1NS1A

Rna-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nonstructural protein
molecule keywords NONSTRUCTURAL PROTEIN 1
publication title A novel RNA-binding motif in influenza A virus non-structural protein 1.
pubmed doi rcsb
source organism Influenza a virus
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ns1A00
4DV5O 4GKKO 4LFCO 2UUCO 5BY1A 4DV6O 2Z0AA 4X64O 1N34O 2HHHO 4DR7O 3JAMN 2N74A 1IBKO 2UUBO 1F7YA 4KHPO 4GKJO 5FLXN 2LW7A 4OPAA 2E5LO 1X59A 4X65O 4DV1O 4JI3O 1YZBA 4LF9O 4JI0O 4DR1O 4X62O 3F5TA 4DR3O 1NS1A 4B3SO 1G1XB 2VQFO 4NXNO 5A2QN 1AB3A 2F4VO 4DR6O 4JI5O 1A32A 3SDLA 1IBMO 5BXZA 5IWAO 5BR8O 1XNRO 3RT3C 4DR2O 2ZKOA 4JYAO 3J7AU 3M8AA 4DUZO 2UXCO 4DV7O 2UUAO 4B3RO 4JI2O 5IT9N 1DK1A 4LFAO 1D2DA 4DV4O 1FKAO 1I94O 4B3MO 4DR5O 4LF7O 5LL6Y 5LMUO 5LMNO 2UXDO 2DJVA 2ZM6O 2VQEO 3J81N 4DV0O 4LFBO 1FJGO 4DUYO 4JI1O 1KUQA 4NXMO 1HR0O 2DOSA 1N36O 4JI4O 4LF4O 3O65A 2JRIA 1XMQO 2UXBO 3R66A 3T1YO 4JI6O 2FKXA 4OPHA 1N32O 4X66O 3J80N 4DR4O 4DV2O 1XMOO 2AGAA 1HNWO 4B3TO 5H5NA 4YY3O 1R1BA 4LF5O 4LF8O 1FYJA 2UU9O 4JI7O 4K0KO 4JI8O 1HNXO 4YHHO 3T1HO 4A5UB 1IBLO 3OTOO 4JV5O 1XNQO 4LF6O 4AQYO 1N33O 1AILA 4DV3O 1HNZO 1XEQA 4OX9O 1J5EO 1R6TA
chains in the Genus database with same CATH superfamily
4JZ2A 4ZOLA 2DE0X 5KX5B 1F23A 2EJRA 4LFCO 2YDEA 1P84F 1YIJV 4DR7B 1YJWV 1NKDA 5HFMA 4B7KA 4BW5A 1YXBA 1AR5A 1UFIA 3K79A 3G71V 4O4HA 4JI0B 1RFYA 3GWKC 2LW7A 5CA1A 4I55B 5IYZA 2QGNA 2EULA 3WG7C 4LF9O 1B6QA 4I50A 4LWSA 1ZWIC 2UXCB 5FPOA 1VMGA 3RT3C 3QO7A 2XUMA 2MK3A 3CHXA 4FM1A 1MZEA 4NTWA 4DUZO 3VOUA 3K57A 1VF7A 2UUAO 3RW0A 4LH6A 5B1AB 2IW5A 4ABMA 4EEQA 2B1GA 2R72A 5JQGA 4DV4O 1CP9A 3UO3A 1K4DC 3ABTA 5E79Z 1M93A 1OHHG 2Q4PA 3TXSA 2LO1A 4LF4B 2ZE7A 1K33A 2NNUA 3B4SA 1GO3F 3G80A 2GV9A 4EKWA 4UV8A 1H2MA 1SA0B 2BE3A 1MOFA 2ODMA 2DW4A 1YVWA 4X66O 4JI8B 1ZL8B 2R9IA 3N2GB 4P30A 4B3TO 1WAZA 5KHKA 4LF8O 2M7WA 4FIPC 4KL1A 4PA9A 2Q7HA 3FB6C 4DW1A 4DW0A 3FKSG 4WF9V 1EM1A 1OZ0A 3HR0A 1OCCC 1S5HC 2XAJA 4FZ0A 4GZRB 4ZIBA 4KUMA 4YJ3B 1BGYH 2A9HA 4HYOA 4I5SA 4FK5C 3K9SA 3CWBH 2O57A 1SERA 1MZFA 1YJ9V 1FFXB 2E75B 5KA5A 2Y0IA 2PI5A 4DR7O 4J10A 2QKSA 4Q6GA 1AI6A 2ZQMA 2P6JA 4GLXA 2EILB 4D7SA 2QSAA 3CRAA 4JI0O 1G8MA 4DR6B 3BVOA 3RVYA 2QWNB 3E8GA 1NTZH 1XDCA 3JD2A 5H2FZ 1S5LZ 1N0NA 2UXCO 2CH7B 4LC1A 4LBEC 2ARHA 3QF7A 3W7WA 5B3SC 5CBFA 4UVAA 3AG1B 1HR0B 3ZIAG 1U97A 4P2ZA 4TV9B 1N36B 1VIBA 4WFHA 1KUQA 4L8JA 1NVPB 4LF4O 3O65A 1RM1B 4MTFA 3JCZA 3CPWU 2IM9A 4DV2B 3PN1A 4ZOLB 2N04A 4LF5B 3E86A 2IH3C 4DO2A 1KKDA 1V55C 2RCVA 1R3KC 4JI8O 1KYOF 3CXHF 4O4HB 5CA1B 5IYZB 5EC2C 3ZJZA 5L3FA 2EIMC 2EINC 1XUQA 2GTAA 4CH5A 4I50B 3A0RA 4LWSB 5IYCO 5B1OA 4DV6B 4X1YA 1E1QG 2CGNA 4BW9A 1M57C 4CC5A 1S72V 1FPOA 2Z0AA 3WB1A 1NVPD 5JQGB 2GBOA 1Q3EA 3ABKC 3B09A 5FNVA 3D8CA 4X62B 3Q4HB 1S5JA 1AI7A 1GRJA 1CXZB 1JR9A 4QE7A 3U11A 4X9QA 2VS0A 4FLXA 2RJZA 2NR5A 3C90A 4DR6O 4XBFA 5CBGA 3SDLA 4F4LA 2HKOA 5BXZA 3W7UA 2L35A 4RUFA 4DR5B 2E76B 1H38A 5IJ0A 2RNBA 2LGQA 1FJGB 4LR3A 3D3IA 3BCCH 4TQDA 4RWUA 1XHZA 1ZSPA 1FXKA 4X20B 5JWPA 1W0JG 2JEXA 2QKAA 1HR0O 4QE9A 5LP6C 1Q90D 2V1DA 4UCUA 5LOVA 3D36A 4JGSA 1N36O 5EBWC 1AJPA 1VF6C 3SPCA 1PNKA 1DGSA 3R66A 2B5UA 5KA6A 1VQPV 2WLHA 3ZHRA 2WWWA 2BTQA 4E4EA 3UO2A 2YI8A 4DV2O 2R9RB 4U3JA 3E2EA 3HPLC 4UCOA 4ICGA 4LF5O 1SQPH 1SQVH 2Q73A 3ZMTA 5C93A 1COWG 1N33B 1WB8A 2YIAA 2IU0A 1K92A 3OGCC 1L1FA 2C2AA 3UCSC 1K7DA 1TVKA 3BHPA 1YHQV 2CTPA 5IYDO 2D2CB 4FM2A 2NN4A 4DV6O 1T5EA 5CN0A 5JVDA 3X2QB 5ITZA 5LBQA 4X65B 2CE4A 4X89A 1NJIW 5GONA 4J7JA 2Q0AA 1EN6A 3OE7G 2VQFB 2EIJC 1TAEA 1WN7A 1PD3A 4X62O 1OCRB 4B7EA 5LXTA 4BIZA 3BY6A 3CCRV 4FLWA 3JSNA 1SF9A 2JJ1G 4B3RB 4NR1A 3K08A 1Q82W 4PHZA 3SJAC 3KZIZ 3M8AA 1DK1A 1ZTEA 2EIMB 3IC7A 4DR5O 4JAVA 2P22C 2HFEC 2R9AA 1YDXA 3STLC 4W4KA 3CP1A 5KAFZ 1FJGO 3BABA 1M57B 1EZJA 1ZUQA 2CDYA 1FS0G 2GUZA 5LGTA 2OCCC 2ZE8A 1SS3A 3AK2A 1XMOB 5IJ9A 2BCCH 2Y4UA 4QGPA 2WLKA 4RQEA 4X1YB 1U96A 2Q67A 3CCMV 4U7NA 3CCLV 2Q69A 1IBLB 3H01A 2IJJA 2V7QG 1K5QA 3K0GA 4H37A 5FNVB 1AJNA 1ROPA 1N33O 1IZ3A 1GKFA 1GN6A 1K34A 1QLNA 4F6RA 3ZMZA 3RVZA 4CC6A 3MDSA 2DQ0A 1BE3H 5CB4A 1AJQA 4MTGA 4LCUC 1DTOA 3B77A 4R6ZA 3K59A 2JVDA 4PD4F 3SYOA 3ZHQA 3A2FA 2EIKC 1KBHA 4PDRA 1JMKC 1IDSA 5IJ0B 3O9OA 1YI2V 2DN9A 1F7YA 