3AG7A

An auxilin-like j-domain containing protein, jac1 j-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
b'GPLGSEEIKNIDAKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGASANQKYMAEKVFELLQEAWDHFNTLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein F9E10.5
publication title Crystallographic and functional analyses of J-domain of JAC1 essential for chloroplast photorelocation movement in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3ag7A00
2QWPB 2YUAA 1BQZA 1NZ6A 2CTQA 1WJZA 1N4CA 2EJ7A 1HDJA 2OCHA 2LGWA 2GUZA 2GUZB 2QWRB 3BVOA 3UO2A 1FAFA 2PF4E 2QWQB 2QWOB 2M6YA 4J80A 2N05A 1FPOA 2DMXA 2CTPA 2L6LA 2YS8A 3AG7A 2Y4TA 2QWNB 2CTWA 1XBLA 3UO3A 3APQA 1GH6A 2QSAA 2Y4UA 3UCSC 1BQ0A 2KQXA 4IT5A 4J7ZA 3APOA 2DN9A 1IURA 2CTRA 2CUGA 4RWUA 2LO1A 2N04A
chains in the Genus database with same CATH superfamily
5EBMC 5L3DA 3CCQV 4X1IA 2ZQMA 3CEIA 3ABLB 5CBGA 4I4TA 2QA4V 2ZIOA 4MTFA 1WP8A 4FZ0A 3J81N 3W7WA 1VP7A 2NNUA 4JYAO 1SQPH 1MA1A 1VQ6V 5EBWC 4PHZA 3BY6A 3CJHA 4DV1O 4LFAO 5B3SC 2DQ0A 2WLHA 2E3CA 5B5EZ 3C90A 2BTQB 3T1YO 2YIBA 3UQ8A 4LF4O 4O2BA 2DWDC 2ARHA 3CCSV 2JK5C 3ZN0A 3SJCC 4NR1A 2CGOA 2FKXA 1NH2B 3SGIA 4TUYA 5A2QN 4PDLA 3QO7A 5DM6V 4HNAB 4DW0A 4UV9A 4FPPA 1F23A 2YIBD 2NR5A 3ZHRA 5IJ9B 3CCUV 3E22A 3OMIB 4LCUC 3VBBA 3OE7G 1Q8IA 5EZYB 5KHHA 2LJ2A 3QO5A 5H2FZ 3K9AA 4G2KA 3WFVA 4MVUA 4LFCB 4GX0A 1BL8A 3RBZA 3AK1A 1Q6IA 2Y69C 4EB6B 1VEWA 3R66A 1N0NA 4DUZO 2YS8A 5E79Z 1QU7A 3AK3A 2NLJC 4TV8A 2F4VB 4B7KA 1KUQA 3W7UA 1EFRG 1XNQO 1EBOA 4UCSA 3IJ4A 5CMUA 4DXWA 4LF6B 2Q67A 5BY1A 2EIMB 3AK2A 4KFMA 4MVMA 4I4TB 4B3MB 4XDKA 3JALB 1V55C 3G67A 4X1YA 4IIJA 2B9ZA 3B8MA 2H94A 3L74H 1K34A 4OGQB 3ZHQA 1XMOB 3HKDA 4YY3B 4DRXA 1DGSA 3ZRXA 4DR1O 1OCCB 5JWPA 1YXBA 5B1NA 3K08A 4JI6B 4X65B 5JQGA 4WFFA 4HYOA 3HR0A 2Q0OC 2RMKB 1MSDA 3D36C 3E8GA 1O9GA 1OCZB 2GV9A 5IJ0B 4LBEC 1NQTA 5FNVA 1YITV 2OYQA 4ASUG 5JJNB 2DW4A 2D3OW 2M7WA 4JI4O 2M6YA 3RYFB 3ZBHA 1PKXA 3JAKB 4I0XB 4R8CA 1Z2GA 1OCRC 1RM1B 4QJFB 4OX9B 2QM7A 3ETQA 1K97A 2P7TC 4AQYO 2DOSA 1DK1A 4PDRA 1SA0B 1N33O 4BR6A 3E86A 1BSMA 5H9CA 3FX7A 4KHPO 4BW9A 4I50A 2N05A 1VQMV 1ENVA 1SQQH 3U11A 4DV4O 3R65A 2ZINA 1QLNA 5GONA 4PA6A 3ASOC 5KAIZ 1AB3A 1R6KA 4UVBA 5IYZA 3P3NA 4F6EA 4DR6B 1I7FA 2ADPA 5LP6B 4LWSB 5GW7A 4JI8B 1KYOF 2IM9A 4B3SO 1GN6A 5KX5A 1YSCA 1VQ5V 1RSOA 5BMVB 4NTYA 3H1LH 4XDLA 3JARA 4W4KA 3H9VA 3M99B 2P22C 4ZBMA 2C2AA 2Z3YA 1GTOA 4X1YB 1H2MA 4U7NA 3CC4V 3H01A 3T4DA 3OR6C 3HKDB 4RQEA 2LW7A 1HNWO 1XUQA 1GN2A 4ZKIA 3ABMB 3CRMA 4JV5O 2PF4E 2DYRB 3CCVV 1QVGU 3BA8A 1OHHG 2IH3C 1RPRA 4O2AB 1NU1H 2P06A 1Q3EA 4FM0A 5CBFA 3APQA 2ITDC 5JCOA 3HKCA 1X4TA 2IH1C 2WPDG 1VQNV 1XQ8A 3STLC 1FXKB 2VQFB 2HJFC 2UXDB 4PA7A 4MS2A 4DR4O 2RNBA 1WA8A 5J2TB 4PI0A 1N36O 2DQ3A 4H13B 3BAAA 2UUAO 4Z1VA 4JI1O 2WLNA 3HKEA 3ETGA 1AILA 4XDJA 1H2LA 4DV2B 4B3TO 4DV0O 1PPJH 4K8XA 3T1CA 1WPXA 1TAEA 3AG1B 4DV6B 2PTMA 1E1RG 3RVZA 1XEQA 4GYCB 5EK0A 4X89A 3JATB 1KP2A 5KHKA 3JASA 1XNRB 3N2KA 1US6A 5ITZA 5DEDA 3DTUB 3HKBB 1IZ3A 1WPBA 3F5WC 1OCOC 3E8HA 3TCUA 2V7QG 1IBLB 4WBNB 2ZR3A 4ZOLB 2XAHA 1WB8A 4LFBO 4PA4A 3P32A 5LOVA 1TA8A 4NVPA 4EEQA 2BSKA 4LF5B 3PJSK 3A0BZ 4O4LB 4I9QA 3JARB 3E89A 4UVCA 5KMGB 4LH6A 4QNHB 5C8YB 1QCEA 3IAYA 3ABTA 4NXNO 1VF5B 5IE9A 1Q86W 3EFFK 1PNKA 5JH7A 5LA6A 1K73W 3K5OA 3S3XA 2Q69A 4ZI7B 1HNZO 5EBLC 3RWRD 3HKCB 4J7JA 3UCSC 2QEXV 4TV9A 5BXZA 4JTCB 1BQZA 2DYSC 1NKDA 1WA8B 3KCYA 2P4VA 2BCCH 4JAUA 5LL6Y 4Q20A 2F4VO 4JI7B 3G80A 3BRCA 2ITCC 5IWAB 3JD1A 2WLIB 3CRRA 1N34B 3K03A 5EC2C 2FMLA 4FM1A 4GKJB 3B77A 1E1QG 2JEXA 3N2GA 2Q7EA 5BZBA 1S5HC 2GSMB 2WLJA 2EZPA 4B3MO 3P3PA 3JASB 3N2KB 2Q0AA 2VS0A 2JS3A 1G8MA 2UXCO 3OAAG 2EIJB 3SYAA 1QR8A 3BHPA 1IXBA 3T4ZA 1L0LH 4DO2A 3W7SA 4FLWA 5FPOA 2BE3A 3ETEA 5CN0A 5B3SB 1IURA 3K0GA 1KD1W 2W6JG 3K9SA 1XHZA 5LOVB 3TETA 3OUFA 5EYPA 1AVMA 2Q6AA 2GUZA 2WWWA 4JI6O 4X65O 2X0LA 2A79B 2X6CA 1UFIA 2R9AA 3D36A 2IU0A 3GB7C 2HP8A 