3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
3OUFA 4PA3A 4J9ZB 3PJSK 3SYPA 2WLIB 4LBEC 1QLEC 2DYRC 2EINC 1XL6A 3UM7A 5IY5C 1S5HC 1R3IC 3EFFK 2DWEC 2EIJC 4RO2A 3GB7C 4HYOA 1XL4A 2Q67A 4RUEA 2ITDC 4MVMA 5EBWC 2NLJC 1K4CC 2A9HA 2WLJA 2X6CA 1ORQC 4P9PA 2HFEC 4DXWA 4R7CA 5EC1C 3UKMA 3IFXA 4I9WA 4MS2A 3SJQC 2OCCC 2YEVA 2Y69C 1J95A 3LDEA 4H37A 5B1BC 3SPCA 1OCZC 3JYCA 4QNHB 1M57C 3K03A 2KB1A 4G27B 4EKWA 1R3LC 3AG3C 2ZXWC 1OCOC 2WLLB 3F7YC 4JTAB 2AHZA 2EIMC 5CBHA 4JTCB 2HG5C 3OGCC 4H33A 2BOBC 4XDLA 3VOUA 2WLMA 3TETA 2BOCC 2IH3C 4GX2A 5BZBA 1K4DC 3FB6C 4RUFA 4CBCA 4G28B 3AG1C 4UUJC 5EK0A 2ITCC 5CBFA 4MW8A 4X88A 4LCUC 5CBGA 3STZC 3RVZA 4X89A 2X6AA 4R50A 3ZRSA 3E89A 5EBLC 3ASNC 3ABLC 4R8CA 2Q68A 1P7BA 3OR6C 3OUSA 4MTGA 3LUTB 5E1AC 4ZBMA 3AG2C 1LNQA 4XDKA 4P30A 3T4DA 4WFHA 3E86A 1V55C 3E8GA 4X8AA 5B3SC 4PDRA 3SPIA 2P7TC 2A0LA 2IH1C 5J9PC 2H8PC 4HZ3A 2WLLA 4MSWC 3RBZA 3RVYA 3IGAC 1G4YB 4F4LA 2A79B 2ATKC 2DWDC 3FB7C 4QE7A 3LDDA 2QTOA 4MVRA 2WLIA 3FB8C 4WFGA 4XDJA 3SYAA 4JTDB 2W0FC 4MTFA 3K0GA 1M56C 3SYQA 3K08A 1OCRC 1KKDA 3ASOC 2HVKC 3T4ZA 5KUKA 4MVQA 2Q69A 5EBMC 3FB5C 5EC2C 4TWKA 2HVJC 3F7VC 2WLNA 3T2MA 2Q6AA 3AG4C 2WLKA 3ZJZA 4PA4A 2EILC 4J9YB 3SPHA 1JVMA 3ABMC 3K0DA 3E8FA 2X6BA 3K04A 4MTOA 3LNMB 4PDMA 4BW5A 5B1AC 1OCCC 3OR7C 1R3JC 3E8BA 4RAIA 4PA9A 4LP8A 4MVUA 1BL8A 3SYOA 3HPLC 3RW0A 3T1CA 1V54C 4QE9A 3TCUA 3K06A 3WG7C 3SPGA 2HJFC 4KFMA 4GX0A 4MVZA 2R9RB 4P2ZA 3SPJA 3STLC 3X2QC 1R3KC 4GX5A 3E8HA 2DYSC 3KG2A 4PA7A 4R6ZA 3LDCA 3R65A 4PA6A 5KUMA 4PDVA 2EIKC 2WLHA 2AHYA 3BEHA 4MVOA 3E83A 2ZD9A 2K1EA 3SYCA 1ZWIC 4MVSA 4OXSA 3ABKC 4GX1A 3F5WC 4WFEA 2JK5C 4P9OA 4PDLA 4MW3A 4WFFA 2QKSA
chains in the Genus database with same CATH superfamily
2IJHA 2AZ2A 3QO8A 4JI5B 3JATA 1QLEC 4UVCA 2P4VA 5KX5A 4X1KA 5B1OA 1ZLZA 3ZHVA 2HFEC 2FKXA 3SJQC 1P4RA 3ZBHA 5FPRA 3HKBA 2EX3A 4X1YA 4JI3O 4GT1A 2G38A 1F51A 4PI2A 3OTOO 2XNDG 4IYHA 4DR5B 1XMOO 2ZR3A 5IE9A 1PNKA 4O2AB 1XDCA 2Q7GA 3A8TA 3AG1C 4UUJC 4GKKO 2UXNA 4YHHO 3IC9A 5CBGA 1PL0A 1GM9A 2N05A 2QE7G 1QNMA 3JCZA 3LUTB 2JJ2G 5LMUO 1LNQA 3LSUA 2B1IA 3ZHQA 4LFAB 2EIJB 4UXNA 3B40A 4FVMA 3T1HB 1HNZB 1MOFA 1XUQA 2A79B 5K1PA 4XDJA 1N33B 2Q0AA 4PD4F 5B3SB 5GTHZ 1Z5VA 1ZL8A 3VQXA 3K9SA 3C3TA 4FFKA 2UXXA 1M56B 4IHJB 2ZE8A 2Y0PA 5B1NA 2QJ1A 3L74H 1NVPB 1EBOA 2Q7EA 1V9PA 4AQYO 2Q73A 4PJ0Z 1DF5A 3LNNA 2KG7B 1N0NA 3JASB 1WPXA 4TSFG 1QU7A 4UVBA 2LGWA 2P90A 5JH7A 2JDIG 1M93A 1H8EG 5L3FA 4P9OA 4PDLA 2FMLA 1OCRB 3OGIB 1GN6A 3TGUH 3I56V 4I0XA 3CCEV 1FKAO 1FFXA 1YDXA 5IY5C 1S72V 5ITZB 1N4CA 4JI6B 2UXBO 3SDLA 2DMXA 1VQ9V 5IYDO 1AR5A 4H37A 1N32O 3N2GB 1SQBH 5IYZB 1OCOC 3F7YC 1K5SA 2F43G 1N34O 4NVPA 5BMVB 4CH5A 4LFBO 1BE3H 1M5IA 1F4NA 2QWPB 5LA6B 3L75H 5EIBD 3CCSV 2EIMB 3RYHB 1TVKB 4DR3B 3LSQA 3AG2C 1IVSA 4Z2WA 1B3QA 3OTFA 4DV3B 4X8AA 1VQKV 4TV9B 5EIBC 4BIOA 5J9PC 4UCUA 2ZR2A 3CXCU 4MVRA 3ETEA 1LR1A 4LH6A 4LNUA 2FYUH 1AB3A 3S3XA 4JV5B 3QG5A 5LOVB 3R66A 5KHIA 4FLZA 2E5LO 3WB2A 1QR9A 3OW2U 3BRCA 2LW7A 2E76B 1Y6XA 3SPHA 4J42A 3OMIB 1YF2A 5KMGB 5BXZA 3G67A 5KHGA 1OCCC 2AGAA 4QJFB 1NBMG 2HLDG 4DV2B 3T1CA 1VQ5V 2WPDG 2DJVA 3SPJA 3HKEB 4IL6Z 4GX5A 1BS3A 3APQA 1ZWIC 3DGEA 4B3RB 1F4MA 2VWJA 4YY3B 4TV8A 2PYJA 3ZEDA 4FLXA 4LF5O 3RYFA 1SQFA 3K5LA 3I5DA 3JSNA 3AG4B 2AXTZ 4EB6A 2YI8A 5IJ9B 1KU9A 4R7CA 3KZIZ 1S5LZ 4OGQB 1BHAA 2PY5A 2IU3A 1H2GA 5C8YB 1R3LC 4CC5A 5LP6A 1JA8A 5BZBA 3FFQA 1KQSU 1CXZB 1NTMH 1YZBA 2P6JA 1SZTA 2L6LA 2A3QA 4WBNB 1XNRB 4D6TH 1TUBA 4X65B 1P7BA 4LF4B 4LF6B 3TXQA 4P30A 3T4DA 1ZSPA 3E86A 1I94O 1SZXA 2K9PA 4JAVA 3RVYA 4B7EA 4Z1MG 3RYIB 3A2FA 2ATKC 1QVFU 4F6RB 5B1BB 1VARA 2JEXA 3MD0A 3K0GA 2EJ7A 1PNMA 3K08A 2BSKA 5JVDB 5J2TB 3FB5C 1IBMB 2ZDIA 4NB5A 4AILC 2CK3G 4WFBV 1MA1A 2Q6AA 2WLKA 3ZRXA 3ICXA 2HHHO 3ETDA 2X6BA 1IBLB 4MTOA 3QO7A 3UT5B 3RWRD 3E2EA 4O2AA 1Z2GA 4U7NA 4UB6Z 4DK0A 2HJFC 1VQPV 2XUMA 4MVZA 4LF9B 2GHYA 4I9QA 2EZOA 3J7AU 3E83A 4JI2B 3F5WC 1SKVA 3HKBB 4MW3A 4K0KB 4X1YB 3H1HH 4JI8O 4H0LB 2F93B 2W6IG 1TGOA 1XL6A 2B5UA 2ZE5A 5HFMA 2F4VO 5EYPB 1FPOA 2XAHA 4DUZB 4UCVA 2LJ2A 3ABUA 5B1AB 1BHBA 1QLEB 2ZE6A 4PI0A 4X20A 4IHJA 2N74A 5IDJA 1GM8A 1Y74B 1AI6A 1S0VA 2A06H 4BIUA 4PHZA 3U11A 1SESA 5D5PA 4DR6B 2KG7A 1EM1A 1ZL8B 1JMKC 4CBCA 3JASA 1X59A 1YIJV 3G6BA 4HNAB 2Z3YA 4KHPB 5JQGA 2R70A 3W7WA 2JVDA 3L71H 3AG1B 3ZIAG 4O2BB 1BSMA 1YCIA 4UV9A 2UXDO 3D3IA 3FB7C 3CMAV 2OCCB 5L3BA 4AHCA 4JTDB 1M57B 1AJNA 5GTIZ 2CAZC 4DR2O 1PD3A 2XTAA 1SA0A 2V7QG 5JH7B 3CRAA 1WB7A 3CEIA 4O4LA 3ZMSA 3T1YB 3N2GA 3K57A 4JASA 1WAZA 1K33A 1R3JC 3HR0A 3H1LH 1FFXB 5TISZ 3RW0A 4YIOA 3K06A 1GK9A 1KYOF 5LA6A 4DV1O 3E8HA 3CC2V 2ADQB 3JSLA 2PYLA 2C2AA 1AR4A 1TVKA 4C7UA 1H2SB 2CGOA 4CS3A 1SRYA 4TV9A 1IXBA 1KECA 1Y66A 3ZN1A 1Q6IA 1J5EB 3O9OA 2GDSA 1IBKB 4B3TB 2YXLA 3CRRA 4DXWA 5LOVA 2BE3A 3CYOA 4U7OA 2UUAO 4OPHA 5IY5B 5LYJA 2ZNJA 3P3PA 1L0NH 2VWKA 3AG3C 2ZXWC 5KMGA 4XBFA 1BT8A 4DYLA 2IH3C 4DR4O 3JD4A 4LNUB 2ETNA 4K8XA 2Q4PA 1NTZH 3ZMUA 3HKEA 1OCOB 3CB2A 4LCUC 3ETGA 1XNQO 4ZI7B 2M7WA 2ZQMA 4DV4O 4NTYA 1S3JA 2VRZA 5LBQA 4O4IB 2ZKOA 2QWRB 5A2QN 4AI8A 2ZIOA 4JI7B 1PP9H 2QTOA 4QIWF 5H6QA 3QNEA 3G4SV 2GTAA 3SYQA 1YEWA 4Q20A 4GZRB 2Y48A 1PNLA 3SJCC 4FLYA 5DN6G 1N36B 5EC2C 2Q69A 3ZRVA 5IJ9A 1HNXO 4NXNO 4BWAA 2EULA 4HAMA 3ABMC 4TV8B 5C8YA 3RYFB 4CC6A 2X0LA 3BY6A 1Q86W 4WCEV 3SYOA 2QA4V 3CC4V 3STLC 1TA8A 4JI5O 2DYSC 5IJ0B 1SQGA 4DR1O 4R6ZA 2Q8VA 1OCCB 1PKXA 3ZHTA 4JYCA 4FM1A 3TJTA 2F66C 3EHBB 1QCEA 3B09A 5LP6B 4B3SO 5LGTA 2EINC 4F6RA 1RM1C 3MAQA 1Q90D 4DW1A 1Q6UA 2QKCA 4LF8B 5LHGA 2X6CA 5JVDA 5J2TA 1TUBB 1JJOA 3WFVA 1HW7A 5KA5A 4G27B 3VQWA 4BIZA 5CBHA 4EEQA 3VOUA 1CP9A 5JCOA 3UT5A 4DV6B 1K4DC 5CB4B 2YXYA 