1JJ2U

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jj2U00
3CCSV 2OTLV 2D3OW 1NJIW 2OTJV 1VQ4V 1VQ6V 1M90W 1VQ5V 1YITV 3CC2V 1VQNV 1YJ9V 1JJ2U 1K73W 1W2BU 3CPWU 3CCRV 3CXCU 1M1KW 1Q82W 3G4SV 1R73A 4WFBV 1VQ7V 3G71V 1K8AW 1VQ9V 3CCUV 3CD6V 1S72V 3CCQV 4WCEV 3I55V 1YIJV 1K9MW 1VQ8V 1Q86W 5DM6V 1VQOV 3CC7V 1Q81W 1KC8W 2QEXV 1YJNV 1YHQV 1KD1W 4WF9V 1Q7YW 3CMEV 1KQSU 3CCMV 3CCJV 3CCVV 3CC4V 3CCEV 1VQPV 1QVFU 1VQKV 3G6EV 1N8RW 1VQLV 1YI2V 4WFAV 3CMAV 3OW2U 1YJWV 1QVGU 1VQMV 3CCLV 3I56V 2QA4V
chains in the Genus database with same CATH superfamily
2E5LO 3HB3B 3K5LA 2N04A 3SPJA 4LCUC 1EBOA 1TA8A 3MD0A 4ZKIA 5F2VO 4K0KO 3JASA 2Q7HA 3UM7A 4P9PA 2ZDIA 2F43G 2GHYA 3SPIA 4X20A 2F1MA 5JCOC 4KHPO 1WNSA 3P3NA 4O4HB 5L3EA 3SPHA 2YXHA 4QE7A 2WLIA 3CRMA 4FM0A 1NTMH 1K4CC 4D6TH 4CBCA 3N27A 4MVZA 1TVKB 2H94A 3CP1A 4J10A 2YICA 2EIKB 4I4TA 2E75B 1V9PA 5EZYA 4MVUA 4O2AA 1AR5A 4DV0O 4PA9A 3JSNA 2X0LA 2YIBA 4B3SB 5D5PA 3TGUH 4J9YB 5DECA 1N0JA 1Y76B 4DK1A 4DR1B 1SQFA 5CMUA 4LF6B 4KUMA 4JPRA 5B1NA 4R8CA 4X64B 4TV8A 5JCOA 3RVYA 1AJPA 3UO2A 1H2SB 4QIWF 4HYOA 3A8TA 3UQ8A 1RSOB 3NXSA 3SYOA 2IBZH 4JI5O 1OCRC 2OCCB 3OFNG 4X66O 1RM1B 4D7TA 1IBLO 1IVSA 1D5NA 1NH2D 2ETNA 1FJGO 1BL8A 4PI0A 2ZM6B 1FXVA 3K0DA 4CC6A 1BQ0A 4DV7O 1XBLA 3Q4HA 3RYCB 3D8CA 2EILB 5GTIZ 3TCUA 5J2TB 1NR1A 4U3JA 1URFA 1R73A 3S3XA 2A79B 2UXXA 4DXWA 4YJ2B 3JAKB 2YIBD 2DYRC 3ML0A 1NKDA 3R66A 4NYKA 4JV5O 1NS1A 3JYCA 4JI2B 4I0XA 2R9IA 3EHBB 3GWOA 4X65B 4YHHB 1AB3A 1VQ9V 4DR6B 3JARB 2VWJA 2VQEO 1AI4A 1YXBA 1XMQB 2QSAA 4BW9A 1XNQO 1YHQV 1P4RA 1FPOA 4PDMA 1XMOB 4JI7O 3CC4V 4FLUA 4ASUG 1CP9A 2JK5C 2UU9B 2ZR2A 3F7YC 2OWOA 2A06H 1S3JA 4XDJA 1TUBB 1BHBA 1WB7A 2JEXA 3F5WC 4X62B 3BVOA 3L75H 3K5OA 4GX2A 1GN6A 1GN4A 3M99B 4I50B 2R9RB 2EULA 5C93A 4JI1B 4AI8A 5KA5A 4D7SA 2Q68A 2IH1C 2LW1A 4IHJA 4B3TO 3ASNC 3JCUZ 1H2NA 2QWRB 4I5SA 3ABMB 2L35A 3CC2V 1H2MA 4LF9B 1SESA 1THZA 1VQ7V 1AP5A 3CD6V 5IYZB 2CUGA 5H6RA 2BSKA 3JD0A 3ZMSA 1EN4A 2F93B 4ZOLB 1VF7A 1I5YA 4WFFA 5CA3A 2B5UA 3ABKC 3AG7A 1T5EA 4L8JA 1KB9F 1QQCA 1KUQA 3U0ZA 1IXBA 4FFBA 4CH3A 2QWNB 2FB5A 1E1QG 4DR7B 2NR5A 3LNNA 3IAYA 4R6ZA 1FFXB 1YTFB 1HNZO 3W7WA 1OCOC 2R9AA 1Y67A 5BR8B 4ICGA 2XAQA 4PA7A 5IE9A 1PL0A 3A2FA 2UUAO 1K92A 3C3SA 4B3MB 2W6JG 2AZ2A 3HKDA 2LW7A 4FPPA 4X1KB 3K59A 1XL4A 4NXMB 5B1AC 4OX9B 3JD1A 1FXKB 2ZT9B 3D3IA 1ZX3A 4GKJB 4AHCA 1M57C 4JYCA 4GX0A 1HWYA 2P22C 1K9MW 3WB1A 1OV9A 5IJ9A 3UT5A 3JCZA 3B8MA 3K5NA 3HKEA 4PV1B 2X6CA 1N4CA 4DR4B 5EYPB 3L70H 3HPLC 1W59A 4IYIA 4JI6O 4LF8O 4KFMA 3CYOA 4X1IB 2D2CB 1N36B 4BW5A 3BHPA 1ZUQA 4U3FH 5A9GA 4GYCB 3H1HH 4JI4B 4CS4A 1XEQA 3OUFA 2EZPA 3E8GA 1R6KA 4IT5A 5CA0B 3M7MX 2OTJV 2E76B 1S77D 3AG4B 3JAWB 4TUYA 1S5JA 4EFEA 3BABA 3PN1A 1AJNA 4HAMA 1DK1A 5J2UB 1K5SA 5B3SB 4JZGA 2OT5A 3K5MA 2P67A 4R7CA 3IGAC 4B3SO 3ZHUA 3CCLV 4MVOA 4JAAA 2ZNJA 5L3BA 1VF5B 3TETA 4IGGA 5LMUO 2BOCC 3RYFB 3RGBA 1H8EG 1OHHG 1VQ8V 3H01A 1OCCB 3FX7A 4F6EA 3DSQA 4EB6A 1Y74A 1N32O 1ZTEA 2EJRA 2ZXWB 5B66Z 2DWEC 1YJWV 4Q6GA 1PNLA 3AEIA 1JFFB 2GV9A 2JGDB 3FB7C 3THOA 5KUKA 4K8ZA 1PD3A 4PI2A 3CEIA 4WCEV 3SJQC 1N33B 1F7YA 2XAHA 2QKAA 1E1RG 3AG2B 3TJTA 2ZE8A 2PTMA 1K3EA 4CZZA 3WG7C 3ZRXA 1GKFA 5IWAO 3ZMTA 5L3FA 1ZAUA 2QA4V 1BHAA 4UUJC 2WLJA 1Q82W 1U97A 2Y4TA 2EIJC 2CTPA 1VF6C 1V54C 1P7BA 4DUYB 3G6BA 3RN4A 3J80N 4NTXA 5KAIZ 1Q6HA 1QU7A 5EBMC 4DV4B 1JR9A 3HKCB 1V55B 1I94B 2DQ0A 2XAGA 1IBKO 3CPWU 3L74H 4O4LB 3FB8C 3RYHA 2CH7B 2W0FC 2QE7G 1OZ0A 4OPHA 3TXQA 4CS2A 1GN2A 5LMNO 1S0VA 3WB0A 1F4NA 1AROP 4I55B 3UO3A 2LGWA 3ZS8C 1SQQH 1TUEB 4UV9A 5JJNB 2VQFB 3T2MA 1DGSA 1EN6A 2ZKOA 1GAXA 3JD4A 5C8YB 2WWWA 2Y0IA 3K57A 1N0NA 4PA4A 1S72V 4DV6B 4F6RB 3OMIB 2PUSA 2X7RB 2YEVB 3MDSA 2RDCA 2UXCO 1QLEB 1JQ0A 5CA1A 2Q0OC 1EZJA 2FKXA 5KHJA 1J5EO 2FYUH 3E8HA 2CTQA 5KUMA 4PDVA 1NVPB 3IC7A 1VARA 5JVDB 5IDJA 5KLVH 2Q6AA 3D36A 3W7UA 1SRYA 1XNRO 5LA6A 2RN9A 4ZI7A 1W0KG 3ZMVA 4LNUA 3A0RA 2PI5A 1Z2GA 4JYAO 3H1KH 3DXRA 3A0BZ 5KHKA 1M93A 1VQ4V 2IU3A 2X6BA 1M1KW 2LFRA 4DRXB 3G4SV 4FK5C 3T1YB 5HFMA 2YI9A 2ZIMA 2BTQA 5KMGA 1AI5A 1Z5WA 4I9QA 3BEHA 1BSMA 2QM8A 2ZDIC 1I5XA 4HNAB 1WLEA 3E8BA 4DV3B 4FLWA 1Q7YW 2XASA 4IIJA 4O2BB 3CSXA 2IJJA 2YI8A 3JATB 1M4UA 5E79Z 5BR8O 4NXNB 1H8HG 5H5NA 2RNBA 4I7ZB 4JI3O 4R50A 2WLKA 4MTXA 4UCVA 2WLIB 3JSLA 4B3MO 1YF2A 4OGQB 5DM6V 2DYSB 4PELA 5LGUA 2ZIOA 2DE0X 3MHSC 1HR0B 4DUZO 3RVZA 3G6EV 1GM7A 4WFAV 3ZX6A 3HKBB 4FLXA 4MVMA 3L73H 1JJ2U 1DLBA 4O4JB 1QR9A 2P90A 4AQYO 1JA8A 3OTOB 5BMVA 2DJVA 3CE2A 2JDIG 3N2KB 1XREA 1HNWO 5IJ0A 1PNKA 2EINC 3G80A 3E22A 1MMMA 4EEQA 2EIMB 3FAVA 1K97A 3ETDA 2HVJC 2F4VB 1NR7A 1MNGA 1R6NA 2Q67A 4LFAB 3CCMV 1M56C 2HJFC 4NKGB 2KG7A 1Y6XA 1MABG 3OEHG 3AK1A 5H2FZ 3U10A 3ZHRA 4JI8B 4Z1VA 3CRCA 4PDLA 1FD9A 4X1YA 1K4DC 3OUSA 1ZL8B 4PA3A 3AK2A 2JGUA 2OIEA 1VP7A 4GKKB 3CJHB 1EFRG 3E2EA 1IX9A 3BA9A 4LF5O 1HNXO 4LR3A 3RW0A 4LWSB 4CH4A 3OMAB 4O4HA 1OJHA 4DV5O 2Q69A 2P4KA 5CB4A 1LR1A 4UCOA 4HBNA 3N2GB 1KP3A 2OCCC 1O9GA 1TVKA 4J9ZB 3W7TA 1PV0A 3GB7C 5CBFA 1WA8A 5D5QA 3ZN1A 4LFBO 2JS3A 4LFCO 5BY1A 2UXBO 4DR5B 4YJ3B 3DGEA 5KHGA 1DF4A 1EN5A 3QG5A 1Q86W 3OR6C 4J11A 2JVDA 2FMLA 1HDJA 3SYCA 1JVMA 2H8PC 1SA0B 1Y76A 1O9HA 2UXNA 3OAAG 1NTZH 2DYRB 1G1XB 5B1BC 1XDCA 2IJKA 1OCZB 2CTWA 1SETA 1FYJA 4QJFB 3RFRA 4J7JA 1HP8A 5LOVB 3OT7A 1RSOA 1WP8A 4RWUA 