBA 4BQ3A 3AMQA 4OGQB 1PGW1 2VZ1A 4MVMA 3JCZA 1N34O 1RPOA 1RUC3 2GC2A 5L7OB 2PHLA 4CCDA 1ZL8A 1XPWA 1EV11 1A8DA 1CWPA 2R061 4BW5A 2R7EB 2O8OA 4YM3A 4DV4O 4DR7O 3WHTA 4BIFA 3FYEB 1XMQB 2Q7HA 3ZIAG 5FXVA 3TRSB 2V73A 2ATFA 1JS9A 2Y48A 3DCQA 3QTCA 1XQNA 1SC5B 1OHFA 3NNMA 3QACA 4S2FA 4CXXA 3PHMA 1OOPA 5KA5A 3VDDA 4ZU4A 1QXRA 3AL6A 5F5AA 4AG4A 1AR5A 4XABA 4XUOA 5L3CA 1GZ9A 4NXMO 3OMIB 2WS93 3H1WA 3RYHA 5JVDB 2PN5A 2WSVA 1VBB2 2PMWB 4H37A 5GZCA 1GH6A 3F7VC 2GMPA 2QWPB 4CEWC 5FZAA 4I55B 2C0ZA 1BMV2 1F4MA 2XQRA 2P34A 2JB8A 1W9FA 2VOXA 1S0FA 4TSFG 1J59A 3MIDA 2VZVA 3AYAA 2YHJA 2WLIB 1HLCA 4N53B 5D5PA 1WPBA 2XKOA 4Q20A 2V5DA 1DLBA 4FFBA 4DR4B 3U07A 2VCMA 1YUDA 1K5QA 1K4CC 1AL22 1H4GA 2HWD3 5CFDC 1K97A 4P08A 4W6XA 5GZGA 4I50B 3H3ZA 3SQOA 2WDBA 2CTRA 2V09A 3ZDVA 2LRPA 4HOOA 1Q90D 2HEWF 4IE0A 4LO8A 2FTKA 1AR73 4OQ8A 4QQ2A 1I1EA 2PXJA 1D4VB 2DYSC 2V4AA 2GP3A 5CKMA 1DGWX 4LBJA 4A41A 1SDDB 1VQOV 2XXZA 1N47A 2ZIMA 1OJHA 2P17A 4LF6O 1S77D 2VZ3A 2BVVA 5LOVB 4DUXA 2ZGOA 2CGNA 2WNUA 1TZOA 3CXCU 1CX4A 2AUYA 4W65A 3UGGA 5A70A 4AHXA 1AUYA 1NCQB 1DF4A 4KUMA 4UUJC 4XJ8A 5DAQA 4R4XA 1Q86W 2JX9A 5IVCA 2Q5ZA 5F32A 3SCGA 3SLIA 1S1AA 1KEXA 3VD3A 4UCRA 1YQCA 3K4ZA 1L7LA 2EA7A 2QM4A 3X2QB 4CPBA 4B1MA 1VAVA 2RV9A 1H8VA 1TGOA 1VBD2 3IDEA 2AREA 4PA7A 3VBOB 3RZKA 1AZDA 2ZE5A 4J11A 2FHRA 1VMJA 5HCHA 2XLFA 3CNAA 5JPMB 3HKCB 2HHHB 4K3UA 2CNAA 5FP4A 2XKPA 5LASA 5CBGA 4LBOA 1E1QG 4LK6A 3W5MA 3O0VA 1QH6A 1Q8VA 1UU4A 4WM8A 5CB4B 1UYXA 1LECA 2R072 4BIZA 4C90A 4QKNA 4JI2O 4G9SB 4MXWB 2R041 4QX7A 2QTOA 1ENVA 3RZZA 3GCXA 4JI5B 3TNQA 3O1OA 1XNQO 1IX9A 4Y5Z0 2W91A 5BMVA 1FATA 1OD3A 2XASA 4LP8A 1N34B 1WBFA 4UVCA 4YW4A 4GXLA 5D21A 1O4TA 1VQMV 2R9RB 2WO7A 1MABG 5FY5A 4H0LB 4Y4RA 2HEYF 4EFBA 3GALA 2ARCA 2EALA 2BYVE 1UN1A 2J42A 5DXDA 4XTMA 5HCBA 4UWDA 1RUG1 2QKAA 2YXHA 1LUVA 2X05A 4Q27A 3TXQA 1H2KA 3L72H 1WB8A 3KD4A 3U4XA 4H13B 1OCZC 1NQTA 2GTSA 4YFZA 3LKJA 4O4LB 2Q7EA 3L70H 2WLPA 4FBFA 1RINA 4HMZA 2FZ1A 4MVOA 1YLLA 2YC4A 1MNGA 3UGFA 2VZRA 3LA3A 4EWDA 3T30A 1NG0A 2HBUA 2Y26A 1AJNA 5DZGA 3LUTB 4OVEA 3HVDA 1S0CA 1AXKA 4YVWC 3TB0A 3POGA 1WCDJ 3THDA 3WOGA 1RPRA 1XE0A 1F4NA 1KKDA 1ULPA 1OQDA 1RM1C 1HV1A 3JB4C 1NUKA 2FDHA 4MSWC 1GANA 4AQYB 3PJYA 4ET7A 2QTWB 1X82A 2JE9A 2JDPA 1NLSA 2HWE3 1CVNA 4IV1C 4MHRA 1RHI2 4K40A 3NO8A 3OPTA 4QQOA 3VBRA 1WA8A 2F17A 3G80A 4IE4A 3K08A 3FHIB 4S2DA 2GNDA 4R9CA 5FXZA 1NR1A 1OI6A 2X09A 2YC0A 1UZYA 4BOWA 5IVEA 3ZFFC 1B35C 3FLRA 5CA3A 2NN8A 2WFPA 1NT0A 4F6EA 1KD7A 1F5FA 2VWJA 3WV6A 4Q4V3 3CCSV 4L97A 5F2VO 2WQ8A 2BOBC 1K12A 4CDWA 5FYYA 1KFXL 3NV2A 3LPGA 2MHFA 5JH7B 3AKTA 1SLCA 2RJKA 4Q4W1 3OTOB 2B1IA 3CZJA 4CS3A 4Q29A 4OCTA 1NVPB 4DXRA 4DPNA 2BNNA 2VGDA 3AZZA 4AEDB 3MZHA 3VDBA 4I0BA 2AHYA 3OEBA 3THOA 3JD1A 2D40A 2RE9A 1EN6A 4DR3O 1NZ6A 5FZ9A 1CZSA 1X50A 3HN1A 5JR2A 5F1RA 5KC6A 3FX7A 3K57A 2Q8EA 3OUJA 3ST7A 4HKLA 1R6TA 2VW0A 3D3QA 1WCSA 3OAAG 1L0LH 3FL7A 3OTFA 2YIAA 5LA2A 4FSJA 4OX9O 4DUYB 5FTTC 3WG1A 2YI8A 3K59A 5F7UA 1U12A 2OTJV 3ZYRA 2DVFA 1AI6A 4WVMB 2H94A 2FMYA 2GSYA 3Q8FA 3K5LA 3RW0A 4LORA 1K4DC 4O2AB 1QXPA 3CC4V 1VQNV 3KT7A 2DYCA 4XJWA 4LF5B 4DXTA 3CCMV 1PP9H 4MO3M 4LNUB 4YZ2A 1SQQH 3PUIA 5JOWA 4FIPC 2WO2A 2XGXA 2VUCA 2D98A 3VQYA 4RFRB 1XYNA 3FHAA 2X6AA 3ZXKA 3RMXA 5A9GA 1W6QB 2R0FA 2FMLA 4O4JA 1SETA 1JU3A 5E1AC 1TNRA 4LO7A 3CJIB 3ZSKA 3UKVA 3QO8A 1LNQA 3V0AB 5F5CA 3OYWB 5GONB 2W0FC 3LIHA 5GJ6A 2YICA 1W6OA 2OKXA 3UV9A 4ISRA 5HV4A 1G8MA 3N4MA 3SHRA 4JI0B 1VP7A 3FB8C 2Z79A 2W6IG 1ONAA 1YQ6A 5I0UA 1B06A 1HDKA 2JDZA 2DTWA 3MIFA 4AL9A 4LF8B 1LR1A 5CZKA 3P3NA 1DU3D 2NZ9A 5IY5C 4DR4O 2EILB 5HPOA 1XXNA 4FLUA 2IXJA 1LGBA 3S57A 2L9LA 2XJTA 2IM9A 3MLJA 4JI3B 1ZZBA 4DV5O 3DF0A 3NJYA 5FQ0A 1IDSA 3ZRWA 2RMU2 5LOVA 4ZI7A 3T4ZA 4JAUA 2KG7B 2ZTNA 2PHXA 4AQ2A 4N43C 1LB2A 2OZJA 4ES8A 2PTMA 5FY4A 4XILA 2ZGNA 5JZGA 3RI8A 2QTSA 2BTQA 3ABMC 1I3HA 1K34A 2DUQA 3JBG2 1GP6A 1GU3A 2D2CB 4AI8A 1I94B 2IXHA 1H2NA 2YZ4A 3PUAA 2WPDG 4AYUA 4OYUA 1OCCC 4PJ0Z 1AYN1 4JI6B 3AVRA 1JXNA 2V4DA 3DPRA 4FFBB 4UW5A 1XNBA 4KP4A 1LOBA 1YJLA 1KJRA 3KLSA 4OMCA 4PF1A 4BQ4A 1XNTA 4BQ1A 4LF9O 2A3XA 4UOJA 1YXWA 2WAAA 3BPSA 5GONA 3IDCB 5EFUA 4KWJA 3AEIA 2IXLA 5C9AB 3J81N 1F35A 4QXKA 2JICA 2ARBA 1C1LA 4N21A 4GYCB 1YHQV 2KD7A 4C7UA 4HPKB 2WAMA 1XYOA 3OYWA 2ZJCA 4BW9A 1RUE1 3EO6A 4WM7B 2WFF2 3FHQA 3H7JA 4A2UA 3KQRA 4FFGA 2CWMA 3VBSB 2JRIA 2HKXA 3HD8B 2XAQA 4JAAA 3WW2A 1LR5A 1AR92 5KHKA 3VDAA 3M99B 4MG2A 2VTFA 1F4AA 1N1TA 3CLPA 3NNJA 3HMYA 5KR7A 5C8YB 2UXCB 1OOPC 4AQYO 3ZR6A 1JZ4A 4BQWA 1RXGA 3ABKC 4FJCC 2Y6LA 2DCJA 3A4UA 1NKGA 1TME3 4FO9A 3E8GA 1YDXA 3LE0A 3B8NA 2CDOA 3HKBA 2RM21 5A3PA 4RYDA 4IV3A 3WG3A 3I49A 4JQTA 1WN7A 2Y69C 2VULA 4FP2A 1XE8A 2RNBA 1G4YB 5B1BC 4LO5B 4AAXA 1WMFA 1W04A 1UX7A 4XFIA 1P7GA 2GV9A 4Q0VA 1QJU3 3PN1A 4Q0PA 3JQWA 2YPJA 4OI0A 4Z2AA 4P9PA 5I91A 4I55A 1W6NA 3AG4C 1JZ2A 4W6WA 4CDXA 