3OAAG

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
284
structure length
284
Chain Sequence
AGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
molecule tags Hydrolase/transport protein
total genus 104
structure length 284
sequence length 284
chains with identical sequence O, W, e
ec nomenclature
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3oaaG01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 3oaaG02
5LBQA 3ZMSA 1E79G 3FKSG 3ZMTA 4XBFA 5L3EA 3OEHG 3ZN1A 2CK3G 3ABUA 4Z1MG 5LHHA 3ZMVA 2V7QG 4KUMA 1COWG 1NBMG 3ZIAG 4ASUG 5LGUA 1BMFG 2F43G 2IW5A 2Z3YA 2DW4A 1H8EG 5LHGA 2HKOA 4UVAA 2W6IG 2XNDG 5L3CA 5FL7G 2UXXA 4TSFG 5LGNA 5LHIA 1E1RG 1MABG 5LGTA 1E1QG 3ABTA 5L3BA 2EJRA 2UXNA 4UXNA 4TT3G 2R9IA 2Y48A 2XOKG 5H6RA 1OHHG 3ZMZA 2XAFA 3OFNG 4YXWG 1H8HG 2JJ1G 4UV9A 3OAAG 2WPDG 2Z5UA 4UVCA 5DN6G 2X0LA 5L3FA 3ZN0A 3OEEG 2JDIG 2XASA 2XAGA 2W6JG 4UV8A 5L3DA 4CZZA 2WSSG 1EFRG 4BAYA 1W0KG 2XAJA 2JIZG 2QE7G 5L3GA 2XAQA 5H6QA 3ZMUA 2H94A 2V1DA 1FS0G 3OE7G 2JJ2G 1W0JG 4UVBA 2XAHA 2HLDG
chains in the Genus database with same CATH superfamily
1LUVA 2A9HA 3ZN1A 1Q6UA 4MVZA 3BA9A 4RPPA 1SETA 4QNHB 4JYAO 3RYCA 3DTUB 3CRAA 2ZDIC 2ZDIA 4WCEV 2CTPA 3JAKA 4BW5A 1PL0A 2ZCEA 1SQGA 3K3WA 4B7KA 3GWKC 5KHHA 1JA8A 4LF4B 2BTQA 1Q6IA 4O4HA 2EULA 3RYHB 1KP2A 4IGGA 3K57A 4P9PA 5K1PA 2HVJC 2ZNIA 1XNQB 1T5AA 1I08A 3IC7A 2UXBB 2ZD9A 1IXMA 3CCVV 4JYBA 3RVZA 1GM7A 3WB2A 1P49A 1NU1H 1LR1A 3RYFB 2ZXWC 3M8AA 2Q7GA 3ASOC 1VQ6V 1XMQB 3EOEA 1XOUA 4DK1A 4LFCB 1A5UA 1AI4A 1KECA 2ZE8A 2ZE5A 1A3XA 2XAFA 4LF4O 1F51A 3RN4A 2P4KA 4WFFA 4JI2B 1E0TA 5A9GA 1BQZA 3BY6A 5DN6G 4K0KO 1YZBA 1L1FA 1VQKV 1AJNA 2BSKB 1XNQO 3MHSC 4MVOA 3UCSC 2XAGA 1OV9A 3N2KB 5DM6V 4GKKO 5L3GA 1OCZC 3CCJV 3SPJA 1KB9F 1ZX3A 3ZMUA 2QA4V 3BAAA 4GKJO 1WPBA 3Q4HB 1HR0B 3ETEA 4D6TH 1WLEA 3ZRSA 2Q4PA 5IJ0A 1WB7A 1SQVH 4PDRA 2Q67A 1QR9A 1FXKB 4O4JA 4O4LA 4MVQA 2X7RB 2P5OA 4FZ0A 1BMFG 4DRXA 3OGCC 1SS3A 1QNMA 3SRDA 3T0TA 2DE0X 4DV7B 1WN7A 5BXZA 4RAIA 3CRCA 5BZBA 4CC6A 1R73A 4PJ0Z 5J2TB 3CRMA 4WBNB 1BS3A 4I55B 5GONA 2F66C 1ZAUA 2WLMA 3E8HA 4GX2A 4MVUA 3ABTA 5L3BA 3CCEV 3E89A 3E0WA 3HKEA 3RFRA 2DYRC 4W4LA 1MMMA 2EIKB 3ZX6A 4ZBMA 3ASNC 2F4VB 4FLZA 4KP4A 3FD9A 2ZE7A 4DV7O 2GSMB 3K9SA 1N34B 3JASB 3JAWB 5LP6C 5LYJB 5H2FZ 1RPOA 2VWKA 3CC4V 3CHXA 3ZHVA 4BW9A 1YITV 1GO3F 4NXNB 3BA8A 4X1IA 3STLC 3PN1A 1KUQA 1RFYA 1K33A 3UM7A 1OCRB 4JI6B 1JJOA 1X4TA 3JAMN 2XAJA 3NR7A 4UCOA 3CJHA 1QU7A 2XT9A 3WB0A 2F4VO 1FS0G 3ZHTA 3OE7G 4DUZO 3B77A 3C3TA 4WFHA 1QLEC 3QVNA 2X6BA 1NI8A 1YTFB 1FFTB 3LDEA 2EJ7A 4I5SA 1CPYA 4QGPA 1AI6A 2HLDG 3JD1A 1YDXA 5L3EA 3DC5A 5KHIA 5D5PA 1FAFA 1Z5VA 4D7SA 3ABKB 2UU9B 4RO2A 4ASUG 1EN5A 1LUWA 4JI6O 3D3QA 5EYPB 4X1YB 5LGUA 3IJ4A 1PKLA 1H8EG 2WLLA 1PNKA 3G6BA 4KCWA 1WNSA 2ZNJA 3AG2B 1DF5A 4O2BB 4JPGA 3OTOB 2VS0A 2UXXA 5JJEB 1K34A 4PDVA 3AK2A 1W2BU 3B8MA 5IT9N 3HKDA 4DUYB 1KD1W 1H38A 5LA6A 2RMKB 4R8CA 3ZS8C 1RM1B 4EFEA 3ZCCA 3CB2A 4YY3B 4MVRA 2UU9O 1NVPB 1SC5B 3W7XA 3AG3B 2E75B 4X1KB 2H8PC 3C3SA 2JS5A 3HQPA 4MS2A 5IDJA 4FIPC 3KZIZ 4KRZA 4X64B 2UUCO 2ZQMA 4LP8A 4GLXA 1M56C 1G4YB 4DV4O 4JAUA 1DK1A 2IU0A 1FYJA 2Q0OC 3GR4A 4DUYO 1VMGA 3CCSV 2GUZA 4G1NA 1UJWB 1HW7A 2BOBC 3M7MX 4AHCA 1W0KG 3LSUA 4DV2O 5F2VO 4HYWA 2E74B 1QQCA 4O2AB 3QV9A 1VIBA 1R3LC 2YXYA 4NXMB 2A7WA 2VQEB 3G71V 4A5UB 2ZXWB 1IBLB 3WG7B 4JTDB 2CK3G 2XHBA 4MTXA 4G28B 1AP5A 3D3IA 5EK0A 3BCCH 1NBMG 4PDLA 5CB4B 5JH7A 4EKWA 5GTHZ 4FXFA 4DV6B 1MSDA 1XNRO 2YI8A 1XUQA 1I0HA 5B1NA 3S3WA 2CH7A 4NXMO 4FVMA 4XDLA 4TOIA 3TGUH 2EIMC 2W0XA 4X65O 1Y76A 2QJ1A 1Q7YW 4MVSA 4B3SB 1FFXB 3SPCA 5LGTA 4J80A 2MW2B 1JFFB 4IHJB 1H2SB 2VRZA 3OUSA 4FFBA 3W7UA 5JQGB 1Q43A 5H5NA 3JARB 4E4EA 5LOVB 2L35A 2CGOA 4DV6O 4B3MO 3CCRV 5ITZB 3T07A 2QDOA 2BSKA 4D7TA 3BFRA 1GKFA 3BVOA 5IY5C 3T1YB 4IYIA 1QR8A 4ZOLB 2AGAA 1IBMB 2DQ3A 3LDDA 3A2FA 4JYCA 3FYEB 2ILMA 4FM0A 1YSCA 1R6TA 1GRJA 2YUAA 2IH3C 2Q7HA 2B1GA 5KAIZ 1S5LZ 2A79B 4IT5A 3ZHQA 4ZIBA 2GTAA 1URFA 1GTOA 3LSQA 2LW7A 5JVDB 4H13B 1WJZA 5J9PC 3CMEV 3SJCC 2ZKOA 3T1YO 4C7UA 3WB1A 4Q20A 3BJFA 4J9ZB 1SA0B 2RDCA 4FFKA 1RP3B 3APQA 2DYRB 3KHDA 1YIJV 1OJHA 1F23A 3ASNB 2RN9A 2B1IA 2ADQB 2WLNA 3AK1A 4TUYB 1OZ0A 3ETDA 4KFMA 1BE3H 2GBOA 5IJ9B 5KHKA 3L9DA 3DGEA 1YJWV 5B1BB 3E22A 4BIUA 1JQ0A 4I55A 3JATB 5LGNA 1QHTA 1JCHA 2EINC 2F93B 4DXWA 3AG1C 3QV7A 4LFBB 1GAXA 3ABLB 3TJTA 1S72V 4OX9O 4DYLA 1Y74B 5CMUA 5IWAB 3KTXA 1DF4A 3LSSA 1Y66A 4LF5B 5JCOC 1PD3A 4I4TB 5KUMA 1BSMA 5J2UA 4LF6B 3OTFA 3A0RA 1DLBA 1QLEB 3SPIA 1VQ8V 2WLIA 1FJGB 2CAZC 4CS4A 1AILA 1XDCA 1N33B 1IVSA 1V54C 3JAWA 1PKXA 4UV9A 3K5LA 1FKAO 3ABMC 3T2MA 1MA1A 4CS3A 2W6JG 5BMVB 2G38A 3FAVA 1MZEA 1SQXH 1PNMA 1PKMA 1AR4A 1BGYH 4DR4B 1MSWD 1FJGO 2EZOA 1D5NA 1O9HA 4BIOA 5EZYB 2EZPA 4DR6B 2PGGA 3W7TA 1TA8A 1H2GA 2FB5A 4KHPB 2P4VA 2EILB 3L70H 3H1JH 3RW0A 4JYAB 2Y4TA 1N36B 1Q8IA 1F4NA 3VQYA 1V9PA 2NN4A 1X59A 1WAZA 1K4CC 1AVMA 4KUMA 4EB6B 4RUEA 4HNAB 4DR4O 2ZT9B 1WA8B 4NTWA 2IW5A 1K5SA 5LXTB 4DR6O 2JS3A 1R3KC 1DTOA 2YI9A 4NKGB 4KHPO 2JGDA 3KKYA 3I56V 2UUBO 4TV8B 2QSAA 4ZI7A 1N36O 1AJPA 4X1KA 1Q81W 1TUEB 1WP7A 4WF9V 1R3IC 3FYIB 1ZTEA 4GCZA 4YJ3B 2PYLA 2D3OW 4GT1A 4DR3B 3RWRD 4DR1B 1KMIZ 4K0KB 4X9QA 1OCOB 2Y69B 2ITCC 1PKNA 4UVCA 4FM1A 4DRSA 1XEQA 4FK5C 4IIJB 4TV9B 2Q7EA 1BHAA 3UO3A 3P32A 2QM8A 2XASA 4ICGA 2YXHA 4PDMA 1EZJA 2N05A 3B2EE 3QF7A 3QNEA 1QLNA 4N23A 4GKKB 1N8RW 4B3TB 2LQTA 1GN2A 1G6UA 1L0LH 1EFRG 4O2AA 4GKJB 3OR6C 2QE7G 1V55C 3DSQA 4DR3O 5CBGA 1NKDA 2EIMB 1FPOA 3RVYA 2H94A 4WFBV 2YSUB 4DR1O 2M6YA 1HNXB 4NYKA 3W7SA 4F4LA 