3E8FA

Crystal structure of the the open nak channel- k+/ba2+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8fA00
3E83A 3FB7C 4R8CA 2BOCC 4CBCA 3SPGA 3SYQA 2R9RB 3ASNC 4PA9A 3RVZA 3FB8C 4KFMA 3FB5C 1OCCC 5EK0A 4WFGA 1V54C 2AHZA 3F7YC 1G4YB 3OUFA 5B1BC 3RW0A 2WLIB 2WLLA 3ZJZA 4R6ZA 4UUJC 2X6CA 3FB6C 3PJSK 4RAIA 2ITCC 3TCUA 1JVMA 4P9OA 3SPJA 4LCUC 2Y69C 1OCOC 4MVZA 4HZ3A 2HFEC 3X2QC 4HYOA 2A79B 2AHYA 2ZD9A 4PA3A 1K4CC 3LDEA 1R3IC 5CBHA 3ABLC 3UKMA 2DWEC 5KUMA 5EBLC 4PA6A 1QLEC 4RO2A 3K04A 4PA4A 4PDRA 2EIMC 1ORQC 3STZC 1M57C 2Q67A 3GB7C 2X6BA 2ZXWC 3LDDA 2QKSA 4JTDB 4XDJA 5E1AC 3UM7A 4XDLA 2A9HA 3SJQC 1XL4A 3LNMB 1OCZC 3OR7C 3SPIA 2Q68A 2IH1C 3OUSA 2NLJC 2WLLB 2WLIA 3HPLC 4I9WA 5EC2C 2W0FC 1J95A 3SPCA 4BW5A 2HJFC 3K0DA 2X6AA 4MVMA 1ZWIC 3EFFK 5KUKA 4MTOA 2WLMA 5EC1C 2Q6AA 2WLNA 3AG1C 4TWKA 5EBWC 2A0LA 3TETA 4LP8A 3STLC 4WFHA 2ATKC 3ASOC 3E8GA 1S5HC 2WLJA 4GX0A 2Q69A 3E8FA 2EIKC 2EILC 5BZBA 4QE9A 3F5WC 4G28B 3SYCA 2H8PC 3AG4C 4F4LA 1V55C 2K1EA 4DXWA 4GX2A 3RVYA 3OGCC 3WG7C 4EKWA 3SPHA 1KKDA 2JK5C 3IGAC 4G27B 3F7VC 4GX5A 4R7CA 4XDKA 5EBMC 2KB1A 4MVRA 4MTFA 4MVOA 1R3LC 3ABKC 4RUFA 4X89A 4MSWC 4MVSA 4WFFA 2ITDC 3E8HA 3SYPA 3E86A 5B3SC 1BL8A 4GX1A 4P2ZA 4MS2A 4ZBMA 3T4ZA 2OCCC 4P9PA 3JYCA 3ZRSA 4QNHB 4PA7A 2P7TC 4LBEC 3RBZA 3ABMC 3AG2C 3K03A 3K0GA 4P30A 4J9YB 1XL6A 1K4DC 4MW8A 2IH3C 2WLHA 2HVKC 3R65A 2BOBC 1P7BA 3BEHA 4MTGA 3K06A 4J9ZB 3E89A 3SYAA 2YEVA 4X8AA 5J9PC 5CBGA 2DWDC 2DYSC 4H37A 3AG3C 1R3KC 3E8BA 4RUEA 4X88A 3LDCA 4JTCB 4PDVA 2DYRC 1OCRC 1LNQA 3IFXA 1M56C 2EINC 2HVJC 2QTOA 3KG2A 3OR6C 4PDLA 5B1AC 4MVUA 5IY5C 2WLKA 3SYOA 4H33A 3LUTB 3T2MA 2HG5C 3K08A 3T1CA 2EIJC 3VOUA 4MW3A 4WFEA 5CBFA 4PDMA 3T4DA 4MVQA 4OXSA 4QE7A 4R50A 1R3JC 4JTAB
chains in the Genus database with same CATH superfamily
4OX9B 2LP7A 2BOCC 3KCXA 2IJKA 3RVZA 5FPRA 1N32O 1V9PA 2A7WA 1GN4A 2PGGA 3PJSK 3IAYA 3RN4A 4DV1B 4DR6B 5LMNB 1RP3B 3AK2A 1AB3A 3G6BA 4O2BA 1B06A 2MW2B 1GRJA 4FLZA 3AK1A 1M57C 3ML0A 3G6EV 3JCUZ 2LQTA 2QA4V 3H9VA 1R1BA 2OCHA 4X20B 5B66Z 5IJ0B 3QO7A 4BW5A 3H01A 3DTUB 3K0DA 4J7ZA 2QWQB 4J41A 4HNAA 1BE3H 2BTQB 3HKDA 4TWKA 4DO2A 4UCOA 3CE2A 1W2BU 1H2GA 1BZKA 2H8PC 4N21A 5CA1B 4YJ3B 1AR5A 4RQFA 2WPDG 1NR1A 2WSSG 3HKEB 4AHCA 4MSWC 1PM9A 1TUBA 5LMUB 4CH6A 5AG2A 3M7MX 4LBEC 3UO3A 3B8NA 2JGDA 3JAMN 4DV2O 2IH3C 3OMAB 4X9QA 1QU7A 3SYAA 1EFRG 1GN3A 2XNDG 3JSNA 3ZN0A 1SQQH 5IYCO 2DYRC 4X65O 3OE7G 3RYIB 3ZHVA 4FLWA 3JARB 2EIJB 5EK0A 3F7YC 2EJ7A 5JQGB 2AXTZ 4YXWG 2GUZB 1PL4A 5CB4B 3SPJA 3W7TA 3ZMTA 2FTKA 4HZ3A 1QR8A 2HR3A 4PI0A 1SETA 1CP9A 2AHYA 3JD0A 3H1LH 4ZHQA 1VEWA 5LA6B 2RMKB 1Y4MA 3C3TA 1R3IC 1JR9A 2IJJA 1E79G 1HNZO 2RQ6A 3UM7A 3H1JH 5BR8O 2Q68A 1RSOB 2GDSA 4I9WA 2Q9LA 3ZRVA 2QR4A 1VF7A 1Q81W 4MVMA 3K79A 1VMGA 1PNKA 3O9OA 4TV8B 1Y76B 1K9MW 3WG7B 2ZM6O 4NTWA 3IJ4A 2PYLA 5KHJA 1VF5B 1EM1A 1DF5A 1E1RG 4NXNO 3E8FA 5LXTB 1JQ0A 4KP4A 1BCCH 3AK3A 2BCCH 3JAWB 3W7XA 2V1DA 2HP8A 4LC1A 4OPAA 4JAAA 4F6EA 2UXDO 1HW7A 2CUGA 1XEQA 3R66A 1N36O 1H8EG 5JVDB 3K3WA 3E8HA 4DW0A 4TV9A 4LFBB 1HDJA 3JAKB 3ABTA 1OCCB 4LF4O 4PA7A 1YEWA 3ZN1A 3FYIB 1ROPA 3CHXA 3CCSV 5DEDA 5JCOA 1GN2A 3B2EE 3BAAA 4RWUA 4LF9O 3L72H 4JV5B 1KQSU 1FFXA 2FKXA 3K08A 3HKBB 4JI4B 3DXRB 1PV0A 3UT5A 1XMQO 1R6KA 2DYRB 2R72A 1R73A 4JAVA 2PY5A 4B3SO 1FJGB 4UUJC 3CCLV 1YDXA 3JSLA 2XTAA 2XAQA 4I0XB 4W4KA 3Q4HB 4GZRB 4EEQA 1OCOB 5KUMA 1GMGA 1K73W 4RO2A 1GKFA 5LHHA 1SC5B 5JVDA 4JTDB 3RWRD 3CRQA 4DV0O 3K5OA 4NKGB 3WB1A 4IIJB 1KC8W 2QJ1A 4LP8A 1ZL8B 4ZKIA 1OCRB 4DR2O 2EIKC 4UXNA 4JZGA 5IY5B 5KLVH 2EX3A 1F51A 5J2UA 3F5TA 2DN9A 3WG7C 5JH7B 4G2KA 2ZIOA 1N0JA 1NR7A 1PD3A 1GM8A 4B3MB 4X62O 4LNUA 1N34O 2Q7EA 1BQ0A 4I0XA 3CCJV 5C93A 1MG1A 3CXHF 4DV6B 1H2LA 2Y0IA 2BOBC 2QDOA 5J9PC 1UJWB 3RYFB 3ETDA 1YI2V 3APQA 3OT7A 1FKAO 1TA8A 1VQNV 4EB6A 2UU9O 3P32A 1LUWA 2HJDA 3CCMV 2QWPB 1ZLZA 2ZR2A 1M1KW 5FLXN 5LP6B 5CA0A 2ZDIC 3SYQA 3J81N 4I55B 1H2KA 1V54C 3JD4A 3UO2A 3MD0A 4UCVA 3JASA 4NTYA 4OGQB 4LWSA 5H5NA 1G6UA 4HYOA 2YI9A 2XUMA 3E22B 2R9AA 3T1HO 4DV1O 3CYOA 2JDIG 3AG7A 5LOVB 5LL6Y 2PI4A 2EBOA 2RNBA 3STZC 2PF4E 3OD4A 4O2AB 5FNVA 1PPJH 2FMLA 2NN4A 1PP9H 4DR7O 4B3MO 3OR7C 2IH1C 3OUSA 3VQXA 4B08A 1K8AW 5GONA 5EC1C 2VS0A 4YY3O 2Q4PA 3ZMSA 2H94A 1BQZA 1RPOA 4LF6B 1G8MA 2KSDA 4D6TH 4F4LA 4BAYA 3AG2B 5B5EZ 1GM9A 3ZHSA 2AW9A 4B3TB 1Q86W 2KB1A 3ZCCA 4CC5A 3A0BZ 1L0LH 4WFAV 5IYZB 5J2TB 1OJHA 3SYPA 4O4HB 5B3SC 4X1YB 1MSWD 2P5OA 5KX5B 4LF8B 5IYBO 2ARHA 1I0HA 2XAJA 3ABMC 4N23A 5K1PA 1W0JG 3HB3B 1K5QA 1M9NA 4CS3A 1XNQB 4ZOLA 4LNUB 1WPXA 2DWDC 5L3GA 1N33O 4JYAO 3AG3C 1R3KC 3FFQA 4JTCB 1LUVA 3IFXA 4TUYB 4L87A 3HR0A 4L8JA 5LXTA 5H2FZ 5LHGA 3VOUA 5CBFA 3IC9A 4BW9A 3CMAV 1XILA 3FB7C 2QSAA 3ZHUA 3FB8C 1M4UA 3D3IA 2F93B 4J7KA 3ZIAG 5B1BC 2Q8VA 3FB6C 1Q3EA 1YJWV 3ABMB 1JVMA 4DUYB 1Q90D 2ZE6A 4DR5O 1IXMA 3CJHB 2HFEC 2OIGA 2UXBB 4O4LA 5CA0B 2ILMA 4DR4O 5EYPA 2HHHB 1F7YA 2X6BA 1UFIA 2QKSA 4PI2A 1NH2D 2YICA 4X1YA 3RGBA 1FXHA 2M6YA 3RYCA 4JAUA 1OV9A 1BS3A 3SPIA 4I5SA 4U7OA 2HLDG 1O9GA 1M90W 2FB5A 4LF4B 3ABLB 2VQEO 4DV0B 4LF8O 3TGUH 2Q6AA 3ASNB 2A0LA 1F4NA 3HKDB 2JEXA 1PNMA 1YXBA 2OT5A 2IU0A 2K1EA 1I08A 4GX5A 4WCEV 4JI2O 1JCHA 4MVOA 5BR8B 3I5DA 2ETNA 4JI8B 5EZYB 4K8XA 1RFYA 1WA8B 3ABUA 4X64B 5E79Z 3ABKB 1N8RW 2F66C 3BPZA 1B04A 1NS1A 4DR3O 4MW8A 3G4SV 4MTGA 2CGOA 3K06A 1XI1A 2AZ0A 3OFNG 1S77D 2Q0OC 1YZBA 4X88A 3OM3B 1VQ4V 1NH2B 4DUZB 1VARA 3OEEG 2HVJC 5B1BB 1XMQB 1N0NA 2CTWA 4UV8A 4J10A 1S72V 1VQ7V 1RSOA 3D3QA 3RYHA 1KUQA 5JH7A 1ZAUA 2GTSA 4F6RB 3G71V 1MZEA 4D7SA 4I7ZB 2HKOA 3ZEDA 5ITZB 2ITCC 2QM8A 4IT5A 3CRCA 3GWOA 4QIWF 1W0KG 2DQ3A 4DYLA 1R6NA 1NVPB 1WJZA 4PA4A 3CP1A 2OIEA 2ZXWC 1I5YA 4IGGA 3OW2U 