5JWPA

Crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYEEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title The facial triad in the alpha-ketoglutarate dependent oxygenase FIH: A role for sterics in linking substrate binding to O2 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 5jwpA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jwpA01
1H2LA 1MZEA 1YCIA 2WA3A 2W0XA 1H2KA 3KCYA 4Z1VA 2YDEA 3OD4A 5JWPA 4Z2WA 4AI8A 2Y0IA 3D8CA 3KCXA 4NR1A 2ILMA 1IZ3A 2YC0A 1MZFA 2WA4A 4B7EA 4BIOA 2XUMA 3P3NA 1H2NA 2CGOA 2CGNA 1H2MA 4B7KA 3P3PA 4QU2A 4JAAA
chains in the Genus database with same CATH superfamily
1S5HC 4MVZA 1ND2B 4CCDA 1GYKA 4BQXA 1AR61 1K5MA 2GNBA 1HW7A 3V65A 1OLMA 3WG7C 3DF0A 1K33A 1VALA 5J2TA 3VBSA 5GLTA 2XVLA 4H2AA 3ZCCA 4D7SA 3ZMNA 2OCCC 5DDJ2 4ZS3A 4N43A 1MQTC 2RMU2 5KHKA 2H0BA 4Q5OA 2CY6A 3AMMA 4OPHA 4DR4B 1PO13 5FY0A 3UK9A 5LBQA 4BU2A 1T5EA 3KT4A 5DAQA 1GZCA 1JVMA 1W9SA 4NIAA 1RM1C 2RDSA 4PLMA 4NAOA 4DW1A 4Y22A 1LNQA 2UURA 2ID4A 2R0FA 5EP9A 1VBC3 2GH8A 1ZRRA 4LIVA 4YM0A 5JI9A 1OH4A 4CU8A 4RFT0 4JVAA 4JAVA 1AR83 1T6GC 3PVNA 4MGYE 1WCKA 2YU2A 1YJ9V 1W2TA 1FATA 2Y0PA 4DXRA 2NM1A 2H8PC 1PNGA 1LU1A 1U12A 1UL9A 4LFAB 1RPRA 3VL8A 3CRQA 1W2UA 3ZXGA 3SYCA 3ZFFC 1FAFA 1JUHA 4O4LB 4E2LA 1J95A 1SF9A 2QQWA 1AF9A 1FOD2 3IT8A 5C5TA 3WCSA 4YYOA 4TOIA 1ZZBA 3WINE 4LF9B 3ML0A 1HQNA 5LYJA 3ZN4A 2BFUL 4D8MA 1JZ2A 3U78A 5FKBA 3PUIA 3ZSLA 1AR93 1DP0A 1IQAA 1ZX5A 4Y20B 4B4RA 1S0IA 4V2VA 1VB4A 3E86A 2PA7A 3ZFGA 3P3NA 5EYPA 1Z5VA 1HQLA 1SG3A 2VXJA 1QBZA 2PUSA 3GVMA 4CP9A 5KXBA 2IXHA 5CA0B 1XUQA 4AEKA 2JEXA 1W0PA 4FM1A 2YY1A 3SH5A 2G38A 1UYYA 2RM22 1K3EA 3I2OA 3IDEA 5DEDA 4X88A 1H8EG 2E6VA 3JXSA 4FM2A 4OYUA 4AEDC 3BU7A 3OPZA 4FLVA 4KUMA 2DDUA 1F4HA 1MS3A 3FLPA 4HOOA 1XYNA 5ITZA 4JYAB 2R0HA 4KP4A 1H1MA 2XONA 2GTSA 2MEV3 4C1XA 5ABJC 1GP5A 3W58A 2YDEA 4FPFA 3LOIA 3DGTA 5J98B 1EV12 3VD9A 2X0LA 1QU7A 1QIQA 2DUOA 1RUI2 3BI3A 3OR7C 2BNNA 5HXMA 5LHHA 5IYZB 2WNUB 5F5IA 3N35A 4XZPA 1YFWA 5CYYA 4NHXA 5B1BB 4LO4B 4QXBA 4X62B 3E2EA 3HQXA 3ZRWB 4JKKA 2A3XA 3AVRA 4XQWA 4BQ3A 2OKXA 1RMU3 2A3QA 1ENQA 1NUKA 1LENA 1SPPA 4CP0A 1O8SA 1PMHX 1N36B 4YY3O 4Y1VA 4LBKA 1QU0A 3LIHA 4B3TB 4JQRA 3VBRA 4BHPA 1I08A 5IYCO 3ZSEA 4XF3A 2W0XA 4IYIA 5FZ9A 5L9RA 1W6NA 3TJTA 2LW7A 3IGAC 5FY7A 2WNVC 1XNKA 3H1HH 1WLDA 2AH2A 3JAWB 3ROUA 3S3WA 1JHJA 2P3YA 5JVVA 2J1RA 2YFZA 2YGMA 1UMHA 2ZJCA 4QPKA 3KCCA 4E4EA 4IDZA 4ASKA 3WQ0A 3D3AA 4AEJA 2WWSA 2WN2A 1Q8OA 4GB32 2OTJV 5KC6A 3OTOB 4E4HA 3NWKA 2UU9O 1ZBE1 4R7CA 1J5EB 5B66Z 3A4UA 4KFMA 3R4UA 1SZTA 2R9IA 3UETA 2BJSA 3SPJA 1G6NA 1STMA 4ATFA 2NNUA 2ZGQA 3UO2A 3ZPOA 1VR3A 3OBAA 1PGL1 5JAXA 4E8DA 2OUHA 2F23A 3C7HA 5LXTB 1VP6A 1BHAA 2YG0A 1SFPA 4LMFA 5E16A 4Z82A 5HCHA 5EZYA 3FHAA 4GH4B 4J7ZA 2ORXA 2I07B 3L70H 4PA3A 1W8HA 4RGKA 4RUEA 1DGWA 3LSSA 3CRRA 1NVPB 3TBDA 2WLMA 1GN6A 2P90A 2AYHA 3PVBB 2I2SA 4FLZA 2VGDA 1R1ZA 1XL4A 5JZGA 5A33A 4WFAV 4U3JB 1URFA 3RYRA 1M4UA 3KVAA 2Y69C 1OHHG 4QGPA 2YXLA 2XGXA 2WRAA 4JCKA 3NJZA 2QWQB 2DBNA 3ENRA 3CEWA 3JALB 2DQ0A 1U97A 4LBJA 1UCXA 4XJUA 5FPAA 3DL3A 4TYSA 5LY1A 2R072 3OUJA 2Y26A 2JJ1G 2HH9A 4JI8O 1APNA 2JVDA 5IT6A 3APBA 3ZMSA 3U4XA 4JYAO 4LNUA 3K9AA 2WO3A 5FLIA 1FPN1 4JTCB 2WFF3 2WAAA 3N9LA 4GALA 4MVSA 2P4VA 4ZHQB 3Q9OA 2TNFA 2BTQA 2QQOA 4AW7A 4IEXA 4MO3M 4NIIA 5IVFA 4HZ3A 3ATGA 4X62O 4E4DX 1JZ5A 3O1TA 5FO8B 3TEYA 3TYJA 5FYVA 4J11A 2R061 2B46X 3TGUH 5JJNB 4A6OA 4OULA 3B94A 2ZMLA 1FFXA 1N36O 2TBVA 3AYEA 1ULGA 4NE9A 2FDGA 3HVDA 2VNGA 4XMIA 4YFWA 1RUH3 2BUKA 3K46A 1JOPA 3OCPA 2P7TC 1S0VA 2DURA 1ULEA 3TWIA 5FZIA 1SERA 5F8PA 4BQ4A 1QQP3 4LF4O 3VBUB 1R64A 1Z2GA 1ZBE2 3G6EV 2PELA 2ZXWC 3K06A 4OI0A 1ENSA 1H9WA 2WAMA 1OOPC 4QM9A 4ZHNA 2VBDA 1L3JA 1FXVA 3D82A 3POJA 1OA2A 4FFIA 1AX1A 4RD7A 3UJQA 4CXYA 3AL6A 4GKKB 1Q6IA 3CC2V 5BNPB 5KHGA 1V6KA 1WW6A 1K73W 1N1TA 3JCUZ 3F5WC 1BQZA 2XR4A 3D5OA 4XAEA 2B42B 4UVBA 1XRUA 1XSQA 5DQ0A 5IWAO 1GSLA 4FTBA 1GN4A 1L0NH 3ORJA 1F4NA 2WS93 1XC6A 3M2MA 3B9CA 4CEWB 1W6MB 4OI4A 2YGLA 3UO3A 4FOVA 3K79A 1SQGA 4FLXA 5CBLA 2VQAA 3MW3A 2WLLA 1CPMA 3ZLIA 4B8EA 2SLIA 2VOXA 4CDUC 2CTWA 1H2SB 2Y0IA 1UKGA 3WP4A 2P3IA 3HOBA 2ZINA 1LOFC 1O7FA 2AC1A 3NJYA 4AQ6A 1N0NA 1BBT3 3MIEA 4ZS2A 1SETA 4D94A 2XDVA 3H3UA 1RM1B 2IH3C 1S1AA 4RGAA 3N2GB 2IXIA 2D6MA 4QDSA 2WYSA 4PI2A 5HBAA 3ZO0B 4UCSA 2ZT9B 4LF6B 4X1IB 2JKBA 5DN6G 2EALA 4YW7A 4IE0A 2QQJA 3J81N 1FPN2 1ULCA 4A3ZA 2C9AA 1BK0A 1JHNA 1VBA1 3C90A 2C0ZA 4Q4W1 1VBD1 2Q4SA 3VD4A 3ETGA 4LH7A 4DMIA 2P34A 5FUIA 3ZFFB 5H9RA 2OPWA 1R1A3 3J7AU 3RG0A 2VNOA 4BH9A 1VQLV 3MI8A 2GN3A 4JGSA 4BYYA 1SLTA 2BNOA 2P17A 4Q1PA 4YZ4A 1YHFA 5AFEA 1RUF2 1VJ2A 1TUBB 4ORFA 3LSUA 4WM8C 5CB4A 2BQPA 3NMBA 4LO7A 1SQBH 5IYYA 1WB8A 2D93A 4AFCA 2ES3A 5IHRA 3AYAA 1W2OA 1DQ6A 5JVDA 1TVGA 5A7SA 3SR2C 4CSWA 4NMIA 4LEJA 3FB6C 2DU0A 1GLHA 5A7NA 4P9PA 1QMJA 5IAXA 1NTMH 4YJ3A 1XNDA 3VN4A 5A3NA 3DYMA 2WPDG 1SQFA 2YBSA 4XILA 1LTEA 4BIZA 4XAAA 4ZZ5A 4V1PA 3MLJA 5B1AC 4LJHA 4AAPA 4JI2B 4H44B 4M0HA 2J22A 2VCCA 4AI8A 4CH3A 2FMYA 2HBTA 2HWF3 1XILA 4AEDB 1PM9A 1CN1A 