3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
4QE7A 2ITCC 4BW5A 3WG7C 1OCCC 3AG1C 3E89A 3HPLC 4PA7A 1S5HC 3ASNC 5CBFA 5KUKA 4KFMA 3R65A 2EIKC 4LP8A 3SPCA 3T1CA 4WFGA 4X89A 3PJSK 3UM7A 3KG2A 1BL8A 2Y69C 3OGCC 4R8CA 2NLJC 2EILC 4RUEA 2ATKC 4P9PA 2DYRC 4P9OA 3SYAA 4WFHA 1XL4A 4MVZA 3STLC 3T4DA 2HG5C 4R7CA 3RVZA 1K4CC 4MVOA 4MW3A 3EFFK 3OR6C 3E8GA 4DXWA 3TETA 3SPGA 1OCZC 4UUJC 3SYPA 3F7YC 4PA4A 4WFFA 1OCRC 3SYQA 3AG4C 3FB6C 3E8HA 4GX5A 4I9WA 3E86A 2EIJC 2HVKC 3ABMC 1ORQC 1G4YB 4TWKA 4MSWC 2WLIB 4MS2A 4X8AA 2Q6AA 1QLEC 3ABKC 3K03A 2Q68A 4PA3A 2A0LA 4PDMA 1R3LC 5EBMC 2ITDC 4OXSA 4R50A 4GX1A 3UKMA 4PDLA 2HJFC 4MVQA 2DWDC 3RVYA 3RW0A 3IFXA 2BOBC 3SPJA 3F7VC 1M57C 3T2MA 5CBHA 2HVJC 3F5WC 4WFEA 3RBZA 4G27B 3LDCA 4MVMA 4RUFA 2WLLA 1XL6A 3OR7C 4MTGA 3ZJZA 5EK0A 3LDDA 3LUTB 3FB7C 5IY5C 2BOCC 4QE9A 2WLLB 4PA6A 3K06A 2WLIA 2X6AA 4GX2A 3SJQC 2DWEC 4MVRA 3ZRSA 3SPHA 2WLJA 3OUSA 5J9PC 4QNHB 4XDJA 1R3KC 3LDEA 3JYCA 3AG3C 5B1BC 1V54C 2OCCC 2DYSC 3SYCA 2W0FC 1R3IC 4JTDB 3ASOC 3FB5C 2ZXWC 4MTOA 4XDLA 2QTOA 2AHYA 4MW8A 5EBLC 1JVMA 2A79B 2H8PC 3X2QC 5KUMA 2EIMC 1LNQA 1OCOC 2HFEC 3BEHA 3E8FA 4H33A 4R6ZA 4XDKA 1K4DC 4J9YB 2EINC 2WLMA 4P30A 4JTCB 1ZWIC 5BZBA 4PDVA 4ZBMA 2Q69A 3K08A 4JTAB 3ABLC 5EBWC 4P2ZA 4GX0A 3E8BA 4H37A 5E1AC 3FB8C 2JK5C 4LBEC 4PDRA 4F4LA 3IGAC 2R9RB 1J95A 2A9HA 2P7TC 3LNMB 3SYOA 4EKWA 5EC1C 4PA9A 3AG2C 3K0GA 4RO2A 1R3JC 2ZD9A 4LCUC 2YEVA 4RAIA 5EC2C 2IH1C 3E83A 3K04A 4MVUA 2X6CA 4MTFA 2QKSA 4J9ZB 5B1AC 1KKDA 2X6BA 3VOUA 3T4ZA 5B3SC 2WLHA 4HZ3A 3OUFA 4MVSA 3K0DA 3STZC 4CBCA 3SPIA 2Q67A 2WLKA 2KB1A 4X88A 1P7BA 3GB7C 1M56C 4G28B 3TCUA 2IH3C 4HYOA 5CBGA 1V55C 2WLNA 2K1EA 2AHZA
chains in the Genus database with same CATH superfamily
4LC1A 1TVKA 1FJGB 3IAYA 1TUBB 5KUKA 1QVGU 1VQMV 1DF5A 2DOSA 1DF4A 3JD0A 4CC5A 4XBFA 2LP7A 2ZE8A 4FPPA 4LFCB 3CC7V 4WFHA 2E5LB 2QWPB 3OR6C 1M4UA 3SYQA 2V4DA 4I9WA 4KHPB 1I94B 4MS2A 3CYOA 2Q6AA 3OGIB 2QTSA 1YJ9V 4UB8Z 2Q5ZA 5H6QA 5CA1A 3AG4B 5C8YA 5IYDO 3FX7A 3UKMA 1F23A 3QO5A 4PDLA 1AI6A 2CTPA 1D2DA 4OGQB 3K06A 2PY5A 4DR2B 1XI1A 4KP4A 4FLZA 4K0KO 3L70H 3CC2V 1SERA 1R3KC 4O4LB 4UCUA 4B3MB 1URFA 1H2LA 2XHBA 1N0NA 1R3IC 1JA8A 4H13B 3T1HB 5KLVH 1H38A 4LFBB 4YHHB 4H33A 1IXBA 2Q69A 2OT5A 2Q8VA 3RYHB 3OW2U 1GM8A 3E35A 3OEHG 5DN6G 2UXDB 5KA5A 2EJ7A 2YC0A 4LCUC 3HKCB 3ABLB 2GUZA 4DW1A 3K0DA 4NYKA 2WLKA 3HKDA 2KB1A 2P6JA 4U3JB 5CA0A 2OWOA 2AHZA 4W4KA 2DW4A 3RYFB 4EFEA 1V55B 4Z1MG 1AR5A 1MABG 3CRQA 5BMVB 3UO2A 2E74B 2MW2B 4J7KA 5J2UB 4UUJC 3CCMV 2EILB 2LJ2A 5LP6C 2LW7A 5LYJA 5KHGA 1QQCA 4JI1O 4CH6A 2ZM6B 1US6A 3T1YO 1KECA 4UXNA 1SQPH 3JATB 1W0KG 1XDCA 1N36B 2XAJA 4J10A 5LL6Y 3ZMZA 3FFQA 3SJCC 3CRCA 1DGSA 1WPBA 5BY1A 4X9QA 3ZHTA 2X6AA 1VEWA 1PP9H 4LF5B 2YI8A 1CXZB 4FM2A 3EVKA 1GKFA 2AZ0A 2UUBB 3H01A 4MTOA 1JVMA 3VQYA 1M90W 4UCVA 2ADPA 4BW9A 4PI0A 4JI7B 1A32A 2FTKA 3CJHA 1WA8A 2DN9A 4DUYO 3QVNA 4LF7B 4F4LA 1WA8B 5TISZ 3APOA 2P7TC 4EB6A 4X1YA 1PNLA 2QDOA 3W7TA 2QJ1A 4X1YB 1EN5A 4YY3O 2R72A 4X88A 1PM9A 1E79G 4HYOA 5H9CA 1M93A 1BZKA 3QF7A 1JCHA 1NJIW 1KUQA 3ZRWA 1SZXA 1G6UA 2Q0OC 3C3TA 1VF5B 4CH4A 3BA9A 4JI5B 3LNNA 2DYRC 2XAHA 2GDSA 5JVDB 4J41A 4DXWA 3SPGA 3ZHUA 3SYPA 4HBNA 4N23A 2BTOA 5HFLA 1N8RW 3RN4A 4UFZA 5KHKA 4TQDA 4W4LA 4ZIBA 1QLEC 1MOFA 1OCZB 1IX9A 2A0LA 1OCRB 1Y74A 3LSUA 1YXBA 1KMIZ 3ETDA 3K79A 4X66O 3DGEA 1W0JG 2HJFC 4MVQA 1ZL8A 2YXYA 4O4HB 1M57C 3ZHQA 3CS5A 1QLNA 2F43G 1KQSU 3OR7C 4JV5O 4B7EA 3LUTB 1KC8W 4PI2A 4DK1A 1GO3F 2P67A 1JFFB 3P30A 2D2CB 4DR7B 2OIGA 1AILA 1V54C 4JI8B 3DXRA 1K9MW 1Y4MA 3FB5C 3X2QC 1ZTEA 2ZIOA 1GMGA 4LNUA 4GKJO 2YSUB 2EULA 4LNUB 2HP8A 1LUWA 2JJ1G 2CK3G 2WWWA 1H8HG 4DUZB 1J95A 2JS5A 2Y0PA 3EHBB 1NR1A 3CCJV 3JARA 3DC5A 1F4MA 4ABMA 1HNXO 1KBHA 2WLHA 5GTHZ 1YZBA 1W2BU 3ZX6A 2LO1A 4G28B 1KP2A 1MNGA 5B1AB 5LMNO 5A9GA 3WG7C 1OJHA 2VQFB 2JGUA 4LF6B 4I0XB 2LGWA 2JGDA 3PJSK 1YDXA 5GONB 4I5SA 1BS3A 5AG2A 4WBNA 4BIUA 4QPKA 3STLC 3FYIB 3TGUH 2IM9A 4DR4O 1VIBA 1H2GA 3IC9A 3CD6V 3O9OA 2B1IA 4LFCO 4JI3B 1UJWB 1NT2B 1RSOA 5FL7G 2P90A 1WNSA 3FB6C 1F7YA 2E5LO 2Z5UA 2EIJC 1HNWB 1R6KA 4HNAA 4B08A 1PD3A 3J80N 3JAWA 2E3CA 3RGBA 3SJBC 3KCXA 5IYZA 1I94O 3E2EA 1RPOA 3B09A 1T5EA 4UV9A 3OEEG 4X1KA 3B40A 3JAKA 2XAQA 1S72V 4MVMA 1G8MA 1XL6A 4JASA 5GW7A 1GRJA 3K5NA 2UUAB 3MD0A 1I7FA 3ZRSA 3SPHA 3FAVB 5IY5B 2OCCC 4JTDB 4FLVA 4NTXA 1QBZA 2EZOA 3L74H 4B3MO 3ZS8C 2H8PC 4FLTA 1HR0B 1VQPV 3CRRA 1KU9A 4DR5B 5B1BB 4YJ2B 3SYCA 2Y0IA 3T1HO 1K4DC 4J9YB 2EINC 4DR6B 5B66Z 1NH2B 4JTCB 4LFBO 4PV1B 4F6RB 4LF9B 3P32A 2YICA 4BR6A 1NQTA 4RQEA 2XNDG 2A9HA 2W0XA 2FYUH 3U11A 3UT5B 5EC2C 2EBOA 1SQBH 2C2AA 4J9ZB 1BE3H 2UXDO 2BTQA 1OV9A 3OTOB 4WFBV 3JSLA 2BTQB 3M99B 3Q4HA 2YS8A 4GYCB 2GTSA 5B5EZ 2ITCC 1BT8A 1S5LZ 2ZKOA 4PELA 4YJ3A 2LGQA 3PN1A 4U3FH 5IDJA 3D8CA 2ZT9B 3J81N 4NXMO 4HAMA 2Q9LA 2WAMA 3AG4C 3E8HA 5KX5A 2HVKC 2RN9A 4DW0A 4WFAV 5EYPA 1P7GA 4QPJA 3JALA 1WP7A 4IIJA 4WFEA 3ETGA 4K3AA 4J7JA 1BHBA 1YEWA 4N21A 4DV3B 2KKWA 2PF4E 2KG7B 1S3JA 2DWEC 1ZSPA 1AP6A 4U7OA 2IU3A 2JDIG 4LF8B 4JYAO 4LF5O 1N33B 1WB7A 3B8MA 4TUYB 4TV9B 5L3BA 2AHYA 2W6IG 5JJJB 3E8FA 4R6ZA 5E79Z 2DYSB 3K9AA 2IJJA 2IJKA 1BGYH 4PDVA 1GTOA 1FXKB 4I50A 5IWAB 3ABLC 5LGNA 1Z5WA 2JK5C 2ILMA 4CC6A 1CPYA 4PA9A 5EZYB 4LF7O 3OE7G 2NNUA 3K04A 4LWSA 2OIEA 1KKDA 3AK1A 1X4TA 3QNEA 4LWSB 2JS3A 2B5UA 3A2FA 2GHYA 2IH3C 2A06H 1V55C 2Z3YA 1HNZO 4BW5A 1K92A 2VQEB 4PA7A 1FFXA 1EZJA 1ENVA 2NLJC 2EILC 4QJFB 5JJNB 5LXTA 1XL4A 2HG5C 4JI5O 1AI4A 2N05A 5BR8B 2OCHA 1EN6A 1PPJH 3JD4A 1TUBA 4PHZA 2ZE6A 4FM0A 3WFVA 1UPGA 1PKXA 4Q6GA 1K3EA 3CP1A 1YSCA 3ABKB 1EM1A 3T2MA 1VQNV 1BHAA 2WLLA 4QE9A 2WLLB 1K33A 2CE4A 2XASA 2RQ6A 4JI2O 3OUSA 1TAEA 