3AG7A

An auxilin-like j-domain containing protein, jac1 j-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
GPLGSEEIKNIDAKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGASANQKYMAEKVFELLQEAWDHFNTLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords Putative uncharacterized protein F9E10.5
publication title Crystallographic and functional analyses of J-domain of JAC1 essential for chloroplast photorelocation movement in Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3ag7A00
2CTRA 2CTQA 2L6LA 2QWRB 2Y4UA 1N4CA 1FPOA 2DMXA 2M6YA 4RWUA 2N04A 2KQXA 2YS8A 2QSAA 2YUAA 2PF4E 1WJZA 2GUZA 4IT5A 2QWNB 1XBLA 3UO3A 2QWOB 2QWPB 1BQ0A 1FAFA 3APQA 2GUZB 2N05A 3UCSC 3UO2A 2OCHA 1GH6A 1NZ6A 2LO1A 3BVOA 2QWQB 3AG7A 2CUGA 2CTPA 2Y4TA 2EJ7A 3APOA 2DN9A 1BQZA 1HDJA 4J80A 2LGWA 2CTWA 1IURA 4J7ZA
chains in the Genus database with same CATH superfamily
3ZHUA 3DSQA 4JI5O 1LNQA 2QSAA 1ZTEA 5IY5B 3ZS8C 2E5LB 2JJ1G 4LF7O 3O9OA 1KYOF 2E75B 4GLXA 2ZR3A 2VQEO 4CH5A 3NR7A 2HFEC 1IURA 5FPRA 4LNUA 3IC9A 3K03A 3CSXA 1GK9A 1DGSA 3OD4A 2RNBA 3CRMA 2ZIOA 4MVSA 2YIDA 3UCSC 1EBOA 3ABKC 4U7OA 4R8CA 1BZKA 2Y69B 5LP6A 4YIPA 5L3DA 2XAFA 1HR0B 4DV4O 4LFAB 3ASOB 3K59A 1JJ2U 2UUBO 1NBMG 1VQMV 5H6RA 4GZRB 1V54B 5HFLA 1VARA 2IW5A 4O2BA 5JQGB 1WB7A 3STZC 1MMMA 1OZ0A 4JYAO 3SPIA 2Q7EA 1TUEB 5LA6A 2PY5A 4O4JA 1XOUA 5IY5C 1GRJA 1QLEB 5FNVB 2XAJA 3ZRXA 2P6JA 2Q4PA 2DWEC 1XMOB 1AP5A 4ABMA 4LP8A 4X9QA 2F66C 2IJJA 1E1RG 5EIBC 4JI6O 4DR2O 4LCUC 2DN9A 1TAEA 1F51A 1I94O 1TUBA 5IDJA 4YJ2B 2GHYA 3CRRA 2IBZH 5LYJA 5E1AC 4HNAA 2HHHO 4JYYA 1HWYA 2ITDC 3IJ4A 4TV8B 5LGTA 3QVNA 3ASOC 2E5LO 2HR3A 4FVMA 2DQ3A 5EC2C 5K1PA 2YEVB 2JS3A 4NB5A 4J10A 1V54C 1PNMA 5B1AB 1XEQA 4CZZA 3ETQA 1WPBA 4YXWG 1MOFA 5CBHA 4I9QA 4QPJA 4B3MO 4DV6O 1IBKB 1QLEC 3G80A 2YXHA 1JX9A 2A79B 3RGBA 3ZBHA 3IGAC 1Z2GA 2DMXA 1XHXA 3U10A 4I0XA 1N36B 3D36C 3SYAA 4LWSA 4O4IB 5DEDA 1HDJA 5H9CA 5CBFA 2UU9B 4DK1A 3K9AA 2EZOA 1VQ9V 4UCRA 3H1HH 1S77D 4I4TB 3AG1B 4UVBA 4K8XA 2QWNB 4MVUA 1XMOO 3CMAV 3CC2V 3RYCA 4E4EA 5B1AC 1IBMB 5IJ9A 1M57B 4FLTA 3OGIB 4FFBB 4WFHA 3ZHQA 5F2VO 3T1HB 1WA8A 1FXHA 4NTWA 4BIZA 3SYPA 3RT3C 1Y76A 5KX5B 2Q9LA 5EYPB 4GKKB 1HNWB 2AW9A 5KMGB 3DGEA 2WA4A 1VQNV 3MD0A 4LBEC 4IYHA 4MVMA 2N05A 2UXBO 3PJSK 3X2QC 3CCUV 5FPOA 2HJFC 4WFBV 2OT5A 2PZSA 5DM6V 4PDVA 4TWKA 1SETA 2BOCC 1XL6A 1JMKC 2JDIG 3L74H 1OV9A 2LQTA 2UUAO 1I7FA 1COWG 4PI2A 1SA0B 1MNGA 3JALB 2MW2B 1G1XB 1QQCA 3K06A 2HJDA 4J7JA 2E74B 3VBBA 2UXCB 1NZ6A 1VF7A 2R9IA 4PDRA 3AG1C 5J2UB 4DO2A 3STLC 4OX9O 2X7RB 3JASB 1NKDA 2KB1A 2PUSA 3CYOA 3VOUA 1K5SA 3RVYA 2YSUB 2RDCA 5JJEB 1Q7YW 1ZX3A 5IJ0A 4DR6O 4TT3G 1MG1A 2B1IA 2F23A 1PNKA 3B77A 3J81N 2V4DA 2VWKA 2GTSA 2X6CA 4FIPC 2EX3A 5C8YB 1GO3F 3HKBA 2OIEA 3K0DA 3WB1A 2ZNIA 3TK1A 1TGOA 4J80A 4FLWA 5BMVA 2Q73A 5IYZA 2KQXA 1OCZB 3M8AA 1OCCB 4KHPO 4FMTA 4MTFA 2YDEA 3G6BA 2HVKC 1FXKC 2UXDO 2VQFB 4DW0A 4EKWA 1AILA 1L0LH 4O4JB 5BR8B 1GTOA 1FJGO 4UCTA 3G4SV 1KD1W 4DV7B 4GKKO 2PTMA 1M1KW 2E3CA 4EEQA 2LJ2A 3ETDA 5LMUB 1B3QA 2IJKA 1XNRB 5KHKA 4QE7A 3LDEA 3OTFA 2JRIA 2ZCEA 1IVSA 3W7XA 4U3JA 1NU1H 2FKXA 4X88A 3Q4HB 3IC7A 4HNAB 4PI0A 3S3XA 1YEWA 4UB8Z 3UO2A 1N0NA 3SYQA 4DRXA 3F7VC 4FJCC 1BCCH 2CH7A 3FB7C 1J95A 2EILC 4WF9V 1IXMA 1N34O 1OCZC 3BHPA 1OCCC 2R9RB 2IU0A 2CGOA 2WLLA 2M6YA 2JK5C 4O4LB 4WBNB 3HKEA 2PGGA 1FFTB 3SGIA 3PN1A 4EFBA 3H1LH 2N74A 4TOIA 2PYJA 1AI6A 3SJCC 3L9DA 4CH6A 2DOSA 3CMEV 2P90A 2JEUA 4JI4B 1LUWA 1OCOB 1NVPD 1VMGA 2QM8A 4IL6Z 2QEXV 3CRCA 3JAKA 4J7ZA 1SQXH 4MVQA 3TXQA 4N23A 2EIJB 3FAVB 1L1FA 5TISZ 5A2QN 3AEIA 4DR4O 4K0KO 1X4TA 4NXMB 2ZM6O 1KKDA 4D6TH 3JAWA 3CS5A 3TETA 2FMLA 4CS4A 3OE7G 3QTCA 5LMNO 4WFFA 1S5JA 3ZRWA 4I50A 1NVPB 3K5MA 1O9GA 4WFEA 3SJQC 2JGUA 3ZMZA 2RMKB 1XREA 4PJ0Z 3AK2A 5CA0B 3OR7C 4Q6GA 4JI5B 2QM7A 4UCSA 5LMUO 1IBLB 3K79A 1D2DA 2CTQA 4H0LB 3RYIA 4PELA 1GN3A 2XASA 1PV0A 4LF7B 5ITZB 1SS3A 1MZFA 1OCOC 2ZXWB 1DF4A 1P7BA 4KFMA 4MT8A 