3OAAG

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
284
structure length
284
Chain Sequence
AGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATP synthase subunit alpha
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
total genus 104
structure length 284
sequence length 284
chains with identical sequence O, W, e
ec nomenclature
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3oaaG01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 3oaaG02
4Z1MG 5L3DA 4ASUG 5LHHA 5DN6G 5L3FA 1W0KG 3OEEG 1NBMG 4UVCA 2Z5UA 1OHHG 1MABG 2R9IA 2HKOA 4UV8A 2XAJA 5LGUA 2CK3G 4BAYA 5LHIA 1EFRG 3ZMZA 1BMFG 2WSSG 2IW5A 3OAAG 2W6IG 2EJRA 2F43G 4UV9A 5H6RA 4UVAA 3ZN1A 4UXNA 5LHGA 5L3EA 2WPDG 4KUMA 2DW4A 3FKSG 3OE7G 3ZMVA 5FL7G 2V7QG 2XASA 2XAGA 3ZN0A 4CZZA 3ABUA 5LGTA 3ZIAG 2V1DA 2H94A 5L3CA 2W6JG 2JDIG 1COWG 2JJ2G 2UXNA 1E1RG 2X0LA 3ZMUA 2Z3YA 3ZMSA 2XAHA 2XAQA 2HLDG 2XOKG 2JJ1G 3ABTA 2Y48A 4XBFA 5L3GA 2XAFA 1H8HG 1H8EG 1E1QG 5H6QA 2UXXA 2QE7G 3OEHG 4UVBA 4TSFG 5LBQA 4YXWG 1W0JG 5L3BA 1E79G 4TT3G 5LGNA 1FS0G 2JIZG 3OFNG 3ZMTA 2XNDG
chains in the Genus database with same CATH superfamily
3H1JH 4X1YA 5IYBO 4W4KA 2EILB 5LHHA 1ZWIC 4EFEA 4LF5O 4O4HB 5BR8B 4JI5B 4JI0O 3DXRB 3SYOA 3CXCU 4B3RO 4FLYA 3T1CA 1BSMA 5LA6B 3O9OA 1XL6A 3ASNB 3G71V 5E1AC 2HKOA 2XAJA 2EBOA 2DN9A 1R3KC 4F6EA 4ZI7B 4JI6B 2CTQA 5JQGB 3CHXA 2PI4A 1VMGA 4NYKA 2VWKA 2H3OA 1G4YB 4UVAA 2OT5A 3QG5A 1Q3EA 4OX9O 1QU7A 3IC9A 4JAVA 3DGEA 1ROPA 1NJIW 4DV6O 3U10A 4X65O 3D3QA 4IYHA 4P30A 2VQEO 4GX0A 1P49A 1EZVH 5LP6C 2B1GA 2IH3C 3EFFK 1PKMA 2DQ0A 5CBFA 1ZUQA 4DV0B 4DV1O 1LUWA 1QR9A 1K8AW 4KFMA 2P67A 2W6JG 1NR1A 2JJ2G 3WU2Z 4LC1A 5LMUB 3SJAC 4O4LA 1H2MA 3ZRWB 1CPYA 4B08A 5K1XA 5LOVB 1FFXA 2R9AA 4UCVA 2A3QA 1OCZB 3HQPA 3H01A 1WB7A 4DV3B 2ADPA 2X6AA 1H8EG 3FB7C 4XDLA 2BSKA 3G67A 3BA9A 3KKYA 4NTWA 1BT8A 2YI8A 1FKAO 1RPOA 2Q8VA 3BAAA 4ZHQB 2X6CA 4J11A 1IBLO 2A79B 1N36B 5EK0A 4FLZA 4IHJA 1D2DA 5EZYB 5E79Z 2UUAB 3STZC 1QVFU 2HG5C 3B77A 1OHHG 4D7SA 4X1YB 5DM6V 1FXKC 4B2DD 4JYAO 2AHZA 1BQ0A 3K59A 2XUMA 3IJ4A 2CE4A 4PDVA 2LJ2A 1MOFA 1SQFA 2BOCC 2GSMB 3K9SA 4ZKIA 2VGFA 2DYSC 3OMIB 5KMGA 1M56C 1R3IC 1AI6A 4DV2B 2H8PC 1XNRB 5KHIA 5BMVA 2HFEC 4UB8Z 4NTXA 2W0XA 1Q82W 2P06A 5EIBC 1N33B 3SRFA 3K04A 1GN3A 2M6YA 3APQA 5DECA 4DK1A 4KCVA 5J2TA 3RVZA 2GHYA 3JAWA 2VWJA 4JPRA 2Q73A 4JYYA 1AROP 2V1DA 5C93A 3K08A 1JQ0A 1IZ3A 2R70A 3ZS8C 4PV1B 3EVKA 1Q6UA 4WF9V 3SPCA 3UO2A 4JV5B 4QG9A 2ETNA 1K73W 1QR8A 5B3SC 4YJ5A 1TAEA 2AZ2A 3RYIB 2GDSA 4TSFG 4FK5C 2F93B 2OIGA 3OT7A 4O4LB 1Q6HA 2V4DA 2WA4A 3ABMB 3D3IA 