3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Membrane protein
source organism Bacillus cereus
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
4JTCB 3SPHA 5B1AC 3TETA 4R7CA 4RO2A 4R6ZA 3OR6C 5BZBA 4PA7A 2HVJC 2WLHA 4J9ZB 4LCUC 3OGCC 3OUSA 2DWEC 5KUMA 3K06A 3FB5C 2DYSC 4UUJC 2IH3C 2Y69C 2WLLB 3UM7A 3LNMB 2WLKA 3E83A 2Q67A 3F5WC 1J95A 4XDJA 1XL6A 4MVMA 4LBEC 3R65A 3ASNC 4PDMA 2NLJC 3AG2C 3RW0A 1R3LC 3LDCA 4PA4A 5EBLC 2K1EA 3SPJA 3ABMC 5EBMC 3SPGA 1P7BA 3T4DA 4WFFA 4QNHB 1ZWIC 3SPCA 3LUTB 4WFGA 2A0LA 4RUEA 4J9YB 3IFXA 4JTAB 2ATKC 3RBZA 3ASOC 5EC2C 2DWDC 1M56C 3EFFK 1K4CC 2W0FC 4X8AA 4RUFA 4MVUA 3E8FA 4KFMA 3T4ZA 3JYCA 1BL8A 3AG3C 3K03A 3K04A 4XDKA 4PDLA 2ZXWC 1KKDA 2X6BA 4BW5A 4MS2A 4MTFA 5EBWC 4GX0A 3F7VC 4MVZA 5J9PC 4P2ZA 2BOBC 1R3IC 2IH1C 4WFHA 1ORQC 2WLLA 2EIJC 4MTGA 2DYRC 3OUFA 2HG5C 2A9HA 3FB8C 4GX1A 1JVMA 4WFEA 4R50A 5CBFA 3UKMA 4F4LA 4HZ3A 1S5HC 2WLIB 3HPLC 4MVSA 2X6AA 4MVOA 4EKWA 2HVKC 1XL4A 2Q6AA 3FB7C 4XDLA 3E86A 4H33A 1V55C 2JK5C 3ABLC 3PJSK 4I9WA 3K0GA 2H8PC 4PDVA 2R9RB 2WLJA 2EIKC 4GX5A 5KUKA 3E8GA 4MVQA 1QLEC 2OCCC 2QKSA 2WLNA 2WLIA 4MVRA 4X88A 4QE9A 4DXWA 4MTOA 2AHYA 4GX2A 3AG4C 3K08A 4LP8A 3SPIA 3TCUA 4PA6A 5B3SC 4PDRA 3SYOA 4PA3A 3SYPA 2WLMA 5CBGA 4H37A 2HFEC 2Q69A 2Q68A 2EINC 3IGAC 1LNQA 2AHZA 5EK0A 1V54C 4MW3A 3E89A 3LDDA 2BOCC 4MW8A 3SJQC 3F7YC 4ZBMA 5B1BC 4CBCA 3RVZA 3RVYA 3LDEA 1K4DC 3KG2A 1OCCC 3AG1C 5E1AC 4P30A 3E8BA 3K0DA 2A79B 4QE7A 4RAIA 4JTDB 3ZRSA 3STZC 2P7TC 4G27B 1OCOC 4R8CA 1OCRC 2YEVA 4HYOA 3SYAA 3SYQA 3E8HA 4P9OA 5IY5C 4X89A 2QTOA 2ITCC 3T2MA 1R3JC 5CBHA 2ZD9A 4OXSA 3OR7C 3VOUA 1G4YB 3FB6C 4MSWC 3GB7C 2X6CA 4G28B 3BEHA 4PA9A 3WG7C 1OCZC 3STLC 3X2QC 5EC1C 2EILC 4P9PA 4TWKA 1M57C 3T1CA 3SYCA 2KB1A 2EIMC 2ITDC 3ZJZA 1R3KC 3ABKC 2HJFC
chains in the Genus database with same CATH superfamily
5B1AC 2RNBA 4RO2A 1ZX3A 4N23A 2WSSG 1VQ8V 2DWEC 4YHHO 4F6RA 1IZ3A 5B1NA 1VQ9V 4UB6Z 5EYPB 3BY6A 5ITZB 3AK1A 3ZN1A 3ZHRA 4U3FH 5EBLC 4I5SA 4JI4O 2BTQA 4LF8O 1Q86W 2DW4A 1WB7A 4O4IA 3B2EE 2NN4A 3EHBB 3ASNB 4FLYA 2O57A 5JJEB 2KSDA 4PHZA 2XAGA 3ZHVA 3DTUB 3I55V 4EB6B 2JS5A 4U3JA 3VQYA 3QO8A 2N04A 1PM9A 4PD4F 2OCHA 1W0JG 4AILC 1SQPH 4WFBV 1N34B 1KC8W 3A8TA 5CMUA 4EKWA 2CUGA 1PNKA 3ABLC 3CB2A 4IL6Z 1L8DA 2H8PC 1W59A 3W7XA 2F43G 4DV2O 2QKAA 3CC4V 3KCXA 1VQLV 2Q8VA 4JAVA 3H1HH 4DR7O 1EZVH 5IY5B 1N33B 4FMTA 2QDOA 4DV0O 3RT3C 4DR4B 1U96A 2W6JG 3WFVA 2BOCC 4BIZA 1H8EG 1PL0A 3ETGA 2OIEA 1TVKB 4D7SA 4P30A 1IBLB 4JGSA 2RCVA 2JEXA 1NR1A 1I94B 1VARA 2QTOA 3RFRA 3SJBC 2OTJV 2CDYA 3CJHB 1UJWB 2FB5A 4OPHA 3U0ZA 3T1CA 3DXRA 2VQEB 4X65O 2JS3A 3ZJZA 1SF9A 2DN9A 2WLHA 1N0JA 5KUMA 2KQXA 3CWBH 5B66Z 2IM9A 2IBZH 4WBNA 4UVCA 4X64O 2UXDO 2UXCO 3RYHA 4BIUA 1NTZH 1KU9A 1Q5OA 1WNSA 1N8RW 3ABMC 3ZMUA 2UU9O 4LF8B 4QNHB 2ODMA 4TUYB 1M56C 4DYLA 1XILA 1NU1H 5F2VO 1JFFB 1E79G 1BL8A 4QPKA 1FXHA 1QR8A 1YZBA 4I50A 1XI1A 2X6BA 2QM4A 4MS2A 4MTFA 4DUZB 5EBWC 1XQ8A 1Y76B 2P5OA 4OX9B 2UXBO 1ZSPA 3AG2B 4LNUA 4GKJO 1BCCH 4NTYA 3HKBA 4JI7B 3OEHG 3UKMA 5L3DA 1SQXH 3THOA 3JD4A 1GTOA 2LFSA 4F6EA 1NS1A 1EM1A 2F95B 4DV4O 4DR4O 4K35A 1JOYA 1B6QA 1WN7A 4Z1MG 1TGOA 4PDVA 2R9RB 4JI8O 2A3QA 1R6NA 1D5AA 4MVRA 3K08A 1J5EO 4BWAA 2JGUA 4YIPA 2EIKB 1VQMV 3ZHUA 1Q3EA 1V54C 1X59A 3AG3B 2XASA 3N27A 4NB5A 2PF4E 4NXMB 4CBCA 1K4DC 3AG1C 4DR2B 4RAIA 2YI9A 5B1AB 5JH7A 3X2QB 1M9NA 3D3QA 4P9OA 1EN6A 1AP5A 4X89A 2HP8A 2DOSA 5KX5B 4LR3A 3CD6V 4DR5B 3BHPA 5CA0B 3JAKA 1K97A 2UUCO 2WA4A 4J80A 3CMAV 1FJGO 3TXQA 2Q0OC 4GZRB 3B4SA 3OTFA 1GK9A 5C8YA 1XHXA 3JCZA 1IXMA 5HFMA 3CCMV 1I5XA 1JR9A 3UT5B 3I56V 3DXRB 3SPJA 1XMOO 3ASOC 4O4HA 1K8AW 4RUFA 1QR9A 4LFAO 1V55B 5L3GA 3ZBHA 1SQBH 2E5LB 2EILB 5A9GA 2JGDA 3ZMTA 1IBKB 2FL4A 4YJ3A 5KHIA 1NQTA 4DRXA 4GUNA 3AEIA 1V54B 2BOBC 1WAZA 5IJ0A 5BMVA 4O4IB 4R50A 2ZE7A 1XNRO 2DJVA 1K5SA 3P32A 4GYCB 1OCRB 2WWWA 2YSUB 4X9QA 2IU3A 1FXKA 3QTCA 2QWNB 4DR3B 3CE2A 3K0GA 2Z5UA 5B1OA 3UCSC 4GX5A 3R66A 2XTAA 4LP8A 4PA6A 3SYOA 5GTHZ 2Q7EA 2AHZA 1YJ9V 4FFKA 1G6UA 1SZXA 1EBOA 3WB2A 1KP3A 5A2QN 1M5IA 1YJNV 3CXHF 4I9QA 1W0KG 2A79B 1R73A 3SYQA 2PYLA 5H6QA 1LR1A 5LA6A 2YIBA 4UCOA 5CB4B 3ZMVA 3CRMA 1KUQA 4ASUG 2CK3G 1ROPA 1SQFA 1HR0O 3CCLV 2M6YA 1AILA 4PA7A 1URFA 4J9ZB 2Q73A 4LH7A 1M56B 1K92A 5IT9N 1JX9A 3ZHSA 5B1BB 4MVMA 2VRZA 4JPRA 3RW0A 1QNMA 4JI0B 4C7UA 3I5DA 1H8HG 5IYZA 1DGSA 3BA9A 1OV9A 3BCCH 4B3MO 2BSKA 2YICA 1K4CC 4E4EA 4LF9B 2DQ0A 3JASB 4J10A 4MVUA 2LQTA 2ZDIC 5JVDB 2AGAA 1PP9H 4BW5A 4FM1A 1UFIA 3L75H 4IIJA 2CTWA 4OPAA 2P90A 3OE7G 1VQ5V 2D2CB 2B1IA 2DYRC 3HKDB 3J80N 2YIDA 3W7TA 2WAMA 5J2TA 1YTFD 5IYZB 3HPLC 2ZE5A 4MVSA 2HLDG 3K79A 2R9IA 1XL4A 1TA8A 3P3PA 3S3XA 1EN5A 3CXCU 4LF5B 5LGUA 3HB3B 2N05A 2JGDB 3A0RA 5E79Z 5CA0A 1NR7A 1HP8A 5KAIZ 2M7WA 4TQDA 1P7GA 1XEQA 1TUBB 1Q6IA 4ZBMA 5B1BC 1GM7A 1BS3A 2A7WA 1RM1C 2F4VO 4ZI7A 3ZRSA 1O9GA 1XREA 1XNQO 1YJWV 5EIBC 5JWPA 2YEVA 4FLTA 4UV8A 1XOUA 4X1IB 4NXNO 3MD0A 3OW2U 2YXHA 5FNVB 1PL4A 2YS8A 2H3OA 3ABKC 3GWOA 3OTOO 4O4HB 1IBMO 3FD9A 5JH7B 3OUSA 4X66O 5EZYA 2ZM6O 2HEPA 1Y67A 5KAFZ 3R65A 1ZL8B 4QJFB 4WFFA 1XMOB 5C8YB 1AROP 3DSQA 2A0LA 2GUZA 3CRQA 4YJ2A 3JAWB 1M90W 3ZRXA 2P6JA 1F23A 4GKKB 2Y69B 2NNUA 1S0VA 3QG5A 1KYOF 2BTOA 5LMUB 3O9OA 1SC5B 3AG4B 1AJQA 1TUEB 1YEWA 4HAMA 2EZPA 2JJ1G 3TGUH 4HZ3A 1HNZO 2WLIB 2OTLV 2IJIA 3E86A 2JK5C 1FXKC 4UVAA 3RYFB 4I9WA 4TT3G 4KL1A 1MOFA 3RWRD 3E8GA 1J5EB 4CC6A 4DXWA 1I94O 2UUAB 3FYEB 5LOVA 1ZLZA 2FKXA 2WLMA 1Q82W 4H37A 3E22B 3K5LA 4DW1A 5EK0A 1YXBA 4JI2O 1TVKA 1BHBA 3JAMN 4JYAB 1H38A 1DLBA 3OD4A 2ZT9B 2QTSA 3ZIAG 3STZC 3BA8A 1Q43A 4R8CA 3HKCB 4IYIA 4JV5B 2E75B 1VMGA 2ITCC 4OX9O 2UXBB 2P4VA 1D5NA 4MSWC 2UUBO 5CA1A 3JD2A 2F23A 3X2QC 4I50B 