4KXRA

Structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE25
publication title Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 35
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4kxrA00
2GTSA 4KXRA 4IYIA 4J10A 4J11A 4J7JA 4IYHA 4W4LA 3FX7A 2G38A 4J7KA 4J41A 4W4KA 4J42A
chains in the Genus database with same CATH superfamily
2V1DA 3AG3C 4O4IB 1DF4A 2CTQA 3LNMB 1ZTEA 4PELA 4DUYO 5IY5C 4JYCA 3JD1A 1LR1A 4JPRA 4NVPA 4EFBA 2JEUA 1WLEA 4IL6Z 3IJ4A 2CTRA 2E74B 5DN6G 2X6AA 1JVMA 1I5YA 1MSWD 3ZRVA 4N23A 1FAFA 3E8FA 4B08A 5LOVB 3O9OA 1FKAO 5B3SC 1NT2B 3UCSC 1Q6HA 1TUBA 2ITCC 2YIAA 3OTOO 2E76B 2WLMA 1RSOA 5IYBO 4FLXA 5LYJB 2ZKOA 1HNWB 2DMXA 4MVUA 3B40A 2HKOA 1V9PA 3CWBH 3I56V 3TGUH 1JPXA 1NBMG 1N34O 1H2NA 1E79G 3DTUB 1LUVA 1HR0O 3ETEA 4J7ZA 3MAQA 1OCZB 1BS3A 5B1AB 5A2QN 3H1IH 2WLKA 1IBMB 3E83A 1RFYA 4DW0A 3B77A 3L71H 2HG5C 3ZMSA 1PD3A 1WB8A 4DV3O 4CC6A 4YXWG 4DUZO 2VRZA 3FB7C 4YIOA 2EINB 4DR5O 5H6QA 4PDVA 3E22A 2BSKB 2P5OA 2ITDC 4R7CA 3HKEB 3JARB 1KUQA 4IT5A 4FLYA 5EC2C 3K03A 2BCCH 4LFCO 1OJHA 4YJ3B 1N33O 3CCEV 3H1HH 3JSLA 1BCCH 3QO8A 2UUBO 3K59A 2K1EA 5GTIZ 1N8RW 2A3QA 2XNDG 3DXRA 3T1YB 4WFFA 3CC2V 1VP7A 4OGQB 1JFFA 4JAAA 1K8AW 1N0JA 3OM3B 1AP5A 4GKKB 3ZN1A 4X66B 3K5NA 2PGGA 4MTGA 1J5EO 2LO1A 1EZJA 4FM2A 1M5IA 4G27B 4FK5C 4NXNB 3CRRA 1GK9A 2X0LA 1IBKO 5LXTB 1Q3EA 1Q5OA 1XQ8A 3QF7A 2JGDA 5GW7A 1Y74B 2VQFO 2EINC 4RQEA 2AZ0A 4IYIA 5LA6A 4JI4O 4W4LA 1YIJV 3FB5C 5IWAB 4X1YA 4JZ2A 2AW9A 4GLXA 3LUTB 3AEIA 1GO3F 2YI9A 5BY1A 2ETNA 3GWOA 4QJFB 4DR2B 1Y66A 2HR3A 1AP6A 1R3IC 1XHXA 1TVKA 5DEDA 4IIJA 1XREA 3ZN0A 5EYPA 3CJHA 1YTFB 2H8PC 2RMKB 2ZE8A 4WFHA 1HNXB 4DV6B 1TA8A 1XOUA 2ZDIA 1YI2V 3ZMUA 5B66Z 2UXCB 4LC1A 4F6RA 4MTOA 4JI0B 4KUMA 5GTHZ 3RYIA 3L70H 4UVAA 4PD4F 1YXBA 2A06H 1L1FA 1WJZA 1K97A 2Z5UA 4FZ1A 3AG2B 3K08A 3SJBC 2YSUB 3ZHQA 4QGPA 1EN5A 1V54B 3VQVA 2DYRC 5EBWC 4OXSA 3OAAG 1SQQH 2OYQA 2QDOA 3CMEV 5JJEB 2PZSA 2FTKA 5LHHA 2ZM6B 1XL4A 1WA8B 1NTZH 1OCRB 2H94A 3CSXA 4CH4A 3HKBA 2Q7EA 4X1KA 1R1BA 2ZXWB 1OCCC 2EZPA 1GN2A 2Z0AA 1SQBH 2LGWA 1ZX3A 4JI3O 4JYAB 1O9HA 3RYHA 4J80A 1HWYA 3P3PA 4TUYB 4LF9B 1XNQB 1VMGA 3DGEA 1Q8IA 3M99B 4LF8B 4DR1O 4WFEA 4FFBB 4DV0O 3QG5A 1N32O 4B3TO 3UT5A 1XNRB 1TUBB 5EC1C 2B1IA 3CRMA 2LGQA 4G2KA 2XAGA 3T4ZA 3IAYA 4JV5O 3GVMA 5A9GA 1NKDA 1FD9A 4O4IA 2YUAA 3J80N 4DV4B 3OT7A 1F4NA 3AG2C 4DR7O 3NR7A 3TETA 1V54C 5IYZB 4GX2A 3IC9A 3ZHTA 2ADQB 3SJAC 1VF6A 2HLDG 2M7WA 2EILB 3G6EV 3CYOA 3JCUZ 3WU2Z 1NI8A 1OCRC 4H37A 4X8AA 1SQGA 5LOVA 4K0KO 2IJHA 2EIMB 1AB3A 2KB1A 3ASOB 1B04A 2BTQB 3OMNB 2VQEB 1WAZA 5F2VO 3ZMTA 2ARHA 4L8JA 1GKFA 1H2SB 1Q81W 3F5TA 1S5JA 5LYJA 5J9PC 4AQYO 2JJ1G 1PNKA 1Y76B 4LR3A 1NZ6A 4BW9A 2Y69C 3J7AU 1H2LA 1NH2B 3ZBHA 1VQOV 4KXRA 3E22B 1S0VA 2ADPA 1L0NH 3T1HO 4JI7B 1RM1C 4Q20A 4UCOA 1QHTA 1PL0A 2PI5A 3SGIA 3ASNB 1VQNV 5KX5B 2UUAB 1AILA 2PYLA 2UU9B 2HVJC 3VBBA 2FL4A 1S5LZ 1KB9F 1WPXA 3FD9A 3B8NA 4O4HA 2UXDO 1VQMV 1IBLO 3T4DA 3RYFB 4BIOA 3CCVV 1P4RA 4P9PA 1R3LC 1PNLA 2IJKA 4ZKIA 1SQFA 1JFFB 1AROP 2QKCA 4UCTA 4FVMA 4UCSA 3A0RA 1BSMA 2QKSA 1S3JA 4JI8B 2JK5C 1BHBA 4K8ZA 2L35A 2BSKA 1YTFD 1VQLV 3HKDB 1HNZO 4CH3A 4NXMO 4JTAB 1H2MA 5CN0A 4KHPO 3K5LA 1IZ3A 1ZUQA 4B7EA 3FX7A 1K4CC 5KAIZ 5EIBD 2IU0A 4EEQA 3OW2U 4JI2O 1MG1A 4JGSA 1AVMA 3E8GA 3HB3B 1YF2A 2AHZA 4I4TB 2OCHA 5KA6A 2QSAA 1FJGB 5LMUO 3BFRA 2Y0IA 3UO2A 1S77D 4U7OA 2QE7G 2CUGA 2Q67A 1AR4A 3H1LH 3IC7A 3CJHB 5FL7G 1EZVH 1AR5A 2DN9A 2FKXA 1SZXA 2ZT9B 2HHHO 3IFXA 4B3SB 1SZTA 2UUCB 1G4YB 3OMAB 2YEVA 2Q9LA 4CH5A 5BZBA 1THZA 1WB7A 2FYUH 5LXTA 1PP9H 3JD4A 3OMIB 4DV1B 2AHYA 4B3RO 2EIJB 2XTAA 1Y74A 5HFLA 2QTOA 4TQFA 5KHIA 2AZ2A 2JEXA 3EVKA 1EN4A 3CRCA 1I5XA 5KHGA 3BA9A 1B6QA 4TWKA 3SPHA 1W0JG 3B4SA 3P32A 4GT1A 4BWAA 4UCUA 4DYLA 2DW4A 