3SYAA 3X2QC 1WB8A 2AXTZ 3T4ZA 1ORQC 3B40A 3UT5A 3GG8A 3ZMSA 2OCCC 3U11A 1ZSPA 3H1IH 2Q73A 3DXRA 5CA1A 4XDKA 2Y0PA 4PV1B 4B3TO 3H1LH 4UB6Z 4LF9O 2IU3A 4UCRA 3MD0A 2C2AA 4FLVA 3A0BZ 4I0XB 2DW4A 5IY5B 4NB5A 1M4UA 3ETQA 2Q6AA 1HNXO 1K7DA 1US6A 2GHYA 4RQFA 4FLWA 5HFLA 2IM9A 2KQXA 2XTAA 3F5WC 1TAEA 1NTMH 3G4SV 3E8BA 1GN3A 3T1HO 4CC5A 4DV3O 2KG7A 1KKDA 3SYQA 4QE7A 3IC9A 4UFZA 2JRIA 1OHHG 4LNUA 4JI7O 2QKCA 2F23A 4U3JB 5KLVH 2QR4A 4JI8O 2RNBA 1YVWA 1GM9A 2LJ2A 2EX3A 3CMAV 2DMXA 4N21A 4U3FH 4CH5A 1ZL8B 3UQ8A 3K06A 2JDIG 2Q69A 1XREA 2PTMA 4UCTA 3TXQA 3OT7A 4LR3A 3RT3C 3G2GA 4MSWC 3HKBB 4FJCC 3OMNB 4YJ2A 3EVKA 3N2GB 4WJ8A 1VP8A 4P9OA 4DUZB 4UCVA 2EINB 3SRKA 3HKCA 3AG1B 5C8YB 1TUBA 3IAYA 1T5EA 4BIZA 5FNVB 4PA7A 4Z2WA 2XAHA 4ZHQB 2K9PA 1M90W 1AB3A 1P7GA 4K3AA 3OEHG 4O4IB 4DR2O 4LCUC 5CA3A 3ABUA 3CCQV 3ZMVA 4CS2A 4GX1A 2QM7A 2Z0AA 1N0JA 4QPKA 1COWG 5EBWC 2DYSB 5TISZ 3APOA 5KMGA 3K79A 4DV5O 1WPXA 5CBFA 4W4KA 4I50B 4J7JA 3ABMB 1QVFU 4J42A 1I94O 5FL7G 1KU9A 5LMNO 3IGAC 4E2LA 4OXSA 3CSXA 2PZSA 2ZE6A 1MABG 3VOUA 3QV8A 3RYIB 4JI1B 2PF4E 4KXRA 2OCHA 3SPGA 1F7YA 2E28A 2UXNA 1FXVA 2ETNA 3A0HZ 1MOFA 2YIBD 1IURA 4R50A 2UUCB 3LNNA 2JEUA 3SPHA 2QWQB 1DGSA 4DV4B 5H6RA 1K73W 2CGNA 2HG5C 3OFNG 1VEWA 2JJ1G 2AW9A 2VGFA 3IS4A 2R9AA 1GN6A 4X20B 2X0LA 4JI0O 1O9GA 3J80N 3J81N 4JI1O 2FL4A 4H33A 3OMIB 2YEVB 4LWSA 4DV2B 2JVDA 4GX0A 2WSSG 2R72A 3QV6A 3GWOA 4AILC 1VQ5V 1SKVA 2HJFC 1B06A 2XAQA 3E35A 2AHZA 1SF9A 3FB5C 3RYCB 3F5TA 1F3WA 2JJ2G 2RQ6A 3JYCA 4JI5O 2W0FC 4JAAA 1IDSA 1TVKB 3JAKB 3RBZA 2P6JA 4AQYO 3ZRWA 1NH2D 4QPJA 4PELA 4QJFB 3SJQC 4ABMA 2BTQB 4O4HB 3B4SA 2UXDB 3H1KH 4CH3A 1WA8A 4IYHA 4K8XA 3BEHA 1VQOV 1XNRB 2N74A 4JI3O 3I5DA 2Q5ZA 5CA0A 1Q86W 3L74H 2VQFO 2MK3A 3QTGA 2A06H 4X65B 1CXZB 4IMAA 3ASOB 4JPRA 1EN4A 5FPOA 1Y4MA 2KSDA 3L73H 1B3QA 2LW1A 4MT8A 3E86A 1NR7A 4JZ2A 4AI8A 1NTKH 1PP9H 2KKWA 4H37A 3ME3A 1E1QG 2UXCO 1R6NA 2QWOB 2UXDO 1IBKO 3QG5A 4R6ZA 4R7CA 3K5NA 3RYHA 2UUAO 4B3MB 2CTWA 4P30A 3TXSA 3U10A 2EBOA 2OCCB 3RYFA 5IE9A 3AK3A 3ZHUA 3S3XA 1N0NA 5L3FA 4FLXA 2ZINA 4QIWF 1OCZB 1J5EB 5C93A 1S77D 3D36A 2PUSA 2E5LO 3CYOA 1R6KA 3E0VA 3LNMB 4X62B 4YNGA 5KA5A 3EXAA 3SR2C 1D2DA 3U2ZA 2ZR2A 5IJ0B 3FB6C 2IBZH 2OYQA 1JPXA 1BT8A 1B04A 1TGOA 4YJ5A 1MZFA 3UKMA 4O4LB 3KCXA 1HDJA 3N2KA 2OTLV 5EC1C 1T57A 4BWAA 1E79G 3FKSG 4DRXB 4FLYA 2LP7A 1J5EO 2H3OA 2Q9LA 4J11A 3T4DA 2V7QG 4X62O 4I0XA 4X66O 1QVGU 3Q4HA 5B3SC 4H44B 5GONB 2GDSA 2KB1A 4PA6A 1VQPV 4JV5O 5B66Z 1S76D 3CCMV 5D5QA 1BL8A 3SRHA 4Z1VA 5DECA 3HKEB 4OX9B 5KHGA 5E79Z 1FXKA 5FPRA 2VGGA 2ZIMA 2L6LA 3E8FA 2OIEA 1ZWIC 4G27B 3CCUV 1Z5WA 3K08A 3L72H 4NTYA 3J7AU 3AG7A 2P7TC 1XL6A 4TT3G 5LP6B 5J2TA 1Q82W 1PKYA 4WBNA 2D2CB 4U3JA 2LFSA 1H2LA 5CBHA 1A3WA 2YDEA 4X1IB 2O57A 4DO2A 4J41A 3CXCU 4H0LB 4RUFA 1OCCC 3HR0A 3CJHB 2EIKC 1EN6A 3OGIB 5B5EZ 2Y4UA 3N2GA 3VQWA 2VGIA 4KS0A 2JK5C 2CUGA 3HQOA 1XHXA 1KP3A 3ZJZA 4MVMA 3JASA 2WA4A 3JCZA 4DW1A 5LYJA 5KX5B 1ZLZA 1M93A 1W59A 3OMAB 4B08A 3ZRXA 4G2KA 3JD3A 4JI4O 2WLLB 4EFBA 1RSOB 1YHQV 2WWWA 2DWDC 5LHHA 5EIBC 5GTIZ 3JCUZ 4DV0O 1QCEA 4PA4A 4PA9A 2CE4A 1M57C 3GVMA 4DR7B 3HKDB 1VP7A 3TK1A 2PYJA 5LA6B 3CXHF 3H9VA 3P3PA 2B5UA 3AAGA 2WLKA 1B6QA 1GK9A 3OUFA 3W7WA 2UUBB 4IL6Z 1J95A 1VQLV 5EYPA 4X1YA 2YXLA 4I9WA 1KBHA 3AG4C 1K9MW 3AG2C 3ZRVA 4X89A 4O2BA 4F6EA 5EBMC 1M56B 3SRFA 2R70A 4ZKIA 3OD4A 2GV9A 1HNWO 1H2MA 4DR7O 5IYBO 1L8DA 1AI7A 2ATKC 4UCUA 3GB7C 3KG2A 3CWBH 1JX9A 3BRCA 4YXWG 2GUZB 3LUTB 1BZKA 1Y67A 3BABA 3G6EV 1VF7A 4I9QA 4JF3A 1IXBA 1R3JC 3ZHRA 1G1XB 1ZUQA 2YIAA 3H6OA 1ROPA 3ZN0A 4U7OA 2ZM6O 1YXBA 4OPHA 3CE2A 1HP8A 4UCSA 1NQTA 1P84F 1XI1A 1XMOO 1HWYA 4CH6A 3CC7V 1VF6C 4OGQB 1VF6A 2HJDA 2NLJC 4LF8B 1R1BA 1TVKA 5BR8B 1AI5A 4I7ZB 4DR5O 3B8NA 1ZJHA 1SQBH 4LFAB 1W0JG 5JH7B 5IYZB 4KL1A 1AJQA 5IYDO 2PI4A 2M7WA 3AEIA 1E0UA 4LF9B 2HR3A 1XILA 2CH7B 2P90A 2ODMA 3ETGA 3HPLC 5A2QN 2Y0IA 1Y76B 1BHBA 2Z3YA 4LF8O 2X6CA 5LHGA 3STZC 3WG7C 5BR8O 1YCIA 4F6RB 1VQ9V 2PI5A 3K59A 3FB7C 2W6IG 1I7FA 4FFBB 4PA3A 3EFFK 2QGNA 4LFAO 1M5IA 4BR6A 3U0ZA 4J9YB 5CB4A 1E1RG 3T1HB 4DV3B 3GQYA 2RJZA 2DJVA 3SYOA 3F7YC 2UXBO 4UUJC 4B2DA 1VQ7V 3K5MA 2HEPA 2AZ0A 1VQNV 5AG2A 3CC2V 1L0NH 1EM1A 1K8AW 4JI7B 1GH6A 3WFVA 2P06A 1XMQO 1FFXA 4JI8B 3K9AA 1PNLA 4LFCO 2IH1C 1H8HG 1JFFA 1Q5OA 4IHJA 3PJSK 4KCVA 2WPDG 1K92A 4TWKA 4QE9A 1Q90D 1N4CA 4Q6GA 1PV0A 5JQGA 4JI2O 4QG6A 2DQ0A 3VQVA 3T05A 3JARA 5KAFZ 5B3SB 3QTCA 5LOVA 3SDLA 4GZRB 4YHHB 5KUKA 1SRYA 3JSNA 3ML0A 3R66A 2WLJA 5ITZA 4FXJA 1NH2B 1S3JA 3E8GA 1XBLA 3CPWU 4ZOLA 2IJHA 4LC1A 2RCVA 5H6QA 2ADPA 1AQFA 2G50A 2HP8A 1GM8A 4DR2B 1JR9A 4MTOA 3JD4A 2VWJA 3C90A 1HR0O 2NR5A 3E22B 4YHHO 3JD0A 3H1HH 4MTFA 4DV5B 1D5AA 5JVDA 4RQEA 3ZHSA 1MG1A 3L71H 1NZ6A 2CTRA 1I94B 4QGCA 1JJ2U 3K04A 1SA0A 1U96A 1OCCB 2WA3A 5LMNB 4FZ1A 5J2UB 3SYPA 5LMUB 4TUYA 2E76B 3QO5A 3TETA 2WLIB 2QTSA 1GN4A 3THOA 5IJ9A 2ZIOA 2BTOA 3TCUA 3DC6A 1V54B 5B1BC 1UPGA 5LP6A 2IJIA 3FB8C 2FKXA 1PL4A 3JATA 3LDCA 1AP6A 2QM4A 4X8AA 2Q68A 4RWUA 3JALB 2GTSA 4GUNA 2JGUA 3ABLC 1Q3EA 2R9RB 4TQDA 1FD9A 1Y74A 4FMTA 4MTGA 4JI0B 3FAVB 2Z5UA 3P3NA 1K5QA 5LMUO 4I4TA 4FPPA 3I55V 2Q8VA 1M57B 2CDYA 2DN9A 3OEEG 2QTOA 1N34O 1YF2A 1AR1B 2YICA 1NJIW 5B1AC 4CBCA 2FYUH 1RPRA 4UV8A 5L3DA 2ZR3A 3D8CA 5KX5A 2JEXA 4FM2A 2HFEC 4JZGA 1F4MA 1K3EA 4NXNO 2IJKA 4WFGA 2VGBA 4UB8Z 2EIJC 1VARA 4JI5B 4HZ3A 3K03A 5DEDA 1KC8W 4AQYB 3CEIA 2A0LA 3AG4B 3CP1A 4DV1B 1Y6XA 5BMVA 3VQXA 1RSOA 3FFQA 3HQNA 4KCUA 3MDSA 5EC2C 1S5JA 3QO8A 4J10A 2HVKC 1Z2GA 1SQPH 2X6AA 3IFXA 5EZYA 2Q0AA 4JI3B 3JSLA 4QG8A 2JGDB 5K1XA 2VQFB 2IJJA 