2WLNA 2WLIA 2VQEB 3L71H 1B04A 2EIJC 4AHCA 3OAAG 3OM3B 1SRYA 1WB8A 2Q5ZA 4JZ2A 3VQWA 2OCCC 1QVFU 3JATB 4W4KA 2GSMB 5KA5A 4X89A 1RM1B 5KUKA 4TUYB 2XUMA 4F6RA 1PP9H 4DR7O 2GDSA 4PDLA 4DV4B 1CXZB 1NI8A 3D8CA 5DECA 1VQ4V 3M7MX 2UUBB 1AVMA 4O4HA 3BY6A 3CRQA 2P22C 1KB9F 3L70H 1IZ3A 2YIAA 2ZR2A 2Q0AA 3JCUZ 2F93B 2Z5UA 3AG4B 3K3WA 5IJ0B 4J9YB 4JYAB 1KBHA 3K9SA 5JVDB 1AJQA 1Q90D 4TV9A 1O9HA 2KG7A 3EFFK 1R6NA 2LGWA 3RN4A 1BT8A 2FTKA 2WSSG 2AZ0A 4JPRA 2ZXWC 3HKCA 3FB5C 3H9VA 2ZE6A 3QO8A 1Q6IA 2W0FC 4UCOA 4TQFA 4ZHQA 1Q3EA 3OMAB 4JI6B 4DR2B 3TCUA 1V55B 3N2GB 1AP6A 5CB4A 5KAIZ 1I94B 1RM1C 2IJHA 4QE9A 3RYHA 1GKFA 2XNDG 3P30A 2HHHB 4X20B 4YY3B 2Y4UA 5KUMA 3KZIZ 1XQ8A 4K8ZA 3JARA 3OMIB 2JGDB 1IBLO 2HKOA 4RQFA 3DC6A 2VWJA 1VEWA 3BFRA 4QNHB 4I7ZB 3WU2Z 3IFXA 3H1JH 3DXRA 3G67A 4IHJA 2QTOA 5KAFZ 3AG4C 1JVMA 4KUMA 5KA6A 4L87A 2GV9A 5B1NA 1YITV 3BA9A 1YF2A 1GN6A 2IU3A 3CWBH 4B3MB 4GT1A 4DV6B 1B6QA 1G4YB 2A7WA 3FFQA 4X62O 3L72H 1Y74B 3CCEV 4GYCB 4LFBO 4R50A 1K9MW 4DUZO 4NXNO 3I56V 1JQ0A 2NLJC 3SYCA 2ZE5A 2CTWA 2Y0PA 2R9AA 3QO7A 4QPKA 1V55C 4K35A 2A06H 3HKDA 1AR4A 3P32A 4B3RO 2Q68A 2OTLV 1YXBA 2K9PA 4JYCA 3QG5A 2KKWA 3C3SA 4O2AA 1LR1A 1VQ6V 1VQ5V 4JI3O 4FM0A 1U96A 4FLVA 1HNXO 1IX9A 4J41A 4LC1A 2P06A 1FFXB 3ICXA 2WLKA 2LFSA 2L6LA 4Z1MG 4DV3O 1MABG 4J9ZB 2XAGA 1WJZA 4GUNA 3UO3A 5B66Z 2OTJV 3GVMA 3E22B 4JYBA 1N8RW 3JD1A 3CPWU 1SERA 4IIJB 2WA3A 2LFRA 4ASUG 1HNZO 1F4NA 4MTXA 4WFAV 5H6QA 4YJ3B 1XDCA 4UFZA 1N4CA 3E2EA 5JCOC 4AILC 1QR8A 2UXBB 4YY3O 1QCEA 4E2LA 4ZI7A 1FKAO 5AG2A 2F1MA 2BTQA 1D5AA 1XMQO 1IXBA 5LHGA 3TJTA 1GM9A 2JJ2G 3APOA 2UUAB 3WB2A 4PA9A 2LP7A 5GW7A 5KHHA 2IM9A 1RSOA 2BCCH 5KLVH 1ROPA 1AR1B 1W59A 2DE0X 4FZ0A 1H8HG 4KXRA 2ZQMA 3N2KA 4OX9B 5D5QA 5JH7A 1XL4A 1YI2V 3X2QB 4DR6B 4PA4A 2HG5C 4X1IA 1S5LZ 4WCEV 1VIBA 1S5HC 2R70A 2WLMA 3B8MA 2Z0AA 1NR7A 5GONB 4UB6Z 3OUFA 3CCQV 1MA1A 2YIBA 3E8GA 2FL4A 4X1YB 3UT5B 3K08A 2X6BA 5KHGA 3CX5F 4FLYA 4KHPB 1J5EO 4B08A 2QKSA 3AG3C 3A8TA 3SPJA 4I55A 2UXDB 1R6KA 1H8EG 1XI1A 3LSQA 3M99B 4AQYB 2QTSA 5EC1C 1S0VA 3P3NA 1FJGB 5EBLC 4GX5A 3HKCB 3WB0A 1SESA 4NVPA 2XOKG 3AG2C 4RUEA 2FB5A 1TA8A 3CXCU 1KC8W 5CN0A 4BAYA 3FX7A 2KSDA 4YHHB 1M90W 4GKJO 2Q0OC 5J9PC 2UXXA 4J42A 4HZ3A 1K7DA 4JTDB 1R6TA 2XAHA 3THOA 2Q69A 4X1KB 4GX2A 4PA7A 4DUYO 3MHHC 2EIKB 1UJWB 3SJAC 1JFFB 1FXKB 1Q6UA 4LF4O 2EJRA 4C7UA 5BXZA 5CA1A 3OGCC 3LDCA 1TVKA 1SF9A 1FYJA 1KKCA 4B3TO 3FD9A 3JD2A 2ZD9A 2VRZA 1N34B 5L3EA 4A5UB 2ZNJA 3AK1A 1JPXA 3EVKA 1PL0A 4DV5B 4LH7A 3MHSC 4LNUB 1EFRG 1PKXA 2PI5A 2QR4A 3UKMA 5E79Z 1K4CC 3C3TA 4JI1O 2ATKC 1WP8A 1BGYH 3SYOA 5LP6B 1UPGA 1NJIW 3E35A 4TQDA 4DR4B 4K0KB 4MW8A 1VP7A 1FD9A 2B9ZA 2EILB 2GBOA 2ZM6B 3ZRVA 2NNUA 1BHBA 4CBCA 2EIKC 1ZL8A 4O2BB 2EJ7A 5LMNB 1BQZA 4D7TA 4O2AB 4AI8A 4EB6A 1N33O 1H2MA 4UCUA 2YI8A 3DTUB 5LA6B 1GN2A 2A0LA 5CBGA 5JJNB 4AQYO 5LGNA 2AXTZ 4BR6A 1SQVH 2Q8VA 4ZOLA 2ODMA 4UVAA 1GAXA 3I55V 2ILMA 3ZN1A 4LFCO 1D5NA 5IYCO 2DYSB 3L73H 4YHHO 3OT7A 1SZXA 2EIMB 4F4LA 1M9NA 1V9PA 2H3OA 3K5NA 1K92A 2PI4A 1S72V 1K33A 4JI0O 3HB3B 2YUAA 1TUBB 3CCRV 1NS1A 4U3FH 5LYJB 3OFNG 3QNEA 3CCSV 3W7SA 1VF6A 3K0GA 4CC5A 3ZCCA 5LP6C 1BMFG 1BS3A 3ZRSA 4PHZA 3F5TA 3UQ8A 5IE9A 3OMNB 2QWRB 3K04A 1YIJV 4QJFB 4X65O 3ZJZA 2HLDG 2ZINA 5JWPA 1RSOB 2Z3YA 4DV5O 3JCZA 4DV0O 3LUTB 4DR7B 1P4RA 3SDLA 2QA4V 4YIOA 1SQBH 1I08A 1AI4A 1NTMH 1CEZA 5DN6G 1GM8A 1A32A 1HW7A 5JH7B 4H33A 2B5UA 1L8DA 5JQGA 2DYSC 2QWOB 1X59A 3APQA 2D3OW 3IAYA 2EIMC 1E1QG 1ZWIC 3E8HA 4P2ZA 1VQOV 2OCCB 2ITCC 2Y0IA 2QWQB 5FNVA 4DV2O 3CC4V 1FXVA 2RQ6A 1K8AW 4I0XB 3A0BZ 1L0NH 3ASNB 4LWSB 3G6EV 4P30A 3CC7V 4G2KA 5B3SB 2F4VO 3ZMSA 2XTAA 4ZBMA 4QIWF 4DXWA 3A2FA 3EHBB 3GWOA 3RYCB 3D36A 1JOYA 4NTYA 4YJ2A 5IYBO 5IJ9B 1WA8B 3JSNA 4DYLA 5B1BB 5D5PA 3D3IA 1Y76B 3SPCA 4TV8A 3W7UA 3ETGA 1QLNA 1VQ7V 1K34A 1NR1A 5BY1A 2X6AA 2YEVA 1Q82W 3OW2U 4PA6A 3LDDA 3ABUA 2RJZA 2CGNA 4W4LA 3UM7A 4I5SA 5B5EZ 2WLJA 4X64O 3ZX6A 2QKCA 4X66B 3CJHA 2WLHA 