4K35A 5HFMA 4RWUA 1Q86W 4DV7B 2XASA 1O9GA 2V7QG 2P6JA 4PA4A 5FPRA 5B1BC 4DR3O 4BIUA 3H1JH 1XMQB 2OCCB 4MVRA 3E8BA 1Z5WA 3CXHF 2AGAA 5TISZ 1A32A 1FFTB 4MTFA 1GN3A 1H38A 3ZEDA 2OT5A 4NR1A 4BIZA 2WLIA 2PI4A 1YVWA 2ZDIC 4JI6O 3JD2A 3D3QA 1NQTA 1VQ9V 2NN4A 4W4KA 3T2MA 1PV0A 4MVZA 1K7DA 5L3CA 3F5WC 1WA8A 1JR9A 3MDSA 4JI5B 1BT8A 4ABMA 2EIKC 1UFIA 5B1NA 4QPJA 3FKSG 4TT3G 1NH2D 4PA3A 1MA1A 4AI8A 4UCRA 2GTAA 2JJ2G 5CBGA 3CRAA 3CC4V 2WLJA 4O2AA 4TUYA 2NNUA 1I7FA 4NKGB 1YJNV 4E2LA 3D36A 4FPPA 4FFBA 4PA9A 1K4DC 1M4UA 3L9DA 2KKWA 1HNWO 5FPOA 4LF6O 4GCZA 1B06A 3M8AA 2D3OW 5LMNO 2NR5A 2X7RB 1CEZA 1AI7A 1TAEA 4X9QA 3BHPA 1US6A 1ZLZA 1MZFA 5IYZA 1KKDA 1P7BA 2XAJA 4XBFA 4PDMA 1OZ0A 2QM4A 3DC6A 2DWEC 3SPJA 2HP8A 3FB8C 2A79B 1YEWA 1H2KA 5LGNA 3K5OA 4I9WA 4MVSA 4E4EA 1JJOA 3SYQA 2FB5A 4BR6A 4B3MO 2BTQA 4O4HB 3RGBA 1H2GA 4UV8A 4X64B 2ZNJA 3K04A 1ZAUA 1N34B 2YIBD 1R6KA 1K3EA 2BOCC 1VF6C 5JWPA 4XDLA 2LP7A 1HR0B 4GX1A 1Y76A 1QNMA 2XAQA 1OHHG 4OX9O 1CP9A 1JCHA 3N2GB 1IX9A 2F66C 2R9IA 5L3BA 4DV2O 3PJSK 3K57A 2ILMA 5KX5A 4IHJB 4JAUA 4MW3A 2JRIA 1URFA 3EHBB 3QO7A 4KP4A 4LP8A 1K9MW 1KP2A 4LH6A 4DUZB 1LUWA 3WB2A 2HJDA 3HKCB 4MVOA 4DR5B 3K79A 4J9YB 1GH6A 3RYFA 4K8XA 4MVMA 2YICA 1VQ5V 3ETDA 5KUKA 4J7JA 1OCZC 4H44B 1VQ7V 1VQ6V 4Z1MG 5B1AC 3ZRWB 2JVDA 1N33B 2HFEC 4WFAV 2OTLV 1FXKB 1QVGU 3PN1A 3HKDA 5FNVA 1SF9A 5IYDO 1AI4A 3SPGA 3C90A 2YEVB 3W7UA 4JYYA 1NVPB 5FLXN 4PJ0Z 3J81N 2R9AA 1DK1A 3UO3A 2VWJA 4B7KA 3AK3A 1SERA 3D8CA 2WSSG 3TXSA 1QCEA 3WB1A 2Z3YA 3RN4A 4I4TA 2XUMA 4FZ0A 4CH6A 4JYBA 4MSWC 5J2TB 2YIBA 4I7ZB 2V4DA 1J5EB 2E5LO 4FIPC 3A0HZ 5IYCO 1VIBA 3KCXA 1BE3H 2JS3A 2HEPA 3ABMB 1I94O 3JSNA 5BR8O 2E75B 4PDLA 2P67A 4GKJO 2VQFB 2Q7HA 5H6RA 2D2CB 3CXCU 3CS5A 3T1CA 3KKYA 1BQ0A 2LW1A 4NTYA 4WCEV 3G67A 5J2UB 2G38A 3MD0A 2PYJA 5KA5A 5B1OA 1BQZA 3WG7B 2LW7A 2WLIB 2ZIOA 3BRCA 4LFBO 1IURA 4HYOA 2RJZA 3JATB 4F6EA 3SYAA 1ZL8B 5JJJB 5KHHA 4YJ2A 4PA7A 2DWDC 2QM7A 3LDDA 3MHHC 1PL4A 3ABKB 1XHZA 1CPYA 1FXHA 1Q90D 2ZR2A 2LFSA 1YJ9V 4O2AB 2JS5A 1P84F 3OGCC 2WA4A 5CBFA 2IH1C 4LCUC 3ABTA 3ABMC 2EULA 4DXWA 4JASA 2DQ3A 3DSQA 1G6UA 3SJCC 4DV5O 3ETGA 2HJFC 4R8CA 4HZ3A 3TK1A 3ZS8C 5EIBC 4JI3B 3OEHG 1M57B 3FB6C 3CC7V 4IGGA 2K9PA 4UXNA 4Z2WA 4YHHO 1Z2GA 3LSQA 4I55B 4TOIA 4DR1B 1RP3B 1ZSPA 3WG7C 4DV0B 3ZJZA 4HNAB 5JVDB 2F23A 2YXLA 1F23A 4FMTA 4B3TB 4LWSB 1AI5A 1D2DA 5K1PA 2DE0X 3H1KH 2UXBO 5BMVB 2CH7B 4U7NA 3KG2A 2Q8VA 3CX5F 2ODMA 4JV5B 4WF9V 2B9ZA 3KZIZ 4IYHA 3QO5A 3JD3A 1S76D 4ZOLB 1SETA 2ZXWC 2F4VO 2WA3A 1M56B 4R50A 3LSUA 3ZHUA 4KL1A 4ZIBA 2R9RB 4J10A 4UFZA 4UB6Z 4HBNA 2DYSB 4AHCA 1MOFA 3RYCB 4X62O 1COWG 4Q6GA 5ITZA 2JGUA 3D36C 2GV9A 3N2KB 1NTKH 1OV9A 1DLBA 3TJTA 3UM7A 4K0KB 1Y4MA 4GX0A 2W0FC 2UXXA 1AR1B 1WN7A 2E3CA 2YXHA 1NVPD 4UV9A 2KG7A 3UQ8A 2P7TC 1AJQA 3S3WA 3I55V 1U96A 5LL6Y 1SQPH 5IJ0A 2XHBA 1ROPA 2WLNA 3CCMV 3OGIB 1M57C 4ZI7B 2QGNA 1Y6XA 4QPKA 4RQFA 1V55B 3CB2A 3FYEB 1XMOO 3L73H 4X65O 4NB5A 2Q73A 4LF5B 4OPAA 3SDLA 3T1HB 3ZRSA 3ZHRA 4YY3O 5E79Z 2LFRA 2EILC 3TXQA 4YIPA 3F7VC 3CEIA 3Q4HB 1RPRA 3U10A 3N2GA 5FNVB 4LNUA 2EIMC 1SA0B 4DR4O 3ASOC 2GHYA 1GM8A 1L0LH 1I08A 1XL6A 3CP1A 2UXDB 1IBLB 3M7MX 2QWRB 3OR6C 5JH7B 1AJNA 1KKCA 4IHJA 4FLWA 2YDEA 3BY6A 3JAKB 2ZIMA 3FAVB 4XDKA 2DYSC 5CA0A 1YJWV 1KQSU 4G28B 5LP6B 3HKCA 4EFEA 4I0XB 4I5SA 4MW8A 1G8MA 1B3QA 2ZCEA 4MVQA 1HNZB 3ABLB 5LGTA 3ICXA 4NXMB 2P4KA 2EZOA 3ASNC 4LFAO 4JZGA 3L72H 4GX5A 3G6BA 4Z1VA 1H8EG 3LNNA 3VOUA 3ZRWA 3ZX6A 1X59A 1FXKA 4JI2B 1EM1A 4DR6O 4LF4O 3H9VA 4X20B 1I0HA 3E89A 4JI1O 3A0BZ 3HR0A 5LMUB 1QQCA 2FMLA 4FLZA 1SQXH 2P90A 1BL8A 2F95B 1M93A 4O2BB 3AG4B 1KYOF 3RFRA 4FFKA 1M1KW 2QJ1A 3SJQC 5LBQA 5J2TA 1MMMA 2HHHB 3CMAV 4LF7O 1MSDA 5CA1B 1NJIW 2WAMA 4DV7O 1YZBA 3AG3B 5K1XA 1VF7A 1KU9A 4B3RB 4YJ2B 