2EILC 4XDJA 2F43G 1KQSU 4ZI7B 1SQFA 2OTJV 3NXSA 2HKOA 1SESA 3G80A 4UVAA 2BOCC 4GYCB 3ICXA 3R65A 2BE3A 4DV1O 2K1EA 4TSFG 4EB6A 2UXCB 4HNAA 3B09A 1SQQH 3OTOO 2B9ZA 1IBKB 1IX9A 4FLTA 1XQ8A 2WAMA 2F95B 5LXTA 2UUAB 2EJRA 2QKAA 4JYYA 1UFIA 4UXNA 2YS8A 3SJAC 4YY3O 3JD2A 4TV8A 4X88A 1P4RA 3OAAG 2QKSA 2FTKA 3HB3B 4X64O 2E5LB 2NNUA 1BCCH 1PPJH 2WLHA 3G67A 1V55B 2DOSA 4YJ3A 1JMKC 4J7ZA 4PHZA 3CRRA 3X2QB 1OCOC 2Y69C 4OPAA 4CZZA 3UT5B 4P2ZA 5JJNB 4U7NA 4BAYA 2JIZG 2QEXV 4TV9A 4IIJA 3SGIA 4JTCB 5KA6A 3DXRB 2HHHB 1N32B 3N25A 5CA1B 4JAVA 5IYZA 1F3XA 1ENVA 3K0DA 5IYCO 3VBBA 3D36C 3N27A 1SZTA 5LBQA 3ZBHA 2YIDA 2VQEO 1EZVH 4X66B 4TQFA 1U97A 1IBLO 4Z1MG 5EIBD 2QWNB 3OR7C 5KHJA 1S0VA 1QBZA 4JV5B 3CS5A 3WU2Z 1EBOA 1NTZH 1YTFD 4PI2A 4F6RA 1Q6HA 3UO2A 2YIBA 4MW3A 2HHHO 1P7BA 4O4JB 1N32O 4HYOA 1WP8A 2ITDC 5L3CA 2KG7B 3E2EA 3E83A 2ARHA 5LHIA 3MAQA 1I5XA 1YI2V 4LNUB 3K0GA 4NR1A 3CCLV 4B3SO 3FX7A 1NS1A 2PY5A 2N04A 3K58A 2R9IA 4NVPA 3QO7A 3F7VC 2QWRB 1HNZB 4HYVA 3T1CA 1FXKC 2OT5A 1VF5B 4IP7A 4YJ2B 5LL6Y 4GX5A 1NVPD 5B1OA 3OM3B 1SZXA 4DK0A 3KCYA 3CX5F 3HKCB 4NTXA 1PM9A 1TUBB 2AZ2A 5JWPA 3ZEDA 5GW7A 1BQ0A 1IBMO 4PI0A 4LF7B 1VQ4V 4YIPA 3O65A 1M9NA 3A8TA 2FMLA 1K4DC 1NR1A 1MNGA 2YC0A 1HNZO 5E1AC 1LNQA 1ZL8A 3BHPA 2V1DA 4YIOA 4B3RB 1AR5A 4JI4B 4CH4A 2A3QA 1IZ3A 4UVBA 2E3CA 5KMGB 3HKBA 5EBLC 1VQMV 1G8MA 3ZMTA 1FXHA 4XBFA 2LGQA 4JASA 4DV0B 4DW0A 2AHYA 2F1MA 4K8ZA 5C8YA 4JTAB 2LGWA 4LF7O 1YJ9V 4WFEA 3ZIAG 5FNVA 1A49A 4ZHQA 3O9OA 5JCOA 3K5OA 4O4IA 5H9CA 1CP9A 4B3RO 5BY1A 1H2NA 1OCRC 1XL4A 2XNDG 2DWEC 4J7KA 1K97A 2CTQA 4WFAV 5B1AB 1XHZA 1JOYA 3MHHC 2DYSC 4B7EA 3EHBB 3MA8A 2P22C 4I50A 1HNWB 2EIJB 3JALA 5JJJB 1H2KA 4LFBO 5IWAO 4B2DD 4K35A 4MW8A 4HBNA 4L8JA 4LF5O 2Y48A 2XOKG 4LF6O 3BPZA 3ABKC 2P67A 5CN0A 3BJTA 2LFRA 2BCCH 3RYIA 3ZMZA 1NT2B 5HFMA 5FLXN 4LWSB 3PP7A 4HAMA 1M1KW 1CEZA 2XUMA 1YEWA 1N33O 2ZM6B 1KKCA 3L75H 1A32A 3H01A 1THZA 1YJNV 1AROP 1KYOF 2LO1A 1S5HC 1SERA 4QG9A 2OIGA 1XMOB 1JVMA 4JGSA 3CD6V 3ZRWB 3OW2U 4LBEC 3RGBA 3P30A 4X20A 4LH7A 4LH6A 4DR5B 1RM1C 2OWOA 1I5YA 4PD4F 4L87A 4FLUA 4EEQA 3SJBC 2QWPB 3AG3C 2V4DA 3M99B 2YEVA 3CRQA 3SYCA 1GMGA 4KCTA 5CA0B
chains in the Genus database with same CATH topology
3JD4A 2A9HA 4QPJA 3ZN1A 4PELA 4Q20A 4QJFB 4J9ZB 4MVZA 3SJQC 2DYRB 1SETA 4QNHB 3JD0A 3DTUB 1YIJV 2ZDIC 4MTFA 1F23A 2ZDIA 3ASNB 4WCEV 2B1IA 2WLNA 1OZ0A 3BEHA 3ETDA 4KFMA 4RQEA 1VQOV 4BW5A 1PL0A 1MG1A 3K3WA 1Q86W 1JJ2U 3K04A 2MK3A 1OCCB 3DGEA 5B1BB 4BIUA 1YJWV 1JQ0A 3ASOB 4JPRA 1KP2A 3SYPA 1Y4MA 5LGNA 1JCHA 3QO5A 4MT8A 2EINC 3E86A 4P9PA 4DXWA 2HVJC 3TETA 1NR7A 3AG1C 2WLIB 3ABLB 1S72V 3IC7A 2ZD9A 4H37A 1IXMA 5CMUA 3TCUA 3CCVV 4JYBA 1E1QG 3RVZA 1DF4A 1V54B 3LSSA 1GM7A 1R6NA 1Y66A 5B1BC 2IJIA 3FB8C 2ZXWC 3LDCA 4R6ZA 4R7CA 3ASOC 1PD3A 1VQ6V 5KUMA 4X8AA 2Q68A 3A0RA 1DLBA 1QLEB 3SPIA 1AI4A 1KECA 2WLIA 4P30A 1VQ8V 3ABLC 2R9RB 2XAFA 2EBOA 2OCCB 1F51A 1V54C 4FMTA 4MTGA 1PKXA 4WFFA 4UV9A 2Z5UA 3BY6A 1K5QA 5DN6G 1L1FA 5L3FA 3ABMC 1VQKV 4FPPA 3T2MA 3I55V 1AJNA 4QIWF 1OCZB 1M57B 5C93A 3MHSC 1S77D 3D36A 3OEEG 2QTOA 4MVOA 1NJIW 1AR1B 3CYOA 5B1AC 2XAGA 1R6KA 2W6JG 4CBCA 3LNMB 4UV8A 1RPRA 5L3DA 5KA5A 2ZR3A 2JEXA 2HFEC 1F4MA 1K3EA 1PNMA 5DM6V 2ZR2A 2IJKA 4WFGA 2EIJC 1MSWD 3FB6C 5L3GA 2EZOA 1OCZC 4HZ3A 3CCJV 3K03A 3SPJA 3ZMUA 2QA4V 1KC8W 2EZPA 1JPXA 2A0LA 3AG4B 3CP1A 3W7TA 1H2GA 3ETEA 3UKMA 1WLEA 2EILB 5EC2C 3ZRSA 5EC1C 3RW0A 2OTLV 1E79G 3FKSG 2LP7A 3QO8A 2HVKC 2X6AA 3IFXA 4PDRA 1F4NA 3T4DA 2Q67A 2V7QG 1K4CC 4KUMA 4RUEA 1QVGU 1QR9A 1FXKB 5B3SC 2IJJA 2KB1A 2EILC 4MVQA 2X7RB 4XDJA 1BMFG 2F43G 2IW5A 1KQSU 4PA6A 1VQPV 1K5SA 1S76D 3CCMV 3OGCC 2OTJV 1BL8A 3NXSA 2HKOA 1SESA 4UVAA 2BOCC 3R65A 1R3KC 1DTOA 2K1EA 4RAIA 4TSFG 5BZBA 1R73A 1FXKA 3I56V 3E8FA 4G27B 1ZWIC 2WAMA 2WLMA 1AJPA 3E8HA 4GX2A 3K08A 4MVUA 3CCUV 3ABTA 5L3BA 2EJRA 3CCEV 1Q81W 1TUEB 3E89A 4WF9V 2P7TC 1XL6A 4UXNA 1R3IC 3FYIB 4TT3G 4GCZA 2DYRC 1Q82W 2D3OW 3JD2A 4GT1A 2EIKB 2LFSA 4ZBMA 3ASNC 5CBHA 4X88A 1OCOB 4KP4A 2Y69B 2ITCC 4DO2A 1P4RA 3OAAG 2QKSA 4UVCA 2GSMB 2FTKA 3HB3B 3CXCU 2NNUA 4RUFA 2WLHA 1OCCC 1BHAA 4FK5C 1V55B 1RPOA 3P32A 2EIKC 2QM8A 3CC4V 2XASA 4PDMA 1YITV 1GO3F 1EZJA 3QNEA 3X2QB 1OCOC 2JK5C 3STLC 2Y69C 4N23A 4CZZA 1QLNA 1N8RW 3UM7A 1K33A 1OCRB 1KP3A 4P2ZA 3ZJZA 4U7NA 1EFRG 4BAYA 4MVMA 2XAJA 3JCZA 2JIZG 3OR6C 2QEXV 2QE7G 1V55C 4JTCB 5CBGA 1NKDA 2EIMB 3RVYA 4WFBV 2H94A 2YSUB 5KA6A 1FS0G 4JAVA 3OMAB 3OE7G 3W7SA 3B77A 4F4LA 1ENVA 3SYAA 3K0DA 4WFHA 1QLEC 3X2QC 5IYCO 2X6BA 3VBBA 1YTFB 1FFTB 3LDEA 4I5SA 3T4ZA 1CPYA 1ORQC 1AI6A 2HLDG 3JD1A 1SZTA 3ZRXA 4G2KA 5LBQA 3ZMSA 3JD3A 2OCCC 2WLLB 5L3EA 1YHQV 2WWWA 2DWDC 5LHHA 4Z1MG 1QCEA 3ABKB 4XDKA 3OR7C 1S0VA 4PA4A 4RO2A 1QBZA 4PA9A 1M57C 4ASUG 1EBOA 1YTFD 2IU3A 3MD0A 2C2AA 3TK1A 5LGUA 2DW4A 1H8EG 2B5UA 1PNKA 2WLLA 5IY5B 3AG2B 2WLKA 3AAGA 1DF5A 4MW3A 1P7BA 2Q6AA 1GK9A 1B6QA 4HYOA 1K7DA 2ITDC 3OUFA 5L3CA 2GHYA 3W7WA 4RQFA 2UXXA 5HFLA 1J95A 3E2EA 1K34A 3E83A 4PDVA 5LHIA 1VQLV 1W2BU 1I5XA 3B8MA 3F5WC 1KD1W 1YI2V 3G4SV 1H38A 4I9WA 3AG4C 1K9MW 4R8CA 3AG2C 3E8BA 3K0GA 1RM1B 3ZRVA 4X89A 5EBMC 1M56B 3CCLV 3ZCCA 4MVRA 4ZKIA 1NVPB 1KKDA 3W7XA 3AG3B 3SYQA 4QE7A 5IYBO 2R9IA 1AI7A 2H8PC 3QO7A 3F7VC 2ATKC 3GB7C 1OHHG 4MS2A 4FIPC 5IDJA 3KG2A 1JX9A 2ZQMA 4YXWG 3T1CA 1FXKC 2OT5A 4LP8A 3LUTB 1M56C 1G4YB 4JAUA 3G6EV 4GX5A 4JF3A 1R3JC 2IU0A 1NVPD 1GM9A 5B1OA 3OM3B 3CMAV 1ROPA 3ZN0A 4N21A 3K06A 4U7OA 2JDIG 2Q69A 5GW7A 3CCSV 1NQTA 1VQ4V 1M9NA 4MSWC 4FJCC 3OMNB 1UJWB 2BOBC 1HWYA 1W0KG 1K4DC 3CC7V 4P9OA 1NR1A 2NLJC 5E1AC 1LNQA 2EINB 3AG1B 