4X1IA 4X65O 1SKVA 1FXKB 2IJIA 2WLNA 2IU3A 2F4VB 1M1KW 3H9VA 3F5TA 3ABLB 2VQFO 5BR8B 5LOVB 1I5YA 4TUYB 1ZL8A 3FD9A 4TWKA 2PUSA 1AR1B 2H8PC 4HAMA 2JIZG 1QLEC 1HW7A 2JGDA 4B3RO 5IT9N 5LMNB 1NQTA 2BTQB 3S3WA 4U3JB 1G4YB 2HVKC 2ZXWC 3ZBHA 4W4LA 3R65A 4K3AA 5IY5B 2DYSB 4FZ1A 1P7GA 2ADPA 3CYOA 4IYHA 3CJHA 4NVPA 1KMIZ 2DOSA 3ZMUA 3P30A 1TVKB 2VWKA 2JRIA 1JVMA 1AI5A 1I7FA 2OCHA 3DTUB 1AVMA 1XMOO 1FYJA 2OIEA 1SZTA 3GWOA 5JVDB 4L87A 3ZCCA 5ITZB 1IBLO 4DXWA 5GONB 3LUTB 1KKCA 3FB7C 4GKKB 5D5QA 2CH7A 2DYRB 1QBZA 1VQ5V 4MT8A 2NLJC 4H33A 2JS3A 4QIWF 3ETEA 2OCCB 4WFFA 3OUFA 3H1IH 1ZX3A 3G4SV 2VRZA 1WJZA 4JASA 4DRXA 1SQQH 3TGUH 1V54B 2PY5A 4I4TA 4WFEA 3L74H 5CA0A 1XNRB 4DK1A 1WPBA 2GUZB 3E8FA 2F4VO 1KQSU 1AROP 2Y48A 5BZBA 1V9PA 1Y66A 5BR8O 1NBMG 3SGIA 5IJ9B 4AI8A 2BSKB 2FL4A 3LNMB 3VQVA 4MVRA 1Q6IA 1E79G 2KSDA 1IVSA 5EBLC 1JQ0A 3N27A 1GM7A 1K3EA 5LMNO 2Q5ZA 2PF4E 2DMXA 3E89A 3J81N 2HLDG 1KU9A 5EYPA 1M9NA 1PL4A 1XMQB 5EIBC 1DLBA 2EIKB 4FFBA 4ZI7A 3RN4A 4PDLA 4F6RB 2DWDC 1N32B 1WNSA 3ASNB 5CB4B 3K58A 1OCOC 4MTOA 5D5PA 5LA6A 2AGAA 1B06A 3Q4HA 5H5NA 4YHHB 3OTOB 3BPZA 4JTCB 1M56B 1K4CC 4FMTA 1Q43A 1N4CA 1MNGA 1W59A 4J42A 3RBZA 1QLEB 4X1IB 1AILA 3DGEA 3OEHG 1VQ9V 2EJ7A 1CEZA 4RO2A 1SESA 2AW9A 3P3NA 1YSCA 4GKKO 2K1EA 3F5WC 4KP4A 3K3WA 2YSUB 2RMKB 3MHHC 1Y74A 2JGDB 4KHPB 3EVKA 4X20A 2DWEC 4OXSA 2XTAA 3RYIA 2X6AA 1VP7A 3ETDA 3H1LH 3WU2Z 1BQ0A 2QDOA 1PL0A 1YZBA 3CRQA 5J9PC 4J11A 3CJHB 3L9DA 5IWAB 3LSQA 1L0LH 1WA8A 2AHYA 5IYBO 1XL4A 1ENVA 1XNRO 2B1IA 5DECA 4B3MB 5LMUB 1JPXA 4KFMA 1VARA 2YXLA 5JCOC 5K1XA 5LHIA 3CCEV 3G6BA 4O4IA 3G67A 3K04A 4FJCC 3N2KA 2QR4A 2XOKG 3GVMA 1L0NH 2WLMA 2ZINA 5KAIZ 4CS2A 4JAUA 2FMLA 3K9AA 4UB8Z 2YIBA 3TCUA 2XHBA 3CD6V 1K5SA 1XMQO 3JASA 4CZZA 2H94A 1SQBH 1HNWB 1R6NA 2ITDC 1L8DA 1N32O 2HEPA 3IJ4A 5KLVH 1R1BA 1XNQB 1NR7A 5B66Z 5J2UA 1H2GA 4YHHO 2LW1A 3OTOO 2A7WA 1SQFA 4AHCA 1SETA 2Y69C 4DRXB 2XAQA 3QTCA 3OMAB 4GUNA 4H13B 4I9WA 3DC6A 1VQLV 1H8EG 4I4TB 1VQ6V 2QJ1A 5CA0B 3MAQA 3SYAA 4BIUA 2AHZA 1XOUA 4BIOA 3WG7B 3ZRXA 1VF5B 2QM8A 3I56V 4UCVA 2BTOA 3W7TA 2WA3A 2W0FC 1IBKB 2LQTA 1BQZA 3FX7A 1VQ7V 2V4DA 4KHPO 1OCOB 3VQWA 5EYPB 1E1RG 1NS1A 3B8NA 4GCZA 4PDVA 3H1HH 1VQMV 4FFBB 4HZ3A 4ZI7B 1GM9A 2YUAA 1M90W 5IWAO 5FL7G 2WAMA 2KKWA 2EZOA 1LUWA 4EFEA 5LA6B 5L3GA 1GAXA 1D2DA 3H1JH 4B3MO 1GH6A 3CXCU 2A06H 5LMUO 4RAIA 1MG1A 5LGNA 3GB7C 3SJBC 3L71H 1SZXA 4O2AA 5GW7A 4FVMA 2UXBB 1LR1A 4J9YB 4WFAV 5LP6A 1BZKA 4DR4B 3E8BA 1GMGA 1OCCB 3OUSA 1VF6A 2G38A 3EFFK 1HNXB 1HNWO 1QR8A 1Y74B 4BR6A 1RSOA 2HJDA 3OAAG 1AP5A 1N8RW 4C7UA 1S0VA 3AG4C 3RYIB 3MD0A 1XNQO 1Z5WA 1R6KA 4PV1B 4TQFA 4BAYA 4TUYA 1EBOA 3E22A 4JYBA 5CA3A 2YIDA 1NTKH 4DV5B 1QQCA 5IE9A 2AZ2A 3CC7V 1NI8A 1WA8B 3ZHSA 4FPPA 3T4ZA 1Y67A 4IHJB 1Z5VA 5BY1A 4Q20A 3K0DA 2ZIOA 2QM7A 3OGIB 5LGUA 2WLLA 3OMNB 2BOBC 2ZE6A 1IBKO 2FB5A 5EK0A 4FLVA 4O4IB 2AXTZ 3N2KB 4Z1MG 5B3SB 3PJSK 3AG3C 2P06A 3ABUA 2YC0A 3T2MA 3AK3A 4R8CA 3JASB 3TETA 4LFAB 4RUEA 1O9HA 1RP3B 4XDKA 1NT2B 3CB2A 2P67A 4CH3A 1B04A 5LL6Y 5J2UB 1WP7A 4TSFG 1GK9A 2DQ3A 2IH1C 1V55B 4FLTA 4IGGA 1RPOA 4EB6A 4O4JA 3CC2V 3BEHA 4JI6B 1Q7YW 1EN5A 1H8HG 1Y76A 2UXBO 3RWRD 2EINB 3JYCA 3SJCC 3F7VC 1HWYA 2FKXA 2PGGA 3LNNA 4K0KB 4DR4O 3OMIB 5F2VO 2OTLV 2P90A 3LSSA 2Y0PA 1HNXO 3CS5A 1EFRG 3RYCA 1PV0A 4MVQA 4MVZA 4DV3B 2UXXA 3ZMVA 1KD1W 1NZ6A 2F23A 1IXBA 3DXRA 3ZHVA 3ABKB 2MW2B 3IAYA 3WB2A 3AK1A 2ZNJA 4N23A 2BSKA 2PZSA 1PNLA 4DV5O 1BSMA 4QJFB 2ETNA 5KHHA 2QKCA 4AILC 4UVBA 1HDJA 4BWAA 2BOCC 2GSMB 2N74A 2B9ZA 3JD0A 2XASA 3SPGA 3SYCA 4K8ZA 4NXNB 1KP3A 5B1BC 2CUGA 2LP7A 1WLEA 1JJ2U 3T1CA 3TXQA 4UCSA 4JI5B 4ZHQA 4O2AB 4KXRA 1IBMB 1G1XB 2VWJA 4DR2B 4WFBV 1QVFU 4Z1VA 1QU7A 1R3LC 5LP6B 2ZKOA 2YICA 1QCEA 3ZEDA 1EZVH 2OTJV 5HFLA 3CCJV 4LFAO 4RQFA 3CX5F 3U10A 4PI2A 2LGWA 1J95A 2OT5A 4DV0B 1FFTB 3ETGA 2QWPB 4LFBB 1RSOB 2ZNIA 4LH7A 4YIPA 2KB1A 2CTRA 2QM4A 1I0HA 3L72H 3FAVA 2QA4V 3T4DA 4DK0A 3JD1A 1UJWB 3E22B 4LP8A 4PI0A 1SRYA 5E1AC 4ZKIA 1S3JA 3RYHA 2JK5C 4MSWC 4JI6O 4OPHA 4JI7B 5KUKA 2QWQB 4UV9A 2ZDIC 1YF2A 3EHBB 3G6EV 3NXSA 3OW2U 3F7YC 4NTXA 1DF4A 2KQXA 1ORQC 4K0KO 1EN4A 4J80A 2WLLB 3FFQA 3JALB 1JJOA 2XAGA 4TV8A 3APQA 4DV3O 3SJQC 3MHSC 3A8TA 1XEQA 3BFRA 1XILA 2EIJB 3K5LA 2WPDG 1IURA 3OEEG 4QPKA 2ZE5A 3CEIA 3WFVA 