4KXRA

Structure of the mycobacterium tuberculosis type vii secretion system chaperone espg5 in complex with pe25-ppe41 dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
NPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords PE25
total genus 35
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00934 PE PE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4kxrA00
4J41A 4J7JA 4W4LA 4IYIA 4J10A 4J11A 3FX7A 4J42A 2GTSA 4W4KA 4KXRA 4J7KA 4IYHA 2G38A
chains in the Genus database with same CATH superfamily
2FB5A 2XT9A 4F4LA 2OIEA 1NH2D 2ARHA 4E4EA 4LF4O 4DV1B 2RNBA 1RSOB 3EHBB 5EBMC 4DUZB 1Q82W 2P67A 3HKCB 3IGAC 2VQFB 4DV1O 3OR6C 2R9IA 3JASB 1TUBB 4LWSA 5DN6G 3FX7A 4UCRA 2HKOA 5H9CA 1OZ0A 1Q86W 4DYLA 5EC1C 5KHJA 2CUGA 4X64O 2Q0AA 4NXNB 4J9ZB 2UXCB 1GAXA 3RWRD 1JCHA 1EN4A 2X7RB 4DR2B 2NR5A 3SYPA 3AG1C 3TGUH 3WG7C 2YI9A 5FNVB 4GLXA 4KHPO 2Z5UA 4CS4A 4J9YB 5IYZB 3L9DA 3B40A 4P30A 4NKGB 1QU7A 4YJ3A 2LW1A 3BRCA 3IFXA 1JFFB 3DXRB 4J80A 3FAVB 2D2CB 1H2KA 3ZX6A 1GTOA 4DV7B 4ZHQA 5CA0B 4NXMO 2UUCO 2CK3G 1JMKC 4ZI7A 5IJ0A 4TV8B 1XI1A 4EEQA 1AILA 1Y76A 1ZL8B 2UXXA 1HWYA 2DWDC 3C3SA 2JK5C 3R66A 1N32O 1XUQA 1GRJA 4FK5C 4LBEC 2P5OA 2CTRA 2YC0A 3CWBH 1TAEA 4GX1A 5KAIZ 1XNRB 4RO2A 5H6RA 2X6AA 2QWRB 1XEQA 2DWEC 3ZHVA 5C93A 1N34O 4QGPA 2WLLA 2LP7A 3VQXA 3RYFB 3A0BZ 2A7WA 5KLVH 3OGCC 1X59A 4PELA 1SKVA 4C7UA 1N34B 3CRCA 4QIWF 1VQ9V 1KBHA 1B04A 1WP8A 2XAGA 4UXNA 1XL6A 1RP3B 2XUMA 2WLMA 1OCOB 2FMLA 4MVQA 2BOCC 2YEVB 3ETDA 1IBMO 1Y67A 4JI7O 4LP8A 5B66Z 2GDSA 1MNGA 1ORQC 2ZR2A 1OCRB 3LNMB 3IC7A 4JI1O 3SGIA 5L3DA 2ZDIC 1G8MA 3KCYA 4NB5A 2NN4A 3CRMA 1B6QA 4UB6Z 5BR8O 1IXBA 3PJSK 2QWNB 1SRYA 5DEDA 3ASNC 1URFA 4DR3B 4JGSA 4AI8A 4DR7O 3BFRA 3LDCA 1GK9A 2L35A 3O9OA 4PA7A 3HKDA 3K5NA 4YHHO 4DR7B 1L1FA 2UUAO 2BTOA 3ABMC 1VF5B 3L74H 3ZEDA 1CPYA 4P2ZA 4DV4B 1ZWIC 1VEWA 2AHZA 1YHQV 1I94O 2UXBB 1BQ0A 4MS2A 2YXYA 5L3CA 1N33O 4DV4O 3JD0A 3STZC 2B9ZA 3KG2A 1AJQA 4UVAA 4DR6B 1MABG 4JI8B 2RCVA 3KCXA 1ROPA 1VMGA 1R3JC 4AQYO 2LW7A 3I5DA 1FPOA 5FLXN 3GB7C 1FS0G 4OPHA 3CD6V 4ZOLA 3JAKB 2ZXWB 3F7YC 3X2QC 3CCQV 2X6CA 3T1HO 2EIMC 1YCIA 1PL4A 4BW5A 2IH3C 3UT5B 4IIJA 3LDDA 3H1KH 4MW8A 4WFBV 4A5UB 3CCMV 4JYCA 1BQZA 3L73H 3T1YO 1MMMA 1N36B 1QVFU 5LMNB 2HVKC 4JI0O 1V55B 1VQMV 3B8MA 1LUVA 4N23A 3CB2A 4PDVA 1EN6A 3KZIZ 3STLC 1VQOV 3JARA 2AW9A 3CCVV 1M56B 4X1IB 3G4SV 3OEEG 1PL0A 5B1AB 3ZRWA 1GKFA 5GW7A 4CS3A 1NZ6A 3DTUB 1SESA 2QE7G 3ABMB 4MT8A 3P3PA 1K34A 3UKMA 4DW1A 4K8XA 4FFKA 1KMIZ 2QA4V 3Q4HB 4IHJB 5J2TB 5A9GA 3HPLC 3CC4V 4L8JA 5LGTA 4R7CA 5KX5A 4TWKA 5IY5C 1IXMA 2DN9A 2VQEB 1S5LZ 2EIKB 2IJIA 1ZSPA 1W0KG 4LNUB 1LNQA 4Q20A 1JPXA 4ZIBA 1M90W 1FD9A 4BR6A 1Q3EA 1VQKV 5E79Z 2W6IG 3GWOA 3F7VC 4KP4A 2OIGA 3ETQA 3W7UA 2ZIOA 1QBZA 4I4TA 5EC2C 2EIKC 1O9GA 1HNZB 1I0HA 2HEPA 2P7TC 5DM6V 1VQPV 5EZYA 3SPJA 4XDKA 3RYFA 1KYOF 2LQTA 4GX5A 3P3NA 2QKAA 5L3EA 1MSDA 4JYYA 1RPRA 2WLJA 4DV3O 1G1XB 4RAIA 3X2QB 4ABMA 3L75H 1RM1B 1M57C 2JGDB 2RN9A 4CH3A 5LMUB 3BEHA 4LNUA 1E1RG 4O2AB 3T4ZA 5EYPA 4DV0B 3OEHG 1KQSU 1FJGB 3K9SA 3SJBC 2CTPA 1AI7A 4EFBA 3E86A 5LGNA 2UUBO 4OXSA 1QLNA 1H2SB 5KUKA 4CH4A 1GN4A 4YIOA 4TT3G 1AJPA 1AR5A 2IJJA 4ZOLB 5L3BA 3T2MA 2Z0AA 1WPBA 2QJ1A 4GZRB 2RQ6A 3ZHQA 5GTHZ 2JDIG 4H37A 3RYHB 2Q7GA 1WJZA 4J7KA 1H8EG 1YEWA 2VQFO 3THOA 2YEVA 1FKAO 1VF7A 3JAWA 1YDXA 1S0VA 1K4CC 1EFRG 5H2FZ 4X65O 3ZN0A 3RGBA 2GUZA 4UV9A 2XAFA 5FPRA 1JA8A 3SR2C 5IE9A 1F4NA 2F66C 1HNXB 2ZIMA 2R9AA 2HG5C 4X65B 4GUNA 1QHTA 4Z1VA 3EVKA 4LFAB 3PN1A 3SPGA 1Q6HA 3N2GB 4X1IA 4MVRA 5B3SC 5KA6A 2IBZH 4LFCO 4B08A 4UV8A 3DC6A 2JIZG 4I0XA 2CGNA 5H6QA 2XAHA 1GH6A 4LFCB 3Q4HA 4JI5O 2DW4A 2BTQA 4QE9A 4X62O 4O4IA 2UXNA 2H8PC 2PI5A 2IJKA 1F23A 3JD1A 2R72A 3JYCA 4PA4A 3CCEV 2JVDA 4JI6O 4LF9O 5LOVA 2Z3YA 4LF8O 1DTOA 