5B1NA 2NLJC 2XAHA 4JGSA 1SQBH 1NTKH 1COWG 5KAIZ 3FAVA 3C90A 5KUKA 4MTOA 1U97A 1OHHG 3ASOC 2B9ZA 4U3JA 1Z5VA 1D2DA 3J80N 2LO1A 4JV5O 5CA3A 5C8YA 3RVYA 3SPHA 4KHPB 2JK5C 1WPBA 2YS8A 4IHJA 3QO5A 2XASA 2ITDC 1JOYA 3JARA 1QLNA 1H8HG 4QNHB 3K03A 1T5EA 1N32B 1DLBA 4YHHO 4FM2A 1Y76A 4JI3B 1NKDA 2WLHA 4I9QA 1JMKC 4JI6O 4UVAA 2CH7B 1J5EB 2EJRA 4PDVA 1SQVH 5B1AC 2AGAA 3LUTB 1JJ2U 3D8CA 2C2AA 4WFEA 3T4DA 4X66B 4GYCB 4O4JA 4B3SB 4K0KB 2NR5A 1FJGO 5KHHA 2WWWA 1OZ0A 5JJNB 4R8CA 3SJAC 2GHYA 1S0VA 3JATA 2UUBO 5CB4A 3K5NA 1I94O 4JI0B 1BSMA 1QLEB 4YJ3A 3SJBC 3KKYA 1J5EO 2CGNA 5BMVA 2BSKB 3NXSA 1QBZA 1QNMA 1FFXB 1K5SA 1ORQC 4AQYO 1XNRO 2Q67A 3JALA 1E1QG 2R70A 2QM4A 1L1FA 3G67A 4DR1O 3EFFK 5KHIA 3B4SA 3CCEV 4PELA 3AG1C 4I50B 5JJJB 1GH6A 1HR0O 1DF4A 5KX5A 1X59A 4LF9B 4JF3A 1VP7A 4LFAO 2UXDB 1P49A 4DXWA 2P67A 4GCZA 3U11A 3F7VC 3ABKC 1NI8A 4PD4F 3P3PA 1KMIZ 5LYJA 1B3QA 3ZMVA 3JYCA 4BWAA 3BCCH 4IIJA 2Q7HA 2UUAO 3JCZA 4H0LB 1QQCA 3WU2Z 4K35A 4IHJB 2UUCB 4TOIA 4JI7O 3LDCA 1JPXA 2QTOA 4PDLA 3CX5F 4TQFA 1AVMA 1AP5A 1JFFB 4MVQA 3MAQA 1QVGU 4QE7A 5J2TA 2EZOA 1S3JA 1WAZA 4DW1A 1XOUA 2GBOA 3CC7V 2HEPA 2X6CA 3DC6A 2Y0PA 3T1YO 2Z3YA 2E76B 1FYJA 2DE0X 1I94B 2YXLA 3DXRA 1Y66A 5LMNO 2F23A 1IZ3A 3E22A 5JCOC 1QLEC 5LBQA 2Y4TA 2EIMC 4KUMA 3BY6A 1IDSA 2R9IA 4PDRA 5HFMA 4FFBB 3O65A 1KECA 2VWJA 1R6TA 2EIMB 4CS2A 2QEXV 3DGEA 4PHZA 1K92A 3EXAA 5LGNA 1IVSA 1TAEA 4JI3O 1NQTA 3L71H 3PN1A 4GKKO 3T1HB 1BGYH 2EILC 4QE9A 5DN6G 4G28B 2YC0A 2H3OA 4FLXA 1V55C 1YCIA 1VF6C 4JI7B 2IM9A 5EBMC 3BHPA 1SF9A 4PV1B 3SR2C 4JI5B 1MABG 4MVSA 4AI8A 2DYSB 3CRMA 2OCCC 1AI5A 2IW5A 3ZRSA 5H9CA 3RBZA 2P7TC 2DJVA 5IJ9B 1M5IA 1LR1A 1SERA 2JS3A 2YUAA 4FFKA 2RDCA 3RYFA 1X4TA 3K57A 3BEHA 2KG7B 3QF7A 2Z0AA 3B77A 3OTOO 4E2LA 4WBNA 3TXQA 4EB6B 3M99B 3AG1B 1HNXO 1VIBA 2UXXA 4MT8A 3KG2A 5D5QA 4U7NA 1H2MA 4FVMA 4JI1B 4X62B 1WB8A 3QO8A 3L75H 3ETGA 1MA1A 5A9GA 2CAZC 3CS5A 4DUYO 2ODMA 4X1KA 2WLIB 1Q6UA 2Y69C 3OAAG 4FZ0A 1FXKA 3CCRV 3N2GA 1QVFU 2ZD9A 4PA3A 1FXKB 2IU3A 2Y69B 1IX9A 1Q5OA 1NT2B 2CTQA 4FM0A 4NR1A 4HAMA 3B40A 4XDLA 3SJQC 5KMGB 4NXMB 4EFEA 4AQYB 1XNRB 1D5AA 3HPLC 1Y74A 2KG7A 3SPCA 1SKVA 2JGDB 4LF5B 4X1KB 4BIUA 2V4DA 3AEIA 3BRCA 5IWAB 4PJ0Z 5LOVA 3UT5B 4NTXA 3RYHB 1AJPA 2UXCO 4GX0A 3CMEV 1A32A 1P4RA 4YIPA 4TUYA 2UUCO 5KHKA 2QKAA 4G27B 4CS4A 2VWKA 1VQPV 4CC6A 4MTFA 2Q73A 4X64O 4X89A 2B5UA 4P2ZA 3ZMZA 4MS2A 3DC5A 4F6RA 2VQEB 4DV4B 1SQFA 1EN5A 2YIBA 3CC2V 4J9YB 3W7UA 1XDCA 3N2GB 4WBNB 1AROP 3GVMA 1NVPD 2LW1A 1WN7A 2YEVA 4X8AA 5CBGA 2OCCB 2Y48A 3LSSA 3I56V 3ZRWA 2WA3A 5L3CA 4JZ2A 3ZBHA 2OTJV 2IJHA 4O4IB 1IBMB 3SYOA 1KKCA 4H33A 2ADQB 4JYYA 2HG5C 2EIJC 2JJ1G 4DK0A 1YTFD 2ZINA 4JPRA 2YIBD 5IE9A 4DK1A 2P4VA 2VRZA 4UV9A 1EBOA 2LW7A 4WFGA 4DV6O 3OUFA 3A2FA 3CSXA 4R6ZA 4DR1B 1MMMA 1FFTB 1M57B 1Q8IA 4RAIA 1XNQO 1ZSPA 3EHBB 5EIBD 3HKCA 1TGOA 4TQDA 2YEVB 1AJNA 4NXNB 4ASUG 5EYPB 5CBHA 2DWEC 4JI1O 2IJIA 4TSFG 4LH6A 5EZYA 1BHAA 4ZI7B 4YJ2A 5GTIZ 2PYJA 2F43G 1Q7YW 2YIAA 3FYEB 3LDDA 1XUQA 3CJHA 3L70H 4QGPA 1GTOA 2UXCB 4FMTA 1D5NA 1KU9A 2HJFC 5FL7G 4U3JB 2WLMA 4FLVA 4CZZA 4I50A 4UVBA 1IXBA 3B8MA 1XREA 4ICGA 3OMNB 3CXCU 3SYCA 1XMOO 3DSQA 1XHXA 3ICXA 2Q5ZA 2XAGA 3SJCC 3ZX6A 3IC7A 4GX2A 4W4LA 1FXVA 4XDKA 1HNZB 3CC4V 1FXKC 2F4VB 5EIBC 4WFFA 3BA9A 5JQGA 2FL4A 4P9PA 3A0HZ 2UXNA 4TV8A 3K5MA 2HVKC 5LGUA 1P7BA 2G38A 4H37A 5C8YB 1CEZA 3OTOB 3NR7A 5LHIA 1IBKB 1SS3A 1AI6A 3T1CA 5H6QA 2RCVA 5LMUO 4R50A 3UKMA 5CMUA 3E83A 4FZ1A 3VQVA 2LGQA 4QPKA 2GUZA 2WLLA 4DRXB 2P6JA 3ZJZA 2JIZG 4O2AA 3TCUA 4P9OA 1W59A 2L35A 4FFBA 4JASA 1YSCA 4X1IB 2Q7GA 1OCOC 1GN6A 5IJ9A 1WP8A 4FIPC 2BSKA 1AR4A 4Q20A 2UU9B 1SZTA 5GONB 3D36A 2JJ2G 3H1KH 1YTFB 3P3NA 1U96A 4DV3O 2HHHO 4K8ZA 2WLLB 4AILC 1YJ9V 1URFA 1FPOA 2PI5A 3SGIA 3AG3B 2UUAB 4I55A 1AP6A 4O4IA 2LFRA 4FLUA 2XHBA 1HNWO 3F5WC 2EINB 2F4VO 1YIJV 4LFCO 4CH4A 1MZFA 1ZX3A 1QR9A 2QM7A 1FS0G 2V7QG 5FNVB 4DRXA 5L3FA 3J7AU 2KKWA 3K58A 3AG2C 1Q82W 4A5UB 2E74B 1IBLB 1NTZH 2L6LA 4JYAB 4JI0O 1Q6IA 1Q6HA 5DECA 1AR1B 1QHTA 1BT8A 4Z1VA 4ZOLB 1VQ6V 1OCRC 1KBHA 3BFRA 4DV5B 3E35A 5IY5C 1ZUQA 2IBZH 1NJIW 2ZE8A 3JD1A 2P06A 2YI8A 3JD2A 4JTAB 4CBCA 5LYJB 4RQEA 3ASNC 4KFMA 2RJZA 1G4YB 3HKEA 5LP6C 3CWBH 4OPHA 1GO3F 5H6RA 1CXZB 5KMGA 1K34A 2WA4A 1KYOF 1WNSA 2A79B 3OTFA 1K4CC 3ZS8C 1EZJA 3K04A 1KP2A 1SRYA 2YXYA 4UFZA 3RFRA 2ZNIA 4O4HA 1DK1A 4B3RB 1IURA 1VQ9V 4WFBV 1NU1H 3QG5A 3TK1A 4LFBO 2W0FC 1J95A 2X6AA 1SA0A 2D3OW 3ETQA 1TVKA 3S3XA 5EBWC 3TETA 1H38A 1VF6A 4WFHA 2ZE7A 4BIZA 2OTLV 1Y6XA 3I55V 1WA8A 1N33B 1HR0B 2K9PA 4EKWA 3HKCB 1SZXA 4R7CA 3SDLA 3M8AA 4QPJA 5KA6A 4DV3B 1O9HA 1B6QA 1VQKV 3WFVA 5HFLA 2PUSA 1N36B 2F95B 2JS5A 2QWOB 4P30A 4IL6Z 1SQGA 1XL6A 2JGUA 2OYQA 5FPOA 4ABMA 5IJ0A 2E3CA 2P4KA 4BIOA 2NNUA 4GLXA 4DR6O 4QJFB 2P22C 1IBKO 3P30A 1LNQA 5L3EA 1QCEA 2ADPA 1RM1B 1JA8A 1EZVH 4MVUA 3T2MA 1BMFG 3CB2A 1M93A 4PDMA 2LJ2A 2YDEA 4XDJA 4ZHQB 3MHSC 4PA9A 4LF7B 4B3RO 1XQ8A 2AHZA 2CK3G 1F23A 3RW0A 1AI4A 5JJEB 2CDYA 4JYBA 2QWNB 5J2UB 4B7EA 1L8DA 2DQ0A 4DUZO 4DR4B 1BHBA 5EBLC 3QVNA 4PA6A 1DGSA 1ENVA 3X2QB 1AI7A 4JI2B 5IYZA 3JASB 1Y67A 1VQMV 3LNMB 1THZA 5DM6V 3BA8A 2WLIA 2RN9A 2ZQMA 1MSDA 2EIKB 5TISZ 1MNGA 4B7KA 2B1IA 3E8GA 3E2EA 3CCQV 2Q69A 1M56B 1JJOA 5BZBA 5LGTA 5LA6A 3MDSA 4J11A 1VQ8V 3IGAC 3RYCB 3JAWA 3CD6V 2PTMA 1XBLA 3U10A 4JI4O 5JWPA 4GX1A 1US6A 1SQXH 1RM1C 1KB9F 4NYKA 4O4LB 1PNLA 2PZSA 1K4DC 4KL1A 5ITZA 1YITV 4DR2B 3R65A 4GKKB 2JEUA 1YF2A 1RPRA 2BTOA 2F1MA 4FJCC 1NBMG 2EILB 2BE3A 3EVKA 3THOA 1M56C 2XT9A 1MOFA 1AILA 4UVCA 3OR6C 1AJQA 2DOSA 2WLKA 1UPGA 4OX9O 2M7WA 1V54B 1TUBB 4I4TA 2QTSA 4J7JA 4MW3A 4HNAB 4OXSA 4YJ2B 4ZI7A 2B1GA 2ZDIA 2CE4A 3SPGA 3BABA 2R9RB 4TV9B 2X0LA 4DR5B 