4KXRA

Structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
b'NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE25
publication title Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 35
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4kxrA00
4IYHA 3FX7A 4IYIA 4W4KA 4J42A 4KXRA 4J10A 4J7KA 2G38A 4W4LA 2GTSA 4J41A 4J11A 4J7JA
chains in the Genus database with same CATH superfamily
1EZJA 1IVSA 5B1BB 2DQ0A 2M7WA 4HNAB 2ZKOA 5EC2C 2QKAA 3DGEA 1ZWIC 4GX1A 5BMVB 3T1HO 1KU9A 3JATB 2H8PC 4JTDB 3CS5A 4JYYA 1R3KC 3BEHA 2Q9LA 4JV5O 1KP2A 4JI8B 5EK0A 4X65O 3D36A 3RFRA 3O65A 1ROPA 3JAKA 1GMGA 1X4TA 4DV4B 1RSOA 1I94B 1XL6A 3CYOA 1D5NA 2CH7B 3E83A 3OTFA 3OTOO 3CC4V 2ZE7A 5K1XA 3BA8A 2EINC 3ASNC 1BS3A 3HKBA 1KKDA 1K4DC 4J7KA 2V7QG 2YI9A 4LF5B 1NS1A 5JVDB 4FZ0A 2Q7GA 3VBBA 1XUQA 4YIOA 4ASUG 3NR7A 1VMGA 1Q3EA 4HZ3A 3RW0A 1ZTEA 4X62O 5DM6V 1WP8A 1M56B 5BR8O 3AK2A 3BFRA 2FKXA 5FL7G 1FD9A 4PA6A 2R70A 2LGQA 3I55V 2ETNA 4J80A 2ZQMA 5EBMC 3A8TA 1E79G 1JCHA 3KZIZ 1OCCB 5L3DA 4DR5B 5AG2A 3CE2A 4JI3O 1FS0G 1LR1A 3AG7A 4DUZO 2UUBO 1GN6A 4HNAA 2Q0OC 2QKCA 2R9RB 5L3EA 3SJAC 4DV0B 4TOIA 1Q86W 3OMNB 2RN9A 4MVOA 4GLXA 3L74H 1GN2A 5J2TB 3ABUA 1WB7A 1S72V 5BMVA 5B3SB 2WA3A 1YCIA 3JATA 3VQWA 2AGAA 2OT5A 1CP9A 2KKWA 3AG4B 4E4EA 4HYOA 3RN4A 1QR8A 4IYIA 3JD1A 1YTFB 3ZJZA 3LSUA 2IJJA 1XL4A 4JZGA 5JCOA 5CA1B 3ABKC 4H37A 1NVPD 2VWKA 2JIZG 3ASOC 3F5WC 4GCZA 4G27B 2UXDB 4PA7A 2CH7A 2JK5C 1GM8A 4X89A 1HNWB 4DV5B 2OIGA 4OPHA 1WB8A 4FVMA 1W0KG 5JVDA 4DR2O 2B1IA 1VQLV 1NBMG 4IHJA 3ETEA 4GYCB 5KHKA 2E76B 3AK1A 4EFEA 2K9PA 5GTIZ 1IZ3A 2Y0IA 3E2EA 2GDSA 3O9OA 4UCUA 4NXMB 3B8NA 3RYIB 2F66C 4NXNB 3CHXA 1FXKC 5FLXN 4R6ZA 1Q81W 1QNMA 1YSCA 3H1IH 3QO5A 2XAGA 4K0KO 3WB2A 4QNHB 2Z0AA 3THOA 3VQXA 5A2QN 1KBHA 3K5OA 4JI2O 1W2BU 1MNGA 5J2TA 5H5NA 2EILC 4JF3A 1BHAA 3IC9A 5K1PA 4U7NA 3ZHUA 4P9OA 4QPKA 2NNUA 2Y4UA 1QVGU 1N34B 3CCVV 1QBZA 5LP6B 1OCOC 3ICXA 4GX5A 5CA1A 3T1YO 2CE4A 4B3RO 1H2MA 4QPJA 4UCRA 4IT5A 3JD0A 3CRAA 3CJHB 1CEZA 4U3FH 2W0XA 1H8HG 3ETDA 4UXNA 1L0NH 4JV5B 4XBFA 1EFRG 1JX9A 2LFRA 2XHBA 2Q0AA 4X65B 2UXCO 2CAZC 3D3QA 4DR3B 2CTRA 3A0BZ 3WB1A 3UO2A 3FYIB 4DV3O 3DSQA 3TGUH 1QU7A 3SJQC 4D6TH 1LUWA 1TUBB 3OTOB 5FNVB 4MVZA 2W6JG 1XMOO 4DV7O 1FXVA 4B7EA 3RYIA 4JAVA 3UQ8A 5CBHA 1WJZA 1RM1B 4RWUA 2ZIOA 3IJ4A 4FMTA 1BL8A 2JS3A 1VQMV 3ZRWB 4ZOLB 4IYHA 3ZHQA 4B7KA 4X62B 2HP8A 1KP3A 5BR8B 1THZA 3PJSK 4LF9O 2DYSB 2HEPA 2YIAA 1VQNV 2ZD9A 1GRJA 4CS4A 4BIZA 4JI3B 3SPHA 2UUBB 4DUZB 5LP6A 4LFCO 4LF8O 3AK3A 4K8ZA 2PGGA 1K3EA 1SS3A 5LGNA 1V54B 1IBLO 4FLXA 1GAXA 4U7OA 1Q5OA 5BZBA 3CJHA 1QVFU 2OIEA 3ZCCA 2BE3A 4X8AA 5LHIA 1Z5VA 1WP7A 5CMUA 2UUAO 3U0ZA 2C2AA 3SJCC 4WBNB 3OM3B 2IW5A 3QF7A 2JRIA 2ZXWC 1HDJA 1F51A 3CCEV 1ZL8B 4CH6A 5GONB 5FNVA 3E22B 5IYZB 3OGCC 1BT8A 1N8RW 3RYCB 4I4TB 1MSDA 3K57A 4RQEA 1UPGA 2VQFO 4DR2B 1K73W 3RWRD 2EIJB 3L73H 3ZRWA 4ZOLA 1KMIZ 3MHHC 4NKGB 1DF5A 4J9ZB 1U96A 3D36C 1NQTA 2IH1C 3ZMTA 5DN6G 1N4CA 2L35A 3WG7C 2DJVA 2NR5A 1HNZO 1IXMA 1VF6A 5C93A 3IGAC 1YJNV 1EN5A 5EC1C 4TV8B 2CGNA 3ETGA 3BABA 2N05A 4ICGA 3AG3B 4F6RB 4K0KB 3L71H 4L87A 1CPYA 1XHZA 2Y69B 4JI2B 4TUYB 3K9AA 3B09A 4LF6B 3ZIAG 4R8CA 1H2KA 3WU2Z 1NTMH 2VRZA 5F2VO 1MG1A 4LP8A 1VEWA 3BA9A 4Z1VA 2ZINA 1YIJV 4WBNA 3T1YB 1YJ9V 2DYRB 4B3RB 2QWOB 2X6CA 4MVQA 2XAFA 5B66Z 5KAIZ 3ZN0A 5C8YB 2CDYA 1ZL8A 2V1DA 5KAFZ 5GONA 1P4RA 2ZNIA 3E22A 4LWSB 2XOKG 5IYZA 2QM4A 3RYCA 1QQCA 4FFKA 4I4TA 2UXCB 2AZ0A 3DXRB 3FB7C 2QJ1A 4GKKO 4PDMA 2WLLB 4DV3B 5IYBO 4O4JB 4J9YB 4TV9B 2FL4A 4N23A 4LFBO 3OT7A 5JCOC 4WF9V 4WCEV 4PDVA 3AEIA 1XMOB 1SQFA 4DV7B 4MT8A 1IXBA 4PI2A 4XDJA 4JTCB 1MOFA 1I5XA 4JYBA 4G2KA 3K9SA 3J7AU 1O9HA 2GTSA 4TV8A 1NU1H 1BE3H 3UO3A 4WFFA 3W7SA 2AZ2A 1GK9A 4F6RA 5EZYB 1QHTA 2QR4A 2XNDG 