4EEQA 1SC5B 4DV1B 1J5EB 4O2BB 3LSSA 4DR7O 5EBLC 1GN3A 4JI8O 4LH7A 1FS0G 2WA3A 1ZWIC 2B9ZA 2ZNIA 5IJ0B 2UXXA 5IE9A 3E8BA 3FB8C 1M5IA 2UXBO 3CSXA 4JI0B 4O4LA 3K0GA 2UUCB 1R3JC 1NBMG 1B6QA 1JX9A 2AZ2A 4PJ0Z 3E83A 4MVUA 2YXHA 3VOUA 3O65A 1K5SA 3MDSA 3JASB 4JAUA 1P7BA 1TGOA 4DRXB 3JD3A 2NR5A 4TSFG 5CBGA 3TXQA 1VQ9V 5B3SB 3RYHA 1QHTA 4NXNB 1JOYA 2UU9B 2CAZC 1O9GA 4RWUA 3P3NA 4MT8A 3HKCA 3T1CA 1XREA 3KG2A 4IL6Z 4O4IB 4D7SA 2CTWA 2F4VO 1HW7A 3CC4V 5KMGB 2EIKB 2QE7G 4U3JA 2FL4A 1OCZC 4DV5O 1OCRC 3ZHVA 1COWG 3CXHF 4NTWA 3OTFA 2GBOA 4JI3O 4OPHA 2DE0X 4ZI7A 3RYFA 1QVFU 1Y66A 2JVDA 4KUMA 2QWNB 4ZI7B 1CEZA 4GLXA 3CCEV 4IHJA 5BMVA 4IHJB 3F5WC 5J2UA 4DV0B 1AP5A 4NB5A 3SGIA 3LDCA 1JQ0A 2ZCEA 3BRCA 5EK0A 1VF7A 2PI4A 4DV7B 2LQTA 3THOA 5JQGB 1RM1B 2ODMA 4DV2B 2WLJA 2Q7GA 5IT9N 3H9VA 3JATA 3K9SA 1SQXH 3ML0A 2WA4A 4CZZA 3N2GA 3N2GB 1JJOA 2BSKB 1WLEA 3CCSV 4DR5O 1KB9F 3OMAB 3BCCH 4A5UB 4UV8A 1IURA 4DR6O 1E1QG 2ZQMA 3CCVV 1GM9A 4JYBA 4AHCA 3APQA 1XEQA 2AGAA 2AW9A 5B1AC 1IBLB 1BSMA 4LF4O 4NTYA 4OPAA 3OUFA 1Q8IA 4DV6B 1NTMH 3OTOO 2YIAA 3MHSC 3TCUA 4DR3O 2PI5A 3AEIA 1PNMA 3L73H 1B06A 2JEUA 2QR4A 3OAAG 3SPCA 4B3RB 1H2MA 1AB3A 1RP3B 2XOKG 3DSQA 5LHIA 3AG1B 4E4EA 1RPRA 1M1KW 1FYJA 5D5PA 1QU7A 2P22C 5KAFZ 1HWYA 3F7YC 4PA4A 2P06A 1N34B 5L3GA 1SESA 2QM7A 4JI6O 2PZSA 3ETEA 3UQ8A 3RYCA 5JVDA 3ZCCA 3RYCB 1K34A 2M7WA 2EX3A 1X59A 1JPXA 2QWOB 4JYCA 5IY5C 2PUSA 4PA6A 2EZPA 3JCZA 3B77A 1F51A 3W7SA 4TV8A 4X64B 4TV8B 5B1BC 3CRAA 4O4HA 4B3SB 1N33O 2VRZA 3CRMA 1GN4A 5LMUB 3P3PA 1R6NA 2FKXA 3AG3B 4FVMA 1N4CA 1VF6C 4BAYA 1TA8A 4P2ZA 1JFFA 5IWAO 4JPRA 1AJQA 2QM8A 2XUMA 1QR9A 2ARHA 1IZ3A 1Q86W 1YIJV 4Z2WA 1G1XB 1NKDA 1W59A 4YIOA 1GAXA 1VP7A 2X7RB 3H1IH 3K57A 4O4JB 1GM7A 1M56C 3ZMTA 2BCCH 3L75H 2K1EA 2HKOA 1AROP 4UVAA 2P5OA 5B1OA 3A0HZ 5FNVB 1N0JA 3L72H 1M9NA 1WPXA 5LA6B 5CBFA 1WB8A 2UXCO 2VQEO 1YTFB 3OGCC 2HEPA 4RUEA 5KAIZ 4F6EA 2OTLV 4MVZA 2M6YA 1K4CC 1XNQO 1ZX3A 2K9PA 4K0KB 2IJHA 3W7WA 1GN2A 4WFFA 3H1LH 1I5YA 1VQKV 1G4YB 4X62B 4I0XA 2ETNA 2ZE7A 5GONA 3OMNB 4OXSA 2CH7B 1FJGO 3OM3B 2P4VA 3SDLA 3IFXA 1WN7A 2HVJC 4IYIA 4X1IB 1YVWA 1SA0B 4WF9V 3D3IA 1NI8A 5J9PC 4J7ZA 3LDEA 2QA4V 2F95B 4KHPO 2DYSC 3WB0A 4O2AB 2RCVA 4DYLA 4Q20A 1FXKC 1Q6IA 1EZVH 4DV1O 4GZRB 3H1HH 4FLUA 2WLMA 3JD2A 3M8AA 2ZXWB 4QGPA 2GTAA 1F4NA 1SQFA 3M7MX 1XHXA 5E1AC 3FAVA 4H44B 4GT1A 4DR2O 4RAIA 2Q0AA 3ZBHA 1SQQH 3T4ZA 1Q6UA 4CBCA 2Q73A 4YJ2A 3SPIA 4I4TB 3B8NA 4F6RA 4OX9B 2X0LA 4YHHO 1WJZA 1Q7YW 2DQ3A 4JAVA 4J80A 5H6RA 4I9QA 3QO7A 3RWRD 3ZN1A 1AI7A 1VF6A 3UT5A 3I56V 1SZTA 4NXNO 1AR4A 4TOIA 4DK0A 1OCCB 3KZIZ 1GK9A 5L3DA 2HJDA 3CMEV 2Z0AA 4CS2A 5ITZB 1EN4A 2Y69B 2CUGA 3G6EV 4AQYB 4GX5A 4FFBB 2WLIB 1H2KA 3ZEDA 4X8AA 1WAZA 3ABKC 3BA8A 3TK1A 3AK3A 1M56B 1IXMA 5HFMA 2Y4UA 1SRYA 4DO2A 5LOVB 2VWKA 5KHIA 4FM1A 4G27B 3FB7C 3GVMA 4DV0O 4IYHA 1MZFA 4ZOLB 4DV7O 5LHHA 4XDJA 2DQ0A 3JYCA 4YY3B 1GH6A 1MSDA 4UCOA 2W0FC 2ZM6O 1XUQA 3D3QA 4G2KA 3ETQA 1LNQA 3K3WA 3CCLV 1FAFA 3OFNG 1KYOF 1N36O 3KCYA 3R66A 4JTAB 3FKSG 4MTXA 1IBKB 2KG7A 3CMAV 4GX0A 4H37A 1OCOB 3OMIB 4CS4A 2QSAA 3G67A 2EJRA 3K5LA 4UCTA 3GWOA 1IVSA 2QKCA 1AJPA 4IGGA 2YEVA 1IBMB 4DV4B 4TUYA 4TV9A 4ZKIA 1XILA 2YEVB 4ZHQB 1R6TA 3ZRVA 5B3SC 4HZ3A 5CB4B 4UCSA 3ABTA 4I55B 2UUBO 2IJIA 3N2KB 1YI2V 1FXKA 5LBQA 5IJ9B 3HPLC 3ASNC 5DM6V 4JI7O 3IJ4A 2FMLA 5EZYA 1EFRG 4WCEV 2EIKC 3ICXA 3J7AU 2HHHB 4R8CA 3SR2C 2P4KA 3FYEB 4B3RO 4P9PA 1XMQB 1UFIA 2GSMB 3QTCA 4P9OA 1VQ4V 4JZ2A 3C3SA 2H3OA 1SQGA 2RMKB 3RVZA 3TETA 1S76D 3WU2Z 1ROPA 2LFSA 4FLXA 1MZEA 4DR1B 3HKEB 4PA3A 1KD1W 1P84F 4D6TH 4AI8A 1MG1A 1N34O 1VQ6V 1SKVA 1R1BA 4LFAB 2IU0A 1Y76B 3NR7A 1RM1C 3SJAC 3QG5A 3RBZA 1XNRB 5A2QN 2YIDA 3ZJZA 4GCZA 4EFBA 1MSWD 3UO3A 1FXVA 2F66C 3SJQC 3UCSC 2LFRA 5KHJA 3W7UA 5IYCO 4FZ1A 4X65B 1AJNA 3ZHSA 2NN4A 4XDLA 2QTOA 1K8AW 2A79B 5LMNB 3OT7A 3CPWU 2L35A 3ZMUA 4B3SO 3ASOB 3K5MA 4ZBMA 5LMUO 4JF3A 2YI9A 1WP8A 1Y6XA 3TJTA 1TVKB 1BMFG 1AI5A 5FPOA 4EKWA 2HLDG 4RO2A 3H1KH 2IBZH 1D5AA 4O2BA 4L8JA 4DR4B 4MTFA 2X6CA 3CCUV 4K8XA 1Q5OA 4C7UA 3IC7A 1I5XA 2R70A 1Q43A 2XAGA 2R9AA 1JJ2U 5IJ0A 1S0VA 5JCOC 3G6BA 5L3CA 3AG1C 3E89A 3BFRA 5EIBC 1SF9A 5CA1B 2Q4PA 5C8YB 1YITV 4DUZO 4JYYA 1Z5VA 3HR0A 3JASA 4GKKB 2H94A 5FLXN 3SYAA 4DRXA 2MK3A 4MVOA 4FLWA 2F23A 3ZIAG 1FPOA 3E86A 1YTFD 3RT3C 1ORQC 4FZ0A 2ZE5A 3JAMN 3BVOA 4X62O 4O4IA 1R3LC 3I55V 2VQFO 5H5NA 3ABMB 4LF6O 1RFYA 2CGNA 2N04A 5KMGA 2BOBC 2N74A 3ASNB 3F7VC 3ABUA 2F93B 4RUFA 4MTGA 2ZR3A 1Z2GA 3TXSA 1S5JA 4GUNA 5JH7A 1QCEA 1I0HA 3FD9A 3N27A 5JH7B 3CHXA 2RNBA 4QNHB 3VBBA 4CS3A 3AG3C 1HNWO 1N32B 1Q82W 2E76B 3I5DA 4E2LA 4FLYA 2GUZB 4FJCC 1FFTB 2R9IA 3SYOA 5CA3A 4XDKA 3JCUZ 1NTKH 3HKDB 3MHHC 5CA0B 2B1GA 5JQGA 2DMXA 3CE2A 2JEXA 5EBWC 3G71V 2EIMB 1E1RG 1OHHG 1H8EG 5EC1C 4FFKA 3VQXA 1FKAO 3JSNA 2VS0A 2UUAO 4NXMB 2YDEA 2YIBA 5LGUA 3RFRA 3AG2B 2BSKA 4J11A 1ZUQA 2CTRA 1HR0O 3HB3B 1MMMA 4NKGB 5LYJB 4JI4B 4OX9O 3DC6A 4LF9O 5F2VO 3D36C 3BPZA 3R65A 3NXSA 2G38A 3UM7A 1BL8A 2OTJV 1NZ6A 2BE3A 3ZHRA 1SQVH 4B7KA 1NH2D 2ZDIC 3A0RA 3T4DA 1K97A 4AILC 1PNKA 1PL4A 3E8GA 4JGSA 5B1NA 4JYAB 3BY6A 3BHPA 1U97A 4AQYO 1NVPB 2CTQA 2Q68A 3A0BZ 5JCOA 4NR1A 5EBMC 1XMOB 2YUAA 4FMTA 3MAQA 2ZIMA 2UXNA 2DWDC 3SPJA 1R73A 4UVBA 4RQFA 5L3FA 4B3TB 1V9PA 3WB2A 2QKAA 3CJHB 4JZGA 1MA1A 4K35A 4BIZA 5KHHA 3CB2A 2Y4TA 1XHZA 2A3QA 4JAAA 3RYIA 4EB6B 1Q90D 2ZXWC 3RYIB 4KL1A 1YJWV 1HNZB 1NTZH 1B04A 3BEHA 2F1MA 2GV9A 1U96A 3L9DA 5K1PA 2FB5A 1AVMA 2KSDA 2IW5A 4ASUG 3ZRWB 5D5QA 4YXWG 1PL0A 1IBKO 4DV3O 1VMGA 2V1DA 2VWJA 1YJNV 1IBMO 4LF8O 3S3WA 4DV4O 2Q67A 3GB7C 5LGTA 1LUVA 2ZNJA 2JJ2G 3ZMSA 2WLNA 2L6LA 1AR1B 1OCCC 4KFMA 4LP8A 4X89A 2Y69C 1Y74B 1BQZA 2HHHO 4UCRA 1SS3A 