2QGNA 2BTQA 5B3SB 2ZNJA 3ZMUA 1JX9A 4LCUC 1VQOV 3A8TA 4FM1A 3A0RA 2MK3A 4MVZA 1PL0A 3MHHC 4H44B 2VQFB 2EULA 3OEHG 4Q6GA 4D7TA 4FLYA 4DV5O 3LDEA 3VBBA 1XMOB 3ABLC 1SQPH 4I4TB 4LF6O 1XHZA 2O57A 4B3TO 2YIDA 1XL4A 1F4MA 1OCZC 4KXRA 3H1IH 5L3BA 1VQLV 2DMXA 4O4JB 2Z5UA 4BR6A 3CCUV 4C7UA 3JATB 2Q0AA 4LF5O 2VQFO 3G80A 1P84F 1FAFA 3AG4C 2E5LB 3S3WA 2GSMB 1K33A 4IYIA 4NXMO 4NB5A 1BL8A 1IBLO 1GK9A 2ZXWB 3OGIB 3T4ZA 1FD9A 4TT3G 4DV7O 1K3EA 1KD1W 1Q43A 2ZKOA 3K0GA 1OCZB 5BXZA 2N05A 4YY3B 4O2BB 2QE7G 4U3FH 2FYUH 1JFFA 2QKCA 4LR3A 4J9ZB 3ZRWB 3LNNA 3E89A 4X65B 5B1AB 1SA0B 2GTAA 1YHQV 4DV2B 3E8BA 4RUEA 2CH7A 1PKXA 4LFCB 3UCSC 1Z5WA 2LGWA 1S76D 1ZTEA 4E4EA 2JRIA 5B1OA 1HNXB 4MTXA 5IYDO 2XOKG 3FAVB 2EZPA 1YVWA 1R3JC 3WB2A 3ETEA 1NZ6A 1KP3A 1N4CA 4YIOA 1L0NH 1S5JA 3CRRA 3TXSA 3ZRXA 3H1HH 2CTRA 2UUBB 2ZM6B 2KQXA 3CEIA 3JD3A 3X2QC 1ZL8A 2W6IG 2XAFA 3CPWU 1G1XB 1I7FA 2YXHA 3HKBA 4UCSA 3JAKA 3CRAA 3UQ8A 2N04A 3ASOB 3FX7A 3N27A 2A9HA 2W6JG 3ZHRA 4Z2WA 4JI5O 2Y4UA 5EC2C 2A06H 3AG4B 3QTCA 4WF9V 4LH7A 2W0XA 3L9DA 3GWKC 1N34B 1ZWIC 2ZIMA 2E75B 5BY1A 5D5PA 4FPPA 3STLC 4DR3B 2WLJA 3BVOA 1NTMH 3RYIA 5IWAO 1H2SB 4LWSB 5IDJA 2P90A 3OGCC 1KKDA 1HNWB 4MVRA 3WB0A 2E5LO 4DR7B 4RUFA 3E86A 1K7DA 4UB8Z 1GAXA 3KCYA 3W7SA 1I5XA 1TVKB 4ZIBA 2OWOA 4X20A 3D36C 4NVPA 4X1IA 1K97A 3U0ZA 4FLTA 2ZE5A 4IYHA 2ZCEA 4YHHB 3FD9A 1EN4A 1CPYA 2DYSC 3W7WA 3KZIZ 5KA5A 4KHPO 1V55B 4GUNA 4UCTA 3K59A 4K3AA 1YJNV 5KAFZ 4JI8O 4HBNA 5CN0A 2YSUB 2AZ2A 4UB6Z 3FB5C 1OCCC 4UCUA 3FKSG 5IT9N 1HWYA 4XBFA 3OMIB 3VQWA 4JI6B 2D2CB 4Z1MG 2DW4A 2GV9A 3N2KA 1IBMO 2UXBO 3K9AA 3QNEA 2N74A 3GB7C 4J80A 5E1AC 5GW7A 3L74H 4JYCA 4EFBA 2QWRB 2CTPA 1EN6A 4CH5A 4DV7B 1SESA 4DV4O 1GM7A 2WLNA 4LFAB 2ATKC 5A2QN 1S5HC 3APOA 4H13B 1WLEA 3N2KB 4UCRA 3ZHQA 1DTOA 3K5LA 3LSUA 1TUEB 4GKJO 1VQ5V 3RT3C 2ZR3A 3VQYA 2A3QA 1WB7A 5GTHZ 1R3LC 3C3SA 1Z2GA 4ZBMA 1WP7A 4FK5C 3Q4HA 2WAMA 3CCVV 1H2NA 5BMVB 2ZT9B 1S5LZ 2LFSA 1P7GA 1Y74B 3B09A 3T1YB 3K9SA 4CH3A 2JVDA 3JALB 4GKJB 5KHGA 4J42A 5F2VO 4X66O 4K0KO 2EINC 5L3DA 4GT1A 3LSQA 3L73H 3TJTA 5K1XA 5LP6A 4LF7O 2X7RB 5CA1A 1HP8A 3ZHTA
chains in the Genus database with same CATH topology
3MHSC 3FB7C 2LP7A 2BOCC 2IJKA 4PA9A 3RVZA 3FB8C 3D3IA 2AHZA 2CK3G 3ZIAG 1F23A 5B1BC 3RW0A 2WLIB 1AI4A 3FB6C 3PJSK 1YJWV 3ABMB 1JVMA 4JYBA 1IXMA 2DQ0A 2Y69C 3OAAG 2HFEC 1FXKA 3CCRV 1QVFU 2ZD9A 4PA3A 1FXKB 2IU3A 2Y69B 1BHBA 5EBLC 4PA6A 1ENVA 1M57C 3ML0A 1AI7A 3X2QB 2X6BA 3G6EV 4HAMA 2QKSA 1NH2D 4XDLA 3SJQC 2QA4V 1FXHA 1VQMV 3LNMB 4JAUA 1THZA 3SPIA 5DM6V 2WLIA 4I5SA 3HPLC 2HLDG 3QO7A 4U7OA 3SPCA 4BW5A 1M90W 3H01A 2ZQMA 3DTUB 3ABLB 3K0DA 2EIKB 4BIUA 3AEIA 2Q6AA 4TWKA 3ASNB 2A0LA 4DO2A 1F4NA 1AJPA 2B1IA 3E8GA 3E2EA 3CCQV 4GX0A 2Q69A 1W2BU 1M56B 2JEXA 3CMEV 1PNMA 5BZBA 1H2GA 2OT5A 1P4RA 2H8PC 5LGTA 4N21A 2IU0A 2K1EA 1VQ8V 4RQFA 2WPDG 4G27B 3IGAC 4GX5A 4WCEV 1VQPV 1JCHA 1NR1A 2WSSG 4MTFA 4MVOA 3CD6V 4X89A 4MSWC 2B5UA 4GX1A 4P2ZA 3ZMZA 4MS2A 3ABUA 4LBEC 3B8NA 1RM1C 3ABKB 1N8RW 3CC2V 4J9YB 3W7UA 1PNLA 1K4DC 1YITV 4MW8A 2IH3C 3OMAB 1AROP 3R65A 1NVPD 3G4SV 2JEUA 4MTGA 3K06A 1RPRA 3SYAA 1EFRG 2XNDG 2YEVA 3OFNG 4X8AA 2OCCB 5CBGA 1S77D 2Y48A 3LSSA 4FJCC 3ZN0A 3I56V 1NBMG 2EILB 4X88A 3ZRWA 3OM3B 1VQ4V 5IYCO 5L3CA 2DYRC 1NH2B 1M56C 2OTJV 2IJHA 3OEEG 1MOFA 2HVJC 5B1BB 4UVCA 3OR6C 3OE7G 1AJQA 2WLKA 4H33A 3SYOA 2M7WA 2HG5C 1V54B 2EIJC 2JJ1G 4MW3A 1YTFD 4JPRA 4UV8A 4OXSA 1S72V 2B1GA 2ZDIA 1VQ7V 3SPGA 2R9RB 4UV9A 2X0LA 2EIJB 3G71V 1EBOA 5EK0A 4WFGA 3F7YC 2HKOA 3OUFA 5B3SB 4R6ZA 3ZMUA 1JX9A 4YXWG 1FFTB 1M57B 4RAIA 2ITCC 2QM8A 3SPJA 3W7TA 4LCUC 1VQOV 3ZMTA 3EHBB 3A0RA 2MK3A 4MVZA 2FTKA 1PL0A 2YEVB 3GWOA 3MHHC 1QR8A 2HR3A 4HZ3A 1SETA 1AJNA 4QIWF 1CP9A 1W0KG 2AHYA 3JD0A 2DQ3A 3OEHG 4ASUG 1Y4MA 1R6NA 1R3IC 2IJJA 3ABLC 3LDEA 3VBBA 5CBHA 1NVPB 2DWEC 2IJIA 1E79G 4TSFG 1BHAA 4PA4A 2F43G 3CP1A 2ZXWC 1Q7YW 3FYEB 3LDDA 1I5YA 3UM7A 1XL4A 3OW2U 1F4MA 1OCZC 5B1NA 2Q68A 2NLJC 4I9WA 2XAHA 4JGSA 3ZRVA 1GTOA 5L3BA 1VQLV 4FMTA 2HJFC 1COWG 1Q81W 4MVMA 3K79A 1PNKA 2Z5UA 5FL7G 4MTOA 2WLMA 5KUKA 1K9MW 3WG7B 3CCUV 1OHHG 3ASOC 4CZZA 1DF5A 1E1RG 3E8FA 4UVBA 3B8MA 3CXCU 3OMNB 3SYCA 1JQ0A 4KP4A 3AG4C 2XAGA 5CA3A 3IC7A 4GX2A 3RVYA 2V1DA 3W7XA 1FXVA 3SPHA 2JK5C 4XDKA 4LC1A 3CC4V 2GSMB 1K33A 1FXKC 3QO5A 1H8EG 2XASA 4WFFA 3K3WA 2ITDC 3E8HA 1JOYA 1BL8A 1GK9A 3ABTA 2ZXWB 3T4ZA 1QLNA 1OCCB 4P9PA 1H8HG 4TT3G 4QNHB 1K3EA 4PA7A 1KD1W 3K03A 3ZN1A 3K0GA 1OCZB 2UXNA 3FYIB 1DLBA 2QE7G 1ROPA 3CCSV 1NKDA 2WLHA 2HVKC 5LGUA 1P7BA 4J9ZB 4UVAA 3ZRWB 3E89A 5B1AB 1YHQV 4H37A 3E8BA 4RUEA 1CEZA 2EJRA 1PKXA 4PDVA 1KQSU 5B1AC 5LHIA 1S76D 3LUTB 1JJ2U 5B1OA 1AI6A 2C2AA 3K08A 4MTXA 5H6QA 3T1CA 4WFEA 5IYDO 2XOKG 3T4DA 2EZPA 4R50A 3UKMA 2WWWA 1R3JC 5CMUA 1OZ0A 3E83A 3ETEA 4R8CA 1R6KA 2GHYA 1KP3A 2DYRB 1S0VA 1R73A 4QPKA 4JAVA 2WLLA 3ZRXA 2P6JA 3ZJZA 2JIZG 4UUJC 1QLEB 3TCUA 3CCLV 4P9OA 4JASA 1YSCA 2XAQA 3JD3A 1OCOC 4FIPC 3X2QC 2W6IG 4Q20A 2XAFA 3CPWU 3NXSA 1QBZA 1SZTA 3D36A 1OCOB 2JJ2G 5KUMA 1GMGA 1K73W 4RO2A 1K5SA 1GKFA 1ORQC 2Q67A 5LHHA 1E1QG 3ASOB 1YTFB 4JTDB 2A9HA 2W6JG 2WLLB 5EC2C 1L1FA 3AG4B 1YJ9V 4WF9V 1ZWIC 3EFFK 2PI5A 3CCEV 4PELA 3AG3B 3AG1C 1KC8W 4FPPA 4LP8A 3STLC 2WLJA 1DF4A 2LFRA 1OCRB 4ZKIA 2EIKC 4JF3A 3F5WC 4UXNA 5IY5B 2EINB 1F51A 1YIJV 4DXWA 5IDJA 2P67A 2P90A 3OGCC 4GCZA 3WG7C 1KKDA 1QR9A 3F7VC 4G2KA 3CMAV 2QM7A 4MVRA 1FS0G 2V7QG 1NR7A 3ABKC 4RUFA 1PD3A 1GM8A 5L3FA 3E86A 1K7DA 3ZMVA 3JYCA 1Q82W 3AG2C 3CCJV 5C93A 3W7SA 1I5XA 1MG1A 3JCZA 2BOBC 1K97A 1AR1B 5J9PC 1UJWB 1YI2V 3ETDA 1CPYA 2DYSC 3W7WA 3LDCA 1VQ6V 5KA5A 1JPXA 1OCRC 1VQNV 1V55B 2QTOA 4PDLA 3P32A 3E35A 5IY5C 1YJNV 3CCMV 2ZR2A 4MVQA 1QVGU 4QE7A 1NJIW 3JD1A 1M1KW 