4B08A 1KD1W 4E4EA 3CCVV 4JYYA 3LUTB 1KKCA 1SQVH 4ABMA 4ZHQB 2HEPA 1R3LC 4GZRB 3F7VC 4GX5A 5JWPA 2YC0A 2LGQA 5DN6G 1U96A 2Y69C 5EBWC 3FD9A 2HHHB 4UCSA 2ZE5A 1GM8A 3RYCA 4Z1MG 3CMEV 3VQYA 1US6A 3MAQA 5EIBD 4UVBA 4FFBB 1XI1A 1AI6A 1VQMV 4DV2B 4DR2B 4YJ2A 3APQA 1I7FA 4O4IB 4FFKA 3TXSA 2VS0A 4H0LB 5EC2C 2A9HA 5FNVB 1N34O 2GUZA 3ASNB 1NI8A 4WFGA 1UFIA 1G4YB 2UXDO 1Z5VA 2Z5UA 3ABMC 3E8FA 3SGIA 2YS8A 3GVMA 3SYAA 4X9QA 3JARA 3ZRWB 1NZ6A 2QWQB 3ZHSA 2FTKA 3UCSC 4RQFA 1YITV 1VQ5V 4QPKA 2XOKG 2WA3A 2UUCB 3L72H 3P3PA 4BR6A 2IH3C 1Q90D 2QM7A 1B04A 1BE3H 4NTYA 1WAZA 4RAIA 3M8AA 3ABKB 3B77A 4B3RB 4LP8A 2HVKC 1XHZA 3LSSA 1K34A 2MK3A 3T1HO 2XNDG 4JTDB 2PYJA 3FYEB 1Q8IA 2ZINA 1RPRA 3C90A 5IJ9B 4CS3A 3FB5C 2ARHA 3UT5B 1MOFA 1J95A 4TWKA 4TQFA 5DEDA 3HKEB 1JMKC 1OCOB 4YY3O 1QR8A 5H9CA 4WBNB 5JJEB 4UCRA 1ZLZA 2E3CA 2XHBA 1AR1B 4DV1B 3SJAC 5B1OA 1IBMO 3EVKA 3IC9A 1BMFG 3ABTA 3MHHC 3STLC 5IY5C 3CCUV 4ZOLA 5JH7A 4DR3O 4JI0B 2QR4A 3BAAA 3HR0A 2B9ZA 4L87A 5B1AB 1VQOV 1S5LZ 2O57A 1YJNV 4G28B 3SPCA 3VOUA 1FXKC 4EKWA 3CCJV 1KECA 3OR7C 2UUBO 3ABLC 4LF4B 2N05A 4MTFA 2VRZA 4LF7B 4FMTA 1NJIW 1K7DA 1XUQA 1VMGA 4MS2A 2XUMA 1K73W 3CCRV 3GWKC 2E5LB 5FPOA 1XILA 2WLLB 5CBHA 2WSSG 4K0KB 1QNMA 1YIJV 2V4DA 3IFXA 3JD2A 2Y4UA 3QTCA 4J7KA 3KKYA 1RP3B 4TV9B 3KCYA 3RYIA 1Y66A 4G2KA 4KHPB 4JAVA 2GBOA 1XHXA 2HJDA 5E1AC 2RJZA 5JQGB 1GMGA 4X1KA 3A0HZ 2DW4A 4K8XA 1FXKA 1R3KC 1UJWB 1N8RW 1CXZB 3OGCC 4KP4A 5KHIA 1WPXA 4UXNA 4DV0B 5B3SC 2Q7EA 4DR1O 2Q5ZA 3ETQA 2QTOA 4LF6O 1GK9A 2R70A 4K35A 5LYJB 4X64O 3OTFA 2Y0PA 5EYPA 1KQSU 4B7KA 2KB1A 3OGIB 4JYBA 4X1IA 3CWBH 2WLHA 3CCSV 3X2QB 2CGOA 2Q73A 3AG1C 5LXTB 2QM4A 3KZIZ 5LHIA 5IYDO 4JI5B 3B40A 3SDLA 2ZM6O 3CRQA 4X66B 3ZIAG 1ZSPA 1IBLB 2V1DA 2Z0AA 2AZ0A 5CA0A 1IDSA 2QKSA 1AILA 3ZMZA 1FJGB 3JAWA 1TAEA 2JRIA 4DV7B 5ITZB 1FFTB 4CC5A 2DOSA 2P06A 2ATKC 5J2UA 3SPGA 3WG7B 5GW7A 2QGNA 4JASA 3R65A 3ASOC 2ILMA 2QTSA 2EIJB 4AILC 4JI2O 4N21A 2EX3A 1V54B 3RYFA 1Q43A 4JV5B 4X65O 4YHHO 4DR6O 3B8NA 3FFQA 4PA6A 1XMQO 3CHXA 3KG2A 2RMKB 1CEZA 4FJCC 2JJ1G 5LP6C 1XMOO 2FL4A 3D36C 2VQEB 5LGTA 1V55C 2AW9A 1JFFA 1QLNA 2JGDA 2UU9O 1XNQB 1MA1A 4FLZA 4JI7B 3APOA 3I56V 5JJJB 4X62O 2EZOA 2XAFA 4PJ0Z 3LSUA 4WFBV 1MZFA 3TK1A 1PPJH 3AK3A 5KHHA 3IJ4A 3VQWA 1G6UA 1GN3A 5GONB 4JI1O 3QO8A 1JCHA 1SZXA 2BTQB 5KX5A 2Z3YA 3AG3C 4LF9O 4IIJB 3LNMB 2HFEC 4B3TB 1VQNV 1YJ9V 5BXZA 4QNHB 4MW3A 5LP6A 2GTAA 3HKCA 2IW5A 2W0XA 2WPDG 3ZRSA 2LFSA 4RUEA 4O4LA 2HKOA 2LQTA 2CH7A 3T4ZA 1QVGU 1H2LA 2CK3G 4JTAB 1G8MA 1QBZA 4I55A 4B7EA 3CXCU 3BRCA 2Q8VA 1COWG 3S3WA 2P4VA 3U11A 3EXAA 4DR7O 3FB6C 1EM1A 4CH6A 5C8YA 1H2KA 3JASB 1WP7A 3ZCCA 1W0JG 4XBFA 2XT9A 1HNZB 2YEVA 4MT8A 1R6TA 4X20B 4UFZA 4OPAA 4GX1A 3H1JH 3ZMUA 3I5DA 4W4KA 4GLXA 1BT8A 5IJ0B 1NH2B 4UB8Z 2UUAB 1R3IC 1H38A 3E22B 1KKDA 3K03A 3FAVB 2G38A 1H2GA 2RCVA 4U7OA 4NXMO 1RFYA 4OX9O 5JVDA 3VQXA 3JALA 4I4TB 1SKVA 3SYPA 4GKJO 3LDEA 5EZYB 3E89A 4OXSA 3P30A 4WFEA 4O2AB 4J80A 4KL1A 1YEWA 2YDEA 4UCUA 1SQPH 4RUFA 4P2ZA 1WN7A 1MSDA 3WB2A 4FZ1A 3BPZA 3O65A 2ITCC 2Q4PA 2L6LA 4YXWG 4DR4O 2ZCEA 5EC1C 4HNAA 4RQEA 2JS5A 4TV8B 1YSCA 1WPBA 3SJCC 4TOIA 2KQXA 4QPJA 4O2BA 2LP7A 3D3QA 1N36O 3JATA 2M7WA 3CB2A 2F95B 4BIZA 1ORQC 4G27B 4JI6B 4LF8B 4NVPA 2EINB 4JI4O 4Z2WA 2DQ3A 2DWDC 3ZEDA 2LO1A 2YXLA 3SJBC 3CCEV 1SQGA 4FVMA 1XOUA 2EIMC 4PDRA 5CB4B 2AHZA 2ZQMA 5FL7G 3H1IH 1M56B 2EIKC 4WFHA 1KYOF 1NVPD 2QDOA 1F23A 3Q4HB 3E83A 5EIBC 3HKBA 1WA8B 5IYCO 2BE3A 4U3JB 4BAYA 2JJ2G 4O4JA 4DYLA 4UCTA 1GM9A 2V7QG 2XAJA 2YUAA 3K04A 4C7UA 3RBZA 3N2KA 2HG5C 4MSWC 4PHZA 2K1EA 1S76D 5LMUB 4JZ2A 4I0XB 4TSFG 1KC8W 3EFFK 1I0HA 5AG2A 2DN9A 4LC1A 1OCRB 1X4TA 3ETEA 4MVQA 1BGYH 2QWPB 1N32B 5FPRA 1RM1C 4FM2A 1BS3A 1Q3EA 1EZVH 3STZC 4FLTA 2VWKA 3OEEG 1N33O 5IYBO 4QGPA 2JEUA 2EILC 2ZD9A 3K06A 4UVAA 1SQBH 2ZR3A 1IXMA 1X59A 1ZL8A 2PGGA 3DTUB 3VBBA 5IWAB 5TISZ 3CJHA 4BWAA 4DUYO 1GTOA 3BY6A 4IHJB 4GCZA 5B1BB 2EJ7A 1S5HC 4LWSA 4DV4O 1OCZC 4A5UB 1PKXA 2OCHA 2GUZB 4FLYA 3FKSG 2WA4A 1I94O 2CTRA 5EK0A 2BSKB 2KKWA 2Q0AA 3N2GA 3K0GA 1GO3F 2PI4A 1IBKB 1K5QA 3K3WA 2P7TC 3ETGA 3CCQV 5H6QA 3ZHVA 2Y69B 3CC7V 1JJOA 3NR7A 5LMNB 5GTHZ 1KP2A 5J2TA 2BTOA 2QJ1A 2VQFO 3JAMN 4YJ3A 2H3OA 2PY5A 3JAKA 3WU2Z 3W7XA 4DV6O 4U7NA 3JD3A 1YDXA 1NU1H 1SA0A 4UVCA 3UKMA 2QEXV 2CAZC 1P49A 1M5IA 4WF9V 1AJQA 1P84F 3CRRA 3K58A 2UXCB 2M6YA 3KCXA 3CS5A 1SC5B 4BIOA 1J5EB 5LOVA 2WLNA 1F51A 2C2AA 1SERA 2X6AA 4ZHQA 3E35A 3HKDB 2AGAA 4FM1A 2BCCH 2ZE7A 4H37A 2Q9LA 5L3GA 1VIBA 1VEWA 5A2QN 1TUBA 1YVWA 1KU9A 1L0LH 5JH7B 1XNRB 3OE7G 3BA8A 4JYAB 2NNUA 3OMNB 3T1YO 1L8DA 2ZNIA 4I50A 1DTOA 2K9PA 3OM3B 1JX9A 3C3TA 1PP9H 3LDCA 4DV3O 5FLXN 1DF5A 2PF4E 1JOYA 4NXNO 4JF3A 1GRJA 4O4IA 1QVFU 1VQLV 5FNVA 2R72A 5IYZA 3QVNA 3ZJZA 3K9AA 1MSWD 2ITDC 4DW1A 4MW8A 3FYIB 3RYIB 3ZHQA 1AVMA 4JI3B 3ZRWA 2BOBC 1YCIA 3QO7A 1HR0O 2Q7GA 1B3QA 5IY5B 5LHGA 1MG1A 3ABUA 5CN0A 1M57B 4MTGA 4TUYB 2AXTZ 1KBHA 1HW7A 4DUZB 2F23A 2P5OA 3J7AU 5L3DA 1PM9A 4NB5A 3DC6A 2KSDA 3ABLB 2OIGA 3OTOO 1FFXA 1A32A 3O9OA 4P30A 1K33A 4AQYB 2YSUB 2HLDG 1BQZA 3L71H 3WFVA 2JIZG 1B06A 4X89A 3ICXA 3BCCH 1YZBA 2MW2B 3LDDA 1M9NA 2YIAA 2DMXA 4EB6B 4K3AA 1Y74B 3ZN0A 1AI7A 4WBNA 1HNWB 3P32A 2F4VO 2WAMA 2WLMA 4LFAO 2EBOA 3RT3C 3E86A 4X88A 2OYQA 1NTKH 2LJ2A 3AG4C 4JI8O 2IJHA 1NQTA 4J41A 3OW2U 4P9OA 1WJZA 2W6IG 