1JJ2U

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jj2U00
1N8RW 3CCLV 1QVFU 1JJ2U 1YHQV 2OTLV 3CD6V 2OTJV 1K73W 1VQNV 3G71V 3CC7V 3CC2V 4WFAV 1VQLV 1K8AW 1VQOV 3CCMV 1VQKV 3I56V 1M1KW 1VQ7V 3G4SV 1YJ9V 3CCSV 1YJNV 4WF9V 1YI2V 3G6EV 3CMAV 3I55V 3CPWU 3CC4V 1VQMV 4WFBV 3CCQV 3OW2U 1Q82W 1K9MW 3CCJV 1QVGU 1Q7YW 3CXCU 1VQ5V 1Q81W 1W2BU 2D3OW 2QEXV 1KD1W 3CCVV 1VQ8V 1KC8W 1R73A 4WCEV 1VQ6V 3CCEV 1VQPV 2QA4V 1VQ9V 1YIJV 1Q86W 1KQSU 1VQ4V 3CCUV 1YJWV 1M90W 5DM6V 3CMEV 1YITV 1S72V 3CCRV 1NJIW
chains in the Genus database with same CATH superfamily
2Q6AA 4B7EA 3CC7V 2ITDC 2R9IA 2NN4A 4X65B 1I0HA 3FYIB 3OMIB 2QKCA 2EZPA 1BT8A 2LW1A 1JMKC 5CBGA 3LNNA 5EYPB 4ZHQA 2YIDA 2ZR2A 3B77A 2Q7GA 2WLJA 4DUYB 4QE7A 3R65A 4DV1O 1G8MA 3TXSA 4YXWG 3CD6V 2ZKOA 2Y69C 4DXWA 2VQEO 4LFAB 3CRCA 3T1CA 1XBLA 3I5DA 3BA8A 3SYQA 3CRAA 1BL8A 4QNHB 2WLKA 1BMFG 5IYDO 3JSNA 5B5EZ 2AZ2A 5KX5A 5LMUB 2E75B 4YY3B 2P4VA 3WG7B 4X1YB 1OHHG 1Y66A 4I4TA 1BHAA 4DV5B 2UXDB 3ASOC 2N05A 1MABG 3HKEB 5DECA 3JD2A 3CX5F 5EC2C 4JZ2A 1AI6A 3CCUV 4J10A 4UVAA 4I5SA 1G6UA 4EKWA 3J80N 2XAQA 5IWAO 1SKVA 4LP8A 3QF7A 2WA3A 2YI8A 4UCRA 1FFTB 2ZE6A 1YDXA 3K0GA 3NR7A 4E4EA 2DJVA 3JARB 3LNMB 4LNUB 2QM4A 4O2BB 3H1JH 2K1EA 3CRRA 5CA1A 1FYJA 3E83A 1AJQA 1GN2A 1VP7A 4ASUG 4DR3B 4DR2B 5LHIA 3PJSK 3ZHSA 4B7KA 1EBOA 3SPHA 2EZOA 1N33B 1UJWB 4DV0B 4YJ2A 3U0ZA 1FD9A 2JK5C 2YDEA 3A0RA 1QNMA 1PPJH 5FNVB 2ZT9B 3ZIAG 2CK3G 2XAGA 4J9ZB 1LR1A 2RCVA 2ZR3A 4JI5B 4YJ3B 3G67A 1JFFB 2YUAA 3APOA 4LF8B 5EBMC 4MTFA 2E74B 3KCXA 5AG2A 3B09A 3ZS8C 1XHXA 4TUYA 1SQGA 4TV8B 1NU1H 4QIWF 2OTLV 1DF5A 1M57C 1VQLV 1P49A 4ZOLB 1Y74A 1ZUQA 3JASB 1M1KW 1IXBA 3K57A 3PN1A 1KMIZ 3CPWU 4LFCO 3QTCA 1HNWB 1LNQA 3GWOA 3U10A 3JAKB 4C7UA 2VQEB 4X66B 2KG7A 4FLYA 3L73H 5DN6G 3JYCA 3CWBH 2DYSC 1KKCA 5FLXN 2JS3A 2LJ2A 4DRXA 1S72V 3AK3A 5B1AC 1K73W 3E89A 3AG3C 4X20B 3SPJA 4YIPA 2H94A 4J7JA 3HKDA 3K79A 5B1BC 3CRMA 1I94O 1MSDA 1OCRB 2Q7HA 1AJPA 1HNZO 2CGOA 1IDSA 1VF5B 2YC0A 3SGIA 2GHYA 5D5PA 1TVKA 4UV8A 3OGIB 2ITCC 1FJGB 2OIEA 5H6QA 4RO2A 2WLLA 3SYCA 2YXYA 2X6BA 2JIZG 4NYKA 3W7XA 3D36A 5KHKA 1V9PA 1IURA 3UQ8A 1YI2V 4JZGA 4F6RA 5IWAB 2XT9A 2Q8VA 5DEDA 1CXZB 4HYOA 3BVOA 1AROP 3Q4HB 1H2SB 4MVQA 4RUFA 4X1IB 3RYCB 1RSOA 2RMKB 1WNSA 2QE7G 1ZL8A 2JGDA 2B1IA 1N36B 1SRYA 1GKFA 1H8EG 3BHPA 3N2GB 2P90A 3OR6C 5IJ0A 1XHZA 4QPJA 1HNXO 2L6LA 4HAMA 1XNQB 3C3SA 4X1KA 3BFRA 2KSDA 4MVMA 2IU3A 2RDCA 1FXKB 2CE4A 4F4LA 1IZ3A 3OUSA 1WB8A 2EIJC 5CA0B 3OE7G 1YSCA 1KYOF 2B1GA 3KCYA 2FTKA 5C8YA 5D5QA 3H1LH 2QWRB 3CYOA 4BAYA 2YXHA 4U7OA 3IC7A 3UT5B 2MK3A 2D2CB 2ZIMA 3P3PA 4IHJB 4PA9A 5BR8B 4EB6B 4XDLA 2Z0AA 3TCUA 2WLIA 3DTUB 4QE9A 1F4MA 3K06A 1GAXA 2EIMB 4FZ1A 1HP8A 2HHHO 3E8HA 4JI4B 4HNAA 3ZN0A 4CC5A 5BMVB 2Q0AA 3E86A 5CBFA 5IDJA 1VQOV 4DK1A 1RM1B 2OWOA 4OXSA 2YIBA 5BY1A 3CCJV 1BZKA 1KBHA 4D7SA 4MSWC 4U3JA 5L3EA 1S76D 3CE2A 1O9HA 4KXRA 3G71V 2ZCEA 3CC2V 4MS2A 1THZA 3DXRA 1WP8A 1Y4MA 4TSFG 1ZSPA 3ABTA 2UUAB 1QCEA 1JA8A 5L3FA 1FJGO 4X8AA 4AQYB 1WA8A 2EIKB 2GDSA 2NR5A 2ADQB 1NQTA 4CH5A 4OPAA 1G1XB 4JI1O 4UCSA 4D7TA 2F95B 4JYBA 1JJ2U 5LOVB 1S0VA 1WJZA 2OTJV 3HKBB 1K7DA 3ZHRA 2AHZA 1S5JA 5JH7A 2Q4PA 4TT3G 3ZBHA 1XMQB 2WAMA 3G6EV 4LF7B 2W0FC 1YXBA 2XTAA 3J81N 5GW7A 1M56C 5ITZB 1OV9A 4J80A 4JV5B 3AK2A 2LFRA 1SQFA 4FZ0A 1NKDA 3N27A 3UM7A 1Q5OA 3RYIB 4I55A 1H2LA 4JI2B 2IM9A 4O4LB 5F2VO 5J2TA 1Q7YW 1F23A 5GONA 4WCEV 3HPLC 5LOVA 2ILMA 2ZQMA 4QPKA 1EN4A 3CXHF 3J7AU 3E22A 3OEHG 5IJ9A 5LGUA 3IAYA 2M6YA 2UU9O 1WA8B 1JX9A 3L72H 2W6IG 3QVNA 4PA4A 2OCCB 3B4SA 1R3KC 2VWKA 5H5NA 4PJ0Z 5JJEB 2Q67A 4LC1A 2CTPA 1KECA 2WLMA 5GTIZ 2XASA 5BR8O 3OTFA 1EN6A 1GO3F 3ZHTA 1XILA 1B3QA 2IH3C 1Y67A 5JVDB 5IYBO 3K9SA 3ASOB 4CZZA 1N34O 2WWWA 1K3EA 4IGGA 3A0BZ 3ICXA 4G2KA 3WG7C 4O4HB 1VQ9V 2BSKB 4NKGB 3CHXA 3LSUA 5LXTB 1SZTA 1YITV 3E8BA 5E79Z 2BSKA 3LSSA 1K97A 5H9CA 1GK9A 1OCRC 3L71H 1KP3A 5KUKA 2WLIB 4DO2A 3OFNG 4B3MO 1E1QG 2EX3A 2N04A 5JVDA 3JAWA 3OAAG 5EBWC 1BCCH 4UVBA 2UUAO 2EILC 2DYSB 4UUJC 2DYRB 3E35A 3ZMSA 5CA0A 4UV9A 3TGUH 1F4NA 1GN6A 3JCUZ 3H1KH 4MVSA 1CEZA 4BW5A 3SPGA 3CCSV 2UXCB 2A06H 4WFGA 3D3QA 3IJ4A 1M57B 4BIUA 4MVOA 1J5EB 1RFYA 2ZIOA 3H1HH 3N2GA 2RJZA 1RPOA 4JI6B 2XAFA 3AG7A 1B6QA 4B3TB 1ZL8B 2OYQA 3ZRSA 4O4LA 2GUZB 2ZM6O 1YTFB 1QLEB 2QWOB 4EFEA 4I55B 2P7TC 1SERA 1QLNA 4I50B 1RSOB 4GUNA 3RYCA 1KQSU 4JI2O 3CB2A 3F5WC 3OGCC 1SETA 4GX5A 5IT9N 1D5AA 3Q4HA 4IYIA 2BE3A 3QO7A 1DF4A 3FX7A 3G80A 4RAIA 4TQFA 3LDDA 1QR9A 2P22C 2PTMA 2HJFC 2JJ1G 5LHGA 5KHHA 3L75H 4GYCB 1EM1A 2P67A 2DN9A 4GKJO 3HKBA 4FLXA 3EVKA 3GWKC 4DUZO 4R8CA 2ZE5A 2CGNA 5CN0A 4X64B 2BOCC 1KB9F 4X9QA 4NXMB 2DE0X 4ZBMA 1BGYH 1MG1A 2R9AA 5CA3A 4FFBA 2P4KA 1OCOC 1LUWA 1H2KA 2Y4TA 5LMNO 3JCZA 3RBZA 4I0XA 1N32O 1QU7A 5LGTA 1N34B 3VOUA 2QSAA 4U3JB 3IFXA 2O57A 4FVMA 2EINB 2Q5ZA 3AG1C 4W4LA 3AEIA 1FFXA 5JCOC 4B3RO 1V55C 1YZBA 3FB8C 2M7WA 4Z2WA 3MAQA 3JD1A 4L87A 1Q43A 1Y74B 3K5NA 2UXXA 3CS5A 1US6A 4X89A 1JJOA 4KP4A 4WFFA 4JI0O 5BXZA 1OJHA 5KHGA 4JTAB 5LHHA 1DK1A 5JQGB 1PD3A 3W7TA 2YIBD 2A3QA 4MW3A 2WLNA 3RVZA 3SYOA 4IHJA 3RFRA 5B1NA 1Q82W 3QNEA 4MTOA 3STLC 2QEXV 5KUMA 2EILB 1QR8A 1W0KG 1Q90D 2K9PA 3RVYA 4JYYA 3OD4A 3CMEV 3DGEA 2RNBA 1ENVA 4IYHA 2UXBO 2JGUA 2F43G 4FMTA 4YJ2B 3D3IA 2A79B 1JCHA 5LP6B 1VQKV 2LGQA 5JQGA 2WA4A 4DR5O 2UUBB 2F1MA 