3ABKB 3OGCC 1FFXB 2YSUB 2RJZA 2JIZG 1J95A 4X1KA 5L3DA 1RP3B 2BSKB 2NNUA 1WNSA 2KG7A 4H37A 1QLEC 5C8YA 5JJJB 5FLXN 3E83A 2IJHA 2KKWA 1KB9F 3JATA 1W59A 4LFCO 1MSWD 2MK3A 4UCRA 3CP1A 1K7DA 3H1LH 1G1XB 4TOIA 2R9IA 4XDKA 4HBNA 2PUSA 4IHJB 4IL6Z 2L6LA 3GVMA 3JD0A 2OYQA 4PDLA 4J7KA 2QDOA 2ZXWC 1EFRG 4B3MB 2WAMA 4TV8A 2QWNB 1KP3A 4UV9A 4PI0A 2RNBA 1GKFA 1OCOC 3BHPA 4G27B 1PL4A 2EINB 4O2BA 4UCOA 2VQFO 4LF6O 4B3SB 1UFIA 1XNQO 1F3XA 5LXTA 1JVMA 2ZE6A 4DUZB 1S76D 3GR4A 4DV5B 2YXHA 5BMVB 2OIEA 2UXDO 4MVMA 3E2EA 3KZIZ 2JGUA 3A8TA 1T5EA 1COWG 4GKJB 3T1HB 3UKMA 5J2UA 5J2TB 2AXTZ 3SJQC 3ZJZA 1GO3F 3FFQA 3B8MA 3JAWB 4NVPA 4L87A 4UCSA 1K5SA 2Y48A 4XBFA 4LP8A 4MVUA 5L3GA 2Z0AA 4E4EA 4R7CA 4QPKA 3LDCA 3L70H 4AQYB 5CN0A 3X2QB 1N0NA 3GG8A 4U3JA 2D3OW 4LF8B 4DR2O 4JI7O 3KCYA 2OWOA 4NTYA 2Q69A 4JI1O 4JF3A 1IDSA 4ASUG 3T1YB 2QTOA 4YJ2A 1SQVH 2NLJC 2UXCO 3CCLV 1R3LC 3T05A 2JS3A 3E86A 3VOUA 4LF9B 1PM9A 2E76B 1G8MA 3OW2U 3E8HA 4X1KB 5KUKA 2ZE5A 4FLVA 3GB7C 3R66A 2KG7B 3J80N 4RPPA 5C8YB 1EBOA 3ZRVA 2KB1A 2PI5A 3JATB 2IJIA 5JWPA 2FKXA 2F43G 4WFEA 3ZHUA 2YIAA 2JEUA 1K5QA 4U7OA 4TWKA 4TV8B 1N32B 2AGAA 4KUMA 1GH6A 5JH7A 3RW0A 1KMIZ 3IC7A 3THOA 4H0LB 2XAGA 1K9MW 3T4ZA 4O2BB 3VQXA 2LW1A 2VGIA 1R3JC 1UPGA 1YITV 4DXWA 5CA0B 2WLMA 4YIPA 5KUMA 4B2DA 4JAUA 3ASOB 5LXTB 4BIOA 2QKSA 4BIUA 3K5MA 3BJTA 3ABLB 2PTMA 1GK9A 4GX2A 4OGQB 3UM7A 2HHHB 5LMNO 3OTFA 1NR7A 1YCIA 1E1QG 5CBGA 1I94B 4MVZA 4UVBA 2Q4PA 5J2UB 1WP8A 1VQPV 4FFBA 1SERA 1VARA 4JI3O 1BCCH 3GWOA 2JEXA 4JPGA 3H1KH 3ZMTA 4GKKO 2UXBB 5AG2A 4W4LA 2EINC 4FVMA 2ARHA 1OZ0A 1FXVA 3B8NA 1L0LH 4U3JB 4NXMO 4FLWA 3QV7A 1QNMA 5H2FZ 1PNKA 4O4HA 3QV8A 5FNVA 4ZBMA 2NN4A 2QA4V 1VQOV 1IBMB 4UV8A 4YJ2B 2CTPA 3FB8C 1SQBH 3MHHC 4X8AA 2PY5A 1M4UA 3PN1A 2EJ7A 1O9HA 4Q6GA 1NVPB 2UU9B 1Q5OA 3RWRD 1F51A 5H6RA 2YUAA 4QE7A 2IBZH 1Y66A 5JCOA 1WLEA 3SPJA 4PHZA 1CP9A 1V9PA 3PP7A 1OV9A 3LSUA 5IWAO 3OE7G 1VF6C 1VQ6V 2OTJV 1N34B 1WPXA 4YHHB 3MD0A 4DR4B 1HNXO 1N8RW 4JI2O 1XI1A 4CZZA 3L72H 3M7MX 3H1HH 3RBZA 4DO2A 4P2ZA 2E3CA 4LH6A 1PKLA 2ZM6O 4KCUA 5KA5A 1FD9A 1I7FA 1R1BA 5JH7B 1VQ9V 4CS2A 3FB6C 3SGIA 3H1IH 4MTXA 2FTKA 1VQ5V 2ITCC 1XMQB 2EIKB 1VQ4V 1E0UA 1S72V 3HKCB 4I5SA 3WB1A 3A2FA 4KCTA 4K8ZA 4FLUA 3RFRA 1HR0B 4DR7B 3DC5A 3HKDB 2QWOB 3AG4C 4JAAA 2UUBB 4DR1O 4KRZA 2L35A 3SR2C 1SQGA 3CX5F 3C3TA 4HYOA 4IIJA 2GTSA 1R6NA 3O65A 3AG2B 4OPAA 3FD9A 4FFBB 3W7SA 3HQOA 3QV6A 3CCQV 3AG3B 3CC4V 1SRYA 3SJCC 1W2BU 4K0KO 2O57A 2YEVA 3JD2A 5IY5C 2UUCB 2A06H 3CC7V 2DYRB 3JSLA 1KKCA 1YJNV 5K1PA 2IW5A 2RDCA 4RQEA 4DR5B 2Q68A 3ASOC 5FNVB 3RN4A 4TQFA 3ABLC 1EM1A 5EC2C 4UXNA 