5IDJA 5IY5B 2GDSA 5LP6C 1QR8A 1VQ8V 5CB4B 3A2FA 1N36O 4HAMA 2H3OA 4I50A 4AILC 3ABLC 1GRJA 1DF5A 2PF4E 2EBOA 4D6TH 5J2UA 3THOA 2R72A 1FYJA 1QBZA 5B3SB 3K58A 1M9NA 2QWNB 5DM6V 1SQVH 3BABA 1ENVA 4O4JB 4DR3B 3JATA 5D5PA 4D7TA 5BXZA 3RVZA 4UVBA 2X6BA 1ZWIC 1ZL8A 2EIJC 2F93B 2N74A 1ORQC 1Q7YW 3EXAA 2OIEA 4DO2A 3JALB 3ZHVA 4H33A 3JCZA 5LGUA 1D5AA 2ZNIA 5C8YB 4JI6B 1D5NA 1BZKA 4RO2A 3KCYA 4FM1A 1WP8A 4PI2A 2MK3A 1F51A 2Q4PA 2ZQMA 2UXNA 3JASB 2GUZB 1T5EA 1HP8A 3OUFA 3G80A 1R3JC 3AG1B 2Q68A 5IJ9B 2Q0AA 1GMGA 1FPOA 1XI1A 2QTSA 3BA8A 2OCCC 4QIWF 4DUYB 5JQGA 2WLLB 1JX9A 1PM9A 1F7YA 2RCVA 2YC0A 2Q5ZA 3APQA 1W2BU 5ITZB 3K3WA 4RUFA 2ZINA 4I55A 3JYCA 1SKVA 2AXTZ 2LJ2A 4HNAA 2DQ0A 3E8HA 1N0NA 2KG7B 5JVDA 1IBMO 2OWOA 1MZEA 5EZYB 4LWSA 2QWOB 4EKWA 4PI0A 3JAMN 4GYCB 4U3JB 5IJ0B 3OTOB 5BMVA 2Y0PA 3U11A 2CH7A 4X64O 2RDCA 4LF6B 1Y67A 2Y4UA 5E1AC 2QR4A 3EFFK 3F7YC 5LMNB 1MNGA 4ZOLA 1XUQA 3N27A 1EN6A 4JTCB 1PKXA 5KMGA 3CCLV 1BGYH 3SR2C 4XDJA 1YITV 2Q6AA 1QLEB 3SPCA 4ASUG 4FLVA 4MTXA 1EFRG 3RYCA 3JAWB 4H13B 4LNUB 3N2KA 1QU7A 2RN9A 4D7SA 3AG1C 3OD4A 2B5UA 3K9SA 4B3MB 3HPLC 4LBEC 1KECA 2EJ7A 4QE7A 2ZR3A 3U0ZA 4TQDA 2ATKC 3W7WA 4EB6A 4DV3B 4NYKA 4DRXB 3T1YO 1K92A 2QEXV 1TUEB 4F4LA 5CA0B 4ZI7A 3W7SA 3OTFA 1JMKC 1G1XB 4OX9B 4WBNB 1KMIZ 4GKKO 4J41A 4ZBMA 2W6IG 4X66O 4O4LB 4DV2B 2Y4TA 4LFCB 2GTSA 3Q4HA 3SYPA 2N05A 1TGOA 5JCOA 4NXNO 1P7GA 3TCUA 4JTDB 1SA0A 4PV1B 3L75H 2UUBB 3G4SV 1FFXB 1FXVA 3STLC 4X89A 1YHQV 1KD1W 3QVNA 5H2FZ 3IGAC 5JH7A 5IWAO 3JAKA 2O57A 5GONB 1YCIA 3UKMA 1QLEC 1VARA 4P30A 3FAVA 3C3TA 1F4MA 4DR2O 2DYRB 3R66A 4NTWA 3O65A 5EK0A 5LP6A 3BAAA 4I0XA 1WPBA 4L87A 1OCOB 4NTXA 5B5EZ 1K33A 1HNXO 4TV9A 1QLNA 4P2ZA 2F43G 4PDRA 2EX3A 3OEEG 4DV6O 3AG7A 1SRYA 3OFNG 4WFGA 2YIDA 4PHZA 1YSCA 4TV8B 1IBKB 2UXCO 1RPOA 3W7TA 1SESA 3APOA 3FFQA 1EBOA 1OCCB 4JI0O 1XDCA 3AK1A 2A0LA 2QWPB 4ZHQB 5AG2A 4X20A 5L3GA 4JI4B 1E1RG 3E2EA 4BAYA 4DK0A 5H9CA 3R65A 4I50B 1FS0G 4TSFG 4I9QA 2IH3C 3CCUV 3QTCA 5JJNB 4CS3A 4C7UA 2Q7GA 2CTPA 2KQXA 1U97A 1K5QA 3BVOA 2E5LB 4O2BA 1Q43A 1KP3A 1N4CA 5C93A 2GBOA 4GUNA 1FXKC 1VQ4V 4GZRB 1I94B 5BR8B 2ZM6O 1JOYA 1NTMH 3ZHSA 2CTWA 1BHAA 3CRQA 4GKJB 5KLVH 5CA1A 3C3SA 3VQYA 2A9HA 4UVCA 4K3AA 5IT9N 4X1IB 1IDSA 2QKAA 3BPZA 4U3FH 4FJCC 4JYAO 2WLHA 5CMUA 4UUJC 5CB4A 4LF9O 3LDCA 1XNQO 1OCOC 1P49A 5CA3A 4LF8O 4J11A 1NU1H 2BOBC 1GAXA 3QNEA 2PUSA 1UPGA 3K06A 5KHKA 2HVKC 3VQWA 4LFBB 3ZCCA 2XT9A 3ABUA 3S3XA 2P22C 2ZE7A 2VS0A 1HW7A 1XNRO 1J95A 1IXMA 1S5HC 2F1MA 3BEHA 4FLTA 4O4JA 1Q6UA 1XBLA 1AI6A 2CE4A 4DV4O 3CHXA 2Y69B 4MS2A 3CCQV 5JQGB 1QR9A 3K0GA 3WB0A 3DC5A 3OUSA 3ZMZA 1RM1B 1VF5B 2CGNA 2P06A 3P3NA 3JALA 3LDEA 1GM9A 1XEQA 2CK3G 5C8YA 3RW0A 1DTOA 1RSOB 4N21A 1AJPA 1N32B 3SYOA 4DV5B 3ZRXA 2VQEO 4CZZA 5EBMC 1VEWA 1GN4A 3LSSA 3JASA 2GUZA 2XOKG 3WFVA 1Q82W 1IXBA 1K5SA 5IJ9A 4YHHB 3ABKC 1R6TA 2IW5A 5KMGB 4DR7B 1W59A 3RVYA 3K9AA 1CXZB 4A5UB 4RAIA 2MW2B 2WLLA 1GTOA 4JI7O 1KC8W 2WWWA 3L74H 2QWQB 2QM8A 1VQKV 2IM9A 2UXBB 3H01A 1GM7A 3NXSA 2IBZH 2UUAO 3P30A 2UU9O 4JAVA 2DOSA 2YXYA 5H5NA 1VQPV 2PY5A 5L3EA 5EZYA 3A8TA 4J42A 4FM0A 2F4VB 3CPWU 1JQ0A 4DK1A 4U3JA 3CCSV 1S72V 4EB6B 4UCVA 3RT3C 4J9ZB 2IJJA 2VWKA 4AQYB 4LF5O 2PTMA 4CC5A 2LQTA 2W0XA 1MABG 2CAZC 4X62B 1L8DA 4JI8O 1R3KC 1Q6IA 2JDIG 3B2EE 3ETQA 3JD0A 2OIGA 1PNMA 4ICGA 5DECA 3GWKC 3JAWA 4CS2A 5LHGA 2IJIA 4WFBV 1NS1A 3DXRB 1E1QG 2Q0OC 3CE2A 3CCRV 5KAFZ 2JIZG 2YI8A 1XMOB 1Z5VA 1KBHA 4X65B 1M56C 1FJGO 4QNHB 2X6CA 4DRXA 4J7KA 4YY3B 3K0DA 3HKEA 3JARA 4QE9A 4LH7A 3ZIAG 4P9OA 1XILA 5L3FA 2R70A 3OE7G 4WBNA 5IE9A 3SPIA 2RQ6A 4YJ3A 1IVSA 4TV9B 4O4LA 3VQXA 4DR4B 2BE3A 5KHJA 2A7WA 3CD6V 2Y48A 4KHPB 1UJWB 1W0KG 4RUEA 3SYCA 4B3SO 1NR7A 2JGDB 2UUCO 1WP7A 5LA6B 2IU3A 5B1BB 2NLJC 4X1YB 2M6YA 2WPDG 2B1GA 