4KXRA

Structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords PE25
total genus 35
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4kxrA00
4J7KA 4KXRA 4J11A 3FX7A 4IYHA 4J7JA 4W4KA 2GTSA 4J41A 4W4LA 2G38A 4J42A 4J10A 4IYIA
chains in the Genus database with same CATH superfamily
3CRCA 4KL1A 4JI3O 1XHXA 4WFBV 3W7XA 1QQCA 2UU9O 1L8DA 2DQ3A 1B3QA 4TV8A 5JJEB 4PDRA 1J5EB 2JS3A 1I5YA 4DUYB 1SQQH 1TVKA 1WP7A 2CGOA 2W6JG 3DC6A 1GO3F 1GN3A 5CA1B 1XNQO 1N4CA 2IJKA 3TXSA 4MT8A 4ZOLB 1FXVA 5TISZ 1ZLZA 4MTXA 2GTAA 3E8HA 1TUEB 3PN1A 1AI7A 3OTOB 1WA8A 3SYAA 1MSWD 3B2EE 4YJ2A 4RAIA 5LGTA 2D3OW 1HNZB 2FTKA 1YVWA 1MA1A 3HKDA 2UXNA 4U7NA 3S3XA 4WFAV 4B3TB 1V54B 1H8HG 1K8AW 3X2QC 3STLC 4PA4A 3FAVA 1SA0B 3JD3A 3Q4HB 4FM2A 4H13B 4J11A 3U11A 2A7WA 1RM1C 3APQA 1KMIZ 3IC9A 5IY5B 3KCXA 2Y0PA 4FLWA 2WA4A 3OW2U 2QWNB 4DV1B 3F7YC 5JH7B 3AK2A 1R3IC 2OTJV 3TETA 5FL7G 1B04A 3NR7A 3UCSC 1K5SA 2YUAA 3UT5A 4DR3O 5E79Z 1OCRC 4HZ3A 2Y69B 4NR1A 1Q43A 3CCLV 1DF5A 2EJ7A 2QTOA 2WLHA 2KKWA 4HBNA 4UCVA 1YIJV 1S76D 2IH3C 1PM9A 3B8MA 4MVZA 3M7MX 3F7VC 5IJ9A 4ZI7B 2ZM6O 4KXRA 4X89A 2RMKB 4DV6O 4LC1A 2UUCO 4NYKA 5CA0B 3AG3B 2KSDA 2Q5ZA 2ZIOA 3CCQV 4GT1A 4FM1A 4JAUA 4BIOA 2W0FC 3L70H 2F43G 3QTCA 1H2SB 2YICA 1FXKB 1BL8A 1IVSA 4LWSB 4N23A 2E3CA 2HVJC 5JVDB 4CS4A 1AP5A 2KG7B 2X7RB 4IGGA 3HKCB 1HNWO 4FVMA 4EKWA 3GB7C 5IYZA 3AG7A 2LFSA 4TV9A 4XDLA 3BA9A 1S3JA 1OCOC 2DYRC 4KHPB 4J10A 4O2BB 1RPOA 3IC7A 1WPBA 3AEIA 3ZMSA 4UB8Z 4LF7B 1DTOA 2VWKA 2N05A 4QJFB 3SYPA 1R3JC 3OTOO 2YXYA 4E2LA 2F93B 3CB2A 3HKBA 4Q6GA 2QWPB 3BY6A 4EFBA 1VQOV 1VQ7V 1KKCA 4P9PA 3B77A 5JCOC 4GUNA 1KP2A 1SQBH 1D2DA 2QR4A 4BW9A 4JI7O 2QM4A 3OMIB 4JI7B 3NXSA 5H9CA 4J7JA 2Q73A 3CRRA 2R9AA 2DJVA 4LF5B 2A3QA 3ZRWA 1GN6A 3TXQA 4YHHO 1XUQA 2ZR3A 2LW7A 3AK3A 2HEPA 1YEWA 4JYBA 2UXDO 2RDCA 1HR0O 3FYEB 1BT8A 1JMKC 1VQLV 1AJNA 4PDMA 1G1XB 5LMNB 1GTOA 4LF9O 4O4HA 1NT2B 3OMNB 5L3CA 4A5UB 5H2FZ 3JD1A 1QR9A 2AXTZ 4R8CA 3JCZA 3SJBC 5FNVB 3ASNB 4L87A 2JGDA 4X1YB 4BIZA 2XAQA 3RWRD 2BTOA 3JD4A 1L0NH 1XMOO 4QE9A 1JX9A 3E22A 3WB2A 4CS3A 4GKJB 1QLEB 2ZQMA 4B7KA 1QCEA 4I7ZB 2FKXA 2QKAA 1WJZA 2GUZB 1I0HA 4B3SO 2XHBA 4BAYA 1EZVH 3K03A 1TGOA 3JAKB 2CE4A 4H33A 4XBFA 5FPRA 5L3BA 4LNUA 2WAMA 4P2ZA 2ZM6B 1HNXB 5GW7A 1MOFA 4P30A 4DR2B 1EBOA 1UPGA 1LNQA 2ZNJA 5LHGA 2BTQB 2JJ2G 4LR3A 4MVOA 1ZL8B 2RJZA 1S77D 5LP6C 4XDKA 1K3EA 4TUYA 3IAYA 5LBQA 5HFMA 2WLIB 4C7UA 1MNGA 5J2TB 4WBNA 3LSQA 5EZYA 3E83A 4OX9B 4DR6B 1Q7YW 4I50A 2QJ1A 3VQXA 1VQ8V 4K35A 3K5LA 3JATB 1BQ0A 4LP8A 5LMUB 2XAHA 1ENVA 1RSOB 1FJGO 1MMMA 3IJ4A 4WFHA 2ETNA 1VQ9V 3R66A 4FLTA 3JSLA 2LO1A 1AJPA 1EN6A 4ASUG 3APOA 1ZWIC 3GWKC 2QM7A 1R3LC 1N33O 1F23A 3QF7A 1VQPV 1SERA 1LUWA 3ZIAG 1SQVH 5ITZB 5KUKA 3BEHA 3CX5F 2PYLA 1I7FA 2Q69A 2ZKOA 2WPDG 5LHIA 4NXNB 1XNQB 5C8YA 1N32O 2YEVA 4DK1A 1FKAO 1P84F 3OFNG 1BQZA 3LSUA 2ZDIC 4FZ0A 4JASA 4JAAA 1Q82W 1KKDA 1WNSA 1M56C 3FB8C 2WLNA 3JAWA 5J2UA 1J5EO 4DR4O 4FJCC 4YJ3A 1SA0A 3SGIA 1WP8A 3ABUA 3G6EV 2ODMA 2ZXWB 4HNAB 5LOVB 5L3EA 1KP3A 1YTFB 1YJ9V 3C90A 1V9PA 3VQYA 2IU0A 2A06H 2R9IA 1K97A 1P7BA 2F23A 4UCOA 2VQFB 1SZXA 1BMFG 2Q67A 2V7QG 2A0LA 2QKSA 2Q0OC 1D5AA 4QIWF 2WWWA 1K4CC 4O4JB 2RQ6A 3D3QA 1ZTEA 5KAIZ 2WLLA 1GKFA 3MDSA 3FYIB 2Y0IA 3E89A 2FMLA 2XASA 1EFRG 4PHZA 1XL6A 1YJWV 1BE3H 3ZMUA 5JQGB 2OCCC 1K5QA 3ZHSA 3E8GA 2ZT9B 1Y6XA 1MZEA 1DGSA 1M4UA 3ASOC 5D5QA 3DXRA 3ABMB 2Z3YA 4FLVA 1FFXB 4B3MB 2DMXA 3VOUA 1IBLB 1OCZC 1HNXO 2DE0X 1E79G 1VF6A 4LFAO 4JI1O 1THZA 3CYOA 4UCRA 5B66Z 2OTLV 4QGPA 3K58A 3TJTA 5B1NA 3BPZA 2YDEA 4B3SB 2WLKA 4GCZA 4DO2A 2QA4V 4X1IA 2CAZC 4YY3B 2PI5A 1BZKA 2HFEC 2B5UA 4GKJO 2IJHA 4BR6A 1H2KA 2PI4A 1AI4A 2EINC 4MTOA 3J80N 4NXMO 1SQGA 1O9GA 4DK0A 4JV5O 3X2QB 4CBCA 4HYOA 2ARHA 1R6NA 4UVAA 