4M01A 3UKVA 1ZRCA 1XNRB 2LUWA 2CTRA 4IV3C 3T2TA 4BLJA 4EV0A 2BSKB 4D7TA 1H0BA 1O9HA 3RYIA 5KC5A 4DR5B 5L3DA 3AMQA 1PIV1 1V9U3 5DUUA 2XKPA 3K48A 3VBOB 4BE3A 4COVA 2R042 4IV1A 3AZXA 1OA3A 5L73A 4DEQA 3D0SA 1PMIA 5CFCC 2LQTA 3RJRA 4SBVA 3MUZ1 5H9SA 4CU9A 1JS9A 1XMOO 1OF4A 2E7AA 3WDTA 2DFBA 3ZHUA 1C8M3 2J1TA 1ZZ8A 4NPRA 1IBMB 2FKXA 2QTSA 1F4AA 4XTPA 3ZXFA 4P9WA 4UW3A 4FVMA 2B5UA 1G9BA 3AP9A 3DPRA 3NR7A 1IZ3A 4J9ZB 2X5IC 1QKQA 2HVKC 1JZ6A 1NI8A 2BEOA 4G28B 5J3UA 4CS2A 1FAYA 4AXOA 3NV3A 2VG9A 2JJ2G 4AEMA 4UCRA 5LMUB 1ZZ6A 2P1BA 5K0UA 4HNAB 4KG8A 1JJOA 2P3JA 3N9MA 4XJAA 3J9SA 1A32A 5JCOA 3OGCC 5IT9N 5FAXA 5JIAA 2EX3A 2DWDC 3SYOA 4YW4A 3NKTA 4CS4A 2YBKA 3DTUB 3SKJE 4CZSA 2PTMA 1Q6HA 5IW0A 1QH7A 3EXAA 1VQMV 2GU9A 4JAAA 3MFAA 3GGLA 3IC7A 3POYA 1VBA2 1K5SA 4LF6O 1MPXA 3ZN6A 3RYFA 4XFHA 2ZKOA 1FXKC 1GQGA 1NLRA 4I9WA 1TQ5A 2XAHA 4ZY9A 1XB9A 4BLIA 3LKJA 5L9BA 4DUXA 2ZX2A 1SDDB 1RXGA 1NCRC 2FCUA 4X64B 1PVC3 4AI2A 1S0BA 4MVOA 4H13B 4X8PA 3O9OA 1D0HA 2NLJC 5AVAA 2JB4A 2V7QG 1JI6A 3DYPA 5F32A 2V4VA 5G04L 5JMOA 4NXMB 2Z79A 2XPJA 3NKGA 1K5JA 1I94O 3WW1A 1SKVA 4Y4YA 2DFCA 4E2GA 3HKDB 3A8TA 5EBMC 4XJWA 4RS5A 1HLCA 5DECA 3P3PA 3JBG2 3RS6A 3E5QA 1JBCA 2WKKA 1URXA 4TLFA 5FYMA 1U5YA 3A7QA 5GZFA 4GLXA 3PLQA 4Y1XA 4RO2A 1OLRA 2Y69B 1Y3TA 3QD6A 3E8BA 4DV5B 2OZJA 4YVWC 2F6BA 2ET1A 4M4RA 3I4IA 4HKLA 1UOJA 4DXWA 5CN0A 4MVRA 4QQHA 2Z0AA 2ZGUA 3ZMZA 2XBO1 4PT6A 4PDMA 4QKFA 2JG9B 4EN7B 1EP0A 2ZZQA 2WLJA 1US2A 4R9DA 5JH7B 1ZLZA 1D2SA 1LESA 3BTZA 4BK5A 3V0BB 4YW3A 3HKCB 2VW1A 4DR5O 3CRMA 2QM7A 3FLTA 5IVJA 2GSMB 2VZPA 1KMIZ 4CCCA 4GCZA 1DLBA 5IJ0B 3ZR6A 2UY8A 1A8DA 4HK8A 3K57A 3B8NA 1VF6A 3ST7A 3CJHB 2O14A 5IAVA 1UMZA 3K58A 2RJKA 1C5IA 4O4LA 4FFBB 4FMTA 2CTPA 3IDAA 2WFPA 1BEV2 3O12A 2Y38A 1HRV3 3RZJA 5IVVA 2VZUA 4C91A 4OMDA 3I54A 3RWKX 3AJZA 2Y6GA 2ZX1A 5LMUO 3HR0A 4RYDA 3LDKA 1XREA 3UQ8A 2G19A 3LA3A 4AL9A 4IW3A 1RFYA 5GJ6A 3SC7X 2ZXWB 3THTA 3ILNA 1GOGA 1ULFA 1C3HA 2E51A 4IE7A 4Y20A 2F17A 3U4SA 5CZKA 1K7DA 4W4KA 1SQPH 2D40A 2DVAA 5CFDC 5CA0A 3U10A 3CE2A 3IAQA 5KXEA 4YVSC 4JKMA 4R4ZA 3FWEA 1Q43A 3OOXA 5L3CA 5FQ0B 2E31A 2LALA 2YICA 4UB6Z 5IVBA 3KHBA 1MS9A 1OCOC 1ZUQA 4PF1A 3D8CA 1OF3A 1PGW2 1MS1A 3LD8A 5FY4A 4FPEA 5J96B 4QDQA 4A7KA 2RS33 2F1MA 1N0JA 1FMD1 1LECA 1OUXA 1YYNA 4CDQC 1CR7A 1QJX3 3OGJA 2XWJB 4XUPA 3S7EA 1I5PA 4CE8A 2DYSC 1S0FA 5EIYB 2B9UA 5C9AC 1QEXA 3GBGA 1EN6A 4JYYA 5FZ7A 4D6SA 3BKZA 1UN1A 1E5SA 4I9QA 5IYZA 3WDVA 2WNUA 3IAPA 4NAMA 4NIHA 3R05A 2WWJA 4AE2A 3AZYA 3DYOA 4NWWA 3ZRWA 5CADA 1R083 4GMP1 2PGGA 3NJVA 4F6EA 4JZRA 2X6CA 4X6QB 4P9GA 1PO12 1VQKV 4QXKA 4KBBA 2CAZC 1W06A 5LBCA 4AHYA 3AMNA 1M57B 5FZDA 2ARXA 2GN7A 4YPJA 3DXUA 3AP6A 1VBC2 2CTQA 2GP5A 4FM0A 1QJY1 2XAGA 2AW9A 3K59A 4LO8A 4LOTA 1AR82 5D8AC 5L7OC 5GALA 1MZ6A 1GP6A 1LJ7A 3PJYA 2EXKA 3MEPA 2RR13 2KA3A 1BLZA 1NQJA 5KA6A 3HKEB 5FJKA 4YM2A 3JSNA 4I5SA 1ASJ3 2CH7B 4RQPC 2XUMA 1EPZA 2BOJA 4W6YA 4CUCA 5JI7A 3FC0A 1UD1A 2K9PA 4Q2FA 2GDSA 2QWPB 2UUCB 4KBZA 4JRAA 5LXTA 4WM8B 2JDPA 1HDKA 2GAUA 1M56C 3K51A 3OB8A 1VLNA 3WNMA 1S5JA 4ZBMA 3CJXA 4GH4A 5T3NA 3I2IA 2V09A 2FL4A 2IVJA 3FUQA 3AMPA 1HQWA 1AR1B 4P5HA 4XW3A 4PIYA 5A7PA 3K4AA 4FPGA 4RUFA 1WCQA 3OBRA 3UGGA 4IE5A 4QPWA 5GZDA 1U5ZA 5B1AB 1ND3C 3P32A 1RVF1 5BR8B 2UXNA 3J26N 4F8AA 3MLLA 4U3JA 1M93A 4JZGA 1UW8A 2ARAA 3ZYRA 2ZEWA 5BY5A 2LO1A 2P6HA 3O1SA 3ILFA 1RJ8A 2D7FA 3ZMTA 4K6BA 2P5OA 4J42A 3JALA 2WT2A 2JB8A 2QTOA 4IV3B 4E27A 3HNBM 3MW4A 3D0JA 5L3FA 3WLUA 2RDRA 1IS5A 2DTWA 3JAKB 2MEV2 1FYUA 1FKAO 3U37A 5DAPA 2YFUA 3OG2A 4KGGA 5F37A 1GOHA 2E9QA 2QDNA 1J1LA 1GV9A 1S0CA 5AVPA 3O65A 2UXDO 1D4VB 3FAVA 3L2HA 4W8JA 2VCMA 2NYYA 2VXRA 1KP2A 2P2KA 3SPCA 4ZHQA 1FXZA 1RMU2 4FZ1A 1C4RA 1RUOA 1VAMA 2Q8CA 2VQTA 4IGOA 1SDWA 2ZA9A 2WABA 2E75B 2TUNA 1RUE1 3JD73 1G6UA 2IVIB 4NB5A 1XNQO 2JEUA 2D2CB 2WA3A 5B5EZ 4B4QA 1NKDA 3DXRA 2C1FA 3MIFA 1RL3A 4DIQA 4DR2B 1QJY2 4H33A 1SBEA 4FPKA 1YWKA 2DV9A 4QIWF 4NHYA 1AYN1 3K75B 1MEC3 4YM1A 4RR3C 4LORA 4M3CB 4CEYC 2BYVE 5M0TA 3VBUA 5K1XA 2AREA 4UCOA 4XJ8A 3AZWA 5JR2A 3L2YA 4PQQA 1EYBA 5IJRA 2WZR3 4E4SA 3AG4C 2XWBB 3M1HA 4XDKA 1J3PA 3CX5F 3VDDB 5IK4A 5C6CA 3ETEA 1NCRB 3NXSA 1I7FA 5T54A 2UY9A 3BRCA 5ACA3 3AYCA 3MW2A 4XVHA 5FTTC 1OPOA 4QQLA 1R3JC 3SJBC 1Q86W 3M3OA 3HPNA 3L9JT 1HB2A 4FPYA 3LCPA 4LBMA 5LHIA 5LBBA 2Y64A 3GHMA 1J3RA 4QU2A 5E1AC 4UFLA 2QQPA 1CJDA 4OQ8A 2PYJA 4JV4A 4RSUA 1JZ3A 4PJ0Z 2MK3A 1UYPA 4QKNA 5FREA 4DR6B 4CEWA 1S76D 4NXNB 1W6MA 1J59A 1QGLA 1I9RA 1RVF2 4ZKIA 2YC4A 4TQFA 4O4JB 2BOBC 3CRAA 4L11A 3CD6V 1CPYA 4FLTA 3BA9A 4NJ4A 2FMDA 2R16A 1H8TC 1SLCA 5BR8O 4ZI7B 3H1YA 2ATFA 3WD5A 3CCEV 4J25A 4Q8KA 1ROPA 2BV4A 1UY2A 1B35C 2E53A 3ZYPA 3PUAA 4LULA 4XBLA 2VMFA 4PDWA 2X7RB 2EZPA 3WNOA 4DRVA 3WU2Z 1O3SA 1QNYA 3UT5B 5FFOC 2YIDA 3KF3A 1E5RA 1QCEA 4E2SA 1JYXA 1RUG1 4P14A 1CAVB 2WFF2 2W2IA 1W6QB 3ZFEC 2B9ZA 4GWJA 3RZGA 5EJ3A 1N1VA 1QLEC 1R3IC 2N7GA 4YGBA 1GNYA 1ZNPA 3ZOIA 3QF7A 5I93A 3MHHC 5HFLA 2EIMB 1PO21 1W59A 4XMAA 4JQTA 5C8CA 4NOTA 1VMHA 4BCUA 1JYWA 4UFHA 2VQFB 1E5HA 3QACA 4MSVA 2VZTA 4JDOA 4P9IA 2LP7A 1PKXA 2AZ2A 