4DV1B 3OT7A 4R50A 4X8AA 2XT9A 3LDCA 4OPAA 3B8MA 3ZHTA 3FYIB 1IXMA 1BHBA 4PJ0Z 1XHXA 4X1KA 2P5OA 2ADQB 4NXNO 1GN4A 4EB6B 4O4JB 2Y4TA 3ZRVA 4JI5O 1Y4MA 1Y76B 1IBMO 4IT5A 4X88A 4DR2O 5C8YA 1GN3A 3J7AU 1Q8IA 3W7XA 1WPXA 2Q7GA 1FKAO 2PYJA 2EILC 1GTOA 5EZYA 4G27B 4JI1B 3RFRA 2QWRB 2XAHA 4O4LA 2DJVA 1OJHA 2ZR2A 1Q6HA 4DV0O 5FPRA 4E2LA 3RYCB 4LFBO 3SPHA 2GHYA 3I55V 2CK3G 3HKDA 4PA3A 1YTFB 5DM6V 3DXRB 1VQKV 3FB5C 4R7CA 1W2BU 5JJNB 4GYCB 4YY3B 3AG7A 2IJKA 3J80N 3AG1C 3QNEA 5GTHZ 4WBNA 2QWOB 4WCEV 4JI7O 1H2KA 1Q86W 2F1MA 5K1PA 2JDIG 1RM1C 3LSUA 1R3JC 1URFA 4J9ZB 4NKGB 4GX1A 2P7TC 2IBZH 4I9QA 4ZHQB 2HP8A 5L3EA 3ICXA 2HG5C 2UUCB 1AR4A 2WLIA 3KG2A 2KG7A 1SQGA 4GX5A 3BA9A 2HHHB 1OCZC 1PM9A 2LFRA 2GDSA 1YTFD 3ZRWA 1TUEB 3RYFA 4I7ZB 3JAMN 2N05A 1P4RA 2F66C 3K5NA 1I08A 1K8AW 3D3QA 4DV1O 3FAVB 4UCRA 2IJHA 2ZXWB 5BMVA 2F95B 4J7KA 4MVOA 1MMMA 3K5MA 3STZC 3OTFA 3RYHB 2JS5A 1I94B 1AI4A 3QO8A 3M99B 1PNMA 1ZAUA 4QNHB 5TISZ 2UXDB 1GM8A 4I0XA 4DUYB 1KECA 3OR6C 4JTAB 1O9GA 4B08A 3UT5A 4F6EA 5JCOA 4O2BA 1YITV 4JI1O 1CPYA 4TV8B 3ZX6A 3T1YB 1WB7A 4UB6Z 3CCSV 4IHJA 1BHAA 1R3IC 2PI4A 3WB0A 4CBCA 4UVCA 3ML0A 3E35A 2H3OA 3ZHUA 1K97A 1UPGA 5KHJA 2CTWA 4K35A 1VEWA 4YY3O 3U0ZA 4AQYB 1H2NA 4FM0A 1JFFA 2K9PA 3JSLA 5L3CA 2WLJA 2HVJC 4PA4A 1Q6UA 1W0KG 4P9OA 5EC1C 3JATA 4JYCA 3HKEA 3SYPA 2QEXV 4X1KB 2QTOA 1NR1A 1R6TA 4NYKA 2CGOA 3QO5A 2L6LA 2E3CA 3A0BZ 2UUCO 2YXHA 5C8YB 2Q68A 3VQXA 2ZR3A 3IFXA 1BCCH 4GKJB 2HHHO 2E5LB 3CCVV 1XBLA 2CAZC 3NR7A 3IC9A 3ZS8C 5EZYB 5EBMC 5KHGA 4DYLA 4O4LB 4DR3B 1FAFA 1JA8A 1B3QA 3BA8A 3W7SA 3HKDB 5CBHA 3SPJA 1TUBA 1LUVA 3L75H 3CSXA 4PA7A 1AB3A 3JD3A 2ZD9A 4FLZA 1THZA 2QTSA 4OGQB 3X2QC 1QVGU 4JPRA 3C3SA 2ZT9B 4LNUA 1DF5A 4Z2WA 4J41A 1I94O 2ZM6B 4CS4A 1XQ8A 2YEVA 2YI9A 4WBNB 1PKXA 3HKCA 1OCRC 3CMAV 2UXDO 4ASUG 1KC8W 4TT3G 3JCUZ 4DUYO 4JI4B 3OFNG 1OCZB 1US6A 4UCTA 1TA8A 2Z3YA 4IIJA 1OV9A 4JF3A 1KP2A 1I5XA 1KB9F 5H9CA 4HBNA 2M6YA 3P32A 1LNQA 1MSDA 2X6BA 4HNAA 2WLIB 2HJFC 3T1YO 1JOYA 2KG7B 3UM7A 4JTDB 3B2EE 5DEDA 4U7OA 3T1HB 4IYIA 3UQ8A 3ZRWB 3HB3B 2A3QA 4LF6B 3RYFB 2ZIMA 3AG2C 5EIBD 2Q9LA 3S3XA 3H1KH 1HNZB 4UUJC 4AQYO 2XNDG 4NB5A 3CE2A 2FYUH 3HKBA 3E83A 5KMGA 4MW8A 5BMVB 1F51A 4D7TA 2OWOA 3ZMSA 2JEUA 3ASOC 1Z2GA 3BRCA 1MA1A 3JAKA 3DC5A 1XREA 3JAWA 4G28B 4MVUA 1TGOA 2F93B 4MW3A 1QNMA 1D5AA 4YIOA 4YJ2A 4UXNA 3A0HZ 3ZN0A 2ILMA 4I0XB 4JI3B 5L3DA 5IDJA 3SPIA 4GKJO 2R70A 3CCQV 3CRCA 2E5LO 4B3SB 3UT5B 3OD4A 3CMEV 1JCHA 1YJNV 4O2BB 4GX2A 4DR3O 5LYJA 2P4VA 4JYAB 4N21A 5A2QN 1XI1A 3JARA 4JI2B 1YEWA 2ATKC 4JYYA 4LF7B 2EX3A 2CTQA 5B5EZ 2YXYA 3KKYA 3LDDA 3JALA 3AEIA 1FXKC 2VQEB 2D3OW 5LHHA 3RGBA 2UXNA 1N0JA 3ABLC 4NXMB 2ZM6O 3FYEB 2GTSA 3D36C 4P9PA 4MVMA 1JFFB 2E74B 1QHTA 3UKMA 3JATB 3SYQA 4JI4O 3K06A 3HKEB 2Q6AA 2Y69B 5JJJB 5J2TA 3CRMA 3K5OA 3ABMC 2LJ2A 2UU9B 1JX9A 4D6TH 1NTMH 5IY5C 2DYSC 4JV5B 2RDCA 2A79B 1K73W 2Q8VA 1VQOV 3L70H 3T1HO 1S76D 2P4KA 4LF6O 1R73A 2Z5UA 3I5DA 1J5EB 5JH7A 1HNZO 2W6JG 2X7RB 4TOIA 1TUBB 3EXAA 5JJEB 1G6UA 3OM3B 4X64B 2YIBD 1BL8A 1F4MA 1N34B 2FTKA 4FFKA 2UUBB 5B1NA 4LNUB 3TJTA 1NH2B 2YEVB 4DR1B 3HKCB 1VQNV 3CCUV 1X59A 2DYRC 4JI3O 1GN2A 1VQ8V 4B3SO 4IIJB 2W6IG 5KX5A 4DV7B 3AG2B 3KCXA 4JYAO 4EFBA 4HNAB 1MSWD 1M4UA 4NTYA 4JI2O 4CH6A 2Q0OC 1X4TA 4LF7O 1V54C 5KUMA 2QE7G 1MABG 4I55A 2LFSA 2VQEO 3ASOB 1AP6A 4NXMO 2A0LA 1PP9H 4UFZA 1NH2D 3AG4B 3HKBB 4YXWG 4CS3A 1H2SB 4QPJA 1YCIA 3K03A 5KMGB 1M5IA 3DSQA 4H0LB 3SR2C 2JJ2G 2WA4A 3JAKB 3JAWB 2UU9O 4YJ2B 2ITCC 2WSSG 4A5UB 2ZDIA 4JV5O 3L73H 3KCYA 2YS8A 2RN9A 4OX9B 4K8XA 5B1AC 3ASNC 4MVSA 1XL6A 1SA0A 1HP8A 2PTMA 4JAAA 1QR9A 4U3FH 4GT1A 5LYJB 4LFCB 1J5EO 3ZN1A 4XDJA 5H6RA 3JARB 4MTXA 3TK1A 3THOA 1M56C 2EZPA 3OR7C 3AG3B 3N2GA 4J7ZA 3CC4V 3LDEA 4X64O 4CH4A 2PYLA 1N34O 2EBOA 1PPJH 5GTIZ 2UUBO 4LF9B 2X0LA 5FLXN 3ABMB 2OYQA 3QG5A 4MS2A 4DR1O 4FLYA 1H2LA 1K9MW 4ZBMA 3VBBA 1SQXH 4YJ3A 3ETQA 4DUZB 1RPRA 2X6CA 1A32A 5A9GA 2UUAB 1Q81W 5KHIA 1D5NA 3CRRA 3APOA 5J2TB 4DV4B 1Y6XA 4DV7O 1FFXA 3VQYA 1BMFG 1SC5B 5DN6G 2JGUA 4G2KA 2F43G 3FB8C 3C3TA 1P7BA 3B40A 4GX0A 3P3PA 4XDLA 1NU1H 5AG2A 5L3BA 5JH7B 3ZRSA 1WP8A 4X66B 1BS3A 2Q7EA 2ZCEA 3M7MX 4JZGA 4PA6A 4B3TB 3E8HA 1F4NA 4WFGA 5LXTB 4LF8B 5LHGA 3QVNA 2W0XA 3BAAA 2AZ0A 1IX9A 4H44B 4PDMA 1BT8A 5H6QA 4FLUA 4TV9A 2OIGA 2RQ6A 1FXHA 2XAFA 3JD4A 1P49A 1ZLZA 3IGAC 5CMUA 1FXVA 1FD9A 1Q5OA 4OX9O 1S77D 1VQ4V 4PELA 2HR3A 4IL6Z 5B1BB