3H9VA 5B5EZ 1QCEA 2B1IA 4GKKO 4UV8A 4HZ3A 4ZIBA 3QO5A 3CRAA 2HP8A 3K08A 1IURA 3CMAV 1YTFD 3BFRA 2WLLA 4IL6Z 5LL6Y 4ZBMA 1IZ3A 1OCCC 1M90W 2CDYA 1MZEA 4TV9A 3VQVA 4LF5B 1HNXB 3W7SA 2ZXWC 4KXRA 4F4LA 2RQ6A 3ZHTA 3AG1B 3X2QC 3SR2C 4DV5B 1L0NH 1NBMG 4N23A 3B09A 5L3CA 1R3JC 3RYHB 4XDLA 1ZWIC 1Q6UA 5JQGA 1FXHA 2ODMA 2B1GA 1D2DA 1LNQA 2OTLV 1B6QA 3B4SA 4DR5O 2Y48A 3AG2C 1QHTA 1PNMA 2CGNA 4MVSA 4LFBB 1ENVA 5EBLC 4LFCB 2UXBB 5LGNA 2PYLA 4YIOA 4NR1A 1Y4MA 3G67A 5BZBA 3H1LH 5K1PA 4DO2A 2IJIA 3CX5F 3ASOB 4DW0A 3DC5A 3B2EE 5LYJA 1VQPV 1XQ8A 1FS0G 3J81N 5CA1B 2NLJC 2A3QA 1TGOA 5KX5B 4X8AA 1Q5OA 1R1BA 4FZ0A 5KA6A 3LSQA 4LBEC 4JGSA 3F5TA 2NN4A 5LXTA 5LP6B 1YI2V 2CE4A 5LHHA 1XL6A 1P7GA 4MTOA 1VQKV 2ZE6A 5LA6B 3ZBHA 2D3OW 4E2LA 4ZI7B 3SYQA 3ZRVA 4I9WA 1FKAO 4LNUB 2HHHO 4YIPA 1SQXH 3G71V 3QF7A 4UB6Z 4IYHA 3DXRB 2YIDA 5ITZA 3K79A 4BIUA 1LUVA 5IT9N 2QKCA 3QNEA 2XTAA 1PL4A 2N74A 3CXHF 4DV2O 5KMGB 4DR2O 2ADPA 2GSMB 4PD4F 3OD4A 1UPGA 1GH6A 5LBQA 1W2BU 1QLEC 3AG3B 2A0LA 4RO2A 1VF6A 1CPYA 3T4DA 4QE9A 1N34B 5K1XA 2E74B 2UXDB 2GTSA 1ROPA 2UUCO 1LUWA 3L9DA 4GUNA 2ADQB 4H13B 2AHYA 3T1CA 4NTWA 1L1FA 1RPOA 1FAFA 3JALB 4JTCB 4B3RO 3I55V 1BCCH 1I08A 4TT3G 1D5AA 5CBGA 3RWRD 4J42A 1JPXA 4GT1A 1WB8A 2A7WA 4FIPC 4DK0A 4JAUA 3T1HB 1SZTA 5HFLA 1NT2B 5BMVB 4F6RA 1VQ6V 5GONA 2IU0A 2YXYA 4EFBA 2IM9A 1K8AW 1AP6A 4YY3B 4LH7A 1KMIZ 4DV1O 4TQDA 5KAFZ 4XDKA 1E79G 4MVRA 1SS3A 4J7ZA 4LH6A 3PJSK 2QWOB 1BZKA 1IBMB 1AR4A 2DYSC 4JI0O 2KG7B 5J9PC 4CH5A 1Q6IA 2F66C 4H44B 2P6JA 1F4MA 4Q20A 4DR3B 4H33A 4FLVA 1Q81W 2HR3A 3K9SA 1SF9A 2GDSA 4W4LA 4LF4O 2PZSA 4DRXA 4X1YB 4LF7O 2UUBB
chains in the Genus database with same CATH topology
4FMTA 3HB3B 1NJIW 1V55B 1K7DA 2DQ0A 2XAGA 4MS2A 4LCUC 1EBOA 3SPJA 3MD0A 3K0GA 4ZKIA 1GO3F 3CPWU 3CCRV 1K73W 2PI4A 1K5QA 3FB8C 3UM7A 4P9PA 2W0FC 2QE7G 2WLLB 1OZ0A 3K3WA 2WSSG 2P7TC 3ETGA 5CBHA 2ZDIA 5H6QA 3CCQV 1YIJV 2F43G 1S0VA 3IFXA 3JD2A 2GHYA 2Y69B 1F4NA 3CC7V 1AROP 3SPIA 1KP2A 1Y66A 4G2KA 5L3EA 3SPHA 4JAVA 1TUEB 4UV9A 3T2MA 4QE7A 2WLIA 3JD4A 2WWWA 3W7XA 1K4CC 4CBCA 4U7NA 3JD3A 5E1AC 4MVZA 2H94A 3CP1A 4PA4A 1S72V 1GMGA 3OMIB 2X7RB 2EIKB 2YEVB 4UVCA 3UKMA 2QEXV 2DW4A 4WF9V 1QLEB 1AJQA 1JQ0A 1FXKA 1R3KC 4MVUA 1UJWB 1EZJA 1N8RW 3OGCC 4KP4A 1WPXA 3E8HA 4PA9A 4UXNA 5KUMA 2X0LA 4PDVA 5B3SC 2WLNA 1NVPB 1F51A 4J9YB 3IC7A 2C2AA 2QTOA 1SERA 2X6AA 3E35A 1GK9A 5IDJA 5CMUA 2Q6AA 3D36A 4KUMA 3W7UA 1SRYA 4H37A 4JPRA 5L3GA 5B1NA 4R8CA 1KQSU 1W0KG 2KB1A 3ZMVA 3A0RA 3RVYA 2PI5A 4JYBA 1AJPA 3OE7G 4QIWF 4HYOA 2WLHA 3CCSV 3X2QB 2NNUA 1VQ4V 3OMNB 2IU3A 3AG1C 3NXSA 3SYOA 2X6BA 1DTOA 1M1KW 3OM3B 1OCRC 2LFRA 3G4SV 2OCCB 1JX9A 4FK5C 3OFNG 5HFMA 5LHIA 5IYDO 1RM1B 1AI5A 3BEHA 3LDCA 1NH2D 2QM8A 1DF5A 2ZDIC 1I5XA 1JOYA 3ZIAG 2V1DA 1BL8A 1WLEA 3E8BA 4JF3A 1FXVA 3K0DA 2QKSA 1Q7YW 2XASA 3ZMZA 2IJJA 1H8HG 1QVFU 1VQLV 1FFTB 3ZJZA 3K9AA 2EILB 1MSWD 2ITDC 3TCUA 2ATKC 4MW8A 3FYIB 1NR1A 3SPGA 4R50A 1R73A 3WG7B 5GW7A 2A79B 3ZRWA 2WLKA 4MTXA 2UXXA 4JASA 2BOBC 4DXWA 2WLIB 3R65A 3ASOC 5DM6V 2DYSB 3QO7A 4PELA 2DYRC 5LGUA 5IY5B 5LHGA 3MHSC 1MG1A 2EIJB 3ML0A 3ABUA 5CN0A 1M57B 1NKDA 4MTGA 4N21A 3RVZA 1GM7A 3G6EV 4WFAV 1V54B 3JYCA 4MVMA 2R9IA 3EHBB 1JJ2U 3GWOA 1DLBA 5L3DA 1QR9A 1VQ9V 3B8NA 4PA6A 2P90A 3ABLB 3KG2A 1CEZA 4FJCC 2JJ1G 1AI4A 4P30A 5LGTA 1K33A 1V55C 1YHQV 1P4RA 1QLNA 4PDMA 2YSUB 2HLDG 3WFVA 3CC4V 2JDIG 2JIZG 4ASUG 1CP9A 4X89A 2JK5C 2ZR2A 3F7YC 3I56V 3LDDA 1M9NA 1S3JA 4XDJA 1PNKA 2EINC 3ZN0A 1AI7A 2EZOA 2XAFA 1BHBA 2JEXA 3F5WC 3P32A 4WFBV 3TK1A 2EIMB 2WAMA 1K97A 3ETDA 2HVJC 2WLMA 4GX2A 2EBOA 3M99B 2R9RB 1NR7A 3E86A 4X88A 1R6NA 2Q67A 5C93A 3CCMV 1M56C 2HJFC 3QO8A 1MABG 1JCHA 5KA5A 3AG4C 3OEHG 2IJHA 1NQTA 2Q68A 2Z3YA 3AG3C 3OW2U 4P9OA 2IH1C 3ASNC 4PDLA 3LNMB 2HFEC 1VQNV 3CC2V 4I5SA 3ABMB 1YJ9V 2W6IG 1SESA 1THZA 1VQ7V 3CD6V 4QNHB 1QCEA 2B1IA 1K4DC 3OUSA 4MW3A 4PA3A 4UV8A 4HZ3A 5H6RA 2IW5A 3QO5A 2WPDG 3JD0A 3ZMSA 1EFRG 3ZRSA 3E2EA 2LFSA 3K08A 4RUEA 1I5YA 4WFFA 2HKOA 5CA3A 3T4ZA 3CMAV 2WLLA 1QVGU 1YTFD 2CK3G 4JTAB 1G8MA 4ZBMA 1OCCC 1M90W 2B5UA 1QBZA 3RW0A 3ABKC 3CXCU 3OMAB 1COWG 3W7SA 2ZXWC 4F4LA 3FB6C 2Q69A 3AG1B 1E1QG 3X2QC 1NBMG 4N23A 5L3CA 1KP3A 1R3JC 2OCCC 4R6ZA 4XDLA 3ZCCA 1ZWIC 1W0JG 4XBFA 1YTFB 3W7WA 1FXHA 1OCOC 4J9ZB 2B1GA 3W7TA 1LNQA 3GB7C 2XAQA 5CBFA 2OTLV 1B6QA 2YEVA 4MT8A 4PA7A 3ZN1A 2Y48A 4GX1A 3AG2C 1PL0A 3ZMUA 1PNMA 3DGEA 4MVSA 1ENVA 1K92A 5EBLC 1DF4A 1NH2B 1Q86W 5LGNA 3OR6C 3SYCA 1Y4MA 1R3IC 1H38A 5BZBA 1JVMA 2W6JG 4DO2A 1KKDA 2H8PC 3K03A 2IJIA 1H2GA 4U7OA 2UXNA 3OAAG 3ASOB 4FPPA 1VQPV 1XL4A 5B1AC 1FS0G 2DYRB 3SYPA 5B1BC 2IJKA 3JD1A 1FXKB 3E89A 3LDEA 4OXSA 3P30A 4WFEA 1OCZB 3D3IA 2NLJC 4X8AA 1SETA 1M57C 4JYCA 4QJFB 5KA6A 3LSQA 4GX0A 1HWYA 4RUFA 1K9MW 4LBEC 4P2ZA 4JGSA 1KD1W 3CCVV 3JCZA 3LUTB 3B8MA 2ITCC 1R3LC 1YI2V 4YXWG 3F7VC 4GX5A 5LHHA 1XL6A 2X6CA 5EC1C 4MTOA 1VQKV 5DN6G 4RQEA 2D3OW 4E2LA 3SYQA 1YSCA 2Y69C 4I9WA 3HPLC 5EBWC 3ZRVA 4QPJA 2LP7A 3G71V 4KFMA 2M7WA 3CYOA 4BIZA 1ORQC 4G27B 4BW5A 1GM8A 3K79A 2EINB 4Z1MG 2DQ3A 2DWDC 4BIUA 3CMEV 3QNEA 3CCEV 3OUFA 4UVBA 2GSMB 1AI6A 2EIMC 4PDRA 1VQMV 2EZPA 3E8GA 2AHZA 2ZQMA 1R6KA 5FL7G 2OTJV 1M56B 2EIKC 4WFHA 5LBQA 1W2BU 1NVPD 1S77D 3AG4B 1QLEC 5EC2C 2A9HA 1F23A 3AG3B 2A0LA 4RO2A 3E83A 3ASNB 5IYCO 1AJNA 1CPYA 4HAMA 3T4DA 4QE9A 4WFGA 