4TSFG 4LF5O 3FKSG 1JR9A 2XOKG 2IW5A 2GSMB 4YJ2A 1YJWV 2P4KA 3ZMZA 1UFIA 3AG4B 2B5UA 3TK1A 5IDJA 3OR7C 2GBOA 1PD3A 4DO2A 1FXVA 5JWPA 1WA8B 1XL4A 4LFBO 5LHHA 4I55B 5IJ0B 4RUEA 4R8CA 3B8NA 1M9NA 2CTWA 1AVMA 4H0LB 3TETA 4LFBB 2P06A 1GN2A 4B7EA 4FFBA 3ZBHA 5KHIA 1H2MA 4IIJB 2HVJC 3OUFA 3UCSC 4WFHA 1KP2A 1BL8A 1R3IC 1IBMB 3M99B 1DGSA 4KFMA 2JEXA 2BSKA 5KMGA 2PUSA 1WLEA 3QVNA 2EINB 2V1DA 3ZCCA 2CH7A 2DQ0A 3RYHA 2WA3A 4F6RB 4FLVA 3SDLA 2YUAA 3RVZA 2QWQB 1RFYA 2Q7HA 4I5SA 1VQ6V 3ZMVA 3OT7A 4MTFA 1BCCH 5HFLA 1BS3A 2E74B 3E8GA 4CC5A 4DR3O 4X66O 5ITZB 1TA8A 4GX0A 4NXMB 3CRRA 2VWKA 1R1BA 3AG4C 3K79A 4W4LA 5B1AC 4EB6A 2CE4A 2DYRB 1QR9A 4NTYA 4NTXA 1HR0B 3FB8C 2UXBO 3QF7A 1OV9A 4J41A 1XMQB 3K9AA 3RFRA 3VBBA 2OT5A 3MHHC 4HYOA 3JALA 1R6TA 2P4VA 1XMOO 2WLLB 4JZGA 5CA0A 2YSUB 4B3RB 1V54C 2KKWA 4IGGA 1YXBA 4FJCC 4JZ2A 3K57A 3T1HB 4DR4O 2HP8A 5LP6B 2LGWA 4B3TO 4QJFB 2XHBA 1HNWO 3ASOB 2ZNJA 1B3QA 1NS1A 3OUSA 5IYBO 4O4JA 1PP9H 4B3TB 2LFRA 4JI7B 1YI2V 1SC5B 2KQXA 2R70A 3H01A 4LF7B 2CGOA 4X1YA 3W7TA 2AZ0A 3HKEA 2BCCH 2C2AA 1SQQH 4JI1B 4J7JA 5J2UB 3DSQA 1KB9F 2YIAA 1PPJH 3F5WC 3L72H 1GM9A 3CSXA 4I55A 5JCOC 4TQFA 3E8BA 3O65A 2HHHO 4GT1A 1G4YB 3BABA 4QNHB 3VQWA 3MAQA 3J80N 1XOUA 1T5EA 2XNDG 3JATB 1GM7A 4OX9B 1M1KW 1ZL8A 5CB4A 2YXHA 4NVPA 4JI4O 1XHXA 1KC8W 3B77A 1VQ5V 4X20A 2IJHA 5E1AC 5DECA 1CEZA 3R65A 1VQ8V 2E75B 1M5IA 3CC2V 3ABTA 1SQVH 4TUYB 5LGUA 5D5PA 1BGYH 3B4SA 2FKXA 3JARB 1OCRC 1KKCA 1XBLA 1RSOA 3AK1A 2XAJA 3IJ4A 3RYIB 1EZVH 1P49A 4DR6O 2ZE7A 2QM7A 1JVMA 1NTZH 5JCOA 4LWSB 2UU9O 3SYOA 1QR8A 4AQYB 3JAMN 2ADQB 1H38A 2E5LO 4GKKO 1K97A 3SJCC 1UJWB 1U97A 4JV5O 1FFXB 2ETNA 1J5EO 3MD0A 5KA5A 2Y4UA 4GX2A 4DV3B 5C8YA 1OCCB 1QLEC 2ZT9B 1PM9A 2EILB 2ODMA 1R6KA 1IBKB 5LMUO 5C8YB 2A3QA 1JJOA 3CMEV 2QEXV 2A9HA 1Q7YW 2PTMA 2HFEC 1K9MW 4DR5B 5B1OA 1AI4A 2MW2B 1L8DA 4WCEV 1V9PA 2LJ2A 3JSLA 1ZLZA 4G27B 3OTOO 4K0KO 1DF4A 1L0LH 2B1IA 1FFTB 3J81N 2EX3A 4FLXA 4X1KB 3H1LH 4U7OA 5KAFZ 1L0NH 1XILA 4Z1MG 3A0HZ 2ITCC 1SS3A 5IYZA 3E2EA 2EIJB 3CPWU 3APOA 3D36C 2AGAA 1XHZA 3N2KB 1TVKA 3CCRV 5B1BB 4UUJC 1AR1B 2Q5ZA 3UO2A 4EB6B 3FB5C 4UCTA 4RQEA 3HKBA 3ZRVA 4OGQB 4TUYA 1HNXO 5BY1A 1YVWA 1VQ7V 3LSQA 4DK1A 4JYAO 5KUMA 1P84F 2V4DA 3GWKC 3AEIA 5F2VO 4FM0A 3SYQA 1X4TA 5EK0A 3BVOA 1FXKA 4IT5A 3WB2A 4X9QA 1VF6C 3I56V 1HNZO 2F23A 3RVYA 5L3FA 4FZ1A 1M57B 4TQDA 1YJ9V 3L70H 4X62B 1Y76B 4MTXA 2EJRA 1NR1A 5HFMA 2YI8A 3WB0A 3ZHSA 4F6EA 2JGDA 2JS5A 1Z5VA 4O4JB 2MK3A 1QNMA 2F43G 2ZM6O 5JH7B 2LFSA 1BHBA 4XBFA 2K9PA 4U7NA 5KMGB 2CTQA 4R50A 3QG5A 2PYLA 4AILC 2WLKA 3HKEB 1BMFG 2NLJC 4MVOA 2Q67A 5LA6B 3NR7A 2PY5A 2VS0A 4DUZO 2OWOA 4X8AA 5IJ9A 4UFZA 4DV2B 2YDEA 4ICGA 1Q43A 4FLZA 2HLDG 5A2QN 1TUBA 4DRXA 5GTIZ 2DYRC 1Q81W 1FFXA 4NR1A 1VQLV 1SQXH 4WBNA 4NXNO 2UXCO 2Y48A 4LR3A 4DR2O 3K3WA 5BMVB 4O2BA 4CBCA 2EIJC 2X0LA 2NNUA 4KHPB 4FVMA 4PDRA 3U10A 1IVSA 1BT8A 4JAAA 2QKCA 2ZCEA 1OCZC 1DLBA 1WA8A 1K3EA 5IY5B 4TV9A 3ZHTA 2IU3A 5TISZ 2HJDA 2XTAA 3H1HH 3OAAG 4KUMA 3UT5A 3IC9A 4I50A 4B7KA 4O4LA 3BY6A 1I5YA 2Q4PA 4J11A 4WBNB 3OMIB 3HKDB 2JJ1G 3K06A 1D5NA 2WPDG 4H13B 1B06A 3LUTB 1YITV 2JGUA 1Z2GA 1N0JA 3N2GA 1VP7A 1N32B 3K0DA 3DGEA 1M93A 5GONA 3TJTA 4PDMA 3SJAC 4YJ3B 4JI6B 3KKYA 4DV6B 4DV7O 1Q5OA 3OW2U 1AJNA 2OTJV 2YICA 1XNQB 1XMQO 3CMAV 5LXTB 2DMXA 3BHPA 4DV6O 3SPIA 1DK1A 1BZKA 3CJHA 2PZSA 3ETGA 3QNEA 1XNQO 5JJEB 1N8RW 3QO7A 4QPKA 2O57A 1Y74B 1XREA 3CJHB 3JATA 4P9OA 1QQCA 3SYCA 2QTOA 1MZFA 1XNRO 4CH5A 5JVDB 4B3MO 1KKDA 4U3FH 4FM2A 4PDLA 2Q9LA 4J7ZA 1YTFD 3K04A 1SA0B 4IYHA 3E22A 1SETA 2EZPA 2WWWA 3AG7A 5LYJA 1NKDA 1EM1A 1SA0A 5JQGA 3FFQA 3FB7C 3NXSA 3E22B 2EZOA 3T4DA 5CBHA 1W0JG 4WFFA 2N04A 5CA3A 2OCCB 3AG1B 1NR7A 4K3AA 2ZNIA 3IAYA 3QO8A 4NTWA 3D36A 2H3OA 1JX9A 1KU9A 1R6NA 2B1GA 5BR8B 4LF6B 4WFAV 3ML0A 3CX5F 