1JJ2U

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jj2U00
3G6EV 2D3OW 5DM6V 3CCUV 1VQKV 1Q7YW 1VQ5V 3CC2V 3G71V 2QA4V 3I56V 2OTLV 3CCJV 1VQ7V 3CCSV 1YIJV 1NJIW 3G4SV 1VQLV 3CCVV 1JJ2U 1YITV 3CCEV 1KC8W 1YJ9V 1KQSU 2QEXV 1KD1W 2OTJV 3CCLV 1Q82W 1Q86W 1R73A 4WFBV 3CD6V 1N8RW 1VQMV 1YI2V 1QVGU 1K9MW 1VQNV 4WF9V 1K73W 3CMAV 3CC7V 3OW2U 1VQOV 3CCRV 4WCEV 1QVFU 1YJWV 1YJNV 1M90W 3CCMV 4WFAV 1VQPV 3CC4V 3I55V 3CPWU 3CXCU 1W2BU 1YHQV 1VQ8V 1S72V 1VQ9V 3CCQV 1VQ6V 1Q81W 1M1KW 3CMEV 1K8AW 1VQ4V
chains in the Genus database with same CATH superfamily
1EFRG 1G1XB 1WPXA 4JYCA 1NR7A 1TUBA 4TUYB 3TETA 3H1LH 1J5EO 5CMUA 1Y76A 3UT5A 4X64B 4MVRA 2V1DA 4J7ZA 4AHCA 1X59A 4IGGA 3GB7C 1NTZH 2VWKA 4AQYO 4LH7A 3ABTA 4L8JA 4JI4B 3MAQA 4DK0A 4CH3A 4B3SB 1N32O 5LP6B 4DR5O 3CXHF 4J42A 5LGTA 2M6YA 1Q86W 5FL7G 2OIEA 5L3FA 3RWRD 4I7ZB 3B40A 5BR8O 1ROPA 2N05A 3JSLA 1WJZA 5EYPB 4NXMB 1R6TA 4KHPO 5LHGA 2XASA 4DV7O 5KHHA 3AK2A 1XEQA 3LDEA 1YJ9V 3L9DA 4U7OA 1KQSU 3CCLV 1AR5A 1Y67A 2WAMA 4WCEV 2H3OA 5KAIZ 4PA9A 1PL4A 3CX5F 2EZOA 2EIMC 5BMVA 4J9YB 4GKJB 4U3FH 4GX5A 4DR7O 1KBHA 3RYFA 1XNRB 4X1KA 5BZBA 5CA3A 1MMMA 1DLBA 2AW9A 3RYIA 1VQ7V 1EBOA 2QWOB 2P7TC 3KCXA 3U11A 2AXTZ 1HW7A 2EZPA 3F5WC 4QPJA 1Q82W 1YI2V 4GX2A 1FAFA 1ZSPA 1SA0B 4XDKA 1VQPV 4OPHA 2Y69C 4MTOA 3OUFA 3P30A 3JARB 3ZRWB 1NU1H 1NH2B 3ZHQA 4DR4O 3SPHA 3CP1A 2A3QA 4H44B 3CCJV 5EBLC 4UV8A 3HR0A 4G28B 3SPIA 3ASOB 4YY3B 5KX5A 3BAAA 3HPLC 2ZINA 4H13B 4RUEA 2LW1A 3ZCCA 1HWYA 4DV2B 4D6TH 1B3QA 5EZYB 2ZD9A 3N2GB 2Q69A 4UV9A 4YHHB 3TCUA 1K5QA 4FPPA 4MT8A 4NR1A 4I5SA 5EK0A 2ZXWB 3CJHB 4DRXA 4LFCB 5EIBC 2Y4UA 1QVFU 2EIMB 2P22C 4Z1MG 3L71H 3K5OA 5KMGA 1XMQO 5B1BC 5LP6A 1COWG 3OM3B 4P9PA 4UVAA 4LF4O 2F4VB 1NR1A 1RP3B 2HLDG 4F6EA 3ABMC 1YITV 3D3IA 3JAMN 3ZMTA 1AI5A 4E2LA 1I7FA 2DN9A 2CTPA 1MNGA 5LA6A 4JI5O 2ZNJA 3WG7B 2UXCO 1HNWB 1QQCA 1SQQH 5B1OA 4DV4B 3C3TA 2JGDA 1VQ6V 3FAVA 3QO5A 1QHTA 4DV6O 3L74H 2EILC 4NTXA 4N21A 2FTKA 3CD6V 5LHHA 1YXBA 5KUKA 4X1YA 1YJNV 1W0JG 1J95A 3BCCH 2ZT9B 3AK3A 4TV8A 4JI3O 3FKSG 4LH6A 5E1AC 2PI5A 3OR6C 2X6CA 1HP8A 2GTAA 3ZRVA 1QLEC 1WNSA 2CUGA 4BIZA 4D7TA 3K0DA 3X2QC 2B9ZA 5IJ0B 3CMAV 2JS5A 2EULA 4PJ0Z 1P4RA 2YUAA 3W7UA 1OV9A 5B1BB 4NVPA 5B66Z 5CA0B 3NR7A 1TA8A 1U97A 3AG3C 3BHPA 1AR4A 2R9IA 1N0NA 2RDCA 3UO2A 2GDSA 4JI2B 1JFFA 3FD9A 3K9SA 4JYAB 1R1BA 4JPRA 3UM7A 1I5XA 1ENVA 1F51A 1JVMA 4DR3B 4FFBA 4UUJC 2Q68A 1XNQO 4RQFA 2P4KA 2Z3YA 1XDCA 3BA9A 2EINC 1OJHA 3H1JH 1VQ5V 1Y66A 1BQZA 2EILB 4DV5B 3L73H 1GO3F 3RGBA 4IIJA 1NQTA 4IL6Z 4MVOA 4TT3G 3WB2A 3B8MA 1WN7A 3APQA 5H6QA 2QTOA 3HB3B 1M56B 4P2ZA 3QO7A 4PA6A 1MSWD 4LF9O 1RM1C 3JATA 4I55B 1D5NA 1QU7A 3D36C 2XAFA 1S5LZ 4TV9B 3STLC 1GM7A 1KC8W 1DF5A 2B5UA 3E22A 1AJPA 1E1QG 4K0KO 3SJQC 2AZ0A 3ASNB 2IM9A 3B09A 3R66A 1N0JA 3TGUH 2CH7A 5LYJB 1S77D 1BZKA 4NKGB 4ZI7A 2NNUA 3NXSA 3OMNB 1XMOB 5GONA 1HNZB 2A79B 4TQFA 1VQLV 3PJSK 4X66B 4O4IB 2DW4A 4J11A 5B3SC 2PF4E 1B6QA 2W0XA 3HKCB 4UCVA 2BTOA 5JJJB 2PY5A 1AVMA 4EB6B 4GT1A 1F4MA 1G6UA 2LO1A 1OZ0A 3GWKC 4UB8Z 2EINB 4FIPC 2CDYA 3SDLA 4X1IA 2AZ2A 3RYCB 3FYEB 4BR6A 5HFMA 4O4HA 5BY1A 4MVZA 4U3JB 3QTCA 3W7TA 4B3RO 2LW7A 3OTOB 3SR2C 4OXSA 2DWDC 2P5OA 1JQ0A 2P4VA 3IFXA 4Z2WA 1N33B 3LUTB 4HAMA 1JX9A 2PI4A 2JGUA 2UUCB 4W4LA 2X6AA 1IXMA 1XHXA 1YTFB 1WPBA 2WLHA 1HR0B 2FMLA 4DV3O 1R6KA 3BPZA 1H2SB 2DMXA 4K35A 4JAUA 3ABLB 4DV0B 5C8YA 3MHHC 4QPKA 1GN3A 4ZKIA 4YJ2B 4DR2O 2WLIA 3EXAA 2X7RB 1EN5A 2CTQA 3SYQA 2KQXA 2R72A 2IJKA 3SYPA 5B3SB 4LWSB 2ILMA 1N36B 3SYCA 1NVPD 1RFYA 2WLLA 2XUMA 4X20B 1MA1A 4NB5A 1FD9A 2BSKA 3OGCC 1V54B 4R6ZA 1D5AA 4GX1A 2ZKOA 4KFMA 3SYAA 2E5LB 1BHBA 4YXWG 2OCCC 1SS3A 2PZSA 1PL0A 1PM9A 3N2KA 4GZRB 2YEVA 5K1XA 4ZHQA 4MTFA 5JH7B 5JCOC 3CEIA 3OT7A 1VQOV 2CGOA 4LF6B 1ZL8A 4IT5A 2UU9O 4QIWF 4G2KA 1NTMH 4LR3A 4EFEA 2YIAA 2VQEO 2VS0A 3DC5A 4PA4A 1B06A 4I9WA 1Q6HA 2EIJC 5JJEB 5B5EZ 1MABG 3HKCA 4X62B 4WFBV 4FM2A 4JYBA 2HHHO 3K08A 2YXHA 1YJWV 2Q7GA 4G27B 2QM7A 4X65B 3JSNA 4TSFG 1ORQC 4CH4A 3RYCA 2UXXA 5LL6Y 1CXZB 3BFRA 1N34B 4FLZA 2KG7A 4LFAB 5IYZA 3H9VA 2XHBA 1RSOA 1GH6A 2V4DA 1G4YB 4I9QA 3CRRA 3M99B 4O2BB 3E35A 3D36A 4X64O 4DO2A 2UUAB 1LUWA 1VQ4V 4K8ZA 4WFHA 3CC2V 4RWUA 3CCSV 1US6A 1Q6UA 3CSXA 5KHIA 4I4TA 1XI1A 4JI4O 1H2KA 2QR4A 4OPAA 1VQMV 4B3SO 3HKEB 3OW2U 1BQ0A 1S5JA 3BEHA 3WB1A 2LQTA 3CRMA 5CBGA 4LF5B 1BT8A 2YS8A 1Q81W 4I50A 1IZ3A 3ZHUA 1FJGB 4DW0A 4NXNB 1GN6A 3DXRA 2VQFO 4RQEA 1O9GA 3E86A 3APOA 3TJTA 1H2GA 3JALA 4H0LB 4W4KA 4DUYB 2JEXA 1YSCA 1CP9A 4X8AA 3H1KH 3CCQV 3THOA 1QNMA 3K5NA 3RVZA 3LNMB 1AR1B 2VWJA 2ZDIC 1VQKV 3JAWA 2LGQA 1YDXA 2ZCEA 5JVDB 1GN4A 1GM8A 4O4JB 2ADPA 3IAYA 1E1RG 5JQGA 4KXRA 4LP8A 2JJ2G 3CCMV 4JI7B 1NKDA 1L8DA 4CS3A 4J41A 1DK1A 3KCYA 4L87A 5IWAO 1V9PA 1H8EG 4UVCA 4E4EA 4PI0A 2QE7G 2X6BA 2FB5A 4JI1B 1K4CC 3T1YB 4HNAB 3HKBB 1VP7A 3ASOC 4FMTA 1ZAUA 2DYRB 2WA3A 2UXDB 1S72V 2WLJA 5L3DA 4F6RB 1RPOA 1GTOA 1H2MA 4MS2A 2JDIG 4DV2O 2IU3A 2OYQA 4AILC 4DUZO 3RW0A 3ETQA 4YHHO 3JD4A 2ZXWC 3UKMA 3OE7G 4JI8B 1WLEA 3HKDB 4DV1O 5GTHZ 4O4LA 1OCZC 3ETEA 4IHJB 3M7MX 3FB7C 2RJZA 4EEQA 4LF8O 2QWQB 3ZX6A 1N8RW 5A9GA 4JASA 1VQNV 1EN4A 1R3LC 1OCRB 4JV5O 3WG7C 1URFA 1TVKB 5IYCO 1J5EB 5CA1A 5ITZB 2XAHA 4YJ3A 1AJQA 2BTQA 1SQBH 2ETNA 3IGAC 4DV4O 4JGSA 1F7YA 3AG7A 3ZS8C 4AQYB 4B3TO 3N27A 1JMKC 1SQXH 1KP2A 