1QXJA 5FZGA 1E5SA 4BA6A 5FZOA 1WMDA 2X10A 4CEYB 3WINE 1ND3C 4JRAA 5FCCA 2HLDG 3R05A 3BTYA 2WLIA 3CRQA 2B9UA 3RZGA 3ZOIA 5FL7G 1NE4A 3WNPA 1NZIA 5J2UB 2FCUA 1VE0A 3T0BA 4JI4O 1TA8A 1Z7S2 4D69A 1GN4A 3CRAA 5LBQA 1AI7A 1PPJH 4L11A 3N2GB 4PQQA 3ZMOA 1SA0A 4TXWA 5CISA 1LUWA 1RUI3 4Z1VA 4TQDA 4K8XA 4J7JA 1K3EA 5J9PC 4AR2A 1Q81W 4DRXA 3J7AU 1A6CA 2BEOA 3WCSA 3UM7A 1J3PA 3LDEA 3JBG3 2YBPA 1KBHA 3I4IA 3K9SA 4KWKA 2O14A 1THZA 4K0KB 4YVSA 4NRMA 1ND2B 5CA6A 2ZPXA 4DINB 1RHI3 1BEV2 1W0NA 3L71H 1M5IA 4D8MA 4XDKA 1L3JA 1O3RA 1Q8SA 4LUKA 4C8DA 4B7EA 1NKDA 1NXD1 3AG2B 2RMKB 1JHNA 3ME2A 1QNYA 3RI9A 5LHHA 2W46A 2J1EA 3BTXA 3ZXJA 1SCSA 5ERLA 3MDPA 4LR3A 1BJQA 4N43B 4Y5SA 5DUXA 3H3UA 2B8MA 1RUF1 3E8HA 2YROA 3VV1A 5F3CA 3AG1C 5HBAA 3RFRA 3BPZA 2WLQA 4JI5O 1AX1A 5FZ6A 1TME2 3SGIA 3C3TA 2DV9A 3ABZA 4A7YA 3F5WC 5A7SA 1YZBA 2HG5C 5FUNA 4WFFA 4MTFA 4CXWA 4LLFA 3TBDA 4MTXA 2WABA 2PGGA 1O5UA 3OFNG 5FYTA 4LWSB 1H2SB 1VBE3 3RPQA 1UOBA 4LKFA 3SEEA 3IB3A 5FYUA 2DF7A 2XL7A 4F4LA 2TBVA 3I2FA 4AVVA 3ABTA 2TEPA 4XACA 4YGBA 1J3QA 3POEA 3ZSLA 3LEGA 1KU9A 3LIGA 5A1FA 1SLLA 2QBXA 5A33B 4DRXB 3BKZA 2E7AA 1X7NA 1JZ7A 2JK5C 5JH7A 5A80A 1UY4A 1M93A 2P3JA 4LHKA 2IU3A 1YQ2A 5DAVA 4GB32 5JQGB 3TEWA 3P30A 3K03A 3L75H 5IK4A 4TUYA 1SHWB 2EIMB 4QDSA 4F6RA 3AYDA 5T52A 1GICA 2KSDA 2W39A 4XUPA 3CEWA 1PHMA 3LDRA 3BOWA 4YZ3A 2CYFA 2W87A 4F83A 4QB6A 4QKDA 1BEV1 4GAZA 3MIHA 4F3JA 3WP3A 3ZN6A 5GLWA 3IJ4A 3PVNA 1W3XA 1I7FA 5BV6A 2QFEA 1RTVA 2Y0IA 2JJ1G 2Q0OC 3OCPA 3OD4A 2RJ2A 5H9RA 1CZTA 2Y4TA 4Q6GA 1QKQA 1SLBA 1ZLZA 4I5SA 4E2LA 5F8PA 2OUHA 1MS3A 1K5MA 1I0HA 2W08A 1R1A3 4XDJA 3WG4A 5E79Z 1GP4A 4NIDA 3H1LH 4R6ZA 5DZEA 3D36A 3SPGA 2CL2A 3CX5F 4QGMA 3KF3A 4N43A 4JI3O 3FBYA 3LDDA 1VBD3 4GKKO 2GC3A 4WM8B 1F7YA 1QJZA 2YIBD 2IXKA 1D2SA 2KB1A 1Y7BA 5DG1A 1Y74A 1I94O 2W47A 1D5NA 2WINB 5LCWL 5FMBA 5D1IA 4MGZE 1O5LA 4CTEA 4O4JB 3BODA 3K9AA 3MICA 2XL9A 4LNVA 3IGAC 5EIYB 4LHNA 3O0WA 4XJZA 2Q73A 4XQDA 3K75B 1RVF2 3A2FA 1U5XA 2QZ2A 4Z07A 1BQZA 3ON7A 4RO2A 4JV5B 4JTAB 3M3OA 4TTGA 5CKQA 1Y43B 2YMZA 2UXBB 1VQ7V 1VQ6V 3UL2A 3A7QA 4J6GA 4IIJB 4UW4A 1W2TA 3N3HA 1RIRA 4HPKA 2YUAA 1FYJA 1MEC1 1LOFC 1OD5A 4KMQA 4GMP3 2F95B 2PI5A 1MACA 2DOSA 1QHTA 5B1NA 1K3IA 4LPLA 2D6OX 3GZTB 4JI7B 4FQ4A 1H0BA 1XB9A 1ZAUA 2A6YA 4XZUG 5DABA 3PU8A 5HV0A 4OPAA 4DR2O 1OUSA 1BCXA 2VU9A 3H1HH 5JI9A 4LF7O 4XE9A 1D2DA 3NNGA 1VALA 3UKTA 4X1IB 1K5MB 4XC9A 2WLKA 1QNWA 2I74A 1V6NA 3VKNA 1SQVH 2B39A 3AG4B 3B01A 2FB5A 5J98B 2GNMA 4MYEA 1Y3TA 5JXGA 5L9RA 1H8EG 1NXMA 1WMXA 4LA2A 3WF1A 4IGQA 3OGIB 1E5HA 5L19A 4K8ZA 3OPWA 5C3RA 1XU2A 2J1UA 3OMAB 4LHLA 5C3QA 5C8WA 2E26A 3WU2Z 2WN3A 5KAFZ 1SF9A 3BN6A 2BW8A 2EX3A 2VUJA 1NE6A 4DXWA 3RBZA 3SCHA 3JSLA 5DDJ3 3KV4A 1D4M2 4M01A 1PL4A 1KECA 4WFAV 2Z5UA 1HX6A 5BNNC 3SYQA 2Q1ZB 2B1GA 1RUI1 3J80N 1J3RA 1IG3A 3KHCA 1B35A 4FZ0A 1ULEA 1QWRA 1ZUQA 1SPPB 5JVVA 2QGNA 4I09A 4LIUA 3KSCA 3LPFA 3A8TA 3I55V 3MIBA 1AXYA 1ASJ2 5JOZA 2XHBA 2ZEWA 1VBB1 1W0PA 1AR91 4DV7O 5A32A 4RQPC 2JB4A 2P06A 5BR8O 5LWBA 2PAMA 3NV1A 1GN2A 1W8TA 3NV3A 4PBOA 4PDWC 4J1WA 1EUTA 4CS2A 2DQ3A 3JATA 2JDHA 4LE4A 2JIZG 1H2GA 3VZJA 1H2LA 4AEDA 4FPKA 4ATEA 4I3GA 2P90A 4D6SA 2YFUA 1FMD1 4XFAA 3GZEA 3RZHA 3IZOA 3JARB 3WQ0A 4MV2A 4FFIA 3CCLV 2X6CA 1S0JA 3MW3A 4JYAB 3FE5A 5KX5B 1SFYA 4FM2A 5LRSA 4JGYA 1RUE3 4Z82A 3ILFA 4KXRA 4WM8C 3SCFA 3V0BB 2C5DA 3N2KA 1JVMA 2R0HA 5IW0A 4GZRB 3PJSK 4E4EA 1BK0A 2AGSA 4BQ5A 1CAXA 3ALQA 3FN9A 4Q0QA 4QHBA 4KU7A 4BPZA 1NCQC 1VBE1 4XMIA 5CADA 5LGTA 4O4HB 4DR1B 3G7DA 1PZ7A 1LHNA 4FOYA 2BUKA 4YJ3B 3UKMA 1WD3A 5FXXA 4URAA 3M3EA 3LQCA 1R093 2TUNA 5SV8A 2R30A 2B45X 2DYSB 1QF3A 2RS53 1AL23 1X8MA 4MOAA 5IYDO 2EJRA 2BOCC 1GN3A 1K42A 2AACA 1BCCH 3LEMA 4DV4B 3HT2A 2WSSG 1VF6C 3IIIA 1A32A 4XJAA 3O14A 4LBMA 5KHHA 1XMOO 2VQTA 3MO4A 3R4UA 5E1RA 1AR61 2DBIA 4R4ZA 4NVPA 2WA3A 4UB8Z 5A32B 3G6EV 4COVA 1H1MA 1RUJ2 2IH1C 1IS6A 4TSVA 3J9SA 1ULCA 4DR2B 3ACHA 4D6TH 3KZIZ 3IFXA 4PI2A 1I9RA 3T2QA 5FBJA 3VHNA 4YW7A 1EN4A 2ENRA 1RUF3 1OHHG 3M8LA 1OCRB 1CX1A 3E6CC 4XF0A 4PA4A 2O0OA 1YVWA 5CIRA 1YQ5A 5ANQA 4R8CA 2E33A 4ZZ5A 2D44A 1HN0A 1VRBA 2W0XA 5FLJA 1R3JC 1PIV2 1V00A 3N9QA 3U1XA 2QA4V 2VUDA 1AYM2 1WA4A 2KXLA 2DMXA 1VBC2 2Q30A 3PTRB 2PF4E 1OVSA 5C3OA 4U2AA 2FDFA 3I5DA 1JBCA 4OHXA 4HVOA 3LGRA 2GP5A 2EZOA 1DYOA 1XOUA 3PJQA 4EYUA 3EXAA 2PHDA 2KQXA 1UZ0A 1NTKH 3KM5A 1N0NA 2RG4A 3MHSC 3RSJA 2CAVA 1HKDA 3HKEB 3JAKA 2IU0A 4A44A 2VTXJ 1QJU1 2YGLA 5L36A 4GA9A 2ZHMA 4LITA 2WNOA 4CDXB 4R9BA 4YY3B 4YG0A 4Y20A 2WC2A 5FO9B 3T2TA 3ELNA 5IVFA 3WNNA 1XILA 2DTYA 5J7MA 5C93A 4XQWA 1Y9MA 2QQPA 4AAPA 3UT5B 2ZA9A 4JX0A 2DCZA 3GBWA 2P4KA 4LF6B 1TAEA 4J9YB 1KQSU 4I2OA 5CA1B 2FDJA 4LCUC 4Q4X2 1G8WA 5JSOA 1YYNA 1AVBA 4KI5M 1GMMA 1NTZH 1SZXA 2YU2A 2QEXV 4IIJA 4OI4A 2ZGKA 4BU2A 2ZCEA 1RUH2 5EBWC 3E35A 1V6OA 3WDUA 3D6EA 2ZM6B 4RGKA 1UY3A 4DNYA 5I8YA 4NMIA 1AX2A 1SBEA 1HXS2 