4O4JA 5DEDA 4TT3G 1ZL8B 4R7CA 1S77D 1VQ5V 4MW3A 1XMQO 3JD1A 4JI2B 4I7ZB 1L8DA 5FNVA 3CCQV 3ZRXA 4TWKA 5LA6A 2CDYA 5LP6A 1D5NA 1ZLZA 3BAAA 5LP6B 4PDMA 4BIOA 2ITDC 1LR1A 5GTIZ 4DR1O 3DXRB 1XQ8A 3VQVA 3D36A 5LHGA 3RW0A 3K59A 1P49A 4H0LB 2JIZG 3EXAA 2RJZA 3CWBH 4LFAO 2UXBB 2QWRB 1Y67A 5J2TA 1NU1H 2ZDIA 1XNRO 5J2TB 5BR8O 2CH7A 2CGOA 1L0LH 3JARB 1L1FA 5C93A 3ZN0A 1FXHA 4X65O 2PYJA 4X1IA 1BQ0A 1OCOC 5CMUA 2RDCA 4FIPC 4P30A 1XBLA 1SA0A 1FD9A 5JJEB 2HR3A 3K08A 1DTOA 1OZ0A 2JRIA 4QIWF 4LH6A 1Q6HA 3IGAC 2R9RB 1NR7A 3VQWA 2JGDB 2F4VB 2ZINA 4O2AA 2A7WA 1GN6A 4TQFA 1QNMA 2DJVA 4DV5B 1K5QA 4WBNB 1J5EO 2ZR2A 2QWQB 1RSOB 2W6JG 4QE7A 3CX5F 4HNAB 3JAWB 2Y48A 1TUEB 5IYZB 1YF2A 4PD4F 1XOUA 4JI0O 2ATKC 1YCIA 2UUCO 1JMKC 3ZMVA 4I4TA 3C90A 3CCRV 3LSQA 4X1KB 3EFFK 4GKKO 3JAKB 4JI1B 2DYRB 1Q3EA 2Q7HA 4MSWC 4U7NA 3T1YB 3K03A 1VARA 4NVPA 1Q81W 2UU9O 4R50A 1THZA 4GX1A 3RVYA 4J42A 2QGNA 1QLEB 4YIPA 5ITZA 1K73W 2V7QG 2BOCC 4FFBA 3W7XA 2WLIA 2OYQA 1M57B 3BABA 1KP3A 4MVRA 2D3OW 1O9HA 4LF4B 1VQ7V 1KKCA 3ASOC 4D7TA 5LOVA 4DR3B 3KKYA 1N32O 3U0ZA 1V54B 3Q4HB 4DUYB 1H2NA 3L71H 3X2QB 4ZOLA 1HDJA 4PDRA 1SETA 4CH3A 4YJ3B 2ZD9A 3G80A 4CH5A 2IH1C 2QKSA 3DTUB 1ZAUA 2X6BA 4DV2O 4LR3A 3GWKC 3OD4A 3AK2A 1QR8A 2LW1A 1I08A 1CP9A 1VQ8V 2ADQB 1EBOA 5KA6A 5KX5B 4JI6B 4IT5A 1S5HC 5EYPB 2YIBD 4JI4O 4WFGA 3JALB 2XT9A 3WG7B 4ZHQA 2KQXA 5DECA 4L87A 1JR9A 5CB4A 5JWPA 4FK5C 3B2EE 4I55A 3N2KA 4IIJB 4KXRA 1IBLO 1NS1A 1DK1A 2PYLA 5IJ9A 3B4SA 4DV6O 2QM4A 3ABMC 2AXTZ 2Q7EA 3CEIA 3K5OA 4X66B 5IYBO 2QEXV 5FPRA 2EIJB 1DLBA 1IDSA 2YXLA 3WB1A 1XMOO 2PGGA 4JV5B 3CXCU 4UB6Z 5CBHA 4X20A 3U10A 1NVPD 3LDDA 4X20B 1YHQV 3AG7A 1L0NH 4I50B 4B3TO 4GX2A 5CN0A 3HKEA 4Z1VA 3E22A 1H2SB 5K1XA 3E22B 1PV0A 2O57A 2XTAA 5EIBD 1B3QA 5BXZA 3A8TA 4MW8A 1Y76A 5KUMA 4GKJB 2EIMC 2HFEC 2OCCB 3QO8A 4UVCA 2PTMA 5BZBA 5L3EA 2UXCB 3F5TA 1BCCH 4LBEC 1VQOV 1HP8A 2EINB 3H1JH 1FFXB 3LNMB 3AG2C 1P4RA 3S3XA 1HNXB 1K7DA 3G4SV 2XAFA 1VQLV 3HKBA 1XNQB 4X64O 4K8ZA 3HKBB 2WPDG 4MVSA 3STZC 2E75B 4ICGA 5LXTB 4BWAA 3K58A 2WSSG 5H2FZ
chains in the Genus database with same CATH topology
4LC1A 2HKOA 1AROP 2ITCC 4UVAA 5B1OA 1M9NA 1WPXA 4PELA 5CBFA 5KUKA 1QVGU 1VQMV 1DF5A 3R65A 3NXSA 3UM7A 1DF4A 1YTFB 1BL8A 3OGCC 2OTJV 3JD0A 4XBFA 4RUEA 2LP7A 5IDJA 4FPPA 1NH2D 3CC7V 2OTLV 2ZDIC 3A0RA 4MVZA 4WFHA 3T4DA 1K97A 1PNKA 1K4CC 4HAMA 3OR6C 3E8GA 2IJHA 3W7WA 4WFFA 2WAMA 3SYQA 3AG4C 4JGSA 5B1NA 3E8HA 4I9WA 1I5YA 2HVKC 1VQKV 1G4YB 4WFAV 3BY6A 4MS2A 3CYOA 2Q6AA 1NVPB 4QPJA 1YJ9V 2Q68A 3OMNB 5H6QA 3AG4B 5EBMC 4OXSA 3OM3B 4FMTA 5IYDO 3UKMA 1F23A 3QO5A 4PDLA 2UXNA 1AI6A 2DWDC 3IFXA 3SPJA 1R73A 2HVJC 4WFEA 3ETGA 4UVBA 4RQFA 5L3FA 1BHBA 4N21A 4WF9V 3K06A 3D3IA 1S3JA 2DWEC 4KP4A 3CC2V 4U7OA 2IU3A 4BIZA 2JDIG 5J9PC 1SERA 1R3KC 3LDEA 2QA4V 2DYSC 1R3IC 3B8MA 2ZXWC 4Q20A 5L3BA 1FXKC 2AHYA 1YJWV 2W6IG 1H38A 3BEHA 4H33A 3E8FA 4R6ZA 2DYSB 2WLMA 3K9AA 3JD2A 2IJJA 2IJKA 2ZXWB 4PDVA 2Q69A 1GTOA 1FXKB 1F4NA 2OT5A 3ABLC 5LGNA 3OW2U 1GM8A 2IW5A 3E35A 5E1AC 4ASUG 2JK5C 3OEHG 3ZRWB 4YXWG 1PL0A 1CPYA 5DN6G 5KA5A 4GT1A 4PA9A 3OE7G 4LCUC 4RAIA 2NNUA 2V1DA 3ABLB 3K04A 1KKDA 3T4ZA 3QNEA 1YJNV 3K0DA 4CBCA 3SPIA 2Q67A 2WLKA 2B5UA 2KB1A 3B8NA 2P6JA 3GB7C 5LGTA 2GHYA 2IH3C 2JJ2G 3ZMSA 1V55C 2Z3YA 2X0LA 2WLNA 2AHZA 4BW5A 1AR1B 1Q7YW 1K92A 1OCCC 2DQ3A 4JAVA 5H6RA 4PA7A 2DW4A 3QO7A 4KFMA 3ZN1A 1AI7A 4LP8A 3I56V 1SZTA 1V55B 4X89A 1EZJA 2Y69C 4Z1MG 1ENVA 2NLJC 1MABG 2EILC 1OCCB 1GK9A 4QJFB 4TT3G 1XL4A 5L3DA 2HG5C 4R7CA 1AI4A 1S77D 3CMEV 1VQ5V 4MW3A 2Y69B 3JD1A 4UUJC 3G6EV 3CCMV 2EILB 3CCQV 4GX5A 3ZRXA 4TWKA 3JD4A 2WLIB 4X8AA 3ABKC 3TK1A 1M56B 4PDMA 1IXMA 1KECA 2ITDC 4UXNA 5HFMA 3WFVA 1PKXA 1W0KG 1SRYA 3D36A 5LHGA 4DO2A 3RW0A 1K3EA 2XAJA 3CP1A 1YSCA 2JIZG 3ABKB 3ZMZA 3T2MA 1VQNV 4G27B 1BHAA 2WLLA 3FB7C 4QE9A 2WLLB 2ZDIA 1K33A 2X6AA 2XASA 5LHHA 3OUSA 1GKFA 4XDJA 2DQ0A 3JYCA 2W0FC 3H01A 3LSSA 4MTOA 5EBLC 4G2KA 1JVMA 1L1FA 5C93A 1M90W 3ZN0A 1FXHA 1FS0G 1LNQA 1OCOC 3K3WA 5CMUA 3CCLV 3OFNG 4FIPC 4P30A 1ZWIC 2FTKA 2HR3A 3K08A 4JTAB 1DTOA 3FKSG 1OZ0A 4MTXA 3CMAV 2UXXA 4GX0A 3E8BA 4H37A 4QIWF 3FB8C 1OCOB 4F4LA 3IGAC 3OMIB 2R9RB 2P7TC 2EJRA 1NR7A 3GWOA 3K0GA 1AJPA 1R3JC 2YEVA 1NBMG 1B6QA 1JX9A 3E83A 4MVUA 1PNLA 4ZKIA 3W7TA 3VOUA 2YEVB 3ZRVA 5B3SC 1K5SA 4HZ3A 1K5QA 3ABTA 4JAUA 2IJIA 4X88A 1P7BA 2ZR2A 3JD3A 1E79G 4HYOA 1FXKA 4TSFG 5H9CA 5CBGA 5LBQA 1YI2V 1VQ9V 1JCHA 4QE7A 2W6JG 5B3SB 1NJIW 1JOYA 3ZRWA 3HPLC 3ASNC 4MT8A 5DM6V 1EFRG 4WCEV 2EIKC 3T1CA 2Y48A 3KG2A 1TUEB 4R8CA 3FYEB 2ATKC 4P9PA 2DYRC 2XAHA 2GSMB 4P9OA 3ZMVA 3CC4V 1VQ4V 3CCRV 2EIKB 3LSQA 3RVZA 2QE7G 3EFFK 3TETA 1S76D 4DXWA 3SPGA 1OCZC 1ROPA 3SYPA 1OCRC 2LFSA 1COWG 4N23A 2DYRB 5HFLA 1N8RW 4MSWC 4U7NA 1QVFU 1QLEC 1MOFA 1Y66A 4KUMA 1OCZB 3K03A 1CEZA 4PA3A 2A0LA 1OCRB 1Q81W 3CCEV 1KD1W 3ETDA 3K79A 1MG1A 4R50A 3DGEA 1THZA 4GX1A 1VQ6V 1W0JG 2IU0A 2HJFC 4MVQA 3RVYA 1QLEB 1RM1C 1M57C 3F5WC 3RBZA 3LDCA 1JQ0A 2F43G 1K73W 1QLNA 1KQSU 3OR7C 3ZJZA 5EK0A 3LUTB 2V7QG 4GCZA 2BOCC 1KC8W 2PI4A 3W7XA 1MSWD 2WLIA 1GO3F 1FXVA 1RM1B 1M57B 3SJQC 1KP3A 2P67A 4MVRA 3P30A 2WLJA 2D3OW 2LFRA 3W7UA 5IYCO 1V54C 1VQ7V 1K9MW 1Y4MA 1AJNA 3ASOC 3FB5C 4XDLA 2QTOA 3ML0A 1K8AW 2A79B 3X2QC 4CZZA 3CPWU 1V54B 3ZMUA 1GMGA 1WLEA 3ASOB 2YSUB 3CCSV 4ZBMA 3OMAB 4JF3A 4UV8A 3X2QB 1E1QG 2JJ1G 2CK3G 2WWWA 2ZQMA 1SETA 4PDRA 1H8HG 1BMFG 3CCVV 1AI5A 1J95A 1GM9A 4EKWA 2HLDG 4JYBA 3EHBB 4RO2A 2ZD9A 1NR1A 3CCJV 2IH1C 4MTFA 2X6CA 5B1AC 2QKSA 3DTUB 3CCUV 2X6BA 1F4MA 2WLHA 3OUFA 1QR8A 3IC7A 1W2BU 1I5XA 1CP9A 3MHSC 4G28B 1KP2A 3TCUA 5B1AB 2XAGA 1VQ8V 1JJ2U 1S0VA 1EBOA 3WG7C 5KA6A 2PI5A 3AEIA 1PNMA 5L3CA 3AG1C 3E89A 1S5HC 2JEUA 3OAAG 