5B3SB 1K5SA 1G4YB 2Z5UA 2OT5A 3ABMC 3E8FA 4BAYA 2JJ2G 3SYAA 2P67A 3ZRWB 4R7CA 3IGAC 1ROPA 1GM9A 2V7QG 3CCLV 4MVOA 2FTKA 2XAJA 3K04A 5L3BA 4RQFA 1YITV 2AHYA 3TETA 1VQ5V 4QPKA 2XOKG 3RBZA 3T1CA 1L1FA 1RPOA 2BOCC 2IH3C 2HG5C 4MSWC 1S76D 2K1EA 2QM7A 4JTCB 1H8EG 1OHHG 3I55V 1VQ8V 4TSFG 4RAIA 3H01A 1OCCB 4TT3G 1KC8W 3ABKB 3B77A 3EFFK 4LP8A 5CBGA 2HVKC 4LC1A 1OCRB 3ETEA 1JPXA 4MVQA 3LSSA 1K34A 2MK3A 4GT1A 2XNDG 4JTDB 2EJRA 2ZXWB 3FYEB 4FIPC 2DWEC 1RPRA 4JAUA 1YJWV 1RM1C 1SZTA 3FB5C 5HFLA 1MOFA 1PNLA 3AEIA 1VQ6V 1J95A 4TWKA 2IU0A 3FB7C 3STZC 5KUKA 1K8AW 3OEEG 1OCOB 1PD3A 5IYBO 1QR8A 4WCEV 3SJQC 5H9CA 2XAHA 2JEUA 2EILC 1E1RG 3AG2B 2ZD9A 3K06A 4UVAA 1K3EA 2ZR3A 4CZZA 4XDKA 1IXMA 1E79G 3WG7C 3ZRXA 1AR1B 1GKFA 5B1OA 4MVRA 3ZMTA 5L3FA 2QA4V 3DTUB 3VBBA 1BHAA 3PJSK 4UUJC 1BMFG 2DYSC 3ABTA 5J9PC 2WLJA 1Q82W 3MHHC 3STLC 5IY5C 2P6JA 3CCUV 2EIJC 1GTOA 1F4MA 3BY6A 4Q20A 4L87A 5B1AB 1V54C 1P7BA 4H33A 4GCZA 5B1BB 1VQOV 1Q81W 1YJNV 2HR3A 4G28B 3SPCA 3VOUA 1FXKC 1S5HC 4EKWA 1KECA 3OR7C 3CCJV 1OCZC 1PKXA 3FKSG 5EBMC 3ABLC 5EK0A 4MTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  2OTL V;  2D3O W;  1NJI W;  2OTJ V;  1VQ4 V;  1VQ6 V;  1M90 W;  1VQ5 V;  1YIT V;  3CC2 V;  1VQN V;  1YJ9 V;  1JJ2 U;  1K73 W;  1W2B U;  3CPW U;  3CCR V;  3CXC U;  1M1K W;  1Q82 W;  3G4S V;  1R73 A;  4WFB V;  1VQ7 V;  3G71 V;  1K8A W;  1VQ9 V;  3CCU V;  3CD6 V;  1S72 V;  3CCQ V;  4WCE V;  3I55 V;  1YIJ V;  1K9M W;  1VQ8 V;  1Q86 W;  5DM6 V;  1VQO V;  3CC7 V;  1Q81 W;  1KC8 W;  2QEX V;  1YJN V;  1YHQ V;  1KD1 W;  4WF9 V;  1Q7Y W;  3CME V;  1KQS U;  3CCM V;  3CCJ V;  3CCV V;  3CC4 V;  3CCE V;  1VQP V;  1QVF U;  1VQK V;  3G6E V;  1N8R W;  1VQL V;  1YI2 V;  4WFA V;  3CMA V;  3OW2 U;  1YJW V;  1QVG U;  1VQM V;  3CCL V;  3I56 V;  2QA4 V; 
#chains in the Genus database with same CATH topology
 2E5L O;  3HB3 B;  3K5L A;  2N04 A;  3SPJ A;  4LCU C;  1EBO A;  1TA8 A;  3MD0 A;  4ZKI A;  5F2V O;  4K0K O;  3JAS A;  2Q7H A;  3UM7 A;  4P9P A;  2ZDI A;  2F43 G;  2GHY A;  3SPI A;  4X20 A;  2F1M A;  5JCO C;  4KHP O;  1WNS A;  3P3N A;  4O4H B;  5L3E A;  3SPH A;  2YXH A;  4QE7 A;  2WLI A;  3CRM A;  4FM0 A;  1NTM H;  1K4C C;  4D6T H;  4CBC A;  3N27 A;  4MVZ A;  1TVK B;  2H94 A;  3CP1 A;  4J10 A;  2YIC A;  2EIK B;  4I4T A;  2E75 B;  1V9P A;  5EZY A;  4MVU A;  4O2A A;  1AR5 A;  4DV0 O;  4PA9 A;  3JSN A;  2X0L A;  2YIB A;  4B3S B;  5D5P A;  3TGU H;  4J9Y B;  5DEC A;  1N0J A;  1Y76 B;  4DK1 A;  4DR1 B;  1SQF A;  5CMU A;  4LF6 B;  4KUM A;  4JPR A;  5B1N A;  4R8C A;  4X64 B;  4TV8 A;  5JCO A;  3RVY A;  1AJP A;  3UO2 A;  1H2S B;  4QIW F;  4HYO A;  3A8T A;  3UQ8 A;  1RSO B;  3NXS A;  3SYO A;  2IBZ H;  4JI5 O;  1OCR C;  2OCC B;  3OFN G;  4X66 O;  1RM1 B;  4D7T A;  1IBL O;  1IVS A;  1D5N A;  1NH2 D;  2ETN A;  1FJG O;  1BL8 A;  4PI0 A;  2ZM6 B;  1FXV A;  3K0D A;  4CC6 A;  1BQ0 A;  4DV7 O;  1XBL A;  3Q4H A;  3RYC B;  3D8C A;  2EIL B;  5GTI Z;  3TCU A;  5J2T B;  1NR1 A;  4U3J A;  1URF A;  1R73 A;  3S3X A;  2A79 B;  2UXX A;  4DXW A;  4YJ2 B;  3JAK B;  2YIB D;  2DYR C;  3ML0 A;  1NKD A;  3R66 A;  4NYK A;  4JV5 O;  1NS1 A;  3JYC A;  4JI2 B;  4I0X A;  2R9I A;  3EHB B;  3GWO A;  4X65 B;  4YHH B;  1AB3 A;  1VQ9 V;  4DR6 B;  3JAR B;  2VWJ A;  2VQE O;  1AI4 A;  1YXB A;  1XMQ B;  2QSA A;  4BW9 A;  1XNQ O;  1YHQ V;  1P4R A;  1FPO A;  4PDM A;  1XMO B;  4JI7 O;  3CC4 V;  4FLU A;  4ASU G;  1CP9 A;  2JK5 C;  2UU9 B;  2ZR2 A;  3F7Y C;  2OWO A;  2A06 H;  1S3J A;  4XDJ A;  1TUB B;  1BHB A;  1WB7 A;  2JEX A;  3F5W C;  4X62 B;  3BVO A;  3L75 H;  3K5O A;  4GX2 A;  1GN6 A;  1GN4 A;  3M99 B;  4I50 B;  2R9R B;  2EUL A;  5C93 A;  4JI1 B;  4AI8 A;  5KA5 A;  4D7S A;  2Q68 A;  2IH1 C;  2LW1 A;  4IHJ A;  4B3T O;  3ASN C;  3JCU Z;  1H2N A;  2QWR B;  4I5S A;  3ABM B;  2L35 A;  3CC2 V;  1H2M A;  4LF9 B;  1SES A;  1THZ A;  1VQ7 V;  1AP5 A;  3CD6 V;  5IYZ B;  2CUG A;  5H6R A;  2BSK A;  3JD0 A;  3ZMS A;  1EN4 A;  2F93 B;  4ZOL B;  1VF7 A;  1I5Y A;  4WFF A;  5CA3 A;  2B5U A;  3ABK C;  3AG7 A;  1T5E A;  4L8J A;  1KB9 F;  1QQC A;  1KUQ A;  3U0Z A;  1IXB A;  4FFB A;  4CH3 A;  2QWN B;  2FB5 A;  1E1Q G;  4DR7 B;  2NR5 A;  3LNN A;  3IAY A;  4R6Z A;  1FFX B;  1YTF B;  1HNZ O;  3W7W A;  1OCO C;  2R9A A;  1Y67 A;  5BR8 B;  4ICG A;  2XAQ A;  4PA7 A;  5IE9 A;  1PL0 A;  3A2F A;  2UUA O;  1K92 A;  3C3S A;  4B3M B;  2W6J G;  2AZ2 A;  3HKD A;  2LW7 A;  4FPP A;  4X1K B;  3K59 A;  1XL4 A;  4NXM B;  5B1A C;  4OX9 B;  3JD1 A;  1FXK B;  2ZT9 B;  3D3I A;  1ZX3 A;  4GKJ B;  4AHC A;  1M57 C;  4JYC A;  4GX0 A;  1HWY A;  2P22 C;  1K9M W;  3WB1 A;  1OV9 A;  5IJ9 A;  3UT5 A;  3JCZ A;  3B8M A;  3K5N A;  3HKE A;  4PV1 B;  2X6C A;  1N4C A;  4DR4 B;  5EYP B;  3L70 H;  3HPL C;  1W59 A;  4IYI A;  4JI6 O;  4LF8 O;  4KFM A;  3CYO A;  4X1I B;  2D2C B;  1N36 B;  4BW5 A;  3BHP A;  1ZUQ A;  4U3F H;  5A9G A;  4GYC B;  3H1H H;  4JI4 B;  4CS4 A;  1XEQ A;  3OUF A;  2EZP A;  3E8G A;  1R6K A;  4IT5 A;  5CA0 B;  3M7M X;  2OTJ V;  2E76 B;  1S77 D;  3AG4 B;  3JAW B;  4TUY A;  1S5J A;  4EFE A;  3BAB A;  3PN1 A;  1AJN A;  4HAM A;  1DK1 A;  5J2U B;  1K5S A;  5B3S B;  4JZG A;  2OT5 A;  3K5M A;  2P67 A;  4R7C A;  3IGA C;  4B3S O;  3ZHU A;  3CCL V;  4MVO A;  4JAA A;  2ZNJ A;  5L3B A;  