2JS5A 4LH7A 4DUYB 1YZBA 2PYLA 1M57B 4LNUA 3IC7A 3APOA 4DK1A 4DR3B 3Q4HA 4LF7O 1AP5A 3CCRV 1IVSA 5B1AC 3CHXA 3RYHB 1S72V 2VWJA 1ZL8B 2EULA 1SQBH 4WFHA 3CD6V 2QWNB 3OM3B 1LUVA 3AG3C 2CTRA 4K0KB 2X6AA 1L0NH 2JVDA 2RDCA 1PNLA 2Y69B 1A32A 1NTZH 3G4SV 3JAWB 1Y66A 1MNGA 1K5SA 4YJ3B 3RYIA 1COWG 1EZJA 2UUCB 1RPOA 3K06A 1BS3A 2MK3A 4DR6O 3K5LA 1URFA 3SPIA 3CS5A 1S5JA 3KKYA 2ZD9A 4JI8O 1XMQO 4RWUA 3L70H 2UU9B 1K4DC 4BIZA 2ZIMA 1ZSPA 5LXTA 1JPXA 4MW8A 1G6UA 1V55B 3ASNC 1R3JC 2ZM6O 1XILA 3KCXA 1Q90D 1FD9A 4GKKB 2DJVA 5L3EA 3FB6C 3OW2U 3K59A 1R3LC 3K5MA 3EXAA 5LMUO 2N04A 2CK3G 1I0HA 2X7RB 3EVKA 5EYPB 3EHBB 2UXBB 1XDCA 2PUSA 3F7VC 2IBZH 3SYPA 1GN4A 3RGBA 2EZOA 4H0LB 2Q7HA 2P4KA 1M1KW 3OMNB 1IBMB 1HNXO 2VQFO 3A2FA 2YICA 4X64B 3E2EA 3BCCH 1D5NA 1QBZA 1OV9A 2IJKA 3CXHF 5B1BC 2OTJV 4X1KA 4YHHO 3Q4HB 3RYCA 2F23A 1OCRB 1I08A 2F93B 3F5TA 4DV2O 3F7YC 4UVAA 3CCLV 4FM2A 3UT5A 4K3AA 4DV6O 3FAVB 3G71V 1YJNV 1JFFA 4JI3B 1Q43A 3H1IH 4X8AA 4Q6GA 3W7TA 3H1KH 1DF5A 3MAQA 2E5LO 4TQDA 4DR2O 1ORQC 1QR9A 1XNRO 5H6RA 1N32O 1TUBA 4IHJA 1L8DA 1IBKB 3ASOB 3QTCA 3S3WA 3L75H 5IYCO 1NVPB 3WG7C 2WLLA 2OT5A 2L35A 4FLXA 1RFYA 1KC8W 4X20A 1QLEB 3CE2A 3FYEB 2LQTA 5CB4B 1SRYA 2K9PA 4IGGA 3UM7A 5KHIA 2JEUA 1I94B 3STZC 2X6BA 1S0VA 3H1HH 3A0HZ 1JVMA 3AG2C 3WB2A 2KG7A 3J80N 2F95B 4MT8A 3CX5F 5LHGA 3H1JH 2Z0AA 1TVKB 4JPRA 3ABKC 5JVDB 3B8NA 2Q9LA 4JI2B 2GDSA 5L3BA 3BPZA 1MSWD 1JA8A 3WB1A 4ZHQA 5IYDO 1LR1A 3CMAV 1DLBA 3L71H 5CA1B 3TXSA 2XTAA 1VARA 2XAQA 2OCCC 2XT9A 2AZ0A 5BR8O 2VQEO 4F6RA 3JSNA 4X1KB 2HG5C 4X1IB 4R7CA 3ZHSA 1FFXA 2YI8A 5FLXN 2F1MA 4UV8A 5KUKA 2F43G 1YTFB 5IWAO 1YHQV 1V9PA 3OTOB 4OPHA 1N34O 1AI7A 4DR7B 1FJGB 2YXLA 4GKJO 2PYJA 2EILC 1HR0B 1GAXA 1D5AA 1Z5VA 2DWEC 2RQ6A 2XAJA 4WFGA 3K5NA 5JJJB 3CJHB 3LDCA 5DECA 1TUBB 5F2VO 3QF7A 1M5IA 4CH5A 3OR7C 4O2BB 4JASA 2ZE6A 4LR3A 1OCOB 4O4HA 4AI8A 4JI5B 1KQSU 2PY5A 4TT3G 4I55A 4FIPC 4NXMO 2ZNJA 2QKCA 2Y4UA 4TUYB 2DN9A 1AJPA 5TISZ 3RW0A 2EJ7A 1Y76A 1YDXA 2CH7A 1F4NA 2RN9A 3FB7C 4GT1A 3E22B 3C3SA 3LDDA 2JGDA 3ABUA 2ZR2A 4MVQA 2A06H 3L73H 4DV5B 4ABMA 4CH4A 3CXCU 4J10A 3ZN1A 4N21A 4D7SA 4IYHA 5C93A 2IJJA 3SYCA 3ABLC 1H2GA 1JOYA 4K0KO 2HHHB 4TV8B 4TOIA 2HJDA 4HBNA 1Y74A 1K92A 4F6RB 1NTMH 1VQ8V 4GUNA 4BW5A 2UUCO 1FFXB 1DTOA 5KLVH 1QQCA 4B3RB 2LFRA 4I5SA 2IU3A 3CYOA 3AG7A 1S77D 1XBLA 4UXNA 1BE3H 3WB0A 4DV3B 3UKMA 3P30A 4IIJB 3LSQA 2YSUB 3CC2V 1PNMA 2ZDIC 3B09A 2E76B 2YEVA 4JI0B 3CWBH 4E2LA 3ZMSA 2Y0PA 4P9PA 4H44B 4DRXB 3THOA 2UXNA 4H33A 2ZCEA 1KU9A 4LP8A 1H2NA 3D8CA 1U96A 5JQGB 4I55B 3OMAB 4EKWA 5KHGA 1H8HG 1EN5A 2QSAA 2P5OA 2KQXA 5KA5A 3AG4C 2CGNA 3T1HB 2B1IA 4LF9B 3BFRA 5FNVB 1OZ0A 1R73A 4LF8B 2W6IG 1Y76B 1ZUQA 3A8TA 4DR5O 1AI5A 1WJZA 3JCZA 2JJ1G 2CH7B 5KUMA 4R6ZA 2Z5UA 2Q68A 2IW5A 1S76D 4PV1B 2R9RB 1GM9A 4NYKA 2AGAA 2QTSA 4R50A 4GX1A 3LSSA 3JYCA 4J7ZA 2A0LA 1NR7A 2WLKA 5B1AB 4TQFA 3ZMVA 3JCUZ 1SERA 3X2QB 2XAFA 2OTLV 4UCRA 3UO2A 3SPCA 2ZE8A 2EIMC 4I50B 1WN7A 1F51A 3AG3B 2YI9A 4JI3O 3VOUA 3CRCA 4X9QA 4KXRA 5GONB 4CS4A 1GM7A 1XI1A 5IYZB 4G27B 1BMFG 1YJWV 1XHXA 3K58A 4BWAA 4P9OA 4X62B 2CAZC 4JYAB 3DXRA 4GLXA 3SPGA 5KX5B 5J2UA 4YIPA 4J11A 1RSOB 3SPJA 3I55V 3VQVA 1OCCC 5GTIZ 3SJBC 3ZEDA 2XOKG 2BOCC 4WFAV 4JYCA 1YCIA 4U3JA 4K8ZA 4O4JA 4CS2A 3O65A 4JZ2A 5AG2A 1GK9A 5L3CA 4FLUA 1IDSA 4NB5A 4MVRA 4MTOA 2UUBB 2A7WA 4LFCO 3AEIA 1RM1C 1Q6HA 2HVKC 1SQXH 1VQOV 4JI2O 1Y4MA 3E8FA 3GWOA 3ZHVA 2EBOA 3ZMUA 4JAVA 1AI6A 1J5EB 3HKEB 4BIUA 1Q81W 4AHCA 5LYJA 1VQ9V 5B1BB 4DUZB 1Q5OA 2WLMA 4LF6O 1HP8A 4CZZA 1L1FA 2QWPB 1XNQB 2QJ1A 3RN4A 5LP6C 1GO3F 4JYYA 4DR7O 5LMNB 2QE7G 2FB5A 5ITZB 3LDEA 3ZRSA 1NT2B 3ZRWA 2ETNA 2P6JA 1XMOO 1SETA 2QKAA 1VQ7V 1GRJA 4YY3O 4UB8Z 3C3TA 3LNNA 4CBCA 2WA3A 1SESA 4P2ZA 5J2UB 4YJ2A 2BSKB 1KECA 4JI5O 5DN6G 1Y67A 1B3QA 2EJRA 1SQVH 3OFNG 5EC1C 4IYIA 2LFSA 2AW9A 1AR1B 3K3WA 3N27A 4HZ3A 5L3FA 4DW1A 1W2BU 1Q7YW 1FXKC 5CA0A 5JH7B 2Q73A 2QWRB 2Y48A 5LA6B 1D2DA 1VF7A 3J7AU 3IFXA 1GKFA 