chains in the Genus database with same CATH topology
4DV5O 4GKKO 4LFCO 2UUCO 5BY1A 4DV6O 2Z0AA 4X64O 1N34O 2HHHO 4DR7O 3JAMN 2N74A 1IBKO 2UUBO 1F7YA 4KHPO 4GKJO 5FLXN 2LW7A 4OPAA 2E5LO 1X59A 4X65O 4DV1O 4JI3O 1YZBA 4LF9O 4JI0O 4DR1O 4X62O 3F5TA 4DR3O 1NS1A 4B3SO 1G1XB 2VQFO 4NXNO 5A2QN 1AB3A 2F4VO 4DR6O 4JI5O 1A32A 3SDLA 1IBMO 5BXZA 5IWAO 5BR8O 1XNRO 3RT3C 4DR2O 2ZKOA 4JYAO 3J7AU 3M8AA 4DUZO 2UXCO 4DV7O 2UUAO 4B3RO 4JI2O 5IT9N 1DK1A 4LFAO 1D2DA 4DV4O 1FKAO 1I94O 4B3MO 4DR5O 4LF7O 5LL6Y 5LMUO 5LMNO 2UXDO 2DJVA 2ZM6O 2VQEO 3J81N 4DV0O 4LFBO 1FJGO 4DUYO 4JI1O 1KUQA 4NXMO 1HR0O 2DOSA 1N36O 4JI4O 4LF4O 3O65A 2JRIA 1XMQO 2UXBO 3R66A 3T1YO 4JI6O 2FKXA 4OPHA 1N32O 4X66O 3J80N 4DR4O 4DV2O 1XMOO 2AGAA 1HNWO 4B3TO 5H5NA 4YY3O 1R1BA 4LF5O 4LF8O 1FYJA 2UU9O 4JI7O 4K0KO 4JI8O 1HNXO 4YHHO 3T1HO 4A5UB 1IBLO 3OTOO 4JV5O 1XNQO 4LF6O 4AQYO 1N33O 1AILA 4DV3O 1HNZO 1XEQA 4OX9O 1J5EO 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  4GKK O;  4LFC O;  2UUC O;  5BY1 A;  4DV6 O;  2Z0A A;  4X64 O;  1N34 O;  2HHH O;  4DR7 O;  3JAM N;  2N74 A;  1IBK O;  2UUB O;  1F7Y A;  4KHP O;  4GKJ O;  5FLX N;  2LW7 A;  4OPA A;  2E5L O;  1X59 A;  4X65 O;  4DV1 O;  4JI3 O;  1YZB A;  4LF9 O;  4JI0 O;  4DR1 O;  4X62 O;  3F5T A;  4DR3 O;  1NS1 A;  4B3S O;  1G1X B;  2VQF O;  4NXN O;  5A2Q N;  1AB3 A;  2F4V O;  4DR6 O;  4JI5 O;  1A32 A;  3SDL A;  1IBM O;  5BXZ A;  5IWA O;  5BR8 O;  1XNR O;  3RT3 C;  4DR2 O;  2ZKO A;  4JYA O;  3J7A U;  3M8A A;  4DUZ O;  2UXC O;  4DV7 O;  2UUA O;  4B3R O;  4JI2 O;  5IT9 N;  1DK1 A;  4LFA O;  1D2D A;  4DV4 O;  1FKA O;  1I94 O;  4B3M O;  4DR5 O;  4LF7 O;  5LL6 Y;  5LMU O;  5LMN O;  2UXD O;  2DJV A;  2ZM6 O;  2VQE O;  3J81 N;  4DV0 O;  4LFB O;  1FJG O;  4DUY O;  4JI1 O;  1KUQ A;  4NXM O;  1HR0 O;  2DOS A;  1N36 O;  4JI4 O;  4LF4 O;  3O65 A;  2JRI A;  1XMQ O;  2UXB O;  3R66 A;  3T1Y O;  4JI6 O;  2FKX A;  4OPH A;  1N32 O;  4X66 O;  3J80 N;  4DR4 O;  4DV2 O;  1XMO O;  2AGA A;  1HNW O;  4B3T O;  5H5N A;  4YY3 O;  1R1B A;  4LF5 O;  4LF8 O;  1FYJ A;  2UU9 O;  4JI7 O;  4K0K O;  4JI8 O;  1HNX O;  4YHH O;  3T1H O;  4A5U B;  1IBL O;  3OTO O;  4JV5 O;  1XNQ O;  4LF6 O;  4AQY O;  1N33 O;  1AIL A;  4DV3 O;  1HNZ O;  1XEQ A;  4OX9 O;  1J5E O;  1R6T A; 
#chains in the Genus database with same CATH topology
 4JZ2 A;  4ZOL A;  2DE0 X;  5KX5 B;  1F23 A;  2EJR A;  4LFC O;  2YDE A;  1P84 F;  1YIJ V;  4DR7 B;  1YJW V;  1NKD A;  5HFM A;  4B7K A;  4BW5 A;  1YXB A;  1AR5 A;  1UFI A;  3K79 A;  3G71 V;  4O4H A;  4JI0 B;  1RFY A;  3GWK C;  2LW7 A;  5CA1 A;  4I55 B;  5IYZ A;  2QGN A;  2EUL A;  3WG7 C;  4LF9 O;  1B6Q A;  4I50 A;  4LWS A;  1ZWI C;  2UXC B;  5FPO A;  1VMG A;  3RT3 C;  3QO7 A;  2XUM A;  2MK3 A;  3CHX A;  4FM1 A;  1MZE A;  4NTW A;  4DUZ O;  3VOU A;  3K57 A;  1VF7 A;  2UUA O;  3RW0 A;  4LH6 A;  5B1A B;  2IW5 A;  4ABM A;  4EEQ A;  2B1G A;  2R72 A;  5JQG A;  4DV4 O;  1CP9 A;  3UO3 A;  1K4D C;  3ABT A;  5E79 Z;  1M93 A;  1OHH G;  2Q4P A;  3TXS A;  2LO1 A;  4LF4 B;  2ZE7 A;  1K33 A;  2NNU A;  3B4S A;  1GO3 F;  3G80 A;  2GV9 A;  4EKW A;  4UV8 A;  1H2M A;  1SA0 B;  2BE3 A;  1MOF A;  2ODM A;  2DW4 A;  1YVW A;  4X66 O;  4JI8 B;  1ZL8 B;  2R9I A;  3N2G B;  4P30 A;  4B3T O;  1WAZ A;  5KHK A;  4LF8 O;  2M7W A;  4FIP C;  4KL1 A;  4PA9 A;  2Q7H A;  3FB6 C;  4DW1 A;  4DW0 A;  3FKS G;  4WF9 V;  1EM1 A;  1OZ0 A;  3HR0 A;  1OCC C;  1S5H C;  2XAJ A;  4FZ0 A;  4GZR B;  4ZIB A;  4KUM A;  4YJ3 B;  1BGY H;  2A9H A;  4HYO A;  4I5S A;  4FK5 C;  3K9S A;  3CWB H;  2O57 A;  1SER A;  1MZF A;  1YJ9 V;  1FFX B;  2E75 B;  5KA5 A;  2Y0I A;  2PI5 A;  4DR7 O;  4J10 A;  2QKS A;  4Q6G A;  1AI6 A;  2ZQM A;  2P6J A;  4GLX A;  2EIL B;  4D7S A;  2QSA A;  3CRA A;  4JI0 O;  1G8M A;  4DR6 B;  3BVO A;  3RVY A;  2QWN B;  3E8G A;  1NTZ H;  1XDC A;  3JD2 A;  5H2F Z;  1S5L Z;  1N0N A;  2UXC O;  2CH7 B;  4LC1 A;  4LBE C;  2ARH A;  3QF7 A;  3W7W A;  5B3S C;  5CBF A;  4UVA A;  3AG1 B;  1HR0 B;  3ZIA G;  1U97 A;  4P2Z A;  4TV9 B;  1N36 B;  1VIB A;  4WFH A;  1KUQ A;  4L8J A;  1NVP B;  4LF4 O;  3O65 A;  1RM1 B;  4MTF A;  3JCZ A;  3CPW U;  