4O2AB 2EIJC 4LBEC 3CXCU 4NXMB 2JK5C 3ETEA 2OIEA 1FPOA 1R3KC 5FLXN 1IBMB 1S0VA 2XOKG 3WG7C 4UV9A 1COWG 1P7GA 4MVMA 3ABMC 3ZX6A 5KHIA 1YXBA 1OCZB 1S72V 2P67A 4LFAB 1HDJA 3JD2A 1WN7A 5GTIZ 1AR5A 1GMGA 1NVPD 4BIUA 2DW4A 1S5LZ 4L8JA 4KUMA 2QEXV 3BRCA 5IYCO 2X0LA 3ZRVA 1ZX3A 1X4TA 4MW8A 4J41A 2PGGA 4O4IB 1H2NA 2F66C 2Q68A 4CH4A 3SJQC 3STZC 3OEEG 4O4HB 3AK1A 3VBBA 1R1BA 5FNVA 4IIJA 4U3FH 3C3TA 3RYCA 4WCEV 5EBLC 5BR8B 3DSQA 3E22B 5H6QA 2X6BA 2JDIG 4W4LA 1JJ2U 2B1IA 3EVKA 1BCCH 5EBMC 2Q0AA 4UXNA 2BCCH 4X65O 5LXTB 1XQ8A 1FJGB 1WLEA 2O57A 3BHPA 1FS0G 2ITDC 1JFFA 3CS5A 4K8ZA 4DV2B 4DR6O 1IURA 5J9PC 5EBWC 2YXLA 3G6BA 1XHZA 4DRXA 3VQVA 1ZL8A 4JAVA 2L6LA 3K5NA 1SZTA 3CPWU 4OPAA 4NXNO 5LHHA 2B1GA 3AG1B 5IYBO 1IXBA 1TA8A 3KG2A 2ZDIA 4IYIA 3OUSA 2EILB 1V55C 2A79B 2EIMB 4JI2B 1QR8A 1QU7A 4LF4B 4FPPA 4LFCB 2KG7A 1YTFD 3CD6V 2XAFA 1VMGA 3P30A 2P4KA 1NH2D 3JASB 1OJHA 4I4TA 2LGQA 4FFKA 3K57A 2PTMA 4X64B 1F7YA 4FM0A 4O2BA 4U3JB 3LNMB 2UUAO 1GM8A 4IT5A 4AQYB 5LMUO 1SQFA 1F4NA 3ZMZA 3ZHTA 5EC2C 2UXBB 1EZJA 4DR5B 1M1KW 1Y74B 5GTHZ 1XOUA 3H1IH 4OXSA 1YITV 1QLEC 2RCVA 2HLDG 2M6YA 4B3TO 2NN4A 2CTRA 3JD0A 5CA3A 5CMUA 3QVNA 2UXDB 3K04A 1M5IA 1NU1H 4LH7A 1YDXA 3B8NA 1AR1B 2Q4PA 4DR2O 2IM9A 3LUTB 5LYJA 1PP9H 3CJHA 5IWAO 1NR1A 3K79A 2DQ0A 5IJ0B 3P3NA 1H8EG 4EB6B 3P3PA 5LOVA 3HB3B 2XUMA 3QO5A 2P4VA 4R7CA 4DUZO 3C3SA 3OGCC 1M9NA 3SPHA 4DUYO 3EFFK 3QO7A 3SDLA 1LR1A 1I94B 5FPOA 5EIBD 2XAGA 4DW0A 3SYCA 3ETGA 1Q90D 3H9VA 1PV0A 3RVZA 3H01A 3T1CA 2EIMC 2Y48A 4O4JA 2EIKC 2HJFC 4LF7O 5IYDO 3ZN0A 2C2AA 1KQSU 3ZJZA 5LP6B 1RFYA 3K06A 3U10A 5JQGA 4LFBB 4PA6A 5IDJA 1D5NA 3JAKA 5B5EZ 3WG7B 2CTPA 2Z0AA 4LH6A 3SPIA 1DLBA 1N0NA 4WFFA 3ZS8C 1JOYA 1MSDA 1FXHA 1N36O 1B06A 2HHHB 2BTQA 1N0JA 1W0KG 2IJIA 3ZHRA 2E74B 3GVMA 4TV8B 4AQYO 4ABMA 2YIBA 1WPXA 5EIBC 3L75H 3OTFA 3K9SA 3D3IA 4DV4O 3G67A 1JR9A 3KCYA 4WBNB 1Y66A 1IX9A 2X6AA 4MTGA 4LF4O 4ZBMA 4J7KA 1JPXA 3RYFB 2IU3A 2Q6AA 3ABTA 3A0RA 2QKCA 1Y76A 1NI8A 4JYAB 4FLZA 1H2LA 1Y4MA 3F5TA 4DR3B 3L73H 3MHSC 3T1HO 4IHJA 2W0XA 1V54C 4I5SA 4Q20A 1GK9A 2XT9A 2M7WA 1QLNA 3T4ZA 3SPJA 5KMGA 3Q4HA 1H38A 3I5DA 2QWOB 4UVCA 1KUQA 1R73A 4FZ1A 4UCSA 3E8BA 2XAJA 4ZHQA 1VQKV 2NNUA 2VWJA 4X62B 1VQ5V 1GN2A 1GAXA 1N8RW 3E2EA 4UV8A 4X20A 3L74H 1E1RG 1QVGU 3OR6C 2P06A 3DC5A 3T1HB 5KA6A 4F6EA 4DV7B 2CUGA 2F1MA 4O4IA 5LA6A 3FB6C 4DV6B 2E5LB 1VF5B 1SC5B 3N27A 2AHYA 2Y69C 3AG1C 3JAWB 4DV3O 3CSXA 3OR7C 4GX0A 3TCUA 1AJQA 4JZGA 4I0XB 3UQ8A 2Q7GA 1GM7A 2ILMA 3LSSA 3RYCB 4FLUA 2ZE7A 5IT9N 1YF2A 2JS5A 3CCSV 4FMTA 2XTAA 1VQMV 3RYHB 1K9MW 1NBMG 4DV1O 1A32A 4G28B 2X6CA 2HHHO 5CBGA 4MVRA 1E1QG 2NR5A 2OT5A 1NS1A 3N2KB 4QPKA 1Z5VA 2R70A 3F5WC 5B3SC 3BABA 2QDOA 3UM7A 3SYQA 2HR3A 3AG3C 4DRXB 3M8AA 3I55V 2IH1C 4TV9B 2V1DA 1VF7A 1TUBA 1IBMO 1BGYH 3CMEV 3FB7C 1WAZA 1VQ6V 2VQEO 4PJ0Z 4EFEA 2CTWA 5CB4A 1AB3A 4I55B 4OPHA 3FAVB 4WF9V 1OCCC 2FL4A 3JAMN 4DXWA 1K73W 2HVKC 2Q8VA 3LDCA 4FFBB 2ZE6A 1KC8W 3JYCA 4LF8B 5LGUA 4DV0O 4X1IB 3JASA 4NB5A 5KUMA 2UUBB 2PYJA 1VQNV 3CRQA 2OCCB 4JI4O 3CMAV 1OCRB 4JI5B 1WB8A 5CA1A 1M93A 2VS0A 2BSKA 4CC6A 4DUZB 3K0DA 1QHTA 1NTZH 4K0KB 2UU9B 2EJRA 1FD9A 1EN4A 3KZIZ 4FLYA 3CRAA 1OHHG 1T5EA 2LW1A 4NTWA 3K5MA 1RPRA 5L3GA 4B3MO 4RQFA 4YJ2B 4GYCB 1XEQA 3A8TA 5LL6Y 2ZCEA 1JVMA 2JVDA 3VQWA 3D36C 5CN0A 3CCRV 3RYIA 5L3FA 2UXXA 3W7UA 2DYSB 3KKYA 4F4LA 5AG2A 3T1YB 1G6UA 3T1YO 1KECA 3CJHB 4DR5O 2UXBO 3FX7A 3O65A 3SPCA 1BHBA 1U96A 2BOCC 3HKCA 4GKKO 4OGQB 3K5OA 1URFA 4LCUC 2VQFO 4MTFA 4X9QA 3I56V 1RP3B 1VARA 1OCOB 2DYRB 1L0LH 4RUFA 1NTKH 1IBKO 3HPLC 4UCTA 4JI1B 4JF3A 2BOBC 2PZSA 4HAMA 1IBLO 1DK1A 5IY5C 4JI8B 4DW1A 5EYPA 4G27B 4MVSA 5KHGA 1HWYA 4J42A 3RFRA 4TQDA 4DV5O 5BMVB 4KP4A 2EZPA 4DV0B 4TUYB 1OCCB 3BCCH 1S5JA 1XL4A 1MZFA 1O9HA 1M56B 