4KXRA

Structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords PE25
publication title Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 35
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4kxrA00
4W4LA 2GTSA 4J42A 3FX7A 4J41A 4KXRA 4J7KA 4IYIA 4J7JA 4J11A 2G38A 4J10A 4IYHA 4W4KA
chains in the Genus database with same CATH superfamily
2A3QA 3CE2A 1IBLO 4K0KO 2KB1A 4X66O 4X8AA 2P7TC 1Y76A 1BQZA 5A9GA 3CCJV 1JFFB 3K59A 3CC2V 3LUTB 3RT3C 3OMIB 1N4CA 5L3BA 1DTOA 1AI6A 4PA4A 1XQ8A 2Q8VA 1V55B 5BMVB 1MABG 2WWWA 4LWSA 4MVMA 2UUBO 1H38A 1GAXA 2IBZH 4DV5B 2EIKC 4GLXA 3SYCA 4LF5O 1I5XA 1X4TA 3K5NA 5ITZB 5H6QA 2KG7B 3AG7A 3DTUB 5EBLC 1JMKC 3MHHC 4DUYB 4DV1O 1YXBA 1DLBA 3ASOB 5HFMA 3FAVB 1FS0G 2P90A 4DR5B 2AHZA 2UXDB 2QWPB 2Z0AA 1IURA 1IDSA 3OAAG 4K8ZA 1ZTEA 4BAYA 3T1HO 3QVNA 2WLMA 4ZI7A 2D3OW 1FJGO 4K8XA 4JV5O 5KMGB 1WPXA 3ZMSA 3CRAA 3E8GA 1HDJA 4CS4A 2QE7G 2HP8A 3K0DA 3WG7C 3VOUA 2UUAO 1M1KW 3H1LH 1WNSA 1QVGU 1OCCC 1XHZA 1TUEB 1W2BU 4QPKA 2D2CB 1QLNA 1P7BA 1YCIA 5B1AC 2EILB 2XAHA 2ZM6B 2XOKG 2YDEA 4MVZA 4QJFB 3B40A 4JI5B 4LFBO 4DRXA 3BA9A 2WLNA 4MW3A 2BSKB 1GN3A 4GCZA 1TUBB 3ZHTA 2QEXV 3B77A 4IHJA 3J81N 2OIEA 4KUMA 3JCZA 4DK1A 4BWAA 4IIJA 1XHXA 2H94A 3M8AA 3K9AA 1VP7A 4LF6O 5LGUA 4JZ2A 2EIMB 3ZMVA 4I55B 5IJ0B 1VQLV 1Z5VA 4E4EA 1VQ4V 4RAIA 2HG5C 3KG2A 3E8BA 4KFMA 1P7GA 2ZR3A 1SQBH 4TV9B 3K03A 5KX5A 1FAFA 2MW2B 5CA1B 5GONB 2RN9A 2LO1A 1XL6A 4DK0A 1WB7A 2OCCB 2DJVA 2DYRB 4LH6A 5LXTB 1G6UA 4WBNA 4O4LA 3D36A 4YJ3B 4CC6A 3EVKA 4ZOLB 1PL4A 2EINC 2OT5A 3N2GB 4JI4B 2JDIG 3UM7A 3RBZA 4UB6Z 3PJSK 1AI7A 3B09A 1YTFB 4LCUC 5B1NA 2GDSA 1EFRG 3ASOC 2WLIA 4DV0O 1PNKA 1YIJV 1K9MW 2R9RB 3AG3C 4DV7B 4AI8A 3P32A 3CMEV 3JD0A 3LNMB 3X2QC 4JAUA 4O2AA 3FB7C 4FIPC 1Y74B 3ABKB 1VF6A 2DN9A 3LSUA 4NYKA 4JTAB 2GUZB 2BOCC 1BHBA 3SJAC 3IFXA 1P49A 5EC2C 4X1KA 1K4CC 1FFXB 3BEHA 3TK1A 2LQTA 4NB5A 3ZN0A 3SYQA 3T2MA 1WN7A 5B1OA 1WAZA 3RFRA 4UUJC 3HKCA 5CN0A 2OWOA 1K33A 4NKGB 4DR7B 1MZFA 1RSOA 4PDVA 4B7KA 1QR9A 3L71H 2V1DA 1Q6IA 3UO3A 5F2VO 5JCOA 1US6A 1SQGA 3ASNB 1KP2A 1SA0B 2BOBC 5IYCO 4B3RB 2EIMC 3L9DA 2QDOA 3JARA 4DR1O 3J7AU 4OPHA 4O4IA 4LBEC 1V9PA 4CZZA 3ZHVA 3JAMN 4F4LA 3ZHUA 1ZLZA 4DV4O 3IAYA 3JD3A 3DXRA 3G6BA 1G8MA 2DWDC 5B1BC 3JALB 5HFLA 2XHBA 4JAVA 2B1IA 2OCCC 3CHXA 1JCHA 3CS5A 1NVPD 3ZIAG 1XMOB 2CH7A 4DR4B 3UT5A 4WCEV 3CJHA 1AJPA 1GM8A 2ZM6O 2IW5A 2YEVA 4JI0B 1MSDA 2CDYA 5KAIZ 4XBFA 4WFAV 2P4KA 5LL6Y 1BE3H 2LP7A 4XDKA 1HNXO 1TVKA 4Z2WA 2F4VB 4GKKB 1E1RG 2L35A 3FKSG 2YI9A 1BSMA 2HJDA 3L70H 1FXHA 3HKBB 3F5TA 3C3SA 1P84F 4DV3O 2ZD9A 4NR1A 4D7SA 4BW5A 4NTXA 5J9PC 2HVKC 2B9ZA 4UCVA 2WLKA 1PM9A 1VQOV 3JD2A 4N23A 3RYIA 1XI1A 2QWRB 4OX9B 1PKXA 4PDRA 5JVDB 1SQFA 4X89A 1QU7A 1UFIA 4AQYB 3SPCA 4RUEA 1L0NH 4YIOA 1K5QA 1DK1A 3IC7A 4KXRA 1CXZB 1Q6UA 2Y4UA 3AG4B 1FXKB 4I4TB 4DUZB 2Y69C 1KP3A 2ADQB 3VBBA 4CH6A 1SQQH 3WB0A 4IGGA 1SRYA 1NI8A 3CP1A 3JAKA 1Y4MA 1B06A 2LW1A 4EB6A 1YEWA 3E8HA 5LA6A 4JAAA 3ASNC 5KHHA 4MTOA 2JK5C 1ZSPA 3ABUA 4X64B 1FYJA 2KKWA 1OCZB 5IYBO 5L3CA 2HFEC 1WB8A 2UXCO 5H9CA 1Y66A 3TCUA 4KHPB 3E86A 4WFFA 2YI8A 1H2NA 5K1XA 2F93B 3ABLB 1AROP 5LOVB 4TV8A 1NR1A 4FLZA 3N2KB 3FFQA 5FPRA 3RGBA 4W4KA 2ETNA 4L8JA 1ORQC 1Q7YW 1JX9A 3E22A 4JI2O 3JCUZ 1I08A 3H9VA 4KP4A 4Q6GA 5DN6G 3CX5F 4X62O 3ZN1A 3OGIB 4ZHQB 3SJCC 4X20A 5GTIZ 4FFBB 1SESA 3W7SA 2HVJC 2IM9A 5AG2A 3OM3B 2N74A 4DV6O 1Y67A 1B6QA 2PUSA 4J7KA 4JYBA 1MOFA 1H2GA 4LP8A 2HKOA 3E22B 4BIZA 2EIJB 2QR4A 2AZ0A 5CBGA 4G27B 3U11A 4F6RB 1Z2GA 4B7EA 1G1XB 2P6JA 3CRCA 2GBOA 1NQTA 4LF9B 3RN4A 1VQ5V 4TQDA 1SERA 3CEIA 4JYYA 1QLEB 1RPOA 5LP6C 4FZ0A 3OR6C 3ZRWA 4P9PA 3FX7A 1QCEA 5L3GA 4X65B 4J11A 4JI6O 3C3TA 5CA3A 3SGIA 1VF5B 2WLHA 1OCOC 3A0HZ 4MS2A 1F51A 4TUYA 1GN4A 1I7FA 2R72A 2HLDG 3DSQA 