1COWG 1DK1A 2EIMC 1PV0A 3UT5A 4B7EA 2GTAA 4B3RB 5JJJB 1DF5A 2DYSC 1R6TA 3L70H 4GCZA 4LFBO 5IJ0B 3NXSA 3F5WC 3O65A 4XDJA 2MK3A 2NLJC 4DK0A 3PN1A 4N21A 1ZWIC 5BR8O 1YVWA 1K9MW 4B7KA 4YIOA 1K34A 3CCJV 1NH2B 2W0FC 3C90A 4K0KB 1QU7A 4HNAB 4NTWA 4RWUA 4LWSA 1IBKO 1GM8A 5KA5A 3SGIA 4PDLA 1VF6C 2ZXWC 5KMGA 3RYCB 3QO7A 1ORQC 1N36B 3ZS8C 3K5NA 5L3CA 3FB8C 4GX1A 4DR7B 2P22C 2YXLA 5EZYB 4Q20A 4U7OA 4AI8A 4E2LA 5L3EA 4YJ3B 1F51A 4H33A 1OHHG 1PKXA 4LF5O 1IURA 4JYAO 2PUSA 5KX5A 1SQQH 3G71V 2QKSA 1Q6UA 4BR6A 4X88A 4H44B 3ZX6A 1QHTA 2JVDA 2CGNA 2YEVB 1VF7A 3J7AU 3RN4A 2Q68A 4FZ1A 2EINC 3ABTA 4A5UB 4DR6O 4JI8B 3JSLA 3ETDA 4F6RB 2ZKOA 5JCOC 4H13B 4ZKIA 3G6BA 2LJ2A 4B3TB 4UXNA 2E76B 4TUYA 2EZOA 4LFBB 3BRCA 1BZKA 4NTXA 3WG7C 4ZOLA 2ZNJA 3E35A 3CCSV 5LYJB 1HNXB 3CRRA 3TETA 1ZTEA 1EN4A 1FFXA 3JSNA 5LMUO 3AG1B 3FB5C 4JASA 2F4VB 5KHKA 1YF2A 5IWAO 2JJ2G 3B40A 1DF4A 2XHBA 5CA1B 2LW1A 4TOIA 4JI3O 1MZEA 3IFXA 1US6A 3JD3A 4IYHA 2WA3A 1S76D 1L0LH 3K04A 2ZR2A 1NTKH 2BCCH 3A0HZ 1IVSA 2IH1C 4JYYA 2EX3A 4JI3B 2YC0A 3VBBA 4JI6O 2VQFO 3JALA 2BTQB 1AJNA 2Y48A 4JZGA 1IX9A 1Z5VA 1SERA 1JMKC 4XDLA 5GONB 2Q5ZA 1KQSU 3K59A 3CS5A 3WG7B 2CTQA 1QLEC 2WLNA 3UQ8A 2DE0X 4FLUA 2K9PA 4MTOA 4B08A 3KKYA 2OIGA 4X65B 1N33O 3SYPA 4B3SO 2UUCB 3N2KA 2ZE6A 4LFAB 4I7ZB 1VQNV 1B3QA 1B06A 5IYBO 4WBNB 5K1PA 3M8AA 2P7TC 4DR2O 1NT2B 3S3WA 2L6LA 4B3TO 1VQOV 4LF4B 3ASOB 1DTOA 3QF7A 1SQGA 1TUBA 2Q7GA 4FVMA 1IXBA 2EILC 2QGNA 1M57C 3KCYA 3TJTA 3JATB 1WPXA 1GN6A 4JTCB 1QQCA 1OCOB 4LC1A 5HFLA 5BZBA 3VQXA 2XNDG 1CPYA 4I4TA 4UUJC 1KBHA 2Y69C 5BMVB 1RSOB 3CYOA 3JARB 4NXNB 1WB8A 1OCZB 1K33A 3CHXA 3H1JH 3L72H 1R3LC 1BGYH 3E22A 3T4DA 3ETEA 4WFGA 4J9YB 1MSWD 5EC2C 3EFFK 4DR1O 2KG7A 1Z5WA 2VS0A 1HW7A 3JATA 3ZHQA 5GONA 4JF3A 3GVMA 5J9PC 1FYJA 4DK1A 1GN2A 2PY5A 4FM0A 2LGQA 2YXYA 3OUFA 4DV7O 5CBFA 1NKDA 3ZMSA 4FJCC 5LHGA 3D36C 3AK2A 3FB7C 2QWQB 1V55C 2JIZG 5LMNO 4I4TB 3T1YB 3C3TA 4DO2A 1FD9A 4YJ2B 5K1XA 5B3SC 1K73W 1AVMA 1SESA 1BHAA 3ZRVA 5CBGA 4DV3B 2C2AA 5KHHA 4O4JB 1GO3F 4B3RO 4X62B 2E3CA 3LDDA 4LF9O 4IIJB 1VEWA 5LP6C 2HHHB 4JAAA 4NVPA 4QE7A 5CB4A 1FS0G 2Q9LA 3SYAA 2UXXA 1B04A 3Q4HB 3CC7V 4FPPA 5IJ9A 2XAQA 3M7MX 2YIAA 2ARHA 1MNGA 1WLEA 4CZZA 4LF7O 5LL6Y 1GN4A 4JI2B 5FL7G 4R6ZA 4TQFA 3M99B 2XAJA 4IHJB 5DECA 1NH2D 1OJHA 3CCEV 1L0NH 3AG2C 3WB1A 4GLXA 4I0XB 5GTIZ 4ZHQA 1IBMB 4G2KA 4DR1B 5B5EZ 4KFMA 3ABLB 4QIWF 3WU2Z 4IGGA 1CXZB 1S5JA 3G67A 1KKDA 2FTKA 4LF6O 2AW9A 3D8CA 2LFRA 2XUMA 1JJOA 4UCUA 1QLEB 1YIJV 1BSMA 2VWKA 4DV7B 3BVOA 5BR8B 4K0KO 1S3JA 3LSQA 4DUZO 1NTMH 2B5UA 5DEDA 1F4NA 4CH5A 3OEEG 1Y4MA 5JVDA 1YHQV 4KP4A 2UXCB 3K57A 4GX2A 3TCUA 2R70A 1RP3B 4TV8B 4FLZA 3CC2V 1I0HA 2DYRB 3OT7A 3DGEA 4MW3A 4K8XA 5LGNA 2UUBB 4LFCO 2A06H 3RVZA 4H0LB 2FYUH 5DM6V 4J42A 4JTDB 1KECA 2Q7HA 1OCOC 1Y74B 1HNWO 1KP2A 2CH7B 5LOVB 3VQVA 1FAFA 3U11A 4OGQB 2ZD9A 3HKEB 3FB6C 1QLNA 2UU9B 2YI8A 4JI7O 2EJ7A 1N32B 2ILMA 4MTXA 1FJGB 3F5TA 1KMIZ 3FX7A 1SS3A 4J7ZA 4JI0O 2EBOA 5EBMC 5D5PA 1P7BA 3SPGA 3JAKB 3SPCA 1SKVA 4RUEA 4FZ0A 3GWKC 4X8AA 2ZIOA 4NXMO 3ZMZA 1O9HA 3JD0A 3JCUZ 1PD3A 1VQKV 2H94A 3RYCA 1SA0B 4CC5A 2PZSA 1XHZA 1JFFA 5IWAB 1P4RA 3EVKA 5BY1A 3CRCA 3CCRV 2EIJC 4MTGA 5GW7A 2HG5C 2GV9A 4IHJA 3B8MA 5B3SB 4UCTA 5JJNB 2QE7G 4Q6GA 2CE4A 4AHCA 2AXTZ 2DMXA 2N74A 4YY3O 4CS4A 2Q6AA 5H6RA 1H2KA 2XAFA 4AQYO 1N36O 3SJAC 4GT1A 1P49A 2AHYA 2QM7A 1FFTB 2EJRA 2GUZB 1H2NA 2HKOA 5D5QA 2Q69A 1PNMA 1Y66A 2DYSB 4WFAV 3IAYA 5L3FA 1AI5A 3IJ4A 1OCCC 3KG2A 4QPJA 5EYPA 2RJZA 1U97A 1Q8IA 1M93A 1MA1A 1V9PA 1THZA 5CBHA 1AJPA 3T1YO 1T5EA 1E1QG 4L87A 3H1IH 1OCZC 2GBOA 4L8JA 4JI1B 1I08A 2OWOA 2ETNA 5AG2A 2ZXWB 2OT5A 2V1DA 2ITDC 1KKCA 4R7CA 1BQ0A 2ZQMA 2YIBD 4LCUC 3K5OA 2W0XA 2BE3A 3T1HB 4X20A 3IC7A 2Z3YA 1P84F 3ML0A 2HJDA 4DV1O 2YDEA 3HR0A 3EXAA 4I55A 4BAYA 4O4JA 3RYFA 2XOKG 4JI4B 2DWDC 3APQA 1I5YA 3CMEV 4KHPB 3VQWA 2Y4UA 3JYCA 1Q81W 3A0BZ 5LHIA 2CTPA 3L71H 1MMMA 4D7TA 3Q4HA 3LSSA 3B77A 1R3IC 2WLLA 4Z2WA 2OCCB 2A9HA 3APOA 3ZCCA 3FAVA 4UVBA 4F4LA 4D6TH 5H5NA 3H1KH 3K3WA 4YY3B 2QSAA 1N34O 2JDIG 2YUAA 3NR7A 1RM1B 2EIKC 2E74B 2W6IG 2UUAO 3K58A 2GHYA 3MHSC 2V4DA 1W2BU 3IGAC 1H2SB 3JARA 2B1GA 1SQVH 1AI7A 4X1KB 4X1YB 1X4TA 5H2FZ 1GM9A 3E8HA 1HNWB 4UCVA 3OR7C 4JI6B 4ZHQB 4PV1B 3G4SV 2IJJA 2EULA 2F66C 2CGOA 4FLXA 1JPXA 1TAEA 3HKCA 1HNZB 3CEIA 3OR6C 4X66B 4RQEA 5LMNB 5H9CA 5IYCO 2IH3C 4PI0A 1NI8A 3E83A 3ICXA 4ABMA 1QVFU 2LP7A 2ZE8A 5LP6A 4DV1B 5JQGB 3OGIB 4PA4A 5FPRA 2MW2B 1Q7YW 1JCHA 2QJ1A 1AI6A 3HKDA 2ATKC 1XUQA 4KHPO 1GKFA 2VQEO 3AG3C 5J2TB 5EIBD 4DV5B 2HHHO 3L73H 3IC9A 4MVZA 1WPBA 1YITV 2IW5A 4U7NA 3WB0A 2L35A 4X1YA 4HBNA 2AZ0A 2P06A 5CA3A 3E2EA 2HVKC 4U3JB 2LW7A 1GN3A 4LF6B 3PJSK 5IJ9B 1K3EA 4W4LA 1LUWA 2WLJA 3ZN0A 4MVQA 3ABMB 1MSDA 2HR3A 1SZTA 4J7KA 4DV0B 3MHHC 5BXZA 1G8MA 3D36A 4JYBA 1Z2GA 4I0XA 4DR6B 2B9ZA 1BT8A 2QWPB 2ZINA 5KHGA 3UO3A 3OAAG 4HYOA 3P3NA 1LUVA 4UCSA 1GMGA 5LYJA 3T2MA 2GDSA 1AR4A 2RN9A 3VOUA 1SETA 4O2AA 4G28B 2LO1A 3QNEA 4EFEA 1N0NA 5EC1C 1YI2V 1RPOA 1KD1W 2FMLA 3SYCA 2HJFC 4GKKO 3AG7A 5KLVH 3K06A 1NJIW 2EIMB 2WLKA 3TXSA 4ICGA 1J95A 4PDMA 1QCEA 3FFQA 2EINB 3LDCA 4JYCA 4CH3A 4X62O 2F93B 3FAVB 3L74H 3LUTB 3ZRWA 3RBZA 3OTOB 1AI4A 1PNLA 3E8FA 2Y0PA 3W7WA 2ZM6B 3K03A 2IU0A 4XDKA 1NVPB 2QWRB 1YSCA 3RGBA 3RYIB 5J2UA 4DV3O 4WCEV 1M1KW 1BMFG 4FK5C 2QEXV 1S5HC 4TV9B 1AR1B 5IDJA 1BQZA 4DV6B 4DR3O 1SA0A 1S77D 5CN0A 5LA6B 2OCCC 3JASA 4JV5O 4HNAA 2JEUA 2DQ3A 3SPIA 1XBLA 3ETQA 1K7DA 1VF6A 2PTMA 5KA6A 1Y74A 1YDXA 3SJCC 4FFBB 1PPJH 1LNQA 2QWOB 1ZAUA 3E89A 2ZDIA 2UXNA 3ZHTA 2XAHA 4MW8A 3JD1A 3F7YC 3RYHB 3DC6A 4DW0A 4ZOLB 1MABG 1YCIA 4NKGB 2QM8A 4FLVA 3CCUV 4G27B 4UB8Z 3LSUA 1GH6A 2ZIMA 3FKSG 4X64B 3ABUA 4I55B 2RDCA 