3KT7A 3WFVA 4M3CE 3M3CA 3IPVA 4OXSA 2AENA 1D2QA 1GO3F 3S6PA 4G4FA 2QJVA 4GWIA 3DXTA 5TISZ 4EB6B 4H7LA 4QHOA 4K8RB 1DYKA 2FZ1A 1AYN2 1SC5B 3CBNA 2IC1A 3KM5A 1NS1A 2RHPA 2IZWA 5LOVB 1SLAA 2GSYA 3ZMOA 1Q5OA 5C3PA 1GM9A 1R091 2JWPA 1E57A 3POEA 1HJGA 2JX9A 4LPLA 1XU1A 1M06G 4GX0A 3KT1A 4CCJA 1KKDA 5F1RA 3TAYA 1BJQA 4IQPA 1YSCA 2QE7G 3H8XA 3CO2A 2WDBA 3JB8A 2O8QA 4YVSB 5FYSA 2IU3A 5IVCA 4PJYA 5KXDA 3L71H 2JDNA 3PTYA 2D98A 4GQ7A 3FHIB 2EIBA 2QR4A 1FFTB 2X05A 3H1JH 2PZSA 3HD8B 4X66O 1R3LC 1X36A 1MS8A 4GWMA 4CPBA 1S0DA 1OCRB 4HN1A 4CDQB 2Y34A 1SFYA 1NXD1 3RQ0A 1NVPD 5C9AB 4KHPO 1Z7S1 1DTOA 2E76B 4GYCB 2R49A 3E5UA 3LSEA 5JSPA 1AX0A 3VBOA 2XOKG 3P30A 2OZ6A 2VWKA 4PA6A 4P5YA 1X8EA 4DR6O 1NR7A 4LP8A 3WG1A 1GZWA 4GUNA 4FPPA 4M4PA 3O1MA 1ST8A 1GQPA 1W6PB 5KXCA 1C1FA 1NY71 2SBAA 2F43G 3K4DA 1IBKO 4I2OA 3AL5A 2XXZA 4S2HA 1BBT2 1CIYA 4WFHA 3DSQA 2ATKC 2EINC 1QF3A 1D4M1 2RDQA 1UU5A 2CDOA 4HNAA 3FL7A 1S0GA 2EIJC 4DV0B 3AKSA 1AI7A 2JDUA 4HAMA 1RUG2 5D8AB 2MW2B 5L7OB 4YARA 4UFZA 1DGWX 5LBFA 2OA2A 1XDCA 1C28A 5FRAA 1YQCA 1H1AA 2ARCA 1RINA 4NR1A 4YNIA 4GT1A 5EV7A 2YS8A 1KB9F 4BPZA 3IMNA 2ADEA 3WF1A 3CJIC 5LY2A 4HT1T 1R1A2 4QE7A 1W2BU 1UY1A 1V6JA 2DUPA 2HWD1 3B9IA 5A1LA 3RFRA 1DGRN 4CU7A 3K3NA 3Q4HB 3USUB 1DG6A 3ILRA 1V6MA 5EIBC 3BGAA 4OZOA 4OCTA 4QKBA 3T1MA 3RN4A 5JLVA 1J3QA 3CCVV 5ANNA 1YI7A 1AVBA 2VQFO 1RUD1 1M56B 2VOKA 1QXRA 4ZXKA 4BWOA 1OT5A 5LP6B 3E8HA 2GMEA 3J8F1 4XFAA 3VBFB 3L74H 4QQ2A 4O2BA 2DVGA 3ASNC 2XQRA 4Q4Y1 4MVMA 2JIJA 1OA4A 4B1LA 1W04A 3HKDA 1AROP 1QVFU 4Z07A 3AJYA 4Q6GA 1JYNA 2XJVA 1NA1A 1Q81W 1BYHA 2WQ4A 4JI4B 5EWSA 1SLLA 1ND3B 1V6IA 4NIDA 4IUGA 3N4MA 3TRSB 3TN91 4H37A 1VRBA 3FBMA 4X65B 2ADPA 1G9CA 2MHFA 2HWF2 4IIJA 3LA7A 3LNMB 1WPBA 2WNEA 4I4TB 1TNFA 3MIDA 4BIFA 2RCVA 4Q26A 4O4IA 5KA5A 3IZOA 4XFCA 4MGTA 1COV1 4LUMA 4MADA 4K8XA 4ISRA 1V9PA 3B2EE 4FPJA 1YHQV 1PK6C 2JG9A 4P9OA 3M7MX 5FZ6A 1KJLA 2YI8A 3KS7A 4QDRA 3WXPA 2RVAA 1V9U2 4J9YB 3RBZA 1UY0A 4CC6A 2R32A 2VAUA 1LUVA 5JH7A 3POBA 1I0HA 3ZXAC 3CMEV 5E1RA 1HB4A 2CL2A 2WQZC 3OFNG 4CCEA 3V0BA 1LOGA 4UWDA 3HKCA 2BW8A 4YJ2B 5AC93 3N27A 4QMAA 4XTMA 1IOAA 3IIAA 3GWOA 1K92A 3VL9A 1QJEA 4AWDA 2V73A 3VQVA 1C8M2 2GV9A 4LKDA 2VUAA 1OKOA 2WWWA 1H2LA 1QLNA 5LA0A 4LBQD 3T2OA 3B77A 4N90A 4HSJA 5FY1A 3CJHA 2Q7HA 1AL21 2XG3A 1GZ9A 3OTFA 3BIEA 3CYOA 1D4M2 1PX3A 2EICA 1FS0G 2Y60A 1AXZA 4K21A 3RRDA 3ZKUA 1NH2D 1UXXX 3TB0A 3ZHSA 2XJPA 3WQ7A 4L92A 4UW5A 3ACIA 4LFCB 4WVZA 4JX0A 2H6CA 4GULA 4W50A 2A79B 3FYIB 1KD1W 3SEPA 1UYZA 5BNOA 4RR3B 1NG0A 3ABKB 4YXWG 2RS11 4CEYB 3RZKA 1I5ZA 1WAZA 2GUZB 1A3KA 4YGCA 3TCUA 1LULA 4DV4O 2RDCA 1MACA 4BXSV 2QQVA 3JB4C 2HG5C 2G1MA 3AG4B 2QSAA 4Y4RA 1JW6A 1FX5A 5EZWA 5DUXA 2ADQB 2Y33A 5IVYA 1W3XA 1PVC2 2DE0X 3H8OA 2MNGA 4AI1A 3WNNA 1LODA 2WQ8A 1CAXB 1QWRA 1RUC1 1K3IA 4HBNA 1LHVA 1RUD2 3INAA 1P84F 2HWE1 2OIGA 3CWBH 3ZX7A 1UZYA 5FBJA 2VECA 3A0HZ 2RV9A 2UUBB 3BFRA 1ZZ9A 4YLZA 1DF5A 1Y76B 4OUMA 2HWC3 1HNZB 4Q4Y2 4U3FH 2E5LB 1UZZA 3KLSA 3WF2A 1MZFA 3AG3C 1OKQA 1HW5A 1XHXA 5FPVA 3HIFA 1OCZC 3ETDA 1AILA 5FLJA 2FCVA 1YJLA 1PM4A 5LMNB 1ZRIA 3K5LA 1EAH1 2FMLA 3LPGA 3TN92 2JDIG 3VZKA 3WUDA 2VE1A 5I8YA 1WCDJ 4NO4A 1OZ0A 3K77A 3GB7C 3EBRA 5I8TA 2R7EB 2X8KA 4QQPA 1EM1A 3CC7V 1VBE3 2D6LX 2PHUA 5B3SB 4X65O 2GHYA 1COV2 3QBQA 4XXAA 4K40A 4AG4A 2N05A 2ZE7A 2IFRA 1EUUA 1IS4A 1QXJA 5FLHA 4TT3G 3ZMUA 3CIHA 4Q0QA 2O0OA 2BPA2 4FOQA 4IEPA 2AZ5A 2QQMA 1KC8W 5D1IA 1BQ0A 4M0NA 4BQWA 4LA3A 2VUDA 2EA7A 3T2PA 5E8AA 1PGSA 3LEMA 4HFSA 3AB0A 1K5MC 4FPOB 3ZFEB 3CCSV 2QBXA 3RYPA 4NPLA 5FZHA 3BOPA 4GX1A 3VBSC 5JIUA 3VZNA 3KV6A 2PF4E 4N43C 3T2MA 4MVTA 3TXQA 5CBGA 1GMMA 1LEDA 3LE0A 5T5LA 4BQYA 3MDSA 4B3SB 5I8SA 1AL22 1ENRA 2GNDA 4MTOA 2DYRC 1E1RG 3ZXDA 1SLIA 1LOAA 4WFGA 3AEIA 5T50A 3FB8C 1KUQA 1DF0A 3JYCA 3ZYBA 1Z78A 4LH6A 4DR7B 2IJHA 1BVVA 1X8MA 1PV0A 4IE6A 3VUOA 4AQYB 2D3PA 3SQOA 4JI6B 2RS12 4J6GA 4DEVA 4I3PA 4LFCO 3LZZA 3UGFA 1X9TA 1RB8G 3AKQA 3AP5A 3VV1A 3NNFA 3ABMC 1SACA 2HWB1 1D7PM 1JR9A 2VMHA 4CCLA 2VZ3A 2XHBA 5FKCA 3ACFA 3VLBB 3WDYA 2OWOA 3W59A 1VRH1 5ERLA 2QGNA 1JJ2U 2QM4A 3ZYJB 5I0SA 4U2AA 2DVFA 1X59A 1UZWA 4TN7A 1TG7A 1YI9A 2ZNJA 5FP4A 4WZCA 2DCYA 1TAEA 2RS53 5FZ8A 5T5PA 4FFGA 1NOVA 4PHZA 3C3VA 2VBBA 2UXBB 2BGCA 4JTNA 3R4DB 4XQDA 3UGHA 4K3UA 3ZFGC 4J7KA 2CAVA 1I5XA 3N9OA 3BY6A 2C5DA 1BMV1 2XAFA 2EXHA 4NHMA 4I0XA 1HNZO 1YI2V 4ITCA 4DV1B 3QTCA 3CF6E 1M9NA 2H94A 1IPJA 3N2KB 1AR4A 1DBNA 3KKYA 4DZGA 3IKWA 2HVJC 4W6WA 1ODMA 3HNMA 2D97A 4XURA 2Q8VA 4F6RB 4LHLA 2XL9A 1WUVA 2NPIA 1N34B 1W99A 1IPKA 1AI5A 1O8PA 3M7AA 4X20B 3KCXA 1Y67A 5C8YB 1FD9A 3G80A 5F6KA 3IAYA 1L7QA 2LW1A 3GBWA 4C0BA 1NLSA 5FDBA 2EIGA 4AFMA 5JOZA 1FJGB 2EIJB 4N53B 1NJIW 4LXLA 1WA4A 1W90A 4DUZB 2ERFA 4XFFA 4EROA 4LBNA 3JD0A 4EFBA 3NQHA 2JICA 3O5SA 5BNNB 2DVBA 2XHNA 1AUYA 2RR12 3VBRC 2UXCB 2DCZA 2Y6LA 1SEFA 3CJIB 3KV4A 4MGKE 1XSRA 1B3QA 2ZKNA 3VDDA 3ZSMA 2CGOA 1QJU1 4Q0VA 2G9ZA 5GONA 1AP5A 3SYAA 3PN1A 4JI3O 3B02A 4QPIB 4GJYA 1I1EA 4K3AA 4R52A 4ARYA 3UV9A 4LCUC 5IYBO 2IUWA 1W8OA 2OW4A 2QCSB 3ASNB 4BM8A 4B4PA 2G4IA 5A80A 1DGRA 3SCHA 