3BA9A 3VQXA 3ZX6A 2QDOA 4JI4B 3B40A 1N0JA 4OX9O 2ODMA 1BT8A 2KKWA 5LHIA 1DF4A 3CCMV 3B4SA 4CH6A 1J95A 1AROP 4TV9B 2ZE5A 4FLTA 1CP9A 4YXWG 4WF9V 5LHHA 1N33B 2EINC 2QGNA 3NR7A 1IX9A 4N23A 1FAFA 3JD4A 4KHPB 2HHHO 1S3JA 3FB5C 5LYJB 5FL7G 2BTOA 3CRQA 1Z5WA 4QIWF 3K57A 1SKVA 4MTGA 4NTXA 4Z1MG 1CEZA 3N2GB 1EN6A 4JYBA 3OT7A 2BTQA 3SDLA 4B3SB 2EILB 4DV3O 4D6TH 2ZDIA 2Y4TA 4JI0O 1SQFA 3SJQC 5KHJA 3RFRA 1THZA 2IJHA 1B06A 2VWKA 4HNAA 3SYOA 1WAZA 1HWYA 2LGQA 3GVMA 1FYJA 1HNWB 2HR3A 1FKAO 2GUZB 1V54C 5IJ9A 2Q7GA 1ZWIC 3E8BA 5EZYA 2LP7A 1YF2A 4JV5B 1YI2V 1NVPD 3LUTB 1NH2D 1O9HA 2CTPA 5B1OA 1R3KC 2GHYA 1FXHA 2UXDO 4LF8O 4LNUB 3TJTA 1YIJV 5HFMA 4FMTA 2LW1A 3IC9A 2EIKC 1P84F 4B7EA 2A3QA 2N74A 3CRAA 4L87A 1FXVA 4JTAB 5CBHA 2AHZA 3WU2Z 1NBMG 4EB6A 2ATKC 1JQ0A 2XNDG 4UCOA 3MHHC 2K1EA 3K79A 3ZS8C 1E79G 2ZKOA 4FFBA 3RVYA 4B3TB 1R1BA 3ZHUA 1ZX3A 1NS1A 5GTHZ 1VQPV 4RUFA 2PZSA 1KBHA 1PL4A 3RYIB 3E35A 3OTFA 4P30A 3A0RA 5A9GA 3SPHA 1YEWA 2AXTZ 3JALA 1F4MA 2OWOA 1IBLO 4BIOA 1PD3A 4X62O 1ROPA 1GH6A 2PI4A 2EIJC 1GN3A 4YIOA 2XAGA 4FZ1A 5B66Z 2YUAA 3QG5A 4ZIBA 3DSQA 4LF5O 2DE0X 1MZFA 5LXTB 4LFBB 3DC6A 1YTFD 1K33A 2R72A 2YXHA 4MW3A 3OD4A 2G38A 1K4CC 3FFQA 1P4RA 2ZT9B 3LNMB 3OEEG 4TWKA 5K1XA 4I7ZB 3VQWA 4H37A 5IT9N 5IJ0A 1M57C 1QVFU 5KAFZ 3GWKC 2CTQA 4NXNB 3CC7V 4DYLA 2ZXWC 1M4UA 2QWOB 2KSDA 3RYFA 3SYQA 3JAKA 4I0XA 3MD0A 1R6NA 2UUBO 2OIEA 3AG4B 4F4LA 2IJIA 4WFEA 1KKDA 4J7KA 1HNZB 1SA0A 2CUGA 5LGUA 4MTXA 3SR2C 3CP1A 4J41A 3LSUA 3RYCB 1J5EO 2Q5ZA 4E4EA 2F66C 4JI7O 3OGCC 5H5NA 2HKOA 5IY5C 4B08A 3OEHG 3ETDA 3FKSG 3UT5B 1PP9H 4FFBB 3JD0A 2FL4A 1JFFB 5IDJA 1BZKA 2HFEC 4CH3A 2KB1A 5LP6A 4LWSA 1I5YA 4XBFA 1KB9F 2GTSA 5LMNO 1Q82W 3CB2A 5BMVA 3DGEA 4IHJB 2W0XA 1F7YA 1NR1A 1AR4A 1BHBA 4J42A 4W4LA 2UXCB 3UO3A 2WLLB 5FPRA 1SZTA 1G4YB 4X20B 4DV7B 4J9YB 1T5EA 2HLDG 4GZRB 3ZIAG 4U3FH 4DUYO 1M90W 4O2AA 1VQKV 1CPYA 2KG7B 2O57A 4DR3O 2YIDA 1P7GA 1M56C 1FXKA 1AP6A 2B5UA 3QO8A 4Z2WA 5J2TA 2JJ2G 1WNSA 4LF7B 2Q4PA 3O9OA 2AHYA 5EIBD 4J9ZB 4ZHQB 1Q6UA 3I56V 1UPGA 1MABG 5CA3A 1K5QA 4U7OA 2DYSB 2E75B 1XL6A 4MVSA 3QVNA 3JD2A 1VF6C 2RCVA 1N4CA 4UCTA 2JDIG 3JATA 1XREA 2XHBA 3CCJV 4CC5A 3ICXA 2L6LA 3HKBA 3ZMTA 1XL4A 4HAMA 4L8JA 1SQGA 3ZRVA 3TXQA 5LGNA 2JRIA 5LGTA 5E1AC 4WBNA 2UU9O 1KP3A 4ZOLA 2Q8VA 1NI8A 3CPWU 2EX3A 1XMQB 4NTWA 2OCHA 4TSFG 3G6BA 5K1PA 2YXYA 2WAMA 1QLEC 4O4LA 4X66B 4GKKO 2AZ2A 1JMKC 4O4HB 5KMGA 1K8AW 3KG2A 2E74B 2ZM6B 5C8YA 3VQYA 3CCEV 3FB8C 4KP4A 4IT5A 1ZTEA 4C7UA 1RP3B 1QNMA 2UXBO 1R3IC 4PJ0Z 2R9IA 3OUSA 5LMUB 4JAAA 4DK0A 3RT3C 2XUMA 1FS0G 3JD3A 1IBMO 1GMGA 1PV0A 1WLEA 4QGPA 4ZI7A 2JGDB 2FYUH 4X64O 1SC5B 4AILC 1K9MW 2FTKA 1X59A 1K3EA 4PD4F 1HNXB 3ZJZA 1EZVH 4O4IA 1SS3A 3BVOA 4YHHB 2QWQB 4CS3A 1IXMA 4CC6A 4PA9A 2CDYA 5L3GA 5HFLA 4D7TA 2QM8A 2WLIA 3CSXA 3BABA 2EINB 1FFTB 5D5QA 1JX9A 1Y74B 3TGUH 2VRZA 5LBQA 4UCUA 4OXSA 1R6TA 1IBKO 2E5LB 4DR2B 4DV1B 4LFAB 2HVJC 4K35A 4J80A 1H2KA 1TUEB 2DMXA 4JGSA 1N32B 2MW2B 1XOUA 3T1YB 1P7BA 4LF4B 4JTDB 2Y0IA 2QM4A 2YEVB 1M9NA 2H3OA 4A5UB 3M7MX 1NZ6A 3E83A 3ASNB 3FYIB 1VQLV 1JCHA 1OCZC 1I94O 3ZCCA 1BCCH 2PI5A 1LUWA 4LC1A 4PI2A 3D3QA 1MOFA 1VQ4V 3JAMN 1V54B 4PDMA 4EFBA 2JIZG 2V4DA 1HDJA 4X88A 2LGWA 1OJHA 1PM9A 3K0DA 2H8PC 4QE7A 3RYHA 3HPLC 4GX5A 1ZL8A 2WA4A 1AI4A 2GBOA 1VIBA 2EIKB 1M93A 4FFKA 5D5PA 3KZIZ 5JJEB 1B04A 3L72H 3TK1A 4O4IB 4PA3A 2XASA 5BR8B 2UXXA 2VQEB 2B1GA 3JAWA 4YJ3A 2ZE7A 4I9WA 3OTOO 3OGIB 5J9PC 2W0FC 1FJGO 2ADQB 4UUJC 1S5LZ 1HR0O 1CXZB 4MSWC 3IGAC 2OIGA 1JJ2U 4OPAA 1K7DA 4RQFA 4QPJA 2D2CB 3NXSA 3PN1A 1N8RW 3DXRB 4RO2A 1LNQA 1W0JG 4DR1B 1SF9A 3WG7B 4FLYA 3U10A 2WSSG 3ABMC 1U97A 2ILMA 3W7XA 4WCEV 3ZHTA 2DYRC 1KMIZ 4FK5C 3JSLA 1P49A 1BQ0A 4U3JB 4KUMA 4NXMB 5EIBC 3ML0A 4DV7O 1H8EG 4O4JB 4UCVA 3U0ZA 1PL0A 2YC0A 4JF3A 1JR9A 3AG2B 1W0KG 4PELA 5KA6A 4KL1A 3T2MA 4GX2A 4DV5O 1MG1A 1W59A 3FD9A 2ZNIA 2NN4A 3ABKB 2QKSA 1H2SB 2ZXWB 4AQYB 2QTOA 1BGYH 4UFZA 3AG1C 3K04A 1EN4A 1HW7A 