1Q86W 2ZIMA 2ZNIA 1R6TA 5J2TA 1JFFB 1ORQC 1NR7A 4LWSA 1YHQV 1WA8B 3RT3C 3ZHQA 4NTYA 2ADPA 3L9DA 4RO2A 4D7TA 3CCMV 5B3SB 5IYZB 2QSAA 2D2CB 3ABKB 2HP8A 2JIZG 3ETDA 3SR2C 3CRMA 1W59A 5HFLA 5BR8O 3B09A 2OIGA 5KHKA 1OV9A 2QWRB 3ZHUA 1RM1B 5BXZA 1TAEA 3ZEDA 5JH7A 4TOIA 3T2MA 1QVFU 4F6RB 3QG5A 1N32B 3JARA 4X66B 4DV5B 4J80A 2YEVB 1N34B 1M90W 1JQ0A 1MABG 2P90A 3MD0A 1G4YB 2WLJA 5KLVH 1DF4A 5KMGB 3OE7G 2MW2B 2YXHA 5IJ9B 2AW9A 4ZI7A 3ETQA 2UXCB 2DOSA 1N33B 5C93A 4ZHQB 1GH6A 3W7TA 4DV7O 5B1BC 2EX3A 5B1AB 4O4LB 1CP9A 1M57B 3K08A 3SPGA 4E4EA 5DN6G 3CWBH 1XMOB 3K9AA 1SQPH 1P4RA 3OMAB 1ROPA 2IBZH 5JVDA 4OX9O 1PKXA 1SS3A 4FIPC 2KB1A 2Y4TA 3JATA 3JALA 1YSCA 4IL6Z 4YIOA 3JSNA 2GTSA 1R6KA 3R65A 2V4DA 4QE7A 4JI6B 4TWKA 3G80A 1FAFA 4J9ZB 2H94A 5KX5B 3WFVA 2Q7HA 4B7EA 2EILC 4Z2WA 4JYYA 4PA7A 3L72H 3HKBB 2DN9A 3ZMTA 1FFXA 3LDDA 2R9RB 3CHXA 3ZHVA 4W4KA 1US6A 5ITZA 1K33A 4DV4B 4N21A 4DR1O 3SJAC 4D6TH 2JGUA 4LF5O 4BW5A 3FFQA 5A2QN 2CK3G 5LP6A 4CH5A 2B9ZA 4YIPA 4JI4B 3CC2V 2DWEC 1JJOA 1Q3EA 3CXHF 2CTQA 2W6IG 5F2VO 2LP7A 4YJ3B 2DYSC 2L35A 2E76B 4I50B 4X88A 1AI5A 4LF6B 2ZR2A 4XDJA 3FB5C 5JCOA 3J81N 4O2AA 4FFBA 3CCUV 4GX1A 4LF9B 2YC0A 2EIKB 1K34A 4EEQA 2ZE5A 3RN4A 1H2GA 3CCEV 3QO8A 1YCIA 4CH6A 2GDSA 4H44B 3OEHG 4I9QA 5JJNB 2QTSA 3WB0A 3EHBB 4YHHB 1B6QA 3ASNC 1GM9A 5KHHA 3RYFA 2ZD9A 3JCUZ 1FFTB 1VQ4V 2GV9A 4DR4B 1UJWB 1Q6IA 1I94O 5B1AC 4NVPA 2LQTA 1KU9A 1GRJA 2PY5A 3J7AU 2EINB 2QE7G 4R6ZA 2UUCB 1LUVA 3H1JH 5JJJB 1Q5OA 1YJNV 4B3RO 1J95A 5K1XA 5JWPA 5IWAB 3LDEA 4MSWC 2WLMA 5K1PA 5KA5A 4BWAA 1FYJA 2JRIA 1VF6C 2OWOA 3RW0A 3N2GB 2E5LO 1IXMA 3G71V 2EULA 2WA3A 4ICGA 4JI6O 3MHHC 1M57C 2QWQB 4JTDB 1VP7A 4PV1B 4H37A 5B1OA 5LXTA 3RVYA 2XNDG 5EZYB 1ZSPA 2JEUA 1S5HC 4QPJA 3K3WA 3GWOA 3B4SA 4PDVA 1Q6HA 1EM1A 3ML0A 2F95B 1RSOA 2E75B 1GN4A 2Y4UA 4GX5A 1HP8A 1NKDA 5EK0A 2EIJB 2UUAB 1PL4A 3ABKC 3DGEA 1JA8A 2LGWA 2ADQB 3HKEB 1XILA 1KBHA 3WB1A 1SF9A 5BMVA 4RWUA 3AG4B 4JYAO 4LFCO 2GHYA 1K4DC 1YZBA 2R72A 3ZMVA 4JI2O 4X8AA 4TT3G 5DM6V 2Z5UA 1XI1A 2H3OA 2YIDA 1I08A 2EBOA 5DECA 3A0BZ 5KHJA 2ZXWC 3BAAA 4B3RB 2GBOA 1PL0A 3D8CA 4I4TB 3UO3A 4X1KA 2YI8A 4FLXA 3FD9A 3UT5B 2JJ1G 4UFZA 4PI0A 4ZKIA 3CC7V 1FXKC 1NJIW 4PA9A 3S3WA 1CXZB 2YI9A 2CDYA 4HNAA 4JI3B 4JGSA 1Y74A 1OZ0A 3K0GA 1L1FA 2OCHA 4UB6Z 4TSFG 4X65B 5D5PA 1HR0B 4JTCB 4F6RA 2Q9LA 1HNZO 1XBLA 1BS3A 2BSKB 4PELA 2AGAA 2FB5A 2CH7B 1F51A 1QBZA 4AHCA 2AZ2A 1FXKA 1P49A 2WLLB 3ZCCA 1IDSA 5DEDA 1Q81W 3AG2C 4UUJC 1NVPB 3U0ZA 2F4VO 2YSUB 3W7WA 1PNMA 2P5OA 1XDCA 5KAFZ 5GONB 3RYIB 1SETA 1EN5A 3ICXA 3OGIB 3DTUB 4CC5A 1Z2GA 2VRZA 4IIJB 1WB7A 3OT7A 1NQTA 4CS2A 2HJDA 3ZRXA 2RN9A 2EZOA 1TVKB 3JALB 3CEIA 4JI0O 3ABLB 1W0JG 3M99B 4KHPO 3P32A 5LGNA 4AI8A 5KX5A 4ZOLA 4U7OA 1HNWB 4D7SA 4LF6O 1CEZA 1ZAUA 3ZRSA 3UKMA 4PI2A 3AG2B 4NTXA 4JV5B 1Q6UA 4IYHA 5EYPB 3L71H 3H1KH 3HKDB 4B08A 2P22C 4YY3O 4X64O 4DR1B 1Z5WA 2KQXA 3FKSG 3MAQA 1I5XA 1NTMH 3E86A 4Z1VA 3CE2A 4KFMA 4MW3A 1AROP 2LFRA 5H6RA 2JGDB 4K0KO 5A9GA 5B1BB 2FYUH 3ABLC 1AILA 1SESA 1Y76B 2A9HA 4P9OA 1N34O 1AVMA 2JEXA 4X66O 3RGBA 2UUBO 4U3JA 4K8XA 1MG1A 3A0HZ 1PNKA 2YIBD 4IHJB 4WFEA 4WFGA 3BA8A 1X59A 1SRYA 4DR7B 2BE3A 3OUFA 4LNUB 4UCUA 3CCJV 3OM3B 4DV2O 1U97A 3SYOA 1AR4A 1NZ6A 1HW7A 2VQEB 4FK5C 4R50A 1SQXH 2QGNA 4PA3A 5CBFA 4DYLA 3B40A 4AILC 2QM8A 3LNNA 5CA0A 1KB9F 2RNBA 2N74A 2YS8A 1KYOF 3JARB 1CPYA 5CBHA 3CC4V 2ZINA 2MK3A 2UXCO 2P7TC 4CZZA 4MVUA 1K92A 5BZBA 1G8MA 1PPJH 2ZE8A 1SKVA 1XNRB 3G4SV 1Y67A 2CGNA 3BFRA 3N2GA 1K7DA 4K3AA 4O4LA 1QNMA 3E8FA 5EC1C 1W2BU 1VIBA 3PJSK 2N04A 2YIAA 3OD4A 4GZRB 1XNRO 4TQFA 2G38A 2NLJC 4PDLA 1IZ3A 1BHAA 4H0LB 2LJ2A 1NH2B 3H1LH 3IGAC 2PF4E 1BSMA 4DV3B 4G2KA 3EXAA 3BVOA 2AZ0A 3RBZA 3CP1A 4YXWG 5C8YB 1UFIA 3HR0A 3QNEA 4I9WA 5BY1A 4RUEA 1Q8IA 