4BR6A 5H6QA 4TUYA 4LF9B 1S0VA 5GW7A 2X0LA 3QO7A 3GWKC 1FAFA 2WWWA 1M56C 5JJEB 3ZHRA 2EJRA 1RPOA 3C3SA 3BAAA 4PA4A 5CA3A 1R6TA 2LQTA 4LFCB 2B1GA 4LF8B 4JZ2A 3W7WA 4DV1O 3MDSA 3K04A 1OCCC 1IBLB 3IAYA 4O4HB 5IJ9B 2QWRB 2ZR2A 4GT1A 1VQPV 2XT9A 2NLJC 4IIJB 5C8YA 1FFXB 2EJ7A 2YSUB 2MW2B 1JVMA 4LWSA 3SDLA 4EKWA 3PN1A 1AR5A 1H2NA 5BXZA 3SJBC 1N33B 2UUAB 4ZI7B 1RPRA 2JJ2G 1NZ6A 2EZPA 5KX5B 3DXRA 4N21A 1R3IC 2WLLA 1BQZA 4UV9A 1US6A 4O4JA 3JAMN 4TV9A 4DR1O 4YIPA 1IBKO 5KMGB 1GN3A 2DN9A 1K34A 1L0LH 1R1BA 4JAUA 4HAMA 3B40A 1D2DA 3QG5A 1JA8A 3K59A 1LNQA 2JS5A 5LOVB 2VQFB 3F5TA 3OMAB 3ZMZA 4DR3O 3LNNA 5EZYA 1SQBH 4DXWA 4DUYO 2BSKB 3ZHVA 3TXQA 1L8DA 1AJNA 1SKVA 1SESA 5KHHA 1H2SB 4UCSA 1Q7YW 4R7CA 3CCQV 1HNZB 1BMFG 4P2ZA 1HNXO 4LNUB 2GUZB 2PI5A 3K79A 3JCZA 3ZS8C 3IFXA 4OX9O 4GKJB 1Y4MA 4JI5B 2PZSA 4WFEA 4XDLA 1SQGA 2JEUA 2YI8A 2CK3G 4O4HA 5IJ9A 3G80A 3AG1B 1I5YA 1U97A 4IIJA 1Q6HA 1IBMO 2BTOA 5IY5C 5IWAO 3Q4HB 2ZE5A 1FFXA 1XREA 4FLVA 2WLHA 5EIBD 1M9NA 4DV6O 4ZI7A 1WPXA 4X88A 5KX5A 1YVWA 3JCUZ 1WN7A 2ZE8A 2KB1A 2HG5C 2PY5A 1E1QG 4LR3A 1EBOA 5KMGA 1PKXA 2QDOA 3RT3C 1XMQO 2QEXV 2OCCB 1FJGO 4NTYA 1PL0A 1F7YA 1M1KW 4TQDA 4BW5A 1DGSA 1URFA 5LOVA 2G38A 3GWOA 4GKKB 3P3NA 4B08A 4LFBB 2BSKA 5EIBC 4ZBMA 4MTFA 1P7GA 1XHXA 1DLBA 4CS2A 3E8HA 2LW1A 4DYLA 1NTZH 4LNUA 4ZIBA 2GUZA 2X7RB 1Q90D 1YHQV 1AILA 1DTOA 2YIBD 1PD3A 1AI4A 1PNLA 2D2CB 2LJ2A 1MZEA 5B1NA 2RQ6A 3D3IA 3UM7A 3SPJA 1B6QA 3QO8A 4QJFB 5H2FZ 4MW8A 3Q4HA 1W59A 2IU0A 2ZDIC 2X6BA 3CRMA 2EINB 3CPWU 2DYSC 3ASNB 1XNQO 2LO1A 3S3WA 1F4NA 4LC1A 2YXYA 1MABG 1VF6C 1D5AA 3C90A 1NT2B 2PYLA 3FFQA 2XUMA 3VQYA 2D3OW 3CRQA 4DV1B 4KXRA 4K8XA 4W4LA 1N32B 3CC7V 5J2UB 2YUAA 3X2QC 1F4MA 2IJKA 2P7TC 4LF6O 1VQ6V 4E2LA 1EN4A 4YXWG 4HBNA 4DK0A 2RDCA 2DWDC 5IDJA 3MD0A 4O4LB 2N04A 4BIUA 5IYDO 4ZKIA 2WLJA 1JOYA 4MTGA 5TISZ 1K4CC 4NTXA 1BGYH 4DR1B 1IBKB 3JALB 3E89A 1IURA 3DTUB 1I0HA 4K3AA 3M8AA 1GKFA 4J42A 1PNKA 1SF9A 4UCOA 2H3OA 3OR7C 1AI7A 4JI6O 4D7SA 2LFSA 4PDRA 3S3XA 2QTOA 4UCTA 3CXCU 3TXSA 1KECA 3ABLB 4GZRB 4DUYB 2DE0X 3ZMVA 2A0LA 3ASOB 5JH7B 3OGIB 5BY1A 1YI2V 3FB5C 4DRXB 1NH2D 3BHPA 1L1FA 2F43G 1IX9A 2P06A 1B06A 3ABMC 1HNXB 1AROP 3SYAA 3BPZA 4MVMA 4OX9B 1WAZA 5LA6B 1S76D 4FJCC 5HFLA 3ZX6A 2R72A 4MTXA 4DW0A 4PV1B 5J2UA 4X64O 2ARHA 3JASB 5DEDA 5J9PC 1IBMB 1SQVH 5IWAB 2UXBB 3NXSA 3LSQA 4LBEC 4FFBB 1M57C 1M4UA 4YY3O 4X9QA 3CSXA 4B3MB 3W7XA 4O4LA 1E1RG 4DK1A 1FFTB 1WLEA 2B5UA 4DV6B 3G67A 1FXKB 1S5HC 3ZRXA 2PUSA 3CD6V 1QLEC 1WPBA 3L75H 2HFEC 1R3LC 1H38A 3JALA 2EZOA 3C3TA 2YC0A 1XMQB 3ZHSA 3LSSA 1FJGB 3EHBB 3OR6C 2EILB 4UV8A 1N33O 3EXAA 5IYCO 5GTHZ 5E1AC 4CH5A 1PNMA 3BY6A 1G6UA 1EN6A 2ADQB 2W6IG 1OCOB 2P22C 3RVYA 1K92A 1OHHG 2IBZH 1W0JG 1HR0O 1TUBA 3K0DA 5JH7A 4UUJC 3SYQA 3EVKA 4DRXA 2X6AA 4H0LB 1TUEB 2VWJA 4TQFA 2HJFC 4I9QA 4PI0A 1VQ4V 3TJTA 4PA9A 1J5EO 3JYCA 3FB6C 5LA6A 2DW4A 1V55B 3GVMA 1OCZC 3RYHB 1VQKV 4H44B 2PF4E 1SQQH 2GBOA 3CMEV 3JASA 2GSMB 1TVKB 2W0FC 1YITV 1F23A 5LYJB 4FFBA 2DWEC 2DMXA 1KKCA 4GKJO 2P90A 1XNQB 4KHPO 3HKCB 4JI5O 2YS8A 5KA6A 1ENVA 4X1IB 4OPAA 4DV2O 2XAQA 1FXKA 4BAYA 2EIMC 5B1AC 4JI4O 3CXHF 4MS2A 1P49A 2WPDG 3OFNG 4AILC 2ZIMA 4I55B 1DK1A 4NVPA 2FYUH 2HLDG 1AVMA 2YXLA 4MVRA 3G71V 4KL1A 1V9PA 1Y6XA 5D5QA 4Z1MG 4LH7A 2EX3A 1BZKA 1Q43A 5CA0B 1BCCH 1OCRC 3DC6A 3AG2B 4JPRA 2R9AA 2OTJV 2OCHA 5B1BC 4X1YB 4TWKA 4Q6GA 4BIOA 1FXHA 3E8FA 3JARB 3CCMV 4B3SO 2QWPB 1A32A 5FPRA 1Y76B 2IH3C 1SRYA 2KG7B 2WAMA 2JDIG 4JI6B 3J81N 4FZ1A 4G28B 4O2AB 1JQ0A 2Q5ZA 3UCSC 3RYHA 4GUNA 1PP9H 2JGUA 5E79Z 2WA4A 2ZXWB 3T1CA 3FAVB 2JGDB 1G8MA 1TVKA 3CC2V 5FPOA 1KQSU 4UFZA 1KC8W 4U3JB 2JEXA 4CC5A 5LHGA 5LYJA 1Z2GA 1JFFB 2Z5UA 4RO2A 4WFGA 4I7ZB 3HKCA 4X1IA 1AP6A 1NI8A 4DW1A 4LH6A 1YXBA 3SPCA 2A06H 4PDLA 4LFAO 3ZRVA 2QA4V 