1JJ2U

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jj2U00
1Q82W 3CCJV 3CMAV 3CCLV 3G4SV 1VQ4V 1YIJV 1VQ8V 4WCEV 1JJ2U 2OTLV 1Q81W 1VQLV 3CCRV 1YHQV 1N8RW 1M90W 3CCVV 3I55V 3CCQV 2QEXV 1VQ7V 1VQ9V 4WF9V 1M1KW 3CMEV 3G6EV 3CD6V 1YITV 3CPWU 2QA4V 3CCMV 3CC7V 1W2BU 1KQSU 3I56V 1VQPV 2D3OW 3CCSV 1K8AW 1K9MW 3CC2V 1QVFU 2OTJV 1YJ9V 1VQMV 3CC4V 1K73W 1KC8W 1R73A 1YJNV 3CCEV 1KD1W 1S72V 1VQNV 4WFBV 1Q7YW 1VQOV 1VQ5V 3G71V 4WFAV 3OW2U 1VQKV 1Q86W 1NJIW 1VQ6V 1QVGU 5DM6V 3CCUV 1YJWV 1YI2V 3CXCU
chains in the Genus database with same CATH superfamily
4MTXA 1IZ3A 1RSOA 5IYCO 3WU2Z 4YXWG 4IHJA 4JI0O 3W7WA 3LNNA 5EC1C 3SPJA 2XASA 5C8YB 2E5LO 1Z2GA 4B3SB 1IXMA 3E8FA 3BA8A 4FLZA 1WNSA 2XAGA 1PPJH 1DF5A 1KD1W 1KYOF 1H8EG 3L70H 1SERA 1AI6A 1P7GA 3BHPA 3T4DA 1CP9A 1BCCH 2QWRB 4J42A 5IT9N 4LFBO 4YJ3B 1NS1A 3LUTB 2ZNIA 4PI0A 3K03A 1XUQA 4X1KA 2PYJA 3FB8C 3SJQC 1HW7A 4PJ0Z 2NN4A 1GKFA 3JD1A 3HPLC 1UPGA 1S77D 1D2DA 4TV8B 5CMUA 3SDLA 3JASB 3X2QC 4LR3A 4B3RO 3JSLA 4G27B 4UB8Z 1UJWB 4X66B 4JYCA 1FFXB 2KQXA 4LP8A 4OX9B 2PZSA 3QF7A 3SJCC 2LP7A 3OTFA 3IFXA 1VIBA 1EFRG 2N04A 3OEEG 1MSWD 3SJAC 3CC7V 4X1KB 4FMTA 4NXNB 3AK3A 3CRAA 2AZ0A 1N33B 4I9QA 3ZCCA 1PL4A 4MVUA 2QM4A 2QWQB 1DTOA 1IBLO 5IWAO 2XHBA 3BFRA 4GX5A 2YUAA 4KXRA 1JPXA 2E3CA 3I55V 3JATB 2FB5A 2E75B 5B66Z 2A79B 3STZC 1COWG 3BPZA 4ZHQB 1GH6A 4GKJB 3D3QA 4X88A 3K0DA 3CRCA 2Q0OC 4TQDA 3SGIA 5LHGA 3ZBHA 2QM7A 4WFFA 1P7BA 5JCOA 3CCRV 1YHQV 1GN2A 3TETA 5EZYB 2IU0A 4O2AB 4LF7O 4LF5O 1PNLA 5C8YA 1N4CA 3DGEA 2QTOA 1HWYA 1XL6A 4RUEA 4FLYA 1JA8A 2DOSA 3VQYA 3ETGA 2ZE8A 4ZI7B 5KA6A 3ABMB 1OJHA 3SPIA 3ZIAG 3QNEA 3H9VA 1I08A 5GTIZ 2EIMC 1R3JC 4TOIA 1YTFD 4E2LA 2UXDO 3THOA 2PI5A 1MSDA 3K9AA 3N2KA 4LF9B 4LFAB 2A7WA 2FMLA 1S5HC 4ICGA 4RQFA 2B9ZA 1CPYA 4FFBA 5LXTA 1XL4A 2P5OA 4FZ0A 1N36B 4JI0B 1ZSPA 4K8ZA 4NVPA 1EZVH 3ZEDA 4BW9A 2CH7A 1JJ2U 1JQ0A 1I5XA 1HR0B 4MVMA 2F1MA 4UCSA 2QJ1A 2RN9A 4PA6A 1NU1H 5J9PC 3L73H 3AG7A 3T1CA 3ZRSA 2X6AA 2CAZC 2ETNA 4Z1VA 5L3BA 1TVKA 4O4HA 5BMVB 5E1AC 3RYFA 2AGAA 1ZX3A 1M56C 5K1PA 3L72H 3UKMA 2F4VO 5LGTA 1QR8A 4PA7A 1ENVA 1WB7A 2HLDG 4JGSA 4CS2A 1IURA 2PI4A 2Y69C 4LFCO 4EB6B 5CB4A 1MG1A 4DV7B 4LC1A 1CEZA 4WFAV 5DEDA 4FFKA 1MZFA 1VF6A 4D7TA 3D3IA 4GX0A 5B1AB 1EN6A 2IJJA 2ZINA 2M7WA 5EBMC 1AP6A 2H3OA 4NXMO 4DW0A 4H44B 2GDSA 2UXCO 2YIBD 1SETA 4JI2O 4UVCA 4LF6B 4BIUA 1R3KC 4IYHA 1L0LH 4I50B 5TISZ 3C3TA 3J7AU 2IH1C 1V54C 3CXCU 1VQ8V 1XEQA 4MW8A 2DQ0A 1FXKC 3E83A 4AILC 3UO3A 2OWOA 4GKJO 4LWSB 2WWWA 4JAUA 3JD4A 2JEUA 1R73A 1YJNV 1SF9A 3KCYA 3F7VC 4DR2B 2RJZA 3IAYA 1SQQH 3K5LA 3R65A 2P06A 4BIZA 4UXNA 3IC9A 1VQ4V 4DR3O 4GX2A 4O2AA 3ZMUA 1I5YA 1VQMV 1XBLA 2EIKB 4PA4A 5J2UB 2WLLA 5IJ9B 1LR1A 4CS4A 2HJDA 4WFHA 5LA6A 1FXKB 1KBHA 5EC2C 3TXSA 1YXBA 4IGGA 3G67A 4DO2A 4DV0B 1Q90D 4B7EA 2Q9LA 3TK1A 1JX9A 1PP9H 1K5SA 5LL6Y 3JAKB 1P49A 4L8JA 2G38A 4JI6B 3SYQA 3OTOO 1E1RG 3ETQA 3NXSA 5FL7G 4BR6A 1QNMA 1S0VA 1OCZC 4U3JB 1VF6C 2XUMA 5B1AC 4DV2O 3L75H 1F23A 4B3TO 3GWKC 3S3WA 3MD0A 4DR2O 2UUBB 5KA5A 4KHPB 4HNAA 1PD3A 2ZE5A 2KB1A 1SZTA 3OR7C 1V54B 1WB8A 3E22A 2ADQB 4U3JA 2Q67A 1Q6HA 2RCVA 1JVMA 3BA9A 4NTXA 5CA1B 4DW1A 1MOFA 3GB7C 3UM7A 3WG7B 2Y4UA 1IBMB 4LF4O 1QU7A 3FAVA 1ZL8B 5JQGB 3ZN1A 3FB5C 3DTUB 5CBHA 1VQLV 1Q3EA 1PM9A 1JFFA 2W6JG 4JYYA 3K58A 4UV9A 2P6JA 2BTOA 3CCMV 1HDJA 1AJPA 4L87A 2HHHB 3AK1A 3WB0A 4O4JA 4FFBB 5LXTB 3E86A 1Y66A 4GKKB 1MMMA 3W7SA 2V7QG 2NLJC 3E2EA 1GN6A 4WFGA 2HKOA 4X89A 2B1IA 4DUZO 4JI5O 3B09A 4F6RB 2JK5C 1VARA 1FJGO 4KHPO 4FVMA 2DQ3A 3JASA 3AG4C 4GT1A 2QWOB 1SKVA 3IGAC 4P30A 2PF4E 4JV5B 1VQ9V 4DV5B 1OCCC 5J2TA 1X4TA 2CTPA 4IHJB 1Y76B 5BZBA 1GRJA 3QVNA 1KKDA 1XMQO 3RYIB 3N2KB 3CHXA 4FLXA 4UVBA 4AQYB 4JI4B 2UXXA 1NR1A 2CDYA 2RMKB 2Q0AA 5FPOA 2YXLA 4JYBA 1YSCA 2UXBB 1M56B 4N23A 1GN4A 2UUCB 4JI6O 4CC5A 4OX9O 5LMUO 4K35A 1WA8A 2XAHA 3WB2A 4PDVA 1GMGA 2EILB 2YEVB 1M57C 5LHHA 1R3LC 5IE9A 1HP8A 4DUZB 3AG3C 1K4CC 4R6ZA 4XDKA 4NXNO 3C90A 3LSUA 5LBQA 5KX5A 1XNQB 2JGUA 4X1YA 3B4SA 3ICXA 4DV3B 2UUBO 2LFRA 2AW9A 2R9AA 4DV1O 2Y0IA 1QBZA 3CCUV 4DR6B 1AI5A 2YIDA 3ZMZA 2E76B 1HNXO 4WBNB 2ZXWC 2P67A 1KKCA 2Z0AA 3JALB 4DV4B 3K57A 1QQCA 3FYIB 3UQ8A 3PJSK 1N34O 2PYLA 3AG4B 3AG2B 3C3SA 2F4VB 2XNDG 4D7SA 1M57B 4IIJB 4O4HB 1K5QA 2UXBO 1YVWA 2HG5C 4YJ2A 1H2NA 2N05A 4JPRA 3QG5A 4ZOLB 3AK2A 4WBNA 1BMFG 1EN5A 2FL4A 4JZ2A 3JALA 4TV9B 1YJ9V 1CXZB 4N21A 4R8CA 4LF7B 4QIWF 4WFBV 5FLXN 1MNGA 4Q20A 3OR6C 1QLEB 3LDCA 4O4JB 3UO2A 2KG7B 3RYCA 1ZLZA 5A9GA 1G4YB 2Q4PA 1H2GA 4JF3A 1MA1A 4FPPA 4YJ2B 5A2QN 4JYAO 4HZ3A 4LF6O 3D36A 4JZGA 4PA3A 3E35A 4I0XA 1XQ8A 2XAQA 3ABUA 2P22C 1A32A 1RM1B 2UU9B 4X65O 4TV9A 1EZJA 2CUGA 3KG2A 1R6KA 2B1GA 4J11A 1AR4A 4U7OA 4DRXA 2M6YA 1DGSA 4P2ZA 3ZN0A 1HNZO 2H94A 3CRQA 5JVDB 1ZUQA 4JTCB 2XAFA 5CA0A 1GM9A 3OUSA 1K4DC 3ZHQA 4X8AA 5H5NA 4NYKA 3PN1A 1KC8W 4FLVA 1BSMA 5KAFZ 1W0JG 4AI8A 3P30A 4HBNA 1FD9A 1BQ0A 3B8MA 2PTMA 2MW2B 2QKCA 3B77A 5C93A 2QWPB 3SR2C 1Q8IA 1ZTEA 2L6LA 1I7FA 1K7DA 1Q81W 2JEXA 4DV7O 1DF4A 4IYIA 2EINC 4BW5A 4DK0A 3T1HB 2ZM6B 2WSSG 5LP6B 4UCRA 1OCOC 2RDCA 2QSAA 2YIBA 2OTJV 3KCXA 1SESA 4OGQB 2BTQA 4QE9A 1R1BA 3ZX6A 4BIOA 1AJQA 5LA6B 3E8BA 2R72A 3CCSV 5IYBO 2CTQA 5LYJA 3EFFK 2A0LA 1VEWA 4PDMA 1W0KG 5ITZA 4OXSA 1NTMH 4DR6O 3P32A 3A0RA 4X1IA 1FAFA 1LUVA 1D5AA 1P84F 1X59A 4X20B 