2M6YA 4FM2A 2BSKB 4MW8A 4JF3A 2X6AA 1N33O 3E89A 3ASNC 3D3QA 2Q68A 3OM3B 4QPKA 1K73W 1H2KA 1L0LH 2GV9A 4PDRA 3SPIA 2UU9O 2BTQB 2CTQA 4JYAB 3IGAC 1B04A 1VF6A 1WJZA 4LF7B 3CRQA 1US6A 2JS5A 2Y69B 4UCTA 2F23A 4FIPC 1FAFA 5IWAB 4PELA 2WAMA 5EYPA 3T4ZA 5KUKA 4MVQA 1YXBA 2GUZB 2UXCO 4BR6A 3GWOA 1MSWD 2YIBD 5B5EZ 2BCCH 2KSDA 2LGQA 3ZJZA 1I5YA 4UCSA 1Y74A 1JVMA 3CX5F 4OX9B 3HKCB 1E1QG 2XT9A 3AK2A 1T5EA 3HPLC 1V54C 2LW1A 4QE9A 5CN0A 5H2FZ 3UCSC 4JYBA 4LR3A 1Q8IA 3FYEB 4F6EA 2HJDA 3LDCA 1M90W 4FZ0A 4HNAA 4MVOA 5KHKA 2LQTA 4X20B 2L35A 1SS3A 1EN6A 4O2BA 4CS4A 5H5NA 3U0ZA 3AG7A 2WLIB 2AW9A 4JI1O 3CCMV 1A32A 3HKDA 4JI3B 3DXRB 3JAMN 3OTOB 4BW9A 4ZHQB 2E3CA 1X4TA 3KKYA 5JQGB 1XMOB 3P3NA 1YHQV 3X2QB 2ZM6O 3G71V 3N2KA 4GKKB 3ZX6A 1HWYA 4H33A 3ABKB 4CH3A 2FB5A 5JWPA 1EN4A 4UCRA 1K92A 5LMUB 2VQFO 2P22C 2ZINA 1PM9A 1SC5B 1KC8W 4X89A 4LFCO 1NR7A 3FYIB 1SA0B 2A7WA 1Q5OA 4J7JA 2Z0AA 2P5OA 1QVGU 1ZTEA 4O4LB 1GAXA 2X7RB 1VQ7V 3CXHF 4CZZA 3B8NA 3LDDA 3B2EE 2DN9A 3JCUZ 5L3DA 1SQQH 3GWKC 3CJHA 2KQXA 3PN1A 5EBMC 2QTSA 4X64O 2WLNA 1VQNV 3ZHRA 4BW5A 1FJGO 4B3RO 3AK1A 3WG7C 4QGPA 3S3WA 3CHXA 2V4DA 4DUYO 1F7YA 2AHYA 4ZI7A 3IC7A 2DE0X 2K1EA 3B77A 3QTCA 4OXSA 4TQFA 5LYJB 1ORQC 1UPGA 4J9ZB 4O4IA 3VBBA 2WA3A 1TAEA 3G80A 1UFIA 5H6RA 1HNWB 1GRJA 3KCYA 2XASA 5GONA 1N32B 4RO2A 3ZMZA 2N04A 4N21A 5CA1A 3CP1A 2A9HA 1H2LA 2PGGA 4GUNA 4WFAV 2GBOA 3CCJV 4FLWA 1ZX3A 4NR1A 4UFZA 4LFBB 3K03A 1R6NA 4RWUA 2HG5C 2VQEO 1FXKC 2HKOA 2IBZH 4J80A 1H8HG 4QPJA 2ITCC 5CBFA 5CMUA 5IJ0A 3H01A 1K9MW 4I7ZB 1SQXH 1G6UA 3OUSA 3OE7G 3L73H 5LGUA 2QDOA 1QBZA 2OWOA 3OEEG 4NXMB 4JZGA 4BAYA 1R6KA 2E5LB 1JPXA 1XHZA 1KD1W 2GTSA 3A0HZ 1JOYA 2HP8A 3D36C 2MW2B 1FXVA 1MG1A 2QSAA 2UUCO 1GMGA 1Q6HA 2QM4A 3SJBC 5FL7G 3BAAA 1JX9A 2EILC 3K04A 4IT5A 1XILA 4K3AA 1SF9A 2R72A 4PA9A 4MVUA 2ZDIC 2YIAA 1V55B 2W6JG 2YSUB 3AEIA 5CB4A 1RSOA 3JD2A 2ADPA 2CH7A 2ZE7A 1MABG 4J41A 3BA8A 2DYSB 2OT5A 1M4UA 2BTQA 2FL4A 2RCVA 1AI4A 1KP2A 3SYPA 3J81N 1NR1A 1GH6A 5DEDA 5LMNO 1BGYH 3CS5A 2EIJC 5IYCO 1ENVA 4RUEA 4DW0A 4LWSB 1BQ0A 3NXSA 5EZYB 3BHPA 4TUYA 1VQLV 4GLXA 2GUZA 2IM9A 2F95B 2CDYA 3C3SA 3HKCA 1VIBA 4GCZA 5BR8O 1DK1A 1QQCA 2RQ6A 2ARHA 1I5XA 5KHHA 1I94B 1NZ6A 2UUBO 1AJPA 1MMMA 1Y76B 4FMTA 2YDEA 1KUQA 3JD0A 3D8CA 4DR7O 1SETA 1WB8A 1N0JA 4G2KA 1TUEB 4WFGA 2WLIA 3FB8C 1BCCH 4B7KA 2W0FC 2EBOA 1D5AA 1OJHA 1OCRC 2OCHA 3CCUV 1Y67A 3OAAG 1Q43A 3DXRA 3H1IH 4ZHQA 4X62O 5KHJA 2HVJC 3DC5A 2LFSA 4FFBB 4PDMA 3FX7A 2D2CB 1YSCA 5J2UB 2H94A 1K5QA 1HR0O 4ZIBA 4GKJO 2V1DA 4JPRA 3Q4HB 3HKDB 4KP4A 2CTWA 1K34A 3CRCA 5KUMA 3BEHA 3WB0A 4JI8B 4FM0A 2ZNIA 1V54B 4FLVA 3M99B 1M1KW 1FYJA 4I50A 4PA3A 3N2KB 3ZN0A 2OTLV 3CSXA 3ZHSA 1F23A 1BQZA 1YTFD 1GN2A 3QVNA 2QWQB 2ITDC 2Y0IA 4MVMA 5EBWC 1K4CC 2Q7HA 1FFTB 1PV0A 2YICA 3SPCA 1RP3B 1S76D 1EN5A 4DRXA 4H13B 3K5NA 3K5OA 4DV7O 2DW4A 2ZT9B 4B3MB 3CJHB 3ABLC 1WA8B 3K59A 2UXDB 1S5JA 3FD9A 3UO2A 4O4HB 1KP3A 2CUGA 4J11A 3CCVV 4X66O 2LO1A 3RBZA 4MSWC 1FS0G 1G4YB 4DR2B 3L9DA 1U97A 3CE2A 4E4EA 1KKCA 3K9AA 3ASOC 1EZJA 2HVKC 5E79Z 1EZVH 2HEPA 3P32A 1I0HA 3K3WA 3H9VA 2YEVB 3L72H 1LUVA 3AG4C 2LFRA 2FTKA 3WU2Z 3P30A 4DV0O 3AG2B 1O9HA 1B06A 1GN3A 4GX0A 5GONB 3OD4A 2OYQA 4PA7A 2OIEA 4JI0O 5CA1B 4JI4O 4PDVA 1THZA 1XMQO 3BCCH 1FXHA 1IX9A 2YXHA 5KAIZ 5D5QA 1H2MA 1ZAUA 4I55B 4ZOLB 1XOUA 3PJSK 4DV5O 1NJIW 4X1IA 1K7DA 3JALB 2DYRC 5CA3A 5CA0A 1R73A 2UUAB 1NTKH 5A9GA 4HYOA 2Q67A 5AG2A 3W7UA 4W4LA 4DV6O 3W7XA 4YIPA 3LDEA 2O57A 5B1BC 1JR9A 3JYCA 4DR4B 4YXWG 4EKWA 3JAWB 2BTOA 3M7MX 1XNQB 3TETA 4DV4B 3C90A 4JYAO 2WA4A 5KAFZ 5EK0A 4DR5O 3STZC 3RVZA 3ZRSA 2H3OA 1P84F 1FXKB 1SERA 3DSQA 2YS8A 1BMFG 4YJ2A 5H9CA 3FAVA 2QEXV 3H1KH 2P7TC 2H8PC 2WLLA 2CE4A 2MK3A 1GKFA 1P49A 4LFAO 4NXNB 4JYYA 1NS1A 3T1HO 4E2LA 1OV9A 1VQOV 1HNZO 1RSOB 2QWNB 4LWSA 3OMNB 4Z1VA 2CH7B 5EZYA 1YJ9V 5L3EA 3T2MA 3RGBA 2P67A 5DECA 1HDJA 2NR5A 4RQFA 4DR1B 5B1AC 3OR7C 3TXSA 4NTXA 4FLTA 4B08A 3TCUA 2EILB 4J7ZA 2ZCEA 3KG2A 3ZRWB 2DQ3A 4DK1A 4ABMA 2JGDB 4GX1A 4O4JB 3DTUB 4TUYB 4JGSA 1Y76A 2JK5C 2EZPA 3ZMTA 4B3SB 4D7SA 1QLNA 1CEZA 2Z5UA 1KBHA 3ZMVA 4GYCB 2DWEC 4K8ZA 3GB7C 4YJ3B 1XL4A 4NKGB 1AI5A 2WLJA 4Q6GA 3K5MA 2OCCC 1J95A 2QM8A 1M57C 3W7SA 4FFBA 4JI6O 3K58A 4JTCB 1M9NA 2WLMA 5J2UA 3IAYA 1AI7A 4TQDA 1VQMV 1NI8A 3Q4HA 3JAKA 2UU9B 1IURA 2E74B 3OR6C 4KUMA 4KXRA 2JEUA 3JARB 2YIBA 1E1RG 2QM7A 1WLEA 4UV8A 1W0JG 2VS0A 4DR3O 3RN4A 3M8AA 4YHHB 1NH2D 1BZKA 5FPOA 5K1XA 3SYAA 4DV3O 1NQTA 3EVKA 3THOA 1R6TA 3B4SA 2UXCB 4A5UB 2RNBA 1WP8A 2B1GA 4J10A 1RPRA 4FZ1A 4CH4A 4JV5O 1CPYA 1Q7YW 5B66Z 4J9YB 1NT2B 4I50B 1WNSA 4L87A 2E75B 1VF5B 4U3JB 1QHTA 3OFNG 1VMGA 3JD3A 3KCXA 4LP8A 3BABA 2R9RB 4X9QA 3CCRV 1DF4A 4PA6A 2EIKC 2XAJA 4DV2O 1HNWO 1DGSA 1WA8A 2LP7A 4JAAA 4AQYB 4O4HA 4JI1B 4ASUG 3RT3C 4DRXB 1N8RW 1B6QA 3IJ4A 5FNVA 3UM7A 4YY3O 2XHBA 1S5HC 3EFFK 2YI9A 1K3EA 5DM6V 2ZM6B 2NLJC 1Z5WA 1JFFB 5EC1C 3IFXA 1D5NA 2YEVA 1OCZC 2CTPA 2Q0OC 3BA9A 2VQFB 2OIGA 3ML0A 3AK3A 4H44B 4LFCB 2BOBC 4JAUA 4HBNA 3BPZA 2UXBB 1YTFB 1ZUQA 4NXMO 4G28B 1KMIZ 1VQ8V 3RYCB 4RQEA 3MHHC 1G8MA 2W0XA 3RFRA 1Q81W 2EJRA 3OT7A 1N34B 4IIJB 1GM7A 3CCLV 1AP5A 2IJJA 2IU0A 4I55A 1XNRO 4ZOLA 2ODMA 3ABLB 4F4LA 4X65O 4LF6O 4LF4O 2IJIA 3JALA 4MTFA 4X64B 1AR1B 3AG3B 2ZXWB 3JD1A 5JJJB 1SQPH 2P4KA 5LP6C 3W7TA 3HB3B 1FJGB 4IGGA 3E22B 2DOSA 3ASOB 4PA4A 2PI4A 3K0DA 3E8FA 1Y4MA 1AROP 1IBMO 4DUYB 3JAWA 4X1IB 4JZ2A 4FPPA 4D7TA 1W0KG 5CA0B 4P2ZA 4W4KA 1I08A 3U10A 1JJ2U 2ILMA 1IBLO 3G6EV 1WN7A 3B8MA 3K79A 4CS2A 3R65A 5FLXN 2WLHA 3SYCA 2ZD9A 1FXKA 4LF9O 1DTOA 1OZ0A 2JIZG 4TOIA 1QR8A 4JI2O 5LXTA 1VF7A 4NTWA 1DLBA 4K0KO 5LHHA 5JJEB 3QF7A 1XHXA 3ABMB 2QKAA 3CCQV 3CWBH 1E79G 2DYRB 3UKMA 1YVWA 4TT3G 