2W6JG 1PPJH 4DV1O 3GB7C 2L6LA 1V55C 1FFXA 3FYIB 5L3DA 5D5QA 1TVKB 1YDXA 4R6ZA 4IIJB 4CBCA 1SC5B 3MHSC 5EYPB 4BW5A 5GONA 3E35A 5EBLC 4OPHA 2ZD9A 1M90W 4LFAB 2CGOA 5JCOC 2QA4V 1K34A 3AK2A 4F6RB 3X2QB 2C2AA 2XAFA 1SS3A 4DR6B 4LF4B 3RYIB 4PA6A 4JI1B 3W7XA 4TV8A 2EIKB 3B8MA 1LNQA 1XMQO 3K5MA 3BCCH 2Q69A 3ML0A 2XAHA 3RBZA 1H8HG 4ZHQA 1JJ2U 2ZE6A 1WNSA 2BTOA 2OTJV 3STZC 2DJVA 4LF7B 3I5DA 3HKBB 1X4TA 2EJRA 4X1KB 5LHIA 1R73A 1BMFG 4CS4A 2RNBA 2GSMB 2KSDA 4FLUA 2N04A 3OR7C 3RYHB 1GN6A 3E86A 2YS8A 4JF3A 4KFMA 3ZMVA 1DGSA 4JI5O 3D3IA 3B09A 1R6NA 4H0LB 1N36B 2ZE5A 4MT8A 5KUMA 4X1IA 1NR1A 4X88A 4UB8Z 1QVFU 2CDYA 4DW1A 3AG4C 5CBHA 1HDJA 1K73W 3UT5B 3X2QC 3CCJV 3RWRD 2P4VA 3G71V 1JA8A
chains in the Genus database with same CATH topology
2GTSA 4KXRA 4IYIA 4J10A 4J11A 4J7JA 4IYHA 4W4LA 3FX7A 2G38A 4J7KA 4J41A 4W4KA 4J42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTS A;  4KXR A;  4IYI A;  4J10 A;  4J11 A;  4J7J A;  4IYH A;  4W4L A;  3FX7 A;  2G38 A;  4J7K A;  4J41 A;  4W4K A;  4J42 A; 
#chains in the Genus database with same CATH topology
 2V1D A;  3AG3 C;  4O4I B;  1DF4 A;  2CTQ A;  3LNM B;  1ZTE A;  4PEL A;  4DUY O;  5IY5 C;  4JYC A;  3JD1 A;  1LR1 A;  4JPR A;  4NVP A;  4EFB A;  2JEU A;  1WLE A;  4IL6 Z;  3IJ4 A;  2CTR A;  2E74 B;  5DN6 G;  2X6A A;  1JVM A;  1I5Y A;  1MSW D;  3ZRV A;  4N23 A;  1FAF A;  3E8F A;  4B08 A;  5LOV B;  3O9O A;  1FKA O;  5B3S C;  1NT2 B;  3UCS C;  1Q6H A;  1TUB A;  2ITC C;  2YIA A;  3OTO O;  2E76 B;  2WLM A;  1RSO A;  5IYB O;  4FLX A;  5LYJ B;  2ZKO A;  1HNW B;  2DMX A;  4MVU A;  3B40 A;  2HKO A;  1V9P A;  3CWB H;  3I56 V;  3TGU H;  1JPX A;  1NBM G;  1N34 O;  1H2N A;  1E79 G;  3DTU B;  1LUV A;  1HR0 O;  3ETE A;  4J7Z A;  3MAQ A;  1OCZ B;  1BS3 A;  5B1A B;  5A2Q N;  3H1I H;  2WLK A;  1IBM B;  3E83 A;  1RFY A;  4DW0 A;  3B77 A;  3L71 H;  2HG5 C;  3ZMS A;  1PD3 A;  1WB8 A;  4DV3 O;  4CC6 A;  4YXW G;  4DUZ O;  2VRZ A;  3FB7 C;  4YIO A;  2EIN B;  4DR5 O;  5H6Q A;  4PDV A;  3E22 A;  2BSK B;  2P5O A;  2ITD C;  4R7C A;  3HKE B;  3JAR B;  1KUQ A;  4IT5 A;  4FLY A;  5EC2 C;  3K03 A;  2BCC H;  4LFC O;  1OJH A;  4YJ3 B;  1N33 O;  3CCE V;  3H1H H;  3JSL A;  1BCC H;  3QO8 A;  2UUB O;  3K59 A;  2K1E A;  5GTI Z;  1N8R W;  2A3Q A;  2XND G;  3DXR A;  3T1Y B;  4WFF A;  3CC2 V;  1VP7 A;  4OGQ B;  1JFF A;  4JAA A;  1K8A W;  1N0J A;  3OM3 B;  1AP5 A;  4GKK B;  3ZN1 A;  4X66 B;  3K5N A;  2PGG A;  4MTG A;  1J5E O;  2LO1 A;  1EZJ A;  4FM2 A;  1M5I A;  4G27 B;  4FK5 C;  4NXN B;  3CRR A;  1GK9 A;  2X0L A;  1IBK O;  5LXT B;  1Q3E A;  1Q5O A;  1XQ8 A;  3QF7 A;  2JGD A;  5GW7 A;  1Y74 B;  2VQF O;  2EIN C;  4RQE A;  2AZ0 A;  4IYI A;  5LA6 A;  4JI4 O;  4W4L A;  1YIJ V;  3FB5 C;  5IWA B;  4X1Y A;  4JZ2 A;  2AW9 A;  4GLX A;  3LUT B;  3AEI A;  1GO3 F;  2YI9 A;  5BY1 A;  2ETN A;  3GWO A;  4QJF B;  4DR2 B;  1Y66 A;  2HR3 A;  1AP6 A;  1R3I C;  1XHX A;  1TVK A;  5DED A;  4IIJ A;  1XRE A;  3ZN0 A;  5EYP A;  3CJH A;  1YTF B;  2H8P C;  2RMK B;  2ZE8 A;  4WFH A;  1HNX B;  4DV6 B;  1TA8 A;  1XOU A;  2ZDI A;  1YI2 V;  3ZMU A;  5B66 Z;  2UXC B;  4LC1 A;  4F6R A;  4MTO A;  4JI0 B;  4KUM A;  5GTH Z;  3RYI A;  3L70 H;  4UVA A;  4PD4 F;  1YXB A;  2A06 H;  1L1F A;  1WJZ A;  1K97 A;  2Z5U A;  4FZ1 A;  3AG2 B;  3K08 A;  3SJB C;  2YSU B;  3ZHQ A;  4QGP A;  1EN5 A;  1V54 B;  3VQV A;  2DYR C;  5EBW C;  4OXS A;  3OAA G;  1SQQ H;  2OYQ A;  2QDO A;  3CME V;  5JJE B;  2PZS A;  2FTK A;  5LHH A;  2ZM6 B;  1XL4 A;  1WA8 B;  1NTZ H;  1OCR B;  2H94 A;  3CSX A;  4CH4 A;  3HKB A;  2Q7E A;  4X1K A;  1R1B A;  2ZXW B;  1OCC C;  2EZP A;  1GN2 A;  2Z0A A;  1SQB H;  2LGW A;  1ZX3 A;  4JI3 O;  4JYA B;  1O9H A;  3RYH A;  4J80 A;  1HWY A;  3P3P A;  4TUY