3O0VA 5DDJ1 2QWOB 3VQYA 2VBPA 3G6JB 4AVSA 2RMU1 3OY8B 2ZIMA 3WNKA 1VBB3 4AQYO 2C26A 3AK3A 2ZGSA 3H9AA 5BV6A 2VOWA 3HN1A 3ZIWA 4JI6O 2HWB2 2O1QA 1MSWD 4IEYA 5IK7A 5FZAA 4A44A 1VRH2 4PQ9A 3MIHA 4P2ZA 4DOUA 4BW9A 3K0DA 2ZE8A 5ANQA 1IXMA 4NYKA 3C7OA 1FNZA 5CKNA 2D3RA 1ZBA1 1CJPA 1HR0B 3NL1A 2ZABA 4A5UB 3ZIAG 5JQGB 3K04A 4XYXA 4ZI7A 1ZL8B 5C93A 2VVFA 2VQ0A 2HJIA 5A2QN 3H0OA 1YEWA 2JGUA 4UFMA 2YXHA 3B69A 5FJHA 4D7YA 1S2BA 3ASIA 5DUWA 1BMV2 2QZ3A 4HXCA 4BISA 3FBYA 4SLIA 5JZGC 5DZGA 3BEHA 2ZS6B 1CX4A 1V55C 1CZSA 1FOD1 1LCLA 2WSSG 2ZTNA 3VZJA 5FZ0A 1IPSA 3IM0A 1CAVA 1YVWA 5F2VO 2HFEC 1W6QA 4N9IA 3F95A 1BSMA 2ZGLA 5F39A 4AZZA 3RW0A 4EFEA 3SXWA 1BZKA 3RYCB 1GQHA 4JGZA 1FYJA 1VF7A 5KHIA 3JD72 1ZA4A 4DRRA 3O1VA 1EUTA 1F51A 1H38A 3O1UA 1N34O 4I3GA 3S57A 3ZYGA 2VZOA 1PNKA 2RM21 1IBLB 3ZHVA 1JN2P 3EHKA 2IJIA 5J2UA 5LOVA 2ZM6O 3ASOC 4FCAA 1JX9A 1QXPA 4ABMA 3LDRA 2VQEB 2A5ZA 4DUZO 3E8FA 4QJFB 4NKGB 1WMEA 1DZTA 3NJXA 2J1AA 2ZAHA 1OMIA 3O7OA 4LF8O 3E8GA 1HRI1 4UB8Z 5LA9A 3Q8AA 4O2AB 5ACA2 2D5FA 1QJU2 1O4YA 4C1WA 2ZKLA 5LRSA 4XBQA 5FZ1A 1GKFA 4LBOA 1AI4A 1DU3D 3JATB 1DQ2A 4WBBA 1E79G 4YY3B 4UV9A 2VZRA 3MPPG 2P3KA 1A34A 1UU6A 5A9GA 3DKQA 2XAJA 3CCUV 3EYPA 2BNMA 2DCTA 4OMCA 1PNLA 3T1LA 1L1FA 4H3WA 5DG2A 1RP3B 1ZSPA 3K0GA 1N1YA 4RQFA 2P22C 2FDJA 4TZDA 2YPDA 4L8QA 1TME1 4IGPA 2AGSA 1RHI3 1OSGA 5F5QA 3KGLA 1IHMA 1P4RA 5FL7G 5LB6A 2UU9B 5J48A 3W7SA 4AQ2A 1Y9GA 3PL0A 2C6SA 2Y6HA 2JDMA 4K9SA 1YIPA 3WB2A 3J4UH 3I7DA 3LIGA 2CHHA 5H2FZ 1ZBA2 3R0RA 4GB31 1W6PA 1ACCA 2DYCA 4QX3A 2IH1C 1L7RA 1Y66A 5LK5A 5LWBA 5LL6Y 3HQRA 5FZOA 3J7NA 2FCTA 4LLFA 4BMBA 2JRIA 1UO9A 2A6YA 4AHXA 4WV8A 1EV13 2JS3A 4QPGC 1HR0O 2ZE5A 1QOTA 3I97A 1RUI3 5C3OA 1TA8A 3VKNA 1KU9A 1VQNV 1X82A 2Y6JA 1XNTA 2PHTA 2CAUA 1K5MB 1G1XB 1AR63 3WP5A 3VKOA 5LA6B 3WUCA 5J2TB 4ZZ8A 2D6PA 3G7DA 5D5PA 4AVCA 4N7UA 2K2SA 2JXAA 2EJ7A 1AR71 4Y1ZA 3D3QA 1RXFA 3ZXKA 4JI7O 4KQ7A 1LHOA 3CXHF 1WB7A 3E97A 2QWNB 5JXGA 4XBNA 5T55A 3U14A 4AGRA 1BCCH 1G9AA 5I0RA 1SESA 5H9PA 2DYRB 3PHMA 1QOSA 2GH2A 3K5MA 3MHSC 1U0AA 3Q4HA 3USUA 3I2JA 4YW5A 4HKOA 1NCQC 1MVEA 4XHBA 2ZQMA 4LK6A 5LP6A 4AK3A 2AZ0A 3H3ZA 3VBFA 5T52A 3RZLA 4JI8B 1IBLO 3QO7A 4QNHB 1SCRA 2HHHO 5EJ1B 1F8VA 4RWUA 4Y33A 4XOGA 3N9NA 1JMKC 1POV1 2R071 4AHZA 5FNVA 2DJVA 1HRI2 1ND3A 5B4NA 2VQEO 4FP2A 5FP3A 1GBGA 4Q4X1 1YJWV 5LYJB 2EILC 4ONUA 4COUA 2ARBA 5I0DA 2NZ9A 1YF2A 3SH4A 3FD9A 4JC1A 3RNSA 4C7UA 3MUY1 1UX6A 5FPUA 4I4TA 3PIJA 4FO9A 4IEOA 4GZ9A 4GKYA 1NKGA 2F4VO 2W1UA 5FLXN 1IDSA 2OUJA 3MIGA 1DGLA 4K20A 4BA6A 1H6XA 5EYPB 4IL7A 1RYYA 4LT5A 3ES1A 3LSDA 2WLNA 2QUOA 3FYEB 1CWPA 1MMMA 4Q20A 1TME2 1PL0A 3ICXA 5C4WB 1JYTA 1YFUA 4KWUA 4YSFA 4MUVA 4IXLA 1US6A 2A0LA 4YJ2A 1G9FA 1UOBA 3N7MA 4LF4B 2AUYA 2BU9A 2YB7A 3OUHA 2V4AA 4KWLA 4DV2O 3N7JA 4H7MA 1X50A 1PZ8A 1N3PA 4FK5C 1KEXA 1XJAA 3OAAG 3B4SA 4AHCA 4FPCA 3H42B 4TUYB 3BPZA 5CU1A 2PHXA 1Y6XA 3T1YO 3F5TA 2WLHA 4GZRB 2LGWA 1OLME 2UWAA 2UYAA 2A06H 1NQDA 1OURA 5BZBA 2CDPA 1A78A 1XYPA 3WT3A 4LNVA 2CUGA 1OXCA 5L19A 3VBBA 5F3EA 2YXYA 1MSDA 4WFBV 2ZX4A 3G71V 3T1CA 2RE9A 4QU1A 4MX3A 4RR3A 3ZIXA 4LR4A 5IWAB 3H8UA 4S2FA 4I55A 2W91A 1RSOA 2WNOA 5DUVA 2FD8A 4LKEA 3HKBB 4IEZA 5FY9A 5L3EA 2HYXA 4BJ0A 1BK1A 1AR72 3DPRC 4YW1A 3EXUA 2IW5A 3ABLC 1W6NB 4WZFA 2A71A 5IY5C 2BZDA 2G9GA 4XDLA 1MS0A 4UBHA 5K0UC 4QD2A 2ZIOA 1RUJ1 1AXKA 1S72V 1PZ9A 5CMUA 3PNAA 2A3WA 3CL1A 5KAIZ 5JCOC 1EY2A 2KG7B 1VQ4V 5A6QA 4YGDA 4RGGA 2AEYA 3RPQA 3JQWA 1K34A 4CVUA 2B45X 3BPSA 3UKMA 2IXKA 4IHJB 3KD4A 3EJKA 4NVPA 1ZBE3 3C7EA 4MHRA 1H8HG 2JG8C 1JU4A 1V54C 3KGZA 2X09A 4CDWC 5J09A 3NW4A 5FYCA 4ASLA 3KHCA 5CBFA 3T30A 3SISA 4EZ4A 2BWAA 1VARA 3ZHRA 1Y9MA 3DGEA 5DZEA 1IG3A 3STZC 2W6JG 1OQ1A 4PI0A 4YWAA 4Q4X2 2WAOA 4GXLA 1POQA 1KXGA 4MS2A 3CMAV 4EZHA 3E22A 5B4XA 2F93B 2K1EA 2YHJA 3WQ1A 5A6ZA 5L9VA 1JOYA 3WCRA 4QAWA 1YUDA 2VMCA 1YC61 2HBUA 4KGQA 5JZGB 4BWAA 4MH0E 3D3IA 1V55B 1CQ9A 1EPWA 4P02B 1POV0 1Q8QA 2VZVA 1RUF1 5IK8A 4A6SA 5AC92 3ZFEA 2WLPA 4JF3A 5CEHA 2CV6A 1UFIA 4UYBA 3UKNA 1HDJA 5FXWA 3GZTB 4XEZA 2D6NA 2QQLA 1IS3A 4I02A 4BW5A 3OGIB 5FYYA 3U07A 4FJCC 3AVSA 3ZRVA 4DXTA 3ABZA 3K3WA 3AG1C 1CAWA 3EHBB 4WM7B 3MF9A 3UL2A 4L97A 2Y4TA 3FX3A 4QB1A 1FPN3 4A3XA 4AGGA 3QH7A 3W7XA 2EF6A 2ZCEA 1N8RW 4Q0UA 3ASOB 3ZJZA 2FBEA 5HV4A 1GMGA 5A7WA 3BOWA 1VF6C 2ZHNA 4DV6O 1UKRA 2J1SA 4Y26A 2QA4V 2R063 1FFXB 2EIEA 2ARHA 1RUJ2 2E7TA 2DQ3A 5H9CA 2R041 3HWJA 2DCJA 1SA0A 4JDNA 3T08A 2D6OX 2YZ4A 4CDXA 1QH6A 1XMOB 1R3KC 1LB2A 4DV7B 1I6XA 1M4WA 4U7NA 4LUKA 4DR1B 3HJRA 3A23A 5K9YA 4IEUA 3OEAA 1Y7BA 5KMGB 1P7BA 4MXWB 4URAA 3WG7B 4UCVA 4I0AA 2IJKA 5FMCA 1MABG 2RG4A 2OCCB 2V1DA 1MQTB 4J41A 1GTOA 4ZONA 1UZ0A 5CIRA 1RGSA 1W0NA 4LBQB 2QWRB 2WLKA 4XQ4A 1LNSA 1WJZA 3CCRV 1HP8A 3FX7A 2RMKB 2VMDA 2R9RB 3I2HA 2YEVA 4FQ4A 5FPRA 1DYOA 2PYLA 4EKWA 3WB1A 1NH2B 2BTOA 4RA0A 3CEIA 4IEQA 3VKLA 1OI6A 3I59B 4NTWA 2BOIA 5C3QA 4UUJC 1AJPA 4AOCA 1VBE2 4IGGA 3POIA 1TMF1 2JIGA 4F6RA 5L3BA 5CA3A 2JE8A 4WFEA 4LE4A 3RMYA 4FVVA 4JKLA 2QQNA 1W39A 2VRZA 4CBCA 4C8DA 4QPGB 1EZJA 1DQ0A 1R73A 4X20A 3MPBA 4GWNA 3ZN0A 3NNMA 