4YJ2B 4LF5B 4MS2A 2VQEB 4FLUA 1XBLA 2Y69C 3FAVB 3D36A 4KL1A 4N23A 5KA6A 4DUZO 2WLLB 3OGCC 4XDLA 2WWWA 2BOCC 4ZKIA 2CTRA 5IYBO 5IT9N 2XAQA 1UJWB 2WSSG 4I5SA 5F2VO 1K8AW 5JJNB 2Y4TA 3ZRWA 4DR6O 2RDCA 4ZBMA 3UO3A 2EINB 2JGDA 1RM1B 4XDKA 3OMAB 4O4JA 3H1JH 4I4TB 1G1XB 5B3SC 1AVMA 2IH1C 1NVPD 1URFA 1WP7A 3FKSG 4HZ3A 3QO5A 4LC1A 2IJKA 4KHPO 3JATB 2UUCB 1JCHA 1L1FA 5KX5B 1M56C 3APOA 3BFRA 4X1KB 4U3FH 4YJ3A 3ETQA 2B9ZA 1ROPA 4TWKA 3E35A 3F7VC 2QWOB 1XEQA 1RPOA 2F1MA 3ASNB 3OEHG 3SPGA 4EFEA 4KFMA 3T1YO 3X2QC 1HP8A 2Q5ZA 2ZIMA 4PV1B 2HHHB 4DO2A 4FJCC 3ABKC 1L8DA 4WF9V 3JARA 5LMNB 1NKDA 3NR7A 1S77D 1Q3EA 3SJAC 1XREA 4K35A 4LBEC 1GO3F 2GSMB 1SQVH 1R3IC 5BY1A 2KKWA 3JAKB 1J5EO 4P9PA 5L3GA 1IBKO 1XQ8A 5GW7A 5BR8B 3J80N 5HFLA 3N27A 4B3TO 2YUAA 4QNHB 3EXAA 2CGNA 2KB1A 4B3MO 4NYKA 5C93A 2OTJV 1P7GA 1I7FA 2EIMC 2F4VB 4FK5C 4U3JA 1PL4A 2UUBB 2PTMA 1RFYA 4X88A 5ITZA 4R50A 5EBLC 4DR7B 1D2DA 3SGIA 1LUWA 1VQ6V 1COWG 4EFBA 2RJZA 5IYZA 1U96A 2IW5A 4I0XB 1IDSA 2DWDC 5BMVA 4X62B 3TK1A 1IZ3A 3SR2C 2Y4UA 3A0RA 2RN9A 3WB1A 1KKDA 3L70H 1MSDA 2JS3A 4JI7O 1FD9A 3RYHA 1JFFA 3UQ8A 4J7KA 2YIDA 1HR0B 4ICGA 4OPAA 4GKJB 1H2NA 1N36O 1NH2B 3LNMB 5FNVB 1GTOA 3E8BA 4RAIA 2NN4A 1AJQA 1BL8A 2PUSA 1OHHG 5LGNA 1XI1A 1R3KC 3BVOA 2PZSA 3RYCA 2PI5A 2RMKB 4MVSA 1AP6A 1Q82W 3CRMA 4IIJA 3LSSA 2QKSA 3CC7V 2HR3A 1W2BU 3OUFA 3CMEV 2EIKB 1O9GA 4DV1B 3DC6A 1K97A 2XAFA 4UCOA 3O65A 2P06A 3ZHUA 3CPWU 4MTXA 2JGUA 3F5TA 1VQ4V 4I9WA 5L3CA 1AILA 3WG7B 1VEWA 2QR4A 1NU1H 3E22A 4LF8O 4DV7B 4JTAB 1MZFA 2AHZA 1JQ0A 2Q9LA 1OCZB 1W59A 2XAGA 2YC0A 4GX2A 1MNGA 3FB6C 4RUFA 4LH7A 1WPBA 4X66B 4R8CA 3A0BZ 5E1AC 4MTGA 3ZS8C 4WFHA 1V55C 3E8GA 5LL6Y 2DQ0A 5KLVH 2A0LA 2AZ0A 1YITV 2JRIA 2D3OW 2XOKG 4QE7A 2QGNA 4CH6A 1IXMA 2R9IA 4EB6B 1H38A 1PPJH 3I55V 4LF7O 3MDSA 1KB9F 4WBNA 4UVAA 1R1BA 5JCOC 1YI2V 4DV0B 3CD6V 5IWAO 2JJ1G 4IYIA 1GN4A 3MHSC 2R9AA 3GVMA 3RYIA 1MZEA 3VQYA 5LXTB 3ABTA 4JI0B 4JI4B 1VP7A 4MT8A 1XMQB 1YJWV 4UB8Z 2PF4E 3VQVA 1HNXB 1YJNV 4L8JA 3ZCCA 4OX9O 5LHIA 2NNUA 4DV5B 1VF6C 1EFRG 4WFEA 4WFFA 4I4TA
chains in the Genus database with same CATH topology
1SRYA 2OT5A 1KECA 1Y66A 1N8RW 1B6QA 3ZN1A 1AI4A 1KP2A 2IJHA 3SYPA 3QO8A 1NR1A 1QLEC 4UVCA 3UM7A 1S5HC 3EFFK 2EIJC 5B1OA 5IYCO 1ENVA 4RUEA 1K3EA 5DM6V 2NLJC 3NXSA 4DXWA 2HFEC 3CYOA 5EC1C 3IFXA 1VQLV 4U7OA 3SJQC 1P4RA 2YEVA 5IY5B 1OCZC 4GT1A 1F51A 3AG3C 2XNDG 2ZXWC 3ML0A 4XBFA 2BOBC 2ZR3A 4GCZA 1PNKA 4JAUA 2IH3C 3JD4A 1YTFB 3ZMUA 4G28B 3AG1C 4UUJC 1VQ8V 2UXNA 1OCOB 4RQEA 1I5XA 5CBGA 1PL0A 3MHHC 1G8MA 1GM9A 3ETGA 4LCUC 2QE7G 2M7WA 2ZQMA 3JCZA 3LUTB 1Q81W 2JJ2G 1AJPA 2EJRA 1LNQA 4FMTA 2B1IA 1S3JA 1GM7A 3JD0A 2EIJB 3CCLV 2IJJA 4UXNA 5LBQA 2IU0A 3ABLB 4F4LA 1SETA 1MOFA 2A79B 4G2KA 2QTOA 4XDJA 1TUEB 2IJIA 2WLIA 3FB8C 4WFGA 4QIWF 2W0FC 4MTFA 5H6QA 3QNEA 5B3SB 3G4SV 2EBOA 3SYQA 4Q20A 1OCRC 1AR1B 3AG3B 3CCUV 2ZXWB 3JD1A 2Y48A 1PNLA 3OAAG 5DN6G 5EC2C 2Q69A 3ZRVA 2UXXA 3W7TA 3HB3B 1M56B 2HVJC 5B1NA 2LFSA 4HAMA 3ASOB 1NVPB 4PA4A 1EBOA 3ABMC 2PI4A 3K0DA 3E8FA 1Y4MA 1AROP 4PDMA 2X0LA 1YSCA 1DF5A 3BY6A 1Q86W 2H94A 4WCEV 3SYOA 1K5QA 4FPPA 2QA4V 3CC4V 1W0KG 4P2ZA 3STLC 1JJ2U 2V1DA 4JPRA 1WPXA 4TSFG 4KP4A 3G6EV 2DYSC 3B8MA 3K79A 4R6ZA 1OCCB 3R65A 1K34A 1PKXA 4UVBA 2P90A 5KUMA 2WLHA 3BEHA 3SYCA 2ZD9A 1FXKA 1V54B 4JYCA 1DTOA 2JDIG 1OZ0A 1H8EG 2JIZG 5L3FA 4P9OA 4PDLA 3M99B 1M1KW 1OCRB 1QR8A 4PA3A 3EHBB 3ZN0A 3I56V 1QCEA 2OTLV 3CCEV 5LGTA 1DLBA 2EINC 1RM1C 5LHHA 1F23A 5IY5C 1YTFD 3ABMB 3CCQV 1S72V 2ITDC 4MVMA 5EBWC 5LHGA 1K4CC 2X6CA 1E79G 2DYRB 3UKMA 1VQ9V 4TT3G 5IYDO 4MS2A 3WFVA 2Y69C 1FFTB 4H37A 3D36A 4N23A 3SPCA 5KA6A 5KA5A 4G27B 1S76D 4BIZA 1OCOC 2WLLB 3F7YC 1K5SA 5CBHA 2F43G 3OGCC 4XDLA 3VOUA 1CP9A 2WWWA 2BOCC 4ZKIA 1K4DC 5IYBO 1F4NA 2XAQA 1UJWB 2WSSG 4I5SA 4MW8A 4JF3A 3CCSV 2DW4A 2EIMB 1K8AW 2X6AA 3E89A 3ZRWA 3ASNC 3ABLC 2Q68A 3OM3B 4ZBMA 4QPKA 1K73W 2EINB 1RM1B 3LSQA 3AG2C 4XDKA 3OMAB 1KP3A 4X8AA 1VQKV 5B3SC 4PDRA 3SPIA 3CCVV 2IH1C 1NVPD 3FKSG 4HZ3A 4MSWC 3RBZA 5J9PC 1FS0G 1G4YB 2IJKA 3IGAC 3QO5A 4LC1A 2ZR2A 3CXCU 1JCHA 4MVRA 1L1FA 2Y69B 3ETEA 4FIPC 1M56C 3K9AA 3ASOC 1EZJA 4PELA 2HVKC 2WAMA 3P32A 3T4ZA 3K3WA 5KUKA 1QR9A 4MVQA 1ROPA 2YEVB 4TWKA 3E35A 3GWOA 1MSWD 3OW2U 3F7VC 3AG4C 3ZJZA 2LFRA 1I5YA 3SPHA 1RPOA 2FTKA 1JVMA 3OMIB 1E1QG 3ASNB 1OCCC 3P30A 4QJFB 1NBMG 2HLDG 3AG2B 3HPLC 3T1CA 1V54C 4QE9A 1VQ5V 5CN0A 3OEHG 2WPDG 3SPGA 4JYBA 4GX0A 4KFMA 3SPJA 3X2QC 3FYEB 4GX5A 4PA7A 3LDCA 1M90W 4PDVA 1THZA 4MVOA 4DO2A 4FJCC 1ZWIC 1FXHA 3ABKC 3DGEA 4WF9V 1F4MA 1NKDA 3PJSK 1S77D 1NJIW 2WLIB 1K7DA 4LBEC 1GO3F 2DYRC 2GSMB 5CA3A 3AG4B 1R73A 1R3IC 3CCMV 4HYOA 2Q67A 3W7UA 4P9PA 3W7XA 5L3GA 4R7CA 3LDEA 5GW7A 5B1BC 1BHAA 3JYCA 2IU3A 5HFLA 1YHQV 3X2QB 1H2GA 4QNHB 4YXWG 4EKWA 2KB1A 3G71V 5C93A 1R3LC 2OTJV 2EIMC 1HWYA 4FK5C 4H33A 3ABKB 3TETA 1K92A 5BZBA 1KQSU 5EK0A 4X88A 1KC8W 2P6JA 3STZC 1SZTA 3RVZA 4X89A 4R50A 3ZRSA 1NR7A 3FYIB 5EBLC 1FXKB 1SERA 1P7BA 1BMFG 5H9CA 4P30A 3T4DA 3E86A 1COWG 1QVGU 2QEXV 1VQ6V 2P7TC 2X7RB 4JAVA 2H8PC 3RVYA 2WLLA 4Z1MG 2IW5A 1VQ7V 2MK3A 4CZZA 3B8NA 2ATKC 2DWDC 1GKFA 1QVFU 3LDDA 5B1BB 2JEXA 3MD0A 3K0GA 3TK1A 4E2LA 1PNMA 3A0RA 3K08A 1VQOV 1KKDA 5L3DA 3OMNB 5EBMC 3FB5C 1YJ9V 5L3EA 2ZDIA 2CK3G 4WFBV 2WLNA 3T2MA 2Q6AA 2WLKA 1VQNV 3ZRXA 3ETDA 2P67A 2X6BA 4MTOA 1NH2B 3LNMB 4RQFA 4BW5A 5B1AC 1GTOA 3E8BA 3OR7C 3QO7A 4RAIA 3E2EA 1AJQA 1BL8A 3WG7C 3TCUA 4U7NA 2EILB 1OHHG 2HJFC 1VQPV 4MVZA 5LGNA 2GHYA 1R3KC 3KG2A 2EZOA 3ZRWB 2DQ3A 2PI5A 2AHYA 3IC7A 3E83A 2K1EA 4MVSA 3B77A 4OXSA 4GX1A 3DTUB 3F5WC 4JGSA 2JK5C 3ZMTA 2EZPA 1Q82W 4MW3A 3LSSA 1ORQC 2QKSA 3CC7V 2HR3A 1W2BU 3OUFA 3CMEV 4J9ZB 2EIKB 3VBBA 1QLNA 1CEZA 