3HKEA 4X62O 4Z1MG 4ZIBA 5IE9A 5J2UB 4J7ZA 3ZRWB 4I55A 1XREA 4RQEA 2GSMB 1AI6A 4DR7O 3OAAG 3E35A 2IJJA 3ZN1A 1KD1W 1F4MA 2DWDC 4GX2A 2K1EA 4MS2A 4QNHB 4MVQA 1AP6A 4X1KB 2HG5C 1XMQB 2AHZA 5E1AC 3AG4C 3ASOB 2Q7EA 1V55B 1VEWA 3H1HH 4JI8O 5LYJB 4PD4F 2PUSA 4JZ2A 4X1YA 2H8PC 4I0XA 4GLXA 3CCVV 5IJ0A 1ZUQA 4UVBA 3TGUH 4CH3A 4EB6A 1IBKB 4J9YB 1H2MA 4JYCA 1XMQO 2GUZA 3TK1A 3THOA 5L3DA 4JI5O 4JPRA 3RYHA 1PNLA 2F4VB 4GKKB 3UO2A 4NKGB 4JTAB 4LF8O 3DXRB 1JCHA 1N36B 3WU2Z 2OYQA 2CH7A 2P6JA 1PD3A 3K59A 3N2KA 3A2FA 2K9PA 2ITCC 3W7SA 5LMNO 4X20B 5H5NA 4LFBO 3SJCC 2IW5A 3IFXA 1YI2V 4JI0B 3O9OA 1TUBB 2ATKC 5LA6B 2WLIA 3D36A 3ZBHA 5GONA 5CB4B 2WSSG 3T4DA 2HKOA
chains in the Genus database with same CATH topology
4J7KA 4KXRA 4J11A 3FX7A 4IYHA 4J7JA 4W4KA 2GTSA 4J41A 4W4LA 2G38A 4J42A 4J10A 4IYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7K A;  4KXR A;  4J11 A;  3FX7 A;  4IYH A;  4J7J A;  4W4K A;  2GTS A;  4J41 A;  4W4L A;  2G38 A;  4J42 A;  4J10 A;  4IYI A; 
#chains in the Genus database with same CATH topology
 3CRC A;  4KL1 A;  4JI3 O;  1XHX A;  4WFB V;  3W7X A;  1QQC A;  2UU9 O;  1L8D A;  2DQ3 A;  1B3Q A;  4TV8 A;  5JJE B;  4PDR A;  1J5E B;  2JS3 A;  1I5Y A;  4DUY B;  1SQQ H;  1TVK A;  1WP7 A;  2CGO A;  2W6J G;  3DC6 A;  1GO3 F;  1GN3 A;  5CA1 B;  1XNQ O;  1N4C A;  2IJK A;  3TXS A;  4MT8 A;  4ZOL B;  1FXV A;  5TIS Z;  1ZLZ A;  4MTX A;  2GTA A;  3E8H A;  1TUE B;  3PN1 A;  1AI7 A;  3OTO B;  1WA8 A;  3SYA A;  1MSW D;  3B2E E;  4YJ2 A;  4RAI A;  5LGT A;  2D3O W;  1HNZ B;  2FTK A;  1YVW A;  1MA1 A;  3HKD A;  2UXN A;  4U7N A;  3S3X A;  4WFA V;  4B3T B;  1V54 B;  1H8H G;  1K8A W;  3X2Q C;  3STL C;  4PA4 A;  3FAV A;  1SA0 B;  3JD3 A;  3Q4H B;  4FM2 A;  4H13 B;  4J11 A;  3U11 A;  2A7W A;  1RM1 C;  3APQ A;  1KMI Z;  3IC9 A;  5IY5 B;  3KCX A;  2Y0P A;  4FLW A;  2WA4 A;  3OW2 U;  2QWN B;  4DV1 B;  3F7Y C;  5JH7 B;  3AK2 A;  1R3I C;  2OTJ V;  3TET A;  5FL7 G;  1B04 A;  3NR7 A;  3UCS C;  1K5S A;  2YUA A;  3UT5 A;  4DR3 O;  5E79 Z;  1OCR C;  4HZ3 A;  2Y69 B;  4NR1 A;  1Q43 A;  3CCL V;  1DF5 A;  2EJ7 A;  2QTO A;  2WLH A;  2KKW A;  4HBN A;  4UCV A;  1YIJ V;  1S76 D;  2IH3 C;  1PM9 A;  3B8M A;  4MVZ A;  3M7M X;  3F7V C;  5IJ9 A;  4ZI7 B;  2ZM6 O;  4KXR A;  4X89 A;  2RMK B;  4DV6 O;  4LC1 A;  2UUC O;  4NYK A;  5CA0 B;  3AG3 B;  2KSD A;  2Q5Z A;  2ZIO A;  3CCQ V;  4GT1 A;  4FM1 A;  4JAU A;  4BIO A;  2W0F C;  3L70 H;  2F43 G;  3QTC A;  1H2S B;  2YIC A;  1FXK B;  1BL8 A;  1IVS A;  4LWS B;  4N23 A;  2E3C A;  2HVJ C;  5JVD B;  4CS4 A;  1AP5 A;  2KG7 B;  2X7R B;  4IGG A;  3HKC B;  1HNW O;  4FVM A;  4EKW A;  3GB7 C;  5IYZ A;  3AG7 A;  2LFS A;  4TV9 A;  4XDL A;  3BA9 A;  1S3J A;  1OCO C;  2DYR C;  4KHP B;  4J10 A;  4O2B B;  1RPO A;  3IC7 A;  1WPB A;  3AEI A;  3ZMS A;  4UB8 Z;  4LF7 B;  1DTO A;  2VWK A;  2N05 A;  4QJF B;  3SYP A;  1R3J C;  3OTO O;  2YXY A;  4E2L A;  2F93 B;  3CB2 A;  3HKB A;  4Q6G A;  2QWP B;  3BY6 A;  4EFB A;  1VQO V;  1VQ7 V;  1KKC A;  4P9P A;  3B77 A;  5JCO C;  4GUN A;  1KP2 A;  1SQB H;  1D2D A;  2QR4 A;  4BW9 A;  4JI7 O;  2QM4 A;  3OMI B;  4JI7 B;  3NXS A;  5H9C A;  4J7J A;  2Q73 A;  3CRR A;  2R9A A;  2DJV A;  4LF5 B;  2A3Q A;  3ZRW A;  1GN6 A;  3TXQ A;  4YHH O;  1XUQ A;  2ZR3 A;  2LW7 A;  3AK3 A;  2HEP A;  1YEW A;  4JYB A;  2UXD O;  2RDC A;  1HR0 O;  3FYE B;  1BT8 A;  1JMK C;  1VQL V;  1AJN A;  4PDM A;  1G1X B;  5LMN B;  1GTO A;  4LF9 O;  4O4H A;  1NT2 B;  3OMN B;  5L3C A;  4A5U B;  5H2F Z;  3JD1 A;  1QR9 A;  2AXT Z;  4R8C A;  3JCZ A;  3SJB C;  5FNV B;  3ASN B;  4L87 A;  2JGD A;  4X1Y B;  4BIZ A;  2XAQ A;  3RWR D;  2BTO A;  3JD4 A;  1L0N H;  1XMO O;  4QE9 A;  1JX9 A;  3E22 A;  3WB2 A;  4CS3 A;  4GKJ B;  1QLE