5LRRA 3ZYIB 4K1ZA 4FI9A 2WNUC 3ZEDA 5B1BC 3GJBA 4N53A 5EC1C 1UPIA 1W6OA 4KNCA 1I94B 4QE9A 4G2KA 2WUHA 3E83A 4N8MA 2VJXA 5BNNA 4XUQA 2GBOA 1AL0G 4RHV1 3LWCA 3HNYM 2WT1A 3JARB 2AHYA 1UF2C 5EJZB 3MD0A 5BY1A 3R65A 4QKDA 3ACGA 2R6QA 2XT9A 1SQ4A 4I0WB 4XFBA 5IK5A 3JBG1 2XVKA 2I74A 4HG6B 1DGSA 4UVCA 4CUBA 3OYWA 4AFBA 1NCQB 2P6JA 2I45A 4MGSA 2VCAA 4ZU4A 4QPIA 3WDWA 4F4LA 1VBA3 3SH3A 1W28A 3LSQA 4Q4W3 3S7IA 1VBD3 5HCFA 4K7JA 1QR9A 3OGSA 1SHWB 2X29A 3WV6A 1I5YA 5KAFZ 4XE9A 2VQUA 5ABJB 3I3EA 4MVQA 3THDA 4YZ2A 4Q4V1 3SEEA 4JYBA 1HXS1 3H7JA 2XTAA 4CU6A 1BGYH 1N47A 3N9QA 2W46A 1WMFA 2FDIA 1ZREA 3L72H 3H1KH 1H2MA 5CB4B 2IWGB 1NXMA 1CXZB 1CPNA 1WD4A 4QX5A 1PL4A 2IBZH 2K9ZA 2C2AA 5JVDB 3PU3A 3X2QC 4XJ9A 5F5AA 1AYM1 3C8XA 5JQGA 4FFFA 5F2WA 4P9JA 4YJ3B 4DV7O 2UUAO 4DR1O 5TSWA 4XABA 3U11A 3WW4A 5IFPA 2BCCH 3OMNB 5GLUA 5D21A 4QX1A 1Q8VA 5J37A 2BRTA 3OEBA 3ZMVA 3FHQA 1H8VA 1X33A 4DXSA 2ILMA 1XI1A 2WNVB 1BEV1 2A7WA 4QGNA 2IU0A 3ZKYA 2XOMA 4NTXA 3RMXA 3K3OA 4UXNA 3GZAA 4A7YA 4XBFA 3AZZA 3LAGA 4B3NA 2AGAA 4JI0B 5SV5A 1TMF2 1DIWA 4HPKA 2ZE6A 3D36A 3SPGA 1PIV3 4YIOA 1DDLA 1WW5A 1YTFD 4EWAA 1LKNA 1OD5A 1QJZA 5FO9B 2PLV1 1JUIA 5CG9A 3KCYA 1O4TA 4LF7O 4KU8A 1B6QA 1D2DA 4J7JA 2VS0A 4HANA 1WD3A 2W94A 3AX4A 3CSXA 3MV01 4XIKA 3RI8A 1PGW1 3ETQA 4WBNA 3WEZA 4EJRA 4LBEC 4FOYA 5FOBB 1AJNA 3ABLB 4RHV2 1YXBA 1JODA 2VWJA 1XBLA 2YUEA 1GOFA 2VU9A 1ORQC 3WHTA 4M3CF 4D3WA 4EN6B 4O2AA 3Q8FA 3PUHA 2PAKA 1BL8A 3B40A 4JI1B 2Q5TA 1XNCA 4PA9A 1CIWA 3KVBA 1ND2A 3HB3B 2W1WA 5FK8A 2D3OW 3ZVXA 1DFQA 3VBUC 2VPVA 4R8HA 2JG8B 1PP9H 4DW0A 5A6XA 4DUWA 1V54B 2ZZJA 4PV1B 4CDWB 5ISLA 1JYCA 1PO11 2WL1A 4DV3B 4YZ3A 3HQUA 4L99A 5A1AA 1J58A 2NLRA 2ODMA 4I09A 1MZ5A 1TEIA 4Q4V2 1H2GA 4KMQA 1HXS2 2ZGTA 3FJSA 1F35A 2P4EA 1VBC1 2E26A 5FZ4A 2VM9A 3ON7A 2ZMKA 2WA4A 5BMVB 1JPXA 4DPNA 1O5LA 1M5IA 4GX5A 4AI9A 1AR81 2PAMA 2A9HA 4XUOA 2CWSA 4XXPA 4TLGA 2DWEC 2J1EA 1UPSA 2W52A 1AYM2 3W5NA 3QCWA 4LKSA 3DECA 3ALQA 3OF1A 1YO8A 5F3IA 5CKMA 5JSOA 5FV3A 2V5DA 4QHZA 4I30A 1NAEA 3ZXLA 4IGQA 2PN5A 4E2QA 4BQ1A 4B3RO 4X1KB 3KV5A 1W9TA 3CC4V 1WA6X 5LA6A 5IFTA 4MG2A 5JUVA 1BT8A 3DC5A 1N3QA 4Q29A 2XBO3 3R6SA 4EN9B 1AR91 4PDWC 2KM2A 2W0FC 1W9YA 4JI0O 1OOPB 5T5JA 2JDAA 4JZ2A 3AG1B 3ABTA 2XLFA 3TEWA 3PMSA 1AI6A 1OV9A 2J42A 2H3OA 2PLV2 4CTEA 1KECA 4CS3A 4DRXB 1NBMG 1G86A 3CRCA 4JTOA 2PQQA 2GC3A 4FLYA 4Q27A 1NR1A 5C3SA 2A75A 1QDOA 1WCUA 3PMEA 2W9XA 3GJAA 1F5FA 4EEQA 1JZ7A 1YRZA 3KMHA 4A7ZA 5C8CC 2W39A 1VP7A 3KZ4C 4EN0A 1PNFA 2EAKA 1HNXB 1YJKA 1GWLA 1ULDA 1K12A 1GN2A 1NZ6A 2WC2A 3GNEA 1KITA 2IXLA 3TEXA 2MEV1 2UXDB 3LB9A 5EIBD 3S3XA 3LEIA 3VQWA 4QX8A 1XU2A 1ZZCA 3W7WA 2NN8A 5LA2A 2GC0A 2CDYA 3PTRB 1C1LA 2JGDB 3IC9A 1NZCA 3THPA 1K4CC 1RMU1 4CDUB 2UXXA 1XNQB 3AFKA 2YC0A 4JI1O 1GK9A 2B1IA 4O4HB 1K5QA 5JOWA 2EIKC 1H1IA 1O9GA 3IIIA 4TV9B 2GMPA 4FXKB 1SS3A 3GZUC 3GBFA 1X4TA 2WINB 3MICA 3F7VC 1RHI2 5C4WA 2Q7GA 1W8WA 3WG2A 5GTIZ 2WO1A 1CAUB 3JAWA 2Q67A 2B9VA 4DV3O 5D2AA 4AQSA 4QXHA 1VAKA 3VHNA 5C71A 4K0KB 4LK7A 2YIBD 1BVP1 2V72A 1E5IA 5CB7A 1YQ6A 3I2FA 1US3A 5D5QA 4TV8B 2EJRA 1ODNA 2XAQA 3SYPA 3GXUA 1ZAUA 2DVDA 1FMD3 1V6LA 2E32A 3H01A 4UFIA 2YBPA 4TUYA 4TQDA 1WCSA 3BU0A 4KL1A 2WBKA 5FY5A 4ZU5A 3VBOC 2EXJA 2DWRA 3A22A 4WFFA 4CH6A 1NLQA 1CGPA 1BHGA 1IX9A 2C24A 4HSLA 1AR62 1QHDA 2QDOA 3T0BA 3A0RA 4GMP3 1PPJH 4L8JA 2D43A 4GAZA 3HKBA 2Y6FA 1OQEA 2KR2A 1AR92 4FAHA 1WW7A 1GP4A 1YQ5A 2JS5A 2UWBA 3H1IH 2OX0A 3FFQA 4HZFA 1LHWA 4DR4O 2KD7A 5AFBA 5JMCA 4ARXA 4DB5A 3LA2A 1QJY3 2KG7A 1OFSA 2ETEA 4XDPA 2GDFA 5J9PC 3BTXA 3JQXA 1IGOA 5F6LB 5GM0A 5E6HA 5CKQA 1EN5A 5A32B 4IHJA 3X29B 5A3UA 4GKJB 1EN4A 1GM7A 2R9AA 4DINB 4D69A 1PNMA 1BKZA 3SITA 4YHHB 4AI3A 4WF9V 5FYBA 3ABUA 1UNBA 1O3QA 5B1OA 3ZSJA 3I55V 1BQPA 4LFAO 4UFKA 2ZGMA 1UOGA 5BPXA 2BVVA 1HNXO 2FDFA 3K5OA 2C9KA 4JRLA 4JGYC 2AXTZ 5CFCB 2XJUA 1BE3H 3WZ1A 1DLCA 5LK7B 1MA1A 2WFF1 5J7MA 3X2QB 4LF9O 5KLVH 1ALYA 4W4ZA 2B8MA 1DCSA 2PQSA 3NNLA 3HT2A 1W2AX 3M3QA 1W9WA 3MV11 1BXHA 1KDKA 1S4CA 1CESA 3QO5A 4CCOA 3T4ZA 1NA1C 3GF6A 4NROA 2CNAA 1W8UA 4DR3B 2X5IB 3LFMA 3AYDA 2XJTA 3TNQA 4CP2A 4FTSA 1RVF3 3BODA 1WKYA 3ME2A 1Z0HA 5A3LA 1XE8A 2ZR2A 2EAAA 3F2ZA 4DY5A 2Y48A 1RUH1 5DXDA 4AYUA 2Y6KA 3R4SA 1W0JG 2BFUS 1G9DA 3OBZA 4YM3A 4FP3A 5IE9A 1NE4A 3UM7A 4XF9A 3RJ2X 5FY8A 2CYFA 3SPIA 1S2EA 4JHTA 1DYPA 5JWPA 3O1PA 2WZPP 3C7FA 4G3YC 1GFF2 2YV8A 4K0KO 1QQP1 2JG9C 5FZGA 1GWMA 2GNMA 3LDEA 1FXKB 1MS4A 1MG1A 4GMP0 1KDMA 3CMGA 1LOEA 1WP8A 1NYWA 2ZDIA 3FAVB 5A3TA 4X66B 3W7TA 5LGNA 4N9HA 4WM7A 4E4ZA 3VZMA 3OR6C 4N21A 3QH6A 1B09A 5B2GB 1JXNA 1VQ7V 4XFIA 3TEZA 3AG2C 2ZD9A 5EK0A 4IERA 3KF5A 3BALA 5BNPA 1YIJV 2A73B 2VH9A 2N74A 4AFDA 3T0AA 2B1GA 1RUE3 4Q8LA 1Y4WA 4KHPB 4S2GA 2BGOA 5DABA 3VOUA 1GICA 3BHPA 3NNGA 3KZIZ 4PD4F 1KP3A 2EBOA 3DXRB 3GWKC 2WS91 4B3TO 1IKPA 5HXVA 1Q6UA 4D6QA 4ICGA 3POFA 2LRPA 1W2NA 1D5AA 4J1XA 1NU1H 1KKCA 5BNOC 1AYN3 1H2KA 3BN6A 5FZEA 2NN4A 1IBKB 5HI0A 5FZBA 3VQXA 3A0BZ 5KMGA 4YVWB 2IM9A 4MXWA 1U96A 1DQ4A 1W3VA 3J7HA 4TWTA 1DF4A 1HWYA 2E3CA 2WJSA 1GAXA 3H1WA 1LGNA 2ETNA 3OTOO 3POGA 1MQTA 