3OAAG

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
284
structure length
284
Chain Sequence
AGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
molecule tags Hydrolase/transport protein
molecule keywords ATP synthase subunit alpha
total genus 104
structure length 284
sequence length 284
chains with identical sequence O, W, e
ec nomenclature
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3oaaG01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 3oaaG02
2XNDG 2UXXA 1FS0G 2XOKG 4UXNA 2XAJA 2W6IG 4KUMA 1OHHG 4XBFA 3ZMZA 2EJRA 5L3GA 5H6QA 4CZZA 2R9IA 5LBQA 2JJ1G 1NBMG 2Y48A 4Z1MG 2W6JG 5L3CA 1MABG 3ZMVA 5L3BA 2UXNA 1H8EG 2Z3YA 3ZMSA 2JDIG 2CK3G 2XAHA 4TT3G 2WPDG 3ZMTA 2V7QG 3OAAG 3ABTA 5LGNA 2XAGA 2JJ2G 4YXWG 1E79G 4TSFG 2QE7G 1COWG 5LHHA 2XAQA 5LGTA 2H94A 5H6RA 4UV9A 1H8HG 2XASA 3ZN0A 1W0KG 5L3FA 2DW4A 5LGUA 4UVBA 2F43G 4BAYA 1E1QG 4ASUG 5L3EA 3ZIAG 3OFNG 2X0LA 3OEHG 3OE7G 1E1RG 5LHIA 5DN6G 2HKOA 2WSSG 3ZMUA 1W0JG 2IW5A 3ABUA 2V1DA 2Z5UA 4UVAA 2HLDG 3OEEG 3ZN1A 1BMFG 4UVCA 1EFRG 5LHGA 3FKSG 4UV8A 5L3DA 5FL7G 2JIZG 2XAFA
chains in the Genus database with same CATH superfamily
3SR2C 3JSLA 3SRKA 2M6YA 5E79Z 4DK0A 4QPKA 2IU0A 4PA4A 4TV9A 4YJ2A 1M56C 5JQGA 1G6UA 2CTPA 4H37A 3I5DA 4I5SA 4UCTA 4JI1O 4MW3A 5BMVA 2Q5ZA 5FNVA 3G6EV 1QLEB 4U7OA 4NXMO 4L8JA 3RYIA 2AXTZ 3GVMA 2CTQA 1O9GA 4I50A 1IZ3A 2P5OA 1RM1B 3D36C 4WCEV 1Q81W 3LSUA 2ZXWB 1VP7A 1SQVH 4GKKO 2ZCEA 2QKSA 3F7VC 2DE0X 2Q9LA 5GONB 2ZINA 4UV9A 1V55B 5JJEB 1K33A 3BPZA 3PP7A 4WFBV 2EIJB 2D2CB 3C3SA 3T0TA 1L8DA 3APOA 1S5LZ 1JX9A 4GX5A 3ZN0A 2YICA 3OD4A 2F1MA 3B77A 3QV7A 1AJNA 4O4JA 1L1FA 2QWRB 1ORQC 1PKLA 3OFNG 4DV1B 1OCOB 2R9AA 1Q6UA 3ZRWB 4AI8A 1OCCB 3H1KH 3ZMUA 2QM4A 4X1KA 2IM9A 1K3EA 1SQXH 2EJ7A 5LA6B 4UVAA 5GONA 2HLDG 4MSWC 4FZ1A 1VMGA 3P32A 4NXMB 1RP3B 4DR3B 3JAWB 4KL1A 3CCSV 3B09A 3Q4HB 1ENVA 2ZM6O 4DK1A 2HHHB 1EN5A 3A2FA 3BRCA 3ZBHA 1QQCA 1VQLV 2JIZG 3HKBA 3LSQA 4DRXA 2GUZA 4JI3B 2ZT9B 1YJNV 5CB4A 1K4CC 3B8MA 1K7DA 3OW2U 2P22C 3IGAC 1OCRB 4O2AA 4LH6A 2OCCC 3K9SA 4LF9O 2OIGA 2QKAA 3ZMSA 4LF8B 2F66C 1QHTA 4BIZA 3APQA 2QTSA 2AZ0A 4JTCB 4CS4A 4DR2B 1SZTA 4HNAA 1NTZH 1PPJH 1YXBA 1TUBA 3L70H 3ZRSA 4MVMA 1Q8IA 1I5XA 4P30A 2AHZA 4X1KB 5LP6B 3ZHVA 4DR1B 5B1BB 4DR5O 4O2BA 2YS8A 1N34O 1H8HG 5LYJB 2ZE6A 3ABKC 1W0KG 1Y4MA 3D3IA 1DTOA 1JQ0A 3SJBC 1V55C 1N4CA 4HYWA 3ASOC 4R7CA 2RCVA 4ZKIA 5AG2A 4EKWA 1Q6HA 3LDDA 4MTXA 3HQNA 1JR9A 4JI6B 3U0ZA 2K9PA 3GQYA 3E8FA 3KHDA 1PL0A 4LNUA 1F51A 2Y0IA 4HZ3A 4O4LB 4AQYO 4LFCB 3TGUH 4I0XB 2GUZB 1FS0G 1SQPH 4WFGA 2CGOA 4LF9B 3QV6A 1WN7A 5EYPA 2GHYA 3N2KA 5KHHA 4J11A 2RNBA 3IAYA 4RQEA 1BSMA 1OCZC 1A5UA 4JYAB 1N33B 4B3RO 2N74A 4LCUC 1DF4A 4B08A 2ADPA 1EZJA 2JDIG 5B1BC 3NXSA 3H1LH 1BL8A 5CA0A 5J2TB 2JGDA 2ZR2A 1N0NA 3E22A 3QO8A 3ETEA 2EULA 2ADQB 3BABA 1U97A 5EBWC 3FB8C 2XAQA 2A79B 5DEDA 2UUCO 2LJ2A 1AI4A 1I94O 4PDMA 4J7JA 1S76D 5B1OA 3ASNC 2E5LB 4R8CA 2HHHO 1YTFD 1THZA 2FTKA 1PP9H 1YJWV 5EC2C 2JRIA 3WB1A 1FFXA 4EFEA 4QNHB 4PI2A 1SQQH 1D5AA 3ZIAG 5H9CA 4MTOA 3U2ZA 1FYJA 4U7NA 1CP9A 2P90A 3CC4V 1J5EB 1WPBA 4D7TA 3FAVA 2VWKA 2Z5UA 4WBNA 4JZGA 4FLUA 3ZHUA 1Q6IA 4PD4F 3QG5A 4LBEC 1GTOA 1NVPD 4HBNA 2IH3C 4MVZA 1M5IA 1IBMO 3WG7B 4DR2O 5IWAB 1QNMA 3RW0A 2UUAO 4BIUA 5BR8O 1VQ5V 1TA8A 1K73W 3GR4A 3TETA 3J7AU 4UCVA 4JI7B 4JYAO 4UB6Z 4DUZO 1EBOA 3OR7C 5KUKA 2K1EA 1BQ0A 2ODMA 4RAIA 3P3PA 2E74B 3JAWA 3K9AA 3X2QB 2VGIA 5CN0A 1M57B 5LA6A 4DR3O 1GN6A 2N04A 1E0UA 3E8BA 1FXKC 1QCEA 4DV4O 2GDSA 1V9PA 5K1PA 4LFBO 2XAGA 2JJ2G 1IXBA 3JCZA 1Y74A 4DV6B 5EZYA 3E0WA 1X59A 3CCQV 4JI6O 1K4DC 1ROPA 1V54B 3G67A 2WLJA 1KMIZ 3G80A 4XDJA 4X89A 4K8ZA 3DC5A 5KX5B 1XQ8A 3OGIB 4KCUA 1NH2D 3EOEA 3DSQA 3W7UA 1S5JA 3H1HH 5BMVB 1YCIA 2DWEC 2CTWA 3BHPA 3J81N 4PA7A 1I0HA 4R6ZA 5JQGB 1E1QG 5J2TA 4KRZA 3KG2A 4LF5B 3L71H 1AP6A 4X66O 3ZRWA 4X64B 5LP6A 1L0NH 1N36B 2W0FC 3RN4A 2EX3A 3HKCA 1M56B 4ABMA 1GKFA 3ZCCA 3DGEA 1UJWB 1P49A 1G1XB 5C8YA 1A3WA 2MK3A 4X62O 2ILMA 2YI9A 4MTFA 4BR6A 1Q5OA 3HR0A 4JAUA 2CUGA 4X8AA 1ZLZA 4ZI7A 2OT5A 4MTGA 4KUMA 4XBFA 3RYCA 1QU7A 3JSNA 5H6QA 2WLLB 4DR5B 2B1GA 1TVKA 1US6A 1LUVA 1NBMG 4J10A 3QV9A 3VQXA 4PJ0Z 1O9HA 1JFFA 4TQFA 1HWYA 3ABLB 3RBZA 2YDEA 1Q43A 2DWDC 4K0KO 3D8CA 3RWRD 4O4IA 1SA0B 1PL4A 3CRAA 5IJ9A 3HQOA 3ETGA 5LOVB 3T1YO 4CS2A 1WNSA 1JMKC 2RDCA 5B1NA 1R3IC 2HVKC 3UCSC 1YHQV 3SYAA 2EIMB 4FLZA 2XTAA 1HR0B 3N27A 2Y0PA 3MA8A 4DV2B 2C2AA 3T2MA 4JI0O 3CCRV 3WU2Z 4DV0B 2Q7GA 3JALA 4TOIA 2EIKC 3CCVV 4JAAA 5KAIZ 1LUWA 4DV5B 4YIPA 5JWPA 2A0LA 2DMXA 1QLNA 2ARHA 1GK9A 2P6JA 1I94B 3JD2A 1SERA 3OEEG 4MVQA 1VQMV 3THOA 5EZYB 2GBOA 5KAFZ 1H38A 1N32O 2AGAA 1OCCC 1OZ0A 5ITZA 2WWWA 5L3DA 4KCWA 3OMNB 1W59A 1VQ8V 4Z1VA 2UXXA 4X65B 1NT2B 1NJIW 2ITDC 5DECA 3K06A 4NXNB 4O4LA 5EIBD 2ZD9A 3AG3C 5IYZA 4Z1MG 1S3JA 1PNLA 2W6JG 5EBMC 3TK1A 2F23A 3K57A 1NS1A 2DYRC 1M57C 4P9OA 4EB6B 3L74H 3BCCH 4F6RA 2PUSA 2YEVB 3T1CA 1H2NA 1FXKB 1GRJA 4F6RB 4PELA 1ZWIC 1NTKH 1H2MA 2HJDA 3BA8A 5E1AC 1DGSA 3A0HZ 3ABLC 2ZXWC 3CC2V 3SPIA 3GB7C 5CA1A 5LHHA 3AG3B 4J9ZB 1YJ9V 2PTMA 1PKMA 4Q20A 3CX5F 1DLBA 5CMUA 1Y6XA 3L73H 2P4KA 4X66B 4YJ5A 4E4EA 5JCOC 2Q69A 4LWSA 4EFBA 4FK5C 1RM1C 2WLKA 4JV5B 2G38A 1D2DA 1IBKO 5IDJA 2UUBB 3TCUA 2BOBC 4DV2O 2WSSG 3FYIB 4JI8B 4YJ3B 1IBKB 4F4LA 4JI2B 1HW7A 4LF7O 2VGFA 1TAEA 1BMFG 4J80A 3AG1C 4WFEA 1FFXB 3JAKA 3ME3A 2W0XA 3IFXA 4O4HB 3CCLV 3I55V 1XDCA 1ZX3A 4I4TB 4ZI7B 3T1YB 3C3TA 2WA4A 2F95B 3CMAV 1AROP 1B3QA 1VQ4V 4FLVA 3K0DA 3U11A 5CA1B 2JJ1G 1MA1A 3E35A 1E0TA 4GUNA 3E22B 5L3CA 2H8PC 4FFBA 4GT1A 3SYQA 2OCCB 4KFMA 