B;  2ZQM A;  4B7K A;  1QCE A;  4I7Z B;  2FKX A;  2QKA A;  1WJZ A;  2GUZ B;  1I0H A;  4B3S O;  2XHB A;  4BAY A;  1EZV H;  3K03 A;  1TGO A;  3JAK B;  2CE4 A;  4H33 A;  4XBF A;  5FPR A;  5L3B A;  4LNU A;  2WAM A;  4P2Z A;  2ZM6 B;  1HNX B;  5GW7 A;  1MOF A;  4P30 A;  4DR2 B;  1EBO A;  1UPG A;  1LNQ A;  2ZNJ A;  5LHG A;  2BTQ B;  2JJ2 G;  4LR3 A;  4MVO A;  1ZL8 B;  2RJZ A;  1S77 D;  5LP6 C;  4XDK A;  1K3E A;  4TUY A;  3IAY A;  5LBQ A;  5HFM A;  2WLI B;  4C7U A;  1MNG A;  5J2T B;  4WBN A;  3LSQ A;  5EZY A;  3E83 A;  4OX9 B;  4DR6 B;  1Q7Y W;  4I50 A;  2QJ1 A;  3VQX A;  1VQ8 V;  4K35 A;  3K5L A;  3JAT B;  1BQ0 A;  4LP8 A;  5LMU B;  2XAH A;  1ENV A;  1RSO B;  1FJG O;  1MMM A;  3IJ4 A;  4WFH A;  2ETN A;  1VQ9 V;  3R66 A;  4FLT A;  3JSL A;  2LO1 A;  1AJP A;  1EN6 A;  4ASU G;  3APO A;  1ZWI C;  3GWK C;  2QM7 A;  1R3L C;  1N33 O;  1F23 A;  3QF7 A;  1VQP V;  1SER A;  1LUW A;  3ZIA G;  1SQV H;  5ITZ B;  5KUK A;  3BEH A;  3CX5 F;  2PYL A;  1I7F A;  2Q69 A;  2ZKO A;  2WPD G;  5LHI A;  4NXN B;  1XNQ B;  5C8Y A;  1N32 O;  2YEV A;  4DK1 A;  1FKA O;  1P84 F;  3OFN G;  1BQZ A;  3LSU A;  2ZDI C;  4FZ0 A;  4JAS A;  4JAA A;  1Q82 W;  1KKD A;  1WNS A;  1M56 C;  3FB8 C;  2WLN A;  3JAW A;  5J2U A;  1J5E O;  4DR4 O;  4FJC C;  4YJ3 A;  1SA0 A;  3SGI A;  1WP8 A;  3ABU A;  3G6E V;  2ODM A;  2ZXW B;  4HNA B;  5LOV B;  5L3E A;  1KP3 A;  1YTF B;  1YJ9 V;  3C90 A;  1V9P A;  3VQY A;  2IU0 A;  2A06 H;  2R9I A;  1K97 A;  1P7B A;  2F23 A;  4UCO A;  2VQF B;  1SZX A;  1BMF G;  2Q67 A;  2V7Q G;  2A0L A;  2QKS A;  2Q0O C;  1D5A A;  4QIW F;  2WWW A;  1K4C C;  4O4J B;  2RQ6 A;  3D3Q A;  1ZTE A;  5KAI Z;  2WLL A;  1GKF A;  3MDS A;  3FYI B;  2Y0I A;  3E89 A;  2FML A;  2XAS A;  1EFR G;  4PHZ A;  1XL6 A;  1YJW V;  1BE3 H;  3ZMU A;  5JQG B;  2OCC C;  1K5Q A;  3ZHS A;  3E8G A;  2ZT9 B;  1Y6X A;  1MZE A;  1DGS A;  1M4U A;  3ASO C;  5D5Q A;  3DXR A;  3ABM B;  2Z3Y A;  4FLV A;  1FFX B;  4B3M B;  2DMX A;  3VOU A;  1IBL B;  1OCZ C;  1HNX O;  2DE0 X;  1E79 G;  1VF6 A;  4LFA O;  4JI1 O;  1THZ A;  3CYO A;  4UCR A;  5B66 Z;  2OTL V;  4QGP A;  3K58 A;  3TJT A;  5B1N A;  3BPZ A;  2YDE A;  4B3S B;  2WLK A;  4GCZ A;  4DO2 A;  2QA4 V;  4X1I A;  2CAZ C;  4YY3 B;  2PI5 A;  1BZK A;  2HFE C;  2B5U A;  4GKJ O;  2IJH A;  4BR6 A;  1H2K A;  2PI4 A;  1AI4 A;  2EIN C;  4MTO A;  3J80 N;  4NXM O;  1SQG A;  1O9G A;  4DK0 A;  4JV5 O;  3X2Q B;  4CBC A;  4HYO A;  2ARH A;  1R6N A;  4UVA A;  4O2A B;  2EIJ C;  4LBE C;  3CXC U;  4NXM B;  2JK5 C;  3ETE A;  2OIE A;  1FPO A;  1R3K C;  5FLX N;  1IBM B;  1S0V A;  2XOK G;  3WG7 C;  4UV9 A;  1COW G;  1P7G A;  4MVM A;  3ABM C;  3ZX6 A;  5KHI A;  1YXB A;  1OCZ B;  1S72 V;  2P67 A;  4LFA B;  1HDJ A;  3JD2 A;  1WN7 A;  5GTI Z;  1AR5 A;  1GMG A;  1NVP D;  4BIU A;  2DW4 A;  1S5L Z;  4L8J A;  4KUM A;  2QEX V;  3BRC A;  5IYC O;  2X0L A;  3ZRV A;  1ZX3 A;  1X4T A;  4MW8 A;  4J41 A;  2PGG A;  4O4I B;  1H2N A;  2F66 C;  2Q68 A;  4CH4 A;  3SJQ C;  3STZ C;  3OEE G;  4O4H B;  3AK1 A;  3VBB A;  1R1B A;  5FNV A;  4IIJ A;  4U3F H;  3C3T A;  3RYC A;  4WCE V;  5EBL C;  5BR8 B;  3DSQ A;  3E22 B;  5H6Q A;  2X6B A;  2JDI G;  4W4L A;  1JJ2 U;  2B1I A;  3EVK A;  1BCC H;  5EBM C;  2Q0A A;  4UXN A;  2BCC H;  4X65 O;  5LXT B;  1XQ8 A;  1FJG B;  1WLE A;  2O57 A;  3BHP A;  1FS0 G;  2ITD C;  1JFF A;  3CS5 A;  4K8Z A;  4DV2 B;  4DR6 O;  1IUR A;  5J9P C;  5EBW C;  2YXL A;  3G6B A;  1XHZ A;  4DRX A;  3VQV A;  1ZL8 A;  4JAV A;  2L6L A;  3K5N A;  1SZT A;  3CPW U;  4OPA A;  4NXN O;  5LHH A;  2B1G A;  3AG1 B;  5IYB O;  1IXB A;  1TA8 A;  3KG2 A;  2ZDI A;  4IYI A;  3OUS A;  2EIL B;  1V55 C;  2A79 B;  2EIM B;  4JI2 B;  1QR8 A;  1QU7 A;  4LF4 B;  4FPP A;  4LFC B;  2KG7 A;  