2V1DA 1AI5A 3B8NA 4BIZA 1R3LC 1W0JG 4PA7A 4UVBA 2XAHA 3G71V 1M90W 5EBLC 1VQMV 2ZXWB 1G8MA 3ZMTA 1AJQA 1FXHA 4XBFA 4JASA 3OEHG 5IYDO 2AHYA 2PI4A 2M7WA 4JTDB 3WG7B 4LCUC 3AEIA 5CA3A 2CK3G 4MTXA 4JTAB 3ABUA 3CCQV 2HR3A 3ZMVA 2P90A 1YJ9V 4G28B 4GX1A 2QM7A 3ETGA 4WFEA 4QPKA 3D3IA 3HPLC 1COWG 5EK0A 1NBMG 3ZIAG 5EBWC 2DYSB 4PDLA 3K79A 1WPXA 4EKWA 1BHBA 5CBFA 2Z3YA 2X6CA 5LHGA 5H9CA 3STZC 3ABMB 3WG7C 1CP9A 1QVFU 1VQ9V 2PI5A 3FB7C 2W6IG 1OCRC 4PA3A 1XL4A 2XNDG 5B1NA 5FL7G 2DWEC 1K97A 3EFFK 4XDLA 4WFAV 5B1AB 3IGAC 1JOYA 3MHHC 2DYSC 2EIMC 4E2LA 4J9YB 4OXSA 3EHBB 1E1RG 1MABG 3VOUA 4MVSA 1Q7YW 3SPCA 5LGTA 3SPGA 2EIJB 2UXNA 3OUSA 3SYOA 3F7YC 3W7UA 1FXVA 4UUJC 1MOFA 1VQ7V 4MW8A 4R50A 1VQNV 3CC2V 2Y48A 2JEUA 3SPHA 1K8AW 3WFVA 2XOKG 1K73W 3ABKC 2P67A 5CN0A 5H6RA 2LFRA 3K9AA 3ZMZA 1PNLA 5HFMA 2HG5C 3OFNG 3CCRV 2IH1C 1H8HG 4HAMA 1M1KW 1CEZA 2JJ1G 3PJSK 2WPDG 1K92A 4TWKA 4QE9A 2X0LA 1GKFA 5IY5C 1QR8A 3H01A 2DQ0A 1THZA 2DQ3A 3LDDA 1YJNV 1NH2D 5B3SB 1AROP 1S5HC 4H33A 4JYCA 3OMIB 1SERA 2YEVB 5KUKA 1SRYA 3FYEB 3ML0A 1JVMA 2WLJA 4GX0A 4JGSA 2WSSG 3CD6V 3ZRWB 3OW2U 1NH2B 1YSCA 4LBEC 3P30A 1S3JA 2IH3C 2B1GA 3GWOA 1VQ5V 3E8GA 1RM1C 2A79B 3CPWU 2IJHA 2HJFC 1I5YA 4LC1A 2XAQA 5H6QA 4L87A 3E35A 2AHZA 3FB5C 1GTOA 3LSQA 3AG3C 3M99B 2YEVA 2JJ2G 3JYCA 3SYCA 1GMGA 1GM8A 5J9PC 3CMEV 2W0FC 3RBZA 2P6JA 3ZRWA 4MTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBQ A;  3ZMS A;  1E79 G;  3FKS G;  3ZMT A;  4XBF A;  5L3E A;  3OEH G;  3ZN1 A;  2CK3 G;  3ABU A;  4Z1M G;  5LHH A;  3ZMV A;  2V7Q G;  4KUM A;  1COW G;  1NBM G;  3ZIA G;  4ASU G;  5LGU A;  1BMF G;  2F43 G;  2IW5 A;  2Z3Y A;  2DW4 A;  1H8E G;  5LHG A;  2HKO A;  4UVA A;  2W6I G;  2XND G;  5L3C A;  5FL7 G;  2UXX A;  4TSF G;  5LGN A;  5LHI A;  1E1R G;  1MAB G;  5LGT A;  1E1Q G;  3ABT A;  5L3B A;  2EJR A;  2UXN A;  4UXN A;  4TT3 G;  2R9I A;  2Y48 A;  2XOK G;  5H6R A;  1OHH G;  3ZMZ A;  2XAF A;  3OFN G;  4YXW G;  1H8H G;  2JJ1 G;  4UV9 A;  3OAA G;  2WPD G;  2Z5U A;  4UVC A;  5DN6 G;  2X0L A;  5L3F A;  3ZN0 A;  3OEE G;  2JDI G;  2XAS A;  2XAG A;  2W6J G;  4UV8 A;  5L3D A;  4CZZ A;  2WSS G;  1EFR G;  4BAY A;  1W0K G;  2XAJ A;  2JIZ G;  2QE7 G;  5L3G A;  2XAQ A;  5H6Q A;  3ZMU A;  2H94 A;  2V1D A;  1FS0 G;  3OE7 G;  2JJ2 G;  1W0J G;  4UVB A;  2XAH A;  2HLD G; 
#chains in the Genus database with same CATH topology
 1LUV A;  2A9H A;  3ZN1 A;  1Q6U A;  4MVZ A;  3BA9 A;  4RPP A;  1SET A;  4QNH B;  4JYA O;  3RYC A;  3DTU B;  3CRA A;  2ZDI C;  2ZDI A;  4WCE V;  2CTP A;  3JAK A;  4BW5 A;  1PL0 A;  2ZCE A;  1SQG A;  3K3W A;  4B7K A;  3GWK C;  5KHH A;  1JA8 A;  4LF4 B;  2BTQ A;  1Q6I A;  4O4H A;  2EUL A;  3RYH B;  1KP2 A;  4IGG A;  3K57 A;  4P9P A;  5K1P A;  2HVJ C;  2ZNI A;  1XNQ B;  1T5A A;  1I08 A;  3IC7 A;  2UXB B;  2ZD9 A;  1IXM A;  3CCV V;  4JYB A;  3RVZ A;  1GM7 A;  3WB2 A;  1P49 A;  1NU1 H;  1LR1 A;  3RYF B;  2ZXW C;  3M8A A;  2Q7G A;  3ASO C;  1VQ6 V;  1XMQ B;  3EOE A;  1XOU A;  4DK1 A;  4LFC B;  1A5U A;  1AI4 A;  1KEC A;  2ZE8 A;  2ZE5 A;  1A3X A;  2XAF A;  4LF4 O;  1F51 A;  3RN4 A;  2P4K A;  4WFF A;  4JI2 B;  1E0T A;  5A9G A;  1BQZ A;  3BY6 A;  5DN6 G;  4K0K O;  1YZB A;  1L1F A;  1VQK V;  1AJN A;  2BSK B;  1XNQ O;  3MHS C;  4MVO A;  3UCS C;  2XAG A;  1OV9 A;  3N2K B;  5DM6 V;  4GKK O;  5L3G A;  1OCZ C;  3CCJ V;  3SPJ A;  1KB9 F;  1ZX3 A;  3ZMU A;  2QA4 V;  3BAA A;  4GKJ O;  1WPB A;  3Q4H B;  1HR0 B;  3ETE A;  4D6T H;  1WLE A;  3ZRS A;  2Q4P A;  5IJ0 A;  1WB7 A;  1SQV H;  4PDR A;  2Q67 A;  1QR9 A;  1FXK B;  4O4J A;  4O4L A;  4MVQ A;  2X7R B;  2P5O A;  4FZ0 A;  1BMF G;  4DRX A;  3OGC C;  1SS3 A;  1QNM A;  3SRD A;  3T0T A;  2DE0 X;  4DV7 B;  1WN7 A;  5BXZ A;  4RAI A;  3CRC A;  5BZB A;  4CC6 A;  1R73 A;  4PJ0 Z;  5J2T B;  3CRM A;  4WBN B;  1BS3 A;  4I55 B;  5GON A;  2F66 C;  1ZAU A;  2WLM A;  3E8H A;  4GX2 A;  4MVU A;  3ABT A;  5L3B A;  3CCE V;  3E89 A;  3E0W A;  3HKE A;  3RFR A;  2DYR C;  4W4L A;  1MMM A;  2EIK B;  3ZX6 A;  4ZBM A;  3ASN C;  2F4V B;  4FLZ A;  4KP4 A;  3FD9 A;  2ZE7 A;  4DV7 O;  2GSM B;  3K9S A;  1N34 B;  3JAS B;  3JAW B;  5LP6 C;  5LYJ B;  5H2F Z;  1RPO A;  2VWK A;  3CC4 V;  3CHX A;  3ZHV A;  4BW9 A;  1YIT V;  1GO3 F;  4NXN B;  3BA8 A;  4X1I A;  3STL C;  3PN1 A;  1KUQ A;  1RFY A;  1K33 A;  3UM7 A;  1OCR B;  4JI6 B;  1JJO A;  1X4T A;  3JAM N;  2XAJ A;  3NR7 A;  4UCO A;  3CJH A;  1QU7 A;  2XT9 A;  3WB0 A;  2F4V O;  1FS0 G;  3ZHT A;  3OE7 G;  4DUZ O;  3B77 A;  3C3T A;  4WFH A;  1QLE C;  3QVN A;  2X6B A;  1NI8 A;  1YTF B;  1FFT B;  3LDE A;  2EJ7 A;  4I5S A;  1CPY A;  4QGP A;  1AI6 A;  2HLD G;  3JD1 A;  1YDX A;  5L3E A;  3DC5 A;  5KHI A;  5D5P A;  1FAF A;  1Z5V A;  4D7S A;  3ABK B;  2UU9 B;  4RO2 A;  4ASU G;  1EN5 A;  1LUW A;  4JI6 O;  3D3Q A;  5EYP B;  4X1Y B;  5LGU A;  3IJ4 A;  1PKL A;  1H8E G;  2WLL A;  1PNK A;  3G6B A;  4KCW A;  1WNS A;  2ZNJ A;  3AG2 B;  1DF5 A;  4O2B B;  4JPG A;  3OTO B;  2VS0 A;  2UXX A;  5JJE B;  1K34 A;  4PDV A;  3AK2 A;  1W2B U;  3B8M A;  5IT9 N;  3HKD A;  4DUY B;  1KD1 W;  1H38 A;  5LA6 A;  2RMK B;  4R8C A;  3ZS8 C;  1RM1 B;  4EFE A;  3ZCC A;  3CB2 A;  4YY3 B;  4MVR A;  2UU9 O;  1NVP B;  1SC5 B;  3W7X A;  3AG3 B;  2E75 B;  4X1K B;  2H8P C;  3C3S A;  2JS5 A;  3HQP A;  4MS2 A;  5IDJ A;  4FIP C;  3KZI Z;  4KRZ A;  4X64 B;  2UUC O;  2ZQM A;  4LP8 A;  4GLX A;  1M56 C;  1G4Y B;  4DV4 O;  4JAU A;  1DK1 A;  2IU0 A;  1FYJ A;  2Q0O C;  3GR4 A;  4DUY O;  1VMG A;  3CCS V;  2GUZ A;  4G1N A;  1UJW B;  1HW7 A;  2BOB C;  3M7M X;  4AHC