3OE7G 1YZBA 2B9ZA 2A9HA 4X64B 2BOBC 4OXSA 4I55A 3E8GA 4FPPA 5EYPB 4CBCA 3G6BA 4UB6Z 3MHSC 4CH3A 4LF4O 1YTFD 1G4YB 4YY3B 5LBQA 2HVJC 2K1EA 4D7TA 3WG7B 1QLNA 1Q8IA 1XNRO 3EFFK 3VQVA 1XBLA 5CA0A 4AQYO 4GX0A 4TT3G 4CS3A 3N2KB 5JQGB 2JJ1G 1N32O 4MW3A 1GTOA 2Q7HA 2YICA 1I7FA 3P30A 1YF2A 4X1YA 3B4SA 1COWG 3K03A 4MSWC 5EBWC 3JSNA 1GO3F 1SA0B 3JARA 2R9IA 1ZAUA 4WFHA 1Y76A 1K5SA 2KG7A 4YJ3B 1VQ7V 5B3SC 1UFIA 3UT5B 4O2AA 2BOCC 2IJIA 3AG4C 4CZZA 2XASA 3CCLV 2WLMA 4I5SA 4J7ZA 1FYJA 1HR0B 2V4DA 3KKYA 3FAVA 2JGDA 1R73A 2Q67A 3MAQA 3ABTA 5EBLC 3H1KH 4U3JA 4FLZA 5KA5A 5JWPA 1JFFA 1R3JC 1J5EB 1M5IA 5H6RA 1HWYA 2NN4A 3ETQA 4JI1O 3SR2C 4P30A 1P7BA 4UVCA 2BTQB 2ZM6B 5EYPA 3SYCA 4DR6O 5L3BA 3K5LA 1VIBA 1NTKH 3E8BA 1SETA 1JMKC 3CX5F 3CCUV 2Z3YA 2EIKB 4KHPB 4H33A 4I0XB 2IU3A 2YXHA 4DV2B 3TCUA 5CB4B 1KUQA 5DECA 4EFBA 3N2KA 5JQGA 1XOUA 1K8AW 4JI4B 4PELA 1TAEA 3TETA 4W4KA 3CCSV 3B77A 3L72H 4X66O 1VQ9V 2UXBO 1SZTA 1SA0A 4IHJB 1H2GA 4NR1A 1VF5B 3HR0A 1N0NA 4J41A 5L3GA 4B3MO 1K33A 4YJ3A 2IM9A 1ZLZA 4DR7B 3UT5A 2ZNJA 3APOA 1IDSA 4NYKA 1AR1B 1QCEA 1O9GA 1GN4A 5LP6C 3G4SV 5LMUO 1N36B 3ZEDA 2UU9O 1EM1A 2UXNA 1FKAO 1B3QA 2Q6AA 3QTCA 5KUKA 4B3SB 1M93A 1JPXA 3LDEA 3B8MA 3LNMB 2P4KA 4DR4O 1M90W 4B3TO 1Q82W 3CRCA 4TSFG 3JAWB 4JI0O 3P32A 4PD4F 1Q6IA 1VQOV 2O57A 3L9DA 3N27A 3ZMUA 1SQXH 3CEIA 4FK5C 3WFVA 2Y0PA 2DQ3A 2BTQA 3ABLC 3JD4A 3HKEB 3KCYA 2ILMA 1PPJH 3L70H 2P5OA 4I0XA 4UVBA 1TA8A 2CTQA 2L6LA 3M99B 2QTSA 4QGPA 5H9CA 5CB4A 5IT9N 4LFAB 1RM1C 1YEWA 2VQEO 3U10A 3A2FA 4A5UB 2UUCB 4X1KB 1Y67A 2E75B 3F7YC 4JI7O 3LDDA 3RGBA 4LF4B 3OW2U 3HB3B 2EULA 2GV9A 1SC5B 5KHGA 5KHJA 1BSMA 2RCVA 1XNRB 3T4ZA 4O2BB 4AQYB 2AHYA 3IC7A 1G1XB 1KD1W 1XILA 1HW7A 1RP3B 2LP7A 4K35A 2WLIB 2HHHO 3OUFA 3G6EV 3OD4A 2YDEA 2N74A 1ZSPA 2Q68A 1VP7A 5LHHA 3K08A 1CXZB 2ODMA 1V54C 2QE7G 2XAJA 3SPGA 4AI8A 5IY5B 4F6EA 3ZN1A 1SQPH 1XEQA 4IL6Z 2F23A 3B2EE 2FB5A 4Q20A 3FKSG 4RQFA 3JAWA 4ZHQB 4PA3A 3H1LH 2Y48A 3VOUA 3ML0A 5LMNO 1NR1A 3STZC 2P6JA 1Q6UA 3BCCH 3ZMSA 2RNBA 3HKEA 4FIPC 1T5EA 4PHZA 1RFYA 2WLNA 3A0RA 4YHHO 2QKSA 4J11A 3SGIA 5KUMA 1K5QA 2PTMA 2E74B 2E5LO 2F1MA 1JJOA 3T1HB 4UCVA 4X20B 4JI1B 3ABKB 2QGNA 3E86A 1K7DA 2WLKA 2GHYA 4JTAB 4X1KA 1HP8A 5ITZB 1V55C 1ZX3A 2EIJC 3OEEG 4DR6B 1P84F 3STLC 5L3CA 3H1JH 2YEVB 4UB8Z 1K97A 1MA1A 1BQ0A 4JGSA 2CGOA 2XAHA 2Q4PA 4CC6A 1SERA 4FM2A 3R66A 1S5LZ 3CP1A 3APQA 3RBZA 3BRCA 4O2BA 1S3JA 4GX2A 2QWQB 4QE9A 3T4DA 1VQ5V 1UJWB 2A7WA 2HVKC 3K06A 5CBFA 1K9MW 3E35A 2WLIA 4XDKA 3AG3C 2F4VO 2QM7A 4X66B 3R65A 4MVUA 4AHCA 4JASA 4KUMA 2Y69C 2HKOA 4RUEA 2ZT9B 3ZBHA 3OMIB 1NVPB 3CCRV 5B5EZ 4JAAA 1I08A 4R50A 1JJ2U 4I50B 2Q7EA 2A3QA 2AW9A 5LXTB 2Q73A 4ZHQA 1N0JA 4JYAO 3K0GA 5LMUB 2UU9B 4NB5A 3I56V 3K5MA 1LUVA 4P9PA 3AG2C 2DYRC 2PYJA 3X2QB 4LF7O 2CUGA 4IGGA 1R6KA 4KP4A 4DR4B 1PV0A 4ABMA 4B3TB 2CTWA 1EZVH 4JI0B 1YDXA 3KG2A 5JJNB 3UKMA 4KFMA 3SYOA 1S5JA 3H9VA 4X20A 4EEQA 1SZXA 1GM7A 1NKDA 1PM9A 3K5NA 5ITZA 4BW9A 4L8JA 3JD2A 4WFAV 2YEVA 2E3CA 1H8EG 2H94A 3FX7A 1AP5A 1ORQC 2OYQA 1J95A 2P67A 5LGUA 5KLVH 3LUTB 1TGOA 4OGQB 3OUSA 4YJ2B 3RYFB 3HKDB 3HPLC 2VQEB 3JSLA 1GH6A 4MVSA 4J7JA 5CN0A 1H2LA 2ITCC 1WA8B 2ZM6O 4JI8O 4CH4A 4JI7B 3KCXA 4FLTA 4DV4O 1I94O 5LGTA 3P3PA 1PL4A 3ABMB 4UVAA 1FPOA 1NJIW 3ZHTA 5JJJB 4I50A 3QNEA 2ZDIA 5LXTA 1MMMA 1NR7A 3J80N 3RVZA 1Y66A 5D5PA 4PJ0Z 2QWNB 2HHHB 4NTWA 4FLWA 4LF5O 5CBGA 1AJPA 4LCUC 2CTPA 2YIBA 1MZFA 1M57B 3FYEB 1B04A 4DR7O 2M6YA 2DOSA 2PI4A 1XDCA 2OTLV 3N2GB 3H1HH 1GM9A 5LMNB 1N36O 4I9WA 1NH2B 5IJ0B 2YIDA 3W7TA 4DR5O 4BWAA 2OWOA 1QLEB 2JVDA 4F4LA 1AJQA 3CMAV 4O4IB 2GTAA 2KQXA 2ZR3A 4QE7A 4DV0O 3K58A 2RJZA 4Z2WA 1Y74B 4YHHB 4FM0A 1XI1A 2VS0A 3TK1A 2Q69A 2QM8A 2HR3A 1X59A 2E5LB 2AHZA 3FD9A 4MTOA 2HJDA 3H01A 1MSWD 1Z5WA 4RAIA 2ATKC 3W7UA 