1OCZB 2QR4A 1D5AA 5JVDA 5B1BC 4LF6O 5ITZA 1TVKB 2QSAA 4U3JA 4H33A 4JPRA 4CH6A 1AB3A 1WP7A 1R3LC 3CS5A 3LSSA 1I5XA 2Q73A 3CP1A 3AG2B 3ZRSA 2HJFC 4JAUA 4PA6A 2F93B 1IURA 2DYSC 2ATKC 3C90A 4BW9A 2PYJA 3LDEA 3BAAA 2QWOB 1IBLB 3ETEA 2EINC 1GN6A 2DJVA 3WG7B 2UUAB 3SPHA 5EZYB 4IL6Z 5B3SB 2YIBD 4JI2O 4UCUA 4JI3O 3ABLB 1I94B 2DYSB 4UCVA 1XMOB 2Y69C 5EYPB 4YIPA 2CAZC 5B1NA 1FXKB 4ZI7B 1FXHA 3VQYA 1N33B 3CCLV 4FFBB 4JI2B 1EBOA 5LP6C 2F1MA 4UVBA 3RT3C 4CZZA 4JI8O 3D3IA 2RJZA 1F7YA 2DE0X 2IM9A 2G38A 2QTSA 2JEUA 1K4DC 1YSCA 3L71H 1GM8A 5LMNO 1WAZA 1Y66A 3G6BA 4YY3B 3W7WA 1NU1H 3DXRA 3JALB 1IBKO 1I7FA 4PD4F 5LYJB 1LR1A 4DV5O 3JD2A 4PA9A 4GCZA 4DRXB 1DF5A 4YY3O 4I9WA 2IU0A 3SYAA 2BTQB 1S77D 3CHXA 3BCCH 3T1YB 1NTKH 3SJQC 1MOFA 5JJJB 5LP6A 3OMNB 2XASA 1VIBA 1SF9A 2WSSG 4PA3A 1K5QA 3VOUA 2Y0PA 2WAMA 4RWUA 1NT2B 2CDYA 4OX9O 5LOVB 4U3JB 3ASOC 2ZD9A 1EN5A 4LC1A 4G28B 2W6JG 2VQEO 3CCUV 2YXLA 1JJ2U 4I0XB 5JJNB 4DR1B 3JD4A 1TGOA 3CCSV 1YJNV 2Y69B 2F95B 1KP3A 2HR3A 1S5JA 5LA6A 1OHHG 4D7SA 4AHCA 2WLIB 4UCOA 1K5SA 3CXHF 3OMAB 4N21A 4ZKIA 3WFVA 3K5MA 4Q6GA 2GV9A 4H44B 3ZMTA 2ZE8A 5CA1A 1S3JA 1Q90D 2V7QG 3G6EV 4GKJB 1IZ3A 4JTDB 3K5LA 1RPOA 3W7SA 1G6UA 5BZBA 3RYCB 1FAFA 4FM1A 1YF2A 1LUWA 4GKKB 1W2BU 5BXZA 1MSWD 4GKJO 5EBWC 1P4RA 1AROP 3ZMSA 4MW3A 1SQBH 1SQFA 1MG1A 4I4TB 1V54B 1ZAUA 4D7TA 2Q0OC 3OGIB 3K58A 3BPZA 5JQGB 4ZBMA 5AG2A 1Z5WA 2M7WA 5IWAO 4DXWA 3S3WA 3K03A 1P7GA 2ZE6A 3ZN1A 4X89A 4O4LB 4X88A 1K7DA 3FB6C 4X1KA 3OTOB 4K0KB 3EXAA 3E8FA 2UUBB 4KL1A 5EIBC 4LF4B 2AXTZ 2YIBA 2ADPA 4HNAB 4X20B 5FPOA 2A0LA 1ZX3A 3N2KA 4DW0A 3AG2C 2YS8A 2YIDA 2Q7EA 2OCHA 3QO5A 2GTSA 2AHYA 1PNKA 2EIMB 1NQTA 2JJ2G 2FL4A 3A2FA 3DC5A 2QDOA 3E83A 2WA4A 1YTFB 4FPPA 5CMUA 4FZ0A 4X64B 5IT9N 1COWG 3JAWB 3CRAA 3U0ZA 1E79G 1V55C 3AK3A 3ICXA 2UXDO 3M8AA 1KUQA 4LCUC 1I08A 2JRIA 1NH2B 3JSNA 1JQ0A 3A0RA 4MTGA 2E76B 5J2TA 1S72V 4HNAA 2GHYA 2KG7B 1JOYA 1VQNV 2W0XA 3ZJZA 4D6TH 2ZXWC 3AG3B 4LH7A 3UQ8A 1FXKC 2ILMA 4YJ2B 4PI0A 5FL7G 3LNNA 1THZA 1NJIW 1BHAA 1HDJA 1AP5A 2X6BA 4TV9B 5K1PA 1GMGA 4BAYA 4RQFA 3B2EE 2N74A 4MVMA 3K5OA 2BOBC 4O4HB 4I50B 3H1IH 1OJHA 1PV0A 4LF8B 1R3KC 3ZRXA 3M7MX 2EJ7A 4LF5B 4DV2O 4MVUA 3RYCA 1K73W 3C3TA 1US6A 1AI5A 1U96A 3FYEB 1XQ8A 5EBLC 3ZHUA 1PKXA 3OFNG 4FIPC 4E2LA 4B3MB 5CBFA 5CN0A 1N0NA 1KD1W 4QPJA 3HKBB 4HZ3A 3RN4A 3U11A 3MHSC 1H8HG 2ZE5A 3RYIA 3MDSA 1O9HA 4CS2A 3G67A 2P22C 5J2UA 3D3QA 4ZHQB 1H2GA 1WPXA 4G2KA 2XAQA 2RDCA 4FMTA 1H2LA 4PJ0Z 2Q69A 3TXSA 3CYOA 5IYCO 2WLNA 2BE3A 4EFEA 1AP6A 5B5EZ 3CXCU 4X66B 1S5HC 1HP8A 4UCSA 1A32A 1VF6A 3TCUA 3JCUZ 2QKSA 2BSKB 2KG7A 5CBGA 2OYQA 1EZJA 1K8AW 4BWAA 1F51A 2CH7B 4DK0A 3E35A 5J9PC 2UUCB 2QM4A 3G80A 3HKCA 2Q68A 1SZTA 4W4KA 2FTKA 4QE7A 5EIBD 4I7ZB 3D8CA 4XDLA 3E8HA 3ASNB 5LXTA 3N27A 1NI8A 4WF9V 3UM7A 4KXRA 4MSWC 4MTOA 3I55V 2WLIA 2ITDC 5KX5B 3SPCA 3JD3A 5LHIA 1WB7A 4B3RO 2EBOA 1ENVA 1HR0O 4HAMA 3WU2Z 2DQ3A 4JF3A 3BA8A 4GYCB 2OCCC 2KSDA 1RM1C 4DR4B 4UVCA 3CCJV 5BMVA 1YIJV 3ZMUA 1Y6XA 1SERA 3CC7V 4PI2A 2FYUH 2PF4E 1OCCC 1QLEB 3FD9A 4EKWA 3JAKA 4P9PA 3ZRWB 1MA1A 2ZR3A 3EFFK 4BIZA 3AG3C 1E1QG 1AR4A 1NTMH 2P90A 2ZINA 4O4HA 4WFEA 1N4CA 3AK2A 3ABLC 4O4IB 3OTFA 3E89A 5FNVA 4TV8A 1HNWB 1N36O 5KHGA 1CP9A 4JI0B 1PNMA 2A06H 1M4UA 2PGGA 1Q6UA 1MZEA 4B3SO 3OD4A 3RW0A 3BA9A 3K0GA 5L3GA 5KHHA 1P7BA 3G71V 4LF7O 2EILC 2EULA 5D5QA 4B3SB 2Y0IA 4XDJA 5H5NA 4JI4B 2VRZA 4X1YB 3RBZA 1TUEB 3FAVA 1WN7A 4F6RA 3ZIAG 1IDSA 4DUYB 2E3CA 2GTAA 5K1XA 1PNLA 2HHHB 3LSUA 5LL6Y 4DR1O 3B09A 4YHHB 4WFGA 1SQPH 4DUYO 3T1CA 1QVGU 3HR0A 1IBLO 4LH6A 3F5TA 1YZBA 4FLWA 1R73A 4OPAA 3W7XA 4JI3B 2RMKB 2E5LB 1VARA 4JV5B 5LHGA 2Y4TA 1GO3F 2D3OW 1F4MA 4O2BB 1J5EB 2Q6AA 1QCEA 4JAVA 1SQGA 3H9VA 5LBQA 4YXWG 1H2NA 2JS3A 2QM8A 5JH7A 5IJ9B 2UU9B 2IH1C 2KB1A 1BE3H 3CEIA 4FLUA 