2ZE7A 2DJVA 5FLXN 2A3QA 1WLEA 4X62B 3CCJV 3ASNC 2P4KA 4LFBB 1GH6A 1US6A 4DUZB 4NXNB 3JSLA 5B3SC 2YXLA 2VS0A 5JJJB 5L3BA 3CCVV 3BRCA 3ZMVA 2QM4A 3LNMB 3J80N 2IH3C 4HAMA 1I5YA 2LGQA 2EBOA 2UXNA 4RWUA 2N04A 4B3RB 3BAAA 2Q7HA 3CCMV 2PYLA 2UUCB 2JVDA 4O4IA 1ZLZA 4JI3B 4OXSA 2G38A 5B1BC 1M56B 3A0HZ 4MTGA 4XBFA 1HNXB 1H38A 2X0LA 5GTHZ 3RBZA 3BABA 4I4TA 4DV3B 3HKBB 3D3QA 5EZYA 1FPOA 4J11A 1E79G 4UVCA 3ZHVA 4LF9O 5BMVB 4JV5O 3OTOB 1VQ8V 4DR3O 5IYZB 1XUQA 4FFBA 3WFVA 1ENVA 1HNZB 3TXSA 1EZJA 2CTPA 4X8AA 1DK1A 5KX5A 3B40A 5EYPA 4Q20A 3CB2A 2JIZG 4XDKA 1AI5A 3E89A 5HFMA 5KMGA 4UCVA 3FYEB 4LF8O 2XHBA 4NYKA 1N32O 1KP2A 1P7GA 4RAIA 1XBLA 1XMQB 2DWDC 1FAFA 3K57A 4XDLA 4MVOA 1PL4A 1I5XA 1DTOA 3R65A 5EIBD 1YHQV 3E83A 1I0HA 1SQGA 1SA0A 1WAZA 3JALA 1MSWD 2BOBC 1SQQH 1WN7A 1W0KG 2RN9A 4RUFA 1Q5OA 1M56C 1HP8A 4U3JB 3CXHF 2QKAA 4X66O 1XNQO 1B06A 2CE4A 5EBMC 1EN4A 5J2UA 4UV9A 4FK5C 4PV1B 3JASA 5L3FA 4JI2O 1KQSU 1N0JA 1NH2D 4DRXB 1R1BA 4I9WA 5IT9N 2CH7B 4DV1O 1VQPV 4FZ1A 2FYUH 2Q7GA 1R3LC 2E76B 2XT9A 1P84F 2WLLB 3VQVA 2P67A 4U7NA 3DC5A 5C8YA 2WWWA 5EBWC 3HKEB 4H37A 1H2GA 4G27B 1DF5A 2CUGA 2UUCO 2Y4TA 2W0XA 2QE7G 1WNSA 4NKGB 1AJNA 4JASA 3CE2A 2ZDIA 4JI8O 1NH2B 4BW5A 4XDJA 1J5EB 5IWAO 4B7EA 1OHHG 3JAKB 3L75H 1Z5VA 2LW7A 3E8FA 5EK0A 1ZUQA 2ZE8A 3OTOO 4UXNA 3ML0A 2HVJC 1Q43A 3CD6V 1T5EA 2R72A 1VQLV 3JAWB 1Q8IA 5H5NA 2B1GA 1JR9A 1Q86W 2W6JG 1MZEA 3ZRWB 4CC6A 4I50B 1VF6C 2CAZC 4GKJB 5GTIZ 4UV8A 3NXSA 1MSDA 2NR5A 4JI7O 4K3AA 4RQEA 2OYQA 1Y6XA 4QGPA 4DUYB 3AG3B 3Q4HA 1KU9A 4LF4B 2L35A 3BEHA 2Y69C 2GUZA 5K1XA 3RYIB 1ORQC 3JYCA 4NR1A 4B3TB 5A9GA 2O57A 2WAMA 4JTCB 4NTXA 1NT2B 2YI9A 3AG2B 2WLIB 3I5DA 3H01A 1R3IC 4CS2A 4O4LA 4LR3A 4WBNA 1RP3B 4HYOA 1AR5A 2F43G 3B09A 4MSWC 4LF6B 3K58A 4HBNA 3H1KH 1QHTA 3CJHB 3G71V 4JI1B 4BIUA 4FPPA 3T4DA 3FB8C 3LSUA 2P4VA 4JAAA 1YSCA 4F6RB 1PD3A 2M7WA 3FAVA 4ZIBA 1HR0O 1JA8A 4LFAO 4O4HB 3N27A 3KKYA 2CDYA 1F7YA 3E8BA 3HR0A 5J2TA 1CPYA 4JF3A 1RFYA 2ADQB 1Z5WA 1W2BU 3H1IH 2LW1A 3ZHTA 4FLZA 2GTAA 1Y67A 4BIOA 5LBQA 1N33B 2YC0A 3T1CA 1K5QA 1SQPH 4TV9B 2KG7B 1YDXA 4JGSA 3CRAA 5EZYB 1EZVH 4DK0A 4J7KA 2QWPB 5CA0A 5H2FZ 3ABMB 1VF5B 1KECA 4LFCB 1WPXA 1DLBA 3W7TA 2BSKA 1VQKV 4B3SB 2LO1A 1JJOA 4ZHQB 3RYFA 2QJ1A 1AB3A 2Y48A 4JI0B 5CB4B 5ITZA 2ZKOA 1PNLA 1K97A 1JCHA 2PF4E 3RYHB 3K5LA 1F4MA 3QF7A 4R7CA 5LXTA 3JARB 1GN4A 4BW9A 3A0RA 3OR6C 1P49A 3U0ZA 4GCZA 3JATA 5LHIA 4X65B 3DXRB 3FB6C 4IHJB 3ZHRA 1SKVA 4LH6A 4IGGA 4TUYA 4DV0B 3RW0A 5LOVA 2HEPA 1GM7A 4LF6O 4DR1B 4Z2WA 4PD4F 1Q81W 1IBKO 3ZN0A 3W7WA 2AHYA 3R66A 2BE3A 1NTZH 4CH3A 4UUJC 3ABMC 2NN4A 5LL6Y 4H13B 1XILA 2JEXA 1M57C 1Q6HA 3AK3A 3SPHA 5CMUA 1SC5B 4KL1A 3MDSA 5JVDA 1BQ0A 4DV2B 3HKDB 5LHHA 3JAMN 5CA3A 2P5OA 1N36O 1GMGA 4H44B 4MW3A 3ZEDA 3OUSA 2F4VB 1UFIA 1RPOA 4P9PA 2UU9O 3CHXA 3EXAA 4ZKIA 1R3JC 1YZBA 3J7AU 1EM1A 3N2GA 1K73W 1K4DC 1F23A 3KCYA 3BA8A 1BE3H 1U97A 5L3CA 1CP9A 4JZGA 3RWRD 2IJIA 3AG7A 3B2EE 1IBMO 3FKSG 4R6ZA 4X20A 4B3SO 4DW1A 3T1HO 5L3GA 3WG7B 2YXYA 2JGDA 4PA3A 2ARHA 1W0JG 4FM1A 3KCXA 3B8NA 3LSSA 1SQFA 3SJBC 4DR5B 1OCRB 4JAVA 3F7YC 1HNWO 1LUVA 1G6UA 2WPDG 3ETEA 3RFRA 4ZI7B 1Y4MA 1URFA 3CEIA 4B7KA 2V1DA 3E86A 1YVWA 5C93A 2BTQB 1M5IA 2AZ2A 4X64B 2D2CB 3GB7C 1PPJH 1S76D 4KP4A 1S3JA 4FLXA 3O65A 2RCVA 4D7SA 3LNNA 1AJPA 3F5WC 5JCOA 4IYIA 1Y74A 4G28B 2GUZB 2EULA 3K5OA 2C2AA 2P7TC 2MK3A 2YIBD 4MTOA 4TSFG 2BTOA 2ZDIC 4DR1O 1QU7A 2F95B 2UXCO 3N2KB 3JD4A 3RVZA 3T2MA 3BCCH 4Z1VA 3QO5A 2HP8A 5KHJA 1NTKH 1K3EA 4X1IB 4FFKA 2XAQA 3WG7C 2OCHA 3CCLV 4OPAA 3CP1A 1FFXA 1OCRC 3ABLB 1KUQA 1PM9A 1M4UA 4LF9B 4JV5B 4DR3B 3E22A 4LF5B 3JD3A 3T1YB 1AI7A 4IIJA 4JAUA 2DYRB 5IYDO 5J2TB 2QDOA 4FLUA 5KHIA 4YJ3A 2H94A 4I55B 4ICGA 2EZPA 4CH4A 4MS2A 1M93A 4LF8B 1N32B 1FS0G 2ETNA 2VQFO 4OPHA 3ZMUA 4EFEA 1H2NA 1NQTA 3OEHG 1BHAA 2A9HA 3MAQA 5BR8O 1EN5A 1XHZA 4DV7O 4RO2A 2H8PC 4DR5O 1QR9A 3BVOA 1H2LA 2EINB 1RPRA 2ZT9B 1H2SB 2V7QG 2BSKB 2AHZA 1BL8A 3HPLC 4PDMA 2AGAA 