1YTF D;  3CD6 V;  2XAF A;  1VMG A;  3P30 A;  2P4K A;  1NH2 D;  3JAS B;  1OJH A;  4I4T A;  2LGQ A;  4FFK A;  3K57 A;  2PTM A;  4X64 B;  1F7Y A;  4FM0 A;  4O2B A;  4U3J B;  3LNM B;  2UUA O;  1GM8 A;  4IT5 A;  4AQY B;  5LMU O;  1SQF A;  1F4N A;  3ZMZ A;  3ZHT A;  5EC2 C;  2UXB B;  1EZJ A;  4DR5 B;  1M1K W;  1Y74 B;  5GTH Z;  1XOU A;  3H1I H;  4OXS A;  1YIT V;  1QLE C;  2RCV A;  2HLD G;  2M6Y A;  4B3T O;  2NN4 A;  2CTR A;  3JD0 A;  5CA3 A;  5CMU A;  3QVN A;  2UXD B;  3K04 A;  1M5I A;  1NU1 H;  4LH7 A;  1YDX A;  3B8N A;  1AR1 B;  2Q4P A;  4DR2 O;  2IM9 A;  3LUT B;  5LYJ A;  1PP9 H;  3CJH A;  5IWA O;  1NR1 A;  3K79 A;  2DQ0 A;  5IJ0 B;  3P3N A;  1H8E G;  4EB6 B;  3P3P A;  5LOV A;  3HB3 B;  2XUM A;  3QO5 A;  2P4V A;  4R7C A;  4DUZ O;  3C3S A;  3OGC C;  1M9N A;  3SPH A;  4DUY O;  3EFF K;  3QO7 A;  3SDL A;  1LR1 A;  1I94 B;  5FPO A;  5EIB D;  2XAG A;  4DW0 A;  3SYC A;  3ETG A;  1Q90 D;  3H9V A;  1PV0 A;  3RVZ A;  3H01 A;  3T1C A;  2EIM C;  2Y48 A;  4O4J A;  2EIK C;  2HJF C;  4LF7 O;  5IYD O;  3ZN0 A;  2C2A A;  1KQS U;  3ZJZ A;  5LP6 B;  1RFY A;  3K06 A;  3U10 A;  5JQG A;  4LFB B;  4PA6 A;  5IDJ A;  1D5N A;  3JAK A;  5B5E Z;  3WG7 B;  2CTP A;  2Z0A A;  4LH6 A;  3SPI A;  1DLB A;  1N0N A;  4WFF A;  3ZS8 C;  1JOY A;  1MSD A;  1FXH A;  1N36 O;  1B06 A;  2HHH B;  2BTQ A;  1N0J A;  1W0K G;  2IJI A;  3ZHR A;  2E74 B;  3GVM A;  4TV8 B;  4AQY O;  4ABM A;  2YIB A;  1WPX A;  5EIB C;  3L75 H;  3OTF A;  3K9S A;  3D3I A;  4DV4 O;  3G67 A;  1JR9 A;  3KCY A;  4WBN B;  1Y66 A;  1IX9 A;  2X6A A;  4MTG A;  4LF4 O;  4ZBM A;  4J7K A;  1JPX A;  3RYF B;  2IU3 A;  2Q6A A;  3ABT A;  3A0R A;  2QKC A;  1Y76 A;  1NI8 A;  4JYA B;  4FLZ A;  1H2L A;  1Y4M A;  3F5T A;  4DR3 B;  3L73 H;  3MHS C;  3T1H O;  4IHJ A;  2W0X A;  1V54 C;  4I5S A;  4Q20 A;  1GK9 A;  2XT9 A;  2M7W A;  1QLN A;  3T4Z A;  3SPJ A;  5KMG A;  3Q4H A;  1H38 A;  3I5D A;  2QWO B;  4UVC A;  1KUQ A;  1R73 A;  4FZ1 A;  4UCS A;  3E8B A;  2XAJ A;  4ZHQ A;  1VQK V;  2NNU A;  2VWJ A;  4X62 B;  1VQ5 V;  1GN2 A;  1GAX A;  1N8R W;  3E2E A;  4UV8 A;  4X20 A;  3L74 H;  1E1R G;  1QVG U;  3OR6 C;  2P06 A;  3DC5 A;  3T1H B;  5KA6 A;  4F6E A;  4DV7 B;  2CUG A;  2F1M A;  4O4I A;  5LA6 A;  3FB6 C;  4DV6 B;  2E5L B;  1VF5 B;  1SC5 B;  3N27 A;  2AHY A;  2Y69 C;  3AG1 C;  3JAW B;  4DV3 O;  3CSX A;  3OR7 C;  4GX0 A;  3TCU A;  1AJQ A;  4JZG A;  4I0X B;  3UQ8 A;  2Q7G A;  1GM7 A;  2ILM A;  3LSS A;  3RYC B;  4FLU A;  2ZE7 A;  5IT9 N;  1YF2 A;  2JS5 A;  3CCS V;  4FMT A;  2XTA A;  1VQM V;  3RYH B;  1K9M W;  1NBM G;  4DV1 O;  1A32 A;  4G28 B;  2X6C A;  2HHH O;  5CBG A;  4MVR A;  1E1Q G;  2NR5 A;  2OT5 A;  1NS1 A;  3N2K B;  4QPK A;  1Z5V A;  2R70 A;  3F5W C;  5B3S C;  3BAB A;  2QDO A;  3UM7 A;  3SYQ A;  2HR3 A;  3AG3 C;  4DRX B;  3M8A A;  3I55 V;  2IH1 C;  4TV9 B;  2V1D A;  1VF7 A;  1TUB A;  1IBM O;  1BGY H;  3CME V;  3FB7 C;  1WAZ A;  1VQ6 V;  2VQE O;  4PJ0 Z;  4EFE A;  2CTW A;  5CB4 A;  1AB3 A;  4I55 B;  4OPH A;  3FAV B;  4WF9 V;  1OCC C;  2FL4 A;  3JAM N;  4DXW A;  1K73 W;  2HVK C;  2Q8V A;  3LDC A;  4FFB B;  2ZE6 A;  1KC8 W;  3JYC A;  4LF8 B;  5LGU A;  4DV0 O;  4X1I B;  3JAS A;  4NB5 A;  5KUM A;  2UUB B;  2PYJ A;  1VQN V;  3CRQ A;  2OCC B;  4JI4 O;  3CMA V;  1OCR B;  4JI5 B;  1WB8 A;  5CA1 A;  1M93 A;  2VS0 A;  2BSK A;  4CC6 A;  4DUZ B;  3K0D A;  1QHT A;  1NTZ H;  4K0K B;  2UU9 B;  2EJR A;  1FD9 A;  1EN4 A;  3KZI Z;  4FLY A;  3CRA A;  1OHH G;  1T5E A;  2LW1 A;  4NTW A;  3K5M A;  1RPR A;  5L3G A;  4B3M O;  4RQF A;  4YJ2 B;  4GYC B;  1XEQ A;  3A8T A;  5LL6 Y;  2ZCE A;  1JVM A;  2JVD A;  3VQW A;  3D36 C;  5CN0 A;  3CCR V;  3RYI A;  5L3F A;  2UXX A;  3W7U A;  2DYS B;  3KKY A;  4F4L A;  5AG2 A;  