2W0FC 2PI4A 3FYIB 1NVPD 3ZS8C 1UPGA 2OTLV 4K35A 1SZXA 1Q6IA 4DV5B 4IHJA 2ZQMA 3OM3B 4DV0O 1FJGO 4NYKA 4FLYA 4JTCB 3TXQA 4R6ZA 2VWJA 3A8TA 3K59A 4ASUG 1IX9A 3CRQA 1VQ4V 4DR5O 4J42A 3ABKB 1FYJA 2ZKOA 3WB1A 1BSMA 3P30A 1W59A 1OCOC 2DOSA 3ABUA 4FLTA 1S76D 2ZDIA 2P6JA 3JASA 4JASA 2F4VO 4I9QA 4BIOA 3JCZA 3ABKC 3S3XA 4CC6A 1CXZB 4JYAB 4BIUA 4K8ZA 2WLHA 2F4VB 4PV1B 3VQVA 1KECA 1Y74A 4HBNA 4PHZA 1XDCA 2L6LA 4JTAB 4LFAO 4IYIA 4MVZA 5GONB 2UXDB 2LGQA 1D2DA 1ZUQA 4TOIA 4O2AA 2K1EA 3J7AU 4MVSA 2QWPB 3OE7G 4L87A 5KHKA 3GVMA 1NBMG 1GN3A 2M6YA 1JFFA 1HW7A 3CE2A 1Q8IA 1K33A 1ZTEA 3HB3B 4JI5B 1K92A 2A79B 3ZHRA 4UB8Z 2LO1A 1WB8A 1M56C 4Z2WA 3UO3A 3K08A 4JYBA 5CA1B 2R9RB 3APQA 3QTCA 1NVPB 1AI6A 4LF9B 3H1JH 2H94A 1J95A 4J10A 5CB4B 3P32A 2Q8VA 2N05A 1Y4MA 2QGNA 1WNSA 2GUZB 2ZM6B 4RUFA 5IWAB 2AZ2A 5IYDO
chains in the Genus database with same CATH topology
4J41A 4J7JA 4W4LA 4IYIA 4J10A 4J11A 3FX7A 4J42A 2GTSA 4W4KA 4KXRA 4J7KA 4IYHA 2G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J41 A;  4J7J A;  4W4L A;  4IYI A;  4J10 A;  4J11 A;  3FX7 A;  4J42 A;  2GTS A;  4W4K A;  4KXR A;  4J7K A;  4IYH A;  2G38 A; 
#chains in the Genus database with same CATH topology
 2FB5 A;  2XT9 A;  4F4L A;  2OIE A;  1NH2 D;  2ARH A;  4E4E A;  4LF4 O;  4DV1 B;  2RNB A;  1RSO B;  3EHB B;  5EBM C;  4DUZ B;  1Q82 W;  2P67 A;  3HKC B;  3IGA C;  2VQF B;  4DV1 O;  3OR6 C;  2R9I A;  3JAS B;  1TUB B;  4LWS A;  5DN6 G;  3FX7 A;  4UCR A;  2HKO A;  5H9C A;  1OZ0 A;  1Q86 W;  4DYL A;  5EC1 C;  5KHJ A;  2CUG A;  4X64 O;  2Q0A A;  4NXN B;  4J9Z B;  2UXC B;  1GAX A;  3RWR D;  1JCH A;  1EN4 A;  2X7R B;  4DR2 B;  2NR5 A;  3SYP A;  3AG1 C;  3TGU H;  3WG7 C;  2YI9 A;  5FNV B;  4GLX A;  4KHP O;  2Z5U A;  4CS4 A;  4J9Y B;  5IYZ B;  3L9D A;  3B40 A;  4P30 A;  4NKG B;  1QU7 A;  4YJ3 A;  2LW1 A;  3BRC A;  3IFX A;  1JFF B;  3DXR B;  4J80 A;  3FAV B;  2D2C B;  1H2K A;  3ZX6 A;  1GTO A;  4DV7 B;  4ZHQ A;  5CA0 B;  4NXM O;  2UUC O;  2CK3 G;  1JMK C;  4ZI7 A;  5IJ0 A;  4TV8 B;  1XI1 A;  4EEQ A;  1AIL A;  1Y76 A;  1ZL8 B;  2UXX A;  1HWY A;  2DWD C;  3C3S A;  2JK5 C;  3R66 A;  1N32 O;  1XUQ A;  1GRJ A;  4FK5 C;  4LBE C;  2P5O A;  2CTR A;  2YC0 A;  3CWB H;  1TAE A;  4GX1 A;  5KAI Z;  1XNR B;  4RO2 A;  5H6R A;  2X6A A;  2QWR B;  1XEQ A;  2DWE C;  3ZHV A;  5C93 A;  1N34 O;  4QGP A;  2WLL A;  2LP7 A;  3VQX A;  3RYF B;  3A0B Z;  2A7W A;  5KLV H;  3OGC C;  1X59 A;  4PEL A;  1SKV A;  4C7U A;  1N34 B;  3CRC A;  4QIW F;  1VQ9 V;  1KBH A;  1B04 A;  1WP8 A;  2XAG A;  4UXN A;  1XL6 A;  1RP3 B;  2XUM A;  2WLM A;  1OCO B;  2FML A;  4MVQ A;  2BOC C;  2YEV B;  3ETD A;  1IBM O;  1Y67 A;  4JI7 O;  4LP8 A;  5B66 Z;  2GDS A;  1MNG A;  1ORQ C;  2ZR2 A;  1OCR B;  3LNM B;  3IC7 A;  4JI1 O;  3SGI A;  5L3D A;  2ZDI C;  1G8M A;  3KCY A;  4NB5 A;  2NN4 A;  3CRM A;  1B6Q A;  4UB6 Z;  5BR8 O;  1IXB A;  3PJS K;  2QWN B;  1SRY A;  5DED A;  3ASN C;  1URF A;  4DR3 B;  4JGS A;  4AI8 A;  4DR7 O;  3BFR A;  3LDC A;  1GK9 A;  2L35 A;  3O9O A;  4PA7 A;  3HKD A;  3K5N A;  4YHH O;  4DR7 B;  1L1F A;  2UUA O;  2BTO A;  3ABM C;  1VF5 B;  3L74 H;  3ZED A;  1CPY A;  4P2Z A;  4DV4 B;  1ZWI C;  1VEW A;  2AHZ A;  1YHQ V;  1I94 O;  2UXB B;  1BQ0 A;  4MS2 A;  2YXY A;  5L3C A;  1N33 O;  4DV4 O;  3JD0 A;  3STZ C;  2B9Z A;  3KG2 A;  1AJQ A;  4UVA A;  4DR6 B;  1MAB G;  4JI8 B;  2RCV A;  3KCX A;  1ROP A;  1VMG A;  1R3J C;  4AQY O;  2LW7 A;  3I5D A;  1FPO A;  5FLX N;  3GB7 C;  1FS0 G;  4OPH A;  3CD6 V;  4ZOL A;  3JAK B;  2ZXW B;  3F7Y C;  3X2Q C;  3CCQ V;  2X6C A;  3T1H O;  2EIM C;  1YCI A;  1PL4 A;  4BW5 A;  2IH3 C;  3UT5 B;  4IIJ A;  3LDD A;  3H1K H;  4MW8 A;  4WFB V;  4A5U B;  3CCM V;  4JYC A;  1BQZ A;  3L73 H;  3T1Y O;  1MMM A;  1N36 B;  1QVF U;  