2K1EA 2DN9A 1Z5WA 1K97A 4PDLA 3TCUA 3CCQV 4GCZA 1M1KW 1GN3A 1N36O 3APOA 1OZ0A 4ABMA 5H6QA 1HNWO 3FYEB 1F4NA 3E8GA 1N32B 3KKYA 4HNAB 4O4IA 2DYRC 1YEWA 4MVZA 1G8MA 2VWKA 3ZJZA 2ZQMA 2ZT9B 1KMIZ 1J5EB 3CC4V 1KP2A 4DR3B 5CA1A 1JJOA 2Y69B 3MDSA 5FNVB 1WA8B 4FLTA 1OCRB 3CMAV 2YEVA 5IJ9A 3E22B 4DV0O 3FX7A 1LNQA 2WA3A 4UCTA 1BGYH 2HVKC 2VQFO 1GK9A 1U96A 4FM0A 1YITV 5IY5B 5JJEB 5L3CA 4I0XB 3CSXA 1FS0G 3AEIA 3FFQA 5LP6C 2OT5A 1Y4MA 3JAKA 4W4LA 4ASUG 2ZIOA 3ZRWB 2JS5A 1G6UA 3Q4HB 5EBLC 1B3QA 2EIMB 1OCZB 2ZR2A 2Q6AA 5KHKA 2NR5A 4D6TH 2WLJA 1V55C 1K9MW 3X2QB 4JV5O 3CP1A 4GLXA 4EB6A 4FLUA 5LOVB 1THZA 2YSUB 4MS2A 3NR7A 1QVGU 3ZHVA 4UB6Z 4X1IB 1BL8A 2AHYA 1Y74B 5B3SB 1M90W 3DC6A 3H01A 3BEHA 3B40A 5LHIA 4AQYO 5KAIZ 3ETDA 4K3AA 3OGIB 1OCCB 1VQKV 2Q68A 1URFA 2DW4A 2IJKA 2FTKA 3F5TA 2YXHA 2QE7G 3LDEA 4G28B 2EJ7A 2Q7EA 1BE3H 4K0KB 1PV0A 3RYIA 4JI1B 1Y74A 1L1FA 2F95B 1JFFB 4LBEC 1OV9A 1SQVH 4J9YB 2AXTZ 4FM2A 4DR5B 1Q7YW 1K33A 1VQOV 4QGPA 4F4LA 1OCRC 2ITCC 5B5EZ 1NVPB 1FJGB 3AG1C 3CRRA 1QLNA 4DR4O 2GUZB 3BABA 3GVMA 4X1YB 5IJ0A 5CN0A 5FPRA 2EBOA 4LF9O 4LFAO 1N32O 1Q6IA 1W59A 5KHHA 2JJ2G 4YHHO 3OT7A 4EKWA 1O9GA 4J7JA 4E4EA 1U97A 1XMQB 3FAVB 3IJ4A 5JCOC 1E1QG 1TA8A 4KP4A 3RYHA 5BXZA 3L71H 1HR0O 3W7XA 4JI8B 2N74A 2ZXWB 5IYDO 3RBZA 2WLNA 3FD9A 1OHHG 2UXNA 2IJIA 4PELA 1H2MA 4PDRA 3TGUH 2UUCO 4MVRA 1TUEB 3BAAA 3ABKB 4W4KA 1D5NA 4MVOA 2D3OW 3HKDB 4HYOA 1XMOB 3HR0A 1NKDA 2ZDIC 2P90A 3ZRWA 3L9DA 4O2BB 5BY1A 4DV3O 2CH7B 1N0NA 2IM9A 4DR4B 2R9IA 2UU9O 2GHYA 4QJFB 3AG3B 2QKSA 2WLIB 2K9PA 1KB9F 4NXMB 3ASOC 2CTRA 4ZIBA 1XNQO 2A9HA 3RW0A 1NH2B 3H1LH 2EILC 5KHGA 3BY6A 1GM8A 3DXRA 3G80A 5L3FA 3CYOA 5B1BC 4JI7B 3H1KH 1N34B 3RFRA 1H8HG 4LWSA 2WLIA 1B06A 1EN4A 4K8XA 3K9SA 3QO5A 3SYPA 3CCEV 4DV4O 1AILA 1GM7A 2ZD9A 2XT9A 2V4DA 4H37A 1YZBA 3FKSG 3R66A 4OPAA 5JH7B 4UFZA 5K1XA 1RPOA 1ZWIC 1AJNA 1XNRB 1FXHA 1V55B 2EIJC 1I0HA 2DYSC 1DK1A 4EEQA 1LUWA 5JJJB 1S72V 4TT3G 4JYAB 5JQGA 1PNMA 3J80N 2X6BA 5CA3A 1T5EA 1WPBA 2MK3A 4DK1A 3CMEV 2GBOA 4RQEA 4TSFG 1R6NA 4R50A 3QTCA 4J7KA 5FNVA 1PKXA 1VQ5V 5GONB 3QO8A 1SQFA 5GTHZ 1F51A 3OTOB 1VP7A 2X7RB 1SQPH 4CH4A 3W7TA 4JASA 1BT8A 1W2BU 2HJFC 1JCHA 3OE7G 3EHBB 1K73W 4B08A 5ITZB 1Z5VA 2WLLB 4CS3A 2OIEA 2ADPA 3G71V 3RVYA 3VQXA 4UCOA 3Q4HA 3U11A 3AG1B 4OPHA 4O4IB 1XNRO 4J80A 4B3MB 2OTLV 2ZM6O 1WP7A 2JDIG 3CEIA 3CCVV 2XOKG 3K08A 3F7YC 3M99B 5EYPB 4FM1A 3MHSC 4ZBMA 3SPHA 1VF5B 1M9NA 3JD3A 4QE7A 1M93A 4DUYB 5LP6A 1XREA 2DE0X 4NTWA 3K0GA 1IBMO 4DXWA 2UXDB 1S3JA 1SS3A 4LF8O 1F7YA 2Q5ZA 3TJTA 1XILA 5JVDA 5LYJB 1P4RA 1RPRA 1KQSU 2OCCB 4U7NA 3CWBH 1IDSA 1KP3A 4R7CA 1RM1C 2HR3A 3OM3B 4X65B 4X20A 2C2AA 3A8TA 1M5IA 1RSOB 2PUSA 2RNBA 3LDDA 2IW5A 3JCUZ 4UVAA 2YC0A 2ZR3A 3CPWU 4NKGB 4JI5B 5GW7A 3N2GB 1RP3B 1SRYA 3RT3C 1JR9A 4B3TB 1VQNV 5L3DA 2WLHA 1PNKA 1ZL8A 5LMNB 1PL0A 2JIZG 2OYQA 5H9CA 3DC5A 4DV5O 1J5EO 4HAMA 1YTFB 2F66C 3VQWA 5EZYA 2V1DA 2QA4V 2OCCC 3I56V 1BZKA 3U0ZA 3I5DA 4YY3O 5E79Z 3K3WA 2B5UA 2PGGA 3ZHSA 3ABMC 1Q5OA 3ABLB 1TVKB 4LF8B 3BVOA 2CE4A 3T1YO 1BS3A 1Y67A 4DRXB 1FYJA 3D36C 1XOUA 1VQ7V 4JAVA 2UXCB 1AVMA 4G2KA 3HB3B 2BSKB 5EYPA 1K92A 4MW3A 2ZE6A 2LQTA 5IYZA 2ILMA 1US6A 2BE3A 1Y76A 2BOBC 4YIPA 3H1JH 2EINB 3T4ZA 2EULA 1Q6UA 5LGNA 3H1IH 1IXBA 1WAZA 4X9QA 3CD6V 5H2FZ 4NTYA 1H2KA 2WLMA 3CJHA 3UCSC 4CC6A 1WJZA 3LSSA 2L35A 2JVDA 5DM6V 4RUFA 4B3MO 1NI8A 3LSQA 4MT8A 5CBFA 2HFEC 3OGCC 2WPDG 4IL6Z 3VBBA 3WFVA 5B1BB 1HNXB 1IBKB 2HVJC 1NZ6A 4MTFA 4GX1A 4IT5A 4Z2WA 2CGNA 1NT2B 1AR5A 2PY5A 3ASNC 4I9WA 1RFYA 2EJRA 1IVSA 1DLBA 1NQTA 2GTAA 5B3SC 1GO3F 1EBOA 2ZE7A 4U3FH 1SQGA 3RYHB 4DR5O 4BAYA 2Z5UA 4UCUA 4B3RB 2P4VA 1GAXA 3AG2C 2DYSB 2ZCEA 1E79G 4PHZA 3G6BA 3HKEB 1XI1A 4AHCA 5LOVA 5AG2A 3UT5A 4MTGA 2JJ1G 1YI2V 3ZS8C 3ZHTA 1NH2D 1TUBA 1B04A 3E89A 2DWEC 1M4UA 3BCCH 2WLKA 4MTOA 2VWJA 1N8RW 3OD4A 3ZRVA 4YHHB 4PV1B 4DV6B 2F93B 3LNMB 2GV9A 3SYOA 1IBLB 1MABG 1QHTA 1JOYA 5IJ0B 3ZMVA 1NTZH 4XDJA 4DR7O 1NJIW 1FFXA 4X64B 2D2CB 4NB5A 2WA4A 2CTWA 1SA0A 4DR1B 2HEPA 1KU9A 2YXYA 3DXRB 1SQXH 4JI8O 4LNUB 3ZMSA 1IBKO 1GTOA 1YDXA 3E8HA 4J7ZA 1HNZB 4YY3B 3JATA 2XTAA 1AP5A 2QM8A 5IDJA 3JARA 4GYCB 4Z1MG 1H38A 2E5LB 1AR1B 3MAQA 4LFBB 2YI8A 4GUNA 1IX9A 3GWOA 2QDOA 3TXQA 2EZPA 4I4TB 5KMGA 2W0XA 3RGBA 4QNHB 1S5JA 2EZOA 4WFEA 2VQEO 1XMOO 1NTKH 5KHIA 4I55B 4XDLA 2X0LA 3CX5F 4O4LA 3HKBA 5EIBC 3P3NA 2UUAB 2ARHA 3FB6C 3APQA 1VQ6V 1B6QA 4NR1A 4BWAA 3IC7A 4J41A 4TQFA 5KLVH 1ZAUA 2A3QA 4O2BA 3ABKC 1I94O 3CS5A 4Q6GA 4DV6O 4FLWA 4XBFA 2YS8A 3K06A 1NBMG 2ZNJA 4LH6A 2QKAA 3N27A 4GZRB 5IWAB 4FK5C 4DR7B 2R70A 3JSNA 3JYCA 4C7UA 3ASOB 4DR1O 2OCHA 1WN7A 3K5NA 2IH3C 1YIJV 4MVSA 3STLC 4H0LB 2FKXA 4I5SA 3OMNB 1TAEA 4FIPC 1J95A 5KX5B 4ZHQA 3SYCA 5F2VO 5KUKA 1AROP 4F6RA 4LCUC 5JWPA 1HNWB 2W0FC 4JI4O 2IJHA 1TGOA 5L3GA 2Q7GA 1K34A 1EM1A 3JD0A 1V9PA 2GUZA 5EK0A 3RN4A 2JS3A 3CC2V 4UV8A 4TV8A 3CE2A 1NR7A 2E74B 4KUMA 5LMUB 3U10A 4F6EA 1JMKC 5B1OA 4CH6A 1UFIA 4ZI7A 4LF5B 3HKEA 4TUYB 3MHHC 3JAWA 5BMVA 3UT5B 3J81N 3K5MA 3RWRD 3JCZA 2DMXA 3F5WC 3SJBC 4X66O 4JI2B 2YICA 2JGDA 4WF9V 3FB7C 4UCVA 5IY5C 4KL1A 3VQVA 1F4MA 4ZOLA 1ORQC 2BCCH 4X62O 4PI2A 5B1NA 3ABTA 3EVKA 1L0NH 3M8AA 4O4LB 3ABLC 3CXHF 1N33O 2KSDA 2LFSA 3P3PA 4WCEV 2Q69A 4J9ZB 4JI3O 4FJCC 3ZMTA 2CGOA 1ROPA 1K8AW 1SZXA 4JI7O 3JARB 1H2SB 2EIKC 2ZIMA 1FXVA 2LO1A 