2WSSG 4EB6B 4YJ2A 3RYFA 3HKDA 3ZRSA 2EBOA 1OV9A 3I5DA 3T2MA 1WA8A 3QVNA 5LL6Y 1AR4A 2UXXA 2XTAA 1VF7A 4JYCA 2Q8VA 1AI5A 2UXDO 2P4VA 1DF4A 1JR9A 2ZE6A 3A0HZ 3WB0A 1OZ0A 1HNWO 1XQ8A 3LDCA 4DV5O 2EIKC 2Y4TA 4FM1A 2UUCO 1OCZB 2BCCH 1YJWV 3K3WA 2F4VB 2F95B 3CB2A 4DO2A 5HFMA 3JAKB 1BHBA 4C7UA 3FB8C 5L3FA 2LW7A 3D8CA 1S77D 1RSOB 1KYOF 3AG1C 4FLUA 2RMKB 4H13B 2ZCEA 3CRRA 2MK3A 3GB7C 2ITDC 1R6NA 5KHIA 3U11A 3CWBH 2QSAA 3CCJV 1OJHA 2F93B 2ADPA 5A9GA 3N2GA 1AI6A 4NXMO 4NXNO 4JYAB 3HKBB 3M7MX 1ZUQA 3SPIA 1VQ8V 2EIMB 5B1AB 5IJ0A 1WNSA 4LF7B 4O4IA 4J10A 3JD3A 2FTKA 4RUFA 4WFBV 3OAAG 2AXTZ 1QR9A 4FLYA 4QIWF 2LGWA 5B1OA 1AB3A 1Y74A 3OEHG 3F7VC 3SYPA 2OCCC 1KB9F 2A79B 3BVOA 2FMLA 5IE9A 1VARA 1OCRB 2KSDA 4EB6A 3DC5A 2IJHA 1N34O
chains in the Genus database with same CATH topology
4IYHA 3FX7A 4IYIA 4W4KA 4J42A 4KXRA 4J10A 4J7KA 2G38A 4W4LA 2GTSA 4J41A 4J11A 4J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYH A;  3FX7 A;  4IYI A;  4W4K A;  4J42 A;  4KXR A;  4J10 A;  4J7K A;  2G38 A;  4W4L A;  2GTS A;  4J41 A;  4J11 A;  4J7J A; 
#chains in the Genus database with same CATH topology
 1EZJ A;  1IVS A;  5B1B B;  2DQ0 A;  2M7W A;  4HNA B;  2ZKO A;  5EC2 C;  2QKA A;  3DGE A;  1ZWI C;  4GX1 A;  5BMV B;  3T1H O;  1KU9 A;  3JAT B;  2H8P C;  4JTD B;  3CS5 A;  4JYY A;  1R3K C;  3BEH A;  2Q9L A;  4JV5 O;  1KP2 A;  4JI8 B;  5EK0 A;  4X65 O;  3D36 A;  3RFR A;  3O65 A;  1ROP A;  3JAK A;  1GMG A;  1X4T A;  4DV4 B;  1RSO A;  1I94 B;  1XL6 A;  3CYO A;  1D5N A;  2CH7 B;  3E83 A;  3OTF A;  3OTO O;  3CC4 V;  2ZE7 A;  5K1X A;  3BA8 A;  2EIN C;  3ASN C;  1BS3 A;  3HKB A;  1KKD A;  1K4D C;  4J7K A;  2V7Q G;  2YI9 A;  4LF5 B;  1NS1 A;  5JVD B;  4FZ0 A;  2Q7G A;  3VBB A;  1XUQ A;  4YIO A;  4ASU G;  3NR7 A;  1VMG A;  1Q3E A;  4HZ3 A;  3RW0 A;  1ZTE A;  4X62 O;  5DM6 V;  1WP8 A;  1M56 B;  5BR8 O;  3AK2 A;  3BFR A;  2FKX A;  5FL7 G;  1FD9 A;  4PA6 A;  2R70 A;  2LGQ A;  3I55 V;  2ETN A;  4J80 A;  2ZQM A;  5EBM C;  3A8T A;  1E79 G;  1JCH A;  3KZI Z;  1OCC B;  5L3D A;  4DR5 B;  5AG2 A;  3CE2 A;  4JI3 O;  1FS0 G;  1LR1 A;  3AG7 A;  4DUZ O;  2UUB O;  1GN6 A;  4HNA A;  2Q0O C;  2QKC A;  2R9R B;  5L3E A;  3SJA C;  4DV0 B;  4TOI A;  1Q86 W;  3OMN B;  2RN9 A;  4MVO A;  4GLX A;  3L74 H;  1GN2 A;  5J2T B;  3ABU A;  1WB7 A;  1S72 V;  5BMV A;  5B3S B;  2WA3 A;  1YCI A;  3JAT A;  3VQW A;  2AGA A;  2OT5 A;  1CP9 A;  2KKW A;  3AG4 B;  4E4E A;  4HYO A;  3RN4 A;  1QR8 A;  4IYI A;  3JD1 A;  1YTF B;  3ZJZ A;  3LSU A;  2IJJ A;  1XL4 A;  4JZG A;  5JCO A;  5CA1 B;  3ABK C;  4H37 A;  1NVP D;  2VWK A;  2JIZ G;  3ASO C;  3F5W C;  4GCZ A;  4G27 B;  2UXD B;  4PA7 A;  2CH7 A;  2JK5 C;  1GM8 A;  4X89 A;  1HNW B;  4DV5 B;  2OIG A;  4OPH A;  1WB8 A;  4FVM A;  1W0K G;  5JVD A;  4DR2 O;  2B1I A;  1VQL V;  1NBM G;  4IHJ A;  3ETE A;  4GYC B;  5KHK A;  2E76 B;  3AK1 A;  4EFE A;  2K9P A;  5GTI Z;  1IZ3 A;  2Y0I A;  3E2E A;  2GDS A;  3O9O A;  4UCU A;  4NXM B;  3B8N A;  3RYI B;  2F66 C;  4NXN B;  3CHX A;  1FXK C;  5FLX N;  4R6Z A;  1Q81 W;  1QNM A;  1YSC A;  3H1I H;  3QO5 A;  2XAG A;  4K0K O;  3WB2 A;  4QNH B;  2Z0A A;  3THO A;  3VQX A;  5A2Q N;  1KBH A;  3K5O A;  4JI2 O;  1W2B U;  1MNG A;  5J2T A;  5H5N A;  2EIL C;  4JF3 A;  1BHA A;  3IC9 A;  5K1P A;  4U7N A;  3ZHU A;  4P9O A;  4QPK A;  2NNU A;  2Y4U A;  1QVG U;  1N34 B;  3CCV V;  1QBZ A;  5LP6 B;  1OCO C;  3ICX A;  4GX5 A;  5CA1 A;  3T1Y O;  2CE4 A;  4B3R O;  1H2M A;  4QPJ A;  4UCR A;  4IT5 A;  3JD0 A;  3CRA A;  3CJH B;  1CEZ A;  4U3F H;  2W0X A;  1H8H G;  3ETD A;  4UXN A;  1L0N H;  4JV5 B;  4XBF A;  1EFR G;  1JX9 A;  2LFR A;  2XHB A;  2Q0A A;  4X65 B;  2UXC O;  2CAZ C;  3D3Q A;  4DR3 B;  2CTR A;  3A0B Z;  3WB1 A;  3UO2 A;  3FYI B;  4DV3 