3SPCA 4WFGA 3PJSK 2XOKG 3WG7B 1YITV 5LHIA 4I5SA 4L87A 3AG1B 1RPRA 4FK5C 2H94A 1M1KW 3SYAA 4BIUA 4QPKA 3STLC 3FYIB 2MK3A 3CD6V 1H2GA 4MVOA 2B1IA 3ZIAG 1UJWB 1HWYA 3F7YC 4PA4A 2P90A 5FL7G 3FB6C 2Z5UA 3E86A 2EIJC 1YTFD 3ABMC 1ORQC 1R6KA 1PD3A 5L3GA 1SESA 2QM7A 5IYBO 2QEXV 1R3LC 3I55V 3E2EA 2EIJB 1RPOA 3ABMB 1DLBA 4UV9A 3ETEA 3OEEG 2BOBC 3ASNB 3F7VC 3CXCU 3ABUA 5CBHA 3ZCCA 1K34A 2M7WA 2XAQA 1S72V 4MVMA 1JPXA 1G8MA 4RUFA 1XL6A 1NVPD 4MTGA 4JYCA 3LDDA 5IY5C 1YHQV 4JASA 2ZR3A 5GW7A 4PA6A 2EZPA 3JCZA 3B77A 1QCEA 4GX2A 5CN0A 1F51A 3W7SA 3MD0A 3ZRSA 3SPHA 4QNHB 5B1BC 3VBBA 3AG3C 5IY5B 2OCCC 1Q82W 4JTDB 4E2LA 1QBZA 2EZOA 4MW8A 2H8PC 1VQPV 5KUMA 4FJCC 2EIMC 1FFTB 1R6NA 2HFEC 3AG3B 2R9IA 5B1BB 2OCCB 4XDKA 3SYCA 1K4DC 4J9YB 2EINC 5CA3A 3QO8A 4UVCA 1NH2B 3MHHC 4JTCB 5BZBA 5L3EA 4BAYA 3P32A 2B1GA 3G71V 2JEXA 5EBWC 4P2ZA 2EIMB 4LBEC 1NQTA 1VQOV 4RQEA 1E1RG 2XNDG 2EINB 1OHHG 1H8EG 2A9HA 3LNMB 4JPRA 3SYOA 1AJQA 5EC1C 2QM8A 3AG2C 1P4RA 1QR9A 1K7DA 3G4SV 5EC2C 1Q86W 2EBOA 2XAFA 2C2AA 1VQLV 1YIJV 4J9ZB 5LGUA 1NKDA 4WFBV 2WPDG 4MVSA 3STZC 2X7RB 3AG2B 3M99B 1GM7A 1M56C 3ZMTA 2WSSG 3HB3B 2K1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QE7 A;  2ITC C;  4BW5 A;  3WG7 C;  1OCC C;  3AG1 C;  3E89 A;  3HPL C;  4PA7 A;  1S5H C;  3ASN C;  5CBF A;  5KUK A;  4KFM A;  3R65 A;  2EIK C;  4LP8 A;  3SPC A;  3T1C A;  4WFG A;  4X89 A;  3PJS K;  3UM7 A;  3KG2 A;  1BL8 A;  2Y69 C;  3OGC C;  4R8C A;  2NLJ C;  2EIL C;  4RUE A;  2ATK C;  4P9P A;  2DYR C;  4P9O A;  3SYA A;  4WFH A;  1XL4 A;  4MVZ A;  3STL C;  3T4D A;  2HG5 C;  4R7C A;  3RVZ A;  1K4C C;  4MVO A;  4MW3 A;  3EFF K;  3OR6 C;  3E8G A;  4DXW A;  3TET A;  3SPG A;  1OCZ C;  4UUJ C;  3SYP A;  3F7Y C;  4PA4 A;  4WFF A;  1OCR C;  3SYQ A;  3AG4 C;  3FB6 C;  3E8H A;  4GX5 A;  4I9W A;  3E86 A;  2EIJ C;  2HVK C;  3ABM C;  1ORQ C;  1G4Y B;  4TWK A;  4MSW C;  2WLI B;  4MS2 A;  4X8A A;  2Q6A A;  1QLE C;  3ABK C;  3K03 A;  2Q68 A;  4PA3 A;  2A0L A;  4PDM A;  1R3L C;  5EBM C;  2ITD C;  4OXS A;  4R50 A;  4GX1 A;  3UKM A;  4PDL A;  2HJF C;  4MVQ A;  2DWD C;  3RVY A;  3RW0 A;  3IFX A;  2BOB C;  3SPJ A;  3F7V C;  1M57 C;  3T2M A;  5CBH A;  2HVJ C;  3F5W C;  4WFE A;  3RBZ A;  4G27 B;  3LDC A;  4MVM A;  4RUF A;  2WLL A;  1XL6 A;  3OR7 C;  4MTG A;  3ZJZ A;  5EK0 A;  3LDD A;  3LUT B;  3FB7 C;  5IY5 C;  2BOC C;  4QE9 A;  2WLL B;  4PA6 A;  3K06 A;  2WLI A;  2X6A A;  4GX2 A;  3SJQ C;  2DWE C;  4MVR A;  3ZRS A;  3SPH A;  2WLJ A;  3OUS A;  5J9P C;  4QNH B;  4XDJ A;  1R3K C;  3LDE A;  3JYC A;  3AG3 C;  5B1B C;  1V54 C;  2OCC C;  2DYS C;  3SYC A;  2W0F C;  1R3I C;  4JTD B;  3ASO C;  3FB5 C;  2ZXW C;  4MTO A;  4XDL A;  2QTO A;  2AHY A;  4MW8 A;  5EBL C;  1JVM A;  2A79 B;  2H8P C;  3X2Q C;  5KUM A;  2EIM C;  1LNQ A;  1OCO C;  2HFE C;  3BEH A;  3E8F A;  4H33 A;  4R6Z A;  4XDK A;  1K4D C;  4J9Y B;  2EIN C;  2WLM A;  4P30 A;  4JTC B;  1ZWI C;  5BZB A;  4PDV A;  4ZBM A;  2Q69 A;  3K08 A;  4JTA B;  3ABL C;  5EBW C;  4P2Z A;  4GX0 A;  3E8B A;  4H37 A;  5E1A C;  3FB8 C;  2JK5 C;  4LBE C;  4PDR A;  4F4L A;  3IGA C;  2R9R B;  1J95 A;  2A9H A;  2P7T C;  3LNM B;  3SYO A;  4EKW A;  5EC1 C;  4PA9 A;  3AG2 C;  3K0G A;  4RO2 A;  1R3J C;  2ZD9 A;  4LCU C;  2YEV A;  4RAI A;  5EC2 C;  2IH1 C;  3E83 A;  3K04 A;  4MVU A;  2X6C A;  4MTF A;  2QKS A;  4J9Z B;  5B1A C;  1KKD A;  2X6B A;  3VOU A;  3T4Z A;  5B3S C;  2WLH A;  4HZ3 A;  3OUF A;  4MVS A;  3K0D A;  3STZ C;  4CBC A;  3SPI A;  2Q67 A;  2WLK A;  2KB1 A;  4X88 A;  1P7B A;  3GB7 C;  1M56 C;  4G28 B;  3TCU A;  2IH3 C;  4HYO A;  5CBG A;  1V55 C;  2WLN A;  2K1E A;  2AHZ A; 
#chains in the Genus database with same CATH topology
 4LC1 A;  1TVK A;  1FJG B;  3IAY A;  1TUB B;  5KUK A;  1QVG U;  1VQM V;  1DF5 A;  2DOS A;  1DF4 A;  3JD0 A;  4CC5 A;  4XBF A;  2LP7 A;  2ZE8 A;  4FPP A;  4LFC B;  3CC7 V;  4WFH A;  2E5L B;  2QWP B;  3OR6 C;  1M4U A;  3SYQ A;  2V4D A;  4I9W A;  4KHP B;  1I94 B;  4MS2 A;  3CYO A;  2Q6A A;  3OGI B;  2QTS A;  1YJ9 V;  4UB8 Z;  2Q5Z A;  5H6Q A;  5CA1 A;  3AG4 B;  5C8Y A;  5IYD O;  3FX7 A;  3UKM A;  1F23 A;  3QO5 A;  4PDL A;  1AI6 A;  2CTP A;  1D2D A;  4OGQ B;  3K06 A;  2PY5 A;  4DR2 B;  1XI1 A;  4KP4 A;  4FLZ A;  4K0K O;  3L70 H;  3CC2 V;  1SER A;  1R3K C;  4O4L B;  4UCU A;  4B3M B;  1URF A;  1H2L A;  2XHB A;  1N0N A;  1R3I C;  1JA8 A;  4H13 B;  3T1H B;  5KLV H;  1H38 A;  4LFB B;  4YHH B;  4H33 A;  1IXB A;  2Q69 A;  2OT5 A;  2Q8V A;  3RYH B;  3OW2 U;  1GM8 A;  3E35 A;  3OEH G;  5DN6 G;  2UXD B;  5KA5 A;  2EJ7 A;  2YC0 A;  4LCU C;  3HKC B;  3ABL B;  2GUZ A;  4DW1 A;  3K0D A;  4NYK A;  2WLK A;  3HKD A;  2KB1 A;  2P6J A;  4U3J B;  5CA0 A;  2OWO A;  2AHZ A;  4W4K A;  2DW4 A;  3RYF B;  4EFE A;  1V55 B;  4Z1M G;  1AR5 A;  1MAB G;  3CRQ A;  5BMV B;  3UO2 A;  2E74 B;  2MW2 B;  4J7K A;  5J2U B;  4UUJ C;  3CCM V;  2EIL B;  2LJ2 A;  5LP6 C;  2LW7 A;  5LYJ A;  5KHG A;  1QQC A;  4JI1 O;  4CH6 A;  2ZM6 B;  1US6 A;  3T1Y O;  1KEC A;  4UXN A;  1SQP H;  3JAT B;  1W0K G;  1XDC A;  1N36 B;  2XAJ A;  4J10 A;  5LL6 Y;  3ZMZ A;  3FFQ A;  3SJC C;  3CRC A;  1DGS A;  1WPB A;  5BY1 A;  4X9Q A;  3ZHT A;  2X6A A;  1VEW A;  1PP9 H;  4LF5 B;  2YI8 A;  1CXZ B;  4FM2 A;  3EVK A;  1GKF A;  2AZ0 A;  2UUB B;  3H01 A;  4MTO A;  1JVM A;  3VQY A;  1M90 W;  4UCV A;  2ADP A;  4BW9 A;  4PI0 A;  4JI7 B;  1A32 A;  2FTK A;  3CJH A;  1WA8 A;  2DN9 A;  4DUY O;  3QVN A;  4LF7 B;  4F4L A;  1WA8 B;  5TIS Z;  3APO A;  2P7T C;  4EB6 A;  4X1Y A;  1PNL A;  2QDO A;  3W7T A;  2QJ1 A;  4X1Y B;  1EN5 A;  4YY3 O;  2R72 A;  4X88 A;  1PM9 A;  1E79 G;  4HYO A;  5H9C A;  1M93 A;  1BZK