4XDJA 4U7NA 1Q43A 3CC4V 2A06H 2VS0A 1Q3EA 4YY3B 1VEWA 5LBQA 3AG4C 2Y48A 3M7MX 4B3MO 3W7WA 5JH7B 1OV9A 5FNVA 1XMOO 1I94O 1PNLA 4HZ3A 1XNRO 2ATKC 5B3SB 1E79G 2VWKA 4U3JB 4UV8A 1L1FA 2UUCB 1JJOA 1MSWD 1O9GA 4HNAA 4FFKA 2XNDG 5C8YA 2Q69A 3NXSA 4FVMA 1Q86W 2XAQA 4GT1A 2YIBA 2LW7A 1IX9A 1ENVA 5FNVB 2IH1C 4OGQB 3A0BZ 2FB5A 3AG1C 3ABLC 3T4DA 4ABMA 1K7DA 2ZXWB 4HAMA 1F4NA 2PGGA 3UO2A 4JYAB 2JIZG 4OX9O 1M57B 4UVBA 3OMAB 4J10A 3OUFA 3KKYA 1AR5A 4AHCA 1K73W 2HHHO 5IYDO 4AQYO 1WP7A 2CGNA 3H1KH 5CB4A 4LFAO 4LFCB 4I50A 4R50A 2NLJC 2Q5ZA 3OT7A 1N33O 4LF4B 3C90A 1R3JC 2FKXA 5KHJA 2E5LB 3D3IA 4DR6O 1BZKA 2YIBD 4P2ZA 4UCRA 1YJ9V 3CCEV 4FMTA 2RCVA 4TOIA 3CPWU 5B5EZ 2UXBB 1KKCA 1JA8A 1AI5A 2Q4PA 3JSNA 5EYPA 2CK3G 2MK3A 4UV9A 1HR0B 3OEHG 4ZBMA 1OHHG 2IJIA 5LHGA 1FXVA 1SQPH 3G80A 3I55V 3CCVV 2X0LA 3BVOA 4LNUB 4FLUA 2JGDB 1GN2A 3ZRXA 3CCMV 2QGNA 2W0XA 5LMUO 1HNZB 3EFFK 2JJ1G 1WA8A 2WAMA 4LC1A 4YHHB 4FK5C 2C2AA 1Y76B 2XUMA 4UCTA 2CGOA 4PA3A 4JYCA 3VQYA 2Q0OC 1EN5A 4E2LA 2FYUH 2QJ1A 4AILC 1VQMV 4U7OA 2LGWA 2YXHA 4Q20A 3JATA 3FYEB 1RM1B 3QTCA 2P4VA 1NTZH 1U96A 4LWSB 4DR2B 3HPLC 5EIBC 2YXYA 1VQKV 3ZRVA 3FYIB 5JJEB 4NVPA 5JJJB 1KC8W 4NXNB 1MMMA 2W0FC 2ZT9B 4B3TO 4CC5A 2CUGA 3ZS8C 5DECA 4RUFA 1J5EB 2GSMB 3BA8A 3WB1A 5IT9N 1AJNA 4J42A 4EEQA 2ZXWC 3TGUH 2WLJA 2ZDIA 1N34O 1K5SA 2EBOA 2GTSA 4MVSA 3CCSV 1B3QA 2UU9O 5IJ9A 4ZI7B 2EJ7A 2QKAA 3LNNA 4WFEA 1D2DA 2CTWA 4CH4A 1LUVA 3QG5A 3JAWA 3K5OA 4UVAA 1ZUQA 2B5UA 4X88A 5GTHZ 3APQA 4TSFG 4MT8A 1BMFG 2AHYA 1Q5OA 4DRXB 2GTAA 2M7WA 4K35A 1YJWV 5J2UA 2LJ2A 1PV0A 3FD9A 1SQXH 2BTQA 1NTMH 2VQFB 4IHJB 2DQ0A 4MVOA 3K57A 1S5JA 4IIJB 4LF7B 2F95B 4QGPA 3SR2C 4GKJO 2FMLA 1BGYH 1H8EG 1V55C 5E79Z 1N36B 3D8CA 1RP3B 1KYOF 4NXMO 5KX5B 1R6NA 3ABMB 3DC6A 4O4JA 1S77D 1JJ2U 3IJ4A 3DC5A 1NH2D 3QO5A 1ZWIC 3BFRA 2QKCA 3BABA 4UCSA 4LF4O 3CSXA 1IVSA 2X7RB 3D3QA 2CTRA 2ZE8A 1P4RA 4O4LB 4WBNB 1M90W 1E1QG 1K4DC 5LGNA 2AGAA 5KA5A 1QR8A 1HW7A 1F23A 4LF8O 2ZIMA 3BY6A 3SJQC 4FM0A 5D5PA 4TT3G 3CWBH 1WP8A 4IYIA 1AB3A 2PYJA 2EJRA 2WLIB 3P3NA 4PDLA 3CCQV 4W4LA 1QHTA 4J9YB 1IBKB 1R6TA 5LYJA 1GH6A 1A32A 4JZGA 3W7TA 1Q82W 2ZIOA 2QSAA 2ARHA 4O2AB 3S3WA 3ZBHA 2ITCC 2EILC 5LMNB 5IWAB 3TETA 5IE9A 4O4HA 1CP9A 1M93A 2ITDC 4X1KB 1Z5WA 1SQVH 4DV5O 4DV2B 1K34A 4U3FH 4IL6Z 3Q4HA 3OMNB 5E1AC 3HKCB 1BCCH 4DUYO 4D6TH 5LHHA 4UB8Z 3G6EV 1RSOB 1IBMB 4GUNA 4DR5O 1HP8A 4DR2O 2VQEB 1BQ0A 1NVPB 2UXDO 3LDCA 2OIGA 4JI7B 3MHSC 3H1IH 3BCCH 1SS3A 1F7YA 1NU1H 2JRIA 3ZMTA 3WFVA 1GM9A 5EZYA 1DGSA 1YDXA 3JARB 3P3PA 2DYRC 4O4IB 1KECA 5IY5B 3RYCA 4ICGA 3FB6C 3HR0A 3W7XA 3CB2A 1CPYA 1SZXA 3P30A 4X1YA 3DXRB 4JI5O 1T5EA 4JI3B 1S76D 2RMKB 3T1YB 2KQXA 5FLXN 4MTGA 3HKEA 4NTWA 3CCRV 3I56V 4A5UB 3D36C 3K5MA 4FM1A 2IJHA 2CH7B 3UT5B 2Q67A 2Q6AA 3CJHB 3K0GA 3ABKC 5LP6A 1M9NA 3VQVA 1FD9A 3JYCA 2YEVB 3QNEA 1VQ6V 3AK1A 1V54B 2R9IA 4J80A 1BL8A 1TVKB 4MVUA 2XAFA 2XASA 2DWEC 4JI1B 4I0XA 1CEZA 5LHIA 2A9HA 2VQFO 4D7TA 1FKAO 2XTAA 2EZOA 3SJBC 2IU0A 1VQPV 4YJ2A 1NTKH 1ZX3A 1VF6C 3E35A 4DR3B 4FLVA 1JQ0A 3ABTA 1VMGA 1WLEA 4GX1A 3RYIB 2RDCA 3L75H 1KD1W 1PD3A 4GYCB 1LR1A 2FL4A 1KBHA 4JI4O 2QTSA 3SPIA 2JS3A 2EULA 1S0VA 3JASA 5LGTA 3N27A 4J7JA 5KUKA 3RWRD 3ICXA 4MTXA 4DV7O 4JTDB 2VWJA 2ZQMA 2PI4A 4DXWA 2W6JG 3STLC 3UKMA 1IXMA 2IJKA 1KU9A 3MAQA 4UCUA 3JAKB 1GRJA 1NKDA 4O2BA 4J7ZA 1IBLB 4K0KB 4EB6B 2E74B 5D5QA 3I5DA 1IZ3A 1UPGA 3K04A 2HR3A 2Y0PA 3SPHA 4X66B 3BPZA 1XEQA 5LA6B 5BY1A 5BR8B 1I5YA 3ZEDA 2E76B 5J2TA 1IXBA 3K9SA 2XAGA 3OR7C 3GVMA 4UCOA 3QO8A 1B04A 5B66Z 2X6AA 4B08A 4BIOA 3WU2Z 2WLLA 3A0RA 4DR7O 2PF4E 4TV8B 5GW7A 2V4DA 1R3LC 2F23A 3ETEA 1YITV 2PTMA 3IGAC 1DF4A 2QWNB 4LF5B 4DV2O 3U0ZA 2W6IG 1AI4A 3RYFA 4R6ZA 1OCRB 4B3RO 1TGOA 2GV9A 4X20B 2GHYA 3T1CA 1UJWB 1KB9F 1YVWA 1LUWA 2UXXA 