2IM9 A;  4DV2 B;  3PN1 A;  4ZOL B;  2N04 A;  4LF5 B;  3E86 A;  2IH3 C;  4DO2 A;  1KKD A;  1V55 C;  2RCV A;  1R3K C;  4JI8 O;  1KYO F;  3CXH F;  4O4H B;  5CA1 B;  5IYZ B;  5EC2 C;  3ZJZ A;  5L3F A;  2EIM C;  2EIN C;  1XUQ A;  2GTA A;  4CH5 A;  4I50 B;  3A0R A;  4LWS B;  5IYC O;  5B1O A;  4DV6 B;  4X1Y A;  1E1Q G;  2CGN A;  4BW9 A;  1M57 C;  4CC5 A;  1S72 V;  1FPO A;  2Z0A A;  3WB1 A;  1NVP D;  5JQG B;  2GBO A;  1Q3E A;  3ABK C;  3B09 A;  5FNV A;  3D8C A;  4X62 B;  3Q4H B;  1S5J A;  1AI7 A;  1GRJ A;  1CXZ B;  1JR9 A;  4QE7 A;  3U11 A;  4X9Q A;  2VS0 A;  4FLX A;  2RJZ A;  2NR5 A;  3C90 A;  4DR6 O;  4XBF A;  5CBG A;  3SDL A;  4F4L A;  2HKO A;  5BXZ A;  3W7U A;  2L35 A;  4RUF A;  4DR5 B;  2E76 B;  1H38 A;  5IJ0 A;  2RNB A;  2LGQ A;  1FJG B;  4LR3 A;  3D3I A;  3BCC H;  4TQD A;  4RWU A;  1XHZ A;  1ZSP A;  1FXK A;  4X20 B;  5JWP A;  1W0J G;  2JEX A;  2QKA A;  1HR0 O;  4QE9 A;  5LP6 C;  1Q90 D;  2V1D A;  4UCU A;  5LOV A;  3D36 A;  4JGS A;  1N36 O;  5EBW C;  1AJP A;  1VF6 C;  3SPC A;  1PNK A;  1DGS A;  3R66 A;  2B5U A;  5KA6 A;  1VQP V;  2WLH A;  3ZHR A;  2WWW A;  2BTQ A;  4E4E A;  3UO2 A;  2YI8 A;  4DV2 O;  2R9R B;  4U3J A;  3E2E A;  3HPL C;  4UCO A;  4ICG A;  4LF5 O;  1SQP H;  1SQV H;  2Q73 A;  3ZMT A;  5C93 A;  1COW G;  1N33 B;  1WB8 A;  2YIA A;  2IU0 A;  1K92 A;  3OGC C;  1L1F A;  2C2A A;  3UCS C;  1K7D A;  1TVK A;  3BHP A;  1YHQ V;  2CTP A;  5IYD O;  2D2C B;  4FM2 A;  2NN4 A;  4DV6 O;  1T5E A;  5CN0 A;  5JVD A;  3X2Q B;  5ITZ A;  5LBQ A;  4X65 B;  2CE4 A;  4X89 A;  1NJI W;  5GON A;  4J7J A;  2Q0A A;  1EN6 A;  3OE7 G;  2VQF B;  2EIJ C;  1TAE A;  1WN7 A;  1PD3 A;  4X62 O;  1OCR B;  4B7E A;  5LXT A;  4BIZ A;  3BY6 A;  3CCR V;  4FLW A;  3JSN A;  1SF9 A;  2JJ1 G;  4B3R B;  4NR1 A;  3K08 A;  1Q82 W;  4PHZ A;  3SJA C;  3KZI Z;  3M8A A;  1DK1 A;  1ZTE A;  2EIM B;  3IC7 A;  4DR5 O;  4JAV A;  2P22 C;  2HFE C;  2R9A A;  1YDX A;  3STL C;  4W4K A;  3CP1 A;  5KAF Z;  1FJG O;  3BAB A;  1M57 B;  1EZJ A;  1ZUQ A;  2CDY A;  1FS0 G;  2GUZ A;  5LGT A;  2OCC C;  2ZE8 A;  1SS3 A;  3AK2 A;  1XMO B;  5IJ9 A;  2BCC H;  2Y4U A;  4QGP A;  2WLK A;  4RQE A;  4X1Y B;  1U96 A;  2Q67 A;  3CCM V;  4U7N A;  3CCL V;  2Q69 A;  1IBL B;  3H01 A;  2IJJ A;  2V7Q G;  1K5Q A;  3K0G A;  4H37 A;  5FNV B;  1AJN A;  1ROP A;  1N33 O;  1IZ3 A;  1GKF A;  1GN6 A;  1K34 A;  1QLN A;  4F6R A;  3ZMZ A;  3RVZ A;  4CC6 A;  3MDS A;  2DQ0 A;  1BE3 H;  5CB4 A;  1AJQ A;  4MTG A;  4LCU C;  1DTO A;  3B77 A;  4R6Z A;  3K59 A;  2JVD A;  4PD4 F;  3SYO A;  3ZHQ A;  3A2F A;  2EIK C;  1KBH A;  4PDR A;  1JMK C;  1IDS A;  5IJ0 B;  3O9O A;  1YI2 V;  2DN9 A;  1F7Y A;  4X1I A;  4X65 O;  1SKV A;  1FXK B;  2IJI A;  2WLN A;  2IU3 A;  2F4V B;  1M1K W;  3H9V A;  3F5T A;  3ABL B;  2VQF O;  5BR8 B;  5LOV B;  1I5Y A;  4TUY B;  1ZL8 A;  3FD9 A;  4TWK A;  2PUS A;  1AR1 B;  2H8P C;  4HAM A;  2JIZ G;  1QLE C;  1HW7 A;  2JGD A;  4B3R O;  5IT9 N;  5LMN B;  1NQT A;  2BTQ B;  3S3W A;  4U3J B;  1G4Y B;  2HVK C;  2ZXW C;  3ZBH A;  4W4L A;  3R65 A;  4K3A A;  5IY5 B;  2DYS B;  4FZ1 A;  1P7G A;  2ADP A;  3CYO A;  4IYH A;  3CJH A;  4NVP A;  1KMI Z;  2DOS A;  3ZMU A;  3P30 A;  1TVK B;  2VWK A;  2JRI A;  1JVM A;  1AI5 A;  1I7F A;  2OCH A;  3DTU B;  1AVM A;  1XMO O;  1FYJ A;  2OIE A;  1SZT A;  3GWO A;  5JVD B;  4L87 A;  3ZCC A;  5ITZ B;  1IBL O;  4DXW A;  5GON B;  3LUT B;  1KKC A;  3FB7 C;  4GKK B;  5D5Q A;  2CH7 A;  2DYR B;  1QBZ A;  1VQ5 V;  4MT8 A;  2NLJ C;  4H33 A;  2JS3 A;  4QIW F;  3ETE A;  2OCC B;  4WFF A;  3OUF A;  3H1I H;  1ZX3 A;  3G4S V;  2VRZ A;  1WJZ A;  4JAS A;  4DRX A;  1SQQ H;  3TGU H;  1V54 B;  2PY5 A;  4I4T A;  4WFE A;  3L74 H;  5CA0 A;  1XNR B;  4DK1 A;  1WPB A;  2GUZ B;  3E8F A;  2F4V O;  1KQS U;  1ARO P;  2Y48 A;  5BZB A;  1V9P A;  1Y66 A;  5BR8 O;  1NBM G;  3SGI A;  5IJ9 B;  4AI8 A;  2BSK B;  2FL4 A;  3LNM B;  3VQV A;  4MVR A;  1Q6I A;  1E79 G;  2KSD A;  1IVS A;  5EBL C;  1JQ0 A;  3N27 A;  1GM7 A;  1K3E A;  5LMN O;  2Q5Z A;  2PF4 E;  2DMX A;  3E89 A;  3J81 N;  2HLD G;  1KU9 A;  5EYP A;  1M9N A;  1PL4 A;  1XMQ B;  5EIB C;  1DLB A;  2EIK B;  4FFB A;  4ZI7 A;  3RN4 A;  4PDL A;  4F6R B;  2DWD C;  1N32 B;  1WNS A;  3ASN B;  5CB4 B;  3K58 A;  1OCO C;  4MTO