2BOBC 4EFEA 2P90A 3X2QC 1BHAA 4RAIA 1YJ9V 1NTKH 4NKGB 1TGOA 2YDEA 3HB3B 4IL6Z 2OCCB 2HEPA 2JGUA 3FAVA 2PGGA 4ICGA 1VF6A 4DV4B 2P67A 2QR4A 3QNEA 3MHSC 1B6QA 3L9DA 4UB6Z 4JZGA 5H6QA 4WFBV 4B3RO 2CE4A 1MZEA 4FJCC 4FVMA 1SZXA 2R70A 1AJNA 5IY5B 4MVZA 1FPOA 4FLZA 1KKCA 2V1DA 1AJQA 3ZRWB 3M8AA 2YIAA 4MVOA 1EM1A 2A9HA 1I5XA 3B2EE 4FLVA 1MMMA 1NJIW 3D3IA 4GCZA 3ZMZA 5CB4A 4X66O 4YJ2B 1G1XB 4G28B 1WP7A 3CMEV 2GTAA 3T1HO 2CTWA 3BEHA 3G6EV 4LF9O 1Y6XA 1ZLZA 3I5DA 1TVKA 1AR5A 1ZAUA 2LO1A 5JCOC 1YVWA 2RJZA 5JVDA 1GM8A 3SJAC 1UJWB 5CA0B 4DR4B 4DR5B 1VMGA 4QPKA 4PDVA 4RUEA 5IYBO 1WB7A 1N36B 2UUAB 1QHTA 1M56B 4JI1B 1JJOA 3DC5A 5CA1A 3MDSA 4DV0B 4QE9A 1H38A 4BAYA
chains in the Genus database with same CATH topology
2QWPB 2YUAA 1BQZA 1NZ6A 2CTQA 1WJZA 1N4CA 2EJ7A 1HDJA 2OCHA 2LGWA 2GUZA 2GUZB 2QWRB 3BVOA 3UO2A 1FAFA 2PF4E 2QWQB 2QWOB 2M6YA 4J80A 2N05A 1FPOA 2DMXA 2CTPA 2L6LA 2YS8A 3AG7A 2Y4TA 2QWNB 2CTWA 1XBLA 3UO3A 3APQA 1GH6A 2QSAA 2Y4UA 3UCSC 1BQ0A 2KQXA 4IT5A 4J7ZA 3APOA 2DN9A 1IURA 2CTRA 2CUGA 4RWUA 2LO1A 2N04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2YUA A;  1BQZ A;  1NZ6 A;  2CTQ A;  1WJZ A;  1N4C A;  2EJ7 A;  1HDJ A;  2OCH A;  2LGW A;  2GUZ A;  2GUZ B;  2QWR B;  3BVO A;  3UO2 A;  1FAF A;  2PF4 E;  2QWQ B;  2QWO B;  2M6Y A;  4J80 A;  2N05 A;  1FPO A;  2DMX A;  2CTP A;  2L6L A;  2YS8 A;  3AG7 A;  2Y4T A;  2QWN B;  2CTW A;  1XBL A;  3UO3 A;  3APQ A;  1GH6 A;  2QSA A;  2Y4U A;  3UCS C;  1BQ0 A;  2KQX A;  4IT5 A;  4J7Z A;  3APO A;  2DN9 A;  1IUR A;  2CTR A;  2CUG A;  4RWU A;  2LO1 A;  2N04 A; 
#chains in the Genus database with same CATH topology
 5EBM C;  5L3D A;  3CCQ V;  4X1I A;  2ZQM A;  3CEI A;  3ABL B;  5CBG A;  4I4T A;  2QA4 V;  2ZIO A;  4MTF A;  1WP8 A;  4FZ0 A;  3J81 N;  3W7W A;  1VP7 A;  2NNU A;  4JYA O;  1SQP H;  1MA1 A;  1VQ6 V;  5EBW C;  4PHZ A;  3BY6 A;  3CJH A;  4DV1 O;  4LFA O;  5B3S C;  2DQ0 A;  2WLH A;  2E3C A;  5B5E Z;  3C90 A;  2BTQ B;  3T1Y O;  2YIB A;  3UQ8 A;  4LF4 O;  4O2B A;  2DWD C;  2ARH A;  3CCS V;  2JK5 C;  3ZN0 A;  3SJC C;  4NR1 A;  2CGO A;  2FKX A;  1NH2 B;  3SGI A;  4TUY A;  5A2Q N;  4PDL A;  3QO7 A;  5DM6 V;  4HNA B;  4DW0 A;  4UV9 A;  4FPP A;  1F23 A;  2YIB D;  2NR5 A;  3ZHR A;  5IJ9 B;  3CCU V;  3E22 A;  3OMI B;  4LCU C;  3VBB A;  3OE7 G;  1Q8I A;  5EZY B;  5KHH A;  2LJ2 A;  3QO5 A;  5H2F Z;  3K9A A;  4G2K A;  3WFV A;  4MVU A;  4LFC B;  4GX0 A;  1BL8 A;  3RBZ A;  3AK1 A;  1Q6I A;  2Y69 C;  4EB6 B;  1VEW A;  3R66 A;  1N0N A;  4DUZ O;  2YS8 A;  5E79 Z;  1QU7 A;  3AK3 A;  2NLJ C;  4TV8 A;  2F4V B;  4B7K A;  1KUQ A;  3W7U A;  1EFR G;  1XNQ O;  1EBO A;  4UCS A;  3IJ4 A;  5CMU A;  4DXW A;  4LF6 B;  2Q67 A;  5BY1 A;  2EIM B;  3AK2 A;  4KFM A;  4MVM A;  4I4T B;  4B3M B;  4XDK A;  3JAL B;  1V55 C;  3G67 A;  4X1Y A;  4IIJ A;  2B9Z A;  3B8M A;  2H94 A;  3L74 H;  1K34 A;  4OGQ B;  3ZHQ A;  1XMO B;  3HKD A;  4YY3 B;  4DRX A;  1DGS A;  3ZRX A;  4DR1 O;  1OCC B;  5JWP A;  1YXB A;  5B1N A;  3K08 A;  4JI6 B;  4X65 B;  5JQG A;  4WFF A;  4HYO A;  3HR0 A;  2Q0O C;  2RMK B;  1MSD A;  3D36 C;  3E8G A;  1O9G A;  1OCZ B;  2GV9 A;  5IJ0 B;  4LBE C;  1NQT A;  5FNV A;  1YIT V;  2OYQ A;  4ASU G;  5JJN B;  2DW4 A;  2D3O W;  2M7W A;  4JI4 O;  2M6Y A;  3RYF B;  3ZBH A;  1PKX A;  3JAK B;  4I0X B;  4R8C A;  1Z2G A;  1OCR C;  1RM1 B;  4QJF B;  4OX9 B;  2QM7 A;  3ETQ A;  1K97 A;  2P7T C;  4AQY O;  2DOS A;  1DK1 A;  4PDR A;  1SA0 B;  1N33 O;  4BR6 A;  3E86 A;  1BSM A;  5H9C A;  3FX7 A;  4KHP O;  4BW9 A;  4I50 A;  2N05 A;  1VQM V;  1ENV A;  1SQQ H;  3U11 A;  4DV4 O;  3R65 A;  2ZIN A;  1QLN A;  5GON A;  4PA6 A;  3ASO C;  5KAI Z;  1AB3 A;  1R6K A;  4UVB A;  5IYZ A;  3P3N A;  4F6E A;  4DR6 B;  1I7F A;  2ADP A;  5LP6 B;  4LWS B;  5GW7 A;  4JI8 B;  1KYO F;  2IM9 A;  4B3S O;  1GN6 A;  5KX5 A;  1YSC A;  1VQ5 V;  1RSO A;  5BMV B;  4NTY A;  3H1L H;  4XDL A;  3JAR A;  4W4K A;  3H9V A;  