3T1Y B;  1G6U A;  3T1Y O;  1KEC A;  3CJH B;  4DR5 O;  2UXB O;  3FX7 A;  3O65 A;  3SPC A;  1BHB A;  1U96 A;  2BOC C;  3HKC A;  4GKK O;  4OGQ B;  3K5O A;  1URF A;  4LCU C;  2VQF O;  4MTF A;  4X9Q A;  3I56 V;  1RP3 B;  1VAR A;  1OCO B;  2DYR B;  1L0L H;  4RUF A;  1NTK H;  1IBK O;  3HPL C;  4UCT A;  4JI1 B;  4JF3 A;  2BOB C;  2PZS A;  4HAM A;  1IBL O;  1DK1 A;  5IY5 C;  4JI8 B;  4DW1 A;  5EYP A;  4G27 B;  4MVS A;  5KHG A;  1HWY A;  4J42 A;  3RFR A;  4TQD A;  4DV5 O;  5BMV B;  4KP4 A;  2EZP A;  4DV0 B;  4TUY B;  1OCC B;  3BCC H;  1S5J A;  1XL4 A;  1MZF A;  1O9H A;  1M56 B;  1Q86 W;  2ZIM A;  2ZNI A;  1R6T A;  5J2T A;  1JFF B;  1ORQ C;  1NR7 A;  4LWS A;  1YHQ V;  1WA8 B;  3RT3 C;  3ZHQ A;  4NTY A;  2ADP A;  3L9D A;  4RO2 A;  4D7T A;  3CCM V;  5B3S B;  5IYZ B;  2QSA A;  2D2C B;  3ABK B;  2HP8 A;  2JIZ G;  3ETD A;  3SR2 C;  3CRM A;  1W59 A;  5HFL A;  5BR8 O;  3B09 A;  2OIG A;  5KHK A;  1OV9 A;  2QWR B;  3ZHU A;  1RM1 B;  5BXZ A;  1TAE A;  3ZED A;  5JH7 A;  4TOI A;  3T2M A;  1QVF U;  4F6R B;  3QG5 A;  1N32 B;  3JAR A;  4X66 B;  4DV5 B;  4J80 A;  2YEV B;  1N34 B;  1M90 W;  1JQ0 A;  1MAB G;  2P90 A;  3MD0 A;  1G4Y B;  2WLJ A;  5KLV H;  1DF4 A;  5KMG B;  3OE7 G;  2MW2 B;  2YXH A;  5IJ9 B;  2AW9 A;  4ZI7 A;  3ETQ A;  2UXC B;  2DOS A;  1N33 B;  5C93 A;  4ZHQ B;  1GH6 A;  3W7T A;  4DV7 O;  5B1B C;  2EX3 A;  5B1A B;  4O4L B;  1CP9 A;  1M57 B;  3K08 A;  3SPG A;  4E4E A;  5DN6 G;  3CWB H;  1XMO B;  3K9A A;  1SQP H;  1P4R A;  3OMA B;  1ROP A;  2IBZ H;  5JVD A;  4OX9 O;  1PKX A;  1SS3 A;  4FIP C;  2KB1 A;  2Y4T A;  3JAT A;  3JAL A;  1YSC A;  4IL6 Z;  4YIO A;  3JSN A;  2GTS A;  1R6K A;  3R65 A;  2V4D A;  4QE7 A;  4JI6 B;  4TWK A;  3G80 A;  1FAF A;  4J9Z B;  2H94 A;  5KX5 B;  3WFV A;  2Q7H A;  4B7E A;  2EIL C;  4Z2W A;  4JYY A;  4PA7 A;  3L72 H;  3HKB B;  2DN9 A;  3ZMT A;  1FFX A;  3LDD A;  2R9R B;  3CHX A;  3ZHV A;  4W4K A;  1US6 A;  5ITZ A;  1K33 A;  4DV4 B;  4N21 A;  4DR1 O;  3SJA C;  4D6T H;  2JGU A;  4LF5 O;  4BW5 A;  3FFQ A;  5A2Q N;  2CK3 G;  5LP6 A;  4CH5 A;  2B9Z A;  4YIP A;  4JI4 B;  3CC2 V;  2DWE C;  1JJO A;  1Q3E A;  3CXH F;  2CTQ A;  2W6I G;  5F2V O;  2LP7 A;  4YJ3 B;  2DYS C;  2L35 A;  2E76 B;  4I50 B;  4X88 A;  1AI5 A;  4LF6 B;  2ZR2 A;  4XDJ A;  3FB5 C;  5JCO A;  3J81 N;  4O2A A;  4FFB A;  3CCU V;  4GX1 A;  4LF9 B;  2YC0 A;  2EIK B;  1K34 A;  4EEQ A;  2ZE5 A;  3RN4 A;  1H2G A;  3CCE V;  3QO8 A;  1YCI A;  4CH6 A;  2GDS A;  4H44 B;  3OEH G;  4I9Q A;  5JJN B;  2QTS A;  3WB0 A;  3EHB B;  4YHH B;  1B6Q A;  3ASN C;  1GM9 A;  5KHH A;  3RYF A;  2ZD9 A;  3JCU Z;  1FFT B;  1VQ4 V;  2GV9 A;  4DR4 B;  1UJW B;  1Q6I A;  1I94 O;  5B1A C;  4NVP A;  2LQT A;  1KU9 A;  1GRJ A;  2PY5 A;  3J7A U;  2EIN B;  2QE7 G;  4R6Z A;  2UUC B;  1LUV A;  3H1J H;  5JJJ B;  1Q5O A;  1YJN V;  4B3R O;  1J95 A;  5K1X A;  5JWP A;  5IWA B;  3LDE A;  4MSW C;  2WLM A;  5K1P A;  5KA5 A;  4BWA A;  1FYJ A;  2JRI A;  1VF6 C;  2OWO A;  3RW0 A;  3N2G B;  2E5L O;  1IXM A;  3G71 V;  2EUL A;  2WA3 A;  4ICG A;  4JI6 O;  3MHH C;  1M57 C;  2QWQ B;  4JTD B;  1VP7 A;  4PV1 B;  4H37 A;  5B1O A;  5LXT A;  3RVY A;  2XND G;  5EZY B;  1ZSP A;  2JEU A;  1S5H C;  4QPJ A;  3K3W A;  3GWO A;  3B4S A;  4PDV A;  1Q6H A;  1EM1 A;  3ML0 A;  2F95 B;  1RSO A;  2E75 B;  1GN4 A;  2Y4U A;  4GX5 A;  1HP8 A;  1NKD A;  5EK0 A;  2EIJ B;  2UUA B;  1PL4 A;  3ABK C;  3DGE A;  1JA8 A;  2LGW A;  2ADQ B;  3HKE B;  1XIL A;  1KBH A;  3WB1 A;  1SF9 A;  5BMV A;  4RWU A;  3AG4 B;  4JYA O;  4LFC O;  2GHY A;  1K4D C;  1YZB A;  2R72 A;  3ZMV A;  4JI2 O;  4X8A A;  4TT3 G;  5DM6 V;  2Z5U A;  1XI1 A;  2H3O A;  2YID A;  1I08 A;  2EBO A;  5DEC A;  3A0B Z;  5KHJ A;  2ZXW C;  3BAA A;  4B3R B;  2GBO