4CEYC 4HVQA 4ZIBA 4UF0B 4GIQA 5AFEA 4NTYA 2GALA 2LTNA 1E79G 1M06G 5F9TA 3ZHVA 4CP0A 5FLIA 1WW7A 2CK3G 4JYYA 3BRCA 3AMMA 1FXKC 3J8F3 2ODMA 1UQXA 4IV3B 1SESA 5EYXA 2IXCA 4LF9B 4ASLA 3T0DA 3FAVB 4LFCO 1PM4A 4IEWA 2YEVB 1WMEA 2ZXWC 3F95A 1XREA 1COV2 4WV8A 2MK3A 4K8RB 3JD3A 4NHKA 3NKGA 4LOTA 2O8QA 3ASNB 1U5ZA 4OHVA 3SPHA 2CTQA 1AR4A 3PUQA 2DVGA 2HWE1 4Q0UA 1FMD3 5IYBO 2UWAA 1OQ1A 1COV3 4FXKB 3RS6A 3K06A 1OF4A 5C4WA 4ZHNA 3M8AA 3UO3A 1CJPA 5GLUA 4TV9A 4IT5A 4IEYA 2XTAA 3CJIA 1GNZA 2A75A 4SBVA 5LEJA 2RHPA 4UBHA 4IGPA 5C8CC 3AJYA 1NVPD 1OBNA 4CP9B 1HXS3 1LGNA 3RWRD 3CF6E 1BMV1 1C5IA 1GM7A 3NNFA 5K1PA 1UMIA 4R9DA 4OPHA 4HETA 5BY1A 1HB1A 3E1F1 1BVP1 3CDZB 3JB8A 4TQFA 4WM7C 3U0ZA 2QQNA 4LULA 2AYHA 3PL0A 2JJ2G 3AMHA 2JECA 5I93A 5JPNB 5FZMA 1F15A 3OGSA 3I59B 5HXMA 3RYRA 1D0HA 3ZXDA 3AL5A 3IPVB 3MAQA 1BMFG 4BISA 4EWEA 2HFEC 2V1DA 3S3WA 1H38A 2P5OA 3GZUC 2BGCA 4IE6A 4ARXA 1DK1A 5DN6G 5K4LA 3POYA 1R092 1UD1A 3ZYPA 4P9GA 4FFKA 3B00A 2PLV1 1WW6A 3GJBA 4YZ5A 1JU4A 5F2SA 3NSTA 4LKSA 4CUBA 4XDOA 2DBNA 1OCCB 4LT5A 4UF0A 2ZGSA 4J7ZA 3NJXA 1ZBA3 3ZSEA 3MLKA 1GBGA 5FYMA 4MHUA 2PY5A 2VMIA 2BP6A 2LP7A 1GWMA 1QH7A 3DXRB 2K9ZA 4XDPA 2W1QA 4G4FA 4NN0A 2B4KA 1ZVFA 2DQ0A 2WT2A 2JD9A 4LK7A 1L8DA 4FOVA 4QPKA 2D7FA 4N7UA 2JDMA 5HFMA 1S5HC 3STZC 3HOBA 1JYWA 1YFUA 5AVAA 5G04L 3SC7X 5DQ0A 1QU0A 3DXTA 1JZ8A 1LEDA 3HNMA 3PVOA 4CP9A 3GZAA 3VQVA 2PI4A 5I0TA 5LRRA 4DS0A 5IYCO 1DF0A 4ICGA 2X8KA 2ZT9B 3VZLA 3CB2A 1M1KW 1AR63 5EYPB 2DVAA 3RYIA 3DC6A 1OCOB 2VBDA 5IE9A 2Q1MA 4MGQA 2LGQA 1GP5A 2C1FA 1HJFA 4XJ9A 1JA8A 2YPDA 3WDTA 1C8NA 1MR5A 4UI9L 4U7OA 1MZEA 1QQP1 4Z1MG 1KFUL 2ZX2A 1ZA4A 1IBKB 2EIDA 1YO8A 1S0VA 3H42B 2P3YA 1A34A 2IFWA 1S4CA 5A3TA 3BTZA 5EIBD 4JCKA 2WWWA 5A3UA 5GLVA 2A9HA 1JYTA 1WLCA 4QQLA 3WSOA 2F23A 1W6MA 3ENRA 4IEVA 1AHSA 5LMUB 1JOPA 1QHDA 2A73B 3Q8EA 3T4VA 4FLVA 1XMOB 5FPVA 4ZHQB 2PHFA 1Q56A 2EXKA 3ZN0A 1G9FA 4FLYA 2HJDA 5JIAA 2UXDB 5FV3A 4NUBA 1VBC1 3AP4A 3ITQA 4WVMA 4PIYA 1UOJA 2LM3A 3CL1A 1WUVA 3OEHG 2XJUA 4MGSA 1LKNA 5FK7A 4E27A 4H7LA 2RDNA 4J9ZB 2XJSA 4ZXEA 1XNRB 1NYWA 3U37A 4FPCA 2VQ0A 2DE0X 3UK9A 1JFFB 2EVXA 4E8DA 3IAQA 5FZLA 2D93A 3AG1B 5KHIA 1ZZ8A 2C4XA 4ZKTB 4XAAA 2WUHA 2Q5TA 4I3PA 1IVSA 3RGBA 4JRLA 1BT8A 1S0EA 1UWWA 5LA6A 4MSVA 2W1WA 5A1AA 1OFSA 2ZBJA 3TK1A 1QJEA 1DIWA 1KYOF 4HN0A 3W21A 1FXZA 5KAIZ 4OHYA 3GHNA 1KMIZ 5K9YA 1AR93 4NRQA 4BQYA 4GWIA 2HWC2 4ABMA 2VWKA 3KF5A 5LBCA 1S2BA 1CP9A 1N3PA 5FLHA 5IHRA 1JZ5A 1HNWB 2VD7A 2XJVA 1ND2C 4U36A 5JR7B 3VBUA 2YIDA 2BWCA 1WP8A 3HQRA 1ZBE2 3ZYFA 1RUC2 4LFCB 1N1SA 4BR6A 4HKOA 3M3CA 5FPLA 4JI8O 3HR0A 3IWZA 4BQ2A 2I45A 1IPSA 3SJAC 1FJGB 3AP5A 4YGDA 1KJLA 4IV1B 3OB8A 4OI1A 4WFEA 1UU5A 1XC6A 1W3VA 2JXAA 2GU9A 3GNEA 2B42B 4AEMA 2Y60A 1SBFA 1XE7A 2ETNA 1YFWA 1JPXA 3I3DA 2WZ8A 1FOD2 3NQHA 1V70A 4LF4O 4AGGA 1FAYA 3TN91 5BYNA 1UKGA 4KGGA 2EIKB 1F2NA 2D3RA 3RYPA 2DYRB 1CAVA 2V7QG 3HKDA 1X59A 4RR3B 4BK4A 2BVBA 2UXBO 2R043 5DG2A 2ZEZA 2MW2B 2VVDA 5LP6A 1NCQA 1UAIA 4PELA 1OV9A 4JZRA 4BMEA 4NHXA 4K1ZA 4EN6B 4HSLA 5FZ0A 4IGOA 4IETA 3O9OA 1DYKA 2AXTZ 1JOYA 4B3TO 3SPIA 3HBZA 1V9U3 1NH2B 4O4IB 3OR7C 4UFMA 2QQUA 5C4WB 1JYVA 5T5OA 2ZHLA 4NO4A 1CPNA 1RUD3 5B4NA 1ENSA 1GWLA 1PX4A 2QQVA 4HYOA 3GDBA 2YXLA 3TOJA 4WVZA 5LA6B 4B08A 3VKLA 4J7KA 2J1SA 1ZBE3 4W4KA 3RRDA 1M56C 4GCZA 4UB6Z 1V55C 4QU2A 1AJPA 3B09A 3WX5A 3OE7G 2AR6A 3TAYA 1QVFU 4MVRA 3ROUA 3E5QA 4YZ4A 3SH3A 2P3IA 5EBLC 5FPBA 4FAGA 2W95A 1NCRA 1W6QA 3C7EA 2NR5A 5BNPC 2ZS6B 2F4VB 2P6JA 5CAZA 2W68A 2R073 4DRVA 2X53S 4JGYB 2DJVA 1A8MA 1CONA 3J4UH 3AYCA 2JD4A 4MX3A 1YF2A 4DW0A 4YW2A 4AHWA 1IBMO 3KVBA 2VQAA 5FMCA 1JTZX 3POJA 5C9AC 2RM23 4BXSV 3F5TA 2GN3A 4A45A 1TQ5A 5FUPA 2IVIB 5LY1A 2HH9A 4LO6B 1FMD2 1RB8G 1T2XA 4JTOA 4X66O 3CO2A 4KQ7A 1O9HA 4LF7B 4U3JA 4XUNA 2JG9A 2VOWA 3LWCA 1MEC2 3JD2A 1OLRA 3S3XA 4FPEA 2D6LX 1Q6UA 1QJX1 5IWAO 1W9YA 5EV7A 3JD72 1IBKO 4AHCA 4RWUA 2YDEA 1QJX3 4QX3A 1F23A 4CH6A 2LROA 3MLLA 4ISQA 1UYPA 3KCYA 1D4M3 5IYZA 2JIGA 1VRH3 5EQUA 4EN7B 5JI7A 4K8FA 4OI2A 2PA7A 2UUBO 4ZS3A 4FLTA 2VQUA 4Y20B 3TETA 4I7ZB 5LYJA 3CJHB 5A2QN 5ACA1 2ORXA 1VEWA 2WIIB 5FMOS 1QDCA 4Y1ZA 2VNOA 4MVQA 1YFYA 1PD3A 4AVAA 1BBT2 5A3LA 2YB7A 3BOPA 1QLNA 1OXCA 1FKAO 1XJAA 4YW5A 2BERA 2PELA 5J96B 3DTUB 5AG2A 5T55A 4CU9A 2Z0AA 2ZX1A 3CCUV 2HWD2 1GKFA 1OSGA 1ZZ9A 1K45A 5A6YA 2RR12 3EB7A 1RMU3 4KFMA 2CH7A 3SKJE 2DWRA 1I08A 2SBAA 3M7AA 1J84A 5BR8B 1UF2C 1VPHA 5FKCA 1DTOA 2K1EA 2QE3A 3T2MA 1GUIA 1MS0A 4CEWB 2JE7A 4LXLA 2NNUA 1DGLA 2FBEA 5I0SA 1CEZA 1TMF1 2G9GA 1U5YA 2NLJC 4J80A 1CPYA 3GXUA 3ZMNA 2XHNA 5AVPA 3ICXA 3SITA 1O9GA 1OC1A 5C6CA 1RUG2 1Y4WA 4CDQB 4JGZB 4DIQA 3I56V 2QCSB 2YU1A 2DCTA 1KGYA 3OD0A 4IL7A 3H1KH 3O12A 3ZMVA 2A6XA 2ZKNA 2W2IA 3VKMA 2VAUA 4QQHA 1DBNA 5B3SC 1HNWO 1RC6A 1V54C 3SJQC 4E4SA 2ZNIA 2HWF1 3VL9A 4TV9B 2X5IC 1RITA 1HW7A 5DECA 4H7MA 1BHBA 4U7NA 4HKWA 2YXYA 5IJ9A 