2W6IG 2Z5UA 1K97A 1XL6A 2XAFA 5H6RA 2B5UA 2XASA 3ZMVA 3CPWU 2DWEC 4RO2A 3ZMZA 3GB7C 5HFMA 1XL4A 4MTXA 4N21A 1AI5A 2XAHA 3CP1A 2A9HA 3ABUA 2WLJA 5B1AB 1BHBA 1QLEB 1VQ4V 4WFAV 4I9WA 5L3CA 2OCCC 3WG7B 3CCJV 1J95A 2QM8A 5IDJA 1GM8A 1M57C 3W7SA 3K03A 1R6NA 1AI6A 1S0VA 4JTAB 4BIUA 2AHZA 1JQ0A 4JTCB 2HG5C 1FXKC 1M9NA 2WLMA 1SESA 2HKOA 1OCZB 2XAGA 4GX2A 1H8HG 3FB6C 4RUFA 4CBCA 4QPJA 1AI7A 2ITCC 5CBFA 1VQMV 1YIJV 5CMUA 3H01A 1K9MW 4R8CA 2Z3YA 3OR6C 3OUSA 4KUMA 4MTGA 5E1AC 2JEUA 3OE7G 3W7WA 1E1RG 3AG1B 4WFHA 3ZIAG 1V55C 3E8GA 5LGUA 1QBZA 2DQ0A 2QM7A 1WLEA 2A0LA 4UV8A 1W0JG 1YITV 3OEEG 4UV9A 2D3OW 2XOKG 1NH2D 3D3IA 3FB7C 4BAYA 4QE7A 1R6KA 3CMAV 2OCCB 1JPXA 3SYAA 1IXMA 2R9IA 5L3BA 4JTDB 1NQTA 1KD1W 1JOYA 1H38A 1M57B 1AJNA 1FXVA 1MG1A 3I55V 1PD3A 1GMGA 4UVAA 2V7QG 2B1GA 1YI2V 1RPRA 3CD6V 1CPYA 5FL7G 1Q7YW 1JX9A 2EILC 2JJ1G 4J9YB 3MHSC 3ZMSA 4L87A 3K04A 4JASA 3ABTA 1K33A 1R3JC 3OFNG 4LP8A 3JD3A 4MVUA 4PA9A 2ZDIC 4MT8A 3RW0A 3K06A 1GK9A 1YJWV 1V55B 2W6JG 2YSUB 2R9RB 3AEIA 3ZCCA 1YJNV 5LHIA 3CCRV 1DF4A 3E8HA 3JD2A 3CC2V 4PA6A 2NNUA 2EIKC 2XAJA 2C2AA 1MABG 2LP7A 1EFRG 4WFEA 4WFFA 4ASUG 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUF A;  4PA3 A;  4J9Z B;  3PJS K;  3SYP A;  2WLI B;  4LBE C;  1QLE C;  2DYR C;  2EIN C;  1XL6 A;  3UM7 A;  5IY5 C;  1S5H C;  1R3I C;  3EFF K;  2DWE C;  2EIJ C;  4RO2 A;  3GB7 C;  4HYO A;  1XL4 A;  2Q67 A;  4RUE A;  2ITD C;  4MVM A;  5EBW C;  2NLJ C;  1K4C C;  2A9H A;  2WLJ A;  2X6C A;  1ORQ C;  4P9P A;  2HFE C;  4DXW A;  4R7C A;  5EC1 C;  3UKM A;  3IFX A;  4I9W A;  4MS2 A;  3SJQ C;  2OCC C;  2YEV A;  2Y69 C;  1J95 A;  3LDE A;  4H37 A;  5B1B C;  3SPC A;  1OCZ C;  3JYC A;  4QNH B;  1M57 C;  3K03 A;  2KB1 A;  4G27 B;  4EKW A;  1R3L C;  3AG3 C;  2ZXW C;  1OCO C;  2WLL B;  3F7Y C;  4JTA B;  2AHZ A;  2EIM C;  5CBH A;  4JTC B;  2HG5 C;  3OGC C;  4H33 A;  2BOB C;  4XDL A;  3VOU A;  2WLM A;  3TET A;  2BOC C;  2IH3 C;  4GX2 A;  5BZB A;  1K4D C;  3FB6 C;  4RUF A;  4CBC A;  4G28 B;  3AG1 C;  4UUJ C;  5EK0 A;  2ITC C;  5CBF A;  4MW8 A;  4X88 A;  4LCU C;  5CBG A;  3STZ C;  3RVZ A;  4X89 A;  2X6A A;  4R50 A;  3ZRS A;  3E89 A;  5EBL C;  3ASN C;  3ABL C;  4R8C A;  2Q68 A;  1P7B A;  3OR6 C;  3OUS A;  4MTG A;  3LUT B;  5E1A C;  4ZBM A;  3AG2 C;  1LNQ A;  4XDK A;  4P30 A;  3T4D A;  4WFH A;  3E86 A;  1V55 C;  3E8G A;  4X8A A;  5B3S C;  4PDR A;  3SPI A;  2P7T C;  2A0L A;  2IH1 C;  5J9P C;  2H8P C;  4HZ3 A;  2WLL A;  4MSW C;  3RBZ A;  3RVY A;  3IGA C;  1G4Y B;  4F4L A;  2A79 B;  2ATK C;  2DWD C;  3FB7 C;  4QE7 A;  3LDD A;  2QTO A;  4MVR A;  2WLI A;  3FB8 C;  4WFG A;  4XDJ A;  3SYA A;  4JTD B;  2W0F C;  4MTF A;  3K0G A;  1M56 C;  3SYQ A;  3K08 A;  1OCR C;  1KKD A;  3ASO C;  2HVK C;  3T4Z A;  5KUK A;  4MVQ A;  2Q69 A;  5EBM C;  3FB5 C;  5EC2 C;  4TWK A;  2HVJ C;  3F7V C;  2WLN A;  3T2M A;  2Q6A A;  3AG4 C;  2WLK A;  3ZJZ A;  4PA4 A;  2EIL C;  4J9Y B;  3SPH A;  1JVM A;  3ABM C;  3K0D A;  3E8F A;  2X6B A;  3K04 A;  4MTO A;  3LNM B;  4PDM A;  4BW5 A;  5B1A C;  1OCC C;  3OR7 C;  1R3J C;  3E8B A;  4RAI A;  4PA9 A;  4LP8 A;  4MVU A;  1BL8 A;  3SYO A;  3HPL C;  3RW0 A;  3T1C A;  1V54 C;  4QE9 A;  3TCU A;  3K06 A;  3WG7 C;  3SPG A;  2HJF C;  4KFM A;  4GX0 A;  4MVZ A;  2R9R B;  4P2Z A;  3SPJ A;  3STL C;  3X2Q C;  1R3K C;  4GX5 A;  3E8H A;  2DYS C;  3KG2 A;  4PA7 A;  4R6Z A;  3LDC A;  3R65 A;  4PA6 A;  5KUM A;  4PDV A;  2EIK C;  2WLH A;  2AHY A;  3BEH A;  4MVO A;  3E83 A;  2ZD9 A;  2K1E A;  3SYC A;  1ZWI C;  4MVS A;  4OXS A;  3ABK C;  4GX1 A;  3F5W C;  4WFE A;  2JK5 C;  4P9O A;  4PDL A;  4MW3 A;  4WFF A;  2QKS A; 
#chains in the Genus database with same CATH topology
 2IJH A;  2AZ2 A;  3QO8 A;  4JI5 B;  3JAT A;  1QLE C;  4UVC A;  2P4V A;  5KX5 A;  4X1K A;  5B1O A;  1ZLZ A;  3ZHV A;  2HFE C;  2FKX A;  3SJQ C;  1P4R A;  3ZBH A;  5FPR A;  3HKB A;  2EX3 A;  4X1Y A;  4JI3 O;  4GT1 A;  2G38 A;  1F51 A;  4PI2 A;  3OTO O;  2XND G;  4IYH A;  4DR5 B;  1XMO O;  2ZR3 A;  5IE9 A;  1PNK A;  4O2A B;  1XDC A;  2Q7G A;  3A8T A;  3AG1 C;  4UUJ C;  4GKK O;  2UXN A;  4YHH O;  3IC9 A;  5CBG A;  1PL0 A;  1GM9 A;  2N05 A;  2QE7 G;  1QNM A;  3JCZ A;  3LUT B;  2JJ2 G;  5LMU O;  1LNQ A;  3LSU A;  2B1I A;  3ZHQ A;  4LFA B;  2EIJ B;  4UXN A;  3B40 A;  4FVM A;  3T1H B;  1HNZ B;  1MOF A;  1XUQ A;  2A79 B;  5K1P A;  4XDJ A;  1N33 B;  2Q0A A;  4PD4 F;  5B3S B;  5GTH Z;  1Z5V A;  1ZL8 A;  3VQX A;  3K9S A;  3C3T A;  4FFK A;  2UXX A;  1M56 B;  4IHJ B;  2ZE8 A;  2Y0P A;  5B1N A;  2QJ1 A;  3L74 H;  1NVP B;  1EBO A;  2Q7E A;  1V9P A;  4AQY O;  2Q73 A;  4PJ0 Z;  1DF5 A;  3LNN A;  2KG7 B;  1N0N A;  3JAS B;  1WPX A;  4TSF G;  1QU7 A;  4UVB A;  2LGW A;  2P90 A;  5JH7 A;  2JDI G;  1M93 A;  1H8E G;  5L3F A;  4P9O A;  4PDL A;  2FML A;  1OCR B;  3OGI B;  1GN6 A;  3TGU H;  3I56 V;  4I0X A;  3CCE V;  1FKA O;  1FFX A;  1YDX A;  5IY5 C;  1S72 V;  5ITZ B;  1N4C A;  4JI6 B;  2UXB O;  3SDL A;  2DMX A;  1VQ9 V;  5IYD O;  1AR5 A;  4H37 A;  1N32 O;  3N2G B;  1SQB H;  5IYZ B;  1OCO C;  3F7Y C;  1K5S A;  2F43 G;  1N34 O;  4NVP A;  5BMV B;  4CH5 A;  4LFB O;  1BE3 H;  1M5I A;  1F4N A;  2QWP B;  5LA6 B;  3L75 H;  5EIB D;  3CCS V;  2EIM B;  3RYH B;  1TVK B;  4DR3 B;  3LSQ A;  3AG2 C;  1IVS A;  4Z2W A;  1B3Q A;  3OTF A;  4DV3 B;  4X8A A;  1VQK V;  4TV9 B;  5EIB C;  4BIO A;  5J9P C;  4UCU A;  2ZR2 A;  3CXC U;  4MVR A;  3ETE A;  1LR1 A;  4LH6 A;  4LNU A;  2FYU H;  1AB3 A;  3S3X A;  4JV5 B;  3QG5 A;  5LOV B;  3R66 A;  5KHI A;  4FLZ A;  2E5L O;  3WB2 A;  1QR9 A;  3OW2 U;  3BRC A;  2LW7 A;  2E76 B;  1Y6X A;  3SPH A;  4J42 A;  3OMI B;  1YF2 A;  5KMG