4DR6B 3FB8C 2DYSB 3P32A 1N32B 4MSWC 4WFEA 3MD0A 4DR5B 1KB9F 3B77A 1YHQV 3IJ4A 3E2EA 2QKSA 2XTAA 1YVWA 4TUYA 3H1HH 5KHKA 4KHPB 2IJJA 3JASB 3TK1A 1NZ6A 3W7SA 1OCZB 5CB4B 2CE4A 3W7WA 2A06H 3RYHB 4PD4F 2XAQA 1EZVH 1VF6C 1V55C 5DN6G 3LDDA 4PHZA 2ZE6A 2QSAA 4DR7B 3OGIB 1I08A 1IBLB 5FLXN 1WA8B 3I55V 3AK1A 5EYPA 1L0NH 2BOCC 2XAGA 3K0GA 2D3OW 3ZMSA 2E3CA 4DR3O 2XAJA 3P3NA 1Y4MA 1IBKO 3K57A 2Q9LA 5L3CA 3H1IH 5LMNB 4IYHA 2YI9A 4NTWA 3L72H 2FYUH 4PDLA 2JJ1G 4UB6Z 1PV0A 1HNXB 2UXNA 3A2FA 2ZDIA 1M56C 1VEWA 4C7UA 1BSMA 5H5NA 3JAKB 3JD1A 1Q7YW 1PKXA 1KMIZ 2CTRA 3GWOA 2Q67A 3BA8A 1AILA 4B7EA 1K34A 2R9RB 1R73A 3STZC 4MTXA 4EFBA 1SA0A 3FX7A 1B04A 4WFAV 3JARA 3ASNC 4P30A 2K9PA 5LBQA 3ZRWA 1K33A 4F4LA 4PDVA 3ZHVA 3CCUV 4FLUA 2PGGA 3T1HB 2W6JG 1V55B 1NT2B 3I5DA 1E79G 1LNQA 1FXKC 5CN0A 3VOUA 4CS4A 2YDEA 3F7VC 2B1GA 4EKWA 3LNNA 4H37A 1WP7A 1KUQA 1M4UA 1XMQB 1DGSA 5CBHA 4LF4B 4X88A 1HNZO 1XBLA 2YSUB 5J2TB 5EZYA 3N2GA 3WU2Z 5LGUA 3K9AA 3QVNA 5EC1C 3OD4A 4X89A 1AI4A 3A0HZ 1KU9A 2GUZB 3SJBC 3H01A 3ML0A 5LOVB 2HG5C 2OWOA 2H8PC 3CJHA 3DTUB 1SZXA 1XHZA 1FFTB 2ZE8A 3OTOO 3O65A 3EVKA 2WLKA 2ITDC 1AB3A 2MK3A 5LMUB 2W0FC 4MW8A 1N33O 4FZ1A 4JI3B 2AHZA 2QM8A 1QVGU 5H9CA 1P7GA 2QM4A 5GW7A 4JI6O 3ABLC 4JZ2A 3T4ZA 1N4CA 4JI0B 1FXKB 4B3MB 1ZWIC 1GK9A 4MVQA 1I94B 3B2EE 5FPOA 2HKOA 3LDCA 4PDRA 2EBOA 4R8CA 3AG1C 1RPRA 1YEWA 3TXSA 2Q7EA 1FS0G 4K8XA 1T5EA 1Q43A 4JTCB 1V54C 4ZOLB 5DM6V 2N04A 5C93A 2P06A 1SQFA 3K3WA 5L3EA 2UUBO 1XNQB 3JCUZ 4UFZA 2Q7HA 4WFFA 4LFBO 1FXHA 5IJ0A 4P9OA 1NI8A 3OEEG 5EIBD 4WFGA 4N23A 1JCHA 4FK5C 5LXTB 4DR1B 1VF6A 5CA0A 4UXNA 4TWKA 1UFIA 2L35A 1KKCA 3MHSC 2PYLA 3UCSC 3VQYA 3IC9A 4LF9B 2Q0AA 2HJFC 1FFXB 1IBMO 3M8AA 3CRCA 5LHIA 1L1FA 3LSQA 1SQVH 1Y74B 3CE2A 3BY6A 3AG2B 4K0KB 4BAYA 3ZRSA 4CZZA 2RMKB 2OCHA 1LR1A 2HEPA 3ZMVA 3AG1B 5IJ9B 4TQDA 5KHGA 2GSMB 1GMGA 3J81N 3CHXA 2JK5C 2Y0PA 3CPWU 2PUSA 2AHYA 4U7NA 3C90A 1R6NA 2QWPB 1OHHG 4I55A 1TAEA 1Q8IA 4O2AB 4XDLA 4TV9A 3DSQA 1M5IA 3VQWA 1OCCB 2UUAO 4DXWA 2ZM6O 3OTFA 1NTKH 5JJNB 3MDSA 1H2NA 4CS2A 2HR3A 3OR7C 1VIBA 4WBNB 1BMFG 4GYCB 5LYJA 2NLJC 3RBZA 3ZJZA 1M1KW 4J10A 4PDMA 3ETDA 4B3RB 4DW1A 5L3BA 3SPJA 1IURA 1H38A 1GRJA 1TUBB 4UCRA 3ZMZA 4BW5A 4I0XB 4LF5O 3ZEDA 4O4IA 3UO3A 3CCEV 4NTYA 1HDJA 2GV9A 1Y76B 1OCOB 2B1IA 3UT5B 1VMGA 4EB6A 1FJGO 3PN1A 3CC7V 4BW9A 3KZIZ 1MZEA 1K5SA 4TOIA 4YIOA 1VQ8V 4DV3B 1K7DA 5FNVB 3CRAA 5IDJA 2F1MA 5IYBO 1IX9A 1ZUQA 2IJHA 1I5YA 2BOBC 4U3JA 3L70H 5IE9A 3RVYA 4DR2B 3D3QA 3RN4A 2A0LA 5LXTA 1VF5B 4J7JA 1G8MA 2WPDG 5K1PA 1A32A 3G71V 4JI7O 4PA3A 3OMAB 1XREA 5KAFZ 2R9AA 2RNBA 2ZIOA 4DK1A 1P7BA 2ZR3A 4HYOA 1SRYA 5EBMC 4JI1O 3T1YO 2CGNA 2DYRC 3OFNG 5BMVB 1VQ9V 1M57C 3C3SA 4YJ2A 3AEIA 3RYFB 4OGQB 2EJRA 4X1KB 4UCSA 2BE3A 3RYIB 2FL4A 2UXDO 2UU9B 4LWSA 5JWPA 4NXMO 4JYYA 3F5TA 3SPGA 3A8TA 3ABKB 4UCTA 4X20A 1AI6A 1NS1A 3K5LA 4QJFB 3J80N 3K03A 4LNUB 2QGNA 3QF7A 5GTIZ 4FFKA 2UXBB 3E8FA 1XQ8A 1JJ2U 3JYCA 3K79A 2YIBA 5KX5B 4GKJO 5JH7A 2QKCA 1XNRO 3SYOA 1K73W 1EN6A 2W6IG 2ZNIA 1K4DC 3D8CA 2P90A 1OCRC 1GAXA 1IVSA 2JEUA 1MSDA 1F23A 1VARA 2ARHA 4I0XA 5DECA 1O9HA 2CTWA 4Q6GA 1PNMA 4D7SA 1KYOF 3G80A 2D2CB 3K59A 1K9MW 4DRXB 3J7AU 2QKAA 3ZHTA 4CH6A 1NBMG 2HJDA 1BCCH 1M57B 2DYSC 4YY3O 2F66C 5FNVA 1VF7A 5KMGB 4DR6O 4LF7B 2GBOA 3S3XA 4LC1A 2Q6AA 3VBBA 3EFFK 1W0KG 3W7XA 5LA6B 4O2BA 5IY5B 4ZBMA 2JGDB 2P6JA 2VQFB 3K58A 2LJ2A 1XL6A 5FPRA 3FAVB 5KLVH 4LFCO 4PI2A 1YIJV 4GKKB 4UCUA 3LSSA 1GM9A 5JCOA 4FLXA 2JVDA 1CPYA 3WB0A 2F93B 4OX9B 1SC5B 1Z5VA 3HKEA 2F4VO 4FM1A 4X1YB 1R3KC 2EIKC 4BWAA 5J9PC 1PNLA 4TV8B 3VQXA 4FM0A 2ZR2A 2IU0A 2WA4A 1IBLO 1HNWO 2CK3G 4CC5A 1AP5A 4ABMA 2LFRA 2WSSG 3FB6C 4H33A 1Y6XA 2ZQMA 4JAVA 3CB2A 3RFRA 3GVMA 5E79Z 5IWAB 1XL4A 4Z1VA 4QGPA 4LNUA 4XBFA 5LMNO 3JD2A 2IJIA 3SPCA 5D5QA 4B7KA 1NJIW 1HNXO 2DQ0A 1M9NA 3ZRXA 2YI8A 2WWWA 1XILA 1AROP 3CS5A 5JVDA 2EJ7A 5BR8B 2O57A 4O4JA 1JFFB 2MW2B 1UJWB 1AJNA 2ZE5A 2IW5A 4DV7B 1F4NA 4DUZB 1S0VA 4UCOA 4FFBB 5B1NA 1SETA 1QBZA 1JA8A 1SESA 1JJOA 1M93A 5J2UB 4DV1B 4HNAA 4IIJB 3A0RA 3AG4C 3B8NA 3HKBA 3U0ZA 1WB7A 3T1HO 4QNHB 1BGYH 4LF8B 2EIKB 5L3GA 3CC4V 1U96A 3SGIA 5BXZA 3P3PA 4HBNA 4JI2O 3JATB 4JYAO 4F6RA 2M7WA 3ZBHA 1P49A 2Q8VA 1K92A 2IH1C 2DJVA 3ZN0A 4JV5B 2YICA 3SJCC 2HVJC 4GCZA 2KB1A 3E22B 1X4TA 3U10A 2XNDG 2Y69B 4DR4B 2YIDA 4MVUA 3CCRV 1JR9A 2Z5UA 2V7QG 5EBWC 4DV5O 3HKDA 2E75B 2CH7B 4IHJA 2AGAA 4B3TB 4RO2A 3WFVA 4ZI7B 1SQGA 1SQPH 2YXYA 4JTDB 1K97A 2QWRB 1TGOA 1FXVA 5GONB 5A2QN 2IH3C 2A7WA 1IXBA 2OTJV 3F7YC 3K04A 5LMUO 2FKXA 1P84F 1TVKA 5B1AC 4JZGA 5ITZA 4MVMA 4BIOA 1H8HG 4X1IB 5AG2A 1R3JC 2OT5A 2QA4V 2LGWA 4O4HB 2ITCC 3AG4B 3CCVV 1NH2D 4FLVA 2QEXV 4JI0O 4B08A 1R3IC 3S3WA 4B3MO 3B4SA 1XMOO 2F23A 2IBZH 1I94O 4X66O 1SKVA 5EC2C 4LCUC 3G6EV 3ABMB 5KHJA 1PP9H 3BABA 3L75H 4JI5B 5KA5A 2UXCB 4JTAB 2XT9A 3K06A 2JRIA 1QR9A 3EHBB 1PPJH 1GN2A 3JASA 4J7KA 3O9OA 4KUMA 2ODMA 4K3AA 2Y4TA 5CB4A 1IBKB 4DV6B 3G67A 1H2LA 3Q4HB 3RYHA 2YC0A 5C8YB 2OIGA 2QJ1A 2CAZC 1QCEA 2Q73A 2WLIB 4MW3A 5J2UA 2RQ6A 1JPXA 4DR1O 1NVPB 3T4DA 5CBFA 2F43G 2Q4PA 4AI8A 2WLLB 3G6BA 2UUCO 2Y48A 1WA8A 5B1AB 2BSKB 1HR0O 2PYJA 1QLEB 3JD3A 3E8GA 2E74B 1AP6A 3AG2C 1TUEB 1YCIA 4DV0O 3OAAG 3X2QB 3N2KB 2YEVB 1LUVA 4ZHQB 3ZHRA 1AI7A 3QO8A 1D2DA 4PV1B 1Z5WA 1K3EA 1ZL8B 1UPGA 4RUFA 3ZN1A 3JAKA 1N36O 3AG3B 1SERA 