1NS1A

Rna-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel RNA-binding motif in influenza A virus non-structural protein 1.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Nonstructural protein
molecule keywords NONSTRUCTURAL PROTEIN 1
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ns1A00
1J5EO 4DUZO 2DOSA 4NXMO 3T1YO 3J81N 3R66A 4B3RO 5FLXN 2DJVA 4JI0O 4LF4O 2E5LO 5IWAO 4KHPO 4DR7O 4DV0O 2LW7A 1FJGO 4JI6O 4X66O 4NXNO 4DR6O 3JAMN 4LF5O 1I94O 2N74A 4JI2O 4DUYO 1N33O 4LFBO 5BY1A 4GKJO 4JI3O 3J80N 2ZM6O 4DV4O 4DR2O 1NS1A 1HNWO 1IBKO 3RT3C 4DV6O 4DR3O 4AQYO 4YHHO 2HHHO 2ZKOA 4OX9O 4B3SO 5A2QN 4JI1O 2UUCO 2F4VO 4DR4O 2UXCO 1R6TA 3J7AU 1FKAO 4JI7O 4A5UB 4GKKO 3T1HO 4LF8O 3M8AA 4YY3O 2UXDO 4DV3O 4LF9O 1D2DA 4LF6O 2AGAA 4DV7O 4DV2O 4LF7O 1XNRO 5LMNO 4X64O 1HNXO 4JI8O 4B3MO 4B3TO 1A32A 1DK1A 5H5NA 2UU9O 1F7YA 3O65A 4X65O 2VQFO 1XMOO 1IBMO 1G1XB 4LFCO 4JV5O 4DR1O 1N36O 1HNZO 5IT9N 2VQEO 4OPHA 1X59A 4LFAO 2FKXA 3OTOO 1XNQO 1YZBA 4X62O 2UUBO 1AB3A 4DV1O 5BXZA 4OPAA 4JI4O 3SDLA 1KUQA 5LMUO 1N32O 1XMQO 1IBLO 1XEQA 3F5TA 1R1BA 1HR0O 4JYAO 1AILA 2Z0AA 5BR8O 4DV5O 4DR5O 1N34O 4JI5O 4K0KO 5LL6Y 2JRIA 2UUAO 2UXBO 1FYJA
chains in the Genus database with same CATH superfamily
3FB6C 5CBGA 2DWEC 2QE7G 2LFRA 1W59A 1SS3A 2WA3A 4TUYB 1NTKH 5IWAO 3FB5C 4DO2A 1SKVA 1QLEB 5HFLA 5BY1A 1R3KC 1FXKB 3MD0A 4X8AA 1WB7A 2Q7EA 3MDSA 1YIJV 3CSXA 5D5PA 1I94B 2IJHA 4DV6O 2W6IG 1K33A 1S5LZ 1YCIA 5J2UA 4OX9O 1WJZA 1SETA 2LFSA 1R3IC 2ZDIC 4PA3A 4K3AA 3JAKA 2AW9A 1YEWA 3E8BA 3CRAA 3JALA 4J9YB 3TXSA 3K9SA 4TV9B 4PA7A 4UVBA 1MA1A 1WP7A 3K5LA 4LF8B 3A0RA 3ZBHA 4LF7O 4H33A 1XNRO 2LGQA 1Y74A 1YVWA 4KL1A 1EM1A 2ITDC 1NU1H 1BL8A 3ABMC 3VBBA 4Z2WA 3W7TA 1VQMV 5IYZA 4GX0A 1P4RA 4LF5B 1Q7YW 4TWKA 1K73W 1HNZO 1IZ3A 3A2FA 3ZMZA 2VQEO 4GKJB 2HFEC 2QWRB 4LNUA 1FFTB 3UCSC 4DRXB 1SQFA 2EX3A 4MVSA 3JAWA 1RP3B 3F5WC 3CCRV 3TXQA 1VMGA 2Q0OC 1AI7A 2XHBA 1XEQA 1GO3F 2QWQB 3CP1A 5JH7B 1U97A 3H01A 1V9PA 1XNRB 4J80A 2QDOA 4P9PA 1N32B 4E4EA 3VQXA 2CDYA 2UXBO 1N0NA 4QJFB 2Y0IA 4UCUA 1F4NA 3ZHVA 4WFEA 4PA9A 3SYPA 4DK0A 2HLDG 1JOYA 2DJVA 1IBMB 4DR7O 3CE2A 3SJCC 4RUFA 3AK1A 5BMVA 1QVGU 1M90W 1QR9A 2LGWA 4FLYA 2IW5A 5ITZA 4NYKA 2CTQA 2AZ2A 2LP7A 4NXMB 3AK2A 1VF6A 4WFAV 4DR3B 2RN9A 3OMNB 3JALB 4DR2B 2KSDA 2ZE8A 1VQLV 1GN3A 2ZKOA 4YHHO 5CA0B 4HBNA 2Q8VA 3ZRWB 5A2QN 2GHYA 5CB4A 3ZS8C 2GTAA 4ASUG 3ZEDA 1EN6A 3X2QB 4UXNA 2IU0A 4JYCA 3JAKB 2W0FC 4DV0B 4O4LB 5KHHA 3UQ8A 4N21A 4G28B 4ZHQB 1D2DA 4ZKIA 4WBNB 3OEEG 3IFXA 2IH3C 5IYZB 1RSOB 2GBOA 1SA0A 1BE3H 1TUBA 4NTXA 1Q5OA 1Q8IA 2HG5C 1H2KA 1AI6A 4MVMA 4BW9A 1CXZB 5J2TA 1OCOC 2EZPA 4I0XB 4U3JA 3QO8A 3C3SA 2JGDB 2EINB 3B8NA 2ITCC 3RYHB 1YTFB 2QGNA 5HFMA 3E89A 1MMMA 1G6UA 4J9ZB 5B1BC 3E35A 1NJIW 2BTOA 3QVNA 2Q69A 3BAAA 1KP2A 2YC0A 3BA9A 1QR8A 3OGIB 1EBOA 3RW0A 2Z5UA 5BZBA 2UXDB 1IDSA 2F93B 3UT5A 3ETEA 3IC9A 1FYJA 2JEXA 3FFQA 2G38A 4R8CA 4B3RO 1H8HG 2VQFB 4F6EA 2AHZA 2EILB 3ZMSA 2D3OW 4B3MB 4JI2O 3A0BZ 3L72H 5IJ0B 4LBEC 2ZE5A 2OYQA 3BFRA 1N4CA 3SJQC 4LF7B 3JSNA 4DV4O 2OT5A 5L3CA 1L0NH 1HNWO 5LHGA 2WLMA 1D5AA 3AG4C 1XI1A 2WLIA 3NXSA 4L87A 3E83A 2E5LB 3L73H 3JYCA 5LA6B 2CUGA 5CMUA 4R6ZA 5CA0A 3B40A 1M9NA 3ZRWA 3SYAA 4RO2A 1VQ4V 3JAWB 1YDXA 1SA0B 3RGBA 5J2UB 5JCOC 2OCHA 2GUZB 3H1LH 2HJFC 2P90A 1B3QA 1HNXO 3DXRA 4B3MO 4WBNA 3H1JH 1FFXA 5LBQA 2B1IA 2EJRA 3HKBB 2UU9O 3RYCB 3O65A 4MS2A 1TUBB 2DYSB 5KAFZ 2WAMA 4W4LA 1GN2A 3OMAB 1X59A 5L3FA 3G67A 1OCOB 2JDIG 4FFBA 1OCRC 3BA8A 4OGQB 1FD9A 4UB8Z 1MOFA 1GKFA 1YI2V 1S3JA 4JYAO 2E3CA 3BY6A 1K7DA 1Q43A 4DR6B 3B8MA 3K08A 5IE9A 5AG2A 1BHAA 3M99B 4NR1A 5LP6A 4DV2B 1JPXA 1WAZA 5EZYB 3X2QC 3ZMVA 4YJ3A 1SQVH 2DMXA 3AG1C 1ZAUA 4YHHB 4PDMA 2EILC 5H2FZ 2QKSA 4H0LB 2M7WA 1S0VA 5LP6C 4X1KB 3FAVA 1XL4A 1I94O 4J42A 5EIBC 3RFRA 1UPGA 1I5YA 1SESA 5KMGA 1MZEA 2YSUB 2IH1C 1IBKO 4DR3O 3P3PA 2P67A 1WA8B 2RJZA 1R6TA 1IXMA 1XREA 4TV8B 3K59A 1KYOF 2MW2B 3K9AA 4PI2A 3ZIAG 1Q6HA 1CPYA 1K5SA 2AGAA 2V4DA 1AJNA 1XOUA 1ZWIC 3ABKB 4MTOA 1GK9A 4MVOA 4PELA 5FNVB 1B6QA 3LNMB 3CD6V 5H5NA 3C3TA 2C2AA 3SPHA 1IBMO 4TT3G 4RAIA 3LNNA 2WLLB 3EXAA 1ZL8A 2X6CA 3SGIA 1UJWB 1T5EA 2Q5ZA 5LGTA 2YIBD 5GONA 4CS4A 3STLC 4ZBMA 2P6JA 4BIZA 3N2GA 2BE3A 3JARB 4CBCA 5BR8B 1YF2A 1S77D 4CS3A 4DK1A 3UKMA 