3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
2HG5C 3SPGA 5KUMA 4XDJA 3SYOA 2BOBC 3E86A 2H8PC 4JTDB 3FB6C 4RUEA 3TCUA 3BEHA 1LNQA 5EBLC 1R3LC 4GX5A 3RVYA 3OGCC 2OCCC 4RUFA 1R3KC 2Q67A 3LUTB 4WFHA 5J9PC 4PA7A 4JTAB 2X6BA 2ITCC 2KB1A 3E8HA 4PA4A 2AHZA 1S5HC 2IH3C 2X6CA 4LBEC 1K4CC 4RO2A 3E83A 3HPLC 5B1AC 4R6ZA 5B1BC 3TETA 3GB7C 3IGAC 2EINC 4KFMA 3K08A 3JYCA 3K0GA 3SYQA 3E8FA 2ATKC 2IH1C 3K0DA 4ZBMA 3ZRSA 5EBWC 2EIMC 2HVJC 4MVUA 4WFEA 5E1AC 3RVZA 2BOCC 3T4ZA 2HJFC 4MTGA 4UUJC 2EIKC 3K06A 2WLIB 2W0FC 1ZWIC 2WLLB 3K04A 4G27B 4MVZA 2JK5C 4OXSA 3E89A 4LCUC 4X88A 4XDLA 3LNMB 4MS2A 3FB7C 4MVMA 2WLKA 3OUSA 4LP8A 2AHYA 3AG1C 3LDCA 3OR7C 3FB8C 2NLJC 3ZJZA 3ABMC 2WLNA 3ASOC 3E8BA 3SPJA 4J9ZB 2HFEC 1XL6A 3EFFK 2DYSC 4PDRA 4QNHB 4JTCB 1ORQC 2A79B 4BW5A 4PDMA 3AG2C 4MVSA 4P9OA 1QLEC 4CBCA 1V54C 4MSWC 2HVKC 4HZ3A 3SJQC 1K4DC 2WLMA 2X6AA 3ABKC 3UKMA 2DWDC 3ASNC 3E8GA 2WLIA 4RAIA 3WG7C 2WLLA 3VOUA 5KUKA 5BZBA 4WFGA 4F4LA 3F5WC 2Q69A 1P7BA 2ITDC 3OR6C 4GX0A 4MTFA 2YEVA 3F7VC 1KKDA 3SPHA 4GX2A 2Q68A 4P9PA 4H37A 5EC2C 1G4YB 1J95A 3K03A 4EKWA 2ZD9A 2DWEC 4HYOA 5B3SC 4GX1A 4J9YB 3STZC 1M56C 5CBFA 1R3IC 2A0LA 2EILC 3IFXA 3SYCA 2EIJC 3RBZA 4P30A 3SPIA 4QE9A 2P7TC 2K1EA 4X8AA 5EK0A 1V55C 2WLHA 4WFFA 4H33A 3AG3C 2R9RB 4MVQA 3PJSK 4DXWA 4PDVA 4MVRA 4MTOA 5CBGA 5EBMC 3T1CA 4XDKA 4TWKA 4G28B 4PDLA 1BL8A 3SYAA 3SYPA 1XL4A 1OCCC 5IY5C 4I9WA 2A9HA 1JVMA 4R7CA 4R50A 3T2MA 5CBHA 3LDDA 4X89A 2Y69C 2QKSA 1R3JC 2QTOA 3STLC 3X2QC 4PA6A 4MW3A 3SPCA 5EC1C 3T4DA 1M57C 3UM7A 4QE7A 4R8CA 3KG2A 3R65A 1OCZC 3AG4C 1OCOC 4MVOA 4MW8A 3LDEA 2Q6AA 3ABLC 2DYRC 1OCRC 2WLJA 4P2ZA 3OUFA 3F7YC 4PA9A 4PA3A 3RW0A 2ZXWC 3FB5C
chains in the Genus database with same CATH superfamily
1HNWB 4K35A 3ABMB 1EM1A 3B2EE 3TCUA 4B3SB 4RQFA 3RVYA 1WNSA 4WFHA 2P6JA 2X6BA 2Y48A 3L74H 3J80N 1YSCA 4BIZA 1PPJH 3AK1A 2V4DA 1AI5A 4W4KA 4X1IA 3BA8A 5CB4A 5H9CA 2F4VO 4GKKB 3JAWA 3S3WA 4LNUB 4NB5A 4DR7B 2XASA 1WA8A 2WA3A 1BQZA 1ZWIC 1SZXA 4LF6B 1K5QA 1PNLA 1U96A 1K9MW 2B1IA 3G6EV 3E89A 2CTRA 4LF9O 3FB7C 1SC5B 4QJFB 3AG7A 3ETQA 4B3TO 5CA0B 4K3AA 3ABMC 4FK5C 2EJRA 2UUCO 4J9ZB 2HFEC 1SA0A 3HKBA 3H9VA 2A79B 3APOA 2IJHA 4DR6O 4DV1B 1JJOA 1OCOB 1BHAA 3HKCA 3RYFA 2DYRB 3QG5A 4F4LA 3B4SA 2GUZA 5KX5B 3QO5A 4I0XB 4DUZO 3O9OA 1VEWA 5EYPB 2QSAA 4D7TA 2JGDA 1AI4A 3OTOO 2OWOA 1XBLA 2XUMA 5GONA 2OCCB 5EZYA 5B5EZ 4LF7O 2JJ2G 3JATB 1K73W 4OPHA 3BABA 3D3QA 3O65A 4JI0O 4MTOA 4O2BB 2DOSA 4UV9A 2AW9A 3OMIB 3SYAA 5IY5C 1N32O 3D36C 2E3CA 2NNUA 3BCCH 2QKSA 5BXZA 3SPCA 5FNVA 2EIKB 4JI4O 3JD4A 1OCOC 5IYCO 2L6LA 3LDEA 2DYRC 2D3OW 4PI0A 2QGNA 4P2ZA 2OIEA 1D5AA 1QBZA 5HFLA 1XOUA 1S3JA 1X59A 3JCUZ 3CWBH 1GO3F 1BGYH 4GX5A 2OCCC 3RN4A 4FM2A 1NH2D 1B04A 2CTQA 4U7OA 5LL6Y 2CTWA 1N34B 5BMVA 3E8FA 4ZBMA 2Q7EA 2K9PA 3RVZA 2EIKC 1F7YA 2WLIB 3K9AA 1EFRG 5JJJB 2VQFB 1XHXA 3K59A 3ZX6A 4LCUC 3LNMB 1GTOA 1ZL8B 1K97A 3SPJA 2QTSA 4MVSA 1H2SB 5JQGB 3RFRA 1M57B 2EULA 3THOA 3RGBA 4X66O 4O4LB 2WLLA 4LF8B 4JV5B 4JI2O 3OR6C 2QWQB 4O4IA 2UXBO 4JI8O 4DUYO 4EKWA 1P84F 2A0LA 1NVPB 1YXBA 2FB5A 5A2QN 2WLHA 4H33A 4ASUG 1K34A 1XMOB 1QVFU 2QM4A 5JH7A 2DMXA 4N21A 3SYPA 2OYQA 2R70A 5LYJA 1R3JC 2EIMB 4X1KA 1M57C 1CP9A 1IBLB 4R8CA 2NR5A 2QM7A 1AROP 1JQ0A 4KL1A 3OD4A 3OFNG 2GV9A 5KA6A 4O4JA 5J2TB 1FJGO 3A0BZ 1N4CA 4X1YB 1Y74B 3JAKB 2A3QA 4O4HB 2YC0A 3RYCA 4LFAO 2PTMA 3CJHB 3ZRXA 3AK2A 4JTAB 2QWNB 1VQNV 1EZVH 1KD1W 2X6CA 1S76D 3IGAC 1NU1H 1HNWO 1G8MA 3G71V 1RPOA 2LQTA 4NR1A 4B3SO 2EIMC 1KBHA 1OCZB 2E5LO 1H2LA 2CUGA 1VMGA 1F4NA 3SR2C 4MVMA 4K8XA 4DV2B 1CXZB 2IU0A 3ZHRA 2BE3A 5IYZA 1OCCB 1DK1A 4ZOLB 3W7UA 4JTCB 2Q9LA 4LF6O 3L73H 2GSMB 3GVMA 1ZTEA 1MOFA 4GX0A 2MW2B 1BQ0A 4FLZA 2ODMA 2Q68A 2KSDA 2YIAA 3P3PA 3UCSC 5JWPA 4NXMO 5H5NA 3M99B 2ADQB 4FLTA 4J9YB 5L3CA 2IJIA 2YI9A 4BW9A 1J5EB 2A06H 3K9SA 4KHPO 3VQYA 3WB2A 5H6RA 3AG1B 1N0JA 4X8AA 1N33B 1FD9A 1KMIZ 1BL8A 2VWJA 2P5OA 1OCCC 3KCYA 3TJTA 4JI6B 4B3RO 5LGUA 2JRIA 3TGUH 1PKXA 1D2DA 3I5DA 1W0JG 1NJIW 4JAAA 1BHBA 2HP8A 3A0RA 4AHCA 2QA4V 1OCRC 4X65O 3K5NA 4PA9A 3RW0A 2QWOB 1IZ3A 3JATA 4RUEA 4Q6GA 1EZJA 2EILB 4FVMA 4O2BA 3FB6C 3WFVA 2F1MA 1SRYA 5LGNA 1KECA 3LUTB 1PV0A 2PI5A 4PA4A 4X1IB 1V9PA 2KKWA 4IGGA 5CB4B 3GB7C 4HBNA 4EB6B 3K0GA 3SYQA 2ATKC 5EIBC 1YZBA 2HVJC 2VS0A 5H2FZ 1JFFA 4DV5B 1DF5A 1L0LH 5CA3A 1G6UA 2QEXV 5LMNB 1QR8A 2Q8VA 4JI3B 3L75H 4X64O 2PY5A 4DR3B 2GDSA 1BSMA 2DYSC 1SA0B 2Q7HA 3AEIA 4OGQB 4P9OA 1K4DC 2PZSA 2DWDC 4RAIA 2WLIA 3F7VC 2P4VA 4DV6B 3T1HO 1VQ8V 1T5EA 1H8HG 1L0NH 4HYOA 1Z2GA 1I94O 1Q5OA 3CE2A 3JALA 3AK3A 3FX7A 1W0KG 3N2KB 2RDCA 5EZYB 2F95B 1Q81W 2QJ1A 4JV5O 5JQGA 4KP4A 3FKSG 2UUAB 4I4TA 4FLUA 3ETDA 4DK1A 4QGPA 5JJNB 5HFMA 3VQVA 3CYOA 3NR7A 4UB6Z 3BFRA 1EN4A 3BRCA 3ZBHA 1US6A 1XMOO 2Y4TA 4DV7B 4QPJA 1CEZA 4EFBA 1K7DA 2OTJV 3ZMZA 3BEHA 2Q0OC 4I5SA 2OT5A 3JASB 1IBLO 1TUBB 3CCQV 1GRJA 2KB1A 3E8HA 1HR0O 5GTIZ 1GN3A 5BMVB 1RSOA 3CMEV 1KYOF 5D5QA 4DR1O 4DR2B 5J2TA 1IBKO 4MVUA 3DC6A 4X1YA 1Y74A 4AILC 3JAKA 4TV9A 2ZXWB 2DE0X 1PL4A 4BIOA 3IAYA 3ZMVA 1VQPV 3FB8C 3U0ZA 4FMTA 4LF4O 2WLNA 2RQ6A 2RNBA 3OTFA 1L1FA 1ROPA 1WJZA 3DC5A 4JYAB 3KCXA 4QNHB 3LSUA 4DV3B 2Y69B 4LWSB 2KG7A 2YS8A 5L3GA 2QE7G 1Q43A 2JS3A 1Q86W 4DV2O 2IJKA 2CGNA 2YEVA 4O4IB 4P9PA 4DR4B 4GLXA 5KLVH 4UCVA 1JCHA 1OZ0A 1IURA 4JI1O 4MTXA 3SYCA 3ZS8C 4ZOLA 1TVKA 1BE3H 3A2FA 4TV8B 3OGIB 2UXXA 2QKAA 3W7XA 4TUYA 1KP2A 4BWAA 4CH6A 4DV4O 3HKDA 3T2MA 1NQTA 1V54B 1IDSA 2Y69C 3W7WA 4X1KB 4PA6A 3ZHUA 1J5EO 1WB8A 1JPXA 4L8JA 2AZ2A 1N33O 3T1YO 2R72A 4PA3A 4O4JB 2N04A 1D5NA 1M9NA 3APQA 5E79Z 4B7EA 4L87A 1AJNA 2R9AA 4JI6O 4ZHQB 3SYOA 2BTQB 4RWUA 3ZMUA 1Q6IA 5CA1B 3CRQA 2P4KA 1B06A 1RP3B 4DW1A 2AHZA 3L71H 