4X66O 1DTOA 4J9YB 3BRCA 1X4TA 1AJNA 3QVNA 4AILC 2WPDG 3SRHA 1LR1A 4PA3A 2VGBA 1GM8A 3QNEA 2Y0PA 4I9QA 3DSQA 2A7WA 1HNWO 1KBHA 4A5UB 4JYCA 5CMUA 3U0ZA 1BHAA 3L71H 3JASA 2F4VB 1K4DC 1OCCB 5IJ0B 4HZ3A 4G28B 4CS4A 2XAQA 4QJFB 3SJBC 5BR8O 4JI5O 4KHPB 4Z1VA 1T5AA 3J81N 3FYIB 1PV0A 3BY6A 1BL8A 3P30A 4O4IA 3ML0A 2YIDA 4DR3B 1EZJA 2HR3A 3ETGA 1NVPD 1VQLV 1YXBA 1YTFD 4JI6O 3LSSA 5FPOA 3RYIA 3FAVA 2QTSA 3OFNG 3BABA 3JARB 3KCXA 4CC5A 4QE9A 1TVKA 3FX7A 1YSCA 3ICXA 5KHJA 5JJNB 5CBHA 4OPHA 1L0NH 4X9QA 2YC0A 3JSNA 4IIJB 2KSDA 4DV0O 5KHHA 4TV9A 3RVYA 4ABMA 3SYAA 1R73A 3OAAG 4BW5A 2Q5ZA 5JJEB 3QV9A 5LMUO 5EBWC 4LR3A 1EN6A 1NU1H 3BCCH 2YEVB 1XREA 1HNZB 1OCRB 1SQXH 2N74A 1RPRA 1JMKC 1VEWA 2EIKC 2Q9LA 4DV3O 1M93A 2LFRA 4B3TB 1P84F 3ZRXA 3R65A 1N4CA 4WFBV 4BIZA 1L1FA 2HJDA 2Q7GA 1IURA 4MTGA 1N36O 1Y6XA 4E2LA 4PDRA 5A9GA 5J9PC 3M8AA 1XOUA 2ZR3A 4DUYB 1F7YA 2UUAO 3E8BA 2B1IA 2JJ1G 1SETA 3SRDA 3AG3C 1SS3A 2E5LB 3JASB 2EZPA 4JI8B 4JI4B 1DGSA 4CH6A 2DWEC 4FM0A 2ADQB 2QWPB 1GRJA 4MTFA 2DYRC 4G1NA 1JA8A 5LL6Y 4LF7B 2EILC 1US6A 2Z5UA 2ZINA 5KAFZ 4N21A 4X62B 1PP9H 4O4IB 1PL0A 4FFKA 1KUQA 5B1OA 4DV2O 1XNRO 1GAXA 4LF4B 4UCUA 5L3FA 1B04A 3ASNC 4DV4B 3FAVB 5EBMC 3HPLC 3UQ8A 2OTLV 1N33O 4U3FH 2Y69B 2ZNIA 2M7WA 4N23A 1TVKB 1NTKH 5JCOC 1QVGU 2DJVA 1SC5B 4AI8A 1RSOA 1S5JA 2LGWA 3A0RA 3Q4HA 1OCCC 4F4LA 2F23A 1Q86W 3SYCA 4LFAB 5IE9A 3WG7B 4TV9B 3ZHTA 4MVRA 4P9PA 5LHGA 4JV5O 5D5PA 2XHBA 4F6RA 3N2KA 3QO8A 5CA3A 3H9VA 2XT9A 1PKNA 3CRQA 4J41A 1SZXA 2DW4A 3W7TA 5IJ9B 3G4SV 1HDJA 1UJWB 1MSDA 4GX5A 4RQFA 1ZLZA 1H2NA 3S3XA 2G38A 1SA0A 1TUEB 3LDDA 1SESA 3STLC 1E1RG 4K35A 2QKAA 2VRZA 2Z3YA 1E0TA 1OCZC 3JYCA 3RYHA 3I56V 2ZDIC 3OUSA 4J7JA 1NTMH 3WB2A 5CA0A 4DK0A 4BR6A 3K5OA 3OGIB 5GW7A 2E28A 5GTHZ 1Q7YW 1I5YA 3QO5A 1NKDA 4B3MO 1NS1A 1AP6A 1QHTA 4PA6A 1CXZB 3F5WC 4PA7A 1B3QA 2F95B 2HVJC 2WWWA 1ZL8A 1AI5A 5B1NA 4EFBA 3OD4A 3P3PA 3CXHF 1JJOA 2P4KA 2PYJA 1OCRC 2BTOA 3VQVA 3TK1A 3F7YC 4B3SO 1PPJH 3E22A 3IGAC 3RYCA 3MA8A 4MS2A 2WA3A 2OCCB 4DUZO 4TQDA 4DV5O 3E35A 1K4CC 5LGUA 4DV7B 4UCTA 2X6BA 4DR6B 1H2LA 4NXNB 3ZHQA 5B1AB 2EJRA 4GKJO 3T1HO 3CS5A 3CCSV 4YJ3A 1FPOA 1XHZA 4DRSA 1RSOB 3Q4HB 2HVKC 2OCHA 2RCVA 2HEPA 3QTCA 1DLBA 4IYIA 1F23A 1ZX3A 4AQYO 3K0DA 4EKWA 4LF8O 3ZIAG 4F6RB 1N0JA 3N2KB 2YS8A 1JJ2U 1A5UA 1Q43A 4I50A 1QBZA 4CH3A 3T1YO 2BTQA 1KC8W 3ZMSA 3S3WA 3K06A 1NI8A 4JASA 4QNHB 1MZEA 3L9DA 1P4RA 4NKGB 4LF9O 1SA0B 2FL4A 1JX9A 3G2GA 2GV9A 2Y69C 2Q6AA 3ABMC 3OTOB 2JRIA 3ABKC 2QE7G 3KG2A 4WFFA 4J80A 3CCUV 3RYHB 3GQYA 3RGBA 3HKCA 2R9RB 1BE3H 2BCCH 2XNDG 1AR5A 1YVWA 2YDEA 2YI9A 3HKDA 3WG7C 