1HP8A 4XDJA 2XAFA 4E2LA 4X1KA 1Y76A 1BQ0A 5JQGB 1NH2B 3CHXA 5FLXN 3K5MA 4UCRA 1LUVA 2XT9A 4B3TB 3E22A 3UT5B 3W7XA 3FYEB 2Q7HA 4LF9B 3FD9A 2YICA 1K3EA 4MTXA 3JASB 1NBMG 3G4SV 4FM0A 2YIDA 1TVKB 3FAVB 3B09A 2F66C 2FL4A 5LMUB 3OD4A 4DV4B 3T2MA 4AQYO 5IJ0A 3W7SA 1SERA 1OZ0A 1MSDA 4K35A 4ZOLA 2DQ0A 2M6YA 2PYLA 3ZHSA 4UCVA 4IIJA 2DE0X 5DM6V 1PNMA 2VWJA 2ZCEA 3DTUB 4UB6Z 4X64O 1GRJA 1XBLA 1DF4A 2ZR2A 1BGYH 4I55B 4CH3A 1DK1A 2DQ3A 2HVKC 4YXWG 5EYPB 4JAUA 1ZLZA 3BPZA 2VQFO 2PZSA 2ZE6A 3ASNB 4RWUA 3RVYA 4LP8A 2XUMA 4I9QA 2ZM6B 3JARA 1VQPV 4X62O 1GAXA 5BXZA 4B7EA 4OPAA 3WFVA 5B1AC 1WN7A 2JIZG 2OIEA 5JVDB 4JYYA 1N32O 2OCCC 1WPBA 2KQXA 5GONB 3U0ZA 2QSAA 4WFFA 4X62B 1ZUQA 4Z1MG 1HDJA 5IJ9B 3WG7C 3ZRXA 4WFHA 5IY5B 3FB8C 1FJGB 2QJ1A 3APQA 1XUQA 5CBHA 3J81N 3CYOA 4CZZA 1NI8A 3CCLV 1I0HA 2P06A 3HPLC 5CA1A 4U7NA 5EC1C 4LFAB 4HNAA 3K5NA 4LF5O 1IX9A 5E79Z 2WWWA 1HNZB 1JX9A 2NLJC 1OCZB 1VARA 4GUNA 4MVQA 3QNEA 5LYJA 1K92A 1R3JC 1FXKA 1I5XA 1VF5B 4PDLA 2PUSA 1LNQA 5CN0A 2GDSA 3ZRSA 2WLKA 2A0LA 1FKAO 4RQFA 1H2GA 4K8ZA 2FB5A 3TJTA 2V7QG 2YXHA 1JFFB 3EVKA 4I50B 3RWRD 4CS2A 4JYAB 4DV3O 1H8EG 2WSSG 4HAMA 3F7VC 4JI8O 1JR9A 2EIMC 1PKXA 4G27B 4JI3B 4I7ZB 1YJNV 4DR1O 3CCMV 2X0LA 4LCUC 3WB2A 3K57A 3CMAV 5LHHA 5B3SB 3BEHA 3L74H 4O2BB 4PDVA 3ABKC 3L9DA 5CA3A 1GH6A 4LNUB 2CTWA 2IU3A 2VWKA 2WLLA 1SQXH 1R1BA 1H2NA 2RCVA 5BR8O 4DR5O 3JD1A 5B66Z 2JRIA 3RYIA 1OCZC 3QG5A 2DOSA 1OCCC 5TISZ 5H6RA 4ZOLB 3MAQA 1US6A 3CWBH 3PN1A 4CC6A 4IYIA 1JVMA 4R50A 4ABMA 3G71V 1K9MW 5LYJB 4BIOA 5LOVB 3BRCA 2PY5A 1BQZA 3JD4A 5B1BB 3M7MX 4JGSA 3SYOA 4B3SO 2FYUH 3ASOC 1VQ6V 1VF7A 1BS3A 2A79B 4DV7O 1M56C 2RMKB 1PL0A 4UV8A 5JCOA 2YI8A 1NQTA 1KKDA 4PA4A 4B08A 2LQTA 3KKYA 3TETA 5B1OA 4IIJB 2QM8A 4DV6B 4X65O 1B04A 3CC4V 1AVMA 1I08A 2JS5A 3CCJV 4GT1A 3KCYA 1HW7A 1EFRG 4UUJC 4LF4B 2RNBA 4I55A 2B5UA 5KHIA 1NZ6A 3Q4HB 1AB3A 3CRMA 2CK3G 2LO1A 2UXXA 2ZNJA 1NVPB 3HKDA 5LMUO 1SC5B 3G6EV 4QPKA 2EJ7A 1RPOA 1AR5A 2Q7GA 2Z0AA 4DV5O 1N34O 3E8HA 2FTKA 4FK5C 2K9PA 4DUZO 4BWAA 3RYFA 3JCUZ 1XNQB 1P49A 1HNXB 5D5QA 4DV5B 4ZI7A 1S76D 1XMOB 2E5LO 1JMKC 2GV9A 4FLZA 2QM7A 1SQBH 4DR6O 3ML0A 1SQPH 2X7RB 3RN4A 2N74A 4QE9A 3ZHUA 4JAVA 3FX7A 1I7FA 5CA1B 4B7KA 2YIBA 2ZT9B 3RT3C 1VQNV 2P4VA 1MSWD 4I9WA 4JPRA 1L8DA 3GWOA 5KA6A 2ZNIA 2Q6AA 2F4VO 2BTQA 2YIAA 3N2KA 1YTFD 1FXHA 1AR4A 3UM7A 2N05A 3M8AA 3WG7B 3CCQV 2YXYA 5KA5A 5C93A 1FPOA 3E8GA 1GN4A 3GWKC 4PDRA 1RM1B 3T4DA 2GUZA 3JCZA 5E1AC 2R9RB 3OW2U 5FL7G 1N33B 1KBHA 1E79G 1K8AW 4MVRA 2QWNB 2OIGA 2KG7B 4GKKB 2IBZH 2V1DA 5H6QA 3W7UA 4DRXA 2EULA 2YDEA 3WB0A 3ABLB 1KKCA 1QLNA 4MW8A 2VS0A 1GM8A 5LOVA 3HKCB 3D36A 4NVPA 4X20B 2RDCA 3CXHF 2ARHA 5KX5A 4MVZA 4JAAA 4FLTA 3OEHG 1MABG 4XDKA 4CH6A 5EZYA 2H94A 4YJ3B 4XBFA 3JAMN 1AI5A 3BABA 1IURA 4DUYO 4GKJO 2WPDG 2JS3A 1OJHA 4JI3O 1EN4A 4QNHB 4HZ3A 2ODMA 1F51A 3OR7C 2DYRC 1KQSU 4H13B 3H9VA 4JI1O 2HJDA 2A3QA 1DF5A 5GW7A 4X66B 3LDCA 1B06A 1H2LA 3Q4HA 3DSQA 3ASNC 2CH7A 5EC2C 4WF9V 1AJPA 2HVJC 3K58A 2XNDG 2Y48A 4U3FH 1HR0B 2XTAA 5EIBD 5LGUA 4DR7B 4O2AB 3DC5A 4NTYA 1A32A 4MVUA 2XASA 1RSOA 2B1GA 4FLXA 2EIJC 3H1HH 2R70A 2ZDIA 3HR0A 5FNVA 1Y74B 4PHZA 1N36O 4CH5A 4KXRA 1M1KW 5IT9N 4JI0B 4OPHA 3CRQA 2F43G 5JH7A 1XNQO 4EKWA 2N04A 5DN6G 3FB7C 4DR5B 2JGDA 1YHQV 3LDEA 2DW4A 3TCUA 5B5EZ 2CTPA 4H44B 3AG1B 3CRCA 5EK0A 4BIUA 4X1IB 2R72A 4K0KO 3SR2C 1Q81W 2YEVB 4TUYA 1J5EO 2UU9B 2ADQB 1AI4A 3I56V 4EB6B 5BMVB 1VEWA 3T1YO 2A9HA 2P7TC 3R66A 3K79A 2R9AA 1ORQC 1N36B 3SPJA 3CB2A 1MNGA 4GX2A 1NH2D 3RBZA 1Z2GA 4WFBV 2ZM6O 1URFA 1YJ9V 1RFYA 3D36C 2E75B 4LH7A 2HHHO 2BSKA 3QTCA 4J41A 2WA4A 1NR1A 1R6NA 2EIKB 1V54C 2XAQA 3AG3C 4I0XA 3CXCU 1EZVH 4U3JB 3S3XA 2WLIB 3APOA 3ZHRA 4U7OA 2KG7A 2PI5A 2EINC 2Q67A 4YY3O 4IYHA 3ABMB 4YIPA 1QVFU 4X65B 4GCZA 2E74B 3N2KB 3K0DA 5L3BA 5KUMA 3S3WA 4X1YA 4O4LA 1M56B 2PTMA 1W2BU 4JI4B 4UCSA 4ZHQA 2YI9A 4EFBA 5JJNB 5J9PC 1OCRB 3DXRB 1XMOO 5IDJA 1FFXB 1R6KA 4BR6A 1D5NA 2F1MA 4QIWF 1PV0A 4JI5B 4LF6B 1CP9A 1YJWV 1YZBA 4FLWA 2OTJV 1N34B 4UCOA 4EEQA 1VQ7V 1GMGA 2YEVA 4FMTA 1AROP 4KHPB 2H8PC 3RYHA 5FPOA 5JVDA 5K1XA 1M57B 4UVCA 2UUAO 1KECA 1NVPD 5KAIZ 1BCCH 2BOBC 3QO7A 3ETDA 4NXMO 5LMNB 3HKCA 5LP6B 2Y0PA 1OCCB 3UO3A 4EB6A 1H2MA 1JJ2U 2HR3A 2LW7A 4CC5A 2CE4A 4P30A 3OAAG 2MK3A 1VIBA 3K0GA 5KX5B 