3VBHC 1XQNA 3OGGA 4Z1VA 5H6RA 3LNNA 1BBT1 1OVPA 1J5EO 4RQEA 2VTXA 4LBQA 3FB5C 4WCEV 5IVEA 4G27B 4GKJO 2A3YA 4WVMB 4DK1A 4A4AA 1PGL2 4YHHO 3H3LA 5I0UA 3N2GA 3RZZA 2VOTA 2JECA 4X1IA 2VD7A 2PHFA 2ZAAA 3BUCA 1JYVA 2XH6A 2VTFA 2E63A 2Z42A 3I59A 1UOFA 4P00B 3I3DA 3T2QA 1LGBA 1QDCA 2QEXV 3VD7A 1W0OA 1J1TA 3LPFA 2Q30A 4AFAA 3H7YA 3EO6A 2H6BA 1O59A 3ELNA 4QPGA 3Q8CA 1JCHA 1OCCC 5FP9A 4X1YB 3ZFFA 1R1A1 4NHKA 4MGIE 2WT0A 5FPBA 4JYCA 4GX2A 2LS6A 3QG5A 1A6CA 3WW2A 1JQ0A 1K45A 3BB6A 4ZU7A 4DR3O 1NT0A 1CD3G 4NWVA 1JA8A 2OIIA 3CQOA 1RUH2 1TUBA 4XUNA 1T6BX 3MDPA 4MHUA 3FZ3A 5FYHA 1YCIA 4PDWB 1QQP2 1JOJA 3JARA 2VUJA 2Q8EA 4LO5B 3Q8EA 1ZX3A 4QX0A 5FWEA 3HBZA 4QWNA 1M57C 2LROA 2FHRA 4MTFA 4ISQA 1GR3A 3CCQV 4QHBA 5CFDB 4LC1A 3N3HA 3CNAA 2B7YA 3ZDSA 2B5HA 1RUG3 2YMZA 1NCQA 2Q5ZA 5A7OA 3S5AA 4B3MB 2HJDA 1FV2A 3LDCA 2HWF1 2WSVA 3PJQA 1OCOB 5LASA 4AEDA 1YZBA 1PO23 5FZCA 5C8CB 1I3HA 1ULPA 3VZLA 3ZDVA 3MAQA 2WYFA 1N33B 5BNQA 1SQQH 3CCLV 3N7LA 1THZA 2R062 5FR3A 2JJ6A 2BSKA 2DYSB 5FZMA 5ABJA 2WS92 5KR7A 3FE5A 4UF0B 4MTGA 1V9U1 1BS3A 5L3GA 2ZEXA 3IPVB 3BTAA 3KSCA 2DMXA 1OC1A 3IFXA 4OPAA 1C5HA 4OX9B 2TEPA 1XBFA 4MOAA 5F9TA 1GH6A 2Y4UA 4LFBB 4BB3A 3NAPC 1R093 2ADDA 1C8M1 5GKAC 3W7UA 4L9BA 1JYIA 4NPMA 2EIKB 4DYLA 1P49A 1GU3A 4HKWA 4CA9A 3WR0A 3RT3C 2LTNA 4QGMA 4OUEA 4R9AA 1LEMA 4E8CA 5JJEB 3K5NA 1OUSA 4UW4A 1V6NA 4EN8B 4EQVA 2WNVA 1EFRG 3ZR5A 4DUYB 3UNPA 1Y43B 2ZHKA 2VNVA 1XNBA 4O9EA 2M7WA 5IJ9B 2WZ8A 4DV4B 1ULOA 5LW9A 3O14A 4GKKO 3A2FA 3IB3A 1O6UA 2DTYA 1Q8SA 5A6YA 1CZVA 1REFA 5C3RA 2AR6A 1LU2A 3VDCA 3FMGA 4I50B 1Z7S3 5FYUA 5CVRA 2L35A 1O3TA 4RQPB 1LR5A 4FZ0A 2OTLV 1QNWA 3OBTA 2UYBA 1V6OA 2RJ2A 3DV8A 1NE6A 1PVC1 3G6BA 2A70A 1ENVA 2OYZA 1GZWB 1ZTEA 3JASB 3WG3A 2ET7A 1SQVH 1MOFA 4LQRA 4OI1A 1ONAA 1F31A 5FCCA 4QX2A 4BDVB 2KB1A 3H1LH 2CWMA 5LZ6A 2OQ7A 1D4M3 2Q7EA 4FLWA 4KXRA 4LKFA 1FI2A 4OLLA 2HEPA 3FB7C 3ZXEA 1KBHA 5CA1B 4Y1YA 3JZVA 1U5IA 3KB5A 3MZHA 2KQXA 4FLUA 1C8NA 4O61A 5LEKA 4Y5Z0 2Z69A 5K8SA 4Q4W2 3I5DA 1OBNA 3M3IA 3N7KA 1VBD2 2WIIB 3J80N 2VW2A 4N23A 2JG8A 4JDMA 4J1WA 5FOJB 2P4KA 2NP0A 1WA8B 5LBEA 4CDWA 4B3MO 2VY0A 2PI5A 3UT0A 2W68A 4LHNA 3WP6A 4Z8BA 3VDDC 1ZWIC 1U5XA 2HWD3 4NN0A 1J84A 2LM3A 2ITDC 4CXXA 2PAEA 1S3JA 1N33O 1FPOA 4B7EA 4CCNA 4JGYB 1AJKA 2ZEZA 3K08A 1RUD3 3CDZB 3WF3A 1R6TA 5BMVA 4O2BB 3J8F3 1SQXH 5FPZA 5CG8A 1KRIA 3FUOA 2VC9A 4MT8A 4CH5A 3QOPA 4IE4A 4Q4Y3 2ZX0A 4F83A 3HPLC 5EXOA 3WF0A 2XJQA 4OX9O 2C4XA 1Y9QA 5IJ0A 1DLLA 2Z5WA 4CXWA 4LBLA 4EWEA 1NA1B 4LFBO 2OS2A 4XFGA 3WDXA 2P37A 4RN5A 2P67A 5C5UA 1ZRFA 5A3MA 4MVUA 4FFBA 1HJFA 3TN93 3B93A 1HRV1 2V4DA 4X1KA 2BVBA 4IIJB 2XHKA 4JHZA 4YW2A 4IT5A 3OMAB 5KWRA 3B7MA 1WP7A 2RQ6A 4XC9A 4O4IB 4JI2O 4PELA 1UYXA 3JCZA 4R9BA 1SCSA 2F66C 4U7OA 1COV3 4PIXA 5LATA 4LWSB 3EFFK 4DUYO 1N3OA 3KWVA 4CCMA 5GTHZ 5HFMA 3IWZA 1UPGA 3E5XA 1AB3A 1COWG 4Y1UA 1XNRO 3TK1A 1DHKB 1PIV2 1LHNA 3ZS8C 2X53S 1OOPA 3MFCA 1V70A 1ZA7A 1LUWA 3O1OA 5H9QA 4AAXA 4F7ZA 1K4DC 4O9GA 2RNBA 1CEZA 2B4KA 1IKQA 4DRXA 3SHRA 4XIOA 5I0TA 3AG2B 4A41A 3A21A 5LGUA 3S5QA 2PHRA 5FQ0A 5CAZA 5C70A 1SRYA 4HVRA 1IQDC 4WVWA 2EIMC 2ZNIA 4I7ZB 4JGZC 3SJQC 2XNDG 2RS31 2CSGA 3ZYHA 1AL23 2W6IG 3T4HB 4Z2WA 4HN0A 1H9PA 1O3RA 1IBMO 1QJX1 5C7GA 3J7MA 2FDKA 4E9KA 5F7UA 2XMLA 2NQYA 1IVSA 3ZRSA 4Y5SA 4K1YA 2E7QA 2ZGPA 2YPJA 3JD4A 2EVXA 4W65A 1MR5A 5BNOB 4FPHA 1JZ4A 1BMFG 2QQUA 2QQKA 1KFUL 2RS13 2JGDA 1LHUA 4KWJA 1R081 4OVEA 4CDUA 2B39A 2GZWA 1UMIA 3AKPA 4KWKA 2W95A 1H8TB 4L87A 4KI5M 2YU1A 4O4HA 1D0GA 4COYA 2K46A 1LOFA 4RL7A 4YZ1A 1GWKA 3VBHB 3T4VA 3ZSKA 4TV9A 5HCBA 4XDOA 1B35B 5DZFA 5DAVA 4FFHA 1VEWA 3AMHA 3N36A 4XCBA 2HP8A 1W9FA 3EMRA 3V0AB 2GC2A 3LEGA 1CAUA 1LRHA 5FZFA 1YTFB 2RJLA 4XPVA 4FAGA 4X64O 1RUC3 3B8MA 2VNRA 2ZHMA 2HWE3 4ASMB 5A1FA 4TV8A 4NRMA 4J80A 1QLEB 1OCRC 2JD4A 2RR11 1Q82W 1W03A 2JEMA 2O8OA 2GNTA 1S0JA 2HLEA 3HKEA 3OW2U 4NXMO 1OCCB 1ASJ1 5JXJA 1AXYA 3ACLA 4JI3B 2ENRA 3I3QA 4P08A 2CH7A 1O4ZA 4YIPA 4UBGA 1HNWB 3APQA 1W8TA 1UXZA 5T5OA 3WF4A 4XF1A 1EAH3 2Z3YA 1B06A 1HRV2 4ASUG 3AKRA 3E35A 1XXNA 2PHLA 3CXCU 1XL6A 1GNHA 1P8JA 1N32B 2KSDA 4WM8A 1F23A 1WGPA 5GZCA 4MXVA 4DV5O 2XBO2 3LDBA 3H1MA 3L75H 4P9XA 3RWNA 4IEVA 3DC6A 2JDZA 1YIFA 3W20A 3IJ4A 1CVNA 4UXAA 3JCIA 2YC2A 1SLBA 5IWFA 1QOOA 3AP7A 2HEYF 3VD5A 3ZN1A 3OGRA 1AX2A 2P6CA 1KYOF 1RITA 3P6BA 4B1MA 1F7YA 4AILC 5KX5B 1CZTA 3NNJA 4QT6A 2Q73A 4QPJA 4UI9L 3V56A 2L9LA 3GCXA 3KV9A 5A32A 2QKCA 2YYOA 5EYXA 1VPHA 3G67A 5DM6V 1F5JA 2RS32 4JAUA 4ES9A 4IV3A 5FPXA 3FKSG 3T1HB 3SDLA 1HIXA 1QJX2 2Z2SB 3JAKA 3O0XA 4LO6B 4MW8A 1N4CA 2YI9A 1HN1A 4W4LA 2Q1MA 5KUKA 5CFCA 5LP6C 1YXWA 3ZXJA 3VBFC 5FBZA 5K4LA 3NAPB 1G4YB 3BVOA 3U0ZA 3ZHTA 4EE2A 1VE0A 4CCKA 1R082 5BXZA 3AM2A 1TVKB 4MGQA 1WZXA 4XF4A 3TXSA 1LR1A 4Z1MG 3PJSK 2R70A 2HEVF 5IATA 2HWB3 3WNLA 3JD71 4CUGA 4QQOA 1VIWB 2EINB 1VRH3 2X5IA 3SCGA 5FUNA 2JD9A 2JIZG 2QJ1A 3N9PA 5B1NA 1TUEB 5GLVA 1XYOA 3WY6A 2WWUA 2FYUH 5DAXA 1DZQA 1CONA 4PIZA 5A7QA 3IDBB 2ZM6B 2Q69A 5J36A 3HAGA 2BERA 1MEC1 3P5BA 3EB7A 2DUQA 1FMD2 1HKDA 4M3CA 2BTVC 1TGOA 4LF8B 3W9AA 1MZEA 3SKVA 3B5LB 