B;  4LF9 B;  1XNQ B;  1VMG A;  3DGE A;  1Q8I A;  3M99 B;  4LF8 B;  4DR1 O;  4WFE A;  4FFB B;  4DV0 O;  3QG5 A;  1N32 O;  4B3T O;  3UT5 A;  1XNR B;  1TUB B;  5EC1 C;  2B1I A;  3CRM A;  2LGQ A;  4G2K A;  2XAG A;  3T4Z A;  3IAY A;  4JV5 O;  3GVM A;  5A9G A;  1NKD A;  1FD9 A;  4O4I A;  2YUA A;  3J80 N;  4DV4 B;  3OT7 A;  1F4N A;  3AG2 C;  4DR7 O;  3NR7 A;  3TET A;  1V54 C;  5IYZ B;  4GX2 A;  3IC9 A;  3ZHT A;  2ADQ B;  3SJA C;  1VF6 A;  2HLD G;  2M7W A;  2EIL B;  3G6E V;  3CYO A;  3JCU Z;  3WU2 Z;  1NI8 A;  1OCR C;  4H37 A;  4X8A A;  1SQG A;  5LOV A;  4K0K O;  2IJH A;  2EIM B;  1AB3 A;  2KB1 A;  3ASO B;  1B04 A;  2BTQ B;  3OMN B;  2VQE B;  1WAZ A;  5F2V O;  3ZMT A;  2ARH A;  4L8J A;  1GKF A;  1H2S B;  1Q81 W;  3F5T A;  1S5J A;  5LYJ A;  5J9P C;  4AQY O;  2JJ1 G;  1PNK A;  1Y76 B;  4LR3 A;  1NZ6 A;  4BW9 A;  2Y69 C;  3J7A U;  1H2L A;  1NH2 B;  3ZBH A;  1VQO V;  4KXR A;  3E22 B;  1S0V A;  2ADP A;  1L0N H;  3T1H O;  4JI7 B;  1RM1 C;  4Q20 A;  4UCO A;  1QHT A;  1PL0 A;  2PI5 A;  3SGI A;  3ASN B;  1VQN V;  5KX5 B;  2UUA B;  1AIL A;  2PYL A;  2UU9 B;  2HVJ C;  3VBB A;  2FL4 A;  1S5L Z;  1KB9 F;  1WPX A;  3FD9 A;  3B8N A;  4O4H A;  2UXD O;  1VQM V;  1IBL O;  3T4D A;  3RYF B;  4BIO A;  3CCV V;  1P4R A;  4P9P A;  1R3L C;  1PNL A;  2IJK A;  4ZKI A;  1SQF A;  1JFF B;  1ARO P;  2QKC A;  4UCT A;  4FVM A;  4UCS A;  3A0R A;  1BSM A;  2QKS A;  1S3J A;  4JI8 B;  2JK5 C;  1BHB A;  4K8Z A;  2L35 A;  2BSK A;  1YTF D;  1VQL V;  3HKD B;  1HNZ O;  4CH3 A;  4NXM O;  4JTA B;  1H2M A;  5CN0 A;  4KHP O;  3K5L A;  1IZ3 A;  1ZUQ A;  4B7E A;  3FX7 A;  1K4C C;  5KAI Z;  5EIB D;  2IU0 A;  4EEQ A;  3OW2 U;  4JI2 O;  1MG1 A;  4JGS A;  1AVM A;  3E8G A;  3HB3 B;  1YF2 A;  2AHZ A;  4I4T B;  2OCH A;  5KA6 A;  2QSA A;  1FJG B;  5LMU O;  3BFR A;  2Y0I A;  3UO2 A;  1S77 D;  4U7O A;  2QE7 G;  2CUG A;  2Q67 A;  1AR4 A;  3H1L H;  3IC7 A;  3CJH B;  5FL7 G;  1EZV H;  1AR5 A;  2DN9 A;  2FKX A;  1SZX A;  2ZT9 B;  2HHH O;  3IFX A;  4B3S B;  1SZT A;  2UUC B;  1G4Y B;  3OMA B;  2YEV A;  2Q9L A;  4CH5 A;  5BZB A;  1THZ A;  1WB7 A;  2FYU H;  5LXT A;  1PP9 H;  3JD4 A;  3OMI B;  4DV1 B;  2AHY A;  4B3R O;  2EIJ B;  2XTA A;  1Y74 A;  5HFL A;  2QTO A;  4TQF A;  5KHI A;  2AZ2 A;  2JEX A;  3EVK A;  1EN4 A;  3CRC A;  1I5X A;  5KHG A;  3BA9 A;  1B6Q A;  4TWK A;  3SPH A;  1W0J G;  3B4S A;  3P32 A;  4GT1 A;  4BWA A;  4UCU A;  4DYL A;  2DW4 A;  4K35 A;  5HFM A;  4RWU A;  1Q86 W;  4DV7 B;  2XAS A;  1O9G A;  2V7Q G;  2P6J A;  4PA4 A;  5FPR A;  5B1B C;  4DR3 O;  4BIU A;  3H1J H;  1XMQ B;  2OCC B;  4MVR A;  3E8B A;  1Z5W A;  3CXH F;  2AGA A;  5TIS Z;  1A32 A;  1FFT B;  4MTF A;  1GN3 A;  1H38 A;  3ZED A;  2OT5 A;  4NR1 A;  4BIZ A;  2WLI A;  2PI4 A;  1YVW A;  2ZDI C;  4JI6 O;  3JD2 A;  3D3Q A;  1NQT A;  1VQ9 V;  2NN4 A;  4W4K A;  3T2M A;  1PV0 A;  4MVZ A;  1K7D A;  5L3C A;  3F5W C;  1WA8 A;  1JR9 A;  3MDS A;  4JI5 B;  1BT8 A;  4ABM A;  2EIK C;  1UFI A;  5B1N A;  4QPJ A;  3FKS G;  4TT3 G;  1NH2 D;  4PA3 A;  1MA1 A;  4AI8 A;  4UCR A;  2GTA A;  2JJ2 G;  5CBG A;  3CRA A;  3CC4 V;  2WLJ A;  4O2A A;  4TUY A;  2NNU A;  1I7F A;  4NKG B;  1YJN V;  4E2L A;  3D36 A;  4FPP A;  4FFB A;  4PA9 A;  1K4D C;  1M4U A;  3L9D A;  2KKW A;  1HNW O;  5FPO A;  4LF6 O;  4GCZ A;  1B06 A;  3M8A A;  2D3O W;  5LMN O;  2NR5 A;  2X7R B;  1CEZ A;  1AI7 A;  1TAE A;  4X9Q A;  3BHP A;  1US6 A;  1ZLZ A;  1MZF A;  5IYZ A;  1KKD A;  1P7B A;  2XAJ A;  4XBF A;  4PDM A;  1OZ0 A;  2QM4 A;  3DC6 A;  2DWE C;  3SPJ A;  2HP8 A;  3FB8 C;  2A79 B;  1YEW A;  1H2K A;  5LGN A;  3K5O A;  4I9W A;  4MVS A;  4E4E A;  1JJO A;  3SYQ A;  2FB5 A;  4BR6 A;  4B3M O;  2BTQ A;  4O4H B;  3RGB A;  1H2G A;  4UV8 A;  4X64 B;  2ZNJ A;  3K04 