A;  5D5P A;  5LA6 A;  2AGA A;  1B06 A;  3Q4H A;  5H5N A;  4YHH B;  3OTO B;  3BPZ A;  4JTC B;  1M56 B;  1K4C C;  4FMT A;  1Q43 A;  1N4C A;  1MNG A;  1W59 A;  4J42 A;  3RBZ A;  1QLE B;  4X1I B;  1AIL A;  3DGE A;  3OEH G;  1VQ9 V;  2EJ7 A;  1CEZ A;  4RO2 A;  1SES A;  2AW9 A;  3P3N A;  1YSC A;  4GKK O;  2K1E A;  3F5W C;  4KP4 A;  3K3W A;  2YSU B;  2RMK B;  3MHH C;  1Y74 A;  2JGD B;  4KHP B;  3EVK A;  4X20 A;  2DWE C;  4OXS A;  2XTA A;  3RYI A;  2X6A A;  1VP7 A;  3ETD A;  3H1L H;  3WU2 Z;  1BQ0 A;  2QDO A;  1PL0 A;  1YZB A;  3CRQ A;  5J9P C;  4J11 A;  3CJH B;  3L9D A;  5IWA B;  3LSQ A;  1L0L H;  1WA8 A;  2AHY A;  5IYB O;  1XL4 A;  1ENV A;  1XNR O;  2B1I A;  5DEC A;  4B3M B;  5LMU B;  1JPX A;  4KFM A;  1VAR A;  2YXL A;  5JCO C;  5K1X A;  5LHI A;  3CCE V;  3G6B A;  4O4I A;  3G67 A;  3K04 A;  4FJC C;  3N2K A;  2QR4 A;  2XOK G;  3GVM A;  1L0N H;  2WLM A;  2ZIN A;  5KAI Z;  4CS2 A;  4JAU A;  2FML A;  3K9A A;  4UB8 Z;  2YIB A;  3TCU A;  2XHB A;  3CD6 V;  1K5S A;  1XMQ O;  3JAS A;  4CZZ A;  2H94 A;  1SQB H;  1HNW B;  1R6N A;  2ITD C;  1L8D A;  1N32 O;  2HEP A;  3IJ4 A;  5KLV H;  1R1B A;  1XNQ B;  1NR7 A;  5B66 Z;  5J2U A;  1H2G A;  4YHH O;  2LW1 A;  3OTO O;  2A7W A;  1SQF A;  4AHC A;  1SET A;  2Y69 C;  4DRX B;  2XAQ A;  3QTC A;  3OMA B;  4GUN A;  4H13 B;  4I9W A;  3DC6 A;  1VQL V;  1H8E G;  4I4T B;  1VQ6 V;  2QJ1 A;  5CA0 B;  3MAQ A;  3SYA A;  4BIU A;  2AHZ A;  1XOU A;  4BIO A;  3WG7 B;  3ZRX A;  1VF5 B;  2QM8 A;  3I56 V;  4UCV A;  2BTO A;  3W7T A;  2WA3 A;  2W0F C;  1IBK B;  2LQT A;  1BQZ A;  3FX7 A;  1VQ7 V;  2V4D A;  4KHP O;  1OCO B;  3VQW A;  5EYP B;  1E1R G;  1NS1 A;  3B8N A;  4GCZ A;  4PDV A;  3H1H H;  1VQM V;  4FFB B;  4HZ3 A;  4ZI7 B;  1GM9 A;  2YUA A;  1M90 W;  5IWA O;  5FL7 G;  2WAM A;  2KKW A;  2EZO A;  1LUW A;  4EFE A;  5LA6 B;  5L3G A;  1GAX A;  1D2D A;  3H1J H;  4B3M O;  1GH6 A;  3CXC U;  2A06 H;  5LMU O;  4RAI A;  1MG1 A;  5LGN A;  3GB7 C;  3SJB C;  3L71 H;  1SZX A;  4O2A A;  5GW7 A;  4FVM A;  2UXB B;  1LR1 A;  4J9Y B;  4WFA V;  5LP6 A;  1BZK A;  4DR4 B;  3E8B A;  1GMG A;  1OCC B;  3OUS A;  1VF6 A;  2G38 A;  3EFF K;  1HNX B;  1HNW O;  1QR8 A;  1Y74 B;  4BR6 A;  1RSO A;  2HJD A;  3OAA G;  1AP5 A;  1N8R W;  4C7U A;  1S0V A;  3AG4 C;  3RYI B;  3MD0 A;  1XNQ O;  1Z5W A;  1R6K A;  4PV1 B;  4TQF A;  4BAY A;  4TUY A;  1EBO A;  3E22 A;  4JYB A;  5CA3 A;  2YID A;  1NTK H;  4DV5 B;  1QQC A;  5IE9 A;  2AZ2 A;  3CC7 V;  1NI8 A;  1WA8 B;  3ZHS A;  4FPP A;  3T4Z A;  1Y67 A;  4IHJ B;  1Z5V A;  5BY1 A;  4Q20 A;  3K0D A;  2ZIO A;  2QM7 A;  3OGI B;  5LGU A;  2WLL A;  3OMN B;  2BOB C;  2ZE6 A;  1IBK O;  2FB5 A;  5EK0 A;  4FLV A;  4O4I B;  2AXT Z;  3N2K B;  4Z1M G;  5B3S B;  3PJS K;  3AG3 C;  2P06 A;  3ABU A;  2YC0 A;  3T2M A;  3AK3 A;  4R8C A;  3JAS B;  3TET A;  4LFA B;  4RUE A;  1O9H A;  1RP3 B;  4XDK A;  1NT2 B;  3CB2 A;  2P67 A;  4CH3 A;  1B04 A;  5LL6 Y;  5J2U B;  1WP7 A;  4TSF G;  1GK9 A;  2DQ3 A;  2IH1 C;  1V55 B;  4FLT A;  4IGG A;  1RPO A;  4EB6 A;  4O4J A;  3CC2 V;  3BEH A;  4JI6 B;  1Q7Y W;  1EN5 A;  1H8H G;  1Y76 A;  2UXB O;  3RWR D;  2EIN B;  3JYC A;  3SJC C;  3F7V C;  1HWY A;  2FKX A;  2PGG A;  3LNN A;  4K0K B;  4DR4 O;  3OMI B;  5F2V O;  2OTL V;  2P90 A;  3LSS A;  2Y0P A;  1HNX O;  3CS5 A;  1EFR G;  3RYC A;  1PV0 A;  4MVQ A;  4MVZ A;  4DV3 B;  2UXX A;  3ZMV A;  1KD1 W;  1NZ6 A;  2F23 A;  1IXB A;  3DXR A;  3ZHV A;  3ABK B;  2MW2 B;  3IAY A;  3WB2 A;  3AK1 A;  2ZNJ A;  4N23 A;  2BSK A;  2PZS A;  1PNL A;  4DV5 O;  1BSM A;  4QJF B;  2ETN A;  5KHH A;  2QKC A;  4AIL C;  4UVB A;  1HDJ A;  4BWA A;  2BOC C;  2GSM B;  2N74 A;  2B9Z A;  3JD0 A;  2XAS A;  3SPG A;  3SYC A;  4K8Z A;  4NXN B;  1KP3 A;  5B1B C;  2CUG A;  2LP7 A;  1WLE A;  1JJ2 U;  3T1C A;  3TXQ A;  4UCS A;  4JI5 B;  4ZHQ A;  4O2A B;  4KXR A;  1IBM B;  1G1X B;  2VWJ A;  4DR2 B;  4WFB V;  1QVF U;  4Z1V A;  1QU7 A;  1R3L C;  5LP6 B;  2ZKO A;  2YIC A;  1QCE A;  3ZED A;  1EZV H;  2OTJ V;  5HFL A;  3CCJ V;  4LFA O;  4RQF A;  3CX5 F;  3U10 A;  4PI2 A;  2LGW A;  1J95 A;  2OT5 A;  4DV0 B;  1FFT B;  3ETG A;  2QWP B;  4LFB B;  1RSO B;  2ZNI A;  4LH7 A;  4YIP A;  2KB1 A;  2CTR A;  2QM4 A;  1I0H A;  3L72 H;  3FAV A;  2QA4 V;  3T4D