1PNKA 3EHBB 1N0NA 4DV2B 4JI6O 2CDYA 3E8FA 4OX9B 2NNUA 3M99B 3CCLV 4O2BA 1HR0B 3JD0A 4YHHB 1FFXB 3K5MA 4GLXA 1EZVH 3JARA 3G4SV 1P84F 3GVMA 5B3SC 4GKKO 1H2MA 2R70A 5B1BB 5LP6C 2HKOA 3IC9A 3SJAC 3K58A 2PI4A 4GCZA 4X1IA 1R6KA 1M93A 1XNRO 1EFRG 2QWPB 5FPRA 3RWRD 3VQWA 1AB3A 1CP9A 4TWKA 3ZRVA 4DUZB 4F6RB 2Y0PA 4X64O 1X59A 3CJHB 2QA4V 4CC6A 4X1YA 1I7FA 3CJHA 4ABMA 1IBMB 5FL7G 1R6TA 5LMNB 3ZMTA 1FPOA 3ABUA 1N32B 3BEHA 2MW2B 4DV4B 4BR6A 2IJKA 3LDEA 3HKDB 4LF5B 1WPXA 2QGNA 4P2ZA 3THOA 1EZJA 1QVFU 3B40A 4LBEC 2H3OA 3C3TA 1K8AW 4I9WA 3SPCA 1U96A 2GTSA 4XDJA 3T1YO 4DV3O 1OCCB 1XMOB 1I5YA 2LFSA 3U11A 1XQ8A 4LR3A 1B04A 2D3OW 4A5UB 1KC8W 2HFEC 1D2DA 5KHIA 4X65O 3ZJZA 2AW9A 1BE3H 3OT7A 2ZE8A 4U3FH 2EIKC 1FAFA 3CCMV 4H44B 1IXMA 1M9NA 5LP6A 2EULA 4DR1B 1X4TA 3FB5C 4CS2A 2UXBB 2JEXA 4DV6O 2FL4A 2KB1A 2LW7A 1DLBA 5FNVA 4MVZA 3ZHVA 4PI2A 4DV7B 4FM0A 2AGAA 2EIJB 2Y4UA 3T2MA 4ICGA 4DV2O 2IW5A 1YEWA 1ROPA 1GM7A 3MD0A 1AR4A 1RM1C 4DR6O 3K9AA 2AZ0A 1XL4A 2CTWA 1PV0A 1S5HC 3QO5A 3ZHUA 4YHHO 4JF3A 5JCOA 4J11A 5LXTA 2PUSA 4O4HA 1YIJV 1NBMG 3BABA 4GKKB 2E5LO 1T5EA 1SQQH 4QJFB 4LNUA 1KUQA 3ABLB 1XI1A 3F5TA 1K4DC 1AR1B 3ABMC 2X6AA 1XNRB 3SPIA 1MSWD 1MOFA 3S3XA 4I0XB 3ZX6A 2JJ2G 3JD3A 1FXHA 4WBNA 4CBCA 4JI7B 1YTFD 4XBFA 1S5LZ 4FFBB 3MHSC 4FLUA 5B3SB 4I9QA 3SJQC 3HKEA 2W6JG 2IH1C 1NTZH 3AG4B 3CCVV 4I4TB 5GONB 5KLVH 3NXSA 4X62B 4DR2O 2E76B 4LF5O 3BA9A 4BIOA 1R3JC 5EC1C 4K8ZA 3ETQA 4JAAA 1BSMA 4MVUA 3FKSG 2IU0A 2ZXWB 1FXVA 2XAJA 2PYLA 3AG1B 1P7BA 1SZXA 2F23A 1O9GA 2BTOA 1VQPV 4I50A 1WPBA 4DV3B 5EK0A 2X7RB 5ITZA 1XMOO 2GUZA 4JPRA 2PGGA 4LF8O 2Z3YA 2XOKG 5A2QN 4WFHA 3RGBA 4DUYO 2X6CA 4DV1B 5JH7B 1P7GA 1F7YA 4LF9B 1K33A 2H8PC 3ABLC 2QM7A 1PP9H 2FYUH 3APQA 2X0LA 4LFAO 1M5IA 4HBNA 2RQ6A 4LH7A 2V4DA 1HW7A 4CH3A 4LFCB 1HNWO 1XOUA 4KFMA 5A9GA 3K5LA 4DV6B 3G6BA 4O4JB 4R7CA 3VQVA 5LMUO 1NR1A 3RT3C 4NTWA 3AG3B 4YY3O 2QKAA 1I08A 3CXCU 3M7MX 2OIGA 2WSSG 1GRJA 4NTYA 1H38A 4AILC 5E1AC 4DR6B 4J41A 3JAWB 2HJDA 1I94B 1NJIW 3ABKC 3QO8A 2HP8A 3VBBA 1BQ0A 4Z1VA 2UXNA 2DW4A 4TV9B 1AI4A 1VF7A 1ZWIC 2E5LB 1NT2B 4PELA 1JPXA 3OR7C 1W2BU 2NLJC 4HNAB 1QHTA 4IIJA 3JATA 4LWSB 2QWNB 4Q6GA 3K08A 3OM3B 2VQFO 3ZRWB 4O2AA 4EB6A 3OTOO 1YCIA 3UT5A 3DC5A 3B2EE 1AVMA 1OCCC 5GTHZ 1Z5VA 1YJ9V 5IY5B 1BHBA 3D8CA 3UO3A 3E2EA 2EBOA 1CPYA 5C8YB 1MNGA 4NXNO 3SJBC 4JI7O 4NVPA 2YIAA 4RQEA 1MMMA 2JRIA 3KZIZ 3JD4A 4DR3O 2Q68A 1Q6UA 2PY5A 3A0HZ 2DMXA 3RYFB 1N36O 2HEPA 3ZRXA 3WB0A 2EJRA 3DC6A 3I56V 4DV0O 4RQFA 4JAUA 3TK1A 3DSQA 4CS3A 4X1KB 4X62O 4BWAA 3B8MA 1HNXB 3R66A 5IJ9B 1XNQO 3FYEB 5CB4B 1NS1A 3E22B 5IJ0B 2QTOA 4K8XA 2OT5A 5J2TB 1YHQV 2BTQB 1L0LH 1SA0A 1VF6C 5LA6A 3RYIA 3HR0A 4PDVA 1VIBA 3A2FA 1B06A 1Q3EA 2B9ZA 2BOBC 3STZC 3QG5A 2FKXA 3P30A 1GH6A 4PDMA 3UO2A 2DQ3A 1YJWV 2R9RB 4LF9O 3KKYA 2VRZA 4DR7O 5L3GA 4G27B 1P4RA 4X66O 4W4KA 3T4DA 2ZE7A 2HHHB 4DYLA 1Q6IA 3ETGA 2WLLB 3JALB 5C93A 1QVGU 3C90A 2YICA 3ZMUA 1R1BA 1G4YB 5J2UA 4FLWA 2XNDG 1DTOA 2WLHA 3VQYA 1HNZB 4DW1A 2VWJA 4GX1A 3VQXA 4FFKA 3DXRB 1Y6XA 1KP2A 2UUCB 4U7NA 4DRXB 3D36C 3WB2A 2YXLA 3ZMVA 1NR7A 5B1AB 1AI7A 4G28B 5EIBD 2KG7B 1SQBH 3P3NA 3ASNB 3JAKA 4GT1A 5EIBC 2FB5A 4LFBB 2YEVB 3ABMB 1M56B 3K5OA 1H2NA 3JASA 1GN3A 1URFA 4JI3O 4ZOLA 4JI1B 2LO1A 2VQFB 1VQMV 5BMVA 3OTOB 4DW0A 2IJJA 4FPPA 5TISZ 3RYHB 1VMGA 4LF7O 4J7KA 2YI9A 1JFFA 2JVDA 4NXNB 1SESA 2Q9LA 5LYJB 1N0JA 4ZKIA 1GTOA 1JOYA 1K5SA 4K3AA 5B66Z 1UPGA 4MT8A 1XEQA 1E79G 2LGWA 1SQVH 2IJHA 1VQ4V 2ZNJA 3A8TA 3UCSC 3WFVA 3FB6C 1FXKA 1ZTEA 4FM2A 4LCUC 1E1RG 2HG5C 3JSLA 2ADPA 5CBHA 1ZAUA 2DWDC 4RWUA 5KA5A 2F4VB 2YSUB 4MTXA 1D5NA 1YVWA 1KKDA 2JGDB 4TOIA 2P6JA 4KHPO 2EIMC 1NH2B 4DR4B 1WP7A 1WB7A 4J9YB 4I7ZB 4JI4O 4IT5A 1ZLZA 4BW9A 4GX0A 1GN4A 4DR7B 4IL6Z 3WU2Z 1KD1W 1GMGA 1VQ8V 1NZ6A 1JVMA 1TA8A 3K0DA 2DYRC 3AK1A 1TUBB 2LQTA 4PD4F 3ASNC 3FAVA 3TXQA 3EFFK 4N21A 3CCRV 2HLDG 4EEQA 3FAVB 1TUBA 3K3WA 2QR4A 3H9VA 2CTQA 1VQ7V 4P9PA 4PDRA 1Q8IA 4FK5C 5LBQA 1SC5B 4MW8A 1AP6A 3W7WA 5JJNB 2V1DA 1TVKB 2VS0A 4XDKA 3L70H 4PDLA 5KX5B 1Q86W 1H8HG 2UUCO 4B3MB 4CH6A 5FPOA 1V54B 4AQYO 5IYCO 2RN9A 2R72A 4HZ3A 4X20A 4UB8Z 2CTRA 3ZEDA 4LFBO 1VQ6V 3X2QC 4JI3B 3RW0A 1K4CC 1XMQO 5EYPA 3ZCCA 1ZX3A 4UXNA 4FM1A 1M4UA 3P32A 1OCZB 4JYCA 5HFLA 4RUEA 1PKXA 2XHBA 3W7SA 4JV5O 1R3IC 3LUTB 5H2FZ 3ETDA 4OGQB 2OCCC 4PV1B 2ZINA 1DGSA 3CCQV 4TV8A 1W59A 4TUYB 3EXAA 1NH2D 1K34A 1K5QA 3HB3B 5IYZB 2QKSA 3H01A 3AG4C 3FB7C 5LL6Y 4P30A 4JTDB 1MZEA 4YJ3A 3RYHA 4KL1A 4JYAB 5IYZA 2ZDIC 4NTXA 3F7VC 3ETEA 3JAMN 4B3SB 2DQ0A 4F6EA 4LF6O 5H6RA 1YF2A 2CH7A 2P06A 1OCZC 4BIZA 1HDJA 2IJIA 2UU9B 4D6TH 3BY6A 1IBLO 2YEVA 3S3WA 3N2KB 3X2QB 1M90W 2A0LA 4UCVA 3SDLA 2QDOA 3IGAC 4ZI7B 5L3CA 4J42A 2Q69A 4OPHA 5IE9A 5CA1B 4GKJB 2F4VO 2G38A 3T4ZA 4FLTA 1KU9A 1AP5A 3E8GA 3OW2U 4KHPB 4DR4O 1Z2GA 1Y76A 4TQDA 1AR5A 4WFEA 3L9DA 1SF9A 1TAEA 2GBOA 2F66C 1NTMH 1WLEA 2YS8A 1NTKH 1FS0G 1PNMA 2JEUA 3K04A 1PL0A 3MHHC 3JALA 4O4IB 5CMUA 3LDCA 2QJ1A 1VQ5V 4PA3A 2WPDG 4JGSA 1SQPH 3RN4A 3ABKB 2QM8A 1L1FA 1AJNA 2ODMA 3CSXA 4B3RB 2N74A 2PF4E 1J95A 1PL4A 4E2LA 3B8NA 5J9PC 1XL6A 4CS4A 2HVKC 1PNLA 1VARA 1WAZA 4JI0B 4K0KB 2DOSA 5LA6B 3BAAA 1FKAO 3BRCA 4QGPA 1IX9A 4L8JA 5JWPA 5K1PA 2AXTZ 2UXCO 1IBKO 4FIPC 1XREA 3F7YC 1TGOA 2PYJA 1EN5A 5K1XA 1LUVA 4UCOA 5CB4A 1J5EO 3CMAV 2F93B 4FLVA 4NR1A 4LH6A 3BCCH 