2XHBA 4FLXA 3VQXA 3ZN1A 4WFEA 3T4ZA 4AI8A 3MHHC 3E22B 2H94A 4J41A 2YI8A 1QLNA 4MVZA 4NTXA 4I55A 3IJ4A 4ICGA 2GTSA 1N8RW 2ZT9B 3SJAC 2RJZA 4F6RB 2NLJC 4PV1B 1PNMA 2EZOA 2HHHO 3D3IA 5IYZB 1EBOA 1R1BA 3EFFK 4EB6A 3D8CA 4DV5O 2IJJA 1I0HA 3H1KH 3ZEDA 4JASA 4JI3O 1R6NA 3B77A 5JJEB 3E8GA 5J2UB 1ZLZA 5IWAB 2V1DA 5LMUB 3SPHA 5LBQA 4LFBO 3S3XA 1QNMA 1YJWV 2Z5UA 3P3NA 4U3JA 3UQ8A 1VQMV 3EVKA 4P30A 3SPIA 5A9GA 2N74A 3UO3A 1NH2B 4MVQA 1VQ6V 3ML0A 4DV6O 3WU2Z 5ITZB 4YHHO 4UCUA 1XNRB 4GCZA 1H8EG 4I9WA 5EC1C 4EEQA 2QWPB 4MVOA 1H38A 1ZAUA 3N2KA 2CGOA 1VQOV 4FZ1A 4YIPA 1COWG 2UUAO 1Q6UA 1WLEA 1Y76A 1BCCH 5IYBO 1FXHA 4PHZA 4UVBA 5GTHZ 5IDJA 2ZKOA 1R73A 4HAMA 2QWRB 3CRCA 3Q4HA 1QLEB 3AG3B 4JPRA 4PI2A 2FL4A 2WPDG 4UFZA 2IM9A 4LBEC 2FKXA 2BSKA 4DV7O 3TXSA 1SZTA 3X2QB 1NKDA 4OX9B 3U11A 4IYIA 3JAMN 4JAVA 1JFFB 3K06A 3ZIAG 1I08A 3C3TA 4X88A 1HNXB 2F66C 3JASA 1TUBA 4GZRB 3SJBC 3ETGA 3HR0A 1PL0A 1XMQB 2Y0IA 3CD6V 1ORQC 2YSUB 1S77D 1QLEC 3BAAA 2HVKC 1NZ6A 3GWKC 3CC2V 2P22C 3VOUA 1P7BA 1KKDA 1YHQV 3OAAG 1AJPA 2ZE6A 1S72V 1NT2B 1HDJA 2X7RB 3JALB 2AGAA 4JI7O 2K1EA 1K33A 4DV0B 4LWSA 2R9RB 4IT5A 4DXWA 4BIUA 1TGOA 4G28B 4DR4O 4I4TB 1BS3A 2DN9A 2VWKA 4J42A 2FTKA 2JVDA 3K5LA 1FS0G 3MHSC 4FPPA 5LXTA 5FPRA 2W6IG 1ZX3A 5LP6B 1NTKH 1KUQA 4XDJA 3LSQA 3ASOB 4TV8A 2EIJB 4C7UA 4GKJB 1W59A 2EJ7A 1R3LC 2ZIMA 1ENVA 1XNQB 4UV8A 1Z5WA 4FZ0A 1AP6A 1H2MA 1MNGA 2XNDG 4J7JA 3VBBA 2Q4PA 2Q7GA 4CH3A 1RSOB 3CP1A 2YICA 3L9DA 5FL7G 2HJFC 4X20A 3CRAA 4ZHQA 2BTQA 1U97A 1HNZB 4TV9B 2WLKA 5IJ9A 5JVDA 2NN4A 5CA1A 3OR7C 3ASOC 4FLVA 3HB3B 3JSNA 2L35A 3G67A 2Q73A 2KG7B 2VRZA 1MZFA 3E22A 3L72H 3AG4B 3ZMTA 3UO2A 1Q3EA 4JYCA 1PD3A 2Q69A 2YEVB 2XAFA 1Y67A 3ZHVA 1KQSU 4GKKO 1P7GA 4F6RA 2PYJA 1YVWA 3W7TA 4Z1MG 1SF9A 5DN6G 4DR7O 4QE9A 4DRXB 1TVKB 5IWAO 4AQYB 2E74B 2JDIG 4TUYB 5J2UA 3U10A 4FJCC 3AG2B 4IHJB 3HKDB 5CBHA 3CCEV 1R6KA 4I50A 2LO1A 1GN4A 4JAUA 3RT3C 3RYIB 1M1KW 3T4DA 4UVCA 1OCZC 2QM8A 3AG4C 5B1NA 2ZINA 4YY3B 1Q7YW 1MG1A 1O9GA 4KXRA 1M90W 1S5LZ 4DV1O 2LFSA 4J7ZA 3SPGA 4Q20A 2BOBC 1FXKA 2DJVA 3TXQA 4FM1A 1VQKV 3W7SA 5ITZA 3I56V 2YXLA 1V55B 4NVPA 2UXCB 2ILMA 3J7AU 1NBMG 3N2GB 2ZIOA 3FAVA 2YUAA 1Q8IA 1L8DA 4J7KA 1DF4A 1LR1A 2IH1C 2OTLV 3QO8A 2F23A 1MA1A 1QQCA 2Y0PA 1P49A 5KAIZ 4I55B 4XDLA 2UXDB 2O57A 3AG1C 2PF4E 1SQGA 1XL6A 4E2LA 3M8AA 4BW5A 1XQ8A 3VQWA 1N36B 5FPOA 1HNXO 1YCIA 5B1AB 2JJ1G 3RYHA 3OEEG 5EC2C 2LGQA 5B66Z 1GN6A 3CC4V 1J95A 1N34O 3OT7A 2DWEC 3SJCC 1G1XB 4U3JB 1HW7A 2EILC 3IFXA 4H44B 3K58A 2LJ2A 2QDOA 1CPYA 1HWYA 2VQFO 3L70H 4UCOA 4U3FH 3CCJV 1FPOA 1GH6A 4YXWG 4R7CA 1VF5B 2XTAA 5IE9A 3KKYA 2CH7A 4LF9B 3KG2A 4DV0O 1SERA 4B3TB 2HLDG 1F51A 3OW2U 4WF9V 2B5UA 2UUCB 2P06A 1KB9F 4X62B 4LF8O 1Y76B 1M56B 2G38A 4JI5B 4B3MB 3CRRA 3QVNA 4NTWA 4DR6B 3Q4HB 1ZSPA 4K0KB 1QHTA 2ZR3A 4JYBA 3ZMSA 3ASNB 3ZRWA 4PELA 1VQ9V 5BY1A 2BSKB 2AZ0A 4LH7A 5LP6A 3LSSA 2PI4A 3FD9A 3ZRSA 4ZI7B 4UUJC 1YF2A 5B3SB 4LF7B 3K04A 1BT8A 1PP9H 4G27B 4RQEA 1JR9A 4MS2A 4TOIA 3OUSA 3JCZA 4LP8A 4D7SA 4DO2A 5LA6A 2KQXA 5DECA 2P90A 2WA4A 1IX9A 2RN9A 2WWWA 1WPBA 3B40A 3ASNC 2EINB 3ABLB 4ZIBA 2DQ0A 2QKCA 3F5WC 4LFCB 4I9QA 2UXNA 1THZA 1G4YB 1QR9A 5KHGA 5B3SC 4GX1A 5CBFA 4IIJA 1H2KA 3RBZA 1MSWD 1UPGA 5EK0A 4YJ2A 1AP5A 3QF7A 3CSXA 3DGEA 4XDKA 3CCLV 4PD4F 4G2KA 2Z3YA 3G80A 1AI7A 3UM7A 5LXTB 1JMKC 1DLBA 2IU3A 3ABLC 4H13B 4AQYO 1H2GA 2C2AA 2WSSG 1KKCA 2ZXWC 5KA5A 4DRXA 1QVGU 5KUMA 2HKOA 3JD0A 3H01A 2CK3G 1LNQA 2H3OA 5EBLC 1VP7A 3K3WA 3IC9A 2CE4A 4RUFA 4X66B 4QIWF 4IHJA 4UB8Z 5KHIA 3A8TA 2UUBB 2ZE8A 3RYIA 3DSQA 2UXBB 2LP7A 3WG7B 1K4CC 4RO2A 4JI8B 2YIBD 4JF3A 1E1QG 1YTFD 4DUYB 2IBZH 4CS4A 2QR4A 3JYCA 4FM0A 2B9ZA 1JOYA 1I7FA 1SS3A 3IC7A 2EX3A 4X20B 2DQ3A 4UXNA 2M6YA 3JD1A 3A0HZ 5BR8B 1VF6A 5JVDB 5IJ9B 1XHZA 3RWRD 1XUQA 4IYHA 1OV9A 4CH4A 3N2GA 3K5MA 3EXAA 1AVMA 3TK1A 5CN0A 3QO7A 1RPRA 1V54C 4HZ3A 2OIGA 3UKMA 1FJGB 2ADPA 4YJ3B 3H1IH 2UXDO 3WG7C 5KUKA 1F23A 4WCEV 4LFAB 3DTUB 2BCCH 4I7ZB 2OCHA 2IW5A 3STZC 1VQLV 1GKFA 1N36O 4LC1A 1AI6A 2HEPA 1TAEA 4WBNA 1JX9A 1SQBH 5LMNO 1SKVA 4FLYA 1FFTB 2E5LB 4DR3O 3MDSA 1AR1B 4I50B 4GUNA 3ABUA 2ZNJA 4FFBA 3MAQA 4QE7A 3R65A 3ZHTA 5K1XA 2W6JG 4NYKA 1SQQH 1WN7A 3CCUV 4ZKIA 1N0NA 4CZZA 3E86A 1FXKB 2EZPA 1X4TA 2ARHA 1M5IA 2X0LA 5J9PC 4PA7A 1M93A 1AR5A 3CXHF 5L3BA 1S5HC 2ZDIA 5IY5B 3E83A 3FAVB 4X62O 4NXMB 3I55V 4KFMA 5GW7A 4JI5O 2JGUA 2N05A 4B3MO 5EBWC 4KHPB 1P4RA 3C90A 3G6BA 1HP8A 4WFBV 1NI8A 4K0KO 2HR3A 1R6TA 1WPXA 2Q0AA 2YDEA 4B3RB 5C93A 3ZJZA 3P30A 5CMUA 4HNAA 1FXKC 2YXYA 1AR4A 4PDMA 4MSWC 1S0VA 1QU7A 4A5UB 4X65B 3JSLA 3SJQC 4ZI7A 4DR5B 4UVAA 1SQXH 3RYHB 1Z5VA 1DTOA 1VQ7V 3B8MA 2Z0AA 1FKAO 4H37A 1YJNV 2A7WA 1BMFG 4NTYA 4DR2O 1MMMA 5D5PA 2P7TC 3OEHG 3AG3C 1RM1B 4LFCO 1GMGA 2MK3A 4DK0A 2YIBA 4BAYA 1MABG 3STLC 3X2QC 4JYAO 2CH7B 4X64B 2ZM6B 4DV3O 1FFXB 5KAFZ 5C8YB 2GHYA 1ZUQA 3N27A 4O2AB 3BY6A 2D2CB 2XAJA 1W2BU 1SQFA 2Q5ZA 2XAHA 3OM3B 1RM1C 1SQPH 5IJ0B 4JGSA 2F93B 3QTCA 3ZRWB 3T1HB 4J80A 1GM9A 1A32A 4R6ZA 5DM6V 3HKEA 1TA8A 3UT5A 4Z2WA 1I94B 3CCVV 2AXTZ 4JZGA 2W0FC 2F43G 1WP7A 2UUBO 1GAXA 3SGIA 4OXSA 5JCOA 1I5YA 2HJDA 4B08A 1PNKA 3F5TA 1XI1A 1GN2A 1Y66A 3FYIB 1QCEA 3CB2A 5LA6B 1IXMA 1M4UA 1SETA 5BR8O 5FLXN 2WLMA 2PGGA 1B6QA 4K8ZA 5BZBA 5H6QA 5LP6C 3JARA 1YDXA 4F6EA 3CC7V 1E79G 2ZD9A 3DXRB 4LF5B 1FYJA 4UCSA 1HR0B 2P67A 5LOVB 2EIJC 2JS5A 2E76B 1WB7A 4IIJB 4JZ2A 4FIPC 3C3SA 4Z1VA 2LW1A 4X9QA 4YJ2B 5B1OA 4MVRA 5CBGA 5EBMC 4DR1B 1IBKB 5KMGA 5IYDO 4H0LB 4YJ3A 3CEIA 4DW0A 4CS3A 4R50A 2GBOA 1VARA 1XILA 4KUMA 4MW3A 1TUEB 4FFKA 1YITV 1GM7A 1NR7A 2CAZC 1OJHA 1S5JA 4LF4B 2PYLA 4CS2A 3WB1A 5LHHA 2LGWA 5LMUO 5KHJA 1NVPD 4UCTA 2RMKB 2VQEB 5L3DA 1B3QA 4OPAA 2ITCC 1PM9A 