A;  1PL0 A;  3D8C A;  4I4T B;  3UO3 A;  4X1K A;  2YI8 A;  4FLX A;  3FD9 A;  3UT5 B;  2JJ1 G;  4UFZ A;  4PI0 A;  4ZKI A;  3CC7 V;  1FXK C;  1NJI W;  4PA9 A;  3S3W A;  1CXZ B;  2YI9 A;  2CDY A;  4HNA A;  4JI3 B;  4JGS A;  1Y74 A;  1OZ0 A;  3K0G A;  1L1F A;  2OCH A;  4UB6 Z;  4TSF G;  4X65 B;  5D5P A;  1HR0 B;  4JTC B;  4F6R A;  2Q9L A;  1HNZ O;  1XBL A;  1BS3 A;  2BSK B;  4PEL A;  2AGA A;  2FB5 A;  2CH7 B;  1F51 A;  1QBZ A;  4AHC A;  2AZ2 A;  1FXK A;  1P49 A;  2WLL B;  3ZCC A;  1IDS A;  5DED A;  1Q81 W;  3AG2 C;  4UUJ C;  1NVP B;  3U0Z A;  2F4V O;  2YSU B;  3W7W A;  1PNM A;  2P5O A;  1XDC A;  5KAF Z;  5GON B;  3RYI B;  1SET A;  1EN5 A;  3ICX A;  3OGI B;  3DTU B;  4CC5 A;  1Z2G A;  2VRZ A;  4IIJ B;  1WB7 A;  3OT7 A;  1NQT A;  4CS2 A;  2HJD A;  3ZRX A;  2RN9 A;  2EZO A;  1TVK B;  3JAL B;  3CEI A;  4JI0 O;  3ABL B;  1W0J G;  3M99 B;  4KHP O;  3P32 A;  5LGN A;  4AI8 A;  5KX5 A;  4ZOL A;  4U7O A;  1HNW B;  4D7S A;  4LF6 O;  1CEZ A;  1ZAU A;  3ZRS A;  3UKM A;  4PI2 A;  3AG2 B;  4NTX A;  4JV5 B;  1Q6U A;  4IYH A;  5EYP B;  3L71 H;  3H1K H;  3HKD B;  4B08 A;  2P22 C;  4YY3 O;  4X64 O;  4DR1 B;  1Z5W A;  2KQX A;  3FKS G;  3MAQ A;  1I5X A;  1NTM H;  3E86 A;  4Z1V A;  3CE2 A;  4KFM A;  4MW3 A;  1ARO P;  2LFR A;  5H6R A;  2JGD B;  4K0K O;  5A9G A;  5B1B B;  2FYU H;  3ABL C;  1AIL A;  1SES A;  1Y76 B;  2A9H A;  4P9O A;  1N34 O;  1AVM A;  2JEX A;  4X66 O;  3RGB A;  2UUB O;  4U3J A;  4K8X A;  1MG1 A;  3A0H Z;  1PNK A;  2YIB D;  4IHJ B;  4WFE A;  4WFG A;  3BA8 A;  1X59 A;  1SRY A;  4DR7 B;  2BE3 A;  3OUF A;  4LNU B;  4UCU A;  3CCJ V;  3OM3 B;  4DV2 O;  1U97 A;  3SYO A;  1AR4 A;  1NZ6 A;  1HW7 A;  2VQE B;  4FK5 C;  4R50 A;  1SQX H;  2QGN A;  4PA3 A;  5CBF A;  4DYL A;  3B40 A;  4AIL C;  2QM8 A;  3LNN A;  5CA0 A;  1KB9 F;  2RNB A;  2N74 A;  2YS8 A;  1KYO F;  3JAR B;  1CPY A;  5CBH A;  3CC4 V;  2ZIN A;  2MK3 A;  2UXC O;  2P7T C;  4CZZ A;  4MVU A;  1K92 A;  5BZB A;  1G8M A;  1PPJ H;  2ZE8 A;  1SKV A;  1XNR B;  3G4S V;  1Y67 A;  2CGN A;  3BFR A;  3N2G A;  1K7D A;  4K3A A;  4O4L A;  1QNM A;  3E8F A;  5EC1 C;  1W2B U;  1VIB A;  3PJS K;  2N04 A;  2YIA A;  3OD4 A;  4GZR B;  1XNR O;  4TQF A;  2G38 A;  2NLJ C;  4PDL A;  1IZ3 A;  1BHA A;  4H0L B;  2LJ2 A;  1NH2 B;  3H1L H;  3IGA C;  2PF4 E;  1BSM A;  4DV3 B;  4G2K A;  3EXA A;  3BVO A;  2AZ0 A;  3RBZ A;  3CP1 A;  4YXW G;  5C8Y B;  1UFI A;  3HR0 A;  3QNE A;  4I9W A;  5BY1 A;  4RUE A;  1Q8I A;  3HKE A;  4X62 O;  4Z1M G;  4ZIB A;  5IE9 A;  5J2U B;  4J7Z A;  3ZRW B;  4I55 A;  1XRE A;  4RQE A;  2GSM B;  1AI6 A;  4DR7 O;  3OAA G;  3E35 A;  2IJJ A;  3ZN1 A;  1KD1 W;  1F4M A;  2DWD C;  4GX2 A;  2K1E A;  4MS2 A;  4QNH B;  4MVQ A;  1AP6 A;  4X1K B;  2HG5 C;  1XMQ B;  2AHZ A;  5E1A C;  3AG4 C;  3ASO B;  2Q7E A;  1V55 B;  1VEW A;  3H1H H;  4JI8 O;  5LYJ B;  4PD4 F;  2PUS A;  4JZ2 A;  4X1Y A;  2H8P C;  4I0X A;  4GLX A;  3CCV V;  5IJ0 A;  1ZUQ A;  4UVB A;  3TGU H;  4CH3 A;  4EB6 A;  1IBK B;  4J9Y B;  1H2M A;  4JYC A;  1XMQ O;  2GUZ A;  3TK1 A;  3THO A;  5L3D A;  4JI5 O;  4JPR A;  3RYH A;  1PNL A;  2F4V B;  4GKK B;  3UO2 A;  4NKG B;  4JTA B;  4LF8 O;  3DXR B;  1JCH A;  1N36 B;  3WU2 Z;  2OYQ A;  2CH7 A;  2P6J A;  1PD3 A;  3K59 A;  3N2K A;  3A2F A;  2K9P A;  2ITC C;  3W7S A;  5LMN O;  4X20 B;  5H5N A;  4LFB O;  3SJC C;  2IW5 A;  3IFX A;  1YI2 V;  4JI0 B;  3O9O A;  1TUB B;  2ATK C;  5LA6 B;  2WLI A;  3D36 A;  3ZBH A;  5GON A;  5CB4 B;  2WSS G;  3T4D A;  2HKO A; 
#chains in the Genus database with same CATH homology
 4J7K A;  4KXR A;  4J11 A;  3FX7 A;  4IYH A;  4J7J A;  4W4K A;  2GTS A;  4J41 A;  4W4L A;  2G38 A;  4J42 A;  4J10 A;  4IYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...