1BL8A 3RT3C 2P67A 4LBEC 2QTSA 2NN4A 3CWBH 3QNEA 1L0LH 3DGEA 4KL1A 2DQ3A 2GHYA 2E5LO 1OCCC 4CC6A 3KKYA 2ZE7A 3OUSA 3SJAC 1QLNA 1W59A 3JCZA 3E8BA 3KG2A 1SF9A 3CMEV 3ABUA 4FVMA 2HP8A 1KECA 4LF6O 2OTLV 1IDSA 2KSDA 4ASUG 2KG7B 5IYZB 5KUMA 3ZHSA 4GLXA 1MG1A 1RSOB 3ZMUA 1RM1B 1OCOC 4QE7A 5J2TA 3CRQA 5IT9N 2C2AA 1Z2GA 4X62O 2HVKC 4ZIBA 3A0BZ 2Z0AA 2GUZA 4A5UB 4DYLA 2N74A 5LOVA 4X65O 4JI6B 4I4TB 2GTSA 4ICGA 1KKDA 3T1CA 2YXLA 2G38A 4BIUA 1BHAA 1Q5OA 3JD0A 5DEDA 1N34O 3Q4HA 1MZFA 4LFAO 1S5HC 4Q20A 4I50B 1Q3EA 1GKFA 4MVSA 3DXRB 4UVBA 4GUNA 1XOUA 3FB5C 1Q6IA 2DWEC 2RN9A 1M90W 3JALB 2H94A 1W2BU 2BCCH 2UUBB 4PELA 1DTOA 2E76B 3IC7A 3OEHG 1FXKA 5H2FZ 4LFBB 2ATKC 1WP8A 3JAWB 1WAZA 1BS3A 3VQVA 1YZBA 1ZLZA 1FKAO 4FZ0A 4GX0A 4RAIA 1SZTA 3ICXA 5JQGB 5D5PA 4NXNO 1FYJA 3ABKC 4X9QA 3CXCU 3TXQA 5F2VO 2K1EA 1IBMB 1K8AW 4ZOLA 4QE9A 1S76D 1THZA 4FLWA 2DE0X 2JIZG 1EM1A 2L6LA 4PA7A 4DUYO 3DC6A 3FYIB 1PNKA 1KD1W 2X0LA 5HFLA 5H6RA 4R50A 1DF4A 2EX3A 2UXBO 4CH5A 4JF3A 1QR8A 4FLTA 4J80A 4MTGA 3QG5A 1FPOA 3ZIAG 1JOYA 3OMIB 2DOSA 3R65A 5IYDO 2WLNA 4KP4A 5KA6A 1FFXA 5TISZ 2JS3A 3E8HA 3CYOA 1YTFD 2A9HA 2Q5ZA 4WF9V 3FFQA 2ADQB 2RCVA 1Y74A 2NR5A 4O4LB 2ZM6B 2OCCB 1MOFA 1EZJA 2VRZA 3I56V 1CEZA 4HZ3A 1S3JA 2QDOA 3UQ8A 5LP6C 2WLMA 2Y0IA 4CBCA 3BVOA 3BRCA 4R7CA 4YIPA 1ZTEA 5IJ9A 3K5MA 1ZX3A 4LF7O 2VQEB 3ETGA 1KP3A 1BE3H 1Q90D 3E89A 3LSUA 2F95B 2Q0OC 3T2MA 4FJCC 1YF2A 5CA1B 4O2AA 1I0HA 2KKWA 5IY5C 2HHHB 1PD3A 2EIJB 4IYIA 2BTQB 4YJ3B 4JI8O 3G4SV 2LP7A 2PTMA 1WB8A 4XDJA 5LGNA 4NYKA 4JAAA 2LFSA 3E83A 4GKKO 2YIBD 2HFEC 4WBNA 4J9ZB 2ZIMA 1XUQA 2XOKG 4FLYA 2QWNB 4OX9O 2R70A
chains in the Genus database with same CATH topology
1EFRG 5B1NA 1WPXA 4JYCA 2WLKA 1BHBA 2ITDC 1SETA 2MK3A 4YXWG 1NR7A 2OCCC 1QBZA 3TETA 1SESA 2W0FC 1PL0A 4MW8A 2YEVA 5CMUA 3A0RA 4MTFA 2AHZA 3AG4C 3B8NA 4MVRA 2QM8A 4QNHB 2V1DA 1QVGU 5H9CA 1VQOV 2EIKB 5L3GA 3CC4V 3GB7C 4QIWF 4G2KA 5GW7A 3ABLC 3T4ZA 3ABTA 2M7WA 1FXKB 1K92A 2IH1C 3ZN0A 4PA4A 1ZWIC 1GK9A 4MVQA 4I9WA 5LGTA 2EIJC 2HVJC 4GCZA 1MABG 1Q86W 2KB1A 2HKOA 4WFBV 3LDCA 4JYBA 4PDRA 2EBOA 4R8CA 5FL7G 2XNDG 2Y69B 3K08A 3AG1C 5L3FA 1RPRA 4MVUA 3CCRV 1YJWV 2Z5UA 2V7QG 5EBWC 4G27B 2QM7A 1FS0G 1ROPA 4TSFG 1ORQC 4JTCB 4RO2A 3WFVA 1V54C 5DM6V 2UXXA 5LHGA 5C93A 2XASA 4JTDB 1K97A 1FXVA 3K3WA 5L3EA 2IH3C 3LDEA 1YJ9V 4U7OA 1KQSU 2OTJV 3CCLV 3F7YC 4WFFA 3K04A 1FXHA 4P9OA 2WAMA 4WCEV 3OEEG 4PA9A 1G4YB 4WFGA 4N23A 3M99B 1JCHA 2EZOA 2EIMC 4FK5C 5B1AC 3E35A 4J9YB 3D36A 4DO2A 1VQ4V 4GX5A 4UXNA 4MVMA 4TWKA 1H8HG 5BZBA 5CA3A 1R3JC 1DLBA 4WFHA 3CC2V 2OT5A 2QA4V 1VQ7V 3CCSV 3MHSC 1EBOA 2P7TC 3CCVV 2ITCC 3AG4B 1NH2D 2EZPA 3F5WC 2QEXV 4QPJA 2HJFC 1Q82W 1R3IC 1VQMV 1YI2V 4GX2A 3OW2U 3BEHA 4XDKA 5LHIA 1L1FA 1VQPV 2Y69C 3LSQA 5CBGA 4MTOA 3OUFA 3P30A 5EC2C 4LCUC 3ZRWB 1Q81W 3BY6A 3G6EV 1NH2B 3SPHA 3AG2B 3ABMB 3CP1A 3CCJV 5KA5A 4BAYA 5EBLC 4JTAB 4UV8A 3K06A 3ZRSA 4G28B 3SPIA 4CZZA 1QR9A 3ASOB 3EHBB 3ZMVA 3AG1B 3HPLC 4RQEA 4RUEA 3E86A 4KUMA 3ZCCA 1HWYA 2GSMB 1GMGA 1H2GA 2JK5C 3CPWU 2JEXA 2AHYA 4U7NA 1YSCA 1CP9A 2ZD9A 4X8AA 3CCQV 1R6NA 3RVZA 3LNMB 2Q69A 1QCEA 4UV9A 1OHHG 2ZDIC 1AR1B 3TCUA 1VQKV 2WLIB 4XDLA 1K5QA 4MW3A 4FPPA 4MT8A 4I5SA 1JPXA 1OCCB 5EK0A 1NVPB 3T4DA 4DXWA 5CBFA 1GM8A 2F43G 2ZXWB 1E1RG 4LP8A 2WLLB 2Y48A 2JJ2G 2HR3A 3OR7C 1QVFU 3CCMV 2EIMB 1NKDA 5B1AB 1BMFG 4Z1MG 2NLJC 3RBZA 3ZJZA 1M1KW 4PDMA 3ETDA 4L87A 1QLEB 3JD3A 5B1BC 5L3BA 1COWG 3OM3B 1H8EG 4P9PA 4UVAA 4UVCA 3SPJA 3E8GA 1NR1A 2QE7G 1H38A 2HLDG 4BW5A 3ZMZA 2X6BA 3AG2C 3ABMC 1YITV 1TUEB 3D3IA 3CCEV 3OAAG 1K4CC 3X2QB 3ZMTA 1AI5A 2YEVB 4E2LA 1OCOB 2B1IA 3ASOC 1AI7A 3QO8A 4FMTA 3WG7B 3CC7V 2DYRB 1K5SA 1K3EA 5B1OA 1VQ8V 1S72V 2WLJA 4RUFA 3ZN1A 1VQ6V 5L3DA 3AG3B 1SERA 1K7DA 3QO5A 5IDJA 1GTOA 1RPOA 1BL8A 4MS2A 5IYBO 2JDIG 2IJHA 2P67A 4LBEC 2IU3A 1I5YA 2BOBC 3RW0A 2EILC 3QNEA 3DGEA 2DQ3A 2GHYA 4N21A 3JD4A 2FTKA 3CD6V 5LHHA 1OCCC 3RVYA 5KUKA 2ZXWC 3OUSA 3UKMA 1QLNA 1YJNV 3OE7G 1W0JG 2A0LA 3JCZA 1WLEA 1J95A 3E8BA 1G8MA 1OCZC 2WPDG 3ETEA 3FKSG 3KG2A 5E1AC 3FB7C 3CMEV 3ABUA 2PI5A 3OR6C 1KECA 3G71V 2X6CA 2OTLV 3ZRVA 4PA3A 3OMAB 1QLEC 4BIZA 4ASUG 1P7BA 5KUMA 1MG1A 1N8RW 2ZR3A 4JASA 3K0DA 4HYOA 3X2QC 1VQNV 1SRYA 3CMAV 5EBMC 3ZMUA 1RM1B 1R3LC 1OCOC 1OCRB 4QE7A 1P4RA 2C2AA 3WG7C 3W7UA 2DYRC 3OFNG 1VQ9V 5IYCO 5B1BB 1M57C 2HVKC 3AEIA 2EJRA 2XAHA 1AJQA 3AG3C 3IGAC 2R9IA 4JGSA 1KKDA 3SPGA 3T1CA 4JPRA 1KP2A 1I5XA 3UM7A 4BIUA 3ABKB 1BHAA 1AI6A 1ENVA 2DYSB 1F51A 3FB8C 3P32A 4MSWC 4WFEA 1JVMA 3JD0A 3MD0A 3B77A 4QJFB 1S5HC 3K03A 4UUJC 1YHQV 2Q68A 4RQFA 3E2EA 2Z3YA 4Q20A 2QKSA 2EINC 1VQ5V 1Y66A 3E8FA 2EILB 1GKFA 4MVSA 1JJ2U 1GO3F 3JYCA 3K79A 4UVBA 1NQTA 2IJJA 4MVOA 4TT3G 3B8MA 5H6QA 3SYOA 2QTOA 3HB3B 3FB5C 3TK1A 1K73W 2DWEC 1M56B 4P2ZA 2W6IG 3QO7A 1M90W 4PA6A 3W7SA 1OCZB 2H94A 1MSWD 1W2BU 3W7WA 1RM1C 1K4DC 2P90A 4PELA 1OCRC 1DTOA 2JEUA 3IC7A 3OEHG 1FXKA 2XAQA 1F23A 2ATKC 2XAFA 1V55C 5DN6G 3STLC 1GM7A 1PNMA 1KC8W 4GX0A 1DF5A 4RAIA 3LDDA 2B5UA 1SZTA 1AJPA 1E1QG 1K9MW 3SJQC 3ASNB 1NBMG 3I55V 3ABKC 1M57B 2DYSC 3CXCU 1S77D 2BOCC 3K0GA 2XAGA 2K1EA 1K8AW 4QE9A 2D3OW 2NNUA 3NXSA 3ZMSA 1S76D 1THZA 3OMNB 2XAJA 1Y4MA 2JIZG 2A79B 4PA7A 1VQLV 3PJSK 4LC1A 5L3CA 2DW4A 3FYIB 1PNKA 1KD1W 2X0LA 5HFLA 2Q6AA 5B3SC 3VBBA 1B6QA 5H6RA 1DF4A 4PDLA 3EFFK 4R50A 1W0KG 