4FJCC 4HNAA 2ZNJA 3MAQA 3AG7A 3L73H 3QF7A 4KXRA 2ILMA 1W0KG 3A0BZ 1N32O 4HYWA 1ZL8B 1O9GA 4FLTA 4I7ZB 3RYFA 1NT2B 4QG8A 1DF4A 2CUGA 4WFHA 1FYJA 4YY3B 2P5OA 1Q90D 1J5EB 1WB8A 3DTUB 3E22B 3RYCB 4JZ2A 3KTXA 4I0XA 5DEDA 1HP8A 4DYLA 3VQYA 3MDSA 3ZHRA 1K3EA 5IT9N 2HHHO 3T0TA 4FZ0A 1MNGA 3G80A 1TUBB 1I94O 1WA8A 5GONA 1H2GA 4U7NA 1XBLA 4YJ3B 3CWBH 2IH1C 5IYDO 1JPXA 1YTFB 5LP6B 1U96A 1AI7A 3JALB 3E0WA 3I55V 2DQ3A 2UXBO 2ATKC 4X64B 4QPJA 3T2MA 3CPWU 3CCMV 1GN2A 4MVSA 4LBEC 5CB4B 4KP4A 1XMOB 2HLDG 1YJWV 1NZ6A 4LWSA 4BW9A 1IBKB 1BZKA 2PGGA 3ABTA 5IJ0A 1XL4A 3E0VA 3IS4A 1BQZA 4R8CA 2B9ZA 4I50B 3X2QC 2OCCC 4GLXA 4CS3A 2BTQB 2QM8A 5D5QA 1IBMO 1BHBA 2MW2B 4YXWG 4MW8A 1H38A 3SYQA 4QGCA 4CC6A 2UU9O 4R6ZA 5LGNA 1FS0G 2ZR2A 2A0LA 2DOSA 3K3WA 3AG1B 1S5HC 2YXLA 5EYPA 1VQNV 3ZHVA 3JARA 3E8GA 5EC1C 2RN9A 4ZOLA 3P32A 4KCWA 3W7WA 4DRXA 3HQNA 1NBMG 3U2ZA 5EBLC 1JFFA 3ZEDA 4I9WA 2IM9A 4YHHO 1N34O 1ZTEA 1Q6IA 2ITDC 3B2EE 3OR6C 4DR4O 1F4MA 4HNAB 3KHDA 4LFBB 2CK3G 1GN4A 1FXKB 1S3JA 1FJGB 3ZCCA 2WSSG 1IXBA 3IFXA 5KLVH 3RYFB 2WLKA 2CH7A 3CCEV 1U97A 2DMXA 3LNNA 4LF5B 2LO1A 2DYSB 4JI0B 1M56B 1M5IA 2W0FC 4B3RB 1SQQH 3FKSG 2EULA 3HKBA 4I0XB 4KL1A 2JS5A 3CJHA 1HR0O 3T07A 4DR7O 2RQ6A 3CMAV 4DW1A 2RMKB 1WJZA 2C2AA 4WFAV 3ZN0A 2UUBO 1A49A 5LGTA 2LP7A 2ODMA 5L3CA 3T4DA 1Y76A 1V55B 1WA8B 3M99B 5GONB 5ITZA 4P9OA 1AJPA 3A0HZ 4PELA 3K9AA 1AI4A 4OX9B 5H9CA 3FYEB 3JD1A 5KHGA 3LSQA 4DV6B 3B40A 1K92A 4X65B 2VQEB 3JAKA 1XQ8A 1VP7A 2Y0IA 1G6UA 1M9NA 3TCUA 4FLXA 2UUCO 1URFA 5LBQA 5B3SB 4FXJA 2Q0OC 4LWSB 1S0VA 1M1KW 3OM3B 4DV1B 4TT3G 1KP2A 3CRRA 3E89A 4DR5O 1Y4MA 3OMAB 1V54B 3SDLA 3CCJV 5FPRA 4MVQA 1VF7A 3L74H 3FB5C 4G2KA 1QLEB 2QEXV 1BS3A 1KU9A 1ZJHA 4QG6A 1FAFA 5EYPB 1S77D 1QLNA 2P22C 5IYCO 4WBNA 2IJJA 4ZOLB 5GTIZ 1B6QA 1GN6A 3CE2A 3UCSC 3TXQA 1GM7A 4DRXB 2F4VO 2ZXWB 3BPZA 1IBLB 1JFFB 5KA6A 4UFZA 1CEZA 2DWDC 4KHPO 5B5EZ 3EOEA 3ZN1A 1VF5B 1QCEA 4Z2WA 1NH2B 1OCOB 2IU0A 2LGQA 4FM1A 1FFTB 4RUEA 4DR3O 2K1EA 2R72A 3W7XA 1HWYA 2PZSA 4JYAB 2CH7B 2Q7HA 3B09A 4GT1A 1S5LZ 3LUTB 1I0HA 3MHSC 1A32A 1VP8A 4FXFA 4MSWC 1SF9A 5IJ9A 1YI2V 3ZMUA 3AG1C 3BA8A 3HKBB 3CJHB 3SYPA 4MW3A 2XOKG 1K97A 2AHYA 5BY1A 2K9PA 1EN5A 4CH4A 1GM9A 2FMLA 1R6KA 2XAFA 1Y76B 5ITZB 4MTOA 2VGGA 1XDCA 3H6OA 3ETQA 2Q7EA 1AB3A 4O2AA 4IGGA 3AG2C 3K0GA 3N25A 3OR7C 4FM2A 4PI2A 3JAKB 2HJFC 4PA9A 1HNZO 2A9HA 3ZX6A 1Q81W 2EIMB 4B3TO 1IX9A 3BVOA 4X1IA 2QR4A 4H33A 4J7ZA 4I55A 3OEEG 5EIBD 5JVDA 1PKYA 3WB0A 1DK1A 5IYZA 3HR0A 2EZOA 3L75H 3PJSK 1WPBA 2YXYA 5KAIZ 3F7VC 3CRMA 4X89A 1K33A 1V55C 3AK2A 1YZBA 4K3AA 4CBCA 4DUYO 1YHQV 3TXSA 3QO7A 