3OMNB 3OMAB 2ATKC 3RYFA 4DK0A 4ZHQB 4DR5B 4B3TO 2ARHA 2UUBO 5KAIZ 2ZM6B 2CUGA 2JS5A 2QTSA 3AG2B 2HVJC 2XUMA 3T1HO 2EJ7A 1MA1A 4J7ZA 2ZXWC 1N4CA 1ORQC 1K9MW 4GZRB 2P5OA 4FLZA 1HR0O 4JYAO 3K59A 4B3SO 5LYJA 4JI8O 2ZD9A 4LF6B 3SR2C 3KG2A 4O2AB 5DM6V 4K35A 1L0NH 1XUQA 1IBLB 2B5UA 3HKCA 5EBLC 3SYAA 4EFBA 3CC4V 4UCUA 5EZYB 4ZIBA 4NXMO 2Y69B 1R73A 3FD9A 3UKMA 4P9OA 2E3CA 5EZYA 4H33A 3ZHQA 1A32A 1FXKC 3GB7C 4LF4O 2LP7A 4JTCB 1UFIA 3OEEG 1IBMO 3BPZA 4MTGA 4PHZA 4YIOA 2Q7EA 1JR9A 1QQCA 4KUMA 2QWQB 3CCEV 2HR3A 4DV4O 5KMGA 1NVPD 3CP1A 3MDSA 5JJJB 1I5XA 5J2UB 2V7QG 2GSMB 2A9HA 4Z1MG 1VF6A 3SYPA 4NB5A 2JDIG 4B08A 1Q81W 1XDCA 3AG2C 3T1YB 2Y48A 5HFMA 3ZN1A 4AHCA 4K0KO 2L35A 4WFAV 1BQZA 1TUEB 4WF9V 4H13B 1VEWA 3TJTA 3I55V 1IBKB 5IY5C 5L3DA 1R6NA 3OUFA 1V54C 2CAZC 1RP3B 3W7UA 4PA6A 2IBZH 3L74H 1F51A 1SA0B 2BTQA 4DR1O 1Z5WA 1AI5A 1GM8A 3CRQA 2ETNA 1V55B 4GX2A 4UVCA 4Q20A 2ZDIA 2EINC 4OX9O 1H2GA 4DV7O 3M8AA 4MVRA 4DV5O 3T1HB 2UXDO 4UB6Z 4X88A 5B1OA 1AILA 5L3BA 2ZNIA 1COWG 4WBNB 3O9OA 3O65A 3SJCC 2Q0OC 1IVSA 4O4IA 2C2AA 1OCOB 2Z5UA 1QLEC 2KKWA 3K03A 2Q73A 5BZBA 3ZMZA 1YJNV 4JI8B 1R3LC 4WFBV 4UFZA 3WB1A 4CH4A 1OZ0A 2Y0IA 4H37A 1Q6HA 1RPRA 4H0LB 5KMGB 2AHYA 5KAFZ 1Y76B 1U97A 5KHJA 3ZRWA 4JAVA 3CEIA 1N8RW 3JATB 4LWSA 4IIJB 2OCHA 2DWEC 4R50A 4PI0A 4PA7A 4ZI7A 4TV9A 1NI8A 1GM9A 3N2KA 1HWYA 4N23A 4AI8A 2PZSA 5KA6A 3FFQA 3LSQA 1PM9A 2W0XA 4LF4B 2FMLA 2BCCH 1WN7A 4FJCC 4JASA 1VQNV 1S3JA 2CH7B 2KQXA 1SS3A 5LGNA 1BS3A 3H1IH 2GV9A 4R6ZA 3HKCB 1N33O 1MZFA 1JQ0A 2XAHA 3ML0A 1K92A 2A7WA 4O4JA 1SQXH 1W0JG 4UCTA 1NVPB 1QBZA 3TETA 4JI5O 2GTAA 1L8DA 2PI5A 1S77D
chains in the Genus database with same CATH topology
2Q6AA 4QJFB 1V54B 5LGUA 3CC7V 2ITDC 2R9IA 3ABLB 5IYCO 4HZ3A 3FYIB 1JX9A 1K4DC 3OMIB 2W6IG 4PA4A 1AR1B 2EZPA 2OCCB 3ABMC 2X6AA 1R3KC 5CBGA 3SPIA 1VQ6V 1MSWD 2ZR2A 2Q67A 3X2QC 3B77A 4LC1A 3RW0A 1MOFA 1KECA 2WLJA 1K4CC 3R65A 4QE7A 1G8MA 3ZCCA 2JJ2G 3JD3A 1FXHA 2WLMA 2XASA 4UXNA 3P32A 4YXWG 4CBCA 3CD6V 1YTFD 2Y69C 1OCZB 4JYCA 5HFLA 4XBFA 4DXWA 1GO3F 3MHSC 4RUEA 1PKXA 3W7SA 2IH3C 1R3IC 3LUTB 3T1CA 5B3SB 3ETDA 5IYBO 2OCCC 3SJQC 3ASOB 3SYQA 4CZZA 2W6JG 3CCQV 2WWWA 1K3EA 1BL8A 2IH1C 4QNHB 2WLKA 4G2KA 1BMFG 3AG4B 3CCVV 1NH2D 3WG7C 1K34A 5IYDO 1K5QA 3HB3B 1VQ9V 2QKSA 3NXSA 1SZTA 1YITV 3WG7B 3H01A 3AG4C 3FB7C 4P30A 4JTDB 3E8BA 1OHHG 1Y66A 3LSSA 1R3JC 1K97A 5EC1C 5H9CA 1BHAA 2ZDIC 3ASOC 1GK9A 1OCRC 3F7VC 1KP3A 3ETEA 2WLIB 5KUKA 4MVUA 1MABG 2DQ0A 4DO2A 3FKSG 3OFNG 2ZXWB 5H6RA 2IU0A 1FXVA 1E1QG 2XAJA 1OCZC 3AG1B 1P7BA 3JD2A 5EC2C 4BIZA 3OAAG 2IJIA 1VQPV 3BY6A 5EBWC 5EK0A 2X7RB 2YEVA 1AI6A 3CCUV 3X2QB 1M90W 2A0LA 4UVBA 2EILC 2DYSB 3IGAC 4UVAA 4UUJC 4I5SA 4EKWA 5L3CA 2DYRB 3E35A 2Q69A 2XAQA 4JPRA 3ZMSA 4LP8A 2Z3YA 4UV9A 1F4NA 2XOKG 4WFHA 4MVSA 1CEZA 4BW5A 3SPGA 3CCSV 2X6CA 3T4ZA 1FFTB 1K33A 2H8PC 3ABLC 3E8GA 4WFGA 3OW2U 2QM7A 3K0GA 2X0LA 1M57B 3LNMB 4BIUA 4WFEA 4MVOA 2K1EA 1WLEA 4KFMA 1RPOA 2XAFA 1FS0G 1PNMA 4R7CA 2JEUA 3K04A 3E83A 1PL0A 1AJQA 1NR1A 1B6QA 3MHHC 4ASUG 5LHIA 3AG3B 3PJSK 3ZRSA 5CMUA 3LDCA 1EBOA 3SPHA 3CXCU 1VQ5V 4PA3A 2EZOA 1YTFB 1QLEB 2WPDG 2WSSG 4JGSA 1H38A 2P7TC 1SERA 1QLNA 5E1AC 3ABKB 2QM8A 1L1FA 1AJNA 1UJWB 1KQSU 2JK5C 3F5WC 3A0RA 3OGCC 1SETA 4GX5A 1NJIW 3ABKC 3QO8A 1J95A 3ZIAG 3VBBA 4E2LA 3QO7A 2UXNA 2CK3G 3B8NA 1DF4A 2DW4A 2XAGA 5J9PC 1XL6A 4RAIA 2HVKC 4J9ZB 3LDDA 1AI4A 1QR9A 1PNLA 1ZWIC 2ZR3A 2HJFC 2JJ1G 4PELA 5LHGA 1JPXA 3OR7C 5EBMC 2NLJC 1W2BU 4MTFA 2P67A 4R8CA 3K08A 3OM3B 5CN0A 3ZRWB 4QIWF 2OTLV 2BOCC 4FIPC 1DF5A 1M57C 1VQLV 3F7YC 4ZBMA 1OCCC 1M1KW 1MG1A 1YJ9V 1BHBA 5IY5B 5CA3A 3E2EA 3CMAV 3CPWU 1OCOC 1CPYA 2EBOA 1LNQA 3GWOA 4RQEA 3JCZA 3RBZA 3OMNB 3OMAB 2ATKC 5DN6G 3JYCA 3JD4A 2Q68A 2DYSC 5LGTA 1S72V 3VOUA 5B1AC 1K73W 3IFXA 3AG2B 3E89A 2HVJC 3ZRXA 3AG3C 2EINB 3SPJA 2EJRA 3I56V 2H94A 3AG1C 4RQFA 4JAUA 3AEIA 3TK1A 1V55C 3K79A 2ZXWC 1ORQC 3B8MA 5B1BC 3FB8C 2M7WA 1K9MW 3FYEB 3JD1A 1OCRB 1AJPA 4L87A 2QTOA 2UXXA 4X89A 2GHYA 2ZD9A 2OT5A 3KG2A 5DM6V 4KP4A 4UV8A 2ITCC 4WFFA 5H6QA 1YHQV 4JTAB 4RO2A 5LHHA 2WLLA 1PD3A 3W7TA 3SYCA 2X6BA 2JIZG 3W7XA 2B5UA 3D36A 5EBLC 4MW3A 3SYAA 2WLNA 4PDVA 1YI2V 3RVZA 3SYOA 3CC4V 5B1NA 1Q82W 2BOBC 3STZC 3QNEA 4MTOA 3STLC 2QEXV 5KUMA 3P30A 2Y69B 1R73A 2EILB 4PDMA 1QR8A 4HYOA 2DQ3A 1W0KG 1AROP 3RVYA 3UKMA 4P9OA 1YJWV 2R9RB 4MVQA 3DGEA 3CMEV 1ENVA 4RUFA 4H33A 5L3GA 4G27B 2F43G 4FMTA 3D3IA 2A79B 1P4RA 1JCHA 1FXKC 3T4DA 1VQKV 3GB7C 2LP7A 3ETGA 2QE7G 2WLLB 4JTCB 3OEEG 4MTGA 1PNKA 5C93A 1QVGU 3EHBB 2B1IA 1SRYA 4KUMA 1GKFA 1H8EG 3CCEV 3ZMUA 2HR3A 1G4YB 3E8FA 2P90A 3OR6C 1NVPD 4QPJA 2NNUA 3CP1A 2XNDG 1DTOA 3M99B 4HAMA 3CCLV 1I5XA 2WLHA 3JD0A 4GX1A 2V7QG 2GSMB 2A9HA 4MVMA 4Z1MG 2IU3A 3G4SV 5B3SC 5B1BB 3SYPA 1FXKB 1KP2A 2HKOA 2JDIG 4U7NA 4F4LA 1Q81W 3OUSA 3ZMVA 3AG2C 1NR7A 5B1AB 2EIJC 2PI4A 1AI7A 3OE7G 4G28B 2Y48A 4GCZA 5HFMA 1YSCA 1R6KA 3ZN1A 3ASNB 4GT1A 2B1GA 2FTKA 1EFRG 2YEVB 3ABMB 1M56B 4WFAV 1CP9A 3CYOA 4BAYA 1TUEB 4TWKA 4U7OA 3ZRVA 3IC7A 4WF9V 2MK3A 3I55V 1VQMV 4PA9A 5L3DA 5IY5C 1R6NA 3OUFA 4XDLA 1V54C 3TCUA 2WLIA 2IJJA 3DTUB 4QE9A 1F4MA 3K06A 3W7UA 4PA6A 2EIMB 2QA4V 4FPPA 1F51A 3E8HA 3ZN0A 1AI5A 1SESA 5FL7G 3E86A 5CBFA 1GM8A 3ZMTA 5IDJA 1VQOV 3ABUA 3BEHA 1V55B 4ZKIA 4GX2A 4UVCA 4Q20A 1GTOA 2ZDIA 1RM1B 1JOYA 1K5SA 2EINC 4OXSA 