3M99 B;  2P22 C;  4ZBM A;  2C2A A;  2Z3Y A;  1GTO A;  4X1Y B;  1H2M A;  4U7N A;  3CC4 V;  3H01 A;  3T4D A;  3OR6 C;  3HKD B;  4RQE A;  2LW7 A;  1HNW O;  1XUQ A;  1GN2 A;  4ZKI A;  3ABM B;  3CRM A;  4JV5 O;  2PF4 E;  2DYR B;  3CCV V;  1QVG U;  3BA8 A;  1OHH G;  2IH3 C;  1RPR A;  4O2A B;  1NU1 H;  2P06 A;  1Q3E A;  4FM0 A;  5CBF A;  3APQ A;  2ITD C;  5JCO A;  3HKC A;  1X4T A;  2IH1 C;  2WPD G;  1VQN V;  1XQ8 A;  3STL C;  1FXK B;  2VQF B;  2HJF C;  2UXD B;  4PA7 A;  4MS2 A;  4DR4 O;  2RNB A;  1WA8 A;  5J2T B;  4PI0 A;  1N36 O;  2DQ3 A;  4H13 B;  3BAA A;  2UUA O;  4Z1V A;  4JI1 O;  2WLN A;  3HKE A;  3ETG A;  1AIL A;  4XDJ A;  1H2L A;  4DV2 B;  4B3T O;  4DV0 O;  1PPJ H;  4K8X A;  3T1C A;  1WPX A;  1TAE A;  3AG1 B;  4DV6 B;  2PTM A;  1E1R G;  3RVZ A;  1XEQ A;  4GYC B;  5EK0 A;  4X89 A;  3JAT B;  1KP2 A;  5KHK A;  3JAS A;  1XNR B;  3N2K A;  1US6 A;  5ITZ A;  5DED A;  3DTU B;  3HKB B;  1IZ3 A;  1WPB A;  3F5W C;  1OCO C;  3E8H A;  3TCU A;  2V7Q G;  1IBL B;  4WBN B;  2ZR3 A;  4ZOL B;  2XAH A;  1WB8 A;  4LFB O;  4PA4 A;  3P32 A;  5LOV A;  1TA8 A;  4NVP A;  4EEQ A;  2BSK A;  4LF5 B;  3PJS K;  3A0B Z;  4O4L B;  4I9Q A;  3JAR B;  3E89 A;  4UVC A;  5KMG B;  4LH6 A;  4QNH B;  5C8Y B;  1QCE A;  3IAY A;  3ABT A;  4NXN O;  1VF5 B;  5IE9 A;  1Q86 W;  3EFF K;  1PNK A;  5JH7 A;  5LA6 A;  1K73 W;  3K5O A;  3S3X A;  2Q69 A;  4ZI7 B;  1HNZ O;  5EBL C;  3RWR D;  3HKC B;  4J7J A;  3UCS C;  2QEX V;  4TV9 A;  5BXZ A;  4JTC B;  1BQZ A;  2DYS C;  1NKD A;  1WA8 B;  3KCY A;  2P4V A;  2BCC H;  4JAU A;  5LL6 Y;  4Q20 A;  2F4V O;  4JI7 B;  3G80 A;  3BRC A;  2ITC C;  5IWA B;  3JD1 A;  2WLI B;  3CRR A;  1N34 B;  3K03 A;  5EC2 C;  2FML A;  4FM1 A;  4GKJ B;  3B77 A;  1E1Q G;  2JEX A;  3N2G A;  2Q7E A;  5BZB A;  1S5H C;  2GSM B;  2WLJ A;  2EZP A;  4B3M O;  3P3P A;  3JAS B;  3N2K B;  2Q0A A;  2VS0 A;  2JS3 A;  1G8M A;  2UXC O;  3OAA G;  2EIJ B;  3SYA A;  1QR8 A;  3BHP A;  1IXB A;  3T4Z A;  1L0L H;  4DO2 A;  3W7S A;  4FLW A;  5FPO A;  2BE3 A;  3ETE A;  5CN0 A;  5B3S B;  1IUR A;  3K0G A;  1KD1 W;  2W6J G;  3K9S A;  1XHZ A;  5LOV B;  3TET A;  3OUF A;  5EYP A;  1AVM A;  2Q6A A;  2GUZ A;  2WWW A;  4JI6 O;  4X65 O;  2X0L A;  2A79 B;  2X6C A;  1UFI A;  2R9A A;  3D36 A;  2IU0 A;  3GB7 C;  2HP8 A;  2JS5 A;  4LH7 A;  4DUY B;  1YZB A;  2PYL A;  1M57 B;  4LNU A;  3IC7 A;  3APO A;  4DK1 A;  4DR3 B;  3Q4H A;  4LF7 O;  1AP5 A;  3CCR V;  1IVS A;  5B1A C;  3CHX A;  3RYH B;  1S72 V;  2VWJ A;  1ZL8 B;  2EUL A;  1SQB H;  4WFH A;  3CD6 V;  2QWN B;  3OM3 B;  1LUV A;  3AG3 C;  2CTR A;  4K0K B;  2X6A A;  1L0N H;  2JVD A;  2RDC A;  1PNL A;  2Y69 B;  1A32 A;  1NTZ H;  3G4S V;  3JAW B;  1Y66 A;  1MNG A;  1K5S A;  4YJ3 B;  3RYI A;  1COW G;  1EZJ A;  2UUC B;  1RPO A;  3K06 A;  1BS3 A;  2MK3 A;  4DR6 O;  3K5L A;  1URF A;  3SPI A;  3CS5 A;  1S5J A;  3KKY A;  2ZD9 A;  4JI8 O;  1XMQ O;  4RWU A;  3L70 H;  2UU9 B;  1K4D C;  4BIZ A;  2ZIM A;  1ZSP A;  5LXT A;  1JPX A;  4MW8 A;  1G6U A;  1V55 B;  3ASN C;  1R3J C;  2ZM6 O;  1XIL A;  3KCX A;  1Q90 D;  1FD9 A;  4GKK B;  2DJV A;  5L3E A;  3FB6 C;  3OW2 U;  3K59 A;  1R3L C;  3K5M A;  3EXA A;  5LMU O;  2N04 A;  2CK3 G;  1I0H A;  2X7R B;  3EVK A;  5EYP B;  3EHB B;  2UXB B;  1XDC A;  2PUS A;  3F7V C;  2IBZ H;  3SYP A;  1GN4 A;  3RGB A;  2EZO A;  4H0L B;  2Q7H A;  2P4K A;  1M1K W;  3OMN B;  1IBM B;  1HNX O;  2VQF O;  3A2F A;  2YIC A;  4X64 B;  3E2E A;  3BCC H;  1D5N A;  1QBZ A;  1OV9 A;  2IJK A;  3CXH F;  5B1B C;  2OTJ V;  4X1K A;  4YHH O;  3Q4H B;  3RYC A;  2F23 A;  1OCR B;  1I08 A;  2F93 B;  3F5T A;  4DV2 O;  3F7Y C;  4UVA A;  3CCL V;  4FM2 A;  3UT5 A;  4K3A A;  4DV6 O;  3FAV B;  3G71 V;  1YJN V;  1JFF A;  4JI3 B;  1Q43 A;  3H1I H;  4X8A A;  4Q6G A;  3W7T A;  3H1K H;  1DF5 A;  3MAQ A;  2E5L O;  4TQD A;  4DR2 O;  1ORQ C;  1QR9 A;  1XNR O;  5H6R A;  1N32 O;  1TUB A;  4IHJ A;  1L8D A;  1IBK B;  3ASO B;  