1VF5 B;  3TET A;  4IGG A;  5LMU O;  2BOC C;  3RYF B;  3RGB A;  1H8E G;  1OHH G;  1VQ8 V;  3H01 A;  1OCC B;  3FX7 A;  4F6E A;  3DSQ A;  4EB6 A;  1Y74 A;  1N32 O;  1ZTE A;  2EJR A;  2ZXW B;  5B66 Z;  2DWE C;  1YJW V;  4Q6G A;  1PNL A;  3AEI A;  1JFF B;  2GV9 A;  2JGD B;  3FB7 C;  3THO A;  5KUK A;  4K8Z A;  1PD3 A;  4PI2 A;  3CEI A;  4WCE V;  3SJQ C;  1N33 B;  1F7Y A;  2XAH A;  2QKA A;  1E1R G;  3AG2 B;  3TJT A;  2ZE8 A;  2PTM A;  1K3E A;  4CZZ A;  3WG7 C;  3ZRX A;  1GKF A;  5IWA O;  3ZMT A;  5L3F A;  1ZAU A;  2QA4 V;  1BHA A;  4UUJ C;  2WLJ A;  1Q82 W;  1U97 A;  2Y4T A;  2EIJ C;  2CTP A;  1VF6 C;  1V54 C;  1P7B A;  4DUY B;  3G6B A;  3RN4 A;  3J80 N;  4NTX A;  5KAI Z;  1Q6H A;  1QU7 A;  5EBM C;  4DV4 B;  1JR9 A;  3HKC B;  1V55 B;  1I94 B;  2DQ0 A;  2XAG A;  1IBK O;  3CPW U;  3L74 H;  4O4L B;  3FB8 C;  3RYH A;  2CH7 B;  2W0F C;  2QE7 G;  1OZ0 A;  4OPH A;  3TXQ A;  4CS2 A;  1GN2 A;  5LMN O;  1S0V A;  3WB0 A;  1F4N A;  1ARO P;  4I55 B;  3UO3 A;  2LGW A;  3ZS8 C;  1SQQ H;  1TUE B;  4UV9 A;  5JJN B;  2VQF B;  3T2M A;  1DGS A;  1EN6 A;  2ZKO A;  1GAX A;  3JD4 A;  5C8Y B;  2WWW A;  2Y0I A;  3K57 A;  1N0N A;  4PA4 A;  1S72 V;  4DV6 B;  4F6R B;  3OMI B;  2PUS A;  2X7R B;  2YEV B;  3MDS A;  2RDC A;  2UXC O;  1QLE B;  1JQ0 A;  5CA1 A;  2Q0O C;  1EZJ A;  2FKX A;  5KHJ A;  1J5E O;  2FYU H;  3E8H A;  2CTQ A;  5KUM A;  4PDV A;  1NVP B;  3IC7 A;  1VAR A;  5JVD B;  5IDJ A;  5KLV H;  2Q6A A;  3D36 A;  3W7U A;  1SRY A;  1XNR O;  5LA6 A;  2RN9 A;  4ZI7 A;  1W0K G;  3ZMV A;  4LNU A;  3A0R A;  2PI5 A;  1Z2G A;  4JYA O;  3H1K H;  3DXR A;  3A0B Z;  5KHK A;  1M93 A;  1VQ4 V;  2IU3 A;  2X6B A;  1M1K W;  2LFR A;  4DRX B;  3G4S V;  4FK5 C;  3T1Y B;  5HFM A;  2YI9 A;  2ZIM A;  2BTQ A;  5KMG A;  1AI5 A;  1Z5W A;  4I9Q A;  3BEH A;  1BSM A;  2QM8 A;  2ZDI C;  1I5X A;  4HNA B;  1WLE A;  3E8B A;  4DV3 B;  4FLW A;  1Q7Y W;  2XAS A;  4IIJ A;  4O2B B;  3CSX A;  2IJJ A;  2YI8 A;  3JAT B;  1M4U A;  5E79 Z;  5BR8 O;  4NXN B;  1H8H G;  5H5N A;  2RNB A;  4I7Z B;  4JI3 O;  4R50 A;  2WLK A;  4MTX A;  4UCV A;  2WLI B;  3JSL A;  4B3M O;  1YF2 A;  4OGQ B;  5DM6 V;  2DYS B;  4PEL A;  5LGU A;  2ZIO A;  2DE0 X;  3MHS C;  1HR0 B;  4DUZ O;  3RVZ A;  3G6E V;  1GM7 A;  4WFA V;  3ZX6 A;  3HKB B;  4FLX A;  4MVM A;  3L73 H;  1JJ2 U;  1DLB A;  4O4J B;  1QR9 A;  2P90 A;  4AQY O;  1JA8 A;  3OTO B;  5BMV A;  2DJV A;  3CE2 A;  2JDI G;  3N2K B;  1XRE A;  1HNW O;  5IJ0 A;  1PNK A;  2EIN C;  3G80 A;  3E22 A;  1MMM A;  4EEQ A;  2EIM B;  3FAV A;  1K97 A;  3ETD A;  2HVJ C;  2F4V B;  1NR7 A;  1MNG A;  1R6N A;  2Q67 A;  4LFA B;  3CCM V;  1M56 C;  2HJF C;  4NKG B;  2KG7 A;  1Y6X A;  1MAB G;  3OEH G;  3AK1 A;  5H2F Z;  3U10 A;  3ZHR A;  4JI8 B;  4Z1V A;  3CRC A;  4PDL A;  1FD9 A;  4X1Y A;  1K4D C;  3OUS A;  1ZL8 B;  4PA3 A;  3AK2 A;  2JGU A;  2OIE A;  1VP7 A;  4GKK B;  3CJH B;  1EFR G;  3E2E A;  1IX9 A;  3BA9 A;  4LF5 O;  1HNX O;  4LR3 A;  3RW0 A;  4LWS B;  4CH4 A;  3OMA B;  4O4H A;  1OJH A;  4DV5 O;  2Q69 A;  2P4K A;  5CB4 A;  1LR1 A;  4UCO A;  4HBN A;  3N2G B;  1KP3 A;  2OCC C;  1O9G A;  1TVK A;  4J9Z B;  3W7T A;  1PV0 A;  3GB7 C;  5CBF A;  1WA8 A;  5D5Q A;  3ZN1 A;  4LFB O;  2JS3 A;  4LFC O;  5BY1 A;  2UXB O;  4DR5 B;  4YJ3 B;  3DGE A;  5KHG A;  1DF4 A;  1EN5 A;  3QG5 A;  1Q86 W;  3OR6 C;  4J11 A;  2JVD A;  2FML A;  1HDJ A;  3SYC A;  1JVM A;  2H8P C;  1SA0 B;  1Y76 A;  1O9H A;  2UXN A;  3OAA G;  1NTZ H;  2DYR B;  1G1X B;  5B1B C;  1XDC A;  2IJK A;  1OCZ B;  2CTW A;  1SET A;  1FYJ A;  4QJF B;  3RFR A;  4J7J A;  1HP8 A;  5LOV B;  3OT7 A;  1RSO A;  1WP8 A;  4RWU A;  4B08 A;  1KD1 W;  4E4E A;  3CCV V;  4JYY A;  3LUT B;  1KKC A;  1SQV H;  4ABM A;  4ZHQ B;  2HEP A;  1R3L C;  4GZR B;  3F7V C;  4GX5 A;  5JWP A;  2YC0 A;  2LGQ A;  5DN6 G;  1U96 A;  2Y69 C;  5EBW C;  3FD9 A;  2HHH B;  4UCS A;  2ZE5 A;  1GM8 A;  3RYC A;  4Z1M G;  3CME V;  3VQY A;  1US6 A;  3MAQ A;  5EIB D;  4UVB A;  4FFB B;  1XI1 A;  1AI6 A;  1VQM V;  4DV2 B;  4DR2 B;  4YJ2 A;  3APQ A;  1I7F A;  4O4I B;  4FFK A;  3TXS A;  2VS0 A;  4H0L B;  5EC2 C;  2A9H A;  5FNV B;  1N34 O;  2GUZ A;  3ASN B;  1NI8 A;  4WFG A;  1UFI A;  1G4Y B;  2UXD O;  1Z5V A;  2Z5U A;  3ABM C;  3E8F A;  3SGI A;  2YS8 A;  3GVM A;  3SYA A;  4X9Q A;  3JAR A;  3ZRW B;  1NZ6 A;  2QWQ B;  3ZHS A;  2FTK A;  3UCS C;  4RQF A;  1YIT V;  1VQ5 V;  4QPK A;  2XOK G;  2WA3 A;  2UUC B;  3L72 H;  3P3P A;  4BR6 A;  2IH3 C;  1Q90 D;  2QM7 A;  1B04 A;  1BE3 H;  4NTY A;  1WAZ A;  4RAI A;  3M8A A;  3ABK B;  3B77 A;  4B3R B;  4LP8 A;  2HVK C;  1XHZ A;  3LSS A;  1K34 A;  2MK3 A;  3T1H O;  2XND G;  4JTD B;  2PYJ A;  3FYE B;  1Q8I A;  2ZIN A;  1RPR A;  3C90 A;  5IJ9 B;  4CS3 A;  3FB5 C;  2ARH A;  3UT5 B;  1MOF A;  1J95 A;  4TWK A;  4TQF A;  5DED A;  3HKE B;  1JMK C;  1OCO B;  4YY3 O;  1QR8 A;  5H9C A;  4WBN B;  5JJE B;  4UCR A;  1ZLZ A;  2E3C A;  2XHB A;  1AR1 B;  4DV1 B;  3SJA C;  5B1O A;  1IBM O;  3EVK A;  3IC9 A;  1BMF G;  3ABT A;  3MHH C;  3STL C;  5IY5 C;  3CCU V;  4ZOL A;  5JH7 A;  4DR3 O;  4JI0 B;  2QR4 A;  3BAA A;  3HR0 A;  2B9Z A;  4L87 A;  5B1A B;  1VQO V;  1S5L Z;  2O57 A;  1YJN V;  4G28 B;  3SPC A;  3VOU A;  1FXK C;  4EKW A;  3CCJ V;  1KEC A;  3OR7 C;  2UUB O;  3ABL C;  4LF4 B;  2N05 