4PV1B 1YSCA 1H8EG 3B4SA 2AZ2A 3UT5A 1MZEA 1QR8A 2Z3YA 3R65A 5D5QA 4PDLA 4QJFB 1AI5A 2HR3A 2ZNJA 5KUMA 4Z2WA 4NVPA 4HYVA 5K1XA 2QWNB 5FLXN 3K0GA 3AAGA 3E83A 3J80N 1WJZA 1H2KA 2H94A 4DV7O 5JCOA 1JCHA 4GKJO 4TQDA 3EXAA 2WLHA 2HFEC 2OIEA 1Q7YW 3F7YC 3G6BA 4DW1A 1SESA 3LDCA 4YHHB 3G2GA 4BW9A 2DOSA 2QM8A 4UCUA 5ITZB 2Y4UA 4FIPC 2VGGA 2IBZH 1NU1H 2RMKB 4NKGB 3OEHG 1N32B 5LHIA 3CD6V 3C90A 3CRMA 1T57A 2G50A 4IMAA 5KMGB 4NXNO 2KKWA 3H1JH 1NH2B 4KHPB 3QTGA 3S3WA 3G4SV 3ZN1A 1JVMA 3FYEB 4B3MB 3JAKB 3AK2A 4JAVA 2UUAB 1FXHA 4DV3B 4FM1A 3AG2C 5C8YB 1J5EO 1H2LA 2OWOA 2VGBA 1FJGO 2E28A 1SA0A 4DR6B 4OGQB 2R9RB 2XNDG 3PJSK 4JI4O 2PI4A 4JI5B 3AG1B 2EJRA 2M7WA 3B8NA 3OR6C 4EB6A 3HB3B 1VF6C 4DV0O 2CH7B 2EINC 4LNUB 4B7KA 2A7WA 4DR1O 3EHBB 1R3JC 3CYOA 1ZSPA 4X1YB 2UXNA 1OCOC 4GLXA 1OCRC 2YI8A 3AG2B 5J2UB 5GTIZ 1VQNV 2KG7B 4P2ZA 4IIJA 3RYIB 5A2QN 3ZMTA 4XDKA 3ZX6A 4QG9A 2UXCB 1Q3EA 3JD1A 4OX9B 4LC1A 2A9HA 3OGCC 2X7RB 3D3QA 4MVUA 4LWSB 1F7YA 1MMMA 3L75H 5F2VO 3M99B 1YI2V 1BZKA 4IHJB 5KHGA 1ZL8A 2QM7A 2P7TC 3VQWA 2BOCC 4KXRA 3IC9A 4FLYA 3VQYA 1P7BA 1N33O 5IYZB 1PNMA 2F43G 1Z5WA 1FD9A 3OE7G 2IH1C 4CC5A 1Q90D 4X20B 2IJIA 5KMGA 4D6TH 3H1IH 2JEXA 2O57A 1Q82W 1N36O 4JTDB 4JI4B 1WP7A 3BVOA 5LHGA 3M8AA 5JH7A 2YXLA 3H01A 4UV8A 1B06A 4JYYA 4RUFA 4O4IB 2XAFA 4U3JB 2WA3A 2FKXA 4MS2A 1WB7A 4MVRA 4LFAB 2ZIMA 2NNUA 2N05A 3OTFA 3E2EA 1WPXA 3K5MA 3DTUB 3LDEA 4ZOLB 3SYCA 4DV4B 4JYBA 2Q67A 5FPOA 2ITCC 1KP2A 3SYPA 1I08A 4AILC 3LNMB 3KCXA 1NI8A 4GKKB 5JJJB 5BZBA 3CCEV 5IYBO 1WLEA 1E79G 1R73A 3FB6C 2YC0A 2QWOB 3N2KB 3X2QC 3ZHTA 1XI1A 4NTYA 5EBLC 4CC6A 4MVOA 4JI5O 5LP6C 2JEUA 1XHZA 4OX9O 5FPRA 1YF2A 2XUMA 4C7UA 5KHJA 4I4TA 4KCVA 3CXHF 4B2DD 1SC5B 4I9QA 1Q86W 2B9ZA 2XHBA 4WFHA 4DV1O 2CDYA 4JI7O 4LF8O 1B04A 1PM9A 1MZFA 2HP8A 3IS4A 1P7GA 3IJ4A 4UVBA 3T1HO 1SQFA 5EYPB 2HG5C 3ZRXA 1JJ2U 4FLTA 1DK1A 1GM8A 1MOFA 4BWAA 3B40A 3AK1A 4X62B 2EZPA 3I56V 4DUZB 2CAZC 4GX2A 1KKDA 2QEXV 4U3JA 2PYJA 1W2BU 3BJTA 4B3SB 2EILC 4PHZA 1NVPB 1UPGA 3CRCA 2Z0AA 1VF7A 2MW2B 1XMQO 3L72H 1AVMA 4UXNA 1A49A 4WFAV 3JATB 2XAJA 4DW0A 4FMTA 1OHHG 4NTWA 4X65O 1WAZA 1AILA 1PD3A 2BSKB 4FJCC 1URFA 1KKCA 1N0JA 2R9IA 3Q4HA 3CS5A 3HPLC 3RVYA 2FYUH 1M9NA 4LP8A 2DJVA 4GCZA 5IY5B 3ZS8C 4UCSA 3ZMVA 1J95A 1GN2A 1OV9A 1T5AA 1HDJA 1K8AW 2QGNA 3FX7A 5GW7A 3AG4B 4ZHQB 2E3CA 4DV3O 4QIWF 4O4HA 4CH5A 5LOVA 4UB8Z 3K59A 1I5YA 4DO2A 1GAXA 1XHXA 1KU9A 1T5EA 4UCRA 4DYLA 4LF6B 2WLIB 4WBNB 5LXTB 5CBGA 2Q73A 2F93B 1XOUA 4IIJB 1P4RA 5B1AB 1K5SA 3MHSC 2Y4TA 3RYFA 2UUCB 2LGWA 2L6LA 1S77D 2XASA 4DRSA 4FFBB 1XMQB 2EILB 1EM1A 4U3FH 2X6CA 4W4LA 5B3SB 2QTOA 3SJAC 1KYOF 4LF4B 2X0LA 2WLLA 4K0KB 3T4ZA 1XL6A 2QSAA 1VIBA 1OCZB 4FXFA 4CH4A 3CP1A 3E8GA 4OPHA 4E2LA 2LW7A 3BEHA 1XMOB 4JV5O 1JOYA 2V1DA 3CWBH 2IJKA 3AG7A 1AJPA 3O9OA 4JI2O 4YHHO 3QV8A 4X1IA 2FB5A 3JASA 4FFKA 4X88A 3A0RA 2JS5A 1GN4A 2E76B 1EZVH 4HNAB 5LYJA 4RQFA 4TV9B 1WP8A 4GZRB 2ZE5A 3ZHRA 4B3TB 5LMUO 1F3XA 1HNWO 2XOKG 2EIJC 3ABKB 1FPOA 2LFSA 3KKYA 4QGPA 2BTQB 4DR7O 5J2UA 5HFLA 1LNQA 1R6KA 1KP3A 5L3GA 4CZZA 3K58A 1VQ7V 3OMIB 5C93A 2Q7EA 3BY6A 4K3AA 2Q0AA 2Y48A 2PZSA 4ZOLA 2ZE7A 4DXWA 4JI0B 5IYCO 1IXMA 1GMGA 1L0LH 1MABG 2WLNA 3K5NA 5B66Z 3F5TA 5KX5A 1JPXA 1H2GA 2LFRA 3ML0A 3K08A 2P4VA 2P67A 1R6TA 1OJHA 4DR6O 1S0VA 2Q7HA 3OAAG 3HKBB 4YXWG 4QPJA 2HJFC 2FMLA 3FFQA 3AK3A 1KUQA 4ZIBA 1IBLO 5LGTA 4UUJC 1XMOO 4EEQA 1HP8A 3OTOO 1XNQO 3SJQC 3H9VA 2GTSA 1FAFA 2PI5A 1K34A 1AB3A 3UT5B 3AEIA 3QO7A 3ABMB 1F3WA 2F4VO 4LFAO 3CJHA 5L3FA 2QR4A 2WLMA 2YXHA 1WA8A 5KHIA 3A8TA 1YDXA 2Q8VA 1RPRA 3JATA 1BE3H 3OMAB 4UCOA 4J7ZA 4PDVA 1BGYH 4IP7A 3N25A 4G27B 4JGSA 4KHPO 2JGUA 4UVCA 1K5QA 5B3SC 1HNWB 4F6EA 2LO1A 3R66A 3PN1A 1BT8A 3SJCC 4LH7A 2OCHA 2CTRA 2QWPB 3MAQA 2LP7A 3RYHB 1X4TA 4IGGA 5FL7G 3SPJA 2ZR3A 1NQTA 1XNRO 3T1HB 1KC8W 4YJ3A 4IT5A 5CBFA 1Z5VA 3ZRVA 3TXSA 4DV5O 1GM7A 3WFVA 4K8XA 5B5EZ 3GG8A 1Y66A 4JF3A 2EIMC 3S3XA 3CE2A 4DR4B 2A3QA 4I50B 4FLWA 2F4VB 3N2GB 3W7XA 4TT3G 2WPDG 3GWKC 4BW5A 1YVWA 2YIAA 4X20A 4TUYB 1PKXA 4FM2A 1MG1A 4JPRA 1CPYA 4GKJB 5JJNB 3ZEDA 3QF7A 2NR5A 1N8RW 3RVZA 4KP4A 3WB2A 1NR7A 2JGDB 2YXYA 5H6RA 1CXZB 4H13B 1RSOB 1NR1A 2Q0OC 2V4DA 2QA4V 5LMNO 1XEQA 2ZDIA 3CCMV 5H2FZ 3SPCA 5CA3A 5GTHZ 1XILA 5A9GA 3JD3A 1HR0O 4I55A 5KHKA 1F4MA 3E86A 3JASB 4DR7B 1VQ6V 2GSMB 5LGUA 2UXBO 1TGOA 4QE7A 2Q68A 4B3TO 4FXJA 4MT8A 3RFRA 1IVSA 1H2SB 3MD0A 1K92A 2DQ0A 1IBMB 2ZIOA 3KZIZ 3QVNA 5B1AC 1XREA 4LF6O 4B3RB 1NZ6A 3RGBA 1M1KW 2D3OW 1SS3A 3ZJZA 4BIOA 1Y74B 2HEPA 4QE9A 3L9DA 2KQXA 1N34B 3FKSG 4QG8A 1F4NA 3JD0A 3SYOA 3QNEA 1EN6A 5KLVH 1B6QA 3HKCB 3CEIA 3SRFA 1SQBH 3WG7C 1PKYA 3HQPA 4LF7B 1IBLB 3QO5A 3JALB 3ZMZA 2FL4A 4JI8O 4ICGA 1AQFA 1Y76B 1ZUQA 3NR7A 4H33A 4QG6A 2B1IA 2DYRB 2YUAA 4LF4O 4I9WA 3QTCA 3STZC 4NYKA 5L3BA 1QBZA 5JVDA 1PKNA 1F23A 3UO2A 3N2GA 2YEVA 4YIOA 2CGNA 2OYQA 4TSFG 2DYSB 2GTAA 2QE7G 3MHHC 1HNZB 4LFBB 1COWG 2WAMA 1JJOA 1GO3F 3ETQA 1R3LC 1KBHA 3UQ8A 2PF4E 1M90W 1Y76A 3H6OA 1VQ9V 2OTJV 1AJQA 1NTMH 3OT7A 5LXTA 1A3XA 3T07A 4HYOA 4MVSA 1VQOV 4J9YB 1VP8A 1GH6A 4WF9V 2QWQB 1IURA 5EK0A 3SPGA 1VEWA 5BR8B 1K97A 1R1BA 2ZDIC 2JK5C 1IX9A 4GX1A 4JTAB 3D36A 4RUEA 4DRXB 2VQFO 1RPOA 1WA8B 4X1YA 1SQGA 2IJHA 2UXDO 3AG4C 3B2EE 3K79A 3K04A 2DQ3A 2JVDA 1EFRG 3CJHB 2R72A 1XUQA 4X1IB 4YNGA 2QKCA 3BAAA 4CH3A 2E5LO 4B3SO 1P84F 5CA0B 4OXSA 3F5WC 1EN4A 2UU9B 2EZOA 3A0BZ 1G4YB 1VARA 1ZTEA 2ETNA 3E0VA 3ASOB 2YSUB 5LBQA 4AQYB 3JARA 4TV8B 5IJ0A 3K03A 1SF9A 1Z2GA 1BHAA 2EINB 2VQEO 4B2DA 3HKDA 2VWJA 4P9PA 4FLXA 2KG7A 3ASNB 4MW8A 3FB7C 1YIJV 3CSXA 1JFFB 2RJZA 1FJGB 5LGNA 3SRHA 