4LWSB 2PI5A 1VQ7V 3H1LH 2KB1A 2F1MA 2CH7A 3OGCC 1BE3H 3CRAA 2QR4A 2WLLB 3UM7A 3P30A 4CH6A 2Y0IA 3ASNC 2Z0AA 1VQPV 4LF4O 1ENVA 1FKAO 2K1EA 3B09A 3N2GB 2Q4PA 3HKBB 1R6KA 2R72A 1XMQB 2RMKB 1RPRA 1G1XB 3ABKB 1FXVA 4LF7B 1AB3A 3OM3B 2X7RB 1VQ4V 2PGGA 5KMGB 4CS2A 1N32O 5IYDO 1ZUQA 5IE9A 3A2FA 1CEZA 3BABA 1IDSA 2ZCEA 4LFCB 2X6AA 4MVOA 3SDLA 1H2GA 3KZIZ 3D3IA 4DV6O 4EB6A 2LGWA 3T1HO 3CCVV 3ZEDA 1CP9A 5LXTA 3K9AA 3AG4C 3OFNG 2WPDG 4UCRA 5LHHA 4JI5B 2QA4V 4DUYO 1WA8A 4NR1A 2ZNIA 4LNUB 3BAAA 4FLWA 5TISZ 5ITZA 3LDEA 4JI1O 4X20B 3MAQA 1RFYA 1FFXB 4JZ2A 1XNQB 3G80A 1OCRC 3L9DA 5IY5C 2NR5A 1R3JC 1YTFB 2CAZC 4LH6A 1GAXA 3BEHA 5DN6G 3N2GA 2VQFB 5L3BA 4P9PA 4FIPC 4AQYB 1EFRG 4FFBA 1OCCB 4QGPA 2KKWA 1M57B 4BIOA 3LNMB 4ZI7B 3J81N 3K5MA 1SRYA 1Y76A 1JA8A 2ADPA 3CJHA 1KB9F 3CCQV 2XT9A 2ADQB 3SR2C 4TSFG 5LXTB 1M4UA 2BSKB 1QVGU 1WJZA 4J41A 5JCOA 1OZ0A 3FYIB 5FNVA 5J2UB 3RYIA 1VQ6V 2GSMB 2PI4A 4DR5O 3OMAB 4GX0A 4P2ZA 1XDCA 4ZIBA 1NZ6A 3B8NA 1VIBA 3ZRWB 4B3MB 1JVMA 4JAUA 4KXRA 1E1RG 4GKJB 2JRIA 4MT8A 3UO2A 4W4KA 4DV5O 1FPOA 4KUMA 3HKEA 4PI2A 2WLIA 2ZR3A 4QE9A 2KG7B 1AP6A 1I7FA 4Z1VA 2D3OW 3QO5A 3H01A 2EIJB 4PA3A 3BFRA 1NBMG 2IJHA 2G38A 3SJQC 1S72V 3RVYA 1F4MA 2PYJA 1S5LZ 2UXDB 1UPGA 3N2KB 2P4KA 3E8BA 3K0DA 1EZJA 3CSXA 4EEQA 4O4LB 4IT5A 3W7UA 4TV8A 4RQFA 4DV4B 3OMIB 1Q6HA 3JAWA 5LBQA 1G4YB 3GB7C 1JQ0A 2X6CA 3U10A 3CX5F 1L1FA 1GRJA 3STLC 4TWKA 3CP1A 1ZL8A 1WP8A 1FXKB 2Q0AA 1HNXO 3SPHA 2CTRA 4CH4A 2HVJC 4WF9V 2VWJA 4YHHB 4X1KA 1IBLO 3H9VA 1HDJA 2Q67A 1Y6XA 1XL6A 2RQ6A 4LBEC 5JQGA 3QVNA 3C3SA 2X0LA 1H2MA 3AK3A 4PELA 4CS3A 1Q90D 1XNRB 1QBZA 4O2BB 4K8ZA 4UV9A 4JTAB 3T4ZA 4UFZA 1H2LA 1JJ2U 3TK1A 4PJ0Z 3F7VC 5FLXN 2P67A 4TV9A 2V7QG 2IJKA 4WFHA 4YXWG 4WFEA 4O4LA 4BW9A 1VP7A 1VF5B 5LP6B 1XMQO 2OYQA 1AR5A 1K5QA 4O2AB 5KUKA 1HWYA 4X1IA 1F7YA 4NYKA 3BPZA 4J11A 4PDRA 5KHJA 4DUYB 1N4CA 2HFEC 4B3SB 4JI5O 1A32A 3LNNA 3G6EV 3K9SA 4J7JA 1R1BA 3DC5A 3MDSA 2QKCA 1HR0B 2AZ2A 1WP7A 4DV2B 4K3AA 5E1AC 4XBFA 1MG1A 2GTSA 2R9AA 3JALB 3OMNB 1NVPD 1WA8B 5FPOA 4EFBA 4DRXB 4OXSA 5C93A 3CPWU 1D2DA 5LGTA 4O2BA 3W7SA 4PA9A 2Y4TA 4FM2A 2E5LO 1MZFA 1RSOA 1R3KC
chains in the Genus database with same CATH topology
5B1AC 5FL7G 4RO2A 4R6ZA 4N23A 3M99B 2WSSG 1VQ8V 2XAJA 2DWEC 3OUSA 3K06A 1NJIW 5B1NA 1VQ9V 2EIMB 2WLKA 3BY6A 1J95A 1NH2D 3CCEV 3R65A 4PDMA 1QCEA 3ZN1A 3AG2C 2EINB 3LDCA 5EBLC 4I5SA 4JYCA 4QJFB 4WFFA 1Q86W 2DW4A 3LUTB 1AROP 2A0LA 3ZRWA 3RBZA 1M90W 3EHBB 2P6JA 3ASNB 3ZRXA 4G2KA 1F23A 1AI4A 2Y69B 1PNLA 3E8FA 3ABLB 4KFMA 4QIWF 2NNUA 2XAGA 3W7WA 3K03A 3DTUB 2IU0A 4XDKA 1S0VA 1NVPB 3I55V 1KKDA 2FTKA 3QO8A 2LFRA 1YSCA 3AG4B 1AJQA 1TUEB 1W0JG 1QLEB 4HAMA 1YIJV 2EZPA 2JJ1G 4WCEV 4WFBV 1BMFG 4FK5C 1M1KW 4HZ3A 2QEXV 1S5HC 1KC8W 1S3JA 2WLIB 2OTLV 1AR1B 5CMUA 5IDJA 4EKWA 3LSQA 2IJIA 3E86A 2B5UA 2JK5C 1FXKC 4UVAA 1PNKA 3ABLC 4I9WA 1F4NA 4TT3G 2H8PC 1S77D 1MOFA 3OEEG 1Y4MA 3W7XA 2F43G 1YHQV 3E8GA 5CN0A 4KP4A 2OCCC 3CC4V 4DXWA 2JEUA 2DQ3A 4GX2A 3SPIA 1VQLV 3TCUA 4JAVA 1K7DA 3FYEB 5KA6A 5IY5B 3CC2V 2DYRB 2WLMA 1Q82W 4FMTA 4H37A 1LNQA 3DGEA 5EK0A 4MW3A 3E89A 5LGNA 2W6JG 2ZDIA 2UXNA 2XAHA 2BOCC 4MW8A 3WFVA 3JD1A 3F7YC 1H8EG 1PL0A 3ETGA 4BIZA 1BHBA 3RVZA 5DM6V 1H38A 1MABG 4P30A 1DLBA 4JGSA 4JTDB 1KECA 3ZIAG 2JEXA 2QM8A 3STZC 3CCUV 4G27B 1NR1A 1OCOC 4R8CA 1KP2A 2QTOA 2ITCC 3FKSG 2OTJV 2ZD9A 3FB6C 4MSWC 1QLNA 3ABUA 3JD2A 1UJWB 3X2QC 1COWG 3T1CA 2PI5A 1VQ7V 2KB1A 2EIMC 4MTXA 3ZJZA 2WLHA 3OGCC 5KUMA 1DF5A 2DYSC 4GCZA 2WLLB 3UM7A 3NXSA 3P30A 4UVCA 3F5WC 4XDJA 3ASNC 2MK3A 2EBOA 2NLJC 4BIUA 1VQPV 1ENVA 1N8RW 2K1EA 3ABMC 5EBMC 3SPGA 1P7BA 4N21A 3ZMUA 4QNHB 1ZWIC 3SPCA 1R6KA 1K9MW 4RUEA 1K34A 1M56C 3CCJV 1NH2B 2W0FC 4X8AA 1RPRA 3ZMZA 3JD0A 3ABKB 1E79G 1FXVA 1BL8A 1PD3A 1VQKV 2H94A 4QPKA 1GM8A 5KA5A 1FXHA 1QR8A 3OM3B 4PDLA 2ZXWC 2X6BA 2X7RB 4MS2A 4MTFA 1VQ4V 5EBWC 1P4RA 3QO7A 3CCRV 1ORQC 3AG2B 2EIJC 4MTGA 5L3CA 5GW7A 2HG5C 3FB8C 4GX1A 5IYDO 3B8MA 4Q20A 5B3SB 3OEHG 3UKMA 4U7OA 4E2LA 5L3DA 1CEZA 5L3EA 2QE7G 3JD4A 2X6AA 1GTOA 2LFSA 4MVOA 2Q6AA 1H2GA 1JOYA 1F51A 3D3IA 4H33A 1B6QA 1OHHG 1PKXA 4Z1MG 4PDVA 5H6RA 2R9RB 3CCVV 1R6NA 2XAFA 1CP9A 3G71V 2QKSA 4MVRA 4X88A 4GT1A 3K9AA 2AHYA 2QM7A 3AG4C 3K08A 2WPDG 3OFNG 5LHHA 1FFTB 2YEVB 2QA4V 2EJRA 2HKOA 2Q69A 2EIKB 2Q68A 1VQMV 2EINC 1PNMA 1Y66A 2DYSB 1V54C 3ABTA 3AG3B 4WFAV 2XASA 4CBCA 3LDEA 1K4DC 1AI5A 5L3FA 3KG2A 1OCCC 3AG1C 4QPJA 4RAIA 3ETDA 5B1AB 3X2QB 1M9NA 1OCRC 4ZKIA 4P9OA 5IY5C 4X89A 4UXNA 1THZA 1R3JC 5CBHA 2EZOA 1YTFB 3CD6V 1AJPA 1E1QG 1K97A 3BEHA 4L87A 3WG7C 5DN6G 1OCZC 5L3BA 4P9PA 3E35A 2ZXWB 2OT5A 2V1DA 3CMAV 2ITDC 3CCSV 4FIPC 3TETA 4R7CA 2ZQMA 4LCUC 1GK9A 1EFRG 1OCCB 3AG1B 3FB5C 1M57B 3IC7A 2Z3YA 4JASA 3JCZA 1IXMA 5HFMA 3LNMB 3ML0A 3CCMV 1I5XA 1SRYA 2JJ2G 3I56V 3SPJA 1DF4A 4BAYA 3CCQV 2XOKG 3IFXA 3ASOC 2DWDC 1K8AW 1I5YA 3CMEV 4TSFG 4RUFA 3JD3A 1QR9A 1V55B 1S76D 3JYCA 5L3GA 1Q81W 1QVGU 5LHIA 3K04A 2EILB 1OZ0A 2ZR2A 3FYIB 3ZMTA 1VQ6V 2GSMB 2PI4A 1NQTA 3OMAB 4GX0A 3LSSA 3AEIA 3B77A 4P2ZA 1V54B 2BOBC 1R3IC 2IH1C 2WLLA 2OCCB 3B8NA 3ZRWB 2A9HA 1JVMA 3VBBA 3ZCCA 4JAUA 4R50A 4UVBA 1E1RG 1AJNA 2Y48A 4F4LA 1K5SA 3P32A 4MT8A 3K3WA 1OCRB 2WWWA 2YSUB 1SERA 2IU3A 1FXKA 2JDIG 4XDLA 3K0GA 1KQSU 2Z5UA 5B1OA 4KUMA 1RM1B 2EIKC 2W6IG 4GX5A 3WG7B 1QLEC 2WLNA 2WLIA 2ZR3A 4QE9A 4MTOA 4LP8A 2D3OW 2GHYA 3QO5A 4PA6A 3MHSC 1W2BU 3H01A 2EIJB 3SYOA 4PA3A 3SYPA 1NBMG 2AHZA 3IGAC 1YJ9V 2IJHA 1EBOA 1KP3A 3SJQC 1VQNV 5IYBO 1YJNV 1S72V 3RVYA 1F4MA 2B1GA 1W0KG 3E8BA 3K0DA 1EZJA 2A79B 1AI7A 3W7UA 2P7TC 4RQFA 1R73A 1GM9A 3E8HA 3OMIB 3SYQA 1VQOV 5H6QA 3ASOB 1DTOA 5LBQA 3OR7C 1G4YB 3G4SV 3GB7C 1JQ0A 2IJJA 2X6CA 3ZMVA 4ASUG 2CK3G 1ROPA 1L1FA 3STLC 