1NS1A

Rna-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
b'MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILKEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSTRUCTURAL PROTEIN 1
publication title A novel RNA-binding motif in influenza A virus non-structural protein 1.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Nonstructural protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ns1A00
2FKXA 4NXNO 4B3SO 1FJGO 4DR4O 3J80N 4JI8O 4OPHA 1FKAO 4YY3O 1N36O 3O65A 2JRIA 4DUYO 4OX9O 4JI0O 1N33O 4JI1O 4DUZO 1AB3A 1R6TA 1NS1A 2UU9O 5BXZA 1HNXO 4LF8O 4KHPO 4DV7O 1I94O 4DV2O 4GKKO 4X62O 2DJVA 5LMNO 4JV5O 1XMOO 1XMQO 4B3MO 1XEQA 1A32A 4LFCO 5H5NA 4LF9O 4DR3O 1R1BA 5LMUO 1F7YA 5A2QN 4LF6O 2UUCO 4DR1O 1HNZO 3T1YO 1IBLO 4DV4O 1IBKO 4X65O 4A5UB 1XNRO 4DV6O 3M8AA 4LF7O 5BY1A 3T1HO 2F4VO 3OTOO 4DV1O 4DR6O 1HR0O 4NXMO 5BR8O 1HNWO 5IT9N 4JI5O 4B3RO 1N32O 1FYJA 3JAMN 1N34O 2ZKOA 2UUAO 5LL6Y 5FLXN 2ZM6O 4OPAA 4JI6O 5IWAO 4B3TO 4DR7O 4JI4O 4LF4O 3R66A 4LFBO 2Z0AA 4YHHO 2N74A 2AGAA 4LF5O 4JYAO 2UUBO 1G1XB 4DV3O 2HHHO 1YZBA 3RT3C 3J81N 1X59A 4JI7O 2E5LO 1AILA 2UXDO 2LW7A 4GKJO 4DR5O 2UXBO 4DR2O 2UXCO 1XNQO 1D2DA 3J7AU 3SDLA 4AQYO 2VQEO 2DOSA 4DV0O 4X64O 1J5EO 4K0KO 3F5TA 4LFAO 1KUQA 4JI3O 1IBMO 4X66O 4DV5O 2VQFO 4JI2O 1DK1A
chains in the Genus database with same CATH superfamily
4LWSA 1WA8A 3N27A 4CC5A 2Q73A 4JI8O 2CDYA 1N34B 5L3DA 2ZNJA 1Y4MA 4UV8A 3ZRWA 1Z5VA 1AP6A 4PHZA 2PY5A 4NTXA 5JCOA 4W4LA 3W7TA 3FX7A 1R6TA 4DRXB 2CUGA 5B1BB 5BXZA 3B8MA 3MHSC 4GX0A 2JIZG 4X20B 3SYPA 2LQTA 2WSSG 5LMNO 5EK0A 2HJFC 2LGWA 2WLLA 3JALA 4YXWG 1EZJA 3K08A 1LR1A 1IZ3A 4J7JA 2P67A 1Q6HA 4JI2B 5EIBD 1K73W 4DO2A 3LSUA 1IBKO 2OIGA 1DTOA 3LUTB 3G6EV 4UXNA 1VQ4V 1VQ5V 3I55V 1MOFA 2RDCA 4X1IA 5EBWC 3DGEA 2ZM6O 4FFBB 2N74A 4I50B 2UUBO 4DV3O 1H2MA 1UFIA 2R9RB 3SYOA 3G4SV 4XDJA 4JAUA 2CTPA 3DC6A 1M90W 1Q7YW 1MABG 1SA0B 4DR5O 1WP8A 3C3SA 3FB8C 2DOSA 3CCSV 2CTWA 2DN9A 3CSXA 3IFXA 3APOA 2A3QA 5LOVA 1OCZB 1ZWIC 1TVKA 1Q81W 3RVZA 3GB7C 4U3JA 2JS3A 1YITV 4LF6B 1IBLB 2VWJA 3BEHA 5K1XA 4DV6B 3RYFB 2AXTZ 3L73H 4R6ZA 1KYOF 3OTOB 4X8AA 5DECA 4DR6B 2AZ0A 1S5HC 3UO2A 4X62O 1I7FA 3MAQA 3WU2Z 3ZHRA 3VOUA 2EJRA 1GM9A 3JATA 1YHQV 1VARA 4UUJC 2L35A 5LYJB 4K0KB 5EYPA 1NZ6A 2WLJA 4JYAB 1TAEA 1HNZO 5GTHZ 1AI7A 5B1NA 4GLXA 3E22B 4NYKA 2IM9A 4LNUB 1THZA 2OWOA 2DMXA 3CCQV 5EBMC 2ZE6A 5K1PA 4AI8A 4MTXA 2ZKOA 2W0FC 3ZMSA 2YI9A 1QVGU 3RBZA 2EILC 3OW2U 2V1DA 4DR7O 2Z0AA 3PN1A 5JQGA 3RT3C 4JAVA 1DGSA 3DXRB 4I0XB 2RQ6A 4BW5A 1PPJH 3ASOC 5LGNA 1NVPD 2E3CA 4HNAA 1KBHA 2UUCB 1RM1B 4NTWA 1K3EA 3JAKB 1NTKH 4J41A 1G4YB 2KQXA 2P90A 2XASA 2EIKB 4LFAO 3JARB 4JZGA 4JI3O 4GKKB 2BCCH 5KHHA 2VQFO 3UQ8A 2JGDA 2E76B 4FLXA 3ZHVA 3TXQA 4B3SO 4DK0A 2MK3A 1WA8B 3VQXA 4D7TA 3K58A 5A9GA 2X6CA 1ZSPA 5LMUB 3LDCA 5BZBA 4OX9O 1MA1A 3ZRWB 2MW2B 5GONA 3BABA 3CX5F 1GKFA 4PI2A 4EEQA 1FFTB 1NQTA 2HLDG 1VF6C 1AJQA 4LFCO 1K9MW 4KXRA 1FPOA 2WLLB 2OYQA 2IH1C 2Y0PA 3JCZA 3SPCA 2YUAA 3L72H 4LH6A 1N0JA 1SQPH 1EBOA 4TT3G 1KU9A 3A8TA 1U96A 4I7ZB 3E83A 4FLWA 4UCRA 1Q90D 3CRCA 5BR8O 1FAFA 3RW0A 4EB6B 1L0LH 3JAMN 1FFXA 1K5SA 3OMNB 1WJZA 1FXKC 1O9GA 2GTAA 2OCCB 3C90A 4PDLA 2XUMA 3AG1B 4ZI7B 3ABTA 4O4IB 4J7ZA 2LW7A 2OIEA 4Z1VA 3ABKB 2JJ2G 2DWDC 4GKJO 4FLTA 1GAXA 1XILA 2GSMB 1XNQO 4ZIBA 4I55A 2Y48A 5LHGA 2AHZA 3K9AA 2QWPB 5LBQA 2Q4PA 3RFRA 3N2KB 3H01A 1ZAUA 3DC5A 4CH4A 2N05A 1N4CA 4LF9B 2ZNIA 3HKEA 2FTKA 2G38A 3HPLC 4ZBMA 3TETA 5LOVB 4YY3O 1QLNA 3E8HA 3K0GA 4MSWC 4U3JB 4WBNA 3ABUA 3S3WA 5CA3A 4BAYA 3UM7A 5FL7G 1XNRB 4K8XA 3TCUA 1NT2B 1B3QA 2WAMA 4JGSA 4B7EA 4IIJA 4DK1A 4UCTA 3M7MX 4X9QA 5TISZ 2JS5A 2IJHA 5H5NA 4RUEA 1WB7A 3JSNA 1MZFA 2W6IG 5ITZA 3JATB 5IWAB 2ZT9B 2EBOA 4DRXA 2QSAA 3FYEB 4HAMA 1SQBH 2DQ0A 3IC7A 5EZYA 5EYPB 3M8AA 4RO2A 2OCHA 1R6NA 1B6QA 1WN7A 1WLEA 5IJ0A 2Q69A 1EZVH 4CZZA 3DSQA 4F4LA 4UCUA 2OT5A 3I56V 3E89A 1PD3A 2VRZA 3RVYA 4YHHO 1S3JA 1SS3A 3FB7C 5JQGB 1H2GA 1VQOV 2QM7A 1HDJA 4J80A 1WPXA 4B08A 2YEVA 1N8RW 3SGIA 2UXBO 2DYSC 4Q6GA 3SPGA 3CC7V 4HNAB 2CGNA 1K7DA 4KHPB 2AHYA 1XL6A 1XHXA 4DV2B 1J5EO 2B1GA 5L3FA 2P06A 3EFFK 4UB6Z 3QF7A 4E4EA 3U10A 4TWKA 2AW9A 4JV5B 1XMOB 1JA8A 4IL6Z 3CC4V 2JGDB 1Q43A 1SERA 2CE4A 4PA6A 3HKDA 1SA0A 1GK9A 3UCSC 1PV0A 4O4LA 2LFRA 3VQVA 4JI4B 