3ABKB 4QPKA 1KU9A 3TETA 4CC6A 4LNUA 4XBFA 4MT8A 2UU9B 4JI1B 1WP8A 1VQ5V 5E1AC 1XNRO 3E2EA 1OCRB 4NKGB 1K3EA 2BTOA 4PJ0Z 1SESA 3CHXA 3K57A 5CA0A 3LDCA 4E4EA 4DV4B 1MZEA 3D36A 4NXNB 1F4MA 2WAMA 3B09A 3BVOA 3CCMV 3QNEA 4ABMA 3CPWU 3AG2C 3KZIZ 1OHHG 3T1YB 2ZQMA 2X6AA 3ABKC 4WFAV 4WFGA 5KX5A 3OMAB 4I0XA 2ITDC 4JYYA 5EYPA 3ZRVA 3ABTA 4GYCB 3LNNA 2R9IA 4OX9O 3JD3A 3PN1A 2FMLA 4DR5O 3CRMA 4IL6Z 1VF6C 5KHHA 4WBNB 1V55C 4WFFA 5LGTA 3PJSK 1IBMB 4TWKA 1SQVH 1AILA 2DYSB 3E35A 2CDYA 3H1LH 1KP3A 4CC5A 2A9HA 1JVMA 1FAFA 1XMQO 2QTOA 4W4LA 1K8AW 4FFBB 2XOKG 3MD0A 3JAWB 1E1RG 2CTPA 2Q6AA 2WLJA 3P32A 3F7YC 4J10A 2HHHB 1XEQA 2F4VB 1WA8B 1LUWA 1YEWA 2ZR2A 1GM8A 5K1PA 2H8PC 2W0XA 1Y6XA 2ZNIA 4YIOA 4J11A 2ZM6O 1R3KC 2Q67A 1AJQA 1NTZH 5KHKA 2JIZG 4DYLA 4N23A 2GTAA 1YJ9V 2IH3C 4LFBB 4B7KA 5B1AC 1Y4MA 2ETNA 3HKBB 1VQ4V 5EIBD 3G4SV 1FFXA 5L3FA 3FYEB 3K5OA 5C8YA 1YIJV 2BOCC 4O2AA 2YXHA 5F2VO 3HKCB 3RYFB 2JK5C 2GUZB 3K79A 1ZL8A 1RFYA 2V7QG 4YHHB 5L3EA 2AHYA 3H1HH 1KC8W 1IVSA 2JGDB 3B8NA 3M7MX 3R66A 4DUZB 1BZKA 5GONB 5IJ0A 4HNAB 3CCSV 1EN6A 4GT1A 4CBCA 3OTOB 4EFEA 3ZCCA 4TSFG 4GKJO 3OMNB 2ZDIC 4O4LA 1YI2V 1XNQO 4JI0B 4MTFA 4LR3A 5FNVB 1MSDA 2RCVA 1N32B 4LH6A 4TQFA 3NXSA 1M56C 1R3IC 2JEUA 4JI4B 1UFIA 2PUSA 1HNZO 2DW4A 3T1CA 5B1BB 4PDLA 1NR1A 3ZHQA 4CH5A 1YTFB 1XL4A 3ICXA 2ZE7A 4LF5O 4X89A 2FYUH 3WB0A 3DXRA 2XAQA 1O9HA 1IXBA 5LOVA 3OE7G 1XDCA 3FB5C 2HG5C 1JJ2U 1URFA 4JTDB 4O4HA 4TQDA 2YIDA 1H2NA 3OGCC 3CJHA 5AG2A 1WAZA 4FLWA 2XT9A 3H1JH 2JEXA 2ZCEA 5B1BC 3BHPA 3HPLC 1EN5A 2EBOA 2EINC 3HKEB 3UT5B 3K08A 2E75B 3K0DA 4JI7B 3CS5A 4MTGA 2VQEO 2WLLB 1K5SA 3ZHSA 1NS1A 4YY3O 4JI2B 1FXVA 2UU9O 3E8BA 3GWOA 3CMAV 3J81N 3BPZA 4PDRA 1AB3A 2ZE5A 1UJWB 5LHGA 5JH7B 4U7NA 2UXCO 1GK9A 4TT3G 4D6TH 3EHBB 3BA9A 4UCRA 3JARB 3FFQA 5LYJB 4GX2A 3ZN0A 4NXNO 3K03A 1K92A 5TISZ 2B1GA 5IT9N 1Q6HA 2LFRA 5JCOC 1JA8A 3CXCU 3ETEA 3CX5F 3CCRV 2M7WA 4PDVA 4BR6A 1Q82W 1I5XA 5KMGB 3RYCB 1Q90D 3JD2A 1DGSA 1LUVA 2LW7A 3LDDA 2Y4UA 1VF7A 3SDLA 1XREA 5DEDA 1NTMH 4MW8A 5LHIA 1VIBA 3OUFA 1IBMO 2XAGA
chains in the Genus database with same CATH topology
3BY6A 2LFSA 3ABMB 4Q20A 4QPJA 3SPGA 1CEZA 2BOBC 1FXKA 1K7DA 2OTJV 3ZMZA 3TCUA 3BEHA 1VQKV 4I5SA 3W7SA 2XAJA 2OT5A 4RQFA 3I56V 1W2BU 3RVYA 1V55B 3CCQV 2XAHA 4WFHA 2P6JA 2X6BA 2Y48A 2KB1A 3E8HA 3OM3B 1YSCA 4BIZA 1RM1C 1NBMG 1AI5A 4JGSA 3ZRWB 1GM9A 5H9CA 4R6ZA 5DM6V 1DF4A 2IH1C 3CMEV 3CCVV 2OTLV 2XASA 3QO8A 4MVUA 2W0FC 1ZWIC 2F43G 1K5QA 1PNLA 1K9MW 4OXSA 2B1IA 3G6EV 3E89A 4XDLA 1I5YA 2ZXWB 3FB7C 1PNKA 4QJFB 3AG1C 3ZMVA 1VQPV 3FB8C 3ABMC 4FK5C 4FMTA 1Y66A 2EJRA 2WLNA 3FYIB 4J9ZB 2HFEC 1XL6A 1L1FA 1QCEA 1ROPA 1IXMA 4E2LA 4QNHB 2A79B 4BW5A 2Y69B 1SETA 2IJHA 2WLMA 5L3GA 5B1AB 2QE7G 1Q86W 1OCOB 2JJ1G 1BHAA 2IJKA 1B6QA 2DYRB 5BZBA 4F4LA 3QO5A 5H6QA 2YEVA 3OEEG 4P9PA 5EC2C 3CC7V 3CC4V 1J95A 1E79G 1JCHA 1AI4A 2ZD9A 2DWEC 1OZ0A 2EILC 3IFXA 4MTXA 2P67A 3SYCA 2EIJC 2OCCB 4FIPC 2JJ2G 1CPYA 1HWYA 1K73W 5B1OA 4MVRA 4MTOA 5CBGA 2UXXA 5EBMC 3CCJV 4YXWG 4UV9A 3W7XA 3OMIB 5IYDO 3SYAA 1KP2A 5IY5C 4R7CA 4R50A 3T2MA 1NQTA 1V54B 2NNUA 2Y69C 2QKSA 3W7WA 4KUMA 4PA6A 4MW3A 3SPCA 1TUEB 2EIKB 3JD4A 3KG2A 1JPXA 1OCOC 5IYCO 1YITV 1SERA 1GM7A 2HLDG 1F51A 3LDEA 3OW2U 1NR7A 2DYRC 4WF9V 2D3OW 4P2ZA 2B5UA 1QBZA 4PA3A 5HFLA 1M9NA 5LHHA 1S3JA 4L87A 1AJNA 1M56B 3SYOA 1GO3F 4GX5A 1NVPD 3ZMUA 2OCCC 2ZR3A 5L3DA 4JYBA 2ITCC 1NH2D 3ABKB 3ZMSA 2AHZA 3ASNB 4QPKA 3ZRWA 4PELA 4U7OA 1VQ9V 3TETA 3E8FA 3LSSA 2PI4A 4XBFA 4ZBMA 4MT8A 3ZN1A 3ZRSA 1VQ5V 4WFEA 3RVZA 3T4ZA 3MHHC 5E1AC 4UUJC 2EIKC 2H94A 5B3SB 2WLIB 3K04A 3K9AA 1EFRG 4RQEA 4G27B 4MVZA 1OCRB 1QLNA 3E2EA 1K3EA 4LCUC 3LNMB 4MS2A 1GTOA 1SESA 1N8RW 1K97A 3OUSA 3JCZA 4LP8A 3LDCA 2NLJC 4DO2A 1PNMA 2EZOA 3SPJA 3D3IA 1EBOA 3EFFK 3D36A 1F4MA 2WAMA 3CCMV 3QNEA 3CPWU 2IJJA 3AG2C 4MVSA 2P90A 1OHHG 1M57B 2WWWA 2ZQMA 4JASA 2X6AA 1R6NA 3ABKC 4WFAV 3B77A 3ASNC 2EINB 3E8GA 2WLLA 3ABLB 4WFGA 2DQ0A 3F5WC 3OMAB 2ITDC 3OR6C 2V1DA 3SPHA 5LBQA 3ZRVA 2UXNA 1THZA 1G4YB 1QR9A 4EKWA 3ABTA 1YJWV 2Z5UA 5B3SC 4GX1A 5CBFA 2R9IA 2A0LA 3JD3A 1NVPB 1VQMV 3RBZA 4P30A 3SPIA 1MSWD 5EK0A 1V55C 2WLHA 4WFFA 4H33A 1NH2B 5LGTA 4MVQA 3PJSK 1VQ6V 4ASUG 3ML0A 3DGEA 4XDKA 4TWKA 1K34A 2DYSB 3E35A 3CCLV 1QVFU 4N21A 3SYPA 1KP3A 4GCZA 1H8EG 4I9WA 4G2KA 2A9HA 1JVMA 2Z3YA 2QTOA 1R3JC 2EIMB 1AI7A 1K8AW 5EC1C 1M57C 1CP9A 2XOKG 3MD0A 4R8CA 3UM7A 2QM7A 1AROP 4MVOA 1E1RG 1JQ0A 2IU3A 1DLBA 2Q6AA 2WLJA 3ABLC 3OFNG 1H38A 3P32A 1H2GA 1VQOV 2C2AA 3F7YC 2WSSG 5KA6A 1COWG 2ZXWC 5KA5A 1QVGU 1WLEA 5IYBO 1FXHA 5IDJA 2ZR2A 1GM8A 4UVBA 2HKOA 3JD0A 5KUMA 1R73A 3H01A 2H8PC 4HAMA 2CK3G 1LNQA 5EBLC 3K3WA 4RUFA 1QLEB 1R3KC 2Q67A 1AJQA 3AG3B 4JPRA 4QIWF 3ZRXA 4JTAB 2JIZG 1VQNV 2WPDG 4N23A 1KD1W 1YJ9V 2IH3C 2X6CA 4LBEC 2LP7A 3WG7B 1K4CC 4RO2A 5B1AC 1S76D 4JF3A 1E1QG 3IGAC 1Y4MA 1VQ4V 1YTFD 3JYCA 3G4SV 1G8MA 3G71V 5L3FA 1RPOA 1SZTA 3X2QB 1NKDA 3FYEB 1JOYA 1YIJV 2EIMC 1OCZB 2BOCC 4JAVA 3IC7A 3K06A 3ZIAG 2DQ3A 4UXNA 3JD1A 2JK5C 3K79A 1F4NA 4X88A 4MVMA 2V7QG 5L3EA 2AHYA 1KC8W 3B8NA 3ETGA 2IU0A 1PL0A 1OCCB 3CD6V 3CCSV 3TK1A 5CN0A 3W7UA 4JTCB 4GT1A 1ORQC 2YSUB 1S77D 4CBCA 3QO7A 1QLEC 2GSMB 1RPRA 1V54C 3ZCCA 2HVKC 4HZ3A 4TSFG 3OMNB 3UKMA 3CC2V 2ZDIC 3WG7C 1YI2V 3VOUA 5KUKA 1MOFA 1P7BA 4GX0A 1KKDA 4MTFA 1F23A 4WCEV 1YHQV 3OAAG 2Q68A 1AJPA 3DTUB 1S72V 3M99B 2IW5A 3NXSA 2X7RB 4J9YB 5L3CA 3STZC 1M56C 1VQLV 2IJIA 1R3IC 2JEUA 1GKFA 4LC1A 1AI6A 5H6RA 3AG1B 2K1EA 4X8AA 1JX9A 1K33A 2R9RB 4DXWA 4BIUA 2DW4A 3T1CA 1FFTB 5B1BB 4G28B 4PDLA 1BL8A 1NR1A 1YTFB 1XL4A 1OCCC 1AR1B 5LGUA 2FTKA 4X89A 1FS0G 3ABUA 1PKXA 1W0JG 3MHSC 4FPPA 4QE7A 1NJIW 3R65A 1BHBA 3A0RA 2W6IG 2XAQA 2W6JG 2QA4V 