2W6IG 2Y0PA 3A0BZ 4KFMA 2GTSA 3OW2U 4FZ1A 5JH7A 1QVFU 3QO7A 4JAAA 5HFLA 3CCLV 3G4SV 1SC5B 1AI4A 3O65A 1WPXA 1R6TA 2IU3A 4CBCA 4LH7A 4PA9A 5CA0B 3CJHB 2EX3A 2ITDC 3A2FA 5D5QA 2QGNA 3HKBB 4RWUA 2P7TC 1XDCA 2BOCC 4LFCB 5HFMA 3CCJV 2CK3G 3SYAA 2F23A 1I94B 4DUYO 1TUBB 3SPGA 5EBWC 2P4KA 3OEHG 2X6CA 1K3EA 2VS0A 4X62B 2QTSA 3G6EV 4K0KO 3BRCA 2DJVA 2VQFB 4MSWC 4JI1O 4CZZA 1KECA 3OFNG 4DV1B 3DSQA 4I50A 5H6RA 1XHZA 3B8NA 5GONA 5BR8B 5JJNB 3ASNB 4TUYA 3OAAG 4H33A 1Q43A 1Q82W 3JAWB 4P9OA 1VMGA 1NVPD 4JI3B 3RYFB 2AZ2A 4LNUA 2ODMA 2BTQB 3H1HH 2H8PC 1FKAO 5LMNO 2BSKA 3CRMA 1XHXA 4H13B 2ZKOA 1N0JA 4A5UB 1FFTB 2QWNB 2XAJA 1QR9A 3K5OA 5L3EA 4I4TA 5KMGB 4DYLA 1QLEC 2JRIA 2R9RB 2DWDC 2QEXV 3JD2A 2VRZA 3B2EE 4I55A 1VQPV 3WG7C 1OCOB 1YF2A 5J2UA 1AI7A 3WB1A 5DN6G 4PD4F 1Q86W 3L74H 2KG7A 1YJWV 4CH3A 2NNUA 2LJ2A 4YJ3A 4JTDB 3ZHUA 3T2MA 4QPJA 5DECA 4TWKA 1FXKA 3T1YB 3W7UA 3N2GA 1O9HA 4GKKO 1BQZA 5BR8O 5IYZB 1SQBH 3OMAB 5D5PA 4CH5A 2O57A 2WAMA 2Q8VA 3ETEA 4I7ZB 1MZEA 4B7KA 2ATKC 2YI9A 2YIAA 2YDEA 4YIOA 2HP8A 2OIGA 4RO2A 2Y4TA 2Y48A 2QR4A 4DV2B 1AB3A 2RQ6A 2LW7A 1L8DA 2DYRB 3HKCA 4EFBA 2FYUH 5EIBD 1H2LA 4P9PA 3S3XA 1G1XB 1SA0B 2Z3YA 3T1HO 5CBGA 1S5LZ 1FPOA 2LGWA 5KUMA 3ML0A 4J10A 3K59A 3HKDA 1QCEA 4B3SO 3OMIB 2ZDIA 3VOUA 1R3IC 2GSMB 2IBZH 3JAMN 1BHBA 2LGQA 3K79A 5KHJA 2VQEB 2Q7HA 4RAIA 3HKCB 3ZHRA 1WLEA 3SPCA 2A06H 1Y6XA 4MVQA 2AHZA 4LF4B 3KZIZ 2JGDB 2HHHO 1S76D 1WP8A 2UUAO 1YCIA 5CB4B 1KUQA 2F43G 5LGUA 4UUJC 4EFEA 2KKWA 4IIJA 3RVZA 2EIJB 3CB2A 4ZKIA 2LW1A 4JTAB 3OUFA 3K04A 3D8CA 3A0HZ 4X64O 4QPKA 1BHAA 3M7MX 3ZRXA 3EXAA 5J2TB 1VF7A 3O9OA 2Q73A 3RYCB
chains in the Genus database with same CATH topology
1OCCC 4MTXA 1E1QG 5IYCO 3ZMSA 5BZBA 1GTOA 4YXWG 3W7WA 3SPJA 5EC1C 2XASA 4KP4A 3E8HA 1KKDA 1IXMA 3E8FA 2QM8A 2XAGA 3W7XA 5IDJA 1DF5A 2ZXWB 4Z1MG 4UVBA 5IYDO 3RBZA 1H38A 2WLNA 1KD1W 1OHHG 1AR1B 2UXNA 1H8EG 1SERA 2IJIA 1AI6A 4PELA 3GWOA 2EZPA 2UXXA 4PDRA 3T4DA 1CP9A 1NR1A 4QNHB 3LUTB 4JYBA 4MVRA 1TUEB 3K03A 1YSCA 3ABKB 1M56B 4N23A 2EZOA 4WFEA 3FB8C 3SJQC 4MVOA 3JD1A 1GKFA 2D3OW 3HPLC 1S77D 4XDLA 2X0LA 5CMUA 4HYOA 3X2QC 2XAHA 3FB6C 1NKDA 4G27B 1UJWB 4JYCA 4PDVA 2ZDIC 1GMGA 2P90A 1B6QA 2EILB 3ZRWA 2YEVB 1M57C 3IC7A 5LHHA 1R3LC 4LP8A 3AG3C 1K4CC 4R6ZA 4XDKA 2LP7A 2R9IA 2GHYA 3ABKC 3IFXA 5LBQA 4QJFB 3AG3B 1EFRG 4XBFA 2QKSA 2WLIB 3OEEG 1MSWD 3K06A 1NBMG 3CC7V 2LFRA 4FMTA 4FK5C 3ASOC 3JYCA 2A9HA 3RW0A 3ZCCA 1NH2B 3ASOB 4MVUA 2EILC 1QBZA 1DTOA 3BY6A 1GM8A 3CCUV 2IH3C 5L3FA 1AI5A 3ZMZA 3CYOA 1YIJV 4MVSA 5B1BC 4GX5A 3STLC 1JPXA 4I5SA 3OMNB 3I55V 2ZXWC 2P67A 4FIPC 1J95A 1H8HG 2A79B 3SYCA 2WLIA 3FYIB 3STZC 5KUKA 1AROP 1COWG 3PJSK 3QO5A 3SYPA 3CCEV 4LCUC 3AG4B 3AG2B 2W0FC 1GM7A 2ZD9A 2XNDG 4X88A 3K0DA 4H37A 1M57B 5LHGA 3FKSG 2IJHA 2QM7A 4WFFA 1K5QA 1P7BA 2HG5C 5L3GA 1K34A 1RPOA 1ZWIC 1AJNA 4JPRA 3CCRV 3JD0A 1YHQV 3TETA 2IU0A 1FXHA 1V55B 1BMFG 1PNLA 2EIJC 2DYSC 3DGEA 5EK0A 2QTOA 3CC2V 4UV8A 1HWYA 1XL6A 1NR7A 4KUMA 1YJ9V 4RUEA 4N21A 5B1OA 4R8CA 1S72V 4QIWF 4WFBV 4Q20A 3ETGA 3MHHC 3OR6C 1QLEB 5KA6A 3LDCA 4TT3G 3ABMB 1PNMA 3SPIA 3ZIAG 3QNEA 2X6BA 1G4YB 3JCZA 2EIMC 5CA3A 1R3JC 3F5WC 1H2GA 1YTFD 2MK3A 4JF3A 4E2LA 4FPPA 2PI5A 4WF9V 3K9AA 4HZ3A 3CMEV 3FB7C 3D36A 5IY5C 4RQEA 4PA3A 1F4MA 3E35A 4TSFG 1ORQC 2XAQA 1RM1B 3ABUA 1R6NA 4R50A 1S5HC 5B1NA 1EZJA 3ABTA 4RQFA 1PKXA 1CPYA 1VQ5V 3KG2A 1XL4A 3ABLC 1R6KA 3QO8A 1F51A 2B1GA 2LFSA 4U7OA 4WCEV 2Q69A 2X7RB 4P2ZA 3ZN0A 1JJ2U 4J9ZB 2H94A 4FJCC 1JQ0A 1I5XA 4JTCB 4MVMA 2XAFA 3W7TA 3ZMTA 4PA6A 1GM9A 5J9PC 1ROPA 4JASA 3OUSA 1W2BU 1K8AW 1K4DC 2HJFC 4X8AA 1JCHA 3T1CA 3OE7G 3EHBB 3ZRSA 2X6AA 1K73W 1KC8W 2WLLB 1W0JG 2EIKC 1FXVA 2W6IG 3P30A 4KFMA 5L3BA 3B8MA 3G71V 3OW2U 3RVYA 1QVFU 3B77A 3QO7A 5C93A 5HFLA 5E1AC 3CCLV 3G4SV 3AG1B 1M56C 1AI4A 3UKMA 1K7DA 1WPXA 1Q81W 2OTLV 5LGTA 2JDIG 3CCVV 2JEXA 1QR8A 2XOKG 2IU3A 4PA7A 1DF4A 1ENVA 2EINC 2HLDG 4JGSA 4CBCA 3K08A 4BW5A 3F7YC 3M99B 4PA9A 2PI4A 3MHSC 4ZBMA 2Y69C 3SPHA 1M9NA 2WSSG 1MG1A 2ITDC 3JD3A 4QE7A 1OCOC 4LC1A 1CEZA 2P7TC 4WFAV 2BOCC 3K0GA 2OTJV 5HFMA 3CCJV 2CK3G 3SYAA 1SESA 4DXWA 3SPGA 1S3JA 3D3IA 4QE9A 4GX0A 5B1AB 5EBWC 1AJQA 2IJJA 3OEHG 2X6CA 1K3EA 2M7WA 5EBMC 3E8BA 3G6EV 1P4RA 1RPRA 4MSWC 2OCCB 4U7NA 3CCSV 1KQSU 5IYBO 4CZZA 1KECA 1SETA 3OFNG 3EFFK 2A0LA 4PDMA 5H6RA 1W0KG 3B8NA 4UVCA 1KP3A 1R3KC 4OXSA 4R7CA 4BIUA 1RM1C 3P32A 2HR3A 3A0RA 2IH1C 3ASNB 1V54C 3OAAG 4H33A 3CXCU 3OM3B 4P9OA 1Q82W 2C2AA 1NVPD 1VQ8V 2K1EA 4MW8A 2DQ0A 1FXKC 3E83A 1K97A 4PDLA 3LDDA 2IW5A 4GCZA 3TCUA 3CCQV 1M1KW 4UVAA 2H8PC 2ZR3A 1OZ0A 3CPWU 5GW7A 2WWWA 1SRYA 4JAUA 3JD4A 5H6QA 2JEUA 1R73A 1YJNV 3FYEB 1F4NA 1VQNV 3E8GA 5L3DA 2WLHA 1FFTB 2XAJA 3F7VC 1PNKA 1PL0A 2JIZG 2DYRC 1QR9A 5L3EA 3R65A 4BIZA 4UXNA 5H9CA 1QLEC 1VQ4V 4MVZA 1G8MA 2R9RB 4HAMA 2DWDC 1YTFB 2QEXV 3JD2A 3ZJZA 4GX2A 2ZQMA 3ZMUA 2V1DA 1I5YA 2QA4V 2OCCC 3I56V 1VQPV 3CC4V 1VQMV 3WG7C 1OCOB 1KP2A 2EIKB 1AI7A 3K3WA 2B5UA 4PA4A 2Y69B 5DN6G 2WLLA 1Q86W 3ABMC 1YJWV 1OCRB 3ABLB 2NNUA 3CMAV 2YEVA 4WFHA 1LNQA 4JTDB 3T2MA 4QPJA 1FXKB 5EC2C 2HVKC 1VQ7V 4JAVA 1GK9A 4TWKA 1FXKA 4G2KA 4DO2A 5IY5B 1YITV 5L3CA 3TK1A 1JX9A 3W7UA 3HB3B 1FS0G 1K92A 3AEIA 2OT5A 1Y4MA 4MW3A 1K5SA 3OMAB 3SYQA 4ASUG 1E1RG 3NXSA 3ZRWB 5FL7G 2WAMA 3ETEA 2BOBC 2EINB 1S0VA 1OCZC 3T4ZA 2ATKC 5EBLC 5LGNA 