3QTC A;  3S3W A;  3L75 H;  5IYC O;  1NVP B;  3WG7 C;  2WLL A;  2OT5 A;  2L35 A;  4FLX A;  1RFY A;  1KC8 W;  4X20 A;  1QLE B;  3CE2 A;  3FYE B;  2LQT A;  5CB4 B;  1SRY A;  2K9P A;  4IGG A;  3UM7 A;  5KHI A;  2JEU A;  1I94 B;  3STZ C;  2X6B A;  1S0V A;  3H1H H;  3A0H Z;  1JVM A;  3AG2 C;  3WB2 A;  2KG7 A;  3J80 N;  2F95 B;  4MT8 A;  3CX5 F;  5LHG A;  3H1J H;  2Z0A A;  1TVK B;  4JPR A;  3ABK C;  5JVD B;  3B8N A;  2Q9L A;  4JI2 B;  2GDS A;  5L3B A;  3BPZ A;  1MSW D;  1JA8 A;  3WB1 A;  4ZHQ A;  5IYD O;  1LR1 A;  3CMA V;  1DLB A;  3L71 H;  5CA1 B;  3TXS A;  2XTA A;  1VAR A;  2XAQ A;  2OCC C;  2XT9 A;  2AZ0 A;  5BR8 O;  2VQE O;  4F6R A;  3JSN A;  4X1K B;  2HG5 C;  4X1I B;  4R7C A;  3ZHS A;  1FFX A;  2YI8 A;  5FLX N;  2F1M A;  4UV8 A;  5KUK A;  2F43 G;  1YTF B;  5IWA O;  1YHQ V;  1V9P A;  3OTO B;  4OPH A;  1N34 O;  1AI7 A;  4DR7 B;  1FJG B;  2YXL A;  4GKJ O;  2PYJ A;  2EIL C;  1HR0 B;  1GAX A;  1D5A A;  1Z5V A;  2DWE C;  2RQ6 A;  2XAJ A;  4WFG A;  3K5N A;  5JJJ B;  3CJH B;  3LDC A;  5DEC A;  1TUB B;  5F2V O;  3QF7 A;  1M5I A;  4CH5 A;  3OR7 C;  4O2B B;  4JAS A;  2ZE6 A;  4LR3 A;  1OCO B;  4O4H A;  4AI8 A;  4JI5 B;  1KQS U;  2PY5 A;  4TT3 G;  4I55 A;  4FIP C;  4NXM O;  2ZNJ A;  2QKC A;  2Y4U A;  4TUY B;  2DN9 A;  1AJP A;  5TIS Z;  3RW0 A;  2EJ7 A;  1Y76 A;  1YDX A;  2CH7 A;  1F4N A;  2RN9 A;  3FB7 C;  4GT1 A;  3E22 B;  3C3S A;  3LDD A;  2JGD A;  3ABU A;  2ZR2 A;  4MVQ A;  2A06 H;  3L73 H;  4DV5 B;  4ABM A;  4CH4 A;  3CXC U;  4J10 A;  3ZN1 A;  4N21 A;  4D7S A;  4IYH A;  5C93 A;  2IJJ A;  3SYC A;  3ABL C;  1H2G A;  1JOY A;  4K0K O;  2HHH B;  4TV8 B;  4TOI A;  2HJD A;  4HBN A;  1Y74 A;  1K92 A;  4F6R B;  1NTM H;  1VQ8 V;  4GUN A;  4BW5 A;  2UUC O;  1FFX B;  1DTO A;  5KLV H;  1QQC A;  4B3R B;  2LFR A;  4I5S A;  2IU3 A;  3CYO A;  3AG7 A;  1S77 D;  1XBL A;  4UXN A;  1BE3 H;  3WB0 A;  4DV3 B;  3UKM A;  3P30 A;  4IIJ B;  3LSQ A;  2YSU B;  3CC2 V;  1PNM A;  2ZDI C;  3B09 A;  2E76 B;  2YEV A;  4JI0 B;  3CWB H;  4E2L A;  3ZMS A;  2Y0P A;  4P9P A;  4H44 B;  4DRX B;  3THO A;  2UXN A;  4H33 A;  2ZCE A;  1KU9 A;  4LP8 A;  1H2N A;  3D8C A;  1U96 A;  5JQG B;  4I55 B;  3OMA B;  4EKW A;  5KHG A;  1H8H G;  1EN5 A;  2QSA A;  2P5O A;  2KQX A;  5KA5 A;  3AG4 C;  2CGN A;  3T1H B;  2B1I A;  4LF9 B;  3BFR A;  5FNV B;  1OZ0 A;  1R73 A;  4LF8 B;  2W6I G;  1Y76 B;  1ZUQ A;  3A8T A;  4DR5 O;  1AI5 A;  1WJZ A;  3JCZ A;  2JJ1 G;  2CH7 B;  5KUM A;  4R6Z A;  2Z5U A;  2Q68 A;  2IW5 A;  1S76 D;  4PV1 B;  2R9R B;  1GM9 A;  4NYK A;  2AGA A;  2QTS A;  4R50 A;  4GX1 A;  3LSS A;  3JYC A;  4J7Z A;  2A0L A;  1NR7 A;  2WLK A;  5B1A B;  4TQF A;  3ZMV A;  3JCU Z;  1SER A;  3X2Q B;  2XAF A;  2OTL V;  4UCR A;  3UO2 A;  3SPC A;  2ZE8 A;  2EIM C;  4I50 B;  1WN7 A;  1F51 A;  3AG3 B;  2YI9 A;  4JI3 O;  3VOU A;  3CRC A;  4X9Q A;  4KXR A;  5GON B;  4CS4 A;  1GM7 A;  1XI1 A;  5IYZ B;  4G27 B;  1BMF G;  1YJW V;  1XHX A;  3K58 A;  4BWA A;  4P9O A;  4X62 B;  2CAZ C;  4JYA B;  3DXR A;  4GLX A;  3SPG A;  5KX5 B;  5J2U A;  4YIP A;  4J11 A;  1RSO B;  3SPJ A;  3I55 V;  3VQV A;  1OCC C;  5GTI Z;  3SJB C;  3ZED A;  2XOK G;  2BOC C;  4WFA V;  4JYC A;  1YCI A;  4U3J A;  4K8Z A;  4O4J A;  4CS2 A;  3O65 A;  4JZ2 A;  5AG2 A;  1GK9 A;  5L3C A;  4FLU A;  1IDS A;  4NB5 A;  4MVR A;  4MTO A;  2UUB B;  2A7W A;  4LFC O;  3AEI A;  1RM1 C;  1Q6H A;  2HVK C;  1SQX H;  1VQO V;  4JI2 O;  1Y4M A;  3E8F A;  3GWO A;  3ZHV A;  2EBO A;  3ZMU A;  4JAV A;  1AI6 A;  1J5E B;  3HKE B;  4BIU A;  1Q81 W;  4AHC A;  5LYJ A;  1VQ9 V;  5B1B B;  4DUZ B;  1Q5O A;  2WLM A;  4LF6 O;  1HP8 A;  4CZZ A;  1L1F A;  2QWP B;  1XNQ B;  2QJ1 A;  3RN4 A;  5LP6 C;  1GO3 F;  4JYY A;  4DR7 O;  5LMN B;  2QE7 G;  2FB5 A;  5ITZ B;  3LDE A;  3ZRS A;  1NT2 B;  3ZRW A;  2ETN A;  2P6J A;  1XMO O;  1SET A;  2QKA A;  1VQ7 V;  1GRJ A;  4YY3 O;  4UB8 Z;  3C3T A;  3LNN A;  4CBC A;  2WA3 A;  1SES A;  