2EZOA 1S3JA 4JTAB 4CBCA 3JD2A 2ZDIC 3SYQA 4RQEA 3ASNC 5CN0A 2YSUB 4KFMA 3FB5C 1OCCC 1V54C 1G4YB 3JD4A 3FKSG 3CC7V 3MD0A 1HWYA 4XBFA 1GO3F 3OMIB 2X6CA 2Z3YA 5H6RA 1K34A 4Z1MG 4HYOA 2A79B 2DW4A 1Y66A 1K4CC 3CYOA 2JDIG 1EZJA 1QLEC 5LBQA 2PI4A 3K04A 2EBOA 3K9AA 4PDRA 2EIMC 3BY6A 3QNEA 1KP2A 2R9IA 4KUMA 1SRYA 3STZC 3GB7C 5HFMA 5E1AC 5GW7A 1KECA 4JYCA 3OR7C 1VQ9V 2IH1C 2EIMB 4WFBV 3OUSA 3TK1A 2W0FC 1J95A 2X6AA 1K8AW 1SESA 2D3OW 5EC1C 2QEXV 3DGEA 1K92A 1GM7A 2WLNA 5EBWC 3TETA 1H38A 5LGNA 3ZMSA 4WFHA 2ATKC 4BIZA 2OTLV 1S5HC 1NQTA 1WLEA 3I55V 2EILC 2H94A 1DTOA 4QE9A 4G28B 5DN6G 1RPOA 1G8MA 1TUEB 1VQ5V 4F4LA 2ZR3A 4BAYA 1V55C 3AG2B 1GM9A 4EKWA 5EBMC 4R7CA 1Q86W 2KB1A 3ZCCA 1R3LC 4QPJA 5KA6A 1MABG 4MVSA 4WFAV 1B6QA 3SYPA 1VQKV 5B3SC 3WFVA 1MSWD 5HFLA 4ZBMA 2DYSB 4FK5C 2OCCC 1AI5A 2IW5A 3ZRSA 5H9CA 2P7TC 3RBZA 3CCVV 2WAMA 3ABMC 5IYBO 2XAJA 4P30A 4N23A 1XL6A 1SERA 1W0JG 3HB3B 2LFSA 1K5QA 1M9NA 3BEHA 3B77A 2NNUA 4E2LA 1WPXA 2DWDC 5L3GA 3M99B 3AG1B 1R3KC 3AG3C 4QJFB 4JTCB 3P30A 1LNQA 3IFXA 5L3EA 1QCEA 4L87A 1RM1B 2UXXA 2EINC 4MT8A 3KG2A 5L3DA 4GT1A 3LSQA 4MVUA 4U7NA 3T2MA 1BMFG 5LHGA 3QO8A 2X7RB 3VOUA 5CBFA 4PDMA 4XDJA 3ETGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E83 A;  3FB7 C;  4R8C A;  2BOC C;  4CBC A;  3SPG A;  3SYQ A;  2R9R B;  3ASN C;  4PA9 A;  3RVZ A;  3FB8 C;  4KFM A;  3FB5 C;  1OCC C;  5EK0 A;  4WFG A;  1V54 C;  2AHZ A;  3F7Y C;  1G4Y B;  3OUF A;  5B1B C;  3RW0 A;  2WLI B;  2WLL A;  3ZJZ A;  4R6Z A;  4UUJ C;  2X6C A;  3FB6 C;  3PJS K;  4RAI A;  2ITC C;  3TCU A;  1JVM A;  4P9O A;  3SPJ A;  4LCU C;  2Y69 C;  1OCO C;  4MVZ A;  4HZ3 A;  2HFE C;  3X2Q C;  4HYO A;  2A79 B;  2AHY A;  2ZD9 A;  4PA3 A;  1K4C C;  3LDE A;  1R3I C;  5CBH A;  3ABL C;  3UKM A;  2DWE C;  5KUM A;  5EBL C;  4PA6 A;  1QLE C;  4RO2 A;  3K04 A;  4PA4 A;  4PDR A;  2EIM C;  1ORQ C;  3STZ C;  1M57 C;  2Q67 A;  3GB7 C;  2X6B A;  2ZXW C;  3LDD A;  2QKS A;  4JTD B;  4XDJ A;  5E1A C;  3UM7 A;  4XDL A;  2A9H A;  3SJQ C;  1XL4 A;  3LNM B;  1OCZ C;  3OR7 C;  3SPI A;  2Q68 A;  2IH1 C;  3OUS A;  2NLJ C;  2WLL B;  2WLI A;  3HPL C;  4I9W A;  5EC2 C;  2W0F C;  1J95 A;  3SPC A;  4BW5 A;  2HJF C;  3K0D A;  2X6A A;  4MVM A;  1ZWI C;  3EFF K;  5KUK A;  4MTO A;  2WLM A;  5EC1 C;  2Q6A A;  2WLN A;  3AG1 C;  4TWK A;  5EBW C;  2A0L A;  3TET A;  4LP8 A;  3STL C;  4WFH A;  2ATK C;  3ASO C;  3E8G A;  1S5H C;  2WLJ A;  4GX0 A;  2Q69 A;  3E8F A;  2EIK C;  2EIL C;  5BZB A;  4QE9 A;  3F5W C;  4G28 B;  3SYC A;  2H8P C;  3AG4 C;  4F4L A;  1V55 C;  2K1E A;  4DXW A;  4GX2 A;  3RVY A;  3OGC C;  3WG7 C;  4EKW A;  3SPH A;  1KKD A;  2JK5 C;  3IGA C;  4G27 B;  3F7V C;  4GX5 A;  4R7C A;  4XDK A;  5EBM C;  2KB1 A;  4MVR A;  4MTF A;  4MVO A;  1R3L C;  3ABK C;  4RUF A;  4X89 A;  4MSW C;  4MVS A;  4WFF A;  2ITD C;  3E8H A;  3SYP A;  3E86 A;  5B3S C;  1BL8 A;  4GX1 A;  4P2Z A;  4MS2 A;  4ZBM A;  3T4Z A;  2OCC C;  4P9P A;  3JYC A;  3ZRS A;  4QNH B;  4PA7 A;  2P7T C;  4LBE C;  3RBZ A;  3ABM C;  3AG2 C;  3K03 A;  3K0G A;  4P30 A;  4J9Y B;  1XL6 A;  1K4D C;  4MW8 A;  2IH3 C;  2WLH A;  2HVK C;  3R65 A;  2BOB C;  1P7B A;  3BEH A;  4MTG A;  3K06 A;  4J9Z B;  3E89 A;  3SYA A;  2YEV A;  4X8A A;  5J9P C;  5CBG A;  2DWD C;  2DYS C;  4H37 A;  3AG3 C;  1R3K C;  3E8B A;  4RUE A;  4X88 A;  3LDC A;  4JTC B;  4PDV A;  2DYR C;  1OCR C;  1LNQ A;  3IFX A;  1M56 C;  2EIN C;  2HVJ C;  2QTO A;  3KG2 A;  3OR6 C;  4PDL A;  5B1A C;  4MVU A;  5IY5 C;  2WLK A;  3SYO A;  4H33 A;  3LUT B;  3T2M A;  2HG5 C;  3K08 A;  3T1C A;  2EIJ C;  3VOU A;  4MW3 A;  4WFE A;  5CBF A;  4PDM A;  3T4D A;  4MVQ A;  4OXS A;  4QE7 A;  4R50 A;  1R3J C;  4JTA B; 
#chains in the Genus database with same CATH topology
 4OX9 B;  2LP7 A;  2BOC C;  3KCX A;  2IJK A;  3RVZ A;  5FPR A;  1N32 O;  1V9P A;  2A7W A;  1GN4 A;  2PGG A;  3PJS K;  3IAY A;  3RN4 A;  4DV1 B;  4DR6 B;  5LMN B;  1RP3 B;  3AK2 A;  1AB3 A;  3G6B A;  4O2B A;  1B06 A;  2MW2 B;  1GRJ A;  4FLZ A;  3AK1 A;  1M57 C;  3ML0 A;  3G6E V;  3JCU Z;  2LQT A;  2QA4 V;  3H9V A;  1R1B A;  2OCH A;  4X20 B;  5B66 Z;  5IJ0 B;  3QO7 A;  4BW5 A;  3H01 A;  3DTU B;  3K0D A;  4J7Z A;  2QWQ B;  4J41 A;  4HNA A;  1BE3 H;  2BTQ B;  3HKD A;  4TWK A;  4DO2 A;  4UCO A;  3CE2 A;  1W2B U;  1H2G A;  1BZK A;  2H8P C;  4N21 A;  5CA1 B;  4YJ3 B;  1AR5 A;  4RQF A;  2WPD G;  1NR1 A;  2WSS G;  3HKE B;  4AHC A;  4MSW C;  1PM9 A;  1TUB A;  5LMU B;  4CH6 A;  5AG2 A;  3M7M X;  4LBE C;  3UO3 A;  3B8N A;  2JGD A;  3JAM N;  4DV2 O;  2IH3 C;  3OMA B;  4X9Q A;  1QU7 A;  3SYA A;  1EFR G;  1GN3 A;  2XND G;  3JSN A;  3ZN0 A;  1SQQ H;  5IYC O;  2DYR C;  4X65 O;  3OE7 G;  3RYI B;  3ZHV A;  4FLW A;  3JAR B;  2EIJ B;  5EK0 A;  3F7Y C;  2EJ7 A;  5JQG B;  2AXT Z;  4YXW G;  2GUZ B;  1PL4 A;  5CB4 B;  3SPJ A;  3W7T A;  3ZMT A;  2FTK A;  4HZ3 A;  1QR8 A;  2HR3 A;  4PI0 A;  1SET A;  1CP9 A;  2AHY A;  3JD0 A;  3H1L H;  4ZHQ A;  1VEW A;  5LA6 B;  2RMK B;  1Y4M A;  3C3T A;  1R3I C;  1JR9 A;  2IJJ A;  1E79 G;  1HNZ O;  2RQ6 A;  3UM7 A;  3H1J H;  5BR8 O;  2Q68 A;  1RSO B;  2GDS A;  4I9W A;  2Q9L A;  3ZRV A;  2QR4 A;  1VF7 A;  1Q81 W;  4MVM A;  3K79 A;  1VMG A;  1PNK A;  3O9O A;  4TV8 B;  1Y76 B;  1K9M W;  3WG7 B;  2ZM6 O;  4NTW A;  3IJ4 A;  2PYL A;  5KHJ A;  1VF5 B;  1EM1 A;  1DF5 A;  1E1R G;  4NXN O;  3E8F A;  5LXT B;  1JQ0 A;  4KP4 A;  1BCC H;  3AK3 A;  2BCC H;  3JAW B;  3W7X A;  2V1D A;  2HP8 A;  4LC1 A;  4OPA A;  4JAA A;  4F6E A;  2UXD O;  1HW7 A;  2CUG A;  1XEQ A;  3R66 A;  1N36 O;  1H8E G;  5JVD B;  3K3W A;  3E8H A;  4DW0 A;  4TV9 A;  4LFB B;  1HDJ A;  3JAK B;  3ABT A;  1OCC B;  4LF4 O;  4PA7 A;  