2JGUA 2A06H 4DR1B 2CTRA 4IHJB 3SYCA 2X6AA 1IXBA 5LA6A 4R7CA 4BW5A 2IJIA 3ABLC 3TGUH 3F7YC 4O2AA 2X6BA 4UV9A 5CB4B 4JF3A 1Q3EA 1AP6A 4DW1A 5KMGB 1EN5A 1O9GA 4O4IA 4FZ0A 2UXCO 3BVOA 4FM1A 4JI1B 2UUAB 2BSKB 4NTWA 1NKDA 2Z3YA 4IL6Z 3T1HO 1OV9A 4KP4A 4NB5A 1QBZA 4X1YB 1FAFA 2Y4UA 5GTIZ 4LR3A 2W6JG 2AHYA 2Y69B 1UFIA 4MTGA 4FLVA 3CCUV 4O4HA 1JJOA 1NR7A 4JI8B 2CH7B 1IVSA 2JJ2G 4K8XA 2XAHA 2UUBB 4JASA 4K0KB 3LSUA 3OFNG 4PJ0Z 4JI6B 1W0JG 2LW1A 2HP8A 2FKXA 2UUBO 1QHTA 3JATB 4DYLA 4O4JB 2O57A 5DECA 4TOIA 3CCSV 3HKEA 1VF6C 3G80A 1JA8A 4NKGB 1JQ0A 5EBMC 4O2BA 3AG4B 5DEDA 4FFBB 3JD2A 4LH6A 3ZMUA 3HB3B 1Y6XA 3AEIA 1THZA 3U11A 2P4KA 4JZGA 4AI8A 3LUTB 2XAGA 2AXTZ 2PGGA 3ZRVA 1DLBA 2D2CB 1QLEC 3ICXA 2HHHB 3IGAC 3GB7C 4X1IA 4IHJA 5KLVH 5LHIA 4DV0O 4JI6O 5K1PA 2ZE7A 3K03A 2Q0AA 2EBOA 5B1NA 1M57C 1XL6A 1P84F 2QWOB 3J80N 3L70H 1PNKA 2UXNA 3LSQA 4JI2B 3DC6A 4OX9B 1P7BA 2F95B 4KUMA 4DR4O 3L75H 1K34A 3D3QA 1COWG 1KC8W 4JI7O 3JD0A 3IJ4A 1KP3A 2NN4A 1BMFG 4F4LA 1XMQB 4X64B 3A0HZ 3O9OA 2Q68A 4LF6O 1KU9A 3N2GB 3R65A 1XILA 1SRYA 3CEIA 5FPRA 3VQVA 3JD3A 3RYCA 4JV5B 3QO5A 2F4VB 1J5EB 4FPPA 2QR4A 1Q86W 1Y66A 1ZL8B 2H3OA 4GYCB 4LFBB 2NR5A 3ZN0A 4TQFA 4MW3A 2GTSA 1E1QG 1S72V 1NTZH 3A8TA 4JV5O 1BHBA 1Y76B 5JQGA 3H1KH 5EYPA 4TV8A 3HKEB 3CCVV 3T1CA 2BOCC 4J7JA 2Q4PA 3ABUA 3FYIB 4DV1O 3SYQA 3N27A 4WCEV 3OMIB 1V54B 4PV1B 3OUFA 4JZ2A 1VQKV 3E8FA 1XMQO 1TVKA 4UVAA 5IY5C 4O4JA 1VQOV 1AILA 5IWAB 3T1YB 1HNWB 1ZTEA 3AG7A 4JTDB 1V55B 2EZOA 3HKDB 5LL6Y 2QTOA 2E76B 3CC7V 4X88A 2CGOA 1EZJA 3H1IH 5IYCO 1XHXA 1H2SB 1WPXA 5C8YA 5IJ9A 2F23A 4G2KA 5ITZB 2W0XA 1F23A 1QU7A 3CS5A 3L71H 3RYFB 1SZTA 1K5QA 2PF4E 1PD3A 1N33O 1ROPA 1SZXA 1HWYA 4AILC 1KB9F 2ILMA 2ZIOA 5GTHZ 1JCHA 2Q73A 1K97A 4FZ1A 1NTMH 3BCCH 1L1FA 4I5SA 1GTOA 1AP5A 5EBWC 3MHSC 4YY3B 5LGNA 2UUCO 2XAJA 1Q90D 1RPRA 5KHKA 2Q9LA 4DV3B 3J7AU 3CC2V 3CMEV 2QKCA 5EBLC 4AHCA 3P30A 4FM2A 1O9HA 1XHZA 3JASA 4F6RA 2VQEB 2EIJB 4YJ2B 2ZD9A 3WB1A 3P32A 1TUEB 3ZX6A 4GX1A 2ETNA 1Y4MA 2YS8A 1Z5VA 3THOA 3KCXA 2DWDC 4GX5A 2IJJA 4O4HB 1X4TA 1TGOA 1SQGA 4MT8A 2QWPB 2QKAA 1M4UA 4XDLA 4DXWA 1S5JA 4H37A 1LR1A 2IJKA 3ZHTA 4GLXA 4JYBA 2QTSA 5KHGA 1P7GA 2ZXWC 1ZSPA 1FXKC 3ZN1A 3AG2B 4B3SB 1VP7A 2ADPA 2IM9A 1H38A 3OM3B 4TQDA 3QF7A 3T4ZA 4RUEA 2UXBB 4LF4O 2JK5C 3G6BA 4QGPA 1FS0G 1GM7A 2XOKG 5IYBO 4D7TA 3AK3A 3PJSK 4X66O 1JFFA 4AQYB 1IBLB 2P22C 4JI7B 2WLHA 1PM9A 1U96A 1ZX3A 2JEUA 2OCCB 2Y4TA 4J7ZA 1NS1A 5B1AB 5L3GA 3SPCA 4D6TH 1FXVA 1KMIZ 4P2ZA 4I50A 4DUZB 3SJAC 1R3LC 4WFGA 1L0LH 2AZ0A 4A5UB 4Q20A 3OE7G 4HNAB 4MSWC 2UXDO 3I5DA 4LF9O 1WP8A 2FMLA 3HKBA 1SF9A 2L6LA 3W7WA 3ABTA 1F4MA 3OGCC 1AJQA 4IGGA 4B3RB 2OWOA 1K4DC 3SPIA 1RM1C 3CX5F 4BAYA 4F6RB 5CBFA 1PNLA 3IC7A 3K04A 3U10A 4PI0A 3B77A 1Q82W 2ZINA 3B4SA 4LFCO 5LXTB 3D3IA 4DW0A 3IAYA 4N23A 4X89A 4LFCB 4JI4O 2LJ2A 1KUQA 3CJHA 3CCEV 5H9CA 1OHHG 3D8CA 5IYDO 4UFZA 4RQEA 2RQ6A 3LDDA 3CPWU 2ZIMA 3OUSA 5JWPA 1N0JA 4JI5O 3BHPA 4ICGA 1YXBA 4QPJA 1WLEA 2PYJA 1KD1W 4TSFG 4KHPO 3VQYA 1Y67A 3OTFA 1FJGO 1SQQH 5F2VO 2ZQMA 2QA4V 4J11A 3VQWA 1V55C 4P9OA 5C8YB 2DYSC 3KZIZ 2GSMB 4UCTA 5B3SC 4LFBO 2YXLA 1WA8A 2P5OA 4TV9A 1DTOA 4EFEA 3DGEA 3RYIB 2Y69C 3T1HB 1M93A 1MZFA 1QQCA 2JVDA 3K5OA 3OTOB 1TA8A 1NT2B 5KUKA 1S5HC 1YSCA 1M5IA 4GKKO 3ZHQA 4LF8O 3WU2Z 3ZMTA 4I4TB 1PP9H 4PA6A 1GN6A 1G4YB 3B2EE 4DV2O 5LMNO 4CH4A 4W4KA 2OTLV 4LC1A 3I55V 2UXCB 4LWSA 1DGSA 3ETQA 1LUWA 4JTCB 4IT5A 1VQ8V 1Q6UA 3ZJZA 3MHHC 2HEPA 4J10A 4YJ2A 2CAZC 2K1EA 1QNMA 3RVZA 3VOUA 4FLUA 2KKWA 3CJHB 2EIKC 2L35A 4LFAO 3OTOO 4FVMA 1IBKB 2JJ1G 3ASOB 4FIPC 4PD4F 3SDLA 1QCEA 1W0KG 1IBLO 2NNUA 1Z5WA 5KHJA 3EHBB 1HR0O 2WLNA 3CRRA 1WNSA 2BCCH 2QM4A 2KB1A 2UUCB 1K4CC 2B9ZA 2HKOA 3E22B 5L3DA 4ZIBA 1J95A 1R73A 4L8JA 3UO2A 3OT7A 4FJCC 4DUYB 4JI0O 3GVMA 1AR1B 1PL4A 3OR6C 3E2EA 3LSSA 2PI4A 4NXNO 1CEZA 4Q6GA 3ETGA 3EFFK 3P3NA 3NR7A 1GM9A 1Q6IA 2A7WA 2BTQB 3STZC 4NXNB 4QE7A 3FKSG 4DR2O 1YITV 1G8MA 1XQ8A 2WLJA 3ZCCA 4DV7B 4YIOA 1WB8A 5JJJB 4I4TA 4X9QA 2DN9A 4FFKA 4ZI7B 2CGNA 5JJEB 1VQ5V 4J7KA 3AG2C 4MTFA 2QEXV 4O4IB 4LWSB 3AG3B 2ZXWB 1MG1A 3C90A 1BSMA 5J2TB 4D7SA 4DR4B 3JSLA 2EIMB 4B3TO 4GZRB 1F7YA 4Z1VA 1ENVA 3SJBC 3TK1A 4C7UA 1G1XB 4OXSA 4JTAB 4DV1B 2VRZA 5A9GA 1N8RW 1PPJH 3K3WA 1BT8A 4KFMA 4X20A 2DYRB 3SPGA 5L3EA 2R9IA 3KG2A 2ATKC 3K06A 1E1RG 1BZKA 5LXTA 1TAEA 3E86A 3F5TA 1XDCA 3JATA 1VQ9V 2YUAA 4HYOA 2ZR3A