A;  3QF7 A;  1JCH A;  1NJI W;  1KUQ A;  3ZRW A;  1SZX A;  1G6U A;  2Q0O C;  3C3T A;  1VF5 B;  4CH4 A;  3BA9 A;  4JI5 B;  3LNN A;  2DYR C;  2XAH A;  2GDS A;  5JVD B;  4J41 A;  4DXW A;  3SPG A;  3ZHU A;  3SYP A;  4HBN A;  4N23 A;  2BTO A;  5HFL A;  1N8R W;  3RN4 A;  4UFZ A;  5KHK A;  4TQD A;  4W4L A;  4ZIB A;  1QLE C;  1MOF A;  1OCZ B;  1IX9 A;  2A0L A;  1OCR B;  1Y74 A;  3LSU A;  1YXB A;  1KMI Z;  3ETD A;  3K79 A;  4X66 O;  3DGE A;  1W0J G;  2HJF C;  4MVQ A;  1ZL8 A;  2YXY A;  4O4H B;  1M57 C;  3ZHQ A;  3CS5 A;  1QLN A;  2F43 G;  1KQS U;  3OR7 C;  4JV5 O;  4B7E A;  3LUT B;  1KC8 W;  4PI2 A;  4DK1 A;  1GO3 F;  2P67 A;  1JFF B;  3P30 A;  2D2C B;  4DR7 B;  2OIG A;  1AIL A;  1V54 C;  4JI8 B;  3DXR A;  1K9M W;  1Y4M A;  3FB5 C;  3X2Q C;  1ZTE A;  2ZIO A;  1GMG A;  4LNU A;  4GKJ O;  2YSU B;  2EUL A;  4LNU B;  2HP8 A;  1LUW A;  2JJ1 G;  2CK3 G;  2WWW A;  1H8H G;  4DUZ B;  1J95 A;  2JS5 A;  2Y0P A;  3EHB B;  1NR1 A;  3CCJ V;  3JAR A;  3DC5 A;  1F4M A;  4ABM A;  1HNX O;  1KBH A;  2WLH A;  5GTH Z;  1YZB A;  1W2B U;  3ZX6 A;  2LO1 A;  4G28 B;  1KP2 A;  1MNG A;  5B1A B;  5LMN O;  5A9G A;  3WG7 C;  1OJH A;  2VQF B;  2JGU A;  4LF6 B;  4I0X B;  2LGW A;  2JGD A;  3PJS K;  1YDX A;  5GON B;  4I5S A;  1BS3 A;  5AG2 A;  4WBN A;  4BIU A;  4QPK A;  3STL C;  3FYI B;  3TGU H;  2IM9 A;  4DR4 O;  1VIB A;  1H2G A;  3IC9 A;  3CD6 V;  3O9O A;  2B1I A;  4LFC O;  4JI3 B;  1UJW B;  1NT2 B;  1RSO A;  5FL7 G;  2P90 A;  1WNS A;  3FB6 C;  1F7Y A;  2E5L O;  2Z5U A;  2EIJ C;  1HNW B;  1R6K A;  4HNA A;  4B08 A;  1PD3 A;  3J80 N;  3JAW A;  2E3C A;  3RGB A;  3SJB C;  3KCX A;  5IYZ A;  1I94 O;  3E2E A;  1RPO A;  3B09 A;  1T5E A;  4UV9 A;  3OEE G;  4X1K A;  3B40 A;  3JAK A;  2XAQ A;  1S72 V;  4MVM A;  1G8M A;  1XL6 A;  4JAS A;  5GW7 A;  1GRJ A;  3K5N A;  2UUA B;  3MD0 A;  1I7F A;  3ZRS A;  3SPH A;  3FAV B;  5IY5 B;  2OCC C;  4JTD B;  4FLV A;  4NTX A;  1QBZ A;  2EZO A;  3L74 H;  4B3M O;  3ZS8 C;  2H8P C;  4FLT A;  1HR0 B;  1VQP V;  3CRR A;  1KU9 A;  4DR5 B;  5B1B B;  4YJ2 B;  3SYC A;  2Y0I A;  3T1H O;  1K4D C;  4J9Y B;  2EIN C;  4DR6 B;  5B66 Z;  1NH2 B;  4JTC B;  4LFB O;  4PV1 B;  4F6R B;  4LF9 B;  3P32 A;  2YIC A;  4BR6 A;  1NQT A;  4RQE A;  2XND G;  2A9H A;  2W0X A;  2FYU H;  3U11 A;  3UT5 B;  5EC2 C;  2EBO A;  1SQB H;  2C2A A;  4J9Z B;  1BE3 H;  2UXD O;  2BTQ A;  1OV9 A;  3OTO B;  4WFB V;  3JSL A;  2BTQ B;  3M99 B;  3Q4H A;  2YS8 A;  4GYC B;  2GTS A;  5B5E Z;  2ITC C;  1BT8 A;  1S5L Z;  2ZKO A;  4PEL A;  4YJ3 A;  2LGQ A;  3PN1 A;  4U3F H;  5IDJ A;  3D8C A;  2ZT9 B;  3J81 N;  4NXM O;  4HAM A;  2Q9L A;  2WAM A;  3AG4 C;  3E8H A;  5KX5 A;  2HVK C;  2RN9 A;  4DW0 A;  4WFA V;  5EYP A;  1P7G A;  4QPJ A;  3JAL A;  1WP7 A;  4IIJ A;  4WFE A;  3ETG A;  4K3A A;  4J7J A;  1BHB A;  1YEW A;  4N21 A;  4DV3 B;  2KKW A;  2PF4 E;  2KG7 B;  1S3J A;  2DWE C;  1ZSP A;  1AP6 A;  4U7O A;  2IU3 A;  2JDI G;  4LF8 B;  4JYA O;  4LF5 O;  1N33 B;  1WB7 A;  3B8M A;  4TUY B;  4TV9 B;  5L3B A;  2AHY A;  2W6I G;  5JJJ B;  3E8F A;  4R6Z A;  5E79 Z;  2DYS B;  3K9A A;  2IJJ A;  2IJK A;  1BGY H;  4PDV A;  1GTO A;  1FXK B;  4I50 A;  5IWA B;  3ABL C;  5LGN A;  1Z5W A;  2JK5 C;  2ILM A;  4CC6 A;  1CPY A;  4PA9 A;  5EZY B;  4LF7 O;  3OE7 G;  2NNU A;  3K04 A;  4LWS A;  2OIE A;  1KKD A;  3AK1 A;  1X4T A;  3QNE A;  4LWS B;  2JS3 A;  2B5U A;  3A2F A;  2GHY A;  2IH3 C;  2A06 H;  1V55 C;  2Z3Y A;  1HNZ O;  4BW5 A;  1K92 A;  2VQE B;  4PA7 A;  1FFX A;  1EZJ A;  1ENV A;  2NLJ C;  2EIL C;  4QJF B;  5JJN B;  5LXT A;  1XL4 A;  2HG5 C;  4JI5 O;  1AI4 A;  2N05 A;  5BR8 B;  2OCH A;  1EN6 A;  1PPJ H;  3JD4 A;  1TUB A;  4PHZ A;  2ZE6 A;  4FM0 A;  3WFV A;  1UPG A;  1PKX A;  4Q6G A;  1K3E A;  3CP1 A;  1YSC A;  3ABK B;  1EM1 A;  3T2M A;  1VQN V;  1BHA A;  2WLL A;  4QE9 A;  2WLL B;  1K33 A;  2CE4 A;  2XAS A;  2RQ6 A;  4JI2 O;  3OUS A;  1TAE A;  4EEQ A;  1SC5 B;  4DV1 B;  1J5E B;  4O2B B;  3LSS A;  4DR7 O;  5EBL C;  1GN3 A;  4JI8 O;  4LH7 A;  1FS0 G;  2WA3 A;  1ZWI C;  2B9Z A;  2ZNI A;  5IJ0 B;  2UXX A;  5IE9 A;  3E8B A;  3FB8 C;  1M5I A;  2UXB O;  3CSX A;  4JI0 B;  4O4L A;  3K0G A;  2UUC B;  1R3J C;  1NBM G;  1B6Q A;  1JX9 A;  2AZ2 A;  4PJ0 Z;  3E83 A;  4MVU A;  2YXH A;  3VOU A;  3O65 A;  1K5S A;  3MDS A;  3JAS B;  4JAU A;  1P7B A;  1TGO A;  4DRX B;  3JD3 A;  2NR5 A;  4TSF G;  5CBG A;  3TXQ A;  1VQ9 V;  5B3S B;  3RYH A;  1QHT A;  4NXN B;  1JOY A;  2UU9 B;  2CAZ C;  1O9G A;  4RWU A;  3P3N A;  4MT8 A;  3HKC A;  3T1C A;  1XRE A;  3KG2 A;  4IL6 Z;  4O4I B;  4D7S A;  2CTW A;  2F4V O;  1HW7 A;  3CC4 V;  5KMG B;  2EIK B;  2QE7 G;  4U3J A;  2FL4 A;  1OCZ C;  4DV5 O;  1OCR C;  3ZHV A;  1COW G;  3CXH F;  4NTW A;  3OTF A;  2GBO A;  4JI3 O;  4OPH A;  2DE0 X;  4ZI7 A;  3RYF A;  1QVF U;  1Y66 A;  2JVD A;  4KUM A;  2QWN B;  4ZI7 B;  1CEZ A;  4GLX A;  3CCE V;  4IHJ A;  5BMV A;  4IHJ B;  3F5W C;  5J2U A;  4DV0 B;  1AP5 A;  4NB5 A;  3SGI A;  3LDC A;  1JQ0 A;  2ZCE A;  3BRC A;  5EK0 A;  1VF7 A;  2PI4 A;  4DV7 B;  2LQT A;  3THO A;  5JQG B;  1RM1 B;  2ODM A;  4DV2 B;  2WLJ A;  2Q7G A;  5IT9 N;  3H9V A;  3JAT A;  3K9S A;  1SQX H;  3ML0 A;  2WA4 A;  4CZZ A;  3N2G A;  3N2G B;  1JJO A;  2BSK B;  1WLE A;  3CCS V;  4DR5 O;  1KB9 F;  3OMA B;  3BCC H;  4A5U B;  4UV8 A;  1IUR A;  4DR6 O;  1E1Q G;  2ZQM A;  3CCV V;  1GM9 A;  4JYB A;  4AHC A;  3APQ A;  1XEQ A;  2AGA A;  2AW9 A;  5B1A C;  1IBL B;  1BSM A;  4LF4 O;  4NTY A;  4OPA A;  3OUF A;  1Q8I A;  4DV6 B;  1NTM H;  3OTO O;  2YIA A;  3MHS C;  3TCU A;  4DR3 O;  2PI5 A;  3AEI A;  1PNM A;  3L73 H;  1B06 A;  2JEU A;  2QR4 A;  3OAA G;  3SPC A;  4B3R