B;  5BXZ A;  3G67 A;  5KHG A;  1OCC C;  2AGA A;  4QJF B;  1NBM G;  2HLD G;  4DV2 B;  3T1C A;  1VQ5 V;  2WPD G;  2DJV A;  3SPJ A;  3HKE B;  4IL6 Z;  4GX5 A;  1BS3 A;  3APQ A;  1ZWI C;  3DGE A;  4B3R B;  1F4M A;  2VWJ A;  4YY3 B;  4TV8 A;  2PYJ A;  3ZED A;  4FLX A;  4LF5 O;  3RYF A;  1SQF A;  3K5L A;  3I5D A;  3JSN A;  3AG4 B;  2AXT Z;  4EB6 A;  2YI8 A;  5IJ9 B;  1KU9 A;  4R7C A;  3KZI Z;  1S5L Z;  4OGQ B;  1BHA A;  2PY5 A;  2IU3 A;  1H2G A;  5C8Y B;  1R3L C;  4CC5 A;  5LP6 A;  1JA8 A;  5BZB A;  3FFQ A;  1KQS U;  1CXZ B;  1NTM H;  1YZB A;  2P6J A;  1SZT A;  2L6L A;  2A3Q A;  4WBN B;  1XNR B;  4D6T H;  1TUB A;  4X65 B;  1P7B A;  4LF4 B;  4LF6 B;  3TXQ A;  4P30 A;  3T4D A;  1ZSP A;  3E86 A;  1I94 O;  1SZX A;  2K9P A;  4JAV A;  3RVY A;  4B7E A;  4Z1M G;  3RYI B;  3A2F A;  2ATK C;  1QVF U;  4F6R B;  5B1B B;  1VAR A;  2JEX A;  3MD0 A;  3K0G A;  2EJ7 A;  1PNM A;  3K08 A;  2BSK A;  5JVD B;  5J2T B;  3FB5 C;  1IBM B;  2ZDI A;  4NB5 A;  4AIL C;  2CK3 G;  4WFB V;  1MA1 A;  2Q6A A;  2WLK A;  3ZRX A;  3ICX A;  2HHH O;  3ETD A;  2X6B A;  1IBL B;  4MTO A;  3QO7 A;  3UT5 B;  3RWR D;  3E2E A;  4O2A A;  1Z2G A;  4U7N A;  4UB6 Z;  4DK0 A;  2HJF C;  1VQP V;  2XUM A;  4MVZ A;  4LF9 B;  2GHY A;  4I9Q A;  2EZO A;  3J7A U;  3E83 A;  4JI2 B;  3F5W C;  1SKV A;  3HKB B;  4MW3 A;  4K0K B;  4X1Y B;  3H1H H;  4JI8 O;  4H0L B;  2F93 B;  2W6I G;  1TGO A;  1XL6 A;  2B5U A;  2ZE5 A;  5HFM A;  2F4V O;  5EYP B;  1FPO A;  2XAH A;  4DUZ B;  4UCV A;  2LJ2 A;  3ABU A;  5B1A B;  1BHB A;  1QLE B;  2ZE6 A;  4PI0 A;  4X20 A;  4IHJ A;  2N74 A;  5IDJ A;  1GM8 A;  1Y74 B;  1AI6 A;  1S0V A;  2A06 H;  4BIU A;  4PHZ A;  3U11 A;  1SES A;  5D5P A;  4DR6 B;  2KG7 A;  1EM1 A;  1ZL8 B;  1JMK C;  4CBC A;  3JAS A;  1X59 A;  1YIJ V;  3G6B A;  4HNA B;  2Z3Y A;  4KHP B;  5JQG A;  2R70 A;  3W7W A;  2JVD A;  3L71 H;  3AG1 B;  3ZIA G;  4O2B B;  1BSM A;  1YCI A;  4UV9 A;  2UXD O;  3D3I A;  3FB7 C;  3CMA V;  2OCC B;  5L3B A;  4AHC A;  4JTD B;  1M57 B;  1AJN A;  5GTI Z;  2CAZ C;  4DR2 O;  1PD3 A;  2XTA A;  1SA0 A;  2V7Q G;  5JH7 B;  3CRA A;  1WB7 A;  3CEI A;  4O4L A;  3ZMS A;  3T1Y B;  3N2G A;  3K57 A;  4JAS A;  1WAZ A;  1K33 A;  1R3J C;  3HR0 A;  3H1L H;  1FFX B;  5TIS Z;  3RW0 A;  4YIO A;  3K06 A;  1GK9 A;  1KYO F;  5LA6 A;  4DV1 O;  3E8H A;  3CC2 V;  2ADQ B;  3JSL A;  2PYL A;  2C2A A;  1AR4 A;  1TVK A;  4C7U A;  1H2S B;  2CGO A;  4CS3 A;  1SRY A;  4TV9 A;  1IXB A;  1KEC A;  1Y66 A;  3ZN1 A;  1Q6I A;  1J5E B;  3O9O A;  2GDS A;  1IBK B;  4B3T B;  2YXL A;  3CRR A;  4DXW A;  5LOV A;  2BE3 A;  3CYO A;  4U7O A;  2UUA O;  4OPH A;  5IY5 B;  5LYJ A;  2ZNJ A;  3P3P A;  1L0N H;  2VWK A;  3AG3 C;  2ZXW C;  5KMG A;  4XBF A;  1BT8 A;  4DYL A;  2IH3 C;  4DR4 O;  3JD4 A;  4LNU B;  2ETN A;  4K8X A;  2Q4P A;  1NTZ H;  3ZMU A;  3HKE A;  1OCO B;  3CB2 A;  4LCU C;  3ETG A;  1XNQ O;  4ZI7 B;  2M7W A;  2ZQM A;  4DV4 O;  4NTY A;  1S3J A;  2VRZ A;  5LBQ A;  4O4I B;  2ZKO A;  2QWR B;  5A2Q N;  4AI8 A;  2ZIO A;  4JI7 B;  1PP9 H;  2QTO A;  4QIW F;  5H6Q A;  3QNE A;  3G4S V;  2GTA A;  3SYQ A;  1YEW A;  4Q20 A;  4GZR B;  2Y48 A;  1PNL A;  3SJC C;  4FLY A;  5DN6 G;  1N36 B;  5EC2 C;  2Q69 A;  3ZRV A;  5IJ9 A;  1HNX O;  4NXN O;  4BWA A;  2EUL A;  4HAM A;  3ABM C;  4TV8 B;  5C8Y A;  3RYF B;  4CC6 A;  2X0L A;  3BY6 A;  1Q86 W;  4WCE V;  3SYO A;  2QA4 V;  3CC4 V;  3STL C;  1TA8 A;  4JI5 O;  2DYS C;  5IJ0 B;  1SQG A;  4DR1 O;  4R6Z A;  2Q8V A;  1OCC B;  1PKX A;  3ZHT A;  4JYC A;  4FM1 A;  3TJT A;  2F66 C;  3EHB B;  1QCE A;  3B09 A;  5LP6 B;  4B3S O;  5LGT A;  2EIN C;  4F6R A;  1RM1 C;  3MAQ A;  1Q90 D;  4DW1 A;  1Q6U A;  2QKC A;  4LF8 B;  5LHG A;  2X6C A;  5JVD A;  5J2T A;  1TUB B;  1JJO A;  3WFV A;  1HW7 A;  5KA5 A;  4G27 B;  3VQW A;  4BIZ A;  5CBH A;  4EEQ A;  3VOU A;  1CP9 A;  5JCO A;  3UT5 A;  4DV6 B;  1K4D C;  5CB4 B;  2YXY A;  2M6Y A;  4FM2 A;  2BSK B;  4MW8 A;  4JF3 A;  2X6A A;  1N33 O;  3E89 A;  3ASN C;  3D3Q A;  2Q68 A;  3OM3 B;  4QPK A;  1K73 W;  1H2K A;  1L0L H;  2GV9 A;  4PDR A;  3SPI A;  2UU9 O;  2BTQ B;  2CTQ A;  4JYA B;  3IGA C;  1B04 A;  1VF6 A;  1WJZ A;  4LF7 B;  3CRQ A;  1US6 A;  2JS5 A;  2Y69 B;  4UCT A;  2F23 A;  4FIP C;  1FAF A;  5IWA B;  4PEL A;  2WAM A;  5EYP A;  3T4Z A;  5KUK A;  4MVQ A;  1YXB A;  2GUZ B;  2UXC O;  4BR6 A;  3GWO A;  1MSW D;  2YIB D;  5B5E Z;  2BCC H;  2KSD A;  2LGQ A;  3ZJZ A;  1I5Y A;  4UCS A;  1Y74 A;  1JVM A;  3CX5 F;  4OX9 B;  3HKC B;  1E1Q G;  2XT9 A;  3AK2 A;  1T5E A;  3HPL C;  1V54 C;  2LW1 A;  4QE9 A;  5CN0 A;  5H2F Z;  3UCS C;  4JYB A;  4LR3 A;  1Q8I A;  3FYE B;  4F6E A;  2HJD A;  3LDC A;  1M90 W;  4FZ0 A;  4HNA A;  4MVO A;  5KHK A;  2LQT A;  4X20 B;  2L35 A;  1SS3 A;  1EN6 A;  4O2B A;  4CS4 A;  5H5N A;  3U0Z A;  3AG7 A;  2WLI B;  2AW9 A;  4JI1 O;  3CCM V;  1A32 A;  3HKD A;  4JI3 B;  3DXR B;  3JAM N;  3OTO B;  4BW9 A;  4ZHQ B;  2E3C A;  1X4T A;  3KKY A;  5JQG B;  1XMO B;  3P3N A;  1YHQ V;  3X2Q B;  2ZM6 O;  3G71 V;  3N2K A;  4GKK B;  3ZX6 A;  1HWY A;  4H33 A;  3ABK B;  4CH3 A;  2FB5 A;  5JWP A;  1EN4 A;  4UCR A;  1K92 A;  5LMU B;  2VQF O;  2P22 C;  2ZIN A;  1PM9 A;  1SC5 B;  1KC8 W;  4X89 A;  4LFC O;  1NR7 A;  3FYI B;  1SA0 B;  2A7W A;  1Q5O A;  4J7J A;  2Z0A A;  2P5O A;  1QVG U;  1ZTE A;  4O4L B;  1GAX A;  2X7R B;  1VQ7 V;  3CXH F;  4CZZ A;  3B8N A;  3LDD A;  3B2E E;  2DN9 A;  3JCU Z;  5L3D A;  1SQQ H;  3GWK C;  3CJH A;  2KQX A;  3PN1 A;  5EBM C;  2QTS A;  4X64 O;  2WLN A;  1VQN V;  3ZHR A;  4BW5 A;  1FJG O;  4B3R O;  3AK1 A;  3WG7 C;  4QGP A;  3S3W A;  3CHX A;  2V4D A;  4DUY O;  1F7Y A;  2AHY A;  4ZI7 A;  3IC7 