3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
3F7VC 3ZJZA 4P2ZA 3WG7C 3SYQA 4GX5A 3OR7C 3UKMA 1R3IC 2ATKC 2EIKC 4I9WA 2WLLA 3SYCA 3E86A 3AG4C 4R6ZA 4RAIA 4MVQA 1ORQC 4JTCB 4PDMA 2P7TC 4CBCA 4MVMA 4PA3A 3OUFA 4H33A 2H8PC 1XL4A 4RUEA 4WFFA 2W0FC 4MS2A 5EBWC 4MTOA 5KUMA 4ZBMA 2IH3C 4WFEA 3TETA 2Q69A 2WLMA 5EC1C 1K4DC 4OXSA 2HVKC 3JYCA 4LP8A 4XDLA 3E8HA 4PA9A 4HYOA 4X89A 2YEVA 2Q6AA 2WLLB 4PA6A 2HVJC 1JVMA 2WLNA 3LDEA 3TCUA 2WLIB 3IGAC 4MVRA 1R3JC 3EFFK 2WLHA 3K0DA 2HJFC 1XL6A 4X88A 2X6BA 4WFGA 4JTAB 2NLJC 3K0GA 4J9YB 3LDDA 2R9RB 3RW0A 4RO2A 3T1CA 4F4LA 4MW8A 1P7BA 2BOCC 3E8FA 5CBGA 3FB8C 3OGCC 1BL8A 3FB6C 2DWEC 4BW5A 3FB5C 2AHYA 4PA7A 4GX1A 4DXWA 3RVYA 3E8BA 3STZC 5CBHA 4XDJA 2AHZA 4MVSA 1M56C 4QE7A 1S5HC 2WLIA 2QKSA 2EIMC 2WLJA 1QLEC 4MVOA 2KB1A 4RUFA 3RBZA 4JTDB 2K1EA 3AG1C 3K04A 4G27B 3KG2A 5E1AC 2EINC 3SPGA 4LCUC 1OCZC 4X8AA 1G4YB 4GX2A 3R65A 3OR6C 3ABKC 4MTFA 4P9PA 3SJQC 4EKWA 2BOBC 2A9HA 4MVZA 1J95A 1OCRC 4H37A 5KUKA 3SYPA 2HFEC 1M57C 3F5WC 4R50A 3ZRSA 3GB7C 5EBLC 4J9ZB 4PDRA 4G28B 5IY5C 4WFHA 5J9PC 1OCCC 3E89A 4MSWC 4UUJC 5B1AC 4MW3A 4PDLA 5B3SC 2DYSC 2X6CA 2EILC 3UM7A 2EIJC 4QNHB 2JK5C 3E8GA 3F7YC 5EK0A 2IH1C 2ZXWC 4HZ3A 3SPCA 3SPIA 4MVUA 3T4ZA 2ITDC 3ABLC 3FB7C 5EC2C 3LNMB 1V55C 3LDCA 2QTOA 3STLC 3K03A 4GX0A 3K08A 4P30A 5B1BC 1OCOC 3SPHA 4R8CA 3T4DA 4PDVA 1LNQA 1R3LC 3BEHA 2DWDC 3HPLC 4XDKA 1R3KC 5CBFA 3PJSK 2DYRC 4TWKA 2HG5C 5EBMC 2OCCC 3LUTB 2ITCC 2X6AA 3K06A 3T2MA 2A0LA 3SYAA 2Q68A 4MTGA 2A79B 2ZD9A 3ASNC 3X2QC 2WLKA 3AG3C 3SPJA 2Y69C 4R7CA 4PA4A 1ZWIC 2Q67A 3VOUA 3E83A 5BZBA 4QE9A 1KKDA 1K4CC 3IFXA 4LBEC 3ASOC 3RVZA 3AG2C 3OUSA 4P9OA 3SYOA 3ABMC 4KFMA 1V54C
chains in the Genus database with same CATH superfamily
4J7KA 3WG7C 3CXCU 4HNAA 3EHBB 3MD0A 2IW5A 2WLLA 1EZJA 3NR7A 4DR2O 2YC0A 4ZIBA 5LXTB 1YEWA 4DUZO 2H8PC 3RT3C 2P4KA 3IC7A 1FYJA 2XAGA 4PA9A 3W7SA 2Q6AA 4PA6A 1D5AA 1L0NH 4PI0A 1VF7A 3RYCB 3VBBA 4WBNA 3AK3A 3T1CA 4F4LA 1GN6A 4B3TO 1N34B 4DR6O 4FLTA 4DV7O 1KU9A 1V54B 2PTMA 1B04A 5LMUO 3CD6V 2XASA 2AHZA 2CTPA 4UCUA 2NNUA 3FYIB 1K3EA 3JSNA 4EEQA 2R70A 2BCCH 3CC2V 5EYPA 3HR0A 3LSUA 4JYYA 2FMLA 1OCRC 4JI7O 5KHHA 1M57C 3D8CA 4H44B 1UJWB 5GW7A 1JFFA 3S3XA 3TXSA 2QWRB 3BAAA 4QNHB 1VARA 3TGUH 4J7JA 4TQFA 1JA8A 4JI0O 3THOA 2KSDA 3FKSG 4GKJO 3T4DA 4FM1A 4LF6B 3J81N 2DQ3A 5CA0A 5DECA 2LGWA 4TWKA 3OE7G 5A9GA 4JI8B 2OCCC 1HR0B 1B06A 2X6AA 3ASNB 5LHHA 1Q90D 3G6EV 3P30A 1EZVH 1CPYA 3Q4HB 3B8MA 1QR9A 2CDYA 5IJ9A 5ITZA 3LNNA 4DR3B 2M6YA 1Q3EA 1M57B 2B9ZA 3SYCA 3K3WA 4MVQA 2P7TC 3FAVB 4NXNB 2ZM6O 5CA1A 1BQ0A 3BHPA 4XDLA 1Z5WA 2WLNA 5LOVB 4FLXA 1YHQV 4AILC 1RSOA 1AJQA 3CSXA 3K0GA 3ETGA 4IYIA 1WAZA 3FB8C 1BL8A 1GTOA 1QVFU 1AR4A 4UXNA 1JPXA 4JI6B 1ENVA 3G80A 4YY3O 2CGNA 5FPOA 1URFA 1R6NA 4CS2A 1NZ6A 5KHGA 2XNDG 1FPOA 4O4JB 3U10A 2Y69B 3L71H 4HBNA 3O9OA 1TVKB 1VQ9V 3K5MA 3SYPA 4BIUA 1JX9A 1EN6A 2EIMB 3JAWB 3CCVV 1Y76B 5TISZ 2ZDIC 3CRAA 3LNMB 1UPGA 1V55C 1S72V 2QTOA 3F5TA 1K8AW 1OCOB 2QR4A 3CYOA 1XBLA 1TGOA 1QR8A 4IL6Z 1RM1C 2YI8A 4GT1A 4DR5B 3ZMUA 2Q67A 2IM9A 2H3OA 3ASOC 3ZHTA 3OUSA 3LSSA 4JI1B 1P84F 2XOKG 1OCRB 4KHPB 1VQLV 3AEIA 2KKWA 5CB4B 3ZX6A 1CP9A 1ZL8B 4E2LA 2D2CB 4TSFG 4CBCA 3J80N 3W7WA 1IBMB 1K33A 3TETA 5EC1C 1VQMV 4DK1A 1SKVA 4FLVA 1SS3A 4FFKA 2AGAA 5CN0A 3ETEA 4Z1MG 3B2EE 4O2BA 4AI8A 2P22C 1I94O 3N27A 4BW9A 3CS5A 5B1NA 1IDSA 1V55B 2QWPB 5BR8O 2YS8A 5B1BB 1PNMA 1NJIW 1FXHA 2YIAA 3STZC 2E74B 3RBZA 2QJ1A 5C93A 1XHXA 2QEXV 5KLVH 2VS0A 4LCUC 3K59A 3ETQA 1KMIZ 1YJNV 4MVZA 4FK5C 3QG5A 4J9ZB 5JH7A 4DV4B 1WLEA 2WA4A 1NTMH 3CRQA 1N8RW 3ABLC 3FB7C 2QWQB 4FJCC 1YDXA 4UB6Z 3K03A 1SQFA 5B1BC 1VMGA 2Q73A 1F4MA 4PDVA 1EBOA 4D6TH 2HG5C 3GWOA 4B08A 1FFTB 1SQXH 3ZHVA 3B4SA 1EN5A 1BSMA 4B3TB 2DMXA 1FAFA 2GBOA 1Y67A 1W59A 1P4RA 4TV9B 1TAEA 4LF4O 3HKBA 4PJ0Z 1IZ3A 5J2TA 3DXRA 2EZOA 4JTCB 4X20B 1XNQO 2QKCA 5LMNO 4MS2A 3CCUV 4DR4O 3B09A 4OXSA 1H2SB 1R6KA 4LNUB 2ARHA 4DW1A 1EM1A 3OMNB 4MVRA 3K0DA 1KUQA 3ZIAG 1AI7A 2E75B 4JASA 5A2QN 3OTFA 4DV1O 1XMOB 1E1QG 1TUEB 1M1KW 4JF3A 1U97A 1N36O 5D5PA 4BW5A 3I55V 2E5LO 4JI3B 1DGSA 4DR1B 1MG1A 2RJZA 1M56B 2OTJV 2WLJA 3D36C 2YIDA 1WP7A 3RN4A 5LYJB 4W4KA 2K1EA 2F43G 3SJBC 2XHBA 3KG2A 5EZYB 1HWYA 1VQPV 4X8AA 1HNZO 1J95A 3U11A 4PDRA 1OCCB 4UUJC 3QO8A 1I5XA 3H1JH 4EFEA 2HHHO 4TV8B 2EJ7A 4GX0A 2JJ1G 2Q7EA 4R8CA 4O2BB 3HPLC 5J2UA 3EVKA 2ZCEA 4JI5O 2CAZC 3RWRD 3SYAA 2Q68A 5K1PA 2HEPA 5KHIA 3HKEA 3H1IH 3SPJA 1VP7A 5HFLA 1OCZB 5BZBA 4UFZA 5DEDA 3AG2B 1K97A 3ZJZA 1N0NA 4X65B 5IT9N 3N2KA 2C2AA 5L3FA 2UU9O 1VQ8V 1QHTA 2CE4A 2EILB 1MNGA 3QNEA 4H33A 3ZN0A 1NTZH 4UCSA 4MTOA 4Z2WA 3JYCA 5C8YB 3TCUA 3LDEA 4JI3O 3OD4A 1S5LZ 1AP5A 3EFFK 4DR7B 3CE2A 3K79A 2YDEA 1K92A 1F4NA 2XAJA 4YIPA 3JD2A 3LSQA 5LP6B 4J9YB 1GM7A 2R9AA 4J80A 1VIBA 1FXKB 3GWKC 5D5QA 3IAYA 3DGEA 4JYAO 1OZ0A 5FNVA 3WB2A 4IGGA 2JGDB 3RGBA 3N2GA 4X1YA 3N2GB 4FLWA 1SESA 4YHHB 5IYZA 2QDOA 4DV6B 1M5IA 2UXXA 2P90A 3QF7A 3K58A 3DXRB 4B3SO 1RP3B 3R65A 4NR1A 2GDSA 4NXNO 4NXMB 3ZRWB 5LL6Y 1XQ8A 4CC6A 1QNMA 1XMQO 1F51A 3WFVA 4EB6B 4LF8O 3AG4B 4O4HB 3BCCH 3SPIA 2GUZB 4UCRA 4J7ZA 4LFBB 3HKEB 4B3MB 4J11A 1MABG 1OCOC 3RYIA 1YTFB 3CCRV 2DWDC 5L3GA 2CTRA 1B3QA 5K1XA 5BY1A 4GKKO 3LUTB 1BMFG 2YICA 1YJ9V 2N05A 2ZE8A 4TV8A 1O9GA 2Y69C 3MHHC 2Y48A 1P49A 4Z1VA 3ABMB 3SYQA 1HDJA 2Q0AA 5LGTA 2PI5A 4DYLA 5DM6V 4RWUA 4PDMA 2ZXWB 1Y74A 4UCOA 2CTWA 1XL4A 4OPAA 4WFFA 5IJ0B 5EZYA 5EBWC 2L35A 2IH3C 3ZMSA 3H1KH 3OW2U 3TXQA 1K4DC 1XHZA 4ZKIA 3JATA 2WLLB 3BY6A 4UV8A 2WLIB 2LW7A 2UUAB 1NQTA 1QQCA 4WFGA 4EB6A 5JVDA 2XAFA 1IBLB 1VQ6V 5KA6A 1BHAA 2Q4PA 3KCXA 2DWEC 4DRXA 2AXTZ 2WSSG 1AB3A 4XBFA 1M56C 1QLEC 1IBMO 1NT2B 5IE9A 1JOYA 3APQA 