2IJKA 3LDEA 1H2GA 3CCJV 4MT8A 1WPXA 1E79G 4MVRA 2IJHA 4MSWC 4X88A 5B1OA 5L3BA 5L3EA 1VQ4V 1COWG 4P2ZA 1S76D 1EZJA 3WFVA 1QVFU 4LBEC 3FB6C 1FXKA 3G71V 2C2AA 3CC2V 1K8AW 1OCOB 4I9WA 4MS2A 3SPCA 1THZA 1QLEC 2Z5UA 1Y4MA 3K03A 4XDJA 4TSFG 5BZBA 3ZMZA 1YJNV 1OCCB 3ABTA 1I5YA 2LFSA 1QCEA 1R3LC 4LCUC 4WFBV 5L3FA 4X8AA 1E1RG 1OZ0A 2D3OW 2HG5C 2EIKB 4H37A 1RPRA 1KC8W 2AHYA 2HFEC 5CBHA 2DWDC 1NQTA 5KA5A 3ZJZA 2YSUB 4MTXA 3ZRWA 4JAVA 2EIKC 4JYBA 1KKDA 1N8RW 2P6JA 1JJ2U 1S0VA 2EIMC 2OTJV 1NH2B 1K7DA 2AHZA 3CCMV 4J9YB 4TT3G 1IXMA 1M9NA 2DWEC 2WAMA 4R50A 3G6EV 3FB5C 4GX0A 2W0FC 4PA7A 2JEXA 5GW7A 1KD1W 1M56C 1GM9A 1GMGA 1HWYA 4N23A 1VQ8V 1JVMA 3K0DA 3LSQA 5KA6A 2DYRC 2KB1A 1DLBA 3ASNC 2LFRA 4MVZA 3EFFK 4N21A 3CCRV 4FJCC 4JASA 2HLDG 2EIJB 3T2MA 1NKDA 1VQNV 3K3WA 1S3JA 3UM7A 2IW5A 5LGNA 4R6ZA 1ROPA 1GM7A 3MD0A 1VQ7V 4P9PA 1RM1C 1JQ0A 3K9AA 4PDRA 4FK5C 1XL4A 5LBQA 2XAHA 4MW8A 1S5HC 3ML0A 3QO5A 1Q7YW 3W7WA 2V1DA 1K92A 4JF3A 1F23A 4XDKA 4WCEV 1W0JG 3HPLC 4PDLA 1YIJV 1NBMG 1NVPB 1Q86W 1QBZA 3TETA 1H8HG 2ZQMA 4QPKA 1S77D 2PI5A 3OEHG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  3CCL V;  1QVF U;  1JJ2 U;  1YHQ V;  2OTL V;  3CD6 V;  2OTJ V;  1K73 W;  1VQN V;  3G71 V;  3CC7 V;  3CC2 V;  4WFA V;  1VQL V;  1K8A W;  1VQO V;  3CCM V;  1VQK V;  3I56 V;  1M1K W;  1VQ7 V;  3G4S V;  1YJ9 V;  3CCS V;  1YJN V;  4WF9 V;  1YI2 V;  3G6E V;  3CMA V;  3I55 V;  3CPW U;  3CC4 V;  1VQM V;  4WFB V;  3CCQ V;  3OW2 U;  1Q82 W;  1K9M W;  3CCJ V;  1QVG U;  1Q7Y W;  3CXC U;  1VQ5 V;  1Q81 W;  1W2B U;  2D3O W;  2QEX V;  1KD1 W;  3CCV V;  1VQ8 V;  1KC8 W;  1R73 A;  4WCE V;  1VQ6 V;  3CCE V;  1VQP V;  2QA4 V;  1VQ9 V;  1YIJ V;  1Q86 W;  1KQS U;  1VQ4 V;  3CCU V;  1YJW V;  1M90 W;  5DM6 V;  3CME V;  1YIT V;  1S72 V;  3CCR V;  1NJI W; 
#chains in the Genus database with same CATH topology
 2Q6A A;  4B7E A;  3CC7 V;  2ITD C;  2R9I A;  2NN4 A;  4X65 B;  1I0H A;  3FYI B;  3OMI B;  2QKC A;  2EZP A;  1BT8 A;  2LW1 A;  1JMK C;  5CBG A;  3LNN A;  5EYP B;  4ZHQ A;  2YID A;  2ZR2 A;  3B77 A;  2Q7G A;  2WLJ A;  4DUY B;  4QE7 A;  3R65 A;  4DV1 O;  1G8M A;  3TXS A;  4YXW G;  3CD6 V;  2ZKO A;  2Y69 C;  4DXW A;  2VQE O;  4LFA B;  3CRC A;  3T1C A;  1XBL A;  3I5D A;  3BA8 A;  3SYQ A;  3CRA A;  1BL8 A;  4QNH B;  2WLK A;  1BMF G;  5IYD O;  3JSN A;  5B5E Z;  2AZ2 A;  5KX5 A;  5LMU B;  2E75 B;  4YY3 B;  2P4V A;  3WG7 B;  4X1Y B;  1OHH G;  1Y66 A;  4I4T A;  1BHA A;  4DV5 B;  2UXD B;  3ASO C;  2N05 A;  1MAB G;  3HKE B;  5DEC A;  3JD2 A;  3CX5 F;  5EC2 C;  4JZ2 A;  1AI6 A;  3CCU V;  4J10 A;  4UVA A;  4I5S A;  1G6U A;  4EKW A;  3J80 N;  2XAQ A;  5IWA O;  1SKV A;  4LP8 A;  3QF7 A;  2WA3 A;  2YI8 A;  4UCR A;  1FFT B;  2ZE6 A;  1YDX A;  3K0G A;  3NR7 A;  4E4E A;  2DJV A;  3JAR B;  3LNM B;  4LNU B;  2QM4 A;  4O2B B;  3H1J H;  2K1E A;  3CRR A;  5CA1 A;  1FYJ A;  3E83 A;  1AJQ A;  1GN2 A;  1VP7 A;  4ASU G;  4DR3 B;  4DR2 B;  5LHI A;  3PJS K;  3ZHS A;  4B7K A;  1EBO A;  3SPH A;  2EZO A;  1N33 B;  1UJW B;  4DV0 B;  4YJ2 A;  3U0Z A;  1FD9 A;  2JK5 C;  2YDE A;  3A0R A;  1QNM A;  1PPJ H;  5FNV B;  2ZT9 B;  3ZIA G;  2CK3 G;  2XAG A;  4J9Z B;  1LR1 A;  2RCV A;  2ZR3 A;  4JI5 B;  4YJ3 B;  3G67 A;  1JFF B;  2YUA A;  3APO A;  4LF8 B;  5EBM C;  4MTF A;  2E74 B;  3KCX A;  5AG2 A;  3B09 A;  3ZS8 C;  1XHX A;  4TUY A;  1SQG A;  4TV8 B;  1NU1 H;  4QIW F;  2OTL V;  1DF5 A;  1M57 C;  1VQL V;  1P49 A;  4ZOL B;  1Y74 A;  1ZUQ A;  3JAS B;  1M1K W;  1IXB A;  3K57 A;  3PN1 A;  1KMI Z;  3CPW U;  4LFC O;  3QTC A;  1HNW B;  1LNQ A;  3GWO A;  3U10 A;  3JAK B;  4C7U A;  2VQE B;  4X66 B;  2KG7 A;  4FLY A;  3L73 H;  5DN6 G;  3JYC A;  3CWB H;  2DYS C;  1KKC A;  5FLX N;  2JS3 A;  2LJ2 A;  4DRX A;  1S72 V;  3AK3 A;  5B1A C;  1K73 W;  3E89 A;  3AG3 C;  4X20 B;  3SPJ A;  4YIP A;  2H94 A;  4J7J A;  3HKD A;  3K79 A;  5B1B C;  3CRM A;  1I94 O;  1MSD A;  1OCR B;  2Q7H A;  1AJP A;  1HNZ O;  2CGO A;  1IDS A;  1VF5 B;  2YC0 A;  3SGI A;  2GHY A;  5D5P A;  1TVK A;  4UV8 A;  3OGI B;  2ITC C;  1FJG B;  2OIE A;  5H6Q A;  4RO2 A;  2WLL A;  3SYC A;  2YXY A;  2X6B A;  2JIZ G;  4NYK A;  3W7X A;  3D36 A;  5KHK A;  1V9P A;  1IUR A;  3UQ8 A;  1YI2 V;  4JZG A;  4F6R A;  5IWA B;  2XT9 A;  2Q8V A;  5DED A;  1CXZ B;  4HYO A;  3BVO A;  1ARO P;  3Q4H B;  1H2S B;  4MVQ A;  4RUF A;  4X1I B;  3RYC B;  1RSO A;  2RMK B;  1WNS A;  2QE7 G;  1ZL8 A;  2JGD A;  2B1I A;  1N36 B;  1SRY A;  1GKF A;  1H8E G;  3BHP A;  3N2G B;  2P90 A;  3OR6 C;  5IJ0 A;  1XHZ A;  4QPJ A;  1HNX O;  2L6L A;  4HAM A;  1XNQ B;  3C3S A;  4X1K A;  3BFR A;  2KSD A;  4MVM A;  2IU3 A;  2RDC A;  1FXK B;  2CE4 A;  4F4L A;  1IZ3 A;  3OUS A;  1WB8 A;  2EIJ C;  5CA0 B;  3OE7 G;  1YSC A;  1KYO F;  2B1G A;  3KCY A;  2FTK A;  5C8Y A;  5D5Q A;  3H1L H;  2QWR B;  3CYO A;  4BAY A;  2YXH A;  4U7O A;  3IC7 A;  3UT5 B;  2MK3 A;  2D2C B;  2ZIM A;  3P3P A;  4IHJ B;  4PA9 A;  5BR8 B;  4EB6 B;  4XDL A;  2Z0A A;  3TCU A;  2WLI A;  3DTU B;  4QE9 A;  1F4M A;  3K06 A;  1GAX A;  2EIM B;  4FZ1 A;  1HP8 A;  2HHH O;  3E8H A;  4JI4 B;  4HNA A;  3ZN0 A;  4CC5 A;  5BMV B;  2Q0A A;  3E86 A;  5CBF A;  5IDJ A;  1VQO V;  4DK1 A;  1RM1 B;  2OWO A;  4OXS A;  2YIB A;  5BY1 A;  3CCJ V;  1BZK A;  1KBH A;  4D7S A;  4MSW C;  4U3J A;  5L3E