4O2BA 3AK3A 1K92A 2R70A 3K04A 4I5SA 4ZOLA 4R7CA 3VBBA 1HNXO 1NBMG 3ZRSA 1JMKC 4QPJA 3PJSK 2A0LA 5GONB 5L3BA 3D3IA 4JF3A 1E79G 4LCUC 3ABLC 4MT8A 1FXKB 3W7WA 1AVMA 4WFFA 4IYHA 2ZCEA 4DYLA 3TXSA 1P49A 4O4JB 4DR1O 1H8HG 1LUWA 1VP7A 2DWEC 1COWG 1I5YA 1NH2B 2R9AA 1VQKV 2ZXWB 3QTCA 4FJCC 1ZLZA 2IU0A 2P4VA 5C8YA 2EINB 2NN4A 5LYJA 3O9OA 1S72V 2ZE7A 2BTOA 3WFVA 5B3SC 5LA6A 2RN9A 1Y67A 2BOCC 2Q6AA 4MW8A 1FFXB 2YXLA 1H38A 1ZX3A 2P5OA 3E22A 1JVMA 3K5MA 4ICGA 1FS0G 3S3XA 3JD3A 4TOIA 1F23A 4FPPA 2YSUB 1PKXA 4GX5A 1JPXA 2UXDO 1BZKA 1K4DC 3R65A 3ZN1A 1VQMV 3CJHA 1QCEA 1K4CC 3T1YB 3QVNA 1Q8IA 3ABMC 3NXSA 5IDJA 1I94B 2VQEO 4I55B 1PNMA 3F5WC 1XI1A 3RYIA 3E86A 4DV5O 4UCOA 4PJ0Z 2GTSA 1XDCA 1SQVH 2Q7GA 3WB1A 1BHBA 2IBZH 3DXRA 1HR0B 1S5LZ 1OCOC 1ZUQA 4E2LA 5KMGA 3K79A 3JYCA 4OPHA 5KAFZ 3HKEB 3OEHG 4JI0O 1Q6UA 4GYCB 3CCEV 3BAAA 2EIMC 4DV7O 3G80A 3STZC 4I9WA 3CCJV 5CA0A 4RQEA 1B04A 4FLZA 2QM8A 1HNWB 4IIJB 1S0VA 1N32B 1YTFB 1QR8A 3K5OA 3ASNC 1OCCB 3GWOA 4L87A 1KECA 2KKWA 5DN6G 5IJ9A 3MDSA 3ZBHA 5ITZB 3F7VC 4FM0A 4WFEA 4X1KA 3ZHSA 5BMVB 2HHHB 3BA9A 2GHYA 4GZRB 5EZYB 4MVQA 2IW5A 1SQGA 2F4VO 2FL4A 3E8FA 1CEZA 5IJ0B 3SJBC 1FYJA 3ETQA 1GN2A 1JX9A 3N2GB 4X66B 3K57A 1HWYA 3IJ4A 4IYIA 3R66A 3CEIA 4FM1A 3JASA 2IH3C 5GTIZ 2HVJC 1E1RG 3UT5B 1SRYA 4EB6A 2NLJC 1M57C 1Y74A 2XT9A 3SYQA 1BE3H 2YEVB 3LDEA 2GBOA 3ZMTA 1IBKB 3K0DA 4PV1B 1NU1H 4DW0A 5J2TA 1BQ0A 2HEPA 3K03A 5EIBC 1F4MA 3JSLA 1M5IA 3CXHF 2PYJA 1SETA 4ZI7A 4O4IA 2IJJA 2YICA 1Z2GA 2KB1A 1Q6IA 5CBFA 3OMAB 3SJQC 3HKDB 4I9QA 3CCUV 1US6A 3OUFA 4FVMA 4O4LB 4WFBV 4DV4B 3AG7A 3BA8A 1JJ2U 4YJ2B 4X1YA 4O2BB 4ZOLB 3N2KA 1VEWA 1YJWV 1PNLA 1TA8A 4FLVA 3ZHTA 4RWUA 4DR5B 4JI5B 1GTOA 4DXWA 4QIWF 1QLEC 4H13B 3THOA 5IE9A 4B3TB 3H1KH 1DLBA 1F7YA 2XAQA 4LFBB 4LF5B 2QWQB 1H2NA 4LF6O 1IBLO 5LXTA 2F66C 2HJDA 4HZ3A 4G27B 4JTDB 2E5LB 4DV6O 4KP4A 3OTOO 4UVAA 3ABMB 4DR6O 1Q3EA 1K5QA 3OR7C 5C8YB 1VQ8V 4JAAA 5J2UB 4MVSA 4J10A 1I5XA 1AI6A 1GN6A 3OT7A 2JGUA 1OCOB 5LA6B 1XL4A 4JYAO 1URFA 2PYLA 4DR4B 5JVDB 3TK1A 2Q68A 1YJNV 2UXNA 1QNMA 1VQ9V 3RYHA 3B09A 1KP3A 2EIMB 1N33B 4DUZB 3CJHB 2QA4V 2QWNB 3H1LH 5J9PC 2UU9B 3A0RA 1PL0A 3L75H 3QO5A 4WFGA 3ZRXA 4GX2A 4Z1MG 3D36C 3AG4C 1KKCA 3ASNB 3RYIB 1XMQB 1CPYA 2X0LA 3STLC 1N0NA 1WNSA 4DR3B 3ZX6A 3QG5A 5KMGB 1CP9A 3GWKC 4DR7B 2EJ7A 3VQYA 3KCXA 1BSMA 1VF6A 3SPIA 2LJ2A 4LP8A 1VQ7V 1M1KW 1SC5B 3BHPA 1XBLA 4GKKO 1AI4A 1D5NA 4MTGA 4CS3A 5CA0B 1M56C 2CH7B 4D7SA 3CCMV 2UUAB 1H2KA 2WA3A 4JI6B 1ROPA 2GV9A 5LMUO 1JR9A 4HBNA 2VQFB 4LBEC 5IJ9B 2YXHA 1YJ9V 3SYAA 4A5UB 3OM3B 4X1KB 2HVKC 3BRCA 3CMEV 2QGNA 1FXKA 1TUBA 3FAVA 1S5JA 4MS2A 2ZE8A 1SESA 4ABMA 5IT9N 2LFSA 1B06A 4H33A 1QQCA 4AILC 1VQNV 4O4JA 5LL6Y 3JD0A 1IBMB 3I5DA 4EFBA 3RGBA 2Q7HA 1ZL8A 1IXMA 5FPOA 1JFFA 2DYRC 4JYBA 4NXNB 4O2AA 1GO3F 1BCCH 1AILA 3JASB 3DTUB 4CH3A 2D2CB 4JI1B 3SR2C 4LR3A 2HR3A 1Y74B 1G8MA 4WFHA 4MVZA 2FMLA 3SYCA 4MTOA 2DW4A 3JAWA 1NKDA 2R72A 3ZN0A 5J2TB 2WLIA 4FZ1A 1SZXA 4KL1A 3MHHC 1DK1A 3HKCA 2VS0A 2HG5C 1X4TA 3QO7A 5B1AC 2Y4TA 2Q8VA 1UJWB 1FKAO 2YIBD 5IYDO 5AG2A 1IX9A 4CBCA 2H94A 2XOKG 2PZSA 4FIPC 1AB3A 3LNMB 4CS4A 4X1YB 1IVSA 2ZIOA 1QHTA 4DV1B 3CRRA 1W0JG 2RNBA 1KC8W 2M6YA 1IURA 2XAHA 3K06A 4LF9O 2F43G 1Q86W 2QTSA 5FNVA 1KP2A 3P3PA 4P9OA 2PI4A 4NB5A 4F6EA 3OE7G 4XDLA 2O57A 3Q4HA 3LNNA 5LXTB 5D5PA 1R3IC 3OR6C 1XNRO 3ZIAG 4JI7B 1Q5OA 4N23A 5LP6C 1AR4A 3IGAC 1Y66A 2F95B 1BMFG 4U3FH 2NNUA 2EILB 4H44B 1QR9A 5F2VO 1RP3B 5IYCO 5CN0A 1NJIW 2YIAA 5BMVA 4B7KA 5IWAO 4TQFA 2B5UA 1PM9A 3ASOB 4JTCB 1G1XB 3HB3B 3J81N 4J9ZB 1N36B 4G28B 1VF7A 3OMIB 4NR1A 4DUYB 1WAZA 5B66Z 2B9ZA 3RYHB 4JZ2A 3CB2A 1JQ0A 3N2GA 4UVBA 3J7AU 3AEIA 2YC0A 1M56B 1R3KC 1BL8A 4X89A 1NVPB 2ATKC 3X2QC 4B3MB 3AG2C 4JTAB 3UT5A 4J7KA 4FZ0A 1AR1B 3B8NA 1XOUA 2Q67A 2RJZA 4BIZA 1VIBA 1LUVA 5H2FZ 3B2EE 1XREA 1QVFU 4X65B 3ETGA 4X88A 3T1CA 1MSWD 3CD6V 4KHPO 1BGYH 3H1HH 4QJFB 4LF7B 4DV2O 1UPGA 3T1HB 1KMIZ 3L70H 1M4UA 5LGUA 1WPBA 1RPOA 1GN3A 4JV5O 1XMOO 3EXAA 2FYUH 1K8AW 1A32A 1I0HA 4O4HB 2QEXV 2RMKB 1J5EB 5E1AC 4YJ2A 3WB0A 4LF4B 3EVKA 2BTQA 2BOBC 1VF5B 3FB5C 4BIUA 2LW1A 2QWRB 3T2MA 3W7XA 3A2FA 1TUBB 3FAVB 1BS3A 3B4SA 4AHCA 1VMGA 5EC2C 4DV0B 4G2KA 3A0BZ 1KB9F 4YIOA 2ADQB 3W7SA 5C93A 2AGAA 1ZL8B 1FJGB 1JFFB 4O2AB 2PF4E 5JJEB 1BT8A 5HFLA 2QM4A 1MNGA 