A;  1W0K G;  3LSU A;  4DV2 O;  5F2V O;  4HYW A;  2E74 B;  1QQC A;  4O2A B;  3QV9 A;  1VIB A;  1R3L C;  2YXY A;  4NXM B;  2A7W A;  2VQE B;  3G71 V;  4A5U B;  2ZXW B;  1IBL B;  3WG7 B;  4JTD B;  2CK3 G;  2XHB A;  4MTX A;  4G28 B;  1AP5 A;  3D3I A;  5EK0 A;  3BCC H;  1NBM G;  4PDL A;  5CB4 B;  5JH7 A;  4EKW A;  5GTH Z;  4FXF A;  4DV6 B;  1MSD A;  1XNR O;  2YI8 A;  1XUQ A;  1I0H A;  5B1N A;  3S3W A;  2CH7 A;  4NXM O;  4FVM A;  4XDL A;  4TOI A;  3TGU H;  2EIM C;  2W0X A;  4X65 O;  1Y76 A;  2QJ1 A;  1Q7Y W;  4MVS A;  4B3S B;  1FFX B;  3SPC A;  5LGT A;  4J80 A;  2MW2 B;  1JFF B;  4IHJ B;  1H2S B;  2VRZ A;  3OUS A;  4FFB A;  3W7U A;  5JQG B;  1Q43 A;  5H5N A;  3JAR B;  4E4E A;  5LOV B;  2L35 A;  2CGO A;  4DV6 O;  4B3M O;  3CCR V;  5ITZ B;  3T07 A;  2QDO A;  2BSK A;  4D7T A;  3BFR A;  1GKF A;  3BVO A;  5IY5 C;  3T1Y B;  4IYI A;  1QR8 A;  4ZOL B;  2AGA A;  1IBM B;  2DQ3 A;  3LDD A;  3A2F A;  4JYC A;  3FYE B;  2ILM A;  4FM0 A;  1YSC A;  1R6T A;  1GRJ A;  2YUA A;  2IH3 C;  2Q7H A;  2B1G A;  5KAI Z;  1S5L Z;  2A79 B;  4IT5 A;  3ZHQ A;  4ZIB A;  2GTA A;  1URF A;  1GTO A;  3LSQ A;  2LW7 A;  5JVD B;  4H13 B;  1WJZ A;  5J9P C;  3CME V;  3SJC C;  2ZKO A;  3T1Y O;  4C7U A;  3WB1 A;  4Q20 A;  3BJF A;  4J9Z B;  1SA0 B;  2RDC A;  4FFK A;  1RP3 B;  3APQ A;  2DYR B;  3KHD A;  1YIJ V;  1OJH A;  1F23 A;  3ASN B;  2RN9 A;  2B1I A;  2ADQ B;  2WLN A;  3AK1 A;  4TUY B;  1OZ0 A;  3ETD A;  4KFM A;  1BE3 H;  2GBO A;  5IJ9 B;  5KHK A;  3L9D A;  3DGE A;  1YJW V;  5B1B B;  3E22 A;  4BIU A;  1JQ0 A;  4I55 A;  3JAT B;  5LGN A;  1QHT A;  1JCH A;  2EIN C;  2F93 B;  4DXW A;  3AG1 C;  3QV7 A;  4LFB B;  1GAX A;  3ABL B;  3TJT A;  1S72 V;  4OX9 O;  4DYL A;  1Y74 B;  5CMU A;  5IWA B;  3KTX A;  1DF4 A;  3LSS A;  1Y66 A;  4LF5 B;  5JCO C;  1PD3 A;  4I4T B;  5KUM A;  1BSM A;  5J2U A;  4LF6 B;  3OTF A;  3A0R A;  1DLB A;  1QLE B;  3SPI A;  1VQ8 V;  2WLI A;  1FJG B;  2CAZ C;  4CS4 A;  1AIL A;  1XDC A;  1N33 B;  1IVS A;  1V54 C;  3JAW A;  1PKX A;  4UV9 A;  3K5L A;  1FKA O;  3ABM C;  3T2M A;  1MA1 A;  4CS3 A;  2W6J G;  5BMV B;  2G38 A;  3FAV A;  1MZE A;  1SQX H;  1PNM A;  1PKM A;  1AR4 A;  1BGY H;  4DR4 B;  1MSW D;  1FJG O;  2EZO A;  1D5N A;  1O9H A;  4BIO A;  5EZY B;  2EZP A;  4DR6 B;  2PGG A;  3W7T A;  1TA8 A;  1H2G A;  2FB5 A;  4KHP B;  2P4V A;  2EIL B;  3L70 H;  3H1J H;  3RW0 A;  4JYA B;  2Y4T A;  1N36 B;  1Q8I A;  1F4N A;  3VQY A;  1V9P A;  2NN4 A;  1X59 A;  1WAZ A;  1K4C C;  1AVM A;  4KUM A;  4EB6 B;  4RUE A;  4HNA B;  4DR4 O;  2ZT9 B;  1WA8 B;  4NTW A;  2IW5 A;  1K5S A;  5LXT B;  4DR6 O;  2JS3 A;  1R3K C;  1DTO A;  2YI9 A;  4NKG B;  4KHP O;  2JGD A;  3KKY A;  3I56 V;  2UUB O;  4TV8 B;  2QSA A;  4ZI7 A;  1N36 O;  1AJP A;  4X1K A;  1Q81 W;  1TUE B;  1WP7 A;  4WF9 V;  1R3I C;  3FYI B;  1ZTE A;  4GCZ A;  4YJ3 B;  2PYL A;  2D3O W;  4GT1 A;  4DR3 B;  3RWR D;  4DR1 B;  1KMI Z;  4K0K B;  4X9Q A;  1OCO B;  2Y69 B;  2ITC C;  1PKN A;  4UVC A;  4FM1 A;  4DRS A;  1XEQ A;  4FK5 C;  4IIJ B;  4TV9 B;  2Q7E A;  1BHA A;  3UO3 A;  3P32 A;  2QM8 A;  2XAS A;  4ICG A;  2YXH A;  4PDM A;  1EZJ A;  2N05 A;  3B2E E;  3QF7 A;  3QNE A;  1QLN A;  4N23 A;  4GKK B;  1N8R W;  4B3T B;  2LQT A;  1GN2 A;  1G6U A;  1L0L H;  1EFR G;  4O2A A;  4GKJ B;  3OR6 C;  2QE7 G;  1V55 C;  3DSQ A;  4DR3 O;  5CBG A;  1NKD A;  2EIM B;  1FPO A;  3RVY A;  2H94 A;  4WFB V;  2YSU B;  4DR1 O;  2M6Y A;  1HNX B;  4NYK A;  3W7S A;  4F4L A;  3SYA A;  3X2Q C;  1WB8 A;  2AXT Z;  3T4Z A;  1ORQ C;  3B40 A;  3UT5 A;  3GG8 A;  3ZMS A;  2OCC C;  3U11 A;  1ZSP A;  3H1I H;  2Q73 A;  3DXR A;  5CA1 A;  4XDK A;  2Y0P A;  4PV1 B;  4B3T O;  3H1L H;  4UB6 Z;  4LF9 O;  2IU3 A;  4UCR A;  3MD0 A;  2C2A A;  4FLV A;  3A0B Z;  4I0X B;  2DW4 A;  5IY5 B;  4NB5 A;  1M4U A;  3ETQ A;  2Q6A A;  1HNX O;  1K7D A;  1US6 A;  2GHY A;  4RQF A;  4FLW A;  5HFL A;  2IM9 A;  2KQX A;  2XTA A;  3F5W C;  1TAE A;  1NTM H;  3G4S V;  3E8B A;  1GN3 A;  3T1H O;  4CC5 A;  4DV3 O;  2KG7 A;  1KKD A;  3SYQ A;  4QE7 A;  3IC9 A;  4UFZ A;  2JRI A;  1OHH G;  4LNU A;  4JI7 O;  2QKC A;  2F23 A;  4U3J B;  5KLV H;  2QR4 A;  4JI8 O;  2RNB A;  1YVW A;  1GM9 A;  2LJ2 A;  2EX3 A;  3CMA V;  2DMX A;  4N21 A;  4U3F H;  4CH5 A;  1ZL8 B;  3UQ8 A;  3K06 A;  2JDI G;  2Q69 A;  1XRE A;  2PTM A;  4UCT A;  3TXQ A;  3OT7 A;  4LR3 A;  3RT3 C;  3G2G A;  4MSW C;  3HKB B;  4FJC C;  3OMN B;  4YJ2 A;  3EVK A;  3N2G B;  4WJ8 A;  1VP8 A;  4P9O A;  4DUZ B;  4UCV A;  2EIN B;  3SRK A;  3HKC A;  3AG1 B;  5C8Y B;  1TUB A;  3IAY A;  1T5E A;  4BIZ A;  5FNV B;  4PA7 A;  4Z2W A;  2XAH A;  4ZHQ B;  2K9P A;  1M90 W;  1AB3 A;  1P7G A;  4K3A A;  3OEH G;  4O4I B;  4DR2 O;  4LCU C;  5CA3 A;  3ABU A;  3CCQ V;  3ZMV A;  4CS2 A;  4GX1 A;  2QM7 A;  2Z0A A;  1N0J A;  4QPK A;  1COW G;  5EBW C;  2DYS B;  5TIS Z;  3APO A;  5KMG A;  3K79 A;  4DV5 O;  1WPX A;  5CBF A;  4W4K A;  4I50 B;  4J7J A;  3ABM B;  1QVF U;  4J42 A;  1I94 O;  5FL7 G;  1KU9 A;  5LMN O;  3IGA C;  4E2L A;  4OXS A;  3CSX A;  2PZS A;  2ZE6 A;  1MAB G;  3VOU A;  3QV8 A;  3RYI B;  4JI1 B;  2PF4 E;  4KXR A;  2OCH A;  3SPG A;  1F7Y A;  2E28 A;  2UXN A;  1FXV A;  2ETN A;  3A0H Z;  1MOF A;  2YIB D;  1IUR A;  4R50 A;  2UUC B;  3LNN A;  2JEU A;  3SPH A;  2QWQ B;  1DGS A;  4DV4 B;  5H6R A;  1K73 W;  2CGN A;  2HG5 C;  3OFN G;  1VEW A;  2JJ1 G;  2AW9 A;  2VGF A;  3IS4 A;  2R9A A;  1GN6 A;  4X20 B;  2X0L A;  4JI0 O;  1O9G A;  3J80 N;  3J81 N;  4JI1 O;  2FL4 A;  4H33 A;  3OMI B;  2YEV B;  4LWS A;  4DV2 B;  2JVD A;  4GX0 