A;  2DE0 X;  2K1E A;  3B77 A;  3QTC A;  4OXS A;  4TQF A;  5LYJ B;  1ORQ C;  1UPG A;  4J9Z B;  4O4I A;  3VBB A;  2WA3 A;  1TAE A;  3G80 A;  1UFI A;  5H6R A;  1HNW B;  1GRJ A;  3KCY A;  2XAS A;  5GON A;  1N32 B;  4RO2 A;  3ZMZ A;  2N04 A;  4N21 A;  5CA1 A;  3CP1 A;  2A9H A;  1H2L A;  2PGG A;  4GUN A;  4WFA V;  2GBO A;  3CCJ V;  4FLW A;  1ZX3 A;  4NR1 A;  4UFZ A;  4LFB B;  3K03 A;  1R6N A;  4RWU A;  2HG5 C;  2VQE O;  1FXK C;  2HKO A;  2IBZ H;  4J80 A;  1H8H G;  4QPJ A;  2ITC C;  5CBF A;  5CMU A;  5IJ0 A;  3H01 A;  1K9M W;  4I7Z B;  1SQX H;  1G6U A;  3OUS A;  3OE7 G;  3L73 H;  5LGU A;  2QDO A;  1QBZ A;  2OWO A;  3OEE G;  4NXM B;  4JZG A;  4BAY A;  1R6K A;  2E5L B;  1JPX A;  1XHZ A;  1KD1 W;  2GTS A;  3A0H Z;  1JOY A;  2HP8 A;  3D36 C;  2MW2 B;  1FXV A;  1MG1 A;  2QSA A;  2UUC O;  1GMG A;  1Q6H A;  2QM4 A;  3SJB C;  5FL7 G;  3BAA A;  1JX9 A;  2EIL C;  3K04 A;  4IT5 A;  1XIL A;  4K3A A;  1SF9 A;  2R72 A;  4PA9 A;  4MVU A;  2ZDI C;  2YIA A;  1V55 B;  2W6J G;  2YSU B;  3AEI A;  5CB4 A;  1RSO A;  3JD2 A;  2ADP A;  2CH7 A;  2ZE7 A;  1MAB G;  4J41 A;  3BA8 A;  2DYS B;  2OT5 A;  1M4U A;  2BTQ A;  2FL4 A;  2RCV A;  1AI4 A;  1KP2 A;  3SYP A;  3J81 N;  1NR1 A;  1GH6 A;  5DED A;  5LMN O;  1BGY H;  3CS5 A;  2EIJ C;  5IYC O;  1ENV A;  4RUE A;  4DW0 A;  4LWS B;  1BQ0 A;  3NXS A;  5EZY B;  3BHP A;  4TUY A;  1VQL V;  4GLX A;  2GUZ A;  2IM9 A;  2F95 B;  2CDY A;  3C3S A;  3HKC A;  1VIB A;  4GCZ A;  5BR8 O;  1DK1 A;  1QQC A;  2RQ6 A;  2ARH A;  1I5X A;  5KHH A;  1I94 B;  1NZ6 A;  2UUB O;  1AJP A;  1MMM A;  1Y76 B;  4FMT A;  2YDE A;  1KUQ A;  3JD0 A;  3D8C A;  4DR7 O;  1SET A;  1WB8 A;  1N0J A;  4G2K A;  1TUE B;  4WFG A;  2WLI A;  3FB8 C;  1BCC H;  4B7K A;  2W0F C;  2EBO A;  1D5A A;  1OJH A;  1OCR C;  2OCH A;  3CCU V;  1Y67 A;  3OAA G;  1Q43 A;  3DXR A;  3H1I H;  4ZHQ A;  4X62 O;  5KHJ A;  2HVJ C;  3DC5 A;  2LFS A;  4FFB B;  4PDM A;  3FX7 A;  2D2C B;  1YSC A;  5J2U B;  2H94 A;  1K5Q A;  1HR0 O;  4ZIB A;  4GKJ O;  2V1D A;  4JPR A;  3Q4H B;  3HKD B;  4KP4 A;  2CTW A;  1K34 A;  3CRC A;  5KUM A;  3BEH A;  3WB0 A;  4JI8 B;  4FM0 A;  2ZNI A;  1V54 B;  4FLV A;  3M99 B;  1M1K W;  1FYJ A;  4I50 A;  4PA3 A;  3N2K B;  3ZN0 A;  2OTL V;  3CSX A;  3ZHS A;  1F23 A;  1BQZ A;  1YTF D;  1GN2 A;  3QVN A;  2QWQ B;  2ITD C;  2Y0I A;  4MVM A;  5EBW C;  1K4C C;  2Q7H A;  1FFT B;  1PV0 A;  2YIC A;  3SPC A;  1RP3 B;  1S76 D;  1EN5 A;  4DRX A;  4H13 B;  3K5N A;  3K5O A;  4DV7 O;  2DW4 A;  2ZT9 B;  4B3M B;  3CJH B;  3ABL C;  1WA8 B;  3K59 A;  2UXD B;  1S5J A;  3FD9 A;  3UO2 A;  4O4H B;  1KP3 A;  2CUG A;  4J11 A;  3CCV V;  4X66 O;  2LO1 A;  3RBZ A;  4MSW C;  1FS0 G;  1G4Y B;  4DR2 B;  3L9D A;  1U97 A;  3CE2 A;  4E4E A;  1KKC A;  3K9A A;  3ASO C;  1EZJ A;  2HVK C;  5E79 Z;  1EZV H;  2HEP A;  3P32 A;  1I0H A;  3K3W A;  3H9V A;  2YEV B;  3L72 H;  1LUV A;  3AG4 C;  2LFR A;  2FTK A;  3WU2 Z;  3P30 A;  4DV0 O;  3AG2 B;  1O9H A;  1B06 A;  1GN3 A;  4GX0 A;  5GON B;  3OD4 A;  2OYQ A;  4PA7 A;  2OIE A;  4JI0 O;  5CA1 B;  4JI4 O;  4PDV A;  1THZ A;  1XMQ O;  3BCC H;  1FXH A;  1IX9 A;  2YXH A;  5KAI Z;  5D5Q A;  1H2M A;  1ZAU A;  4I55 B;  4ZOL B;  1XOU A;  3PJS K;  4DV5 O;  1NJI W;  4X1I A;  1K7D A;  3JAL B;  2DYR C;  5CA3 A;  5CA0 A;  1R73 A;  2UUA B;  1NTK H;  5A9G A;  4HYO A;  2Q67 A;  5AG2 A;  3W7U A;  4W4L A;  4DV6 O;  3W7X A;  4YIP A;  3LDE A;  2O57 A;  5B1B C;  1JR9 A;  3JYC A;  4DR4 B;  4YXW G;  4EKW A;  3JAW B;  2BTO A;  3M7M X;  1XNQ B;  3TET A;  4DV4 B;  3C90 A;  4JYA O;  2WA4 A;  5KAF Z;  5EK0 A;  4DR5 O;  3STZ C;  3RVZ A;  3ZRS A;  2H3O A;  1P84 F;  1FXK B;  1SER A;  3DSQ A;  2YS8 A;  1BMF G;  4YJ2 A;  5H9C A;  3FAV A;  2QEX V;  3H1K H;  2P7T C;  2H8P C;  2WLL A;  2CE4 A;  2MK3 A;  1GKF A;  1P49 A;  4LFA O;  4NXN B;  4JYY A;  1NS1 A;  3T1H O;  4E2L A;  1OV9 A;  1VQO V;  1HNZ O;  1RSO B;  2QWN B;  4LWS A;  3OMN B;  4Z1V A;  2CH7 B;  5EZY A;  1YJ9 V;  5L3E A;  3T2M A;  3RGB A;  2P67 A;  5DEC A;  1HDJ A;  2NR5 A;  4RQF A;  4DR1 B;  5B1A C;  3OR7 C;  3TXS A;  4NTX A;  4FLT A;  4B08 A;  3TCU A;  2EIL B;  4J7Z A;  2ZCE A;  3KG2 A;  3ZRW B;  2DQ3 A;  4DK1 A;  4ABM A;  2JGD B;  4GX1 A;  4O4J B;  3DTU B;  4TUY B;  4JGS A;  1Y76 A;  2JK5 C;  2EZP A;  3ZMT A;  4B3S B;  4D7S A;  1QLN A;  1CEZ A;  2Z5U A;  1KBH A;  3ZMV A;  4GYC B;  2DWE C;  4K8Z A;  3GB7 C;  4YJ3 B;  1XL4 A;  4NKG B;  1AI5 A;  2WLJ A;  4Q6G A;  3K5M A;  2OCC C;  1J95 A;  2QM8 A;  1M57 C;  3W7S A;  4FFB A;  4JI6 O;  3K58 A;  4JTC B;  1M9N A;  2WLM A;  5J2U A;  3IAY A;  1AI7 A;  4TQD A;  1VQM V;  1NI8 A;  3Q4H A;  3JAK A;  2UU9 B;  1IUR A;  2E74 B;  3OR6 C;  4KUM A;  4KXR A;  2JEU A;  3JAR B;  2YIB A;  1E1R G;  2QM7 A;  1WLE A;  4UV8 A;  1W0J G;  2VS0 A;  4DR3 O;  3RN4 A;  3M8A A;  4YHH B;  1NH2 D;  1BZK A;  5FPO A;  5K1X A;  3SYA A;  4DV3 O;  1NQT A;  3EVK A;  3THO A;  1R6T A;  3B4S A;  2UXC B;  4A5U B;  2RNB A;  1WP8 A;  2B1G A;  4J10 A;  1RPR A;  4FZ1 A;  4CH4 A;  4JV5 O;  1CPY A;  1Q7Y W;  5B66 Z;  4J9Y B;  1NT2 B;  4I50 B;  1WNS A;  4L87 A;  2E75 B;  1VF5 B;  4U3J B;  1QHT A;  3OFN G;  1VMG A;  3JD3 A;  3KCX A;  4LP8 A;  3BAB A;  2R9R B;  4X9Q A;  3CCR V;  1DF4 A;  4PA6 A;  2EIK C;  2XAJ A;  4DV2 O;  1HNW O;  1DGS A;  1WA8 A;  2LP7 A;  4JAA A;  4AQY B;  4O4H A;  4JI1 B;  4ASU G;  3RT3 C;  4DRX B;  1N8R W;  1B6Q A;  3IJ4 A;  5FNV A;  3UM7 A;  4YY3 O;  2XHB A;  1S5H C;  3EFF K;  2YI9 A;  1K3E A;  5DM6 V;  2ZM6 B;  2NLJ C;  1Z5W A;  1JFF B;  5EC1 C;  3IFX A;  1D5N A;  2YEV A;  1OCZ C;  2CTP A;  2Q0O C;  3BA9 A;  2VQF B;  2OIG A;  3ML0 A;  3AK3 A;  4H44 B;  4LFC