A;  1S76 D;  3CE2 A;  1O9H A;  4KXR A;  3G71 V;  2ZCE A;  3CC2 V;  4MS2 A;  1THZ A;  3DXR A;  1WP8 A;  1Y4M A;  4TSF G;  1ZSP A;  3ABT A;  2UUA B;  1QCE A;  1JA8 A;  5L3F A;  1FJG O;  4X8A A;  4AQY B;  1WA8 A;  2EIK B;  2GDS A;  2NR5 A;  2ADQ B;  1NQT A;  4CH5 A;  4OPA A;  1G1X B;  4JI1 O;  4UCS A;  4D7T A;  2F95 B;  4JYB A;  1JJ2 U;  5LOV B;  1S0V A;  1WJZ A;  2OTJ V;  3HKB B;  1K7D A;  3ZHR A;  2AHZ A;  1S5J A;  5JH7 A;  2Q4P A;  4TT3 G;  3ZBH A;  1XMQ B;  2WAM A;  3G6E V;  4LF7 B;  2W0F C;  1YXB A;  2XTA A;  3J81 N;  5GW7 A;  1M56 C;  5ITZ B;  1OV9 A;  4J80 A;  4JV5 B;  3AK2 A;  2LFR A;  1SQF A;  4FZ0 A;  1NKD A;  3N27 A;  3UM7 A;  1Q5O A;  3RYI B;  4I55 A;  1H2L A;  4JI2 B;  2IM9 A;  4O4L B;  5F2V O;  5J2T A;  1Q7Y W;  1F23 A;  5GON A;  4WCE V;  3HPL C;  5LOV A;  2ILM A;  2ZQM A;  4QPK A;  1EN4 A;  3CXH F;  3J7A U;  3E22 A;  3OEH G;  5IJ9 A;  5LGU A;  3IAY A;  2M6Y A;  2UU9 O;  1WA8 B;  1JX9 A;  3L72 H;  2W6I G;  3QVN A;  4PA4 A;  2OCC B;  3B4S A;  1R3K C;  2VWK A;  5H5N A;  4PJ0 Z;  5JJE B;  2Q67 A;  4LC1 A;  2CTP A;  1KEC A;  2WLM A;  5GTI Z;  2XAS A;  5BR8 O;  3OTF A;  1EN6 A;  1GO3 F;  3ZHT A;  1XIL A;  1B3Q A;  2IH3 C;  1Y67 A;  5JVD B;  5IYB O;  3K9S A;  3ASO B;  4CZZ A;  1N34 O;  2WWW A;  1K3E A;  4IGG A;  3A0B Z;  3ICX A;  4G2K A;  3WG7 C;  4O4H B;  1VQ9 V;  2BSK B;  4NKG B;  3CHX A;  3LSU A;  5LXT B;  1SZT A;  1YIT V;  3E8B A;  5E79 Z;  2BSK A;  3LSS A;  1K97 A;  5H9C A;  1GK9 A;  1OCR C;  3L71 H;  1KP3 A;  5KUK A;  2WLI B;  4DO2 A;  3OFN G;  4B3M O;  1E1Q G;  2EX3 A;  2N04 A;  5JVD A;  3JAW A;  3OAA G;  5EBW C;  1BCC H;  4UVB A;  2UUA O;  2EIL C;  2DYS B;  4UUJ C;  2DYR B;  3E35 A;  3ZMS A;  5CA0 A;  4UV9 A;  3TGU H;  1F4N A;  1GN6 A;  3JCU Z;  3H1K H;  4MVS A;  1CEZ A;  4BW5 A;  3SPG A;  3CCS V;  2UXC B;  2A06 H;  4WFG A;  3D3Q A;  3IJ4 A;  1M57 B;  4BIU A;  4MVO A;  1J5E B;  1RFY A;  2ZIO A;  3H1H H;  3N2G A;  2RJZ A;  1RPO A;  4JI6 B;  2XAF A;  3AG7 A;  1B6Q A;  4B3T B;  1ZL8 B;  2OYQ A;  3ZRS A;  4O4L A;  2GUZ B;  2ZM6 O;  1YTF B;  1QLE B;  2QWO B;  4EFE A;  4I55 B;  2P7T C;  1SER A;  1QLN A;  4I50 B;  1RSO B;  4GUN A;  3RYC A;  1KQS U;  4JI2 O;  3CB2 A;  3F5W C;  3OGC C;  1SET A;  4GX5 A;  5IT9 N;  1D5A A;  3Q4H A;  4IYI A;  2BE3 A;  3QO7 A;  1DF4 A;  3FX7 A;  3G80 A;  4RAI A;  4TQF A;  3LDD A;  1QR9 A;  2P22 C;  2PTM A;  2HJF C;  2JJ1 G;  5LHG A;  5KHH A;  3L75 H;  4GYC B;  1EM1 A;  2P67 A;  2DN9 A;  4GKJ O;  3HKB A;  4FLX A;  3EVK A;  3GWK C;  4DUZ O;  4R8C A;  2ZE5 A;  2CGN A;  5CN0 A;  4X64 B;  2BOC C;  1KB9 F;  4X9Q A;  4NXM B;  2DE0 X;  4ZBM A;  1BGY H;  1MG1 A;  2R9A A;  5CA3 A;  4FFB A;  2P4K A;  1OCO C;  1LUW A;  1H2K A;  2Y4T A;  5LMN O;  3JCZ A;  3RBZ A;  4I0X A;  1N32 O;  1QU7 A;  5LGT A;  1N34 B;  3VOU A;  2QSA A;  4U3J B;  3IFX A;  2O57 A;  4FVM A;  2EIN B;  2Q5Z A;  3AG1 C;  4W4L A;  3AEI A;  1FFX A;  5JCO C;  4B3R O;  1V55 C;  1YZB A;  3FB8 C;  2M7W A;  4Z2W A;  3MAQ A;  3JD1 A;  4L87 A;  1Q43 A;  1Y74 B;  3K5N A;  2UXX A;  3CS5 A;  1US6 A;  4X89 A;  1JJO A;  4KP4 A;  4WFF A;  4JI0 O;  5BXZ A;  1OJH A;  5KHG A;  4JTA B;  5LHH A;  1DK1 A;  5JQG B;  1PD3 A;  3W7T A;  2YIB D;  2A3Q A;  4MW3 A;  2WLN A;  3RVZ A;  3SYO A;  4IHJ A;  3RFR A;  5B1N A;  1Q82 W;  3QNE A;  4MTO A;  3STL C;  2QEX V;  5KUM A;  2EIL B;  1QR8 A;  1W0K G;  1Q90 D;  2K9P A;  3RVY A;  4JYY A;  3OD4 A;  3CME V;  3DGE A;  2RNB A;  1ENV A;  4IYH A;  2UXB O;  2JGU A;  2F43 G;  4FMT A;  4YJ2 B;  3D3I A;  2A79 B;  1JCH A;  5LP6 B;  1VQK V;  2LGQ A;  5JQG A;  2WA4 A;  4DR5 O;  2UUB B;  2F1M A;  1PNK A;  3EHB B;  1N0N A;  4DV2 B;  4JI6 O;  2CDY A;  3E8F A;  4OX9 B;  2NNU A;  3M99 B;  3CCL V;  4O2B A;  1HR0 B;  3JD0 A;  4YHH B;  1FFX B;  3K5M A;  4GLX A;  1EZV H;  3JAR A;  3G4S V;  1P84 F;  3GVM A;  5B3S C;  4GKK O;  1H2M A;  2R70 A;  5B1B B;  5LP6 C;  2HKO A;  3IC9 A;  3SJA C;  3K58 A;  2PI4 A;  4GCZ A;  4X1I A;  1R6K A;  1M93 A;  1XNR O;  1EFR G;  2QWP B;  5FPR A;  3RWR D;  3VQW A;  1AB3 A;  1CP9 A;  4TWK A;  3ZRV A;  4DUZ B;  4F6R B;  2Y0P A;  4X64 O;  1X59 A;  3CJH B;  2QA4 V;  4CC6 A;  4X1Y A;  1I7F A;  3CJH A;  4ABM A;  1IBM B;  5FL7 G;  1R6T A;  5LMN B;  3ZMT A;  1FPO A;  3ABU A;  1N32 B;  3BEH A;  2MW2 B;  4DV4 B;  4BR6 A;  2IJK A;  3LDE A;  3HKD B;  4LF5 B;  1WPX A;  2QGN A;  4P2Z A;  3THO A;  1EZJ A;  1QVF U;  3B40 A;  4LBE C;  2H3O A;  3C3T A;  1K8A W;  4I9W A;  3SPC A;  1U96 A;  2GTS A;  4XDJ A;  3T1Y O;  4DV3 O;  1OCC B;  1XMO B;  1I5Y A;  2LFS A;  3U11 A;  1XQ8 A;  4LR3 A;  1B04 A;  2D3O W;  4A5U B;  1KC8 W;  2HFE C;  1D2D A;  5KHI A;  4X65 O;  3ZJZ A;  2AW9 A;  1BE3 H;  3OT7 A;  2ZE8 A;  4U3F H;  2EIK C;  1FAF A;  3CCM V;  4H44 B;  1IXM A;  1M9N A;  5LP6 A;  2EUL A;  4DR1 B;  1X4T A;  3FB5 C;  4CS2 A;  2UXB B;  2JEX A;  4DV6 O;  2FL4 A;  2KB1 A;  2LW7 A;  1DLB A;  5FNV A;  4MVZ A;  3ZHV A;  4PI2 A;  4DV7 B;  4FM0 A;  2AGA A;  2EIJ B;  2Y4U A;  3T2M A;  4ICG A;  4DV2 O;  2IW5 A;  1YEW A;  1ROP A;  1GM7 A;  3MD0 A;  1AR4 A;  1RM1 C;  4DR6 O;  3K9A A;  2AZ0 A;  1XL4 A;  2CTW A;  1PV0 A;  1S5H C;  3QO5 A;  3ZHU A;  4YHH O;  4JF3 A;  5JCO A;  4J11 A;  5LXT A;  2PUS A;  4O4H A;  1YIJ V;  1NBM G;  3BAB A;  4GKK B;  2E5L