1IXBA 1FXKA 3L9DA 1UIKA 2WZR1 3MYXA 2A1XA 1ASJ2 4I0XB 2JDKA 5LEJA 3WQBA 3SMHA 3AFGA 1OD3A 3T09A 5DAWA 1NCRA 3PUQA 5ACA1 4AGVA 1G8MA 3A0KA 3BVCA 3W21A 2X6AA 5F5CA 3OM3B 2BGPA 2Q6AA 4COWA 2QM8A 5JJJB 1HNWO 1PVXA 4UVAA 4FTEA 5JOYA 4DO0A 1RC6A 4BR6A 4PLOA 1D5NA 1N32O 3DCQA 3HEIA 4Y3OA 2W47A 3GM8A 4X89A 3T4DA 3K9SA 1WNSA 1T2XA 4OQ9A 4NHLA 1AVMA 2XQXA 2AHZA 1VAVA 1YQ2A 4Q0PA 1G8WA 1XNAA 3ABKC 1E1QG 4O4JA 1O91A 1OFNA 4YVWA 4JTDB 4J10A 1KQSU 1S0EA 4R4XA 4GD4A 3JAMN 3I49A 2W87A 4QX7A 3LOBA 5F3GA 3NSTA 3AP4A 3Q8BA 4DNYA 4GJZA 3S30A 2GC1A 2ZGKA 2EULA 2VMEA 1OJHA 1UWWA 2VTXJ 3BA8A 1PK6B 2GTAA 5GONB 5FUPA 3OMIB 2OYQA 1QJU3 4WVMA 1BHBA 2ZGOA 4YG3A 3UT5A 5DG1A 3WG4A 1SZXA 3T1HO 2Q8DA 1YJNV 1W8NA 2XASA 4ZOLB 2ZX3A 4AR2A 5KUMA 3SPHA 4BMEA 2YIAA 5FZ3A 2UUCO 3CPWU 4JI7B 1GNZA 2Z4FA 4Q0SA 3WP3A 4L2NA 5DDJ3 3OUFA 5A3PA 2RMU3 3PDQA 5JCTA 4V2WA 2P06A 1TZOA 1UX7A 1KFXL 2RN9A 1OPMA 2Q8OA 3VZOA 2A6WA 1LAJA 4PLNA 5FYIA 1OLQA 5FZLA 4X1YA 1GM8A 2MPFA 3IN9A 1KGYA 2VCBA 3I3MA 4OHVA 3RVHA 2IJJA 4R50A 4FQZA 4LA2A 4TTGA 1G7YA 2RDNA 1WN7A 2HJFC 4PCRA 1Y74B 3OUSA 3U1XA 2VR4A 2R1DA 1ZBA3 1L7LA 1XE7A 5EPAA 2HHHB 4PDVA 5B3SC 4EB6A 1WPXA 1MEC2 1RPOA 2WLIB 3RYHB 3RGBA 5GZEA 4URTA 1DZRA 2CTVA 1P7GA 4UCTA 5CA6A 3ETPA 1VQ8V 1JFFB 1AJOA 3CHXA 2AACA 4NRQA 2WZR2 3T0DA 3HN3A 5CFDA 4FT8A 1FOD3 2Q0OC 3VHPA 1JMUB 5LA1A 2VULA 1V00A 4UFJA 4YVSA 3P1IA 4TSVA 2F4VB 4RAIA 1F4MA 4AHWA 3MO4A 2LFRA 3B09A 3I3BA 1OHFA 1SZBA 1N1SA 2R72A 5C8WA 1HN0A 4HVQA 2VVDA 4JGZB 1RUE2 2Y0OA 4HLTA 2Y8KA 2FQPA 4QGLA 2YXSA 2X10A 1NTZH 1H2NA 3T3YA 3PUSA 2ORZA 2VVEA 4CDQA 5F3CA 3AG3B 1HV0A 5C9AA 1OCZB 1A8MA 4UF0A 3AZVA 4Z92B 1W0KG 4PDLA 4DV2B 2RM23 1PZ7A 4YGEA 5LGTA 4AI0A 5J2UB 4CYDA 1XMQB 1GRJA 3BABA 4KH9A 4DR2O 3WB0A 4W6XA 4YRDA 1UQXA 2N04A 2G9FA 5H6QA 4UW6A 4XF0A 3T1YB 2HKXA 3WW3A 4PDRA 1KS4A 1NTKH 3CS5A 2BDRA 1IURA 5C33A 3ES4A 1K42A 1F15A 4O7XA 1F9KA 1PX4A 2O57A 3FLRA 1PHMA 4MW3A 2PYTA 2CGPA 1B04A 2UU8A 3I8TA 1HRI3 2GMMA 3E89A 4HL0A 5FXXA 4CDXC 4WVVA 1YFYA 3M8LA 3RWRD 2QNKA 2VZSA 5FXVA 4CP1A 5LCWL 2J1VA 3O1RA 1HX6A 5IJ9A 4PBOA 3SLIA 1S5LZ 3NRUA 5JDBA 1MS5A 2OPKA 5D8AA 1AZDA 5L7OA 1QVGU 4PF5A 1NT2B 3VBSB 2IFWA 4N43B 2ZXQA 4XZUG 2OT5A 3QLQA 3MLKA 1RUNA 2QFEA 4I50A 3NVCA 1TME3 3BIWE 1VQ5V 4RQPA 3MGUA 1QQCA 5CBHA 1TE1B 3L73H 1LGCA 4Y22B 4XACA 2QDRA 1WMXA 1W05A 3RVZA 3STLC 4NXNO 3JASA 2PXJA 1PD3A 2ZOEB 2OVUA 4GB33 3ZRXA 1W8ZA 4I0BA 1LOCA 5FZOB 4ES8A 3GZEA 3HT1A 4B7KA 4R8CA 3GHNA 1VQ6V 4JASA 1CX1A 4GIQA 4TXWA 3UESA 4LOSA 4EYUA 1FNYA 3IBMA 3AK2A 3ABMB 2VOVA 4ZKTB 4OHWA 2DCKA 4N53C 2FZ2A 5CA1A 1Q90D 1DK1A 2QZ2A 1XEQA 4BAYA 2XL7A 4H0LB 3DEMA 2QQIA 1GN3A 1OQDA 4LHKA 4BIUA 2Q1FA 5BNNC 2LGQA 2D3SA 2NMNA 1GUIA 1AR73 1PO22 4Y5TA 3VDAA 2UWCA 1WA8A 3LDDA 3ZFGB 4KG0A 1UY4A 1HB3A 3OGVA 3M99B 4MTXA 4CP9B 4S2DA 5E79Z 1R6NA 3UKTA 4YFZA 2XJSA 1HB1A 1YITV 4JGYA 4QPIC 4OHYA 2DBIA 3OJBA 1LOBA 4DY3A 4JV5B 2EIDA 5HV0A 5AC91 2IXCA 4AVAA 2OQ6A 2ZACA 4CZZA 2DW4A 1R092 3AK1A 4DFSA 3OD4A 5A70A 3AXEA 4XETA 5ITZB 5LHGA 1POV3 5FNVB 5E88A 1XMQO 2R073 4C90A 2DU1A 2W92A 2ZHLA 3CKHA 2W3JA 4IV1C 1BZWA 3KG2A 4Q4X3 4N7IA 5FWJA 1O5UA 3URFA 3HBKA 3UCSC 3WOGA 2QVSB 3HMYA 3DUIA 1FT9A 1MVQA 1WLWA 1YFXA 2X6BA 2HR3A 1R1BA 1VIBA 3CU7A 4LLOA 4DV6B 4ZXEA 1SPPB 4GKXA 4DXZA 4LWSA 4BZ4A 4IYHA 3IDCB 2JE7A 3USSA 1DQ5A 3ECQA 4CEYA 1WMDA 2GUZA 3VBRB 3VHRA 3FFZA 5FPLA 3B01A 4X9QA 3M4FA 1Z7S2 2CU5A 2RJZA 1RTVA 1WLEA 5FP8A 3NO8A 3ITQA 3WX5A 4A42A 3JD3A 3WVJA 4TSFG 1AP6A 2EZOA 2CGNA 2XLGA 1CAXA 4XUTA 1ZRDA 2BE3A 1FV3A 3H8RA 1NY72 3AK0A 4QXCA 3SJCC 4OI2A 2JDYA 4XCAA 1WBFA 1XOYA 3A0NA 4OFGA 3D36C 2HWC1 2XUEA 1Y76A 1NQTA 4XJZA 5FMOL 5FYTA 2OXBA 2W1QA 1C57A 3D4KA 4XDQA 3OPWA 3TOJA 4A45A 4HMZA 1VQOV 2BP6A 2IXJA 4U36A 1QY4A 4DO2A 3BCWA 3PURA 4JTAB 3TETA 1V0AA 1ZM1A 2AEZA 2ZBJA 3VGIA 1WWYA 4INDA 2ZR3A 1JU3A 2J1UA 4R9CA 3VDBA 4I55B 3I2GA 1RSOB 1FXHA 1UZVA 3GCWA 4JI5B 4OHXA 5EZYB 4DV0O 1AR5A 3I2KA 1H8TA 4NRPA 5DN2A 3GALA 1VBE1 4FSJA 1ZYBA 4CUAA 3DKWA 3JSLA 4COZA 1VMGA 4B29A 2YSUB 3VBHA 3AC0A 5GLWA 4LF5B 5CISA 2K0GA 1JTZX 1B35A 1J83A 2CK3G 1RUJ3 2F95B 2HWD2 4RS5C 4PA4A 2OCHA 3ZX6A 1AJQA 3KQRA 4R6ZA 5FPOA 1GANA 4HVOA 2F4LA 1JZ8A 5A33B 1L0LH 3V0AA 1X7NA 3B3QE 4P9LA 4QPYA 1RIRA 4O65A 3AKTA 3K03A 2HEWF 1ND2C 1YQ8A 3SJAC 2VUCA 2VL4A 4MLOA 3VB9A 1OH3A 3J8F2 4Z2AA 4QM8A 2YUAA 4LITA 3RZHA 1R6KA 2W08A 4CC5A 3I2DA 1QR8A 3M8AA 5F2SA 2XB6C 2XLAA 2HYKA 4P30A 4JV5O 3ZBHA 2DN9A 1OVSA 1AHSA 3BCCH 2BOCC 2ZGRA 3RDIA 3CLPA 4BQ2A 1JH5A 5EBWC 2FTKA 3S0MA 4CRQA 3LF7A 3V64A 4MV2A 2L6LA 3H9VA 5L36A 4FXGB 3VKFC 1XE0A 4LNUB 2D44A 4GA9A 2A6VA 5HCAA 4JI4O 4BOWA 5G05L 3E22B 2QKSA 3M70A 2ITCC 4CPBD 2P5BA 2BTQB 2F4PA 3C2UA 4G9SB 1M90W 1IS6A 3RZMA 4JPRA 3QO8A 2R30A 5I91A 3POWA 2Z5UA 3J7LA 4P9YA 4IEWA 2VO5A 1UJWB 3K4ZA 5EQUA 2ZGNA 3JU9A 1EBOA 4X8NA 4FFKA 4HYOA 5JXIA 3LEKA 2FDHA 5EHDA 4K35A 4UCUA 4LIUA 5AG2A 4DQAA 3E1F1 1RUF3 1Y4MA 1XQ8A 5KX5A 2HLDG 1YNAA 3E6BA 3APOA 1PMJX 1F2NA 2LW8A 2UUAB 2RS51 2GP3A 3E6DA 1XHZA 3NV2A 4YG6A 3CCMV 3ACHA 2WLQA 5E89A 2VZ1A 3WNPA 3H50A 3FN9A 2HWC2 3OSDA 1WLTA 