2JEXA 1Q81W 1XILA 4H13B 4X1IA 3T1HB 2ILMA 5L3DA 4Z1MG 3K79A 4JV5B 2O57A 2LFSA 3E89A 1JOYA 2UUAB 1QNMA 3U10A 1FXKC 1GK9A 1JR9A 2JEUA 3ETQA 3ZRWB 5IYZA 3L74H 1XREA 4FM2A 2NR5A 1VQ8V 4DR4O 5JQGA 4LFBB 4JTCB 4JI0O 5EBWC 1M4UA 4TUYB 3KCXA 1VARA 4JI3O 3T1YO 1YJNV 1X59A 1GKFA 4J9ZB 4X9QA 2UXNA 4NTYA 2F4VO 4GKKO 3BRCA 3ZJZA 2Z3YA 3FB8C 3ZHRA 1OCZC 2IU3A 2M6YA 2JJ2G 1GTOA 4LF6B 4Z1VA 4HYOA 3RYHA 4I7ZB 2DOSA 3BAAA 1AR1B 3AG2B 5KLVH 1GM7A 2YICA 3E83A 1VQ7V 3CCLV 4HNAB 1NS1A 5C8YB 2DQ3A 3G4SV 1YHQV 4FZ1A 3A2FA 4XDLA 2DMXA 5KUMA 4H33A 4F6EA 3ZRSA 5DM6V 3WG7B 4MSWC 4DW0A 5EIBD 3LSSA 4JGSA 4H37A 4DO2A 3JSLA 4DUZO 3LSQA 5FPOA 5B1AB 2YSUB 2CTQA 1O9HA 4CH5A 2EIJC 4FLXA 3JD4A 1R6KA 5EK0A 3KCYA 2Q68A 5CB4B 1JFFA 1EN6A 3CXCU 1PPJH 2G38A 4I50B 4DV0B 4X64O 1QLEC 4BR6A 3B8NA 4GX5A 3E8FA 1F4MA 2JS5A 3QO7A 2PYLA 3T4ZA 2YUAA 3SYAA 4KHPO 4PD4F 1HWYA 1YSCA 3ETDA 5BMVA 3G67A 1S5LZ 5BR8O 1MZEA 5EBMC 2CAZC 1ZL8A 4LR3A 5ITZA 4B3SB 1SC5B 2KG7A 5EYPB 2WSSG 1QBZA 1Y6XA 3CRRA 3H1HH 1KKDA 5H5NA 3SDLA 4R8CA 1VQ9V 1S5HC 3FAVA 4CS3A 2NN4A 5B3SC 5KA6A 1W59A 2EZPA 1BT8A 4WF9V 1WA8B 2A79B 1RFYA 4WFGA 2K1EA 2EINB 3ZMZA 1ZL8B 5C93A 1BS3A 2BTOA 3AK2A 4ASUG 4L87A 3S3XA 4MVRA 5KMGA 1AP6A 1GO3F 4FLYA 1U97A 3GWKC 1EN4A 3A8TA 4LF9O 4DR1B 5CA0A 5FL7G 2QM7A 3AG3B 3OW2U 2E3CA 4OPAA 4FLWA 3JATB 4G2KA 2A7WA 3AG2C 1KMIZ 3X2QB 4DV4B 2DYSB 5KHGA 2IJJA 4X65O 1M57C 2P5OA 2ZE7A 4GZRB 2BSKA 2WPDG 1TUBA 5CBHA 4JI8B 1AILA 2XAJA 3K06A 1S72V 5BZBA 2ZR2A 3JD1A 4YY3O 5CA0B 2LGQA 3RVYA 3APOA 1YF2A 1K8AW 3SYPA 4DYLA 4I55A 5IJ0A 4EKWA 1PNMA 4C7UA 2F43G 3OD4A 2P06A 3SYOA 1PP9H 1HNXB 3ZX6A 2WA4A 5IJ9B 1AVMA 4TV9A 2AZ2A 2UUCO 2QWOB 3UQ8A 3TJTA 5CA1A 2DW4A 3ZHQA 5GONA 4QE7A 3JAWB 5IDJA 2H8PC 4JASA 2L6LA 4QNHB 1OZ0A 4I9QA 4DV3B 1NH2B 5LXTA 4QPJA 2ZINA 1I0HA 1EM1A 1JPXA 2Z5UA 4YJ3A 4FPPA 4GX0A 4ZOLA 5J2UB 4JYAO 4UFZA 3N2GA 2ZE5A 3WB2A 5A2QN 2YS8A 1SF9A 2BTQB 5B1BB 1GN6A 3K08A 1Q6HA 2Q9LA 2R9AA 4LFCO 1SKVA 3K5LA 4CBCA 1KQSU 1Q90D 2CTPA 2ZKOA 3R66A 2N05A 1RM1C 4LH7A 3OTOB 1M5IA 1H2SB 2YXLA 1Y74A 2E5LO 1BHAA 2LFRA 2OCHA 2GUZA 2XT9A 4O4JB 4PA7A 4TWKA 2ZE6A 2UXBO 1ZAUA 1D5AA 1FFXA 1FFTB 2X6BA 1H2LA 3GB7C 3EHBB 2UXCB 1HR0O 1COWG 2Q7HA 2DYSC 4RWUA 2A0LA 4WFBV 1XBLA 3K58A 1YTFD 1HNZO 2Q7GA 3O9OA 3LDDA 3CMAV 3NR7A 4DW1A 4YHHO 4EFBA 4JI2B 4OXSA 4B3SO 1WJZA 4ZIBA 5K1PA 4X62B 1SA0A 2QWQB 3OFNG 3ETGA 5LYJB 2ZDIC 4I5SA 3RW0A 1AJQA 5H2FZ 2PI5A 5JWPA 2Y69B 2F1MA 1H2MA 4DV6B 4PELA 1XMQB 4O4HB 3B4SA 4FJCC 2ZNIA 4IYHA 1N8RW 4UXNA 2YIDA 2KSDA 1HNWB 4QE9A 4NXNO 3Q4HB 3B2EE 3JALA 4UVCA 1W0JG 1SETA 5KAFZ 1J5EO 4IT5A 4MVQA 3W7UA 4I9WA 1D5NA 1THZA 2RNBA 4EFEA 2PY5A 4JI6B 1AP5A 3G71V 3ZHSA 1N0JA 3KZIZ 2E75B 1XNQB 3OGCC 1OJHA 4JF3A 3ABMC 3GWOA 1TA8A 4PI0A 2VRZA 3CYOA 5KHKA 4FLTA 4JI8O 1DF5A 3SPJA 4B3MB 1L8DA 3H01A 1M56B 2F66C 3TXSA 1XOUA 4PDMA 5EZYB 5H6RA 1EBOA 4WFHA 1I94B 1NR7A 1VIBA 3M99B 4P30A 3SPGA 1NT2B 1NJIW 1R3KC 3DGEA 3RYCB 3HKBA 1XNRB 4H44B 3J80N 1ROPA 1EZVH 4X1YB 1FPOA 4CS2A 3CC7V 4BIUA 2ADPA 4RQFA 1MA1A 2Q7EA 3FB5C 4R7CA 5JVDA 3H1JH 2N04A 2PZSA 4K3AA 3HKEB 2R70A 1LNQA 5DEDA 4HBNA 3ZMUA 1FXKA 1H2KA 4I4TA 4LF7O 5LP6B 4H0LB 4ZKIA 4MW8A 1MG1A 3O65A 2EX3A 5CMUA 1R3IC 1N36O 5L3FA 2RJZA 1N0NA 1OCOB 3LDEA 2BCCH 4PA9A 1S3JA 2HHHB 4I0XB 3CD6V 3R65A 4LFAB 3HB3B 2QM4A 4PJ0Z 3CRMA 1N33B 2Q73A 4YJ2B 1N32B 1YZBA 3PN1A 3EXAA 3OTOO 2Y4TA 1YI2V 1GMGA 1XDCA 3THOA 2ODMA 4DR6B 2AW9A 2ZCEA 5LOVA 2Q0AA 4MTFA 3N2KA 5JCOC 2NNUA 4RQEA 4CH3A 2JVDA 3JASB 2IH3C 1KUQA 2RQ6A 1IBKO 4PI2A 5IY5C 3AG1B 4ZHQA 3OE7G 4FFBA 5LMUB 2B1GA 1K97A 4O2BB 2V7QG 2P67A 5LMNO 5IWAO 2QKSA 3ZCCA 1K92A 5BXZA 3OTFA 2UUBB 3RVZA 2QTOA 2WA3A 1L0LH 1Q8IA 3VQXA 4P9OA 2CE4A 3K3WA 4TQFA 1M56C 4F6RA 2YIAA 5J2TB 1K3EA 3OEEG 1H8HG 4DV1B 3STZC 1MNGA 1R73A 