A;  4MTF A;  2VRZ A;  4LF7 B;  4FMT A;  1NJI W;  1K7D A;  1XUQ A;  1VMG A;  4MS2 A;  2XUM A;  1K73 W;  3CCR V;  3GWK C;  2E5L B;  5FPO A;  1XIL A;  2WLL B;  5CBH A;  2WSS G;  4K0K B;  1QNM A;  1YIJ V;  2V4D A;  3IFX A;  3JD2 A;  2Y4U A;  3QTC A;  4J7K A;  3KKY A;  1RP3 B;  4TV9 B;  3KCY A;  3RYI A;  1Y66 A;  4G2K A;  4KHP B;  4JAV A;  2GBO A;  1XHX A;  2HJD A;  5E1A C;  2RJZ A;  5JQG B;  1GMG A;  4X1K A;  3A0H Z;  2DW4 A;  4K8X A;  1FXK A;  1R3K C;  1UJW B;  1N8R W;  1CXZ B;  3OGC C;  4KP4 A;  5KHI A;  1WPX A;  4UXN A;  4DV0 B;  5B3S C;  2Q7E A;  4DR1 O;  2Q5Z A;  3ETQ A;  2QTO A;  4LF6 O;  1GK9 A;  2R70 A;  4K35 A;  5LYJ B;  4X64 O;  3OTF A;  2Y0P A;  5EYP A;  1KQS U;  4B7K A;  2KB1 A;  3OGI B;  4JYB A;  4X1I A;  3CWB H;  2WLH A;  3CCS V;  3X2Q B;  2CGO A;  2Q73 A;  3AG1 C;  5LXT B;  2QM4 A;  3KZI Z;  5LHI A;  5IYD O;  4JI5 B;  3B40 A;  3SDL A;  2ZM6 O;  3CRQ A;  4X66 B;  3ZIA G;  1ZSP A;  1IBL B;  2V1D A;  2Z0A A;  2AZ0 A;  5CA0 A;  1IDS A;  2QKS A;  1AIL A;  3ZMZ A;  1FJG B;  3JAW A;  1TAE A;  2JRI A;  4DV7 B;  5ITZ B;  1FFT B;  4CC5 A;  2DOS A;  2P06 A;  2ATK C;  5J2U A;  3SPG A;  3WG7 B;  5GW7 A;  2QGN A;  4JAS A;  3R65 A;  3ASO C;  2ILM A;  2QTS A;  2EIJ B;  4AIL C;  4JI2 O;  4N21 A;  2EX3 A;  1V54 B;  3RYF A;  1Q43 A;  4JV5 B;  4X65 O;  4YHH O;  4DR6 O;  3B8N A;  3FFQ A;  4PA6 A;  1XMQ O;  3CHX A;  3KG2 A;  2RMK B;  1CEZ A;  4FJC C;  2JJ1 G;  5LP6 C;  1XMO O;  2FL4 A;  3D36 C;  2VQE B;  5LGT A;  1V55 C;  2AW9 A;  1JFF A;  1QLN A;  2JGD A;  2UU9 O;  1XNQ B;  1MA1 A;  4FLZ A;  4JI7 B;  3APO A;  3I56 V;  5JJJ B;  4X62 O;  2EZO A;  2XAF A;  4PJ0 Z;  3LSU A;  4WFB V;  1MZF A;  3TK1 A;  1PPJ H;  3AK3 A;  5KHH A;  3IJ4 A;  3VQW A;  1G6U A;  1GN3 A;  5GON B;  4JI1 O;  3QO8 A;  1JCH A;  1SZX A;  2BTQ B;  5KX5 A;  2Z3Y A;  3AG3 C;  4LF9 O;  4IIJ B;  3LNM B;  2HFE C;  4B3T B;  1VQN V;  1YJ9 V;  5BXZ A;  4QNH B;  4MW3 A;  5LP6 A;  2GTA A;  3HKC A;  2IW5 A;  2W0X A;  2WPD G;  3ZRS A;  2LFS A;  4RUE A;  4O4L A;  2HKO A;  2LQT A;  2CH7 A;  3T4Z A;  1QVG U;  1H2L A;  2CK3 G;  4JTA B;  1G8M A;  1QBZ A;  4I55 A;  4B7E A;  3CXC U;  3BRC A;  2Q8V A;  1COW G;  3S3W A;  2P4V A;  3U11 A;  3EXA A;  4DR7 O;  3FB6 C;  1EM1 A;  4CH6 A;  5C8Y A;  1H2K A;  3JAS B;  1WP7 A;  3ZCC A;  1W0J G;  4XBF A;  2XT9 A;  1HNZ B;  2YEV A;  4MT8 A;  1R6T A;  4X20 B;  4UFZ A;  4OPA A;  4GX1 A;  3H1J H;  3ZMU A;  3I5D A;  4W4K A;  4GLX A;  1BT8 A;  5IJ0 B;  1NH2 B;  4UB8 Z;  2UUA B;  1R3I C;  1H38 A;  3E22 B;  1KKD A;  3K03 A;  3FAV B;  2G38 A;  1H2G A;  2RCV A;  4U7O A;  4NXM O;  1RFY A;  4OX9 O;  5JVD A;  3VQX A;  3JAL A;  4I4T B;  1SKV A;  3SYP A;  4GKJ O;  3LDE A;  5EZY B;  3E89 A;  4OXS A;  3P30 A;  4WFE A;  4O2A B;  4J80 A;  4KL1 A;  1YEW A;  2YDE A;  4UCU A;  1SQP H;  4RUF A;  4P2Z A;  1WN7 A;  1MSD A;  3WB2 A;  4FZ1 A;  3BPZ A;  3O65 A;  2ITC C;  2Q4P A;  2L6L A;  4YXW G;  4DR4 O;  2ZCE A;  5EC1 C;  4HNA A;  4RQE A;  2JS5 A;  4TV8 B;  1YSC A;  1WPB A;  3SJC C;  4TOI A;  2KQX A;  4QPJ A;  4O2B A;  2LP7 A;  3D3Q A;  1N36 O;  3JAT A;  2M7W A;  3CB2 A;  2F95 B;  4BIZ A;  1ORQ C;  4G27 B;  4JI6 B;  4LF8 B;  4NVP A;  2EIN B;  4JI4 O;  4Z2W A;  2DQ3 A;  2DWD C;  3ZED A;  2LO1 A;  2YXL A;  3SJB C;  3CCE V;  1SQG A;  4FVM A;  1XOU A;  2EIM C;  4PDR A;  5CB4 B;  2AHZ A;  2ZQM A;  5FL7 G;  3H1I H;  1M56 B;  2EIK C;  4WFH A;  1KYO F;  1NVP D;  2QDO A;  1F23 A;  3Q4H B;  3E83 A;  5EIB C;  3HKB A;  1WA8 B;  5IYC O;  2BE3 A;  4U3J B;  4BAY A;  2JJ2 G;  4O4J A;  4DYL A;  4UCT A;  1GM9 A;  2V7Q G;  2XAJ A;  2YUA A;  3K04 A;  4C7U A;  3RBZ A;  3N2K A;  2HG5 C;  4MSW C;  4PHZ A;  2K1E A;  1S76 D;  5LMU B;  4JZ2 A;  4I0X B;  4TSF G;  1KC8 W;  3EFF K;  1I0H A;  5AG2 A;  2DN9 A;  4LC1 A;  1OCR B;  1X4T A;  3ETE A;  4MVQ A;  1BGY H;  2QWP B;  1N32 B;  5FPR A;  1RM1 C;  4FM2 A;  1BS3 A;  1Q3E A;  1EZV H;  3STZ C;  4FLT A;  2VWK A;  3OEE G;  1N33 O;  5IYB O;  4QGP A;  2JEU A;  2EIL C;  2ZD9 A;  3K06 A;  4UVA A;  1SQB H;  2ZR3 A;  1IXM A;  1X59 A;  1ZL8 A;  2PGG A;  3DTU B;  3VBB A;  5IWA B;  5TIS Z;  3CJH A;  4BWA A;  4DUY O;  1GTO A;  3BY6 A;  4IHJ B;  4GCZ A;  5B1B B;  2EJ7 A;  1S5H C;  4LWS A;  4DV4 O;  1OCZ C;  4A5U B;  1PKX A;  2OCH A;  2GUZ B;  4FLY A;  3FKS G;  2WA4 A;  1I94 O;  2CTR A;  5EK0 A;  2BSK B;  2KKW A;  2Q0A A;  3N2G A;  3K0G A;  1GO3 F;  2PI4 A;  1IBK B;  1K5Q A;  3K3W A;  2P7T C;  3ETG A;  3CCQ V;  5H6Q A;  3ZHV A;  2Y69 B;  3CC7 V;  1JJO A;  3NR7 A;  5LMN B;  5GTH Z;  1KP2 A;  5J2T A;  2BTO A;  2QJ1 A;  2VQF O;  3JAM N;  4YJ3 A;  2H3O A;  2PY5 A;  3JAK A;  3WU2 Z;  3W7X A;  4DV6 O;  4U7N A;  3JD3 A;  1YDX A;  1NU1 H;  1SA0 A;  4UVC A;  3UKM A;  2QEX V;  2CAZ C;  1P49 A;  1M5I A;  4WF9 V;  1AJQ A;  1P84 F;  3CRR A;  3K58 A;  2UXC B;  2M6Y A;  3KCX A;  3CS5 A;  1SC5 B;  4BIO A;  1J5E B;  5LOV A;  2WLN A;  1F51 A;  2C2A A;  1SER A;  2X6A A;  4ZHQ A;  3E35 A;  3HKD B;  2AGA A;  4FM1 A;  2BCC H;  2ZE7 A;  4H37 A;  2Q9L A;  5L3G A;  1VIB A;  1VEW A;  5A2Q N;  1TUB A;  1YVW A;  1KU9 A;  1L0L H;  5JH7 B;  1XNR B;  3OE7 G;  3BA8 A;  4JYA B;  2NNU A;  3OMN B;  3T1Y O;  1L8D A;  2ZNI A;  4I50 A;  1DTO A;  2K9P A;  3OM3 B;  1JX9 A;  3C3T A;  1PP9 H;  3LDC A;  4DV3 O;  