B;  2BOB C;  4JAU A;  4HBN A;  3BPZ A;  2UXB B;  1YTF B;  1ZUQ A;  4NXM O;  4G28 B;  1KMI Z;  1VQ8 V;  3RYC B;  4RQE A;  3MHH C;  1G8M A;  2W0X A;  3RFR A;  1Q81 W;  2EJR A;  3OT7 A;  1N34 B;  4IIJ B;  1GM7 A;  3CCL V;  1AP5 A;  2IJJ A;  2IU0 A;  4I55 A;  1XNR O;  4ZOL A;  2ODM A;  3ABL B;  4F4L A;  4X65 O;  4LF6 O;  4LF4 O;  2IJI A;  3JAL A;  4MTF A;  4X64 B;  1AR1 B;  3AG3 B;  2ZXW B;  3JD1 A;  5JJJ B;  1SQP H;  2P4K A;  5LP6 C;  3W7T A;  3HB3 B;  1FJG B;  4IGG A;  3E22 B;  2DOS A;  3ASO B;  4PA4 A;  2PI4 A;  3K0D A;  3E8F A;  1Y4M A;  1ARO P;  1IBM O;  4DUY B;  3JAW A;  4X1I B;  4JZ2 A;  4FPP A;  4D7T A;  1W0K G;  5CA0 B;  4P2Z A;  4W4K A;  1I08 A;  3U10 A;  1JJ2 U;  2ILM A;  1IBL O;  3G6E V;  1WN7 A;  3B8M A;  3K79 A;  4CS2 A;  3R65 A;  5FLX N;  2WLH A;  3SYC A;  2ZD9 A;  1FXK A;  4LF9 O;  1DTO A;  1OZ0 A;  2JIZ G;  4TOI A;  1QR8 A;  4JI2 O;  5LXT A;  1VF7 A;  4NTW A;  1DLB A;  4K0K O;  5LHH A;  5JJE B;  3QF7 A;  1XHX A;  3ABM B;  2QKA A;  3CCQ V;  3CWB H;  1E79 G;  2DYR B;  3UKM A;  1YVW A;  4TT3 G;  4YJ2 B;  4LF5 B;  4MS2 A;  2VQE B;  4FLU A;  1XBL A;  2Y69 C;  3FAV B;  3D36 A;  4KL1 A;  4N23 A;  5KA6 A;  4DUZ O;  2WLL B;  3OGC C;  4XDL A;  2WWW A;  2BOC C;  4ZKI A;  2CTR A;  5IYB O;  5IT9 N;  2XAQ A;  1UJW B;  2WSS G;  4I5S A;  5F2V O;  1K8A W;  5JJN B;  2Y4T A;  3ZRW A;  4DR6 O;  2RDC A;  4ZBM A;  3UO3 A;  2EIN B;  2JGD A;  1RM1 B;  4XDK A;  3OMA B;  4O4J A;  3H1J H;  4I4T B;  1G1X B;  5B3S C;  1AVM A;  2IH1 C;  1NVP D;  1URF A;  1WP7 A;  3FKS G;  4HZ3 A;  3QO5 A;  4LC1 A;  2IJK A;  4KHP O;  3JAT B;  2UUC B;  1JCH A;  1L1F A;  5KX5 B;  1M56 C;  3APO A;  3BFR A;  4X1K B;  4U3F H;  4YJ3 A;  3ETQ A;  2B9Z A;  1ROP A;  4TWK A;  3E35 A;  3F7V C;  2QWO B;  1XEQ A;  1RPO A;  2F1M A;  3ASN B;  3OEH G;  3SPG A;  4EFE A;  4KFM A;  3T1Y O;  3X2Q C;  1HP8 A;  2Q5Z A;  2ZIM A;  4PV1 B;  2HHH B;  4DO2 A;  4FJC C;  3ABK C;  1L8D A;  4WF9 V;  3JAR A;  5LMN B;  1NKD A;  3NR7 A;  1S77 D;  1Q3E A;  3SJA C;  1XRE A;  4K35 A;  4LBE C;  1GO3 F;  2GSM B;  1SQV H;  1R3I C;  5BY1 A;  2KKW A;  3JAK B;  1J5E O;  4P9P A;  5L3G A;  1IBK O;  1XQ8 A;  5GW7 A;  5BR8 B;  3J80 N;  5HFL A;  3N27 A;  4B3T O;  2YUA A;  4QNH B;  3EXA A;  2CGN A;  2KB1 A;  4B3M O;  4NYK A;  5C93 A;  2OTJ V;  1P7G A;  1I7F A;  2EIM C;  2F4V B;  4FK5 C;  4U3J A;  1PL4 A;  2UUB B;  2PTM A;  1RFY A;  4X88 A;  5ITZ A;  4R50 A;  5EBL C;  4DR7 B;  1D2D A;  3SGI A;  1LUW A;  1VQ6 V;  1COW G;  4EFB A;  2RJZ A;  5IYZ A;  1U96 A;  2IW5 A;  4I0X B;  1IDS A;  2DWD C;  5BMV A;  4X62 B;  3TK1 A;  1IZ3 A;  3SR2 C;  2Y4U A;  3A0R A;  2RN9 A;  3WB1 A;  1KKD A;  3L70 H;  1MSD A;  2JS3 A;  4JI7 O;  1FD9 A;  3RYH A;  1JFF A;  3UQ8 A;  4J7K A;  2YID A;  1HR0 B;  4ICG A;  4OPA A;  4GKJ B;  1H2N A;  1N36 O;  1NH2 B;  3LNM B;  5FNV B;  1GTO A;  3E8B A;  4RAI A;  2NN4 A;  1AJQ A;  1BL8 A;  2PUS A;  1OHH G;  5LGN A;  1XI1 A;  1R3K C;  3BVO A;  2PZS A;  3RYC A;  2PI5 A;  2RMK B;  4MVS A;  1AP6 A;  1Q82 W;  3CRM A;  4IIJ A;  3LSS A;  2QKS A;  3CC7 V;  2HR3 A;  1W2B U;  3OUF A;  3CME V;  2EIK B;  1O9G A;  4DV1 B;  3DC6 A;  1K97 A;  2XAF A;  4UCO A;  3O65 A;  2P06 A;  3ZHU A;  3CPW U;  4MTX A;  2JGU A;  3F5T A;  1VQ4 V;  4I9W A;  5L3C A;  1AIL A;  3WG7 B;  1VEW A;  2QR4 A;  1NU1 H;  3E22 A;  4LF8 O;  4DV7 B;  4JTA B;  1MZF A;  2AHZ A;  1JQ0 A;  2Q9L A;  1OCZ B;  1W59 A;  2XAG A;  2YC0 A;  4GX2 A;  1MNG A;  3FB6 C;  4RUF A;  4LH7 A;  1WPB A;  4X66 B;  4R8C A;  3A0B Z;  5E1A C;  4MTG A;  3ZS8 C;  4WFH A;  1V55 C;  3E8G A;  5LL6 Y;  2DQ0 A;  5KLV H;  2A0L A;  2AZ0 A;  1YIT V;  2JRI A;  2D3O W;  2XOK G;  4QE7 A;  2QGN A;  4CH6 A;  1IXM A;  2R9I A;  4EB6 B;  1H38 A;  1PPJ H;  3I55 V;  4LF7 O;  3MDS A;  1KB9 F;  4WBN A;  4UVA A;  1R1B A;  5JCO C;  1YI2 V;  4DV0 B;  3CD6 V;  5IWA O;  2JJ1 G;  4IYI A;  1GN4 A;  3MHS C;  2R9A A;  3GVM A;  3RYI A;  1MZE A;  3VQY A;  5LXT B;  3ABT A;  4JI0 B;  4JI4 B;  1VP7 A;  4MT8 A;  1XMQ B;  1YJW V;  4UB8 Z;  2PF4 E;  3VQV A;  1HNX B;  1YJN V;  4L8J A;  3ZCC A;  4OX9 O;  5LHI A;  2NNU A;  4DV5 B;  1VF6 C;  1EFR G;  4WFE A;  4WFF A;  4I4T A; 
#chains in the Genus database with same CATH homology
 1SRY A;  2OT5 A;  1KEC A;  1Y66 A;  1N8R W;  1B6Q A;  3ZN1 A;  1AI4 A;  1KP2 A;  2IJH A;  3SYP A;  3QO8 A;  1NR1 A;  1QLE C;  4UVC A;  3UM7 A;  1S5H C;  3EFF K;  2EIJ C;  5B1O A;  5IYC O;  1ENV A;  4RUE A;  1K3E A;  5DM6 V;  2NLJ C;  3NXS A;  4DXW A;  2HFE C;  3CYO A;  5EC1 C;  3IFX A;  1VQL V;  4U7O A;  3SJQ C;  1P4R A;  2YEV A;  5IY5 B;  1OCZ C;  4GT1 A;  1F51 A;  3AG3 C;  2XND G;  2ZXW C;  3ML0 A;  4XBF A;  2BOB C;  2ZR3 A;  4GCZ A;  1PNK A;  4JAU A;  2IH3 C;  3JD4 A;  1YTF B;  3ZMU A;  4G28 B;  3AG1 C;  4UUJ C;  1VQ8 V;  2UXN A;  1OCO B;  4RQE A;  1I5X A;  5CBG A;  1PL0 A;  3MHH C;  1G8M A;  1GM9 A;  3ETG A;  4LCU C;  2QE7 G;  2M7W A;  2ZQM A;  3JCZ A;  3LUT B;  1Q81 W;  2JJ2 G;  1AJP A;  2EJR A;  1LNQ A;  4FMT A;  2B1I A;  1S3J A;  1GM7 A;  3JD0 A;  2EIJ B;  3CCL V;  2IJJ A;  4UXN A;  5LBQ A;  2IU0 A;  3ABL B;  4F4L A;  1SET A;  1MOF A;  2A79 B;  4G2K A;  2QTO A;  4XDJ A;  1TUE B;  2IJI A;  2WLI A;  3FB8 C;  4WFG A;  4QIW F;  2W0F C;  4MTF A;  5H6Q A;  3QNE A;  5B3S B;  3G4S V;  2EBO A;  3SYQ A;  4Q20 A;  1OCR C;  1AR1 B;  3AG3 B;  3CCU V;  2ZXW B;  3JD1 A;  2Y48 A;  1PNL A;  3OAA G;  5DN6 G;  5EC2 C;  2Q69 A;  3ZRV A;  2UXX A;  3W7T A;  3HB3 B;  1M56 B;  2HVJ C;  5B1N A;  2LFS A;  4HAM A;  3ASO B;  1NVP B;  4PA4 A;  1EBO A;  3ABM C;  2PI4 A;  3K0D A;  3E8F A;  1Y4M A;  1ARO P;  4PDM A;  2X0L A;  1YSC A;  1DF5 A;  