A;  2WSS G;  2R72 A;  3QV6 A;  3GWO A;  4AIL C;  1VQ5 V;  1SKV A;  2HJF C;  1B06 A;  2XAQ A;  3E35 A;  2AHZ A;  1SF9 A;  3FB5 C;  3RYC B;  3F5T A;  1F3W A;  2JJ2 G;  2RQ6 A;  3JYC A;  4JI5 O;  2W0F C;  4JAA A;  1IDS A;  1TVK B;  3JAK B;  3RBZ A;  2P6J A;  4AQY O;  3ZRW A;  1NH2 D;  4QPJ A;  4PEL A;  4QJF B;  3SJQ C;  4ABM A;  2BTQ B;  4O4H B;  3B4S A;  2UXD B;  3H1K H;  4CH3 A;  1WA8 A;  4IYH A;  4K8X A;  3BEH A;  1VQO V;  1XNR B;  2N74 A;  4JI3 O;  3I5D A;  2Q5Z A;  5CA0 A;  1Q86 W;  3L74 H;  2VQF O;  2MK3 A;  3QTG A;  2A06 H;  4X65 B;  1CXZ B;  4IMA A;  3ASO B;  4JPR A;  1EN4 A;  5FPO A;  1Y4M A;  2KSD A;  3L73 H;  1B3Q A;  2LW1 A;  4MT8 A;  3E86 A;  1NR7 A;  4JZ2 A;  4AI8 A;  1NTK H;  1PP9 H;  2KKW A;  4H37 A;  3ME3 A;  1E1Q G;  2UXC O;  1R6N A;  2QWO B;  2UXD O;  1IBK O;  3QG5 A;  4R6Z A;  4R7C A;  3K5N A;  3RYH A;  2UUA O;  4B3M B;  2CTW A;  4P30 A;  3TXS A;  3U10 A;  2EBO A;  2OCC B;  3RYF A;  5IE9 A;  3AK3 A;  3ZHU A;  3S3X A;  1N0N A;  5L3F A;  4FLX A;  2ZIN A;  4QIW F;  1OCZ B;  1J5E B;  5C93 A;  1S77 D;  3D36 A;  2PUS A;  2E5L O;  3CYO A;  1R6K A;  3E0V A;  3LNM B;  4X62 B;  4YNG A;  5KA5 A;  3EXA A;  3SR2 C;  1D2D A;  3U2Z A;  2ZR2 A;  5IJ0 B;  3FB6 C;  2IBZ H;  2OYQ A;  1JPX A;  1BT8 A;  1B04 A;  1TGO A;  4YJ5 A;  1MZF A;  3UKM A;  4O4L B;  3KCX A;  1HDJ A;  3N2K A;  2OTL V;  5EC1 C;  1T57 A;  4BWA A;  1E79 G;  3FKS G;  4DRX B;  4FLY A;  2LP7 A;  1J5E O;  2H3O A;  2Q9L A;  4J11 A;  3T4D A;  2V7Q G;  4X62 O;  4I0X A;  4X66 O;  1QVG U;  3Q4H A;  5B3S C;  4H44 B;  5GON B;  2GDS A;  2KB1 A;  4PA6 A;  1VQP V;  4JV5 O;  5B66 Z;  1S76 D;  3CCM V;  5D5Q A;  1BL8 A;  3SRH A;  4Z1V A;  5DEC A;  3HKE B;  4OX9 B;  5KHG A;  5E79 Z;  1FXK A;  5FPR A;  2VGG A;  2ZIM A;  2L6L A;  3E8F A;  2OIE A;  1ZWI C;  4G27 B;  3CCU V;  1Z5W A;  3K08 A;  3L72 H;  4NTY A;  3J7A U;  3AG7 A;  2P7T C;  1XL6 A;  4TT3 G;  5LP6 B;  5J2T A;  1Q82 W;  1PKY A;  4WBN A;  2D2C B;  4U3J A;  2LFS A;  1H2L A;  5CBH A;  1A3W A;  2YDE A;  4X1I B;  2O57 A;  4DO2 A;  4J41 A;  3CXC U;  4H0L B;  4RUF A;  1OCC C;  3HR0 A;  3CJH B;  2EIK C;  1EN6 A;  3OGI B;  5B5E Z;  2Y4U A;  3N2G A;  3VQW A;  2VGI A;  4KS0 A;  2JK5 C;  2CUG A;  3HQO A;  1XHX A;  1KP3 A;  3ZJZ A;  4MVM A;  3JAS A;  2WA4 A;  3JCZ A;  4DW1 A;  5LYJ A;  5KX5 B;  1ZLZ A;  1M93 A;  1W59 A;  3OMA B;  4B08 A;  3ZRX A;  4G2K A;  3JD3 A;  4JI4 O;  2WLL B;  4EFB A;  1RSO B;  1YHQ V;  2WWW A;  2DWD C;  5LHH A;  5EIB C;  5GTI Z;  3JCU Z;  4DV0 O;  1QCE A;  4PA4 A;  4PA9 A;  2CE4 A;  1M57 C;  3GVM A;  4DR7 B;  3HKD B;  1VP7 A;  3TK1 A;  2PYJ A;  5LA6 B;  3CXH F;  3H9V A;  3P3P A;  2B5U A;  3AAG A;  2WLK A;  1B6Q A;  1GK9 A;  3OUF A;  3W7W A;  2UUB B;  4IL6 Z;  1J95 A;  1VQL V;  5EYP A;  4X1Y A;  2YXL A;  4I9W A;  1KBH A;  3AG4 C;  1K9M W;  3AG2 C;  3ZRV A;  4X89 A;  4O2B A;  4F6E A;  5EBM C;  1M56 B;  3SRF A;  2R70 A;  4ZKI A;  3OD4 A;  2GV9 A;  1HNW O;  1H2M A;  4DR7 O;  5IYB O;  1L8D A;  1AI7 A;  2ATK C;  4UCU A;  3GB7 C;  3KG2 A;  3CWB H;  1JX9 A;  3BRC A;  4YXW G;  2GUZ B;  3LUT B;  1BZK A;  1Y67 A;  3BAB A;  3G6E V;  1VF7 A;  4I9Q A;  4JF3 A;  1IXB A;  1R3J C;  3ZHR A;  1G1X B;  1ZUQ A;  2YIA A;  3H6O A;  1ROP A;  3ZN0 A;  4U7O A;  2ZM6 O;  1YXB A;  4OPH A;  3CE2 A;  1HP8 A;  4UCS A;  1NQT A;  1P84 F;  1XI1 A;  1XMO O;  1HWY A;  4CH6 A;  3CC7 V;  1VF6 C;  4OGQ B;  1VF6 A;  2HJD A;  2NLJ C;  4LF8 B;  1R1B A;  1TVK A;  5BR8 B;  1AI5 A;  4I7Z B;  4DR5 O;  3B8N A;  1ZJH A;  1SQB H;  4LFA B;  1W0J G;  5JH7 B;  5IYZ B;  4KL1 A;  1AJQ A;  5IYD O;  2PI4 A;  2M7W A;  3AEI A;  1E0U A;  4LF9 B;  2HR3 A;  1XIL A;  2CH7 B;  2P90 A;  2ODM A;  3ETG A;  3HPL C;  5A2Q N;  2Y0I A;  1Y76 B;  1BHB A;  2Z3Y A;  4LF8 O;  2X6C A;  5LHG A;  3STZ C;  3WG7 C;  5BR8 O;  1YCI A;  4F6R B;  1VQ9 V;  2PI5 A;  3K59 A;  3FB7 C;  2W6I G;  1I7F A;  4FFB B;  4PA3 A;  3EFF K;  2QGN A;  4LFA O;  1M5I A;  4BR6 A;  3U0Z A;  4J9Y B;  5CB4 A;  1E1R G;  3T1H B;  4DV3 B;  3GQY A;  2RJZ A;  2DJV A;  3SYO A;  3F7Y C;  2UXB O;  4UUJ C;  4B2D A;  1VQ7 V;  3K5M A;  2HEP A;  2AZ0 A;  1VQN V;  5AG2 A;  3CC2 V;  1L0N H;  1EM1 A;  1K8A W;  4JI7 B;  1GH6 A;  3WFV A;  2P06 A;  1XMQ O;  1FFX A;  4JI8 B;  3K9A A;  1PNL A;  4LFC O;  2IH1 C;  1H8H G;  1JFF A;  1Q5O A;  4IHJ A;  3PJS K;  4KCV A;  2WPD G;  1K92 A;  4TWK A;  4QE9 A;  1Q90 D;  1N4C A;  4Q6G A;  1PV0 A;  5JQG A;  4JI2 O;  4QG6 A;  2DQ0 A;  3VQV A;  3T05 A;  3JAR A;  5KAF Z;  5B3S B;  3QTC A;  5LOV A;  3SDL A;  4GZR B;  4YHH B;  5KUK A;  1SRY A;  3JSN A;  3ML0 A;  3R66 A;  2WLJ A;  5ITZ A;  4FXJ A;  1NH2 B;  1S3J A;  3E8G A;  1XBL A;  3CPW U;  4ZOL A;  2IJH A;  4LC1 A;  2RCV A;  5H6Q A;  2ADP A;  1AQF A;  2G50 A;  2HP8 A;  1GM8 A;  4DR2 B;  1JR9 A;  4MTO A;  3JD4 A;  2VWJ A;  3C90 A;  1HR0 O;  2NR5 A;  3E22 B;  4YHH O;  3JD0 A;  3H1H H;  4MTF A;  4DV5 B;  1D5A A;  5JVD A;  4RQE A;  3ZHS A;  1MG1 A;  3L71 H;  1NZ6 A;  2CTR A;  1I94 B;  4QGC A;  1JJ2 U;  3K04 A;  1SA0 A;  1U96 A;  1OCC B;  2WA3 A;  5LMN B;  4FZ1 A;  5J2U B;  3SYP A;  5LMU B;  4TUY A;  2E76 B;  3QO5 A;  3TET A;  2WLI B;  2QTS A;  1GN4 A;  3THO A;  5IJ9 A;  2ZIO A;  2BTO A;  3TCU A;  3DC6 A;  1V54 B;  5B1B C;  1UPG A;  5LP6 A;  2IJI A;  3FB8 C;  2FKX A;  1PL4 A;  3JAT A;  3LDC A;  1AP6 A;  2QM4 A;  4X8A A;  2Q68 A;  4RWU A;  3JAL B;  2GTS A;  4GUN A;  2JGU A;  3ABL C;  1Q3E A;  2R9R B;  4TQD A;  1FD9 A;  1Y74 A;  4FMT A;  4MTG A;  4JI0 B;  3FAV B;  2Z5U A;  3P3N A;  1K5Q A;  