2ZDIA 3HKDA 3W7XA 1I08A 1VQNV 1RPRA 4LFCB 2EJRA 2ZM6B 4D7SA 1FXKA 3L73H 4B3MO 3SJQC 5LGNA 3L75H 3I56V 3EXAA 4DV6O 5IY5C 5LP6C 5IYZB 1XMQB 3ZHQA 2AZ2A 4OX9B 3CMAV 5F2VO 3T4ZA 5C8YA 1AJNA 2AW9A 3T1YB 4QPKA 1L8DA 4YY3B 2OWOA 4WBNB 1SZTA 4QGPA 4TT3G 3CB2A 4NKGB 2Q7GA 5JVDB 2F4VB 1JJ2U 2Q0OC 3VOUA 5KAFZ 4FZ1A 4H13B 3CMEV 4DR6B 1FD9A 4X1KA 3F7VC 1D5NA 2EIKC 2ATKC 2LP7A 4I9WA 4YJ2B 3ETDA 1VQOV 3I5DA 3CJHA 2B5UA 1I0HA 3CCMV 4X64O 3ZHUA 1GKFA 4I55A 3TJTA 2Q69A 1N32B 2A3QA 1Q8IA 3JATB 2CTQA 2B1IA 4ZI7B 1WN7A 3E35A 4DR2B 2NLJC 1VQKV 3ZCCA 5H2FZ 1BCCH 2WA3A 1HNWB 5CBGA 3P3PA 3OGCC 3JALB 4NXMO 2IU3A 3RVYA 2UXCO 2OIEA 1TUBB 3OM3B 2LQTA 5FPRA 1A32A 4J41A 4DV2O 2KB1A 2XAHA 4KL1A 4O4HA 1AP6A 2WAMA 4I55B 3SPGA 2RCVA 1VF6C 2ZR3A 4P9PA 4PELA 4FIPC 3OEHG 1BT8A 2A06H 3CWBH 4BIOA 2UU9B 1U96A 4G28B 1NR1A 3CCSV 5LA6B 3RYHB 1OHHG 2JK5C 3ZEDA 4HZ3A 1WA8A 3FYEB 2UXBO 2Q8VA 1YZBA 4JZ2A 1XNRB 3K08A 1S0VA 1W0KG 4X62O 2A7WA 2JJ2G 1Q5OA 5L3CA 1VF5B 5CA3A 2ITCC 4LFBO 2GSMB 1AR5A 3C3TA 3B77A 2MK3A 1MMMA 2YI9A 1Y76A 4AHCA 5KMGA 5IWAB 2IU0A 3JAKA 5EIBC 1NKDA 1KBHA 2FB5A 3C90A 2HR3A 4UB8Z 4P2ZA 1Q6UA 1EFRG 2YXYA 3OR7C 5EYPB 2F23A 4O4IB 2HJDA 3CEIA 2IJJA 2EULA 2WWWA 4PA3A 5H6QA 3ZMTA 1FFXB 1Q86W 3ABLB 4O4JA 2CH7B 1KECA 3T1HO 4LF7B 4QIWF 4I9QA 3K5OA 5JCOC 1GAXA 4DR1O 1JR9A 2VWJA 1HNXB 2HJFC 2X6BA 2UXNA 1H2MA 1FJGO 2JGUA 2ZR2A 5J2TB 1TUBA 1HW7A 3A2FA 4NVPA 5H5NA 1PL0A 1G6UA 4JAUA 3E8FA 1K9MW 4X66B 4FMTA 3WG7B 1AVMA 4DXWA 4BAYA 2UUCO 4XDJA 1FS0G 4I4TA 2AZ0A 1RPOA 2EIJB 1NH2B 3MDSA 1IBKO 5LYJA 4CH5A 3X2QB 3FFQA 1K34A 4GCZA 1NR7A 1WB8A 5B1OA 1OCZC 3OR6C 4LH7A 2QTSA 2UXBB 3CRMA 3P32A 4Q6GA 3CP1A 4DUYO 3F5WC 3BRCA 1YTFD 4DV3B 4UVBA 2JDIG 2RNBA 1X59A 4PDLA 2YXHA 4ZOLB 1ZAUA 2L6LA 1XI1A 3JARA 5EK0A 3SPCA 1FJGB 3OTOO 2LGQA 1SZXA 1ZSPA 1Q7YW 1T5EA 4JI5B 4E4EA 3L74H 3L9DA 3DC6A 2JEUA 3CHXA 1E1RG 2DYRB 5L3EA 1IVSA 3T1HB 2A0LA 4MTGA 3UT5A 3UO2A 3G4SV 2QA4V 3IFXA 2KQXA 4N21A 2DQ0A 4JI4B 4K0KO 4JV5B 2IBZH 2ZQMA 1AI6A 2OTLV 4DV4O 1Q6HA 4R6ZA 1QLNA 4RAIA 1COWG 3G6BA 1NVPB 1GK9A 4NYKA 1TA8A 2CGOA 1NTKH 5LA6A 3RYHA 1AROP 4JPRA 4IHJA 5B5EZ 2F95B 3OEEG 1MSWD 2QWNB 1WP8A 3J7AU 3QVNA 2NN4A 5IY5B 2UXCB 4JTAB 3ZS8C 4KHPO 4MW8A 3M7MX 2Y4UA 4FLYA 2UXDB 1M9NA 2O57A 4PA7A 3DSQA 4KP4A 1SQPH 1KB9F 3CRRA 1E79G 2QKSA 1CXZB 4YJ3B 4UV9A 4X64B 2DW4A 2YIBD 5B66Z 2EINC 2X7RB 1L0LH 2GV9A 4IIJB 1MZFA 2VQFO 4HNAB 3JD3A 3GB7C 1OCCC 5B1AC 5B3SC 4LR3A 2EIJC 4ZHQB 2ZXWC 4DR5O 2VRZA 1GM9A 4YIOA 1PKXA 4A5UB 4FFBA 1MOFA 4I0XB 2UUAO 4O4IA 4DV0O 1IXBA 2F93B 3T1YO 2A79B 4LF5O 1QU7A 3AG1B 4GKJB 3DTUB 1I94B 3JD4A 2JS5A 1H8HG 1UFIA 3A8TA 3CC4V 4O2AB 2XT9A 1KP2A 1AI5A 4LWSB 4O4LB 1M90W 2V1DA 4LF8B 5H9CA 1VQ4V 4YJ3A 3RYFB 1SF9A 3B40A 1YSCA 2W0FC 5JJJB 5LHGA 3CC7V 3ZHSA 4I50A 4LFCO 3K5LA 3B8NA 2HVKC 3HB3B 3SR2C 5IYDO 1GH6A 2BSKB 5BMVB 4GKKB 4WFAV 3D3QA 4X88A 2ZT9B 4ASUG 5LMUB 3TK1A 2HLDG 3OMIB 4JI0B 1P7BA 5KX5B 3HKCA 3VQYA 2Q5ZA 4IHJB 5JQGA 5AG2A 4K8XA 4MVSA 2ZINA 3AK2A 4TV9A 1RM1B 4RUFA 4K3AA 2QE7G 4BWAA 2PGGA 1H8EG 3FD9A 1M93A 5LBQA 2B1GA 1TVKA 1K5QA 5KUKA 4O4LA 3UO3A 4FZ0A 4WFHA 4CS4A 1IBLO 2X6CA 3JAWA 3F7YC 3HKDB 2M7WA 3JCZA 3LDCA 3U0ZA 4UCVA 1GO3F 3SPHA 5CBFA 1YITV 3CPWU 4WFBV 4FFBB 5EBMC 4RQFA 4WCEV 2Z5UA 3AG3C 1WJZA 4BR6A 2RN9A 4R7CA 3CX5F 5GTIZ 4ZHQA 4FLZA 4LBEC 2EX3A 3AG2C 4DW0A 2CK3G 2FL4A 2ZKOA 4KFMA 1SQGA 4NB5A 4JAAA 1YI2V 5KA5A 2LW1A 4YJ2A 5B3SB 2VWKA 4K0KB 2DN9A 4ZBMA 1Q82W 1NBMG 2WLMA 1PNKA 1ZX3A 5LOVA 5FL7G 4DUZB 5LXTA 3BPZA 5JJNB 2HP8A 1N34O 2PY5A 1FFXA 3MAQA 3A0BZ 4DK0A 1S3JA 2PYJA 2E5LB 2P5OA 1NH2D 5LGUA 3FAVA 1VF6A 1FXVA 3HKCB 3C3SA 1VQ5V 2ETNA 1MSDA 4N23A 2FTKA 5CBHA 4LF6O 5IDJA 1R6TA 2BE3A 5H6RA 4JTDB 4D7TA 4G27B 5E1AC 5LHIA 4MT8A 1QVGU 4LF7O 1DF4A 1Y4MA 3PN1A 1KP3A 1MA1A 4JI2B 5CMUA 2BOBC 5CA0B 1BQZA 3H01A 4DR3O 4HAMA 2HHHB 2QWOB 1KQSU 5CB4A 1BZKA 4IT5A 4MW3A 2EILC 4DV5O 2BTQB 4LF5B 4MVUA 3AK1A 3UT5B 4DV0B 4H0LB 5JJEB 1YCIA 5IWAO 4JI8O 2V4DA 1H2NA 3GVMA 2YUAA 2Q7HA 2P06A 4MTXA 4FLUA 1XREA 4DRXB 4QE9A 3RVZA 5IJ0A 5JCOA 5KHJA 4DV1B 1VQ7V 3OFNG 3UKMA 2Q9LA 4QPJA 4X9QA 2FYUH 4DUYB 4I0XA 1ORQC 4B7KA 3IJ4A 1X4TA 3JCUZ 2EINB 4O2AA 1JCHA 2HKOA 3M8AA 1S76D 4X89A 4UVAA 4I4TB 1JVMA 1SETA 2E3CA 3E22B 1XNQB 1K73W 1XL6A 1N0JA 2OCHA 2ZE7A 5JWPA 3BA8A 3AG3B 4TOIA 1W2BU 3VQXA 2QGNA 2W6JG 4RO2A 1N36B 1WNSA 4JAVA 2DE0X 4NTYA 2KG7B 1F7YA 2NR5A 5GONA 4FM2A 2Y4TA 4DV5B 3P3NA 1KKCA 3A0RA 2RMKB 3DC5A 3VQWA 4CH4A 2OCCB 2MW2B 3H1LH 1OJHA 2Y0PA 2CH7A 2IJKA 1G8MA 3ABKC 4MTFA 4DV3O 1NS1A 5JQGB 2ADQB 4OPHA 1THZA 3APOA 4KXRA 4DV2B 2W0XA 1PL4A 2Z3YA 2P4VA 3ABUA 1IXMA 4U7NA 3H9VA 2DOSA 5EIBD 2IH1C 4U3FH 2ODMA 1NVPD 2ITDC 5L3DA 3QO7A 4Q20A 2BSKA 1LUVA 4LC1A 1H2KA 1R3KC 5KHKA 5IYCO 2DYRC 5BXZA 1KC8W 2JIZG 3RYFA 2PF4E 4B3RB 1SRYA 4X62B 1Q81W 2IJHA 2XUMA 3ASOB 4P9OA 1HNWO 2P67A 3CRCA 5BMVA 3K5NA 1R3IC 3WU2Z 4LH6A 1IURA 3JD0A 4ZOLA 5J2UB 3ZMZA 1Y6XA 2EBOA 2QKAA 1GM8A 2N74A 3MHSC 2V7QG 4PD4F 2UUBO 1KYOF 1F23A 4F6RB 4TUYA 4LP8A 3UCSC 2HVJC 4LF4B 4X66O 4I7ZB 3JALA 4UVCA 2W6IG 3JAMN 2JRIA 3ZN1A 1JMKC 1SC5B 2VQEO 5B1AB 1SQVH 4W4LA 3OAAG 3S3WA 1SA0B 4K8ZA 2K9PA 2BOCC 1PM9A 3ML0A 1N33B 2AHYA 4LWSA 1LUWA 3E8BA 4ZI7A 1AILA 2R9IA 5L3BA 4BIZA 1PD3A 1S5HC 2P6JA 1J5EO 4DR4B 1KD1W 1GMGA 4CS3A 1ZLZA 3K04A 2YIBA 1B6QA 2Z0AA 2LO1A 3CJHB 4GX2A 1BHBA 2QM4A 5CA1B 1S5JA 1DTOA 4K35A 3ZRWA 1ZUQA 1K5SA 1OV9A 2A9HA 3RFRA 3UQ8A 3ZRXA 3O65A 3ICXA 5J9PC 2DYSC 3D3IA 3E8GA 1Z5VA 2ZNIA 5IJ9B 5ITZB 1G1XB 2H94A 5KMGB 3RYIB 2PZSA 1O9HA 4IIJA 1N32O 4NTWA 1YJWV 2BTQA 1I5YA 5HFMA 1ZWIC 3E83A 4EFBA 1FKAO 3AG7A 3JASB 2E76B 3IC9A 2OIGA 1DK1A 1YVWA 1V9PA 4JYCA 4CZZA 2EZPA 3KCYA 2LFSA 5KX5A 2ZNJA 4U3JA 4L8JA 4YXWG 