chains in the Genus database with same CATH topology
1J5EO 4DUZO 2DOSA 4NXMO 3T1YO 3J81N 3R66A 4B3RO 5FLXN 2DJVA 4JI0O 4LF4O 2E5LO 5IWAO 4KHPO 4DR7O 4DV0O 2LW7A 1FJGO 4JI6O 4X66O 4NXNO 4DR6O 3JAMN 4LF5O 1I94O 2N74A 4JI2O 4DUYO 1N33O 4LFBO 5BY1A 4GKJO 4JI3O 3J80N 2ZM6O 4DV4O 4DR2O 1NS1A 1HNWO 1IBKO 3RT3C 4DV6O 4DR3O 4AQYO 4YHHO 2HHHO 2ZKOA 4OX9O 4B3SO 5A2QN 4JI1O 2UUCO 2F4VO 4DR4O 2UXCO 1R6TA 3J7AU 1FKAO 4JI7O 4A5UB 4GKKO 3T1HO 4LF8O 3M8AA 4YY3O 2UXDO 4DV3O 4LF9O 1D2DA 4LF6O 2AGAA 4DV7O 4DV2O 4LF7O 1XNRO 5LMNO 4X64O 1HNXO 4JI8O 4B3MO 4B3TO 1A32A 1DK1A 5H5NA 2UU9O 1F7YA 3O65A 4X65O 2VQFO 1XMOO 1IBMO 1G1XB 4LFCO 4JV5O 4DR1O 1N36O 1HNZO 5IT9N 2VQEO 4OPHA 1X59A 4LFAO 2FKXA 3OTOO 1XNQO 1YZBA 4X62O 2UUBO 1AB3A 4DV1O 5BXZA 4OPAA 4JI4O 3SDLA 1KUQA 5LMUO 1N32O 1XMQO 1IBLO 1XEQA 3F5TA 1R1BA 1HR0O 4JYAO 1AILA 2Z0AA 5BR8O 4DV5O 4DR5O 1N34O 4JI5O 4K0KO 5LL6Y 2JRIA 2UUAO 2UXBO 1FYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E O;  4DUZ O;  2DOS A;  4NXM O;  3T1Y O;  3J81 N;  3R66 A;  4B3R O;  5FLX N;  2DJV A;  4JI0 O;  4LF4 O;  2E5L O;  5IWA O;  4KHP O;  4DR7 O;  4DV0 O;  2LW7 A;  1FJG O;  4JI6 O;  4X66 O;  4NXN O;  4DR6 O;  3JAM N;  4LF5 O;  1I94 O;  2N74 A;  4JI2 O;  4DUY O;  1N33 O;  4LFB O;  5BY1 A;  4GKJ O;  4JI3 O;  3J80 N;  2ZM6 O;  4DV4 O;  4DR2 O;  1NS1 A;  1HNW O;  1IBK O;  3RT3 C;  4DV6 O;  4DR3 O;  4AQY O;  4YHH O;  2HHH O;  2ZKO A;  4OX9 O;  4B3S O;  5A2Q N;  4JI1 O;  2UUC O;  2F4V O;  4DR4 O;  2UXC O;  1R6T A;  3J7A U;  1FKA O;  4JI7 O;  4A5U B;  4GKK O;  3T1H O;  4LF8 O;  3M8A A;  4YY3 O;  2UXD O;  4DV3 O;  4LF9 O;  1D2D A;  4LF6 O;  2AGA A;  4DV7 O;  4DV2 O;  4LF7 O;  1XNR O;  5LMN O;  4X64 O;  1HNX O;  4JI8 O;  4B3M O;  4B3T O;  1A32 A;  1DK1 A;  5H5N A;  2UU9 O;  1F7Y A;  3O65 A;  4X65 O;  2VQF O;  1XMO O;  1IBM O;  1G1X B;  4LFC O;  4JV5 O;  4DR1 O;  1N36 O;  1HNZ O;  5IT9 N;  2VQE O;  4OPH A;  1X59 A;  4LFA O;  2FKX A;  3OTO O;  1XNQ O;  1YZB A;  4X62 O;  2UUB O;  1AB3 A;  4DV1 O;  5BXZ A;  4OPA A;  4JI4 O;  3SDL A;  1KUQ A;  5LMU O;  1N32 O;  1XMQ O;  1IBL O;  1XEQ A;  3F5T A;  1R1B A;  1HR0 O;  4JYA O;  1AIL A;  2Z0A A;  5BR8 O;  4DV5 O;  4DR5 O;  1N34 O;  4JI5 O;  4K0K O;  5LL6 Y;  2JRI A;  2UUA O;  2UXB O;  1FYJ A; 
#chains in the Genus database with same CATH topology
 3FB6 C;  5CBG A;  2DWE C;  2QE7 G;  2LFR A;  1W59 A;  1SS3 A;  2WA3 A;  4TUY B;  1NTK H;  5IWA O;  3FB5 C;  4DO2 A;  1SKV A;  1QLE B;  5HFL A;  5BY1 A;  1R3K C;  1FXK B;  3MD0 A;  4X8A A;  1WB7 A;  2Q7E A;  3MDS A;  1YIJ V;  3CSX A;  5D5P A;  1I94 B;  2IJH A;  4DV6 O;  2W6I G;  1K33 A;  1S5L Z;  1YCI A;  5J2U A;  4OX9 O;  1WJZ A;  1SET A;  2LFS A;  1R3I C;  2ZDI C;  4PA3 A;  4K3A A;  3JAK A;  2AW9 A;  1YEW A;  3E8B A;  3CRA A;  3JAL A;  4J9Y B;  3TXS A;  3K9S A;  4TV9 B;  4PA7 A;  4UVB A;  1MA1 A;  1WP7 A;  3K5L A;  4LF8 B;  3A0R A;  3ZBH A;  4LF7 O;  4H33 A;  1XNR O;  2LGQ A;  1Y74 A;  1YVW A;  4KL1 A;  1EM1 A;  2ITD C;  1NU1 H;  1BL8 A;  3ABM C;  3VBB A;  4Z2W A;  3W7T A;  1VQM V;  5IYZ A;  4GX0 A;  1P4R A;  4LF5 B;  1Q7Y W;  4TWK A;  1K73 W;  1HNZ O;  1IZ3 A;  3A2F A;  3ZMZ A;  2VQE O;  4GKJ B;  2HFE C;  2QWR B;  4LNU A;  1FFT B;  3UCS C;  4DRX B;  1SQF A;  2EX3 A;  4MVS A;  3JAW A;  1RP3 B;  3F5W C;  3CCR V;  3TXQ A;  1VMG A;  2Q0O C;  1AI7 A;  2XHB A;  1XEQ A;  1GO3 F;  2QWQ B;  3CP1 A;  5JH7 B;  1U97 A;  3H01 A;  1V9P A;  1XNR B;  4J80 A;  2QDO A;  4P9P A;  1N32 B;  4E4E A;  3VQX A;  2CDY A;  2UXB O;  1N0N A;  4QJF B;  2Y0I A;  4UCU A;  1F4N A;  3ZHV A;  4WFE A;  4PA9 A;  3SYP A;  4DK0 A;  2HLD G;  1JOY A;  2DJV A;  1IBM B;  4DR7 O;  3CE2 A;  3SJC C;  4RUF A;  3AK1 A;  5BMV A;  1QVG U;  1M90 W;  1QR9 A;  2LGW A;  4FLY A;  2IW5 A;  5ITZ A;  4NYK A;  2CTQ A;  2AZ2 A;  2LP7 A;  4NXM B;  3AK2 A;  1VF6 A;  4WFA V;  4DR3 B;  2RN9 A;  3OMN B;  3JAL B;  4DR2 B;  2KSD A;  2ZE8 A;  1VQL V;  1GN3 A;  2ZKO A;  4YHH O;  5CA0 B;  4HBN A;  2Q8V A;  3ZRW B;  5A2Q N;  2GHY A;  5CB4 A;  3ZS8 C;  2GTA A;  4ASU G;  3ZED A;  1EN6 A;  3X2Q B;  4UXN A;  2IU0 A;  4JYC A;  3JAK B;  2W0F C;  4DV0 B;  4O4L B;  5KHH