5B1AC 2EIMB 1OCZB 2ZR2A 2Q6AA 3CD6V 1F23A 2WLJA 1V55C 1K9MW 2WLMA 3X2QB 4RO2A 3CP1A 3MD0A 2Y48A 5KA5A 1THZA 2YSUB 4MS2A 1PD3A 3LSSA 2KB1A 1SZTA 3OR7C 2DYRB 5DM6V 1QVGU 4RUFA 1V54B 1BL8A 3LSQA 4P9PA 4MT8A 5CBFA 2AHYA 2HFEC 3OGCC 2Z3YA 5B3SB 2WPDG 5CBGA 1M90W 3VBBA 3WFVA 5KUMA 5B1BB 2Q67A 3ML0A 1JVMA 3H01A 2HVJC 3BEHA 1QCEA 4MTFA 5LHIA 4GX1A 3ETDA 3OMIB 1MOFA 3GB7C 2ZDIA 3UM7A 3VOUA 1OCCB 1R3IC 3WG7B 2GSMB 1VQKV 2Q68A 1BHBA 3ASNC 3K79A 2DW4A 3FB5C 4I9WA 2IJKA 4RAIA 3ZN1A 2EJRA 3DTUB 2FTKA 1DLBA 1NQTA 1WLEA 3SPCA 5B3SC 1GO3F 5CBHA 2QE7G 3LDEA 1EBOA 4G28B 1VQLV 4MVQA 2AHZA 2W6JG 1L1FA 4BAYA 4UV9A 1S76D 2Z5UA 2P6JA 4LBEC 3CCMV 4J9YB 3AG2C 2DYSB 1AJPA 4L87A 1E79G 2F43G 5LGUA 1Q7YW 1K33A 1VQOV 4UUJC 4MTGA 3E86A 1Y66A 4F4LA 2JJ1G 1YI2V 1OCRC 1NH2D 2ITCC 3RVZA 3E89A 3W7SA 2DWEC 2V7QG 1NVPB 2EIJB 2NLJC 4ZKIA 3E2EA 1VQ6V 4JTAB 2WLKA 3AG1C 4MTOA 4WFGA 2HKOA 4X89A 2B1IA 1N8RW 3OUFA 3ZRVA 3K04A 1QLNA 2JK5C 3LNMB 5CN0A 4QPKA 3SYOA 1BHAA 1MABG 2EBOA 1JOYA 2DQ3A 3AG4C 3ZRXA 2JJ2G 4GT1A 3ZMVA 3IGAC 4EKWA 4P30A 4XDJA 1NJIW 1VQ9V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 W;  3CCJ V;  3CMA V;  3CCL V;  3G4S V;  1VQ4 V;  1YIJ V;  1VQ8 V;  4WCE V;  1JJ2 U;  2OTL V;  1Q81 W;  1VQL V;  3CCR V;  1YHQ V;  1N8R W;  1M90 W;  3CCV V;  3I55 V;  3CCQ V;  2QEX V;  1VQ7 V;  1VQ9 V;  4WF9 V;  1M1K W;  3CME V;  3G6E V;  3CD6 V;  1YIT V;  3CPW U;  2QA4 V;  3CCM V;  3CC7 V;  1W2B U;  1KQS U;  3I56 V;  1VQP V;  2D3O W;  3CCS V;  1K8A W;  1K9M W;  3CC2 V;  1QVF U;  2OTJ V;  1YJ9 V;  1VQM V;  3CC4 V;  1K73 W;  1KC8 W;  1R73 A;  1YJN V;  3CCE V;  1KD1 W;  1S72 V;  1VQN V;  4WFB V;  1Q7Y W;  1VQO V;  1VQ5 V;  3G71 V;  4WFA V;  3OW2 U;  1VQK V;  1Q86 W;  1NJI W;  1VQ6 V;  1QVG U;  5DM6 V;  3CCU V;  1YJW V;  1YI2 V;  3CXC U; 
#chains in the Genus database with same CATH topology
 4MTX A;  1IZ3 A;  1RSO A;  5IYC O;  3WU2 Z;  4YXW G;  4IHJ A;  4JI0 O;  3W7W A;  3LNN A;  5EC1 C;  3SPJ A;  2XAS A;  5C8Y B;  2E5L O;  1Z2G A;  4B3S B;  1IXM A;  3E8F A;  3BA8 A;  4FLZ A;  1WNS A;  2XAG A;  1PPJ H;  1DF5 A;  1KD1 W;  1KYO F;  1H8E G;  3L70 H;  1SER A;  1AI6 A;  1P7G A;  3BHP A;  3T4D A;  1CP9 A;  1BCC H;  2QWR B;  4J42 A;  5IT9 N;  4LFB O;  4YJ3 B;  1NS1 A;  3LUT B;  2ZNI A;  4PI0 A;  3K03 A;  1XUQ A;  4X1K A;  2PYJ A;  3FB8 C;  3SJQ C;  1HW7 A;  4PJ0 Z;  2NN4 A;  1GKF A;  3JD1 A;  3HPL C;  1UPG A;  1S77 D;  1D2D A;  4TV8 B;  5CMU A;  3SDL A;  3JAS B;  3X2Q C;  4LR3 A;  4B3R O;  3JSL A;  4G27 B;  4UB8 Z;  1UJW B;  4X66 B;  4JYC A;  1FFX B;  2KQX A;  4LP8 A;  4OX9 B;  2PZS A;  3QF7 A;  3SJC C;  2LP7 A;  3OTF A;  3IFX A;  1VIB A;  1EFR G;  2N04 A;  3OEE G;  1MSW D;  3SJA C;  3CC7 V;  4X1K B;  4FMT A;  4NXN B;  3AK3 A;  3CRA A;  2AZ0 A;  1N33 B;  4I9Q A;  3ZCC A;  1PL4 A;  4MVU A;  2QM4 A;  2QWQ B;  1DTO A;  1IBL O;  5IWA O;  2XHB A;  3BFR A;  4GX5 A;  2YUA A;  4KXR A;  1JPX A;  2E3C A;  3I55 V;  3JAT B;  2FB5 A;  2E75 B;  5B66 Z;  2A79 B;  3STZ C;  1COW G;  3BPZ A;  4ZHQ B;  1GH6 A;  4GKJ B;  3D3Q A;  4X88 A;  3K0D A;  3CRC A;  2Q0O C;  4TQD A;  3SGI A;  5LHG A;  3ZBH A;  2QM7 A;  4WFF A;  1P7B A;  5JCO A;  3CCR V;  1YHQ V;  1GN2 A;  3TET A;  5EZY B;  2IU0 A;  4O2A B;  4LF7 O;  4LF5 O;  1PNL A;  5C8Y A;  1N4C A;  3DGE A;  2QTO A;  1HWY A;  1XL6 A;  4RUE A;  4FLY A;  1JA8 A;  2DOS A;  3VQY A;  3ETG A;  2ZE8 A;  4ZI7 B;  5KA6 A;  3ABM B;  1OJH A;  3SPI A;  3ZIA G;  3QNE A;  3H9V A;  1I08 A;  5GTI Z;  2EIM C;  1R3J C;  4TOI A;  1YTF D;  4E2L A;  2UXD O;  3THO A;  2PI5 A;  1MSD A;  3K9A A;  3N2K A;  4LF9 B;  4LFA B;  2A7W A;  2FML A;  1S5H C;  4ICG A;  4RQF A;  2B9Z A;  1CPY A;  4FFB A;  5LXT A;  1XL4 A;  2P5O A;  4FZ0 A;  1N36 B;  4JI0 B;  1ZSP A;  4K8Z A;  4NVP A;  1EZV H;  3ZED A;  4BW9 A;  2CH7 A;  1JJ2 U;  1JQ0 A;  1I5X A;  1HR0 B;  4MVM A;  2F1M A;  4UCS A;  2QJ1 A;  2RN9 A;  4PA6 A;  1NU1 H;  5J9P C;  3L73 H;  3AG7 A;  3T1C A;  3ZRS A;  2X6A A;  2CAZ C;  2ETN A;  4Z1V A;  5L3B A;  1TVK A;  4O4H A;  5BMV B;  5E1A C;  3RYF A;  2AGA A;  1ZX3 A;  1M56 C;  5K1P A;  3L72 H;  3UKM A;  2F4V O;  5LGT A;  1QR8 A;  4PA7 A;  1ENV A;  1WB7 A;  2HLD G;  4JGS A;  4CS2 A;  1IUR A;  2PI4 A;  2Y69 C;  4LFC O;  4EB6 B;  5CB4 A;  1MG1 A;  4DV7 B;  4LC1 A;  1CEZ A;  4WFA V;  5DED A;  4FFK A;  1MZF A;  1VF6 A;  4D7T A;  3D3I A;  4GX0 A;  5B1A B;  1EN6 A;  2IJJ A;  2ZIN A;  2M7W A;  5EBM C;  1AP6 A;  2H3O A;  4NXM O;  4DW0 A;  4H44 B;  2GDS A;  2UXC O;  2YIB D;  1SET A;  4JI2 O;  4UVC A;  4LF6 B;  4BIU A;  1R3K C;  4IYH A;  1L0L H;  4I50 B;  5TIS Z;  3C3T A;  3J7A U;  2IH1 C;  1V54 C;  3CXC U;  1VQ8 V;  1XEQ A;  4MW8 A;  2DQ0 A;  1FXK C;  3E83 A;  4AIL C;  3UO3 A;  2OWO A;  4GKJ O;  4LWS B;  2WWW A;  4JAU A;  3JD4 A;  2JEU A;  1R73 A;  1YJN V;  1SF9 A;  3KCY A;  3F7V C;  4DR2 B;  2RJZ A;  3IAY A;  1SQQ H;  3K5L A;  3R65 A;  2P06 A;  4BIZ A;  4UXN A;  3IC9 A;  1VQ4 V;  4DR3 O;  4GX2 A;  4O2A A;  3ZMU A;  1I5Y A;  1VQM V;  1XBL A;  2EIK B;  4PA4 A;  5J2U B;  2WLL A;  5IJ9 B;  1LR1 A;  4CS4 A;  2HJD A;  4WFH A;  5LA6 A;  1FXK B;  1KBH A;  5EC2 C;  3TXS A;  1YXB A;  4IGG A;  3G67 A;  4DO2 A;  4DV0 B;  1Q90 D;  4B7E A;  2Q9L A;  3TK1 A;  1JX9 A;  1PP9 H;  1K5S A;  5LL6 Y;  3JAK B;  1P49 A;  