O;  1T5E A;  1SQQ H;  4QJF B;  4LNU A;  1KUQ A;  3ABL B;  1XI1 A;  3F5T A;  1K4D C;  1AR1 B;  3ABM C;  2X6A A;  1XNR B;  3SPI A;  1MSW D;  1MOF A;  3S3X A;  4I0X B;  3ZX6 A;  2JJ2 G;  3JD3 A;  1FXH A;  4WBN A;  4CBC A;  4JI7 B;  1YTF D;  4XBF A;  1S5L Z;  4FFB B;  3MHS C;  4FLU A;  5B3S B;  4I9Q A;  3SJQ C;  3HKE A;  2W6J G;  2IH1 C;  1NTZ H;  3AG4 B;  3CCV V;  4I4T B;  5GON B;  5KLV H;  3NXS A;  4X62 B;  4DR2 O;  2E76 B;  4LF5 O;  3BA9 A;  4BIO A;  1R3J C;  5EC1 C;  4K8Z A;  3ETQ A;  4JAA A;  1BSM A;  4MVU A;  3FKS G;  2IU0 A;  2ZXW B;  1FXV A;  2XAJ A;  2PYL A;  3AG1 B;  1P7B A;  1SZX A;  2F23 A;  1O9G A;  2BTO A;  1VQP V;  4I50 A;  1WPB A;  4DV3 B;  5EK0 A;  2X7R B;  5ITZ A;  1XMO O;  2GUZ A;  4JPR A;  2PGG A;  4LF8 O;  2Z3Y A;  2XOK G;  5A2Q N;  4WFH A;  3RGB A;  4DUY O;  2X6C A;  4DV1 B;  5JH7 B;  1P7G A;  1F7Y A;  4LF9 B;  1K33 A;  2H8P C;  3ABL C;  2QM7 A;  1PP9 H;  2FYU H;  3APQ A;  2X0L A;  4LFA O;  1M5I A;  4HBN A;  2RQ6 A;  4LH7 A;  2V4D A;  1HW7 A;  4CH3 A;  4LFC B;  1HNW O;  1XOU A;  4KFM A;  5A9G A;  3K5L A;  4DV6 B;  3G6B A;  4O4J B;  4R7C A;  3VQV A;  5LMU O;  1NR1 A;  3RT3 C;  4NTW A;  3AG3 B;  4YY3 O;  2QKA A;  1I08 A;  3CXC U;  3M7M X;  2OIG A;  2WSS G;  1GRJ A;  4NTY A;  1H38 A;  4AIL C;  5E1A C;  4DR6 B;  4J41 A;  3JAW B;  2HJD A;  1I94 B;  1NJI W;  3ABK C;  3QO8 A;  2HP8 A;  3VBB A;  1BQ0 A;  4Z1V A;  2UXN A;  2DW4 A;  4TV9 B;  1AI4 A;  1VF7 A;  1ZWI C;  2E5L B;  1NT2 B;  4PEL A;  1JPX A;  3OR7 C;  1W2B U;  2NLJ C;  4HNA B;  1QHT A;  4IIJ A;  3JAT A;  4LWS B;  2QWN B;  4Q6G A;  3K08 A;  3OM3 B;  2VQF O;  3ZRW B;  4O2A A;  4EB6 A;  3OTO O;  1YCI A;  3UT5 A;  3DC5 A;  3B2E E;  1AVM A;  1OCC C;  5GTH Z;  1Z5V A;  1YJ9 V;  5IY5 B;  1BHB A;  3D8C A;  3UO3 A;  3E2E A;  2EBO A;  1CPY A;  5C8Y B;  1MNG A;  4NXN O;  3SJB C;  4JI7 O;  4NVP A;  2YIA A;  4RQE A;  1MMM A;  2JRI A;  3KZI Z;  3JD4 A;  4DR3 O;  2Q68 A;  1Q6U A;  2PY5 A;  3A0H Z;  2DMX A;  3RYF B;  1N36 O;  2HEP A;  3ZRX A;  3WB0 A;  2EJR A;  3DC6 A;  3I56 V;  4DV0 O;  4RQF A;  4JAU A;  3TK1 A;  3DSQ A;  4CS3 A;  4X1K B;  4X62 O;  4BWA A;  3B8M A;  1HNX B;  3R66 A;  5IJ9 B;  1XNQ O;  3FYE B;  5CB4 B;  1NS1 A;  3E22 B;  5IJ0 B;  2QTO A;  4K8X A;  2OT5 A;  5J2T B;  1YHQ V;  2BTQ B;  1L0L H;  1SA0 A;  1VF6 C;  5LA6 A;  3RYI A;  3HR0 A;  4PDV A;  1VIB A;  3A2F A;  1B06 A;  1Q3E A;  2B9Z A;  2BOB C;  3STZ C;  3QG5 A;  2FKX A;  3P30 A;  1GH6 A;  4PDM A;  3UO2 A;  2DQ3 A;  1YJW V;  2R9R B;  4LF9 O;  3KKY A;  2VRZ A;  4DR7 O;  5L3G A;  4G27 B;  1P4R A;  4X66 O;  4W4K A;  3T4D A;  2ZE7 A;  2HHH B;  4DYL A;  1Q6I A;  3ETG A;  2WLL B;  3JAL B;  5C93 A;  1QVG U;  3C90 A;  2YIC A;  3ZMU A;  1R1B A;  1G4Y B;  5J2U A;  4FLW A;  2XND G;  1DTO A;  2WLH A;  3VQY A;  1HNZ B;  4DW1 A;  2VWJ A;  4GX1 A;  3VQX A;  4FFK A;  3DXR B;  1Y6X A;  1KP2 A;  2UUC B;  4U7N A;  4DRX B;  3D36 C;  3WB2 A;  2YXL A;  3ZMV A;  1NR7 A;  5B1A B;  1AI7 A;  4G28 B;  5EIB D;  2KG7 B;  1SQB H;  3P3N A;  3ASN B;  3JAK A;  4GT1 A;  5EIB C;  2FB5 A;  4LFB B;  2YEV B;  3ABM B;  1M56 B;  3K5O A;  1H2N A;  3JAS A;  1GN3 A;  1URF A;  4JI3 O;  4ZOL A;  4JI1 B;  2LO1 A;  2VQF B;  1VQM V;  5BMV A;  3OTO B;  4DW0 A;  2IJJ A;  4FPP A;  5TIS Z;  3RYH B;  1VMG A;  4LF7 O;  4J7K A;  2YI9 A;  1JFF A;  2JVD A;  4NXN B;  1SES A;  2Q9L A;  5LYJ B;  1N0J A;  4ZKI A;  1GTO A;  1JOY A;  1K5S A;  4K3A A;  5B66 Z;  1UPG A;  4MT8 A;  1XEQ A;  1E79 G;  2LGW A;  1SQV H;  2IJH A;  1VQ4 V;  2ZNJ A;  3A8T A;  3UCS C;  3WFV A;  3FB6 C;  1FXK A;  1ZTE A;  4FM2 A;  4LCU C;  1E1R G;  2HG5 C;  3JSL A;  2ADP A;  5CBH A;  1ZAU A;  2DWD C;  4RWU A;  5KA5 A;  2F4V B;  2YSU B;  4MTX A;  1D5N A;  1YVW A;  1KKD A;  2JGD B;  4TOI A;  2P6J A;  4KHP O;  2EIM C;  1NH2 B;  4DR4 B;  1WP7 A;  1WB7 A;  4J9Y B;  4I7Z B;  4JI4 O;  4IT5 A;  1ZLZ A;  4BW9 A;  4GX0 A;  1GN4 A;  4DR7 B;  4IL6 Z;  3WU2 Z;  1KD1 W;  1GMG A;  1VQ8 V;  1NZ6 A;  1JVM A;  1TA8 A;  3K0D A;  2DYR C;  3AK1 A;  1TUB B;  2LQT A;  4PD4 F;  3ASN C;  3FAV A;  3TXQ A;  3EFF K;  4N21 A;  3CCR V;  2HLD G;  4EEQ A;  3FAV B;  1TUB A;  3K3W A;  2QR4 A;  3H9V A;  2CTQ A;  1VQ7 V;  4P9P A;  4PDR A;  1Q8I A;  4FK5 C;  5LBQ A;  1SC5 B;  4MW8 A;  1AP6 A;  3W7W A;  5JJN B;  2V1D A;  1TVK B;  2VS0 A;  4XDK A;  3L70 H;  4PDL A;  5KX5 B;  1Q86 W;  1H8H G;  2UUC O;  4B3M B;  4CH6 A;  5FPO A;  1V54 B;  4AQY O;  5IYC O;  2RN9 A;  2R72 A;  4HZ3 A;  4X20 A;  4UB8 Z;  2CTR A;  3ZED A;  4LFB O;  1VQ6 V;  3X2Q C;  4JI3 B;  3RW0 A;  1K4C C;  1XMQ O;  5EYP A;  3ZCC A;  1ZX3 A;  4UXN A;  4FM1 A;  1M4U A;  3P32 A;  1OCZ B;  4JYC A;  5HFL A;  4RUE A;  1PKX A;  2XHB A;  3W7S A;  4JV5 O;  1R3I C;  3LUT B;  5H2F Z;  3ETD A;  4OGQ B;  2OCC C;  4PV1 B;  2ZIN A;  1DGS A;  3CCQ V;  4TV8 A;  1W59 A;  4TUY B;  3EXA A;  1NH2 D;  1K34 A;  1K5Q A;  3HB3 B;  5IYZ B;  2QKS A;  3H01 A;  3AG4 C;  3FB7 C;  5LL6 Y;  4P30 A;  4JTD B;  1MZE A;  4YJ3 A;  3RYH A;  4KL1 A;  4JYA B;  5IYZ A;  2ZDI C;  4NTX A;  3F7V C;  3ETE A;  3JAM N;  4B3S B;  2DQ0 A;  4F6E A;  4LF6 O;  5H6R A;  1YF2 A;  2CH7 A;  2P06 A;  1OCZ C;  4BIZ A;  1HDJ A;  2IJI A;  2UU9 B;  4D6T H;  3BY6 A;  1IBL O;  2YEV A;  3S3W A;  3N2K B;  3X2Q B;  1M90 W;  2A0L A;  