4GT1A 3W7XA 1F4MA 4JF3A 2JJ1G 1QR8A 2UXNA 1OZ0A 2ZDIA 1M56C 4MTGA 4ZBMA 5IY5B 2EINB 2P6JA 4FIPC 3JD1A 3ZIAG 1XL6A 1JOYA 3OMIB 1Q7YW 1PKXA 3FYEB 5HFMA 3R65A 1YIJV 5IYDO 2WLNA 3GWOA 2Q67A 4KP4A 3LSSA 1GM9A 5KA6A 1K34A 2R9RB 4MVZA 3E8HA 1R73A 3W7TA 1CPYA 3STZC 3CYOA 1YTFD 2A9HA 4WF9V 4MTXA 4OXSA 2DWDC 4WFAV 1R3KC 2EIKC 3ASNC 5J9PC 1PNLA 1JQ0A 4P30A 5LBQA 3IFXA 3ZRWA 1K33A 4F4LA 4PDVA 2OCCB 3LUTB 1MOFA 4HAMA 3CCUV 1EZJA 2ZR2A 2IU0A 1JX9A 2W6JG 1V55B 2PI4A 2CK3G 3I56V 1E79G 1CEZA 4HZ3A 1LNQA 1FXKC 1IXMA 1S3JA 2X6AA 5CN0A 3VOUA 2LFRA 2WSSG 3FB6C 3F7VC 1YTFB 2WLMA 2WLHA 4H33A 2B1GA 4EKWA 2ZQMA 4H37A 4JAVA 4CBCA 4R7CA 1R6KA 1XL4A 5CBHA 4X88A 3ETGA 4JAUA 1KP3A 2YSUB 3ABLB 3E89A 4XBFA 3JD2A 3MHHC 4QPKA 2IJIA 3K9AA 5LGUA 5EC1C 4ZKIA 3SPCA 3T2MA 4FJCC 5IY5C 4X89A 2WLIA 1PD3A 2EIJB 1NJIW 1AI4A 1M9NA 2DQ0A 2X7RB 3SYQA 3ZRXA 2LP7A 3H01A 3G4SV 2WWWA 3ML0A 2IJKA 3SYPA 1AROP 2HG5C 5B3SB 4XDJA 5LGNA 1UJWB 2H8PC 3DTUB 3SYCA 2LFSA 1NVPD 2WLLA 1AJNA 3E83A 1FFTB 2IW5A 2HFEC 3OGCC 4J9ZB 1F4NA 1V54B 1S0VA 4R6ZA 4GX1A 2XOKG 4KFMA 3SYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E V;  2D3O W;  5DM6 V;  3CCU V;  1VQK V;  1Q7Y W;  1VQ5 V;  3CC2 V;  3G71 V;  2QA4 V;  3I56 V;  2OTL V;  3CCJ V;  1VQ7 V;  3CCS V;  1YIJ V;  1NJI W;  3G4S V;  1VQL V;  3CCV V;  1JJ2 U;  1YIT V;  3CCE V;  1KC8 W;  1YJ9 V;  1KQS U;  2QEX V;  1KD1 W;  2OTJ V;  3CCL V;  1Q82 W;  1Q86 W;  1R73 A;  4WFB V;  3CD6 V;  1N8R W;  1VQM V;  1YI2 V;  1QVG U;  1K9M W;  1VQN V;  4WF9 V;  1K73 W;  3CMA V;  3CC7 V;  3OW2 U;  1VQO V;  3CCR V;  4WCE V;  1QVF U;  1YJW V;  1YJN V;  1M90 W;  3CCM V;  4WFA V;  1VQP V;  3CC4 V;  3I55 V;  3CPW U;  3CXC U;  1W2B U;  1YHQ V;  1VQ8 V;  1S72 V;  1VQ9 V;  3CCQ V;  1VQ6 V;  1Q81 W;  1M1K W;  3CME V;  1K8A W;  1VQ4 V; 
#chains in the Genus database with same CATH topology
 1EFR G;  1G1X B;  1WPX A;  4JYC A;  1NR7 A;  1TUB A;  4TUY B;  3TET A;  3H1L H;  1J5E O;  5CMU A;  1Y76 A;  3UT5 A;  4X64 B;  4MVR A;  2V1D A;  4J7Z A;  4AHC A;  1X59 A;  4IGG A;  3GB7 C;  1NTZ H;  2VWK A;  4AQY O;  4LH7 A;  3ABT A;  4L8J A;  4JI4 B;  3MAQ A;  4DK0 A;  4CH3 A;  4B3S B;  1N32 O;  5LP6 B;  4DR5 O;  3CXH F;  4J42 A;  5LGT A;  2M6Y A;  1Q86 W;  5FL7 G;  2OIE A;  5L3F A;  3RWR D;  4I7Z B;  3B40 A;  5BR8 O;  1ROP A;  2N05 A;  3JSL A;  1WJZ A;  5EYP B;  4NXM B;  1R6T A;  4KHP O;  5LHG A;  2XAS A;  4DV7 O;  5KHH A;  3AK2 A;  1XEQ A;  3LDE A;  1YJ9 V;  3L9D A;  4U7O A;  1KQS U;  3CCL V;  1AR5 A;  1Y67 A;  2WAM A;  4WCE V;  2H3O A;  5KAI Z;  4PA9 A;  1PL4 A;  3CX5 F;  2EZO A;  2EIM C;  5BMV A;  4J9Y B;  4GKJ B;  4U3F H;  4GX5 A;  4DR7 O;  1KBH A;  3RYF A;  1XNR B;  4X1K A;  5BZB A;  5CA3 A;  1MMM A;  1DLB A;  2AW9 A;  3RYI A;  1VQ7 V;  1EBO A;  2QWO B;  2P7T C;  3KCX A;  3U11 A;  2AXT Z;  1HW7 A;  2EZP A;  3F5W C;  4QPJ A;  1Q82 W;  1YI2 V;  4GX2 A;  1FAF A;  1ZSP A;  1SA0 B;  4XDK A;  1VQP V;  4OPH A;  2Y69 C;  4MTO A;  3OUF A;  3P30 A;  3JAR B;  3ZRW B;  1NU1 H;  1NH2 B;  3ZHQ A;  4DR4 O;  3SPH A;  3CP1 A;  2A3Q A;  4H44 B;  3CCJ V;  5EBL C;  4UV8 A;  3HR0 A;  4G28 B;  3SPI A;  3ASO B;  4YY3 B;  5KX5 A;  3BAA A;  3HPL C;  2ZIN A;  4H13 B;  4RUE A;  2LW1 A;  3ZCC A;  1HWY A;  4DV2 B;  4D6T H;  1B3Q A;  5EZY B;  2ZD9 A;  3N2G B;  2Q69 A;  4UV9 A;  4YHH B;  3TCU A;  1K5Q A;  4FPP A;  4MT8 A;  4NR1 A;  4I5S A;  5EK0 A;  2ZXW B;  3CJH B;  4DRX A;  4LFC B;  5EIB C;  2Y4U A;  1QVF U;  2EIM B;  2P22 C;  4Z1M G;  3L71 H;  3K5O A;  5KMG A;  1XMQ O;  5B1B C;  5LP6 A;  1COW G;  3OM3 B;  4P9P A;  4UVA A;  4LF4 O;  2F4V B;  1NR1 A;  1RP3 B;  2HLD G;  4F6E A;  3ABM C;  1YIT V;  3D3I A;  3JAM N;  3ZMT A;  1AI5 A;  4E2L A;  1I7F A;  2DN9 A;  2CTP A;  1MNG A;  5LA6 A;  4JI5 O;  2ZNJ A;  3WG7 B;  2UXC O;  1HNW B;  1QQC A;  1SQQ H;  5B1O A;  4DV4 B;  3C3T A;  2JGD A;  1VQ6 V;  3FAV A;  3QO5 A;  1QHT A;  4DV6 O;  3L74 H;  2EIL C;  4NTX A;  4N21 A;  2FTK A;  3CD6 V;  5LHH A;  1YXB A;  5KUK A;  4X1Y A;  1YJN V;  1W0J G;  1J95 A;  3BCC H;  2ZT9 B;  3AK3 A;  4TV8 A;  4JI3 O;  3FKS G;  4LH6 A;  5E1A C;  2PI5 A;  3OR6 C;  2X6C A;  1HP8 A;  2GTA A;  3ZRV A;  1QLE C;  1WNS A;  2CUG A;  4BIZ A;  4D7T A;  3K0D A;  3X2Q C;  2B9Z A;  5IJ0 B;  3CMA V;  2JS5 A;  2EUL A;  4PJ0 Z;  1P4R A;  2YUA A;  3W7U A;  1OV9 A;  5B1B B;  4NVP A;  5B66 Z;  5CA0 B;  3NR7 A;  1TA8 A;  1U97 A;  3AG3 C;  3BHP A;  1AR4 A;  2R9I A;  1N0N A;  2RDC A;  3UO2 A;  2GDS A;  4JI2 B;  1JFF A;  3FD9 A;  3K9S A;  4JYA B;  1R1B A;  4JPR A;  3UM7 A;  1I5X A;  1ENV A;  1F51 A;  1JVM A;  4DR3 B;  4FFB A;  4UUJ C;  2Q68 A;  1XNQ O;  4RQF A;  2P4K A;  2Z3Y A;  1XDC A;  3BA9 A;  2EIN C;  1OJH A;  3H1J H;  1VQ5 V;  1Y66 A;  1BQZ A;  2EIL B;  4DV5 B;  3L73 H;  1GO3 F;  3RGB A;  4IIJ A;  1NQT A;  4IL6 Z;  4MVO A;  4TT3 G;  3WB2 A;  3B8M A;  1WN7 A;  3APQ A;  5H6Q A;  2QTO A;  3HB3 B;  1M56 B;  4P2Z A;  3QO7 A;  4PA6 A;  1MSW D;  4LF9 O;  1RM1 C;  3JAT A;  4I55 B;  1D5N A;  1QU7 A;  3D36 C;  2XAF A;  1S5L Z;  4TV9 B;  3STL C;  1GM7 A;  1KC8 W;  1DF5 A;  2B5U A;  3E22 A;  1AJP A;  1E1Q G;  4K0K O;  3SJQ C;  2AZ0 A;  3ASN B;  2IM9 A;  3B09 A;  3R66 A;  1N0J A;  3TGU H;  2CH7 A;  5LYJ B;  1S77 D;  1BZK A;  4NKG B;  4ZI7 A;  2NNU A;  3NXS A;  3OMN B;  