5LMN B;  2HVK C;  4JI0 O;  1V55 B;  1VQM V;  3B8M A;  1LUV A;  4N23 A;  3CB2 A;  4PDV A;  1EN6 A;  3KZI Z;  3STL C;  1VQO V;  3JAR A;  2AW9 A;  3CCV V;  1M56 B;  4X1I B;  3G4S V;  3OEE G;  1PL0 A;  5B1A B;  3ZRW A;  1GKF A;  5GW7 A;  4CS3 A;  1NZ6 A;  3DTU B;  1SES A;  2QE7 G;  3ABM B;  4MT8 A;  3P3P A;  1K34 A;  3UKM A;  4DW1 A;  4K8X A;  4FFK A;  1KMI Z;  2QA4 V;  3Q4H B;  4IHJ B;  5J2T B;  5A9G A;  3HPL C;  3CC4 V;  4L8J A;  5LGT A;  4R7C A;  5KX5 A;  4TWK A;  5IY5 C;  1IXM A;  2DN9 A;  2VQE B;  1S5L Z;  2EIK B;  2IJI A;  1ZSP A;  1W0K G;  4LNU B;  1LNQ A;  4Q20 A;  1JPX A;  4ZIB A;  1M90 W;  1FD9 A;  4BR6 A;  1Q3E A;  1VQK V;  5E79 Z;  2W6I G;  3GWO A;  3F7V C;  4KP4 A;  2OIG A;  3ETQ A;  3W7U A;  2ZIO A;  1QBZ A;  4I4T A;  5EC2 C;  2EIK C;  1O9G A;  1HNZ B;  1I0H A;  2HEP A;  2P7T C;  5DM6 V;  1VQP V;  5EZY A;  3SPJ A;  4XDK A;  3RYF A;  1KYO F;  2LQT A;  4GX5 A;  3P3N A;  2QKA A;  5L3E A;  1MSD A;  4JYY A;  1RPR A;  2WLJ A;  4DV3 O;  1G1X B;  4RAI A;  3X2Q B;  4ABM A;  3L75 H;  1RM1 B;  1M57 C;  2JGD B;  2RN9 A;  4CH3 A;  5LMU B;  3BEH A;  4LNU A;  1E1R G;  4O2A B;  3T4Z A;  5EYP A;  4DV0 B;  3OEH G;  1KQS U;  1FJG B;  3K9S A;  3SJB C;  2CTP A;  1AI7 A;  4EFB A;  3E86 A;  5LGN A;  2UUB O;  4OXS A;  1QLN A;  1H2S B;  5KUK A;  4CH4 A;  1GN4 A;  4YIO A;  4TT3 G;  1AJP A;  1AR5 A;  2IJJ A;  4ZOL B;  5L3B A;  3T2M A;  2Z0A A;  1WPB A;  2QJ1 A;  4GZR B;  2RQ6 A;  3ZHQ A;  5GTH Z;  2JDI G;  4H37 A;  3RYH B;  2Q7G A;  1WJZ A;  4J7K A;  1H8E G;  1YEW A;  2VQF O;  3THO A;  2YEV A;  1FKA O;  1VF7 A;  3JAW A;  1YDX A;  1S0V A;  1K4C C;  1EFR G;  5H2F Z;  4X65 O;  3ZN0 A;  3RGB A;  2GUZ A;  4UV9 A;  2XAF A;  5FPR A;  1JA8 A;  3SR2 C;  5IE9 A;  1F4N A;  2F66 C;  1HNX B;  2ZIM A;  2R9A A;  2HG5 C;  4X65 B;  4GUN A;  1QHT A;  4Z1V A;  3EVK A;  4LFA B;  3PN1 A;  3SPG A;  1Q6H A;  3N2G B;  4X1I A;  4MVR A;  5B3S C;  5KA6 A;  2IBZ H;  4LFC O;  4B08 A;  4UV8 A;  3DC6 A;  2JIZ G;  4I0X A;  2CGN A;  5H6Q A;  2XAH A;  1GH6 A;  4LFC B;  3Q4H A;  4JI5 O;  2DW4 A;  2BTQ A;  4QE9 A;  4X62 O;  4O4I A;  2UXN A;  2H8P C;  2PI5 A;  2IJK A;  1F23 A;  3JD1 A;  2R72 A;  3JYC A;  4PA4 A;  3CCE V;  2JVD A;  4JI6 O;  4LF9 O;  5LOV A;  2Z3Y A;  4LF8 O;  1DTO A;  4TSF G;  4LF5 O;  3FKS G;  1JR9 A;  2XOK G;  2IW5 A;  2GSM B;  4YJ2 A;  1YJW V;  2P4K A;  3ZMZ A;  1UFI A;  3AG4 B;  2B5U A;  3TK1 A;  5IDJ A;  3OR7 C;  2GBO A;  1PD3 A;  4DO2 A;  1FXV A;  5JWP A;  1WA8 B;  1XL4 A;  4LFB O;  5LHH A;  4I55 B;  5IJ0 B;  4RUE A;  4R8C A;  3B8N A;  1M9N A;  2CTW A;  1AVM A;  4H0L B;  3TET A;  4LFB B;  2P06 A;  1GN2 A;  4B7E A;  4FFB A;  3ZBH A;  5KHI A;  1H2M A;  4IIJ B;  2HVJ C;  3OUF A;  3UCS C;  4WFH A;  1KP2 A;  1BL8 A;  1R3I C;  1IBM B;  3M99 B;  1DGS A;  4KFM A;  2JEX A;  2BSK A;  5KMG A;  2PUS A;  1WLE A;  3QVN A;  2EIN B;  2V1D A;  3ZCC A;  2CH7 A;  2DQ0 A;  3RYH A;  2WA3 A;  4F6R B;  4FLV A;  3SDL A;  2YUA A;  3RVZ A;  2QWQ B;  1RFY A;  2Q7H A;  4I5S A;  1VQ6 V;  3ZMV A;  3OT7 A;  4MTF A;  1BCC H;  5HFL A;  1BS3 A;  2E74 B;  3E8G A;  4CC5 A;  4DR3 O;  4X66 O;  5ITZ B;  1TA8 A;  4GX0 A;  4NXM B;  3CRR A;  2VWK A;  1R1B A;  3AG4 C;  3K79 A;  4W4L A;  5B1A C;  4EB6 A;  2CE4 A;  2DYR B;  1QR9 A;  4NTY A;  4NTX A;  1HR0 B;  3FB8 C;  2UXB O;  3QF7 A;  1OV9 A;  4J41 A;  1XMQ B;  3K9A A;  3RFR A;  3VBB A;  2OT5 A;  3MHH C;  4HYO A;  3JAL A;  1R6T A;  2P4V A;  1XMO O;  2WLL B;  4JZG A;  5CA0 A;  2YSU B;  4B3R B;  1V54 C;  2KKW A;  4IGG A;  1YXB A;  4FJC C;  4JZ2 A;  3K57 A;  3T1H B;  4DR4 O;  2HP8 A;  5LP6 B;  2LGW A;  4B3T O;  4QJF B;  2XHB A;  1HNW O;  3ASO B;  2ZNJ A;  1B3Q A;  1NS1 A;  3OUS A;  5IYB O;  4O4J A;  1PP9 H;  4B3T B;  2LFR A;  4JI7 B;  1YI2 V;  1SC5 