3RYFB 1XNRO 4P9OA 3KG2A 1XNQB 2Q6AA 2W6IG 2K1EA 1YJ9V 3ZHSA 5FL7G 4JI2B 3ABLC 3BPZA 2Q67A 5LXTB 3B4SA 5CA1B 1TVKB 4DV1B 1SZTA 2QGNA 1KMIZ 1QVGU 1EN6A 3ZMTA 3TGUH 4CS3A 3U11A 2DYRC 2CTRA 1KP3A 3C90A 4IT5A 5GONA 2DQ0A 3ZIAG 2JS5A 3FYIB 4JTAB 4MVZA 3JD0A 4X1YA 5LOVB 3UT5A 2YICA 2ADPA 3SR2C 1QBZA 3SPGA 1R3KC 4JI8B 2ZIMA 4JI4O 5IWAB 1YTFD 3GWKC 1BSMA 3T4ZA 3S3WA 1YJNV 2EINC 4OGQB 4LF5O 1R73A 3T1YO 1H2KA 4NXMO 1THZA 1G8MA 1AROP 3ABKB 1ZL8B 3P3PA 2IH1C 5BZBA 3VQXA 4GX0A 1ZSPA 1OJHA 3OEEG 4L8JA 4GX1A 1WP7A 4MVRA 2YS8A 4EB6B 4FM2A 1YCIA 1YTFB 2CK3G 2DW4A 2OWOA 1IDSA 3ABTA 4BWAA 4JI7B 1ZAUA 1YJWV 4N21A 5LGUA 4F6EA 4ZOLB 4X1KA 3VQYA 1Y66A 5B1OA 2OIGA 4WFGA 1JFFA 1FXKA 1QNMA
chains in the Genus database with same CATH topology
2CTRA 2CTQA 2L6LA 2QWRB 2Y4UA 1N4CA 1FPOA 2DMXA 2M6YA 4RWUA 2N04A 2KQXA 2YS8A 2QSAA 2YUAA 2PF4E 1WJZA 2GUZA 4IT5A 2QWNB 1XBLA 3UO3A 2QWOB 2QWPB 1BQ0A 1FAFA 3APQA 2GUZB 2N05A 3UCSC 3UO2A 2OCHA 1GH6A 1NZ6A 2LO1A 3BVOA 2QWQB 3AG7A 2CUGA 2CTPA 2Y4TA 2EJ7A 3APOA 2DN9A 1BQZA 1HDJA 4J80A 2LGWA 2CTWA 1IURA 4J7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTR A;  2CTQ A;  2L6L A;  2QWR B;  2Y4U A;  1N4C A;  1FPO A;  2DMX A;  2M6Y A;  4RWU A;  2N04 A;  2KQX A;  2YS8 A;  2QSA A;  2YUA A;  2PF4 E;  1WJZ A;  2GUZ A;  4IT5 A;  2QWN B;  1XBL A;  3UO3 A;  2QWO B;  2QWP B;  1BQ0 A;  1FAF A;  3APQ A;  2GUZ B;  2N05 A;  3UCS C;  3UO2 A;  2OCH A;  1GH6 A;  1NZ6 A;  2LO1 A;  3BVO A;  2QWQ B;  3AG7 A;  2CUG A;  2CTP A;  2Y4T A;  2EJ7 A;  3APO A;  2DN9 A;  1BQZ A;  1HDJ A;  4J80 A;  2LGW A;  2CTW A;  1IUR A;  4J7Z A; 
#chains in the Genus database with same CATH topology
 3ZHU A;  3DSQ A;  4JI5 O;  1LNQ A;  2QSA A;  1ZTE A;  5IY5 B;  3ZS8 C;  2E5L B;  2JJ1 G;  4LF7 O;  3O9O A;  1KYO F;  2E75 B;  4GLX A;  2ZR3 A;  2VQE O;  4CH5 A;  3NR7 A;  2HFE C;  1IUR A;  5FPR A;  4LNU A;  3IC9 A;  3K03 A;  3CSX A;  1GK9 A;  1DGS A;  3OD4 A;  2RNB A;  3CRM A;  2ZIO A;  4MVS A;  2YID A;  3UCS C;  1EBO A;  3ABK C;  4U7O A;  4R8C A;  1BZK A;  2Y69 B;  5LP6 A;  4YIP A;  5L3D A;  2XAF A;  1HR0 B;  4DV4 O;  4LFA B;  3ASO B;  3K59 A;  1JJ2 U;  2UUB O;  1NBM G;  1VQM V;  5H6R A;  4GZR B;  1V54 B;  5HFL A;  1VAR A;  2IW5 A;  4O2B A;  5JQG B;  1WB7 A;  3STZ C;  1MMM A;  1OZ0 A;  4JYA O;  3SPI A;  2Q7E A;  1TUE B;  5LA6 A;  2PY5 A;  4O4J A;  1XOU A;  5IY5 C;  1GRJ A;  1QLE B;  5FNV B;  2XAJ A;  3ZRX A;  2P6J A;  2Q4P A;  2DWE C;  1XMO B;  1AP5 A;  4ABM A;  4LP8 A;  4X9Q A;  2F66 C;  2IJJ A;  1E1R G;  5EIB C;  4JI6 O;  4DR2 O;  4LCU C;  2DN9 A;  1TAE A;  1F51 A;  1I94 O;  1TUB A;  5IDJ A;  4YJ2 B;  2GHY A;  3CRR A;  2IBZ H;  5LYJ A;  5E1A C;  4HNA A;  2HHH O;  4JYY A;  1HWY A;  2ITD C;  3IJ4 A;  4TV8 B;  5LGT A;  3QVN A;  3ASO C;  2E5L O;  2HR3 A;  4FVM A;  2DQ3 A;  5EC2 C;  5K1P A;  2YEV B;  2JS3 A;  4NB5 A;  4J10 A;  1V54 C;  1PNM A;  5B1A B;  1XEQ A;  4CZZ A;  3ETQ A;  1WPB A;  4YXW G;  1MOF A;  5CBH A;  4I9Q A;  4QPJ A;  4B3M O;  4DV6 O;  1IBK B;  1QLE C;  3G80 A;  2YXH A;  1JX9 A;  2A79 B;  3RGB A;  3ZBH A;  3IGA C;  1Z2G A;  2DMX A;  1XHX A;  3U10 A;  4I0X A;  1N36 B;  3D36 C;  3SYA A;  4LWS A;  4O4I B;  5DED A;  1HDJ A;  5H9C A;  5CBF A;  2UU9 B;  4DK1 A;  3K9A A;  2EZO A;  1VQ9 V;  4UCR A;  3H1H H;  1S77 D;  4I4T B;  3AG1 B;  4UVB A;  4K8X A;  2QWN B;  4MVU A;  1XMO O;  3CMA V;  3CC2 V;  3RYC A;  4E4E A;  5B1A C;  1IBM B;  5IJ9 A;  1M57 B;  4FLT A;  3OGI B;  4FFB B;  4WFH A;  3ZHQ A;  5F2V O;  3T1H B;  1WA8 A;  1FXH A;  4NTW A;  4BIZ A;  3SYP A;  3RT3 C;  1Y76 A;  5KX5 B;  2Q9L A;  5EYP B;  4GKK B;  1HNW B;  2AW9 A;  5KMG B;  3DGE A;  2WA4 A;  1VQN V;  3MD0 A;  4LBE C;  4IYH A;  4MVM A;  2N05 A;  2UXB O;  3PJS K;  3X2Q C;  3CCU V;  5FPO A;  2HJF C;  4WFB V;  2OT5 A;  2PZS A;  5DM6 V;  4PDV A;  4TWK A;  1SET A;  2BOC C;  1XL6 A;  1JMK C;  2JDI G;  3L74 H;  1OV9 A;  2LQT A;  2UUA O;  1I7F A;  1COW