4UCV A;  3SDL A;  2QDO A;  3IGA C;  4ZI7 B;  5L3C A;  4J42 A;  2Q69 A;  4OPH A;  5IE9 A;  5CA1 B;  4GKJ B;  2F4V O;  2G38 A;  3T4Z A;  4FLT A;  1KU9 A;  1AP5 A;  3E8G A;  3OW2 U;  4KHP B;  4DR4 O;  1Z2G A;  1Y76 A;  4TQD A;  1AR5 A;  4WFE A;  3L9D A;  1SF9 A;  1TAE A;  2GBO A;  2F66 C;  1NTM H;  1WLE A;  2YS8 A;  1NTK H;  1FS0 G;  1PNM A;  2JEU A;  3K04 A;  1PL0 A;  3MHH C;  3JAL A;  4O4I B;  5CMU A;  3LDC A;  2QJ1 A;  1VQ5 V;  4PA3 A;  2WPD G;  4JGS A;  1SQP H;  3RN4 A;  3ABK B;  2QM8 A;  1L1F A;  1AJN A;  2ODM A;  3CSX A;  4B3R B;  2N74 A;  2PF4 E;  1J95 A;  1PL4 A;  4E2L A;  3B8N A;  5J9P C;  1XL6 A;  4CS4 A;  2HVK C;  1PNL A;  1VAR A;  1WAZ A;  4JI0 B;  4K0K B;  2DOS A;  5LA6 B;  3BAA A;  1FKA O;  3BRC A;  4QGP A;  1IX9 A;  4L8J A;  5JWP A;  5K1P A;  2AXT Z;  2UXC O;  1IBK O;  4FIP C;  1XRE A;  3F7Y C;  1TGO A;  2PYJ A;  1EN5 A;  5K1X A;  1LUV A;  4UCO A;  5CB4 A;  1J5E O;  3CMA V;  2F93 B;  4FLV A;  4NR1 A;  4LH6 A;  3BCC H;  3OMN B;  3OMA B;  2ATK C;  3RYF A;  4DK0 A;  4ZHQ B;  4DR5 B;  4B3T O;  2ARH A;  2UUB O;  5KAI Z;  2ZM6 B;  2CUG A;  2JS5 A;  2QTS A;  3AG2 B;  2HVJ C;  2XUM A;  3T1H O;  2EJ7 A;  1MA1 A;  4J7Z A;  2ZXW C;  1N4C A;  1ORQ C;  1K9M W;  4GZR B;  2P5O A;  4FLZ A;  1HR0 O;  4JYA O;  3K59 A;  4B3S O;  5LYJ A;  4JI8 O;  2ZD9 A;  4LF6 B;  3SR2 C;  3KG2 A;  4O2A B;  5DM6 V;  4K35 A;  1L0N H;  1XUQ A;  1IBL B;  2B5U A;  3HKC A;  5EBL C;  3SYA A;  4EFB A;  3CC4 V;  4UCU A;  5EZY B;  4ZIB A;  4NXM O;  2Y69 B;  1R73 A;  3FD9 A;  3UKM A;  4P9O A;  2E3C A;  5EZY A;  4H33 A;  3ZHQ A;  1A32 A;  1FXK C;  3GB7 C;  4LF4 O;  2LP7 A;  4JTC B;  1UFI A;  3OEE G;  1IBM O;  3BPZ A;  4MTG A;  4PHZ A;  4YIO A;  2Q7E A;  1JR9 A;  1QQC A;  4KUM A;  2QWQ B;  3CCE V;  2HR3 A;  4DV4 O;  5KMG A;  1NVP D;  3CP1 A;  3MDS A;  5JJJ B;  1I5X A;  5J2U B;  2V7Q G;  2GSM B;  2A9H A;  4Z1M G;  1VF6 A;  3SYP A;  4NB5 A;  2JDI G;  4B08 A;  1Q81 W;  1XDC A;  3AG2 C;  3T1Y B;  2Y48 A;  5HFM A;  3ZN1 A;  4AHC A;  4K0K O;  2L35 A;  4WFA V;  1BQZ A;  1TUE B;  4WF9 V;  4H13 B;  1VEW A;  3TJT A;  3I55 V;  1IBK B;  5IY5 C;  5L3D A;  1R6N A;  3OUF A;  1V54 C;  2CAZ C;  1RP3 B;  3W7U A;  4PA6 A;  2IBZ H;  3L74 H;  1F51 A;  1SA0 B;  2BTQ A;  4DR1 O;  1Z5W A;  1AI5 A;  1GM8 A;  3CRQ A;  2ETN A;  1V55 B;  4GX2 A;  4UVC A;  4Q20 A;  2ZDI A;  2EIN C;  4OX9 O;  1H2G A;  4DV7 O;  3M8A A;  4MVR A;  4DV5 O;  3T1H B;  2UXD O;  4UB6 Z;  4X88 A;  5B1O A;  1AIL A;  5L3B A;  2ZNI A;  1COW G;  4WBN B;  3O9O A;  3O65 A;  3SJC C;  2Q0O C;  1IVS A;  4O4I A;  2C2A A;  1OCO B;  2Z5U A;  1QLE C;  2KKW A;  3K03 A;  2Q73 A;  5BZB A;  3ZMZ A;  1YJN V;  4JI8 B;  1R3L C;  4WFB V;  4UFZ A;  3WB1 A;  4CH4 A;  1OZ0 A;  2Y0I A;  4H37 A;  1Q6H A;  1RPR A;  4H0L B;  5KMG B;  2AHY A;  5KAF Z;  1Y76 B;  1U97 A;  5KHJ A;  3ZRW A;  4JAV A;  3CEI A;  1N8R W;  3JAT B;  4LWS A;  4IIJ B;  2OCH A;  2DWE C;  4R50 A;  4PI0 A;  4PA7 A;  4ZI7 A;  4TV9 A;  1NI8 A;  1GM9 A;  3N2K A;  1HWY A;  4N23 A;  4AI8 A;  2PZS A;  5KA6 A;  3FFQ A;  3LSQ A;  1PM9 A;  2W0X A;  4LF4 B;  2FML A;  2BCC H;  1WN7 A;  4FJC C;  4JAS A;  1VQN V;  1S3J A;  2CH7 B;  2KQX A;  1SS3 A;  5LGN A;  1BS3 A;  3H1I H;  2GV9 A;  4R6Z A;  3HKC B;  1N33 O;  1MZF A;  1JQ0 A;  2XAH A;  3ML0 A;  1K92 A;  2A7W A;  4O4J A;  1SQX H;  1W0J G;  4UCT A;  1NVP B;  1QBZ A;  3TET A;  4JI5 O;  2GTA A;  1L8D A;  2PI5 A;  1S77 D; 
#chains in the Genus database with same CATH homology
 2Q6A A;  4QJF B;  1V54 B;  5LGU A;  3CC7 V;  2ITD C;  2R9I A;  3ABL B;  5IYC O;  4HZ3 A;  3FYI B;  1JX9 A;  1K4D C;  3OMI B;  2W6I G;  4PA4 A;  1AR1 B;  2EZP A;  2OCC B;  3ABM C;  2X6A A;  1R3K C;  5CBG A;  3SPI A;  1VQ6 V;  1MSW D;  2ZR2 A;  2Q67 A;  3X2Q C;  3B77 A;  4LC1 A;  3RW0 A;  1MOF A;  1KEC A;  2WLJ A;  1K4C C;  3R65 A;  4QE7 A;  1G8M A;  3ZCC A;  2JJ2 G;  3JD3 A;  1FXH A;  2WLM A;  2XAS A;  4UXN A;  3P32 A;  4YXW G;  4CBC A;  3CD6 V;  1YTF D;  2Y69 C;  1OCZ B;  4JYC A;  5HFL A;  4XBF A;  4DXW A;  1GO3 F;  3MHS C;  4RUE A;  1PKX A;  3W7S A;  2IH3 C;  1R3I C;  3LUT B;  3T1C A;  5B3S B;  3ETD A;  5IYB O;  2OCC C;  3SJQ C;  3ASO B;  3SYQ A;  4CZZ A;  2W6J G;  3CCQ V;  2WWW A;  1K3E A;  1BL8 A;  2IH1 C;  4QNH B;  2WLK A;  4G2K A;  1BMF G;  3AG4 B;  3CCV V;  1NH2 D;  3WG7 C;  1K34 A;  5IYD O;  1K5Q A;  3HB3 B;  1VQ9 V;  2QKS A;  3NXS A;  1SZT A;  1YIT V;  3WG7 B;  3H01 A;  3AG4 C;  3FB7 C;  4P30 A;  4JTD B;  3E8B A;  1OHH G;  1Y66 A;  3LSS A;  1R3J C;  1K97 A;  5EC1 C;  5H9C A;  1BHA A;  2ZDI C;  3ASO C;  1GK9 A;  1OCR C;  3F7V C;  1KP3 A;  3ETE A;  2WLI B;  5KUK A;  4MVU A;  1MAB G;  2DQ0 A;  4DO2 A;  3FKS G;  3OFN G;  2ZXW B;  5H6R A;  2IU0 A;  1FXV A;  1E1Q G;  2XAJ A;  1OCZ C;  3AG1 B;  1P7B A;  3JD2 A;  5EC2 C;  4BIZ A;  3OAA G;  2IJI A;  1VQP V;  3BY6 A;  5EBW C;  5EK0 A;  2X7R B;  2YEV A;  1AI6 A;  3CCU V;  3X2Q B;  1M90 W;  2A0L A;  4UVB A;  2EIL C;  2DYS B;  3IGA C;  4UVA A;  4UUJ C;  4I5S A;  4EKW A;  5L3C A;  2DYR B;  3E35 A;  2Q69 A;  2XAQ A;  4JPR A;  3ZMS A;  4LP8 A;  2Z3Y A;  4UV9 A;  1F4N A;  2XOK G;  4WFH A;  4MVS A;  1CEZ A;  4BW5 A;  3SPG A;  3CCS V;  2X6C A;  3T4Z A;  1FFT B;  1K33 A;  2H8P C;  3ABL C;  3E8G A;  4WFG A;  3OW2 U;  2QM7 A;  3K0G