1YEW A;  3ZN1 A;  3FYI B;  1ROP A;  3CHX A;  3CCS V;  5DED A;  5JCO A;  1GN2 A;  3B2E E;  3BAA A;  4RWU A;  4LF9 O;  3L72 H;  4JV5 B;  1KQS U;  1FFX A;  2FKX A;  3K08 A;  3HKB B;  4JI4 B;  3DXR B;  1PV0 A;  3UT5 A;  1XMQ O;  1R6K A;  2DYR B;  2R72 A;  1R73 A;  4JAV A;  2PY5 A;  4B3S O;  1FJG B;  4UUJ C;  3CCL V;  1YDX A;  3JSL A;  2XTA A;  2XAQ A;  4I0X B;  4W4K A;  3Q4H B;  4GZR B;  4EEQ A;  1OCO B;  5KUM A;  1GMG A;  1K73 W;  4RO2 A;  1GKF A;  5LHH A;  1SC5 B;  5JVD A;  4JTD B;  3RWR D;  3CRQ A;  4DV0 O;  3K5O A;  4NKG B;  3WB1 A;  4IIJ B;  1KC8 W;  2QJ1 A;  4LP8 A;  1ZL8 B;  4ZKI A;  1OCR B;  4DR2 O;  2EIK C;  4UXN A;  4JZG A;  5IY5 B;  5KLV H;  2EX3 A;  1F51 A;  5J2U A;  3F5T A;  2DN9 A;  3WG7 C;  5JH7 B;  4G2K A;  2ZIO A;  1N0J A;  1NR7 A;  1PD3 A;  1GM8 A;  4B3M B;  4X62 O;  4LNU A;  1N34 O;  2Q7E A;  1BQ0 A;  4I0X A;  3CCJ V;  5C93 A;  1MG1 A;  3CXH F;  4DV6 B;  1H2L A;  2Y0I A;  2BOB C;  2QDO A;  5J9P C;  1UJW B;  3RYF B;  3ETD A;  1YI2 V;  3APQ A;  3OT7 A;  1FKA O;  1TA8 A;  1VQN V;  4EB6 A;  2UU9 O;  3P32 A;  1LUW A;  2HJD A;  3CCM V;  2QWP B;  1ZLZ A;  2ZR2 A;  1M1K W;  5FLX N;  5LP6 B;  5CA0 A;  2ZDI C;  3SYQ A;  3J81 N;  4I55 B;  1H2K A;  1V54 C;  3JD4 A;  3UO2 A;  3MD0 A;  4UCV A;  3JAS A;  4NTY A;  4OGQ B;  4LWS A;  5H5N A;  1G6U A;  4HYO A;  2YI9 A;  2XUM A;  3E22 B;  2R9A A;  3T1H O;  4DV1 O;  3CYO A;  2JDI G;  3AG7 A;  5LOV B;  5LL6 Y;  2PI4 A;  2EBO A;  2RNB A;  3STZ C;  2PF4 E;  3OD4 A;  4O2A B;  5FNV A;  1PPJ H;  2FML A;  2NN4 A;  1PP9 H;  4DR7 O;  4B3M O;  3OR7 C;  2IH1 C;  3OUS A;  3VQX A;  4B08 A;  1K8A W;  5GON A;  5EC1 C;  2VS0 A;  4YY3 O;  2Q4P A;  3ZMS A;  2H94 A;  1BQZ A;  1RPO A;  4LF6 B;  1G8M A;  2KSD A;  4D6T H;  4F4L A;  4BAY A;  3AG2 B;  5B5E Z;  1GM9 A;  3ZHS A;  2AW9 A;  4B3T B;  1Q86 W;  2KB1 A;  3ZCC A;  4CC5 A;  3A0B Z;  1L0L H;  4WFA V;  5IYZ B;  5J2T B;  1OJH A;  3SYP A;  4O4H B;  5B3S C;  4X1Y B;  1MSW D;  2P5O A;  5KX5 B;  4LF8 B;  5IYB O;  2ARH A;  1I0H A;  2XAJ A;  3ABM C;  4N23 A;  5K1P A;  1W0J G;  3HB3 B;  1K5Q A;  1M9N A;  4CS3 A;  1XNQ B;  4ZOL A;  4LNU B;  1WPX A;  2DWD C;  5L3G A;  1N33 O;  4JYA O;  3AG3 C;  1R3K C;  3FFQ A;  4JTC B;  1LUV A;  3IFX A;  4TUY B;  4L87 A;  3HR0 A;  4L8J A;  5LXT A;  5H2F Z;  5LHG A;  3VOU A;  5CBF A;  3IC9 A;  4BW9 A;  3CMA V;  1XIL A;  3FB7 C;  2QSA A;  3ZHU A;  3FB8 C;  1M4U A;  3D3I A;  2F93 B;  4J7K A;  3ZIA G;  5B1B C;  2Q8V A;  3FB6 C;  1Q3E A;  1YJW V;  3ABM B;  1JVM A;  4DUY B;  1Q90 D;  2ZE6 A;  4DR5 O;  1IXM A;  3CJH B;  2HFE C;  2OIG A;  2UXB B;  4O4L A;  5CA0 B;  2ILM A;  4DR4 O;  5EYP A;  2HHH B;  1F7Y A;  2X6B A;  1UFI A;  2QKS A;  4PI2 A;  1NH2 D;  2YIC A;  4X1Y A;  3RGB A;  1FXH A;  2M6Y A;  3RYC A;  4JAU A;  1OV9 A;  1BS3 A;  3SPI A;  4I5S A;  4U7O A;  2HLD G;  1O9G A;  1M90 W;  2FB5 A;  4LF4 B;  3ABL B;  2VQE O;  4DV0 B;  4LF8 O;  3TGU H;  2Q6A A;  3ASN B;  2A0L A;  1F4N A;  3HKD B;  2JEX A;  1PNM A;  1YXB A;  2OT5 A;  2IU0 A;  2K1E A;  1I08 A;  4GX5 A;  4WCE V;  4JI2 O;  1JCH A;  4MVO A;  5BR8 B;  3I5D A;  2ETN A;  4JI8 B;  5EZY B;  4K8X A;  1RFY A;  1WA8 B;  3ABU A;  4X64 B;  5E79 Z;  3ABK B;  1N8R W;  2F66 C;  3BPZ A;  1B04 A;  1NS1 A;  4DR3 O;  4MW8 A;  3G4S V;  4MTG A;  2CGO A;  3K06 A;  1XI1 A;  2AZ0 A;  3OFN G;  1S77 D;  2Q0O C;  1YZB A;  4X88 A;  3OM3 B;  1VQ4 V;  1NH2 B;  4DUZ B;  1VAR A;  3OEE G;  2HVJ C;  5B1B B;  1XMQ B;  1N0N A;  2CTW A;  4UV8 A;  4J10 A;  1S72 V;  1VQ7 V;  1RSO A;  3D3Q A;  3RYH A;  1KUQ A;  5JH7 A;  1ZAU A;  2GTS A;  4F6R B;  3G71 V;  1MZE A;  4D7S A;  4I7Z B;  2HKO A;  3ZED A;  5ITZ B;  2ITC C;  2QM8 A;  4IT5 A;  3CRC A;  3GWO A;  4QIW F;  1W0K G;  2DQ3 A;  4DYL A;  1R6N A;  1NVP B;  1WJZ A;  4PA4 A;  3CP1 A;  2OIE A;  2ZXW C;  1I5Y A;  4IGG A;  3OW2 U;  5B1N A;  2NLJ C;  2XAH A;  4JGS A;  1SQB H;  1NTK H;  1COW G;  5KAI Z;  3FAV A;  3C90 A;  5KUK A;  4MTO A;  1U97 A;  1OHH G;  3ASO C;  2B9Z A;  4U3J A;  1Z5V A;  1D2D A;  3J80 N;  2LO1 A;  4JV5 O;  5CA3 A;  5C8Y A;  3RVY A;  3SPH A;  4KHP B;  2JK5 C;  1WPB A;  2YS8 A;  4IHJ A;  3QO5 A;  2XAS A;  2ITD C;  1JOY A;  3JAR A;  1QLN A;  1H8H G;  4QNH B;  3K03 A;  1T5E A;  1N32 B;  1DLB A;  4YHH O;  4FM2 A;  1Y76 A;  4JI3 B;  1NKD A;  2WLH A;  4I9Q A;  1JMK C;  4JI6 O;  4UVA A;  2CH7 B;  1J5E B;  2EJR A;  4PDV A;  1SQV H;  5B1A C;  2AGA A;  3LUT B;  1JJ2 U;  3D8C A;  2C2A A;  4WFE A;  3T4D A;  4X66 B;  4GYC B;  4O4J A;  4B3S B;  4K0K B;  2NR5 A;  1FJG O;  5KHH A;  2WWW A;  1OZ0 A;  5JJN B;  4R8C A;  3SJA C;  2GHY A;  1S0V A;  3JAT A;  2UUB O;  5CB4 A;  3K5N A;  1I94 O;  4JI0 B;  1BSM A;  1QLE B;  4YJ3 A;  3SJB C;  3KKY A;  1J5E O;  2CGN A;  5BMV A;  2BSK B;  3NXS A;  1QBZ A;  1QNM A;  1FFX B;  1K5S A;  1ORQ C;  4AQY O;  1XNR O;  2Q67 A;  3JAL A;  1E1Q G;  2R70 A;  2QM4 A;  1L1F A;  3G67 A;  4DR1 O;  3EFF K;  5KHI A;  3B4S A;  3CCE V;  4PEL A;  3AG1 C;  4I50 B;  5JJJ B;  1GH6 A;  1HR0 O;  1DF4 A;  5KX5 A;  1X59 A;  4LF9 B;  4JF3 A;  1VP7 A;  4LFA O;  2UXD B;  1P49 A;  4DXW A;  2P67 A;  4GCZ A;  3U11 A;  3F7V C;  3ABK C;  1NI8 A;  4PD4 F;  3P3P A;  1KMI Z;  5LYJ A;  1B3Q A;  3ZMV A;  3JYC A;  4BWA A;  3BCC H;  4IIJ A;  2Q7H A;  2UUA O;  3JCZ A;  4H0L B;  1QQC A;  3WU2 Z;  4K35 A;  4IHJ B;  2UUC B;  4TOI A;  4JI7 O;  3LDC A;  1JPX A;  2QTO A;  4PDL A;  3CX5 F;  4TQF A;  1AVM A;  1AP5 A;  1JFF B;  4MVQ A;  3MAQ A;  1QVG U;  4QE7 A;  5J2T A;  2EZO A;  1S3J A;  1WAZ A;  4DW1 A;  1XOU A;  2GBO A;  3CC7 V;  2HEP A;  2X6C A;  3DC6 A;  2Y0P A;  3T1Y O;  2Z3Y A;  2E76 B;  1FYJ A;  2DE0 X;  1I94 B;  2YXL A;  