4L8J A;  2G38 A;  4JI6 B;  3SYQ A;  3OTO O;  1E1R G;  3ETQ A;  3NXS A;  5FL7 G;  4BR6 A;  1QNM A;  1S0V A;  1OCZ C;  4U3J B;  1VF6 C;  2XUM A;  5B1A C;  4DV2 O;  3L75 H;  1F23 A;  4B3T O;  3GWK C;  3S3W A;  3MD0 A;  4DR2 O;  2UUB B;  5KA5 A;  4KHP B;  4HNA A;  1PD3 A;  2ZE5 A;  2KB1 A;  1SZT A;  3OR7 C;  1V54 B;  1WB8 A;  3E22 A;  2ADQ B;  4U3J A;  2Q67 A;  1Q6H A;  2RCV A;  1JVM A;  3BA9 A;  4NTX A;  5CA1 B;  4DW1 A;  1MOF A;  3GB7 C;  3UM7 A;  3WG7 B;  2Y4U A;  1IBM B;  4LF4 O;  1QU7 A;  3FAV A;  1ZL8 B;  5JQG B;  3ZN1 A;  3FB5 C;  3DTU B;  5CBH A;  1VQL V;  1Q3E A;  1PM9 A;  1JFF A;  2W6J G;  4JYY A;  3K58 A;  4UV9 A;  2P6J A;  2BTO A;  3CCM V;  1HDJ A;  1AJP A;  4L87 A;  2HHH B;  3AK1 A;  3WB0 A;  4O4J A;  4FFB B;  5LXT B;  3E86 A;  1Y66 A;  4GKK B;  1MMM A;  3W7S A;  2V7Q G;  2NLJ C;  3E2E A;  1GN6 A;  4WFG A;  2HKO A;  4X89 A;  2B1I A;  4DUZ O;  4JI5 O;  3B09 A;  4F6R B;  2JK5 C;  1VAR A;  1FJG O;  4KHP O;  4FVM A;  2DQ3 A;  3JAS A;  3AG4 C;  4GT1 A;  2QWO B;  1SKV A;  3IGA C;  4P30 A;  2PF4 E;  4JV5 B;  1VQ9 V;  4DV5 B;  1OCC C;  5J2T A;  1X4T A;  2CTP A;  4IHJ B;  1Y76 B;  5BZB A;  1GRJ A;  3QVN A;  1KKD A;  1XMQ O;  3RYI B;  3N2K B;  3CHX A;  4FLX A;  4UVB A;  4AQY B;  4JI4 B;  2UXX A;  1NR1 A;  2CDY A;  2RMK B;  2Q0A A;  5FPO A;  2YXL A;  4JYB A;  1YSC A;  2UXB B;  1M56 B;  4N23 A;  1GN4 A;  2UUC B;  4JI6 O;  4CC5 A;  4OX9 O;  5LMU O;  4K35 A;  1WA8 A;  2XAH A;  3WB2 A;  4PDV A;  1GMG A;  2EIL B;  2YEV B;  1M57 C;  5LHH A;  1R3L C;  5IE9 A;  1HP8 A;  4DUZ B;  3AG3 C;  1K4C C;  4R6Z A;  4XDK A;  4NXN O;  3C90 A;  3LSU A;  5LBQ A;  5KX5 A;  1XNQ B;  2JGU A;  4X1Y A;  3B4S A;  3ICX A;  4DV3 B;  2UUB O;  2LFR A;  2AW9 A;  2R9A A;  4DV1 O;  2Y0I A;  1QBZ A;  3CCU V;  4DR6 B;  1AI5 A;  2YID A;  3ZMZ A;  2E76 B;  1HNX O;  4WBN B;  2ZXW C;  2P67 A;  1KKC A;  2Z0A A;  3JAL B;  4DV4 B;  3K57 A;  1QQC A;  3FYI B;  3UQ8 A;  3PJS K;  1N34 O;  2PYL A;  3AG4 B;  3AG2 B;  3C3S A;  2F4V B;  2XND G;  4D7S A;  1M57 B;  4IIJ B;  4O4H B;  1K5Q A;  2UXB O;  1YVW A;  2HG5 C;  4YJ2 A;  1H2N A;  2N05 A;  4JPR A;  3QG5 A;  4ZOL B;  3AK2 A;  4WBN A;  1BMF G;  1EN5 A;  2FL4 A;  4JZ2 A;  3JAL A;  4TV9 B;  1YJ9 V;  1CXZ B;  4N21 A;  4R8C A;  4LF7 B;  4QIW F;  4WFB V;  5FLX N;  1MNG A;  4Q20 A;  3OR6 C;  1QLE B;  3LDC A;  4O4J B;  3UO2 A;  2KG7 B;  3RYC A;  1ZLZ A;  5A9G A;  1G4Y B;  2Q4P A;  1H2G A;  4JF3 A;  1MA1 A;  4FPP A;  4YJ2 B;  5A2Q N;  4JYA O;  4HZ3 A;  4LF6 O;  3D36 A;  4JZG A;  4PA3 A;  3E35 A;  4I0X A;  1XQ8 A;  2XAQ A;  3ABU A;  2P22 C;  1A32 A;  1RM1 B;  2UU9 B;  4X65 O;  4TV9 A;  1EZJ A;  2CUG A;  3KG2 A;  1R6K A;  2B1G A;  4J11 A;  1AR4 A;  4U7O A;  4DRX A;  2M6Y A;  1DGS A;  4P2Z A;  3ZN0 A;  1HNZ O;  2H94 A;  3CRQ A;  5JVD B;  1ZUQ A;  4JTC B;  2XAF A;  5CA0 A;  1GM9 A;  3OUS A;  1K4D C;  3ZHQ A;  4X8A A;  5H5N A;  4NYK A;  3PN1 A;  1KC8 W;  4FLV A;  1BSM A;  5KAF Z;  1W0J G;  4AI8 A;  3P30 A;  4HBN A;  1FD9 A;  1BQ0 A;  3B8M A;  2PTM A;  2MW2 B;  2QKC A;  3B77 A;  5C93 A;  2QWP B;  3SR2 C;  1Q8I A;  1ZTE A;  2L6L A;  1I7F A;  1K7D A;  1Q81 W;  2JEX A;  4DV7 O;  1DF4 A;  4IYI A;  2EIN C;  4BW5 A;  4DK0 A;  3T1H B;  2ZM6 B;  2WSS G;  5LP6 B;  4UCR A;  1OCO C;  2RDC A;  2QSA A;  2YIB A;  2OTJ V;  3KCX A;  1SES A;  4OGQ B;  2BTQ A;  4QE9 A;  1R1B A;  3ZX6 A;  4BIO A;  1AJQ A;  5LA6 B;  3E8B A;  2R72 A;  3CCS V;  5IYB O;  2CTQ A;  5LYJ A;  3EFF K;  2A0L A;  1VEW A;  4PDM A;  1W0K G;  5ITZ A;  4OXS A;  1NTM H;  4DR6 O;  3P32 A;  3A0R A;  4X1I A;  1FAF A;  1LUV A;  1D5A A;  1P84 F;  1X59 A;  4X20 B;  2K1E A;  2DN9 A;  1Z5W A;  1K97 A;  4PDL A;  3TCU A;  3CCQ V;  4GCZ A;  1M1K W;  1GN3 A;  1N36 O;  3APO A;  1OZ0 A;  4ABM A;  5H6Q A;  1HNW O;  3FYE B;  1F4N A;  3E8G A;  1N32 B;  3KKY A;  4HNA B;  4O4I A;  2DYR C;  1YEW A;  4MVZ A;  1G8M A;  2VWK A;  3ZJZ A;  2ZQM A;  2ZT9 B;  1KMI Z;  1J5E B;  3CC4 V;  1KP2 A;  4DR3 B;  5CA1 A;  1JJO A;  2Y69 B;  3MDS A;  5FNV B;  1WA8 B;  4FLT A;  1OCR B;  3CMA V;  2YEV A;  5IJ9 A;  3E22 B;  4DV0 O;  3FX7 A;  1LNQ A;  2WA3 A;  4UCT A;  1BGY H;  2HVK C;  2VQF O;  1GK9 A;  1U96 A;  4FM0 A;  1YIT V;  5IY5 B;  5JJE B;  5L3C A;  4I0X B;  3CSX A;  1FS0 G;  3AEI A;  3FFQ A;  5LP6 C;  2OT5 A;  1Y4M A;  3JAK A;  4W4L A;  4ASU G;  2ZIO A;  3ZRW B;  2JS5 A;  1G6U A;  3Q4H B;  5EBL C;  1B3Q A;  2EIM B;  1OCZ B;  2ZR2 A;  2Q6A A;  5KHK A;  2NR5 A;  4D6T H;  2WLJ A;  1V55 C;  1K9M W;  3X2Q B;  4JV5 O;  3CP1 A;  4GLX A;  4EB6 A;  4FLU A;  5LOV B;  1THZ A;  2YSU B;  4MS2 A;  3NR7 A;  1QVG U;  3ZHV A;  4UB6 Z;  4X1I B;  1BL8 A;  2AHY A;  1Y74 B;  5B3S B;  1M90 W;  3DC6 A;  3H01 A;  3BEH A;  3B40 A;  5LHI A;  4AQY O;  5KAI Z;  3ETD A;  4K3A A;  3OGI B;  1OCC B;  1VQK V;  2Q68 A;  1URF A;  2DW4 A;  2IJK A;  2FTK A;  3F5T A;  2YXH A;  2QE7 G;  3LDE A;  4G28 B;  2EJ7 A;  2Q7E A;  1BE3 H;  4K0K B;  1PV0 A;  3RYI A;  4JI1 B;  1Y74 A;  1L1F A;  2F95 B;  1JFF B;  4LBE C;  1OV9 A;  1SQV H;  4J9Y B;  2AXT Z;  4FM2 A;  4DR5 B;  1Q7Y W;  1K33 A;  1VQO V;  4QGP A;  4F4L A;  1OCR C;  2ITC C;  5B5E Z;  1NVP B;  1FJG B;  3AG1 C;  3CRR A;  1QLN A;  4DR4 O;  2GUZ B;  3BAB A;  3GVM A;  4X1Y B;  5IJ0 A;  5CN0 A;  5FPR A;  2EBO A;  4LF9 