2EILC 4TWKA 1JPXA 1M57C 3CP1A 1WPXA 1FXKB 3CCLV 4JTCB 3SPHA 1OCOB 4LC1A 3OR6C 5HFLA 5BZBA 4PA7A 2HVJC 2XNDG 4J9ZB 1CPYA 4WF9V 1M56B 4RQEA 4UUJC 5H9CA 1K92A 5IYCO 2IH3C 2Y69C 1JX9A 3E83A 2Q67A 5B1BB 1QVFU 2LP7A 1XL6A 3CYOA 4LBEC 4MVMA 4JPRA 1OCZB 1K33A 2X0LA 3RW0A 1R3LC 4PA4A 4PELA 1H8HG 3T4DA 3ETEA 1Q7YW 1JCHA 1AI6A 1QBZA 4WFGA 4UV9A 4J9YB 4JTAB 2ATKC 1MSWD 5EC2C 3EFFK 1K4CC 1GKFA 2DQ0A 4MVUA 2ZDIC 3T4ZA 3AG3C 1JJ2U 3TK1A 4BW5A 4JF3A 3F7VC 4MVZA 2P67A 5J9PC 2V7QG 2IJKA 4WFHA 2P90A 1YITV 3OE7G 1VQ5V 2B1IA 2DYRC 3OUFA 4YXWG 2IW5A 4U7NA 3W7TA 2WAMA 4WFEA 1YTFD 5CBFA 1NKDA 3ZMSA 4FJCC 5CA3A 5LHGA 3HPLC 4MVSA 3E2EA 2HVKC 2HLDG 3K79A 2R9IA 1XL4A 3FB7C 1V55C 1K5QA 3CXCU 3PJSK 2JIZG 1K3EA 3HB3B 5LGUA 2WLJA 3A0RA 3ZN0A 5KUKA 4MVQA 1HWYA 3ABMB 4DO2A 2HR3A 1NR7A 1SZTA 5B3SC 3MHHC 1K73W 1G8MA 4PDRA 1SESA 2M7WA 1BHAA 3D36A 4JYBA 3ZRVA 5CBGA 2HFEC 2C2AA 1GO3F 3G6EV 3LDDA 4ZBMA 5B1BC 1GM7A 1RM1C 5E1AC 4XBFA 1MG1A 4QE7A 1NVPD 3OMNB 3ZRSA 3OAAG 1YJWV 1FS0G 2YEVA 4HYOA 3SYAA 4UV8A 1GMGA 3T2MA 2UXXA 3MD0A 4OXSA 5C93A 3VOUA 3CPWU 3CC7V 5LGTA 3OW2U 4FPPA 1SETA 3W7SA 2XAQA 4G28B 4PA9A 3QNEA 5EC1C 1WLEA 4CZZA 1YI2V 1RPOA 1KD1W 3SYCA 1R3KC 3ABKC 2HJFC 3GWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTC B;  3SPH A;  5B1A C;  3TET A;  4R7C A;  4RO2 A;  4R6Z A;  3OR6 C;  5BZB A;  4PA7 A;  2HVJ C;  2WLH A;  4J9Z B;  4LCU C;  3OGC C;  3OUS A;  2DWE C;  5KUM A;  3K06 A;  3FB5 C;  2DYS C;  4UUJ C;  2IH3 C;  2Y69 C;  2WLL B;  3UM7 A;  3LNM B;  2WLK A;  3E83 A;  2Q67 A;  3F5W C;  1J95 A;  4XDJ A;  1XL6 A;  4MVM A;  4LBE C;  3R65 A;  3ASN C;  4PDM A;  2NLJ C;  3AG2 C;  3RW0 A;  1R3L C;  3LDC A;  4PA4 A;  5EBL C;  2K1E A;  3SPJ A;  3ABM C;  5EBM C;  3SPG A;  1P7B A;  3T4D A;  4WFF A;  4QNH B;  1ZWI C;  3SPC A;  3LUT B;  4WFG A;  2A0L A;  4RUE A;  4J9Y B;  3IFX A;  4JTA B;  2ATK C;  3RBZ A;  3ASO C;  5EC2 C;  2DWD C;  1M56 C;  3EFF K;  1K4C C;  2W0F C;  4X8A A;  4RUF A;  4MVU A;  3E8F A;  4KFM A;  3T4Z A;  3JYC A;  1BL8 A;  3AG3 C;  3K03 A;  3K04 A;  4XDK A;  4PDL A;  2ZXW C;  1KKD A;  2X6B A;  4BW5 A;  4MS2 A;  4MTF A;  5EBW C;  4GX0 A;  3F7V C;  4MVZ A;  5J9P C;  4P2Z A;  2BOB C;  1R3I C;  2IH1 C;  4WFH A;  1ORQ C;  2WLL A;  2EIJ C;  4MTG A;  2DYR C;  3OUF A;  2HG5 C;  2A9H A;  3FB8 C;  4GX1 A;  1JVM A;  4WFE A;  4R50 A;  5CBF A;  3UKM A;  4F4L A;  4HZ3 A;  1S5H C;  2WLI B;  3HPL C;  4MVS A;  2X6A A;  4MVO A;  4EKW A;  2HVK C;  1XL4 A;  2Q6A A;  3FB7 C;  4XDL A;  3E86 A;  4H33 A;  1V55 C;  2JK5 C;  3ABL C;  3PJS K;  4I9W A;  3K0G A;  2H8P C;  4PDV A;  2R9R B;  2WLJ A;  2EIK C;  4GX5 A;  5KUK A;  3E8G A;  4MVQ A;  1QLE C;  2OCC C;  2QKS A;  2WLN A;  2WLI A;  4MVR A;  4X88 A;  4QE9 A;  4DXW A;  4MTO A;  2AHY A;  4GX2 A;  3AG4 C;  3K08 A;  4LP8 A;  3SPI A;  3TCU A;  4PA6 A;  5B3S C;  4PDR A;  3SYO A;  4PA3 A;  3SYP A;  2WLM A;  5CBG A;  4H37 A;  2HFE C;  2Q69 A;  2Q68 A;  2EIN C;  3IGA C;  1LNQ A;  2AHZ A;  5EK0 A;  1V54 C;  4MW3 A;  3E89 A;  3LDD A;  2BOC C;  4MW8 A;  3SJQ C;  3F7Y C;  4ZBM A;  5B1B C;  4CBC A;  3RVZ A;  3RVY A;  3LDE A;  1K4D C;  3KG2 A;  1OCC C;  3AG1 C;  5E1A C;  4P30 A;  3E8B A;  3K0D A;  2A79 B;  4QE7 A;  4RAI A;  4JTD B;  3ZRS A;  3STZ C;  2P7T C;  4G27 B;  1OCO C;  4R8C A;  1OCR C;  2YEV A;  4HYO A;  3SYA A;  3SYQ A;  3E8H A;  4P9O A;  5IY5 C;  4X89 A;  2QTO A;  2ITC C;  3T2M A;  1R3J C;  5CBH A;  2ZD9 A;  4OXS A;  3OR7 C;  3VOU A;  1G4Y B;  3FB6 C;  4MSW C;  3GB7 C;  2X6C A;  4G28 B;  3BEH A;  4PA9 A;  3WG7 C;  1OCZ C;  3STL C;  3X2Q C;  5EC1 C;  2EIL C;  4P9P A;  4TWK A;  1M57 C;  3T1C A;  3SYC A;  2KB1 A;  2EIM C;  2ITD C;  3ZJZ A;  1R3K C;  3ABK C;  2HJF C; 
#chains in the Genus database with same CATH topology
 5B1A C;  2RNB A;  4RO2 A;  1ZX3 A;  4N23 A;  2WSS G;  1VQ8 V;  2DWE C;  4YHH O;  4F6R A;  1IZ3 A;  5B1N A;  1VQ9 V;  4UB6 Z;  5EYP B;  3BY6 A;  5ITZ B;  3AK1 A;  3ZN1 A;  3ZHR A;  4U3F H;  5EBL C;  4I5S A;  4JI4 O;  2BTQ A;  4LF8 O;  1Q86 W;  2DW4 A;  1WB7 A;  4O4I A;  3B2E E;  2NN4 A;  3EHB B;  3ASN B;  4FLY A;  2O57 A;  5JJE B;  2KSD A;  4PHZ A;  2XAG A;  3ZHV A;  3DTU B;  3I55 V;  4EB6 B;  2JS5 A;  4U3J A;  3VQY A;  3QO8 A;  2N04 A;  1PM9 A;  4PD4 F;  2OCH A;  1W0J G;  4AIL C;  1SQP H;  4WFB V;  1N34 B;  1KC8 W;  3A8T A;  5CMU A;  4EKW A;  2CUG A;  1PNK A;  3ABL C;  3CB2 A;  4IL6 Z;  1L8D A;  2H8P C;  1W59 A;  3W7X A;  2F43 G;  4DV2 O;  2QKA A;  3CC4 V;  3KCX A;  1VQL V;  2Q8V A;  4JAV A;  3H1H H;  4DR7 O;  1EZV H;  5IY5 B;  1N33 B;  4FMT A;  2QDO A;  4DV0 O;  3RT3 C;  4DR4 B;  1U96 A;  2W6J G;  3WFV A;  2BOC C;  4BIZ A;  1H8E G;  1PL0 A;  3ETG A;  2OIE A;  1TVK B;  4D7S A;  4P30 A;  1IBL B;  4JGS A;  2RCV A;  2JEX A;  1NR1 A;  1I94 B;  1VAR A;  2QTO A;  3RFR A;  3SJB C;  2OTJ V;  2CDY A;  3CJH B;  1UJW B;  2FB5 A;  4OPH A;  3U0Z A;  3T1C A;  3DXR A;  2VQE B;  4X65 O;  2JS3 A;  3ZJZ A;  1SF9 A;  2DN9 A;  2WLH A;  1N0J A;  5KUM A;  2KQX A;  3CWB H;  5B66 Z;  2IM9 A;  2IBZ H;  4WBN A;  4UVC A;  4X64 O;  2UXD O;  2UXC O;  3RYH A;  4BIU A;  1NTZ H;  1KU9 A;  1Q5O A;  1WNS A;  1N8R W;  3ABM C;  3ZMU A;  2UU9 O;  4LF8 B;  4QNH B;  2ODM A;  4TUY B;  1M56 C;  4DYL A;  1XIL A;  1NU1 H;  5F2V O;  1JFF B;  1E79 G;  1BL8 A;  4QPK A;  1FXH A;  1QR8 A;  1YZB A;  4I50 A;  1XI1 A;  2X6B A;  2QM4 A;  4MS2 A;  4MTF A;  4DUZ B;  5EBW C;  1XQ8 A;  1Y76 B;  2P5O A;  4OX9 B;  2UXB O;  1ZSP A;  3AG2 B;  4LNU A;  4GKJ O;  1BCC H;  4NTY A;  3HKB A;  4JI7 B;  3OEH G;  3UKM A;  5L3D A;  1SQX H;  3THO A;  3JD4 A;  1GTO A;  2LFS A;  4F6E A;  1NS1 A;  1EM1 A;  2F95 B;  4DV4 O;  4DR4 O;  4K35 A;  