G;  4PI2 A;  1SA0 B;  1MNG A;  3JAL B;  2MW2 B;  1G1X B;  1QQC A;  3K06 A;  2HJD A;  4J7J A;  2E74 B;  3VBB A;  2UXC B;  1NZ6 A;  1VF7 A;  2R9I A;  4PDR A;  3AG1 C;  5J2U B;  4DO2 A;  3STL C;  4OX9 O;  2X7R B;  3JAS B;  1NKD A;  2KB1 A;  2PUS A;  3CYO A;  3VOU A;  1K5S A;  3RVY A;  2YSU B;  2RDC A;  5JJE B;  1Q7Y W;  1ZX3 A;  5IJ0 A;  4DR6 O;  4TT3 G;  1MG1 A;  2B1I A;  2F23 A;  1PNK A;  3B77 A;  3J81 N;  2V4D A;  2VWK A;  2GTS A;  2X6C A;  4FIP C;  2EX3 A;  5C8Y B;  1GO3 F;  3HKB A;  2OIE A;  3K0D A;  3WB1 A;  2ZNI A;  3TK1 A;  1TGO A;  4J80 A;  4FLW A;  5BMV A;  2Q73 A;  5IYZ A;  2KQX A;  1OCZ B;  3M8A A;  1OCC B;  4KHP O;  4FMT A;  4MTF A;  2YDE A;  3G6B A;  2HVK C;  1FXK C;  2UXD O;  2VQF B;  4DW0 A;  4EKW A;  1AIL A;  1L0L H;  4O4J B;  5BR8 B;  1GTO A;  1FJG O;  4UCT A;  3G4S V;  1KD1 W;  4DV7 B;  4GKK O;  2PTM A;  1M1K W;  2E3C A;  4EEQ A;  2LJ2 A;  3ETD A;  5LMU B;  1B3Q A;  2IJK A;  1XNR B;  5KHK A;  4QE7 A;  3LDE A;  3OTF A;  2JRI A;  2ZCE A;  1IVS A;  3W7X A;  4U3J A;  1NU1 H;  2FKX A;  4X88 A;  3Q4H B;  3IC7 A;  4HNA B;  4PI0 A;  3S3X A;  1YEW A;  4UB8 Z;  3UO2 A;  1N0N A;  3SYQ A;  4DRX A;  3F7V C;  4FJC C;  1BCC H;  2CH7 A;  3FB7 C;  1J95 A;  2EIL C;  4WF9 V;  1IXM A;  1N34 O;  1OCZ C;  3BHP A;  1OCC C;  2R9R B;  2IU0 A;  2CGO A;  2WLL A;  2M6Y A;  2JK5 C;  4O4L B;  4WBN B;  3HKE A;  2PGG A;  1FFT B;  3SGI A;  3PN1 A;  4EFB A;  3H1L H;  2N74 A;  4TOI A;  2PYJ A;  1AI6 A;  3SJC C;  3L9D A;  4CH6 A;  2DOS A;  3CME V;  2P90 A;  2JEU A;  4JI4 B;  1LUW A;  1OCO B;  1NVP D;  1VMG A;  2QM8 A;  4IL6 Z;  2QEX V;  3CRC A;  3JAK A;  4J7Z A;  1SQX H;  4MVQ A;  3TXQ A;  4N23 A;  2EIJ B;  3FAV B;  1L1F A;  5TIS Z;  5A2Q N;  3AEI A;  4DR4 O;  4K0K O;  1X4T A;  4NXM B;  2ZM6 O;  1KKD A;  4D6T H;  3JAW A;  3CS5 A;  3TET A;  2FML A;  4CS4 A;  3OE7 G;  3QTC A;  5LMN O;  4WFF A;  1S5J A;  3ZRW A;  4I50 A;  1NVP B;  3K5M A;  1O9G A;  4WFE A;  3SJQ C;  2JGU A;  3ZMZ A;  2RMK B;  1XRE A;  4PJ0 Z;  3AK2 A;  5CA0 B;  3OR7 C;  4Q6G A;  4JI5 B;  2QM7 A;  4UCS A;  5LMU O;  1IBL B;  3K79 A;  1D2D A;  2CTQ A;  4H0L B;  3RYI A;  4PEL A;  1GN3 A;  2XAS A;  1PV0 A;  4LF7 B;  5ITZ B;  1SS3 A;  1MZF A;  1OCO C;  2ZXW B;  1DF4 A;  1P7B A;  4KFM A;  4MT8 A;  2WLN A;  2WLI A;  2VQE B;  3L71 H;  1B04 A;  2EIJ C;  4AHC A;  3OAA G;  3OM3 B;  1SRY A;  1WB8 A;  2Q5Z A;  4JZ2 A;  3VQW A;  2OCC C;  1QVF U;  3JAT B;  4W4K A;  2GSM B;  5KA5 A;  4X89 A;  1RM1 B;  5KUK A;  4TUY B;  2XUM A;  4F6R A;  1PP9 H;  4DR7 O;  2GDS A;  4PDL A;  4DV4 B;  1CXZ B;  1NI8 A;  3D8C A;  5DEC A;  1VQ4 V;  3M7M X;  2UUB B;  1AVM A;  4O4H A;  3BY6 A;  3CRQ A;  2P22 C;  1KB9 F;  3L70 H;  1IZ3 A;  2YIA A;  2ZR2 A;  2Q0A A;  3JCU Z;  2F93 B;  2Z5U A;  3AG4 B;  3K3W A;  5IJ0 B;  4J9Y B;  4JYA B;  1KBH A;  3K9S A;  5JVD B;  1AJQ A;  1Q90 D;  4TV9 A;  1O9H A;  2KG7 A;  3EFF K;  1R6N A;  2LGW A;  3RN4 A;  1BT8 A;  2FTK A;  2WSS G;  2AZ0 A;  4JPR A;  2ZXW C;  3HKC A;  3FB5 C;  3H9V A;  2ZE6 A;  3QO8 A;  1Q6I A;  2W0F C;  4UCO A;  4TQF A;  4ZHQ A;  1Q3E A;  3OMA B;  4JI6 B;  4DR2 B;  3TCU A;  1V55 B;  3N2G B;  1AP6 A;  5CB4 A;  5KAI Z;  1I94 B;  1RM1 C;  2IJH A;  4QE9 A;  3RYH A;  1GKF A;  2XND G;  3P30 A;  2HHH B;  4X20 B;  4YY3 B;  2Y4U A;  5KUM A;  3KZI Z;  1XQ8 A;  4K8Z A;  3JAR A;  3OMI B;  2JGD B;  1IBL O;  2HKO A;  4RQF A;  3DC6 A;  2VWJ A;  1VEW A;  3BFR A;  4QNH B;  4I7Z B;  3WU2 Z;  3IFX A;  3H1J H;  3DXR A;  3G67 A;  4IHJ A;  2QTO A;  5KAF Z;  3AG4 C;  1JVM A;  4KUM A;  5KA6 A;  4L87 A;  2GV9 A;  5B1N A;  1YIT V;  3BA9 A;  1YF2 A;  1GN6 A;  2IU3 A;  3CWB H;  4B3M B;  4GT1 A;  4DV6 B;  1B6Q A;  1G4Y B;  2A7W A;  3FFQ A;  4X62 O;  3L72 H;  1Y74 B;  3CCE V;  4GYC B;  4LFB O;  4R50 A;  1K9M W;  4DUZ O;  4NXN O;  3I56 V;  1JQ0 A;  2NLJ C;  3SYC A;  2ZE5 A;  2CTW A;  2Y0P A;  2R9A A;  3QO7 A;  4QPK A;  1V55 C;  4K35 A;  2A06 H;  