5LMU O;  4I4T A;  4FPP A;  3I55 V;  2Q8V A;  1M57 B;  2CDY A;  2DN9 A;  3OEE G;  2QTO A;  1N34 O;  1YF2 A;  1AR1 B;  2YIC A;  1NJI W;  5B1A C;  4CBC A;  2FYU H;  1RPR A;  4UV8 A;  5L3D A;  2ZR3 A;  3D8C A;  5KX5 A;  2JEX A;  4FM2 A;  2HFE C;  4JZG A;  1F4M A;  1K3E A;  4NXN O;  2IJK A;  4WFG A;  2VGB A;  4UB8 Z;  2EIJ C;  1VAR A;  4JI5 B;  4HZ3 A;  3K03 A;  5DED A;  1KC8 W;  4AQY B;  3CEI A;  2A0L A;  3AG4 B;  3CP1 A;  4DV1 B;  1Y6X A;  5BMV A;  3VQX A;  1RSO A;  3FFQ A;  3HQN A;  4KCU A;  3MDS A;  5EC2 C;  1S5J A;  3QO8 A;  4J10 A;  2HVK C;  1Z2G A;  1SQP H;  2X6A A;  3IFX A;  5EZY A;  2Q0A A;  4JI3 B;  3JSL A;  4QG8 A;  2JGD B;  5K1X A;  2VQF B;  2IJJ A;  2EIL C;  4XDJ A;  2F43 G;  1KQS U;  4ZI7 B;  1SQF A;  2OTJ V;  3NXS A;  2HKO A;  1SES A;  3G80 A;  4UVA A;  2BOC C;  4GYC B;  3ICX A;  3R65 A;  2BE3 A;  4DV1 O;  2K1E A;  4TSF G;  4EB6 A;  2UXC B;  4HNA A;  3B09 A;  1SQQ H;  3OTO O;  2B9Z A;  1IBK B;  1IX9 A;  4FLT A;  1XQ8 A;  2WAM A;  2F95 B;  5LXT A;  2UUA B;  2EJR A;  2QKA A;  4JYY A;  1UFI A;  4UXN A;  2YS8 A;  3SJA C;  4YY3 O;  3JD2 A;  4TV8 A;  4X88 A;  1P4R A;  3OAA G;  2QKS A;  2FTK A;  3HB3 B;  4X64 O;  2E5L B;  2NNU A;  1BCC H;  1PPJ H;  2WLH A;  3G67 A;  1V55 B;  2DOS A;  4YJ3 A;  1JMK C;  4J7Z A;  4PHZ A;  3CRR A;  3X2Q B;  1OCO C;  2Y69 C;  4OPA A;  4CZZ A;  3UT5 B;  4P2Z A;  5JJN B;  4U7N A;  4BAY A;  2JIZ G;  2QEX V;  4TV9 A;  4IIJ A;  3SGI A;  4JTC B;  5KA6 A;  3DXR B;  2HHH B;  1N32 B;  3N25 A;  5CA1 B;  4JAV A;  5IYZ A;  1F3X A;  1ENV A;  3K0D A;  5IYC O;  3VBB A;  3D36 C;  3N27 A;  1SZT A;  5LBQ A;  3ZBH A;  2YID A;  2VQE O;  1EZV H;  4X66 B;  4TQF A;  1U97 A;  1IBL O;  4Z1M G;  5EIB D;  2QWN B;  3OR7 C;  5KHJ A;  1S0V A;  1QBZ A;  4JV5 B;  3CS5 A;  3WU2 Z;  1EBO A;  1NTZ H;  1YTF D;  4PI2 A;  4F6R A;  1Q6H A;  3UO2 A;  2YIB A;  4MW3 A;  2HHH O;  1P7B A;  4O4J B;  1N32 O;  4HYO A;  1WP8 A;  2ITD C;  5L3C A;  2KG7 B;  3E2E A;  3E83 A;  2ARH A;  5LHI A;  3MAQ A;  1I5X A;  1YI2 V;  4LNU B;  3K0G A;  4NR1 A;  3CCL V;  4B3S O;  3FX7 A;  1NS1 A;  2PY5 A;  2N04 A;  3K58 A;  2R9I A;  4NVP A;  3QO7 A;  3F7V C;  2QWR B;  1HNZ B;  4HYV A;  3T1C A;  1FXK C;  2OT5 A;  1VF5 B;  4IP7 A;  4YJ2 B;  5LL6 Y;  4GX5 A;  1NVP D;  5B1O A;  3OM3 B;  1SZX A;  4DK0 A;  3KCY A;  3CX5 F;  3HKC B;  4NTX A;  1PM9 A;  1TUB B;  2AZ2 A;  5JWP A;  3ZED A;  5GW7 A;  1BQ0 A;  1IBM O;  4PI0 A;  4LF7 B;  1VQ4 V;  4YIP A;  3O65 A;  1M9N A;  3A8T A;  2FML A;  1K4D C;  1NR1 A;  1MNG A;  2YC0 A;  1HNZ O;  5E1A C;  1LNQ A;  1ZL8 A;  3BHP A;  2V1D A;  4YIO A;  4B3R B;  1AR5 A;  4JI4 B;  4CH4 A;  2A3Q A;  1IZ3 A;  4UVB A;  2E3C A;  5KMG B;  3HKB A;  5EBL C;  1VQM V;  1G8M A;  3ZMT A;  1FXH A;  4XBF A;  2LGQ A;  4JAS A;  4DV0 B;  4DW0 A;  2AHY A;  2F1M A;  4K8Z A;  5C8Y A;  4JTA B;  2LGW A;  4LF7 O;  1YJ9 V;  4WFE A;  3ZIA G;  5FNV A;  1A49 A;  4ZHQ A;  3O9O A;  5JCO A;  3K5O A;  4O4I A;  5H9C A;  1CP9 A;  4B3R O;  5BY1 A;  1H2N A;  1OCR C;  1XL4 A;  2XND G;  2DWE C;  4J7K A;  1K97 A;  2CTQ A;  4WFA V;  5B1A B;  1XHZ A;  1JOY A;  3MHH C;  2DYS C;  4B7E A;  3EHB B;  3MA8 A;  2P22 C;  4I50 A;  1HNW B;  2EIJ B;  3JAL A;  5JJJ B;  1H2K A;  4LFB O;  5IWA O;  4B2D D;  4K35 A;  4MW8 A;  4HBN A;  4L8J A;  4LF5 O;  2Y48 A;  2XOK G;  4LF6 O;  3BPZ A;  3ABK C;  2P67 A;  5CN0 A;  3BJT A;  2LFR A;  2BCC H;  3RYI A;  3ZMZ A;  1NT2 B;  5HFM A;  5FLX N;  4LWS B;  3PP7 A;  4HAM A;  1M1K W;  1CEZ A;  2XUM A;  1YEW A;  1N33 O;  2ZM6 B;  1KKC A;  3L75 H;  1A32 A;  3H01 A;  1THZ A;  1YJN V;  1ARO P;  1KYO F;  2LO1 A;  1S5H C;  1SER A;  4QG9 A;  2OIG A;  1XMO B;  1JVM A;  4JGS A;  3CD6 V;  3ZRW B;  3OW2 U;  4LBE C;  3RGB A;  3P30 A;  4X20 A;  4LH7 A;  4LH6 A;  4DR5 B;  1RM1 C;  2OWO A;  1I5Y A;  4PD4 F;  4L87 A;  4FLU A;  4EEQ A;  3SJB C;  2QWP B;  3AG3 C;  2V4D A;  3M99 B;  2YEV A;  3CRQ A;  3SYC A;  1GMG A;  4KCT A;  5CA0 B; 
#chains in the Genus database with same CATH homology
 3JD4 A;  2A9H A;  4QPJ A;  3ZN1 A;  4PEL A;  4Q20 A;  4QJF B;  4J9Z B;  4MVZ A;  3SJQ C;  2DYR B;  1SET A;  4QNH B;  3JD0 A;  3DTU B;  1YIJ V;  2ZDI C;  4MTF A;  1F23 A;  2ZDI A;  3ASN B;  4WCE V;  2B1I A;  2WLN A;  1OZ0 A;  3BEH A;  3ETD A;  4KFM A;  4RQE A;  1VQO V;  4BW5 A;  1PL0 A;  1MG1 A;  3K3W A;  1Q86 W;  1JJ2 U;  3K04 A;  2MK3 A;  1OCC B;  3DGE A;  5B1B B;  4BIU A;  1YJW V;  1JQ0 A;  3ASO B;  4JPR A;  1KP2 A;  3SYP A;  1Y4M A;  5LGN A;  1JCH A;  3QO5 A;  4MT8 A;  2EIN C;  3E86 A;  4P9P A;  4DXW A;  2HVJ C;  3TET A;  1NR7 A;  3AG1 C;  2WLI B;  3ABL B;  1S72 V;  3IC7 A;  2ZD9 A;  4H37 A;  1IXM A;  5CMU A;  3TCU A;  3CCV V;  4JYB A;  1E1Q G;  3RVZ A;  1DF4 A;  1V54 B;  3LSS A;  1GM7 A;  1R6N A;  1Y66 A;  5B1B C;  2IJI A;  3FB8 C;  2ZXW C;  3LDC A;  4R6Z A;  4R7C A;  3ASO C;  1PD3 A;  1VQ6 V;  5KUM A;  4X8A A;  2Q68 A;  3A0R A;  1DLB A;  1QLE B;  3SPI A;  1AI4 A;  1KEC A;  2WLI A;  4P30 A;  1VQ8 V;  3ABL C;  2R9R B;  2XAF A;  2EBO A;  2OCC B;  1F51 A;  1V54 C;  4FMT A;  4MTG A;  1PKX A;  4WFF A;  4UV9 A;  2Z5U A;  3BY6 A;  1K5Q A;  5DN6 G;  1L1F A;  5L3F A;  3ABM C;  1VQK V;  4FPP A;  3T2M A;  3I55 V;  1AJN A;  4QIW F;  1OCZ B;  1M57 B;  5C93 A;  3MHS C;  1S77 D;  3D36 A;  3OEE G;  2QTO A;  4MVO A;  1NJI W;  1AR1 B;  3CYO A;  5B1A C;  2XAG A;  1R6K A;  2W6J G;  4CBC A;  3LNM B;  4UV8 A;  1RPR A;  5L3D A;  5KA5 A;  2ZR3 A;  2JEX A;  2HFE C;  1F4M A;  1K3E A;  1PNM A;  5DM6 V;  2ZR2 A;  2IJK A;  4WFG A;  2EIJ C;  1MSW D;  3FB6 