5FLX N;  1DF5 A;  2PF4 E;  1JOY A;  4NXN O;  4JF3 A;  1GRJ A;  4O4I A;  1QVF U;  1VQL V;  5FNV A;  2R72 A;  5IYZ A;  3QVN A;  3ZJZ A;  3K9A A;  1MSW D;  2ITD C;  4DW1 A;  4MW8 A;  3FYI B;  3RYI B;  3ZHQ A;  1AVM A;  4JI3 B;  3ZRW A;  2BOB C;  1YCI A;  3QO7 A;  1HR0 O;  2Q7G A;  1B3Q A;  5IY5 B;  5LHG A;  1MG1 A;  3ABU A;  5CN0 A;  1M57 B;  4MTG A;  4TUY B;  2AXT Z;  1KBH A;  1HW7 A;  4DUZ B;  2F23 A;  2P5O A;  3J7A U;  5L3D A;  1PM9 A;  4NB5 A;  3DC6 A;  2KSD A;  3ABL B;  2OIG A;  3OTO O;  1FFX A;  1A32 A;  3O9O A;  4P30 A;  1K33 A;  4AQY B;  2YSU B;  2HLD G;  1BQZ A;  3L71 H;  3WFV A;  2JIZ G;  1B06 A;  4X89 A;  3ICX A;  3BCC H;  1YZB A;  2MW2 B;  3LDD A;  1M9N A;  2YIA A;  2DMX A;  4EB6 B;  4K3A A;  1Y74 B;  3ZN0 A;  1AI7 A;  4WBN A;  1HNW B;  3P32 A;  2F4V O;  2WAM A;  2WLM A;  4LFA O;  2EBO A;  3RT3 C;  3E86 A;  4X88 A;  2OYQ A;  1NTK H;  2LJ2 A;  3AG4 C;  4JI8 O;  2IJH A;  1NQT A;  4J41 A;  3OW2 U;  4P9O A;  1WJZ A;  2W6I G;  3H9V A;  5B5E Z;  1QCE A;  2B1I A;  4GKK O;  4UV8 A;  4HZ3 A;  4ZIB A;  3QO5 A;  3CRA A;  2HP8 A;  3K08 A;  1IUR A;  3CMA V;  1YTF D;  3BFR A;  2WLL A;  4IL6 Z;  5LL6 Y;  4ZBM A;  1IZ3 A;  1OCC C;  1M90 W;  2CDY A;  1MZE A;  4TV9 A;  3VQV A;  4LF5 B;  1HNX B;  3W7S A;  2ZXW C;  4KXR A;  4F4L A;  2RQ6 A;  3ZHT A;  3AG1 B;  3X2Q C;  3SR2 C;  4DV5 B;  1L0N H;  1NBM G;  4N23 A;  3B09 A;  5L3C A;  1R3J C;  3RYH B;  4XDL A;  1ZWI C;  1Q6U A;  5JQG A;  1FXH A;  2ODM A;  2B1G A;  1D2D A;  1LNQ A;  2OTL V;  1B6Q A;  3B4S A;  4DR5 O;  2Y48 A;  3AG2 C;  1QHT A;  1PNM A;  2CGN A;  4MVS A;  4LFB B;  1ENV A;  5EBL C;  4LFC B;  2UXB B;  5LGN A;  2PYL A;  4YIO A;  4NR1 A;  1Y4M A;  3G67 A;  5BZB A;  3H1L H;  5K1P A;  4DO2 A;  2IJI A;  3CX5 F;  3ASO B;  4DW0 A;  3DC5 A;  3B2E E;  5LYJ A;  1VQP V;  1XQ8 A;  1FS0 G;  3J81 N;  5CA1 B;  2NLJ C;  2A3Q A;  1TGO A;  5KX5 B;  4X8A A;  1Q5O A;  1R1B A;  4FZ0 A;  5KA6 A;  3LSQ A;  4LBE C;  4JGS A;  3F5T A;  2NN4 A;  5LXT A;  5LP6 B;  1YI2 V;  2CE4 A;  5LHH A;  1XL6 A;  1P7G A;  4MTO A;  1VQK V;  2ZE6 A;  5LA6 B;  3ZBH A;  2D3O W;  4E2L A;  4ZI7 B;  3SYQ A;  3ZRV A;  4I9W A;  1FKA O;  4LNU B;  2HHH O;  4YIP A;  1SQX H;  3G71 V;  3QF7 A;  4UB6 Z;  4IYH A;  3DXR B;  2YID A;  5ITZ A;  3K79 A;  4BIU A;  1LUV A;  5IT9 N;  2QKC A;  3QNE A;  2XTA A;  1PL4 A;  2N74 A;  3CXH F;  4DV2 O;  5KMG B;  4DR2 O;  2ADP A;  2GSM B;  4PD4 F;  3OD4 A;  1UPG A;  1GH6 A;  5LBQ A;  1W2B U;  1QLE C;  3AG3 B;  2A0L A;  4RO2 A;  1VF6 A;  1CPY A;  3T4D A;  4QE9 A;  1N34 B;  5K1X A;  2E74 B;  2UXD B;  2GTS A;  1ROP A;  2UUC O;  1LUW A;  3L9D A;  4GUN A;  2ADQ B;  4H13 B;  2AHY A;  3T1C A;  4NTW A;  1L1F A;  1RPO A;  1FAF A;  3JAL B;  4JTC B;  4B3R O;  3I55 V;  1BCC H;  1I08 A;  4TT3 G;  1D5A A;  5CBG A;  3RWR D;  4J42 A;  1JPX A;  4GT1 A;  1WB8 A;  2A7W A;  4FIP C;  4DK0 A;  4JAU A;  3T1H B;  1SZT A;  5HFL A;  1NT2 B;  5BMV B;  4F6R A;  1VQ6 V;  5GON A;  2IU0 A;  2YXY A;  4EFB A;  2IM9 A;  1K8A W;  1AP6 A;  4YY3 B;  4LH7 A;  1KMI Z;  4DV1 O;  4TQD A;  5KAF Z;  4XDK A;  1E79 G;  4MVR A;  1SS3 A;  4J7Z A;  4LH6 A;  3PJS K;  2QWO B;  1BZK A;  1IBM B;  1AR4 A;  2DYS C;  4JI0 O;  2KG7 B;  5J9P C;  4CH5 A;  1Q6I A;  2F66 C;  4H44 B;  2P6J A;  1F4M A;  4Q20 A;  4DR3 B;  4H33 A;  4FLV A;  1Q81 W;  2HR3 A;  3K9S A;  1SF9 A;  2GDS A;  4W4L A;  4LF4 O;  2PZS A;  4DRX A;  4X1Y B;  4LF7 O;  2UUB B; 
#chains in the Genus database with same CATH homology
 4FMT A;  3HB3 B;  1NJI W;  1V55 B;  1K7D A;  2DQ0 A;  2XAG A;  4MS2 A;  4LCU C;  1EBO A;  3SPJ A;  3MD0 A;  3K0G A;  4ZKI A;  1GO3 F;  3CPW U;  3CCR V;  1K73 W;  2PI4 A;  1K5Q A;  3FB8 C;  3UM7 A;  4P9P A;  2W0F C;  2QE7 G;  2WLL B;  1OZ0 A;  3K3W A;  2WSS G;  2P7T C;  3ETG A;  5CBH A;  2ZDI A;  5H6Q A;  3CCQ V;  1YIJ V;  2F43 G;  1S0V A;  3IFX A;  3JD2 A;  2GHY A;  2Y69 B;  1F4N A;  3CC7 V;  1ARO P;  3SPI A;  1KP2 A;  1Y66 A;  4G2K A;  5L3E A;  3SPH A;  4JAV A;  1TUE B;  4UV9 A;  3T2M A;  4QE7 A;  2WLI A;  3JD4 A;  2WWW A;  3W7X A;  1K4C C;  4CBC A;  4U7N A;  3JD3 A;  5E1A C;  4MVZ A;  2H94 A;  3CP1 A;  4PA4 A;  1S72 V;  1GMG A;  3OMI B;  2X7R B;  2EIK B;  2YEV B;  4UVC A;  3UKM A;  2QEX V;  2DW4 A;  4WF9 V;  1QLE B;  1AJQ A;  1JQ0 A;  1FXK A;  1R3K C;  4MVU A;  1UJW B;  1EZJ A;  1N8R W;  3OGC C;  4KP4 A;  1WPX A;  3E8H A;  4PA9 A;  4UXN A;  5KUM A;  2X0L A;  4PDV A;  5B3S C;  2WLN A;  1NVP B;  1F51 A;  4J9Y B;  3IC7 A;  2C2A A;  2QTO A;  1SER A;  2X6A A;  3E35 A;  1GK9 A;  5IDJ A;  5CMU A;  2Q6A A;  3D36 A;  4KUM A;  3W7U A;  1SRY A;  4H37 A;  4JPR A;  5L3G A;  5B1N A;  4R8C A;  1KQS U;  1W0K G;  2KB1 A;  3ZMV A;  3A0R A;  3RVY A;  2PI5 A;  4JYB A;  1AJP A;  3OE7 G;  4QIW F;  4HYO A;  2WLH A;  3CCS V;  3X2Q B;  2NNU A;  1VQ4 V;  3OMN B;  2IU3 A;  3AG1 C;  3NXS A;  3SYO A;  2X6B A;  1DTO A;  1M1K W;  3OM3 B;  1OCR C;  2LFR A;  3G4S V;  2OCC B;  1JX9 A;  4FK5 C;  3OFN G;  5HFM A;  5LHI A;  5IYD O;  1RM1 B;  1AI5 A;  3BEH A;  3LDC A;  1NH2 D;  2QM8 A;  1DF5 A;  2ZDI C;  1I5X A;  1JOY A;  3ZIA G;  2V1D A;  1BL8 A;  1WLE A;  3E8B A;  4JF3 A;  1FXV A;  3K0D A;  2QKS A;  1Q7Y W;  2XAS A;  3ZMZ A;  2IJJ A;  1H8H G;  1QVF U;  1VQL V;  1FFT B;  3ZJZ A;  3K9A A;  2EIL B;  