O;  3DSQ A;  3TGU H;  1QU7 A;  3SJQ C;  4D6T H;  1LUW A;  1TUB B;  3OTO B;  5FNV B;  4MVZ A;  2W6J G;  1XMO O;  4DV7 O;  1FXV A;  4B7E A;  3RYI A;  4JAV A;  3UQ8 A;  5CBH A;  1WJZ A;  1RM1 B;  4RWU A;  2ZIO A;  3IJ4 A;  4FMT A;  1BL8 A;  2JS3 A;  1VQM V;  3ZRW B;  4ZOL B;  4IYH A;  3ZHQ A;  4B7K A;  4X62 B;  2HP8 A;  1KP3 A;  5BR8 B;  1THZ A;  3PJS K;  4LF9 O;  2DYS B;  2HEP A;  2YIA A;  1VQN V;  2ZD9 A;  1GRJ A;  4CS4 A;  4BIZ A;  4JI3 B;  3SPH A;  2UUB B;  4DUZ B;  5LP6 A;  4LFC O;  4LF8 O;  3AK3 A;  4K8Z A;  2PGG A;  1K3E A;  1SS3 A;  5LGN A;  1V54 B;  1IBL O;  4FLX A;  1GAX A;  4U7O A;  1Q5O A;  5BZB A;  3CJH A;  1QVF U;  2OIE A;  3ZCC A;  2BE3 A;  4X8A A;  5LHI A;  1Z5V A;  1WP7 A;  5CMU A;  2UUA O;  3U0Z A;  2C2A A;  3SJC C;  4WBN B;  3OM3 B;  2IW5 A;  3QF7 A;  2JRI A;  2ZXW C;  1HDJ A;  1F51 A;  3CCE V;  1ZL8 B;  4CH6 A;  5GON B;  5FNV A;  3E22 B;  5IYZ B;  3OGC C;  1BT8 A;  1N8R W;  3RYC B;  4I4T B;  1MSD A;  3K57 A;  4RQE A;  1UPG A;  2VQF O;  4DR2 B;  1K73 W;  3RWR D;  2EIJ B;  3L73 H;  3ZRW A;  4ZOL A;  1KMI Z;  3MHH C;  4NKG B;  1DF5 A;  4J9Z B;  1U96 A;  3D36 C;  1NQT A;  2IH1 C;  3ZMT A;  5DN6 G;  1N4C A;  2L35 A;  3WG7 C;  2DJV A;  2NR5 A;  1HNZ O;  1IXM A;  1VF6 A;  5C93 A;  3IGA C;  1YJN V;  1EN5 A;  5EC1 C;  4TV8 B;  2CGN A;  3ETG A;  3BAB A;  2N05 A;  4ICG A;  3AG3 B;  4F6R B;  4K0K B;  3L71 H;  4L87 A;  1CPY A;  1XHZ A;  2Y69 B;  4JI2 B;  4TUY B;  3K9A A;  3B09 A;  4LF6 B;  3ZIA G;  4R8C A;  1H2K A;  3WU2 Z;  1NTM H;  2VRZ A;  5F2V O;  1MG1 A;  4LP8 A;  1VEW A;  3BA9 A;  4Z1V A;  2ZIN A;  1YIJ V;  4WBN A;  3T1Y B;  1YJ9 V;  2DYR B;  4B3R B;  2QWO B;  2X6C A;  4MVQ A;  2XAF A;  5B66 Z;  5KAI Z;  3ZN0 A;  5C8Y B;  2CDY A;  1ZL8 A;  2V1D A;  5KAF Z;  5GON A;  1P4R A;  2ZNI A;  3E22 A;  4LWS B;  2XOK G;  5IYZ A;  2QM4 A;  3RYC A;  1QQC A;  4FFK A;  4I4T A;  2UXC B;  2AZ0 A;  3DXR B;  3FB7 C;  2QJ1 A;  4GKK O;  4PDM A;  2WLL B;  4DV3 B;  5IYB O;  4O4J B;  4J9Y B;  4TV9 B;  2FL4 A;  4N23 A;  4LFB O;  3OT7 A;  5JCO C;  4WF9 V;  4WCE V;  4PDV A;  3AEI A;  1XMO B;  1SQF A;  4DV7 B;  4MT8 A;  1IXB A;  4PI2 A;  4XDJ A;  4JTC B;  1MOF A;  1I5X A;  4JYB A;  4G2K A;  3K9S A;  3J7A U;  1O9H A;  2GTS A;  4TV8 A;  1NU1 H;  1BE3 H;  3UO3 A;  4WFF A;  3W7S A;  2AZ2 A;  1GK9 A;  4F6R A;  5EZY B;  1QHT A;  2QR4 A;  2XND G;  4BR6 A;  5H6Q A;  4TUY A;  4LF9 B;  1S0V A;  5GW7 A;  2X0L A;  3QO7 A;  3GWK C;  1FAF A;  2WWW A;  1M56 C;  5JJE B;  3ZHR A;  2EJR A;  1RPO A;  3C3S A;  3BAA A;  4PA4 A;  5CA3 A;  1R6T A;  2LQT A;  4LFC B;  2B1G A;  4LF8 B;  4JZ2 A;  3W7W A;  4DV1 O;  3MDS A;  3K04 A;  1OCC C;  1IBL B;  3IAY A;  4O4H B;  5IJ9 B;  2QWR B;  2ZR2 A;  4GT1 A;  1VQP V;  2XT9 A;  2NLJ C;  4IIJ B;  5C8Y A;  1FFX B;  2EJ7 A;  2YSU B;  2MW2 B;  1JVM A;  4LWS A;  3SDL A;  4EKW A;  3PN1 A;  1AR5 A;  1H2N A;  5BXZ A;  3SJB C;  1N33 B;  2UUA B;  4ZI7 B;  1RPR A;  2JJ2 G;  1NZ6 A;  2EZP A;  5KX5 B;  3DXR A;  4N21 A;  1R3I C;  2WLL A;  1BQZ A;  4UV9 A;  1US6 A;  4O4J A;  3JAM N;  4TV9 A;  4DR1 O;  4YIP A;  1IBK O;  5KMG B;  1GN3 A;  2DN9 A;  1K34 A;  1L0L H;  1R1B A;  4JAU A;  4HAM A;  3B40 A;  1D2D A;  3QG5 A;  1JA8 A;  3K59 A;  1LNQ A;  2JS5 A;  5LOV B;  2VQF B;  3F5T A;  3OMA B;  3ZMZ A;  4DR3 O;  3LNN A;  5EZY A;  1SQB H;  4DXW A;  4DUY O;  2BSK B;  3ZHV A;  3TXQ A;  1L8D A;  1AJN A;  1SKV A;  1SES A;  5KHH A;  1H2S B;  4UCS A;  1Q7Y W;  4R7C A;  3CCQ V;  1HNZ B;  1BMF G;  4P2Z A;  1HNX O;  4LNU B;  2GUZ B;  2PI5 A;  3K79 A;  3JCZ A;  3ZS8 C;  3IFX A;  4OX9 O;  4GKJ B;  1Y4M A;  4JI5 B;  2PZS A;  4WFE A;  4XDL A;  1SQG A;  2JEU A;  2YI8 A;  2CK3 G;  4O4H A;  5IJ9 A;  3G80 A;  3AG1 B;  1I5Y A;  1U97 A;  4IIJ A;  