A;  2X0L A;  1M57 B;  3LNM B;  4BIU A;  4WFE A;  4MVO A;  2K1E A;  1WLE A;  4KFM A;  1RPO A;  2XAF A;  1FS0 G;  1PNM A;  4R7C A;  2JEU A;  3K04 A;  3E83 A;  1PL0 A;  1AJQ A;  1NR1 A;  1B6Q A;  3MHH C;  4ASU G;  5LHI A;  3AG3 B;  3PJS K;  3ZRS A;  5CMU A;  3LDC A;  1EBO A;  3SPH A;  3CXC U;  1VQ5 V;  4PA3 A;  2EZO A;  1YTF B;  1QLE B;  2WPD G;  2WSS G;  4JGS A;  1H38 A;  2P7T C;  1SER A;  1QLN A;  5E1A C;  3ABK B;  2QM8 A;  1L1F A;  1AJN A;  1UJW B;  1KQS U;  2JK5 C;  3F5W C;  3A0R A;  3OGC C;  1SET A;  4GX5 A;  1NJI W;  3ABK C;  3QO8 A;  1J95 A;  3ZIA G;  3VBB A;  4E2L A;  3QO7 A;  2UXN A;  2CK3 G;  3B8N A;  1DF4 A;  2DW4 A;  2XAG A;  5J9P C;  1XL6 A;  4RAI A;  2HVK C;  4J9Z B;  3LDD A;  1AI4 A;  1QR9 A;  1PNL A;  1ZWI C;  2ZR3 A;  2HJF C;  2JJ1 G;  4PEL A;  5LHG A;  1JPX A;  3OR7 C;  5EBM C;  2NLJ C;  1W2B U;  4MTF A;  2P67 A;  4R8C A;  3K08 A;  3OM3 B;  5CN0 A;  3ZRW B;  4QIW F;  2OTL V;  2BOC C;  4FIP C;  1DF5 A;  1M57 C;  1VQL V;  3F7Y C;  4ZBM A;  1OCC C;  1M1K W;  1MG1 A;  1YJ9 V;  1BHB A;  5IY5 B;  5CA3 A;  3E2E A;  3CMA V;  3CPW U;  1OCO C;  1CPY A;  2EBO A;  1LNQ A;  3GWO A;  4RQE A;  3JCZ A;  3RBZ A;  3OMN B;  3OMA B;  2ATK C;  5DN6 G;  3JYC A;  3JD4 A;  2Q68 A;  2DYS C;  5LGT A;  1S72 V;  3VOU A;  5B1A C;  1K73 W;  3IFX A;  3AG2 B;  3E89 A;  2HVJ C;  3ZRX A;  3AG3 C;  2EIN B;  3SPJ A;  2EJR A;  3I56 V;  2H94 A;  3AG1 C;  4RQF A;  4JAU A;  3AEI A;  3TK1 A;  1V55 C;  3K79 A;  2ZXW C;  1ORQ C;  3B8M A;  5B1B C;  3FB8 C;  2M7W A;  1K9M W;  3FYE B;  3JD1 A;  1OCR B;  1AJP A;  4L87 A;  2QTO A;  2UXX A;  4X89 A;  2GHY A;  2ZD9 A;  2OT5 A;  3KG2 A;  5DM6 V;  4KP4 A;  4UV8 A;  2ITC C;  4WFF A;  5H6Q A;  1YHQ V;  4JTA B;  4RO2 A;  5LHH A;  2WLL A;  1PD3 A;  3W7T A;  3SYC A;  2X6B A;  2JIZ G;  3W7X A;  2B5U A;  3D36 A;  5EBL C;  4MW3 A;  3SYA A;  2WLN A;  4PDV A;  1YI2 V;  3RVZ A;  3SYO A;  3CC4 V;  5B1N A;  1Q82 W;  2BOB C;  3STZ C;  3QNE A;  4MTO A;  3STL C;  2QEX V;  5KUM A;  3P30 A;  2Y69 B;  1R73 A;  2EIL B;  4PDM A;  1QR8 A;  4HYO A;  2DQ3 A;  1W0K G;  1ARO P;  3RVY A;  3UKM A;  4P9O A;  1YJW V;  2R9R B;  4MVQ A;  3DGE A;  3CME V;  1ENV A;  4RUF A;  4H33 A;  5L3G A;  4G27 B;  2F43 G;  4FMT A;  3D3I A;  2A79 B;  1P4R A;  1JCH A;  1FXK C;  3T4D A;  1VQK V;  3GB7 C;  2LP7 A;  3ETG A;  2QE7 G;  2WLL B;  4JTC B;  3OEE G;  4MTG A;  1PNK A;  5C93 A;  1QVG U;  3EHB B;  2B1I A;  1SRY A;  4KUM A;  1GKF A;  1H8E G;  3CCE V;  3ZMU A;  2HR3 A;  1G4Y B;  3E8F A;  2P90 A;  3OR6 C;  1NVP D;  4QPJ A;  2NNU A;  3CP1 A;  2XND G;  1DTO A;  3M99 B;  4HAM A;  3CCL V;  1I5X A;  2WLH A;  3JD0 A;  4GX1 A;  2V7Q G;  2GSM B;  2A9H A;  4MVM A;  4Z1M G;  2IU3 A;  3G4S V;  5B3S C;  5B1B B;  3SYP A;  1FXK B;  1KP2 A;  2HKO A;  2JDI G;  4U7N A;  4F4L A;  1Q81 W;  3OUS A;  3ZMV A;  3AG2 C;  1NR7 A;  5B1A B;  2EIJ C;  2PI4 A;  1AI7 A;  3OE7 G;  4G28 B;  2Y48 A;  4GCZ A;  5HFM A;  1YSC A;  1R6K A;  3ZN1 A;  3ASN B;  4GT1 A;  2B1G A;  2FTK A;  1EFR G;  2YEV B;  3ABM B;  1M56 B;  4WFA V;  1CP9 A;  3CYO A;  4BAY A;  1TUE B;  4TWK A;  4U7O A;  3ZRV A;  3IC7 A;  4WF9 V;  2MK3 A;  3I55 V;  1VQM V;  4PA9 A;  5L3D A;  5IY5 C;  1R6N A;  3OUF A;  4XDL A;  1V54 C;  3TCU A;  2WLI A;  2IJJ A;  3DTU B;  4QE9 A;  1F4M A;  3K06 A;  3W7U A;  4PA6 A;  2EIM B;  2QA4 V;  4FPP A;  1F51 A;  3E8H A;  3ZN0 A;  1AI5 A;  1SES A;  5FL7 G;  3E86 A;  5CBF A;  1GM8 A;  3ZMT A;  5IDJ A;  1VQO V;  3ABU A;  3BEH A;  1V55 B;  4ZKI A;  4GX2 A;  4UVC A;  4Q20 A;  1GTO A;  2ZDI A;  1RM1 B;  1JOY A;  1K5S A;  2EIN C;  4OXS A;  2IJK A;  3LDE A;  1H2G A;  3CCJ V;  4MT8 A;  1WPX A;  1E79 G;  4MVR A;  2IJH A;  4MSW C;  4X88 A;  5B1O A;  5L3B A;  5L3E A;  1VQ4 V;  1COW G;  4P2Z A;  1S76 D;  1EZJ A;  3WFV A;  1QVF U;  4LBE C;  3FB6 C;  1FXK A;  3G71 V;  2C2A A;  3CC2 V;  1K8A W;  1OCO B;  4I9W A;  4MS2 A;  3SPC A;  1THZ A;  1QLE C;  2Z5U A;  1Y4M A;  3K03 A;  4XDJ A;  4TSF G;  5BZB A;  3ZMZ A;  1YJN V;  1OCC B;  3ABT A;  1I5Y A;  2LFS A;  1QCE A;  1R3L C;  4LCU C;  4WFB V;  5L3F A;  4X8A A;  1E1R G;  1OZ0 A;  2D3O W;  2HG5 C;  2EIK B;  4H37 A;  1RPR A;  1KC8 W;  2AHY A;  2HFE C;  5CBH A;  2DWD C;  1NQT A;  5KA5 A;  3ZJZ A;  2YSU B;  4MTX A;  3ZRW A;  4JAV A;  2EIK C;  4JYB A;  1KKD A;  1N8R W;  2P6J A;  1JJ2 U;  1S0V A;  2EIM C;  2OTJ V;  1NH2 B;  1K7D A;  2AHZ A;  3CCM V;  4J9Y B;  4TT3 G;  1IXM A;  1M9N A;  2DWE C;  2WAM A;  4R50 A;  3G6E V;  3FB5 C;  4GX0 A;  2W0F C;  4PA7 A;  2JEX A;  5GW7 A;  1KD1 W;  1M56 C;  1GM9 A;  1GMG A;  1HWY A;  4N23 A;  1VQ8 V;  1JVM A;  3K0D A;  3LSQ A;  5KA6 A;  2DYR C;  2KB1 A;  1DLB A;  3ASN C;  2LFR A;  4MVZ A;  3EFF K;  4N21 A;  3CCR V;  4FJC C;  4JAS A;  2HLD G;  2EIJ B;  3T2M A;  1NKD A;  1VQN V;  3K3W A;  1S3J A;  3UM7 A;  2IW5 A;  5LGN A;  4R6Z A;  1ROP A;  1GM7 A;  3MD0 A;  1VQ7 V;  4P9P A;  1RM1 C;  1JQ0 A;  3K9A A;  4PDR A;  4FK5 C;  1XL4 A;  5LBQ A;  2XAH A;  4MW8 A;  1S5H C;  3ML0 A;  3QO5 A;  1Q7Y W;  3W7W A;  2V1D A;  1K92 A;  4JF3 A;  1F23 A;  4XDK A;  4WCE V;  1W0J G;  3HPL C;  4PDL A;  1YIJ V;  1NBM G;  1NVP B;  1Q86 W;  1QBZ A;  3TET A;  1H8H G;  2ZQM A;  4QPK A;  1S77 D;  2PI5 A;  3OEH G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...