3BY6 A;  1Q86 W;  2H94 A;  4WCE V;  3SYO A;  1K5Q A;  4FPP A;  2QA4 V;  3CC4 V;  1W0K G;  4P2Z A;  3STL C;  1JJ2 U;  2V1D A;  4JPR A;  1WPX A;  4TSF G;  4KP4 A;  3G6E V;  2DYS C;  3B8M A;  3K79 A;  4R6Z A;  1OCC B;  3R65 A;  1K34 A;  1PKX A;  4UVB A;  2P90 A;  5KUM A;  2WLH A;  3BEH A;  3SYC A;  2ZD9 A;  1FXK A;  1V54 B;  4JYC A;  1DTO A;  2JDI G;  1OZ0 A;  1H8E G;  2JIZ G;  5L3F A;  4P9O A;  4PDL A;  3M99 B;  1M1K W;  1OCR B;  1QR8 A;  4PA3 A;  3EHB B;  3ZN0 A;  3I56 V;  1QCE A;  2OTL V;  3CCE V;  5LGT A;  1DLB A;  2EIN C;  1RM1 C;  5LHH A;  1F23 A;  5IY5 C;  1YTF D;  3ABM B;  3CCQ V;  1S72 V;  2ITD C;  4MVM A;  5EBW C;  5LHG A;  1K4C C;  2X6C A;  1E79 G;  2DYR B;  3UKM A;  1VQ9 V;  4TT3 G;  5IYD O;  4MS2 A;  3WFV A;  2Y69 C;  1FFT B;  4H37 A;  3D36 A;  4N23 A;  3SPC A;  5KA6 A;  5KA5 A;  4G27 B;  1S76 D;  4BIZ A;  1OCO C;  2WLL B;  3F7Y C;  1K5S A;  5CBH A;  2F43 G;  3OGC C;  4XDL A;  3VOU A;  1CP9 A;  2WWW A;  2BOC C;  4ZKI A;  1K4D C;  5IYB O;  1F4N A;  2XAQ A;  1UJW B;  2WSS G;  4I5S A;  4MW8 A;  4JF3 A;  3CCS V;  2DW4 A;  2EIM B;  1K8A W;  2X6A A;  3E89 A;  3ZRW A;  3ASN C;  3ABL C;  2Q68 A;  3OM3 B;  4ZBM A;  4QPK A;  1K73 W;  2EIN B;  1RM1 B;  3LSQ A;  3AG2 C;  4XDK A;  3OMA B;  1KP3 A;  4X8A A;  1VQK V;  5B3S C;  4PDR A;  3SPI A;  3CCV V;  2IH1 C;  1NVP D;  3FKS G;  4HZ3 A;  4MSW C;  3RBZ A;  5J9P C;  1FS0 G;  1G4Y B;  2IJK A;  3IGA C;  3QO5 A;  4LC1 A;  2ZR2 A;  3CXC U;  1JCH A;  4MVR A;  1L1F A;  2Y69 B;  3ETE A;  4FIP C;  1M56 C;  3K9A A;  3ASO C;  1EZJ A;  4PEL A;  2HVK C;  2WAM A;  3P32 A;  3T4Z A;  3K3W A;  5KUK A;  1QR9 A;  4MVQ A;  1ROP A;  2YEV B;  4TWK A;  3E35 A;  3GWO A;  1MSW D;  3OW2 U;  3F7V C;  3AG4 C;  3ZJZ A;  2LFR A;  1I5Y A;  3SPH A;  1RPO A;  2FTK A;  1JVM A;  3OMI B;  1E1Q G;  3ASN B;  1OCC C;  3P30 A;  4QJF B;  1NBM G;  2HLD G;  3AG2 B;  3HPL C;  3T1C A;  1V54 C;  4QE9 A;  1VQ5 V;  5CN0 A;  3OEH G;  2WPD G;  3SPG A;  4JYB A;  4GX0 A;  4KFM A;  3SPJ A;  3X2Q C;  3FYE B;  4GX5 A;  4PA7 A;  3LDC A;  1M90 W;  4PDV A;  1THZ A;  4MVO A;  4DO2 A;  4FJC C;  1ZWI C;  1FXH A;  3ABK C;  3DGE A;  4WF9 V;  1F4M A;  1NKD A;  3PJS K;  1S77 D;  1NJI W;  2WLI B;  1K7D A;  4LBE C;  1GO3 F;  2DYR C;  2GSM B;  5CA3 A;  3AG4 B;  1R73 A;  1R3I C;  3CCM V;  4HYO A;  2Q67 A;  3W7U A;  4P9P A;  3W7X A;  5L3G A;  4R7C A;  3LDE A;  5GW7 A;  5B1B C;  1BHA A;  3JYC A;  2IU3 A;  5HFL A;  1YHQ V;  3X2Q B;  1H2G A;  4QNH B;  4YXW G;  4EKW A;  2KB1 A;  3G71 V;  5C93 A;  1R3L C;  2OTJ V;  2EIM C;  1HWY A;  4FK5 C;  4H33 A;  3ABK B;  3TET A;  1K92 A;  5BZB A;  1KQS U;  5EK0 A;  4X88 A;  1KC8 W;  2P6J A;  3STZ C;  1SZT A;  3RVZ A;  4X89 A;  4R50 A;  3ZRS A;  1NR7 A;  3FYI B;  5EBL C;  1FXK B;  1SER A;  1P7B A;  1BMF G;  5H9C A;  4P30 A;  3T4D A;  3E86 A;  1COW G;  1QVG U;  2QEX V;  1VQ6 V;  2P7T C;  2X7R B;  4JAV A;  2H8P C;  3RVY A;  2WLL A;  4Z1M G;  2IW5 A;  1VQ7 V;  2MK3 A;  4CZZ A;  3B8N A;  2ATK C;  2DWD C;  1GKF A;  1QVF U;  3LDD A;  5B1B B;  2JEX A;  3MD0 A;  3K0G A;  3TK1 A;  4E2L A;  1PNM A;  3A0R A;  3K08 A;  1VQO V;  1KKD A;  5L3D A;  3OMN B;  5EBM C;  3FB5 C;  1YJ9 V;  5L3E A;  2ZDI A;  2CK3 G;  4WFB V;  2WLN A;  3T2M A;  2Q6A A;  2WLK A;  1VQN V;  3ZRX A;  3ETD A;  2P67 A;  2X6B A;  4MTO A;  1NH2 B;  3LNM B;  4RQF A;  4BW5 A;  5B1A C;  1GTO A;  3E8B A;  3OR7 C;  3QO7 A;  4RAI A;  3E2E A;  1AJQ A;  1BL8 A;  3WG7 C;  3TCU A;  4U7N A;  2EIL B;  1OHH G;  2HJF C;  1VQP V;  4MVZ A;  5LGN A;  2GHY A;  1R3K C;  3KG2 A;  2EZO A;  3ZRW B;  2DQ3 A;  2PI5 A;  2AHY A;  3IC7 A;  3E83 A;  2K1E A;  4MVS A;  3B77 A;  4OXS A;  4GX1 A;  3DTU B;  3F5W C;  4JGS A;  2JK5 C;  3ZMT A;  2EZP A;  1Q82 W;  4MW3 A;  3LSS A;  1ORQ C;  2QKS A;  3CC7 V;  2HR3 A;  1W2B U;  3OUF A;  3CME V;  4J9Z B;  2EIK B;  3VBB A;  1QLN A;  1CEZ A;  2W6I G;  2Z5U A;  1K97 A;  1XL6 A;  2XAF A;  5H6R A;  2B5U A;  2XAS A;  3ZMV A;  3CPW U;  2DWE C;  4RO2 A;  3ZMZ A;  3GB7 C;  5HFM A;  1XL4 A;  4MTX A;  4N21 A;  1AI5 A;  2XAH A;  3CP1 A;  2A9H A;  3ABU A;  2WLJ A;  5B1A B;  1BHB A;  1QLE B;  1VQ4 V;  4WFA V;  4I9W A;  5L3C A;  2OCC C;  3WG7 B;  3CCJ V;  1J95 A;  2QM8 A;  5IDJ A;  1GM8 A;  1M57 C;  3W7S A;  3K03 A;  1R6N A;  1AI6 A;  1S0V A;  4JTA B;  4BIU A;  2AHZ A;  1JQ0 A;  4JTC B;  2HG5 C;  1FXK C;  1M9N A;  2WLM A;  1SES A;  2HKO A;  1OCZ B;  2XAG A;  4GX2 A;  1H8H G;  3FB6 C;  4RUF A;  4CBC A;  4QPJ A;  1AI7 A;  2ITC C;  5CBF A;  1VQM V;  1YIJ V;  5CMU A;  3H01 A;  1K9M W;  4R8C A;  2Z3Y A;  3OR6 C;  3OUS A;  4KUM A;  4MTG A;  5E1A C;  2JEU A;  3OE7 G;  3W7W A;  1E1R G;  3AG1 B;  4WFH A;  3ZIA G;  1V55 C;  3E8G A;  5LGU A;  1QBZ A;  2DQ0 A;  2QM7 A;  1WLE A;  2A0L A;  4UV8 A;  1W0J G;  1YIT V;  3OEE G;  4UV9 A;  2D3O W;  2XOK G;  1NH2 D;  3D3I A;  3FB7 C;  4BAY A;  4QE7 A;  1R6K A;  3CMA V;  2OCC B;  1JPX A;  3SYA A;  1IXM A;  2R9I A;  5L3B A;  4JTD B;  1NQT A;  1KD1 W;  1JOY A;  1H38 A;  1M57 B;  1AJN A;  1FXV A;  1MG1 A;  3I55 V;  1PD3 A;  1GMG A;  4UVA A;  2V7Q G;  2B1G A;  1YI2 V;  1RPR A;  3CD6 V;  1CPY A;  5FL7 G;  1Q7Y W;  1JX9 A;  2EIL C;  2JJ1 G;  4J9Y B;  3MHS C;  3ZMS A;  4L87 A;  3K04 A;  4JAS A;  3ABT A;  1K33 A;  1R3J C;  3OFN G;  4LP8 A;  3JD3 A;  4MVU A;  4PA9 A;  2ZDI C;  4MT8 A;  3RW0 A;  3K06 A;  1GK9 A;  1YJW V;  1V55 B;  2W6J G;  2YSU B;  2R9R B;  3AEI A;  3ZCC A;  1YJN V;  5LHI A;  3CCR V;  1DF4 A;  3E8H A;  3JD2 A;  3CC2 V;  4PA6 A;  2NNU A;  2EIK C;  2XAJ A;  2C2A A;  1MAB G;  2LP7 A;  1EFR G;  4WFE A;  4WFF A;  4ASU G;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...