4P2Z A;  5J2U B;  4YJ2 A;  2BSK B;  1KEC A;  4JI5 O;  5DN6 G;  1Y67 A;  1B3Q A;  2EJR A;  1SQV H;  3OFN G;  5EC1 C;  4IYI A;  2LFS A;  2AW9 A;  1AR1 B;  3K3W A;  3N27 A;  4HZ3 A;  5L3F A;  4DW1 A;  1W2B U;  1Q7Y W;  1FXK C;  5CA0 A;  5JH7 B;  2Q73 A;  2QWR B;  2Y48 A;  5LA6 B;  1D2D A;  1VF7 A;  3J7A U;  3IFX A;  1GKF A;  3BA9 A;  3VQX A;  3ZX6 A;  2QDO A;  4JI4 B;  3B40 A;  1N0J A;  4OX9 O;  2ODM A;  1BT8 A;  2KKW A;  5LHI A;  1DF4 A;  3CCM V;  3B4S A;  4CH6 A;  1J95 A;  1ARO P;  4TV9 B;  2ZE5 A;  4FLT A;  1CP9 A;  4YXW G;  4WF9 V;  5LHH A;  1N33 B;  2EIN C;  2QGN A;  3NR7 A;  1IX9 A;  4N23 A;  1FAF A;  3JD4 A;  4KHP B;  2HHH O;  1S3J A;  3FB5 C;  5LYJ B;  5FL7 G;  2BTO A;  3CRQ A;  1Z5W A;  4QIW F;  3K57 A;  1SKV A;  4MTG A;  4NTX A;  4Z1M G;  1CEZ A;  3N2G B;  1EN6 A;  4JYB A;  3OT7 A;  2BTQ A;  3SDL A;  4B3S B;  2EIL B;  4DV3 O;  4D6T H;  2ZDI A;  2Y4T A;  4JI0 O;  1SQF A;  3SJQ C;  5KHJ A;  3RFR A;  1THZ A;  2IJH A;  1B06 A;  2VWK A;  4HNA A;  3SYO A;  1WAZ A;  1HWY A;  2LGQ A;  3GVM A;  1FYJ A;  1HNW B;  2HR3 A;  1FKA O;  2GUZ B;  1V54 C;  5IJ9 A;  2Q7G A;  1ZWI C;  3E8B A;  5EZY A;  2LP7 A;  1YF2 A;  4JV5 B;  1YI2 V;  1NVP D;  3LUT B;  1NH2 D;  1O9H A;  2CTP A;  5B1O A;  1R3K C;  2GHY A;  1FXH A;  2UXD O;  4LF8 O;  4LNU B;  3TJT A;  1YIJ V;  5HFM A;  4FMT A;  2LW1 A;  3IC9 A;  2EIK C;  1P84 F;  4B7E A;  2A3Q A;  2N74 A;  3CRA A;  4L87 A;  1FXV A;  4JTA B;  5CBH A;  2AHZ A;  3WU2 Z;  1NBM G;  4EB6 A;  2ATK C;  1JQ0 A;  2XND G;  4UCO A;  3MHH C;  2K1E A;  3K79 A;  3ZS8 C;  1E79 G;  2ZKO A;  4FFB A;  3RVY A;  4B3T B;  1R1B A;  3ZHU A;  1ZX3 A;  1NS1 A;  5GTH Z;  1VQP V;  4RUF A;  2PZS A;  1KBH A;  1PL4 A;  3RYI B;  3E35 A;  3OTF A;  4P30 A;  3A0R A;  5A9G A;  3SPH A;  1YEW A;  2AXT Z;  3JAL A;  1F4M A;  2OWO A;  1IBL O;  4BIO A;  1PD3 A;  4X62 O;  1ROP A;  1GH6 A;  2PI4 A;  2EIJ C;  1GN3 A;  4YIO A;  2XAG A;  4FZ1 A;  5B66 Z;  2YUA A;  3QG5 A;  4ZIB A;  3DSQ A;  4LF5 O;  2DE0 X;  1MZF A;  5LXT B;  4LFB B;  3DC6 A;  1YTF D;  1K33 A;  2R72 A;  2YXH A;  4MW3 A;  3OD4 A;  2G38 A;  1K4C C;  3FFQ A;  1P4R A;  2ZT9 B;  3LNM B;  3OEE G;  4TWK A;  5K1X A;  4I7Z B;  3VQW A;  4H37 A;  5IT9 N;  5IJ0 A;  1M57 C;  1QVF U;  5KAF Z;  3GWK C;  2CTQ A;  4NXN B;  3CC7 V;  4DYL A;  2ZXW C;  1M4U A;  2QWO B;  2KSD A;  3RYF A;  3SYQ A;  3JAK A;  4I0X A;  3MD0 A;  1R6N A;  2UUB O;  2OIE A;  3AG4 B;  4F4L A;  2IJI A;  4WFE A;  1KKD A;  4J7K A;  1HNZ B;  1SA0 A;  2CUG A;  5LGU A;  4MTX A;  3SR2 C;  3CP1 A;  4J41 A;  3LSU A;  3RYC B;  1J5E O;  2Q5Z A;  4E4E A;  2F66 C;  4JI7 O;  3OGC C;  5H5N A;  2HKO A;  5IY5 C;  4B08 A;  3OEH G;  3ETD A;  3FKS G;  3UT5 B;  1PP9 H;  4FFB B;  3JD0 A;  2FL4 A;  1JFF B;  5IDJ A;  1BZK A;  2HFE C;  4CH3 A;  2KB1 A;  5LP6 A;  4LWS A;  1I5Y A;  4XBF A;  1KB9 F;  2GTS A;  5LMN O;  1Q82 W;  3CB2 A;  5BMV A;  3DGE A;  4IHJ B;  2W0X A;  1F7Y A;  1NR1 A;  1AR4 A;  1BHB A;  4J42 A;  4W4L A;  2UXC B;  3UO3 A;  2WLL B;  5FPR A;  1SZT A;  1G4Y B;  4X20 B;  4DV7 B;  4J9Y B;  1T5E A;  2HLD G;  4GZR B;  3ZIA G;  4U3F H;  4DUY O;  1M90 W;  4O2A A;  1VQK V;  1CPY A;  2KG7 B;  2O57 A;  4DR3 O;  2YID A;  1P7G A;  1M56 C;  1FXK A;  1AP6 A;  2B5U A;  3QO8 A;  4Z2W A;  5J2T A;  2JJ2 G;  1WNS A;  4LF7 B;  2Q4P A;  3O9O A;  2AHY A;  5EIB D;  4J9Z B;  4ZHQ B;  1Q6U A;  3I56 V;  1UPG A;  1MAB G;  5CA3 A;  1K5Q A;  4U7O A;  2DYS B;  2E75 B;  1XL6 A;  4MVS A;  3QVN A;  3JD2 A;  1VF6 C;  2RCV A;  1N4C A;  4UCT A;  2JDI G;  3JAT A;  1XRE A;  2XHB A;  3CCJ V;  4CC5 A;  3ICX A;  2L6L A;  3HKB A;  3ZMT A;  1XL4 A;  4HAM A;  4L8J A;  1SQG A;  3ZRV A;  3TXQ A;  5LGN A;  2JRI A;  5LGT A;  5E1A C;  4WBN A;  2UU9 O;  1KP3 A;  4ZOL A;  2Q8V A;  1NI8 A;  3CPW U;  2EX3 A;  1XMQ B;  4NTW A;  2OCH A;  4TSF G;  3G6B A;  5K1P A;  2YXY A;  2WAM A;  1QLE C;  4O4L A;  4X66 B;  4GKK O;  2AZ2 A;  1JMK C;  