1XMO B;  5GON A;  1HNZ B;  2A79 B;  4TQF A;  1VQL V;  3PJS K;  4X66 B;  4O4I B;  2DW4 A;  4J11 A;  5B3S C;  2PF4 E;  1B6Q A;  2W0X A;  3HKC B;  4UCV A;  2BTO A;  5JJJ B;  2PY5 A;  1AVM A;  4EB6 B;  4GT1 A;  1F4M A;  1G6U A;  2LO1 A;  1OZ0 A;  3GWK C;  4UB8 Z;  2EIN B;  4FIP C;  2CDY A;  3SDL A;  4X1I A;  2AZ2 A;  3RYC B;  3FYE B;  4BR6 A;  5HFM A;  4O4H A;  5BY1 A;  4MVZ A;  4U3J B;  3QTC A;  3W7T A;  4B3R O;  2LW7 A;  3OTO B;  3SR2 C;  4OXS A;  2DWD C;  2P5O A;  1JQ0 A;  2P4V A;  3IFX A;  4Z2W A;  1N33 B;  3LUT B;  4HAM A;  1JX9 A;  2PI4 A;  2JGU A;  2UUC B;  4W4L A;  2X6A A;  1IXM A;  1XHX A;  1YTF B;  1WPB A;  2WLH A;  1HR0 B;  2FML A;  4DV3 O;  1R6K A;  3BPZ A;  1H2S B;  2DMX A;  4K35 A;  4JAU A;  3ABL B;  4DV0 B;  5C8Y A;  3MHH C;  4QPK A;  1GN3 A;  4ZKI A;  4YJ2 B;  4DR2 O;  2WLI A;  3EXA A;  2X7R B;  1EN5 A;  2CTQ A;  3SYQ A;  2KQX A;  2R72 A;  2IJK A;  3SYP A;  5B3S B;  4LWS B;  2ILM A;  1N36 B;  3SYC A;  1NVP D;  1RFY A;  2WLL A;  2XUM A;  4X20 B;  1MA1 A;  4NB5 A;  1FD9 A;  2BSK A;  3OGC C;  1V54 B;  4R6Z A;  1D5A A;  4GX1 A;  2ZKO A;  4KFM A;  3SYA A;  2E5L B;  1BHB A;  4YXW G;  2OCC C;  1SS3 A;  2PZS A;  1PL0 A;  1PM9 A;  3N2K A;  4GZR B;  2YEV A;  5K1X A;  4ZHQ A;  4MTF A;  5JH7 B;  5JCO C;  3CEI A;  3OT7 A;  1VQO V;  2CGO A;  4LF6 B;  1ZL8 A;  4IT5 A;  2UU9 O;  4QIW F;  4G2K A;  1NTM H;  4LR3 A;  4EFE A;  2YIA A;  2VQE O;  2VS0 A;  3DC5 A;  4PA4 A;  1B06 A;  4I9W A;  1Q6H A;  2EIJ C;  5JJE B;  5B5E Z;  1MAB G;  3HKC A;  4X62 B;  4WFB V;  4FM2 A;  4JYB A;  2HHH O;  3K08 A;  2YXH A;  1YJW V;  2Q7G A;  4G27 B;  2QM7 A;  4X65 B;  3JSN A;  4TSF G;  1ORQ C;  4CH4 A;  3RYC A;  2UXX A;  5LL6 Y;  1CXZ B;  3BFR A;  1N34 B;  4FLZ A;  2KG7 A;  4LFA B;  5IYZ A;  3H9V A;  2XHB A;  1RSO A;  1GH6 A;  2V4D A;  1G4Y B;  4I9Q A;  3CRR A;  3M99 B;  4O2B B;  3E35 A;  3D36 A;  4X64 O;  4DO2 A;  2UUA B;  1LUW A;  1VQ4 V;  4K8Z A;  4WFH A;  3CC2 V;  4RWU A;  3CCS V;  1US6 A;  1Q6U A;  3CSX A;  5KHI A;  4I4T A;  1XI1 A;  4JI4 O;  1H2K A;  2QR4 A;  4OPA A;  1VQM V;  4B3S O;  3HKE B;  3OW2 U;  1BQ0 A;  1S5J A;  3BEH A;  3WB1 A;  2LQT A;  3CRM A;  5CBG A;  4LF5 B;  1BT8 A;  2YS8 A;  1Q81 W;  4I50 A;  1IZ3 A;  3ZHU A;  1FJG B;  4DW0 A;  4NXN B;  1GN6 A;  3DXR A;  2VQF O;  4RQE A;  1O9G A;  3E86 A;  3APO A;  3TJT A;  1H2G A;  3JAL A;  4H0L B;  4W4K A;  4DUY B;  2JEX A;  1YSC A;  1CP9 A;  4X8A A;  3H1K H;  3CCQ V;  3THO A;  1QNM A;  3K5N A;  3RVZ A;  3LNM B;  1AR1 B;  2VWJ A;  2ZDI C;  1VQK V;  3JAW A;  2LGQ A;  1YDX A;  2ZCE A;  5JVD B;  1GN4 A;  1GM8 A;  4O4J B;  2ADP A;  3IAY A;  1E1R G;  5JQG A;  4KXR A;  4LP8 A;  2JJ2 G;  3CCM V;  4JI7 B;  1NKD A;  1L8D A;  4CS3 A;  4J41 A;  1DK1 A;  3KCY A;  4L87 A;  5IWA O;  1V9P A;  1H8E G;  4UVC A;  4E4E A;  4PI0 A;  2QE7 G;  2X6B A;  2FB5 A;  4JI1 B;  1K4C C;  3T1Y B;  4HNA B;  3HKB B;  1VP7 A;  3ASO C;  4FMT A;  1ZAU A;  2DYR B;  2WA3 A;  2UXD B;  1S72 V;  2WLJ A;  5L3D A;  4F6R B;  1RPO A;  1GTO A;  1H2M A;  4MS2 A;  2JDI G;  4DV2 O;  2IU3 A;  2OYQ A;  4AIL C;  4DUZ O;  3RW0 A;  3ETQ A;  4YHH O;  3JD4 A;  2ZXW C;  3UKM A;  3OE7 G;  4JI8 B;  1WLE A;  3HKD B;  4DV1 O;  5GTH Z;  4O4L A;  1OCZ C;  3ETE A;  4IHJ B;  3M7M X;  3FB7 C;  2RJZ A;  4EEQ A;  4LF8 O;  2QWQ B;  3ZX6 A;  1N8R W;  5A9G A;  4JAS A;  1VQN V;  1EN4 A;  1R3L C;  1OCR B;  4JV5 O;  3WG7 C;  1URF A;  1TVK B;  5IYC O;  1J5E B;  5CA1 A;  5ITZ B;  2XAH A;  4YJ3 A;  1AJQ A;  2BTQ A;  1SQB H;  2ETN A;  3IGA C;  4DV4 O;  4JGS A;  1F7Y A;  3AG7 A;  3ZS8 C;  4AQY B;  4B3T O;  3N27 A;  1JMK C;  1SQX H;  1KP2 A;  4DR6 B;  3FB8 C;  2DYS B;  3P32 A;  1N32 B;  4MSW C;  4WFE A;  3MD0 A;  4DR5 B;  1KB9 F;  3B77 A;  1YHQ V;  3IJ4 A;  3E2E A;  2QKS A;  2XTA A;  1YVW A;  4TUY A;  3H1H H;  5KHK A;  4KHP B;  2IJJ A;  3JAS B;  3TK1 A;  1NZ6 A;  3W7S A;  1OCZ B;  5CB4 B;  2CE4 A;  3W7W A;  2A06 H;  3RYH B;  4PD4 F;  2XAQ A;  1EZV H;  1VF6 C;  1V55 C;  5DN6 G;  3LDD A;  4PHZ A;  2ZE6 A;  2QSA A;  4DR7 B;  3OGI B;  1I08 A;  1IBL B;  5FLX N;  1WA8 B;  3I55 V;  3AK1 A;  5EYP A;  1L0N H;  2BOC C;  2XAG A;  3K0G A;  2D3O W;  3ZMS A;  2E3C A;  4DR3 O;  2XAJ A;  3P3N A;  1Y4M A;  1IBK O;  3K57 A;  2Q9L A;  5L3C A;  3H1I H;  5LMN B;  4IYH A;  2YI9 A;  4NTW A;  3L72 H;  2FYU H;  4PDL A;  2JJ1 G;  4UB6 Z;  1PV0 A;  1HNX B;  2UXN A;  3A2F A;  2ZDI A;  1M56 C;  1VEW A;  4C7U A;  1BSM A;  5H5N A;  3JAK B;  3JD1 A;  1Q7Y W;  1PKX A;  1KMI Z;  2CTR A;  3GWO A;  2Q67 A;  3BA8 A;  1AIL A;  4B7E A;  1K34 A;  2R9R B;  1R73 A;  3STZ C;  4MTX A;  4EFB A;  1SA0 A;  3FX7 A;  1B04 A;  4WFA V;  3JAR A;  3ASN C;  4P30 A;  2K9P A;  5LBQ A;  3ZRW A;  1K33 A;  4F4L A;  4PDV A;  3ZHV A;  3CCU V;  4FLU A;  2PGG A;  3T1H B;  2W6J G;  1V55 B;  1NT2 B;  3I5D A;  1E79 G;  1LNQ A;  1FXK C;  5CN0 A;  3VOU A;  4CS4 A;  2YDE A;  3F7V C;  2B1G A;  4EKW A;  3LNN A;  4H37 A;  1WP7 A;  1KUQ A;  1M4U A;  1XMQ B;  1DGS A;  5CBH A;  4LF4 B;  4X88 A;  1HNZ O;  1XBL A;  2YSU B;  5J2T B;  5EZY A;  3N2G A;  3WU2 Z;  5LGU A;  3K9A A;  3QVN A;  5EC1 C;  3OD4 A;  4X89 A;  1AI4 A;  3A0H Z;  1KU9 A;  2GUZ B;  3SJB C;  3H01 A;  3ML0 A;  5LOV B;  2HG5 C;  2OWO A;  2H8P C;  3CJH A;  3DTU B;  1SZX A;  1XHZ A;  1FFT