3SGIA 2G38A 2D3OW 1GN2A 3KKYA 4B3SB 3JAKB 2YEVA 2JVDA 2GTSA 5FNVB 1HR0O 3VQVA 4JYBA 4X20A 2DYSB 1EN4A 3RW0A 1ZTEA 3ABKB 1I7FA 2RQ6A 1S77D 3FB5C 1R1BA 3WB0A 5JH7B 1GN4A 3E22A 1Q43A 4X1IB 2WLIA 1M4UA 4JI7B 4MVOA 3RYCA 2VQFB 3JARB 2UUBB 1SA0A 1BS3A 4EKWA 1WPXA 2YSUB 4JGSA 4U7OA 3ZBHA 4H37A 2XAQA 1PNLA 2HFEC 4JI1O 3ZHRA 2DJVA 2FKXA 5EBLC 4YHHO 1XILA 4X65O 3SDLA 4FM0A 2PYLA 4TUYB 2BTOA 4JYAB 4J10A 4X1KB 3STLC 2RDCA 2ADPA 4JI6O 2ZE6A 3BEHA 2ZIMA 2PI4A 1SERA 3K06A 1H2LA 2OT5A 2OYQA 1JJOA 3ASNC 3FX7A 4OX9O 1HP8A 3BABA 1DLBA 4ICGA 4TQDA 1QBZA 4PV1B 2GUZA 3CXHF 3BVOA 3SYOA 1AI4A 1WPBA 3CCLV 3OMAB 3L70H 1N4CA 3ZRVA 4GX5A 1SQQH 3E86A 2N04A 3AG4C 4NTXA 5FLXN 4MVMA 2LFRA 1W0JG 4AQYO 4C7UA 5KUMA 1XEQA 4DO2A 1MZEA 3SJCC 4LFAB 3E8HA 2YEVB 3JASA 2GTAA 3IGAC 1N33O 2LJ2A 4FVMA 2WLHA 1WB7A 4DV7B 4X1YB 1D2DA 3K9SA 1ZL8A 2UXDO 4WF9V 3LDDA 2R9RB 4FPPA 4JV5O 4JI4O 3QO5A 2IJIA 2GHYA 1LR1A 2VQEB 1XMOO 3FB6C 4PI2A 4CC5A 3QTCA 1QCEA 1GRJA 2ZIOA 4I5SA 2YXLA 4QE7A 2EIMC 5E79Z 1US6A 1Y66A 3K9AA 3AG1C 4LF9O 2KG7A 4UCTA 4F6EA 3N2KB 2Y0IA 4J42A 1R73A 3H1HH 3CCQV 1Y74B 2QM7A 4RQEA 4MSWC 1K7DA 4GZRB 3ABTA 3UM7A 1H38A 1WA8B 5EC2C 3E2EA 2PUSA 5GONB 1J5EB 3JSLA 4P30A 3OT7A 3R66A 4B3RO 1LNQA 1R3LC 1XDCA 1IBKB 3BFRA 3T2MA 3A0HZ 2WLKA 2F1MA 4KUMA 3OGIB 1JQ0A 4PA4A 1XOUA 3W7UA 1KKDA 3SJAC 1YIJV 1Z2GA 1YF2A 4F6RA 5GTHZ 4JZGA 2EIKB 2ZE5A 3KZIZ 1RSOB 1HNXO 4IYHA 4OGQB 3OUFA 4RUEA 1PV0A 4CH6A 3M99B 3Q4HA 1NU1H 4GYCB 2ILMA 2X0LA 1HNZB 4WFEA 4HYOA 4LF9B 5LMNB 4X1IA 1R3JC 2R72A 4GUNA 2WPDG 5KAIZ 1FXKC 5IYBO 3G67A 4L87A 1RFYA 4U3JB 4DR7O 1GN3A 4CH3A 3NXSA 3CCJV 1DF5A 4QJFB 1AJPA 4GX1A 1JFFB 2CUGA 4LNUA 1AR1B 5LP6A 1IX9A 2QM8A 1NI8A 1VEWA 5DN6G 1BGYH 4JI2O 1PP9H 4LFAO 1G4YB 2JEXA 4G2KA 1P7GA 3W7TA 2UUCB 1YXBA 3CCEV 2JS3A 4R50A 3ZRSA 3HKBB 3E89A 1BE3H 2F66C 4I50B 3D36A 1QLEB 1PPJH 2QSAA 1Q6IA 1SQBH 1XUQA 2JGDA 3JD1A 1CEZA 3G71V 3WB1A 3ZMVA 2F4VO 4XDKA 3PJSK 1L1FA 4PHZA 1H2GA 3L72H 4B7EA 2ZD9A 3OTOB 2XTAA 3X2QC 3K57A 4ABMA 3BA9A 1ROPA 1XNRO 1K4CC 5BR8B 4AQYB 3ABMC 4GLXA 1V54C
chains in the Genus database with same CATH topology
3ZJZA 3WG7C 3CXCU 3EHBB 2ZQMA 1AI6A 1R3IC 3MD0A 2OTLV 2IW5A 2WLLA 1EZJA 3JD0A 2C2AA 4R6ZA 1QLNA 3ZMZA 4RAIA 5L3FA 1COWG 1VQ8V 2EILB 1NVPB 3QNEA 2EBOA 1GK9A 4H33A 2H8PC 3ZN0A 4MTOA 1GM8A 3MHSC 1AROP 2V7QG 3IC7A 4JPRA 1F23A 3JYCA 4LP8A 2XAGA 4PA9A 3W7SA 3TCUA 2Q6AA 4PA6A 2HVJC 3LDEA 3OEEG 1MSWD 3EFFK 4UVCA 2W6IG 3K79A 3ZN1A 3VBBA 5IY5B 1K92A 1F4NA 2XAJA 3JD2A 4JTAB 3LSQA 5B1AB 4J9YB 1GM7A 3OAAG 1FXKB 3T1CA 4F4LA 4MW8A 3DGEA 2BOCC 1OZ0A 1V54B 3ML0A 1M9NA 2AHYA 4PA7A 3CD6V 4KP4A 3E8BA 2XASA 1SESA 2R9IA 5L3BA 2AHZA 1E79G 4BIZA 1PD3A 1S5HC 2P6JA 2QKSA 2UXXA 2P90A 2NNUA 1KD1W 3FYIB 1GMGA 4UV9A 3K04A 2DW4A 1K3EA 2EINC 2X7RB 1B6QA 3CC2V 4GX2A 3R65A 1BHBA 1DTOA 3ZRWA 3ZRWB 1K5SA 2A9HA 1OCRC 1M57C 1UJWB 3JD3A 3ZRXA 3GB7C 1F51A 5GW7A 3WFVA 5J9PC 1OCCC 3AG4B 5B1AC 5B3SC 2DYSC 3D3IA 2EIJC 4QNHB 3E8GA 2ZXWC 3SPIA 1MABG 2H94A 1OCOC 3FKSG 1YTFB 1GM9A 3T4DA 3CCRV 1PKXA 2DWDC 2DQ3A 5L3GA 4TWKA 3OE7G 1MOFA 2OCCC 3LUTB 2X6AA 1BMFG 1YJWV 3ASNB 1I5YA 2A79B 5LHHA 3AG1B 5HFMA 1YJ9V 2Y69C 1ZWIC 3DTUB 3G6EV 3E83A 3MHHC 3P30A 2Y48A 3JD4A 1CPYA 1H8HG 3B8MA 3ABMB 1QR9A 3CC4V 3SYQA 1KP2A 1AI5A 1M90W 1M57B 5LGTA 2PI5A 5DM6V 2V1DA 3SYCA 3K3WA 5H9CA 4JYCA 4MVQA 1VQ4V 4PDMA 2P7TC 2ZXWB 4CZZA 2EZPA 1XL4A 1YSCA 4WFFA 2W0FC 5LHGA 2LFSA 3CC7V 5EBWC 4YXWG 2IH3C 3ZMSA 2D3OW 3OW2U 1K4DC 3B8NA 2HVKC 3HB3B 5IYDO 4XDLA 4ZKIA 2YEVA 2WLLB 3BY6A 2WLNA 4UV8A 1YHQV 2WLIB 1NQTA 4JYBA 4WFAV 4X88A 4WFGA 1AJQA 4ASUG 3K0GA 2DYSB 3ETGA 3TK1A 3RW0A 2XAFA 2HLDG 3ABKB 5KA6A 1VQ6V 3OMIB 1BHAA 1P7BA 1S77D 3FB8C 1BL8A 2DWEC 1GTOA 3FB5C 1QVFU 4UXNA 2WSSG 1JPXA 1ENVA 4MVSA 1M56C 4XBFA 2WLIA 1R6NA 1QLEC 4MVOA 1RM1B 4RUFA 1JOYA 2ZDIA 3W7XA 2XNDG 2QE7G 1VQNV 1RPRA 2Y69B 1H8EG 2EJRA 5LBQA 1FXKA 3SJQC 5LGNA 4EKWA 2B1GA 3I56V 1WPXA 2YSUB 4JGSA 1VQ9V 1K5QA 4U7OA 5KUKA 4H37A 2XAQA 1PNLA 3SYPA 4BIUA 2HFEC 5EBLC 5IY5C 4WFHA 2X6CA 1JX9A 2EIMB 3CCVV 3F7YC 3CMAV 2ZDIC 3T4ZA 1AJNA 3LNMB 4QPKA 2M7WA 1V55C 3JCZA 3LDCA 1S72V 2QTOA 3STLC 1K8AW 1OCOB 1GO3F 3CYOA 3SPHA 5CBFA 3BEHA 1YITV 1SZTA 3CPWU 4WFBV 2PI4A 1SERA 5EBMC 1QR8A 3K06A 4TT3G 2OT5A 1RM1C 4RQFA 4WCEV 2Z5UA 3ASNC 4GT1A 3AG3C 1JJ2U 1DLBA 4R7CA 3ZMUA 2Q67A 3VOUA 1QBZA 3CMEV 4LBEC 3ASOC 3AG2C 3OUSA 3SYOA 2CK3G 1AI4A 3LSSA 4KFMA 2XOKG 1OCRB 3OMAB 3CCLV 3F7VC 3ZRVA 1VQLV 3AEIA 4GX5A 1YI2V 2EIKC 2ATKC 2LP7A 4I9WA 5KA5A 1CP9A 5B3SB 3E86A 3AG4C 3ETDA 1VQOV 4E2LA 4TSFG 4CBCA 4MVMA 2B5UA 2LFRA 1W0JG 3W7WA 3CCMV 5KUMA 4ZBMA 1GKFA 1Q82W 4DO2A 1K33A 3TETA 2Q69A 1NBMG 2WLMA 1PNKA 5EC1C 3E8HA 2YEVB 1VQMV 2B1IA 5FL7G 3E35A 3IGAC 2WLHA 5CN0A 3ETEA 4Z1MG 2NLJC 4WF9V 3LDDA 1S3JA 2R9RB 4FPPA 3ZCCA 1VQKV 1NH2D 5LGUA 5B1NA 1FXVA 3QO5A 1V55B 2IJIA 2GHYA 5CBGA 1VQ5V 3OGCC 3FB6C 5B1BB 1QCEA 1PNMA 1NJIW 1FXHA 4N23A 2IU3A 3RVYA 4I5SA 2FTKA 3STZC 5CBHA 5IDJA 3OM3B 4QE7A 2EIMC 1Y66A 3K9AA 2KB1A 2XAHA 3RBZA 5C93A 5H6RA 4JTDB 3AG1C 4G27B 5E1AC 5LHIA 4MT8A 1QVGU 2QEXV 2WAMA 3SPGA 4LCUC 1DF4A 1Y4MA 2ZR3A 1KP3A 4P9PA 4PELA 4FIPC 5CMUA 2BOBC 1YJNV 3OEHG 1R73A 4MVZA 3H01A 3CCQV 4HAMA 4FK5C 1KQSU 4J9ZB 2QM7A 4G28B 4RQEA 4MSWC 1K7DA 4MW3A 1WLEA 1NR1A 3CCSV 2EILC 3ABTA 3UM7A 1OHHG 2JK5C 1H38A 4HZ3A 3FYEB 1N8RW 4MVUA 3ABLC 5EC2C 3FB7C 3E2EA 4FJCC 3K03A 3K08A 1S0VA 4P30A 5B1BC 1W0KG 1F4MA 2JJ2G 4PDVA 1EBOA 1LNQA 1R3LC 5L3CA 2HG5C 3GWOA 1FFTB 3T2MA 2ITCC 5CA3A 2GSMB 2WLKA 4MTXA 3B77A 2MK3A 4KUMA 4PA4A 1JQ0A 4QE9A 3W7UA 1KKDA 2IU0A 3RVZA 1YIJV 1NKDA 2HR3A 4P2ZA 1EFRG 1P4RA 1VQ7V 3OFNG 3OR7C 3UKMA 2EIKB 4QPJA 2EZOA 2IJJA 1ORQC 4JTCB 2WWWA 4PA3A 5H6QA 3OUFA 