4RAIA 1AQFA 2P7TC 1M57B 1EN4A 1VF6A 4WBNB 5L3EA 3J7AU 4NB5A 2E5LO 1LNQA 2Y4UA 4FZ1A 3CD6V 3CSXA 1IXMA 4JI4O 3N27A 4JI8O 2CDYA 4LFCB 3D36A 1A3XA 1JCHA 2V7QG 5KX5A 2FB5A 2E74B 2ZKOA 5LYJA 2ZIMA 3CCRV 4LF7O 2E75B 4EB6A 3ETDA 1F4NA 4X62O 3BEHA 3CRCA 1V54C 2YIBD 4LF4O 3AK3A 4PJ0Z 2XAHA 1RFYA 4GX1A 1VQ8V 3BJFA 4DV4O 1LUVA 2VQFB 2F1MA 4LF6B 1IVSA 3P3NA 1Y74A 2QM4A 2EIJB 4GUNA 1P7GA 3JCUZ 3C90A 4RUFA 1YEWA 1XNQB 1OJHA 5H6QA 4MT8A 4JYBA 3U11A 2CGOA 3RT3C 3K79A 1W0JG 1D5AA 3EHBB 1MA1A 2UXDB 1RM1B 4Z1MG 4O4JA 3N2GA 4JTCB 4LFAO 1Z5VA 2CGNA 2WLJA 1NH2D 1AR4A 3BFRA 3D8CA 4X88A 1JR9A 2CTRA 2GUZA 4O2AB 3NXSA 1XUQA 2JK5C 4PA4A 1TGOA 2LW7A 3NR7A 1VQ7V 2AZ0A 2GTAA 2N05A 2F66C 1ZSPA 3HB3B 5LHIA 2ZT9B 5KMGB 1SZTA 1KQSU 3EXAA 4X1IB 2Q0AA 4H13B 5JVDB 4I55B 2Y4TA 2W6IG 4DR2B 4JI7B 4WCEV 1AVMA 4PD4F 4JI1B 1GMGA 5IYZB 4J10A 3E8FA 4OXSA 2WLLA 4LCUC 2UXCB 1TA8A 2D2CB 1BGYH 3C3SA 5CA1A 4L8JA 1KYOF 1THZA 4FMTA 4LNUA 2PYLA 2ZIOA 1PNLA 1I08A 1YJ9V 2XASA 3LNMB 1TUBA 3APOA 4QIWF 3JCZA 2H94A 4RWUA 2JDIG 2JGDA 2X0LA 4ICGA 1ENVA 4WFGA 5LP6A 2P4VA 5KX5B 3TETA 3CEIA 4UUJC 3JALA 2BE3A 5LYJB 3ZBHA 4I4TA 1A3WA 2LFSA 3JD4A 1R6TA 2P6JA 2EIMC 1B06A 1SKVA 3DC6A 4JZGA 3SPIA 4EB6B 4HAMA 5CB4A 1H8HG 1X59A 4JTAB 5BXZA 4JGSA 4HYVA 5IDJA 2EX3A 3CB2A 3G6EV 3K57A 4RO2A 4DV7O 4DR6O 4NXNO 2ZCEA 5A2QN 1Y74B 4BWAA 3CRAA 3K5NA 3AG4B 2VS0A 5TISZ 1P7BA 2ZE7A 3UT5A 2ZQMA 1Y67A 3SRKA 4B7KA 1M57C 2QWQB 3K58A 4XDJA 1YIJV 1H2KA 4LH7A 3AK1A 5B66Z 1M90W 1VQMV 4UVCA 4O4JB 5LMNB 1H2SB 1MABG 3N2GB 2YICA 1AR1B 4NR1A 3HKEA 1DF5A 5B1BB 1VIBA 2HP8A 2GUZB 4IP7A 1ZAUA 2QKCA 3F5TA 3ZMZA 1BMFG 5IY5B 3JAMN 4JI3B 1GTOA 4GKKB 4UB6Z 1FXKA 3LDEA 4X20A 2QSAA 2FYUH 1MZFA 2Q67A 1KKDA 1KD1W 1XHXA 2X7RB 3B4SA 2WLHA 4R50A 4K8XA 1YDXA 3K03A 1K34A 3OTOO 5HFLA 2EIJC 4NXMB 3I5DA 4Q20A 3ME3A 4EEQA 3SPHA 1MG1A 2QWRB 2NR5A 2WLLB 1L8DA 3OUFA 2ZE8A 3ZRSA 3VBBA 1T57A 4B7EA 3VQWA 5BZBA 2DE0X 2WLIA 5CA1B 1RM1C 4LNUB 2ZD9A 2KQXA 4KS0A 4GCZA 1D5NA 2B5UA 4QGPA 2JVDA 1MMMA 3GWKC 3CC2V 4GYCB 4TUYA 1NTZH 4ZIBA 4FIPC 3UO3A 2JGDB 5HFMA 4MVOA 2UXXA 3WFVA 4JTDB 5IWAB 4IT5A 3OEHG 4YY3O 1Z2GA 3TJTA 4I4TB 1J5EO 3DXRA 3CYOA 5L3BA 1KECA 1HNXB 4JI2B 4D6TH 3OMNB 1PD3A 5LA6A 1YF2A 2PF4E 2P90A 2ZM6B 1PNMA 1HW7A 5KHKA 3IAYA 5DN6G 2WLNA 4YNGA 4WJ8A 4ZI7A 5JQGA 3K5LA 1PKXA 2CAZC 2LQTA 2YIBA 1AJQA 3UT5B 3QTGA 5B1AC 3TGUH 4BAYA 2QJ1A 4FPPA 4GZRB 3CCVV 4DR1B 2BOBC 4X64O 3D36C 1XMOO 1IBKO 2XTAA 1NQTA 3HKEB 4J42A 1AP5A 1Z5WA 2N04A 4D7TA 4C7UA 3JD3A 3ZMVA 3W7UA 2CTWA 5FL7G 4H44B 4X20B 4K0KB 1F3WA 3ZRWA 2IU3A 1XEQA 5H5NA 5LOVA 4IMAA 3AEIA 3CMEV 2QGNA 3ABUA 1WP7A 2ZDIA 1Q8IA 2GBOA 3ETEA 1I5XA 2UXNA 4DW0A 1XMQO 5F2VO 1WN7A 4PDMA 1ORQC 1FXHA 3SPGA 1XILA 1WAZA 4YIOA 1SQPH 4ZHQA 2QM7A 4X66B 3AAGA 3ZHSA 2WLIB 1QQCA 4J9ZB 4CH5A 2G50A 4AHCA 1VQKV 3G6BA 4LFBO 1AILA 5EZYA 1HNWB 1JOYA 5B1BC 2AW9A 1FJGO 2IJKA 1E79G 4TUYB