1JOY A;  1B6Q A;  1WN7 A;  4Z1M G;  1TGO A;  4PDV A;  2R9R B;  4JI8 O;  2A3Q A;  1R6N A;  1D5A A;  4MVR A;  3K08 A;  1J5E O;  4BWA A;  2JGU A;  4YIP A;  2EIK B;  1VQM V;  3ZHU A;  1Q3E A;  1V54 C;  1X59 A;  3AG3 B;  2XAS A;  3N27 A;  4NB5 A;  2PF4 E;  4NXM B;  4CBC A;  1K4D C;  3AG1 C;  4DR2 B;  4RAI A;  2YI9 A;  5B1A B;  5JH7 A;  3X2Q B;  1M9N A;  3D3Q A;  4P9O A;  1EN6 A;  1AP5 A;  4X89 A;  2HP8 A;  2DOS A;  5KX5 B;  4LR3 A;  3CD6 V;  4DR5 B;  3BHP A;  5CA0 B;  3JAK A;  1K97 A;  2UUC O;  2WA4 A;  4J80 A;  3CMA V;  1FJG O;  3TXQ A;  2Q0O C;  4GZR B;  3B4S A;  3OTF A;  1GK9 A;  5C8Y A;  1XHX A;  3JCZ A;  1IXM A;  5HFM A;  3CCM V;  1I5X A;  1JR9 A;  3UT5 B;  3I56 V;  3DXR B;  3SPJ A;  1XMO O;  3ASO C;  4O4H A;  1K8A W;  4RUF A;  1QR9 A;  4LFA O;  1V55 B;  5L3G A;  3ZBH A;  1SQB H;  2E5L B;  2EIL B;  5A9G A;  2JGD A;  3ZMT A;  1IBK B;  2FL4 A;  4YJ3 A;  5KHI A;  1NQT A;  4DRX A;  4GUN A;  3AEI A;  1V54 B;  2BOB C;  1WAZ A;  5IJ0 A;  5BMV A;  4O4I B;  4R50 A;  2ZE7 A;  1XNR O;  2DJV A;  1K5S A;  3P32 A;  4GYC B;  1OCR B;  2WWW A;  2YSU B;  4X9Q A;  2IU3 A;  1FXK A;  3QTC A;  2QWN B;  4DR3 B;  3CE2 A;  3K0G A;  2Z5U A;  5B1O A;  3UCS C;  4GX5 A;  3R66 A;  2XTA A;  4LP8 A;  4PA6 A;  3SYO A;  5GTH Z;  2Q7E A;  2AHZ A;  1YJ9 V;  4FFK A;  1G6U A;  1SZX A;  1EBO A;  3WB2 A;  1KP3 A;  5A2Q N;  1M5I A;  1YJN V;  3CXH F;  4I9Q A;  1W0K G;  2A79 B;  1R73 A;  3SYQ A;  2PYL A;  5H6Q A;  1LR1 A;  5LA6 A;  2YIB A;  4UCO A;  5CB4 B;  3ZMV A;  3CRM A;  1KUQ A;  4ASU G;  2CK3 G;  1ROP A;  1SQF A;  1HR0 O;  3CCL V;  2M6Y A;  1AIL A;  4PA7 A;  1URF A;  4J9Z B;  2Q73 A;  4LH7 A;  1M56 B;  1K92 A;  5IT9 N;  1JX9 A;  3ZHS A;  5B1B B;  4MVM A;  2VRZ A;  4JPR A;  3RW0 A;  1QNM A;  4JI0 B;  4C7U A;  3I5D A;  1H8H G;  5IYZ A;  1DGS A;  3BA9 A;  1OV9 A;  3BCC H;  4B3M O;  2BSK A;  2YIC A;  1K4C C;  4E4E A;  4LF9 B;  2DQ0 A;  3JAS B;  4J10 A;  4MVU A;  2LQT A;  2ZDI C;  5JVD B;  2AGA A;  1PP9 H;  4BW5 A;  4FM1 A;  1UFI A;  3L75 H;  4IIJ A;  2CTW A;  4OPA A;  2P90 A;  3OE7 G;  1VQ5 V;  2D2C B;  2B1I A;  2DYR C;  3HKD B;  3J80 N;  2YID A;  3W7T A;  2WAM A;  5J2T A;  1YTF D;  5IYZ B;  3HPL C;  2ZE5 A;  4MVS A;  2HLD G;  3K79 A;  2R9I A;  1XL4 A;  1TA8 A;  3P3P A;  3S3X A;  1EN5 A;  3CXC U;  4LF5 B;  5LGU A;  3HB3 B;  2N05 A;  2JGD B;  3A0R A;  5E79 Z;  5CA0 A;  1NR7 A;  1HP8 A;  5KAI Z;  2M7W A;  4TQD A;  1P7G A;  1XEQ A;  1TUB B;  1Q6I A;  4ZBM A;  5B1B C;  1GM7 A;  1BS3 A;  2A7W A;  1RM1 C;  2F4V O;  4ZI7 A;  3ZRS A;  1O9G A;  1XRE A;  1XNQ O;  1YJW V;  5EIB C;  5JWP A;  2YEV A;  4FLT A;  4UV8 A;  1XOU A;  4X1I B;  4NXN O;  3MD0 A;  3OW2 U;  2YXH A;  5FNV B;  1PL4 A;  2YS8 A;  2H3O A;  3ABK C;  3GWO A;  3OTO O;  4O4H B;  1IBM O;  3FD9 A;  5JH7 B;  3OUS A;  4X66 O;  5EZY A;  2ZM6 O;  2HEP A;  1Y67 A;  5KAF Z;  3R65 A;  1ZL8 B;  4QJF B;  4WFF A;  1XMO B;  5C8Y B;  1ARO P;  3DSQ A;  2A0L A;  2GUZ A;  3CRQ A;  4YJ2 A;  3JAW B;  1M90 W;  3ZRX A;  2P6J A;  1F23 A;  4GKK B;  2Y69 B;  2NNU A;  1S0V A;  3QG5 A;  1KYO F;  2BTO A;  5LMU B;  3O9O A;  1SC5 B;  3AG4 B;  1AJQ A;  1TUE B;  1YEW A;  4HAM A;  2EZP A;  2JJ1 G;  3TGU H;  4HZ3 A;  1HNZ O;  2WLI B;  2OTL V;  2IJI A;  3E86 A;  2JK5 C;  1FXK C;  4UVA A;  3RYF B;  4I9W A;  4TT3 G;  4KL1 A;  1MOF A;  3RWR D;  3E8G A;  1J5E B;  4CC6 A;  4DXW A;  1I94 O;  2UUA B;  3FYE B;  5LOV A;  1ZLZ A;  2FKX A;  2WLM A;  1Q82 W;  4H37 A;  3E22 B;  3K5L A;  4DW1 A;  5EK0 A;  1YXB A;  4JI2 O;  1TVK A;  1BHB A;  3JAM N;  4JYA B;  1H38 A;  1DLB A;  3OD4 A;  2ZT9 B;  2QTS A;  3ZIA G;  3STZ C;  3BA8 A;  1Q43 A;  4R8C A;  3HKC B;  4IYI A;  4JV5 B;  2E75 B;  1VMG A;  2ITC C;  4OX9 O;  2UXB B;  2P4V A;  1D5N A;  4MSW C;  2UUB O;  5CA1 A;  3JD2 A;  2F23 A;  3X2Q C;  4I50 B;  1COW G;  1DK1 A;  2EIM C;  1PV0 A;  3UT5 A;  4B7E A;  2GTA A;  4B3R B;  5JJJ B;  1DF5 A;  2DYS C;  1R6T A;  3L70 H;  4GCZ A;  4LFB O;  5IJ0 B;  3NXS A;  3F5W C;  3O65 A;  4XDJ A;  2MK3 A;  2NLJ C;  4DK0 A;  3PN1 A;  4N21 A;  1ZWI C;  5BR8 O;  1YVW A;  1K9M W;  4B7K A;  4YIO A;  1K34 A;  3CCJ V;  1NH2 B;  2W0F C;  3C90 A;  4K0K B;  1QU7 A;  4HNA B;  4NTW A;  4RWU A;  4LWS A;  1IBK O;  1GM8 A;  5KA5 A;  3SGI A;  4PDL A;  1VF6 C;  2ZXW C;  5KMG A;  3RYC B;  3QO7 A;  1ORQ C;  1N36 B;  3ZS8 C;  3K5N A;  5L3C A;  3FB8 C;  4GX1 A;  4DR7 B;  2P22 C;  2YXL A;  5EZY B;  4Q20 A;  4U7O A;  4AI8 A;  4E2L A;  5L3E A;  4YJ3 B;  1F51 A;  4H33 A;  1OHH G;  1PKX A;  4LF5 O;  1IUR A;  4JYA O;  2PUS A;  5KX5 A;  1SQQ H;  3G71 V;  2QKS A;  1Q6U A;  4BR6 A;  4X88 A;  4H44 B;  3ZX6 A;  1QHT A;  2JVD A;  2CGN A;  2YEV B;  1VF7 A;  3J7A U;  3RN4 A;  2Q68 A;  4FZ1 A;  2EIN C;  3ABT A;  4A5U B;  4DR6 O;  4JI8 B;  3JSL A;  3ETD A;  4F6R B;  2ZKO A;  5JCO C;  4H13 B;  4ZKI A;  3G6B A;  2LJ2 A;  4B3T B;  4UXN A;  2E76 B;  4TUY A;  2EZO A;  4LFB B;  3BRC A;  1BZK A;  4NTX A;  3WG7 C;  4ZOL A;  2ZNJ A;  3E35 A;  3CCS V;  5LYJ B;  1HNX B;  3CRR A;  3TET A;  1ZTE A;  1EN4 A;  1FFX A;  3JSN A;  5LMU O;  3AG1 B;  3FB5 C;  4JAS A;  2F4V B;  5KHK A;  1YF2 A;  5IWA O;  2JJ2 G;  3B40 A;  1DF4 A;  2XHB A;  5CA1 B;  2LW1 A;  4TOI A;  4JI3 O;  1MZE A;  3IFX A;  1US6 A;  3JD3 A;  4IYH A;  2WA3 A;  1S76 D;  1L0L H;  3K04 A;  2ZR2 A;  1NTK H;  2BCC H;  3A0H Z;  1IVS A;  2IH1 C;  4JYY A;  2EX3 A;  4JI3 B;  2YC0 A;  3VBB A;  4JI6 O;  2VQF O;  3JAL A;  2BTQ B;  1AJN A;  2Y48 A;  4JZG A;  1IX9 A;  1Z5V A;  1SER A;  1JMK C;  4XDL A;  5GON B;  2Q5Z A;  1KQS U;  3K59 A;  3CS5 A;  3WG7 B;  2CTQ A;  1QLE C;  2WLN A;  3UQ8 A;  2DE0 X;  4FLU A;  2K9P A;  4MTO A;  4B08 A;  3KKY