4RUEA 3ZMTA 3M99B 1Q86W 3ABLB 4MS2A 3CCUV 1KECA 2EINB 2X0LA 4WFEA 1JCHA 2HKOA 4OXSA 4QIWF 1S76D 4HYOA 4X89A 4UVAA 1R6KA 1JVMA 1SETA 3OMNB 4MVRA 1R3JC 3K0DA 1K73W 2HJFC 1XL6A 3ZIAG 2X6BA 2UXNA 3AG3B 1AI7A 2ZR2A 1W2BU 4JASA 2W6JG 2WPDG 4RO2A 1PL0A 1FXKC 4JAVA 5IYBO 1E1QG 1TUEB 4JAUA 4L87A 1M1KW 4JF3A 3E8FA 1K9MW 3NXSA 4BW5A 3I55V 4FMTA 3CCJV 3WG7B 3A0RA 1DF5A 4QJFB 1AJPA 1MG1A 4GX1A 4DXWA 4BAYA 4XDJA 1FS0G 1AR1B 1RPOA 1M56B 2QM8A 2OCCB 2EIJB 2WLJA 1NH2B 2OTJV 5DN6G 2K1EA 2F43G 3X2QB 3KG2A 2IJKA 1K34A 1HWYA 4GCZA 1NR7A 1VQPV 5B1OA 1OCZC 4X8AA 1G4YB 2JEXA 1G8MA 4G2KA 3W7TA 3OR6C 3ABKC 4MTFA 1THZA 3CCEV 1J95A 3P32A 2Z3YA 3CP1A 3F5WC 4R50A 3ZRSA 4PDRA 3ABUA 1IXMA 1OCCB 4U7NA 1YTFD 3E89A 4UUJC 4UVBA 2JDIG 3QO8A 4PDLA 1I5XA 3D36A 1QLEB 5EK0A 2IH1C 3SPCA 1NVPD 2ITDC 5L3DA 3QO7A 4Q20A 1Q7YW 3JD1A 1CEZA 4GX0A 2JJ1G 4LC1A 3G71V 4R8CA 3ZMVA 3HPLC 4XDKA 1R3KC 2JEUA 1E1RG 2DYRB 5L3EA 3PJSK 2DYRC 5IYCO 1L1FA 1KC8W 2A0LA 1H2GA 2JIZG 3SYAA 2Q68A 4MTGA 2ZD9A 3X2QC 3SPJA 1SRYA 5HFLA 1OCZB 1ROPA 3G4SV 2QA4V 1Q81W 2IJHA 5BZBA 1K4CC 3IFXA 3AG2B 4N21A 3ASOB 4P9OA 2DQ0A 3ABMC 1K97A 2P67A 1V54C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7V C;  3ZJZ A;  4P2Z A;  3WG7 C;  3SYQ A;  4GX5 A;  3OR7 C;  3UKM A;  1R3I C;  2ATK C;  2EIK C;  4I9W A;  2WLL A;  3SYC A;  3E86 A;  3AG4 C;  4R6Z A;  4RAI A;  4MVQ A;  1ORQ C;  4JTC B;  4PDM A;  2P7T C;  4CBC A;  4MVM A;  4PA3 A;  3OUF A;  4H33 A;  2H8P C;  1XL4 A;  4RUE A;  4WFF A;  2W0F C;  4MS2 A;  5EBW C;  4MTO A;  5KUM A;  4ZBM A;  2IH3 C;  4WFE A;  3TET A;  2Q69 A;  2WLM A;  5EC1 C;  1K4D C;  4OXS A;  2HVK C;  3JYC A;  4LP8 A;  4XDL A;  3E8H A;  4PA9 A;  4HYO A;  4X89 A;  2YEV A;  2Q6A A;  2WLL B;  4PA6 A;  2HVJ C;  1JVM A;  2WLN A;  3LDE A;  3TCU A;  2WLI B;  3IGA C;  4MVR A;  1R3J C;  3EFF K;  2WLH A;  3K0D A;  2HJF C;  1XL6 A;  4X88 A;  2X6B A;  4WFG A;  4JTA B;  2NLJ C;  3K0G A;  4J9Y B;  3LDD A;  2R9R B;  3RW0 A;  4RO2 A;  3T1C A;  4F4L A;  4MW8 A;  1P7B A;  2BOC C;  3E8F A;  5CBG A;  3FB8 C;  3OGC C;  1BL8 A;  3FB6 C;  2DWE C;  4BW5 A;  3FB5 C;  2AHY A;  4PA7 A;  4GX1 A;  4DXW A;  3RVY A;  3E8B A;  3STZ C;  5CBH A;  4XDJ A;  2AHZ A;  4MVS A;  1M56 C;  4QE7 A;  1S5H C;  2WLI A;  2QKS A;  2EIM C;  2WLJ A;  1QLE C;  4MVO A;  2KB1 A;  4RUF A;  3RBZ A;  4JTD B;  2K1E A;  3AG1 C;  3K04 A;  4G27 B;  3KG2 A;  5E1A C;  2EIN C;  3SPG A;  4LCU C;  1OCZ C;  4X8A A;  1G4Y B;  4GX2 A;  3R65 A;  3OR6 C;  3ABK C;  4MTF A;  4P9P A;  3SJQ C;  4EKW A;  2BOB C;  2A9H A;  4MVZ A;  1J95 A;  1OCR C;  4H37 A;  5KUK A;  3SYP A;  2HFE C;  1M57 C;  3F5W C;  4R50 A;  3ZRS A;  3GB7 C;  5EBL C;  4J9Z B;  4PDR A;  4G28 B;  5IY5 C;  4WFH A;  5J9P C;  1OCC C;  3E89 A;  4MSW C;  4UUJ C;  5B1A C;  4MW3 A;  4PDL A;  5B3S C;  2DYS C;  2X6C A;  2EIL C;  3UM7 A;  2EIJ C;  4QNH B;  2JK5 C;  3E8G A;  3F7Y C;  5EK0 A;  2IH1 C;  2ZXW C;  4HZ3 A;  3SPC A;  3SPI A;  4MVU A;  3T4Z A;  2ITD C;  3ABL C;  3FB7 C;  5EC2 C;  3LNM B;  1V55 C;  3LDC A;  2QTO A;  3STL C;  3K03 A;  4GX0 A;  3K08 A;  4P30 A;  5B1B C;  1OCO C;  3SPH A;  4R8C A;  3T4D A;  4PDV A;  1LNQ A;  1R3L C;  3BEH A;  2DWD C;  3HPL C;  4XDK A;  1R3K C;  5CBF A;  3PJS K;  2DYR C;  4TWK A;  2HG5 C;  5EBM C;  2OCC C;  3LUT B;  2ITC C;  2X6A A;  3K06 A;  3T2M A;  2A0L A;  3SYA A;  2Q68 A;  4MTG A;  2A79 B;  2ZD9 A;  3ASN C;  3X2Q C;  2WLK A;  3AG3 C;  3SPJ A;  2Y69 C;  4R7C A;  4PA4 A;  1ZWI C;  2Q67 A;  3VOU A;  3E83 A;  5BZB A;  4QE9 A;  1KKD A;  1K4C C;  3IFX A;  4LBE C;  3ASO C;  3RVZ A;  3AG2 C;  3OUS A;  4P9O A;  3SYO A;  3ABM C;  4KFM A;  1V54 C; 
#chains in the Genus database with same CATH topology
 4J7K A;  3WG7 C;  3CXC U;  4HNA A;  3EHB B;  3MD0 A;  2IW5 A;  2WLL A;  1EZJ A;  3NR7 A;  4DR2 O;  2YC0 A;  4ZIB A;  5LXT B;  1YEW A;  4DUZ O;  2H8P C;  3RT3 C;  2P4K A;  3IC7 A;  1FYJ A;  2XAG A;  4PA9 A;  3W7S A;  2Q6A A;  4PA6 A;  1D5A A;  1L0N H;  4PI0 A;  1VF7 A;  3RYC B;  3VBB A;  4WBN A;  3AK3 A;  3T1C A;  4F4L A;  1GN6 A;  4B3T O;  1N34 B;  4DR6 O;  4FLT A;  4DV7 O;  1KU9 A;  1V54 B;  2PTM A;  1B04 A;  5LMU O;  3CD6 V;  2XAS A;  2AHZ A;  2CTP A;  4UCU A;  2NNU A;  3FYI B;  1K3E A;  3JSN A;  4EEQ A;  2R70 A;  2BCC H;  3CC2 V;  5EYP A;  3HR0 A;  3LSU A;  4JYY A;  2FML A;  1OCR C;  4JI7 O;  5KHH A;  1M57 C;  3D8C A;  4H44 B;  1UJW B;  5GW7 A;  1JFF A;  3S3X A;  3TXS A;  2QWR B;  3BAA A;  4QNH B;  1VAR A;  3TGU H;  4J7J A;  4TQF A;  1JA8 A;  4JI0 O;  3THO A;  2KSD A;  3FKS G;  4GKJ O;  3T4D A;  4FM1 A;  4LF6 B;  3J81 N;  2DQ3 A;  5CA0 A;  5DEC A;  2LGW A;  4TWK A;  3OE7 G;  5A9G A;  4JI8 B;  2OCC C;  1HR0 B;  1B06 A;  2X6A A;  3ASN B;  5LHH A;  1Q90 D;  3G6E V;  3P30 A;  1EZV H;  1CPY A;  3Q4H B;  3B8M A;  1QR9 A;  2CDY A;  5IJ9 A;  5ITZ A;  3LNN A;  4DR3 B;  2M6Y A;  1Q3E A;  1M57 B;  2B9Z A;  3SYC A;  3K3W A;  4MVQ A;  2P7T C;  3FAV B;  4NXN B;  2ZM6 O;  5CA1 A;  1BQ0 A;  3BHP A;  4XDL A;  1Z5W A;  2WLN A;  5LOV B;  4FLX A;  1YHQ V;  4AIL C;  1RSO A;  1AJQ A;  3CSX A;  3K0G A;  3ETG A;  4IYI A;  1WAZ A;  3FB8 C;  1BL8 A;  1GTO A;  1QVF U;  1AR4 A;  4UXN A;  1JPX A;  4JI6 B;  1ENV A;  3G80 A;  4YY3 O;  2CGN A;  5FPO A;  1URF A;  1R6N A;  4CS2 A;  1NZ6 A;  5KHG A;  2XND G;  1FPO A;  4O4J B;  3U10 A;  2Y69 B;  3L71 H;  4HBN A;  3O9O A;  1TVK B;  1VQ9 V;  3K5M A;  3SYP A;  4BIU A;  1JX9 A;  1EN6 A;  2EIM B;  3JAW B;  3CCV V;  1Y76 B;  5TIS Z;  2ZDI C;  3CRA A;  3LNM B;  1UPG A;  1V55 C;  1S72 V;  2QTO A;  3F5T A;  1K8A W;  1OCO B;  2QR4 A;  3CYO A;  1XBL A;  1TGO A;  1QR8 A;  4IL6 Z;  1RM1 C;  2YI8 A;  4GT1 A;  4DR5 