B;  1H2M A;  1AB3 A;  1RP3 B;  2XOK G;  3DSQ A;  5LHI A;  3AG1 B;  4E4E A;  1RPR A;  1M1K W;  1FYJ A;  5D5P A;  1QU7 A;  2P22 C;  5KAF Z;  1HWY A;  3F7Y C;  4PA4 A;  2P06 A;  1N34 B;  5L3G A;  1SES A;  2QM7 A;  4JI6 O;  2PZS A;  3ETE A;  3UQ8 A;  3RYC A;  5JVD A;  3ZCC A;  3RYC B;  1K34 A;  2M7W A;  2EX3 A;  1X59 A;  1JPX A;  2QWO B;  4JYC A;  5IY5 C;  2PUS A;  4PA6 A;  2EZP A;  3JCZ A;  3B77 A;  1F51 A;  3W7S A;  4TV8 A;  4X64 B;  4TV8 B;  5B1B C;  3CRA A;  4O4H A;  4B3S B;  1N33 O;  2VRZ A;  3CRM A;  1GN4 A;  5LMU B;  3P3P A;  1R6N A;  2FKX A;  3AG3 B;  4FVM A;  1N4C A;  1VF6 C;  4BAY A;  1TA8 A;  4P2Z A;  1JFF A;  5IWA O;  4JPR A;  1AJQ A;  2QM8 A;  2XUM A;  1QR9 A;  2ARH A;  1IZ3 A;  1Q86 W;  1YIJ V;  4Z2W A;  1G1X B;  1NKD A;  1W59 A;  4YIO A;  1GAX A;  1VP7 A;  2X7R B;  3H1I H;  3K57 A;  4O4J B;  1GM7 A;  1M56 C;  3ZMT A;  2BCC H;  3L75 H;  2K1E A;  2HKO A;  1ARO P;  4UVA A;  2P5O A;  5B1O A;  3A0H Z;  5FNV B;  1N0J A;  3L72 H;  1M9N A;  1WPX A;  5LA6 B;  5CBF A;  1WB8 A;  2UXC O;  2VQE O;  1YTF B;  3OGC C;  2HEP A;  4RUE A;  5KAI Z;  4F6E A;  2OTL V;  4MVZ A;  2M6Y A;  1K4C C;  1XNQ O;  1ZX3 A;  2K9P A;  4K0K B;  2IJH A;  3W7W A;  1GN2 A;  4WFF A;  3H1L H;  1I5Y A;  1VQK V;  1G4Y B;  4X62 B;  4I0X A;  2ETN A;  2ZE7 A;  5GON A;  3OMN B;  4OXS A;  2CH7 B;  1FJG O;  3OM3 B;  2P4V A;  3SDL A;  3IFX A;  1WN7 A;  2HVJ C;  4IYI A;  4X1I B;  1YVW A;  1SA0 B;  4WF9 V;  3D3I A;  1NI8 A;  5J9P C;  4J7Z A;  3LDE A;  2QA4 V;  2F95 B;  4KHP O;  2DYS C;  3WB0 A;  4O2A B;  2RCV A;  4DYL A;  4Q20 A;  1FXK C;  1Q6I A;  1EZV H;  4DV1 O;  4GZR B;  3H1H H;  4FLU A;  2WLM A;  3JD2 A;  3M8A A;  2ZXW B;  4QGP A;  2GTA A;  1F4N A;  1SQF A;  3M7M X;  1XHX A;  5E1A C;  3FAV A;  4H44 B;  4GT1 A;  4DR2 O;  4RAI A;  2Q0A A;  3ZBH A;  1SQQ H;  3T4Z A;  1Q6U A;  4CBC A;  2Q73 A;  4YJ2 A;  3SPI A;  4I4T B;  3B8N A;  4F6R A;  4OX9 B;  2X0L A;  4YHH O;  1WJZ A;  1Q7Y W;  2DQ3 A;  4JAV A;  4J80 A;  5H6R A;  4I9Q A;  3QO7 A;  3RWR D;  3ZN1 A;  1AI7 A;  1VF6 A;  3UT5 A;  3I56 V;  1SZT A;  4NXN O;  1AR4 A;  4TOI A;  4DK0 A;  1OCC B;  3KZI Z;  1GK9 A;  5L3D A;  2HJD A;  3CME V;  2Z0A A;  4CS2 A;  5ITZ B;  1EN4 A;  2Y69 B;  2CUG A;  3G6E V;  4AQY B;  4GX5 A;  4FFB B;  2WLI B;  1H2K A;  3ZED A;  4X8A A;  1WAZ A;  3ABK C;  3BA8 A;  3TK1 A;  3AK3 A;  1M56 B;  1IXM A;  5HFM A;  2Y4U A;  1SRY A;  4DO2 A;  5LOV B;  2VWK A;  5KHI A;  4FM1 A;  4G27 B;  3FB7 C;  3GVM A;  4DV0 O;  4IYH A;  1MZF A;  4ZOL B;  4DV7 O;  5LHH A;  4XDJ A;  2DQ0 A;  3JYC A;  4YY3 B;  1GH6 A;  1MSD A;  4UCO A;  2W0F C;  2ZM6 O;  1XUQ A;  3D3Q A;  4G2K A;  3ETQ A;  1LNQ A;  3K3W A;  3CCL V;  1FAF A;  3OFN G;  1KYO F;  1N36 O;  3KCY A;  3R66 A;  4JTA B;  3FKS G;  4MTX A;  1IBK B;  2KG7 A;  3CMA V;  4GX0 A;  4H37 A;  1OCO B;  3OMI B;  4CS4 A;  2QSA A;  3G67 A;  2EJR A;  3K5L A;  4UCT A;  3GWO A;  1IVS A;  2QKC A;  1AJP A;  4IGG A;  2YEV A;  1IBM B;  4DV4 B;  4TUY A;  4TV9 A;  4ZKI A;  1XIL A;  2YEV B;  4ZHQ B;  1R6T A;  3ZRV A;  5B3S C;  4HZ3 A;  5CB4 B;  4UCS A;  3ABT A;  4I55 B;  2UUB O;  2IJI A;  3N2K B;  1YI2 V;  1FXK A;  5LBQ A;  5IJ9 B;  3HPL C;  3ASN C;  5DM6 V;  4JI7 O;  3IJ4 A;  2FML A;  5EZY A;  1EFR G;  4WCE V;  2EIK C;  3ICX A;  3J7A U;  2HHH B;  4R8C A;  3SR2 C;  2P4K A;  3FYE B;  4B3R O;  4P9P A;  1XMQ B;  1UFI A;  2GSM B;  3QTC A;  4P9O A;  1VQ4 V;  4JZ2 A;  3C3S A;  2H3O A;  1SQG A;  2RMK B;  3RVZ A;  3TET A;  1S76 D;  3WU2 Z;  1ROP A;  2LFS A;  4FLX A;  1MZE A;  4DR1 B;  3HKE B;  4PA3 A;  1KD1 W;  1P84 F;  4D6T H;  4AI8 A;  1MG1 A;  1N34 O;  1VQ6 V;  1SKV A;  1R1B A;  4LFA B;  2IU0 A;  1Y76 B;  3NR7 A;  1RM1 C;  3SJA C;  3QG5 A;  3RBZ A;  1XNR B;  5A2Q N;  2YID A;  3ZJZ A;  4GCZ A;  4EFB A;  1MSW D;  3UO3 A;  1FXV A;  2F66 C;  3SJQ C;  3UCS C;  2LFR A;  5KHJ A;  3W7U A;  5IYC O;  4FZ1 A;  4X65 B;  1AJN A;  3ZHS A;  2NN4 A;  4XDL A;  2QTO A;  1K8A W;  2A79 B;  5LMN B;  3OT7 A;  3CPW U;  2L35 A;  3ZMU A;  4B3S O;  3ASO B;  3K5M A;  4ZBM A;  5LMU O;  4JF3 A;  2YI9 A;  1WP8 A;  1Y6X A;  3TJT A;  1TVK B;  1BMF G;  1AI5 A;  5FPO A;  4EKW A;  2HLD G;  4RO2 A;  3H1K H;  2IBZ H;  1D5A A;  4O2B A;  4L8J A;  4DR4 B;  4MTF A;  2X6C A;  3CCU V;  4K8X A;  1Q5O A;  4C7U A;  3IC7 A;  1I5X A;  2R70 A;  1Q43 A;  2XAG A;  2R9A A;  1JJ2 U;  5IJ0 A;  1S0V A;  5JCO C;  3G6B A;  5L3C A;  3AG1 C;  3E89 A;  3BFR A;  5EIB C;  1SF9 A;  5CA1 B;  2Q4P A;  5C8Y B;  1YIT V;  4DUZ O;  4JYY A;  1Z5V A;  3HR0 A;  3JAS A;  4GKK B;  2H94 A;  5FLX N;  3SYA A;  4DRX A;  2MK3 A;  4MVO A;  4FLW A;  2F23 A;  3ZIA G;  1FPO A;  3E86 A;  1YTF D;  3RT3 C;  1ORQ C;  4FZ0 A;  2ZE5 A;  3JAM N;  3BVO A;  4X62 O;  4O4I A;  1R3L C;  3I55 V;  2VQF O;  5H5N A;  3ABM B;  4LF6 O;  1RFY A;  2CGN A;  2N04 A;  5KMG A;  2BOB C;  2N74 A;  3ASN B;  3F7V C;  3ABU A;  2F93 B;  4RUF A;  4MTG A;  2ZR3 A;  1Z2G A;  3TXS A;  1S5J A;  4GUN A;  5JH7 A;  1QCE A;  1I0H A;  3FD9 A;  3N27 A;  5JH7 B;  3CHX A;  2RNB A;  4QNH B;  3VBB A;  4CS3 A;  3AG3 C;  1HNW O;  1N32 B;  1Q82 W;  2E76 B;  3I5D A;  4E2L A;  4FLY A;  2GUZ B;  4FJC C;  1FFT B;  2R9I A;  3SYO A;  5CA3 A;  4XDK A;  3JCU Z;  1NTK H;  3HKD B;  3MHH C;  5CA0 B;  2B1G A;  5JQG A;  2DMX A;  3CE2 A;  2JEX A;  5EBW C;  3G71 V;  2EIM B;  1E1R G;  1OHH G;  1H8E G;  5EC1 C;  4FFK A;  3VQX A;  1FKA O;  3JSN A;  2VS0 A;  2UUA O;  4NXM B;  2YDE A;  2YIB A;  5LGU A;  3RFR A;  3AG2 B;  2BSK A;  4J11 A;  1ZUQ A;  2CTR A;  1HR0 O;  3HB3 B;  1MMM A;  4NKG B;  5LYJ B;  4JI4 B;  4OX9 O;  3DC6 A;  4LF9 O;  5F2V O;  3D36 C;  3BPZ A;  3R65 A;  3NXS