1BHBA 5EC1C 1ZJHA 3CRRA 3RT3C 3OM3B 2Y69C 3K5LA 4PI0A 2VS0A 1QVFU 4FZ0A 4CH6A 4NR1A 4YY3B 1HNXB 2PGGA 1CEZA 4WFFA 4LF5O 1M93A 4G2KA 2L35A 3KTXA 2PY5A 4JASA 5JH7B 2ATKC 4D7SA 4O4JB 2E75B 2VQFB 3JD4A 2ZNIA 1R6NA 4BAYA 4ZHQA 1NKDA 4J42A 4O2BB 5IY5C 1D5NA 1MSDA 3T4DA 4PA3A 4RO2A 3CPWU 3ABUA 3K3WA 4RPPA 1YZBA 4DV7B 2BE3A 3LUTB 3JCUZ 3CC7V 3DXRA 2BTOA 2PYLA 1KECA 1MSWD 2LQTA 1ZAUA 2CE4A 3ICXA 5KA6A 5IYDO 2BCCH 3OUSA 3U10A 5LMNB 4XDLA 2X6BA 3CCJV 1AR4A 5H5NA 1M4UA 4W4KA 4LR3A 3SGIA 3UO3A 4G1NA 5IT9N 3STLC 2W6IG 2A06H 3W7WA 4I0XA 2LW1A 3SRDA 4FM0A 2KB1A 4H44B 4LFCO 2DN9A 5IWAO 2P06A 4IL6Z 3VQVA 4TV8A 3CMEV 1WB8A 1GN3A 3BFRA 1QLEC 1VQKV 5LL6Y 2RQ6A 2YIDA 2UXBB 1AR1B 4DUYO 3SPHA 3VOUA 4X64O 2EIKB 2HVJC 4NB5A 2RN9A 4GYCB 2VQEB 4QGCA 2XAHA 3FB5C 3KCYA 3M7MX 2V7QG 3WB0A 4H0LB 5JVDB 2UXCO 1AI6A 5FNVB 3ABMC 1KD1W 2EBOA 2UUBO 1FFTB 3VBBA 3ZHSA 4L87A 5CBHA 2CH7A 3DXRB 1KB9F 4YJ2B 2BSKA 4X9QA 1K9MW 3SDLA 4GX0A 4TUYA 4CBCA 3FAVB 4ZBMA 4N21A 1RSOA 4PA6A 2OTLV 1JA8A 1KQSU 3CCUV 5BXZA 1PV0A 2Y69B 2GV9A 4JI3O 1U96A 2UXDB 4I7ZB 4O2AB 3ZHQA 2DW4A 4ASUG 4G28B 5L3EA 5LMUB 4TWKA 2YIBA 1E1RG 2Q6AA 1FXKA 4B7EA 3G71V 1W0JG 2IW5A 1AP5A 1VF5B 2ZQMA 5J9PC 2IJJA 2NLJC 1A32A 1YEWA 4K35A 3W7TA 1IDSA 1I7FA 3RYHA 2NN4A 3MDSA 1XBLA 3LNNA 1YITV 2KSDA 4I55B 4HAMA 1FXVA 3E89A 1PNKA 3RYFB 1S72V 3RYCB 3HKEA 3W7SA 3CXCU 3CRQA 2DYSC 2IU3A 4DR4O 3JYCA 1XNRB 4PDRA 2WLIA 1TUEB 4DUYB 1BS3A 3HKDB 4FVMA 2ZM6B 3ETDA 5IJ0B 3LSSA 4YY3O 4OPAA 1QR9A 3OTOB 1XNQB 1DF5A 4KS0A 4IYHA 4AHCA 1SETA 5IE9A 1XL4A 4UFZA 2VRZA 2CK3G 4IHJA 3TXQA 4DV6O 2QJ1A 2AW9A 3DC6A 3ABTA 1Y67A 4J41A 2ZKOA 3CHXA 2XT9A 4JI1B 3UM7A 5TISZ 2YIBD 4J7KA 1R3KC 1LR1A 4JZ2A 5KA5A 1TUBB 1QVGU 4IYIA 5IJ9B 1AI7A 4R50A 3BJFA 1UFIA 2UU9O 1VF6A 2QDOA 3P30A 1SRYA 2B5UA 3UKMA 4N23A 2H3OA 2JS3A 2AHYA 4FPPA 1MNGA 3HKEB 2X6AA 1SKVA 2R70A 2ZE8A 3GWOA 3O65A 5D5PA 3P3NA 1VQPV 1BQZA 4JPGA 3JARB 4KCTA 1HNZO 3EFFK 3CB2A 3EVKA 3JAMN 3T05A 1SZXA 5CB4B 1G8MA 5DN6G 4Q6GA 4B3MO 2HKOA 4RWUA 2BTQA 4JYCA 4WJ8A 4NTXA 5HFMA 4A5UB 1V54C 1FKAO 1HNXO 4PA9A 3K5OA 5BY1A 1YTFB 3TJTA 5DM6V 1AR5A 5EIBC 2Q4PA 3E8HA 1GM9A 1RFYA 4CS3A 1TVKB 1BCCH 1S5HC 3FD9A 1ZL8B 2LGQA 3OUFA 3IC7A 3BA9A
chains in the Genus database with same CATH topology
3WG7C 4X8AA 2OT5A 3QO5A 4MS2A 4MTGA 4KUMA 4MVRA 4XBFA 4QPKA 2IU0A 4PA4A 3ZMZA 5H6QA 2WLLB 4H33A 1M56C 2B1GA 2NNUA 3E2EA 1NBMG 2B1IA 2DYRB 1WPXA 3DTUB 3LDEA 4H37A 4I9WA 4I5SA 3STZC 4MW3A 3SYCA 4JYBA 3G6EV 1QLEB 2Q67A 4U7OA 5L3BA 1QBZA 1HWYA 1F23A 3ABLB 2ITCC 1KP2A 3SYPA 3LNMB 3RBZA 2YEVA 2DWDC 5BZBA 3CCEV 5IYBO 1WLEA 1E79G 4TSFG 1RM1B 2DYSB 2QE7G 3MHHC 1COWG 1R73A 2WAMA 4WCEV 1Q81W 3FB6C 1GO3F 2ZXWB 1R3LC 3ETGA 3X2QC 5EBLC 4MVOA 1M90W 2JEUA 2QKSA 3F7VC 4UV9A 1V55B 1VQ9V 1K33A 2OTJV 1AJQA 4WFBV 2EIJB 4HYOA 4MVSA 1VQOV 4J9YB 5B1NA 1Q86W 4WF9V 1JX9A 1R3IC 4GX5A 4WFHA 2HVKC 3ZN0A 1YHQV 5EK0A 3SYAA 3B77A 2EIMB 3SPGA 1AJNA 4UVBA 1L1FA 1K97A 1ORQC 2HG5C 3ZRXA 2ZDIC 1JJ2U 1GM8A 1MOFA 3OFNG 2JK5C 2C2AA 3T2MA 1OCOB 3CCRV 3I56V 2EZPA 4GX1A 3ZRWB 2EIKC 4JTAB 1OCCB 3D36A 4GX2A 3CCVV 3ZMUA 1KKDA 2QEXV 4RUEA 2A0LA 1RPOA 1QLNA 1K3EA 1GK9A 2IJHA 4UVAA 2P6JA 2HLDG 3JD2A 3AG4C 3K79A 4MSWC 1SERA 3OEEG 3K04A 3P32A 4MVQA 1VQMV 2DQ3A 1W2BU 1EFRG 3CCSV 1H38A 2EILC 1NVPB 1ENVA 1OCCC 1OZ0A 2WWWA 5L3DA 3OMNB 1VQLV 2JIZG 4OXSA 3LSQA 1VQ8V 3F5WC 2UXXA 2EZOA 4UXNA 4WFAV 1NJIW 2XAJA 4FMTA 1G4YB 1OHHG 2ITDC 1PD3A 1YJNV 3K06A 4FJCC 2R9IA 1K4CC 2YSUB 3ASOB 3B8MA 1K7DA 2ZD9A 5LBQA 3AG3C 3OW2U 3HPLC 3IGAC 3RVYA 1M9NA 4LP8A 4Z1MG 4GCZA 1S3JA 1OCRB 1PNLA 2W6JG 3K03A 5EBMC 3TK1A 5IY5B 2OCCC 1BHAA 3ZMVA 2EINB 2DYRC 1M57C 1J95A 4P9OA 1K8AW 4P9PA 3ZMSA 2YEVB 3T1CA 4BIZA 3ASNB 4MW8A 3FB7C 1FXKB 1YIJV 4PELA 1ZWIC 4JTCB 5GW7A 3AG4B 5LGNA 1SZTA 1BHBA 4QIWF 5EC1C 5E1AC 3ABLC 2ZXWC 1I5YA 3CC2V 3OM3B 2Y69C 3GB7C 3SPIA 5LHHA 3ZRSA 1QVFU 4MVMA 4DO2A 3AG3B 2WLIB 4J9ZB 1YJ9V 4Q20A 1I5XA 1DLBA 4P30A 2AHZA 5CBGA 1CEZA 5CMUA 4WFFA 5B1BB 1P4RA 5B1AB 4G2KA 1K5SA 3MHSC 2Q69A 1H8HG 4FK5C 1RM1C 1S77D 2XASA 3ABKC 1W0KG 4JASA 1Y4MA 2ATKC 3D3IA 1DTOA 2WLKA 2EILB 1JQ0A 3JD4A 1V55C 1R6NA 3ASOC 4BAYA 2X6CA 5IDJA 1NKDA 5B3SB 2QTOA 4R7CA 2X0LA 2WLLA 4ZKIA 3TCUA 3T4ZA 2BOBC 1XL6A 4EKWA 3LDDA 4MTXA 2WSSG 5IY5C 1OCZB 3FYIB 3CP1A 3E8GA 3T4DA 4PA3A 4RO2A 4E2LA 3ABUA 3K3WA 3CPWU 3BEHA 1JOYA 4F4LA 2V1DA 3LUTB 3E8FA 1PL0A 2IJKA 1AJPA 1BMFG 3CC7V 3AG1C 4WFEA 1KECA 4X88A 1MSWD 3IFXA 1F51A 3A0RA 5KA6A 4HZ3A 5IYDO 3CCLV 4RQFA 3OUSA 3I55V 4XDLA 2X6BA 3CCJV 1FS0G 2XOKG 2EIJC 3ABKB 3STLC 2LFSA 2W6IG 4WFGA 3W7WA 5HFLA 1LNQA 3CMAV 1R6KA 1KP3A 5L3GA 1AROP 4CZZA 2KB1A 1VQ4V 1VQ7V 3K0DA 3OMIB 2JJ1G 5C93A 3BY6A 2GHYA 2Y48A 3E35A 3CMEV 4DXWA 5L3CA 5IYCO 1IXMA 1GMGA 2H8PC 4RQEA 2WLNA 1MABG 1OCZC 4GT1A 1QLEC 3SYQA 1VQKV 2OCCB 4KFMA 1AR1B 1YSCA 4LCUC 1H8EG 1DF4A 1JPXA 1H2GA 2LFRA 1QR8A 2Z3YA 3R65A 3SPHA 2EIKB 3ML0A 2HVJC 1EZJA 3K08A 2JDIG 5B1BC 3NXSA 4PDLA 2P67A 2XAHA 4QJFB 1S0VA 3FB5C 1AI5A 2V7QG 3OAAG 1BL8A 1AI6A 2HR3A 5KUMA 3ABMC 4YXWG 2ZR2A 4QPJA 2EBOA 2HJFC 1KD1W 1FFTB 3QO8A 3K0GA 3ETEA 3VBBA 3AAGA 4L87A 5CBHA 3E83A 5EBWC 3FB8C 2XAQA 2A79B 5LGTA 4UUJC 2H94A 1K9MW 1AI4A 4GX0A 1JCHA 1S76D 4PDMA 4CBCA 4ZBMA 2WLHA 2HFEC 5B1OA 3SJQC 3ASNC 1Q7YW 4R8CA 3F7YC 4N21A 4PA6A 2OTLV 1K34A 2PI5A 1KQSU 1SESA 3CCUV 1YTFD 3LDCA 1THZA 2FTKA 3AEIA 2QM8A 2Y69B 3QO7A 4FIPC 3ABMB 1YJWV 5EC2C 5L3FA 2DW4A 2WLMA 4ASUG 4QNHB 4G28B 5L3EA 3ZIAG 5H9CA 4TWKA 3OEHG 4MTOA 1E1RG 5LHIA 4U7NA 3CD6V 1CP9A 2Q6AA 1FXKA 2P90A 3CC4V 3G71V 1RPRA 1W0JG 3OMAB 2IW5A 2ZQMA 1NH2B 4PDVA 5J9PC 2Z5UA 2IJJA 