2EX3A 4LC1A 5J2UA 3OGCC 1KQSU 1IXBA 3ZRVA 4DR1B 4MTFA 3U11A 4H0LB 4LF8B 1HP8A 2ZIMA 3SDLA 1W2BU 5JVDA 3CYOA 3JAWB 1BQZA 2PI5A 2WLIB 3ZJZA 2N04A 2GUZA 3HKCB 4YJ3A 2Y0IA 1Y76A 4QE9A 3QO8A 3MD0A 5LP6B 1AJNA 1OCZC 1OHHG 1VQ6V 4GUNA 2XAFA 1I94O 3ETEA 2ZDIC 4K35A 2WLKA 1GM7A 1PP9H 4NVPA 1J95A 4NXMB 1AJPA 3CWBH 4B3RB 2ODMA 4JYYA 3ZEDA 1M93A 3E35A 4MW3A 1V55C 4PA7A 1TUEB 5FNVB 2Y69C 3RYCB 1F4NA 2X6BA 3AG3C 3CP1A 1SQQH 3BY6A 1K34A 2BSKA 3Q4HB 3K3WA 3ML0A 2A79B 3C3TA 1EFRG 1V54C 1SZTA 2CH7A 3E2EA 1YF2A 4DR2B 2UXCB 1HNWO 1N32O 1V9PA 1N34O 4AQYB 4EFEA 3X2QB 4X64B 5HFMA 3AG2B 4H37A 4JYCA 4DV7B 2ZR2A 3AK1A 2JJ1G 1G6UA 1FD9A 4MVMA 2HHHO 4JI8B 2DYSB 1KKDA 2Q5ZA 2F23A 2ADPA 3ETDA 1R3JC 1RFYA 5CMUA 4UB8Z 3UO3A 2P22C 1GMGA 1NTMH 4X66O 1RM1C 2F4VB 4GT1A 4JI2O 5LMNB 1D5AA 4U7OA 3WG7C 3OEEG 4GX1A 4I4TA 2EIKC 1Y6XA 1SQFA 2Z5UA 1YIJV 2EZOA 1Z5WA 3B77A 2E74B 5KA6A 1F51A 3CCRV 4P9PA 5KX5A 3FYIB 3ABLB 3K59A 3CRAA 3G67A 4TV8A 3SPHA 1JJOA 2DE0X 2W0XA 5JCOC 1S76D 2WA4A 1S77D 2CAZC 2NR5A 2ZM6B 1MSDA 4TUYA 1ZTEA 3M99B 2UUBB 4DV3B 4K8ZA 4DV4O 3KG2A 3KCYA 5IY5C 3FB6C 2BTQB 2CGOA 3GVMA 3BCCH 1VQLV 4N21A 5B3SB 3CXCU 1Q82W 2XTAA 1JCHA 4RUFA 4JI5O 3ZMVA 1AR5A 2QKAA 2WWWA 3E8BA 4ZHQA 4B3TO 1P7BA 4Q20A 2JEXA 4LFBO 4LF5O 3D3QA 4RAIA 1X59A 1IDSA 5L3EA 2E5LO 2OCCC 3HKBA 1RSOA 1VQPV 3D36A 2W6JG 4PA4A 1WB8A 3AG1C 1NTZH 2A7WA 3G71V 4PI0A 2P6JA 1H2LA 3ABKC 4BWAA 5B5EZ 4K0KO 2KSDA 1KUQA 5JH7A 4X62B 4UCSA 1P84F 3TGUH 2H8PC 4XDKA 5DM6V 5DEDA 4ZKIA 1MMMA 4DR4O 1V55B 4IHJB 2Y69B 1T5EA 2P7TC 5L3CA 5KHIA 1PL4A 2GUZB 4FFKA 4YJ3B 1OCRC 3ICXA 3AG3B 3O65A 2YIDA 1Y76B 5H9CA 1HNZB 1N33O 2V4DA 4DUZO 1V54B 2UU9O 4TSFG 4CH5A 3OFNG 5KHKA 4TV9A 5EC1C 5IYZA 5JJNB 1EN5A 1XMQO 2ITCC 1KD1W 4WCEV 4GCZA 4EKWA 5KLVH 3SJAC 3SJCC 4DR3O 5LGTA 1YI2V 5A2QN 2UUCO 5L3GA 1BHAA 1FXHA 2CTQA 4TQDA 5LHHA 4YIPA 2EIJC 1L8DA 2BSKB 5BY1A 1NR7A 3BFRA 2KG7B 3K9SA 1SQXH 4UCVA 4O4HA 1W59A 4PD4F 3FD9A 2UUAO 4LFAB 3WG7B 4JI3B 3W7UA 4OPAA 4JI6O 4PA9A 2QTOA 3LDDA 3ZMUA 4B3SB 5LHIA 3G6BA 1M57B 1RPRA 4LWSB 5CA1A 4F6RA 3T4DA 3LSQA 3BPZA 2Y4UA 4OX9B 3SPJA 3HR0A 5JJJB 5FPRA 5KHJA 1JOYA 1L0NH 2HKOA 3T4ZA 4C7UA 5CB4A 1IBMO 3IAYA 4HYOA 4PELA 2FKXA 2L6LA 2XAGA 4NXNO 4LFCB 2QDOA 4WFAV 4I4TB 2PUSA 5IY5B 2PTMA 3JALB 2JRIA 3L71H 4JI1O 3ZHQA 4J42A 3F7YC 1SF9A 4W4KA 3P3NA 2H3OA 4UVCA 3CC2V 4P30A 4QE7A 2YIBA 2BE3A 4JPRA 1QLEB 1AP5A 5KX5B 2JK5C 1OZ0A 1OV9A 4TV8B 5BR8B 5IYBO 4K3AA 1SKVA 2FB5A 1NH2D 2E75B 1I08A 4FLYA 2ILMA 5LP6A 2QR4A 4RQFA 5JWPA 3LSSA 1EM1A 2B1IA 2DQ3A 4X1IB 3K5LA 4TUYB 2QWOB 3CRMA 5H6RA 4KUMA 3FKSG 4WF9V 3K5NA 4FK5C 2XNDG 2LP7A 3JD2A 2HFEC 4DV1O 1MG1A 2Q9LA 1P4RA 4GKJB 1LNQA 4UFZA 1XNQB 2ZXWC 3L74H 2EULA 4IT5A 5KUMA 2C2AA 3RYCA 4JASA 2EINC 5FLXN 1YXBA 2YDEA 4ZHQB 2YXYA 1GM8A 1OCRB 2CTRA 3ZMZA 1YDXA 3E8GA 4JI7O 4YY3B 5KUKA 4QPKA 2F93B 4U7NA 3OGIB 4J11A 3HKBB 1RSOB 3JCUZ 4OXSA 1ORQC 1TVKB 3AG4B 1D2DA 1GH6A 2K1EA 2Q7EA 3CE2A 4BIOA 3CPWU 2UXXA 3F5TA 3H1IH 1GN4A 4P2ZA 4CC6A 3UKMA 5JH7B 1YVWA 2EZPA 4J9YB 2JVDA 2WLHA 3D8CA 3J80N 2QKCA 2ARHA 1EN6A 3KZIZ 1N36O 2ETNA 1O9HA 4R8CA 4DUYO 3P32A 2EIJB 1YTFD 3H9VA 2IJKA 1NS1A 3VQWA 4X20A 1XQ8A 3CCVV 2V7QG 2ZD9A 2DJVA 2LO1A 4PA3A 3ZS8C 1EN4A 4TV9B 4B3MO 3QNEA 4NKGB 3ZCCA 5IYZB 1XEQA 1YEWA 5KHGA 3IC9A 1HW7A 1R1BA 1QBZA 3B40A 2QKSA 3A0HZ 4YHHB 2LGQA 3BVOA 4KFMA 1OCCC 1W0KG 4X65O 3JD1A 2K9PA 4LF7O 1NR1A 3T1HO 2A06H 5B1BC 3KKYA 4NTYA 4PDVA 2UXBB 4FMTA 2M7WA 2JDIG 2F1MA 2DYRB 1L1FA 5D5QA 3APQA 5CBHA 4LH7A 4FFBA 1FXVA 2VWKA 2IU3A 4I50A 2GDSA 4JI4O 4LF4O 2CK3G 3RWRD 1PNKA 2ZE5A 3L9DA 2WLNA 3JD4A 2X6AA 3OAAG 5KAIZ 4CH6A 1P7GA 5CA1B 1R3LC 4PDMA 4F6RB 3ZHUA 4PDRA 1HNXB 1WP7A 5EBLC 4DV0O 4QNHB 3U0ZA 5B1AB 5CB4B 4IGGA 3AK2A 1FJGO 4MVOA 4BR6A 5H6QA 2ZDIA 2PGGA 1H2SB 3RYFA 3OD4A 1ENVA 3NR7A 4LF8O 4UV9A 2ZINA 5GW7A 4MVUA 1M9NA 5KA5A 3TJTA 4IHJA 4OGQB 2XHBA 3CRQA 2XAJA 1K33A 2X7RB 4QGPA 2QE7G 2ZR3A 3WB2A 1NI8A 3RN4A 3CHXA 4L8JA 1CXZB 2WLMA 4CS2A 1OJHA 3T1YO 4DW1A 1R73A 4LNUA 2UXDB 4R50A 5E79Z 4BW9A 2OTJV 1U97A 2QJ1A 3EHBB 1HR0O 4NXMO 2IJIA 5B1OA 1GRJA 1K97A 4B3RO 2RCVA 2ITDC 3OTFA 1DF5A 2VQEB 1AROP 1R6KA 1H8EG 3CMAV 4DV5B 4D6TH 3H1JH 4MVRA 5CBGA 1XUQA 4FM2A 1YCIA 2HP8A 2P4KA 1YZBA 4I0XA 2R9IA 2Z3YA 3CCLV 2KG7A 2Q0OC 3OUSA 2YS8A 3CS5A 2WPDG 1AI5A 1QU7A 4JI0B 4Z2WA 3JAKA 3P30A 2ZQMA 4DR2O 2UXCO 1MZEA 1DF4A 1TGOA 4WBNB 2JEUA 2YI8A 2A9HA 3JARA 4XBFA 2OTLV 4AQYO 4X64O 3FFQA 2AZ2A 2Q0AA 4FLUA 1YSCA 4ASUG 1E1QG 1XHZA 2D3OW