A;  1ZAU A;  1N34 B;  2YIB D;  1R6K A;  1K3E A;  2BOC C;  1VF6 C;  5JWP A;  4XDL A;  2LP7 A;  1HR0 B;  4GX1 A;  1Y76 A;  1QNM A;  2XAQ A;  1OHH G;  4OX9 O;  1CP9 A;  1JCH A;  3N2G B;  1IX9 A;  2F66 C;  2R9I A;  5L3B A;  4DV2 O;  3PJS K;  3K57 A;  2ILM A;  5KX5 A;  4IHJ B;  4JAU A;  4MW3 A;  2JRI A;  1URF A;  3EHB B;  3QO7 A;  4KP4 A;  4LP8 A;  1K9M W;  1KP2 A;  4LH6 A;  4DUZ B;  1LUW A;  3WB2 A;  2HJD A;  3HKC B;  4MVO A;  4DR5 B;  3K79 A;  4J9Y B;  1GH6 A;  3RYF A;  4K8X A;  4MVM A;  2YIC A;  1VQ5 V;  3ETD A;  5KUK A;  4J7J A;  1OCZ C;  4H44 B;  1VQ7 V;  1VQ6 V;  4Z1M G;  5B1A C;  3ZRW B;  2JVD A;  1N33 B;  2HFE C;  4WFA V;  2OTL V;  1FXK B;  1QVG U;  3PN1 A;  3HKD A;  5FNV A;  1SF9 A;  5IYD O;  1AI4 A;  3SPG A;  3C90 A;  2YEV B;  3W7U A;  4JYY A;  1NVP B;  5FLX N;  4PJ0 Z;  3J81 N;  2R9A A;  1DK1 A;  3UO3 A;  2VWJ A;  4B7K A;  3AK3 A;  1SER A;  3D8C A;  2WSS G;  3TXS A;  1QCE A;  3WB1 A;  2Z3Y A;  3RN4 A;  4I4T A;  2XUM A;  4FZ0 A;  4CH6 A;  4JYB A;  4MSW C;  5J2T B;  2YIB A;  4I7Z B;  2V4D A;  1J5E B;  2E5L O;  4FIP C;  3A0H Z;  5IYC O;  1VIB A;  3KCX A;  1BE3 H;  2JS3 A;  2HEP A;  3ABM B;  1I94 O;  3JSN A;  5BR8 O;  2E75 B;  4PDL A;  2P67 A;  4GKJ O;  2VQF B;  2Q7H A;  5H6R A;  2D2C B;  3CXC U;  3CS5 A;  3T1C A;  3KKY A;  1BQ0 A;  2LW1 A;  4NTY A;  4WCE V;  3G67 A;  5J2U B;  2G38 A;  3MD0 A;  2PYJ A;  5KA5 A;  5B1O A;  1BQZ A;  3WG7 B;  2LW7 A;  2WLI B;  2ZIO A;  3BRC A;  4LFB O;  1IUR A;  4HYO A;  2RJZ A;  3JAT B;  4F6E A;  3SYA A;  1ZL8 B;  5JJJ B;  5KHH A;  4YJ2 A;  4PA7 A;  2DWD C;  2QM7 A;  3LDD A;  3MHH C;  1PL4 A;  3ABK B;  1XHZ A;  1CPY A;  1FXH A;  1Q90 D;  2ZR2 A;  2LFS A;  1YJ9 V;  4O2A B;  2JS5 A;  1P84 F;  3OGC C;  2WA4 A;  5CBF A;  2IH1 C;  4LCU C;  3ABT A;  3ABM C;  2EUL A;  4DXW A;  4JAS A;  2DQ3 A;  3DSQ A;  1G6U A;  3SJC C;  4DV5 O;  3ETG A;  2HJF C;  4R8C A;  4HZ3 A;  3TK1 A;  3ZS8 C;  5EIB C;  4JI3 B;  3OEH G;  1M57 B;  3FB6 C;  3CC7 V;  4IGG A;  2K9P A;  4UXN A;  4Z2W A;  4YHH O;  1Z2G A;  3LSQ A;  4I55 B;  4TOI A;  4DR1 B;  1RP3 B;  1ZSP A;  3WG7 C;  4DV0 B;  3ZJZ A;  4HNA B;  5JVD B;  2F23 A;  2YXL A;  1F23 A;  4FMT A;  4B3T B;  4LWS B;  1AI5 A;  1D2D A;  5K1P A;  2DE0 X;  3H1K H;  2UXB O;  5BMV B;  2CH7 B;  4U7N A;  3KG2 A;  2Q8V A;  3CX5 F;  2ODM A;  4JV5 B;  4WF9 V;  2B9Z A;  3KZI Z;  4IYH A;  3QO5 A;  3JD3 A;  1S76 D;  4ZOL B;  1SET A;  2ZXW C;  2F4V O;  2WA3 A;  1M56 B;  4R50 A;  3LSU A;  3ZHU A;  4KL1 A;  4ZIB A;  2R9R B;  4J10 A;  4UFZ A;  4UB6 Z;  4HBN A;  2DYS B;  4AHC A;  1MOF A;  3RYC B;  4X62 O;  1COW G;  4Q6G A;  5ITZ A;  2JGU A;  3D36 C;  2GV9 A;  3N2K B;  1NTK H;  1OV9 A;  1DLB A;  3TJT A;  3UM7 A;  4K0K B;  1Y4M A;  4GX0 A;  2W0F C;  2UXX A;  1AR1 B;  1WN7 A;  2E3C A;  2YXH A;  1NVP D;  4UV9 A;  2KG7 A;  3UQ8 A;  2P7T C;  1AJQ A;  3S3W A;  3I55 V;  1U96 A;  5LL6 Y;  1SQP H;  5IJ0 A;  2XHB A;  1ROP A;  2WLN A;  3CCM V;  3OGI B;  1M57 C;  4ZI7 B;  2QGN A;  1Y6X A;  4QPK A;  4RQF A;  1V55 B;  3CB2 A;  3FYE B;  1XMO O;  3L73 H;  4X65 O;  4NB5 A;  2Q73 A;  4LF5 B;  4OPA A;  3SDL A;  3T1H B;  3ZRS A;  3ZHR A;  4YY3 O;  5E79 Z;  2LFR A;  2EIL C;  3TXQ A;  4YIP A;  3F7V C;  3CEI A;  3Q4H B;  1RPR A;  3U10 A;  3N2G A;  5FNV B;  4LNU A;  2EIM C;  1SA0 B;  4DR4 O;  3ASO C;  2GHY A;  1GM8 A;  1L0L H;  1I08 A;  1XL6 A;  3CP1 A;  2UXD B;  1IBL B;  3M7M X;  2QWR B;  3OR6 C;  5JH7 B;  1AJN A;  1KKC A;  4IHJ A;  4FLW A;  2YDE A;  3BY6 A;  3JAK B;  2ZIM A;  3FAV B;  4XDK A;  2DYS C;  5CA0 A;  1YJW V;  1KQS U;  4G28 B;  5LP6 B;  3HKC A;  4EFE A;  4I0X B;  4I5S A;  4MW8 A;  1G8M A;  1B3Q A;  2ZCE A;  4MVQ A;  1HNZ B;  3ABL B;  5LGT A;  3ICX A;  4NXM B;  2P4K A;  2EZO A;  3ASN