2NLJC 3W7TA 4G27B 4JGSA 3G4SV 3ZN1A 4UVCA 4LBEC 1K5QA 5B3SC 1GTOA 1JVMA 1NVPD 3FYEB 1YITV 2IH3C 4JAVA 4MVZA 1FXHA 4HAMA 1FXVA 3AG2C 3E89A 3WG7B 2LP7A 1PNKA 1S72V 3RW0A 5FL7G 4BIUA 3SPJA 3W7SA 1VQ5V 3CXCU 2R9RB 2XNDG 1K73W 2ZR3A 1NQTA 3PJSK 1KC8W 3TETA 2PI4A 2DYSC 2IU3A 3AG1B 5CBFA 2EJRA 2M7WA 3JYCA 4PDRA 2WLIA 1TUEB 3B8NA 3ZRVA 3OR6C 1GM7A 3HB3B 3WFVA 1EBOA 3OR7C 5KUKA 2K1EA 2EINC 1Y66A 4RAIA 4JF3A 3ETDA 3LSSA 2EIMC 3K9AA 3X2QB 5CN0A 1QR9A 1M57B 3EHBB 1R3JC 1DF5A 3CYOA 2UXNA 1OCOC 1SETA 1OCRC 3AG2B 1XL4A 1VQNV 4P2ZA 2CK3G 3E8BA 3W7XA 1FXKC 1QCEA 2WPDG 4TT3G 3ZMTA 4BW5A 4XDKA 3ABTA 3UM7A 2XAGA 2JJ2G 1PKXA 1MG1A 4JPRA 1CPYA 1R3KC 3JCZA 3JD1A 5KA5A 1QVGU 1N8RW 4LC1A 1AI7A 2A9HA 3RVZA 3OGCC 4KP4A 2X7RB 4R50A 1NR7A 4MVUA 5H6RA 3CCQV 3P30A 1K4DC 1SRYA 2B5UA 3UKMA 4N23A 1ROPA 1NR1A 2AHYA 2QA4V 4FPPA 3M99B 1V54B 1YI2V 2ZDIA 3CCMV 2WLJA 4XDJA 4X89A 3SPCA 5CA3A 2X6AA 2QM7A 2P7TC 1NH2D 3JD3A 2BOCC 3GWOA 3W7UA 3E86A 1F4MA 2DWEC 1VQ6V 3VOUA 2GSMB 1VQPV 1P7BA 5LGUA 4QE7A 1PNMA 2F43G 4PA7A 2Q68A 3EFFK 4R6ZA 1E1QG 4MT8A 3OE7G 2IH1C 3KG2A 1G8MA 5DN6G 2IJIA 3MD0A 2HKOA 1K92A 2DQ0A 4JYCA 3ZRWA 5B1AC 5HFMA 1V54C 2W0FC 2JEXA 4PA9A 1Q82W 1M56B 1GKFA 1YTFB 3ZCCA 5DM6V 1M1KW 3DGEA 4JTDB 2D3OW 3ZJZA 1UJWB 5LHGA 3E8HA 4QE9A 2MK3A 1GM9A 3H01A 3FKSG 4MTFA 1S5HC 1F4NA 3JD0A 3SYOA 3OUFA 3QNEA 4UV8A 3IC7A 1B6QA 4RUFA 4JAUA 2XAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XND G;  2UXX A;  1FS0 G;  2XOK G;  4UXN A;  2XAJ A;  2W6I G;  4KUM A;  1OHH G;  4XBF A;  3ZMZ A;  2EJR A;  5L3G A;  5H6Q A;  4CZZ A;  2R9I A;  5LBQ A;  2JJ1 G;  1NBM G;  2Y48 A;  4Z1M G;  2W6J G;  5L3C A;  1MAB G;  3ZMV A;  5L3B A;  2UXN A;  1H8E G;  2Z3Y A;  3ZMS A;  2JDI G;  2CK3 G;  2XAH A;  4TT3 G;  2WPD G;  3ZMT A;  2V7Q G;  3OAA G;  3ABT A;  5LGN A;  2XAG A;  2JJ2 G;  4YXW G;  1E79 G;  4TSF G;  2QE7 G;  1COW G;  5LHH A;  2XAQ A;  5LGT A;  2H94 A;  5H6R A;  4UV9 A;  1H8H G;  2XAS A;  3ZN0 A;  1W0K G;  5L3F A;  2DW4 A;  5LGU A;  4UVB A;  2F43 G;  4BAY A;  1E1Q G;  4ASU G;  5L3E A;  3ZIA G;  3OFN G;  2X0L A;  3OEH G;  3OE7 G;  1E1R G;  5LHI A;  5DN6 G;  2HKO A;  2WSS G;  3ZMU A;  1W0J G;  2IW5 A;  3ABU A;  2V1D A;  2Z5U A;  4UVA A;  2HLD G;  3OEE G;  3ZN1 A;  1BMF G;  4UVC A;  1EFR G;  5LHG A;  3FKS G;  4UV8 A;  5L3D A;  5FL7 G;  2JIZ G;  2XAF A; 
#chains in the Genus database with same CATH topology
 3SR2 C;  3JSL A;  3SRK A;  2M6Y A;  5E79 Z;  4DK0 A;  4QPK A;  2IU0 A;  4PA4 A;  4TV9 A;  4YJ2 A;  1M56 C;  5JQG A;  1G6U A;  2CTP A;  4H37 A;  3I5D A;  4I5S A;  4UCT A;  4JI1 O;  4MW3 A;  5BMV A;  2Q5Z A;  5FNV A;  3G6E V;  1QLE B;  4U7O A;  4NXM O;  4L8J A;  3RYI A;  2AXT Z;  3GVM A;  2CTQ A;  1O9G A;  4I50 A;  1IZ3 A;  2P5O A;  1RM1 B;  3D36 C;  4WCE V;  1Q81 W;  3LSU A;  2ZXW B;  1VP7 A;  1SQV H;  4GKK O;  2ZCE A;  2QKS A;  3F7V C;  2DE0 X;  2Q9L A;  5GON B;  2ZIN A;  4UV9 A;  1V55 B;  5JJE B;  1K33 A;  3BPZ A;  3PP7 A;  4WFB V;  2EIJ B;  2D2C B;  3C3S A;  3T0T A;  1L8D A;  3APO A;  1S5L Z;  1JX9 A;  4GX5 A;  3ZN0 A;  2YIC A;  3OD4 A;  2F1M A;  3B77 A;  3QV7 A;  1AJN A;  4O4J A;  1L1F A;  2QWR B;  1ORQ C;  1PKL A;  3OFN G;  4DV1 B;  1OCO B;  2R9A A;  1Q6U A;  3ZRW B;  4AI8 A;  1OCC B;  3H1K H;  3ZMU A;  2QM4 A;  4X1K A;  2IM9 A;  1K3E A;  1SQX H;  2EJ7 A;  5LA6 B;  4UVA A;  5GON A;  2HLD G;  4MSW C;  4FZ1 A;  1VMG A;  3P32 A;  4NXM B;  1RP3 B;  4DR3 B;  3JAW B;  4KL1 A;  3CCS V;  3B09 A;  3Q4H B;  1ENV A;  2ZM6 O;  4DK1 A;  2HHH B;  1EN5 A;  3A2F A;  3BRC A;  3ZBH A;  1QQC A;  1VQL V;  2JIZ G;  3HKB A;  3LSQ A;  4DRX A;  2GUZ A;  4JI3 B;  2ZT9 B;  1YJN V;  5CB4 A;  1K4C C;  3B8M A;  1K7D A;  3OW2 U;  2P22 C;  3IGA C;  1OCR B;  4O2A A;  4LH6 A;  2OCC C;  3K9S A;  4LF9 O;  2OIG A;  2QKA A;  3ZMS A;  4LF8 B;  2F66 C;  1QHT A;  4BIZ A;  3APQ A;  2QTS A;  2AZ0 A;  4JTC B;  4CS4 A;  4DR2 B;  1SZT A;  4HNA A;  1NTZ H;  1PPJ H;  1YXB A;  1TUB A;  3L70 H;  3ZRS A;  4MVM A;  1Q8I A;  1I5X A;  4P30 A;  2AHZ A;  4X1K B;  5LP6 B;  3ZHV A;  4DR1 B;  5B1B B;  4DR5 O;  4O2B A;  2YS8 A;  1N34 O;  1H8H G;  5LYJ B;  2ZE6 A;  3ABK C;  1W0K G;  1Y4M A;  3D3I A;  1DTO A;  1JQ0 A;  3SJB C;  1V55 C;  1N4C A;  4HYW A;  3ASO C;  4R7C A;  2RCV A;  4ZKI A;  5AG2 A;  4EKW A;  1Q6H A;  3LDD A;  4MTX A;  3HQN A;  1JR9 A;  4JI6 B;  3U0Z A;  2K9P A;  3GQY A;  3E8F A;  3KHD A;  1PL0 A;  4LNU A;  1F51 A;  2Y0I A;  4HZ3 A;  4O4L B;  4AQY O;  4LFC B;  3TGU H;  4I0X B;  2GUZ B;  1FS0 G;  1SQP H;  4WFG A;  2CGO A;  4LF9 B;  3QV6 A;  1WN7 A;  5EYP A;  2GHY A;  3N2K A;  5KHH A;  4J11 A;  2RNB A;  3IAY A;  4RQE A;  1BSM A;  1OCZ C;  1A5U A;  4JYA B;  1N33 B;  4B3R O;  2N74 A;  4LCU C;  1DF4 A;  4B08 A;  2ADP A;  1EZJ A;  2JDI G;  5B1B C;  3NXS A;  3H1L H;  1BL8 A;  5CA0 A;  5J2T B;  2JGD A;  2ZR2 A;  1N0N A;  3E22 A;  3QO8 A;  3ETE A;  2EUL A;  2ADQ B;  3BAB A;  1U97 A;  5EBW C;  3FB8 C;  2XAQ A;  2A79 B;  5DED A;  2UUC O;  2LJ2 A;  1AI4 A;  1I94 O;  4PDM A;  4J7J A;  1S76 D;  5B1O A;  3ASN C;  2E5L B;  4R8C A;  2HHH O;  1YTF D;  1THZ A;  2FTK A;  1PP9 H;  1YJW V;  5EC2 C;  2JRI A;  3WB1 A;  1FFX A;  4EFE A;  4QNH B;  4PI2 A;  1SQQ H;  1D5A A;  3ZIA G;  5H9C A;  4MTO A;  3U2Z A;  1FYJ A;  4U7N A;  1CP9 A;  2P90 A;  3CC4 V;  1J5E B;  1WPB A;  4D7T A;  3FAV A;  2VWK A;  2Z5U A;  4WBN A;  4JZG A;  4FLU A;  3ZHU A;  1Q6I A;  4PD4 F;  3QG5 A;  4LBE C;  1GTO A;  1NVP D;  4HBN A;  2IH3 C;  4MVZ A;  1M5I A;  1IBM O;  3WG7 B;  4DR2 O;  5IWA B;  1QNM A;  3RW0 A;  2UUA O;  