chains in the Genus database with same CATH topology
2FKXA 4NXNO 4B3SO 1FJGO 4DR4O 3J80N 4JI8O 4OPHA 1FKAO 4YY3O 1N36O 3O65A 2JRIA 4DUYO 4OX9O 4JI0O 1N33O 4JI1O 4DUZO 1AB3A 1R6TA 1NS1A 2UU9O 5BXZA 1HNXO 4LF8O 4KHPO 4DV7O 1I94O 4DV2O 4GKKO 4X62O 2DJVA 5LMNO 4JV5O 1XMOO 1XMQO 4B3MO 1XEQA 1A32A 4LFCO 5H5NA 4LF9O 4DR3O 1R1BA 5LMUO 1F7YA 5A2QN 4LF6O 2UUCO 4DR1O 1HNZO 3T1YO 1IBLO 4DV4O 1IBKO 4X65O 4A5UB 1XNRO 4DV6O 3M8AA 4LF7O 5BY1A 3T1HO 2F4VO 3OTOO 4DV1O 4DR6O 1HR0O 4NXMO 5BR8O 1HNWO 5IT9N 4JI5O 4B3RO 1N32O 1FYJA 3JAMN 1N34O 2ZKOA 2UUAO 5LL6Y 5FLXN 2ZM6O 4OPAA 4JI6O 5IWAO 4B3TO 4DR7O 4JI4O 4LF4O 3R66A 4LFBO 2Z0AA 4YHHO 2N74A 2AGAA 4LF5O 4JYAO 2UUBO 1G1XB 4DV3O 2HHHO 1YZBA 3RT3C 3J81N 1X59A 4JI7O 2E5LO 1AILA 2UXDO 2LW7A 4GKJO 4DR5O 2UXBO 4DR2O 2UXCO 1XNQO 1D2DA 3J7AU 3SDLA 4AQYO 2VQEO 2DOSA 4DV0O 4X64O 1J5EO 4K0KO 3F5TA 4LFAO 1KUQA 4JI3O 1IBMO 4X66O 4DV5O 2VQFO 4JI2O 1DK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKX A;  4NXN O;  4B3S O;  1FJG O;  4DR4 O;  3J80 N;  4JI8 O;  4OPH A;  1FKA O;  4YY3 O;  1N36 O;  3O65 A;  2JRI A;  4DUY O;  4OX9 O;  4JI0 O;  1N33 O;  4JI1 O;  4DUZ O;  1AB3 A;  1R6T A;  1NS1 A;  2UU9 O;  5BXZ A;  1HNX O;  4LF8 O;  4KHP O;  4DV7 O;  1I94 O;  4DV2 O;  4GKK O;  4X62 O;  2DJV A;  5LMN O;  4JV5 O;  1XMO O;  1XMQ O;  4B3M O;  1XEQ A;  1A32 A;  4LFC O;  5H5N A;  4LF9 O;  4DR3 O;  1R1B A;  5LMU O;  1F7Y A;  5A2Q N;  4LF6 O;  2UUC O;  4DR1 O;  1HNZ O;  3T1Y O;  1IBL O;  4DV4 O;  1IBK O;  4X65 O;  4A5U B;  1XNR O;  4DV6 O;  3M8A A;  4LF7 O;  5BY1 A;  3T1H O;  2F4V O;  3OTO O;  4DV1 O;  4DR6 O;  1HR0 O;  4NXM O;  5BR8 O;  1HNW O;  5IT9 N;  4JI5 O;  4B3R O;  1N32 O;  1FYJ A;  3JAM N;  1N34 O;  2ZKO A;  2UUA O;  5LL6 Y;  5FLX N;  2ZM6 O;  4OPA A;  4JI6 O;  5IWA O;  4B3T O;  4DR7 O;  4JI4 O;  4LF4 O;  3R66 A;  4LFB O;  2Z0A A;  4YHH O;  2N74 A;  2AGA A;  4LF5 O;  4JYA O;  2UUB O;  1G1X B;  4DV3 O;  2HHH O;  1YZB A;  3RT3 C;  3J81 N;  1X59 A;  4JI7 O;  2E5L O;  1AIL A;  2UXD O;  2LW7 A;  4GKJ O;  4DR5 O;  2UXB O;  4DR2 O;  2UXC O;  1XNQ O;  1D2D A;  3J7A U;  3SDL A;  4AQY O;  2VQE O;  2DOS A;  4DV0 O;  4X64 O;  1J5E O;  4K0K O;  3F5T A;  4LFA O;  1KUQ A;  4JI3 O;  1IBM O;  4X66 O;  4DV5 O;  2VQF O;  4JI2 O;  1DK1 A; 
#chains in the Genus database with same CATH topology
 4LWS A;  1WA8 A;  3N27 A;  4CC5 A;  2Q73 A;  4JI8 O;  2CDY A;  1N34 B;  5L3D A;  2ZNJ A;  1Y4M A;  4UV8 A;  3ZRW A;  1Z5V A;  1AP6 A;  4PHZ A;  2PY5 A;  4NTX A;  5JCO A;  4W4L A;  3W7T A;  3FX7 A;  1R6T A;  4DRX B;  2CUG A;  5B1B B;  5BXZ A;  3B8M A;  3MHS C;  4GX0 A;  2JIZ G;  4X20 B;  3SYP A;  2LQT A;  2WSS G;  5LMN O;  5EK0 A;  2HJF C;  2LGW A;  2WLL A;  3JAL A;  4YXW G;  1EZJ A;  3K08 A;  1LR1 A;  1IZ3 A;  4J7J A;  2P67 A;  1Q6H A;  4JI2 B;  5EIB D;  1K73 W;  4DO2 A;  3LSU A;  1IBK O;  2OIG A;  1DTO A;  3LUT B;  3G6E V;  4UXN A;  1VQ4 V;  1VQ5 V;  3I55 V;  1MOF A;  2RDC A;  4X1I A;  5EBW C;  3DGE A;  2ZM6 O;  4FFB B;  2N74 A;  4I50 B;  2UUB O;  4DV3 O;  1H2M A;  1UFI A;  2R9R B;  3SYO A;  3G4S V;  4XDJ A;  4JAU A;  2CTP A;  3DC6 A;  1M90 W;  1Q7Y W;  1MAB G;  1SA0 B;  4DR5 O;  1WP8 A;  3C3S A;  3FB8 C;  2DOS A;  3CCS V;  2CTW A;  2DN9 A;  3CSX A;  3IFX A;  3APO A;  2A3Q A;  5LOV A;  1OCZ B;  1ZWI C;  1TVK A;  1Q81 W;  3RVZ A;  3GB7 C;  4U3J A;  2JS3 A;  1YIT V;  4LF6 B;  1IBL B;  2VWJ A;  3BEH A;  5K1X A;  4DV6 B;  3RYF B;  2AXT Z;  3L73 H;  4R6Z A;  1KYO F;  3OTO B;  4X8A A;  5DEC A;  4DR6 B;  2AZ0 A;  1S5H C;  3UO2 A;  4X62 O;  1I7F A;  3MAQ A;  3WU2 Z;  3ZHR A;  3VOU A;  2EJR A;  1GM9 A;  3JAT A;  1YHQ V;  1VAR A;  4UUJ C;  2L35 A;  5LYJ B;  4K0K B;  5EYP A;  1NZ6 A;  2WLJ A;  4JYA B;  1TAE A;  1HNZ O;  5GTH Z;  1AI7 A;  5B1N A;  4GLX A;  3E22 B;  4NYK A;  2IM9 A;  4LNU B;  1THZ A;  2OWO A;  2DMX A;  3CCQ V;  5EBM C;  2ZE6 A;  5K1P A;  4AI8 A;  4MTX A;  2ZKO A;  2W0F C;  3ZMS A;  2YI9 A;  1QVG U;  3RBZ A;  2EIL C;  3OW2 U;  2V1D A;  4DR7 O;  2Z0A A;  3PN1 A;  5JQG A;  3RT3 C;  4JAV A;  1DGS A;  3DXR B;  4I0X B;  2RQ6 A;  4BW5 A;  