O;  4LFA O;  1N32 O;  1Q6I A;  1W59 A;  5KHH A;  2JJ2 G;  4YHH O;  3OT7 A;  4EKW A;  1O9G A;  4J7J A;  4E4E A;  1U97 A;  1XMQ B;  3FAV B;  3IJ4 A;  5JCO C;  1E1Q G;  1TA8 A;  4KP4 A;  3RYH A;  5BXZ A;  3L71 H;  1HR0 O;  3W7X A;  4JI8 B;  2N74 A;  2ZXW B;  5IYD O;  3RBZ A;  2WLN A;  3FD9 A;  1OHH G;  2UXN A;  2IJI A;  4PEL A;  1H2M A;  4PDR A;  3TGU H;  2UUC O;  4MVR A;  1TUE B;  3BAA A;  3ABK B;  4W4K A;  1D5N A;  4MVO A;  2D3O W;  3HKD B;  4HYO A;  1XMO B;  3HR0 A;  1NKD A;  2ZDI C;  2P90 A;  3ZRW A;  3L9D A;  4O2B B;  5BY1 A;  4DV3 O;  2CH7 B;  1N0N A;  2IM9 A;  4DR4 B;  2R9I A;  2UU9 O;  2GHY A;  4QJF B;  3AG3 B;  2QKS A;  2WLI B;  2K9P A;  1KB9 F;  4NXM B;  3ASO C;  2CTR A;  4ZIB A;  1XNQ O;  2A9H A;  3RW0 A;  1NH2 B;  3H1L H;  2EIL C;  5KHG A;  3BY6 A;  1GM8 A;  3DXR A;  3G80 A;  5L3F A;  3CYO A;  5B1B C;  4JI7 B;  3H1K H;  1N34 B;  3RFR A;  1H8H G;  4LWS A;  2WLI A;  1B06 A;  1EN4 A;  4K8X A;  3K9S A;  3QO5 A;  3SYP A;  3CCE V;  4DV4 O;  1AIL A;  1GM7 A;  2ZD9 A;  2XT9 A;  2V4D A;  4H37 A;  1YZB A;  3FKS G;  3R66 A;  4OPA A;  5JH7 B;  4UFZ A;  5K1X A;  1RPO A;  1ZWI C;  1AJN A;  1XNR B;  1FXH A;  1V55 B;  2EIJ C;  1I0H A;  2DYS C;  1DK1 A;  4EEQ A;  1LUW A;  5JJJ B;  1S72 V;  4TT3 G;  4JYA B;  5JQG A;  1PNM A;  3J80 N;  2X6B A;  5CA3 A;  1T5E A;  1WPB A;  2MK3 A;  4DK1 A;  3CME V;  2GBO A;  4RQE A;  4TSF G;  1R6N A;  4R50 A;  3QTC A;  4J7K A;  5FNV A;  1PKX A;  1VQ5 V;  5GON B;  3QO8 A;  1SQF A;  5GTH Z;  1F51 A;  3OTO B;  1VP7 A;  2X7R B;  1SQP H;  4CH4 A;  3W7T A;  4JAS A;  1BT8 A;  1W2B U;  2HJF C;  1JCH A;  3OE7 G;  3EHB B;  1K73 W;  4B08 A;  5ITZ B;  1Z5V A;  2WLL B;  4CS3 A;  2OIE A;  2ADP A;  3G71 V;  3RVY A;  3VQX A;  4UCO A;  3Q4H A;  3U11 A;  3AG1 B;  4OPH A;  4O4I B;  1XNR O;  4J80 A;  4B3M B;  2OTL V;  2ZM6 O;  1WP7 A;  2JDI G;  3CEI A;  3CCV V;  2XOK G;  3K08 A;  3F7Y C;  3M99 B;  5EYP B;  4FM1 A;  3MHS C;  4ZBM A;  3SPH A;  1VF5 B;  1M9N A;  3JD3 A;  4QE7 A;  1M93 A;  4DUY B;  5LP6 A;  1XRE A;  2DE0 X;  4NTW A;  3K0G A;  1IBM O;  4DXW A;  2UXD B;  1S3J A;  1SS3 A;  4LF8 O;  1F7Y A;  2Q5Z A;  3TJT A;  1XIL A;  5JVD A;  5LYJ B;  1P4R A;  1RPR A;  1KQS U;  2OCC B;  4U7N A;  3CWB H;  1IDS A;  1KP3 A;  4R7C A;  1RM1 C;  2HR3 A;  3OM3 B;  4X65 B;  4X20 A;  2C2A A;  3A8T A;  1M5I A;  1RSO B;  2PUS A;  2RNB A;  3LDD A;  2IW5 A;  3JCU Z;  4UVA A;  2YC0 A;  2ZR3 A;  3CPW U;  4NKG B;  4JI5 B;  5GW7 A;  3N2G B;  1RP3 B;  1SRY A;  3RT3 C;  1JR9 A;  4B3T B;  1VQN V;  5L3D A;  2WLH A;  1PNK A;  1ZL8 A;  5LMN B;  1PL0 A;  2JIZ G;  2OYQ A;  5H9C A;  3DC5 A;  4DV5 O;  1J5E O;  4HAM A;  1YTF B;  2F66 C;  3VQW A;  5EZY A;  2V1D A;  2QA4 V;  2OCC C;  3I56 V;  1BZK A;  3U0Z A;  3I5D A;  4YY3 O;  5E79 Z;  3K3W A;  2B5U A;  2PGG A;  3ZHS A;  3ABM C;  1Q5O A;  3ABL B;  1TVK B;  4LF8 B;  3BVO A;  2CE4 A;  3T1Y O;  1BS3 A;  1Y67 A;  4DRX B;  1FYJ A;  3D36 C;  1XOU A;  1VQ7 V;  4JAV A;  2UXC B;  1AVM A;  4G2K A;  3HB3 B;  2BSK B;  5EYP A;  1K92 A;  4MW3 A;  2ZE6 A;  2LQT A;  5IYZ A;  2ILM A;  1US6 A;  2BE3 A;  1Y76 A;  2BOB C;  4YIP A;  3H1J H;  2EIN B;  3T4Z A;  2EUL A;  1Q6U A;  5LGN A;  3H1I H;  1IXB A;  1WAZ A;  4X9Q A;  3CD6 V;  5H2F Z;  4NTY A;  1H2K A;  2WLM A;  3CJH A;  3UCS C;  4CC6 A;  1WJZ A;  3LSS A;  2L35 A;  2JVD A;  5DM6 V;  4RUF A;  4B3M O;  1NI8 A;  3LSQ A;  4MT8 A;  5CBF A;  2HFE C;  3OGC C;  2WPD G;  4IL6 Z;  3VBB A;  3WFV A;  5B1B B;  1HNX B;  1IBK B;  2HVJ C;  1NZ6 A;  4MTF A;  4GX1 A;  4IT5 A;  4Z2W A;  2CGN A;  1NT2 B;  1AR5 A;  2PY5 A;  3ASN C;  4I9W A;  1RFY A;  2EJR A;  1IVS A;  1DLB A;  1NQT A;  2GTA A;  5B3S C;  1GO3 F;  1EBO A;  2ZE7 A;  4U3F H;  1SQG A;  3RYH B;  4DR5 O;  4BAY A;  2Z5U A;  4UCU A;  4B3R B;  2P4V A;  1GAX A;  3AG2 C;  2DYS B;  2ZCE A;  1E79 G;  4PHZ A;  3G6B A;  3HKE B;  1XI1 A;  4AHC A;  5LOV A;  5AG2 A;  3UT5 A;  4MTG A;  2JJ1 G;  1YI2 V;  3ZS8 C;  3ZHT A;  1NH2 D;  1TUB A;  1B04 A;  3E89 A;  2DWE C;  1M4U A;  3BCC H;  2WLK A;  4MTO A;  2VWJ A;  1N8R W;  3OD4 A;  3ZRV A;  4YHH B;  4PV1 B;  4DV6 B;  2F93 B;  3LNM B;  2GV9 A;  3SYO A;  1IBL B;  1MAB G;  1QHT A;  1JOY A;  5IJ0 B;  3ZMV A;  1NTZ H;  4XDJ A;  4DR7 O;  1NJI W;  1FFX A;  4X64 B;  2D2C B;  4NB5 A;  2WA4 A;  2CTW A;  1SA0 A;  4DR1 B;  2HEP A;  1KU9 A;  2YXY A;  3DXR B;  1SQX H;  4JI8 O;  4LNU B;  3ZMS A;  1IBK O;  1GTO A;  1YDX A;  3E8H A;  4J7Z A;  1HNZ B;  4YY3 B;  3JAT A;  2XTA A;  1AP5 A;  2QM8 A;  5IDJ A;  3JAR A;  4GYC B;  4Z1M G;  1H38 A;  2E5L B;  1AR1 B;  3MAQ A;  4LFB B;  2YI8 A;  4GUN A;  1IX9 A;  3GWO A;  2QDO A;  3TXQ A;  2EZP A;  4I4T B;  5KMG A;  2W0X A;  3RGB A;  4QNH B;  1S5J A;  2EZO A;  4WFE A;  2VQE O;  1XMO O;  1NTK H;  5KHI A;  4I55 B;  4XDL A;  2X0L A;  3CX5 F;  4O4L A;  3HKB A;  5EIB C;  3P3N A;  2UUA B;  2ARH A;  3FB6 C;  3APQ A;  1VQ6 V;  1B6Q A;  4NR1 A;  4BWA A;  3IC7 A;  4J41 A;  4TQF A;  5KLV H;  1ZAU A;  2A3Q A;  4O2B A;  3ABK C;  1I94 O;  3CS5 A;  4Q6G A;  4DV6 O;  4FLW A;  4XBF A;  2YS8 A;  3K06 A;  1NBM G;  2ZNJ A;  4LH6 A;  2QKA A;  3N27 A;  4GZR B;  5IWA B;  4FK5 C;  4DR7 B;  2R70 A;  3JSN A;  3JYC A;  4C7U A;  3ASO B;  4DR1 O;  2OCH A;  1WN7 A;  3K5N A;  2IH3 C;  1YIJ V;  4MVS A;  3STL C;  