3HKD A;  1AR4 A;  3P32 A;  4B3R O;  2Q68 A;  2OTL V;  1YXB A;  2K9P A;  4JYC A;  3QG5 A;  2KKW A;  3C3S A;  4O2A A;  1LR1 A;  1VQ6 V;  1VQ5 V;  4JI3 O;  4FM0 A;  1U96 A;  4FLV A;  1HNX O;  1IX9 A;  4J41 A;  4LC1 A;  2P06 A;  1FFX B;  3ICX A;  2WLK A;  2LFS A;  2L6L A;  4Z1M G;  4DV3 O;  1MAB G;  4J9Z B;  2XAG A;  1WJZ A;  4GUN A;  3UO3 A;  5B66 Z;  2OTJ V;  3GVM A;  3E22 B;  4JYB A;  1N8R W;  3JD1 A;  3CPW U;  1SER A;  4IIJ B;  2WA3 A;  2LFR A;  4ASU G;  1HNZ O;  1F4N A;  4MTX A;  4WFA V;  5H6Q A;  4YJ3 B;  1XDC A;  4UFZ A;  1N4C A;  3E2E A;  5JCO C;  4AIL C;  1QR8 A;  2UXB B;  4YY3 O;  1QCE A;  4E2L A;  4ZI7 A;  1FKA O;  5AG2 A;  2F1M A;  2BTQ A;  1D5A A;  1XMQ O;  1IXB A;  5LHG A;  3TJT A;  1GM9 A;  2JJ2 G;  3APO A;  2UUA B;  3WB2 A;  4PA9 A;  2LP7 A;  5GW7 A;  5KHH A;  2IM9 A;  1RSO A;  2BCC H;  5KLV H;  1ROP A;  1AR1 B;  1W59 A;  2DE0 X;  4FZ0 A;  1H8H G;  4KXR A;  2ZQM A;  3N2K A;  4OX9 B;  5D5Q A;  5JH7 A;  1XL4 A;  1YI2 V;  3X2Q B;  4DR6 B;  4PA4 A;  2HG5 C;  4X1I A;  1S5L Z;  4WCE V;  1VIB A;  1S5H C;  2R70 A;  2WLM A;  3B8M A;  2Z0A A;  1NR7 A;  5GON B;  4UB6 Z;  3OUF A;  3CCQ V;  1MA1 A;  2YIB A;  3E8G A;  2FL4 A;  4X1Y B;  3UT5 B;  3K08 A;  2X6B A;  5KHG A;  3CX5 F;  4FLY A;  4KHP B;  1J5E O;  4B08 A;  2QKS A;  3AG3 C;  3A8T A;  3SPJ A;  4I55 A;  2UXD B;  1R6K A;  1H8E G;  1XI1 A;  3LSQ A;  3M99 B;  4AQY B;  2QTS A;  5EC1 C;  1S0V A;  3P3N A;  1FJG B;  5EBL C;  4GX5 A;  3HKC B;  3WB0 A;  1SES A;  4NVP A;  2XOK G;  3AG2 C;  4RUE A;  2FB5 A;  1TA8 A;  3CXC U;  1KC8 W;  5CN0 A;  4BAY A;  3FX7 A;  2KSD A;  4YHH B;  1M90 W;  4GKJ O;  2Q0O C;  5J9P C;  2UXX A;  4J42 A;  4HZ3 A;  1K7D A;  4JTD B;  1R6T A;  2XAH A;  3THO A;  2Q69 A;  4X1K B;  4GX2 A;  4PA7 A;  4DUY O;  3MHH C;  2EIK B;  1UJW B;  3SJA C;  1JFF B;  1FXK B;  1Q6U A;  4LF4 O;  2EJR A;  4C7U A;  5BXZ A;  5CA1 A;  3OGC C;  3LDC A;  1TVK A;  1SF9 A;  1FYJ A;  1KKC A;  4B3T O;  3FD9 A;  3JD2 A;  2ZD9 A;  2VRZ A;  1N34 B;  5L3E A;  4A5U B;  2ZNJ A;  3AK1 A;  1JPX A;  3EVK A;  1PL0 A;  4DV5 B;  4LH7 A;  3MHS C;  4LNU B;  1EFR G;  1PKX A;  2PI5 A;  2QR4 A;  3UKM A;  5E79 Z;  1K4C C;  3C3T A;  4JI1 O;  2ATK C;  1WP8 A;  1BGY H;  3SYO A;  5LP6 B;  1UPG A;  1NJI W;  3E35 A;  4TQD A;  4DR4 B;  4K0K B;  4MW8 A;  1VP7 A;  1FD9 A;  2B9Z A;  2EIL B;  2GBO A;  2ZM6 B;  3ZRV A;  2NNU A;  1BHB A;  4CBC A;  2EIK C;  1ZL8 A;  4O2B B;  2EJ7 A;  5LMN B;  1BQZ A;  4D7T A;  4O2A B;  4AI8 A;  4EB6 A;  1N33 O;  1H2M A;  4UCU A;  2YI8 A;  3DTU B;  5LA6 B;  1GN2 A;  2A0L A;  5CBG A;  5JJN B;  4AQY O;  5LGN A;  2AXT Z;  4BR6 A;  1SQV H;  2Q8V A;  4ZOL A;  2ODM A;  4UVA A;  1GAX A;  3I55 V;  2ILM A;  3ZN1 A;  4LFC O;  1D5N A;  5IYC O;  2DYS B;  3L73 H;  4YHH O;  3OT7 A;  1SZX A;  2EIM B;  4F4L A;  1M9N A;  1V9P A;  2H3O A;  3K5N A;  1K92 A;  2PI4 A;  1S72 V;  1K33 A;  4JI0 O;  3HB3 B;  2YUA A;  1TUB B;  3CCR V;  1NS1 A;  4U3F H;  5LYJ B;  3OFN G;  3QNE A;  3CCS V;  3W7S A;  1VF6 A;  3K0G A;  4CC5 A;  3ZCC A;  5LP6 C;  1BMF G;  1BS3 A;  3ZRS A;  4PHZ A;  3F5T A;  3UQ8 A;  5IE9 A;  3OMN B;  2QWR B;  3K04 A;  1YIJ V;  4QJF B;  4X65 O;  3ZJZ A;  2HLD G;  2ZIN A;  5JWP A;  1RSO B;  2Z3Y A;  4DV5 O;  3JCZ A;  4DV0 O;  3LUT B;  4DR7 B;  1P4R A;  3SDL A;  2QA4 V;  4YIO A;  1SQB H;  1I08 A;  1AI4 A;  1NTM H;  1CEZ A;  5DN6 G;  1GM8 A;  1A32 A;  1HW7 A;  5JH7 B;  4H33 A;  2B5U A;  1L8D A;  5JQG A;  2DYS C;  2QWO B;  1X59 A;  3APQ A;  2D3O W;  3IAY A;  2EIM C;  1E1Q G;  1ZWI C;  3E8H A;  4P2Z A;  1VQO V;  2OCC B;  2ITC C;  2Y0I A;  2QWQ B;  5FNV A;  4DV2 O;  3CC4 V;  1FXV A;  2RQ6 A;  1K8A W;  4I0X B;  3A0B Z;  1L0N H;  3ASN B;  4LWS B;  3G6E V;  4P30 A;  3CC7 V;  4G2K A;  5B3S B;  2F4V O;  3ZMS A;  2XTA A;  4ZBM A;  4QIW F;  4DXW A;  3A2F A;  3EHB B;  3GWO A;  3RYC B;  3D36 A;  1JOY A;  4NTY A;  4YJ2 A;  5IYB O;  5IJ9 B;  1WA8 B;  3JSN A;  4DYL