B;  3ZMU A;  2Q67 A;  2IM9 A;  2H3O A;  3ASO C;  3ZHT A;  3OUS A;  3LSS A;  4JI1 B;  1P84 F;  2XOK G;  1OCR B;  4KHP B;  1VQL V;  3AEI A;  2KKW A;  5CB4 B;  3ZX6 A;  1CP9 A;  1ZL8 B;  4E2L A;  2D2C B;  4TSF G;  4CBC A;  3J80 N;  3W7W A;  1IBM B;  1K33 A;  3TET A;  5EC1 C;  1VQM V;  4DK1 A;  1SKV A;  4FLV A;  1SS3 A;  4FFK A;  2AGA A;  5CN0 A;  3ETE A;  4Z1M G;  3B2E E;  4O2B A;  4AI8 A;  2P22 C;  1I94 O;  3N27 A;  4BW9 A;  3CS5 A;  5B1N A;  1IDS A;  1V55 B;  2QWP B;  5BR8 O;  2YS8 A;  5B1B B;  1PNM A;  1NJI W;  1FXH A;  2YIA A;  3STZ C;  2E74 B;  3RBZ A;  2QJ1 A;  5C93 A;  1XHX A;  2QEX V;  5KLV H;  2VS0 A;  4LCU C;  3K59 A;  3ETQ A;  1KMI Z;  1YJN V;  4MVZ A;  4FK5 C;  3QG5 A;  4J9Z B;  5JH7 A;  4DV4 B;  1WLE A;  2WA4 A;  1NTM H;  3CRQ A;  1N8R W;  3ABL C;  3FB7 C;  2QWQ B;  4FJC C;  1YDX A;  4UB6 Z;  3K03 A;  1SQF A;  5B1B C;  1VMG A;  2Q73 A;  1F4M A;  4PDV A;  1EBO A;  4D6T H;  2HG5 C;  3GWO A;  4B08 A;  1FFT B;  1SQX H;  3ZHV A;  3B4S A;  1EN5 A;  1BSM A;  4B3T B;  2DMX A;  1FAF A;  2GBO A;  1Y67 A;  1W59 A;  1P4R A;  4TV9 B;  1TAE A;  4LF4 O;  3HKB A;  4PJ0 Z;  1IZ3 A;  5J2T A;  3DXR A;  2EZO A;  4JTC B;  4X20 B;  1XNQ O;  2QKC A;  5LMN O;  4MS2 A;  3CCU V;  4DR4 O;  3B09 A;  4OXS A;  1H2S B;  1R6K A;  4LNU B;  2ARH A;  4DW1 A;  1EM1 A;  3OMN B;  4MVR A;  3K0D A;  1KUQ A;  3ZIA G;  1AI7 A;  2E75 B;  4JAS A;  5A2Q N;  3OTF A;  4DV1 O;  1XMO B;  1E1Q G;  1TUE B;  1M1K W;  4JF3 A;  1U97 A;  1N36 O;  5D5P A;  4BW5 A;  3I55 V;  2E5L O;  4JI3 B;  1DGS A;  4DR1 B;  1MG1 A;  2RJZ A;  1M56 B;  2OTJ V;  2WLJ A;  3D36 C;  2YID A;  1WP7 A;  3RN4 A;  5LYJ B;  4W4K A;  2K1E A;  2F43 G;  3SJB C;  2XHB A;  3KG2 A;  5EZY B;  1HWY A;  1VQP V;  4X8A A;  1HNZ O;  1J95 A;  3U11 A;  4PDR A;  1OCC B;  4UUJ C;  3QO8 A;  1I5X A;  3H1J H;  4EFE A;  2HHH O;  4TV8 B;  2EJ7 A;  4GX0 A;  2JJ1 G;  2Q7E A;  4R8C A;  4O2B B;  3HPL C;  5J2U A;  3EVK A;  2ZCE A;  4JI5 O;  2CAZ C;  3RWR D;  3SYA A;  2Q68 A;  5K1P A;  2HEP A;  5KHI A;  3HKE A;  3H1I H;  3SPJ A;  1VP7 A;  5HFL A;  1OCZ B;  5BZB A;  4UFZ A;  5DED A;  3AG2 B;  1K97 A;  3ZJZ A;  1N0N A;  4X65 B;  5IT9 N;  3N2K A;  2C2A A;  5L3F A;  2UU9 O;  1VQ8 V;  1QHT A;  2CE4 A;  2EIL B;  1MNG A;  3QNE A;  4H33 A;  3ZN0 A;  1NTZ H;  4UCS A;  4MTO A;  4Z2W A;  3JYC A;  5C8Y B;  3TCU A;  3LDE A;  4JI3 O;  3OD4 A;  1S5L Z;  1AP5 A;  3EFF K;  4DR7 B;  3CE2 A;  3K79 A;  2YDE A;  1K92 A;  1F4N A;  2XAJ A;  4YIP A;  3JD2 A;  3LSQ A;  5LP6 B;  4J9Y B;  1GM7 A;  2R9A A;  4J80 A;  1VIB A;  1FXK B;  3GWK C;  5D5Q A;  3IAY A;  3DGE A;  4JYA O;  1OZ0 A;  5FNV A;  3WB2 A;  4IGG A;  2JGD B;  3RGB A;  3N2G A;  4X1Y A;  3N2G B;  4FLW A;  1SES A;  4YHH B;  5IYZ A;  2QDO A;  4DV6 B;  1M5I A;  2UXX A;  2P90 A;  3QF7 A;  3K58 A;  3DXR B;  4B3S O;  1RP3 B;  3R65 A;  4NR1 A;  2GDS A;  4NXN O;  4NXM B;  3ZRW B;  5LL6 Y;  1XQ8 A;  4CC6 A;  1QNM A;  1XMQ O;  1F51 A;  3WFV A;  4EB6 B;  4LF8 O;  3AG4 B;  4O4H B;  3BCC H;  3SPI A;  2GUZ B;  4UCR A;  4J7Z A;  4LFB B;  3HKE B;  4B3M B;  4J11 A;  1MAB G;  1OCO C;  3RYI A;  1YTF B;  3CCR V;  2DWD C;  5L3G A;  2CTR A;  1B3Q A;  5K1X A;  5BY1 A;  4GKK O;  3LUT B;  1BMF G;  2YIC A;  1YJ9 V;  2N05 A;  2ZE8 A;  4TV8 A;  1O9G A;  2Y69 C;  3MHH C;  2Y48 A;  1P49 A;  4Z1V A;  3ABM B;  3SYQ A;  1HDJ A;  2Q0A A;  5LGT A;  2PI5 A;  4DYL A;  5DM6 V;  4RWU A;  4PDM A;  2ZXW B;  1Y74 A;  4UCO A;  2CTW A;  1XL4 A;  4OPA A;  4WFF A;  5IJ0 B;  5EZY A;  5EBW C;  2L35 A;  2IH3 C;  3ZMS A;  3H1K H;  3OW2 U;  3TXQ A;  1K4D C;  1XHZ A;  4ZKI A;  3JAT A;  2WLL B;  3BY6 A;  4UV8 A;  2WLI B;  2LW7 A;  2UUA B;  1NQT A;  1QQC A;  4WFG A;  4EB6 A;  5JVD A;  2XAF A;  1IBL B;  1VQ6 V;  5KA6 A;  1BHA A;  2Q4P A;  3KCX A;  2DWE C;  4DRX A;  2AXT Z;  2WSS G;  1AB3 A;  4XBF A;  1M56 C;  1QLE C;  1IBM O;  1NT2 B;  5IE9 A;  1JOY A;  3APQ A;  2ZDI A;  3HKD A;  3W7X A;  1I08 A;  1VQN V;  1RPR A;  4LFC B;  2EJR A;  2ZM6 B;  4D7S A;  1FXK A;  3L73 H;  4B3M O;  3SJQ C;  5LGN A;  3L75 H;  3I56 V;  3EXA A;  4DV6 O;  5IY5 C;  5LP6 C;  5IYZ B;  1XMQ B;  3ZHQ A;  2AZ2 A;  4OX9 B;  3CMA V;  5F2V O;  3T4Z A;  5C8Y A;  1AJN A;  2AW9 A;  3T1Y B;  4QPK A;  1L8D A;  4YY3 B;  2OWO A;  4WBN B;  1SZT A;  4QGP A;  4TT3 G;  3CB2 A;  4NKG B;  2Q7G A;  5JVD B;  2F4V B;  1JJ2 U;  2Q0O C;  3VOU A;  5KAF Z;  4FZ1 A;  4H13 B;  3CME V;  4DR6 B;  1FD9 A;  4X1K A;  3F7V C;  1D5N A;  2EIK C;  2ATK C;  2LP7 A;  4I9W A;  4YJ2 B;  3ETD A;  1VQO V;  3I5D A;  3CJH A;  2B5U A;  1I0H A;  3CCM V;  4X64 O;  3ZHU A;  1GKF A;  4I55 A;  3TJT A;  2Q69 A;  1N32 B;  2A3Q A;  1Q8I A;  3JAT B;  2CTQ A;  2B1I A;  4ZI7 B;  1WN7 A;  3E35 A;  4DR2 B;  2NLJ C;  1VQK V;  3ZCC A;  5H2F Z;  1BCC H;  2WA3 A;  1HNW B;  5CBG A;  3P3P A;  3OGC C;  3JAL B;  4NXM O;  2IU3 A;  3RVY A;  2UXC O;  2OIE A;  1TUB B;  3OM3 B;  2LQT A;  5FPR A;  1A32 A;  4J41 A;  4DV2 O;  2KB1 A;  2XAH A;  4KL1 A;  4O4H A;  1AP6 A;  2WAM A;  4I55 B;  3SPG A;  2RCV A;  1VF6 C;  2ZR3 A;  4P9P A;  4PEL A;  4FIP C;  3OEH G;  1BT8 A;  2A06 H;  3CWB H;  4BIO A;  2UU9 B;  1U96 A;  4G28 B;  1NR1 A;  3CCS V;  5LA6 B;  3RYH B;  1OHH G;  2JK5 C;  3ZED A;  4HZ3 A;  1WA8 A;  3FYE B;  2UXB O;  2Q8V A;  1YZB A;  4JZ2 A;  1XNR B;  3K08 A;  1S0V A;  1W0K G;  4X62 O;  2A7W A;  2JJ2 G;  1Q5O A;  5L3C A;  1VF5 B;  5CA3 A;  2ITC C;  4LFB O;  2GSM B;  1AR5 A;  3C3T A;  3B77 A;  2MK3 A;  1MMM A;  2YI9 A;  1Y76 A;  4AHC A;  5KMG A;  5IWA B;  2IU0 A;  3JAK A;  5EIB C;  1NKD A;  1KBH A;  2FB5 A;  3C90 A;  2HR3 A;  4UB8 Z;  4P2Z A;  1Q6U A;  1EFR G;  2YXY A;  3OR7 C;  5EYP