3DXR A;  1Y66 A;  5LMN O;  2F23 A;  1IZ3 A;  3E22 A;  5JCO C;  1QLE C;  5LBQ A;  2Y4T A;  2EIM C;  4KUM A;  3BY6 A;  1IDS A;  2R9I A;  4PDR A;  5HFM A;  4FFB B;  3O65 A;  1KEC A;  2VWJ A;  1R6T A;  2EIM B;  4CS2 A;  2QEX V;  3DGE A;  4PHZ A;  1K92 A;  3EXA A;  5LGN A;  1IVS A;  1TAE A;  4JI3 O;  1NQT A;  3L71 H;  3PN1 A;  4GKK O;  3T1H B;  1BGY H;  2EIL C;  4QE9 A;  5DN6 G;  4G28 B;  2YC0 A;  2H3O A;  4FLX A;  1V55 C;  1YCI A;  1VF6 C;  4JI7 B;  2IM9 A;  5EBM C;  3BHP A;  1SF9 A;  4PV1 B;  3SR2 C;  4JI5 B;  1MAB G;  4MVS A;  4AI8 A;  2DYS B;  3CRM A;  2OCC C;  1AI5 A;  2IW5 A;  3ZRS A;  5H9C A;  3RBZ A;  2P7T C;  2DJV A;  5IJ9 B;  1M5I A;  1LR1 A;  1SER A;  2JS3 A;  2YUA A;  4FFK A;  2RDC A;  3RYF A;  1X4T A;  3K57 A;  3BEH A;  2KG7 B;  3QF7 A;  2Z0A A;  3B77 A;  3OTO O;  4E2L A;  4WBN A;  3TXQ A;  4EB6 B;  3M99 B;  3AG1 B;  1HNX O;  1VIB A;  2UXX A;  4MT8 A;  3KG2 A;  5D5Q A;  4U7N A;  1H2M A;  4FVM A;  4JI1 B;  4X62 B;  1WB8 A;  3QO8 A;  3L75 H;  3ETG A;  1MA1 A;  5A9G A;  2CAZ C;  3CS5 A;  4DUY O;  2ODM A;  4X1K A;  2WLI B;  1Q6U A;  2Y69 C;  3OAA G;  4FZ0 A;  1FXK A;  3CCR V;  3N2G A;  1QVF U;  2ZD9 A;  4PA3 A;  1FXK B;  2IU3 A;  2Y69 B;  1IX9 A;  1Q5O A;  1NT2 B;  2CTQ A;  4FM0 A;  4NR1 A;  4HAM A;  3B40 A;  4XDL A;  3SJQ C;  5KMG B;  4NXM B;  4EFE A;  4AQY B;  1XNR B;  1D5A A;  3HPL C;  1Y74 A;  2KG7 A;  3SPC A;  1SKV A;  2JGD B;  4LF5 B;  4X1K B;  4BIU A;  2V4D A;  3AEI A;  3BRC A;  5IWA B;  4PJ0 Z;  5LOV A;  3UT5 B;  4NTX A;  3RYH B;  1AJP A;  2UXC O;  4GX0 A;  3CME V;  1A32 A;  1P4R A;  4YIP A;  4TUY A;  2UUC O;  5KHK A;  2QKA A;  4G27 B;  4CS4 A;  2VWK A;  1VQP V;  4CC6 A;  4MTF A;  2Q73 A;  4X64 O;  4X89 A;  2B5U A;  4P2Z A;  3ZMZ A;  4MS2 A;  3DC5 A;  4F6R A;  2VQE B;  4DV4 B;  1SQF A;  1EN5 A;  2YIB A;  3CC2 V;  4J9Y B;  3W7U A;  1XDC A;  3N2G B;  4WBN B;  1ARO P;  3GVM A;  1NVP D;  2LW1 A;  1WN7 A;  2YEV A;  4X8A A;  5CBG A;  2OCC B;  2Y48 A;  3LSS A;  3I56 V;  3ZRW A;  2WA3 A;  5L3C A;  4JZ2 A;  3ZBH A;  2OTJ V;  2IJH A;  4O4I B;  1IBM B;  3SYO A;  1KKC A;  4H33 A;  2ADQ B;  4JYY A;  2HG5 C;  2EIJ C;  2JJ1 G;  4DK0 A;  1YTF D;  2ZIN A;  4JPR A;  2YIB D;  5IE9 A;  4DK1 A;  2P4V A;  2VRZ A;  4UV9 A;  1EBO A;  2LW7 A;  4WFG A;  4DV6 O;  3OUF A;  3A2F A;  3CSX A;  4R6Z A;  4DR1 B;  1MMM A;  1FFT B;  1M57 B;  1Q8I A;  4RAI A;  1XNQ O;  1ZSP A;  3EHB B;  5EIB D;  3HKC A;  1TGO A;  4TQD A;  2YEV B;  1AJN A;  4NXN B;  4ASU G;  5EYP B;  5CBH A;  2DWE C;  4JI1 O;  2IJI A;  4TSF G;  4LH6 A;  5EZY A;  1BHA A;  4ZI7 B;  4YJ2 A;  5GTI Z;  2PYJ A;  2F43 G;  1Q7Y W;  2YIA A;  3FYE B;  3LDD A;  1XUQ A;  3CJH A;  3L70 H;  4QGP A;  1GTO A;  2UXC B;  4FMT A;  1D5N A;  1KU9 A;  2HJF C;  5FL7 G;  4U3J B;  2WLM A;  4FLV A;  4CZZ A;  4I50 A;  4UVB A;  1IXB A;  3B8M A;  1XRE A;  4ICG A;  3OMN B;  3CXC U;  3SYC A;  1XMO O;  3DSQ A;  1XHX A;  3ICX A;  2Q5Z A;  2XAG A;  3SJC C;  3ZX6 A;  3IC7 A;  4GX2 A;  4W4L A;  1FXV A;  4XDK A;  1HNZ B;  3CC4 V;  1FXK C;  2F4V B;  5EIB C;  4WFF A;  3BA9 A;  5JQG A;  2FL4 A;  4P9P A;  3A0H Z;  2UXN A;  4TV8 A;  3K5M A;  2HVK C;  5LGU A;  1P7B A;  2G38 A;  4H37 A;  5C8Y B;  1CEZ A;  3OTO B;  3NR7 A;  5LHI A;  1IBK B;  1SS3 A;  1AI6 A;  3T1C A;  5H6Q A;  2RCV A;  5LMU O;  4R50 A;  3UKM A;  5CMU A;  3E83 A;  4FZ1 A;  3VQV A;  2LGQ A;  4QPK A;  2GUZ A;  2WLL A;  4DRX B;  2P6J A;  3ZJZ A;  2JIZ G;  4O2A A;  3TCU A;  4P9O A;  1W59 A;  2L35 A;  4FFB A;  4JAS A;  1YSC A;  4X1I B;  2Q7G A;  1OCO C;  1GN6 A;  5IJ9 A;  1WP8 A;  4FIP C;  2BSK A;  1AR4 A;  4Q20 A;  2UU9 B;  1SZT A;  5GON B;  3D36 A;  2JJ2 G;  3H1K H;  1YTF B;  3P3N A;  1U96 A;  4DV3 O;  2HHH O;  4K8Z A;  2WLL B;  4AIL C;  1YJ9 V;  1URF A;  1FPO A;  2PI5 A;  3SGI A;  3AG3 B;  2UUA B;  4I55 A;  1AP6 A;  4O4I A;  2LFR A;  4FLU A;  2XHB A;  1HNW O;  3F5W C;  2EIN B;  2F4V O;  1YIJ V;  4LFC O;  4CH4 A;  1MZF A;  1ZX3 A;  1QR9 A;  2QM7 A;  1FS0 G;  2V7Q G;  5FNV B;  4DRX A;  5L3F A;  3J7A U;  2KKW A;  3K58 A;  3AG2 C;  1Q82 W;  4A5U B;  2E74 B;  1IBL B;  1NTZ H;  2L6L A;  4JYA B;  4JI0 O;  1Q6I A;  1Q6H A;  5DEC A;  1AR1 B;  1QHT A;  1BT8 A;  4Z1V A;  4ZOL B;  1VQ6 V;  1OCR C;  1KBH A;  3BFR A;  4DV5 B;  3E35 A;  5IY5 C;  1ZUQ A;  2IBZ H;  1NJI W;  2ZE8 A;  3JD1 A;  2P06 A;  2YI8 A;  3JD2 A;  4JTA B;  4CBC A;  5LYJ B;  4RQE A;  3ASN C;  4KFM A;  2RJZ A;  1G4Y B;  3HKE A;  5LP6 C;  3CWB H;  4OPH A;  1GO3 F;  5H6R A;  1CXZ B;  5KMG A;  1K34 A;  2WA4 A;  1KYO F;  1WNS A;  2A79 B;  3OTF A;  1K4C C;  3ZS8 C;  1EZJ A;  3K04 A;  1KP2 A;  1SRY A;  2YXY A;  4UFZ A;  3RFR A;  2ZNI A;  4O4H A;  1DK1 A;  4B3R B;  1IUR A;  1VQ9 V;  4WFB V;  1NU1 H;  3QG5 A;  3TK1 A;  4LFB O;  2W0F C;  1J95 A;  2X6A A;  1SA0 A;  2D3O W;  3ETQ A;  1TVK A;  3S3X A;  5EBW C;  3TET A;  1H38 A;  1VF6 A;  4WFH A;  2ZE7 A;  4BIZ A;  2OTL V;  1Y6X A;  3I55 V;  1WA8 A;  1N33 B;  1HR0 B;  2K9P A;  4EKW A;  3HKC B;  1SZX A;  4R7C A;  3SDL A;  3M8A A;  4QPJ A;  5KA6 A;  4DV3 B;  1O9H A;  1B6Q A;  1VQK V;  3WFV A;  5HFL A;  2PUS A;  1N36 B;  2F95 B;  2JS5 A;  2QWO B;  4P30 A;  4IL6 Z;  1SQG A;  1XL6 A;  2JGU A;  2OYQ A;  5FPO A;  4ABM A;  5IJ0 A;  2E3C A;  2P4K A;  4BIO A;  2NNU A;  4GLX A;  4DR6 O;  4QJF B;  2P22 C;  1IBK O;  3P30 A;  1LNQ A;  5L3E A;  1QCE A;  2ADP A;  1RM1 B;  1JA8 A;  1EZV H;  4MVU A;  3T2M A;  1BMF G;  3CB2 A;  1M93 A;  4PDM A;  2LJ2 A;  2YDE A;  4XDJ A;  4ZHQ B;  3MHS C;  4PA9 A;  4LF7 B;  4B3R O;  1XQ8 A;  2AHZ A;  2CK3 G;  1F23 A;  3RW0 A;  1AI4 A;  5JJE B;  2CDY A;  4JYB A;  2QWN B;  5J2U B;  4B7E A;  1L8D A;  2DQ0 A;  