4H0L B;  2FKX A;  4I5S A;  3OMN B;  1TAE A;  4FIP C;  1J95 A;  5KX5 B;  4ZHQ A;  3SYC A;  5F2V O;  5KUK A;  1ARO P;  4F6R A;  4LCU C;  5JWP A;  1HNW B;  2W0F C;  4JI4 O;  2IJH A;  1TGO A;  5L3G A;  2Q7G A;  1K34 A;  1EM1 A;  3JD0 A;  1V9P A;  2GUZ A;  5EK0 A;  3RN4 A;  2JS3 A;  3CC2 V;  4UV8 A;  4TV8 A;  3CE2 A;  1NR7 A;  2E74 B;  4KUM A;  5LMU B;  3U10 A;  4F6E A;  1JMK C;  5B1O A;  4CH6 A;  1UFI A;  4ZI7 A;  4LF5 B;  3HKE A;  4TUY B;  3MHH C;  3JAW A;  5BMV A;  3UT5 B;  3J81 N;  3K5M A;  3RWR D;  3JCZ A;  2DMX A;  3F5W C;  3SJB C;  4X66 O;  4JI2 B;  2YIC A;  2JGD A;  4WF9 V;  3FB7 C;  4UCV A;  5IY5 C;  4KL1 A;  3VQV A;  1F4M A;  4ZOL A;  1ORQ C;  2BCC H;  4X62 O;  4PI2 A;  5B1N A;  3ABT A;  3EVK A;  1L0N H;  3M8A A;  4O4L B;  3ABL C;  3CXH F;  1N33 O;  2KSD A;  2LFS A;  3P3P A;  4WCE V;  2Q69 A;  4J9Z B;  4JI3 O;  4FJC C;  3ZMT A;  2CGO A;  1ROP A;  1K8A W;  1SZX A;  4JI7 O;  3JAR B;  1H2S B;  2EIK C;  2ZIM A;  1FXV A;  2LO1 A;  2W6I G;  2Y0P A;  3A0B Z;  4KFM A;  2GTS A;  3OW2 U;  4FZ1 A;  5JH7 A;  1QVF U;  3QO7 A;  4JAA A;  5HFL A;  3CCL V;  3G4S V;  1SC5 B;  1AI4 A;  3O65 A;  1WPX A;  1R6T A;  2IU3 A;  4CBC A;  4LH7 A;  4PA9 A;  5CA0 B;  3CJH B;  2EX3 A;  2ITD C;  3A2F A;  5D5Q A;  2QGN A;  3HKB B;  4RWU A;  2P7T C;  1XDC A;  2BOC C;  4LFC B;  5HFM A;  3CCJ V;  2CK3 G;  3SYA A;  2F23 A;  1I94 B;  4DUY O;  1TUB B;  3SPG A;  5EBW C;  2P4K A;  3OEH G;  2X6C A;  1K3E A;  2VS0 A;  4X62 B;  2QTS A;  3G6E V;  4K0K O;  3BRC A;  2DJV A;  2VQF B;  4MSW C;  4JI1 O;  4CZZ A;  1KEC A;  3OFN G;  4DV1 B;  3DSQ A;  4I50 A;  5H6R A;  1XHZ A;  3B8N A;  5GON A;  5BR8 B;  5JJN B;  3ASN B;  4TUY A;  3OAA G;  4H33 A;  1Q43 A;  1Q82 W;  3JAW B;  4P9O A;  1VMG A;  1NVP D;  4JI3 B;  3RYF B;  2AZ2 A;  4LNU A;  2ODM A;  2BTQ B;  3H1H H;  2H8P C;  1FKA O;  5LMN O;  2BSK A;  3CRM A;  1XHX A;  4H13 B;  2ZKO A;  1N0J A;  4A5U B;  1FFT B;  2QWN B;  2XAJ A;  1QR9 A;  3K5O A;  5L3E A;  4I4T A;  5KMG B;  4DYL A;  1QLE C;  2JRI A;  2R9R B;  2DWD C;  2QEX V;  3JD2 A;  2VRZ A;  3B2E E;  4I55 A;  1VQP V;  3WG7 C;  1OCO B;  1YF2 A;  5J2U A;  1AI7 A;  3WB1 A;  5DN6 G;  4PD4 F;  1Q86 W;  3L74 H;  2KG7 A;  1YJW V;  4CH3 A;  2NNU A;  2LJ2 A;  4YJ3 A;  4JTD B;  3ZHU A;  3T2M A;  4QPJ A;  5DEC A;  4TWK A;  1FXK A;  3T1Y B;  3W7U A;  3N2G A;  1O9H A;  4GKK O;  1BQZ A;  5BR8 O;  5IYZ B;  1SQB H;  3OMA B;  5D5P A;  4CH5 A;  2O57 A;  2WAM A;  2Q8V A;  3ETE A;  4I7Z B;  1MZE A;  4B7K A;  2ATK C;  2YI9 A;  2YIA A;  2YDE A;  4YIO A;  2HP8 A;  2OIG A;  4RO2 A;  2Y4T A;  2Y48 A;  2QR4 A;  4DV2 B;  1AB3 A;  2RQ6 A;  2LW7 A;  1L8D A;  2DYR B;  3HKC A;  4EFB A;  2FYU H;  5EIB D;  1H2L A;  4P9P A;  3S3X A;  1G1X B;  1SA0 B;  2Z3Y A;  3T1H O;  5CBG A;  1S5L Z;  1FPO A;  2LGW A;  5KUM A;  3ML0 A;  4J10 A;  3K59 A;  3HKD A;  1QCE A;  4B3S O;  3OMI B;  2ZDI A;  3VOU A;  1R3I C;  2GSM B;  2IBZ H;  3JAM N;  1BHB A;  2LGQ A;  3K79 A;  5KHJ A;  2VQE B;  2Q7H A;  4RAI A;  3HKC B;  3ZHR A;  1WLE A;  3SPC A;  2A06 H;  1Y6X A;  4MVQ A;  2AHZ A;  4LF4 B;  3KZI Z;  2JGD B;  2HHH O;  1S76 D;  1WP8 A;  2UUA O;  1YCI A;  5CB4 B;  1KUQ A;  2F43 G;  5LGU A;  4UUJ C;  4EFE A;  2KKW A;  4IIJ A;  3RVZ A;  2EIJ B;  3CB2 A;  4ZKI A;  2LW1 A;  4JTA B;  3OUF A;  3K04 A;  3D8C A;  3A0H Z;  4X64 O;  4QPK A;  1BHA A;  3M7M X;  3ZRX A;  3EXA A;  5J2T B;  1VF7 A;  3O9O A;  2Q73 A;  3RYC B; 
#chains in the Genus database with same CATH homology
 1OCC C;  4MTX A;  1E1Q G;  5IYC O;  3ZMS A;  5BZB A;  1GTO A;  4YXW G;  3W7W A;  3SPJ A;  5EC1 C;  2XAS A;  4KP4 A;  3E8H A;  1KKD A;  1IXM A;  3E8F A;  2QM8 A;  2XAG A;  3W7X A;  5IDJ A;  1DF5 A;  2ZXW B;  4Z1M G;  4UVB A;  5IYD O;  3RBZ A;  1H38 A;  2WLN A;  1KD1 W;  1OHH G;  1AR1 B;  2UXN A;  1H8E G;  1SER A;  2IJI A;  1AI6 A;  4PEL A;  3GWO A;  2EZP A;  2UXX A;  4PDR A;  3T4D A;  1CP9 A;  1NR1 A;  4QNH B;  3LUT B;  4JYB A;  4MVR A;  1TUE B;  3K03 A;  1YSC A;  3ABK B;  1M56 B;  4N23 A;  2EZO A;  4WFE A;  3FB8 C;  3SJQ C;  4MVO A;  3JD1 A;  1GKF A;  2D3O W;  3HPL C;  1S77 D;  4XDL A;  2X0L A;  5CMU A;  4HYO A;  3X2Q C;  2XAH A;  3FB6 C;  1NKD A;  4G27 B;  1UJW B;  4JYC A;  4PDV A;  2ZDI C;  1GMG A;  2P90 A;  1B6Q A;  2EIL B;  3ZRW A;  2YEV B;  1M57 C;  3IC7 A;  5LHH A;  1R3L C;  4LP8 A;  3AG3 C;  1K4C C;  4R6Z A;  4XDK A;  2LP7 A;  2R9I A;  2GHY A;  3ABK C;  3IFX A;  5LBQ A;  4QJF B;  3AG3 B;  1EFR G;  4XBF A;  2QKS A;  2WLI B;  3OEE G;  1MSW D;  3K06 A;  1NBM G;  3CC7 V;  2LFR A;  4FMT A;  4FK5 C;  3ASO C;  3JYC A;  2A9H A;  3RW0 A;  3ZCC A;  1NH2 B;  3ASO B;  4MVU A;  2EIL C;  1QBZ A;  1DTO A;  3BY6 A;  1GM8 A;  3CCU V;  2IH3 C;  5L3F A;  1AI5 A;  3ZMZ A;  3CYO A;  1YIJ V;  4MVS A;  5B1B C;  4GX5 A;  3STL C;  1JPX A;  4I5S A;  3OMN B;  3I55 V;  2ZXW C;  2P67 A;  4FIP C;  1J95 A;  1H8H G;  2A79 B;  3SYC A;  2WLI A;  3FYI B;  3STZ C;  5KUK A;  1ARO P;  1COW G;  3PJS K;  3QO5 A;  3SYP A;  3CCE V;  4LCU C;  3AG4 B;  3AG2 B;  2W0F C;  1GM7 A;  2ZD9 A;  2XND G;  4X88 A;  3K0D A;  4H37 A;  1M57 B;  5LHG A;  3FKS G;  2IJH A;  2QM7 A;  4WFF A;  1K5Q A;  1P7B A;  2HG5 C;  5L3G A;  1K34 A;  1RPO A;  1ZWI C;  1AJN A;  4JPR A;  3CCR V;  3JD0 A;  1YHQ V;  3TET A;  2IU0 A;  1FXH