1OCRC 3CCUV 3OE7G 4PA9A 3RW0A 4ZKIA 3FB5C 4RUEA 2HG5C 1EZJA 4XDJA 3LSQA 3ASOB 1JJ2U 4CZZA 2EILB 3E86A 4JTDB 3FB6C 1FXKB 2EIJB 2EZPA 3WFVA 1R3LC 3OGCC 1SRYA 2X0LA 5LGNA 1ENVA 1KECA 3LUTB 5J9PC 4UV8A 4PA7A 2PI5A 4PA4A 3VBBA 2JEXA 2XNDG 1S5HC 2ZDIA 5L3BA 5IY5B 5B1BC 3E83A 3HPLC 2EBOA 3GB7C 2EINC 3I55V 4KFMA 5GW7A 3K08A 3K0GA 3SYQA 2ATKC 3CP1A 3K0DA 5EBWC 2HVJC 5FL7G 1P4RA 2HJFC 4MTGA 4WFBV 1DF5A 2HR3A 2WLLB 5CA3A 1K5SA 2QEXV 1QR8A 1WPXA 2WLKA 3OR7C 1FXVA 5C93A 3ZJZA 3ASOC 3E8BA 3GWOA 3P30A 5CMUA 3CMAV 1FXKC 2DYSC 3HB3B 4PDRA 3AEIA 4PDMA 4P9OA 4MSWC 1UJWB 1S0VA 3SJQC 1K4DC 5LHGA 3AG4B 4UVAA 3ZMTA 2DWDC 4RAIA 2WLIA 4U7NA 4JYCA 1DTOA 1VQ7V 1GK9A 1PD3A 3B8MA 2Q69A 4TT3G 3EHBB 3F7VC 2YEVB 2XAFA 4GX2A 4H37A 3ZN0A 1VQ8V 1KQSU 1YJNV 3K03A 1H8HG 1K92A 2B1GA 4HYOA 1BMFG 3W7TA 4Z1MG 5DN6G 1W0KG 2LFRA 4QE9A 2P7TC 1Q81W 3CXCU 3OEHG 3ETEA 3AG3C 1RM1B 4KP4A 3CCRV 3FKSG 2M7WA 4PDVA 1GMGA 2MK3A 2JDIG 1Q82W 1I5XA 3JD2A 4BAYA 3ETDA 4FJCC 3AG2B 1MABG 5CBHA 3CCEV 1R6KA 3LDDA 4JAUA 3STLC 5HFMA 3X2QC 1M1KW 3CYOA 3T4DA 4UVCA 3AG4C 1OCZC 2QM8A 5B1NA 4MW8A 1Q7YW 1MG1A 5LHIA 1M90W 3OUFA 2XAGA 2GHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HG5 C;  3SPG A;  5KUM A;  4XDJ A;  3SYO A;  2BOB C;  3E86 A;  2H8P C;  4JTD B;  3FB6 C;  4RUE A;  3TCU A;  3BEH A;  1LNQ A;  5EBL C;  1R3L C;  4GX5 A;  3RVY A;  3OGC C;  2OCC C;  4RUF A;  1R3K C;  2Q67 A;  3LUT B;  4WFH A;  5J9P C;  4PA7 A;  4JTA B;  2X6B A;  2ITC C;  2KB1 A;  3E8H A;  4PA4 A;  2AHZ A;  1S5H C;  2IH3 C;  2X6C A;  4LBE C;  1K4C C;  4RO2 A;  3E83 A;  3HPL C;  5B1A C;  4R6Z A;  5B1B C;  3TET A;  3GB7 C;  3IGA C;  2EIN C;  4KFM A;  3K08 A;  3JYC A;  3K0G A;  3SYQ A;  3E8F A;  2ATK C;  2IH1 C;  3K0D A;  4ZBM A;  3ZRS A;  5EBW C;  2EIM C;  2HVJ C;  4MVU A;  4WFE A;  5E1A C;  3RVZ A;  2BOC C;  3T4Z A;  2HJF C;  4MTG A;  4UUJ C;  2EIK C;  3K06 A;  2WLI B;  2W0F C;  1ZWI C;  2WLL B;  3K04 A;  4G27 B;  4MVZ A;  2JK5 C;  4OXS A;  3E89 A;  4LCU C;  4X88 A;  4XDL A;  3LNM B;  4MS2 A;  3FB7 C;  4MVM A;  2WLK A;  3OUS A;  4LP8 A;  2AHY A;  3AG1 C;  3LDC A;  3OR7 C;  3FB8 C;  2NLJ C;  3ZJZ A;  3ABM C;  2WLN A;  3ASO C;  3E8B A;  3SPJ A;  4J9Z B;  2HFE C;  1XL6 A;  3EFF K;  2DYS C;  4PDR A;  4QNH B;  4JTC B;  1ORQ C;  2A79 B;  4BW5 A;  4PDM A;  3AG2 C;  4MVS A;  4P9O A;  1QLE C;  4CBC A;  1V54 C;  4MSW C;  2HVK C;  4HZ3 A;  3SJQ C;  1K4D C;  2WLM A;  2X6A A;  3ABK C;  3UKM A;  2DWD C;  3ASN C;  3E8G A;  2WLI A;  4RAI A;  3WG7 C;  2WLL A;  3VOU A;  5KUK A;  5BZB A;  4WFG A;  4F4L A;  3F5W C;  2Q69 A;  1P7B A;  2ITD C;  3OR6 C;  4GX0 A;  4MTF A;  2YEV A;  3F7V C;  1KKD A;  3SPH A;  4GX2 A;  2Q68 A;  4P9P A;  4H37 A;  5EC2 C;  1G4Y B;  1J95 A;  3K03 A;  4EKW A;  2ZD9 A;  2DWE C;  4HYO A;  5B3S C;  4GX1 A;  4J9Y B;  3STZ C;  1M56 C;  5CBF A;  1R3I C;  2A0L A;  2EIL C;  3IFX A;  3SYC A;  2EIJ C;  3RBZ A;  4P30 A;  3SPI A;  4QE9 A;  2P7T C;  2K1E A;  4X8A A;  5EK0 A;  1V55 C;  2WLH A;  4WFF A;  4H33 A;  3AG3 C;  2R9R B;  4MVQ A;  3PJS K;  4DXW A;  4PDV A;  4MVR A;  4MTO A;  5CBG A;  5EBM C;  3T1C A;  4XDK A;  4TWK A;  4G28 B;  4PDL A;  1BL8 A;  3SYA A;  3SYP A;  1XL4 A;  1OCC C;  5IY5 C;  4I9W A;  2A9H A;  1JVM A;  4R7C A;  4R50 A;  3T2M A;  5CBH A;  3LDD A;  4X89 A;  2Y69 C;  2QKS A;  1R3J C;  2QTO A;  3STL C;  3X2Q C;  4PA6 A;  4MW3 A;  3SPC A;  5EC1 C;  3T4D A;  1M57 C;  3UM7 A;  4QE7 A;  4R8C A;  3KG2 A;  3R65 A;  1OCZ C;  3AG4 C;  1OCO C;  4MVO A;  4MW8 A;  3LDE A;  2Q6A A;  3ABL C;  2DYR C;  1OCR C;  2WLJ A;  4P2Z A;  3OUF A;  3F7Y C;  4PA9 A;  4PA3 A;  3RW0 A;  2ZXW C;  3FB5 C; 
#chains in the Genus database with same CATH topology
 1HNW B;  4K35 A;  3ABM B;  1EM1 A;  3B2E E;  3TCU A;  4B3S B;  4RQF A;  3RVY A;  1WNS A;  4WFH A;  2P6J A;  2X6B A;  2Y48 A;  3L74 H;  3J80 N;  1YSC A;  4BIZ A;  1PPJ H;  3AK1 A;  2V4D A;  1AI5 A;  4W4K A;  4X1I A;  3BA8 A;  5CB4 A;  5H9C A;  2F4V O;  4GKK B;  3JAW A;  3S3W A;  4LNU B;  4NB5 A;  4DR7 B;  2XAS A;  1WA8 A;  2WA3 A;  1BQZ A;  1ZWI C;  1SZX A;  4LF6 B;  1K5Q A;  1PNL A;  1U96 A;  1K9M W;  2B1I A;  3G6E V;  3E89 A;  2CTR A;  4LF9 O;  3FB7 C;  1SC5 B;  4QJF B;  3AG7 A;  3ETQ A;  4B3T O;  5CA0 B;  4K3A A;  3ABM C;  4FK5 C;  2EJR A;  2UUC O;  4J9Z B;  2HFE C;  1SA0 A;  3HKB A;  3H9V A;  2A79 B;  3APO A;  2IJH A;  4DR6 O;  4DV1 B;  1JJO A;  1OCO B;  1BHA A;  3HKC A;  3RYF A;  2DYR B;  3QG5 A;  4F4L A;  3B4S A;  2GUZ A;  5KX5 B;  3QO5 A;  4I0X B;  4DUZ O;  3O9O A;  1VEW A;  5EYP B;  2QSA A;  4D7T A;  2JGD A;  1AI4 A;  3OTO O;  2OWO A;  1XBL A;  2XUM A;  5GON A;  2OCC B;  5EZY A;  5B5E Z;  4LF7 O;  2JJ2 G;  3JAT B;  1K73 W;  4OPH A;  3BAB A;  3D3Q A;  3O65 A;  4JI0 O;  4MTO A;  4O2B B;  2DOS A;  4UV9 A;  2AW9 A;  3OMI B;  3SYA A;  5IY5 C;  1N32 O;  3D36 C;  2E3C A;  2NNU A;  3BCC H;  2QKS A;  5BXZ A;  3SPC A;  5FNV A;  2EIK B;  4JI4 O;  3JD4 A;  1OCO C;  5IYC O;  2L6L A;  3LDE A;  2DYR C;  2D3O W;  4PI0 A;  2QGN A;  4P2Z A;  2OIE A;  1D5A A;  1QBZ A;  5HFL A;  1XOU A;  1S3J A;  1X59 A;  3JCU Z;  3CWB H;  1GO3 F;  1BGY H;  4GX5 A;  2OCC C;  3RN4 A;  4FM2 A;  1NH2 D;  1B04 A;  2CTQ A;  4U7O A;  5LL6 Y;  2CTW A;  1N34 B;  5BMV A;  3E8F A;  4ZBM A;  2Q7E A;  2K9P A;  3RVZ A;  2EIK C;  1F7Y A;  2WLI B;  3K9A A;  1EFR G;  5JJJ B;  2VQF B;  1XHX A;  3K59 A;  3ZX6 A;  4LCU C;  3LNM B;  1GTO A;  1ZL8 B;  1K97 A;  3SPJ A;  2QTS A;  4MVS A;  1H2S B;  5JQG B;  3RFR A;  1M57 B;  2EUL A;  3THO A;  3RGB A;  4X66 O;  4O4L B;  2WLL A;  4LF8 B;  4JV5 B;  4JI2 O;  3OR6 C;  2QWQ B;  4O4I A;  2UXB O;  4JI8 O;  4DUY O;  4EKW A;  1P84 