chains in the Genus database with same CATH topology
3OR7C 1AI5A 5B1NA 5IYBO 2EILB 2HJFC 4PA9A 5LHHA 1ZWIC 1OCRC 2EINC 1OZ0A 2A9HA 1Q81W 3TK1A 1FXVA 3SYOA 3B8NA 3CXCU 3F7YC 2EIMB 4H33A 3IGAC 3T1CA 3OEEG 1PNKA 1XL6A 4MS2A 3ASNB 4ZBMA 3G71V 2OCCB 5E1AC 2QA4V 2HKOA 3E35A 1VQOV 4UV8A 2EZOA 2XAJA 3PJSK 1K4CC 5LGUA 3FB8C 2EBOA 3MHHC 4X8AA 2X6BA 3F7VC 1R3KC 1NVPB 4X89A 5B1AB 1K33A 1V55C 2EJRA 2PI4A 1F51A 3CCSV 5H6RA 4CBCA 1YHQV 1G4YB 4UVAA 4QE7A 2OT5A 3QO7A 1Y66A 4RAIA 1WLEA 2P7TC 1M57B 4JAVA 3DGEA 1ROPA 1NJIW 3SPJA 5L3EA 1CP9A 1LNQA 3CD6V 1IXMA 4P30A 2HVKC 4GX0A 3D36A 3OE7G 1JCHA 1VQ6V 2B1GA 2V7QG 1DLBA 2IH3C 3EFFK 1F23A 1WPXA 2OTJV 2DQ0A 5CBFA 3CCRV 3MD0A 3K0DA 1N8RW 4EKWA 1QR9A 4CZZA 3ZIAG 1K8AW 3RBZA 4KFMA 4DO2A 3ETDA 1F4NA 2P67A 2W6JG 4P2ZA 1JJ2U 1NR1A 3BEHA 2JJ2G 1QBZA 1V54C 5KA5A 1KC8W 4LC1A 3ZMSA 1VQ9V 3K06A 2XAHA 3FB6C 3ZRWB 1CPYA 4JASA 4GX1A 1VQ8V 4MTXA 2FTKA 1VQ5V 2ITCC 1OCZB 2EIKB 4QNHB 1VQ4V 1S72V 1P4RA 3H01A 4I5SA 1JX9A 2Y69C 2EIJB 2Q6AA 3ABMC 4RUFA 2X6AA 1H8EG 3ABKC 5H6QA 3FB7C 4XDLA 4MT8A 2QE7G 3KG2A 4JYBA 4WFFA 3CCUV 3K79A 1W0JG 1RPOA 2R9RB 3AG4C 3EHBB 2X6CA 1RM1B 2XNDG 4Z1MG 2A79B 4JTCB 4HYOA 5EK0A 1R6NA 2WLJA 1NH2D 3WG7C 3AG2B 4FJCC 4X88A 3W7SA 3NXSA 3CCQV 1W0KG 3AG3B 3CC4V 3STZC 1QVFU 1SRYA 2HG5C 2JK5C 3B77A 1OHHG 4PA4A 5DM6V 1W2BU 1FXKC 2AHZA 1DF4A 2YEVA 4WFHA 3JD2A 5IY5C 1VQ7V 3CC7V 2DYRB 3HB3B 5LHIA 1YJNV 1SZTA 4PDVA 2IW5A 1KQSU 3DTUB 4RQEA 1MOFA 2W6IG 4WCEV 2BOCC 2GSMB 2Q68A 3ASOC 4ZKIA 2DYSC 1GMGA 3OMIB 1M56C 3ABLC 1R3IC 1AI6A 4OXSA 2H8PC 3E8FA 2WLLA 5EC2C 4LCUC 4UXNA 1DTOA 1K3EA 2HFEC 4J9YB 1AJNA 1Q82W 2WPDG 1THZA 4FMTA 3K04A 1H2GA 1PNLA 4U7NA 4PA3A 1YJ9V 2XASA 1GM8A 2IH1C 3QNEA 3RVZA 2GHYA 3LNMB 5IYDO 1JPXA 4JPRA 1YTFB 4JYCA 5CMUA 4QIWF 1AI7A 1BHAA 3JCZA 1AROP 2V1DA 2H94A 5C93A 3K08A 3I55V 2DQ3A 2JDIG 1JQ0A 2ATKC 2X0LA 4QPJA 3T2MA 3CPWU 1K4DC 1OCCB 3CCMV 1ENVA 4MVSA 4HZ3A 4WFGA 3TETA 4G28B 4UUJC 4LBEC 4KP4A 2XAQA 2HLDG 4QJFB 4WF9V 1YJWV 3SPCA 2LFSA 3JD4A 3ABTA 2P6JA 2EIMC 1K73W 1XL4A 3SPIA 4HAMA 3FYIB 1QR8A 3BY6A 5B3SC 1H8HG 4R8CA 1BL8A 4JTAB 3P30A 4JGSA 3X2QC 2OCCC 5IDJA 3ML0A 1EZJA 2QM8A 1BHBA 3G6EV 2HR3A 4TSFG 4FK5C 3ETGA 4RO2A 4YXWG 1NVPD 4MW8A 3ABMB 3D3IA 1VQLV 1H38A 3ABKB 3SYQA 3OGCC 2YSUB 1YTFD 3LSSA 4R6ZA 5LGNA 1FS0G 2ZR2A 2A0LA 2JIZG 1J95A 3OFNG 3K3WA 