4DUZ O;  4DR4 B;  1BHB A;  5EBL C;  3QVN A;  4PA6 A;  1DGS A;  1ENV A;  3X2Q B;  1AI7 A;  4JI2 B;  5IYZ A;  3JAS B;  1Y67 A;  1VQM V;  3LNM B;  1THZ A;  5DM6 V;  3BA8 A;  2WLI A;  2RN9 A;  2ZQM A;  1MSD A;  2EIK B;  5TIS Z;  1MNG A;  4B7K A;  2B1I A;  3E8G A;  3E2E A;  3CCQ V;  2Q69 A;  1M56 B;  1JJO A;  5BZB A;  5LGT A;  5LA6 A;  3MDS A;  4J11 A;  1VQ8 V;  3IGA C;  3RYC B;  3JAW A;  3CD6 V;  2PTM A;  1XBL A;  3U10 A;  4JI4 O;  5JWP A;  4GX1 A;  1US6 A;  1SQX H;  1RM1 C;  1KB9 F;  4NYK A;  4O4L B;  1PNL A;  2PZS A;  1K4D C;  4KL1 A;  5ITZ A;  1YIT V;  4DR2 B;  3R65 A;  4GKK B;  2JEU A;  1YF2 A;  1RPR A;  2BTO A;  2F1M A;  4FJC C;  1NBM G;  2EIL B;  2BE3 A;  3EVK A;  3THO A;  1M56 C;  2XT9 A;  1MOF A;  1AIL A;  4UVC A;  3OR6 C;  1AJQ A;  2DOS A;  2WLK A;  1UPG A;  4OX9 O;  2M7W A;  1V54 B;  1TUB B;  4I4T A;  2QTS A;  4J7J A;  4MW3 A;  4HNA B;  4OXS A;  4YJ2 B;  4ZI7 A;  2B1G A;  2ZDI A;  2CE4 A;  3SPG A;  3BAB A;  2R9R B;  4TV9 B;  2X0L A;  4DR5 B;  2QGN A;  2BTQ A;  5B3S B;  2ZNJ A;  3ZMU A;  1JX9 A;  4LCU C;  1VQO V;  3A8T A;  4FM1 A;  3A0R A;  2MK3 A;  4MVZ A;  1PL0 A;  3MHH C;  4H44 B;  2VQF B;  2EUL A;  3OEH G;  4Q6G A;  4D7T A;  4FLY A;  4DV5 O;  3LDE A;  3VBB A;  1XMO B;  3ABL C;  1SQP H;  4I4T B;  4LF6 O;  1XHZ A;  2O57 A;  4B3T O;  2YID A;  1XL4 A;  1F4M A;  1OCZ C;  4KXR A;  3H1I H;  5L3B A;  1VQL V;  2DMX A;  4O4J B;  2Z5U A;  4BR6 A;  3CCU V;  4C7U A;  3JAT B;  2Q0A A;  4LF5 O;  2VQF O;  3G80 A;  1P84 F;  1FAF A;  3AG4 C;  2E5L B;  3S3W A;  2GSM B;  1K33 A;  4IYI A;  4NXM O;  4NB5 A;  1BL8 A;  1IBL O;  1GK9 A;  2ZXW B;  3OGI B;  3T4Z A;  1FD9 A;  4TT3 G;  4DV7 O;  1K3E A;  1KD1 W;  1Q43 A;  2ZKO A;  3K0G A;  1OCZ B;  5BXZ A;  2N05 A;  4YY3 B;  4O2B B;  2QE7 G;  4U3F H;  2FYU H;  1JFF A;  2QKC A;  4LR3 A;  4J9Z B;  3ZRW B;  3LNN A;  3E89 A;  4X65 B;  5B1A B;  1SA0 B;  2GTA A;  1YHQ V;  4DV2 B;  3E8B A;  4RUE A;  2CH7 A;  1PKX A;  4LFC B;  3UCS C;  1Z5W A;  2LGW A;  1S76 D;  1ZTE A;  4E4E A;  2JRI A;  5B1O A;  1HNX B;  4MTX A;  5IYD O;  2XOK G;  3FAV B;  2EZP A;  1YVW A;  1R3J C;  3WB2 A;  3ETE A;  1NZ6 A;  1KP3 A;  1N4C A;  4YIO A;  1L0N H;  1S5J A;  3CRR A;  3TXS A;  3ZRX A;  3H1H H;  2CTR A;  2UUB B;  2ZM6 B;  2KQX A;  3CEI A;  3JD3 A;  3X2Q C;  1ZL8 A;  2W6I G;  2XAF A;  3CPW U;  1G1X B;  1I7F A;  2YXH A;  3HKB A;  4UCS A;  3JAK A;  3CRA A;  3UQ8 A;  2N04 A;  3ASO B;  3FX7 A;  3N27 A;  2A9H A;  2W6J G;  3ZHR A;  4Z2W A;  4JI5 O;  2Y4U A;  5EC2 C;  2A06 H;  3AG4 B;  3QTC A;  4WF9 V;  4LH7 A;  2W0X A;  3L9D A;  3GWK C;  1N34 B;  1ZWI C;  2ZIM A;  2E75 B;  5BY1 A;  5D5P A;  4FPP A;  3STL C;  4DR3 B;  2WLJ A;  3BVO A;  1NTM H;  3RYI A;  5IWA O;  1H2S B;  4LWS B;  5IDJ A;  2P90 A;  3OGC C;  1KKD A;  1HNW B;  4MVR A;  3WB0 A;  2E5L O;  4DR7 B;  4RUF A;  3E86 A;  1K7D A;  4UB8 Z;  1GAX A;  3KCY A;  3W7S A;  1I5X A;  1TVK B;  4ZIB A;  2OWO A;  4X20 A;  3D36 C;  4NVP A;  4X1I A;  1K97 A;  3U0Z A;  4FLT A;  2ZE5 A;  4IYH A;  2ZCE A;  4YHH B;  3FD9 A;  1EN4 A;  1CPY A;  2DYS C;  3W7W A;  3KZI Z;  5KA5 A;  4KHP O;  1V55 B;  4GUN A;  4UCT A;  3K59 A;  4K3A A;  1YJN V;  5KAF Z;  4JI8 O;  4HBN A;  5CN0 A;  2YSU B;  2AZ2 A;  4UB6 Z;  3FB5 C;  1OCC C;  4UCU A;  3FKS G;  5IT9 N;  1HWY A;  4XBF A;  3OMI B;  3VQW A;  4JI6 B;  2D2C B;  4Z1M G;  2DW4 A;  2GV9 A;  3N2K A;  1IBM O;  2UXB O;  3K9A A;  3QNE A;  2N74 A;  3GB7 C;  4J80 A;  5E1A C;  5GW7 A;  3L74 H;  4JYC A;  4EFB A;  2QWR B;  2CTP A;  1EN6 A;  4CH5 A;  4DV7 B;  1SES A;  4DV4 O;  1GM7 A;  2WLN A;  4LFA B;  2ATK C;  5A2Q N;  1S5H C;  3APO A;  4H13 B;  1WLE A;  3N2K B;  4UCR A;  3ZHQ A;  1DTO A;  3K5L A;  3LSU A;  1TUE B;  4GKJ O;  1VQ5 V;  3RT3 C;  2ZR3 A;  3VQY A;  2A3Q A;  1WB7 A;  5GTH Z;  1R3L C;  3C3S A;  1Z2G A;  4ZBM A;  1WP7 A;  4FK5 C;  3Q4H A;  2WAM A;  3CCV V;  1H2N A;  5BMV B;  2ZT9 B;  1S5L Z;  2LFS A;  1P7G A;  1Y74 B;  3B09 A;  3T1Y B;  3K9S A;  4CH3 A;  2JVD A;  3JAL B;  4GKJ B;  5KHG A;  4J42 A;  5F2V O;  4X66 O;  4K0K O;  2EIN C;  5L3D A;  4GT1 A;  3LSQ A;  3L73 H;  3TJT A;  5K1X A;  5LP6 A;  4LF7 O;  2X7R B;  5CA1 A;  1HP8 A;  3ZHT A; 
#chains in the Genus database with same CATH homology
 3MHS C;  3FB7 C;  2LP7 A;  2BOC C;  2IJK A;  4PA9 A;  3RVZ A;  3FB8 C;  3D3I A;  2AHZ A;  2CK3 G;  3ZIA G;  1F23 A;  5B1B C;  3RW0 A;  2WLI B;  1AI4 A;  3FB6 C;  3PJS K;  1YJW V;  3ABM B;  1JVM A;  4JYB A;  1IXM A;  2DQ0 A;  2Y69 C;  3OAA G;  2HFE C;  1FXK A;  3CCR V;  1QVF U;  2ZD9 A;  4PA3 A;  1FXK B;  2IU3 A;  2Y69 B;  1BHB A;  5EBL C;  4PA6 A;  1ENV A;  1M57 C;  3ML0 A;  1AI7 A;  3X2Q B;  2X6B A;  3G6E V;  4HAM A;  2QKS A;  1NH2 D;  4XDL A;  3SJQ C;  2QA4 V;  1FXH A;  1VQM V;  3LNM B;  4JAU A;  1THZ A;  3SPI A;  5DM6 V;  2WLI A;  4I5S A;  3HPL C;  2HLD G;  3QO7 A;  4U7O A;  3SPC A;  4BW5 A;  1M90 W;  3H01 A;  2ZQM A;  3DTU B;  3ABL B;  3K0D A;  2EIK B;  4BIU A;  3AEI A;  2Q6A A;  4TWK A;  3ASN B;  2A0L A;  4DO2 A;  1F4N A;  1AJP A;  2B1I A;  3E8G A;  3E2E A;  3CCQ V;  4GX0 A;  2Q69 A;  1W2B U;  1M56 B;  2JEX A;  3CME V;  1PNM A;  5BZB A;  1H2G A;  2OT5 A;  1P4R A;  2H8P C;  5LGT A;  4N21 A;  2IU0 A;  2K1E A;  1VQ8 V;  4RQF A;  2WPD G;  4G27 B;  3IGA C;  4GX5 A;  4WCE V;  1VQP V;  1JCH A;  1NR1 A;  2WSS G;  4MTF A;  4MVO A;  3CD6 V;  4X89 A;  4MSW C;  2B5U A;  4GX1 A;  4P2Z A;  3ZMZ A;  4MS2 A;  3ABU A;  4LBE C;  3B8N A;  1RM1 C;  3ABK B;  1N8R W;  3CC2 V;  4J9Y B;  3W7U A;  1PNL A;  1K4D C;  1YIT V;  4MW8 A;  2IH3 C;  3OMA B;  1ARO P;  3R65 A;  1NVP D;  3G4S V;  2JEU A;  4MTG A;  3K06 A;  1RPR A;  3SYA A;  1EFR