B;  2F23 A;  4O4I B;  2HJD A;  3CEI A;  2IJJ A;  2EUL A;  2WWW A;  4PA3 A;  5H6Q A;  3ZMT A;  1FFX B;  1Q86 W;  3ABL B;  4O4J A;  2CH7 B;  1KEC A;  3T1H O;  4LF7 B;  4QIW F;  4I9Q A;  3K5O A;  5JCO C;  1GAX A;  4DR1 O;  1JR9 A;  2VWJ A;  1HNX B;  2HJF C;  2X6B A;  2UXN A;  1H2M A;  1FJG O;  2JGU A;  2ZR2 A;  5J2T B;  1TUB A;  1HW7 A;  3A2F A;  4NVP A;  5H5N A;  1PL0 A;  1G6U A;  4JAU A;  3E8F A;  1K9M W;  4X66 B;  4FMT A;  3WG7 B;  1AVM A;  4DXW A;  4BAY A;  2UUC O;  4XDJ A;  1FS0 G;  4I4T A;  2AZ0 A;  1RPO A;  2EIJ B;  1NH2 B;  3MDS A;  1IBK O;  5LYJ A;  4CH5 A;  3X2Q B;  3FFQ A;  1K34 A;  4GCZ A;  1NR7 A;  1WB8 A;  5B1O A;  1OCZ C;  3OR6 C;  4LH7 A;  2QTS A;  2UXB B;  3CRM A;  3P32 A;  4Q6G A;  3CP1 A;  4DUY O;  3F5W C;  3BRC A;  1YTF D;  4DV3 B;  4UVB A;  2JDI G;  2RNB A;  1X59 A;  4PDL A;  2YXH A;  4ZOL B;  1ZAU A;  2L6L A;  1XI1 A;  3JAR A;  5EK0 A;  3SPC A;  1FJG B;  3OTO O;  2LGQ A;  1SZX A;  1ZSP A;  1Q7Y W;  1T5E A;  4JI5 B;  4E4E A;  3L74 H;  3L9D A;  3DC6 A;  2JEU A;  3CHX A;  1E1R G;  2DYR B;  5L3E A;  1IVS A;  3T1H B;  2A0L A;  4MTG A;  3UT5 A;  3UO2 A;  3G4S V;  2QA4 V;  3IFX A;  2KQX A;  4N21 A;  2DQ0 A;  4JI4 B;  4K0K O;  4JV5 B;  2IBZ H;  2ZQM A;  1AI6 A;  2OTL V;  4DV4 O;  1Q6H A;  4R6Z A;  1QLN A;  4RAI A;  1COW G;  3G6B A;  1NVP B;  1GK9 A;  4NYK A;  1TA8 A;  2CGO A;  1NTK H;  5LA6 A;  3RYH A;  1ARO P;  4JPR A;  4IHJ A;  5B5E Z;  2F95 B;  3OEE G;  1MSW D;  2QWN B;  1WP8 A;  3J7A U;  3QVN A;  2NN4 A;  5IY5 B;  2UXC B;  4JTA B;  3ZS8 C;  4KHP O;  4MW8 A;  3M7M X;  2Y4U A;  4FLY A;  2UXD B;  1M9N A;  2O57 A;  4PA7 A;  3DSQ A;  4KP4 A;  1SQP H;  1KB9 F;  3CRR A;  1E79 G;  2QKS A;  1CXZ B;  4YJ3 B;  4UV9 A;  4X64 B;  2DW4 A;  2YIB D;  5B66 Z;  2EIN C;  2X7R B;  1L0L H;  2GV9 A;  4IIJ B;  1MZF A;  2VQF O;  4HNA B;  3JD3 A;  3GB7 C;  1OCC C;  5B1A C;  5B3S C;  4LR3 A;  2EIJ C;  4ZHQ B;  2ZXW C;  4DR5 O;  2VRZ A;  1GM9 A;  4YIO A;  1PKX A;  4A5U B;  4FFB A;  1MOF A;  4I0X B;  2UUA O;  4O4I A;  4DV0 O;  1IXB A;  2F93 B;  3T1Y O;  2A79 B;  4LF5 O;  1QU7 A;  3AG1 B;  4GKJ B;  3DTU B;  1I94 B;  3JD4 A;  2JS5 A;  1H8H G;  1UFI A;  3A8T A;  3CC4 V;  4O2A B;  2XT9 A;  1KP2 A;  1AI5 A;  4LWS B;  4O4L B;  1M90 W;  2V1D A;  4LF8 B;  5H9C A;  1VQ4 V;  4YJ3 A;  3RYF B;  1SF9 A;  3B40 A;  1YSC A;  2W0F C;  5JJJ B;  5LHG A;  3CC7 V;  3ZHS A;  4I50 A;  4LFC O;  3K5L A;  3B8N A;  2HVK C;  3HB3 B;  3SR2 C;  5IYD O;  1GH6 A;  2BSK B;  5BMV B;  4GKK B;  4WFA V;  3D3Q A;  4X88 A;  2ZT9 B;  4ASU G;  5LMU B;  3TK1 A;  2HLD G;  3OMI B;  4JI0 B;  1P7B A;  5KX5 B;  3HKC A;  3VQY A;  2Q5Z A;  4IHJ B;  5JQG A;  5AG2 A;  4K8X A;  4MVS A;  2ZIN A;  3AK2 A;  4TV9 A;  1RM1 B;  4RUF A;  4K3A A;  2QE7 G;  4BWA A;  2PGG A;  1H8E G;  3FD9 A;  1M93 A;  5LBQ A;  2B1G A;  1TVK A;  1K5Q A;  5KUK A;  4O4L A;  3UO3 A;  4FZ0 A;  4WFH A;  4CS4 A;  1IBL O;  2X6C A;  3JAW A;  3F7Y C;  3HKD B;  2M7W A;  3JCZ A;  3LDC A;  3U0Z A;  4UCV A;  1GO3 F;  3SPH A;  5CBF A;  1YIT V;  3CPW U;  4WFB V;  4FFB B;  5EBM C;  4RQF A;  4WCE V;  2Z5U A;  3AG3 C;  1WJZ A;  4BR6 A;  2RN9 A;  4R7C A;  3CX5 F;  5GTI Z;  4ZHQ A;  4FLZ A;  4LBE C;  2EX3 A;  3AG2 C;  4DW0 A;  2CK3 G;  2FL4 A;  2ZKO A;  4KFM A;  1SQG A;  4NB5 A;  4JAA A;  1YI2 V;  5KA5 A;  2LW1 A;  4YJ2 A;  5B3S B;  2VWK A;  4K0K B;  2DN9 A;  4ZBM A;  1Q82 W;  1NBM G;  2WLM A;  1PNK A;  1ZX3 A;  5LOV A;  5FL7 G;  4DUZ B;  5LXT A;  3BPZ A;  5JJN B;  2HP8 A;  1N34 O;  2PY5 A;  1FFX A;  3MAQ A;  3A0B Z;  4DK0 A;  1S3J A;  2PYJ A;  2E5L B;  2P5O A;  1NH2 D;  5LGU A;  3FAV A;  1VF6 A;  1FXV A;  3HKC B;  3C3S A;  1VQ5 V;  2ETN A;  1MSD A;  4N23 A;  2FTK A;  5CBH A;  4LF6 O;  5IDJ A;  1R6T A;  2BE3 A;  5H6R A;  4JTD B;  4D7T A;  4G27 B;  5E1A C;  5LHI A;  4MT8 A;  1QVG U;  4LF7 O;  1DF4 A;  1Y4M A;  3PN1 A;  1KP3 A;  1MA1 A;  4JI2 B;  5CMU A;  2BOB C;  5CA0 B;  1BQZ A;  3H01 A;  4DR3 O;  4HAM A;  2HHH B;  2QWO B;  1KQS U;  5CB4 A;  1BZK A;  4IT5 A;  4MW3 A;  2EIL C;  4DV5 O;  2BTQ B;  4LF5 B;  4MVU A;  3AK1 A;  3UT5 B;  4DV0 B;  4H0L B;  5JJE B;  1YCI A;  5IWA O;  4JI8 O;  2V4D A;  1H2N A;  3GVM A;  2YUA A;  2Q7H A;  2P06 A;  4MTX A;  4FLU A;  1XRE A;  4DRX B;  4QE9 A;  3RVZ A;  5IJ0 A;  5JCO A;  5KHJ A;  4DV1 B;  1VQ7 V;  3OFN G;  3UKM A;  2Q9L A;  4QPJ A;  4X9Q A;  2FYU H;  4DUY B;  4I0X A;  1ORQ C;  4B7K A;  3IJ4 A;  1X4T A;  3JCU Z;  2EIN B;  4O2A A;  1JCH A;  2HKO A;  3M8A A;  1S76 D;  4X89 A;  4UVA A;  4I4T B;  1JVM A;  1SET A;  2E3C A;  3E22 B;  1XNQ B;  1K73 W;  1XL6 A;  1N0J A;  2OCH A;  2ZE7 A;  5JWP A;  3BA8 A;  3AG3 B;  4TOI A;  1W2B U;  3VQX A;  2QGN A;  2W6J G;  4RO2 A;  1N36 B;  1WNS A;  4JAV A;  2DE0 X;  4NTY A;  2KG7 B;  1F7Y A;  2NR5 A;  5GON A;  4FM2 A;  2Y4T A;  4DV5 B;  3P3N A;  1KKC A;  3A0R A;  2RMK B;  3DC5 A;  3VQW A;  4CH4 A;  2OCC B;  2MW2 B;  3H1L H;  1OJH A;  2Y0P A;  2CH7 A;  2IJK A;  1G8M A;  3ABK C;  4MTF A;  4DV3 O;  1NS1 A;  5JQG B;  2ADQ B;  4OPH A;  1THZ A;  3APO A;  4KXR A;  4DV2 B;  2W0X A;  1PL4 A;  2Z3Y A;  2P4V A;  3ABU A;  1IXM A;  4U7N A;  3H9V A;  2DOS A;  5EIB D;  2IH1 C;  4U3F H;  2ODM A;  1NVP D;  2ITD C;  5L3D A;  3QO7 A;  4Q20 A;  2BSK A;  1LUV A;  4LC1 A;  1H2K A;  1R3K C;  5KHK A;  5IYC O;  2DYR C;  5BXZ A;  1KC8 W;  2JIZ G;  3RYF A;  2PF4 E;  4B3R B;  1SRY A;  4X62 B;  1Q81 W;  2IJH A;  2XUM A;  3ASO B;  4P9O A;  1HNW O;  2P67 A;  3CRC A;  5BMV A;  3K5N A;  1R3I C;  3WU2 Z;  4LH6 A;  1IUR A;  3JD0 A;  4ZOL A;  5J2U B;  3ZMZ A;  1Y6X A;  2EBO A;  2QKA A;  1GM8 A;  2N74 A;  3MHS C;  2V7Q G;  4PD4 F;  2UUB O;  1KYO