B;  2ZE8 A;  3OTO O;  3O65 A;  3EVK A;  2WLK A;  2ITD C;  1AB3 A;  2MK3 A;  5LMU B;  2W0F C;  4MW8 A;  1N33 O;  4FZ1 A;  4JI3 B;  2AHZ A;  2QM8 A;  1QVG U;  5H9C A;  1P7G A;  2QM4 A;  5GW7 A;  4JI6 O;  3ABL C;  4JZ2 A;  3T4Z A;  1N4C A;  4JI0 B;  1FXK B;  4B3M B;  1ZWI C;  1GK9 A;  4MVQ A;  1I94 B;  3B2E E;  5FPO A;  2HKO A;  3LDC A;  4PDR A;  2EBO A;  4R8C A;  3AG1 C;  1RPR A;  1YEW A;  3TXS A;  2Q7E A;  1FS0 G;  4K8X A;  1T5E A;  1Q43 A;  4JTC B;  1V54 C;  4ZOL B;  5DM6 V;  2N04 A;  5C93 A;  2P06 A;  1SQF A;  3K3W A;  5L3E A;  2UUB O;  1XNQ B;  3JCU Z;  4UFZ A;  2Q7H A;  4WFF A;  4LFB O;  1FXH A;  5IJ0 A;  4P9O A;  1NI8 A;  3OEE G;  5EIB D;  4WFG A;  4N23 A;  1JCH A;  4FK5 C;  5LXT B;  4DR1 B;  1VF6 A;  5CA0 A;  4UXN A;  4TWK A;  1UFI A;  2L35 A;  1KKC A;  3MHS C;  2PYL A;  3UCS C;  3VQY A;  3IC9 A;  4LF9 B;  2Q0A A;  2HJF C;  1FFX B;  1IBM O;  3M8A A;  3CRC A;  5LHI A;  1L1F A;  3LSQ A;  1SQV H;  1Y74 B;  3CE2 A;  3BY6 A;  3AG2 B;  4K0K B;  4BAY A;  3ZRS A;  4CZZ A;  2RMK B;  2OCH A;  1LR1 A;  2HEP A;  3ZMV A;  3AG1 B;  5IJ9 B;  4TQD A;  5KHG A;  2GSM B;  1GMG A;  3J81 N;  3CHX A;  2JK5 C;  2Y0P A;  3CPW U;  2PUS A;  2AHY A;  4U7N A;  3C90 A;  1R6N A;  2QWP B;  1OHH G;  4I55 A;  1TAE A;  1Q8I A;  4O2A B;  4XDL A;  4TV9 A;  3DSQ A;  1M5I A;  3VQW A;  1OCC B;  2UUA O;  4DXW A;  2ZM6 O;  3OTF A;  1NTK H;  5JJN B;  3MDS A;  1H2N A;  4CS2 A;  2HR3 A;  3OR7 C;  1VIB A;  4WBN B;  1BMF G;  4GYC B;  5LYJ A;  2NLJ C;  3RBZ A;  3ZJZ A;  1M1K W;  4J10 A;  4PDM A;  3ETD A;  4B3R B;  4DW1 A;  5L3B A;  3SPJ A;  1IUR A;  1H38 A;  1GRJ A;  1TUB B;  4UCR A;  3ZMZ A;  4BW5 A;  4I0X B;  4LF5 O;  3ZED A;  4O4I A;  3UO3 A;  3CCE V;  4NTY A;  1HDJ A;  2GV9 A;  1Y76 B;  1OCO B;  2B1I A;  3UT5 B;  1VMG A;  4EB6 A;  1FJG O;  3PN1 A;  3CC7 V;  4BW9 A;  3KZI Z;  1MZE A;  1K5S A;  4TOI A;  4YIO A;  1VQ8 V;  4DV3 B;  1K7D A;  5FNV B;  3CRA A;  5IDJ A;  2F1M A;  5IYB O;  1IX9 A;  1ZUQ A;  2IJH A;  1I5Y A;  2BOB C;  4U3J A;  3L70 H;  5IE9 A;  3RVY A;  4DR2 B;  3D3Q A;  3RN4 A;  2A0L A;  5LXT A;  1VF5 B;  4J7J A;  1G8M A;  2WPD G;  5K1P A;  1A32 A;  3G71 V;  4JI7 O;  4PA3 A;  3OMA B;  1XRE A;  5KAF Z;  2R9A A;  2RNB A;  2ZIO A;  4DK1 A;  1P7B A;  2ZR3 A;  4HYO A;  1SRY A;  5EBM C;  4JI1 O;  3T1Y O;  2CGN A;  2DYR C;  3OFN G;  5BMV B;  1VQ9 V;  1M57 C;  3C3S A;  4YJ2 A;  3AEI A;  3RYF B;  4OGQ B;  2EJR A;  4X1K B;  4UCS A;  2BE3 A;  3RYI B;  2FL4 A;  2UXD O;  2UU9 B;  4LWS A;  5JWP A;  4NXM O;  4JYY A;  3F5T A;  3SPG A;  3A8T A;  3ABK B;  4UCT A;  4X20 A;  1AI6 A;  1NS1 A;  3K5L A;  4QJF B;  3J80 N;  3K03 A;  4LNU B;  2QGN A;  3QF7 A;  5GTI Z;  4FFK A;  2UXB B;  3E8F A;  1XQ8 A;  1JJ2 U;  3JYC A;  3K79 A;  2YIB A;  5KX5 B;  4GKJ O;  5JH7 A;  2QKC A;  1XNR O;  3SYO A;  1K73 W;  1EN6 A;  2W6I G;  2ZNI A;  1K4D C;  3D8C A;  2P90 A;  1OCR C;  1GAX A;  1IVS A;  2JEU A;  1MSD A;  1F23 A;  1VAR A;  2ARH A;  4I0X A;  5DEC A;  1O9H A;  2CTW A;  4Q6G A;  1PNM A;  4D7S A;  1KYO F;  3G80 A;  2D2C B;  3K59 A;  1K9M W;  4DRX B;  3J7A U;  2QKA A;  3ZHT A;  4CH6 A;  1NBM G;  2HJD A;  1BCC H;  1M57 B;  2DYS C;  4YY3 O;  2F66 C;  5FNV A;  1VF7 A;  5KMG B;  4DR6 O;  4LF7 B;  2GBO A;  3S3X A;  4LC1 A;  2Q6A A;  3VBB A;  3EFF K;  1W0K G;  3W7X A;  5LA6 B;  4O2B A;  5IY5 B;  4ZBM A;  2JGD B;  2P6J A;  2VQF B;  3K58 A;  2LJ2 A;  1XL6 A;  5FPR A;  3FAV B;  5KLV H;  4LFC O;  4PI2 A;  1YIJ V;  4GKK B;  4UCU A;  3LSS A;  1GM9 A;  5JCO A;  4FLX A;  2JVD A;  1CPY A;  3WB0 A;  2F93 B;  4OX9 B;  1SC5 B;  1Z5V A;  3HKE A;  2F4V O;  4FM1 A;  4X1Y B;  1R3K C;  2EIK C;  4BWA A;  5J9P C;  1PNL A;  4TV8 B;  3VQX A;  4FM0 A;  2ZR2 A;  2IU0 A;  2WA4 A;  1IBL O;  1HNW O;  2CK3 G;  4CC5 A;  1AP5 A;  4ABM A;  2LFR A;  2WSS G;  3FB6 C;  4H33 A;  1Y6X A;  2ZQM A;  4JAV A;  3CB2 A;  3RFR A;  3GVM A;  5E79 Z;  5IWA B;  1XL4 A;  4Z1V A;  4QGP A;  4LNU A;  4XBF A;  5LMN O;  3JD2 A;  2IJI A;  3SPC A;  5D5Q A;  4B7K A;  1NJI W;  1HNX O;  2DQ0 A;  1M9N A;  3ZRX A;  2YI8 A;  2WWW A;  1XIL A;  1ARO P;  3CS5 A;  5JVD A;  2EJ7 A;  5BR8 B;  2O57 A;  4O4J A;  1JFF B;  2MW2 B;  1UJW B;  1AJN A;  2ZE5 A;  2IW5 A;  4DV7 B;  1F4N A;  4DUZ B;  1S0V A;  4UCO A;  4FFB B;  5B1N A;  1SET A;  1QBZ A;  1JA8 A;  1SES A;  1JJO A;  1M93 A;  5J2U B;  4DV1 B;  4HNA A;  4IIJ B;  3A0R A;  3AG4 C;  3B8N A;  3HKB A;  3U0Z A;  1WB7 A;  3T1H O;  4QNH B;  1BGY H;  4LF8 B;  2EIK B;  5L3G A;  3CC4 V;  1U96 A;  3SGI A;  5BXZ A;  3P3P A;  4HBN A;  4JI2 O;  3JAT B;  4JYA O;  4F6R A;  2M7W A;  3ZBH A;  1P49 A;  2Q8V A;  1K92 A;  2IH1 C;  2DJV A;  3ZN0 A;  4JV5 B;  2YIC A;  3SJC C;  2HVJ C;  4GCZ A;  2KB1 A;  3E22 B;  1X4T A;  3U10 A;  2XND G;  2Y69 B;  4DR4 B;  2YID A;  4MVU A;  3CCR V;  1JR9 A;  2Z5U A;  2V7Q G;  5EBW C;  4DV5 O;  3HKD A;  2E75 B;  2CH7 B;  4IHJ A;  2AGA A;  4B3T B;  4RO2 A;  3WFV A;  4ZI7 B;  1SQG A;  1SQP H;  2YXY A;  4JTD B;  1K97 A;  2QWR B;  1TGO A;  1FXV A;  5GON B;  5A2Q N;  2IH3 C;  2A7W A;  1IXB A;  2OTJ V;  3F7Y C;  3K04 A;  5LMU O;  2FKX A;  1P84 F;  1TVK A;  5B1A C;  4JZG A;  5ITZ A;  4MVM A;  4BIO A;  1H8H G;  4X1I B;  5AG2 A;  1R3J C;  2OT5 A;  2QA4 V;  2LGW A;  4O4H B;  2ITC C;  3AG4 B;  3CCV V;  1NH2 D;  