F;  2A0L A;  1NVP B;  1YXB A;  2FB5 A;  5A2Q N;  2WLH A;  4H33 A;  4ASU G;  1K34 A;  1XMO B;  1QVF U;  2QM4 A;  5JH7 A;  2DMX A;  4N21 A;  3SYP A;  2OYQ A;  2R70 A;  5LYJ A;  1R3J C;  2EIM B;  4X1K A;  1M57 C;  1CP9 A;  1IBL B;  4R8C A;  2NR5 A;  2QM7 A;  1ARO P;  1JQ0 A;  4KL1 A;  3OD4 A;  3OFN G;  2GV9 A;  5KA6 A;  4O4J A;  5J2T B;  1FJG O;  3A0B Z;  1N4C A;  4X1Y B;  1Y74 B;  3JAK B;  2A3Q A;  4O4H B;  2YC0 A;  3RYC A;  4LFA O;  2PTM A;  3CJH B;  3ZRX A;  3AK2 A;  4JTA B;  2QWN B;  1VQN V;  1EZV H;  1KD1 W;  2X6C A;  1S76 D;  3IGA C;  1NU1 H;  1HNW O;  1G8M A;  3G71 V;  1RPO A;  2LQT A;  4NR1 A;  4B3S O;  2EIM C;  1KBH A;  1OCZ B;  2E5L O;  1H2L A;  2CUG A;  1VMG A;  1F4N A;  3SR2 C;  4MVM A;  4K8X A;  4DV2 B;  1CXZ B;  2IU0 A;  3ZHR A;  2BE3 A;  5IYZ A;  1OCC B;  1DK1 A;  4ZOL B;  3W7U A;  4JTC B;  2Q9L A;  4LF6 O;  3L73 H;  2GSM B;  3GVM A;  1ZTE A;  1MOF A;  4GX0 A;  2MW2 B;  1BQ0 A;  4FLZ A;  2ODM A;  2Q68 A;  2KSD A;  2YIA A;  3P3P A;  3UCS C;  5JWP A;  4NXM O;  5H5N A;  3M99 B;  2ADQ B;  4FLT A;  4J9Y B;  5L3C A;  2IJI A;  2YI9 A;  4BW9 A;  1J5E B;  2A06 H;  3K9S A;  4KHP O;  3VQY A;  3WB2 A;  5H6R A;  3AG1 B;  1N0J A;  4X8A A;  1N33 B;  1FD9 A;  1KMI Z;  1BL8 A;  2VWJ A;  2P5O A;  1OCC C;  3KCY A;  3TJT A;  4JI6 B;  4B3R O;  5LGU A;  2JRI A;  3TGU H;  1PKX A;  1D2D A;  3I5D A;  1W0J G;  1NJI W;  4JAA A;  1BHB A;  2HP8 A;  3A0R A;  4AHC A;  2QA4 V;  1OCR C;  4X65 O;  3K5N A;  4PA9 A;  3RW0 A;  2QWO B;  1IZ3 A;  3JAT A;  4RUE A;  4Q6G A;  1EZJ A;  2EIL B;  4FVM A;  4O2B A;  3FB6 C;  3WFV A;  2F1M A;  1SRY A;  5LGN A;  1KEC A;  3LUT B;  1PV0 A;  2PI5 A;  4PA4 A;  4X1I B;  1V9P A;  2KKW A;  4IGG A;  5CB4 B;  3GB7 C;  4HBN A;  4EB6 B;  3K0G A;  3SYQ A;  2ATK C;  5EIB C;  1YZB A;  2HVJ C;  2VS0 A;  5H2F Z;  1JFF A;  4DV5 B;  1DF5 A;  1L0L H;  5CA3 A;  1G6U A;  2QEX V;  5LMN B;  1QR8 A;  2Q8V A;  4JI3 B;  3L75 H;  4X64 O;  2PY5 A;  4DR3 B;  2GDS A;  1BSM A;  2DYS C;  1SA0 B;  2Q7H A;  3AEI A;  4OGQ B;  4P9O A;  1K4D C;  2PZS A;  2DWD C;  4RAI A;  2WLI A;  3F7V C;  2P4V A;  4DV6 B;  3T1H O;  1VQ8 V;  1T5E A;  1H8H G;  1L0N H;  4HYO A;  1Z2G A;  1I94 O;  1Q5O A;  3CE2 A;  3JAL A;  3AK3 A;  3FX7 A;  1W0K G;  3N2K B;  2RDC A;  5EZY B;  2F95 B;  1Q81 W;  2QJ1 A;  4JV5 O;  5JQG A;  4KP4 A;  3FKS G;  2UUA B;  4I4T A;  4FLU A;  3ETD A;  4DK1 A;  4QGP A;  5JJN B;  5HFM A;  3VQV A;  3CYO A;  3NR7 A;  4UB6 Z;  3BFR A;  1EN4 A;  3BRC A;  3ZBH A;  1US6 A;  1XMO O;  2Y4T A;  4DV7 B;  4QPJ A;  1CEZ A;  4EFB A;  1K7D A;  2OTJ V;  3ZMZ A;  3BEH A;  2Q0O C;  4I5S A;  2OT5 A;  3JAS B;  1IBL O;  1TUB B;  3CCQ V;  1GRJ A;  2KB1 A;  3E8H A;  1HR0 O;  5GTI Z;  1GN3 A;  5BMV B;  1RSO A;  3CME V;  1KYO F;  5D5Q A;  4DR1 O;  4DR2 B;  5J2T A;  1IBK O;  4MVU A;  3DC6 A;  4X1Y A;  1Y74 A;  4AIL C;  3JAK A;  4TV9 A;  2ZXW B;  2DE0 X;  1PL4 A;  4BIO A;  3IAY A;  3ZMV A;  1VQP V;  3FB8 C;  3U0Z A;  4FMT A;  4LF4 O;  2WLN A;  2RQ6 A;  2RNB A;  3OTF A;  1L1F A;  1ROP A;  1WJZ A;  3DC5 A;  4JYA B;  3KCX A;  4QNH B;  3LSU A;  4DV3 B;  2Y69 B;  4LWS B;  2KG7 A;  2YS8 A;  5L3G A;  2QE7 G;  1Q43 A;  2JS3 A;  1Q86 W;  4DV2 O;  2IJK A;  2CGN A;  2YEV A;  4O4I B;  4P9P A;  4DR4 B;  4GLX A;  5KLV H;  4UCV A;  1JCH A;  1OZ0 A;  1IUR A;  4JI1 O;  4MTX A;  3SYC A;  3ZS8 C;  4ZOL A;  1TVK A;  1BE3 H;  3A2F A;  4TV8 B;  3OGI B;  2UXX A;  2QKA A;  3W7X A;  4TUY A;  1KP2 A;  4BWA A;  4CH6 A;  4DV4 O;  3HKD A;  3T2M A;  1NQT A;  1V54 B;  1IDS A;  2Y69 C;  3W7W A;  4X1K B;  4PA6 A;  3ZHU A;  1J5E O;  1WB8 A;  1JPX A;  4L8J A;  2AZ2 A;  1N33 O;  3T1Y O;  2R72 A;  4PA3 A;  4O4J B;  2N04 A;  1D5N A;  1M9N A;  3APQ A;  5E79 Z;  4B7E A;  4L87 A;  1AJN A;  2R9A A;  4JI6 O;  4ZHQ B;  3SYO A;  2BTQ B;  4RWU A;  3ZMU A;  1Q6I A;  5CA1 B;  3CRQ A;  2P4K A;  1B06 A;  1RP3 B;  4DW1 A;  2AHZ A;  3L71 H;  2XHB A;  4FLX A;  3VQX A;  3ZN1 A;  4WFE A;  3T4Z A;  4AI8 A;  3MHH C;  3E22 B;  2H94 A;  4J41 A;  2YI8 A;  1QLN A;  4MVZ A;  4NTX A;  4I55 A;  3IJ4 A;  4ICG A;  2GTS A;  1N8R W;  2ZT9 B;  3SJA C;  2RJZ A;  4F6R B;  2NLJ C;  4PV1 B;  1PNM A;  2EZO A;  2HHH O;  3D3I A;  5IYZ B;  1EBO A;  1R1B A;  3EFF K;  4EB6 A;  3D8C A;  4DV5 O;  2IJJ A;  1I0H A;  3H1K H;  3ZED A;  4JAS A;  4JI3 O;  1R6N A;  3B77 A;  5JJE B;  3E8G A;  5J2U B;  1ZLZ A;  5IWA B;  2V1D A;  5LMU B;  3SPH A;  5LBQ A;  4LFB O;  3S3X A;  1QNM A;  1YJW V;  2Z5U A;  3P3N A;  4U3J A;  3UQ8 A;  1VQM V;  3EVK A;  4P30 A;  3SPI A;  5A9G A;  2N74 A;  3UO3 A;  1NH2 B;  4MVQ A;  1VQ6 V;  3ML0 A;  4DV6 O;  3WU2 Z;  5ITZ B;  4YHH O;  4UCU A;  1XNR B;  4GCZ A;  1H8E G;  4I9W A;  5EC1 C;  4EEQ A;  2QWP B;  4MVO A;  1H38 A;  1ZAU A;  3N2K A;  2CGO A;  1VQO V;  4FZ1 A;  4YIP A;  1COW G;  2UUA O;  1Q6U A;  1WLE A;  1Y76 A;  1BCC H;  5IYB O;  1FXH A;  4PHZ A;  4UVB A;  5GTH Z;  5IDJ A;  2ZKO A;  1R73 A;  4HAM A;  2QWR B;  3CRC A;  3Q4H A;  1QLE B;  3AG3 B;  4JPR A;  4PI2 A;  2FL4 A;  2WPD G;  4UFZ A;  2IM9 A;  4LBE C;  2FKX A;  2BSK A;  4DV7 O;  3TXS A;  1SZT A;  3X2Q B;  1NKD A;  4OX9 B;  3U11 A;  4IYI A;  3JAM N;  4JAV A;  1JFF B;  3K06 A;  3ZIA G;  1I08 A;  3C3T A;  4X88 A;  1HNX B;  2F66 C;  3JAS A;  1TUB A;  4GZR B;  3SJB C;  3ETG A;  3HR0 A;  1PL0 A;  1XMQ B;  2Y0I A;  3CD6 V;  1ORQ C;  2YSU B;  1S77 D;  1QLE C;  3BAA A;  2HVK C;  1NZ6 A;  3GWK C;  3CC2 V;  2P22 C;  3VOU A;  1P7B A;  1KKD A;  1YHQ V;  3OAA G;  1AJP A;  2ZE6 A;  1S72 V;  1NT2 B;  1HDJ A;  2X7R B;  3JAL B;  2AGA A;  4JI7 O;  2K1E A;  1K33 A;  4DV0 B;  4LWS A;  2R9R B;  4IT5 A;  4DXW A;  4BIU A;  1TGO A;  4G28 