1J95A 3CRQA 2WLLB 1IBMO 1PL0A 4PV1B 5KHIA 1V54C 1XMQO 1NZ6A 2VQEO 1VQNV 2OTLV 1VF7A 4JI7O 1NBMG 4B3TB 1HNWO 1FJGB 2ZNJA 2AXTZ 3RYFB 3F7VC 4G28B 3UCSC 5TISZ 3B8MA 4YIPA 2BE3A 2K9PA 4PA6A 5JH7A 4BW9A 1W0KG 4N21A 1N34B 2X6CA 4GX2A 3BHPA 2QM8A 1XNQO 1R1BA 4X1IB 4JPRA 1SZTA 1TAEA 1WPBA 4U3JA 2UU9B 2P22C 1QQCA 2H3OA 4KL1A 2EIKB 2HJFC 4YXWG 1JVMA 2Y0IA 3L72H 3QF7A 3AEIA 4RO2A 1URFA 5IYZB 1AR4A 3L73H 4QIWF 5JQGB 3AK3A 2YC0A 1G4YB 3HKDA 3CCUV 3CXHF 3ML0A 4JI1O 2DE0X 3IC9A 3TXQA 4GKJB 3MD0A 2OYQA 3RYHB 2HEPA 1OCCB 3HKDB 4DR3O 3F7YC 1RPRA 3MDSA 5L3EA 4NXMB 2FTKA 2JGUA 4PHZA 1XL4A 3OUSA 3E2EA 1EZJA 1XUQA 1OCRC 2QA4V 5CBFA 1N32O 4J41A 5EC1C 3VQWA 5JJNB 2OTJV 4LNUA 2JGDA 3F5WC 4LF8B 1QVFU
chains in the Genus database with same CATH topology
4W4LA 2GTSA 4J42A 3FX7A 4J41A 4KXRA 4J7KA 4IYIA 4J7JA 4J11A 2G38A 4J10A 4IYHA 4W4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4L A;  2GTS A;  4J42 A;  3FX7 A;  4J41 A;  4KXR A;  4J7K A;  4IYI A;  4J7J A;  4J11 A;  2G38 A;  4J10 A;  4IYH A;  4W4K A; 
#chains in the Genus database with same CATH topology
 2A3Q A;  3CE2 A;  1IBL O;  4K0K O;  2KB1 A;  4X66 O;  4X8A A;  2P7T C;  1Y76 A;  1BQZ A;  5A9G A;  3CCJ V;  1JFF B;  3K59 A;  3CC2 V;  3LUT B;  3RT3 C;  3OMI B;  1N4C A;  5L3B A;  1DTO A;  1AI6 A;  4PA4 A;  1XQ8 A;  2Q8V A;  1V55 B;  5BMV B;  1MAB G;  2WWW A;  4LWS A;  4MVM A;  2UUB O;  1H38 A;  1GAX A;  2IBZ H;  4DV5 B;  2EIK C;  4GLX A;  3SYC A;  4LF5 O;  1I5X A;  1X4T A;  3K5N A;  5ITZ B;  5H6Q A;  2KG7 B;  3AG7 A;  3DTU B;  5EBL C;  1JMK C;  3MHH C;  4DUY B;  4DV1 O;  1YXB A;  1DLB A;  3ASO B;  5HFM A;  3FAV B;  1FS0 G;  2P90 A;  4DR5 B;  2AHZ A;  2UXD B;  2QWP B;  2Z0A A;  1IUR A;  1IDS A;  3OAA G;  4K8Z A;  1ZTE A;  4BAY A;  3T1H O;  3QVN A;  2WLM A;  4ZI7 A;  2D3O W;  1FJG O;  4K8X A;  4JV5 O;  5KMG B;  1WPX A;  3ZMS A;  3CRA A;  3E8G A;  1HDJ A;  4CS4 A;  2QE7 G;  2HP8 A;  3K0D A;  3WG7 C;  3VOU A;  2UUA O;  1M1K W;  3H1L H;  1WNS A;  1QVG U;  1OCC C;  1XHZ A;  1TUE B;  1W2B U;  4QPK A;  2D2C B;  1QLN A;  1P7B A;  1YCI A;  5B1A C;  2EIL B;  2XAH A;  2ZM6 B;  2XOK G;  2YDE A;  4MVZ A;  4QJF B;  3B40 A;  4JI5 B;  4LFB O;  4DRX A;  3BA9 A;  2WLN A;  4MW3 A;  2BSK B;  1GN3 A;  4GCZ A;  1TUB B;  3ZHT A;  2QEX V;  3B77 A;  4IHJ A;  3J81 N;  2OIE A;  4KUM A;  3JCZ A;  4DK1 A;  4BWA A;  4IIJ A;  1XHX A;  2H94 A;  3M8A A;  3K9A A;  1VP7 A;  4LF6 O;  5LGU A;  4JZ2 A;  2EIM B;  3ZMV A;  4I55 B;  5IJ0 B;  1VQL V;  1Z5V A;  4E4E A;  1VQ4 V;  4RAI A;  2HG5 C;  3KG2 A;  3E8B A;  4KFM A;  1P7G A;  2ZR3 A;  1SQB H;  4TV9 B;  3K03 A;  5KX5 A;  1FAF A;  2MW2 B;  5CA1 B;  5GON B;  2RN9 A;  2LO1 A;  1XL6 A;  4DK0 A;  1WB7 A;  2OCC B;  2DJV A;  2DYR B;  4LH6 A;  5LXT B;  1G6U A;  4WBN A;  4O4L A;  3D36 A;  4YJ3 B;  4CC6 A;  3EVK A;  4ZOL B;  1PL4 A;  2EIN C;  2OT5 A;  3N2G B;  4JI4 B;  2JDI G;  3UM7 A;  3RBZ A;  4UB6 Z;  3PJS K;  1AI7 A;  3B09 A;  1YTF B;  4LCU C;  5B1N A;  2GDS A;  1EFR G;  3ASO C;  2WLI A;  4DV0 O;  1PNK A;  1YIJ V;  1K9M W;  2R9R B;  3AG3 C;  4DV7 B;  4AI8 A;  3P32 A;  3CME V;  3JD0 A;  3LNM B;  3X2Q C;  4JAU A;  4O2A A;  3FB7 C;  4FIP C;  1Y74 B;  3ABK B;  1VF6 A;  2DN9 A;  3LSU A;  4NYK A;  4JTA B;  2GUZ B;  2BOC C;  1BHB A;  3SJA C;  3IFX A;  1P49 A;  5EC2 C;  4X1K A;  1K4C C;  1FFX B;  3BEH A;  3TK1 A;  2LQT A;  4NB5 A;  3ZN0 A;  3SYQ A;  3T2M A;  1WN7 A;  5B1O A;  1WAZ A;  3RFR A;  4UUJ C;  3HKC A;  5CN0 A;  2OWO A;  1K33 A;  4NKG B;  4DR7 B;  1MZF A;  1RSO A;  4PDV A;  4B7K A;  1QR9 A;  3L71 H;  2V1D A;  1Q6I A;  3UO3 A;  5F2V O;  5JCO A;  1US6 A;  1SQG A;  3ASN B;  1KP2 A;  1SA0 B;  2BOB C;  5IYC O;  4B3R B;  2EIM C;  3L9D A;  2QDO A;  3JAR A;  4DR1 O;  3J7A