1PPJ H;  3ASO C;  5LGN A;  1NVP D;  2E3C A;  4HNA A;  1KBH A;  2UUC B;  1RM1 B;  4NTW A;  1K3E A;  3JAK B;  1NTK H;  4J41 A;  1G4Y B;  2KQX A;  2P90 A;  2XAS A;  2EIK B;  4LFA O;  3JAR B;  4JZG A;  4JI3 O;  4GKK B;  2BCC H;  5KHH A;  2VQF O;  3UQ8 A;  2JGD A;  2E76 B;  4FLX A;  3ZHV A;  3TXQ A;  4B3S O;  4DK0 A;  2MK3 A;  1WA8 B;  3VQX A;  4D7T A;  3K58 A;  5A9G A;  2X6C A;  1ZSP A;  5LMU B;  3LDC A;  5BZB A;  4OX9 O;  1MA1 A;  3ZRW B;  2MW2 B;  5GON A;  3BAB A;  3CX5 F;  1GKF A;  4PI2 A;  4EEQ A;  1FFT B;  1NQT A;  2HLD G;  1VF6 C;  1AJQ A;  4LFC O;  1K9M W;  4KXR A;  1FPO A;  2WLL B;  2OYQ A;  2IH1 C;  2Y0P A;  3JCZ A;  3SPC A;  2YUA A;  3L72 H;  4LH6 A;  1N0J A;  1SQP H;  1EBO A;  4TT3 G;  1KU9 A;  3A8T A;  1U96 A;  4I7Z B;  3E83 A;  4FLW A;  4UCR A;  1Q90 D;  3CRC A;  5BR8 O;  1FAF A;  3RW0 A;  4EB6 B;  1L0L H;  3JAM N;  1FFX A;  1K5S A;  3OMN B;  1WJZ A;  1FXK C;  1O9G A;  2GTA A;  2OCC B;  3C90 A;  4PDL A;  2XUM A;  3AG1 B;  4ZI7 B;  3ABT A;  4O4I B;  4J7Z A;  2LW7 A;  2OIE A;  4Z1V A;  3ABK B;  2JJ2 G;  2DWD C;  4GKJ O;  4FLT A;  1GAX A;  1XIL A;  2GSM B;  1XNQ O;  4ZIB A;  4I55 A;  2Y48 A;  5LHG A;  2AHZ A;  3K9A A;  2QWP B;  5LBQ A;  2Q4P A;  3RFR A;  3N2K B;  3H01 A;  1ZAU A;  3DC5 A;  4CH4 A;  2N05 A;  1N4C A;  4LF9 B;  2ZNI A;  3HKE A;  2FTK A;  2G38 A;  3HPL C;  4ZBM A;  3TET A;  5LOV B;  4YY3 O;  1QLN A;  3E8H A;  3K0G A;  4MSW C;  4U3J B;  4WBN A;  3ABU A;  3S3W A;  5CA3 A;  4BAY A;  3UM7 A;  5FL7 G;  1XNR B;  4K8X A;  3TCU A;  1NT2 B;  1B3Q A;  2WAM A;  4JGS A;  4B7E A;  4IIJ A;  4DK1 A;  4UCT A;  3M7M X;  4X9Q A;  5TIS Z;  2JS5 A;  2IJH A;  5H5N A;  4RUE A;  1WB7 A;  3JSN A;  1MZF A;  2W6I G;  5ITZ A;  3JAT B;  5IWA B;  2ZT9 B;  2EBO A;  4DRX A;  2QSA A;  3FYE B;  4HAM A;  1SQB H;  2DQ0 A;  3IC7 A;  5EZY A;  5EYP B;  3M8A A;  4RO2 A;  2OCH A;  1R6N A;  1B6Q A;  1WN7 A;  1WLE A;  5IJ0 A;  2Q69 A;  1EZV H;  4CZZ A;  3DSQ A;  4F4L A;  4UCU A;  2OT5 A;  3I56 V;  3E89 A;  1PD3 A;  2VRZ A;  3RVY A;  4YHH O;  1S3J A;  1SS3 A;  3FB7 C;  5JQG B;  1H2G A;  1VQO V;  2QM7 A;  1HDJ A;  4J80 A;  1WPX A;  4B08 A;  2YEV A;  1N8R W;  3SGI A;  2UXB O;  2DYS C;  4Q6G A;  3SPG A;  3CC7 V;  4HNA B;  2CGN A;  1K7D A;  4KHP B;  2AHY A;  1XL6 A;  1XHX A;  4DV2 B;  1J5E O;  2B1G A;  5L3F A;  2P06 A;  3EFF K;  4UB6 Z;  3QF7 A;  4E4E A;  3U10 A;  4TWK A;  2AW9 A;  4JV5 B;  1XMO B;  1JA8 A;  4IL6 Z;  3CC4 V;  2JGD B;  1Q43 A;  1SER A;  2CE4 A;  4PA6 A;  3HKD A;  1SA0 A;  1GK9 A;  3UCS C;  1PV0 A;  4O4L A;  2LFR A;  3VQV A;  4JI4 B;  4O2B A;  3AK3 A;  1K92 A;  2R70 A;  3K04 A;  4I5S A;  4ZOL A;  4R7C A;  3VBB A;  1HNX O;  1NBM G;  3ZRS A;  1JMK C;  4QPJ A;  3PJS K;  2A0L A;  5GON B;  5L3B A;  3D3I A;  4JF3 A;  1E79 G;  4LCU C;  3ABL C;  4MT8 A;  1FXK B;  3W7W A;  1AVM A;  4WFF A;  4IYH A;  2ZCE A;  4DYL A;  3TXS A;  1P49 A;  4O4J B;  4DR1 O;  1H8H G;  1LUW A;  1VP7 A;  2DWE C;  1COW G;  1I5Y A;  1NH2 B;  2R9A A;  1VQK V;  2ZXW B;  3QTC A;  4FJC C;  1ZLZ A;  2IU0 A;  2P4V A;  5C8Y A;  2EIN B;  2NN4 A;  5LYJ A;  3O9O A;  1S72 V;  2ZE7 A;  2BTO A;  3WFV A;  5B3S C;  5LA6 A;  2RN9 A;  1Y67 A;  2BOC C;  2Q6A A;  4MW8 A;  1FFX B;  2YXL A;  1H38 A;  1ZX3 A;  2P5O A;  3E22 A;  1JVM A;  3K5M A;  4ICG A;  1FS0 G;  3S3X A;  3JD3 A;  4TOI A;  1F23 A;  4FPP A;  2YSU B;  1PKX A;  4GX5 A;  1JPX A;  2UXD O;  1BZK A;  1K4D C;  3R65 A;  3ZN1 A;  1VQM V;  3CJH A;  1QCE A;  1K4C C;  3T1Y B;  3QVN A;  1Q8I A;  3ABM C;  3NXS A;  5IDJ A;  1I94 B;  2VQE O;  4I55 B;  1PNM A;  3F5W C;  1XI1 A;  3RYI A;  3E86 A;  4DV5 O;  4UCO A;  4PJ0 Z;  2GTS A;  1XDC A;  1SQV H;  2Q7G A;  3WB1 A;  1BHB A;  2IBZ H;  3DXR A;  1HR0 B;  1S5L Z;  1OCO C;  1ZUQ A;  4E2L A;  5KMG A;  3K79 A;  3JYC A;  4OPH A;  5KAF Z;  3HKE B;  3OEH G;  4JI0 O;  1Q6U A;  4GYC B;  3CCE V;  3BAA A;  2EIM C;  4DV7 O;  3G80 A;  3STZ C;  4I9W A;  3CCJ V;  5CA0 A;  4RQE A;  1B04 A;  4FLZ A;  2QM8 A;  1HNW B;  4IIJ B;  1S0V A;  1N32 B;  1YTF B;  1QR8 A;  3K5O A;  3ASN C;  1OCC B;  3GWO A;  4L87 A;  1KEC A;  2KKW A;  5DN6 G;  5IJ9 A;  3MDS A;  3ZBH A;  5ITZ B;  3F7V C;  4FM0 A;  4WFE A;  4X1K A;  3ZHS A;  5BMV B;  2HHH B;  3BA9 A;  2GHY A;  4GZR B;  5EZY B;  4MVQ A;  2IW5 A;  1SQG A;  2F4V O;  2FL4 A;  3E8F A;  1CEZ A;  5IJ0 B;  3SJB C;  1FYJ A;  3ETQ A;  1GN2 A;  1JX9 A;  3N2G B;  4X66 B;  3K57 A;  1HWY A;  3IJ4 A;  4IYI A;  3R66 A;  3CEI A;  4FM1 A;  3JAS A;  2IH3 C;  5GTI Z;  2HVJ C;  1E1R G;  3UT5 B;  1SRY A;  4EB6 A;  2NLJ C;  1M57 C;  1Y74 A;  2XT9 A;  3SYQ A;  1BE3 H;  2YEV B;  3LDE A;  2GBO A;  3ZMT A;  1IBK B;  3K0D A;  4PV1 B;  1NU1 H;  4DW0 A;  5J2T A;  1BQ0 A;  2HEP A;  3K03 A;  5EIB C;  1F4M A;  3JSL A;  1M5I A;  3CXH F;  2PYJ A;  1SET A;  4ZI7 A;  4O4I A;  2IJJ A;  2YIC A;  1Z2G A;  2KB1 A;  1Q6I A;  5CBF A;  3OMA B;  3SJQ C;  3HKD B;  4I9Q A;  3CCU V;  1US6 A;  3OUF A;  4FVM A;  4O4L B;  4WFB V;  4DV4 B;  3AG7 A;  3BA8 A;  1JJ2 U;  4YJ2 B;  4X1Y A;  4O2B B;  4ZOL B;  3N2K A;  1VEW A;  1YJW V;  1PNL A;  1TA8 A;  4FLV A;  3ZHT A;  4RWU A;  4DR5 B;  4JI5 B;  1GTO A;  4DXW A;  4QIW F;  1QLE C;  4H13 B;  3THO A;  5IE9 A;  4B3T B;  3H1K H;  1DLB A;  1F7Y A;  2XAQ A;  4LFB B;  4LF5 B;  2QWQ B;  1H2N A;  4LF6 O;  1IBL O;  5LXT A;  2F66 C;  2HJD A;  4HZ3 A;  4G27 B;  4JTD B;  2E5L B;  4DV6 O;  4KP4 A;  3OTO O;  4UVA A;  3ABM B;  4DR6 O;  1Q3E A;  1K5Q A;  3OR7 C;  5C8Y B;  1VQ8 V;  4JAA A;  5J2U B;  4MVS A;  4J10 A;  1I5X A;  1AI6 A;  1GN6 A;  3OT7 A;  2JGU A;  1OCO B;  5LA6 B;  1XL4 A;  4JYA O;  1URF A;  2PYL A;  4DR4 B;  5JVD B;  3TK1 A;  2Q68 A;  1YJN V;  2UXN A;  1QNM A;  1VQ9 V;  3RYH A;  3B09 A;  1KP3 A;  2EIM B;  1N33 B;  4DUZ B;  3CJH B;  2QA4 V;  2QWN B;  3H1L H;  5J9P C;  2UU9 B;  3A0R A;  1PL0 A;  3L75 H;  3QO5 A;  4WFG A;  3ZRX A;  4GX2 A;  4Z1M G;  3D36 C;  3AG4 C;  1KKC A;  3ASN B;  3RYI B;  1XMQ B;  1CPY A;  2X0L A;  3STL C;  1N0N A;  1WNS A;  4DR3 B;  3ZX6 A;  3QG5 A;  5KMG B;  1CP9 A;  3GWK C;  4DR7 B;  2EJ7 A;  3VQY A;  3KCX A;  1BSM A;  1VF6 A;  3SPI A;  2LJ2 A;  4LP8 A;  1VQ7 V;  1M1K W;  1SC5 B;  3BHP A;  1XBL A;  4GKK O;  1AI4 A;  1D5N A;  4MTG A;  4CS3 A;  5CA0 B;  1M56 C;  2CH7 B;  4D7S A;  3CCM V;  2UUA B;  1H2K A;  2WA3 A;  4JI6 B;  1ROP A;  2GV9 A;  5LMU O;  1JR9 A;  4HBN A;  2VQF B;  4LBE C;  5IJ9 B;  2YXH A;  1YJ9 V;  3SYA A;  4A5U B;  3OM3 B;  4X1K B;  2HVK C;  3BRC A;  3CME V;  2QGN A;  1FXK A;  1TUB A;  3FAV A;  1S5J A;  4MS2 A;  2ZE8 A;  1SES A;  4ABM A;  5IT9 N;  2LFS A;  1B06 A;  4H33 A;  1QQC A;  4AIL C;  1VQN V;  4O4J A;  5LL6 Y;  3JD0 A;  1IBM B;  3I5D A;  4EFB A;  3RGB A;  2Q7H A;  1ZL8 A;  1IXM A;  5FPO A;  1JFF A;  2DYR C;  4JYB A;  4NXN B;  4O2A A;  1GO3 F;  1BCC H;  1AIL A;  3JAS B;  3DTU B;  4CH3 A;  2D2C B;  4JI1 B;  3SR2 C;  4LR3 A;  2HR3 A;  1Y74 B;  1G8M A;  4WFH A;  4MVZ A;  2FML A;  3SYC A;  4MTO A;  2DW4 A;  3JAW A;  1NKD A;  2R72 A;  3ZN0 A;  5J2T B;  2WLI A;  4FZ1 A;  1SZX A;  4KL1 A;  3MHH C;  1DK1 A;  3HKC A;  2VS0 A;  2HG5 C;  1X4T A;  3QO7 A;  5B1A C;  2Y4T A;  2Q8V A;  1UJW B;  1FKA O;  2YIB D;  5IYD O;  5AG2 A;  1IX9 A;  4CBC A;  2H94 A;  2XOK G;  2PZS A;  4FIP C;  1AB3 A;  3LNM B;  4CS4 A;  4X1Y B;  1IVS A;  2ZIO A;  1QHT A;  4DV1 B;  3CRR A;  1W0J G;  2RNB A;  1KC8 W;  2M6Y A;  1IUR A;  2XAH A;  3K06 A;  4LF9 O;  2F43 G;  1Q86 W;  2QTS A;  5FNV A;  1KP2 A;  3P3P A;  4P9O A;  2PI4 A;  4NB5 A;  4F6E A;  3OE7 G;  4XDL A;  2O57 A;  3Q4H A;  3LNN A;  5LXT B;  5D5P A;  1R3I C;  3OR6 C;  1XNR O;  3ZIA G;  4JI7 B;  1Q5O A;  4N23 A;  5LP6 C;  1AR4 A;  3IGA C;  1Y66 A;  2F95 B;  1BMF G;  4U3F H;  2NNU A;  2EIL B;  4H44 B;  1QR9 A;  5F2V O;  1RP3 B;  5IYC O;  5CN0 A;  1NJI W;  2YIA A;  5BMV A;  4B7K A;  5IWA O;  4TQF A;  2B5U A;  1PM9 A;  3ASO B;  4JTC B;  1G1X B;  3HB3 B;  3J81 N;  4J9Z B;  1N36 B;  4G28 B;  1VF7 A;  3OMI B;  4NR1 A;  4DUY B;  1WAZ A;  5B66 Z;  2B9Z A;  3RYH B;  4JZ2 A;  3CB2 A;  1JQ0 A;  3N2G A;  4UVB A;  3J7A U;  3AEI A;  2YC0 A;  1M56 B;  1R3K C;  1BL8 A;  4X89 A;  1NVP B;  2ATK C;  3X2Q C;  4B3M B;  3AG2 C;  4JTA B;  3UT5 A;  4J7K A;  4FZ0 A;  1AR1 B;  3B8N A;  1XOU A;  2Q67 A;  2RJZ A;  4BIZ A;  1VIB A;  1LUV A;  5H2F Z;  3B2E E;  1XRE A;  1QVF U;  4X65 B;  3ETG A;  4X88 A;  3T1C A;  1MSW D;  3CD6 V;  4KHP O;  1BGY H;  3H1H H;  4QJF B;  4LF7 B;  4DV2 O;  1UPG A;  3T1H B;  1KMI Z;  3L70 H;  1M4U A;  5LGU A;  1WPB A;  1RPO A;  1GN3 A;  4JV5 O;  1XMO O;  3EXA A;  2FYU