A;  4DK0 A;  3JD1 A;  1UJW B;  3E22 B;  4LP8 A;  4PI0 A;  1SRY A;  5E1A C;  4ZKI A;  1S3J A;  3RYH A;  2JK5 C;  4MSW C;  4JI6 O;  4OPH A;  4JI7 B;  5KUK A;  2QWQ B;  4UV9 A;  2ZDI C;  1YF2 A;  3EHB B;  3G6E V;  3NXS A;  3OW2 U;  3F7Y C;  4NTX A;  1DF4 A;  2KQX A;  1ORQ C;  4K0K O;  1EN4 A;  4J80 A;  2WLL B;  3FFQ A;  3JAL B;  1JJO A;  2XAG A;  4TV8 A;  3APQ A;  4DV3 O;  3SJQ C;  3MHS C;  3A8T A;  1XEQ A;  3BFR A;  1XIL A;  2EIJ B;  3K5L A;  2WPD G;  1IUR A;  3OEE G;  4QPK A;  2ZE5 A;  3CEI A;  3WFV A;  4DV1 B;  3OT7 A;  4R50 A;  4X8A A;  2XT9 A;  3LDC A;  4OPA A;  3B8M A;  3ZHT A;  3FYI B;  1IXM A;  1BHB A;  4PJ0 Z;  1XHX A;  4X1K A;  2P5O A;  2ADQ B;  4NXN O;  1GN4 A;  4EB6 B;  4O4J B;  2Y4T A;  3ZRV A;  4JI5 O;  1Y4M A;  1Y76 B;  1IBM O;  4IT5 A;  4X88 A;  4DR2 O;  5C8Y A;  1GN3 A;  3J7A U;  1Q8I A;  3W7X A;  1WPX A;  2Q7G A;  1FKA O;  2PYJ A;  2EIL C;  1GTO A;  5EZY A;  4G27 B;  4JI1 B;  3RFR A;  2QWR B;  2XAH A;  4O4L A;  2DJV A;  1OJH A;  2ZR2 A;  1Q6H A;  4DV0 O;  5FPR A;  4E2L A;  3RYC B;  4LFB O;  3SPH A;  2GHY A;  3I55 V;  2CK3 G;  3HKD A;  4PA3 A;  1YTF B;  5DM6 V;  3DXR B;  1VQK V;  3FB5 C;  4R7C A;  1W2B U;  5JJN B;  4GYC B;  4YY3 B;  3AG7 A;  2IJK A;  3J80 N;  3AG1 C;  3QNE A;  5GTH Z;  4WBN A;  2QWO B;  4WCE V;  4JI7 O;  1H2K A;  1Q86 W;  2F1M A;  5K1P A;  2JDI G;  1RM1 C;  3LSU A;  1R3J C;  1URF A;  4J9Z B;  4NKG B;  4GX1 A;  2P7T C;  2IBZ H;  4I9Q A;  4ZHQ B;  2HP8 A;  5L3E A;  3ICX A;  2HG5 C;  2UUC B;  1AR4 A;  2WLI A;  3KG2 A;  2KG7 A;  1SQG A;  4GX5 A;  3BA9 A;  2HHH B;  1OCZ C;  1PM9 A;  2LFR A;  2GDS A;  1YTF D;  3ZRW A;  1TUE B;  3RYF A;  4I7Z B;  3JAM N;  2N05 A;  1P4R A;  2F66 C;  3K5N A;  1I08 A;  1K8A W;  3D3Q A;  4DV1 O;  3FAV B;  4UCR A;  2IJH A;  2ZXW B;  5BMV A;  2F95 B;  4J7K A;  4MVO A;  1MMM A;  3K5M A;  3STZ C;  3OTF A;  3RYH B;  2JS5 A;  1I94 B;  1AI4 A;  3QO8 A;  3M99 B;  1PNM A;  1ZAU A;  4QNH B;  5TIS Z;  2UXD B;  1GM8 A;  4I0X A;  4DUY B;  1KEC A;  3OR6 C;  4JTA B;  1O9G A;  4B08 A;  3UT5 A;  4F6E A;  5JCO A;  4O2B A;  1YIT V;  4JI1 O;  1CPY A;  4TV8 B;  3ZX6 A;  3T1Y B;  1WB7 A;  4UB6 Z;  3CCS V;  4IHJ A;  1BHA A;  1R3I C;  2PI4 A;  3WB0 A;  4CBC A;  4UVC A;  3ML0 A;  3E35 A;  2H3O A;  3ZHU A;  1K97 A;  1UPG A;  5KHJ A;  2CTW A;  4K35 A;  1VEW A;  4YY3 O;  3U0Z A;  4AQY B;  1H2N A;  4FM0 A;  1JFF A;  2K9P A;  3JSL A;  5L3C A;  2WLJ A;  2HVJ C;  4PA4 A;  1Q6U A;  1W0K G;  4P9O A;  5EC1 C;  3JAT A;  4JYC A;  3HKE A;  3SYP A;  2QEX V;  4X1K B;  2QTO A;  1NR1 A;  1R6T A;  4NYK A;  2CGO A;  3QO5 A;  2L6L A;  2E3C A;  3A0B Z;  2UUC O;  2YXH A;  5C8Y B;  2Q68 A;  3VQX A;  2ZR3 A;  3IFX A;  1BCC H;  4GKJ B;  2HHH O;  2E5L B;  3CCV V;  1XBL A;  2CAZ C;  3NR7 A;  3IC9 A;  3ZS8 C;  5EZY B;  5EBM C;  5KHG A;  4DYL A;  4O4L B;  4DR3 B;  1FAF A;  1JA8 A;  1B3Q A;  3BA8 A;  3W7S A;  3HKD B;  5CBH A;  3SPJ A;  1TUB A;  1LUV A;  3L75 H;  3CSX A;  4PA7 A;  1AB3 A;  3JD3 A;  2ZD9 A;  4FLZ A;  1THZ A;  2QTS A;  4OGQ B;  3X2Q C;  1QVG U;  4JPR A;  3C3S A;  2ZT9 B;  4LNU A;  1DF5 A;  4Z2W A;  4J41 A;  1I94 O;  2ZM6 B;  4CS4 A;  1XQ8 A;  2YEV A;  2YI9 A;  4WBN B;  1PKX A;  3HKC A;  1OCR C;  3CMA V;  2UXD O;  4ASU G;  1KC8 W;  4TT3 G;  3JCU Z;  4DUY O;  4JI4 B;  3OFN G;  1OCZ B;  1US6 A;  4UCT A;  1TA8 A;  2Z3Y A;  4IIJ A;  1OV9 A;  4JF3 A;  1KP2 A;  1I5X A;  1KB9 F;  5H9C A;  4HBN A;  2M6Y A;  3P32 A;  1LNQ A;  1MSD A;  2X6B A;  4HNA A;  2WLI B;  2HJF C;  3T1Y O;  1JOY A;  2KG7 B;  3UM7 A;  4JTD B;  3B2E E;  5DED A;  4U7O A;  3T1H B;  4IYI A;  3UQ8 A;  3ZRW B;  3HB3 B;  2A3Q A;  4LF6 B;  3RYF B;  2ZIM A;  3AG2 C;  5EIB D;  2Q9L A;  3S3X A;  3H1K H;  1HNZ B;  4UUJ C;  4AQY O;  2XND G;  4NB5 A;  3CE2 A;  2FYU H;  3HKB A;  3E83 A;  5KMG A;  4MW8 A;  5BMV B;  1F51 A;  4D7T A;  2OWO A;  3ZMS A;  2JEU A;  3ASO C;  1Z2G A;  3BRC A;  1MA1 A;  3JAK A;  3DC5 A;  1XRE A;  3JAW A;  4G28 B;  4MVU A;  1TGO A;  2F93 B;  4MW3 A;  1QNM A;  1D5A A;  4YIO A;  4YJ2 A;  4UXN A;  3A0H Z;  3ZN0 A;  2ILM A;  4I0X B;  4JI3 B;  5L3D A;  5IDJ A;  3SPI A;  4GKJ O;  2R70 A;  3CCQ V;  3CRC A;  2E5L O;  4B3S B;  3UT5 B;  3OD4 A;  3CME V;  1JCH A;  1YJN V;  4O2B B;  4GX2 A;  4DR3 O;  