U;  4OPH A;  4O4I A;  4LBE C;  1V9P A;  4CZZ A;  3ZHV A;  3JAM N;  4F4L A;  3ZHU A;  1ZLZ A;  4DV4 O;  3IAY A;  3JD3 A;  3DXR A;  3G6B A;  1G8M A;  2DWD C;  5B1B C;  3JAL B;  5HFL A;  2XHB A;  4JAV A;  2B1I A;  2OCC C;  3CHX A;  1JCH A;  3CS5 A;  1NVP D;  3ZIA G;  1XMO B;  2CH7 A;  4DR4 B;  3UT5 A;  4WCE V;  3CJH A;  1AJP A;  1GM8 A;  2ZM6 O;  2IW5 A;  2YEV A;  4JI0 B;  1MSD A;  2CDY A;  5KAI Z;  4XBF A;  4WFA V;  2P4K A;  5LL6 Y;  1BE3 H;  2LP7 A;  4XDK A;  1HNX O;  1TVK A;  4Z2W A;  2F4V B;  4GKK B;  1E1R G;  2L35 A;  3FKS G;  2YI9 A;  1BSM A;  2HJD A;  3L70 H;  1FXH A;  3HKB B;  3F5T A;  3C3S A;  1P84 F;  4DV3 O;  2ZD9 A;  4NR1 A;  4D7S A;  4BW5 A;  4NTX A;  5J9P C;  2HVK C;  2B9Z A;  4UCV A;  2WLK A;  1PM9 A;  1VQO V;  3JD2 A;  4N23 A;  3RYI A;  1XI1 A;  2QWR B;  4OX9 B;  1PKX A;  4PDR A;  5JVD B;  1SQF A;  4X89 A;  1QU7 A;  1UFI A;  4AQY B;  3SPC A;  4RUE A;  1L0N H;  4YIO A;  1K5Q A;  1DK1 A;  3IC7 A;  4KXR A;  1CXZ B;  1Q6U A;  2Y4U A;  3AG4 B;  1FXK B;  4I4T B;  4DUZ B;  2Y69 C;  1KP3 A;  2ADQ B;  3VBB A;  4CH6 A;  1SQQ H;  3WB0 A;  4IGG A;  1SRY A;  1NI8 A;  3CP1 A;  3JAK A;  1Y4M A;  1B06 A;  2LW1 A;  4EB6 A;  1YEW A;  3E8H A;  5LA6 A;  4JAA A;  3ASN C;  5KHH A;  4MTO A;  2JK5 C;  1ZSP A;  3ABU A;  4X64 B;  1FYJ A;  2KKW A;  1OCZ B;  5IYB O;  5L3C A;  2HFE C;  1WB8 A;  2UXC O;  5H9C A;  1Y66 A;  3TCU A;  4KHP B;  3E86 A;  4WFF A;  2YI8 A;  1H2N A;  5K1X A;  2F93 B;  3ABL B;  1ARO P;  5LOV B;  4TV8 A;  1NR1 A;  4FLZ A;  3N2K B;  3FFQ A;  5FPR A;  3RGB A;  4W4K A;  2ETN A;  4L8J A;  1ORQ C;  1Q7Y W;  1JX9 A;  3E22 A;  4JI2 O;  3JCU Z;  1I08 A;  3H9V A;  4KP4 A;  4Q6G A;  5DN6 G;  3CX5 F;  4X62 O;  3ZN1 A;  3OGI B;  4ZHQ B;  3SJC C;  4X20 A;  5GTI Z;  4FFB B;  1SES A;  3W7S A;  2HVJ C;  2IM9 A;  5AG2 A;  3OM3 B;  2N74 A;  4DV6 O;  1Y67 A;  1B6Q A;  2PUS A;  4J7K A;  4JYB A;  1MOF A;  1H2G A;  4LP8 A;  2HKO A;  3E22 B;  4BIZ A;  2EIJ B;  2QR4 A;  2AZ0 A;  5CBG A;  4G27 B;  3U11 A;  4F6R B;  1Z2G A;  4B7E A;  1G1X B;  2P6J A;  3CRC A;  2GBO A;  1NQT A;  4LF9 B;  3RN4 A;  1VQ5 V;  4TQD A;  1SER A;  3CEI A;  4JYY A;  1QLE B;  1RPO A;  5LP6 C;  4FZ0 A;  3OR6 C;  3ZRW A;  4P9P A;  3FX7 A;  1QCE A;  5L3G A;  4X65 B;  4J11 A;  4JI6 O;  3C3T A;  5CA3 A;  3SGI A;  1VF5 B;  2WLH A;  1OCO C;  3A0H Z;  4MS2 A;  1F51 A;  4TUY A;  1GN4 A;  1I7F A;  2R72 A;  2HLD G;  3DSQ A;  4XDJ A;  4U7N A;  1Q43 A;  3CC4 V;  2A06 H;  2VS0 A;  1Q3E A;  4YY3 B;  1VEW A;  5LBQ A;  3AG4 C;  2Y48 A;  3M7M X;  4B3M O;  3W7W A;  5JH7 B;  1OV9 A;  5FNV A;  1XMO O;  1I94 O;  1PNL A;  4HZ3 A;  1XNR O;  2ATK C;  5B3S B;  1E79 G;  2VWK A;  4U3J B;  4UV8 A;  1L1F A;  2UUC B;  1JJO A;  1MSW D;  1O9G A;  4HNA A;  4FFK A;  2XND G;  5C8Y A;  2Q69 A;  3NXS A;  4FVM A;  1Q86 W;  2XAQ A;  4GT1 A;  2YIB A;  2LW7 A;  1IX9 A;  1ENV A;  5FNV B;  2IH1 C;  4OGQ B;  3A0B Z;  2FB5 A;  3AG1 C;  3ABL C;  3T4D A;  4ABM A;  1K7D A;  2ZXW B;  4HAM A;  1F4N A;  2PGG A;  3UO2 A;  4JYA B;  2JIZ G;  4OX9 O;  1M57 B;  4UVB A;  3OMA B;  4J10 A;  3OUF A;  3KKY A;  1AR5 A;  4AHC A;  1K73 W;  2HHH O;  5IYD O;  4AQY O;  1WP7 A;  2CGN A;  3H1K H;  5CB4 A;  4LFA O;  4LFC B;  4I50 A;  4R50 A;  2NLJ C;  2Q5Z A;  3OT7 A;  1N33 O;  4LF4 B;  3C90 A;  1R3J C;  2FKX A;  5KHJ A;  2E5L B;  3D3I A;  4DR6 O;  1BZK A;  2YIB D;  4P2Z A;  4UCR A;  1YJ9 V;  3CCE V;  4FMT A;  2RCV A;  4TOI A;  3CPW U;  5B5E Z;  2UXB B;  1KKC A;  1JA8 A;  1AI5 A;  2Q4P A;  3JSN A;  5EYP A;  2CK3 G;  2MK3 A;  4UV9 A;  1HR0 B;  3OEH G;  4ZBM A;  1OHH G;  2IJI A;  5LHG A;  1FXV A;  1SQP H;  3G80 A;  3I55 V;  3CCV V;  2X0L A;  3BVO A;  4LNU B;  4FLU A;  2JGD B;  1GN2 A;  3ZRX A;  3CCM V;  2QGN A;  2W0X