F;  1F23 A;  4F6R B;  4TUY A;  4LP8 A;  3UCS C;  2HVJ C;  4LF4 B;  4X66 O;  4I7Z B;  3JAL A;  4UVC A;  2W6I G;  3JAM N;  2JRI A;  3ZN1 A;  1JMK C;  1SC5 B;  2VQE O;  5B1A B;  1SQV H;  4W4L A;  3OAA G;  3S3W A;  1SA0 B;  4K8Z A;  2K9P A;  2BOC C;  1PM9 A;  3ML0 A;  1N33 B;  2AHY A;  4LWS A;  1LUW A;  3E8B A;  4ZI7 A;  1AIL A;  2R9I A;  5L3B A;  4BIZ A;  1PD3 A;  1S5H C;  2P6J A;  1J5E O;  4DR4 B;  1KD1 W;  1GMG A;  4CS3 A;  1ZLZ A;  3K04 A;  2YIB A;  1B6Q A;  2Z0A A;  2LO1 A;  3CJH B;  4GX2 A;  1BHB A;  2QM4 A;  5CA1 B;  1S5J A;  1DTO A;  4K35 A;  3ZRW A;  1ZUQ A;  1K5S A;  1OV9 A;  2A9H A;  3RFR A;  3UQ8 A;  3ZRX A;  3O65 A;  3ICX A;  5J9P C;  2DYS C;  3D3I A;  3E8G A;  1Z5V A;  2ZNI A;  5IJ9 B;  5ITZ B;  1G1X B;  2H94 A;  5KMG B;  3RYI B;  2PZS A;  1O9H A;  4IIJ A;  1N32 O;  4NTW A;  1YJW V;  2BTQ A;  1I5Y A;  5HFM A;  1ZWI C;  3E83 A;  4EFB A;  1FKA O;  3AG7 A;  3JAS B;  2E76 B;  3IC9 A;  2OIG A;  1DK1 A;  1YVW A;  1V9P A;  4JYC A;  4CZZ A;  2EZP A;  3KCY A;  2LFS A;  5KX5 A;  2ZNJ A;  4U3J A;  4L8J A;  4YXW G;  3SGI A;  2G38 A;  2D3O W;  1GN2 A;  3KKY A;  4B3S B;  3JAK B;  2YEV A;  2JVD A;  2GTS A;  5FNV B;  1HR0 O;  3VQV A;  4JYB A;  4X20 A;  2DYS B;  1EN4 A;  3RW0 A;  1ZTE A;  3ABK B;  1I7F A;  2RQ6 A;  1S77 D;  3FB5 C;  1R1B A;  3WB0 A;  5JH7 B;  1GN4 A;  3E22 A;  1Q43 A;  4X1I B;  2WLI A;  1M4U A;  4JI7 B;  4MVO A;  3RYC A;  2VQF B;  3JAR B;  2UUB B;  1SA0 A;  1BS3 A;  4EKW A;  1WPX A;  2YSU B;  4JGS A;  4U7O A;  3ZBH A;  4H37 A;  2XAQ A;  1PNL A;  2HFE C;  4JI1 O;  3ZHR A;  2DJV A;  2FKX A;  5EBL C;  4YHH O;  1XIL A;  4X65 O;  3SDL A;  4FM0 A;  2PYL A;  4TUY B;  2BTO A;  4JYA B;  4J10 A;  4X1K B;  3STL C;  2RDC A;  2ADP A;  4JI6 O;  2ZE6 A;  3BEH A;  2ZIM A;  2PI4 A;  1SER A;  3K06 A;  1H2L A;  2OT5 A;  2OYQ A;  1JJO A;  3ASN C;  3FX7 A;  4OX9 O;  1HP8 A;  3BAB A;  1DLB A;  4ICG A;  4TQD A;  1QBZ A;  4PV1 B;  2GUZ A;  3CXH F;  3BVO A;  3SYO A;  1AI4 A;  1WPB A;  3CCL V;  3OMA B;  3L70 H;  1N4C A;  3ZRV A;  4GX5 A;  1SQQ H;  3E86 A;  2N04 A;  3AG4 C;  4NTX A;  5FLX N;  4MVM A;  2LFR A;  1W0J G;  4AQY O;  4C7U A;  5KUM A;  1XEQ A;  4DO2 A;  1MZE A;  3SJC C;  4LFA B;  3E8H A;  2YEV B;  3JAS A;  2GTA A;  3IGA C;  1N33 O;  2LJ2 A;  4FVM A;  2WLH A;  1WB7 A;  4DV7 B;  4X1Y B;  1D2D A;  3K9S A;  1ZL8 A;  2UXD O;  4WF9 V;  3LDD A;  2R9R B;  4FPP A;  4JV5 O;  4JI4 O;  3QO5 A;  2IJI A;  2GHY A;  1LR1 A;  2VQE B;  1XMO O;  3FB6 C;  4PI2 A;  4CC5 A;  3QTC A;  1QCE A;  1GRJ A;  2ZIO A;  4I5S A;  2YXL A;  4QE7 A;  2EIM C;  5E79 Z;  1US6 A;  1Y66 A;  3K9A A;  3AG1 C;  4LF9 O;  2KG7 A;  4UCT A;  4F6E A;  3N2K B;  2Y0I A;  4J42 A;  1R73 A;  3H1H H;  3CCQ V;  1Y74 B;  2QM7 A;  4RQE A;  4MSW C;  1K7D A;  4GZR B;  3ABT A;  3UM7 A;  1H38 A;  1WA8 B;  5EC2 C;  3E2E A;  2PUS A;  5GON B;  1J5E B;  3JSL A;  4P30 A;  3OT7 A;  3R66 A;  4B3R O;  1LNQ A;  1R3L C;  1XDC A;  1IBK B;  3BFR A;  3T2M A;  3A0H Z;  2WLK A;  2F1M A;  4KUM A;  3OGI B;  1JQ0 A;  4PA4 A;  1XOU A;  3W7U A;  1KKD A;  3SJA C;  1YIJ V;  1Z2G A;  1YF2 A;  4F6R A;  5GTH Z;  4JZG A;  2EIK B;  2ZE5 A;  3KZI Z;  1RSO B;  1HNX O;  4IYH A;  4OGQ B;  3OUF A;  4RUE A;  1PV0 A;  4CH6 A;  3M99 B;  3Q4H A;  1NU1 H;  4GYC B;  2ILM A;  2X0L A;  1HNZ B;  4WFE A;  4HYO A;  4LF9 B;  5LMN B;  4X1I A;  1R3J C;  2R72 A;  4GUN A;  2WPD G;  5KAI Z;  1FXK C;  5IYB O;  3G67 A;  4L87 A;  1RFY A;  4U3J B;  4DR7 O;  1GN3 A;  4CH3 A;  3NXS A;  3CCJ V;  1DF5 A;  4QJF B;  1AJP A;  4GX1 A;  1JFF B;  2CUG A;  4LNU A;  1AR1 B;  5LP6 A;  1IX9 A;  2QM8 A;  1NI8 A;  1VEW A;  5DN6 G;  1BGY H;  4JI2 O;  1PP9 H;  4LFA O;  1G4Y B;  2JEX A;  4G2K A;  1P7G A;  3W7T A;  2UUC B;  1YXB A;  3CCE V;  2JS3 A;  4R50 A;  3ZRS A;  3HKB B;  3E89 A;  1BE3 H;  2F66 C;  4I50 B;  3D36 A;  1QLE B;  1PPJ H;  2QSA A;  1Q6I A;  1SQB H;  1XUQ A;  2JGD A;  3JD1 A;  1CEZ A;  3G71 V;  3WB1 A;  3ZMV A;  2F4V O;  4XDK A;  3PJS K;  1L1F A;  4PHZ A;  1H2G A;  3L72 H;  4B7E A;  2ZD9 A;  3OTO B;  2XTA A;  3X2Q C;  3K57 A;  4ABM A;  3BA9 A;  1ROP A;  1XNR O;  1K4C C;  5BR8 B;  4AQY B;  3ABM C;  4GLX A;  1V54 C; 
#chains in the Genus database with same CATH homology
 3ZJZ A;  3WG7 C;  3CXC U;  3EHB B;  2ZQM A;  1AI6 A;  1R3I C;  3MD0 A;  2OTL V;  2IW5 A;  2WLL A;  1EZJ A;  3JD0 A;  2C2A A;  4R6Z A;  1QLN A;  3ZMZ A;  4RAI A;  5L3F A;  1COW G;  1VQ8 V;  2EIL B;  1NVP B;  3QNE A;  2EBO A;  1GK9 A;  4H33 A;  2H8P C;  3ZN0 A;  4MTO A;  1GM8 A;  3MHS C;  1ARO P;  2V7Q G;  3IC7 A;  4JPR A;  1F23 A;  3JYC A;  4LP8 A;  2XAG A;  4PA9 A;  3W7S A;  3TCU A;  2Q6A A;  4PA6 A;  2HVJ C;  3LDE A;  3OEE G;  1MSW D;  3EFF K;  4UVC A;  2W6I G;  3K79 A;  3ZN1 A;  3VBB A;  5IY5 B;  1K92 A;  1F4N A;  2XAJ A;  3JD2 A;  4JTA B;  3LSQ A;  5B1A B;  4J9Y B;  1GM7 A;  3OAA G;  1FXK B;  3T1C A;  4F4L A;  4MW8 A;  3DGE A;  2BOC C;  1OZ0 A;  1V54 B;  3ML0 A;  1M9N A;  2AHY A;  4PA7 A;  3CD6 V;  4KP4 A;  3E8B A;  2XAS A;  1SES A;  2R9I A;  5L3B A;  2AHZ A;  1E79 G;  4BIZ A;  1PD3 A;  1S5H C;  2P6J A;  2QKS A;  2UXX A;  2P90 A;  2NNU A;  1KD1 W;  3FYI B;  1GMG A;  4UV9 A;  3K04 A;  2DW4 A;  1K3E A;  2EIN C;  2X7R B;  1B6Q A;  3CC2 V;  4GX2 A;  3R65 A;  1BHB A;  1DTO A;  3ZRW A;  3ZRW B;  1K5S A;  2A9H A;  1OCR C;  1M57 C;  1UJW B;  3JD3 A;  3ZRX A;  3GB7 C;  1F51 A;  5GW7 A;  3WFV A;  5J9P C;  1OCC C;  3AG4 B;  5B1A C;  5B3S C;  2DYS C;  3D3I A;  2EIJ C;  4QNH B;  3E8G A;  2ZXW C;  3SPI A;  1MAB G;  2H94 A;  1OCO C;  3FKS G;  1YTF B;  1GM9 A;  3T4D A;  3CCR V;  1PKX A;  2DWD C;  2DQ3 A;  5L3G A;  4TWK A;  3OE7 G;  1MOF