4BIU A;  5BR8 O;  1VQ5 V;  1TA8 A;  1K73 W;  3GR4 A;  3TET A;  3J7A U;  4UCV A;  4JI7 B;  4JYA O;  4UB6 Z;  4DUZ O;  1EBO A;  3OR7 C;  5KUK A;  2K1E A;  1BQ0 A;  2ODM A;  4RAI A;  3P3P A;  2E74 B;  3JAW A;  3K9A A;  3X2Q B;  2VGI A;  5CN0 A;  1M57 B;  5LA6 A;  4DR3 O;  1GN6 A;  2N04 A;  1E0U A;  3E8B A;  1FXK C;  1QCE A;  4DV4 O;  2GDS A;  1V9P A;  5K1P A;  4LFB O;  2XAG A;  2JJ2 G;  1IXB A;  3JCZ A;  1Y74 A;  4DV6 B;  5EZY A;  3E0W A;  1X59 A;  3CCQ V;  4JI6 O;  1K4D C;  1ROP A;  1V54 B;  3G67 A;  2WLJ A;  1KMI Z;  3G80 A;  4XDJ A;  4X89 A;  4K8Z A;  3DC5 A;  5KX5 B;  1XQ8 A;  3OGI B;  4KCU A;  1NH2 D;  3EOE A;  3DSQ A;  3W7U A;  1S5J A;  3H1H H;  5BMV B;  1YCI A;  2DWE C;  2CTW A;  3BHP A;  3J81 N;  4PA7 A;  1I0H A;  4R6Z A;  5JQG B;  1E1Q G;  5J2T A;  4KRZ A;  3KG2 A;  4LF5 B;  3L71 H;  1AP6 A;  4X66 O;  3ZRW A;  4X64 B;  5LP6 A;  1L0N H;  1N36 B;  2W0F C;  3RN4 A;  2EX3 A;  3HKC A;  1M56 B;  4ABM A;  1GKF A;  3ZCC A;  3DGE A;  1UJW B;  1P49 A;  1G1X B;  5C8Y A;  1A3W A;  2MK3 A;  4X62 O;  2ILM A;  2YI9 A;  4MTF A;  4BR6 A;  1Q5O A;  3HR0 A;  4JAU A;  2CUG A;  4X8A A;  1ZLZ A;  4ZI7 A;  2OT5 A;  4MTG A;  4KUM A;  4XBF A;  3RYC A;  1QU7 A;  3JSN A;  5H6Q A;  2WLL B;  4DR5 B;  2B1G A;  1TVK A;  1US6 A;  1LUV A;  1NBM G;  4J10 A;  3QV9 A;  3VQX A;  4PJ0 Z;  1O9H A;  1JFF A;  4TQF A;  1HWY A;  3ABL B;  3RBZ A;  2YDE A;  1Q43 A;  2DWD C;  4K0K O;  3D8C A;  3RWR D;  4O4I A;  1SA0 B;  1PL4 A;  3CRA A;  5IJ9 A;  3HQO A;  3ETG A;  5LOV B;  3T1Y O;  4CS2 A;  1WNS A;  1JMK C;  2RDC A;  5B1N A;  1R3I C;  2HVK C;  3UCS C;  1YHQ V;  3SYA A;  2EIM B;  4FLZ A;  2XTA A;  1HR0 B;  3N27 A;  2Y0P A;  3MA8 A;  4DV2 B;  2C2A A;  3T2M A;  4JI0 O;  3CCR V;  3WU2 Z;  4DV0 B;  2Q7G A;  3JAL A;  4TOI A;  2EIK C;  3CCV V;  4JAA A;  5KAI Z;  1LUW A;  4DV5 B;  4YIP A;  5JWP A;  2A0L A;  2DMX A;  1QLN A;  2ARH A;  1GK9 A;  2P6J A;  1I94 B;  3JD2 A;  1SER A;  3OEE G;  4MVQ A;  1VQM V;  3THO A;  5EZY B;  2GBO A;  5KAF Z;  1H38 A;  1N32 O;  2AGA A;  1OCC C;  1OZ0 A;  5ITZ A;  2WWW A;  5L3D A;  4KCW A;  3OMN B;  1W59 A;  1VQ8 V;  4Z1V A;  2UXX A;  4X65 B;  1NT2 B;  1NJI W;  2ITD C;  5DEC A;  3K06 A;  4NXN B;  4O4L A;  5EIB D;  2ZD9 A;  3AG3 C;  5IYZ A;  4Z1M G;  1S3J A;  1PNL A;  2W6J G;  5EBM C;  3TK1 A;  2F23 A;  3K57 A;  1NS1 A;  2DYR C;  1M57 C;  4P9O A;  4EB6 B;  3L74 H;  3BCC H;  4F6R A;  2PUS A;  2YEV B;  3T1C A;  1H2N A;  1FXK B;  1GRJ A;  4F6R B;  4PEL A;  1ZWI C;  1NTK H;  1H2M A;  2HJD A;  3BA8 A;  5E1A C;  1DGS A;  3A0H Z;  3ABL C;  2ZXW C;  3CC2 V;  3SPI A;  3GB7 C;  5CA1 A;  5LHH A;  3AG3 B;  4J9Z B;  1YJ9 V;  2PTM A;  1PKM A;  4Q20 A;  3CX5 F;  1DLB A;  5CMU A;  1Y6X A;  3L73 H;  2P4K A;  4X66 B;  4YJ5 A;  4E4E A;  5JCO C;  2Q69 A;  4LWS A;  4EFB A;  4FK5 C;  1RM1 C;  2WLK A;  4JV5 B;  2G38 A;  1D2D A;  1IBK O;  5IDJ A;  2UUB B;  3TCU A;  2BOB C;  4DV2 O;  2WSS G;  3FYI B;  4JI8 B;  4YJ3 B;  1IBK B;  4F4L A;  4JI2 B;  1HW7 A;  4LF7 O;  2VGF A;  1TAE A;  1BMF G;  4J80 A;  3AG1 C;  4WFE A;  1FFX B;  3JAK A;  3ME3 A;  2W0X A;  3IFX A;  4O4H B;  3CCL V;  3I55 V;  1XDC A;  1ZX3 A;  4I4T B;  4ZI7 B;  3T1Y B;  3C3T A;  2WA4 A;  2F95 B;  3CMA V;  1ARO P;  1B3Q A;  1VQ4 V;  4FLV A;  3K0D A;  3U11 A;  5CA1 B;  2JJ1 G;  1MA1 A;  3E35 A;  1E0T A;  4GUN A;  3E22 B;  5L3C A;  2H8P C;  4FFB A;  4GT1 A;  3SYQ A;  2OCC B;  4KFM A;  4PV1 B;  1YSC A;  1H8E G;  3B4S A;  2AZ2 A;  3UT5 A;  1MZE A;  1QR8 A;  2Z3Y A;  3R65 A;  5D5Q A;  4PDL A;  4QJF B;  1AI5 A;  2HR3 A;  2ZNJ A;  5KUM A;  4Z2W A;  4NVP A;  4HYV A;  5K1X A;  2QWN B;  5FLX N;  3K0G A;  3AAG A;  3E83 A;  3J80 N;  1WJZ A;  1H2K A;  2H94 A;  4DV7 O;  5JCO A;  1JCH A;  4GKJ O;  4TQD A;  3EXA A;  2WLH A;  2HFE C;  2OIE A;  1Q7Y W;  3F7Y C;  3G6B A;  4DW1 A;  1SES A;  3LDC A;  4YHH B;  3G2G A;  4BW9 A;  2DOS A;  2QM8 A;  4UCU A;  5ITZ B;  2Y4U A;  4FIP C;  2VGG A;  2IBZ H;  1NU1 H;  2RMK B;  4NKG B;  3OEH G;  1N32 B;  5LHI A;  3CD6 V;  3C90 A;  3CRM A;  1T57 A;  2G50 A;  4IMA A;  5KMG B;  4NXN O;  2KKW A;  3H1J H;  1NH2 B;  4KHP B;  3QTG A;  3S3W A;  3G4S V;  3ZN1 A;  1JVM A;  3FYE B;  4B3M B;  3JAK B;  3AK2 A;  4JAV A;  2UUA B;  1FXH A;  4DV3 B;  4FM1 A;  3AG2 C;  5C8Y B;  1J5E O;  1H2L A;  2OWO A;  2VGB A;  1FJG O;  2E28 A;  1SA0 A;  4DR6 B;  4OGQ B;  2R9R B;  2XND G;  3PJS K;  4JI4 O;  2PI4 A;  4JI5 B;  3AG1 B;  2EJR A;  2M7W A;  3B8N A;  3OR6 C;  4EB6 A;  3HB3 B;  1VF6 C;  4DV0 O;  2CH7 B;  2EIN C;  4LNU B;  4B7K A;  2A7W A;  4DR1 O;  3EHB B;  1R3J C;  3CYO A;  1ZSP A;  4X1Y B;  2UXN A;  1OCO C;  4GLX A;  1OCR C;  2YI8 A;  3AG2 B;  5J2U B;  5GTI Z;  1VQN V;  2KG7 B;  4P2Z A;  4IIJ A;  3RYI B;  5A2Q N;  3ZMT A;  4XDK A;  3ZX6 A;  4QG9 A;  2UXC B;  1Q3E A;  3JD1 A;  4OX9 B;  4LC1 A;  2A9H A;  3OGC C;  2X7R B;  3D3Q A;  4MVU A;  4LWS B;  1F7Y A;  1MMM A;  3L75 H;  5F2V O;  3M99 B;  1YI2 V;  1BZK A;  4IHJ B;  5KHG A;  1ZL8 A;  2QM7 A;  2P7T C;  3VQW A;  2BOC C;  4KXR A;  3IC9 A;  4FLY A;  3VQY A;  1P7B A;  1N33 O;  5IYZ B;  1PNM A;  2F43 G;  1Z5W A;  1FD9 A;  3OE7 G;  2IH1 C;  4CC5 A;  1Q90 D;  4X20 B;  2IJI A;  5KMG A;  4D6T H;  3H1I H;  2JEX A;  2O57 A;  1Q82 W;  1N36 O;  4JTD B;  4JI4 B;  1WP7 A;  3BVO A;  5LHG A;  3M8A A;  5JH7 A;  2YXL A;  3H01 A;  4UV8 A;  1B06 A;  4JYY A;  4RUF A;  4O4I B;  2XAF A;  4U3J B;  2WA3 A;  2FKX A;  4MS2 A;  1WB7 A;  4MVR A;  4LFA B;  2ZIM A;  2NNU A;  2N05 A;  3OTF A;  3E2E A;  1WPX A;  3K5M A;  3DTU B;  3LDE A;  4ZOL