1Q6H A;  1IBM O;  2BTO A;  5IY5 C;  5IWA O;  3Q4H B;  2ZE5 A;  1FFX A;  1XRE A;  4FLV A;  2WLH A;  5EIB D;  1M9N A;  4DV6 O;  4ZI7 A;  1WPX A;  4X88 A;  5KX5 A;  1YVW A;  3JCU Z;  1WN7 A;  2ZE8 A;  2KB1 A;  2HG5 C;  2PY5 A;  1E1Q G;  4LR3 A;  1EBO A;  5KMG A;  1PKX A;  2QDO A;  3RT3 C;  1XMQ O;  2QEX V;  2OCC B;  1FJG O;  4NTY A;  1PL0 A;  1F7Y A;  1M1K W;  4TQD A;  4BW5 A;  1DGS A;  1URF A;  5LOV A;  2G38 A;  3GWO A;  4GKK B;  3P3N A;  4B08 A;  4LFB B;  2BSK A;  5EIB C;  4ZBM A;  4MTF A;  1P7G A;  1XHX A;  1DLB A;  4CS2 A;  3E8H A;  2LW1 A;  4DYL A;  1NTZ H;  4LNU A;  4ZIB A;  2GUZ A;  2X7R B;  1Q90 D;  1YHQ V;  1AIL A;  1DTO A;  2YIB D;  1PD3 A;  1AI4 A;  1PNL A;  2D2C B;  2LJ2 A;  1MZE A;  5B1N A;  2RQ6 A;  3D3I A;  3UM7 A;  3SPJ A;  1B6Q A;  3QO8 A;  4QJF B;  5H2F Z;  4MW8 A;  3Q4H A;  1W59 A;  2IU0 A;  2ZDI C;  2X6B A;  3CRM A;  2EIN B;  3CPW U;  2DYS C;  3ASN B;  1XNQ O;  2LO1 A;  3S3W A;  1F4N A;  4LC1 A;  2YXY A;  1MAB G;  1VF6 C;  1D5A A;  3C90 A;  1NT2 B;  2PYL A;  3FFQ A;  2XUM A;  3VQY A;  2D3O W;  3CRQ A;  4DV1 B;  4KXR A;  4K8X A;  4W4L A;  1N32 B;  3CC7 V;  5J2U B;  2YUA A;  3X2Q C;  1F4M A;  2IJK A;  2P7T C;  4LF6 O;  1VQ6 V;  4E2L A;  1EN4 A;  4YXW G;  4HBN A;  4DK0 A;  2RDC A;  2DWD C;  5IDJ A;  3MD0 A;  4O4L B;  2N04 A;  4BIU A;  5IYD O;  4ZKI A;  2WLJ A;  1JOY A;  4MTG A;  5TIS Z;  1K4C C;  4NTX A;  1BGY H;  4DR1 B;  1IBK B;  3JAL B;  3E89 A;  1IUR A;  3DTU B;  1I0H A;  4K3A A;  3M8A A;  1GKF A;  4J42 A;  1PNK A;  1SF9 A;  4UCO A;  2H3O A;  3OR7 C;  1AI7 A;  4JI6 O;  4D7S A;  2LFS A;  4PDR A;  3S3X A;  2QTO A;  4UCT A;  3CXC U;  3TXS A;  1KEC A;  3ABL B;  4GZR B;  4DUY B;  2DE0 X;  3ZMV A;  2A0L A;  3ASO B;  5JH7 B;  3OGI B;  5BY1 A;  1YI2 V;  3FB5 C;  4DRX B;  1NH2 D;  3BHP A;  1L1F A;  2F43 G;  1IX9 A;  2P06 A;  1B06 A;  3ABM C;  1HNX B;  1ARO P;  3SYA A;  3BPZ A;  4MVM A;  4OX9 B;  1WAZ A;  5LA6 B;  1S76 D;  4FJC C;  5HFL A;  3ZX6 A;  2R72 A;  4MTX A;  4DW0 A;  4PV1 B;  5J2U A;  4X64 O;  2ARH A;  3JAS B;  5DED A;  5J9P C;  1IBM B;  1SQV H;  5IWA B;  2UXB B;  3NXS A;  3LSQ A;  4LBE C;  4FFB B;  1M57 C;  1M4U A;  4YY3 O;  4X9Q A;  3CSX A;  4B3M B;  3W7X A;  4O4L A;  1E1R G;  4DK1 A;  1FFT B;  1WLE A;  2B5U A;  4DV6 B;  3G67 A;  1FXK B;  1S5H C;  3ZRX A;  2PUS A;  3CD6 V;  1QLE C;  1WPB A;  3L75 H;  2HFE C;  1R3L C;  1H38 A;  3JAL A;  2EZO A;  3C3T A;  2YC0 A;  1XMQ B;  3ZHS A;  3LSS A;  1FJG B;  3EHB B;  3OR6 C;  2EIL B;  4UV8 A;  1N33 O;  3EXA A;  5IYC O;  5GTH Z;  5E1A C;  4CH5 A;  1PNM A;  3BY6 A;  1G6U A;  1EN6 A;  2ADQ B;  2W6I G;  1OCO B;  2P22 C;  3RVY A;  1K92 A;  1OHH G;  2IBZ H;  1W0J G;  1HR0 O;  1TUB A;  3K0D A;  5JH7 A;  4UUJ C;  3SYQ A;  3EVK A;  4DRX A;  2X6A A;  4H0L B;  1TUE B;  2VWJ A;  4TQF A;  2HJF C;  4I9Q A;  4PI0 A;  1VQ4 V;  3TJT A;  4PA9 A;  1J5E O;  3JYC A;  3FB6 C;  5LA6 A;  2DW4 A;  1V55 B;  3GVM A;  1OCZ C;  3RYH B;  1VQK V;  4H44 B;  2PF4 E;  1SQQ H;  2GBO A;  3CME V;  3JAS A;  2GSM B;  1TVK B;  2W0F C;  1YIT V;  1F23 A;  5LYJ B;  4FFB A;  2DWE C;  2DMX A;  1KKC A;  4GKJ O;  2P90 A;  1XNQ B;  4KHP O;  3HKC B;  4JI5 O;  2YS8 A;  5KA6 A;  1ENV A;  4X1I B;  4OPA A;  4DV2 O;  2XAQ A;  1FXK A;  4BAY A;  2EIM C;  5B1A C;  4JI4 O;  3CXH F;  4MS2 A;  1P49 A;  2WPD G;  3OFN G;  4AIL C;  2ZIM A;  4I55 B;  1DK1 A;  4NVP A;  2FYU H;  2HLD G;  1AVM A;  2YXL A;  4MVR A;  3G71 V;  4KL1 A;  1V9P A;  1Y6X A;  5D5Q A;  4Z1M G;  4LH7 A;  2EX3 A;  1BZK A;  1Q43 A;  5CA0 B;  1BCC H;  1OCR C;  3DC6 A;  3AG2 B;  4JPR A;  2R9A A;  2OTJ V;  2OCH A;  5B1B C;  4X1Y B;  4TWK A;  4Q6G A;  4BIO A;  1FXH A;  3E8F A;  3JAR B;  3CCM V;  4B3S O;  2QWP B;  1A32 A;  5FPR A;  1Y76 B;  2IH3 C;  