5KUKA 3LDCA 5BNPB 1SG3A 3HKCA 5BUVA 3URFA 5CYYA 1F31A 2B46X 2PQSA 5JQGA 3SEPA 3TEYA 4B3MO 1BSMA 4L0PA 1KUQA 1NAEA 2WLMA 3WF0A 2Y6GA 1FNZA 1VQPV 3AK0A 2OPKA 4JHZA 4Q4W2 1J58A 1VAKA 2BCCH 2VNVA 4XFHA 3CJXA 1FV2A 4Q4X3 4P9IA 3A0RA 3ZS8C 1H8TB 2N7GA 4GQ7A 2PLV3 3JAWB 3KQ4B 5B1AB 4JI4B 4QXCA 1VAMA 3V0AA 1SFPA 2AW9A 2OCCB 5CFCB 1GTOA 1XNKA 5LBEA 4UYBA 5B1OA 2IJJA 4M0HA 3HQUA 2BTOA 3LB9A 4IE7A 1OH3A 3IT8A 1ZRCA 4W4LA 1GYKA 3WF3A 3GCWA 4QPJA 1ZL8B 2CHHA 2H8PC 5EBMC 4PA6A 4A3XA 1W6PA 1H1IA 3AVSA 1OQEA 2WRAA 5LXTA 1RUNA 4LEJA 2WLJA 3H1IH 4XXAA 1NY72 5FLXN 3WW4A 1KC8W 1MVQA 4UFKA 4QU1A 2XPJA 1CAUB 1JJ2U 3NRUA 5KWRA 3W20A 3O1MA 1STMA 1QR9A 3N9PA 4ZKIA 5LL6Y 1MPXA 4D7TA 2Z42A 2B5UA 1YQ8A 3FLPA 5BPXA 4OZOA 3V56A 5IFTA 3KGZA 4ASKA 5L3FA 5C5TA 3ZMZA 4A7KA 4YVWB 3U78A 4YM1A 2XAFA 5AFBA 3SMHA 4RD7A 3E8FA 2XHKA 3DECA 3DYMA 1NZCA 4BLIA 2MNGA 4N90A 2D6MA 4B3SB 3CS5A 3UCSC 3Q4HB 2CY6A 5FYSA 3WB0A 1POQA 1APNA 3ZIWA 1N4CA 4XUTA 1O4YA 2F1MA 1W9WA 5E8AA 1VBC3 3WDXA 1HV0A 3OF1A 3ZMUA 4FPFA 5GZEA 2WNVA 1PNMA 3ASIA 4YY3O 4DMIA 1FXKA 4NIIA 5I8TA 3W7UA 1V6IA 4IEZA 4DY3A 4OUEA 1UXXX 5LEKA 4JYAO 4CCNA 3T2PA 3WP5A 2VMHA 4M3CA 4GULA 3O1SA 2GNTA 2D6KA 3UYJA 2DWDC 5LGNA 1H8TC 4M3CE 1MS9A 1D7PM 4ZZ8A 2JGDA 1UZWA 1VARA 4Z8BA 5C70A 3HWJA 1NCRB 1HRV2 2LO1A 3T1YB 4D6RA 3AP6A 2WFF1 1H8TA 1LJ7A 4D0QA 2XH6A 3QH7A 4U3FH 3I7DA 4FPYA 3BUCA 4QX5A 2E74B 3L9JT 4LBQD 2G1MA 4XF1A 5J2TA 1SLIA 4L92A 1ORQC 2ZCWA 3GWKC 1AJKA 4XURA 4PHZA 4ZU7A 3N9NA 2CV6A 4QX0A 2Z2SB 4Q4X1 3AB0A 4Q8LA 4C1XA 1MG1A 4UAPA 3BVOA 2Q9LA 3H7YA 4TUYB 2X5IB 4HK9A 3ETPA 5CFDA 2CTWA 4UCSA 1POV1 3LCPA 5FPUA 3B9CA 4DR5O 2Q1FA 2IJHA 4NPMA 1WNSA 1QMJA 3JD4A 1P49A 5FYHA 1EPWA 2E9QA 2BOIA 4FOWA 1JH5A 1RUD2 1UKRA 1UJWB 2VNGA 2XR4A 3FZ3A 2GUZB 2ZXQA 2KR2A 5FY8A 4JKKA 1YJNV 1WD4A 5FO7B 3VKFC 1TG7A 4X64O 1UCXA 4QXHA 4KU8A 4XCBA 4DFSA 2RMU3 1EY2A 2VMFA 3H8RA 2XB6C 2L6LA 1BZKA 3WT3A 2C6SA 4P9XA 4FVMA 4GUNA 4LJHA 2HHHO 3E22B 4L87A 2VZQA 3PU3A 2P6CA 3HNYM 2Y38A 1UZZA 3V64A 1CAWB 4XVHA 4IXLA 1BXHA 3OOXA 1QR8A 3DYOA 4L8JA 3B3QE 3KB5A 3WNXA 3ZHRA 3SISA 2FCVA 1S0DA 5BZBA 4P9OA 4HSJA 4IEXA 1I5YA 5JOXA 4NTWA 2ZMNA 3ZXAC 1QOTA 1ND3A 1CESA 4HT1T 3BIWE 4JQRA 1H9WA 1H9PA 3OUIA 5KX5A 4BWOA 2XWBB 2WSUA 2HWF3 4MW3A 4X1YB 4ITCA 4B3NA 4XW3A 5JJJB 1AP6A 3A22A 3W59A 3JUUA 1XNDA 1U96A 3MI8A 5KHGA 1DG6A 4MVTA 3IMNA 4QKFA 4O61A 3VUOA 2YGMA 5KXEA 2E53A 3OEAA 2X5IA 2CE4A 1E57A 5LBBA 1W2BU 3BGAA 3JXSA 1W8FA 2LW8A 3SJCC 2G9ZA 4TWKA 2BBVA 4U3JB 4KBZA 1WB7A 3IDAA 1SEFA 4O4HA 5CA0A 4B3TB 4RFT0 2GMMA 4DO2A 4LMFA 4UXNA 5C7GA 2NPIA 4PIXA 4RHV1 4ORFA 1X4TA 1ZSPA 1YWKA 1KP3A 1H1AA 4KL1A 4CCOA 2FL4A 1UYZA 3J7NA 2QQLA 4K1YA 1NLRA 1ZM1A 1URXA 4WZFA 4NXNO 4J1XA 2ZR2A 5LA1A 5D5QA 4X1IA 1I5XA 3N9OA 5DZFA 3CBNA 5KUMA 1WPXA 4BK5A 2GBOA 2VE1A 5FZIA 1QCEA 3OGGA 5J48A 4DEVA 4O2BB 1BGYH 3EJKA 2GUZA 5JLVA 4JGSA 2HWF2 3JYCA 1RFYA 3SXWA 3OBAA 2QE7G 3ZO0B 4X89A 1FD9A 5CB4A 1DYPA 4PDVA 4MVZA 4AHYA 1POV0 2CTVA 4CZZA 2CU5A 1UPIA 4CPBD 3ES4A 4FXGB 3SNMA 4QD2A 3IKWA 1IHMA 1Q5OA 3WDWA 2GN7A 3BA8A 4RHV2 2JDUA 3NJVA 2WYFA 2HP8A 3WNKA 5D8AA 4QDRA 5AC92 4JGYC 3GGLA 2A6ZA 5FOJB 1W0OA 1B04A 3CYOA 4YRDA 3SH4A 4EFEA 3G6JB 3E6BA 2YSUB 2ADEA 1XNRO 2GDSA 4DV7B 4FTBA 5L3EA 2EAAA 3E97A 1SQ4A 3ILRA 4XBFA 2BBAA 1Z2GA 2UU9O 5A3MA 4TT3G 2KM2A 1NA1C 3C90A 1CR7A 4Y22A 4PDLA 2VH9A 3PIGA 1VBE2 2CTPA 5T5LA 3DKWA 3JATB 5EJ3A 5KHJA 2W3JA 3O65A 1GKBA 5IAXA 2Q7GA 4UCUA 2PYLA 4CDQA 4MVUA 1N1YA 2BV4A 1PGL2 1UPSA 3W7WA 1V0AA 4HZ3A 4MGKE 4EB6A 1X9PA 4CC5A 2XOKG 2BTQB 1W8ZA 4UFZA 5F6LB 3VD7A 1H6XA 5LMNB 2E31A 4UCVA 2DWEC 4NWVA 2BNMA 5BNOC 4UFJA 1R3IC 1PK6A 1IXMA 2H0VA 4NHYA 5EPAA 1PVXA 5IYYA 5B66Z 5JWPA 3O7OA 4A7ZA 1PKXA 3GBGA 3DEMA 1W0JG 3U4SA 1LU1A 1UPGA 1O3QA 3UJQA 3POIA 2B9ZA 5LYJB 3I2HA 3CRRA 3OGCC 1J5EO 3ACIA 1DGSA 3MV11 4DB5A 3TNPB 1TE1B 1OA3A 4LFAB 2WNVB 2HJFC 1EZJA 1BVVA 5KC5A 1VBA1 3RZJA 4MVSA 1LRHA 1FV3A 4P02B 2GDFA 1QIQA 2RCVA 3N36A 3VBHA 3OGJA 2J7MA 1PO21 3ABUA 4PT6A 3CIHA 4CH5A 3AX4A 2PLV2 1C28A 4YHHO 5HCFA 3LFIA 3MYXA 3ZFEA 4CDXC 2LFRA 2VZPA 5H9PA 1G9AA 3VHOA 2ZE7A 2EBOA 4NIHA 4FLZA 1OA2A 4YSFA 5LMNO 2HYXA 5HFLA 1T6BX 3Q9OA 3PMEA 4AQTA 4Q4V2 4ONUA 2WQ4A 2DURA 2AHZA 2GAUA 1DGRA 3M3QA 3JCIA 3SJBC 1WP7A 1T5EA 1V54B 1YHFA 4XJUA 3OR6C 2QNKA 5E89A 2FYUH 2VJXA 3HQXA 1QJY3 1QY4A 2G9FA 4META 3B40A 2P4EA 3I3BA 2VVEA 5DUUA 4LBLA 1XL4A 4I4TB 1V6JA 1VBA2 2E5LB 3P6BA 3QBQA 3CEIA 1PO11 1AI4A 2R1DA 5BNOA 5ACA3 3VQXA 2RS51 1N32B 3GB7C 5IYZB 1DFQA 2OIGA 1SZTA 1QDOA 3AM2A 1HNXO 5JDBA 4HFSA 4TZDA 4PA3A 1ENXA 3FWEA 1DQ2A 3K79A 5JAXA 2F4VO 5JXIA 2BWAA 1OCRC 3ZYBA 4RAIA 1K9MW 3EMRA 5DUWA 5FP3A 3RYKA 1UNBA 3K2OA 4A4AA 3OSDA 3I59A 1N8RW 3ZYIB 1BKZA 4XXPA 4BWAA 1IQDC 3AG3B 2FQPA 2ADQB 2VMEA 2Q6AA 4LH7A 5T3NA 1PO12 5JIUA 1REEA 3K0DA 4C0BA 1ZRFA 3CD6V 1DGWA 1AYN2 1LHOA 5A6XA 1WLTA 4JKLA 4GX5A 3KGLA 1YTFB 3VBUC 4LBEC 