B;  2KQX A;  2R70 A;  3H01 A;  4LF7 B;  2CGO A;  4X1Y A;  3W7T A;  2AZ0 A;  3HKE A;  2BCC H;  2C2A A;  1SQQ H;  4JI1 B;  4J7J A;  5J2U B;  3DSQ A;  1KB9 F;  2YIA A;  1PPJ H;  3F5W C;  3L72 H;  1GM9 A;  3CSX A;  4I55 A;  5JCO C;  4TQF A;  3E8B A;  3O65 A;  2HHH O;  4GT1 A;  1G4Y B;  3BAB A;  4QNH B;  3VQW A;  3MAQ A;  3J80 N;  1XOU A;  1T5E A;  2XND G;  3JAT B;  1GM7 A;  4OX9 B;  1M1K W;  1ZL8 A;  5CB4 A;  2YXH A;  4NVP A;  4JI4 O;  1XHX A;  1KC8 W;  3B77 A;  1VQ5 V;  4X20 A;  2IJH A;  5E1A C;  5DEC A;  1CEZ A;  3R65 A;  1VQ8 V;  2E75 B;  1M5I A;  3CC2 V;  3ABT A;  1SQV H;  4TUY B;  5LGU A;  5D5P A;  1BGY H;  3B4S A;  2FKX A;  3JAR B;  1OCR C;  1KKC A;  1XBL A;  1RSO A;  3AK1 A;  2XAJ A;  3IJ4 A;  3RYI B;  1EZV H;  1P49 A;  4DR6 O;  2ZE7 A;  2QM7 A;  1JVM A;  1NTZ H;  5JCO A;  4LWS B;  2UU9 O;  3SYO A;  1QR8 A;  4AQY B;  3JAM N;  2ADQ B;  1H38 A;  2E5L O;  4GKK O;  1K97 A;  3SJC C;  1UJW B;  1U97 A;  4JV5 O;  1FFX B;  2ETN A;  1J5E O;  3MD0 A;  5KA5 A;  2Y4U A;  4GX2 A;  4DV3 B;  5C8Y A;  1OCC B;  1QLE C;  2ZT9 B;  1PM9 A;  2EIL B;  2ODM A;  1R6K A;  1IBK B;  5LMU O;  5C8Y B;  2A3Q A;  1JJO A;  3CME V;  2QEX V;  2A9H A;  1Q7Y W;  2PTM A;  2HFE C;  1K9M W;  4DR5 B;  5B1O A;  1AI4 A;  2MW2 B;  1L8D A;  4WCE V;  1V9P A;  2LJ2 A;  3JSL A;  1ZLZ A;  4G27 B;  3OTO O;  4K0K O;  1DF4 A;  1L0L H;  2B1I A;  1FFT B;  3J81 N;  2EX3 A;  4FLX A;  4X1K B;  3H1L H;  4U7O A;  5KAF Z;  1L0N H;  1XIL A;  4Z1M G;  3A0H Z;  2ITC C;  1SS3 A;  5IYZ A;  3E2E A;  2EIJ B;  3CPW U;  3APO A;  3D36 C;  2AGA A;  1XHZ A;  3N2K B;  1TVK A;  3CCR V;  5B1B B;  4UUJ C;  1AR1 B;  2Q5Z A;  3UO2 A;  4EB6 B;  3FB5 C;  4UCT A;  4RQE A;  3HKB A;  3ZRV A;  4OGQ B;  4TUY A;  1HNX O;  5BY1 A;  1YVW A;  1VQ7 V;  3LSQ A;  4DK1 A;  4JYA O;  5KUM A;  1P84 F;  2V4D A;  3GWK C;  3AEI A;  5F2V O;  4FM0 A;  3SYQ A;  1X4T A;  5EK0 A;  3BVO A;  1FXK A;  4IT5 A;  3WB2 A;  4X9Q A;  1VF6 C;  3I56 V;  1HNZ O;  2F23 A;  3RVY A;  5L3F A;  4FZ1 A;  1M57 B;  4TQD A;  1YJ9 V;  3L70 H;  4X62 B;  1Y76 B;  4MTX A;  2EJR A;  1NR1 A;  5HFM A;  2YI8 A;  3WB0 A;  3ZHS A;  4F6E A;  2JGD A;  2JS5 A;  1Z5V A;  4O4J B;  2MK3 A;  1QNM A;  2F43 G;  2ZM6 O;  5JH7 B;  2LFS A;  1BHB A;  4XBF A;  2K9P A;  4U7N A;  5KMG B;  2CTQ A;  4R50 A;  3QG5 A;  2PYL A;  4AIL C;  2WLK A;  3HKE B;  1BMF G;  2NLJ C;  4MVO A;  2Q67 A;  5LA6 B;  3NR7 A;  2PY5 A;  2VS0 A;  4DUZ O;  2OWO A;  4X8A A;  5IJ9 A;  4UFZ A;  4DV2 B;  2YDE A;  4ICG A;  1Q43 A;  4FLZ A;  2HLD G;  5A2Q N;  1TUB A;  4DRX A;  5GTI Z;  2DYR C;  1Q81 W;  1FFX A;  4NR1 A;  1VQL V;  1SQX H;  4WBN A;  4NXN O;  2UXC O;  2Y48 A;  4LR3 A;  4DR2 O;  3K3W A;  5BMV B;  4O2B A;  4CBC A;  2EIJ C;  2X0L A;  2NNU A;  4KHP B;  4FVM A;  4PDR A;  3U10 A;  1IVS A;  1BT8 A;  4JAA A;  2QKC A;  2ZCE A;  1OCZ C;  1DLB A;  1WA8 A;  1K3E A;  5IY5 B;  4TV9 A;  3ZHT A;  2IU3 A;  5TIS Z;  2HJD A;  2XTA A;  3H1H H;  3OAA G;  4KUM A;  3UT5 A;  3IC9 A;  4I50 A;  4B7K A;  4O4L A;  3BY6 A;  1I5Y A;  2Q4P A;  4J11 A;  4WBN B;  3OMI B;  3HKD B;  2JJ1 G;  3K06 A;  1D5N A;  2WPD G;  4H13 B;  1B06 A;  3LUT B;  1YIT V;  2JGU A;  1Z2G A;  1N0J A;  3N2G A;  1VP7 A;  1N32 B;  3K0D A;  3DGE A;  1M93 A;  5GON A;  3TJT A;  4PDM A;  3SJA C;  4YJ3 B;  4JI6 B;  3KKY A;  4DV6 B;  4DV7 O;  1Q5O A;  3OW2 U;  1AJN A;  2OTJ V;  2YIC A;  1XNQ B;  1XMQ O;  3CMA V;  5LXT B;  2DMX A;  3BHP A;  4DV6 O;  3SPI A;  1DK1 A;  1BZK A;  3CJH A;  2PZS A;  3ETG A;  3QNE A;  1XNQ O;  5JJE B;  1N8R W;  3QO7 A;  4QPK A;  2O57 A;  1Y74 B;  1XRE A;  3CJH B;  3JAT A;  4P9O A;  1QQC A;  3SYC A;  2QTO A;  1MZF A;  1XNR O;  4CH5 A;  5JVD B;  4B3M O;  1KKD A;  4U3F H;  4FM2 A;  4PDL A;  2Q9L A;  4J7Z A;  1YTF D;  3K04 