A;  2OIG A;  4X65 B;  1N33 O;  3SYP A;  4B3S O;  2UUC B;  3N2K A;  2ZE6 A;  4LFA B;  4I7Z B;  1VQN V;  1B3Q A;  1B06 A;  5IYB O;  4WBN B;  5K1P A;  3M8A A;  2P7T C;  4DR2 O;  1NT2 B;  3S3W A;  2L6L A;  4B3T O;  1VQO V;  4LF4 B;  3ASO B;  1DTO A;  3QF7 A;  1SQG A;  1TUB A;  2Q7G A;  4FVM A;  1IXB A;  2EIL C;  2QGN A;  1M57 C;  3KCY A;  3TJT A;  3JAT B;  1WPX A;  1GN6 A;  4JTC B;  1QQC A;  1OCO B;  4LC1 A;  5HFL A;  5BZB A;  3VQX A;  2XND G;  1CPY A;  4I4T A;  4UUJ C;  1KBH A;  2Y69 C;  5BMV B;  1RSO B;  3CYO A;  3JAR B;  4NXN B;  1WB8 A;  1OCZ B;  1K33 A;  3CHX A;  3H1J H;  3L72 H;  1R3L C;  1BGY H;  3E22 A;  3T4D A;  3ETE A;  4WFG A;  4J9Y B;  1MSW D;  5EC2 C;  3EFF K;  4DR1 O;  2KG7 A;  1Z5W A;  2VS0 A;  1HW7 A;  3JAT A;  3ZHQ A;  5GON A;  4JF3 A;  3GVM A;  5J9P C;  1FYJ A;  4DK1 A;  1GN2 A;  2PY5 A;  4FM0 A;  2LGQ A;  2YXY A;  3OUF A;  4DV7 O;  5CBF A;  1NKD A;  3ZMS A;  4FJC C;  5LHG A;  3D36 C;  3AK2 A;  3FB7 C;  2QWQ B;  1V55 C;  2JIZ G;  5LMN O;  4I4T B;  3T1Y B;  3C3T A;  4DO2 A;  1FD9 A;  4YJ2 B;  5K1X A;  5B3S C;  1K73 W;  1AVM A;  1SES A;  1BHA A;  3ZRV A;  5CBG A;  4DV3 B;  2C2A A;  5KHH A;  4O4J B;  1GO3 F;  4B3R O;  4X62 B;  2E3C A;  3LDD A;  4LF9 O;  4IIJ B;  1VEW A;  5LP6 C;  2HHH B;  4JAA A;  4NVP A;  4QE7 A;  5CB4 A;  1FS0 G;  2Q9L A;  3SYA A;  2UXX A;  1B04 A;  3Q4H B;  3CC7 V;  4FPP A;  5IJ9 A;  2XAQ A;  3M7M X;  2YIA A;  2ARH A;  1MNG A;  1WLE A;  4CZZ A;  4LF7 O;  5LL6 Y;  1GN4 A;  4JI2 B;  5FL7 G;  4R6Z A;  4TQF A;  3M99 B;  2XAJ A;  4IHJ B;  5DEC A;  1NH2 D;  1OJH A;  3CCE V;  1L0N H;  3AG2 C;  3WB1 A;  4GLX A;  4I0X B;  5GTI Z;  4ZHQ A;  1IBM B;  4G2K A;  4DR1 B;  5B5E Z;  4KFM A;  3ABL B;  4QIW F;  3WU2 Z;  4IGG A;  1CXZ B;  1S5J A;  3G67 A;  1KKD A;  2FTK A;  4LF6 O;  2AW9 A;  3D8C A;  2LFR A;  2XUM A;  1JJO A;  4UCU A;  1QLE B;  1YIJ V;  1BSM A;  2VWK A;  4DV7 B;  3BVO A;  5BR8 B;  4K0K O;  1S3J A;  3LSQ A;  4DUZ O;  1NTM H;  2B5U A;  5DED A;  1F4N A;  4CH5 A;  3OEE G;  1Y4M A;  5JVD A;  1YHQ V;  4KP4 A;  2UXC B;  3K57 A;  4GX2 A;  3TCU A;  2R70 A;  1RP3 B;  4TV8 B;  4FLZ A;  3CC2 V;  1I0H A;  2DYR B;  3OT7 A;  3DGE A;  4MW3 A;  4K8X A;  5LGN A;  2UUB B;  4LFC O;  2A06 H;  3RVZ A;  4H0L B;  2FYU H;  5DM6 V;  4J42 A;  4JTD B;  1KEC A;  2Q7H A;  1OCO C;  1Y74 B;  1HNW O;  1KP2 A;  2CH7 B;  5LOV B;  3VQV A;  1FAF A;  3U11 A;  4OGQ B;  2ZD9 A;  3HKE B;  3FB6 C;  1QLN A;  2UU9 B;  2YI8 A;  4JI7 O;  2EJ7 A;  1N32 B;  2ILM A;  4MTX A;  1FJG B;  3F5T A;  1KMI Z;  3FX7 A;  1SS3 A;  4J7Z A;  4JI0 O;  2EBO A;  5EBM C;  5D5P A;  1P7B A;  3SPG A;  3JAK B;  3SPC A;  1SKV A;  4RUE A;  4FZ0 A;  3GWK C;  4X8A A;  2ZIO A;  4NXM O;  3ZMZ A;  1O9H A;  3JD0 A;  3JCU Z;  1PD3 A;  1VQK V;  2H94 A;  3RYC A;  1SA0 B;  4CC5 A;  2PZS A;  1XHZ A;  1JFF A;  5IWA B;  1P4R A;  3EVK A;  5BY1 A;  3CRC A;  3CCR V;  2EIJ C;  4MTG A;  5GW7 A;  2HG5 C;  2GV9 A;  4IHJ A;  3B8M A;  5B3S B;  4UCT A;  5JJN B;  2QE7 G;  4Q6G A;  2CE4 A;  4AHC A;  2AXT Z;  2DMX A;  2N74 A;  4YY3 O;  4CS4 A;  2Q6A A;  5H6R A;  1H2K A;  2XAF A;  4AQY O;  1N36 O;  3SJA C;  4GT1 A;  1P49 A;  2AHY A;  2QM7 A;  1FFT B;  2EJR A;  2GUZ B;  1H2N A;  2HKO A;  5D5Q A;  2Q69 A;  1PNM A;  1Y66 A;  2DYS B;  4WFA V;  3IAY A;  5L3F A;  1AI5 A;  3IJ4 A;  1OCC C;  3KG2 A;  4QPJ A;  5EYP A;  2RJZ A;  1U97 A;  1Q8I A;  1M93 A;  1MA1 A;  1V9P A;  1THZ A;  5CBH A;  1AJP A;  3T1Y O;  1T5E A;  1E1Q G;  4L87 A;  3H1I H;  1OCZ C;  2GBO A;  4L8J A;  4JI1 B;  1I08 A;  2OWO A;  2ETN A;  5AG2 A;  2ZXW B;  2OT5 A;  2V1D A;  2ITD C;  1KKC A;  4R7C A;  1BQ0 A;  2ZQM A;  2YIB D;  4LCU C;  3K5O A;  2W0X A;  2BE3 A;  3T1H B;  4X20 A;  3IC7 A;  2Z3Y A;  1P84 F;  3ML0 A;  2HJD A;  4DV1 O;  2YDE A;  3HR0 A;  3EXA A;  4I55 A;  4BAY A;  4O4J A;  3RYF A;  2XOK G;  4JI4 B;  2DWD C;  3APQ A;  1I5Y A;  3CME V;  4KHP B;  3VQW A;  2Y4U A;  3JYC A;  1Q81 W;  3A0B Z;  5LHI A;  2CTP A;  3L71 H;  1MMM A;  4D7T A;  3Q4H A;  3LSS A;  3B77 A;  1R3I C;  2WLL A;  4Z2W A;  2OCC B;  2A9H A;  3APO A;  3ZCC A;  3FAV A;  4UVB A;  4F4L A;  4D6T H;  5H5N A;  3H1K H;  3K3W A;  4YY3 B;  2QSA A;  1N34 O;  2JDI G;  2YUA A;  3NR7 A;  1RM1 B;  2EIK C;  2E74 B;  2W6I G;  2UUA O;  3K58 A;  2GHY A;  3MHS C;  2V4D A;  1W2B U;  3IGA C;  1H2S B;  3JAR A;  2B1G A;  1SQV H;  1AI7 A;  4X1K B;  4X1Y B;  1X4T A;  5H2F Z;  1GM9 A;  3E8H A;  1HNW B;  4UCV A;  3OR7 C;  4JI6 B;  4ZHQ B;  4PV1 B;  3G4S V;  2IJJ A;  2EUL A;  2F66 C;  2CGO A;  4FLX A;  1JPX A;  1TAE A;  3HKC A;  1HNZ B;  3CEI A;  3OR6 C;  4X66 B;  4RQE A;  5LMN B;  5H9C A;  5IYC O;  2IH3 C;  4PI0 A;  1NI8 A;  3E83 A;  3ICX A;  4ABM A;  1QVF U;  2LP7 A;  2ZE8 A;  5LP6 A;  4DV1 B;  5JQG B;  3OGI B;  4PA4 A;  5FPR A;  2MW2 B;  1Q7Y W;  1JCH A;  2QJ1 A;  1AI6 A;  3HKD A;  2ATK C;  1XUQ A;  4KHP O;  1GKF A;  2VQE O;  3AG3 C;  5J2T B;  5EIB D;  4DV5 B;  2HHH O;  3L73 H;  3IC9 A;  4MVZ A;  1WPB A;  1YIT V;  2IW5 A;  4U7N A;  3WB0 A;  2L35 A;  4X1Y A;  4HBN A;  2AZ0 A;  2P06 A;  5CA3 A;  3E2E A;  2HVK C;  4U3J B;  2LW7 A;  1GN3 A;  4LF6 B;  3PJS K;  5IJ9 B;  1K3E A;  4W4L A;  1LUW A;  2WLJ A;  3ZN0 A;  4MVQ A;  3ABM B;  1MSD A;  2HR3 A;  1SZT A;  4J7K A;  4DV0 B;  3MHH C;  5BXZ A;  1G8M A;  3D36 A;  4JYB A;  1Z2G A;  4I0X A;  4DR6 B;  2B9Z A;  1BT8 A;  2QWP B;  2ZIN A;  5KHG A;  3UO3 A;  3OAA G;  4HYO A;  3P3N A;  1LUV A;  4UCS A;  1GMG A;  5LYJ A;  3T2M A;  2GDS A;  1AR4 A;  2RN9 A;  3VOU A;  1SET A;  4O2A A;  4G28 B;  2LO1 A;  3QNE A;  4EFE A;  1N0N A;  5EC1 C;  1YI2 V;  1RPO A;  1KD1 W;  2FML A;  3SYC A;  2HJF C;  4GKK O;  3AG7 A;  