2LGWA 3ZHTA 1D4M1 1C4RA 3B77A 1W03A 4YIPA 1O3SA 3OM3B 3MIEA 1M9NA 3S7IA 3K3WA 4QNHB 1DGRN 4YIOA 5A6ZA 5KXBA 1YCIA 4CDUC 4OUMA 4JV4A 5K7PA 1X9TA 3LA7A 4DR6O 2WLNA 4RS5B 2ZQMA 3AK2A 4DY5A 1S2EA 3ZVXA 3G71V 2J1AA 1JR9A 1GWKA 2WZEA 3D3IA 1FYUA 1RL3A 4X1KB 1OCOC 4QB2A 4MLOA 4X62O 1KDKA 3N9LA 1PO13 2OXBA 2QQMA 1R3LC 5DDJ2 4UFLA 5FFOC 1GR3A 2W1UA 4RUEA 3WXPA 1QQP3 2OIEA 3O1UA 2PFWA 4XAEA 4BDVB 4IDZA 1PX3A 4JTDB 4LE3A 4I0AA 3ACGA 4KWUA 2XUMA 1HN1A 2BU9A 2V4VA 5K0UA 1C3HA 1COWG 1SCRA 4FAHA 2RN9A 2V5YA 1IQAA 1CJDA 5FPOA 4A6SA 1S3JA 5B5EZ 2RVAA 3MFCA 1N36B 1ZZCA 5FBZA 1RUE2 4XF9A 4JZGA 5FZKA 4YG6A 2HLEA 3NW4A 4ZPIA 2WT1A 3NAPC 1UY2A 3SPJA 2WLLB 1FX5A 4QQPA 2WZR3 1XOYA 2Y4UA 4V2VA 1LOFA 3FB6C 3AG7A 3USUB 1KKCA 2ET1A 2Z5WA 1HJGA 1VBA3 2VZUA 4D3WA 4LBNA 2YV8A 4JTNA 2VTXA 4B3RO 4DYLA 3T09A 1XNCA 4DO0A 2KKWA 3T1HB 3O1RA 1RP3B 2CUGA 4WBBA 2N05A 2VR4A 4YM0A 1BQPA 2N04A 1G6NA 1BZWA 2ZEXA 4BE3A 1HNZO 3WB1A 4NKGB 5FYZA 3DGTA 1CIYA 3OUSA 5F5IA 4GLXA 4CRQA 3VBSA 1RJ7A 2CAUA 1V55B 2P3KA 1YJWV 5A1LA 1M56B 1KITA 1N33B 4GMP0 3B02A 1GAXA 4RGGA 2GNBA 1WA6X 3D3AA 1SQFA 1OFNA 1OKQA 2ZKOA 4GMP1 1W2AX 3APBA 1Y9GA 3VD4A 1XYPA 4HBNA 1MS1A 3UESA 2Y6FA 2DCKA 3WP6A 4IQPA 1C8M1 2XDVA 3BAAA 1SDWA 4AI2A 1ROPA 4WF9V 4P30A 1Z7S1 3N7MA 2RS33 4DRRA 4ZY9A 4BYYA 2JG8A 2R16A 2G4IA 4OQ9A 1N36O 2VRZA 1DZRA 1JHJA 1SLAA 3D36C 2R062 1ZX3A 2WT0A 4M3CF 2F43G 2A6WA 4DEQA 1K5MC 1AVMA 3T1HO 4NTXA 1DQ0A 1ULGA 1MZ6A 3ASNC 5ABJC 4XIOA 2ADPA 2PHWA 1DQ5A 3ZX7A 4ZXKA 4AXOA 1Q43A 2ZE6A 3FFZA 4LNUA 1R1ZA 2ZXWB 2VY0A 3I8TA 2NMOA 2EICA 2XNDG 5FPAA 3CCEV 5EWSA 1AXZA 4QMAA 4QE9A 4IV3C 2UWCA 1FPN1 1FXKB 1OLQA 4AFMA 3EBRA 3HKEA 3JAKB 2M6YA 5FIXA 4WCEV 4LBQB 1IGOA 2ARXA 2XLGA 3LAGA 2RS52 2P7TC 3THCA 4G2KA 4CP2A 4I0XA 2C9AA 1O3TA 4RA0A 1NLQA 2Y0PA 5GW7A 2PYTA 3S6PA 2E3CA 1W99A 2C24A 1FXVA 2WKKA 4B3MB 2R49A 2VCBA 2K46A 2JDIG 4NAMA 2EINC 1RUJ1 1ZZ7A 4K20A 2IW5A 1S0GA 2Y6JA 1N32O 1JMUB 2HWE2 3B7MA 3WR0A 4YVSB 2IXIA 4JTCB 2FDIA 1US3A 3S5AA 4CCJA 1H2MA 5C33A 2CGOA 3MW4A 3HKDB 1Y9QA 1QJFA 2YS8A 2RR11 4XFFA 4B3SO 1KXGA 4EB6B 4RHV3 3VD5A 3I3MA 1GQHA 3P1IA 1PMHX 2VMCA 4YWAA 2V72A 4XETA 1TVGA 4QAWA 1YIJV 4ZI7B 1UMHA 1PV0A 2PHRA 3WF4A 3HR9A 4YHHB 1JUIA 4HZFA 1VIBA 4Z2WA 4UVBA 5LK5A 3TWIA 5J37A 1W8UA 5EP9A 5B3SB 3RYHB 1UIKA 2EULA 2QDRA 4NRPA 3T1LA 3U75A 3I97A 1LCLA 2NLRA 2VC9A 4UXAA 2XJRA 1HNXB 1L7QA 4CDQC 1AJQA 2BZDA 5A3NA 1WWYA 2RS13 2BNOA 2D6PA 4HXCA 3E5XA 2CWSA 1RMU2 2WNEA 3ABLB 2ZACA 3O1VA 4L9BA 4MZUA 4IYHA 2R042 3HT1A 2QKSA 3FB5C 2ZKLA 4AI0A 3FBMA 4HNAA 3FUOA 1FFXB 2QWNB 2VBBA 5FWJA 2JG8C 2YBKA 3VBRB 4UFHA 1W90A 3C3VA 1O8SA 3AXDA 2F66C 1VLNA 3WP4A 4LF8O 3BCWA 4L8QA 4AFDA 2RDCA 1BE3H 3POSA 2UWBA 2JEUA 5L7OA 3KT4A 2QQIA 3M1HA 4I02A 3CSXA 2WJSA 2JDNA 5FNVA 4QPIA 3MUZ1 5D8AC 3VZMA 4XIKA 1ENQA 2BQPA 3MGUA 3RQ0A 1OLME 2ZEYA 2VZSA 3THPA 3OG2A 4AILC 5JXHA 4CUCA 3CWBH 2HEVF 5C3SA 2DW4A 5CA0B 5JSPA 1H30A 2ZX0A 4I4TA 4M0NA 3VD9A 1BQ0A 1XUQA 1OLMA 3M4FA 2ARAA 1Y6XA 1HR0O 1NBMG 2HWB3 5IVBA 3NVCA 1PIV1 2WA4A 5JVDA 3C3SA 1O7FA 2DU0A 1W59A 4J10A 1ASJ3 3OY8A 1JYNA 3ZHQA 3AJZA 3M2MA 2QKCA 3SYOA 3U10A 2PYJA 5EHDA 1HXS1 3AG2C 4DV0O 1F4HA 4AFBA 2I2SA 1XHZA 5A3WA 4RGAA 3D4KA 3WZ1A 3OTOO 4GB31 2G19A 2A3QA 5FZOB 4BH9A 1AB3A 1COV1 5DMYA 2EIBA 4HNAB 1GNHA 5J2UA 3PNAA 3J7MA 1W39A 1QQP2 1K33A 5FZ8A 2R9IA 2ERFA 3W9AA 3I54A 5GLTA 1W0KG 3IBMA 4QM8A 4DZGA 3J26N 4TWTA 3ZSMA 4E9KA 3OMNB 1CPMA 3ZBHA 4R50A 5BMVB 2VOKA 4CSWA 4NYKA 1AYM1 4YLZA 3J8F1 3WG7C 1Q8IA 1C5HA 2ZMLA 5B2GB 4PV1B 3VZOA 4DW1A 2FDGA 1PGL1 2OT5A 1FT9A 1SS3A 3VBHB 1BBT1 5FYIA 2RDQA 4PDWB 3G67A 4Y22B 5H9QA 2W6JG 3B93A 3C7OA 2R6QA 1IZ3A 5IWAB 4P5HA 3KKYA 4QX1A 3BY6A 3ZHSA 4NJ4A 1R73A 3N7LA 4CCLA 2O1QA 5FP9A 1WW5A 1HP8A 1WCKA 4EQVA 4RQPB 4OUSA 1Q8PA 4UCOA 2KG7A 5IVYA 3JZVA 1ACCA 5ITZA 4P9YA 1OH4A 4P9LA 3NV4A 2UXNA 5B1BB 1HNZB 4MXVA 3POFA 4HONA 1BL8A 1DCSA 4XQ4A 4PLMA 5BNNB 3H01A 3G4SV 2EIGA 1VBB3 2W9XA 1IPKA 1Z5WA 3L73H 1HB2A 3V0BA 4HL0A 3K0GA 4W8JA 1RSOA 2WO3A 4PDMA 1ZREA 3ABKB 5FMOL 2GC0A 3ZXGA 1FOD3 5JJEB 1J5EB 2ZOEB 4A5UB 1TUBB 2D43A 4TLFA 5CMUA 4FTSA 4MADA 1XEQA 5FP8A 2Z69A 3IIAA 3QLQA 1QOSA 3IM0A 2BFUL 4F8AA 3FFQA 3CHXA 3ORJA 4H44B 3JD71 3VBSC 1AF9A 3QOPA 3C7HA 1P8JA 3TGUH 5FPRA 3OPZA 3CC2V 4ZONA 2JE8A 3B5LB 4EN0A 3ILNA 4GT1A 5E6HA 3GWOA 3L74H 4LWSA 4CDWC 3LNMB 1QLEC 4P9JA 1XU1A 4XF3A 4KG8A 1EAH1 4COUA 2ATKC 1VF6A 5FYBA 4H55A 3MBWA 3H1MA 1C8M3 3O1PA 1IKQA 3LZZA 4CYDA 4I0XB 1TMF2 2H6CA 4OX9B 4F6RB 3BB6A 2J1VA 3WDVA 3IN9A 4XCAA 5LA0A 3KCCA 5L9BA 3A0HZ 1HQNA 4CU6A 2F4LA 4O4LA 4LIVA 2DVBA 1E5IA 4BB3A 3NR7A 1RXFA 4UV9A 1AL0G 4JF3A 2Y64A 1G9BA 4QX8A 4XF4A 5AC93 5LY2A 3T4DA 3VZKA 3ZIXA 2QWQB 3LSDA 1LHWA 3BI3A 1HB4A 2CDPA 1M4WA 3LSEA 5ITZB 5CU1A 4XDLA 4NXMB 2QQWA 3ZKYA 4UCTA 3MDSA 5H6QA 1L1FA 3ABMB 1CAXB 1C1FA 1YIPA 2YEVA 2OZ6A 1PMJX 4GX0A 4OZXA 5F39A 3F7YC 4O2BA 1BHGA 