B;  4DR4 O;  4I4T B;  1BS3 A;  2DN9 A;  2VWK A;  4J42 A;  2FTK A;  2JVD A;  3K5L A;  1FS0 G;  3MHS C;  4FPP A;  5LXT A;  5FPR A;  2W6I G;  1ZX3 A;  5LP6 B;  1NTK H;  1KUQ A;  4XDJ A;  3LSQ A;  3ASO B;  4TV8 A;  2EIJ B;  4C7U A;  4GKJ B;  1W59 A;  2EJ7 A;  1R3L C;  2ZIM A;  1ENV A;  1XNQ B;  4UV8 A;  1Z5W A;  4FZ0 A;  1AP6 A;  1H2M A;  1MNG A;  2XND G;  4J7J A;  3VBB A;  2Q4P A;  2Q7G A;  4CH3 A;  1RSO B;  3CP1 A;  2YIC A;  3L9D A;  5FL7 G;  2HJF C;  4X20 A;  3CRA A;  4ZHQ A;  2BTQ A;  1U97 A;  1HNZ B;  4TV9 B;  2WLK A;  5IJ9 A;  5JVD A;  2NN4 A;  5CA1 A;  3OR7 C;  3ASO C;  4FLV A;  3HB3 B;  3JSN A;  2L35 A;  3G67 A;  2Q73 A;  2KG7 B;  2VRZ A;  1MZF A;  3E22 A;  3L72 H;  3AG4 B;  3ZMT A;  3UO2 A;  1Q3E A;  4JYC A;  1PD3 A;  2Q69 A;  2YEV B;  2XAF A;  1Y67 A;  3ZHV A;  1KQS U;  4GKK O;  1P7G A;  4F6R A;  2PYJ A;  1YVW A;  3W7T A;  4Z1M G;  1SF9 A;  5DN6 G;  4DR7 O;  4QE9 A;  4DRX B;  1TVK B;  5IWA O;  4AQY B;  2E74 B;  2JDI G;  4TUY B;  5J2U A;  3U10 A;  4FJC C;  3AG2 B;  4IHJ B;  3HKD B;  5CBH A;  3CCE V;  1R6K A;  4I50 A;  2LO1 A;  1GN4 A;  4JAU A;  3RT3 C;  3RYI B;  1M1K W;  3T4D A;  4UVC A;  1OCZ C;  2QM8 A;  3AG4 C;  5B1N A;  2ZIN A;  4YY3 B;  1Q7Y W;  1MG1 A;  1O9G A;  4KXR A;  1M90 W;  1S5L Z;  4DV1 O;  2LFS A;  4J7Z A;  3SPG A;  4Q20 A;  2BOB C;  1FXK A;  2DJV A;  3TXQ A;  4FM1 A;  1VQK V;  3W7S A;  5ITZ A;  3I56 V;  2YXL A;  1V55 B;  4NVP A;  2UXC B;  2ILM A;  3J7A U;  1NBM G;  3N2G B;  2ZIO A;  3FAV A;  2YUA A;  1Q8I A;  1L8D A;  4J7K A;  1DF4 A;  1LR1 A;  2IH1 C;  2OTL V;  3QO8 A;  2F23 A;  1MA1 A;  1QQC A;  2Y0P A;  1P49 A;  5KAI Z;  4I55 B;  4XDL A;  2UXD B;  2O57 A;  3AG1 C;  2PF4 E;  1SQG A;  1XL6 A;  4E2L A;  3M8A A;  4BW5 A;  1XQ8 A;  3VQW A;  1N36 B;  5FPO A;  1HNX O;  1YCI A;  5B1A B;  2JJ1 G;  3RYH A;  3OEE G;  5EC2 C;  2LGQ A;  5B66 Z;  1GN6 A;  3CC4 V;  1J95 A;  1N34 O;  3OT7 A;  2DWE C;  3SJC C;  1G1X B;  4U3J B;  1HW7 A;  2EIL C;  3IFX A;  4H44 B;  3K58 A;  2LJ2 A;  2QDO A;  1CPY A;  1HWY A;  2VQF O;  3L70 H;  4UCO A;  4U3F H;  3CCJ V;  1FPO A;  1GH6 A;  4YXW G;  4R7C A;  1VF5 B;  2XTA A;  5IE9 A;  3KKY A;  2CH7 A;  4LF9 B;  3KG2 A;  4DV0 O;  1SER A;  4B3T B;  2HLD G;  1F51 A;  3OW2 U;  4WF9 V;  2B5U A;  2UUC B;  2P06 A;  1KB9 F;  4X62 B;  4LF8 O;  1Y76 B;  1M56 B;  2G38 A;  4JI5 B;  4B3M B;  3CRR A;  3QVN A;  4NTW A;  4DR6 B;  3Q4H B;  1ZSP A;  4K0K B;  1QHT A;  2ZR3 A;  4JYB A;  3ZMS A;  3ASN B;  3ZRW A;  4PEL A;  1VQ9 V;  5BY1 A;  2BSK B;  2AZ0 A;  4LH7 A;  5LP6 A;  3LSS A;  2PI4 A;  3FD9 A;  3ZRS A;  4ZI7 B;  4UUJ C;  1YF2 A;  5B3S B;  4LF7 B;  3K04 A;  1BT8 A;  1PP9 H;  4G27 B;  4RQE A;  1JR9 A;  4MS2 A;  4TOI A;  3OUS A;  3JCZ A;  4LP8 A;  4D7S A;  4DO2 A;  5LA6 A;  2KQX A;  5DEC A;  2P90 A;  2WA4 A;  1IX9 A;  2RN9 A;  2WWW A;  1WPB A;  3B40 A;  3ASN C;  2EIN B;  3ABL B;  4ZIB A;  2DQ0 A;  2QKC A;  3F5W C;  4LFC B;  4I9Q A;  2UXN A;  1THZ A;  1G4Y B;  1QR9 A;  5KHG A;  5B3S C;  4GX1 A;  5CBF A;  4IIJ A;  1H2K A;  3RBZ A;  1MSW D;  1UPG A;  5EK0 A;  4YJ2 A;  1AP5 A;  3QF7 A;  3CSX A;  3DGE A;  4XDK A;  3CCL V;  4PD4 F;  4G2K A;  2Z3Y A;  3G80 A;  1AI7 A;  3UM7 A;  5LXT B;  1JMK C;  1DLB A;  2IU3 A;  3ABL C;  4H13 B;  4AQY O;  1H2G A;  2C2A A;  2WSS G;  1KKC A;  2ZXW C;  5KA5 A;  4DRX A;  1QVG U;  5KUM A;  2HKO A;  3JD0 A;  3H01 A;  2CK3 G;  1LNQ A;  2H3O A;  5EBL C;  1VP7 A;  3K3W A;  3IC9 A;  2CE4 A;  4RUF A;  4X66 B;  4QIW F;  4IHJ A;  4UB8 Z;  5KHI A;  3A8T A;  2UUB B;  2ZE8 A;  3RYI A;  3DSQ A;  2UXB B;  2LP7 A;  3WG7 B;  1K4C C;  4RO2 A;  4JI8 B;  2YIB D;  4JF3 A;  1E1Q G;  1YTF D;  4DUY B;  2IBZ H;  4CS4 A;  2QR4 A;  3JYC A;  4FM0 A;  2B9Z A;  1JOY A;  1I7F A;  1SS3 A;  3IC7 A;  2EX3 A;  4X20 B;  2DQ3 A;  4UXN A;  2M6Y A;  3JD1 A;  3A0H Z;  5BR8 B;  1VF6 A;  5JVD B;  5IJ9 B;  1XHZ A;  3RWR D;  1XUQ A;  4IYH A;  1OV9 A;  4CH4 A;  3N2G A;  3K5M A;  3EXA A;  1AVM A;  3TK1 A;  5CN0 A;  3QO7 A;  1RPR A;  1V54 C;  4HZ3 A;  2OIG A;  3UKM A;  1FJG B;  2ADP A;  4YJ3 B;  3H1I H;  2UXD O;  3WG7 C;  5KUK A;  1F23 A;  4WCE V;  4LFA B;  3DTU B;  2BCC H;  4I7Z B;  2OCH A;  2IW5 A;  3STZ C;  1VQL V;  1GKF A;  1N36 O;  4LC1 A;  1AI6 A;  2HEP A;  1TAE A;  4WBN A;  1JX9 A;  1SQB H;  5LMN O;  1SKV A;  4FLY A;  1FFT B;  2E5L B;  4DR3 O;  3MDS A;  1AR1 B;  4I50 B;  4GUN A;  3ABU A;  2ZNJ A;  4FFB A;  3MAQ A;  4QE7 A;  3R65 A;  3ZHT A;  5K1X A;  2W6J G;  4NYK A;  1SQQ H;  1WN7 A;  3CCU V;  4ZKI A;  1N0N A;  4CZZ A;  3E86 A;  1FXK B;  2EZP A;  1X4T A;  2ARH A;  1M5I A;  2X0L A;  5J9P C;  4PA7 A;  1M93 A;  1AR5 A;  3CXH F;  5L3B A;  1S5H C;  2ZDI A;  5IY5 B;  3E83 A;  3FAV B;  4X62 O;  4NXM B;  3I55 V;  4KFM A;  5GW7 A;  4JI5 O;  2JGU A;  2N05 A;  4B3M O;  5EBW C;  4KHP B;  1P4R A;  3C90 A;  3G6B A;  1HP8 A;  4WFB V;  1NI8 A;  4K0K O;  2HR3 A;  1R6T A;  1WPX A;  2Q0A A;  2YDE A;  4B3R B;  5C93 A;  3ZJZ A;  3P30 A;  5CMU A;  4HNA A;  1FXK C;  2YXY A;  1AR4 A;  4PDM A;  4MSW C;  1S0V A;  1QU7 A;  4A5U B;  4X65 B;  3JSL A;  3SJQ C;  4ZI7 A;  4DR5 B;  4UVA A;  1SQX H;  3RYH B;  1Z5V A;  1DTO A;  1VQ7 V;  3B8M A;  2Z0A A;  1FKA O;  4H37 A;  1YJN V;  2A7W A;  1BMF G;  4NTY A;  4DR2 O;  1MMM A;  5D5P A;  2P7T C;  3OEH G;  3AG3 C;  1RM1 B;  4LFC O;  1GMG A;  2MK3 A;  4DK0 A;  2YIB A;  4BAY A;  1MAB G;  3STL C;  3X2Q C;  4JYA O;  2CH7 B;  4X64 B;  2ZM6 B;  4DV3 O;  1FFX B;  5KAF Z;  5C8Y B;  2GHY A;  1ZUQ A;  3N27 A;  4O2A B;  3BY6 A;  2D2C B;  2XAJ A;  1W2B U;  1SQF A;  2Q5Z A;  2XAH A;  3OM3 B;  1RM1 C;  1SQP H;  5IJ0 B;  4JGS A;  2F93 B;  3QTC A;  3ZRW B;  3T1H