3AG4B 3AG1B 5L3DA 1P7BA 4QE9A 1S5HC 2NNUA 2ZQMA 4H37A 1VQNV 1QLEC 1YSCA 1M57C 3E8GA 3E83A 4XDJA 2IJHA 5EC1C 1YIJV 3P32A 5CBHA 3W7WA 1M90W 1VQMV 1NBMG 4UVCA 1MSWD 2MK3A 3CP1A 5EBLC 1K7DA 1MABG 4I9WA 2R9IA 4XDKA 2ITDC 3OR6C 1AR1B 1F4MA 3JD0A 1DF5A 4PDLA 2CK3G 2ZXWC 5B1BB 1FXKB 3RVYA 3SYAA 1EFRG 1S3JA 1R73A 3ZMZA 2WAMA 1BMFG 2WSSG 3IFXA 3OAAG 3ZCCA 5IY5B 4BW5A 1GTOA 1KP3A 2WLKA 4UV9A 1FXKA 3LDEA 5EBWC 1GKFA 1OCOC 4G27B 3CCEV 2YEVB 1OCRB 2EINB 1RPRA 2Q67A 1KKDA 1KD1W 2EIKC 2X7RB 2DYSB 2WLHA 4R50A 1M56B 3K03A 1K34A 2LFRA 2W0FC 2EIJC 5HFLA 4Q20A 3FKSG 3SPHA 1JVMA 1MG1A 3ZRXA 2JEXA 3R65A 1S76D 3CMAV 2WLLB 3OUFA 4WFBV 2C2AA 4WFAV 4BIZA 3ZN0A 1L1FA 3ZRSA 3VBBA 5LGTA 2LP7A 4MVMA 4MTGA 5L3CA 3E2EA 5BZBA 1RM1C 2WLIA 4E2LA 4PDRA 3T4DA 1V55B 1COWG 3M99B 2ZD9A 5J9PC 4P9OA 1AJPA 4PELA 4GCZA 3UKMA 2ZR3A 3K9AA 3SJQC 3ZJZA 1GO3F 3B8MA 2B5UA 4L87A 3E8BA 1AI4A 2B1IA 2JJ1G 1SETA 5H9CA 1K5SA 2Y48A 4XBFA 3AG3C 3FYEB 3JD1A 4LP8A 3LSQA 3CC2V 1K92A 4MVUA 5L3GA 2EZPA 4R7CA 4FIPC 5HFMA 4MVOA 2DWEC 2UXXA 4JTDB 3WFVA 3OEHG 1M9NA 4QPKA 3TCUA 3LDCA 5LBQA 5B3SB 4MTFA 2DYRC 1S0VA 1M1KW 5CN0A 3X2QB 3CYOA 5L3BA 3OM3B 1KECA 4TT3G 1KP2A 2D3OW 3E89A 2EILC 3OMNB 2Z5UA 1PD3A 1Y4MA 3OMAB 4N21A 2Q69A 4JF3A 1V54B 1PL0A 2P90A 4ASUG 1PNMA 5B1OA 2QTOA 3CCJV 2NLJC 3CCLV 5DN6G 5L3FA 2WLNA 4MVQA 1R3LC 3ASNC 5EBMC 2OTLV 3HPLC 3FB5C 4G2KA 1QLEB 3E86A 3VOUA 2QEXV 2Y69B 1PKXA 1G8MA 3OW2U 3E8HA 5KUKA 2M7WA 4N23A 3GB7C 1AJQA 1S77D 1QVGU 5B1AC 1QLNA 4BAYA 4FPPA 1EBOA 5IYCO 3ZRVA 2KB1A 3A0RA 2IJJA 2PI5A 1B6QA 3CCVV 2IJIA 2BOBC 1GM7A 2ZXWB 1OCCC 4F4LA 2F43G 5KA6A 1Q86W 1CEZA 3SYCA 2DWDC 3WG7B 4WFEA 1NQTA 3ZN1A 4MVRA 4P9PA 5LHGA 2JEUA 1K5QA 1QCEA 4U7OA 1NH2B 1OCOB 2IU0A 5CA3A 3QO8A 4TWKA 4KUMA 3JD3A 2DW4A 1FFTB 4RUEA 3ZMVA 3W7TA 2K1EA 5FL7G 3W7UA 3W7XA 1HWYA 3RW0A 3IC7A 3ZRWA 3G4SV 2IU3A 1UJWB 2XAGA 1K9MW 4GT1A 3LUTB 3T4ZA 3AEIA 3CMEV 3MHSC 1R3JC 3ABUA 4GX5A 4RQFA 2ZDIA 4MSWC 1TUEB 3ETEA 4DXWA 1YI2V 3LDDA 1I5XA 1SESA 1YITV 2WLMA 2UXNA 1E1RG 3STLC 3ZMUA 5KUMA 3AG1C 2Z3YA 4JAUA 3ASOB 4PDMA 1ORQC 1FXHA 1OCZC 3SPGA 3JYCA 2QKSA 4BIUA 3I56V 2ZDIC 3OUSA 3ABLB 3SYPA 4MW3A 2XOKG 1K97A 2AHYA 1GK9A 2QM7A 4GX2A 3AAGA 3UM7A 1GM9A 2WLIB 1R6KA 2XAFA 1NR7A 5GW7A 4J9ZB 1E1QG 5CBGA 4MTOA 4MVZA 4UVBA 1Q7YW 1VQKV 1I5YA 3QO5A 1VQPV 1JOYA 5B1BC 1NKDA 1SERA 2IJKA 4PA6A 1E79G 3F5WC 4PA7A 2HVJC 3GWOA 3AG2C 3K0GA 2WWWA 3ZMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1M G;  5L3D A;  4ASU G;  5LHH A;  5DN6 G;  5L3F A;  1W0K G;  3OEE G;  1NBM G;  4UVC A;  2Z5U A;  1OHH G;  1MAB G;  2R9I A;  2HKO A;  4UV8 A;  