3ETQA 1ZTEA 4Q4Y3 2VXRA 3IC9A 1JZ3A 4UW3A 2AC1A 2XBO3 5FXWA 3EHBB 4D94A 2RS11 5LP6C 1GOGA 4JDNA 2JEXA 3WG2A 1KD1W 4G28B 5A7QA 4AOCA 4KHPO 2Q8OA 2GC1A 2WZR1 4DUWA 1L7RA 2WWUA 5CG9A 1MS5A 2WL1A 3DXRA 1LOCA 3K5NA 5H6RA 4DR7B 2ILMA 1RUH3 3C8XA 4BZ4A 5GTHZ 2VW2A 4O2AA 1NR7A 1PL0A 5IAVA 1S72V 3DN7A 3ZMTA 5J36A 2ZIOA 1Y74B 2AZ2A 5EZWA 3MW2A 1KRIA 1FFTB 1US2A 3UGHA 1SA0B 2R9AA 4O4IA 1LTEA 2Q8DA 4GH4A 1KB9F 5GZFA 4H33A 1SBDA 1EV12 4EN9B 4GX1A 3QO5A 4LUMA 1C57A 1HQLA 3AZXA 3VBRC 4Y5TA 3I2JA 3ZRSA 1R091 3KMHA 4P14A 2YI9A 3WW1A 2YG0A 4F7ZA 4PA9A 3SDLA 1ZA7A 4CE8A 2XWJB 4QPIC 1HRV3 2A70A 4K3AA 3ZYGA 2YYOA 3DSQA 2A5ZA 3AKPA 2Q69A 5LW9A 1BEV3 4Q4W3 2WNUB 1Y76A 1W28A 1AI5A 3MPPG 3ABLC 3PUSA 1ZRRA 1R6KA 2WR9A 5FPXA 1Q7YW 2QVSB 2FCTA 2DDUA 3O5SA 3WNMA 1ZWIC 4LH6A 4RQFA 1VQKV 4IEQA 2OTLV 3AP7A 1W2NA 2IC1A 1PVC2 4TOIA 1W8WA 3VZNA 3T2OA 4B7KA 3ZCCA 2WZR2 1TVKB 3NNLA 4NOTA 2WAOA 4MUVA 1GZCA 2NYYA 4PDRA 3RN4A 3PUHA 3EVKA 5D2AA 3NAPA 1R3KC 3OBRA 1FPN3 2VECA 5A3OA 1I5ZA 2UXDO 1YITV 4NR1A 3I2IA 2HKOA 4TV8B 2CAZC 2ITDC 3RG0A 1HQWA 3J7LA 1EP0A 4AEDC 1X8EA 1F5JA 2ID4A 3SYCA 1VF7A 5FREA 5A7WA 2YY1A 1YJ9V 3C7GA 1Q8QA 3IDBB 1HRV1 4XBNA 4YVSC 1X33A 4YNIA 2AEZA 2YBSA 1IS4A 2EINB 2HWC3 3AZVA 2PUSA 2BSKA 5I8SA 3TJTA 5KXDA 4IW3A 1VR3A 3UT5A 3RYIB 4CH4A 5BXZA 2X7RB 3QO7A 3S0MA 5EJ1B 2LFSA 2JJ6A 2ZZJA 1U97A 4JV5O 3EYPA 3UJOA 1B35B 2RS31 3ZFFB 3TEZA 2VNRA 1GLHA 3BVCA 3F2ZA 5T54A 4XUQA 4CDUA 1HRI1 5I0RA 1PM9A 4MW8A 4COYA 2A6VA 2OX0A 3SKVA 1MSDA 5CN0A 2ZE8A 2LS6A 1VF5B 4GWNA 5FZHA 4DK0A 2UY9A 5L9VA 2XJPA 1RUH1 1M90W 2Q0AA 1UY1A 5I0DA 1GOFA 4ZU5A 3A23A 3LOIA 3KV6A 4K21A 2VCCA 3QD6A 3QF7A 4NHLA 1DP0A 4Y3OA 2ZZQA 4JDMA 1RUOA 1MEC3 2UU8A 3HB3B 3EXUA 2P4VA 1V9PA 2Q4PA 5DAXA 2JVDA 5EIBC 1D5AA 2P22C 2UY8A 4AVBA 1YI2V 1S5LZ 4C0HA 4NB5A 2P67A 5C8YA 4EEQA 3H1JH 3IC7A 2JEMA 4MGIE 1G6UA 3RWNA 3RJRA 4N8MA 5C8CB 1OF3A 1QOOA 4M4RA 3AZYA 1DLCA 3ETGA 3BIEA 1W05A 1S5JA 3J8F2 4H14A 5JCOC 3K3OA 3N9MA 1V9U2 2QZ3A 4HLTA 2Y69B 4QPYA 1PZ8A 1GRJA 4CXYA 5DEDA 4Z92B 5FY0A 4X6QB 4FZ1A 2EXHA 2K0GA 1NQJA 2M7WA 1QJY2 3DYPA 2DN9A 3Q8AA 4TN7A 2D3SA 5FY7A 2Q8CA 3WQBA 4NHMA 5JJNB 1XSRA 1HRI3 2VCAA 1GFF2 3BA9A 3GF6A 4YJ3A 1JOJA 2Q67A 3VKOA 1IBMB 3AZWA 4QXBA 4WFGA 3P3PA 4X64B 4B1LA 1IBLO 4NIAA 4ES9A 3WHUA 1LODA 1NQDA 3E89A 2HWC1 2HR3A 1F9KA 4PDWA 1G86A 5HXVA 2BRTA 3INAA 2HVKC 5F3EA 1MZFA 5KMGA 2VQEB 3J7HA 2ZAHA 2ZGMA 1JYCA 3VBHC 2FD8A 1SQGA 5GKAC 5LATA 3EQEA 1ULFA 4ZBMA 3I3EA 3WG7B 1K5SA 4IV1A 5EK0A 2Q68A 1H8HG 2J1RA 5H2FZ 1O8PA 4BIUA 2QQJA 2RDSA 1R1A1 3SR2C 3ZPOA 4WFBV 2UUBB 4ZOLA 4E4DX 2EXJA 1IG0A 5BNNA 1DDLA 4P9WA 5C8CA 1NH2D 5CBHA 3WQ1A 1O59A 3VBOC 2P2KA 4XHBA 3B2EE 4N7IA 4PD4F 1NX9A 2AH2A 1PNKA 3HKBB 4YGEA 3M3IA 2UXCO 2HWD1 2JS3A 1SLTA 4CCEA 1IOAA 3D0JA 2F93B 1JYXA 3ZN4A 1ZRDA 4B4RA 5J1XA 2FMDA 4Y24A 1HWYA 5K1XA 2ZX3A 2VO5A 4GZ9A 5JUVA 4DV3O 3ZRVA 2IH3C 4YGCA 5L3DA 5JOYA 1E5RA 1LEMA 3ZKUA 5LXTB 2RQ6A 4LKEA 3TEXA 3U11A 3T08A 3V65A 1FPOA 2NM1A 1V6KA 1NT2B 2RS32 3B9IA 1LOAA 2Q8VA 1N3OA 1VMFA 4FCAA 1ODMA 3WNLA 5B4XA 3JASA 4Y1VA 1AYM3 5FO8B 1DF5A 4AQ6A 2XAJA 3FUQA 3GHMA 2J1TA 4P00B 1TNFA 1QJY1 5C9AA 3VN4A 3CCVV 4YARA 5GLZA 4GWMA 3WLUA 4QPIB 1N0JA 4JAVA 3MPBA 4PLNA 3I3QA 3ZXFA 4QGPA 2ZGLA 4OFGA 3WVJA 3ML0A 2VMDA 4Y4YA 3T1MA 1JOBA 2L35A 1FJGO 1LHUA 3U14A 4GB33 3JARA 4XFBA 3JALA 1EV13 2OUJA 3GVMA 3ZRWB 2Z4FA 4QGNA 1E1RG 3T1YO 4K0KO 2YUEA 1IS3A 1Y76B 4E4ZA 3OT7A 5C3PA 5FR3A 1EM1A 2XBO1 3JBG1 2JG8B 1DQ6A 4RQPA 1R081 3CJIC 2F6BA 4Y1XA 4BAYA 4X8AA 5IVJA 2NP0A 1XRUA 4CA9A 4FFFA 2HWB1 4LLOA 2XUEA 3PMSA 3WNOA 2FDKA 2XBO2 2WS92 4DV2B 1TUEB 3ZSJA 3D82A 4XTPA 1EPZA 1VQ5V 3VHRA 1RGSA 4JYBA 1F8VA 5FRAA 1AROP 5EZYA 2QKDA 1X36A 1RHI1 2OW4A 2PAEA 4XYXA 4P5YA 3AC0A 3JD73 4N53A 4EZHA 1MS8A 1R083 3K5MA 1GK9A 2MEV3 2HEPA 3P32A 1B3QA 2KA3A 5E16A 4FK5C 3K4AA 5CNAA 4LBQA 3ZR5A 4MGTA 3Q8BA 4XDQA 2VBPA 4L99A 4AF9A 2DUPA 3AMNA 5L7OC 3KG2A 2QR4A 2IWGB 4PJYA 1HDJA 2VQFO 3OW2U 1MSWD 1WAZA 4INDA 2Y6HA 1U5IA 2QSAA 3TN92 3USSA 4MT8A 4I9WA 3ZRXA 4DOUA 4FPPA 1K73W 4BM8A 3ZFFA 4AZZA 1UXZA 5F6KA 2VM9A 4RS5A 2ZX4A 1AL21 3IPVA 4IERA 1AR62 2ZM6O 4K7JA 4QE7A 1NA1A 3ZN5A 2IVJA 1DLLA 4TYSA 1LGCA 5DPNA 1P84F 4XOGA 2RR13 1FXHA 3EFFK 4LO4B 1NS1A 4YXWG 2E76B 4DV2O 4DV0B 2A3WA 5DUVA 1YC61 5L3GA 1YIFA 1WLDA 3ZN6B 2WFF3 4DK1A 1XSQA 5IT9N 2A3YA 1YI7A 2WWSA 2VUAA 1VQ4V 1ND3B 3K4DA 3JALB 1AR72 2QQKA 3ZFGA 2AZ0A 5GM0A 1ND2A 2G38A 1WCUA 4WVVA 1CQ9A 1Q82W 2QDNA 1BBT3 4IGGA 5LHGA 2PHTA 4AVCA 1TME1 4FQZA 2LUWA 4X6RB 1DQ1A 3PLQA 3ZYJB 4OMDA 2HVJC 2WYSA 3ASOB 1WJZA 1GM9A 4JI0O 3T1CA 4AVTA 4AEJA 1VQ9V 1UO9A 2SLIA 3R6SA 1UW8A 1LOGA 4JGZA 5CB7A 2AENA 3O0XA 3B8MA 4GKJO 2CDYA 3CE2A 4GKKB 2BDRA 4YW1A 2ZMKA 4YFWA 1D2QA 4IEUA 4CCMA 3RDIA 3UO2A 2E75B 1S55A 3BTAA 3TXSA 2ZGPA 5FP7A 3S5QA 5F37A 1OOPB 1W8NA 3GM8A 4WBNB 3VDDB 4CVUA 1UX6A 2QM7A 3FB7C 2BSKB 3JCUZ 2D3PA 1SQBH 