4FLV A;  2QEX V;  4JI0 O;  4B08 A;  1R3I C;  3S3W A;  4B3M O;  3B4S A;  1XMO O;  2F23 A;  2IBZ H;  1I94 O;  4X66 O;  1SKV A;  5EC2 C;  4LCU C;  3G6E V;  3ABM B;  5KHJ A;  1PP9 H;  3BAB A;  3L75 H;  4JI5 B;  5KA5 A;  2UXC B;  4JTA B;  2XT9 A;  3K06 A;  2JRI A;  1QR9 A;  3EHB B;  1PPJ H;  1GN2 A;  3JAS A;  4J7K A;  3O9O A;  4KUM A;  2ODM A;  4K3A A;  2Y4T A;  5CB4 A;  1IBK B;  4DV6 B;  3G67 A;  1H2L A;  3Q4H B;  3RYH A;  2YC0 A;  5C8Y B;  2OIG A;  2QJ1 A;  2CAZ C;  1QCE A;  2Q73 A;  2WLI B;  4MW3 A;  5J2U A;  2RQ6 A;  1JPX A;  4DR1 O;  1NVP B;  3T4D A;  5CBF A;  2F43 G;  2Q4P A;  4AI8 A;  2WLL B;  3G6B A;  2UUC O;  2Y48 A;  1WA8 A;  5B1A B;  2BSK B;  1HR0 O;  2PYJ A;  1QLE B;  3JD3 A;  3E8G A;  2E74 B;  1AP6 A;  3AG2 C;  1TUE B;  1YCI A;  4DV0 O;  3OAA G;  3X2Q B;  3N2K B;  2YEV B;  1LUV A;  4ZHQ B;  3ZHR A;  1AI7 A;  3QO8 A;  1D2D A;  4PV1 B;  1Z5W A;  1K3E A;  1ZL8 B;  1UPG A;  4RUF A;  3ZN1 A;  3JAK A;  1N36 O;  3AG3 B;  1SER A;  1BL8 A;  3RT3 C;  2P67 A;  4LBE C;  2QTS A;  2NN4 A;  3CWB H;  3QNE A;  1L0L H;  3DGE A;  4KL1 A;  2DQ3 A;  2GHY A;  2E5L O;  1OCC C;  4CC6 A;  3KKY A;  2ZE7 A;  3OUS A;  3SJA C;  1QLN A;  1W59 A;  3JCZ A;  3E8B A;  3KG2 A;  1SF9 A;  3CME V;  3ABU A;  4FVM A;  2HP8 A;  1KEC A;  4LF6 O;  2OTL V;  1IDS A;  2KSD A;  4ASU G;  2KG7 B;  5IYZ B;  5KUM A;  3ZHS A;  4GLX A;  1MG1 A;  1RSO B;  3ZMU A;  1RM1 B;  1OCO C;  4QE7 A;  5J2T A;  3CRQ A;  5IT9 N;  2C2A A;  1Z2G A;  4X62 O;  2HVK C;  4ZIB A;  3A0B Z;  2Z0A A;  2GUZ A;  4A5U B;  4DYL A;  2N74 A;  5LOV A;  4X65 O;  4JI6 B;  4I4T B;  2GTS A;  4ICG A;  1KKD A;  3T1C A;  2YXL A;  2G38 A;  4BIU A;  1BHA A;  1Q5O A;  3JD0 A;  5DED A;  1N34 O;  3Q4H A;  1MZF A;  4LFA O;  1S5H C;  4Q20 A;  4I50 B;  1Q3E A;  1GKF A;  4MVS A;  3DXR B;  4UVB A;  4GUN A;  1XOU A;  3FB5 C;  1Q6I A;  2DWE C;  2RN9 A;  1M90 W;  3JAL B;  2H94 A;  1W2B U;  2BCC H;  2UUB B;  4PEL A;  1DTO A;  2E76 B;  3IC7 A;  3OEH G;  1FXK A;  5H2F Z;  4LFB B;  2ATK C;  1WP8 A;  3JAW B;  1WAZ A;  1BS3 A;  3VQV A;  1YZB A;  1ZLZ A;  1FKA O;  4FZ0 A;  4GX0 A;  4RAI A;  1SZT A;  3ICX A;  5JQG B;  5D5P A;  4NXN O;  1FYJ A;  3ABK C;  4X9Q A;  3CXC U;  3TXQ A;  5F2V O;  2K1E A;  1IBM B;  1K8A W;  4ZOL A;  4QE9 A;  1S76 D;  1THZ A;  4FLW A;  2DE0 X;  2JIZ G;  1EM1 A;  2L6L A;  4PA7 A;  4DUY O;  3DC6 A;  3FYI B;  1PNK A;  1KD1 W;  2X0L A;  5HFL A;  5H6R A;  4R50 A;  1DF4 A;  2EX3 A;  2UXB O;  4CH5 A;  4JF3 A;  1QR8 A;  4FLT A;  4J80 A;  4MTG A;  3QG5 A;  1FPO A;  3ZIA G;  1JOY A;  3OMI B;  2DOS A;  3R65 A;  5IYD O;  2WLN A;  4KP4 A;  5KA6 A;  1FFX A;  5TIS Z;  2JS3 A;  3E8H A;  3CYO A;  1YTF D;  2A9H A;  2Q5Z A;  4WF9 V;  3FFQ A;  2ADQ B;  2RCV A;  1Y74 A;  2NR5 A;  4O4L B;  2ZM6 B;  2OCC B;  1MOF A;  1EZJ A;  2VRZ A;  3I56 V;  1CEZ A;  4HZ3 A;  1S3J A;  2QDO A;  3UQ8 A;  5LP6 C;  2WLM A;  2Y0I A;  4CBC A;  3BVO A;  3BRC A;  4R7C A;  4YIP A;  1ZTE A;  5IJ9 A;  3K5M A;  1ZX3 A;  4LF7 O;  2VQE B;  3ETG A;  1KP3 A;  1BE3 H;  1Q90 D;  3E89 A;  3LSU A;  2F95 B;  2Q0O C;  3T2M A;  4FJC C;  1YF2 A;  5CA1 B;  4O2A A;  1I0H A;  2KKW A;  5IY5 C;  2HHH B;  1PD3 A;  2EIJ B;  4IYI A;  2BTQ B;  4YJ3 B;  4JI8 O;  3G4S V;  2LP7 A;  2PTM A;  1WB8 A;  4XDJ A;  5LGN A;  4NYK A;  4JAA A;  2LFS A;  3E83 A;  4GKK O;  2YIB D;  2HFE C;  4WBN A;  4J9Z B;  2ZIM A;  1XUQ A;  2XOK G;  4FLY A;  2QWN B;  4OX9 O;  2R70 A; 
#chains in the Genus database with same CATH homology
 1EFR G;  5B1N A;  1WPX A;  4JYC A;  2WLK A;  1BHB A;  2ITD C;  1SET A;  2MK3 A;  4YXW G;  1NR7 A;  2OCC C;  1QBZ A;  3TET A;  1SES A;  2W0F C;  1PL0 A;  4MW8 A;  2YEV A;  5CMU A;  3A0R A;  4MTF A;  2AHZ A;  3AG4 C;  3B8N A;  4MVR A;  2QM8 A;  4QNH B;  2V1D A;  1QVG U;  5H9C A;  1VQO V;  2EIK B;  5L3G A;  3CC4 V;  3GB7 C;  4QIW F;  4G2K A;  5GW7 A;  3ABL C;  3T4Z A;  3ABT A;  2M7W A;  1FXK B;  1K92 A;  2IH1 C;  3ZN0 A;  4PA4 A;  1ZWI C;  1GK9 A;  4MVQ A;  4I9W A;  5LGT A;  2EIJ C;  2HVJ C;  4GCZ A;  1MAB G;  1Q86 W;  2KB1 A;  2HKO A;  4WFB V;  3LDC A;  4JYB A;  4PDR A;  2EBO A;  4R8C A;  5FL7 G;  2XND G;  2Y69 B;  3K08 A;  3AG1 C;  5L3F A;  1RPR A;  4MVU A;  3CCR V;  1YJW V;  2Z5U A;  2V7Q G;  5EBW C;  4G27 B;  2QM7 A;  1FS0 G;  1ROP A;  4TSF G;  1ORQ C;  4JTC B;  4RO2 A;  3WFV A;  1V54 C;  5DM6 V;  2UXX A;  5LHG A;  5C93 A;  2XAS A;  4JTD B;  1K97 A;  1FXV A;  3K3W A;  5L3E A;  2IH3 C;  3LDE A;  1YJ9 V;  4U7O A;  1KQS U;  2OTJ V;  3CCL V;  3F7Y C;  4WFF A;  3K04 A;  1FXH A;  4P9O A;  2WAM A;  4WCE V;  3OEE G;  4PA9 A;  1G4Y B;  4WFG A;  4N23 A;  3M99 B;  1JCH A;  2EZO A;  2EIM C;  4FK5 C;  5B1A C;  3E35 A;  4J9Y B;  3D36 A;  4DO2 A;  1VQ4 V;  4GX5 A;  4UXN A;  4MVM A;  4TWK A;  1H8H G;  5BZB A;  5CA3 A;  1R3J C;  1DLB A;  4WFH A;  3CC2 V;  2OT5 A;  2QA4 V;  1VQ7 V;  3CCS V;  3MHS C;  1EBO A;  2P7T C;  3CCV V;  2ITC C;  3AG4 B;  1NH2 D;  2EZP A;  3F5W C;  2QEX V;  4QPJ A;  2HJF C;  1Q82 W;  1R3I C;  1VQM V;  1YI2 V;  4GX2 A;  3OW2 U;  3BEH A;  4XDK A;  5LHI A;  1L1F A;  1VQP V;  2Y69 C;  3LSQ A;  5CBG A;  4MTO A;  3OUF A;  3P30 A;  5EC2 C;  4LCU C;  3ZRW B;  1Q81 W;  3BY6 A;  3G6E V;  1NH2 B;  3SPH A;  3AG2 B;  3ABM B;  3CP1 A;  3CCJ V;  5KA5 A;  4BAY A;  5EBL C;  