A;  5B1B B;  5D5P A;  3D3I A;  1Y76 B;  3SPC A;  4TV8 A;  3W7U A;  3ETG A;  1QLN A;  1VQ7 V;  1K34 A;  1NR1 A;  5BY1 A;  2X6A A;  2YEV A;  1Q82 W;  3OW2 U;  4PA6 A;  3LDD A;  3ABU A;  2RJZ A;  2CGN A;  4W4L A;  3UM7 A;  4I5S A;  5B5E Z;  2WLJ A;  4X64 O;  3ZX6 A;  2QKC A;  4X66 B;  3CJH A;  2WLH A;  2ZE7 A;  2DJV A;  5FLX N;  2A3Q A;  1WLE A;  4X62 B;  3CCJ V;  3ASN C;  2P4K A;  4LFB B;  1GH6 A;  1US6 A;  4DUZ B;  4NXN B;  3JSL A;  5B3S C;  2YXL A;  2VS0 A;  5JJJ B;  5L3B A;  3CCV V;  3BRC A;  3ZMV A;  2QM4 A;  3LNM B;  3J80 N;  2IH3 C;  4HAM A;  1I5Y A;  2LGQ A;  2EBO A;  2UXN A;  4RWU A;  2N04 A;  4B3R B;  3BAA A;  2Q7H A;  3CCM V;  2PYL A;  2UUC B;  2JVD A;  4O4I A;  1ZLZ A;  4JI3 B;  4OXS A;  2G38 A;  5B1B C;  1M56 B;  3A0H Z;  4MTG A;  4XBF A;  1HNX B;  1H38 A;  2X0L A;  5GTH Z;  3RBZ A;  3BAB A;  4I4T A;  4DV3 B;  3HKB B;  3D3Q A;  5EZY A;  1FPO A;  4J11 A;  1E79 G;  4UVC A;  3ZHV A;  4LF9 O;  5BMV B;  4JV5 O;  3OTO B;  1VQ8 V;  4DR3 O;  5IYZ B;  1XUQ A;  4FFB A;  3WFV A;  1ENV A;  1HNZ B;  3TXS A;  1EZJ A;  2CTP A;  4X8A A;  1DK1 A;  5KX5 A;  3B40 A;  5EYP A;  4Q20 A;  3CB2 A;  2JIZ G;  4XDK A;  1AI5 A;  3E89 A;  5HFM A;  5KMG A;  4UCV A;  3FYE B;  4LF8 O;  2XHB A;  4NYK A;  1N32 O;  1KP2 A;  1P7G A;  4RAI A;  1XBL A;  1XMQ B;  2DWD C;  1FAF A;  3K57 A;  4XDL A;  4MVO A;  1PL4 A;  1I5X A;  1DTO A;  3R65 A;  5EIB D;  1YHQ V;  3E83 A;  1I0H A;  1SQG A;  1SA0 A;  1WAZ A;  3JAL A;  1MSW D;  2BOB C;  1SQQ H;  1WN7 A;  1W0K G;  2RN9 A;  4RUF A;  1Q5O A;  1M56 C;  1HP8 A;  4U3J B;  3CXH F;  2QKA A;  4X66 O;  1XNQ O;  1B06 A;  2CE4 A;  5EBM C;  1EN4 A;  5J2U A;  4UV9 A;  4FK5 C;  4PV1 B;  3JAS A;  5L3F A;  4JI2 O;  1KQS U;  1N0J A;  1NH2 D;  4DRX B;  1R1B A;  4I9W A;  5IT9 N;  2CH7 B;  4DV1 O;  1VQP V;  4FZ1 A;  2FYU H;  2Q7G A;  1R3L C;  2E76 B;  2XT9 A;  1P84 F;  2WLL B;  3VQV A;  2P67 A;  4U7N A;  3DC5 A;  5C8Y A;  2WWW A;  5EBW C;  3HKE B;  4H37 A;  1H2G A;  4G27 B;  1DF5 A;  2CUG A;  2UUC O;  2Y4T A;  2W0X A;  2QE7 G;  1WNS A;  4NKG B;  1AJN A;  4JAS A;  3CE2 A;  2ZDI A;  4JI8 O;  1NH2 B;  4BW5 A;  4XDJ A;  1J5E B;  5IWA O;  4B7E A;  1OHH G;  3JAK B;  3L75 H;  1Z5V A;  2LW7 A;  3E8F A;  5EK0 A;  1ZUQ A;  2ZE8 A;  3OTO O;  4UXN A;  3ML0 A;  2HVJ C;  1Q43 A;  3CD6 V;  1T5E A;  2R72 A;  1VQL V;  3JAW B;  1Q8I A;  5H5N A;  2B1G A;  1JR9 A;  1Q86 W;  2W6J G;  1MZE A;  3ZRW B;  4CC6 A;  4I50 B;  1VF6 C;  2CAZ C;  4GKJ B;  5GTI Z;  4UV8 A;  3NXS A;  1MSD A;  2NR5 A;  4JI7 O;  4K3A A;  4RQE A;  2OYQ A;  1Y6X A;  4QGP A;  4DUY B;  3AG3 B;  3Q4H A;  1KU9 A;  4LF4 B;  2L35 A;  3BEH A;  2Y69 C;  2GUZ A;  5K1X A;  3RYI B;  1ORQ C;  3JYC A;  4NR1 A;  4B3T B;  5A9G A;  2O57 A;  2WAM A;  4JTC B;  4NTX A;  1NT2 B;  2YI9 A;  3AG2 B;  2WLI B;  3I5D A;  3H01 A;  1R3I C;  4CS2 A;  4O4L A;  4LR3 A;  4WBN A;  1RP3 B;  4HYO A;  1AR5 A;  2F43 G;  3B09 A;  4MSW C;  4LF6 B;  3K58 A;  4HBN A;  3H1K H;  1QHT A;  3CJH B;  3G71 V;  4JI1 B;  4BIU A;  4FPP A;  3T4D A;  3FB8 C;  3LSU A;  2P4V A;  4JAA A;  1YSC A;  4F6R B;  1PD3 A;  2M7W A;  3FAV A;  4ZIB A;  1HR0 O;  1JA8 A;  4LFA O;  4O4H B;  3N27 A;  3KKY A;  2CDY A;  1F7Y A;  3E8B A;  3HR0 A;  5J2T A;  1CPY A;  4JF3 A;  1RFY A;  2ADQ B;  1Z5W A;  1W2B U;  3H1I H;  2LW1 A;  3ZHT A;  4FLZ A;  2GTA A;  1Y67 A;  4BIO A;  5LBQ A;  1N33 B;  2YC0 A;  3T1C A;  1K5Q A;  1SQP H;  4TV9 B;  2KG7 B;  1YDX A;  4JGS A;  3CRA A;  5EZY B;  1EZV H;  4DK0 A;  4J7K A;  2QWP B;  5CA0 A;  5H2F Z;  3ABM B;  1VF5 B;  1KEC A;  4LFC B;  1WPX A;  1DLB A;  3W7T A;  2BSK A;  1VQK V;  4B3S B;  2LO1 A;  1JJO A;  4ZHQ B;  3RYF A;  2QJ1 A;  1AB3 A;  2Y48 A;  4JI0 B;  5CB4 B;  5ITZ A;  2ZKO A;  1PNL A;  1K97 A;  1JCH A;  2PF4 E;  3RYH B;  3K5L A;  1F4M A;  3QF7 A;  4R7C A;  5LXT A;  3JAR B;  1GN4 A;  4BW9 A;  3A0R A;  3OR6 C;  1P49 A;  3U0Z A;  4GCZ A;  3JAT A;  5LHI A;  4X65 B;  