4O4H B;  5KMG A;  1K8A W;  3KG2 A;  2E74 B;  2ZM6 B;  5C8Y A;  3VQY A;  3CCE V;  3FB8 C;  4KP4 A;  4IT5 A;  1ZTE A;  4C7U A;  1RP3 B;  1QNM A;  2UXB O;  1R3I C;  4PJ0 Z;  2R9I A;  3OUS A;  5LMU B;  4JAA A;  4DK0 A;  3RT3 C;  2XUM A;  1FS0 G;  3JD3 A;  1IBM O;  1GMG A;  1PV0 A;  1WLE A;  4QGP A;  4ZI7 A;  2JGD B;  2FYU H;  4X64 O;  1SC5 B;  4AIL C;  1K9M W;  2FTK A;  1X59 A;  1K3E A;  4PD4 F;  1HNX B;  3ZJZ A;  1EZV H;  4O4I A;  1SS3 A;  3BVO A;  4YHH B;  2QWQ B;  4CS3 A;  1IXM A;  4CC6 A;  4PA9 A;  2CDY A;  5L3G A;  5HFL A;  4D7T A;  2QM8 A;  2WLI A;  3CSX A;  3BAB A;  2EIN B;  1FFT B;  5D5Q A;  1JX9 A;  1Y74 B;  3TGU H;  2VRZ A;  5LBQ A;  4UCU A;  4OXS A;  1R6T A;  1IBK O;  2E5L B;  4DR2 B;  4DV1 B;  4LFA B;  2HVJ C;  4K35 A;  4J80 A;  1H2K A;  1TUE B;  2DMX A;  4JGS A;  1N32 B;  2MW2 B;  1XOU A;  3T1Y B;  1P7B A;  4LF4 B;  4JTD B;  2Y0I A;  2QM4 A;  2YEV B;  1M9N A;  2H3O A;  4A5U B;  3M7M X;  1NZ6 A;  3E83 A;  3ASN B;  3FYI B;  1VQL V;  1JCH A;  1OCZ C;  1I94 O;  3ZCC A;  1BCC H;  2PI5 A;  1LUW A;  4LC1 A;  4PI2 A;  3D3Q A;  1MOF A;  1VQ4 V;  3JAM N;  1V54 B;  4PDM A;  4EFB A;  2JIZ G;  2V4D A;  1HDJ A;  4X88 A;  2LGW A;  1OJH A;  1PM9 A;  3K0D A;  2H8P C;  4QE7 A;  3RYH A;  3HPL C;  4GX5 A;  1ZL8 A;  2WA4 A;  1AI4 A;  2GBO A;  1VIB A;  2EIK B;  1M93 A;  4FFK A;  5D5P A;  3KZI Z;  5JJE B;  1B04 A;  3L72 H;  3TK1 A;  4O4I B;  4PA3 A;  2XAS A;  5BR8 B;  2UXX A;  2VQE B;  2B1G A;  3JAW A;  4YJ3 A;  2ZE7 A;  4I9W A;  3OTO O;  3OGI B;  5J9P C;  2W0F C;  1FJG O;  2ADQ B;  4UUJ C;  1S5L Z;  1HR0 O;  1CXZ B;  4MSW C;  3IGA C;  2OIG A;  1JJ2 U;  4OPA A;  1K7D A;  4RQF A;  4QPJ A;  2D2C B;  3NXS A;  3PN1 A;  1N8R W;  3DXR B;  4RO2 A;  1LNQ A;  1W0J G;  4DR1 B;  1SF9 A;  3WG7 B;  4FLY A;  3U10 A;  2WSS G;  3ABM C;  1U97 A;  2ILM A;  3W7X A;  4WCE V;  3ZHT A;  2DYR C;  1KMI Z;  4FK5 C;  3JSL A;  1P49 A;  1BQ0 A;  4U3J B;  4KUM A;  4NXM B;  5EIB C;  3ML0 A;  4DV7 O;  1H8E G;  4O4J B;  4UCV A;  3U0Z A;  1PL0 A;  2YC0 A;  4JF3 A;  1JR9 A;  3AG2 B;  1W0K G;  4PEL A;  5KA6 A;  4KL1 A;  3T2M A;  4GX2 A;  4DV5 O;  1MG1 A;  1W59 A;  3FD9 A;  2ZNI A;  2NN4 A;  3ABK B;  2QKS A;  1H2S B;  2ZXW B;  4AQY B;  2QTO A;  1BGY H;  4UFZ A;  3AG1 C;  3K04 A;  1EN4 A;  1HW7 A;  2BOB C;  4EFE A;  2P90 A;  3X2Q C;  1BHA A;  4RAI A;  1YJ9 V;  1NTK H;  4NKG B;  1TGO A;  2YDE A;  3HB3 B;  4IL6 Z;  2OCC B;  2HEP A;  2JGU A;  3FAV A;  2PGG A;  4ICG A;  1VF6 A;  4DV4 B;  2P67 A;  2QR4 A;  3QNE A;  3MHS C;  1B6Q A;  3L9D A;  4UB6 Z;  4JZG A;  5H6Q A;  4WFB V;  4B3R O;  2CE4 A;  1MZE A;  4FJC C;  4FVM A;  1SZX A;  2R70 A;  1AJN A;  5IY5 B;  4MVZ A;  1FPO A;  4FLZ A;  1KKC A;  2V1D A;  1AJQ A;  3ZRW B;  3M8A A;  2YIA A;  4MVO A;  1EM1 A;  2A9H A;  1I5X A;  3B2E E;  4FLV A;  1MMM A;  1NJI W;  3D3I A;  4GCZ A;  3ZMZ A;  5CB4 A;  4X66 O;  4YJ2 B;  1G1X B;  4G28 B;  1WP7 A;  3CME V;  2GTA A;  3T1H O;  2CTW A;  3BEH A;  3G6E V;  4LF9 O;  1Y6X A;  1ZLZ A;  3I5D A;  1TVK A;  1AR5 A;  1ZAU A;  2LO1 A;  5JCO C;  1YVW A;  2RJZ A;  5JVD A;  1GM8 A;  3SJA C;  1UJW B;  5CA0 B;  4DR4 B;  4DR5 B;  1VMG A;  4QPK A;  4PDV A;  4RUE A;  5IYB O;  1WB7 A;  1N36 B;  2UUA B;  1QHT A;  1M56 B;  4JI1 B;  1JJO A;  3DC5 A;  5CA1 A;  3MDS A;  4DV0 B;  4QE9 A;  1H38 A;  4BAY A; 
#chains in the Genus database with same CATH homology
 2QWP B;  2YUA A;  1BQZ A;  1NZ6 A;  2CTQ A;  1WJZ A;  1N4C A;  2EJ7 A;  1HDJ A;  2OCH A;  2LGW A;  2GUZ A;  2GUZ B;  2QWR B;  3BVO A;  3UO2 A;  1FAF A;  2PF4 E;  2QWQ B;  2QWO B;  2M6Y A;  4J80 A;  2N05 A;  1FPO A;  2DMX A;  2CTP A;  2L6L A;  2YS8 A;  3AG7 A;  2Y4T A;  2QWN B;  2CTW A;  1XBL A;  3UO3 A;  3APQ A;  1GH6 A;  2QSA A;  2Y4U A;  3UCS C;  1BQ0 A;  2KQX A;  4IT5 A;  4J7Z A;  3APO A;  2DN9 A;  1IUR A;  2CTR A;  2CUG A;  4RWU A;  2LO1 A;  2N04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...