A;  1V55 B;  1BMF G;  1PNL A;  2EIJ C;  2DYS C;  3DGE A;  5EK0 A;  2QTO A;  3CC2 V;  4UV8 A;  1HWY A;  1XL6 A;  1NR7 A;  4KUM A;  1YJ9 V;  4RUE A;  4N21 A;  5B1O A;  4R8C A;  1S72 V;  4QIW F;  4WFB V;  4Q20 A;  3ETG A;  3MHH C;  3OR6 C;  1QLE B;  5KA6 A;  3LDC A;  4TT3 G;  3ABM B;  1PNM A;  3SPI A;  3ZIA G;  3QNE A;  2X6B A;  1G4Y B;  3JCZ A;  2EIM C;  5CA3 A;  1R3J C;  3F5W C;  1H2G A;  1YTF D;  2MK3 A;  4JF3 A;  4E2L A;  4FPP A;  2PI5 A;  4WF9 V;  3K9A A;  4HZ3 A;  3CME V;  3FB7 C;  3D36 A;  5IY5 C;  4RQE A;  4PA3 A;  1F4M A;  3E35 A;  4TSF G;  1ORQ C;  2XAQ A;  1RM1 B;  3ABU A;  1R6N A;  4R50 A;  1S5H C;  5B1N A;  1EZJ A;  3ABT A;  4RQF A;  1PKX A;  1CPY A;  1VQ5 V;  3KG2 A;  1XL4 A;  3ABL C;  1R6K A;  3QO8 A;  1F51 A;  2B1G A;  2LFS A;  4U7O A;  4WCE V;  2Q69 A;  2X7R B;  4P2Z A;  3ZN0 A;  1JJ2 U;  4J9Z B;  2H94 A;  4FJC C;  1JQ0 A;  1I5X A;  4JTC B;  4MVM A;  2XAF A;  3W7T A;  3ZMT A;  4PA6 A;  1GM9 A;  5J9P C;  1ROP A;  4JAS A;  3OUS A;  1W2B U;  1K8A W;  1K4D C;  2HJF C;  4X8A A;  1JCH A;  3T1C A;  3OE7 G;  3EHB B;  3ZRS A;  2X6A A;  1K73 W;  1KC8 W;  2WLL B;  1W0J G;  2EIK C;  1FXV A;  2W6I G;  3P30 A;  4KFM A;  5L3B A;  3B8M A;  3G71 V;  3OW2 U;  3RVY A;  1QVF U;  3B77 A;  3QO7 A;  5C93 A;  5HFL A;  5E1A C;  3CCL V;  3G4S V;  3AG1 B;  1M56 C;  1AI4 A;  3UKM A;  1K7D A;  1WPX A;  1Q81 W;  2OTL V;  5LGT A;  2JDI G;  3CCV V;  2JEX A;  1QR8 A;  2XOK G;  2IU3 A;  4PA7 A;  1DF4 A;  1ENV A;  2EIN C;  2HLD G;  4JGS A;  4CBC A;  3K08 A;  4BW5 A;  3F7Y C;  3M99 B;  4PA9 A;  2PI4 A;  3MHS C;  4ZBM A;  2Y69 C;  3SPH A;  1M9N A;  2WSS G;  1MG1 A;  2ITD C;  3JD3 A;  4QE7 A;  1OCO C;  4LC1 A;  1CEZ A;  2P7T C;  4WFA V;  2BOC C;  3K0G A;  2OTJ V;  5HFM A;  3CCJ V;  2CK3 G;  3SYA A;  1SES A;  4DXW A;  3SPG A;  1S3J A;  3D3I A;  4QE9 A;  4GX0 A;  5B1A B;  5EBW C;  1AJQ A;  2IJJ A;  3OEH G;  2X6C A;  1K3E A;  2M7W A;  5EBM C;  3E8B A;  3G6E V;  1P4R A;  1RPR A;  4MSW C;  2OCC B;  4U7N A;  3CCS V;  1KQS U;  5IYB O;  4CZZ A;  1KEC A;  1SET A;  3OFN G;  3EFF K;  2A0L A;  4PDM A;  5H6R A;  1W0K G;  3B8N A;  4UVC A;  1KP3 A;  1R3K C;  4OXS A;  4R7C A;  4BIU A;  1RM1 C;  3P32 A;  2HR3 A;  3A0R A;  2IH1 C;  3ASN B;  1V54 C;  3OAA G;  4H33 A;  3CXC U;  3OM3 B;  4P9O A;  1Q82 W;  2C2A A;  1NVP D;  1VQ8 V;  2K1E A;  4MW8 A;  2DQ0 A;  1FXK C;  3E83 A;  1K97 A;  4PDL A;  3LDD A;  2IW5 A;  4GCZ A;  3TCU A;  3CCQ V;  1M1K W;  4UVA A;  2H8P C;  2ZR3 A;  1OZ0 A;  3CPW U;  5GW7 A;  2WWW A;  1SRY A;  4JAU A;  3JD4 A;  5H6Q A;  2JEU A;  1R73 A;  1YJN V;  3FYE B;  1F4N A;  1VQN V;  3E8G A;  5L3D A;  2WLH A;  1FFT B;  2XAJ A;  3F7V C;  1PNK A;  1PL0 A;  2JIZ G;  2DYR C;  1QR9 A;  5L3E A;  3R65 A;  4BIZ A;  4UXN A;  5H9C A;  1QLE C;  1VQ4 V;  4MVZ A;  1G8M A;  2R9R B;  4HAM A;  2DWD C;  1YTF B;  2QEX V;  3JD2 A;  3ZJZ A;  4GX2 A;  2ZQM A;  3ZMU A;  2V1D A;  1I5Y A;  2QA4 V;  2OCC C;  3I56 V;  1VQP V;  3CC4 V;  1VQM V;  3WG7 C;  1OCO B;  1KP2 A;  2EIK B;  1AI7 A;  3K3W A;  2B5U A;  4PA4 A;  2Y69 B;  5DN6 G;  2WLL A;  1Q86 W;  3ABM C;  1YJW V;  1OCR B;  3ABL B;  2NNU A;  3CMA V;  2YEV A;  4WFH A;  1LNQ A;  4JTD B;  3T2M A;  4QPJ A;  1FXK B;  5EC2 C;  2HVK C;  1VQ7 V;  4JAV A;  1GK9 A;  4TWK A;  1FXK A;  4G2K A;  4DO2 A;  5IY5 B;  1YIT V;  5L3C A;  3TK1 A;  1JX9 A;  3W7U A;  3HB3 B;  1FS0 G;  1K92 A;  3AEI A;  2OT5 A;  1Y4M A;  4MW3 A;  1K5S A;  3OMA B;  3SYQ A;  4ASU G;  1E1R G;  3NXS A;  3ZRW B;  5FL7 G;  2WAM A;  3ETE A;  2BOB C;  2EIN B;  1S0V A;  1OCZ C;  3T4Z A;  2ATK C;  5EBL C;  5LGN A;  5B1A C;  2EIM B;  1OCZ B;  2ZR2 A;  2Q6A A;  3CD6 V;  1F23 A;  2WLJ A;  1V55 C;  1K9M W;  2WLM A;  3X2Q B;  4RO2 A;  3CP1 A;  3MD0 A;  2Y48 A;  5KA5 A;  1THZ A;  2YSU B;  4MS2 A;  1PD3 A;  3LSS A;  2KB1 A;  1SZT A;  3OR7 C;  2DYR B;  5DM6 V;  1QVG U;  4RUF A;  1V54 B;  1BL8 A;  3LSQ A;  4P9P A;  4MT8 A;  5CBF A;  2AHY A;  2HFE C;  3OGC C;  2Z3Y A;  5B3S B;  2WPD G;  5CBG A;  1M90 W;  3VBB A;  3WFV A;  5KUM A;  5B1B B;  2Q67 A;  3ML0 A;  1JVM A;  3H01 A;  2HVJ C;  3BEH A;  1QCE A;  4MTF A;  5LHI A;  4GX1 A;  3ETD A;  3OMI B;  1MOF A;  3GB7 C;  2ZDI A;  3UM7 A;  3VOU A;  1OCC B;  1R3I C;  3WG7 B;  2GSM B;  1VQK V;  2Q68 A;  1BHB A;  3ASN C;  3K79 A;  2DW4 A;  3FB5 C;  4I9W A;  2IJK A;  4RAI A;  3ZN1 A;  2EJR A;  3DTU B;  2FTK A;  1DLB A;  1NQT A;  1WLE A;  3SPC A;  5B3S C;  1GO3 F;  5CBH A;  2QE7 G;  3LDE A;  1EBO A;  4G28 B;  1VQL V;  4MVQ A;  2AHZ A;  2W6J G;  1L1F A;  4BAY A;  4UV9 A;  1S76 D;  2Z5U A;  2P6J A;  4LBE C;  3CCM V;  4J9Y B;  3AG2 C;  2DYS B;  1AJP A;  4L87 A;  1E79 G;  2F43 G;  5LGU A;  1Q7Y W;  1K33 A;  1VQO V;  4UUJ C;  4MTG A;  3E86 A;  1Y66 A;  4F4L A;  2JJ1 G;  1YI2 V;  1OCR C;  1NH2 D;  2ITC C;  3RVZ A;  3E89 A;  3W7S A;  2DWE C;  2V7Q G;  1NVP B;  2EIJ B;  2NLJ C;  4ZKI A;  3E2E A;  1VQ6 V;  4JTA B;  2WLK A;  3AG1 C;  4MTO A;  4WFG A;  2HKO A;  4X89 A;  2B1I A;  1N8R W;  3OUF A;  3ZRV A;  3K04 A;  1QLN A;  2JK5 C;  3LNM B;  5CN0 A;  4QPK A;  3SYO A;  1BHA A;  1MAB G;  2EBO A;  1JOY A;  2DQ3 A;  3AG4 C;  3ZRX A;  2JJ2 G;  4GT1 A;  3ZMV A;  3IGA C;  4EKW A;  4P30 A;  4XDJ A;  1NJI W;  1VQ9 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...