B;  4J80 A;  1GM9 A;  1A32 A;  4R6Z A;  5DM6 V;  3HKE A;  1TA8 A;  3UT5 A;  4Z2W A;  1I94 B;  3CCV V;  2AXT Z;  4JZG A;  2W0F C;  2F43 G;  1WP7 A;  2UUB O;  1GAX A;  3SGI A;  4OXS A;  5JCO A;  1I5Y A;  2HJD A;  4B08 A;  1PNK A;  3F5T A;  1XI1 A;  1GN2 A;  1Y66 A;  3FYI B;  1QCE A;  3CB2 A;  5LA6 B;  1IXM A;  1M4U A;  1SET A;  5BR8 O;  5FLX N;  2WLM A;  2PGG A;  1B6Q A;  4K8Z A;  5BZB A;  5H6Q A;  5LP6 C;  3JAR A;  1YDX A;  4F6E A;  3CC7 V;  1E79 G;  2ZD9 A;  3DXR B;  4LF5 B;  1FYJ A;  4UCS A;  1HR0 B;  2P67 A;  5LOV B;  2EIJ C;  2JS5 A;  2E76 B;  1WB7 A;  4IIJ B;  4JZ2 A;  4FIP C;  3C3S A;  4Z1V A;  2LW1 A;  4X9Q A;  4YJ2 B;  5B1O A;  4MVR A;  5CBG A;  5EBM C;  4DR1 B;  1IBK B;  5KMG A;  5IYD O;  4H0L B;  4YJ3 A;  3CEI A;  4DW0 A;  4CS3 A;  4R50 A;  2GBO A;  1VAR A;  1XIL A;  4KUM A;  4MW3 A;  1TUE B;  4FFK A;  1YIT V;  1GM7 A;  1NR7 A;  2CAZ C;  1OJH A;  1S5J A;  4LF4 B;  2PYL A;  4CS2 A;  3WB1 A;  5LHH A;  2LGW A;  5LMU O;  5KHJ A;  1NVP D;  4UCT A;  2RMK B;  2VQE B;  5L3D A;  1B3Q A;  4OPA A;  2ITC C;  1PM9 A;  3ABK B;  4QPK A;  1KU9 A;  3TET A;  4CC6 A;  4LNU A;  4XBF A;  4MT8 A;  2UU9 B;  4JI1 B;  1WP8 A;  1VQ5 V;  5E1A C;  1XNR O;  3E2E A;  1OCR B;  4NKG B;  1K3E A;  2BTO A;  4PJ0 Z;  1SES A;  3CHX A;  3K57 A;  5CA0 A;  3LDC A;  4E4E A;  4DV4 B;  1MZE A;  3D36 A;  4NXN B;  1F4M A;  2WAM A;  3B09 A;  3BVO A;  3CCM V;  3QNE A;  4ABM A;  3CPW U;  3AG2 C;  3KZI Z;  1OHH G;  3T1Y B;  2ZQM A;  2X6A A;  3ABK C;  4WFA V;  4WFG A;  5KX5 A;  3OMA B;  4I0X A;  2ITD C;  4JYY A;  5EYP A;  3ZRV A;  3ABT A;  4GYC B;  3LNN A;  2R9I A;  4OX9 O;  3JD3 A;  3PN1 A;  2FML A;  4DR5 O;  3CRM A;  4IL6 Z;  1VF6 C;  5KHH A;  4WBN B;  1V55 C;  4WFF A;  5LGT A;  3PJS K;  1IBM B;  4TWK A;  1SQV H;  1AIL A;  2DYS B;  3E35 A;  2CDY A;  3H1L H;  1KP3 A;  4CC5 A;  2A9H A;  1JVM A;  1FAF A;  1XMQ O;  2QTO A;  4W4L A;  1K8A W;  4FFB B;  2XOK G;  3MD0 A;  3JAW B;  1E1R G;  2CTP A;  2Q6A A;  2WLJ A;  3P32 A;  3F7Y C;  4J10 A;  2HHH B;  1XEQ A;  2F4V B;  1WA8 B;  1LUW A;  1YEW A;  2ZR2 A;  1GM8 A;  5K1P A;  2H8P C;  2W0X A;  1Y6X A;  2ZNI A;  4YIO A;  4J11 A;  2ZM6 O;  1R3K C;  2Q67 A;  1AJQ A;  1NTZ H;  5KHK A;  2JIZ G;  4DYL A;  4N23 A;  2GTA A;  1YJ9 V;  2IH3 C;  4LFB B;  4B7K A;  5B1A C;  1Y4M A;  2ETN A;  3HKB B;  1VQ4 V;  5EIB D;  3G4S V;  1FFX A;  5L3F A;  3FYE B;  3K5O A;  5C8Y A;  1YIJ V;  2BOC C;  4O2A A;  2YXH A;  5F2V O;  3HKC B;  3RYF B;  2JK5 C;  2GUZ B;  3K79 A;  1ZL8 A;  1RFY A;  2V7Q G;  4YHH B;  5L3E A;  2AHY A;  3H1H H;  1KC8 W;  1IVS A;  2JGD B;  3B8N A;  3M7M X;  3R66 A;  4DUZ B;  1BZK A;  5GON B;  5IJ0 A;  4HNA B;  3CCS V;  1EN6 A;  4GT1 A;  4CBC A;  3OTO B;  4EFE A;  3ZCC A;  4TSF G;  4GKJ O;  3OMN B;  2ZDI C;  4O4L A;  1YI2 V;  1XNQ O;  4JI0 B;  4MTF A;  4LR3 A;  5FNV B;  1MSD A;  2RCV A;  1N32 B;  4LH6 A;  4TQF A;  3NXS A;  1M56 C;  1R3I C;  2JEU A;  4JI4 B;  1UFI A;  2PUS A;  1HNZ O;  2DW4 A;  3T1C A;  5B1B B;  4PDL A;  1NR1 A;  3ZHQ A;  4CH5 A;  1YTF B;  1XL4 A;  3ICX A;  2ZE7 A;  4LF5 O;  4X89 A;  2FYU H;  3WB0 A;  3DXR A;  2XAQ A;  1O9H A;  1IXB A;  5LOV A;  3OE7 G;  1XDC A;  3FB5 C;  2HG5 C;  1JJ2 U;  1URF A;  4JTD B;  4O4H A;  4TQD A;  2YID A;  1H2N A;  3OGC C;  3CJH A;  5AG2 A;  1WAZ A;  4FLW A;  2XT9 A;  3H1J H;  2JEX A;  2ZCE A;  5B1B C;  3BHP A;  3HPL C;  1EN5 A;  2EBO A;  2EIN C;  3HKE B;  3UT5 B;  3K08 A;  2E75 B;  3K0D A;  4JI7 B;  3CS5 A;  4MTG A;  2VQE O;  2WLL B;  1K5S A;  3ZHS A;  1NS1 A;  4YY3 O;  4JI2 B;  1FXV A;  2UU9 O;  3E8B A;  3GWO A;  3CMA V;  3J81 N;  3BPZ A;  4PDR A;  1AB3 A;  2ZE5 A;  1UJW B;  5LHG A;  5JH7 B;  4U7N A;  2UXC O;  1GK9 A;  4TT3 G;  4D6T H;  3EHB B;  3BA9 A;  4UCR A;  3JAR B;  3FFQ A;  5LYJ B;  4GX2 A;  3ZN0 A;  4NXN O;  3K03 A;  1K92 A;  5TIS Z;  2B1G A;  5IT9 N;  1Q6H A;  2LFR A;  5JCO C;  1JA8 A;  3CXC U;  3ETE A;  3CX5 F;  3CCR V;  2M7W A;  4PDV A;  4BR6 A;  1Q82 W;  1I5X A;  5KMG B;  3RYC B;  1Q90 D;  3JD2 A;  1DGS A;  1LUV A;  2LW7 A;  3LDD A;  2Y4U A;  1VF7 A;  3SDL A;  1XRE A;  5DED A;  1NTM H;  4MW8 A;  5LHI A;  1VIB A;  3OUF A;  1IBM O;  2XAG A; 
#chains in the Genus database with same CATH homology
 3BY6 A;  2LFS A;  3ABM B;  4Q20 A;  4QPJ A;  3SPG A;  1CEZ A;  2BOB C;  1FXK A;  1K7D A;  2OTJ V;  3ZMZ A;  3TCU A;  3BEH A;  1VQK V;  4I5S A;  3W7S A;  2XAJ A;  2OT5 A;  4RQF A;  3I56 V;  1W2B U;  3RVY A;  1V55 B;  3CCQ V;  2XAH A;  4WFH A;  2P6J A;  2X6B A;  2Y48 A;  2KB1 A;  3E8H A;  3OM3 B;  1YSC A;  4BIZ A;  1RM1 C;  1NBM G;  1AI5 A;  4JGS A;  3ZRW B;  1GM9 A;  5H9C A;  4R6Z A;  5DM6 V;  1DF4 A;  2IH1 C;  3CME V;  3CCV V;  2OTL V;  2XAS A;  3QO8 A;  4MVU A;  2W0F C;  1ZWI C;  2F43 G;  1K5Q A;  1PNL A;  1K9M W;  4OXS A;  2B1I A;  3G6E V;  3E89 A;  4XDL A;  1I5Y A;  2ZXW B;  3FB7 C;  1PNK A;  4QJF B;  3AG1 C;  3ZMV A;  1VQP V;  3FB8 C;  3ABM C;  4FK5 C;  4FMT A;  1Y66 A;  2EJR A;  2WLN A;  3FYI B;  4J9Z B;  2HFE C;  1XL6 A;  1L1F A;  1QCE A;  1ROP A;  1IXM A;  4E2L A;  4QNH B;  2A79 B;  4BW5 A;  2Y69 B;  1SET A;  2IJH A;  2WLM A;  5L3G A;  5B1A B;  2QE7 G;  1Q86 W;  1OCO B;  2JJ1 G;  1BHA A;  2IJK A;  1B6Q A;  2DYR B;  5BZB A;  4F4L A;  3QO5 A;  5H6Q A;  2YEV A;  3OEE G;  4P9P A;  5EC2 C;  3CC7 V;  3CC4 V;  1J95 A;  1E79 G;  1JCH A;  1AI4 A;  2ZD9 A;  2DWE C;  1OZ0 A;  2EIL C;  3IFX A;  4MTX A;  2P67 A;  3SYC A;  2EIJ C;  2OCC B;  4FIP C;  2JJ2 G;  1CPY A;  1HWY A;  1K73 W;  5B1O A;  4MVR A;  4MTO A;  5CBG A;  2UXX A;  5EBM C;  3CCJ V;  4YXW G;  4UV9 A;  3W7X A;  3OMI B;  5IYD O;  3SYA A;  1KP2 A;  5IY5 C;  4R7C A;  4R50 