3DXR B;  3FB6 C;  4IHJ B;  3ZHR A;  1SKV A;  4LH6 A;  4IGG A;  4TUY A;  4DV0 B;  3RW0 A;  5LOV A;  2HEP A;  1GM7 A;  4LF6 O;  4DR1 B;  4Z2W A;  4PD4 F;  1Q81 W;  1IBK O;  3ZN0 A;  3W7W A;  2AHY A;  3R66 A;  2BE3 A;  1NTZ H;  4CH3 A;  4UUJ C;  3ABM C;  2NN4 A;  5LL6 Y;  4H13 B;  1XIL A;  2JEX A;  1M57 C;  1Q6H A;  3AK3 A;  3SPH A;  5CMU A;  1SC5 B;  4KL1 A;  3MDS A;  5JVD A;  1BQ0 A;  4DV2 B;  3HKD B;  5LHH A;  3JAM N;  5CA3 A;  2P5O A;  1N36 O;  1GMG A;  4H44 B;  4MW3 A;  3ZED A;  3OUS A;  2F4V B;  1UFI A;  1RPO A;  4P9P A;  2UU9 O;  3CHX A;  3EXA A;  4ZKI A;  1R3J C;  1YZB A;  3J7A U;  1EM1 A;  3N2G A;  1K73 W;  1K4D C;  1F23 A;  3KCY A;  3BA8 A;  1BE3 H;  1U97 A;  5L3C A;  1CP9 A;  4JZG A;  3RWR D;  2IJI A;  3AG7 A;  3B2E E;  1IBM O;  3FKS G;  4R6Z A;  4X20 A;  4B3S O;  4DW1 A;  3T1H O;  5L3G A;  3WG7 B;  2YXY A;  2JGD A;  4PA3 A;  2ARH A;  1W0J G;  4FM1 A;  3KCX A;  3B8N A;  3LSS A;  1SQF A;  3SJB C;  4DR5 B;  1OCR B;  4JAV A;  3F7Y C;  1HNW O;  1LUV A;  1G6U A;  2WPD G;  3ETE A;  3RFR A;  4ZI7 B;  1Y4M A;  1URF A;  3CEI A;  4B7K A;  2V1D A;  3E86 A;  1YVW A;  5C93 A;  2BTQ B;  1M5I A;  2AZ2 A;  4X64 B;  2D2C B;  3GB7 C;  1PPJ H;  1S76 D;  4KP4 A;  1S3J A;  4FLX A;  3O65 A;  2RCV A;  4D7S A;  3LNN A;  1AJP A;  3F5W C;  5JCO A;  4IYI A;  1Y74 A;  4G28 B;  2GUZ B;  2EUL A;  3K5O A;  2C2A A;  2P7T C;  2MK3 A;  2YIB D;  4MTO A;  4TSF G;  2BTO A;  2ZDI C;  4DR1 O;  1QU7 A;  2F95 B;  2UXC O;  3N2K B;  3JD4 A;  3RVZ A;  3T2M A;  3BCC H;  4Z1V A;  3QO5 A;  2HP8 A;  5KHJ A;  1NTK H;  1K3E A;  4X1I B;  4FFK A;  2XAQ A;  3WG7 C;  2OCH A;  3CCL V;  4OPA A;  3CP1 A;  1FFX A;  1OCR C;  3ABL B;  1KUQ A;  1PM9 A;  1M4U A;  4LF9 B;  4JV5 B;  4DR3 B;  3E22 A;  4LF5 B;  3JD3 A;  3T1Y B;  1AI7 A;  4IIJ A;  4JAU A;  2DYR B;  5IYD O;  5J2T B;  2QDO A;  4FLU A;  5KHI A;  4YJ3 A;  2H94 A;  4I55 B;  4ICG A;  2EZP A;  4CH4 A;  4MS2 A;  1M93 A;  4LF8 B;  1N32 B;  1FS0 G;  2ETN A;  2VQF O;  4OPH A;  3ZMU A;  4EFE A;  1H2N A;  1NQT A;  3OEH G;  1BHA A;  2A9H A;  3MAQ A;  5BR8 O;  1EN5 A;  1XHZ A;  4DV7 O;  4RO2 A;  2H8P C;  4DR5 O;  1QR9 A;  3BVO A;  1H2L A;  2EIN B;  1RPR A;  2ZT9 B;  1H2S B;  2V7Q G;  2BSK B;  2AHZ A;  1BL8 A;  3HPL C;  4PDM A;  2AGA A;  3RYF B;  1XNR O;  4P9O A;  3KG2 A;  1XNQ B;  2Q6A A;  2W6I G;  2K1E A;  1YJ9 V;  3ZHS A;  5FL7 G;  4JI2 B;  3ABL C;  3BPZ A;  2Q67 A;  5LXT B;  3B4S A;  5CA1 B;  1TVK B;  4DV1 B;  1SZT A;  2QGN A;  1KMI Z;  1QVG U;  1EN6 A;  3ZMT A;  3TGU H;  4CS3 A;  3U11 A;  2DYR C;  2CTR A;  1KP3 A;  3C90 A;  4IT5 A;  5GON A;  2DQ0 A;  3ZIA G;  2JS5 A;  3FYI B;  4JTA B;  4MVZ A;  3JD0 A;  4X1Y A;  5LOV B;  3UT5 A;  2YIC A;  2ADP A;  3SR2 C;  1QBZ A;  3SPG A;  1R3K C;  4JI8 B;  2ZIM A;  4JI4 O;  5IWA B;  1YTF D;  3GWK C;  1BSM A;  3T4Z A;  3S3W A;  1YJN V;  2EIN C;  4OGQ B;  4LF5 O;  1R73 A;  3T1Y O;  1H2K A;  4NXM O;  1THZ A;  1G8M A;  1ARO P;  3ABK B;  1ZL8 B;  3P3P A;  2IH1 C;  5BZB A;  3VQX A;  4GX0 A;  1ZSP A;  1OJH A;  3OEE G;  4L8J A;  4GX1 A;  1WP7 A;  4MVR A;  2YS8 A;  4EB6 B;  4FM2 A;  1YCI A;  1YTF B;  2CK3 G;  2DW4 A;  2OWO A;  1IDS A;  3ABT A;  4BWA A;  4JI7 B;  1ZAU A;  1YJW V;  4N21 A;  5LGU A;  4F6E A;  4ZOL B;  4X1K A;  3VQY A;  1Y66 A;  5B1O A;  2OIG A;  4WFG A;  1JFF A;  1FXK A;  1QNM A; 
#chains in the Genus database with same CATH homology
 2CTR A;  2CTQ A;  2L6L A;  2QWR B;  2Y4U A;  1N4C A;  1FPO A;  2DMX A;  2M6Y A;  4RWU A;  2N04 A;  2KQX A;  2YS8 A;  2QSA A;  2YUA A;  2PF4 E;  1WJZ A;  2GUZ A;  4IT5 A;  2QWN B;  1XBL A;  3UO3 A;  2QWO B;  2QWP B;  1BQ0 A;  1FAF A;  3APQ A;  2GUZ B;  2N05 A;  3UCS C;  3UO2 A;  2OCH A;  1GH6 A;  1NZ6 A;  2LO1 A;  3BVO A;  2QWQ B;  3AG7 A;  2CUG A;  2CTP A;  2Y4T A;  2EJ7 A;  3APO A;  2DN9 A;  1BQZ A;  1HDJ A;  4J80 A;  2LGW A;  2CTW A;  1IUR A;  4J7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...