5KLV H;  3K06 A;  1NJI W;  2EIM B;  2WLK A;  3TXS A;  4ICG A;  1J95 A;  4PDM A;  1QCE A;  3FFQ A;  2EIN B;  3LDC A;  4JYC A;  4CH3 A;  4X62 O;  2F93 B;  3FAV B;  3L74 H;  3LUT B;  3ZRW A;  3RBZ A;  3OTO B;  1AI4 A;  1PNL A;  3E8F A;  2Y0P A;  3W7W A;  2ZM6 B;  3K03 A;  2IU0 A;  4XDK A;  1NVP B;  2QWR B;  1YSC A;  3RGB A;  3RYI B;  5J2U A;  4DV3 O;  4WCE V;  1M1K W;  1BMF G;  4FK5 C;  2QEX V;  1S5H C;  4TV9 B;  1AR1 B;  5IDJ A;  1BQZ A;  4DV6 B;  4DR3 O;  1SA0 A;  1S77 D;  5CN0 A;  5LA6 B;  2OCC C;  3JAS A;  4JV5 O;  4HNA A;  2JEU A;  2DQ3 A;  3SPI A;  1XBL A;  3ETQ A;  1K7D A;  1VF6 A;  2PTM A;  5KA6 A;  1Y74 A;  1YDX A;  3SJC C;  4FFB B;  1PPJ H;  1LNQ A;  2QWO B;  1ZAU A;  3E89 A;  2ZDI A;  2UXN A;  3ZHT A;  2XAH A;  4MW8 A;  3JD1 A;  3F7Y C;  3RYH B;  3DC6 A;  4DW0 A;  4ZOL B;  1MAB G;  1YCI A;  4NKG B;  2QM8 A;  4FLV A;  3CCU V;  4G27 B;  4UB8 Z;  3LSU A;  1GH6 A;  2ZIM A;  3FKS G;  4X64 B;  3ABU A;  4I55 B;  2RDC A;  4LWS B;  2PI5 A;  1VQ7 V;  3H1L H;  2KB1 A;  2F1M A;  2CH7 A;  3OGC C;  1BE3 H;  3CRA A;  2QR4 A;  2WLL B;  3UM7 A;  3P30 A;  4CH6 A;  2Y0I A;  3ASN C;  2Z0A A;  1VQP V;  4LF4 O;  1ENV A;  1FKA O;  2K1E A;  3B09 A;  3N2G B;  2Q4P A;  3HKB B;  1R6K A;  2R72 A;  1XMQ B;  2RMK B;  1RPR A;  1G1X B;  3ABK B;  1FXV A;  4LF7 B;  1AB3 A;  3OM3 B;  2X7R B;  1VQ4 V;  2PGG A;  5KMG B;  4CS2 A;  1N32 O;  5IYD O;  1ZUQ A;  5IE9 A;  3A2F A;  1CEZ A;  3BAB A;  1IDS A;  2ZCE A;  4LFC B;  2X6A A;  4MVO A;  3SDL A;  1H2G A;  3KZI Z;  3D3I A;  4DV6 O;  4EB6 A;  2LGW A;  3T1H O;  3CCV V;  3ZED A;  1CP9 A;  5LXT A;  3K9A A;  3AG4 C;  3OFN G;  2WPD G;  4UCR A;  5LHH A;  4JI5 B;  2QA4 V;  4DUY O;  1WA8 A;  4NR1 A;  2ZNI A;  4LNU B;  3BAA A;  4FLW A;  5TIS Z;  5ITZ A;  3LDE A;  4JI1 O;  4X20 B;  3MAQ A;  1RFY A;  1FFX B;  4JZ2 A;  1XNQ B;  3G80 A;  1OCR C;  3L9D A;  5IY5 C;  2NR5 A;  1R3J C;  1YTF B;  2CAZ C;  4LH6 A;  1GAX A;  3BEH A;  5DN6 G;  3N2G A;  2VQF B;  5L3B A;  4P9P A;  4FIP C;  4AQY B;  1EFR G;  4FFB A;  1OCC B;  4QGP A;  2KKW A;  1M57 B;  4BIO A;  3LNM B;  4ZI7 B;  3J81 N;  3K5M A;  1SRY A;  1Y76 A;  1JA8 A;  2ADP A;  3CJH A;  1KB9 F;  3CCQ V;  2XT9 A;  2ADQ B;  3SR2 C;  4TSF G;  5LXT B;  1M4U A;  2BSK B;  1QVG U;  1WJZ A;  4J41 A;  5JCO A;  1OZ0 A;  3FYI B;  5FNV A;  5J2U B;  3RYI A;  1VQ6 V;  2GSM B;  2PI4 A;  4DR5 O;  3OMA B;  4GX0 A;  4P2Z A;  1XDC A;  4ZIB A;  1NZ6 A;  3B8N A;  1VIB A;  3ZRW B;  4B3M B;  1JVM A;  4JAU A;  4KXR A;  1E1R G;  4GKJ B;  2JRI A;  4MT8 A;  3UO2 A;  4W4K A;  4DV5 O;  1FPO A;  4KUM A;  3HKE A;  4PI2 A;  2WLI A;  2ZR3 A;  4QE9 A;  2KG7 B;  1AP6 A;  1I7F A;  4Z1V A;  2D3O W;  3QO5 A;  3H01 A;  2EIJ B;  4PA3 A;  3BFR A;  1NBM G;  2IJH A;  2G38 A;  3SJQ C;  1S72 V;  3RVY A;  1F4M A;  2PYJ A;  1S5L Z;  2UXD B;  1UPG A;  3N2K B;  2P4K A;  3E8B A;  3K0D A;  1EZJ A;  3CSX A;  4EEQ A;  4O4L B;  4IT5 A;  3W7U A;  4TV8 A;  4RQF A;  4DV4 B;  3OMI B;  1Q6H A;  3JAW A;  5LBQ A;  1G4Y B;  3GB7 C;  1JQ0 A;  2X6C A;  3U10 A;  3CX5 F;  1L1F A;  1GRJ A;  3STL C;  4TWK A;  3CP1 A;  1ZL8 A;  1WP8 A;  1FXK B;  2Q0A A;  1HNX O;  3SPH A;  2CTR A;  4CH4 A;  2HVJ C;  4WF9 V;  2VWJ A;  4YHH B;  4X1K A;  1IBL O;  3H9V A;  1HDJ A;  2Q67 A;  1Y6X A;  1XL6 A;  2RQ6 A;  4LBE C;  5JQG A;  3QVN A;  3C3S A;  2X0L A;  1H2M A;  3AK3 A;  4PEL A;  4CS3 A;  1Q90 D;  1XNR B;  1QBZ A;  4O2B B;  4K8Z A;  4UV9 A;  4JTA B;  3T4Z A;  4UFZ A;  1H2L A;  1JJ2 U;  3TK1 A;  4PJ0 Z;  3F7V C;  5FLX N;  2P67 A;  4TV9 A;  2V7Q G;  2IJK A;  4WFH A;  4YXW G;  4WFE A;  4O4L A;  4BW9 A;  1VP7 A;  1VF5 B;  5LP6 B;  1XMQ O;  2OYQ A;  1AR5 A;  1K5Q A;  4O2A B;  5KUK A;  1HWY A;  4X1I A;  1F7Y A;  4NYK A;  3BPZ A;  4J11 A;  4PDR A;  5KHJ A;  4DUY B;  1N4C A;  2HFE C;  4B3S B;  4JI5 O;  1A32 A;  3LNN A;  3G6E V;  3K9S A;  4J7J A;  1R1B A;  3DC5 A;  3MDS A;  2QKC A;  1HR0 B;  2AZ2 A;  1WP7 A;  4DV2 B;  4K3A A;  5E1A C;  4XBF A;  1MG1 A;  2GTS A;  2R9A A;  3JAL B;  3OMN B;  1NVP D;  1WA8 B;  5FPO A;  4EFB A;  4DRX B;  4OXS A;  5C93 A;  3CPW U;  1D2D A;  5LGT A;  4O2B A;  3W7S A;  4PA9 A;  2Y4T A;  4FM2 A;  2E5L O;  1MZF A;  1RSO A;  1R3K C; 
#chains in the Genus database with same CATH homology
 5B1A C;  5FL7 G;  4RO2 A;  4R6Z A;  4N23 A;  3M99 B;  2WSS G;  1VQ8 V;  2XAJ A;  2DWE C;  3OUS A;  3K06 A;  1NJI W;  5B1N A;  1VQ9 V;  2EIM B;  2WLK A;  3BY6 A;  1J95 A;  1NH2 D;  3CCE V;  3R65 A;  4PDM A;  1QCE A;  3ZN1 A;  3AG2 C;  2EIN B;  3LDC A;  5EBL C;  4I5S A;  4JYC A;  4QJF B;  4WFF A;  1Q86 W;  2DW4 A;  3LUT B;  1ARO P;  2A0L A;  3ZRW A;  3RBZ A;  1M90 W;  3EHB B;  2P6J A;  3ASN B;  3ZRX A;  4G2K A;  1F23 A;  1AI4 A;  2Y69 B;  1PNL A;  3E8F A;  3ABL B;  4KFM A;  4QIW F;  2NNU A;  2XAG A;  3W7W A;  3K03 A;  3DTU B;  2IU0 A;  4XDK A;  1S0V A;  1NVP B;  3I55 V;  1KKD A;  2FTK A;  3QO8 A;  2LFR A;  1YSC A;  3AG4 B;  1AJQ A;  1TUE B;  1W0J G;  1QLE B;  4HAM A;  1YIJ V;  2EZP A;  2JJ1 G;  4WCE V;  4WFB V;  1BMF G;  4FK5 C;  1M1K W;  4HZ3 A;  2QEX V;  1S5H C;  1KC8 W;  1S3J A;  2WLI B;  2OTL V;  1AR1 B;  5CMU A;  5IDJ A;  4EKW A;  3LSQ A;  2IJI A;  3E86 A;  2B5U A;  2JK5 C;  1FXK C;  4UVA A;  1PNK A;  3ABL C;  4I9W A;  1F4N A;  4TT3 G;  2H8P C;  1S77 D;  1MOF A;  3OEE G;  1Y4M A;  3W7X A;  2F43 G;  1YHQ V;  3E8G A;  5CN0 A;  4KP4 A;  2OCC C;  3CC4 V;  4DXW A;  2JEU A;  2DQ3 A;  4GX2 A;  3SPI A;  1VQL V;  3TCU A;  4JAV A;  1K7D A;  3FYE B;  5KA6 A;  5IY5 B;  3CC2 V;  2DYR B;  2WLM A;  1Q82 W;  4FMT A;  4H37 A;  1LNQ A;  3DGE A;  5EK0 A;  4MW3 A;  3E89 A;  5LGN A;  2W6J G;  2ZDI A;  2UXN A;  2XAH A;  2BOC C;  