5LYJ A;  2P4V A;  4JYA B;  4N21 A;  5A2Q N;  1XI1 A;  3JAR A;  4JI2 B;  1YEW A;  2ATK C;  4JYY A;  4LF7 B;  2EX3 A;  2CTQ A;  5B5E Z;  2YXY A;  3KKY A;  3LDD A;  3JAL A;  3AEI A;  1FXK C;  2VQE B;  2D3O W;  5LHH A;  3RGB A;  2UXN A;  1N0J A;  3ABL C;  4NXM B;  2ZM6 O;  3FYE B;  2GTS A;  3D36 C;  4P9P A;  4MVM A;  1JFF B;  2E74 B;  1QHT A;  3UKM A;  3JAT B;  3SYQ A;  4JI4 O;  3K06 A;  3HKE B;  2Q6A A;  2Y69 B;  5JJJ B;  5J2T A;  3CRM A;  3K5O A;  3ABM C;  2LJ2 A;  2UU9 B;  1JX9 A;  4D6T H;  1NTM H;  5IY5 C;  2DYS C;  4JV5 B;  2RDC A;  2A79 B;  1K73 W;  2Q8V A;  1VQO V;  3L70 H;  3T1H O;  1S76 D;  2P4K A;  4LF6 O;  1R73 A;  2Z5U A;  3I5D A;  1J5E B;  5JH7 A;  1HNZ O;  2W6J G;  2X7R B;  4TOI A;  1TUB B;  3EXA A;  5JJE B;  1G6U A;  3OM3 B;  4X64 B;  2YIB D;  1BL8 A;  1F4M A;  1N34 B;  2FTK A;  4FFK A;  2UUB B;  5B1N A;  4LNU B;  3TJT A;  1NH2 B;  2YEV B;  4DR1 B;  3HKC B;  1VQN V;  3CCU V;  1X59 A;  2DYR C;  4JI3 O;  1GN2 A;  1VQ8 V;  4B3S O;  4IIJ B;  2W6I G;  5KX5 A;  4DV7 B;  3AG2 B;  3KCX A;  4JYA O;  4EFB A;  4HNA B;  1MSW D;  1M4U A;  4NTY A;  4JI2 O;  4CH6 A;  2Q0O C;  1X4T A;  4LF7 O;  1V54 C;  5KUM A;  2QE7 G;  1MAB G;  4I55 A;  2LFS A;  2VQE O;  3ASO B;  1AP6 A;  4NXM O;  2A0L A;  1PP9 H;  4UFZ A;  1NH2 D;  3AG4 B;  3HKB B;  4YXW G;  4CS3 A;  1H2S B;  4QPJ A;  1YCI A;  3K03 A;  5KMG B;  1M5I A;  3DSQ A;  4H0L B;  3SR2 C;  2JJ2 G;  2WA4 A;  3JAK B;  3JAW B;  2UU9 O;  4YJ2 B;  2ITC C;  2WSS G;  4A5U B;  2ZDI A;  4JV5 O;  3L73 H;  3KCY A;  2YS8 A;  2RN9 A;  4OX9 B;  4K8X A;  5B1A C;  3ASN C;  4MVS A;  1XL6 A;  1SA0 A;  1HP8 A;  2PTM A;  4JAA A;  1QR9 A;  4U3F H;  4GT1 A;  5LYJ B;  4LFC B;  1J5E O;  3ZN1 A;  4XDJ A;  5H6R A;  3JAR B;  4MTX A;  3TK1 A;  3THO A;  1M56 C;  2EZP A;  3OR7 C;  3AG3 B;  3N2G A;  4J7Z A;  3CC4 V;  3LDE A;  4X64 O;  4CH4 A;  2PYL A;  1N34 O;  2EBO A;  1PPJ H;  5GTI Z;  2UUB O;  4LF9 B;  2X0L A;  5FLX N;  3ABM B;  2OYQ A;  3QG5 A;  4MS2 A;  4DR1 O;  4FLY A;  1H2L A;  1K9M W;  4ZBM A;  3VBB A;  1SQX H;  4YJ3 A;  3ETQ A;  4DUZ B;  1RPR A;  2X6C A;  1A32 A;  5A9G A;  2UUA B;  1Q81 W;  5KHI A;  1D5N A;  3CRR A;  3APO A;  5J2T B;  4DV4 B;  1Y6X A;  4DV7 O;  1FFX A;  3VQY A;  1BMF G;  1SC5 B;  5DN6 G;  2JGU A;  4G2K A;  2F43 G;  3FB8 C;  3C3T A;  1P7B A;  3B40 A;  4GX0 A;  3P3P A;  4XDL A;  1NU1 H;  5AG2 A;  5L3B A;  5JH7 B;  3ZRS A;  1WP8 A;  4X66 B;  1BS3 A;  2Q7E A;  2ZCE A;  3M7M X;  4JZG A;  4PA6 A;  4B3T B;  3E8H A;  1F4N A;  4WFG A;  5LXT B;  4LF8 B;  5LHG A;  3QVN A;  2W0X A;  3BAA A;  2AZ0 A;  1IX9 A;  4H44 B;  4PDM A;  1BT8 A;  5H6Q A;  4FLU A;  4TV9 A;  2OIG A;  2RQ6 A;  1FXH A;  2XAF A;  3JD4 A;  1P49 A;  1ZLZ A;  3IGA C;  5CMU A;  1FXV A;  1FD9 A;  1Q5O A;  4OX9 O;  1S77 D;  1VQ4 V;  4PEL A;  2HR3 A;  4IL6 Z;  5B1B B; 
#chains in the Genus database with same CATH homology
 4DV5 O;  4GKK O;  4LFC O;  2UUC O;  5BY1 A;  4DV6 O;  2Z0A A;  4X64 O;  1N34 O;  2HHH O;  4DR7 O;  3JAM N;  2N74 A;  1IBK O;  2UUB O;  1F7Y A;  4KHP O;  4GKJ O;  5FLX N;  2LW7 A;  4OPA A;  2E5L O;  1X59 A;  4X65 O;  4DV1 O;  4JI3 O;  1YZB A;  4LF9 O;  4JI0 O;  4DR1 O;  4X62 O;  3F5T A;  4DR3 O;  1NS1 A;  4B3S O;  1G1X B;  2VQF O;  4NXN O;  5A2Q N;  1AB3 A;  2F4V O;  4DR6 O;  4JI5 O;  1A32 A;  3SDL A;  1IBM O;  5BXZ A;  5IWA O;  5BR8 O;  1XNR O;  3RT3 C;  4DR2 O;  2ZKO A;  4JYA O;  3J7A U;  3M8A A;  4DUZ O;  2UXC O;  4DV7 O;  2UUA O;  4B3R O;  4JI2 O;  5IT9 N;  1DK1 A;  4LFA O;  1D2D A;  4DV4 O;  1FKA O;  1I94 O;  4B3M O;  4DR5 O;  4LF7 O;  5LL6 Y;  5LMU O;  5LMN O;  2UXD O;  2DJV A;  2ZM6 O;  2VQE O;  3J81 N;  4DV0 O;  4LFB O;  1FJG O;  4DUY O;  4JI1 O;  1KUQ A;  4NXM O;  1HR0 O;  2DOS A;  1N36 O;  4JI4 O;  4LF4 O;  3O65 A;  2JRI A;  1XMQ O;  2UXB O;  3R66 A;  3T1Y O;  4JI6 O;  2FKX A;  4OPH A;  1N32 O;  4X66 O;  3J80 N;  4DR4 O;  4DV2 O;  1XMO O;  2AGA A;  1HNW O;  4B3T O;  5H5N A;  4YY3 O;  1R1B A;  4LF5 O;  4LF8 O;  1FYJ A;  2UU9 O;  4JI7 O;  4K0K O;  4JI8 O;  1HNX O;  4YHH O;  3T1H O;  4A5U B;  1IBL O;  3OTO O;  4JV5 O;  1XNQ O;  4LF6 O;  4AQY O;  1N33 O;  1AIL A;  4DV3 O;  1HNZ O;  1XEQ A;  4OX9 O;  1J5E O;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...