A;  5LMU O;  1HNZ B;  3EFF K;  2JJ1 G;  1WA8 A;  2WAM A;  4LC1 A;  4YHH B;  4FK5 C;  2C2A A;  1Y76 B;  2XUM A;  4UCT A;  2CGO A;  4PA3 A;  4JYC A;  3VQY A;  2Q0O C;  1EN5 A;  4E2L A;  2FYU H;  2QJ1 A;  4AIL C;  1VQM V;  4U7O A;  2LGW A;  2YXH A;  4Q20 A;  3JAT A;  3FYE B;  1RM1 B;  3QTC A;  2P4V A;  1NTZ H;  1U96 A;  4LWS B;  4DR2 B;  3HPL C;  5EIB C;  2YXY A;  1VQK V;  3ZRV A;  3FYI B;  5JJE B;  4NVP A;  5JJJ B;  1KC8 W;  4NXN B;  1MMM A;  2W0F C;  2ZT9 B;  4B3T O;  4CC5 A;  2CUG A;  3ZS8 C;  5DEC A;  4RUF A;  1J5E B;  2GSM B;  3BA8 A;  3WB1 A;  5IT9 N;  1AJN A;  4J42 A;  4EEQ A;  2ZXW C;  3TGU H;  2WLJ A;  2ZDI A;  1N34 O;  1K5S A;  2EBO A;  2GTS A;  4MVS A;  3CCS V;  1B3Q A;  2UU9 O;  5IJ9 A;  4ZI7 B;  2EJ7 A;  2QKA A;  3LNN A;  4WFE A;  1D2D A;  2CTW A;  4CH4 A;  1LUV A;  3QG5 A;  3JAW A;  3K5O A;  4UVA A;  1ZUQ A;  2B5U A;  4X88 A;  5GTH Z;  3APQ A;  4TSF G;  4MT8 A;  1BMF G;  2AHY A;  1Q5O A;  4DRX B;  2GTA A;  2M7W A;  4K35 A;  1YJW V;  5J2U A;  2LJ2 A;  1PV0 A;  3FD9 A;  1SQX H;  2BTQ A;  1NTM H;  2VQF B;  4IHJ B;  2DQ0 A;  4MVO A;  3K57 A;  1S5J A;  4IIJ B;  4LF7 B;  2F95 B;  4QGP A;  3SR2 C;  4GKJ O;  2FML A;  1BGY H;  1H8E G;  1V55 C;  5E79 Z;  1N36 B;  3D8C A;  1RP3 B;  1KYO F;  4NXM O;  5KX5 B;  1R6N A;  3ABM B;  3DC6 A;  4O4J A;  1S77 D;  1JJ2 U;  3IJ4 A;  3DC5 A;  1NH2 D;  3QO5 A;  1ZWI C;  3BFR A;  2QKC A;  3BAB A;  4UCS A;  4LF4 O;  3CSX A;  1IVS A;  2X7R B;  3D3Q A;  2CTR A;  2ZE8 A;  1P4R A;  4O4L B;  4WBN B;  1M90 W;  1E1Q G;  1K4D C;  5LGN A;  2AGA A;  5KA5 A;  1QR8 A;  1HW7 A;  1F23 A;  4LF8 O;  2ZIM A;  3BY6 A;  3SJQ C;  4FM0 A;  5D5P A;  4TT3 G;  3CWB H;  1WP8 A;  4IYI A;  1AB3 A;  2PYJ A;  2EJR A;  2WLI B;  3P3N A;  4PDL A;  3CCQ V;  4W4L A;  1QHT A;  4J9Y B;  1IBK B;  1R6T A;  5LYJ A;  1GH6 A;  1A32 A;  4JZG A;  3W7T A;  1Q82 W;  2ZIO A;  2QSA A;  2ARH A;  4O2A B;  3S3W A;  3ZBH A;  2ITC C;  2EIL C;  5LMN B;  5IWA B;  3TET A;  5IE9 A;  4O4H A;  1CP9 A;  1M93 A;  2ITD C;  4X1K B;  1Z5W A;  1SQV H;  4DV5 O;  4DV2 B;  1K34 A;  4U3F H;  4IL6 Z;  3Q4H A;  3OMN B;  5E1A C;  3HKC B;  1BCC H;  4DUY O;  4D6T H;  5LHH A;  4UB8 Z;  3G6E V;  1RSO B;  1IBM B;  4GUN A;  4DR5 O;  1HP8 A;  4DR2 O;  2VQE B;  1BQ0 A;  1NVP B;  2UXD O;  3LDC A;  2OIG A;  4JI7 B;  3MHS C;  3H1I H;  3BCC H;  1SS3 A;  1F7Y A;  1NU1 H;  2JRI A;  3ZMT A;  3WFV A;  1GM9 A;  5EZY A;  1DGS A;  1YDX A;  3JAR B;  3P3P A;  2DYR C;  4O4I B;  1KEC A;  5IY5 B;  3RYC A;  4ICG A;  3FB6 C;  3HR0 A;  3W7X A;  3CB2 A;  1CPY A;  1SZX A;  3P30 A;  4X1Y A;  3DXR B;  4JI5 O;  1T5E A;  4JI3 B;  1S76 D;  2RMK B;  3T1Y B;  2KQX A;  5FLX N;  4MTG A;  3HKE A;  4NTW A;  3CCR V;  3I56 V;  4A5U B;  3D36 C;  3K5M A;  4FM1 A;  2IJH A;  2CH7 B;  3UT5 B;  2Q67 A;  2Q6A A;  3CJH B;  3K0G A;  3ABK C;  5LP6 A;  1M9N A;  3VQV A;  1FD9 A;  3JYC A;  2YEV B;  3QNE A;  1VQ6 V;  3AK1 A;  1V54 B;  2R9I A;  4J80 A;  1BL8 A;  1TVK B;  4MVU A;  2XAF A;  2XAS A;  2DWE C;  4JI1 B;  4I0X A;  1CEZ A;  5LHI A;  2A9H A;  2VQF O;  4D7T A;  1FKA O;  2XTA A;  2EZO A;  3SJB C;  2IU0 A;  1VQP V;  4YJ2 A;  1NTK H;  1ZX3 A;  1VF6 C;  3E35 A;  4DR3 B;  4FLV A;  1JQ0 A;  3ABT A;  1VMG A;  1WLE A;  4GX1 A;  3RYI B;  2RDC A;  3L75 H;  1KD1 W;  1PD3 A;  4GYC B;  1LR1 A;  2FL4 A;  1KBH A;  4JI4 O;  2QTS A;  3SPI A;  2JS3 A;  2EUL A;  1S0V A;  3JAS A;  5LGT A;  3N27 A;  4J7J A;  5KUK A;  3RWR D;  3ICX A;  4MTX A;  4DV7 O;  4JTD B;  2VWJ A;  2ZQM A;  2PI4 A;  4DXW A;  2W6J G;  3STL C;  3UKM A;  1IXM A;  2IJK A;  1KU9 A;  3MAQ A;  4UCU A;  3JAK B;  1GRJ A;  1NKD A;  4O2B A;  4J7Z A;  1IBL B;  4K0K B;  4EB6 B;  2E74 B;  5D5Q A;  3I5D A;  1IZ3 A;  1UPG A;  3K04 A;  2HR3 A;  2Y0P