A;  3UQ8 A;  4N21 A;  4G28 B;  4ZHQ B;  1D2D A;  4ZKI A;  4WBN B;  3OEE G;  3IFX A;  2IH3 C;  5IYZ B;  1RSO B;  2GBO A;  1SA0 A;  1BE3 H;  1TUB A;  4NTX A;  1Q5O A;  1Q8I A;  2HG5 C;  1H2K A;  1AI6 A;  4MVM A;  4BW9 A;  1CXZ B;  5J2T A;  1OCO C;  2EZP A;  4I0X B;  4U3J A;  3QO8 A;  3C3S A;  2JGD B;  2EIN B;  3B8N A;  2ITC C;  3RYH B;  1YTF B;  2QGN A;  5HFM A;  3E89 A;  1MMM A;  1G6U A;  4J9Z B;  5B1B C;  3E35 A;  1NJI W;  2BTO A;  3QVN A;  2Q69 A;  3BAA A;  1KP2 A;  2YC0 A;  3BA9 A;  1QR8 A;  3OGI B;  1EBO A;  3RW0 A;  2Z5U A;  5BZB A;  2UXD B;  1IDS A;  2F93 B;  3UT5 A;  3ETE A;  3IC9 A;  1FYJ A;  2JEX A;  3FFQ A;  2G38 A;  4R8C A;  4B3R O;  1H8H G;  2VQF B;  4F6E A;  2AHZ A;  2EIL B;  3ZMS A;  2D3O W;  4B3M B;  4JI2 O;  3A0B Z;  3L72 H;  5IJ0 B;  4LBE C;  2ZE5 A;  2OYQ A;  3BFR A;  1N4C A;  3SJQ C;  4LF7 B;  3JSN A;  4DV4 O;  2OT5 A;  5L3C A;  1L0N H;  1HNW O;  5LHG A;  2WLM A;  1D5A A;  3AG4 C;  1XI1 A;  2WLI A;  3NXS A;  4L87 A;  3E83 A;  2E5L B;  3L73 H;  3JYC A;  5LA6 B;  2CUG A;  5CMU A;  4R6Z A;  5CA0 A;  3B40 A;  1M9N A;  3ZRW A;  3SYA A;  4RO2 A;  1VQ4 V;  3JAW B;  1YDX A;  1SA0 B;  3RGB A;  5J2U B;  5JCO C;  2OCH A;  2GUZ B;  3H1L H;  2HJF C;  2P90 A;  1B3Q A;  1HNX O;  3DXR A;  4B3M O;  4WBN A;  3H1J H;  1FFX A;  5LBQ A;  2B1I A;  2EJR A;  3HKB B;  2UU9 O;  3RYC B;  3O65 A;  4MS2 A;  1TUB B;  2DYS B;  5KAF Z;  2WAM A;  4W4L A;  1GN2 A;  3OMA B;  1X59 A;  5L3F A;  3G67 A;  1OCO B;  2JDI G;  4FFB A;  1OCR C;  3BA8 A;  4OGQ B;  1FD9 A;  4UB8 Z;  1MOF A;  1GKF A;  1YI2 V;  1S3J A;  4JYA O;  2E3C A;  3BY6 A;  1K7D A;  1Q43 A;  4DR6 B;  3B8M A;  3K08 A;  5IE9 A;  5AG2 A;  1BHA A;  3M99 B;  4NR1 A;  5LP6 A;  4DV2 B;  1JPX A;  1WAZ A;  5EZY B;  3X2Q C;  3ZMV A;  4YJ3 A;  1SQV H;  2DMX A;  3AG1 C;  1ZAU A;  4YHH B;  4PDM A;  2EIL C;  5H2F Z;  2QKS A;  4H0L B;  2M7W A;  1S0V A;  5LP6 C;  4X1K B;  3FAV A;  1XL4 A;  1I94 O;  4J42 A;  5EIB C;  3RFR A;  1UPG A;  1I5Y A;  1SES A;  5KMG A;  1MZE A;  2YSU B;  2IH1 C;  1IBK O;  4DR3 O;  3P3P A;  2P67 A;  1WA8 B;  2RJZ A;  1R6T A;  1IXM A;  1XRE A;  4TV8 B;  3K59 A;  1KYO F;  2MW2 B;  3K9A A;  4PI2 A;  3ZIA G;  1Q6H A;  1CPY A;  1K5S A;  2AGA A;  2V4D A;  1AJN A;  1XOU A;  1ZWI C;  3ABK B;  4MTO A;  1GK9 A;  4MVO A;  4PEL A;  5FNV B;  1B6Q A;  3LNM B;  3CD6 V;  5H5N A;  3C3T A;  2C2A A;  3SPH A;  1IBM O;  4TT3 G;  4RAI A;  3LNN A;  2WLL B;  3EXA A;  1ZL8 A;  2X6C A;  3SGI A;  1UJW B;  1T5E A;  2Q5Z A;  5LGT A;  2YIB D;  5GON A;  4CS4 A;  3STL C;  4ZBM A;  2P6J A;  4BIZ A;  3N2G A;  2BE3 A;  3JAR B;  4CBC A;  5BR8 B;  1YF2 A;  1S77 D;  4CS3 A;  4DK1 A;  3UKM A;  1HP8 A;  4XDJ A;  2XAF A;  4E2L A;  4X1K A;  1Y76 A;  1BQ0 A;  5JQG B;  1NH2 B;  3CHX A;  5FLX N;  3K5M A;  4UCR A;  1LUV A;  2XT9 A;  4B3T B;  3E22 A;  3UT5 B;  3W7X A;  3FYE B;  2Q7H A;  4LF9 B;  3FD9 A;  2YIC A;  1K3E A;  4MTX A;  3JAS B;  1NBM G;  3G4S V;  4FM0 A;  2YID A;  1TVK B;  3FAV B;  3B09 A;  2F66 C;  2FL4 A;  5LMU B;  3OD4 A;  4DV4 B;  3T2M A;  4AQY O;  5IJ0 A;  3W7S A;  1SER A;  1OZ0 A;  1MSD A;  4K35 A;  4ZOL A;  2DQ0 A;  2M6Y A;  2PYL A;  3ZHS A;  4UCV A;  4IIJ A;  2DE0 X;  5DM6 V;  1PNM A;  2VWJ A;  2ZCE A;  3DTU B;  4UB6 Z;  4X64 O;  1GRJ A;  1XBL A;  1DF4 A;  2ZR2 A;  1BGY H;  4I55 B;  4CH3 A;  1DK1 A;  2DQ3 A;  2HVK C;  4YXW G;  5EYP B;  4JAU A;  1ZLZ A;  3BPZ A;  2VQF O;  2PZS A;  2ZE6 A;  3ASN B;  4RWU A;  3RVY A;  4LP8 A;  2XUM A;  4I9Q A;  2ZM6 B;  3JAR A;  1VQP V;  4X62 O;  1GAX A;  5BXZ A;  4B7E A;  4OPA A;  3WFV A;  5B1A C;  1WN7 A;  2JIZ G;  2OIE A;  5JVD B;  4JYY A;  1N32 O;  2OCC C;  1WPB A;  2KQX A;  5GON B;  3U0Z A;  2QSA A;  4WFF A;  4X62 B;  1ZUQ A;  4Z1M G;  1HDJ A;  5IJ9 B;  3WG7 C;  3ZRX A;  4WFH A;  5IY5 B;  3FB8 C;  1FJG B;  2QJ1 A;  3APQ A;  1XUQ A;  5CBH A;  3J81 N;  3CYO A;  4CZZ A;  1NI8 A;  3CCL V;  1I0H A;  2P06 A;  3HPL C;  5CA1 A;  4U7N A;  5EC1 C;  4LFA B;  4HNA A;  3K5N A;  4LF5 O;  1IX9 A;  5E79 Z;  2WWW A;  1HNZ B;  1JX9 A;  2NLJ C;  1OCZ B;  1VAR A;  4GUN A;  4MVQ A;  3QNE A;  5LYJ A;  1K92 A;  1R3J C;  1FXK A;  1I5X A;  1VF5 B;  4PDL A;  2PUS A;  1LNQ A;  5CN0 A;  2GDS A;  3ZRS A;  2WLK A;  2A0L A;  1FKA O;  4RQF A;  1H2G A;  4K8Z A;  2FB5 A;  3TJT A;  2V7Q G;  2YXH A;  1JFF B;  3EVK A;  4I50 B;  3RWR D;  4CS2 A;  4JYA B;  4DV3 O;  1H8E G;  2WSS G;  4HAM A;  3F7V C;  4JI8 O;  1JR9 A;  2EIM C;  1PKX A;  4G27 B;  4JI3 B;  4I7Z B;  1YJN V;  4DR1 O;  3CCM V;  2X0L A;  4LCU C;  3WB2 A;  3K57 A;  3CMA V;  5LHH A;  5B3S B;  3BEH A;  3L74 H;  4O2B B;  4PDV A;  3ABK C;  3L9D A;  5CA3 A;  1GH6 A;  4LNU B;  2CTW A;  2IU3 A;  2VWK A;  2WLL A;  1SQX H;  1R1B A;  1H2N A;  2RCV A;  5BR8 O;  4DR5 O;  3JD1 A;  5B66 Z;  2JRI A;  3RYI A;  1OCZ C;  3QG5 A;  2DOS A;  1OCC C;  5TIS Z;  5H6R A;  4ZOL B;  3MAQ A;  1US6 A;  3CWB H;  3PN1 A;  4CC6 A;  4IYI A;  1JVM A;  4R50 A;  4ABM A;  3G71 V;  1K9M W;  5LYJ B;  4BIO A;  5LOV B;  3BRC A;  2PY5 A;  1BQZ A;  3JD4 A;  5B1B B;  3M7M X;  4JGS A;  3SYO A;  4B3S O;  2FYU H;  3ASO C;  1VQ6 V;  1VF7 A;  1BS3 A;  2A79 B;  4DV7 O;  1M56 C;  2RMK B;  1PL0 A;  4UV8 A;  5JCO A;  2YI8 A;  1NQT A;  1KKD A;  4PA4 A;  4B08 A;  2LQT A;  3KKY A;  3TET A;  5B1O A;  4IIJ B;  2QM8 A;  4DV6 B;  4X65 O;  1B04 A;  3CC4 V;  1AVM A;  1I08 A;  2JS5 A;  3CCJ V;  4GT1 A;  3KCY A;  1HW7 A;  1EFR G;  4UUJ C;  4LF4 B;  2RNB A;  4I55 A;  2B5U A;  5KHI A;  1NZ6 A;  3Q4H B;  1AB3 A;  3CRM A;  2CK3 G;  2LO1 A;  2UXX A;  2ZNJ A;  1NVP B;  3HKD A;  5LMU O;  1SC5 B;  3G6E V;  4QPK A;  2EJ7 A;  1RPO A;  1AR5 A;  2Q7G A;  2Z0A A;  4DV5 O;  1N34 O;  3E8H A;  2FTK A;  4FK5 C;  2K9P A;  4DUZ O;  4BWA A;  3RYF A;  3JCU Z;  1XNQ B;  1P49 A;  1HNX B;  5D5Q A;  4DV5 B;  4ZI7 A;  1S76 D;  1XMO B;  2E5L O;  1JMK C;  2GV9 A;  4FLZ A;  2QM7 A;  1SQB H;  4DR6 O;  3ML0 A;  1SQP H;  2X7R B;  3RN4 A;  2N74 A;  4QE9 A;  3ZHU A;  4JAV A;  3FX7 A;  1I7F A;  5CA1 B;  4B7K A;  2YIB A;  2ZT9 B;  3RT3 C;  1VQN V;  2P4V A;  1MSW D;  4I9W A;  4JPR A;  1L8D A;  3GWO A;  5KA6 A;  2ZNI A;  2Q6A A;  2F4V O;  2BTQ A;  2YIA A;  3N2K A;  1YTF D;  1FXH A;  1AR4 A;  3UM7 A;  2N05 A;  3M8A A;  3WG7 B;  3CCQ V;  2YXY A;  5KA5 A;  5C93 A;  1FPO A;  3E8G A;  1GN4 A;  3GWK C;  4PDR A;  1RM1 B;  3T4D A;  2GUZ A;  3JCZ A;  5E1A C;  2R9R B;  3OW2 U;  5FL7 G;  1N33 B;  1KBH A;  1E79 G;  1K8A W;  4MVR A;  2QWN B;  2OIG A;  2KG7 B;  4GKK B;  2IBZ H;  2V1D A;  5H6Q A;  3W7U A;  4DRX A;  2EUL A;  2YDE A;  3WB0 A;  3ABL B;  1KKC A;  1QLN A;  4MW8 A;  2VS0 A;  1GM8 A;  5LOV A;  3HKC B;  3D36 A;  4NVP A;  4X20 B;  2RDC A;  3CXH F;  2ARH A;  5KX5 A;  4MVZ A;  4JAA A;  4FLT A;  3OEH G;  1MAB G;  4XDK A;  4CH6 A;  5EZY A;  2H94 A;  4YJ3 B;  4XBF A;  3JAM N;  1AI5 A;  3BAB A;  1IUR A;  4DUY O;  4GKJ O;  2WPD G;  2JS3 A;  1OJH A;  4JI3 O;  1EN4 A;  4QNH B;  4HZ3 A;  2ODM A;  1F51 A;  3OR7 C;  2DYR C;  1KQS U;  4H13 B;  3H9V A;  4JI1 O;  2HJD A;  2A3Q A;  1DF5 A;  5GW7 A;  4X66 B;  3LDC A;  1B06 A;  1H2L A;  3Q4H A;  3DSQ A;  3ASN C;  2CH7 A;  5EC2 C;  4WF9 V;  1AJP A;  2HVJ C;  3K58 A;  2XND G;  2Y48 A;  4U3F H;  1HR0 B;  2XTA A;  5EIB D;  5LGU A;  4DR7 B;  4O2A B;  3DC5 A;  4NTY A;  1A32 A;  4MVU A;  2XAS A;  1RSO A;  2B1G A;  4FLX A;  2EIJ C;  3H1H H;  2R70 A;  2ZDI A;  3HR0 A;  5FNV A;  1Y74 B;  4PHZ A;  1N36 O;  4CH5 A;  4KXR A;  1M1K W;  5IT9 N;  4JI0 B;  4OPH A;  3CRQ A;  2F43 G;  5JH7 A;  1XNQ O;  4EKW A;  2N04 A;  5DN6 G;  3FB7 C;  4DR5 B;  2JGD A;  1YHQ V;  3LDE A;  2DW4 A;  3TCU A;  5B5E Z;  2CTP A;  4H44 B;  3AG1 B;  3CRC A;  5EK0 A;  4BIU A;  4X1I B;  2R72 A;  4K0K O;  3SR2 C;  1Q81 W;  2YEV B;  4TUY A;  1J5E O;  2UU9 B;  2ADQ B;  1AI4 A;  3I56 V;  4EB6 B;  5BMV B;  1VEW A;  3T1Y O;  2A9H A;  2P7T C;  3R66 A;  3K79 A;  2R9A A;  1ORQ C;  1N36 B;  3SPJ A;  3CB2 A;  1MNG A;  4GX2 A;  1NH2 D;  3RBZ A;  1Z2G A;  4WFB V;  2ZM6 O;  1URF A;  1YJ9 V;  1RFY A;  3D36 C;  2E75 B;  4LH7 A;  2HHH O;  2BSK A;  3QTC A;  4J41 A;  2WA4 A;  1NR1 A;  1R6N A;  2EIK B;  1V54 C;  2XAQ A;  3AG3 C;  4I0X A;  3CXC U;  1EZV H;  4U3J B;  3S3X A;  2WLI B;  3APO A;  3ZHR A;  4U7O A;  2KG7 A;  2PI5 A;  2EIN C;  2Q67 A;  4YY3 O;  4IYH A;  3ABM B;  4YIP A;  1QVF U;  4X65 B;  4GCZ A;  2E74 B;  3N2K B;  3K0D A;  5L3B A;  5KUM A;  3S3W A;  4X1Y A;  4O4L A;  1M56 B;  2PTM A;  1W2B U;  4JI4 B;  4UCS A;  4ZHQ A;  2YI9 A;  4EFB A;  5JJN B;  5J9P C;  1OCR B;  3DXR B;  1XMO