3U75A 1CAWB 1K8AW 3NV1A 3UYJA 3ZPYA 2ZMNA 4XHXA 2DOSA 3RSJA 5EBLC 4XDJA 1H6YA 3PVOA 3CCJV 1S2KA 3M3EA 5JSRA 2E33A 5IYDO 1UIJA 4RFRB 5FZKA 1VQ9V 3SGIA 3LGRA 2NR5A 3ZYFA 3N2KA 1H30A 3NAPA 1VF5B 2QKAA 4ZIBA 1SBFA 5A7WB 4LTAA 3K2OA 4EWDA 4MGZE 1TVKA 3F7YC 5IUQA 5APAA 2HKOA 1DQ1A 3OT7A 4DUVA 5FYZA 5A3WA 4JI5O 1W8FA 3C7GA 1QHTA 2WO2A 1VMFA 2Q0AA 4LF7B 1ENXA 4BK4A 4NUBA 1SA0B 5FMOS 4CDXB 1Q3EA 2H0VA 2R043 5C8YA 3RVYA 2JENA 4LF5O 2WLLB 1RUC2 4NIGA 5IDJA 5JR7B 2E74B 2HWE2 4UAPA 3SCFA 4BIOA 4BQ5A 4AQTA 4DS0A 2Q1ZB 1CP9A 4YW6A 4DK0A 2VW0A 4C0HA 5HPOA 3BYWA 5GZGA 3PIGA 5KBFA 4HONA 5EC2C 2UUBO 1KJRA 5FMDA 4NTYA 4UT5A 2W5FA 2YEVB 3CJIA 4ZPIA 2PY5A 2E5LO 5C4WC 3VHOA 5DMYA 2JK5C 1EAH2 2QE3A 3WSOA 4FIPC 3B00A 2QTWB 5GW7A 5K1PA 3VKMA 4Y24A 2VMIA 3CZUA 5A3OA 5KHJA 3RI9A 3BAAA 2YROA 3POSA 5LMNO 1ZVFA 2GALA 3LFIA 4X6RB 1QJFA 2A7AA 3R66A 2DF7A 3E6CC 1TMF3 3OEHG 4I01A 2KKWA 3GDBA 3SNMA 1Q56A 1BCXA 1VB2A 3MBWA 4META 4TWKA 3KQ4B 3SYQA 4AF9A 3QNEA 1VBB1 3OY8A 2XVGA 1WLCA 4MYEA 1SMVA 5FXZA 3WHUA 3ZHQA 1WW4A 3CP1A 2VMGA 2WSUA 2FB5A 4D6TH 1M1KW 3GYDA 5DPNA 1W6OB 5H5NA 1KS5A 2BBAA 2D6KA 3CB2A 1SFNA 2EILB 4ET7A 3G4SV 1VQPV 5GLZA 2KXLA 2RS52 3WDUA 2R1BA 2YIBA 3TNPB 4RHV3 4GH4C 4MZUA 3MIBA 4UOJA 2Q4PA 1H4HA 1UAIA 3JD1A 1ZL8A 1Q8PA 3I56V 1UY3A 4B3RB 4IESA 1PK6A 4L0PA 3WNXA 2JDHA 3THCA 5JXHA 3JBG3 4LR3A 4D6RA 3OYWB 5BXXA 3LUTB 2BWCA 1Q7YW 1Z5WA 4B3SO 2W1SA 2PMWB 4OHZA 4QB2A 4Q1RA 3AXDA 4ZOLA 2XJRA 2ZPXA 2LJ2A 4BXFA 1QNMA 4FBFA 1S77D 5FK7A 4PA7A 4X8AA 2A6XA 4DR7O 1WBLA 1XPWA 3DN7A 3BTYA 1Q8IA 2PHWA 3LQCA 3RYIB 4AVBA 2ZCWA 4IETA 1XOUA 1MNGA 3RYCA 4LHSA 2JE9A 3QVNA 4PBPA 4Q4V3 1HXS3 4IV1B 2A6ZA 4HK9A 1HV1A 4MSWC 2ZEYA 4K8FA 2Q68A 1TNRA 1GZTA 2OT7A 1K9MW 1Y74A 3UJOA 1SBDA 1AYM3 5BUVA 3EQEA 2CE4A 2WO7A 4CH4A 2WLIA 3NV4A 2XKOA 3RYHA 3C3TA 2JKXA 1REEA 4AVTA 4AVVA 3OPTA 2J7MA 3ZM8A 3THOA 4YZ5A 1JOBA 4FPLA 2UXBO 3DPRB 5K7PA 5EYYA 1L8DA 1JFFA 5JOXA 2M6YA 2EXIA 1K97A 5IY5B 4H14A 2WN3A 5K0UB 1BEV3 5JPNB 2PFWA 1PM7A 3JD2A 4KU7A 4H55A 3W5MA 3D6EA 3ZN5A 3OEEG 4FOWA 3JATA 2WR9A 1YLLA 5SV8A 5FP7A 4DV1O 4F3JA 5KHHA 5JPMB 3MF6A 5FMBA 4HETA 3C3SA 1VMJA 5CNAA 3VD3A 4HPKB 3ZN6B 2Q9LA 4ATEA 4IL6Z 3RYFB 1RJ7A 3MHZA 1ZZ7A 4OUSA 2D5HA 2PI4A 3IMMA 2V5YA 5FO7B 2OIEA 1IG0A 3OD0A 4D0QA 4B08A 4UV8A 4M00A 1S55A 1NX9A 1VBB2 2QKDA 2ZDIC 3PU8A 5FIXA 4WM7C 2PLV3 4YG0A 1RHI1 1X9PA 5BYNA 2NMOA 4QB6A 1GKBA 1UU4A 3CZJA 3EVKA 2WZEA 3JUUA 4OGQB 5BNPC 4WBNB 3AG7A 1FJGO 1YDXA 1REDA 4LE3A 2LFSA 2PHDA 4OZXA 3OUIA 1KQRA 4A2UA 3HR9A 5EFUA 3O0WA 3OE7G 3PVEA 3RYKA 1KD7A 2VZQA 1H4GA 4RS5B 2UXCO 1EV11 1NZIA 2BBVA 4K8ZA 1RUI1 1EZVH 5J1XA 4CEWC
chains in the Genus database with same CATH topology
4WM7B 4K1YA 2E7QA 2ZGPA 3MF9A 1ND2B 2YPJA 3UL2A 2EVXA 4W65A 4L97A 3FX3A 4E2SA 1MR5A 1FPN3 5BNOB 1RUG1 4FPHA 1GYKA 4P14A 1CAVB 1AR61 2WFF2 4A3XA 1KFUL 1K5MA 1W6QB 2GNBA 3QH7A 3ZFEC 4AGGA 3V65A 2EF6A 2RS13 5EJ3A 1N1VA 1LHUA 4KWJA 1R081 2N7GA 4OVEA 4YGBA 3DF0A 1ZNPA 1VALA 4CDUA 4OJ8A 2B39A 2GZWA 4Q0UA 5GLTA 2FBEA 3AKPA 4KWKA 3VBSA 2XVLA 1H8TB 3ZMNA 4D7SA 5DDJ2 5I93A 4N43A 3BOWA 1PO21 1MQTC 1D0GA 2RMU2 4COYA 5KHKA 2H0BA 1LOFA 4RL7A 4YZ1A 3VBHB 2ZHNA 2CY6A 3AMMA 1PO13 1UKRA 4XMAA 4M2FA 3ZSKA 5C8CA 4NOTA 5HCBA 3UK9A 4Y26A 1B35B 5DZFA 3KT4A 4BCUA 1GZCA 2R063 1OIJB 3AMHA 1RUJ2 3N36A 2E7TA 3QACA 4MSVA 4JDOA 4PLMA 4P9IA 4Y22A 3V0AB 3KT7A 2UURA 2R0FA 2R041 2GC2A 3HWJA 2DCJA 1VBC3 2GH8A 3M3CA 2D6OX 1ZRRA 1CAUA 1QH6A 2YZ4A 3IPVA 4JDNA 4CDXA 1LRHA 2AENA 4YM0A 1D2QA 1LB2A 1I6XA 1M4WA 5JI9A 4LUKA 3S6PA 2RJLA 4G4FA 4XPVA 4FAGA 2QJVA 4RFT0 1RUC3 2VNRA 2ZHMA 2HWE3 4H7LA 1AR83 4JVAA 5K9YA 4IEUA 1Y7BA 1T6GC 1DYKA 4ASMB 2FZ1A 1AYN2 3PVNA 4MGYE 4MXWB 1WCKA 2IC1A 3KM5A 2RHPA 2IZWA 4I0AA 1SLAA 1FATA 2GSYA 1Q5OA 3ZMOA 2JD4A 1R091 1E57A 2NM1A 1PNGA 1LU1A 1U12A 2JX9A 2RR11 1XU1A 2JEMA 1M06G 2O8OA 1UL9A 3KT1A 2GNTA 1S0JA 3VL8A 1MQTB 5CIRA 1W2UA 3TAYA 1RGSA 1BJQA 3ZXGA 5F1RA 3ZFFC 4IQPA 1ASJ1 1JUHA 1AXYA 3ACLA 4LBQB 2ENRA 1O4ZA 4XQ4A 3CO2A 3JB8A 4UBGA 2O8QA 4YVSB 1OS7A 1AF9A 1FOD2 4FQ4A 5T5OA 3IT8A 4XF1A 1EAH3 4PJYA 3WCSA 5KXDA 4YYOA 1ZZBA 3WINE 3PTYA 2D98A 1HRV2 4GQ7A 3FHIB 3AKRA 1XXNA 4RA0A 4IEQA 2PHLA 4Y0EA 3HD8B 3VKLA 1HQNA 1GNHA 3ZN4A 2BFUL 1OI6A 3I59B 1X36A 4WM8A 1MS8A 4GWMA 1VBE2 1WGPA 5GZCA 4MXVA 4NE0A 3ZSLA 2XBO2 1TMF1 3H1MA 1AR93 4LE4A 1IQAA 4P9XA 1ZX5A 1S0DA 4Y20B 4FVVA 3RMYA 3RWNA 4HN1A 4CDQB 4B4RA 4IEVA 1S0IA 2JDZA 1W39A 1VB4A 1YIFA 2PA7A 3ZFGA 3P3NA 1CVNA 4UXAA 4QPGB 1SFYA 1NXD1 3RQ0A 5C9AB 1DQ0A 3MPBA 1HQLA 3JCIA 4GWNA 1Z7S1 5LRRA 5KXBA 1SLBA 3ZYIB 4K1ZA 2IXHA 2R49A 3E5UA 3LSEA 5JSPA 1AX0A 1QOOA 3VBOA 3AP7A 2HEYF 2WNUC 4AEKA 1W0PA 2YY1A 2OZ6A 3SH5A 1AX2A 1RITA 3O2GA 2RM22 4N53A 1DRTA 4QT6A 1UPIA 3IDEA 1W6OA 4KNCA 2E6VA 1X8EA 3V56A 3WG1A 1GZWA 4AEDC 5A32A 3BU7A 1W6PB 5BNNA 2YYOA 5EYXA 5KXCA 1C1FA 1NY71 2SBAA 3OPZA 1MS3A 1AL0G 3FLPA 4RHV1 4I2OA 1F5JA 3LWCA 1XYNA 2R0HA 2WT1A 2RS32 4S2HA 1BBT2 4ES9A 1H1MA 4J5IA 4IV3A 5FPXA 1UF2C 2MEV3 4C1XA 1QF3A 5ABJC 1D4M1 3W58A 1HIXA 2YDEA 1QJX2 4FPFA 3LOIA 2Z2SB 3DGTA 5J98B 2R6QA 1EV12