4JTA B;  4UV8 A;  3K06 A;  3ZRS A;  4G28 B;  3SPI A;  4CZZ A;  1QR9 A;  3ASO B;  3EHB B;  3ZMV A;  3AG1 B;  3HPL C;  4RQE A;  4RUE A;  3E86 A;  4KUM A;  3ZCC A;  1HWY A;  2GSM B;  1GMG A;  1H2G A;  2JK5 C;  3CPW U;  2JEX A;  2AHY A;  4U7N A;  1YSC A;  1CP9 A;  2ZD9 A;  4X8A A;  3CCQ V;  1R6N A;  3RVZ A;  3LNM B;  2Q69 A;  1QCE A;  4UV9 A;  1OHH G;  2ZDI C;  1AR1 B;  3TCU A;  1VQK V;  2WLI B;  4XDL A;  1K5Q A;  4MW3 A;  4FPP A;  4MT8 A;  4I5S A;  1JPX A;  1OCC B;  5EK0 A;  1NVP B;  3T4D A;  4DXW A;  5CBF A;  1GM8 A;  2F43 G;  2ZXW B;  1E1R G;  4LP8 A;  2WLL B;  2Y48 A;  2JJ2 G;  2HR3 A;  3OR7 C;  1QVF U;  3CCM V;  2EIM B;  1NKD A;  5B1A B;  1BMF G;  4Z1M G;  2NLJ C;  3RBZ A;  3ZJZ A;  1M1K W;  4PDM A;  3ETD A;  4L87 A;  1QLE B;  3JD3 A;  5B1B C;  5L3B A;  1COW G;  3OM3 B;  1H8E G;  4P9P A;  4UVA A;  4UVC A;  3SPJ A;  3E8G A;  1NR1 A;  2QE7 G;  1H38 A;  2HLD G;  4BW5 A;  3ZMZ A;  2X6B A;  3AG2 C;  3ABM C;  1YIT V;  1TUE B;  3D3I A;  3CCE V;  3OAA G;  1K4C C;  3X2Q B;  3ZMT A;  1AI5 A;  2YEV B;  4E2L A;  1OCO B;  2B1I A;  3ASO C;  1AI7 A;  3QO8 A;  4FMT A;  3WG7 B;  3CC7 V;  2DYR B;  1K5S A;  1K3E A;  5B1O A;  1VQ8 V;  1S72 V;  2WLJ A;  4RUF A;  3ZN1 A;  1VQ6 V;  5L3D A;  3AG3 B;  1SER A;  1K7D A;  3QO5 A;  5IDJ A;  1GTO A;  1RPO A;  1BL8 A;  4MS2 A;  5IYB O;  2JDI G;  2IJH A;  2P67 A;  4LBE C;  2IU3 A;  1I5Y A;  2BOB C;  3RW0 A;  2EIL C;  3QNE A;  3DGE A;  2DQ3 A;  2GHY A;  4N21 A;  3JD4 A;  2FTK A;  3CD6 V;  5LHH A;  1OCC C;  3RVY A;  5KUK A;  2ZXW C;  3OUS A;  3UKM A;  1QLN A;  1YJN V;  3OE7 G;  1W0J G;  2A0L A;  3JCZ A;  1WLE A;  1J95 A;  3E8B A;  1G8M A;  1OCZ C;  2WPD G;  3ETE A;  3FKS G;  3KG2 A;  5E1A C;  3FB7 C;  3CME V;  3ABU A;  2PI5 A;  3OR6 C;  1KEC A;  3G71 V;  2X6C A;  2OTL V;  3ZRV A;  4PA3 A;  3OMA B;  1QLE C;  4BIZ A;  4ASU G;  1P7B A;  5KUM A;  1MG1 A;  1N8R W;  2ZR3 A;  4JAS A;  3K0D A;  4HYO A;  3X2Q C;  1VQN V;  1SRY A;  3CMA V;  5EBM C;  3ZMU A;  1RM1 B;  1R3L C;  1OCO C;  1OCR B;  4QE7 A;  1P4R A;  2C2A A;  3WG7 C;  3W7U A;  2DYR C;  3OFN G;  1VQ9 V;  5IYC O;  5B1B B;  1M57 C;  2HVK C;  3AEI A;  2EJR A;  2XAH A;  1AJQ A;  3AG3 C;  3IGA C;  2R9I A;  4JGS A;  1KKD A;  3SPG A;  3T1C A;  4JPR A;  1KP2 A;  1I5X A;  3UM7 A;  4BIU A;  3ABK B;  1BHA A;  1AI6 A;  1ENV A;  2DYS B;  1F51 A;  3FB8 C;  3P32 A;  4MSW C;  4WFE A;  1JVM A;  3JD0 A;  3MD0 A;  3B77 A;  4QJF B;  1S5H C;  3K03 A;  4UUJ C;  1YHQ V;  2Q68 A;  4RQF A;  3E2E A;  2Z3Y A;  4Q20 A;  2QKS A;  2EIN C;  1VQ5 V;  1Y66 A;  3E8F A;  2EIL B;  1GKF A;  4MVS A;  1JJ2 U;  1GO3 F;  3JYC A;  3K79 A;  4UVB A;  1NQT A;  2IJJ A;  4MVO A;  4TT3 G;  3B8M A;  5H6Q A;  3SYO A;  2QTO A;  3HB3 B;  3FB5 C;  3TK1 A;  1K73 W;  2DWE C;  1M56 B;  4P2Z A;  2W6I G;  3QO7 A;  1M90 W;  4PA6 A;  3W7S A;  1OCZ B;  2H94 A;  1MSW D;  1W2B U;  3W7W A;  1RM1 C;  1K4D C;  2P90 A;  4PEL A;  1OCR C;  1DTO A;  2JEU A;  3IC7 A;  3OEH G;  1FXK A;  2XAQ A;  1F23 A;  2ATK C;  2XAF A;  1V55 C;  5DN6 G;  3STL C;  1GM7 A;  1PNM A;  1KC8 W;  4GX0 A;  1DF5 A;  4RAI A;  3LDD A;  2B5U A;  1SZT A;  1AJP A;  1E1Q G;  1K9M W;  3SJQ C;  3ASN B;  1NBM G;  3I55 V;  3ABK C;  1M57 B;  2DYS C;  3CXC U;  1S77 D;  2BOC C;  3K0G A;  2XAG A;  2K1E A;  1K8A W;  4QE9 A;  2D3O W;  2NNU A;  3NXS A;  3ZMS A;  1S76 D;  1THZ A;  3OMN B;  2XAJ A;  1Y4M A;  2JIZ G;  2A79 B;  4PA7 A;  1VQL V;  3PJS K;  4LC1 A;  5L3C A;  2DW4 A;  3FYI B;  1PNK A;  1KD1 W;  2X0L A;  5HFL A;  2Q6A A;  5B3S C;  3VBB A;  1B6Q A;  5H6R A;  1DF4 A;  4PDL A;  3EFF K;  4R50 A;  1W0K G;  4GT1 A;  3W7X A;  1F4M A;  4JF3 A;  2JJ1 G;  1QR8 A;  2UXN A;  1OZ0 A;  2ZDI A;  1M56 C;  4MTG A;  4ZBM A;  5IY5 B;  2EIN B;  2P6J A;  4FIP C;  3JD1 A;  3ZIA G;  1XL6 A;  1JOY A;  3OMI B;  1Q7Y W;  1PKX A;  3FYE B;  5HFM A;  3R65 A;  1YIJ V;  5IYD O;  2WLN A;  3GWO A;  2Q67 A;  4KP4 A;  3LSS A;  1GM9 A;  5KA6 A;  1K34 A;  2R9R B;  4MVZ A;  3E8H A;  1R73 A;  3W7T A;  1CPY A;  3STZ C;  3CYO A;  1YTF D;  2A9H A;  4WF9 V;  4MTX A;  4OXS A;  2DWD C;  4WFA V;  1R3K C;  2EIK C;  3ASN C;  5J9P C;  1PNL A;  1JQ0 A;  4P30 A;  5LBQ A;  3IFX A;  3ZRW A;  1K33 A;  4F4L A;  4PDV A;  2OCC B;  3LUT B;  1MOF A;  4HAM A;  3CCU V;  1EZJ A;  2ZR2 A;  2IU0 A;  1JX9 A;  2W6J G;  1V55 B;  2PI4 A;  2CK3 G;  3I56 V;  1E79 G;  1CEZ A;  4HZ3 A;  1LNQ A;  1FXK C;  1IXM A;  1S3J A;  2X6A A;  5CN0 A;  3VOU A;  2LFR A;  2WSS G;  3FB6 C;  3F7V C;  1YTF B;  2WLM A;  2WLH A;  4H33 A;  2B1G A;  4EKW A;  2ZQM A;  4H37 A;  4JAV A;  4CBC A;  4R7C A;  1R6K A;  1XL4 A;  5CBH A;  4X88 A;  3ETG A;  4JAU A;  1KP3 A;  2YSU B;  3ABL B;  3E89 A;  4XBF A;  3JD2 A;  3MHH C;  4QPK A;  2IJI A;  3K9A A;  5LGU A;  5EC1 C;  4ZKI A;  3SPC A;  3T2M A;  4FJC C;  5IY5 C;  4X89 A;  2WLI A;  1PD3 A;  2EIJ B;  1NJI W;  1AI4 A;  1M9N A;  2DQ0 A;  2X7R B;  3SYQ A;  3ZRX A;  2LP7 A;  3H01 A;  3G4S V;  2WWW A;  3ML0 A;  2IJK A;  3SYP A;  1ARO P;  2HG5 C;  5B3S B;  4XDJ A;  5LGN A;  1UJW B;  2H8P C;  3DTU B;  3SYC A;  2LFS A;  1NVP D;  2WLL A;  1AJN A;  3E83 A;  1FFT B;  2IW5 A;  2HFE C;  3OGC C;  4J9Z B;  1F4N A;  1V54 B;  1S0V A;  4R6Z A;  4GX1 A;  2XOK G;  4KFM A;  3SYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...