B;  3SYC A;  4DV4 B;  4JYB A;  2Q67 A;  5FPO A;  2ITC C;  1KP2 A;  3SYP A;  1I08 A;  4AIL C;  3LNM B;  3KCX A;  1NI8 A;  4GKK B;  5JJJ B;  5BZB A;  3CCE V;  5IYB O;  1WLE A;  1E79 G;  1R73 A;  3FB6 C;  2YC0 A;  2QWO B;  3N2K B;  3X2Q C;  3ZHT A;  1XI1 A;  4NTY A;  5EBL C;  4CC6 A;  4MVO A;  4JI5 O;  5LP6 C;  2JEU A;  1XHZ A;  4OX9 O;  5FPR A;  1YF2 A;  2XUM A;  4C7U A;  5KHJ A;  4I4T A;  4KCV A;  3CXH F;  4B2D D;  1SC5 B;  4I9Q A;  1Q86 W;  2B9Z A;  2XHB A;  4WFH A;  4DV1 O;  2CDY A;  4JI7 O;  4LF8 O;  1B04 A;  1PM9 A;  1MZF A;  2HP8 A;  3IS4 A;  1P7G A;  3IJ4 A;  4UVB A;  3T1H O;  1SQF A;  5EYP B;  2HG5 C;  3ZRX A;  1JJ2 U;  4FLT A;  1DK1 A;  1GM8 A;  1MOF A;  4BWA A;  3B40 A;  3AK1 A;  4X62 B;  2EZP A;  3I56 V;  4DUZ B;  2CAZ C;  4GX2 A;  1KKD A;  2QEX V;  4U3J A;  2PYJ A;  1W2B U;  3BJT A;  4B3S B;  2EIL C;  4PHZ A;  1NVP B;  1UPG A;  3CRC A;  2Z0A A;  1VF7 A;  2MW2 B;  1XMQ O;  3L72 H;  1AVM A;  4UXN A;  1A49 A;  4WFA V;  3JAT B;  2XAJ A;  4DW0 A;  4FMT A;  1OHH G;  4NTW A;  4X65 O;  1WAZ A;  1AIL A;  1PD3 A;  2BSK B;  4FJC C;  1URF A;  1KKC A;  1N0J A;  2R9I A;  3Q4H A;  3CS5 A;  3HPL C;  3RVY A;  2FYU H;  1M9N A;  4LP8 A;  2DJV A;  4GCZ A;  5IY5 B;  3ZS8 C;  4UCS A;  3ZMV A;  1J95 A;  1GN2 A;  1OV9 A;  1T5A A;  1HDJ A;  1K8A W;  2QGN A;  3FX7 A;  5GW7 A;  3AG4 B;  4ZHQ B;  2E3C A;  4DV3 O;  4QIW F;  4O4H A;  4CH5 A;  5LOV A;  4UB8 Z;  3K59 A;  1I5Y A;  4DO2 A;  1GAX A;  1XHX A;  1KU9 A;  1T5E A;  4UCR A;  4DYL A;  4LF6 B;  2WLI B;  4WBN B;  5LXT B;  5CBG A;  2Q73 A;  2F93 B;  1XOU A;  4IIJ B;  1P4R A;  5B1A B;  1K5S A;  3MHS C;  2Y4T A;  3RYF A;  2UUC B;  2LGW A;  2L6L A;  1S77 D;  2XAS A;  4DRS A;  4FFB B;  1XMQ B;  2EIL B;  1EM1 A;  4U3F H;  2X6C A;  4W4L A;  5B3S B;  2QTO A;  3SJA C;  1KYO F;  4LF4 B;  2X0L A;  2WLL A;  4K0K B;  3T4Z A;  1XL6 A;  2QSA A;  1VIB A;  1OCZ B;  4FXF A;  4CH4 A;  3CP1 A;  3E8G A;  4OPH A;  4E2L A;  2LW7 A;  3BEH A;  1XMO B;  4JV5 O;  1JOY A;  2V1D A;  3CWB H;  2IJK A;  3AG7 A;  1AJP A;  3O9O A;  4JI2 O;  4YHH O;  3QV8 A;  4X1I A;  2FB5 A;  3JAS A;  4FFK A;  4X88 A;  3A0R A;  2JS5 A;  1GN4 A;  2E76 B;  1EZV H;  4HNA B;  5LYJ A;  4RQF A;  4TV9 B;  1WP8 A;  4GZR B;  2ZE5 A;  3ZHR A;  4B3T B;  5LMU O;  1F3X A;  1HNW O;  2XOK G;  2EIJ C;  3ABK B;  1FPO A;  2LFS A;  3KKY A;  4QGP A;  2BTQ B;  4DR7 O;  5J2U A;  5HFL A;  1LNQ A;  1R6K A;  1KP3 A;  5L3G A;  4CZZ A;  3K58 A;  1VQ7 V;  3OMI B;  5C93 A;  2Q7E A;  3BY6 A;  4K3A A;  2Q0A A;  2Y48 A;  2PZS A;  4ZOL A;  2ZE7 A;  4DXW A;  4JI0 B;  5IYC O;  1IXM A;  1GMG A;  1L0L H;  1MAB G;  2WLN A;  3K5N A;  5B66 Z;  3F5T A;  5KX5 A;  1JPX A;  1H2G A;  2LFR A;  3ML0 A;  3K08 A;  2P4V A;  2P67 A;  1R6T A;  1OJH A;  4DR6 O;  1S0V A;  2Q7H A;  3OAA G;  3HKB B;  4YXW G;  4QPJ A;  2HJF C;  2FML A;  3FFQ A;  3AK3 A;  1KUQ A;  4ZIB A;  1IBL O;  5LGT A;  4UUJ C;  1XMO O;  4EEQ A;  1HP8 A;  3OTO O;  1XNQ O;  3SJQ C;  3H9V A;  2GTS A;  1FAF A;  2PI5 A;  1K34 A;  1AB3 A;  3UT5 B;  3AEI A;  3QO7 A;  3ABM B;  1F3W A;  2F4V O;  4LFA O;  3CJH A;  5L3F A;  2QR4 A;  2WLM A;  2YXH A;  1WA8 A;  5KHI A;  3A8T A;  1YDX A;  2Q8V A;  1RPR A;  3JAT A;  1BE3 H;  3OMA B;  4UCO A;  4J7Z A;  4PDV A;  1BGY H;  4IP7 A;  3N25 A;  4G27 B;  4JGS A;  4KHP O;  2JGU A;  4UVC A;  1K5Q A;  5B3S C;  1HNW B;  4F6E A;  2LO1 A;  3R66 A;  3PN1 A;  1BT8 A;  3SJC C;  4LH7 A;  2OCH A;  2CTR A;  2QWP B;  3MAQ A;  2LP7 A;  3RYH B;  1X4T A;  4IGG A;  5FL7 G;  3SPJ A;  2ZR3 A;  1NQT A;  1XNR O;  3T1H B;  1KC8 W;  4YJ3 A;  4IT5 A;  5CBF A;  1Z5V A;  3ZRV A;  3TXS A;  4DV5 O;  1GM7 A;  3WFV A;  4K8X A;  5B5E Z;  3GG8 A;  1Y66 A;  4JF3 A;  2EIM C;  3S3X A;  3CE2 A;  4DR4 B;  2A3Q A;  4I50 B;  4FLW A;  2F4V B;  3N2G B;  3W7X A;  4TT3 G;  2WPD G;  3GWK C;  4BW5 A;  1YVW A;  2YIA A;  4X20 A;  4TUY B;  1PKX A;  4FM2 A;  1MG1 A;  4JPR A;  1CPY A;  4GKJ B;  5JJN B;  3ZED A;  3QF7 A;  2NR5 A;  1N8R W;  3RVZ A;  4KP4 A;  3WB2 A;  1NR7 A;  2JGD B;  2YXY A;  5H6R A;  1CXZ B;  4H13 B;  1RSO B;  1NR1 A;  2Q0O C;  2V4D A;  2QA4 V;  5LMN O;  1XEQ A;  2ZDI A;  3CCM V;  5H2F Z;  3SPC A;  5CA3 A;  5GTH Z;  1XIL A;  5A9G A;  3JD3 A;  1HR0 O;  4I55 A;  5KHK A;  1F4M A;  3E86 A;  3JAS B;  4DR7 B;  1VQ6 V;  2GSM B;  5LGU A;  2UXB O;  1TGO A;  4QE7 A;  2Q68 A;  4B3T O;  4FXJ A;  4MT8 A;  3RFR A;  1IVS A;  1H2S B;  3MD0 A;  1K92 A;  2DQ0 A;  1IBM B;  2ZIO A;  3KZI Z;  3QVN A;  5B1A C;  1XRE A;  4LF6 O;  4B3R B;  1NZ6 A;  3RGB A;  1M1K W;  2D3O W;  1SS3 A;  3ZJZ A;  4BIO A;  1Y74 B;  2HEP A;  4QE9 A;  3L9D A;  2KQX A;  1N34 B;  3FKS G;  4QG8 A;  1F4N A;  3JD0 A;  3SYO A;  3QNE A;  1EN6 A;  5KLV H;  1B6Q A;  3HKC B;  3CEI A;  3SRF A;  1SQB H;  3WG7 C;  1PKY A;  3HQP A;  4LF7 B;  1IBL B;  3QO5 A;  3JAL B;  3ZMZ A;  2FL4 A;  4JI8 O;  4ICG A;  1AQF A;  1Y76 B;  1ZUQ A;  3NR7 A;  4H33 A;  4QG6 A;  2B1I A;  2DYR B;  2YUA A;  4LF4 O;  4I9W A;  3QTC A;  3STZ C;  4NYK A;  5L3B A;  1QBZ A;  5JVD A;  1PKN A;  1F23 A;  3UO2 A;  3N2G A;  2YEV A;  4YIO A;  2CGN A;  2OYQ A;  4TSF G;  2DYS B;  2GTA A;  2QE7 G;  3MHH C;  1HNZ B;  4LFB B;  1COW G;  2WAM A;  1JJO A;  1GO3 F;  3ETQ A;  1R3L C;  1KBH A;  3UQ8 A;  2PF4 E;  1M90 W;  1Y76 A;  3H6O A;  1VQ9 V;  2OTJ V;  1AJQ A;  1NTM H;  3OT7 A;  5LXT A;  1A3X A;  3T07 A;  4HYO A;  4MVS A;  1VQO V;  4J9Y B;  1VP8 A;  1GH6 A;  4WF9 V;  2QWQ B;  1IUR A;  5EK0 A;  3SPG A;  1VEW A;  5BR8 B;  1K97 A;  1R1B A;  2ZDI C;  2JK5 C;  1IX9 A;  4GX1 A;  4JTA B;  