H;  1K8A W;  1A32 A;  1I0H A;  4O4H B;  2QEX V;  2RMK B;  1J5E B;  5E1A C;  4YJ2 A;  3WB0 A;  4LF4 B;  3EVK A;  2BTQ A;  2BOB C;  1VF5 B;  3FB5 C;  4BIU A;  2LW1 A;  2QWR B;  3T2M A;  3W7X A;  3A2F A;  1TUB B;  3FAV B;  1BS3 A;  3B4S A;  4AHC A;  1VMG A;  5EC2 C;  4DV0 B;  4G2K A;  3A0B Z;  1KB9 F;  4YIO A;  2ADQ B;  3W7S A;  5C93 A;  2AGA A;  1ZL8 B;  1FJG B;  1JFF B;  4O2A B;  2PF4 E;  5JJE B;  1BT8 A;  5HFL A;  2QM4 A;  1MNG A;  2EX3 A;  4LC1 A;  5J2U A;  3OGC C;  1KQS U;  1IXB A;  3ZRV A;  4DR1 B;  4MTF A;  3U11 A;  4H0L B;  4LF8 B;  1HP8 A;  2ZIM A;  3SDL A;  1W2B U;  5JVD A;  3CYO A;  3JAW B;  1BQZ A;  2PI5 A;  2WLI B;  3ZJZ A;  2N04 A;  2GUZ A;  3HKC B;  4YJ3 A;  2Y0I A;  1Y76 A;  4QE9 A;  3QO8 A;  3MD0 A;  5LP6 B;  1AJN A;  1OCZ C;  1OHH G;  1VQ6 V;  4GUN A;  2XAF A;  1I94 O;  3ETE A;  2ZDI C;  4K35 A;  2WLK A;  1GM7 A;  1PP9 H;  4NVP A;  1J95 A;  4NXM B;  1AJP A;  3CWB H;  4B3R B;  2ODM A;  4JYY A;  3ZED A;  1M93 A;  3E35 A;  4MW3 A;  1V55 C;  4PA7 A;  1TUE B;  5FNV B;  2Y69 C;  3RYC B;  1F4N A;  2X6B A;  3AG3 C;  3CP1 A;  1SQQ H;  3BY6 A;  1K34 A;  2BSK A;  3Q4H B;  3K3W A;  3ML0 A;  2A79 B;  3C3T A;  1EFR G;  1V54 C;  1SZT A;  2CH7 A;  3E2E A;  1YF2 A;  4DR2 B;  2UXC B;  1HNW O;  1N32 O;  1V9P A;  1N34 O;  4AQY B;  4EFE A;  3X2Q B;  4X64 B;  5HFM A;  3AG2 B;  4H37 A;  4JYC A;  4DV7 B;  2ZR2 A;  3AK1 A;  2JJ1 G;  1G6U A;  1FD9 A;  4MVM A;  2HHH O;  4JI8 B;  2DYS B;  1KKD A;  2Q5Z A;  2F23 A;  2ADP A;  3ETD A;  1R3J C;  1RFY A;  5CMU A;  4UB8 Z;  3UO3 A;  2P22 C;  1GMG A;  1NTM H;  4X66 O;  1RM1 C;  2F4V B;  4GT1 A;  4JI2 O;  5LMN B;  1D5A A;  4U7O A;  3WG7 C;  3OEE G;  4GX1 A;  4I4T A;  2EIK C;  1Y6X A;  1SQF A;  2Z5U A;  1YIJ V;  2EZO A;  1Z5W A;  3B77 A;  2E74 B;  5KA6 A;  1F51 A;  3CCR V;  4P9P A;  5KX5 A;  3FYI B;  3ABL B;  3K59 A;  3CRA A;  3G67 A;  4TV8 A;  3SPH A;  1JJO A;  2DE0 X;  2W0X A;  5JCO C;  1S76 D;  2WA4 A;  1S77 D;  2CAZ C;  2NR5 A;  2ZM6 B;  1MSD A;  4TUY A;  1ZTE A;  3M99 B;  2UUB B;  4DV3 B;  4K8Z A;  4DV4 O;  3KG2 A;  3KCY A;  5IY5 C;  3FB6 C;  2BTQ B;  2CGO A;  3GVM A;  3BCC H;  1VQL V;  4N21 A;  5B3S B;  3CXC U;  1Q82 W;  2XTA A;  1JCH A;  4RUF A;  4JI5 O;  3ZMV A;  1AR5 A;  2QKA A;  2WWW A;  3E8B A;  4ZHQ A;  4B3T O;  1P7B A;  4Q20 A;  2JEX A;  4LFB O;  4LF5 O;  3D3Q A;  4RAI A;  1X59 A;  1IDS A;  5L3E A;  2E5L O;  2OCC C;  3HKB A;  1RSO A;  1VQP V;  3D36 A;  2W6J G;  4PA4 A;  1WB8 A;  3AG1 C;  1NTZ H;  2A7W A;  3G71 V;  4PI0 A;  2P6J A;  1H2L A;  3ABK C;  4BWA A;  5B5E Z;  4K0K O;  2KSD A;  1KUQ A;  5JH7 A;  4X62 B;  4UCS A;  1P84 F;  3TGU H;  2H8P C;  4XDK A;  5DM6 V;  5DED A;  4ZKI A;  1MMM A;  4DR4 O;  1V55 B;  4IHJ B;  2Y69 B;  1T5E A;  2P7T C;  5L3C A;  5KHI A;  1PL4 A;  2GUZ B;  4FFK A;  4YJ3 B;  1OCR C;  3ICX A;  3AG3 B;  3O65 A;  2YID A;  1Y76 B;  5H9C A;  1HNZ B;  1N33 O;  2V4D A;  4DUZ O;  1V54 B;  2UU9 O;  4TSF G;  4CH5 A;  3OFN G;  5KHK A;  4TV9 A;  5EC1 C;  5IYZ A;  5JJN B;  1EN5 A;  1XMQ O;  2ITC C;  1KD1 W;  4WCE V;  4GCZ A;  4EKW A;  5KLV H;  3SJA C;  3SJC C;  4DR3 O;  5LGT A;  1YI2 V;  5A2Q N;  2UUC O;  5L3G A;  1BHA A;  1FXH A;  2CTQ A;  4TQD A;  5LHH A;  4YIP A;  2EIJ C;  1L8D A;  2BSK B;  5BY1 A;  1NR7 A;  3BFR A;  2KG7 B;  3K9S A;  1SQX H;  4UCV A;  4O4H A;  1W59 A;  4PD4 F;  3FD9 A;  2UUA O;  4LFA B;  3WG7 B;  4JI3 B;  3W7U A;  4OPA A;  4JI6 O;  4PA9 A;  2QTO A;  3LDD A;  3ZMU A;  4B3S B;  5LHI A;  3G6B A;  1M57 B;  1RPR A;  4LWS B;  5CA1 A;  4F6R A;  3T4D A;  3LSQ A;  3BPZ A;  2Y4U A;  4OX9 B;  3SPJ A;  3HR0 A;  5JJJ B;  5FPR A;  5KHJ A;  1JOY A;  1L0N H;  2HKO A;  3T4Z A;  4C7U A;  5CB4 A;  1IBM O;  3IAY A;  4HYO A;  4PEL A;  2FKX A;  2L6L A;  2XAG A;  4NXN O;  4LFC B;  2QDO A;  4WFA V;  4I4T B;  2PUS A;  5IY5 B;  2PTM A;  3JAL B;  2JRI A;  3L71 H;  4JI1 O;  3ZHQ A;  4J42 A;  3F7Y C;  1SF9 A;  4W4K A;  3P3N A;  2H3O A;  4UVC A;  3CC2 V;  4P30 A;  4QE7 A;  2YIB A;  2BE3 A;  4JPR A;  1QLE B;  1AP5 A;  5KX5 B;  2JK5 C;  1OZ0 A;  1OV9 A;  4TV8 B;  5BR8 B;  5IYB O;  4K3A A;  1SKV A;  2FB5 A;  1NH2 D;  2E75 B;  1I08 A;  4FLY A;  2ILM A;  5LP6 A;  2QR4 A;  4RQF A;  5JWP A;  3LSS A;  1EM1 A;  2B1I A;  2DQ3 A;  4X1I B;  3K5L A;  