A;  3SPH A;  4X66 B;  3BPZ A;  1XEQ A;  5LA6 B;  5BY1 A;  5BR8 B;  1I5Y A;  3ZED A;  2E76 B;  5J2T A;  1IXB A;  3K9S A;  2XAG A;  3OR7 C;  3GVM A;  4UCO A;  3QO8 A;  1B04 A;  5B66 Z;  2X6A A;  4B08 A;  4BIO A;  3WU2 Z;  2WLL A;  3A0R A;  4DR7 O;  2PF4 E;  4TV8 B;  5GW7 A;  2V4D A;  1R3L C;  2F23 A;  3ETE A;  1YIT V;  2PTM A;  3IGA C;  1DF4 A;  2QWN B;  4LF5 B;  4DV2 O;  3U0Z A;  2W6I G;  1AI4 A;  3RYF A;  4R6Z A;  1OCR B;  4B3R O;  1TGO A;  2GV9 A;  4X20 B;  2GHY A;  3T1C A;  1UJW B;  1KB9 F;  1YVW A;  1LUW A;  2UXX A;  2JEX A;  1Q81 W;  1XIL A;  4H13 B;  4X1I A;  3T1H B;  2ILM A;  5L3D A;  4Z1M G;  3K79 A;  4JV5 B;  2O57 A;  2LFS A;  3E89 A;  1JOY A;  2UUA B;  1QNM A;  3U10 A;  1FXK C;  1GK9 A;  1JR9 A;  2JEU A;  3ETQ A;  3ZRW B;  5IYZ A;  3L74 H;  1XRE A;  4FM2 A;  2NR5 A;  1VQ8 V;  4DR4 O;  5JQG A;  4LFB B;  4JTC B;  4JI0 O;  5EBW C;  1M4U A;  4TUY B;  3KCX A;  1VAR A;  4JI3 O;  3T1Y O;  1YJN V;  1X59 A;  1GKF A;  4J9Z B;  4X9Q A;  2UXN A;  4NTY A;  2F4V O;  4GKK O;  3BRC A;  3ZJZ A;  2Z3Y A;  3FB8 C;  3ZHR A;  1OCZ C;  2IU3 A;  2M6Y A;  2JJ2 G;  1GTO A;  4LF6 B;  4Z1V A;  4HYO A;  3RYH A;  4I7Z B;  2DOS A;  3BAA A;  1AR1 B;  3AG2 B;  5KLV H;  1GM7 A;  2YIC A;  3E83 A;  1VQ7 V;  3CCL V;  4HNA B;  1NS1 A;  5C8Y B;  2DQ3 A;  3G4S V;  1YHQ V;  4FZ1 A;  3A2F A;  4XDL A;  2DMX A;  5KUM A;  4H33 A;  4F6E A;  3ZRS A;  5DM6 V;  3WG7 B;  4MSW C;  4DW0 A;  5EIB D;  3LSS A;  4JGS A;  4H37 A;  4DO2 A;  3JSL A;  4DUZ O;  3LSQ A;  5FPO A;  5B1A B;  2YSU B;  2CTQ A;  1O9H A;  4CH5 A;  2EIJ C;  4FLX A;  3JD4 A;  1R6K A;  5EK0 A;  3KCY A;  2Q68 A;  5CB4 B;  1JFF A;  1EN6 A;  3CXC U;  1PPJ H;  2G38 A;  4I50 B;  4DV0 B;  4X64 O;  1QLE C;  4BR6 A;  3B8N A;  4GX5 A;  3E8F A;  1F4M A;  2JS5 A;  3QO7 A;  2PYL A;  3T4Z A;  2YUA A;  3SYA A;  4KHP O;  4PD4 F;  1HWY A;  1YSC A;  3ETD A;  5BMV A;  3G67 A;  1S5L Z;  5BR8 O;  1MZE A;  5EBM C;  2CAZ C;  1ZL8 A;  4LR3 A;  5ITZ A;  4B3S B;  1SC5 B;  2KG7 A;  5EYP B;  2WSS G;  1QBZ A;  1Y6X A;  3CRR A;  3H1H H;  1KKD A;  5H5N A;  3SDL A;  4R8C A;  1VQ9 V;  1S5H C;  3FAV A;  4CS3 A;  2NN4 A;  5B3S C;  5KA6 A;  1W59 A;  2EZP A;  1BT8 A;  4WF9 V;  1WA8 B;  2A79 B;  1RFY A;  4WFG A;  2K1E A;  2EIN B;  3ZMZ A;  1ZL8 B;  5C93 A;  1BS3 A;  2BTO A;  3AK2 A;  4ASU G;  4L87 A;  3S3X A;  4MVR A;  5KMG A;  1AP6 A;  1GO3 F;  4FLY A;  1U97 A;  3GWK C;  1EN4 A;  3A8T A;  4LF9 O;  4DR1 B;  5CA0 A;  5FL7 G;  2QM7 A;  3AG3 B;  3OW2 U;  2E3C A;  4OPA A;  4FLW A;  3JAT B;  4G2K A;  2A7W A;  3AG2 C;  1KMI Z;  3X2Q B;  4DV4 B;  2DYS B;  5KHG A;  2IJJ A;  4X65 O;  1M57 C;  2P5O A;  2ZE7 A;  4GZR B;  2BSK A;  2WPD G;  1TUB A;  5CBH A;  4JI8 B;  1AIL A;  2XAJ A;  3K06 A;  1S72 V;  5BZB A;  2ZR2 A;  3JD1 A;  4YY3 O;  5CA0 B;  2LGQ A;  3RVY A;  3APO A;  1YF2 A;  1K8A W;  3SYP A;  4DYL A;  4I55 A;  5IJ0 A;  4EKW A;  1PNM A;  4C7U A;  2F43 G;  3OD4 A;  2P06 A;  3SYO A;  1PP9 H;  1HNX B;  3ZX6 A;  2WA4 A;  5IJ9 B;  1AVM A;  4TV9 A;  2AZ2 A;  2UUC O;  2QWO B;  3UQ8 A;  3TJT A;  5CA1 A;  2DW4 A;  3ZHQ A;  5GON A;  4QE7 A;  3JAW B;  5IDJ A;  2H8P C;  4JAS A;  2L6L A;  4QNH B;  1OZ0 A;  4I9Q A;  4DV3 B;  1NH2 B;  5LXT A;  4QPJ A;  2ZIN A;  1I0H A;  1EM1 A;  1JPX A;  2Z5U A;  4YJ3 A;  4FPP A;  4GX0 A;  4ZOL A;  5J2U B;  4JYA O;  4UFZ A;  3N2G A;  2ZE5 A;  3WB2 A;  5A2Q N;  2YS8 A;  1SF9 A;  2BTQ B;  5B1B B;  1GN6 A;  3K08 A;  1Q6H A;  2Q9L A;  2R9A A;  4LFC O;  1SKV A;  3K5L A;  4CBC A;  1KQS U;  1Q90 D;  2CTP A;  2ZKO A;  3R66 A;  2N05 A;  1RM1 C;  4LH7 A;  3OTO B;  1M5I A;  1H2S B;  2YXL A;  1Y74 A;  2E5L O;  1BHA A;  2LFR A;  2OCH A;  2GUZ A;  2XT9 A;  4O4J B;  4PA7 A;  4TWK A;  2ZE6 A;  2UXB O;  1ZAU A;  1D5A