A;  2G38 A;  3UM7 A;  1BL8 A;  2OTJ V;  1NZ6 A;  2BE3 A;  3ZHR A;  1SQV H;  4B7K A;  1NH2 D;  2ZDI C;  3A0R A;  3T4D A;  1K97 A;  4AIL C;  1PNK A;  1PL4 A;  3E8G A;  4JGS A;  5B1N A;  4JYA B;  3BY6 A;  3BHP A;  1U97 A;  4AQY O;  1NVP B;  2CTQ A;  2Q68 A;  3A0B Z;  5JCO A;  4NR1 A;  5EBM C;  1XMO B;  2YUA A;  4FMT A;  3MAQ A;  2ZIM A;  2UXN A;  2DWD C;  3SPJ A;  1R73 A;  4UVB A;  4RQF A;  5L3F A;  4B3T B;  1V9P A;  3WB2 A;  2QKA A;  3CJH B;  4JZG A;  1MA1 A;  4K35 A;  4BIZ A;  5KHH A;  3CB2 A;  2Y4T A;  1XHZ A;  2A3Q A;  4JAA A;  3RYI A;  4EB6 B;  1Q90 D;  2ZXW C;  3RYI B;  4KL1 A;  1YJW V;  1HNZ B;  1NTZ H;  1B04 A;  3BEH A;  2F1M A;  2GV9 A;  1U96 A;  3L9D A;  5K1P A;  2FB5 A;  1AVM A;  2KSD A;  2IW5 A;  4ASU G;  3ZRW B;  5D5Q A;  4YXW G;  1PL0 A;  1IBK O;  4DV3 O;  1VMG A;  2V1D A;  2VWJ A;  1YJN V;  1IBM O;  4LF8 O;  3S3W A;  4DV4 O;  2Q67 A;  3GB7 C;  5LGT A;  1LUV A;  2ZNJ A;  2JJ2 G;  3ZMS A;  2WLN A;  2L6L A;  1AR1 B;  1OCC C;  4KFM A;  4LP8 A;  4X89 A;  2Y69 C;  1Y74 B;  1BQZ A;  2HHH O;  4UCR A;  1SS3 A;  4O4J A;  5DED A;  4TT3 G;  1ZL8 B;  4R7C A;  1S77 D;  1VQ5 V;  4MW3 A;  1XMQ O;  3JD1 A;  4JI2 B;  4I7Z B;  1L8D A;  5FNV A;  3CCQ V;  3ZRX A;  4TWK A;  5LA6 A;  2CDY A;  5LP6 A;  1D5N A;  1ZLZ A;  3BAA A;  5LP6 B;  4PDM A;  4BIO A;  2ITD C;  1LR1 A;  5GTI Z;  4DR1 O;  3DXR B;  1XQ8 A;  3VQV A;  3D36 A;  5LHG A;  3RW0 A;  3K59 A;  1P49 A;  4H0L B;  2JIZ G;  3EXA A;  2RJZ A;  3CWB H;  4LFA O;  2UXB B;  2QWR B;  1Y67 A;  5J2T A;  1NU1 H;  2ZDI A;  1XNR O;  5J2T B;  5BR8 O;  2CH7 A;  2CGO A;  1L0L H;  3JAR B;  1L1F A;  5C93 A;  3ZN0 A;  1FXH A;  4X65 O;  2PYJ A;  4X1I A;  1BQ0 A;  1OCO C;  5CMU A;  2RDC A;  4FIP C;  4P30 A;  1XBL A;  1SA0 A;  1FD9 A;  5JJE B;  2HR3 A;  3K08 A;  1DTO A;  1OZ0 A;  2JRI A;  4QIW F;  4LH6 A;  1Q6H A;  3IGA C;  2R9R B;  1NR7 A;  3VQW A;  2JGD B;  2F4V B;  2ZIN A;  4O2A A;  2A7W A;  1GN6 A;  4TQF A;  1QNM A;  2DJV A;  4DV5 B;  1K5Q A;  4WBN B;  1J5E O;  2ZR2 A;  2QWQ B;  1RSO B;  2W6J G;  4QE7 A;  3CX5 F;  4HNA B;  3JAW B;  2Y48 A;  1TUE B;  5IYZ B;  1YF2 A;  4PD4 F;  1XOU A;  4JI0 O;  2ATK C;  1YCI A;  2UUC O;  1JMK C;  3ZMV A;  4I4T A;  3C90 A;  3CCR V;  3LSQ A;  4X1K B;  3EFF K;  4GKK O;  3JAK B;  4JI1 B;  2DYR B;  1Q3E A;  2Q7H A;  4MSW C;  4U7N A;  3T1Y B;  3K03 A;  1VAR A;  4NVP A;  1Q81 W;  2UU9 O;  4R50 A;  1THZ A;  4GX1 A;  3RVY A;  4J42 A;  2QGN A;  1QLE B;  4YIP A;  5ITZ A;  1K73 W;  2V7Q G;  2BOC C;  4FFB A;  3W7X A;  2WLI A;  2OYQ A;  1M57 B;  3BAB A;  1KP3 A;  4MVR A;  2D3O W;  1O9H A;  4LF4 B;  1VQ7 V;  1KKC A;  3ASO C;  4D7T A;  5LOV A;  4DR3 B;  3KKY A;  1N32 O;  3U0Z A;  1V54 B;  3Q4H B;  4DUY B;  1H2N A;  3L71 H;  3X2Q B;  4ZOL A;  1HDJ A;  4PDR A;  1SET A;  4CH3 A;  4YJ3 B;  2ZD9 A;  3G80 A;  4CH5 A;  2IH1 C;  2QKS A;  3DTU B;  1ZAU A;  2X6B A;  4DV2 O;  4LR3 A;  3GWK C;  3OD4 A;  3AK2 A;  1QR8 A;  2LW1 A;  1I08 A;  1CP9 A;  1VQ8 V;  2ADQ B;  1EBO A;  5KA6 A;  5KX5 B;  4JI6 B;  4IT5 A;  1S5H C;  5EYP B;  2YIB D;  4JI4 O;  4WFG A;  3JAL B;  2XT9 A;  3WG7 B;  4ZHQ A;  2KQX A;  5DEC A;  4L87 A;  1JR9 A;  5CB4 A;  5JWP A;  4FK5 C;  3B2E E;  4I55 A;  3N2K A;  4IIJ B;  4KXR A;  1IBL O;  1NS1 A;  1DK1 A;  2PYL A;  5IJ9 A;  3B4S A;  4DV6 O;  2QM4 A;  3ABM C;  2AXT Z;  2Q7E A;  3CEI A;  3K5O A;  4X66 B;  5IYB O;  2QEX V;  5FPR A;  2EIJ B;  1DLB A;  1IDS A;  2YXL A;  3WB1 A;  1XMO O;  2PGG A;  4JV5 B;  3CXC U;  4UB6 Z;  5CBH A;  4X20 A;  3U10 A;  1NVP D;  3LDD A;  4X20 B;  1YHQ V;  3AG7 A;  1L0N H;  4I50 B;  4B3T O;  4GX2 A;  5CN0 A;  3HKE A;  4Z1V A;  3E22 A;  1H2S B;  5K1X A;  3E22 B;  1PV0 A;  2O57 A;  2XTA A;  5EIB D;  1B3Q A;  5BXZ A;  3A8T A;  4MW8 A;  1Y76 A;  5KUM A;  4GKJ B;  2EIM C;  2HFE C;  2OCC B;  3QO8 A;  4UVC A;  2PTM A;  5BZB A;  5L3E A;  2UXC B;  3F5T A;  1BCC H;  4LBE C;  1VQO V;  1HP8 A;  2EIN B;  3H1J H;  1FFX B;  3LNM B;  3AG2 C;  1P4R A;  3S3X A;  1HNX B;  1K7D A;  3G4S V;  2XAF A;  1VQL V;  3HKB A;  1XNQ B;  4X64 O;  4K8Z A;  3HKB B;  2WPD G;  4MVS A;  3STZ C;  2E75 B;  4ICG A;  5LXT B;  4BWA A;  3K58 A;  2WSS G;  5H2F Z; 
#chains in the Genus database with same CATH homology
 4LC1 A;  2HKO A;  1ARO P;  2ITC C;  4UVA A;  5B1O A;  1M9N A;  1WPX A;  4PEL A;  5CBF A;  5KUK A;  1QVG U;  1VQM V;  1DF5 A;  3R65 A;  3NXS A;  3UM7 A;  1DF4 A;  1YTF B;  1BL8 A;  3OGC C;  2OTJ V;  3JD0 A;  4XBF A;  4RUE A;  2LP7 A;  5IDJ A;  4FPP A;  1NH2 D;  3CC7 V;  2OTL V;  2ZDI C;  3A0R A;  4MVZ A;  4WFH A;  3T4D A;  1K97 A;  1PNK A;  1K4C C;  4HAM A;  3OR6 C;  3E8G A;  2IJH A;  3W7W A;  4WFF A;  2WAM A;  3SYQ A;  3AG4 C;  4JGS A;  5B1N A;  3E8H A;  4I9W A;  1I5Y A;  2HVK C;  1VQK V;  1G4Y B;  4WFA V;  3BY6 A;  4MS2 A;  3CYO A;  2Q6A A;  1NVP B;  4QPJ A;  1YJ9 V;  2Q68 A;  3OMN B;  5H6Q A;  3AG4 B;  5EBM C;  4OXS A;  3OM3 B;  4FMT A;  5IYD O;  3UKM A;  1F23 A;  3QO5 A;  4PDL A;  2UXN A;  1AI6 A;  2DWD C;  3IFX A;  3SPJ A;  1R73 A;  2HVJ C;  4WFE A;  3ETG A;  4UVB A;  4RQF A;  5L3F A;  1BHB A;  4N21 A;  4WF9 V;  3K06 A;  3D3I A;  1S3J A;  2DWE C;  4KP4 A;  3CC2 V;  4U7O A;  2IU3 A;  4BIZ A;  2JDI G;  5J9P C;  1SER A;  1R3K C;  3LDE A;  2QA4 V;  2DYS C;  1R3I C;  3B8M A;  2ZXW C;  4Q20 A;  5L3B A;  1FXK C;  2AHY A;  1YJW V;  2W6I G;  1H38 A;  3BEH A;  4H33 A;  3E8F A;  4R6Z A;  2DYS B;  2WLM A;  3K9A A;  3JD2 A;  2IJJ A;  2IJK A;  2ZXW B;  4PDV A;  2Q69 A;  1GTO A;  1FXK B;  1F4N A;  2OT5 A;  3ABL C;  5LGN A;  3OW2 U;  1GM8 A;  2IW5 A;  3E35 A;  5E1A C;  4ASU G;  2JK5 C;  3OEH G;  3ZRW B;  4YXW G;  1PL0 A;  1CPY A;  5DN6 