4TUY B;  2QWO B;  3CRM A;  5H6R A;  4KUM A;  3FKS G;  4WF9 V;  3K5N A;  4FK5 C;  2XND G;  2LP7 A;  3JD2 A;  2HFE C;  4DV1 O;  1MG1 A;  2Q9L A;  1P4R A;  4GKJ B;  1LNQ A;  4UFZ A;  1XNQ B;  2ZXW C;  3L74 H;  2EUL A;  4IT5 A;  5KUM A;  2C2A A;  3RYC A;  4JAS A;  2EIN C;  5FLX N;  1YXB A;  2YDE A;  4ZHQ B;  2YXY A;  1GM8 A;  1OCR B;  2CTR A;  3ZMZ A;  1YDX A;  3E8G A;  4JI7 O;  4YY3 B;  5KUK A;  4QPK A;  2F93 B;  4U7N A;  3OGI B;  4J11 A;  3HKB B;  1RSO B;  3JCU Z;  4OXS A;  1ORQ C;  1TVK B;  3AG4 B;  1D2D A;  1GH6 A;  2K1E A;  2Q7E A;  3CE2 A;  4BIO A;  3CPW U;  2UXX A;  3F5T A;  3H1I H;  1GN4 A;  4P2Z A;  4CC6 A;  3UKM A;  5JH7 B;  1YVW A;  2EZP A;  4J9Y B;  2JVD A;  2WLH A;  3D8C A;  3J80 N;  2QKC A;  2ARH A;  1EN6 A;  3KZI Z;  1N36 O;  2ETN A;  1O9H A;  4R8C A;  4DUY O;  3P32 A;  2EIJ B;  1YTF D;  3H9V A;  2IJK A;  1NS1 A;  3VQW A;  4X20 A;  1XQ8 A;  3CCV V;  2V7Q G;  2ZD9 A;  2DJV A;  2LO1 A;  4PA3 A;  3ZS8 C;  1EN4 A;  4TV9 B;  4B3M O;  3QNE A;  4NKG B;  3ZCC A;  5IYZ B;  1XEQ A;  1YEW A;  5KHG A;  3IC9 A;  1HW7 A;  1R1B A;  1QBZ A;  3B40 A;  2QKS A;  3A0H Z;  4YHH B;  2LGQ A;  3BVO A;  4KFM A;  1OCC C;  1W0K G;  4X65 O;  3JD1 A;  2K9P A;  4LF7 O;  1NR1 A;  3T1H O;  2A06 H;  5B1B C;  3KKY A;  4NTY A;  4PDV A;  2UXB B;  4FMT A;  2M7W A;  2JDI G;  2F1M A;  2DYR B;  1L1F A;  5D5Q A;  3APQ A;  5CBH A;  4LH7 A;  4FFB A;  1FXV A;  2VWK A;  2IU3 A;  4I50 A;  2GDS A;  4JI4 O;  4LF4 O;  2CK3 G;  3RWR D;  1PNK A;  2ZE5 A;  3L9D A;  2WLN A;  3JD4 A;  2X6A A;  3OAA G;  5KAI Z;  4CH6 A;  1P7G A;  5CA1 B;  1R3L C;  4PDM A;  4F6R B;  3ZHU A;  4PDR A;  1HNX B;  1WP7 A;  5EBL C;  4DV0 O;  4QNH B;  3U0Z A;  5B1A B;  5CB4 B;  4IGG A;  3AK2 A;  1FJG O;  4MVO A;  4BR6 A;  5H6Q A;  2ZDI A;  2PGG A;  1H2S B;  3RYF A;  3OD4 A;  1ENV A;  3NR7 A;  4LF8 O;  4UV9 A;  2ZIN A;  5GW7 A;  4MVU A;  1M9N A;  5KA5 A;  3TJT A;  4IHJ A;  4OGQ B;  2XHB A;  3CRQ A;  2XAJ A;  1K33 A;  2X7R B;  4QGP A;  2QE7 G;  2ZR3 A;  3WB2 A;  1NI8 A;  3RN4 A;  3CHX A;  4L8J A;  1CXZ B;  2WLM A;  4CS2 A;  1OJH A;  3T1Y O;  4DW1 A;  1R73 A;  4LNU A;  2UXD B;  4R50 A;  5E79 Z;  4BW9 A;  2OTJ V;  1U97 A;  2QJ1 A;  3EHB B;  1HR0 O;  4NXM O;  2IJI A;  5B1O A;  1GRJ A;  1K97 A;  4B3R O;  2RCV A;  2ITD C;  3OTF A;  1DF5 A;  2VQE B;  1ARO P;  1R6K A;  1H8E G;  3CMA V;  4DV5 B;  4D6T H;  3H1J H;  4MVR A;  5CBG A;  1XUQ A;  4FM2 A;  1YCI A;  2HP8 A;  2P4K A;  1YZB A;  4I0X A;  2R9I A;  2Z3Y A;  3CCL V;  2KG7 A;  2Q0O C;  3OUS A;  2YS8 A;  3CS5 A;  2WPD G;  1AI5 A;  1QU7 A;  4JI0 B;  4Z2W A;  3JAK A;  3P30 A;  2ZQM A;  4DR2 O;  2UXC O;  1MZE A;  1DF4 A;  1TGO A;  4WBN B;  2JEU A;  2YI8 A;  2A9H A;  3JAR A;  4XBF A;  2OTL V;  4AQY O;  4X64 O;  3FFQ A;  2AZ2 A;  2Q0A A;  4FLU A;  1YSC A;  4ASU G;  1E1Q G;  1XHZ A;  2D3O W; 
#chains in the Genus database with same CATH homology
 2FKX A;  4NXN O;  4B3S O;  1FJG O;  4DR4 O;  3J80 N;  4JI8 O;  4OPH A;  1FKA O;  4YY3 O;  1N36 O;  3O65 A;  2JRI A;  4DUY O;  4OX9 O;  4JI0 O;  1N33 O;  4JI1 O;  4DUZ O;  1AB3 A;  1R6T A;  1NS1 A;  2UU9 O;  5BXZ A;  1HNX O;  4LF8 O;  4KHP O;  4DV7 O;  1I94 O;  4DV2 O;  4GKK O;  4X62 O;  2DJV A;  5LMN O;  4JV5 O;  1XMO O;  1XMQ O;  4B3M O;  1XEQ A;  1A32 A;  4LFC O;  5H5N A;  4LF9 O;  4DR3 O;  1R1B A;  5LMU O;  1F7Y A;  5A2Q N;  4LF6 O;  2UUC O;  4DR1 O;  1HNZ O;  3T1Y O;  1IBL O;  4DV4 O;  1IBK O;  4X65 O;  4A5U B;  1XNR O;  4DV6 O;  3M8A A;  4LF7 O;  5BY1 A;  3T1H O;  2F4V O;  3OTO O;  4DV1 O;  4DR6 O;  1HR0 O;  4NXM O;  5BR8 O;  1HNW O;  5IT9 N;  4JI5 O;  4B3R O;  1N32 O;  1FYJ A;  3JAM N;  1N34 O;  2ZKO A;  2UUA O;  5LL6 Y;  5FLX N;  2ZM6 O;  4OPA A;  4JI6 O;  5IWA O;  4B3T O;  4DR7 O;  4JI4 O;  4LF4 O;  3R66 A;  4LFB O;  2Z0A A;  4YHH O;  2N74 A;  2AGA A;  4LF5 O;  4JYA O;  2UUB O;  1G1X B;  4DV3 O;  2HHH O;  1YZB A;  3RT3 C;  3J81 N;  1X59 A;  4JI7 O;  2E5L O;  1AIL A;  2UXD O;  2LW7 A;  4GKJ O;  4DR5 O;  2UXB O;  4DR2 O;  2UXC O;  1XNQ O;  1D2D A;  3J7A U;  3SDL A;  4AQY O;  2VQE O;  2DOS A;  4DV0 O;  4X64 O;  1J5E O;  4K0K O;  3F5T A;  4LFA O;  1KUQ A;  4JI3 O;  1IBM O;  4X66 O;  4DV5 O;  2VQF O;  4JI2 O;  1DK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...