C;  4LFA O;  4JZG A;  3L72 H;  4GX5 A;  3G6B A;  4Z1V A;  1H8E G;  3LNN A;  3VOU A;  3ZRW A;  3ZX6 A;  1X59 A;  1FXK A;  4JI2 B;  1EM1 A;  4DR6 O;  4LF4 O;  3H9V A;  4X20 B;  1I0H A;  3E89 A;  4JI1 O;  3A0B Z;  3HR0 A;  5LMU B;  1QQC A;  2FML A;  4FLZ A;  1SQX H;  2P90 A;  1BL8 A;  2F95 B;  1M93 A;  4O2B B;  3AG4 B;  1KYO F;  3RFR A;  4FFK A;  1M1K W;  2QJ1 A;  3SJQ C;  5LBQ A;  5J2T A;  1MMM A;  2HHH B;  3CMA V;  4LF7 O;  1MSD A;  5CA1 B;  1NJI W;  2WAM A;  4DV7 O;  1YZB A;  3AG3 B;  5K1X A;  1VF7 A;  1KU9 A;  4B3R B;  4YJ2 B;  5IDJ A;  5IY5 B;  2GDS A;  5LP6 C;  1QR8 A;  1VQ8 V;  5CB4 B;  3A2F A;  1N36 O;  4HAM A;  2H3O A;  4I50 A;  4AIL C;  3ABL C;  1GRJ A;  1DF5 A;  2PF4 E;  2EBO A;  4D6T H;  5J2U A;  3THO A;  2R72 A;  1FYJ A;  1QBZ A;  5B3S B;  3K58 A;  1M9N A;  2QWN B;  5DM6 V;  1SQV H;  3BAB A;  1ENV A;  4O4J B;  4DR3 B;  3JAT A;  5D5P A;  4D7T A;  5BXZ A;  3RVZ A;  4UVB A;  2X6B A;  1ZWI C;  1ZL8 A;  2EIJ C;  2F93 B;  2N74 A;  1ORQ C;  1Q7Y W;  3EXA A;  2OIE A;  4DO2 A;  3JAL B;  3ZHV A;  4H33 A;  3JCZ A;  5LGU A;  1D5A A;  2ZNI A;  5C8Y B;  4JI6 B;  1D5N A;  1BZK A;  4RO2 A;  3KCY A;  4FM1 A;  1WP8 A;  4PI2 A;  2MK3 A;  1F51 A;  2Q4P A;  2ZQM A;  2UXN A;  3JAS B;  2GUZ B;  1T5E A;  1HP8 A;  3OUF A;  3G80 A;  1R3J C;  3AG1 B;  2Q68 A;  5IJ9 B;  2Q0A A;  1GMG A;  1FPO A;  1XI1 A;  2QTS A;  3BA8 A;  2OCC C;  4QIW F;  4DUY B;  5JQG A;  2WLL B;  1JX9 A;  1PM9 A;  1F7Y A;  2RCV A;  2YC0 A;  2Q5Z A;  3APQ A;  1W2B U;  5ITZ B;  3K3W A;  4RUF A;  2ZIN A;  4I55 A;  3JYC A;  1SKV A;  2AXT Z;  2LJ2 A;  4HNA A;  2DQ0 A;  3E8H A;  1N0N A;  2KG7 B;  5JVD A;  1IBM O;  2OWO A;  1MZE A;  5EZY B;  4LWS A;  2QWO B;  4EKW A;  4PI0 A;  3JAM N;  4GYC B;  4U3J B;  5IJ0 B;  3OTO B;  5BMV A;  2Y0P A;  3U11 A;  2CH7 A;  4X64 O;  2RDC A;  4LF6 B;  1Y67 A;  2Y4U A;  5E1A C;  2QR4 A;  3EFF K;  3F7Y C;  5LMN B;  1MNG A;  4ZOL A;  1XUQ A;  3N27 A;  1EN6 A;  4JTC B;  1PKX A;  5KMG A;  3CCL V;  1BGY H;  3SR2 C;  4XDJ A;  1YIT V;  2Q6A A;  1QLE B;  3SPC A;  4ASU G;  4FLV A;  4MTX A;  1EFR G;  3RYC A;  3JAW B;  4H13 B;  4LNU B;  3N2K A;  1QU7 A;  2RN9 A;  4D7S A;  3AG1 C;  3OD4 A;  2B5U A;  3K9S A;  4B3M B;  3HPL C;  4LBE C;  1KEC A;  2EJ7 A;  4QE7 A;  2ZR3 A;  3U0Z A;  4TQD A;  2ATK C;  3W7W A;  4EB6 A;  4DV3 B;  4NYK A;  4DRX B;  3T1Y O;  1K92 A;  2QEX V;  1TUE B;  4F4L A;  5CA0 B;  4ZI7 A;  3W7S A;  3OTF A;  1JMK C;  1G1X B;  4OX9 B;  4WBN B;  1KMI Z;  4GKK O;  4J41 A;  4ZBM A;  2W6I G;  4X66 O;  4O4L B;  4DV2 B;  2Y4T A;  4LFC B;  2GTS A;  3Q4H A;  3SYP A;  2N05 A;  1TGO A;  5JCO A;  4NXN O;  1P7G A;  3TCU A;  4JTD B;  1SA0 A;  4PV1 B;  3L75 H;  2UUB B;  3G4S V;  1FFX B;  1FXV A;  3STL C;  4X89 A;  1YHQ V;  1KD1 W;  3QVN A;  5H2F Z;  3IGA C;  5JH7 A;  5IWA O;  3JAK A;  2O57 A;  5GON B;  1YCI A;  3UKM A;  1QLE C;  1VAR A;  4P30 A;  3FAV A;  3C3T A;  1F4M A;  4DR2 O;  2DYR B;  3R66 A;  4NTW A;  3O65 A;  5EK0 A;  5LP6 A;  3BAA A;  4I0X A;  1WPB A;  4L87 A;  1OCO B;  4NTX A;  5B5E Z;  1K33 A;  1HNX O;  4TV9 A;  1QLN A;  4P2Z A;  2F43 G;  4PDR A;  2EX3 A;  3OEE G;  4DV6 O;  3AG7 A;  1SRY A;  3OFN G;  4WFG A;  2YID A;  4PHZ A;  1YSC A;  4TV8 B;  1IBK B;  2UXC O;  1RPO A;  3W7T A;  1SES A;  3APO A;  3FFQ A;  1EBO A;  1OCC B;  4JI0 O;  1XDC A;  3AK1 A;  2A0L A;  2QWP B;  4ZHQ B;  5AG2 A;  4X20 A;  5L3G A;  4JI4 B;  1E1R G;  3E2E A;  4BAY A;  4DK0 A;  5H9C A;  3R65 A;  4I50 B;  1FS0 G;  4TSF G;  4I9Q A;  2IH3 C;  3CCU V;  3QTC A;  5JJN B;  4CS3 A;  4C7U A;  2Q7G A;  2CTP A;  2KQX A;  1U97 A;  1K5Q A;  3BVO A;  2E5L B;  4O2B A;  1Q43 A;  1KP3 A;  1N4C A;  5C93 A;  2GBO A;  4GUN A;  1FXK C;  1VQ4 V;  4GZR B;  1I94 B;  5BR8 B;  2ZM6 