A;  1SA0 B;  4IYH A;  3E22 A;  1SET A;  2EZP A;  2WWW A;  3AG7 A;  5LYJ A;  1NKD A;  1EM1 A;  1SA0 A;  5JQG A;  3FFQ A;  3FB7 C;  3NXS A;  3E22 B;  2EZO A;  3T4D A;  5CBH A;  1W0J G;  4WFF A;  2N04 A;  5CA3 A;  2OCC B;  3AG1 B;  1NR7 A;  4K3A A;  2ZNI A;  3IAY A;  3QO8 A;  4NTW A;  3D36 A;  2H3O A;  1JX9 A;  1KU9 A;  1R6N A;  2B1G A;  5BR8 B;  4LF6 B;  4WFA V;  3ML0 A;  3CX5 F;  1OCZ B;  2QR4 A;  1D5A A;  5JVD A;  5B1B C;  4LF6 O;  5ITZ A;  1TVK B;  2QSA A;  4U3J A;  4H33 A;  4JPR A;  4CH6 A;  1AB3 A;  1WP7 A;  1R3L C;  3CS5 A;  3LSS A;  1I5X A;  2Q73 A;  3CP1 A;  3AG2 B;  3ZRS A;  2HJF C;  4JAU A;  4PA6 A;  2F93 B;  1IUR A;  2DYS C;  2ATK C;  3C90 A;  4BW9 A;  2PYJ A;  3LDE A;  3BAA A;  2QWO B;  1IBL B;  3ETE A;  2EIN C;  1GN6 A;  2DJV A;  3WG7 B;  2UUA B;  3SPH A;  5EZY B;  4IL6 Z;  5B3S B;  2YIB D;  4JI2 O;  4UCU A;  4JI3 O;  3ABL B;  1I94 B;  2DYS B;  4UCV A;  1XMO B;  2Y69 C;  5EYP B;  4YIP A;  2CAZ C;  5B1N A;  1FXK B;  4ZI7 B;  1FXH A;  3VQY A;  1N33 B;  3CCL V;  4FFB B;  4JI2 B;  1EBO A;  5LP6 C;  2F1M A;  4UVB A;  3RT3 C;  4CZZ A;  4JI8 O;  3D3I A;  2RJZ A;  1F7Y A;  2DE0 X;  2IM9 A;  2G38 A;  2QTS A;  2JEU A;  1K4D C;  1YSC A;  3L71 H;  1GM8 A;  5LMN O;  1WAZ A;  1Y66 A;  3G6B A;  4YY3 B;  3W7W A;  1NU1 H;  3DXR A;  3JAL B;  1IBK O;  1I7F A;  4PD4 F;  5LYJ B;  1LR1 A;  4DV5 O;  3JD2 A;  4PA9 A;  4GCZ A;  4DRX B;  1DF5 A;  4YY3 O;  4I9W A;  2IU0 A;  3SYA A;  2BTQ B;  1S77 D;  3CHX A;  3BCC H;  3T1Y B;  1NTK H;  3SJQ C;  1MOF A;  5JJJ B;  5LP6 A;  3OMN B;  2XAS A;  1VIB A;  1SF9 A;  2WSS G;  4PA3 A;  1K5Q A;  3VOU A;  2Y0P A;  2WAM A;  4RWU A;  1NT2 B;  2CDY A;  4OX9 O;  5LOV B;  4U3J B;  3ASO C;  2ZD9 A;  1EN5 A;  4LC1 A;  4G28 B;  2W6J G;  2VQE O;  3CCU V;  2YXL A;  1JJ2 U;  4I0X B;  5JJN B;  4DR1 B;  3JD4 A;  1TGO A;  3CCS V;  1YJN V;  2Y69 B;  2F95 B;  1KP3 A;  2HR3 A;  1S5J A;  5LA6 A;  1OHH G;  4D7S A;  4AHC A;  2WLI B;  4UCO A;  1K5S A;  3CXH F;  3OMA B;  4N21 A;  4ZKI A;  3WFV A;  3K5M A;  4Q6G A;  2GV9 A;  4H44 B;  3ZMT A;  2ZE8 A;  5CA1 A;  1S3J A;  1Q90 D;  2V7Q G;  3G6E V;  4GKJ B;  1IZ3 A;  4JTD B;  3K5L A;  1RPO A;  3W7S A;  1G6U A;  5BZB A;  3RYC B;  1FAF A;  4FM1 A;  1YF2 A;  1LUW A;  4GKK B;  1W2B U;  5BXZ A;  1MSW D;  4GKJ O;  5EBW C;  1P4R A;  1ARO P;  3ZMS A;  4MW3 A;  1SQB H;  1SQF A;  1MG1 A;  4I4T B;  1V54 B;  1ZAU A;  4D7T A;  2Q0O C;  3OGI B;  3K58 A;  3BPZ A;  5JQG B;  4ZBM A;  5AG2 A;  1Z5W A;  2M7W A;  5IWA O;  4DXW A;  3S3W A;  3K03 A;  1P7G A;  2ZE6 A;  3ZN1 A;  4X89 A;  4O4L B;  4X88 A;  1K7D A;  3FB6 C;  4X1K A;  3OTO B;  4K0K B;  3EXA A;  3E8F A;  2UUB B;  4KL1 A;  5EIB C;  4LF4 B;  2AXT Z;  2YIB A;  2ADP A;  4HNA B;  4X20 B;  5FPO A;  2A0L A;  1ZX3 A;  3N2K A;  4DW0 A;  3AG2 C;  2YS8 A;  2YID A;  2Q7E A;  2OCH A;  3QO5 A;  2GTS A;  2AHY A;  1PNK A;  2EIM B;  1NQT A;  2JJ2 G;  2FL4 A;  3A2F A;  3DC5 A;  2QDO A;  3E83 A;  2WA4 A;  1YTF B;  4FPP A;  5CMU A;  4FZ0 A;  4X64 B;  5IT9 N;  1COW G;  3JAW B;  3CRA A;  3U0Z A;  1E79 G;  1V55 C;  3AK3 A;  3ICX A;  2UXD O;  3M8A A;  1KUQ A;  4LCU C;  1I08 A;  2JRI A;  1NH2 B;  3JSN A;  1JQ0 A;  3A0R A;  4MTG A;  2E76 B;  5J2T A;  1S72 V;  4HNA A;  2GHY A;  2KG7 B;  1JOY A;  1VQN V;  2W0X A;  3ZJZ A;  4D6T H;  2ZXW C;  3AG3 B;  4LH7 A;  3UQ8 A;  1FXK C;  2ILM A;  4YJ2 B;  4PI0 A;  5FL7 G;  3LNN A;  1THZ A;  1NJI W;  1BHA A;  1HDJ A;  1AP5 A;  2X6B A;  4TV9 B;  5K1P A;  1GMG A;  4BAY A;  4RQF A;  3B2E E;  2N74 A;  4MVM A;  3K5O A;  2BOB C;  4O4H B;  4I50 B;  3H1I H;  1OJH A;  1PV0 A;  4LF8 B;  1R3K C;  3ZRX A;  3M7M X;  2EJ7 A;  4LF5 B;  4DV2 O;  4MVU A;  3RYC A;  1K73 W;  3C3T A;  1US6 A;  1AI5 A;  1U96 A;  3FYE B;  1XQ8 A;  5EBL C;  3ZHU A;  