1SRY A;  2KG7 B;  2WAM A;  2JDI G;  4JI6 B;  3J81 N;  4FZ1 A;  4G28 B;  4O2A B;  1JQ0 A;  2Q5Z A;  3UCS C;  3RYH A;  4GUN A;  1PP9 H;  2JGU A;  5E79 Z;  2WA4 A;  2ZXW B;  3T1C A;  3FAV B;  2JGD B;  1G8M A;  1TVK A;  3CC2 V;  5FPO A;  1KQS U;  4UFZ A;  1KC8 W;  4U3J B;  2JEX A;  4CC5 A;  5LHG A;  5LYJ A;  1Z2G A;  1JFF B;  2Z5U A;  4RO2 A;  4WFG A;  4I7Z B;  3HKC A;  4X1I A;  1AP6 A;  1NI8 A;  4DW1 A;  4LH6 A;  1YXB A;  3SPC A;  2A06 H;  4PDL A;  4LFA O;  3ZRV A;  2QA4 V;  3OE7 G;  1YZB A;  2B9Z A;  2A9H A;  4X64 B;  2BOB C;  4OXS A;  4I55 A;  3E8G A;  4FPP A;  5EYP B;  4CBC A;  3G6B A;  4UB6 Z;  3MHS C;  4CH3 A;  4LF4 O;  1YTF D;  1G4Y B;  4YY3 B;  5LBQ A;  2HVJ C;  2K1E A;  4D7T A;  3WG7 B;  1QLN A;  1Q8I A;  1XNR O;  3EFF K;  3VQV A;  1XBL A;  5CA0 A;  4AQY O;  4GX0 A;  4TT3 G;  4CS3 A;  3N2K B;  5JQG B;  2JJ1 G;  1N32 O;  4MW3 A;  1GTO A;  2Q7H A;  2YIC A;  1I7F A;  3P30 A;  1YF2 A;  4X1Y A;  3B4S A;  1COW G;  3K03 A;  4MSW C;  5EBW C;  3JSN A;  1GO3 F;  1SA0 B;  3JAR A;  2R9I A;  1ZAU A;  4WFH A;  1Y76 A;  1K5S A;  2KG7 A;  4YJ3 B;  1VQ7 V;  5B3S C;  1UFI A;  3UT5 B;  4O2A A;  2BOC C;  2IJI A;  3AG4 C;  4CZZ A;  2XAS A;  3CCL V;  2WLM A;  4I5S A;  4J7Z A;  1FYJ A;  1HR0 B;  2V4D A;  3KKY A;  3FAV A;  2JGD A;  1R73 A;  2Q67 A;  3MAQ A;  3ABT A;  5EBL C;  3H1K H;  4U3J A;  4FLZ A;  5KA5 A;  5JWP A;  1JFF A;  1R3J C;  1J5E B;  1M5I A;  5H6R A;  1HWY A;  2NN4 A;  3ETQ A;  4JI1 O;  3SR2 C;  4P30 A;  1P7B A;  4UVC A;  2BTQ B;  2ZM6 B;  5EYP A;  3SYC A;  4DR6 O;  5L3B A;  3K5L A;  1VIB A;  1NTK H;  3E8B A;  1SET A;  1JMK C;  3CX5 F;  3CCU V;  2Z3Y A;  2EIK B;  4KHP B;  4H33 A;  4I0X B;  2IU3 A;  2YXH A;  4DV2 B;  3TCU A;  5CB4 B;  1KUQ A;  5DEC A;  4EFB A;  3N2K A;  5JQG A;  1XOU A;  1K8A W;  4JI4 B;  4PEL A;  1TAE A;  3TET A;  4W4K A;  3CCS V;  3B77 A;  3L72 H;  4X66 O;  1VQ9 V;  2UXB O;  1SZT A;  1SA0 A;  4IHJ B;  1H2G A;  4NR1 A;  1VF5 B;  3HR0 A;  1N0N A;  4J41 A;  5L3G A;  4B3M O;  1K33 A;  4YJ3 A;  2IM9 A;  1ZLZ A;  4DR7 B;  3UT5 A;  2ZNJ A;  3APO A;  1IDS A;  4NYK A;  1AR1 B;  1QCE A;  1O9G A;  1GN4 A;  5LP6 C;  3G4S V;  5LMU O;  1N36 B;  3ZED A;  2UU9 O;  1EM1 A;  2UXN A;  1FKA O;  1B3Q A;  2Q6A A;  3QTC A;  5KUK A;  4B3S B;  1M93 A;  1JPX A;  3LDE A;  3B8M A;  3LNM B;  2P4K A;  4DR4 O;  1M90 W;  4B3T O;  1Q82 W;  3CRC A;  4TSF G;  3JAW B;  4JI0 O;  3P32 A;  4PD4 F;  1Q6I A;  1VQO V;  2O57 A;  3L9D A;  3N27 A;  3ZMU A;  1SQX H;  3CEI A;  4FK5 C;  3WFV A;  2Y0P A;  2DQ3 A;  2BTQ A;  3ABL C;  3JD4 A;  3HKE B;  3KCY A;  2ILM A;  1PPJ H;  3L70 H;  2P5O A;  4I0X A;  4UVB A;  1TA8 A;  2CTQ A;  2L6L A;  3M99 B;  2QTS A;  4QGP A;  5H9C A;  5CB4 A;  5IT9 N;  4LFA B;  1RM1 C;  1YEW A;  2VQE O;  3U10 A;  3A2F A;  4A5U B;  2UUC B;  4X1K B;  1Y67 A;  2E75 B;  3F7Y C;  4JI7 O;  3LDD A;  3RGB A;  4LF4 B;  3OW2 U;  3HB3 B;  2EUL A;  2GV9 A;  1SC5 B;  5KHG A;  5KHJ A;  1BSM A;  2RCV A;  1XNR B;  3T4Z A;  4O2B B;  4AQY B;  2AHY A;  3IC7 A;  1G1X B;  1KD1 W;  1XIL A;  1HW7 A;  1RP3 B;  2LP7 A;  4K35 A;  2WLI B;  2HHH O;  3OUF A;  3G6E V;  3OD4 A;  2YDE A;  2N74 A;  1ZSP A;  2Q68 A;  1VP7 A;  5LHH A;  3K08 A;  1CXZ B;  2ODM A;  1V54 C;  2QE7 G;  2XAJ A;  3SPG A;  4AI8 A;  5IY5 B;  4F6E A;  3ZN1 A;  1SQP H;  1XEQ A;  4IL6 Z;  2F23 A;  3B2E E;  2FB5 A;  4Q20 A;  3FKS G;  4RQF A;  3JAW A;  4ZHQ B;  4PA3 A;  3H1L H;  2Y48 A;  3VOU A;  3ML0 A;  5LMN O;  1NR1 A;  3STZ C;  2P6J A;  1Q6U A;  3BCC H;  3ZMS A;  2RNB A;  3HKE A;  4FIP C;  1T5E A;  4PHZ A;  1RFY A;  2WLN A;  3A0R A;  4YHH O;  2QKS A;  4J11 A;  3SGI A;  5KUM A;  1K5Q A;  2PTM A;  2E74 B;  2E5L O;  2F1M A;  1JJO A;  3T1H B;  4UCV A;  4X20 B;  4JI1 B;  3ABK B;  2QGN A;  