O;  1JOY A;  1NTM H;  3ZHS A;  2CTW A;  1BHA A;  3CRQ A;  4GKJ B;  5KLV H;  5CA1 A;  3C3S A;  3VQY A;  2A9H A;  4UVC A;  4K3A A;  5IT9 N;  4X1I B;  1IDS A;  2QKA A;  3BPZ A;  4U3F H;  4FJC C;  4JYA O;  2WLH A;  5CMU A;  4UUJ C;  5CB4 A;  4LF9 O;  3LDC A;  1XNQ O;  1OCO C;  1P49 A;  5CA3 A;  4LF8 O;  4J11 A;  1NU1 H;  2BOB C;  1GAX A;  3QNE A;  2PUS A;  1UPG A;  3K06 A;  5KHK A;  2HVK C;  3VQW A;  4LFB B;  3ZCC A;  2XT9 A;  3ABU A;  3S3X A;  2P22 C;  2ZE7 A;  2VS0 A;  1HW7 A;  1XNR O;  1J95 A;  1IXM A;  1S5H C;  2F1M A;  3BEH A;  4FLT A;  4O4J A;  1Q6U A;  1XBL A;  1AI6 A;  2CE4 A;  4DV4 O;  3CHX A;  2Y69 B;  4MS2 A;  3CCQ V;  5JQG B;  1QR9 A;  3K0G A;  3WB0 A;  3DC5 A;  3OUS A;  3ZMZ A;  1RM1 B;  1VF5 B;  2CGN A;  2P06 A;  3P3N A;  3JAL A;  3LDE A;  1GM9 A;  1XEQ A;  2CK3 G;  5C8Y A;  3RW0 A;  1DTO A;  1RSO B;  4N21 A;  1AJP A;  1N32 B;  3SYO A;  4DV5 B;  3ZRX A;  2VQE O;  4CZZ A;  5EBM C;  1VEW A;  1GN4 A;  3LSS A;  3JAS A;  2GUZ A;  2XOK G;  3WFV A;  1Q82 W;  1IXB A;  1K5S A;  5IJ9 A;  4YHH B;  3ABK C;  1R6T A;  2IW5 A;  5KMG B;  4DR7 B;  1W59 A;  3RVY A;  3K9A A;  1CXZ B;  4A5U B;  4RAI A;  2MW2 B;  2WLL A;  1GTO A;  4JI7 O;  1KC8 W;  2WWW A;  3L74 H;  2QWQ B;  2QM8 A;  1VQK V;  2IM9 A;  2UXB B;  3H01 A;  1GM7 A;  3NXS A;  2IBZ H;  2UUA O;  3P30 A;  2UU9 O;  4JAV A;  2DOS A;  2YXY A;  5H5N A;  1VQP V;  2PY5 A;  5L3E A;  5EZY A;  3A8T A;  4J42 A;  4FM0 A;  2F4V B;  3CPW U;  1JQ0 A;  4DK1 A;  4U3J A;  3CCS V;  1S72 V;  4EB6 B;  4UCV A;  3RT3 C;  4J9Z B;  2IJJ A;  2VWK A;  4AQY B;  4LF5 O;  2PTM A;  4CC5 A;  2LQT A;  2W0X A;  1MAB G;  2CAZ C;  4X62 B;  1L8D A;  4JI8 O;  1R3K C;  1Q6I A;  2JDI G;  3B2E E;  3ETQ A;  3JD0 A;  2OIG A;  1PNM A;  4ICG A;  5DEC A;  3GWK C;  3JAW A;  4CS2 A;  5LHG A;  2IJI A;  4WFB V;  1NS1 A;  3DXR B;  1E1Q G;  2Q0O C;  3CE2 A;  3CCR V;  5KAF Z;  2JIZ G;  2YI8 A;  1XMO B;  1Z5V A;  1KBH A;  4X65 B;  1M56 C;  1FJG O;  4QNH B;  2X6C A;  4DRX A;  4J7K A;  4YY3 B;  3K0D A;  3HKE A;  3JAR A;  4QE9 A;  4LH7 A;  3ZIA G;  4P9O A;  1XIL A;  5L3F A;  2R70 A;  3OE7 G;  4WBN A;  5IE9 A;  3SPI A;  2RQ6 A;  4YJ3 A;  1IVS A;  4TV9 B;  4O4L A;  3VQX A;  4DR4 B;  2BE3 A;  5KHJ A;  2A7W A;  3CD6 V;  2Y48 A;  4KHP B;  1UJW B;  1W0K G;  4RUE A;  3SYC A;  4B3S O;  1NR7 A;  2JGD B;  2UUC O;  1WP7 A;  5LA6 B;  2IU3 A;  5B1B B;  2NLJ C;  4X1Y B;  2M6Y A;  2WPD G;  2B1G A;  2W6J G;  1PPJ H;  4DV1 O;  3GB7 C;  2L6L A;  1V55 C;  1FFX A;  3FYI B;  5L3D A;  5D5Q A;  1TVK B;  1YDX A;  4R6Z A;  4IIJ B;  4CBC A;  1SC5 B;  3MHS C;  5EYP B;  4BW5 A;  5GON A;  3E35 A;  5EBL C;  4OPH A;  2ZD9 A;  1M90 W;  4LFA B;  2CGO A;  5JCO C;  2QA4 V;  1K34 A;  3AK2 A;  4F6R B;  3X2Q B;  2C2A A;  2XAF A;  1SS3 A;  4DR6 B;  4LF4 B;  3RYI B;  4PA6 A;  4JI1 B;  3W7X A;  4TV8 A;  2EIK B;  3B8M A;  1LNQ A;  1XMQ O;  3K5M A;  3BCC H;  2Q69 A;  3ML0 A;  2XAH A;  3RBZ A;  1H8H G;  4ZHQ A;  1JJ2 U;  2ZE6 A;  1WNS A;  2BTO A;  2OTJ V;  3STZ C;  2DJV A;  4LF7 B;  3I5D A;  3HKB B;  1X4T A;  2EJR A;  4X1K B;  5LHI A;  1R73 A;  1BMF G;  4CS4 A;  2RNB A;  2GSM B;  2KSD A;  4FLU A;  2N04 A;  3OR7 C;  3RYH B;  1GN6 A;  3E86 A;  2YS8 A;  4JF3 A;  4KFM A;  3ZMV A;  1DGS A;  4JI5 O;  3D3I A;  3B09 A;  1R6N A;  4H0L B;  1N36 B;  2ZE5 A;  4MT8 A;  5KUM A;  4X1I A;  1NR1 A;  4X88 A;  4UB8 Z;  1QVF U;  2CDY A;  4DW1 A;  3AG4 C;  5CBH A;  1HDJ A;  1K73 W;  3UT5 B;  3X2Q C;  3CCJ V;  3RWR D;  2P4V A;  3G71 V;  1JA8 A; 
#chains in the Genus database with same CATH homology
 2GTS A;  4KXR A;  4IYI A;  4J10 A;  4J11 A;  4J7J A;  4IYH A;  4W4L A;  3FX7 A;  2G38 A;  4J7K A;  4J41 A;  4W4K A;  4J42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...