3D36 A;  4RUE A;  4DRX B;  2VQF O;  1RPO A;  1WA8 B;  4X1Y A;  1SQG A;  2IJH A;  2UXD O;  3AG4 C;  3B2E E;  3K79 A;  3K04 A;  2DQ3 A;  2JVD A;  1EFR G;  3CJH B;  2R72 A;  1XUQ A;  4X1I B;  4YNG A;  2QKC A;  3BAA A;  4CH3 A;  2E5L O;  4B3S O;  1P84 F;  5CA0 B;  4OXS A;  3F5W C;  1EN4 A;  2UU9 B;  2EZO A;  3A0B Z;  1G4Y B;  1VAR A;  1ZTE A;  2ETN A;  3E0V A;  3ASO B;  2YSU B;  5LBQ A;  4AQY B;  3JAR A;  4TV8 B;  5IJ0 A;  3K03 A;  1SF9 A;  1Z2G A;  1BHA A;  2EIN B;  2VQE O;  4B2D A;  3HKD A;  2VWJ A;  4P9P A;  4FLX A;  2KG7 A;  3ASN B;  4MW8 A;  3FB7 C;  1YIJ V;  3CSX A;  1JFF B;  2RJZ A;  1FJG B;  5LGN A;  3SRH A;  1BHB A;  5EC1 C;  1ZJH A;  3CRR A;  3RT3 C;  3OM3 B;  2Y69 C;  3K5L A;  4PI0 A;  2VS0 A;  1QVF U;  4FZ0 A;  4CH6 A;  4NR1 A;  4YY3 B;  1HNX B;  2PGG A;  1CEZ A;  4WFF A;  4LF5 O;  1M93 A;  4G2K A;  2L35 A;  3KTX A;  2PY5 A;  4JAS A;  5JH7 B;  2ATK C;  4D7S A;  4O4J B;  2E75 B;  2VQF B;  3JD4 A;  2ZNI A;  1R6N A;  4BAY A;  4ZHQ A;  1NKD A;  4J42 A;  4O2B B;  5IY5 C;  1D5N A;  1MSD A;  3T4D A;  4PA3 A;  4RO2 A;  3CPW U;  3ABU A;  3K3W A;  4RPP A;  1YZB A;  4DV7 B;  2BE3 A;  3LUT B;  3JCU Z;  3CC7 V;  3DXR A;  2BTO A;  2PYL A;  1KEC A;  1MSW D;  2LQT A;  1ZAU A;  2CE4 A;  3ICX A;  5KA6 A;  5IYD O;  2BCC H;  3OUS A;  3U10 A;  5LMN B;  4XDL A;  2X6B A;  3CCJ V;  1AR4 A;  5H5N A;  1M4U A;  4W4K A;  4LR3 A;  3SGI A;  3UO3 A;  4G1N A;  5IT9 N;  3STL C;  2W6I G;  2A06 H;  3W7W A;  4I0X A;  2LW1 A;  3SRD A;  4FM0 A;  2KB1 A;  4H44 B;  4LFC O;  2DN9 A;  5IWA O;  2P06 A;  4IL6 Z;  3VQV A;  4TV8 A;  3CME V;  1WB8 A;  1GN3 A;  3BFR A;  1QLE C;  1VQK V;  5LL6 Y;  2RQ6 A;  2YID A;  2UXB B;  1AR1 B;  4DUY O;  3SPH A;  3VOU A;  4X64 O;  2EIK B;  2HVJ C;  4NB5 A;  2RN9 A;  4GYC B;  2VQE B;  4QGC A;  2XAH A;  3FB5 C;  3KCY A;  3M7M X;  2V7Q G;  3WB0 A;  4H0L B;  5JVD B;  2UXC O;  1AI6 A;  5FNV B;  3ABM C;  1KD1 W;  2EBO A;  2UUB O;  1FFT B;  3VBB A;  3ZHS A;  4L87 A;  5CBH A;  2CH7 A;  3DXR B;  1KB9 F;  4YJ2 B;  2BSK A;  4X9Q A;  1K9M W;  3SDL A;  4GX0 A;  4TUY A;  4CBC A;  3FAV B;  4ZBM A;  4N21 A;  1RSO A;  4PA6 A;  2OTL V;  1JA8 A;  1KQS U;  3CCU V;  5BXZ A;  1PV0 A;  2Y69 B;  2GV9 A;  4JI3 O;  1U96 A;  2UXD B;  4I7Z B;  4O2A B;  3ZHQ A;  2DW4 A;  4ASU G;  4G28 B;  5L3E A;  5LMU B;  4TWK A;  2YIB A;  1E1R G;  2Q6A A;  1FXK A;  4B7E A;  3G71 V;  1W0J G;  2IW5 A;  1AP5 A;  1VF5 B;  2ZQM A;  5J9P C;  2IJJ A;  2NLJ C;  1A32 A;  1YEW A;  4K35 A;  3W7T A;  1IDS A;  1I7F A;  3RYH A;  2NN4 A;  3MDS A;  1XBL A;  3LNN A;  1YIT V;  2KSD A;  4I55 B;  4HAM A;  1FXV A;  3E89 A;  1PNK A;  3RYF B;  1S72 V;  3RYC B;  3HKE A;  3W7S A;  3CXC U;  3CRQ A;  2DYS C;  2IU3 A;  4DR4 O;  3JYC A;  1XNR B;  4PDR A;  2WLI A;  1TUE B;  4DUY B;  1BS3 A;  3HKD B;  4FVM A;  2ZM6 B;  3ETD A;  5IJ0 B;  3LSS A;  4YY3 O;  4OPA A;  1QR9 A;  3OTO B;  1XNQ B;  1DF5 A;  4KS0 A;  4IYH A;  4AHC A;  1SET A;  5IE9 A;  1XL4 A;  4UFZ A;  2VRZ A;  2CK3 G;  4IHJ A;  3TXQ A;  4DV6 O;  2QJ1 A;  2AW9 A;  3DC6 A;  3ABT A;  1Y67 A;  4J41 A;  2ZKO A;  3CHX A;  2XT9 A;  4JI1 B;  3UM7 A;  5TIS Z;  2YIB D;  4J7K A;  1R3K C;  1LR1 A;  4JZ2 A;  5KA5 A;  1TUB B;  1QVG U;  4IYI A;  5IJ9 B;  1AI7 A;  4R50 A;  3BJF A;  1UFI A;  2UU9 O;  1VF6 A;  2QDO A;  3P30 A;  1SRY A;  2B5U A;  3UKM A;  4N23 A;  2H3O A;  2JS3 A;  2AHY A;  4FPP A;  1MNG A;  3HKE B;  2X6A A;  1SKV A;  2R70 A;  2ZE8 A;  3GWO A;  3O65 A;  5D5P A;  3P3N A;  1VQP V;  1BQZ A;  4JPG A;  3JAR B;  4KCT A;  1HNZ O;  3EFF K;  3CB2 A;  3EVK A;  3JAM N;  3T05 A;  1SZX A;  5CB4 B;  1G8M A;  5DN6 G;  4Q6G A;  4B3M O;  2HKO A;  4RWU A;  2BTQ A;  4JYC A;  4WJ8 A;  4NTX A;  5HFM A;  4A5U B;  1V54 C;  1FKA O;  1HNX O;  4PA9 A;  3K5O A;  5BY1 A;  1YTF B;  3TJT A;  5DM6 V;  1AR5 A;  5EIB C;  2Q4P A;  3E8H A;  1GM9 A;  1RFY A;  4CS3 A;  1TVK B;  1BCC H;  1S5H C;  3FD9 A;  1ZL8 B;  2LGQ A;  3OUF A;  3IC7 A;  3BA9 A; 
#chains in the Genus database with same CATH homology
 3WG7 C;  4X8A A;  2OT5 A;  3QO5 A;  4MS2 A;  4MTG A;  4KUM A;  4MVR A;  4XBF A;  4QPK A;  2IU0 A;  4PA4 A;  3ZMZ A;  5H6Q A;  2WLL B;  4H33 A;  1M56 C;  2B1G A;  2NNU A;  3E2E A;  1NBM G;  2B1I A;  2DYR B;  1WPX A;  3DTU B;  3LDE A;  4H37 A;  4I9W A;  4I5S A;  3STZ C;  4MW3 A;  3SYC A;  4JYB A;  3G6E V;  1QLE B;  2Q67 A;  4U7O A;  5L3B A;  1QBZ A;  1HWY A;  1F23 A;  3ABL B;  2ITC C;  1KP2 A;  3SYP A;  3LNM B;  3RBZ A;  2YEV A;  2DWD C;  5BZB A;  3CCE V;  5IYB O;  1WLE A;  1E79 G;  4TSF G;  1RM1 B;  2DYS B;  2QE7 G;  3MHH C;  1COW G;  1R73 A;  2WAM A;  4WCE V;  1Q81 W;  3FB6 C;  1GO3 F;  2ZXW B;  1R3L C;  3ETG A;  3X2Q C;  5EBL C;  4MVO A;  1M90 W;  2JEU A;  2QKS A;  3F7V C;  4UV9 A;  1V55 B;  1VQ9 V;  1K33 A;  2OTJ V;  1AJQ A;  4WFB V;  2EIJ B;  4HYO A;  4MVS A;  1VQO V;  4J9Y B;  5B1N A;  1Q86 W;  4WF9 V;  1JX9 A;  1R3I C;  4GX5 A;  4WFH A;  2HVK C;  3ZN0 A;  1YHQ V;  5EK0 A;  3SYA A;  3B77 A;  2EIM B;  3SPG A;  1AJN A;  4UVB A;  1L1F A;  1K97 A;  1ORQ C;  2HG5 C;  3ZRX A;  2ZDI C;  1JJ2 U;  1GM8 A;  1MOF A;  3OFN G;  2JK5 C;  2C2A A;  3T2M A;  1OCO B;  3CCR V;  3I56 V;  2EZP A;  4GX1 A;  3ZRW B;  2EIK C;  4JTA B;  1OCC B;  3D36 A;  4GX2 A;  3CCV V;  3ZMU A;  1KKD A;  2QEX V;  4RUE A;  2A0L A;  1RPO A;  1QLN A;  1K3E A;  1GK9 A;  2IJH A;  4UVA A;  2P6J A;  2HLD G;  3JD2 A;  3AG4 C;  3K79 A;  4MSW C;  1SER A;  3OEE G;  3K04 A;  3P32 A;  4MVQ A;  1VQM V;  2DQ3 A;  1W2B U;  1EFR G;  3CCS V;  1H38 A;  2EIL C;  1NVP B;  1ENV A;  