A;  2OCC C;  3LUT B;  2X6A A;  1BMF G;  1YJW V;  3ASN B;  1I5Y A;  2A79 B;  5LHH A;  3AG1 B;  5HFM A;  1YJ9 V;  2Y69 C;  1ZWI C;  3DTU B;  3G6E V;  3E83 A;  3MHH C;  3P30 A;  2Y48 A;  3JD4 A;  1CPY A;  1H8H G;  3B8M A;  3ABM B;  1QR9 A;  3CC4 V;  3SYQ A;  1KP2 A;  1AI5 A;  1M90 W;  1M57 B;  5LGT A;  2PI5 A;  5DM6 V;  2V1D A;  3SYC A;  3K3W A;  5H9C A;  4JYC A;  4MVQ A;  1VQ4 V;  4PDM A;  2P7T C;  2ZXW B;  4CZZ A;  2EZP A;  1XL4 A;  1YSC A;  4WFF A;  2W0F C;  5LHG A;  2LFS A;  3CC7 V;  5EBW C;  4YXW G;  2IH3 C;  3ZMS A;  2D3O W;  3OW2 U;  1K4D C;  3B8N A;  2HVK C;  3HB3 B;  5IYD O;  4XDL A;  4ZKI A;  2YEV A;  2WLL B;  3BY6 A;  2WLN A;  4UV8 A;  1YHQ V;  2WLI B;  1NQT A;  4JYB A;  4WFA V;  4X88 A;  4WFG A;  1AJQ A;  4ASU G;  3K0G A;  2DYS B;  3ETG A;  3TK1 A;  3RW0 A;  2XAF A;  2HLD G;  3ABK B;  5KA6 A;  1VQ6 V;  3OMI B;  1BHA A;  1P7B A;  1S77 D;  3FB8 C;  1BL8 A;  2DWE C;  1GTO A;  3FB5 C;  1QVF U;  4UXN A;  2WSS G;  1JPX A;  1ENV A;  4MVS A;  1M56 C;  4XBF A;  2WLI A;  1R6N A;  1QLE C;  4MVO A;  1RM1 B;  4RUF A;  1JOY A;  2ZDI A;  3W7X A;  2XND G;  2QE7 G;  1VQN V;  1RPR A;  2Y69 B;  1H8E G;  2EJR A;  5LBQ A;  1FXK A;  3SJQ C;  5LGN A;  4EKW A;  2B1G A;  3I56 V;  1WPX A;  2YSU B;  4JGS A;  1VQ9 V;  1K5Q A;  4U7O A;  5KUK A;  4H37 A;  2XAQ A;  1PNL A;  3SYP A;  4BIU A;  2HFE C;  5EBL C;  5IY5 C;  4WFH A;  2X6C A;  1JX9 A;  2EIM B;  3CCV V;  3F7Y C;  3CMA V;  2ZDI C;  3T4Z A;  1AJN A;  3LNM B;  4QPK A;  2M7W A;  1V55 C;  3JCZ A;  3LDC A;  1S72 V;  2QTO A;  3STL C;  1K8A W;  1OCO B;  1GO3 F;  3CYO A;  3SPH A;  5CBF A;  3BEH A;  1YIT V;  1SZT A;  3CPW U;  4WFB V;  2PI4 A;  1SER A;  5EBM C;  1QR8 A;  3K06 A;  4TT3 G;  2OT5 A;  1RM1 C;  4RQF A;  4WCE V;  2Z5U A;  3ASN C;  4GT1 A;  3AG3 C;  1JJ2 U;  1DLB A;  4R7C A;  3ZMU A;  2Q67 A;  3VOU A;  1QBZ A;  3CME V;  4LBE C;  3ASO C;  3AG2 C;  3OUS A;  3SYO A;  2CK3 G;  1AI4 A;  3LSS A;  4KFM A;  2XOK G;  1OCR B;  3OMA B;  3CCL V;  3F7V C;  3ZRV A;  1VQL V;  3AEI A;  4GX5 A;  1YI2 V;  2EIK C;  2ATK C;  2LP7 A;  4I9W A;  5KA5 A;  1CP9 A;  5B3S B;  3E86 A;  3AG4 C;  3ETD A;  1VQO V;  4E2L A;  4TSF G;  4CBC A;  4MVM A;  2B5U A;  2LFR A;  1W0J G;  3W7W A;  3CCM V;  5KUM A;  4ZBM A;  1GKF A;  1Q82 W;  4DO2 A;  1K33 A;  3TET A;  2Q69 A;  1NBM G;  2WLM A;  1PNK A;  5EC1 C;  3E8H A;  2YEV B;  1VQM V;  2B1I A;  5FL7 G;  3E35 A;  3IGA C;  2WLH A;  5CN0 A;  3ETE A;  4Z1M G;  2NLJ C;  4WF9 V;  3LDD A;  1S3J A;  2R9R B;  4FPP A;  3ZCC A;  1VQK V;  1NH2 D;  5LGU A;  5B1N A;  1FXV A;  3QO5 A;  1V55 B;  2IJI A;  2GHY A;  5CBG A;  1VQ5 V;  3OGC C;  3FB6 C;  5B1B B;  1QCE A;  1PNM A;  1NJI W;  1FXH A;  4N23 A;  2IU3 A;  3RVY A;  4I5S A;  2FTK A;  3STZ C;  5CBH A;  5IDJ A;  3OM3 B;  4QE7 A;  2EIM C;  1Y66 A;  3K9A A;  2KB1 A;  2XAH A;  3RBZ A;  5C93 A;  5H6R A;  4JTD B;  3AG1 C;  4G27 B;  5E1A C;  5LHI A;  4MT8 A;  1QVG U;  2QEX V;  2WAM A;  3SPG A;  4LCU C;  1DF4 A;  1Y4M A;  2ZR3 A;  1KP3 A;  4P9P A;  4PEL A;  4FIP C;  5CMU A;  2BOB C;  1YJN V;  3OEH G;  1R73 A;  4MVZ A;  3H01 A;  3CCQ V;  4HAM A;  4FK5 C;  1KQS U;  4J9Z B;  2QM7 A;  4G28 B;  4RQE A;  4MSW C;  1K7D A;  4MW3 A;  1WLE A;  1NR1 A;  3CCS V;  2EIL C;  3ABT A;  3UM7 A;  1OHH G;  2JK5 C;  1H38 A;  4HZ3 A;  3FYE B;  1N8R W;  4MVU A;  3ABL C;  5EC2 C;  3FB7 C;  3E2E A;  4FJC C;  3K03 A;  3K08 A;  1S0V A;  4P30 A;  5B1B C;  1W0K G;  1F4M A;  2JJ2 G;  4PDV A;  1EBO A;  1LNQ A;  1R3L C;  5L3C A;  2HG5 C;  3GWO A;  1FFT B;  3T2M A;  2ITC C;  5CA3 A;  2GSM B;  2WLK A;  4MTX A;  3B77 A;  2MK3 A;  4KUM A;  4PA4 A;  1JQ0 A;  4QE9 A;  3W7U A;  1KKD A;  2IU0 A;  3RVZ A;  1YIJ V;  1NKD A;  2HR3 A;  4P2Z A;  1EFR G;  1P4R A;  1VQ7 V;  3OFN G;  3OR7 C;  3UKM A;  2EIK B;  4QPJ A;  2EZO A;  2IJJ A;  1ORQ C;  4JTC B;  2WWW A;  4PA3 A;  5H6Q A;  3OUF A;  4RUE A;  3ZMT A;  3M99 B;  1Q86 W;  3ABL B;  4MS2 A;  3CCU V;  1KEC A;  2EIN B;  2X0L A;  4WFE A;  1JCH A;  2HKO A;  4OXS A;  4QIW F;  1S76 D;  4HYO A;  4X89 A;  4UVA A;  1R6K A;  1JVM A;  1SET A;  3OMN B;  4MVR A;  1R3J C;  3K0D A;  1K73 W;  2HJF C;  1XL6 A;  3ZIA G;  2X6B A;  2UXN A;  3AG3 B;  1AI7 A;  2ZR2 A;  1W2B U;  4JAS A;  2W6J G;  2WPD G;  4RO2 A;  1PL0 A;  1FXK C;  4JAV A;  5IYB O;  1E1Q G;  1TUE B;  4JAU A;  4L87 A;  1M1K W;  4JF3 A;  3E8F A;  1K9M W;  3NXS A;  4BW5 A;  3I55 V;  4FMT A;  3CCJ V;  3WG7 B;  3A0R A;  1DF5 A;  4QJF B;  1AJP A;  1MG1 A;  4GX1 A;  4DXW A;  4BAY A;  4XDJ A;  1FS0 G;  1AR1 B;  1RPO A;  1M56 B;  2QM8 A;  2OCC B;  2EIJ B;  2WLJ A;  1NH2 B;  2OTJ V;  5DN6 G;  2K1E A;  2F43 G;  3X2Q B;  3KG2 A;  2IJK A;  1K34 A;  1HWY A;  4GCZ A;  1NR7 A;  1VQP V;  5B1O A;  1OCZ C;  4X8A A;  1G4Y B;  2JEX A;  1G8M A;  4G2K A;  3W7T A;  3OR6 C;  3ABK C;  4MTF A;  1THZ A;  3CCE V;  1J95 A;  3P32 A;  2Z3Y A;  3CP1 A;  3F5W C;  4R50 A;  3ZRS A;  4PDR A;  3ABU A;  1IXM A;  1OCC B;  4U7N A;  1YTF D;  3E89 A;  4UUJ C;  4UVB A;  2JDI G;  3QO8 A;  4PDL A;  1I5X A;  3D36 A;  1QLE B;  5EK0 A;  2IH1 C;  3SPC A;  1NVP D;  2ITD C;  5L3D A;  3QO7 A;  4Q20 A;  1Q7Y W;  3JD1 A;  1CEZ A;  4GX0 A;  2JJ1 G;  4LC1 A;  3G71 V;  4R8C A;  3ZMV A;  3HPL C;  4XDK A;  1R3K C;  2JEU A;  1E1R G;  2DYR B;  5L3E A;  3PJS K;  2DYR C;  5IYC O;  1L1F A;  1KC8 W;  2A0L A;  1H2G A;  2JIZ G;  3SYA A;  2Q68 A;  4MTG A;  2ZD9 A;  3X2Q C;  3SPJ A;  1SRY A;  5HFL A;  1OCZ B;  1ROP A;  3G4S V;  2QA4 V;  1Q81 W;  2IJH A;  5BZB A;  1K4C C;  3IFX A;  3AG2 B;  4N21 A;  3ASO B;  4P9O A;  2DQ0 A;  3ABM C;  1K97 A;  2P67 A;  1V54 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...