A;  1FFX A;  1FFT B;  2X6B A;  1H2L A;  3GB7 C;  3EHB B;  2UXC B;  1HR0 O;  1COW G;  2Q7H A;  2DYS C;  4RWU A;  2A0L A;  4WFB V;  1XBL A;  3K58 A;  1YTF D;  1HNZ O;  2Q7G A;  3O9O A;  3LDD A;  3CMA V;  3NR7 A;  4DW1 A;  4YHH O;  4EFB A;  4JI2 B;  4OXS A;  4B3S O;  1WJZ A;  4ZIB A;  5K1P A;  4X62 B;  1SA0 A;  2QWQ B;  3OFN G;  3ETG A;  5LYJ B;  2ZDI C;  4I5S A;  3RW0 A;  1AJQ A;  5H2F Z;  2PI5 A;  5JWP A;  2Y69 B;  2F1M A;  1H2M A;  4DV6 B;  4PEL A;  1XMQ B;  4O4H B;  3B4S A;  4FJC C;  2ZNI A;  4IYH A;  1N8R W;  4UXN A;  2YID A;  2KSD A;  1HNW B;  4QE9 A;  4NXN O;  3Q4H B;  3B2E E;  3JAL A;  4UVC A;  1W0J G;  1SET A;  5KAF Z;  1J5E O;  4IT5 A;  4MVQ A;  3W7U A;  4I9W A;  1D5N A;  1THZ A;  2RNB A;  4EFE A;  2PY5 A;  4JI6 B;  1AP5 A;  3G71 V;  3ZHS A;  1N0J A;  3KZI Z;  2E75 B;  1XNQ B;  3OGC C;  1OJH A;  4JF3 A;  3ABM C;  3GWO A;  1TA8 A;  4PI0 A;  2VRZ A;  3CYO A;  5KHK A;  4FLT A;  4JI8 O;  1DF5 A;  3SPJ A;  4B3M B;  1L8D A;  3H01 A;  1M56 B;  2F66 C;  3TXS A;  1XOU A;  4PDM A;  5EZY B;  5H6R A;  1EBO A;  4WFH A;  1I94 B;  1NR7 A;  1VIB A;  3M99 B;  4P30 A;  3SPG A;  1NT2 B;  1NJI W;  1R3K C;  3DGE A;  3RYC B;  3HKB A;  1XNR B;  4H44 B;  3J80 N;  1ROP A;  1EZV H;  4X1Y B;  1FPO A;  4CS2 A;  3CC7 V;  4BIU A;  2ADP A;  4RQF A;  1MA1 A;  2Q7E A;  3FB5 C;  4R7C A;  5JVD A;  3H1J H;  2N04 A;  2PZS A;  4K3A A;  3HKE B;  2R70 A;  1LNQ A;  5DED A;  4HBN A;  3ZMU A;  1FXK A;  1H2K A;  4I4T A;  4LF7 O;  5LP6 B;  4H0L B;  4ZKI A;  4MW8 A;  1MG1 A;  3O65 A;  2EX3 A;  5CMU A;  1R3I C;  1N36 O;  5L3F A;  2RJZ A;  1N0N A;  1OCO B;  3LDE A;  2BCC H;  4PA9 A;  1S3J A;  2HHH B;  4I0X B;  3CD6 V;  3R65 A;  4LFA B;  3HB3 B;  2QM4 A;  4PJ0 Z;  3CRM A;  1N33 B;  2Q73 A;  4YJ2 B;  1N32 B;  1YZB A;  3PN1 A;  3EXA A;  3OTO O;  2Y4T A;  1YI2 V;  1GMG A;  1XDC A;  3THO A;  2ODM A;  4DR6 B;  2AW9 A;  2ZCE A;  5LOV A;  2Q0A A;  4MTF A;  3N2K A;  5JCO C;  2NNU A;  4RQE A;  4CH3 A;  2JVD A;  3JAS B;  2IH3 C;  1KUQ A;  2RQ6 A;  1IBK O;  4PI2 A;  5IY5 C;  3AG1 B;  4ZHQ A;  3OE7 G;  4FFB A;  5LMU B;  2B1G A;  1K97 A;  4O2B B;  2V7Q G;  2P67 A;  5LMN O;  5IWA O;  2QKS A;  3ZCC A;  1K92 A;  5BXZ A;  3OTF A;  2UUB B;  3RVZ A;  2QTO A;  2WA3 A;  1L0L H;  1Q8I A;  3VQX A;  4P9O A;  2CE4 A;  3K3W A;  4TQF A;  1M56 C;  4F6R A;  2YIA A;  5J2T B;  1K3E A;  3OEE G;  1H8H G;  4DV1 B;  3STZ C;  1MNG A;  1R73 A;  1J95 A;  3CRQ A;  2WLL B;  1IBM O;  1PL0 A;  4PV1 B;  5KHI A;  1V54 C;  1XMQ O;  1NZ6 A;  2VQE O;  1VQN V;  2OTL V;  1VF7 A;  4JI7 O;  1NBM G;  4B3T B;  1HNW O;  1FJG B;  2ZNJ A;  2AXT Z;  3RYF B;  3F7V C;  4G28 B;  3UCS C;  5TIS Z;  3B8M A;  4YIP A;  2BE3 A;  2K9P A;  4PA6 A;  5JH7 A;  4BW9 A;  1W0K G;  4N21 A;  1N34 B;  2X6C A;  4GX2 A;  3BHP A;  2QM8 A;  1XNQ O;  1R1B A;  4X1I B;  4JPR A;  1SZT A;  1TAE A;  1WPB A;  4U3J A;  2UU9 B;  2P22 C;  1QQC A;  2H3O A;  4KL1 A;  2EIK B;  2HJF C;  4YXW G;  1JVM A;  2Y0I A;  3L72 H;  3QF7 A;  3AEI A;  4RO2 A;  1URF A;  5IYZ B;  1AR4 A;  3L73 H;  4QIW F;  5JQG B;  3AK3 A;  2YC0 A;  1G4Y B;  3HKD A;  3CCU V;  3CXH F;  3ML0 A;  4JI1 O;  2DE0 X;  3IC9 A;  3TXQ A;  4GKJ B;  3MD0 A;  2OYQ A;  3RYH B;  2HEP A;  1OCC B;  3HKD B;  4DR3 O;  3F7Y C;  1RPR A;  3MDS A;  5L3E A;  4NXM B;  2FTK A;  2JGU A;  4PHZ A;  1XL4 A;  3OUS A;  3E2E A;  1EZJ A;  1XUQ A;  1OCR C;  2QA4 V;  5CBF A;  1N32 O;  4J41 A;  5EC1 C;  3VQW A;  5JJN B;  2OTJ V;  4LNU A;  2JGD A;  3F5W C;  4LF8 B;  1QVF U; 
#chains in the Genus database with same CATH homology
 4W4L A;  2GTS A;  4J42 A;  3FX7 A;  4J41 A;  4KXR A;  4J7K A;  4IYI A;  4J7J A;  4J11 A;  2G38 A;  4J10 A;  4IYH A;  4W4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...