4MW8 A;  3WFV A;  3JD1 A;  3F7Y C;  1H8E G;  1PL0 A;  3ETG A;  4BIZ A;  1BHB A;  3RVZ A;  5DM6 V;  1H38 A;  1MAB G;  4P30 A;  1DLB A;  4JGS A;  4JTD B;  1KEC A;  3ZIA G;  2JEX A;  2QM8 A;  3STZ C;  3CCU V;  4G27 B;  1NR1 A;  1OCO C;  4R8C A;  1KP2 A;  2QTO A;  2ITC C;  3FKS G;  2OTJ V;  2ZD9 A;  3FB6 C;  4MSW C;  1QLN A;  3ABU A;  3JD2 A;  1UJW B;  3X2Q C;  1COW G;  3T1C A;  2PI5 A;  1VQ7 V;  2KB1 A;  2EIM C;  4MTX A;  3ZJZ A;  2WLH A;  3OGC C;  5KUM A;  1DF5 A;  2DYS C;  4GCZ A;  2WLL B;  3UM7 A;  3NXS A;  3P30 A;  4UVC A;  3F5W C;  4XDJ A;  3ASN C;  2MK3 A;  2EBO A;  2NLJ C;  4BIU A;  1VQP V;  1ENV A;  1N8R W;  2K1E A;  3ABM C;  5EBM C;  3SPG A;  1P7B A;  4N21 A;  3ZMU A;  4QNH B;  1ZWI C;  3SPC A;  1R6K A;  1K9M W;  4RUE A;  1K34 A;  1M56 C;  3CCJ V;  1NH2 B;  2W0F C;  4X8A A;  1RPR A;  3ZMZ A;  3JD0 A;  3ABK B;  1E79 G;  1FXV A;  1BL8 A;  1PD3 A;  1VQK V;  2H94 A;  4QPK A;  1GM8 A;  5KA5 A;  1FXH A;  1QR8 A;  3OM3 B;  4PDL A;  2ZXW C;  2X6B A;  2X7R B;  4MS2 A;  4MTF A;  1VQ4 V;  5EBW C;  1P4R A;  3QO7 A;  3CCR V;  1ORQ C;  3AG2 B;  2EIJ C;  4MTG A;  5L3C A;  5GW7 A;  2HG5 C;  3FB8 C;  4GX1 A;  5IYD O;  3B8M A;  4Q20 A;  5B3S B;  3OEH G;  3UKM A;  4U7O A;  4E2L A;  5L3D A;  1CEZ A;  5L3E A;  2QE7 G;  3JD4 A;  2X6A A;  1GTO A;  2LFS A;  4MVO A;  2Q6A A;  1H2G A;  1JOY A;  1F51 A;  3D3I A;  4H33 A;  1B6Q A;  1OHH G;  1PKX A;  4Z1M G;  4PDV A;  5H6R A;  2R9R B;  3CCV V;  1R6N A;  2XAF A;  1CP9 A;  3G71 V;  2QKS A;  4MVR A;  4X88 A;  4GT1 A;  3K9A A;  2AHY A;  2QM7 A;  3AG4 C;  3K08 A;  2WPD G;  3OFN G;  5LHH A;  1FFT B;  2YEV B;  2QA4 V;  2EJR A;  2HKO A;  2Q69 A;  2EIK B;  2Q68 A;  1VQM V;  2EIN C;  1PNM A;  1Y66 A;  2DYS B;  1V54 C;  3ABT A;  3AG3 B;  4WFA V;  2XAS A;  4CBC A;  3LDE A;  1K4D C;  1AI5 A;  5L3F A;  3KG2 A;  1OCC C;  3AG1 C;  4QPJ A;  4RAI A;  3ETD A;  5B1A B;  3X2Q B;  1M9N A;  1OCR C;  4ZKI A;  4P9O A;  5IY5 C;  4X89 A;  4UXN A;  1THZ A;  1R3J C;  5CBH A;  2EZO A;  1YTF B;  3CD6 V;  1AJP A;  1E1Q G;  1K97 A;  3BEH A;  4L87 A;  3WG7 C;  5DN6 G;  1OCZ C;  5L3B A;  4P9P A;  3E35 A;  2ZXW B;  2OT5 A;  2V1D A;  3CMA V;  2ITD C;  3CCS V;  4FIP C;  3TET A;  4R7C A;  2ZQM A;  4LCU C;  1GK9 A;  1EFR G;  1OCC B;  3AG1 B;  3FB5 C;  1M57 B;  3IC7 A;  2Z3Y A;  4JAS A;  3JCZ A;  1IXM A;  5HFM A;  3LNM B;  3ML0 A;  3CCM V;  1I5X A;  1SRY A;  2JJ2 G;  3I56 V;  3SPJ A;  1DF4 A;  4BAY A;  3CCQ V;  2XOK G;  3IFX A;  3ASO C;  2DWD C;  1K8A W;  1I5Y A;  3CME V;  4TSF G;  4RUF A;  3JD3 A;  1QR9 A;  1V55 B;  1S76 D;  3JYC A;  5L3G A;  1Q81 W;  1QVG U;  5LHI A;  3K04 A;  2EIL B;  1OZ0 A;  2ZR2 A;  3FYI B;  3ZMT A;  1VQ6 V;  2GSM B;  2PI4 A;  1NQT A;  3OMA B;  4GX0 A;  3LSS A;  3AEI A;  3B77 A;  4P2Z A;  1V54 B;  2BOB C;  1R3I C;  2IH1 C;  2WLL A;  2OCC B;  3B8N A;  3ZRW B;  2A9H A;  1JVM A;  3VBB A;  3ZCC A;  4JAU A;  4R50 A;  4UVB A;  1E1R G;  1AJN A;  2Y48 A;  4F4L A;  1K5S A;  3P32 A;  4MT8 A;  3K3W A;  1OCR B;  2WWW A;  2YSU B;  1SER A;  2IU3 A;  1FXK A;  2JDI G;  4XDL A;  3K0G A;  1KQS U;  2Z5U A;  5B1O A;  4KUM A;  1RM1 B;  2EIK C;  2W6I G;  4GX5 A;  3WG7 B;  1QLE C;  2WLN A;  2WLI A;  2ZR3 A;  4QE9 A;  4MTO A;  4LP8 A;  2D3O W;  2GHY A;  3QO5 A;  4PA6 A;  3MHS C;  1W2B U;  3H01 A;  2EIJ B;  3SYO A;  4PA3 A;  3SYP A;  1NBM G;  2AHZ A;  3IGA C;  1YJ9 V;  2IJH A;  1EBO A;  1KP3 A;  3SJQ C;  1VQN V;  5IYB O;  1YJN V;  1S72 V;  3RVY A;  1F4M A;  2B1G A;  1W0K G;  3E8B A;  3K0D A;  1EZJ A;  2A79 B;  1AI7 A;  3W7U A;  2P7T C;  4RQF A;  1R73 A;  1GM9 A;  3E8H A;  3OMI B;  3SYQ A;  1VQO V;  5H6Q A;  3ASO B;  1DTO A;  5LBQ A;  3OR7 C;  1G4Y B;  3G4S V;  3GB7 C;  1JQ0 A;  2IJJ A;  2X6C A;  3ZMV A;  4ASU G;  2CK3 G;  1ROP A;  1L1F A;  3STL C;  2EIL C;  4TWK A;  1JPX A;  1M57 C;  3CP1 A;  1WPX A;  1FXK B;  3CCL V;  4JTC B;  3SPH A;  1OCO B;  4LC1 A;  3OR6 C;  5HFL A;  5BZB A;  4PA7 A;  2HVJ C;  2XND G;  4J9Z B;  1CPY A;  4WF9 V;  1M56 B;  4RQE A;  4UUJ C;  5H9C A;  1K92 A;  5IYC O;  2IH3 C;  2Y69 C;  1JX9 A;  3E83 A;  2Q67 A;  5B1B B;  1QVF U;  2LP7 A;  1XL6 A;  3CYO A;  4LBE C;  4MVM A;  4JPR A;  1OCZ B;  1K33 A;  2X0L A;  3RW0 A;  1R3L C;  4PA4 A;  4PEL A;  1H8H G;  3T4D A;  3ETE A;  1Q7Y W;  1JCH A;  1AI6 A;  1QBZ A;  4WFG A;  4UV9 A;  4J9Y B;  4JTA B;  2ATK C;  1MSW D;  5EC2 C;  3EFF K;  1K4C C;  1GKF A;  2DQ0 A;  4MVU A;  2ZDI C;  3T4Z A;  3AG3 C;  1JJ2 U;  3TK1 A;  4BW5 A;  4JF3 A;  3F7V C;  4MVZ A;  2P67 A;  5J9P C;  2V7Q G;  2IJK A;  4WFH A;  2P90 A;  1YIT V;  3OE7 G;  1VQ5 V;  2B1I A;  2DYR C;  3OUF A;  4YXW G;  2IW5 A;  4U7N A;  3W7T A;  2WAM A;  4WFE A;  1YTF D;  5CBF A;  1NKD A;  3ZMS A;  4FJC C;  5CA3 A;  5LHG A;  3HPL C;  4MVS A;  3E2E A;  2HVK C;  2HLD G;  3K79 A;  2R9I A;  1XL4 A;  3FB7 C;  1V55 C;  1K5Q A;  3CXC U;  3PJS K;  2JIZ G;  1K3E A;  3HB3 B;  5LGU A;  2WLJ A;  3A0R A;  3ZN0 A;  5KUK A;  4MVQ A;  1HWY A;  3ABM B;  4DO2 A;  2HR3 A;  1NR7 A;  1SZT A;  5B3S C;  3MHH C;  1K73 W;  1G8M A;  4PDR A;  1SES A;  2M7W A;  1BHA A;  3D36 A;  4JYB A;  3ZRV A;  5CBG A;  2HFE C;  2C2A A;  1GO3 F;  3G6E V;  3LDD A;  4ZBM A;  5B1B C;  1GM7 A;  1RM1 C;  5E1A C;  4XBF A;  1MG1 A;  4QE7 A;  1NVP D;  3OMN B;  3ZRS A;  3OAA G;  1YJW V;  1FS0 G;  2YEV A;  4HYO A;  3SYA A;  4UV8 A;  1GMG A;  3T2M A;  2UXX A;  3MD0 A;  4OXS A;  5C93 A;  3VOU A;  3CPW U;  3CC7 V;  5LGT A;  3OW2 U;  4FPP A;  1SET A;  3W7S A;  2XAQ A;  4G28 B;  4PA9 A;  3QNE A;  5EC1 C;  1WLE A;  4CZZ A;  1YI2 V;  1RPO A;  1KD1 W;  3SYC A;  1R3K C;  3ABK C;  2HJF C;  3GWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...