O;  5IDJ A;  1FFX B;  1R6K A;  4BR6 A;  1D5N A;  2F1M A;  4QIW F;  1PV0 A;  4JI5 B;  4LF6 B;  1CP9 A;  1YJW V;  1YZB A;  4FLW A;  2OTJ V;  1N34 B;  4UCO A;  4EEQ A;  1VQ7 V;  1GMG A;  2YEV A;  4FMT A;  1ARO P;  4KHP B;  2H8P C;  3RYH A;  5FPO A;  5JVD A;  5K1X A;  1M57 B;  4UVC A;  2UUA O;  1KEC A;  1NVP D;  5KAI Z;  1BCC H;  2BOB C;  3QO7 A;  3ETD A;  4NXM O;  5LMN B;  3HKC A;  5LP6 B;  2Y0P A;  1OCC B;  3UO3 A;  4EB6 A;  1H2M A;  1JJ2 U;  2HR3 A;  2LW7 A;  4CC5 A;  2CE4 A;  4P30 A;  3OAA G;  2MK3 A;  1VIB A;  3K0G A;  5KX5 B;  2JGU A;  2A06 H;  4DR1 B;  2CTR A;  4IHJ B;  3SYC A;  2X6A A;  1IXB A;  5LA6 A;  4R7C A;  4BW5 A;  2IJI A;  3ABL C;  3TGU H;  3F7Y C;  4O2A A;  2X6B A;  4UV9 A;  5CB4 B;  4JF3 A;  1Q3E A;  1AP6 A;  4DW1 A;  5KMG B;  1EN5 A;  1O9G A;  4O4I A;  4FZ0 A;  2UXC O;  3BVO A;  4FM1 A;  4JI1 B;  2UUA B;  2BSK B;  4NTW A;  1NKD A;  2Z3Y A;  4IL6 Z;  3T1H O;  1OV9 A;  4KP4 A;  4NB5 A;  1QBZ A;  4X1Y B;  1FAF A;  2Y4U A;  5GTI Z;  4LR3 A;  2W6J G;  2AHY A;  2Y69 B;  1UFI A;  4MTG A;  4FLV A;  3CCU V;  4O4H A;  1JJO A;  1NR7 A;  4JI8 B;  2CH7 B;  1IVS A;  2JJ2 G;  4K8X A;  2XAH A;  2UUB B;  4JAS A;  4K0K B;  3LSU A;  3OFN G;  4PJ0 Z;  4JI6 B;  1W0J G;  2LW1 A;  2HP8 A;  2FKX A;  2UUB O;  1QHT A;  3JAT B;  4DYL A;  4O4J B;  2O57 A;  5DEC A;  4TOI A;  3CCS V;  3HKE A;  1VF6 C;  3G80 A;  1JA8 A;  4NKG B;  1JQ0 A;  5EBM C;  4O2B A;  3AG4 B;  5DED A;  4FFB B;  3JD2 A;  4LH6 A;  3ZMU A;  3HB3 B;  1Y6X A;  3AEI A;  1THZ A;  3U11 A;  2P4K A;  4JZG A;  4AI8 A;  3LUT B;  2XAG A;  2AXT Z;  2PGG A;  3ZRV A;  1DLB A;  2D2C B;  1QLE C;  3ICX A;  2HHH B;  3IGA C;  3GB7 C;  4X1I A;  4IHJ A;  5KLV H;  5LHI A;  4DV0 O;  4JI6 O;  5K1P A;  2ZE7 A;  3K03 A;  2Q0A A;  2EBO A;  5B1N A;  1M57 C;  1XL6 A;  1P84 F;  2QWO B;  3J80 N;  3L70 H;  1PNK A;  2UXN A;  3LSQ A;  4JI2 B;  3DC6 A;  4OX9 B;  1P7B A;  2F95 B;  4KUM A;  4DR4 O;  3L75 H;  1K34 A;  3D3Q A;  1COW G;  1KC8 W;  4JI7 O;  3JD0 A;  3IJ4 A;  1KP3 A;  2NN4 A;  1BMF G;  4F4L A;  1XMQ B;  4X64 B;  3A0H Z;  3O9O A;  2Q68 A;  4LF6 O;  1KU9 A;  3N2G B;  3R65 A;  1XIL A;  1SRY A;  3CEI A;  5FPR A;  3VQV A;  3JD3 A;  3RYC A;  4JV5 B;  3QO5 A;  2F4V B;  1J5E B;  4FPP A;  2QR4 A;  1Q86 W;  1Y66 A;  1ZL8 B;  2H3O A;  4GYC B;  4LFB B;  2NR5 A;  3ZN0 A;  4TQF A;  4MW3 A;  2GTS A;  1E1Q G;  1S72 V;  1NTZ H;  3A8T A;  4JV5 O;  1BHB A;  1Y76 B;  5JQG A;  3H1K H;  5EYP A;  4TV8 A;  3HKE B;  3CCV V;  3T1C A;  2BOC C;  4J7J A;  2Q4P A;  3ABU A;  3FYI B;  4DV1 O;  3SYQ A;  3N27 A;  4WCE V;  3OMI B;  1V54 B;  4PV1 B;  3OUF A;  4JZ2 A;  1VQK V;  3E8F A;  1XMQ O;  1TVK A;  4UVA A;  5IY5 C;  4O4J A;  1VQO V;  1AIL A;  5IWA B;  3T1Y B;  1HNW B;  1ZTE A;  3AG7 A;  4JTD B;  1V55 B;  2EZO A;  3HKD B;  5LL6 Y;  2QTO A;  2E76 B;  3CC7 V;  4X88 A;  2CGO A;  1EZJ A;  3H1I H;  5IYC O;  1XHX A;  1H2S B;  1WPX A;  5C8Y A;  5IJ9 A;  2F23 A;  4G2K A;  5ITZ B;  2W0X A;  1F23 A;  1QU7 A;  3CS5 A;  3L71 H;  3RYF B;  1SZT A;  1K5Q A;  2PF4 E;  1PD3 A;  1N33 O;  1ROP A;  1SZX A;  1HWY A;  4AIL C;  1KB9 F;  2ILM A;  2ZIO A;  5GTH Z;  1JCH A;  2Q73 A;  1K97 A;  4FZ1 A;  1NTM H;  3BCC H;  1L1F A;  4I5S A;  1GTO A;  1AP5 A;  5EBW C;  3MHS C;  4YY3 B;  5LGN A;  2UUC O;  2XAJ A;  1Q90 D;  1RPR A;  5KHK A;  2Q9L A;  4DV3 B;  3J7A U;  3CC2 V;  3CME V;  2QKC A;  5EBL C;  4AHC A;  3P30 A;  4FM2 A;  1O9H A;  1XHZ A;  3JAS A;  4F6R A;  2VQE B;  2EIJ B;  4YJ2 B;  2ZD9 A;  3WB1 A;  3P32 A;  1TUE B;  3ZX6 A;  4GX1 A;  2ETN A;  1Y4M A;  2YS8 A;  1Z5V A;  3THO A;  3KCX A;  2DWD C;  4GX5 A;  2IJJ A;  4O4H B;  1X4T A;  1TGO A;  1SQG A;  4MT8 A;  2QWP B;  2QKA A;  1M4U A;  4XDL A;  4DXW A;  1S5J A;  4H37 A;  1LR1 A;  2IJK A;  3ZHT A;  4GLX A;  4JYB A;  2QTS A;  5KHG A;  1P7G A;  2ZXW C;  1ZSP A;  1FXK C;  3ZN1 A;  3AG2 B;  4B3S B;  1VP7 A;  2ADP A;  2IM9 A;  1H38 A;  3OM3 B;  4TQD A;  3QF7 A;  3T4Z A;  4RUE A;  2UXB B;  4LF4 O;  2JK5 C;  3G6B A;  4QGP A;  1FS0 G;  1GM7 A;  2XOK G;  5IYB O;  4D7T A;  3AK3 A;  3PJS K;  4X66 O;  1JFF A;  4AQY B;  1IBL B;  2P22 C;  4JI7 B;  2WLH A;  1PM9 A;  1U96 A;  1ZX3 A;  2JEU A;  2OCC B;  2Y4T A;  4J7Z A;  1NS1 A;  5B1A B;  5L3G A;  3SPC A;  4D6T