G;  5KA5 A;  4GT1 A;  4PA9 A;  3OE7 G;  4LCU C;  4RAI A;  2NNU A;  2V1D A;  3ABL B;  3K04 A;  1KKD A;  3T4Z A;  3QNE A;  1YJN V;  3K0D A;  4CBC A;  3SPI A;  2Q67 A;  2WLK A;  2B5U A;  2KB1 A;  3B8N A;  2P6J A;  3GB7 C;  5LGT A;  2GHY A;  2IH3 C;  2JJ2 G;  3ZMS A;  1V55 C;  2Z3Y A;  2X0L A;  2WLN A;  2AHZ A;  4BW5 A;  1AR1 B;  1Q7Y W;  1K92 A;  1OCC C;  2DQ3 A;  4JAV A;  5H6R A;  4PA7 A;  2DW4 A;  3QO7 A;  4KFM A;  3ZN1 A;  1AI7 A;  4LP8 A;  3I56 V;  1SZT A;  1V55 B;  4X89 A;  1EZJ A;  2Y69 C;  4Z1M G;  1ENV A;  2NLJ C;  1MAB G;  2EIL C;  1OCC B;  1GK9 A;  4QJF B;  4TT3 G;  1XL4 A;  5L3D A;  2HG5 C;  4R7C A;  1AI4 A;  1S77 D;  3CME V;  1VQ5 V;  4MW3 A;  2Y69 B;  3JD1 A;  4UUJ C;  3G6E V;  3CCM V;  2EIL B;  3CCQ V;  4GX5 A;  3ZRX A;  4TWK A;  3JD4 A;  2WLI B;  4X8A A;  3ABK C;  3TK1 A;  1M56 B;  4PDM A;  1IXM A;  1KEC A;  2ITD C;  4UXN A;  5HFM A;  3WFV A;  1PKX A;  1W0K G;  1SRY A;  3D36 A;  5LHG A;  4DO2 A;  3RW0 A;  1K3E A;  2XAJ A;  3CP1 A;  1YSC A;  2JIZ G;  3ABK B;  3ZMZ A;  3T2M A;  1VQN V;  4G27 B;  1BHA A;  2WLL A;  3FB7 C;  4QE9 A;  2WLL B;  2ZDI A;  1K33 A;  2X6A A;  2XAS A;  5LHH A;  3OUS A;  1GKF A;  4XDJ A;  2DQ0 A;  3JYC A;  2W0F C;  3H01 A;  3LSS A;  4MTO A;  5EBL C;  4G2K A;  1JVM A;  1L1F A;  5C93 A;  1M90 W;  3ZN0 A;  1FXH A;  1FS0 G;  1LNQ A;  1OCO C;  3K3W A;  5CMU A;  3CCL V;  3OFN G;  4FIP C;  4P30 A;  1ZWI C;  2FTK A;  2HR3 A;  3K08 A;  4JTA B;  1DTO A;  3FKS G;  1OZ0 A;  4MTX A;  3CMA V;  2UXX A;  4GX0 A;  3E8B A;  4H37 A;  4QIW F;  3FB8 C;  1OCO B;  4F4L A;  3IGA C;  3OMI B;  2R9R B;  2P7T C;  2EJR A;  1NR7 A;  3GWO A;  3K0G A;  1AJP A;  1R3J C;  2YEV A;  1NBM G;  1B6Q A;  1JX9 A;  3E83 A;  4MVU A;  1PNL A;  4ZKI A;  3W7T A;  3VOU A;  2YEV B;  3ZRV A;  5B3S C;  1K5S A;  4HZ3 A;  1K5Q A;  3ABT A;  4JAU A;  2IJI A;  4X88 A;  1P7B A;  2ZR2 A;  3JD3 A;  1E79 G;  4HYO A;  1FXK A;  4TSF G;  5H9C A;  5CBG A;  5LBQ A;  1YI2 V;  1VQ9 V;  1JCH A;  4QE7 A;  2W6J G;  5B3S B;  1NJI W;  1JOY A;  3ZRW A;  3HPL C;  3ASN C;  4MT8 A;  5DM6 V;  1EFR G;  4WCE V;  2EIK C;  3T1C A;  2Y48 A;  3KG2 A;  1TUE B;  4R8C A;  3FYE B;  2ATK C;  4P9P A;  2DYR C;  2XAH A;  2GSM B;  4P9O A;  3ZMV A;  3CC4 V;  1VQ4 V;  3CCR V;  2EIK B;  3LSQ A;  3RVZ A;  2QE7 G;  3EFF K;  3TET A;  1S76 D;  4DXW A;  3SPG A;  1OCZ C;  1ROP A;  3SYP A;  1OCR C;  2LFS A;  1COW G;  4N23 A;  2DYR B;  5HFL A;  1N8R W;  4MSW C;  4U7N A;  1QVF U;  1QLE C;  1MOF A;  1Y66 A;  4KUM A;  1OCZ B;  3K03 A;  1CEZ A;  4PA3 A;  2A0L A;  1OCR B;  1Q81 W;  3CCE V;  1KD1 W;  3ETD A;  3K79 A;  1MG1 A;  4R50 A;  3DGE A;  1THZ A;  4GX1 A;  1VQ6 V;  1W0J G;  2IU0 A;  2HJF C;  4MVQ A;  3RVY A;  1QLE B;  1RM1 C;  1M57 C;  3F5W C;  3RBZ A;  3LDC A;  1JQ0 A;  2F43 G;  1K73 W;  1QLN A;  1KQS U;  3OR7 C;  3ZJZ A;  5EK0 A;  3LUT B;  2V7Q G;  4GCZ A;  2BOC C;  1KC8 W;  2PI4 A;  3W7X A;  1MSW D;  2WLI A;  1GO3 F;  1FXV A;  1RM1 B;  1M57 B;  3SJQ C;  1KP3 A;  2P67 A;  4MVR A;  3P30 A;  2WLJ A;  2D3O W;  2LFR A;  3W7U A;  5IYC O;  1V54 C;  1VQ7 V;  1K9M W;  1Y4M A;  1AJN A;  3ASO C;  3FB5 C;  4XDL A;  2QTO A;  3ML0 A;  1K8A W;  2A79 B;  3X2Q C;  4CZZ A;  3CPW U;  1V54 B;  3ZMU A;  1GMG A;  1WLE A;  3ASO B;  2YSU B;  3CCS V;  4ZBM A;  3OMA B;  4JF3 A;  4UV8 A;  3X2Q B;  1E1Q G;  2JJ1 G;  2CK3 G;  2WWW A;  2ZQM A;  1SET A;  4PDR A;  1H8H G;  1BMF G;  3CCV V;  1AI5 A;  1J95 A;  1GM9 A;  4EKW A;  2HLD G;  4JYB A;  3EHB B;  4RO2 A;  2ZD9 A;  1NR1 A;  3CCJ V;  2IH1 C;  4MTF A;  2X6C A;  5B1A C;  2QKS A;  3DTU B;  3CCU V;  2X6B A;  1F4M A;  2WLH A;  3OUF A;  1QR8 A;  3IC7 A;  1W2B U;  1I5X A;  1CP9 A;  3MHS C;  4G28 B;  1KP2 A;  3TCU A;  5B1A B;  2XAG A;  1VQ8 V;  1JJ2 U;  1S0V A;  1EBO A;  3WG7 C;  5KA6 A;  2PI5 A;  3AEI A;  1PNM A;  5L3C A;  3AG1 C;  3E89 A;  1S5H C;  2JEU A;  3OAA G;  3SPC A;  4WFG A;  3PJS K;  2XOK G;  3WG7 B;  1YIT V;  5LHI A;  4I5S A;  4L87 A;  3AG1 B;  1RPR A;  4FK5 C;  2H94 A;  1M1K W;  3SYA A;  4BIU A;  4QPK A;  3STL C;  3FYI B;  2MK3 A;  3CD6 V;  1H2G A;  4MVO A;  2B1I A;  3ZIA G;  1UJW B;  1HWY A;  3F7Y C;  4PA4 A;  2P90 A;  5FL7 G;  3FB6 C;  2Z5U A;  3E86 A;  2EIJ C;  1YTF D;  3ABM C;  1ORQ C;  1R6K A;  1PD3 A;  5L3G A;  1SES A;  2QM7 A;  5IYB O;  2QEX V;  1R3L C;  3I55 V;  3E2E A;  2EIJ B;  1RPO A;  3ABM B;  1DLB A;  4UV9 A;  3ETE A;  3OEE G;  2BOB C;  3ASN B;  3F7V C;  3CXC U;  3ABU A;  5CBH A;  3ZCC A;  1K34 A;  2M7W A;  2XAQ A;  1S72 V;  4MVM A;  1JPX A;  1G8M A;  4RUF A;  1XL6 A;  1NVP D;  4MTG A;  4JYC A;  3LDD A;  5IY5 C;  1YHQ V;  4JAS A;  2ZR3 A;  5GW7 A;  4PA6 A;  2EZP A;  3JCZ A;  3B77 A;  1QCE A;  4GX2 A;  5CN0 A;  1F51 A;  3W7S A;  3MD0 A;  3ZRS A;  3SPH A;  4QNH B;  5B1B C;  3VBB A;  3AG3 C;  5IY5 B;  2OCC C;  1Q82 W;  4JTD B;  4E2L A;  1QBZ A;  2EZO A;  4MW8 A;  2H8P C;  1VQP V;  5KUM A;  4FJC C;  2EIM C;  1FFT B;  1R6N A;  2HFE C;  3AG3 B;  2R9I A;  5B1B B;  2OCC B;  4XDK A;  3SYC A;  1K4D C;  4J9Y B;  2EIN C;  5CA3 A;  3QO8 A;  4UVC A;  1NH2 B;  3MHH C;  4JTC B;  5BZB A;  5L3E A;  4BAY A;  3P32 A;  2B1G A;  3G71 V;  2JEX A;  5EBW C;  4P2Z A;  2EIM B;  4LBE C;  1NQT A;  1VQO V;  4RQE A;  1E1R G;  2XND G;  2EIN B;  1OHH G;  1H8E G;  2A9H A;  3LNM B;  4JPR A;  3SYO A;  1AJQ A;  5EC1 C;  2QM8 A;  3AG2 C;  1P4R A;  1QR9 A;  1K7D A;  3G4S V;  5EC2 C;  1Q86 W;  2EBO A;  2XAF A;  2C2A A;  1VQL V;  1YIJ V;  4J9Z B;  5LGU A;  1NKD A;  4WFB V;  2WPD G;  4MVS A;  3STZ C;  2X7R B;  3AG2 B;  3M99 B;  1GM7 A;  1M56 C;  3ZMT A;  2WSS G;  3HB3 B;  2K1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...