1MSW D;  2ITD C;  3TCU A;  2ATK C;  4MW8 A;  3FYI B;  1NR1 A;  3SPG A;  4R50 A;  1R73 A;  3WG7 B;  5GW7 A;  2A79 B;  3ZRW A;  2WLK A;  4MTX A;  2UXX A;  4JAS A;  2BOB C;  4DXW A;  2WLI B;  3R65 A;  3ASO C;  5DM6 V;  2DYS B;  3QO7 A;  4PEL A;  2DYR C;  5LGU A;  5IY5 B;  5LHG A;  3MHS C;  1MG1 A;  2EIJ B;  3ML0 A;  3ABU A;  5CN0 A;  1M57 B;  1NKD A;  4MTG A;  4N21 A;  3RVZ A;  1GM7 A;  3G6E V;  4WFA V;  1V54 B;  3JYC A;  4MVM A;  2R9I A;  3EHB B;  1JJ2 U;  3GWO A;  1DLB A;  5L3D A;  1QR9 A;  1VQ9 V;  3B8N A;  4PA6 A;  2P90 A;  3ABL B;  3KG2 A;  1CEZ A;  4FJC C;  2JJ1 G;  1AI4 A;  4P30 A;  5LGT A;  1K33 A;  1V55 C;  1YHQ V;  1P4R A;  1QLN A;  4PDM A;  2YSU B;  2HLD G;  3WFV A;  3CC4 V;  2JDI G;  2JIZ G;  4ASU G;  1CP9 A;  4X89 A;  2JK5 C;  2ZR2 A;  3F7Y C;  3I56 V;  3LDD A;  1M9N A;  1S3J A;  4XDJ A;  1PNK A;  2EIN C;  3ZN0 A;  1AI7 A;  2EZO A;  2XAF A;  1BHB A;  2JEX A;  3F5W C;  3P32 A;  4WFB V;  3TK1 A;  2EIM B;  2WAM A;  1K97 A;  3ETD A;  2HVJ C;  2WLM A;  4GX2 A;  2EBO A;  3M99 B;  2R9R B;  1NR7 A;  3E86 A;  4X88 A;  1R6N A;  2Q67 A;  5C93 A;  3CCM V;  1M56 C;  2HJF C;  3QO8 A;  1MAB G;  1JCH A;  5KA5 A;  3AG4 C;  3OEH G;  2IJH A;  1NQT A;  2Q68 A;  2Z3Y A;  3AG3 C;  3OW2 U;  4P9O A;  2IH1 C;  3ASN C;  4PDL A;  3LNM B;  2HFE C;  1VQN V;  3CC2 V;  4I5S A;  3ABM B;  1YJ9 V;  2W6I G;  1SES A;  1THZ A;  1VQ7 V;  3CD6 V;  4QNH B;  1QCE A;  2B1I A;  1K4D C;  3OUS A;  4MW3 A;  4PA3 A;  4UV8 A;  4HZ3 A;  5H6R A;  2IW5 A;  3QO5 A;  2WPD G;  3JD0 A;  3ZMS A;  1EFR G;  3ZRS A;  3E2E A;  2LFS A;  3K08 A;  4RUE A;  1I5Y A;  4WFF A;  2HKO A;  5CA3 A;  3T4Z A;  3CMA V;  2WLL A;  1QVG U;  1YTF D;  2CK3 G;  4JTA B;  1G8M A;  4ZBM A;  1OCC C;  1M90 W;  2B5U A;  1QBZ A;  3RW0 A;  3ABK C;  3CXC U;  3OMA B;  1COW G;  3W7S A;  2ZXW C;  4F4L A;  3FB6 C;  2Q69 A;  3AG1 B;  1E1Q G;  3X2Q C;  1NBM G;  4N23 A;  5L3C A;  1KP3 A;  1R3J C;  2OCC C;  4R6Z A;  4XDL A;  3ZCC A;  1ZWI C;  1W0J G;  4XBF A;  1YTF B;  3W7W A;  1FXH A;  1OCO C;  4J9Z B;  2B1G A;  3W7T A;  1LNQ A;  3GB7 C;  2XAQ A;  5CBF A;  2OTL V;  1B6Q A;  2YEV A;  4MT8 A;  4PA7 A;  3ZN1 A;  2Y48 A;  4GX1 A;  3AG2 C;  1PL0 A;  3ZMU A;  1PNM A;  3DGE A;  4MVS A;  1ENV A;  1K92 A;  5EBL C;  1DF4 A;  1NH2 B;  1Q86 W;  5LGN A;  3OR6 C;  3SYC A;  1Y4M A;  1R3I C;  1H38 A;  5BZB A;  1JVM A;  2W6J G;  4DO2 A;  1KKD A;  2H8P C;  3K03 A;  2IJI A;  1H2G A;  4U7O A;  2UXN A;  3OAA G;  3ASO B;  4FPP A;  1VQP V;  1XL4 A;  5B1A C;  1FS0 G;  2DYR B;  3SYP A;  5B1B C;  2IJK A;  3JD1 A;  1FXK B;  3E89 A;  3LDE A;  4OXS A;  3P30 A;  4WFE A;  1OCZ B;  3D3I A;  2NLJ C;  4X8A A;  1SET A;  1M57 C;  4JYC A;  4QJF B;  5KA6 A;  3LSQ A;  4GX0 A;  1HWY A;  4RUF A;  1K9M W;  4LBE C;  4P2Z A;  4JGS A;  1KD1 W;  3CCV V;  3JCZ A;  3LUT B;  3B8M A;  2ITC C;  1R3L C;  1YI2 V;  4YXW G;  3F7V C;  4GX5 A;  5LHH A;  1XL6 A;  2X6C A;  5EC1 C;  4MTO A;  1VQK V;  5DN6 G;  4RQE A;  2D3O W;  4E2L A;  3SYQ A;  1YSC A;  2Y69 C;  4I9W A;  3HPL C;  5EBW C;  3ZRV A;  4QPJ A;  2LP7 A;  3G71 V;  4KFM A;  2M7W A;  3CYO A;  4BIZ A;  1ORQ C;  4G27 B;  4BW5 A;  1GM8 A;  3K79 A;  2EIN B;  4Z1M G;  2DQ3 A;  2DWD C;  4BIU A;  3CME V;  3QNE A;  3CCE V;  3OUF A;  4UVB A;  2GSM B;  1AI6 A;  2EIM C;  4PDR A;  1VQM V;  2EZP A;  3E8G A;  2AHZ A;  2ZQM A;  1R6K A;  5FL7 G;  2OTJ V;  1M56 B;  2EIK C;  4WFH A;  5LBQ A;  1W2B U;  1NVP D;  1S77 D;  3AG4 B;  1QLE C;  5EC2 C;  2A9H A;  1F23 A;  3AG3 B;  2A0L A;  4RO2 A;  3E83 A;  3ASN B;  5IYC O;  1AJN A;  1CPY A;  4HAM A;  3T4D A;  4QE9 A;  4WFG A;  5B3S B;  1K5S A;  1G4Y B;  2Z5U A;  2OT5 A;  3ABM C;  3E8F A;  4BAY A;  2JJ2 G;  3SYA A;  2P67 A;  3ZRW B;  4R7C A;  3IGA C;  1ROP A;  1GM9 A;  2V7Q G;  3CCL V;  4MVO A;  2FTK A;  2XAJ A;  3K04 A;  5L3B A;  4RQF A;  1YIT V;  2AHY A;  3TET A;  1VQ5 V;  4QPK A;  2XOK G;  3RBZ A;  3T1C A;  1L1F A;  1RPO A;  2BOC C;  2IH3 C;  2HG5 C;  4MSW C;  1S76 D;  2K1E A;  2QM7 A;  4JTC B;  1H8E G;  1OHH G;  3I55 V;  1VQ8 V;  4TSF G;  4RAI A;  3H01 A;  1OCC B;  4TT3 G;  1KC8 W;  3ABK B;  3B77 A;  3EFF K;  4LP8 A;  5CBG A;  2HVK C;  4LC1 A;  1OCR B;  3ETE A;  1JPX A;  4MVQ A;  3LSS A;  1K34 A;  2MK3 A;  4GT1 A;  2XND G;  4JTD B;  2EJR A;  2ZXW B;  3FYE B;  4FIP C;  2DWE C;  1RPR A;  4JAU A;  1YJW V;  1RM1 C;  1SZT A;  3FB5 C;  5HFL A;  1MOF A;  1PNL A;  3AEI A;  1VQ6 V;  1J95 A;  4TWK A;  2IU0 A;  3FB7 C;  3STZ C;  5KUK A;  1K8A W;  3OEE G;  1OCO B;  1PD3 A;  5IYB O;  1QR8 A;  4WCE V;  3SJQ C;  5H9C A;  2XAH A;  2JEU A;  2EIL C;  1E1R G;  3AG2 B;  2ZD9 A;  3K06 A;  4UVA A;  1K3E A;  2ZR3 A;  4CZZ A;  4XDK A;  1IXM A;  1E79 G;  3WG7 C;  3ZRX A;  1AR1 B;  1GKF A;  5B1O A;  4MVR A;  3ZMT A;  5L3F A;  2QA4 V;  3DTU B;  3VBB A;  1BHA A;  3PJS K;  4UUJ C;  1BMF G;  2DYS C;  3ABT A;  5J9P C;  2WLJ A;  1Q82 W;  3MHH C;  3STL C;  5IY5 C;  2P6J A;  3CCU V;  2EIJ C;  1GTO A;  1F4M A;  3BY6 A;  4Q20 A;  4L87 A;  5B1A B;  1V54 C;  1P7B A;  4H33 A;  4GCZ A;  5B1B B;  1VQO V;  1Q81 W;  1YJN V;  2HR3 A;  4G28 B;  3SPC A;  3VOU A;  1FXK C;  1S5H C;  4EKW A;  1KEC A;  3OR7 C;  3CCJ V;  1OCZ C;  1PKX A;  3FKS G;  5EBM C;  3ABL C;  5EK0 A;  4MTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...