3LSQA 4LF5O 2IJKA 3VL8A 3W7XA 5EYPA 4E8CA 5FY1A 5IWFA 2GZWA 3ACFA 4CUAA 3R65A 1ZBA2 4JYCA 1KS4A 3ZJZA 4LBKA 3UETA 2XLAA 5A7NA 4FLXA 5CA1A 2D6NA 1UYYA 1S0IA 4GH4C 5J09A 3R4DB 1MQTB 2OIIA 5JSRA 3E6DA 3C2UA 1JCHA 1JJOA 1B6QA 1PIV3 1N3QA 3B69A 3B94A 3A0NA 3PIJA 4QJFB 4QIWF 2VPVA 2A79B 3JAMN 2BTVC 3QCWA 3N27A 3DPRC 2GH8A 3NJZA 4JASA 3H50A 1NJIW 4AI1A 4AFCA 4AK3A 3OGRA 4QX2A 1BK1A 5CVRA 4OXSA 1ULDA 5DDJ1 3CQOA 1DHKB 4V1PA 1D0GA 2A71A 1HRI2 3LD8A 2OQ6A 1PGW2 2IUWA 3VQWA 4RSUA 2X6BA 5JZGC 4DV5B 3RYFA 4ZOLB 2ZGRA 5JCOA 5H5NA 1YSCA 4G27B 2UU9B 5LBFA 1XBFA 2D97A 1M57B 3LSUA 1OKOA 4B4QA 4GX2A 3FKSG 5FJHA 5J2TB 4O9GA 5L73A 3OUFA 3HEIA 4ZHQA 5DAPA 1KP2A 1VP6A 5JMCA 4KH9A 4CEWA 2NMNA 3W7SA 1OZ0A 3FLTA 4YPJA 1VJ2A 2ADDA 3NAPB 1GV9A 2Y34A 2VOTA 3X29B 2LALA 4NWWA 5FZ1A 1JFFA 4WBNA 1AJOA 4JDOA 4LFBO 3PVBB 4YW6A 1L0NH 4TV8A 2WO1A 5BY5A 1N33O 4M00A 3BYWA 1NOVA 3H9VA 5T50A 1RUG3 4AFAA 2W52A 2QQOA 5FPZA 3HPNA 1SPPA 4X9QA 1NTMH 4GD4A 1IURA 4PLOA 4IHJA 1O6UA 1JMKC 3T4HB 4Q2FA 1WCQA 4N9IA 5A7PA 5IY5B 1SMVA 3APOA 4BMBA 1PK6B 4Q5OA 4Q1PA 3QVNA 3UQ8A 2XAHA 1K5JA 3AFKA 4QPWA 5SV5A 5KMGB 3E22A 5FYCA 3DGEA 2WLLA 5GALA 3K77A 5EYYA 3I2OA 1YNAA 1S2KA 2UYBA 3ZYHA 4CDUB 3CCRV 3KWVA 3DXUA 4FMTA 2GTAA 3OJBA 4HG6B 5HCAA 2EIMC 3AKSA 1W9TA 1Q6HA 3OBTA 1M4UA 2WNUC 3NL1A 4N9HA 2CH7B 2JGDB 3BALA 3WW3A 1H4HA 3VBUB 4NXNB 4FI9A 3AMPA 4NPLA 5ISLA 5EC1C 2X29A 4D7SA 3H9AA 4IEPA 4KG0A 1BYHA 4Q26A 1QNMA 4LR4A 1VBD1 4C1WA 2UURA 1LOEA 1RUJ3 5HI0A 1XBLA 1IKPA 4UT5A 4J41A 2OWOA 2HYKA 2VS0A 1F51A 1RVF3 5F3IA 4QGLA 1SKVA 2PZSA 1GSLA 4XFCA 3MF9A 3CPWU 2HJIA 3GYDA 1RSOB 5TSWA 4EN8B 2K9PA 4N53C 3OEEG 2OCHA 1WLEA 1EZVH 3Q8CA 4X8PA 1G9CA 1DZTA 1G1XB 4MS2A 5FZEA 1TUBA 4JHTA 2UUCO 2IZWA 4FFHA 1QJX2 4FPHA 1YRZA 4JI1B 2E5LO 4EE2A 2ITCC 1ZRIA 2JIJA 2ARHA 1K8AW 4TLGA 2QDOA 3G6BA 5E88A 3ES1A 4NPRA 2AZ5A 4E2QA 3SYPA 2VW1A 3AFGA 4JC1A 4IHJB 3JU9A 3S7EA 5LP6B 5DM6V 4Q4V1 3TYJA 5G05L 1LENA 4S2GA 3VGIA 4NIGA 2A7WA 1J95A 2ET7A 2GSMB 1SRYA 5IJ9B 5BNPA 4X20A 2JDKA 1GMGA 1CAWA 2AGAA 2ES3A 3DV8A 1NCRC 4R7CA 3KHBA 2H6BA 4GWJA 3RVHA 1QEXA 1WLWA 1SACA 4LHSA 3FX3A 1XDCA 3LNNA 1R1BA 3Q4HA 5M0TA 1XL6A 4R9AA 1FNYA 2QWOB 1N1VA 1CN1A 2A06H 1PMIA 1SQXH 2ZGUA 1LESA 5IK8A 4JI8B 5IJ0A 1ZZ6A 1Z7S3 5TISZ 4EWAA 2C9KA 4OHZA 1GOHA 1KQRA 3WF2A 3WDYA 1FI2A 2X0LA 3POWA 2QWRB 4UVAA 2H3OA 3RZLA 4J42A 1W6MB 2Y6KA 3ZFGC 2VQFB 5LGUA 2ORZA 5FKBA 4AGRA 4BHPA 5EXOA 4KGQA 3ZDSA 1RUC1 5FZBA 4FOQA 1HB3A 2OS2A 4DV3B 3EHKA 1W6PB 1QLEB 1UY0A 1RM1B 1UMZA 4C91A 2RJZA 4CDWB 4ZS2A 2WLHA 5ABJB 2BJSA 3E86A 3ZPYA 1S0BA 5IATA 4A42A 4I01A 1EBOA 4FTEA 2OA2A 3PVEA 5IFPA 2VG9A 4DR5B 5FUIA 1G7YA 1NY71 3ZHUA 3W7TA 5AC91 3P5BA 1XI1A 1J1TA 4YVWA 5A7OA 3RVZA 5APAA 3APQA 3QNEA 1URFA 4FPLA 4XBLA 3ZFEC 5ACA2 1XMQO 1EN5A 1J1LA 2ETEA 2EXIA 2XMLA 1RYYA 4Q1RA 4GJZA 1OCZB 3E5UA 4O7XA 2VQEO 2C2AA 5KXCA 2XVLA 2B9VA 1HIXA 2VOVA 3LSSA 5B1AC 2NN4A 1W2OA 2EJ7A 1EAH3 2B5HA 1WBLA 2JDYA 1HR0B 4QPGA 4XEZA 3ACLA 2E51A 1MQTA 1NA1B 3L9DA 4RN5A 2Z3YA 3AK1A 4X88A 1R6NA 5FZFA 1SFNA 1Q3EA 1K7DA 5T5JA 4ASUG 2WQZC 4E4HA 4QHZA 2W94A 3CP1A 2ZR3A 2YXSA 1VMGA 3MD0A 4PI0A 3STLC 3D8CA 2BPA2 1GQGA 5FYVA 3IMMA 3MHZA 1JZ6A 3N2KB 2PAKA 2WN2A 1YFXA 2UUCB 4R52A 2LQTA 3RYCA 2MEV2 2ZGQA 3K46A 4RUFA 3ZM8A 3K58A 1Z0HA 3LDBA 3CRMA 2HBTA 5H9CA 4LTAA 3ZLIA 2B7YA 3MV01 4HANA 4JGZC 5L3BA 5ABJA 4X66B 3QG5A 1OPMA 5A7WB 2WZPP 4UW6A 4FPJA 5EZYB 2XONA 3H0OA 2XG3A 4CU8A 1YXBA 2EIEA 1CAVB 4E2GA 1NU1H 5FZCA 2OVUA 1LU2A 4RR3A 3VBFB 1YTFD 4ATFA 1QGLA 5C5UA 1VMHA 2XOMA 4JI7O 1VB2A 1WW4A 5IK5A 1UL9A 2BE3A 1PNFA 1AR71 1EFRG 3RWKX 2GHYA 4S2HA 1BHAA 2EIJC 2JS5A 1AX0A 1RUI2 1XNQB 3UNPA 1PVC1 4DR6B 1TEIA 2ZINA 1GO3F 1YJKA 3BABA 1OURA 2WS91 4CS4A 2Y8KA 4RL7A 3WD5A 1JQ0A 2JKXA 4HN1A 2XVGA 5GZDA 3KV9A 3L2YA 4FLWA 1O4ZA 4FPGA 4Q0SA 5CBLA 4MGYE 4PBPA 2DUOA 5GTIZ 2IJIA 1NI8A 2E7QA 3WQ7A 2EILC 2QJ1A 4IESA 3JSNA 4AE2A 3I2GA 3FMGA 3THTA 1R64A 5D8AB 3CCQV 3ATGA 5CFCA 4FP3A 4Y1UA 4AQSA 1G9DA 3AXEA 3FC0A 3E83A 4GKXA 4PQ9A 3OBZA 3JD0A 2R071 1MOFA 1CXZB 4BXFA 1AP5A 4YJ2A 2E32A 1AR81 2MPFA 3LEIA 2CSGA 4M4PA 4LKDA 2AEYA 4WM7A 4B8EA 2IFRA 4Q4Y1 1OT5A 3RYCB 2LW7A 2E63A 4DXSA 1US6A 1ASJ1 2YIBA 5LK7B 2VZOA 1W9SA 5LHIA 1LAJA 1A3KA 2WWJA 1GQPA 2R32A 3HJRA 1O91A 3CKHA 5FY9A 1VIWB 1R082 4X62B 3AKQA 1GNYA 3T0AA 2EF6A 2HWB2 3BEHA 1LULA 3M7MX 2A0LA 1OPOA 3B4SA 4KNCA 4BJ0A 4IYIA 5FZ3A 2UYAA 3E8BA 3N35A 2OT7A 2D3OW 1KDMA 5EJZB 3LDKA 4GALA 3PURA 3KVAA 3CMEV 3VBFA 3KT1A 5IDJA 2RS12 1PO23 3CRCA 4EZ4A 2RMU1 3UKNA 1AR82 1REFA 1CZVA 4K6BA 1J83A 5LZ6A 1IPJA 3RJ2X 3ZXEA 3H3LA 4JI1O 4HVRA 3CXHF 2Y0OA 4X20B 3D0SA 3QH6A 4IUGA 1JYIA 5J3UA 3BHPA 4I50A 3CU7A 3K5OA 2ZABA 1XHXA 3LFMA 4M3CB 4X8NA 1JUHA 4B3RB 3HIFA 4L2NA 3AK3A 4CEYA 4JPRA 2WNVC 3A0BZ 4HAMA 1VB4A 4DV1O 4Y33A 4YJ2B 2JENA 1EAH2 2YC2A 3AKRA 2R1BA 2DVDA 3LF7A 5FAXA 2VMGA 3SH5A 2VVFA 4R8HA 4EJRA 