3E86 A;  1K7D A;  2WLK A;  2GHY A;  4JTA B;  4X1K A;  1HP8 A;  5ITZ B;  1V55 C;  1ZX3 A;  2EIJ C;  3OEE G;  4DR6 B;  1P84 F;  3STL C;  5L3C A;  3H1J H;  2YEV B;  4UB8 Z;  1K97 A;  1MA1 A;  1BQ0 A;  4JGS A;  2CGO A;  2XAH A;  2Q4P A;  4CC6 A;  1SER A;  4FM2 A;  3R66 A;  1S5L Z;  3CP1 A;  3APQ A;  3RBZ A;  3BRC A;  4O2B A;  1S3J A;  4GX2 A;  2QWQ B;  4QE9 A;  3T4D A;  1VQ5 V;  1UJW B;  2A7W A;  2HVK C;  3K06 A;  5CBF A;  1K9M W;  3E35 A;  2WLI A;  4XDK A;  3AG3 C;  2F4V O;  2QM7 A;  4X66 B;  3R65 A;  4MVU A;  4AHC A;  4JAS A;  4KUM A;  2Y69 C;  2HKO A;  4RUE A;  2ZT9 B;  3ZBH A;  3OMI B;  1NVP B;  3CCR V;  5B5E Z;  4JAA A;  1I08 A;  4R50 A;  1JJ2 U;  4I50 B;  2Q7E A;  2A3Q A;  2AW9 A;  5LXT B;  2Q73 A;  4ZHQ A;  1N0J A;  4JYA O;  3K0G A;  5LMU B;  2UU9 B;  4NB5 A;  3I56 V;  3K5M A;  1LUV A;  4P9P A;  3AG2 C;  2DYR C;  2PYJ A;  3X2Q B;  4LF7 O;  2CUG A;  4IGG A;  1R6K A;  4KP4 A;  4DR4 B;  1PV0 A;  4ABM A;  4B3T B;  2CTW A;  1EZV H;  4JI0 B;  1YDX A;  3KG2 A;  5JJN B;  3UKM A;  4KFM A;  3SYO A;  1S5J A;  3H9V A;  4X20 A;  4EEQ A;  1SZX A;  1GM7 A;  1NKD A;  1PM9 A;  3K5N A;  5ITZ A;  4BW9 A;  4L8J A;  3JD2 A;  4WFA V;  2YEV A;  2E3C A;  1H8E G;  2H94 A;  3FX7 A;  1AP5 A;  1ORQ C;  2OYQ A;  1J95 A;  2P67 A;  5LGU A;  5KLV H;  3LUT B;  1TGO A;  4OGQ B;  3OUS A;  4YJ2 B;  3RYF B;  3HKD B;  3HPL C;  2VQE B;  3JSL A;  1GH6 A;  4MVS A;  4J7J A;  5CN0 A;  1H2L A;  2ITC C;  1WA8 B;  2ZM6 O;  4JI8 O;  4CH4 A;  4JI7 B;  3KCX A;  4FLT A;  4DV4 O;  1I94 O;  5LGT A;  3P3P A;  1PL4 A;  3ABM B;  4UVA A;  1FPO A;  1NJI W;  3ZHT A;  5JJJ B;  4I50 A;  3QNE A;  2ZDI A;  5LXT A;  1MMM A;  1NR7 A;  3J80 N;  3RVZ A;  1Y66 A;  5D5P A;  4PJ0 Z;  2QWN B;  2HHH B;  4NTW A;  4FLW A;  4LF5 O;  5CBG A;  1AJP A;  4LCU C;  2CTP A;  2YIB A;  1MZF A;  1M57 B;  3FYE B;  1B04 A;  4DR7 O;  2M6Y A;  2DOS A;  2PI4 A;  1XDC A;  2OTL V;  3N2G B;  3H1H H;  1GM9 A;  5LMN B;  1N36 O;  4I9W A;  1NH2 B;  5IJ0 B;  2YID A;  3W7T A;  4DR5 O;  4BWA A;  2OWO A;  1QLE B;  2JVD A;  4F4L A;  1AJQ A;  3CMA V;  4O4I B;  2GTA A;  2KQX A;  2ZR3 A;  4QE7 A;  4DV0 O;  3K58 A;  2RJZ A;  4Z2W A;  1Y74 B;  4YHH B;  4FM0 A;  1XI1 A;  2VS0 A;  3TK1 A;  2Q69 A;  2QM8 A;  2HR3 A;  1X59 A;  2E5L B;  2AHZ A;  3FD9 A;  4MTO A;  2HJD A;  3H01 A;  1MSW D;  1Z5W A;  4RAI A;  2ATK C;  3W7U A;  2WSS G;  4EB6 B;  4YJ2 A;  3RYF A;  3HKD A;  3ZRS A;  2EBO A;  1OV9 A;  3I5D A;  3T2M A;  1WA8 A;  3QVN A;  5LL6 Y;  1AR4 A;  2UXX A;  2XTA A;  1VF7 A;  4JYC A;  2Q8V A;  1AI5 A;  2UXD O;  2P4V A;  1DF4 A;  1JR9 A;  2ZE6 A;  3A0H Z;  3WB0 A;  1OZ0 A;  1HNW O;  1XQ8 A;  3LDC A;  4DV5 O;  2EIK C;  2Y4T A;  4FM1 A;  2UUC O;  1OCZ B;  2BCC H;  1YJW V;  3K3W A;  2F4V B;  2F95 B;  3CB2 A;  4DO2 A;  5HFM A;  3JAK B;  1BHB A;  4C7U A;  3FB8 C;  5L3F A;  2LW7 A;  3D8C A;  1S77 D;  1RSO B;  1KYO F;  3AG1 C;  4FLU A;  2RMK B;  4H13 B;  2ZCE A;  3CRR A;  2MK3 A;  3GB7 C;  2ITD C;  1R6N A;  5KHI A;  3U11 A;  3CWB H;  2QSA A;  3CCJ V;  1OJH A;  2F93 B;  2ADP A;  5A9G A;  3N2G A;  1AI6 A;  4NXM O;  4NXN O;  4JYA B;  3HKB B;  3M7M X;  1ZUQ A;  3SPI A;  1VQ8 V;  2EIM B;  5B1A B;  5IJ0 A;  1WNS A;  4LF7 B;  4O4I A;  4J10 A;  3JD3 A;  2FTK A;  4RUF A;  4WFB V;  3OAA G;  2AXT Z;  1QR9 A;  4FLY A;  4QIW F;  2LGW A;  5B1O A;  1AB3 A;  1Y74 A;  3OEH G;  3F7V C;  3SYP A;  2OCC C;  1KB9 F;  2A79 B;  3BVO A;  2FML A;  5IE9 A;  1VAR A;  1OCR B;  2KSD A;  4EB6 A;  3DC5 A;  2IJH A;  1N34 O; 
#chains in the Genus database with same CATH homology
 4IYH A;  3FX7 A;  4IYI A;  4W4K A;  4J42 A;  4KXR A;  4J10 A;  4J7K A;  2G38 A;  4W4L A;  2GTS A;  4J41 A;  4J11 A;  4J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...