A;  3T2M A;  1NQT A;  1V54 B;  2NNU A;  2Y69 C;  2QKS A;  3W7W A;  4KUM A;  4PA6 A;  4MW3 A;  3SPC A;  1TUE B;  2EIK B;  3JD4 A;  3KG2 A;  1JPX A;  1OCO C;  5IYC O;  1YIT V;  1SER A;  1GM7 A;  2HLD G;  1F51 A;  3LDE A;  3OW2 U;  1NR7 A;  2DYR C;  4WF9 V;  2D3O W;  4P2Z A;  2B5U A;  1QBZ A;  4PA3 A;  5HFL A;  1M9N A;  5LHH A;  1S3J A;  4L87 A;  1AJN A;  1M56 B;  3SYO A;  1GO3 F;  4GX5 A;  1NVP D;  3ZMU A;  2OCC C;  2ZR3 A;  5L3D A;  4JYB A;  2ITC C;  1NH2 D;  3ABK B;  3ZMS A;  2AHZ A;  3ASN B;  4QPK A;  3ZRW A;  4PEL A;  4U7O A;  1VQ9 V;  3TET A;  3E8F A;  3LSS A;  2PI4 A;  4XBF A;  4ZBM A;  4MT8 A;  3ZN1 A;  3ZRS A;  1VQ5 V;  4WFE A;  3RVZ A;  3T4Z A;  3MHH C;  5E1A C;  4UUJ C;  2EIK C;  2H94 A;  5B3S B;  2WLI B;  3K04 A;  3K9A A;  1EFR G;  4RQE A;  4G27 B;  4MVZ A;  1OCR B;  1QLN A;  3E2E A;  1K3E A;  4LCU C;  3LNM B;  4MS2 A;  1GTO A;  1SES A;  1N8R W;  1K97 A;  3OUS A;  3JCZ A;  4LP8 A;  3LDC A;  2NLJ C;  4DO2 A;  1PNM A;  2EZO A;  3SPJ A;  3D3I A;  1EBO A;  3EFF K;  3D36 A;  1F4M A;  2WAM A;  3CCM V;  3QNE A;  3CPW U;  2IJJ A;  3AG2 C;  4MVS A;  2P90 A;  1OHH G;  1M57 B;  2WWW A;  2ZQM A;  4JAS A;  2X6A A;  1R6N A;  3ABK C;  4WFA V;  3B77 A;  3ASN C;  2EIN B;  3E8G A;  2WLL A;  3ABL B;  4WFG A;  2DQ0 A;  3F5W C;  3OMA B;  2ITD C;  3OR6 C;  2V1D A;  3SPH A;  5LBQ A;  3ZRV A;  2UXN A;  1THZ A;  1G4Y B;  1QR9 A;  4EKW A;  3ABT A;  1YJW V;  2Z5U A;  5B3S C;  4GX1 A;  5CBF A;  2R9I A;  2A0L A;  3JD3 A;  1NVP B;  1VQM V;  3RBZ A;  4P30 A;  3SPI A;  1MSW D;  5EK0 A;  1V55 C;  2WLH A;  4WFF A;  4H33 A;  1NH2 B;  5LGT A;  4MVQ A;  3PJS K;  1VQ6 V;  4ASU G;  3ML0 A;  3DGE A;  4XDK A;  4TWK A;  1K34 A;  2DYS B;  3E35 A;  3CCL V;  1QVF U;  4N21 A;  3SYP A;  1KP3 A;  4GCZ A;  1H8E G;  4I9W A;  4G2K A;  2A9H A;  1JVM A;  2Z3Y A;  2QTO A;  1R3J C;  2EIM B;  1AI7 A;  1K8A W;  5EC1 C;  1M57 C;  1CP9 A;  2XOK G;  3MD0 A;  4R8C A;  3UM7 A;  2QM7 A;  1ARO P;  4MVO A;  1E1R G;  1JQ0 A;  2IU3 A;  1DLB A;  2Q6A A;  2WLJ A;  3ABL C;  3OFN G;  1H38 A;  3P32 A;  1H2G A;  1VQO V;  2C2A A;  3F7Y C;  2WSS G;  5KA6 A;  1COW G;  2ZXW C;  5KA5 A;  1QVG U;  1WLE A;  5IYB O;  1FXH A;  5IDJ A;  2ZR2 A;  1GM8 A;  4UVB A;  2HKO A;  3JD0 A;  5KUM A;  1R73 A;  3H01 A;  2H8P C;  4HAM A;  2CK3 G;  1LNQ A;  5EBL C;  3K3W A;  4RUF A;  1QLE B;  1R3K C;  2Q67 A;  1AJQ A;  3AG3 B;  4JPR A;  4QIW F;  3ZRX A;  4JTA B;  2JIZ G;  1VQN V;  2WPD G;  4N23 A;  1KD1 W;  1YJ9 V;  2IH3 C;  2X6C A;  4LBE C;  2LP7 A;  3WG7 B;  1K4C C;  4RO2 A;  5B1A C;  1S76 D;  4JF3 A;  1E1Q G;  3IGA C;  1Y4M A;  1VQ4 V;  1YTF D;  3JYC A;  3G4S V;  1G8M A;  3G71 V;  5L3F A;  1RPO A;  1SZT A;  3X2Q B;  1NKD A;  3FYE B;  1JOY A;  1YIJ V;  2EIM C;  1OCZ B;  2BOC C;  4JAV A;  3IC7 A;  3K06 A;  3ZIA G;  2DQ3 A;  4UXN A;  3JD1 A;  2JK5 C;  3K79 A;  1F4N A;  4X88 A;  4MVM A;  2V7Q G;  5L3E A;  2AHY A;  1KC8 W;  3B8N A;  3ETG A;  2IU0 A;  1PL0 A;  1OCC B;  3CD6 V;  3CCS V;  3TK1 A;  5CN0 A;  3W7U A;  4JTC B;  4GT1 A;  1ORQ C;  2YSU B;  1S77 D;  4CBC A;  3QO7 A;  1QLE C;  2GSM B;  1RPR A;  1V54 C;  3ZCC A;  2HVK C;  4HZ3 A;  4TSF G;  3OMN B;  3UKM A;  3CC2 V;  2ZDI C;  3WG7 C;  1YI2 V;  3VOU A;  5KUK A;  1MOF A;  1P7B A;  4GX0 A;  1KKD A;  4MTF A;  1F23 A;  4WCE V;  1YHQ V;  3OAA G;  2Q68 A;  1AJP A;  3DTU B;  1S72 V;  3M99 B;  2IW5 A;  3NXS A;  2X7R B;  4J9Y B;  5L3C A;  3STZ C;  1M56 C;  1VQL V;  2IJI A;  1R3I C;  2JEU A;  1GKF A;  4LC1 A;  1AI6 A;  5H6R A;  3AG1 B;  2K1E A;  4X8A A;  1JX9 A;  1K33 A;  2R9R B;  4DXW A;  4BIU A;  2DW4 A;  3T1C A;  1FFT B;  5B1B B;  4G28 B;  4PDL A;  1BL8 A;  1NR1 A;  1YTF B;  1XL4 A;  1OCC C;  1AR1 B;  5LGU A;  2FTK A;  4X89 A;  1FS0 G;  3ABU A;  1PKX A;  1W0J G;  3MHS C;  4FPP A;  4QE7 A;  1NJI W;  3R65 A;  1BHB A;  3A0R A;  2W6I G;  2XAQ A;  2W6J G;  2QA4 V;  1OCR C;  3CCU V;  3OE7 G;  4PA9 A;  3RW0 A;  4ZKI A;  3FB5 C;  4RUE A;  2HG5 C;  1EZJ A;  4XDJ A;  3LSQ A;  3ASO B;  1JJ2 U;  4CZZ A;  2EIL B;  3E86 A;  4JTD B;  3FB6 C;  1FXK B;  2EIJ B;  2EZP A;  3WFV A;  1R3L C;  3OGC C;  1SRY A;  2X0L A;  5LGN A;  1ENV A;  1KEC A;  3LUT B;  5J9P C;  4UV8 A;  4PA7 A;  2PI5 A;  4PA4 A;  3VBB A;  2JEX A;  2XND G;  1S5H C;  2ZDI A;  5L3B A;  5IY5 B;  5B1B C;  3E83 A;  3HPL C;  2EBO A;  3GB7 C;  2EIN C;  3I55 V;  4KFM A;  5GW7 A;  3K08 A;  3K0G A;  3SYQ A;  2ATK C;  3CP1 A;  3K0D A;  5EBW C;  2HVJ C;  5FL7 G;  1P4R A;  2HJF C;  4MTG A;  4WFB V;  1DF5 A;  2HR3 A;  2WLL B;  5CA3 A;  1K5S A;  2QEX V;  1QR8 A;  1WPX A;  2WLK A;  3OR7 C;  1FXV A;  5C93 A;  3ZJZ A;  3ASO C;  3E8B A;  3GWO A;  3P30 A;  5CMU A;  3CMA V;  1FXK C;  2DYS C;  3HB3 B;  4PDR A;  3AEI A;  4PDM A;  4P9O A;  4MSW C;  1UJW B;  1S0V A;  3SJQ C;  1K4D C;  5LHG A;  3AG4 B;  4UVA A;  3ZMT A;  2DWD C;  4RAI A;  2WLI A;  4U7N A;  4JYC A;  1DTO A;  1VQ7 V;  1GK9 A;  1PD3 A;  3B8M A;  2Q69 A;  4TT3 G;  3EHB B;  3F7V C;  2YEV B;  2XAF A;  4GX2 A;  4H37 A;  3ZN0 A;  1VQ8 V;  1KQS U;  1YJN V;  3K03 A;  1H8H G;  1K92 A;  2B1G A;  4HYO A;  1BMF G;  3W7T A;  4Z1M G;  5DN6 G;  1W0K G;  2LFR A;  4QE9 A;  2P7T C;  1Q81 W;  3CXC U;  3OEH G;  3ETE A;  3AG3 C;  1RM1 B;  4KP4 A;  3CCR V;  3FKS G;  2M7W A;  4PDV A;  1GMG A;  2MK3 A;  2JDI G;  1Q82 W;  1I5X A;  3JD2 A;  4BAY A;  3ETD A;  4FJC C;  3AG2 B;  1MAB G;  5CBH A;  3CCE V;  1R6K A;  3LDD A;  4JAU A;  3STL C;  5HFM A;  3X2Q C;  1M1K W;  3CYO A;  3T4D A;  4UVC A;  3AG4 C;  1OCZ C;  2QM8 A;  5B1N A;  4MW8 A;  1Q7Y W;  1MG1 A;  5LHI A;  1M90 W;  3OUF A;  2XAG A;  2GHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...