G;  2XND G;  2YEV A;  3OFN G;  4X8A A;  2OCC B;  5CBG A;  1S77 D;  2Y48 A;  3LSS A;  4FJC C;  3ZN0 A;  3I56 V;  1NBM G;  2EIL B;  4X88 A;  3ZRW A;  3OM3 B;  1VQ4 V;  5IYC O;  5L3C A;  2DYR C;  1NH2 B;  1M56 C;  2OTJ V;  2IJH A;  3OEE G;  1MOF A;  2HVJ C;  5B1B B;  4UVC A;  3OR6 C;  3OE7 G;  1AJQ A;  2WLK A;  4H33 A;  3SYO A;  2M7W A;  2HG5 C;  1V54 B;  2EIJ C;  2JJ1 G;  4MW3 A;  1YTF D;  4JPR A;  4UV8 A;  4OXS A;  1S72 V;  2B1G A;  2ZDI A;  1VQ7 V;  3SPG A;  2R9R B;  4UV9 A;  2X0L A;  2EIJ B;  3G71 V;  1EBO A;  5EK0 A;  4WFG A;  3F7Y C;  2HKO A;  3OUF A;  5B3S B;  4R6Z A;  3ZMU A;  1JX9 A;  4YXW G;  1FFT B;  1M57 B;  4RAI A;  2ITC C;  2QM8 A;  3SPJ A;  3W7T A;  4LCU C;  1VQO V;  3ZMT A;  3EHB B;  3A0R A;  2MK3 A;  4MVZ A;  2FTK A;  1PL0 A;  2YEV B;  3GWO A;  3MHH C;  1QR8 A;  2HR3 A;  4HZ3 A;  1SET A;  1AJN A;  4QIW F;  1CP9 A;  1W0K G;  2AHY A;  3JD0 A;  2DQ3 A;  3OEH G;  4ASU G;  1Y4M A;  1R6N A;  1R3I C;  2IJJ A;  3ABL C;  3LDE A;  3VBB A;  5CBH A;  1NVP B;  2DWE C;  2IJI A;  1E79 G;  4TSF G;  1BHA A;  4PA4 A;  2F43 G;  3CP1 A;  2ZXW C;  1Q7Y W;  3FYE B;  3LDD A;  1I5Y A;  3UM7 A;  1XL4 A;  3OW2 U;  1F4M A;  1OCZ C;  5B1N A;  2Q68 A;  2NLJ C;  4I9W A;  2XAH A;  4JGS A;  3ZRV A;  1GTO A;  5L3B A;  1VQL V;  4FMT A;  2HJF C;  1COW G;  1Q81 W;  4MVM A;  3K79 A;  1PNK A;  2Z5U A;  5FL7 G;  4MTO A;  2WLM A;  5KUK A;  1K9M W;  3WG7 B;  3CCU V;  1OHH G;  3ASO C;  4CZZ A;  1DF5 A;  1E1R G;  3E8F A;  4UVB A;  3B8M A;  3CXC U;  3OMN B;  3SYC A;  1JQ0 A;  4KP4 A;  3AG4 C;  2XAG A;  5CA3 A;  3IC7 A;  4GX2 A;  3RVY A;  2V1D A;  3W7X A;  1FXV A;  3SPH A;  2JK5 C;  4XDK A;  4LC1 A;  3CC4 V;  2GSM B;  1K33 A;  1FXK C;  3QO5 A;  1H8E G;  2XAS A;  4WFF A;  3K3W A;  2ITD C;  3E8H A;  1JOY A;  1BL8 A;  1GK9 A;  3ABT A;  2ZXW B;  3T4Z A;  1QLN A;  1OCC B;  4P9P A;  1H8H G;  4TT3 G;  4QNH B;  1K3E A;  4PA7 A;  1KD1 W;  3K03 A;  3ZN1 A;  3K0G A;  1OCZ B;  2UXN A;  3FYI B;  1DLB A;  2QE7 G;  1ROP A;  3CCS V;  1NKD A;  2WLH A;  2HVK C;  5LGU A;  1P7B A;  4J9Z B;  4UVA A;  3ZRW B;  3E89 A;  5B1A B;  1YHQ V;  4H37 A;  3E8B A;  4RUE A;  1CEZ A;  2EJR A;  1PKX A;  4PDV A;  1KQS U;  5B1A C;  5LHI A;  1S76 D;  3LUT B;  1JJ2 U;  5B1O A;  1AI6 A;  2C2A A;  3K08 A;  4MTX A;  5H6Q A;  3T1C A;  4WFE A;  5IYD O;  2XOK G;  3T4D A;  2EZP A;  4R50 A;  3UKM A;  2WWW A;  1R3J C;  5CMU A;  1OZ0 A;  3E83 A;  3ETE A;  4R8C A;  1R6K A;  2GHY A;  1KP3 A;  2DYR B;  1S0V A;  1R73 A;  4QPK A;  4JAV A;  2WLL A;  3ZRX A;  2P6J A;  3ZJZ A;  2JIZ G;  4UUJ C;  1QLE B;  3TCU A;  3CCL V;  4P9O A;  4JAS A;  1YSC A;  2XAQ A;  3JD3 A;  1OCO C;  4FIP C;  3X2Q C;  2W6I G;  4Q20 A;  2XAF A;  3CPW U;  3NXS A;  1QBZ A;  1SZT A;  3D36 A;  1OCO B;  2JJ2 G;  5KUM A;  1GMG A;  1K73 W;  4RO2 A;  1K5S A;  1GKF A;  1ORQ C;  2Q67 A;  5LHH A;  1E1Q G;  3ASO B;  1YTF B;  4JTD B;  2A9H A;  2W6J G;  2WLL B;  5EC2 C;  1L1F A;  3AG4 B;  1YJ9 V;  4WF9 V;  1ZWI C;  3EFF K;  2PI5 A;  3CCE V;  4PEL A;  3AG3 B;  3AG1 C;  1KC8 W;  4FPP A;  4LP8 A;  3STL C;  2WLJ A;  1DF4 A;  2LFR A;  1OCR B;  4ZKI A;  2EIK C;  4JF3 A;  3F5W C;  4UXN A;  5IY5 B;  2EIN B;  1F51 A;  1YIJ V;  4DXW A;  5IDJ A;  2P67 A;  2P90 A;  3OGC C;  4GCZ A;  3WG7 C;  1KKD A;  1QR9 A;  3F7V C;  4G2K A;  3CMA V;  2QM7 A;  4MVR A;  1FS0 G;  2V7Q G;  1NR7 A;  3ABK C;  4RUF A;  1PD3 A;  1GM8 A;  5L3F A;  3E86 A;  1K7D A;  3ZMV A;  3JYC A;  1Q82 W;  3AG2 C;  3CCJ V;  5C93 A;  3W7S A;  1I5X A;  1MG1 A;  3JCZ A;  2BOB C;  1K97 A;  1AR1 B;  5J9P C;  1UJW B;  1YI2 V;  3ETD A;  1CPY A;  2DYS C;  3W7W A;  3LDC A;  1VQ6 V;  5KA5 A;  1JPX A;  1OCR C;  1VQN V;  1V55 B;  2QTO A;  4PDL A;  3P32 A;  3E35 A;  5IY5 C;  1YJN V;  3CCM V;  2ZR2 A;  4MVQ A;  1QVG U;  4QE7 A;  1NJI W;  3JD1 A;  1M1K W;  2EZO A;  1S3J A;  4JTA B;  4CBC A;  3JD2 A;  2ZDI C;  3SYQ A;  4RQE A;  3ASN C;  5CN0 A;  2YSU B;  4KFM A;  3FB5 C;  1OCC C;  1V54 C;  1G4Y B;  3JD4 A;  3FKS G;  3CC7 V;  3MD0 A;  1HWY A;  4XBF A;  1GO3 F;  3OMI B;  2X6C A;  2Z3Y A;  5H6R A;  1K34 A;  4Z1M G;  4HYO A;  2A79 B;  2DW4 A;  1Y66 A;  1K4C C;  3CYO A;  2JDI G;  1EZJ A;  1QLE C;  5LBQ A;  2PI4 A;  3K04 A;  2EBO A;  3K9A A;  4PDR A;  2EIM C;  3BY6 A;  3QNE A;  1KP2 A;  2R9I A;  4KUM A;  1SRY A;  3STZ C;  3GB7 C;  5HFM A;  5E1A C;  5GW7 A;  1KEC A;  4JYC A;  3OR7 C;  1VQ9 V;  2IH1 C;  2EIM B;  4WFB V;  3OUS A;  3TK1 A;  2W0F C;  1J95 A;  2X6A A;  1K8A W;  1SES A;  2D3O W;  5EC1 C;  2QEX V;  3DGE A;  1K92 A;  1GM7 A;  2WLN A;  5EBW C;  3TET A;  1H38 A;  5LGN A;  3ZMS A;  4WFH A;  2ATK C;  4BIZ A;  2OTL V;  1S5H C;  1NQT A;  1WLE A;  3I55 V;  2EIL C;  2H94 A;  1DTO A;  4QE9 A;  4G28 B;  5DN6 G;  1RPO A;  1G8M A;  1TUE B;  1VQ5 V;  4F4L A;  2ZR3 A;  4BAY A;  1V55 C;  3AG2 B;  1GM9 A;  4EKW A;  5EBM C;  4R7C A;  1Q86 W;  2KB1 A;  3ZCC A;  1R3L C;  4QPJ A;  5KA6 A;  1MAB G;  4MVS A;  4WFA V;  1B6Q A;  3SYP A;  1VQK V;  5B3S C;  3WFV A;  1MSW D;  5HFL A;  4ZBM A;  2DYS B;  4FK5 C;  2OCC C;  1AI5 A;  2IW5 A;  3ZRS A;  5H9C A;  2P7T C;  3RBZ A;  3CCV V;  2WAM A;  3ABM C;  5IYB O;  2XAJ A;  4P30 A;  4N23 A;  1XL6 A;  1SER A;  1W0J G;  3HB3 B;  2LFS A;  1K5Q A;  1M9N A;  3BEH A;  3B77 A;  2NNU A;  4E2L A;  1WPX A;  2DWD C;  5L3G A;  3M99 B;  3AG1 B;  1R3K C;  3AG3 C;  4QJF B;  4JTC B;  3P30 A;  1LNQ A;  3IFX A;  5L3E A;  1QCE A;  4L87 A;  1RM1 B;  2UXX A;  2EIN C;  4MT8 A;  3KG2 A;  5L3D A;  4GT1 A;  3LSQ A;  4MVU A;  4U7N A;  3T2M A;  1BMF G;  5LHG A;  3QO8 A;  2X7R B;  3VOU A;  5CBF A;  4PDM A;  4XDJ A;  3ETG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...