1PKX A;  3OFN G;  4FIP C;  4E2L A;  4B3M B;  5CBF A;  5CN0 A;  1N0N A;  1KD1 W;  4QPJ A;  3HKB B;  4HZ3 A;  3RN4 A;  3U11 A;  3MHS C;  1H8H G;  2ZE5 A;  3RYI A;  3MDS A;  1O9H A;  4CS2 A;  3G67 A;  2P22 C;  5J2U A;  3D3Q A;  4ZHQ B;  1H2G A;  1WPX A;  4G2K A;  2XAQ A;  2RDC A;  4FMT A;  1H2L A;  4PJ0 Z;  2Q69 A;  3TXS A;  3CYO A;  5IYC O;  2WLN A;  2BE3 A;  4EFE A;  1AP6 A;  5B5E Z;  3CXC U;  4X66 B;  1S5H C;  1HP8 A;  4UCS A;  1A32 A;  1VF6 A;  3TCU A;  3JCU Z;  2QKS A;  2BSK B;  2KG7 A;  5CBG A;  2OYQ A;  1EZJ A;  1K8A W;  4BWA A;  1F51 A;  2CH7 B;  4DK0 A;  3E35 A;  5J9P C;  2UUC B;  2QM4 A;  3G80 A;  3HKC A;  2Q68 A;  1SZT A;  4W4K A;  2FTK A;  4QE7 A;  5EIB D;  4I7Z B;  3D8C A;  4XDL A;  3E8H A;  3ASN B;  5LXT A;  3N27 A;  1NI8 A;  4WF9 V;  3UM7 A;  4KXR A;  4MSW C;  4MTO A;  3I55 V;  2WLI A;  2ITD C;  5KX5 B;  3SPC A;  3JD3 A;  5LHI A;  1WB7 A;  4B3R O;  2EBO A;  1ENV A;  1HR0 O;  4HAM A;  3WU2 Z;  2DQ3 A;  4JF3 A;  3BA8 A;  4GYC B;  2OCC C;  2KSD A;  1RM1 C;  4DR4 B;  4UVC A;  3CCJ V;  5BMV A;  1YIJ V;  3ZMU A;  1Y6X A;  1SER A;  3CC7 V;  4PI2 A;  2FYU H;  2PF4 E;  1OCC C;  1QLE B;  3FD9 A;  4EKW A;  3JAK A;  4P9P A;  3ZRW B;  1MA1 A;  2ZR3 A;  3EFF K;  4BIZ A;  3AG3 C;  1E1Q G;  1AR4 A;  1NTM H;  2P90 A;  2ZIN A;  4O4H A;  4WFE A;  1N4C A;  3AK2 A;  3ABL C;  4O4I B;  3OTF A;  3E89 A;  5FNV A;  4TV8 A;  1HNW B;  1N36 O;  5KHG A;  1CP9 A;  4JI0 B;  1PNM A;  2A06 H;  1M4U A;  2PGG A;  1Q6U A;  1MZE A;  4B3S O;  3OD4 A;  3RW0 A;  3BA9 A;  3K0G A;  5L3G A;  5KHH A;  1P7B A;  3G71 V;  4LF7 O;  2EIL C;  2EUL A;  5D5Q A;  4B3S B;  2Y0I A;  4XDJ A;  5H5N A;  4JI4 B;  2VRZ A;  4X1Y B;  3RBZ A;  1TUE B;  3FAV A;  1WN7 A;  4F6R A;  3ZIA G;  1IDS A;  4DUY B;  2E3C A;  2GTA A;  5K1X A;  1PNL A;  2HHH B;  3LSU A;  5LL6 Y;  4DR1 O;  3B09 A;  4YHH B;  4WFG A;  1SQP H;  4DUY O;  3T1C A;  1QVG U;  3HR0 A;  1IBL O;  4LH6 A;  3F5T A;  1YZB A;  4FLW A;  1R73 A;  4OPA A;  3W7X A;  4JI3 B;  2RMK B;  2E5L B;  1VAR A;  4JV5 B;  5LHG A;  2Y4T A;  1GO3 F;  2D3O W;  1F4M A;  4O2B B;  1J5E B;  2Q6A A;  1QCE A;  4JAV A;  1SQG A;  3H9V A;  5LBQ A;  4YXW G;  1H2N A;  2JS3 A;  2QM8 A;  5JH7 A;  5IJ9 B;  2UU9 B;  2IH1 C;  2KB1 A;  1BE3 H;  3CEI A;  4FLU A;  2W0F C;  2PI4 A;  3FYI B;  1NVP D;  3ZS8 C;  1UPG A;  2OTL V;  4K35 A;  1SZX A;  1Q6I A;  4DV5 B;  4IHJ A;  2ZQM A;  3OM3 B;  4DV0 O;  1FJG O;  4NYK A;  4FLY A;  4JTC B;  3TXQ A;  4R6Z A;  2VWJ A;  3A8T A;  3K59 A;  4ASU G;  1IX9 A;  3CRQ A;  1VQ4 V;  4DR5 O;  4J42 A;  3ABK B;  1FYJ A;  2ZKO A;  3WB1 A;  1BSM A;  3P30 A;  1W59 A;  1OCO C;  2DOS A;  3ABU A;  4FLT A;  1S76 D;  2ZDI A;  2P6J A;  3JAS A;  4JAS A;  2F4V O;  4I9Q A;  4BIO A;  3JCZ A;  3ABK C;  3S3X A;  4CC6 A;  1CXZ B;  4JYA B;  4BIU A;  4K8Z A;  2WLH A;  2F4V B;  4PV1 B;  3VQV A;  1KEC A;  1Y74 A;  4HBN A;  4PHZ A;  1XDC A;  2L6L A;  4JTA B;  4LFA O;  4IYI A;  4MVZ A;  5GON B;  2UXD B;  2LGQ A;  1D2D A;  1ZUQ A;  4TOI A;  4O2A A;  2K1E A;  3J7A U;  4MVS A;  2QWP B;  3OE7 G;  4L87 A;  5KHK A;  3GVM A;  1NBM G;  1GN3 A;  2M6Y A;  1JFF A;  1HW7 A;  3CE2 A;  1Q8I A;  1K33 A;  1ZTE A;  3HB3 B;  4JI5 B;  1K92 A;  2A79 B;  3ZHR A;  4UB8 Z;  2LO1 A;  1WB8 A;  1M56 C;  4Z2W A;  3UO3 A;  3K08 A;  4JYB A;  5CA1 B;  2R9R B;  3APQ A;  3QTC A;  1NVP B;  1AI6 A;  4LF9 B;  3H1J H;  2H94 A;  1J95 A;  4J10 A;  5CB4 B;  3P32 A;  2Q8V A;  2N05 A;  1Y4M A;  2QGN A;  1WNS A;  2GUZ B;  2ZM6 B;  4RUF A;  5IWA B;  2AZ2 A;  5IYD O; 
#chains in the Genus database with same CATH homology
 4J41 A;  4J7J A;  4W4L A;  4IYI A;  4J10 A;  4J11 A;  3FX7 A;  4J42 A;  2GTS A;  4W4K A;  4KXR A;  4J7K A;  4IYH A;  2G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...