1W6OB 1I5PA 4MTOA 4FT8A 4J25A 3KS7A 1FOD1 4QPGC 1UOGA 5C4WC 1ALYA 1PZ9A 5CBFA 3VHPA 1OUXA 4KBBA 2H0BA 3CC7V 3R66A 3ZFEB 3N7KA 4LFBB 5LMUO 1VRH2 4D6QA 3PDQA 4B29A 5LA9A 1EYBA 3WEZA 3VLBB 3NKTA 3DKQA 3OUHA 1REDA 2ZHKA 2FKXA 3BFRA 1FPN2 3H8OA 3KZ4C 1VQ8V 2XT9A 4COWA 5LB6A 2ZD9A 3ZX6A 4PCRA 4DR1O 4Q8KA 2IBZH 2OPWA 4FVVA 2OQ7A 3R4SA 4CZSA 4XZPA 1P4RA 1PGSA 1ZNPA 1KS5A 3VB9A 3W5NA 3JASB 4AW7A 1QJU2 1JX9A 1ZX5A 2ZDIA 1R1A2 4RQEA 1QQCA 5FMDA 1FAFA 2QJVA 3USUA 3MFAA 4XBQA 1SERA 3RMYA 1XNAA 4KHPB 4FM0A 4MXWA 4X65B 1Y4MA 5IJ0B 3AP9A 5KA6A 1HW5A 2P1BA 1GZWB 4DV6B 5JXJA 4BIOA 4KWLA 4Y26A 4QM9A 5IT6A 4QPGB 1H6YA 1UU6A 2D5HA 1V6MA 2UXXA 3BU0A 1S76D 3JAWA 4DUYO 4QWNA 2DFBA 2P5BA 3GBFA 3HNBM 1YEWA 1ULOA 1RVF1 1WKYA 1IXBA 1U0AA 4GKYA 3MF6A 1Z5VA 3MEPA 2PQQA 1MMMA 2Q4SA 1AYN3 2Y33A 5CEHA 2ZNJA 2OYZA 3K04A 5DN2A 3JQXA 1EUUA 2A1XA 4IE5A 4GJYA 3LEKA 3ZXLA 3FYIB 1GZTA 3IAYA 3HN3A 3DUIA 3IAPA 5BXXA 3MIGA 1MA1A 1MZ5A 2GH2A 5CKNA 2VXJA 4LC1A 3POBA 4COZA 3K51A 4NROA 3L2HA 3PTYA 4HK8A 1GN6A 1C8M2 2P37A 5IK7A 5IJRA 3BU7A 1K92A 2ZAAA 2YFZA 2TNFA 4LF4B 4AVSA 2F4PA 5FZDA 5C71A 2VL4A 1OMIA 3WCRA 4WFHA 4QHOA 1I6XA 3CCJV 1AR1B 4UBGA 3MHHC 3RT3C 1IBLB 2UUAB 1TVKA 3VOUA 2XVKA 2BGOA 3RZMA 2C26A 3M70A 3AYEA 3BCCH 4BLJA 5K0UB 1ZYBA 1SZBA 2FZ2A 4CUGA 4FPOB 2LJ2A 4X65O 2D5FA 3ETEA 5F2WA 1SQPH 3K3NA 3X2QC 3VBOA 3H8UA 4ARYA 2R70A 4AWDA 3N7JA 3LOBA 4GKJB 3O1TA 4DXZA 5IVVA 4AGVA 3A21A 2DU1A 4CH3A 1ODNA 3R0RA 4DV1B 1DZQA 1WA8B 3I2DA 5KBFA 4I0WB 3C7FA 1RUF2 1QVGU 4XHXA 1ZBA1 2W1SA 4UV8A 2J22A 2JDAA 4URTA 3ZEDA 4RS5C 3H1YA 3MUY1 1GZWA 3VDCA 4V2WA 4W6YA 4IEOA 4QKBA 4I9QA 1FFXA 1JI6A 1P7BA 3HPLC 5IUQA 4AI3A 1MS4A 4JZ2A 2XQXA 4BQXA 1W2UA 4B4PA 1PK6C 1CGPA 1QBZA 4H2AA 2RDRA 3OGVA 2BGPA 3N2GA 4XPVA 4QDQA 1AR83 2P6HA 4X1KA 3FAVA 5ANNA 5FDBA 4YYOA 5FNVB 5EC2C 1RMU1 2QUOA 4BCUA 5CFDB 3AG3C 5FOBB 4CU7A 1POV3 5JCTA 5K0UC 2VZTA 2ZHNA 2UUAO 4N23A 2DFCA 2CGPA 2QM8A 1PNGA 4K35A 2EAKA 2EIJB 2LW1A 3FD9A 5FQ0B 1QU7A 1JN2P 1WZXA 4W50A 4DUZB 4MH0E 3H8XA 3ECQA 4OHWA 4AHZA 1M57C 3VBFC 1DQ4A 5BNQA 4JVAA 3DL3A 4OLLA 4ASMB 1JODA 4LA3A 4DR3B 4DQAA 4EKWA 3OY8B 1PVC3 3NXSA 4NE9A 5JZGB 3DC5A 5CG8A 5FWEA 2BOJA 4JI2B 2RM22 4QB1A 4G3YC 2BFUS 1YI9A 5K8SA 4O9EA 3I2KA 1BS3A 5A6QA 5T5PA 4IL6Z 1Q8OA 4CCCA 3HAGA 3RVYA 2XJQA 2XAGA 1RJ8A 3DPRB 1GM8A 4XFGA 3D5OA 1UIJA 2NQYA 2E7TA 1UFIA 3LA2A 2N74A 1W8HA 4MTGA 5FJKA 4X1YA 1CIWA 3K48A 3KCXA 5F3GA 1Q6IA 3CMGA
chains in the Genus database with same CATH topology
5JOYA 1LEMA 2A6ZA 1VRH1 4M25A 4KU7A 5FOJB 4BPZA 1MQTC 2ZGTA 4K9SA 2E6VA 1W0OA 1NCQC 4GH4B 4YRDA 1B09A 3NWKA 3SH4A 1VBE1 4XMIA 5F5QA 3G6JB 2DCYA 3E6BA 5CADA 4XMAA 1ENRA 3U11A 3G7DA 1PZ7A 4FTBA 3V65A 1LHNA 2NM1A 4CP1A 5A33A 1V6KA 2EAAA 3E97A 1SQ4A 4FOYA 2BUKA 2RS32 1OA4A 3ILRA 3B9IA 1LOAA 1N3OA 1V6LA 5A3MA 1PM7A 4FCAA 2KM2A 1NA1C 1WD3A 2I07B 3M3EA 1CR7A 1R093 2TUNA 4YG3A 4Y22A 5SV8A 1LHVA 4Y1VA 2R30A 4D7YA 1AYM3 3VDDC 2VH9A 4YZ1A 1VBE2 2B45X 1QF3A 1OTJA 2RS53 1AL23 1X8MA 3DKWA 5T5LA 5EJ3A 5FO8B 5KHJA 1GKBA 2PHUA 4AQ6A 4WVWA 4CDQA 3FUQA 1N1YA 4EV0A 3GHMA 4QT6A 1PGL2 1UPSA 4H3WA 4PF5A 1TNFA 4Y1YA 3HT2A 1QJY1 3RNSA 3S30A 5C9AA 4MGKE 3VN4A 3SWTA 4YARA 5GLZA 4GWMA 3WLUA 4XJAA 4QPIB 3O14A 4Q4Y2 4LBMA 5KHHA 4AEKA 3R4UA 5E1RA 3MPBA 4PLNA 1AR61 1CAUA 3ZXFA 5F6LB 4R4ZA 4NVPA 2WA3A 5A32B 2ZGLA 4COVA 4SLIA 1H1MA 4OFGA 1RUJ2 3WVJA 2JG9B 3FJSA 4Y4YA 1IS6A 3T1MA 4TSVA 3J9SA 1PO22 2GMEA 1ULCA 1JW6A 3A0KA 4NWVA 2BNMA 3W58A 5BNOB 5BNOC 1LHUA 1I9RA 4GB33 4XFBA 5H9SA 1EV13 1PK6A 2OUJA 2A7AA 2H0VA 2R063 4QGNA 3VHNA 1PVXA 2JG9C 4RR3C 2YUEA 1IS3A 4OULA 2MEV1 4E2SA 4E4ZA 5JWPA 3O7OA 1V9U1 2ENRA 1RUF3 2XBO1 3JBG1 2JG8B 4A7ZA 1DQ6A 3M8LA 4RQPA 3GBGA 1R081 3CJIC 2F6BA 2RJLA 3E6CC 4XF0A 1MVEA 1IS5A 4Y1XA 2O0OA 1LU1A 5CIRA 5CFCC 1T6GC 2NP0A 4PIZA 1XRUA 1O3QA 1CD3G 2D44A 3UJQA 2W0XA 5FLJA 1PIV2 1V00A 1W6NB 2HWB1 4I30A 4LLOA 4WZCA 1AYM2 4DB5A 3TNPB 1WA4A 2KXLA 1A78A 3PMSA 1TE1B 4BG1A 1VBC2 2Q30A 2XBO2 2WS92 1ZBE1 3WY6A 3ZSJA 1OA3A 2K2SA 4U2AA 3D82A 4XTPA 2WNVB 1JBCA 4HVOA 1BVVA 1EPZA 4OHXA 1RGSA 1WGPA 3LGRA 3VHRA 4EROA 3WUCA 1VBA1 4YW3A 5FRAA 5KC5A 2QKDA 1F8VA 1TMF3 1X36A 1RHI1 2OW4A 3ZFGB 1LRHA 1FV3A 3PJQA 2PAEA 4XYXA 1RUD1 2GDFA 3TN93 2PHDA 3WUDA 3N36A 2JKBA 3VBHA 3OGJA 1PO21 1Z78A 3KM5A 4N53A 3JD73 4YM2A 3AMQA 3AX4A 1MS8A 1R083 1PGW1 2PLV2 3RSJA 2CAVA 1C28A 2MEV3 1HKDA 1RUC3 5HCFA 2GC2A 5L7OB 2PHLA 1DS0A 3MYXA 3ZFEA 1EV11 2KA3A 1A8DA 4CDXC 5H9PA 2R061 5E16A 2O8OA 1QJU1 1G9AA 5CNAA 3VHOA 2YGLA 4YM3A 4GA9A 5L36A 4LBQA 2ZHMA 3WHTA 4BIFA 1OA2A 4XDQA 4YSFA 4L99A 4AF9A 3TRSB 2V73A 4CDXB 2ATFA 4R9BA 2DUPA 3AMNA 3Q9OA 4YG0A 5L7OC 3PMEA 4AQTA 2IWGB 4Q4V2 4Y20A 2WC2A 4ONUA 3T2TA 5FO9B 1XQNA 3ELNA 1OHFA 2WQ4A 2DURA 4PJYA 2GAUA 1DGRA 3M3QA 3JCIA 4XJUA 1YHFA 2DTYA 5J7MA 2QNKA 4XQWA 4INDA 2QQPA 5E89A 3QACA 2ZA9A 2DCZA 3GBWA 4S2FA 1U5IA 3HQXA 1QJY3