H;  1FXV A;  1KMI Z;  4P2Z A;  4I50 A;  4DUZ B;  3SJA C;  1R3L C;  4WFG A;  1L0L H;  2AZ0 A;  4A5U B;  4Q20 A;  3OE7 G;  4HNA B;  4MSW C;  2UXD O;  3I5D A;  4LF9 O;  1WP8 A;  2FML A;  3HKB A;  1SF9 A;  2L6L A;  3W7W A;  3ABT A;  1F4M A;  3OGC C;  1AJQ A;  4IGG A;  4B3R B;  2OWO A;  1K4D C;  3SPI A;  1RM1 C;  3CX5 F;  4BAY A;  4F6R B;  5CBF A;  1PNL A;  3IC7 A;  3K04 A;  3U10 A;  4PI0 A;  3B77 A;  1Q82 W;  2ZIN A;  3B4S A;  4LFC O;  5LXT B;  3D3I A;  4DW0 A;  3IAY A;  4N23 A;  4X89 A;  4LFC B;  4JI4 O;  2LJ2 A;  1KUQ A;  3CJH A;  3CCE V;  5H9C A;  1OHH G;  3D8C A;  5IYD O;  4UFZ A;  4RQE A;  2RQ6 A;  3LDD A;  3CPW U;  2ZIM A;  3OUS A;  5JWP A;  1N0J A;  4JI5 O;  3BHP A;  4ICG A;  1YXB A;  4QPJ A;  1WLE A;  2PYJ A;  1KD1 W;  4TSF G;  4KHP O;  3VQY A;  1Y67 A;  3OTF A;  1FJG O;  1SQQ H;  5F2V O;  2ZQM A;  2QA4 V;  4J11 A;  3VQW A;  1V55 C;  4P9O A;  5C8Y B;  2DYS C;  3KZI Z;  2GSM B;  4UCT A;  5B3S C;  4LFB O;  2YXL A;  1WA8 A;  2P5O A;  4TV9 A;  1DTO A;  4EFE A;  3DGE A;  3RYI B;  2Y69 C;  3T1H B;  1M93 A;  1MZF A;  1QQC A;  2JVD A;  3K5O A;  3OTO B;  1TA8 A;  1NT2 B;  5KUK A;  1S5H C;  1YSC A;  1M5I A;  4GKK O;  3ZHQ A;  4LF8 O;  3WU2 Z;  3ZMT A;  4I4T B;  1PP9 H;  4PA6 A;  1GN6 A;  1G4Y B;  3B2E E;  4DV2 O;  5LMN O;  4CH4 A;  4W4K A;  2OTL V;  4LC1 A;  3I55 V;  2UXC B;  4LWS A;  1DGS A;  3ETQ A;  1LUW A;  4JTC B;  4IT5 A;  1VQ8 V;  1Q6U A;  3ZJZ A;  3MHH C;  2HEP A;  4J10 A;  4YJ2 A;  2CAZ C;  2K1E A;  1QNM A;  3RVZ A;  3VOU A;  4FLU A;  2KKW A;  3CJH B;  2EIK C;  2L35 A;  4LFA O;  3OTO O;  4FVM A;  1IBK B;  2JJ1 G;  3ASO B;  4FIP C;  4PD4 F;  3SDL A;  1QCE A;  1W0K G;  1IBL O;  2NNU A;  1Z5W A;  5KHJ A;  3EHB B;  1HR0 O;  2WLN A;  3CRR A;  1WNS A;  2BCC H;  2QM4 A;  2KB1 A;  2UUC B;  1K4C C;  2B9Z A;  2HKO A;  3E22 B;  5L3D A;  4ZIB A;  1J95 A;  1R73 A;  4L8J A;  3UO2 A;  3OT7 A;  4FJC C;  4DUY B;  4JI0 O;  3GVM A;  1AR1 B;  1PL4 A;  3OR6 C;  3E2E A;  3LSS A;  2PI4 A;  4NXN O;  1CEZ A;  4Q6G A;  3ETG A;  3EFF K;  3P3N A;  3NR7 A;  1GM9 A;  1Q6I A;  2A7W A;  2BTQ B;  3STZ C;  4NXN B;  4QE7 A;  3FKS G;  4DR2 O;  1YIT V;  1G8M A;  1XQ8 A;  2WLJ A;  3ZCC A;  4DV7 B;  4YIO A;  1WB8 A;  5JJJ B;  4I4T A;  4X9Q A;  2DN9 A;  4FFK A;  4ZI7 B;  2CGN A;  5JJE B;  1VQ5 V;  4J7K A;  3AG2 C;  4MTF A;  2QEX V;  4O4I B;  4LWS B;  3AG3 B;  2ZXW B;  1MG1 A;  3C90 A;  1BSM A;  5J2T B;  4D7S A;  4DR4 B;  3JSL A;  2EIM B;  4B3T O;  4GZR B;  1F7Y A;  4Z1V A;  1ENV A;  3SJB C;  3TK1 A;  4C7U A;  1G1X B;  4OXS A;  4JTA B;  4DV1 B;  2VRZ A;  5A9G A;  1N8R W;  1PPJ H;  3K3W A;  1BT8 A;  4KFM A;  4X20 A;  2DYR B;  3SPG A;  5L3E A;  2R9I A;  3KG2 A;  2ATK C;  3K06 A;  1E1R G;  1BZK A;  5LXT A;  1TAE A;  3E86 A;  3F5T A;  1XDC A;  3JAT A;  1VQ9 V;  2YUA A;  4HYO A;  2ZR3 A; 
#chains in the Genus database with same CATH homology
 1J5E O;  4DUZ O;  2DOS A;  4NXM O;  3T1Y O;  3J81 N;  3R66 A;  4B3R O;  5FLX N;  2DJV A;  4JI0 O;  4LF4 O;  2E5L O;  5IWA O;  4KHP O;  4DR7 O;  4DV0 O;  2LW7 A;  1FJG O;  4JI6 O;  4X66 O;  4NXN O;  4DR6 O;  3JAM N;  4LF5 O;  1I94 O;  2N74 A;  4JI2 O;  4DUY O;  1N33 O;  4LFB O;  5BY1 A;  4GKJ O;  4JI3 O;  3J80 N;  2ZM6 O;  4DV4 O;  4DR2 O;  1NS1 A;  1HNW O;  1IBK O;  3RT3 C;  4DV6 O;  4DR3 O;  4AQY O;  4YHH O;  2HHH O;  2ZKO A;  4OX9 O;  4B3S O;  5A2Q N;  4JI1 O;  2UUC O;  2F4V O;  4DR4 O;  2UXC O;  1R6T A;  3J7A U;  1FKA O;  4JI7 O;  4A5U B;  4GKK O;  3T1H O;  4LF8 O;  3M8A A;  4YY3 O;  2UXD O;  4DV3 O;  4LF9 O;  1D2D A;  4LF6 O;  2AGA A;  4DV7 O;  4DV2 O;  4LF7 O;  1XNR O;  5LMN O;  4X64 O;  1HNX O;  4JI8 O;  4B3M O;  4B3T O;  1A32 A;  1DK1 A;  5H5N A;  2UU9 O;  1F7Y A;  3O65 A;  4X65 O;  2VQF O;  1XMO O;  1IBM O;  1G1X B;  4LFC O;  4JV5 O;  4DR1 O;  1N36 O;  1HNZ O;  5IT9 N;  2VQE O;  4OPH A;  1X59 A;  4LFA O;  2FKX A;  3OTO O;  1XNQ O;  1YZB A;  4X62 O;  2UUB O;  1AB3 A;  4DV1 O;  5BXZ A;  4OPA A;  4JI4 O;  3SDL A;  1KUQ A;  5LMU O;  1N32 O;  1XMQ O;  1IBL O;  1XEQ A;  3F5T A;  1R1B A;  1HR0 O;  4JYA O;  1AIL A;  2Z0A A;  5BR8 O;  4DV5 O;  4DR5 O;  1N34 O;  4JI5 O;  4K0K O;  5LL6 Y;  2JRI A;  2UUA O;  2UXB O;  1FYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...