1OCC C;  1OZ0 A;  2WWW A;  5L3D A;  3OMN B;  1VQL V;  2JIZ G;  4OXS A;  3LSQ A;  1VQ8 V;  3F5W C;  2UXX A;  2EZO A;  4UXN A;  4WFA V;  1NJI W;  2XAJ A;  4FMT A;  1G4Y B;  1OHH G;  2ITD C;  1PD3 A;  1YJN V;  3K06 A;  4FJC C;  2R9I A;  1K4C C;  2YSU B;  3ASO B;  3B8M A;  1K7D A;  2ZD9 A;  5LBQ A;  3AG3 C;  3OW2 U;  3HPL C;  3IGA C;  3RVY A;  1M9N A;  4LP8 A;  4Z1M G;  4GCZ A;  1S3J A;  1OCR B;  1PNL A;  2W6J G;  3K03 A;  5EBM C;  3TK1 A;  5IY5 B;  2OCC C;  1BHA A;  3ZMV A;  2EIN B;  2DYR C;  1M57 C;  1J95 A;  4P9O A;  1K8A W;  4P9P A;  3ZMS A;  2YEV B;  3T1C A;  4BIZ A;  3ASN B;  4MW8 A;  3FB7 C;  1FXK B;  1YIJ V;  4PEL A;  1ZWI C;  4JTC B;  5GW7 A;  3AG4 B;  5LGN A;  1SZT A;  1BHB A;  4QIW F;  5EC1 C;  5E1A C;  3ABL C;  2ZXW C;  1I5Y A;  3CC2 V;  3OM3 B;  2Y69 C;  3GB7 C;  3SPI A;  5LHH A;  3ZRS A;  1QVF U;  4MVM A;  4DO2 A;  3AG3 B;  2WLI B;  4J9Z B;  1YJ9 V;  4Q20 A;  1I5X A;  1DLB A;  4P30 A;  2AHZ A;  5CBG A;  1CEZ A;  5CMU A;  4WFF A;  5B1B B;  1P4R A;  5B1A B;  4G2K A;  1K5S A;  3MHS C;  2Q69 A;  1H8H G;  4FK5 C;  1RM1 C;  1S77 D;  2XAS A;  3ABK C;  1W0K G;  4JAS A;  1Y4M A;  2ATK C;  3D3I A;  1DTO A;  2WLK A;  2EIL B;  1JQ0 A;  3JD4 A;  1V55 C;  1R6N A;  3ASO C;  4BAY A;  2X6C A;  5IDJ A;  1NKD A;  5B3S B;  2QTO A;  4R7C A;  2X0L A;  2WLL A;  4ZKI A;  3TCU A;  3T4Z A;  2BOB C;  1XL6 A;  4EKW A;  3LDD A;  4MTX A;  2WSS G;  5IY5 C;  1OCZ B;  3FYI B;  3CP1 A;  3E8G A;  3T4D A;  4PA3 A;  4RO2 A;  4E2L A;  3ABU A;  3K3W A;  3CPW U;  3BEH A;  1JOY A;  4F4L A;  2V1D A;  3LUT B;  3E8F A;  1PL0 A;  2IJK A;  1AJP A;  1BMF G;  3CC7 V;  3AG1 C;  4WFE A;  1KEC A;  4X88 A;  1MSW D;  3IFX A;  1F51 A;  3A0R A;  5KA6 A;  4HZ3 A;  5IYD O;  3CCL V;  4RQF A;  3OUS A;  3I55 V;  4XDL A;  2X6B A;  3CCJ V;  1FS0 G;  2XOK G;  2EIJ C;  3ABK B;  3STL C;  2LFS A;  2W6I G;  4WFG A;  3W7W A;  5HFL A;  1LNQ A;  3CMA V;  1R6K A;  1KP3 A;  5L3G A;  1ARO P;  4CZZ A;  2KB1 A;  1VQ4 V;  1VQ7 V;  3K0D A;  3OMI B;  2JJ1 G;  5C93 A;  3BY6 A;  2GHY A;  2Y48 A;  3E35 A;  3CME V;  4DXW A;  5L3C A;  5IYC O;  1IXM A;  1GMG A;  2H8P C;  4RQE A;  2WLN A;  1MAB G;  1OCZ C;  4GT1 A;  1QLE C;  3SYQ A;  1VQK V;  2OCC B;  4KFM A;  1AR1 B;  1YSC A;  4LCU C;  1H8E G;  1DF4 A;  1JPX A;  1H2G A;  2LFR A;  1QR8 A;  2Z3Y A;  3R65 A;  3SPH A;  2EIK B;  3ML0 A;  2HVJ C;  1EZJ A;  3K08 A;  2JDI G;  5B1B C;  3NXS A;  4PDL A;  2P67 A;  2XAH A;  4QJF B;  1S0V A;  3FB5 C;  1AI5 A;  2V7Q G;  3OAA G;  1BL8 A;  1AI6 A;  2HR3 A;  5KUM A;  3ABM C;  4YXW G;  2ZR2 A;  4QPJ A;  2EBO A;  2HJF C;  1KD1 W;  1FFT B;  3QO8 A;  3K0G A;  3ETE A;  3VBB A;  3AAG A;  4L87 A;  5CBH A;  3E83 A;  5EBW C;  3FB8 C;  2XAQ A;  2A79 B;  5LGT A;  4UUJ C;  2H94 A;  1K9M W;  1AI4 A;  4GX0 A;  1JCH A;  1S76 D;  4PDM A;  4CBC A;  4ZBM A;  2WLH A;  2HFE C;  5B1O A;  3SJQ C;  3ASN C;  1Q7Y W;  4R8C A;  3F7Y C;  4N21 A;  4PA6 A;  2OTL V;  1K34 A;  2PI5 A;  1KQS U;  1SES A;  3CCU V;  1YTF D;  3LDC A;  1THZ A;  2FTK A;  3AEI A;  2QM8 A;  2Y69 B;  3QO7 A;  4FIP C;  3ABM B;  1YJW V;  5EC2 C;  5L3F A;  2DW4 A;  2WLM A;  4ASU G;  4QNH B;  4G28 B;  5L3E A;  3ZIA G;  5H9C A;  4TWK A;  3OEH G;  4MTO A;  1E1R G;  5LHI A;  4U7N A;  3CD6 V;  1CP9 A;  2Q6A A;  1FXK A;  2P90 A;  3CC4 V;  3G71 V;  1RPR A;  1W0J G;  3OMA B;  2IW5 A;  2ZQM A;  1NH2 B;  4PDV A;  5J9P C;  2Z5U A;  2IJJ A;  2NLJ C;  3W7T A;  4G27 B;  4JGS A;  3G4S V;  3ZN1 A;  4UVC A;  4LBE C;  1K5Q A;  5B3S C;  1GTO A;  1JVM A;  1NVP D;  3FYE B;  1YIT V;  2IH3 C;  4JAV A;  4MVZ A;  1FXH A;  4HAM A;  1FXV A;  3AG2 C;  3E89 A;  3WG7 B;  2LP7 A;  1PNK A;  1S72 V;  3RW0 A;  5FL7 G;  4BIU A;  3SPJ A;  3W7S A;  1VQ5 V;  3CXC U;  2R9R B;  2XND G;  1K73 W;  2ZR3 A;  1NQT A;  3PJS K;  1KC8 W;  3TET A;  2PI4 A;  2DYS C;  2IU3 A;  3AG1 B;  5CBF A;  2EJR A;  2M7W A;  3JYC A;  4PDR A;  2WLI A;  1TUE B;  3B8N A;  3ZRV A;  3OR6 C;  1GM7 A;  3HB3 B;  3WFV A;  1EBO A;  3OR7 C;  5KUK A;  2K1E A;  2EIN C;  1Y66 A;  4RAI A;  4JF3 A;  3ETD A;  3LSS A;  2EIM C;  3K9A A;  3X2Q B;  5CN0 A;  1QR9 A;  1M57 B;  3EHB B;  1R3J C;  1DF5 A;  3CYO A;  2UXN A;  1OCO C;  1SET A;  1OCR C;  3AG2 B;  1XL4 A;  1VQN V;  4P2Z A;  2CK3 G;  3E8B A;  3W7X A;  1FXK C;  1QCE A;  2WPD G;  4TT3 G;  3ZMT A;  4BW5 A;  4XDK A;  3ABT A;  3UM7 A;  2XAG A;  2JJ2 G;  1PKX A;  1MG1 A;  4JPR A;  1CPY A;  1R3K C;  3JCZ A;  3JD1 A;  5KA5 A;  1QVG U;  1N8R W;  4LC1 A;  1AI7 A;  2A9H A;  3RVZ A;  3OGC C;  4KP4 A;  2X7R B;  4R50 A;  1NR7 A;  4MVU A;  5H6R A;  3CCQ V;  3P30 A;  1K4D C;  1SRY A;  2B5U A;  3UKM A;  4N23 A;  1ROP A;  1NR1 A;  2AHY A;  2QA4 V;  4FPP A;  3M99 B;  1V54 B;  1YI2 V;  2ZDI A;  3CCM V;  2WLJ A;  4XDJ A;  4X89 A;  3SPC A;  5CA3 A;  2X6A A;  2QM7 A;  2P7T C;  1NH2 D;  3JD3 A;  2BOC C;  3GWO A;  3W7U A;  3E86 A;  1F4M A;  2DWE C;  1VQ6 V;  3VOU A;  2GSM B;  1VQP V;  1P7B A;  5LGU A;  4QE7 A;  1PNM A;  2F43 G;  4PA7 A;  2Q68 A;  3EFF K;  4R6Z A;  1E1Q G;  4MT8 A;  3OE7 G;  2IH1 C;  3KG2 A;  1G8M A;  5DN6 G;  2IJI A;  3MD0 A;  2HKO A;  1K92 A;  2DQ0 A;  4JYC A;  3ZRW A;  5B1A C;  5HFM A;  1V54 C;  2W0F C;  2JEX A;  4PA9 A;  1Q82 W;  1M56 B;  1GKF A;  1YTF B;  3ZCC A;  5DM6 V;  1M1K W;  3DGE A;  4JTD B;  2D3O W;  3ZJZ A;  1UJW B;  5LHG A;  3E8H A;  4QE9 A;  2MK3 A;  1GM9 A;  3H01 A;  3FKS G;  4MTF A;  1S5H C;  1F4N A;  3JD0 A;  3SYO A;  3OUF A;  3QNE A;  4UV8 A;  3IC7 A;  1B6Q A;  4RUF A;  4JAU A;  2XAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...