C;  5L3G A;  2EZO A;  1OCZ C;  4HZ3 A;  3CCJ V;  3K03 A;  3SPJ A;  3ZMU A;  2QA4 V;  1KC8 W;  2EZP A;  1JPX A;  2A0L A;  3AG4 B;  3CP1 A;  3W7T A;  1H2G A;  3ETE A;  3UKM A;  1WLE A;  2EIL B;  5EC2 C;  3ZRS A;  5EC1 C;  3RW0 A;  2OTL V;  1E79 G;  3FKS G;  2LP7 A;  3QO8 A;  2HVK C;  2X6A A;  3IFX A;  4PDR A;  1F4N A;  3T4D A;  2Q67 A;  2V7Q G;  1K4C C;  4KUM A;  4RUE A;  1QVG U;  1QR9 A;  1FXK B;  5B3S C;  2IJJ A;  2KB1 A;  2EIL C;  4MVQ A;  2X7R B;  4XDJ A;  1BMF G;  2F43 G;  2IW5 A;  1KQS U;  4PA6 A;  1VQP V;  1K5S A;  1S76 D;  3CCM V;  3OGC C;  2OTJ V;  1BL8 A;  3NXS A;  2HKO A;  1SES A;  4UVA A;  2BOC C;  3R65 A;  1R3K C;  1DTO A;  2K1E A;  4RAI A;  4TSF G;  5BZB A;  1R73 A;  1FXK A;  3I56 V;  3E8F A;  4G27 B;  1ZWI C;  2WAM A;  2WLM A;  1AJP A;  3E8H A;  4GX2 A;  3K08 A;  4MVU A;  3CCU V;  3ABT A;  5L3B A;  2EJR A;  3CCE V;  1Q81 W;  1TUE B;  3E89 A;  4WF9 V;  2P7T C;  1XL6 A;  4UXN A;  1R3I C;  3FYI B;  4TT3 G;  4GCZ A;  2DYR C;  1Q82 W;  2D3O W;  3JD2 A;  4GT1 A;  2EIK B;  2LFS A;  4ZBM A;  3ASN C;  5CBH A;  4X88 A;  1OCO B;  4KP4 A;  2Y69 B;  2ITC C;  4DO2 A;  1P4R A;  3OAA G;  2QKS A;  4UVC A;  2GSM B;  2FTK A;  3HB3 B;  3CXC U;  2NNU A;  4RUF A;  2WLH A;  1OCC C;  1BHA A;  4FK5 C;  1V55 B;  1RPO A;  3P32 A;  2EIK C;  2QM8 A;  3CC4 V;  2XAS A;  4PDM A;  1YIT V;  1GO3 F;  1EZJ A;  3QNE A;  3X2Q B;  1OCO C;  2JK5 C;  3STL C;  2Y69 C;  4N23 A;  4CZZ A;  1QLN A;  1N8R W;  3UM7 A;  1K33 A;  1OCR B;  1KP3 A;  4P2Z A;  3ZJZ A;  4U7N A;  1EFR G;  4BAY A;  4MVM A;  2XAJ A;  3JCZ A;  2JIZ G;  3OR6 C;  2QEX V;  2QE7 G;  1V55 C;  4JTC B;  5CBG A;  1NKD A;  2EIM B;  3RVY A;  4WFB V;  2H94 A;  2YSU B;  5KA6 A;  1FS0 G;  4JAV A;  3OMA B;  3OE7 G;  3W7S A;  3B77 A;  4F4L A;  1ENV A;  3SYA A;  3K0D A;  4WFH A;  1QLE C;  3X2Q C;  5IYC O;  2X6B A;  3VBB A;  1YTF B;  1FFT B;  3LDE A;  4I5S A;  3T4Z A;  1CPY A;  1ORQ C;  1AI6 A;  2HLD G;  3JD1 A;  1SZT A;  3ZRX A;  4G2K A;  5LBQ A;  3ZMS A;  3JD3 A;  2OCC C;  2WLL B;  5L3E A;  1YHQ V;  2WWW A;  2DWD C;  5LHH A;  4Z1M G;  1QCE A;  3ABK B;  4XDK A;  3OR7 C;  1S0V A;  4PA4 A;  4RO2 A;  1QBZ A;  4PA9 A;  1M57 C;  4ASU G;  1EBO A;  1YTF D;  2IU3 A;  3MD0 A;  2C2A A;  3TK1 A;  5LGU A;  2DW4 A;  1H8E G;  2B5U A;  1PNK A;  2WLL A;  5IY5 B;  3AG2 B;  2WLK A;  3AAG A;  1DF5 A;  4MW3 A;  1P7B A;  2Q6A A;  1GK9 A;  1B6Q A;  4HYO A;  1K7D A;  2ITD C;  3OUF A;  5L3C A;  2GHY A;  3W7W A;  4RQF A;  2UXX A;  5HFL A;  1J95 A;  3E2E A;  1K34 A;  3E83 A;  4PDV A;  5LHI A;  1VQL V;  1W2B U;  1I5X A;  3B8M A;  3F5W C;  1KD1 W;  1YI2 V;  3G4S V;  1H38 A;  4I9W A;  3AG4 C;  1K9M W;  4R8C A;  3AG2 C;  3E8B A;  3K0G A;  1RM1 B;  3ZRV A;  4X89 A;  5EBM C;  1M56 B;  3CCL V;  3ZCC A;  4MVR A;  4ZKI A;  1NVP B;  1KKD A;  3W7X A;  3AG3 B;  3SYQ A;  4QE7 A;  5IYB O;  2R9I A;  1AI7 A;  2H8P C;  3QO7 A;  3F7V C;  2ATK C;  3GB7 C;  1OHH G;  4MS2 A;  4FIP C;  5IDJ A;  3KG2 A;  1JX9 A;  2ZQM A;  4YXW G;  3T1C A;  1FXK C;  2OT5 A;  4LP8 A;  3LUT B;  1M56 C;  1G4Y B;  4JAU A;  3G6E V;  4GX5 A;  4JF3 A;  1R3J C;  2IU0 A;  1NVP D;  1GM9 A;  5B1O A;  3OM3 B;  3CMA V;  1ROP A;  3ZN0 A;  4N21 A;  3K06 A;  4U7O A;  2JDI G;  2Q69 A;  5GW7 A;  3CCS V;  1NQT A;  1VQ4 V;  1M9N A;  4MSW C;  4FJC C;  3OMN B;  1UJW B;  2BOB C;  1HWY A;  1W0K G;  1K4D C;  3CC7 V;  4P9O A;  1NR1 A;  2NLJ C;  5E1A C;  1LNQ A;  2EIN B;  3AG1 B;  2V1D A;  1AI5 A;  3B8N A;  4BIZ A;  1R3L C;  1W0J G;  4PA7 A;  4UVB A;  2XAH A;  3G71 V;  1M90 W;  5EBL C;  1VQM V;  2ZXW B;  1G8M A;  3ZMT A;  1AJQ A;  1FXH A;  4XBF A;  4JAS A;  3OEH G;  5IYD O;  2AHY A;  2PI4 A;  2M7W A;  4JTD B;  3WG7 B;  4LCU C;  3AEI A;  5CA3 A;  2CK3 G;  4MTX A;  4JTA B;  3ABU A;  3CCQ V;  2HR3 A;  3ZMV A;  2P90 A;  1YJ9 V;  4G28 B;  4GX1 A;  2QM7 A;  3ETG A;  4WFE A;  4QPK A;  3D3I A;  3HPL C;  1COW G;  5EK0 A;  1NBM G;  3ZIA G;  5EBW C;  2DYS B;  4PDL A;  3K79 A;  1WPX A;  4EKW A;  1BHB A;  5CBF A;  2Z3Y A;  2X6C A;  5LHG A;  5H9C A;  3STZ C;  3ABM B;  3WG7 C;  1CP9 A;  1QVF U;  1VQ9 V;  2PI5 A;  3FB7 C;  2W6I G;  1OCR C;  4PA3 A;  1XL4 A;  2XND G;  5B1N A;  5FL7 G;  2DWE C;  1K97 A;  3EFF K;  4XDL A;  4WFA V;  5B1A B;  3IGA C;  1JOY A;  3MHH C;  2DYS C;  2EIM C;  4E2L A;  4J9Y B;  4OXS A;  3EHB B;  1E1R G;  1MAB G;  3VOU A;  4MVS A;  1Q7Y W;  3SPC A;  5LGT A;  3SPG A;  2EIJ B;  2UXN A;  3OUS A;  3SYO A;  3F7Y C;  3W7U A;  1FXV A;  4UUJ C;  1MOF A;  1VQ7 V;  4MW8 A;  4R50 A;  1VQN V;  3CC2 V;  2Y48 A;  2JEU A;  3SPH A;  1K8A W;  3WFV A;  2XOK G;  1K73 W;  3ABK C;  2P67 A;  5CN0 A;  5H6R A;  2LFR A;  3K9A A;  3ZMZ A;  1PNL A;  5HFM A;  2HG5 C;  3OFN G;  3CCR V;  2IH1 C;  1H8H G;  4HAM A;  1M1K W;  1CEZ A;  2JJ1 G;  3PJS K;  2WPD G;  1K92 A;  4TWK A;  4QE9 A;  2X0L A;  1GKF A;  5IY5 C;  1QR8 A;  3H01 A;  2DQ0 A;  1THZ A;  2DQ3 A;  3LDD A;  1YJN V;  1NH2 D;  5B3S B;  1ARO P;  1S5H C;  4H33 A;  4JYC A;  3OMI B;  1SER A;  2YEV B;  5KUK A;  1SRY A;  3FYE B;  3ML0 A;  1JVM A;  2WLJ A;  4GX0 A;  4JGS A;  2WSS G;  3CD6 V;  3ZRW B;  3OW2 U;  1NH2 B;  1YSC A;  4LBE C;  3P30 A;  1S3J A;  2IH3 C;  2B1G A;  3GWO A;  1VQ5 V;  3E8G A;  1RM1 C;  2A79 B;  3CPW U;  2IJH A;  2HJF C;  1I5Y A;  4LC1 A;  2XAQ A;  5H6Q A;  4L87 A;  3E35 A;  2AHZ A;  3FB5 C;  1GTO A;  3LSQ A;  3AG3 C;  3M99 B;  2YEV A;  2JJ2 G;  3JYC A;  3SYC A;  1GMG A;  1GM8 A;  5J9P C;  3CME V;  2W0F C;  3RBZ A;  2P6J A;  3ZRW A;  4MTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...