2XAJ A;  5LGU A;  2CK3 G;  4BAY A;  5LHI A;  1EFR G;  3ZMZ A;  1BMF G;  2WSS G;  2IW5 A;  3OAA G;  2W6I G;  2EJR A;  2F43 G;  4UV9 A;  5H6R A;  4UVA A;  3ZN1 A;  4UXN A;  5LHG A;  5L3E A;  2WPD G;  4KUM A;  2DW4 A;  3FKS G;  3OE7 G;  3ZMV A;  5FL7 G;  2V7Q G;  2XAS A;  2XAG A;  3ZN0 A;  4CZZ A;  3ABU A;  5LGT A;  3ZIA G;  2V1D A;  2H94 A;  5L3C A;  2W6J G;  2JDI G;  1COW G;  2JJ2 G;  2UXN A;  1E1R G;  2X0L A;  3ZMU A;  2Z3Y A;  3ZMS A;  2XAH A;  2XAQ A;  2HLD G;  2XOK G;  2JJ1 G;  3ABT A;  2Y48 A;  4XBF A;  5L3G A;  2XAF A;  1H8H G;  1H8E G;  1E1Q G;  5H6Q A;  2UXX A;  2QE7 G;  3OEH G;  4UVB A;  4TSF G;  5LBQ A;  4YXW G;  1W0J G;  5L3B A;  1E79 G;  4TT3 G;  5LGN A;  1FS0 G;  2JIZ G;  3OFN G;  3ZMT A;  2XND G; 
#chains in the Genus database with same CATH topology
 3H1J H;  4X1Y A;  5IYB O;  4W4K A;  2EIL B;  5LHH A;  1ZWI C;  4EFE A;  4LF5 O;  4O4H B;  5BR8 B;  4JI5 B;  4JI0 O;  3DXR B;  3SYO A;  3CXC U;  4B3R O;  4FLY A;  3T1C A;  1BSM A;  5LA6 B;  3O9O A;  1XL6 A;  3ASN B;  3G71 V;  5E1A C;  2HKO A;  2XAJ A;  2EBO A;  2DN9 A;  1R3K C;  4F6E A;  4ZI7 B;  4JI6 B;  2CTQ A;  5JQG B;  3CHX A;  2PI4 A;  1VMG A;  4NYK A;  2VWK A;  2H3O A;  1G4Y B;  4UVA A;  2OT5 A;  3QG5 A;  1Q3E A;  4OX9 O;  1QU7 A;  3IC9 A;  4JAV A;  3DGE A;  1ROP A;  1NJI W;  4DV6 O;  3U10 A;  4X65 O;  3D3Q A;  4IYH A;  4P30 A;  2VQE O;  4GX0 A;  1P49 A;  1EZV H;  5LP6 C;  2B1G A;  2IH3 C;  3EFF K;  1PKM A;  2DQ0 A;  5CBF A;  1ZUQ A;  4DV0 B;  4DV1 O;  1LUW A;  1QR9 A;  1K8A W;  4KFM A;  2P67 A;  2W6J G;  1NR1 A;  2JJ2 G;  3WU2 Z;  4LC1 A;  5LMU B;  3SJA C;  4O4L A;  1H2M A;  3ZRW B;  1CPY A;  4B08 A;  5K1X A;  5LOV B;  1FFX A;  2R9A A;  4UCV A;  2A3Q A;  1OCZ B;  3HQP A;  3H01 A;  1WB7 A;  4DV3 B;  2ADP A;  2X6A A;  1H8E G;  3FB7 C;  4XDL A;  2BSK A;  3G67 A;  3BA9 A;  3KKY A;  4NTW A;  1BT8 A;  2YI8 A;  1FKA O;  1RPO A;  2Q8V A;  3BAA A;  4ZHQ B;  2X6C A;  4J11 A;  1IBL O;  2A79 B;  1N36 B;  5EK0 A;  4FLZ A;  4IHJ A;  1D2D A;  5EZY B;  5E79 Z;  2UUA B;  3STZ C;  1QVF U;  2HG5 C;  3B77 A;  1OHH G;  4D7S A;  4X1Y B;  5DM6 V;  1FXK C;  4B2D D;  4JYA O;  2AHZ A;  1BQ0 A;  3K59 A;  2XUM A;  3IJ4 A;  2CE4 A;  4PDV A;  2LJ2 A;  1MOF A;  1SQF A;  2BOC C;  2GSM B;  3K9S A;  4ZKI A;  2VGF A;  2DYS C;  3OMI B;  5KMG A;  1M56 C;  1R3I C;  1AI6 A;  4DV2 B;  2H8P C;  1XNR B;  5KHI A;  5BMV A;  2HFE C;  4UB8 Z;  4NTX A;  2W0X A;  1Q82 W;  2P06 A;  5EIB C;  1N33 B;  3SRF A;  3K04 A;  1GN3 A;  2M6Y A;  3APQ A;  5DEC A;  4DK1 A;  4KCV A;  5J2T A;  3RVZ A;  2GHY A;  3JAW A;  2VWJ A;  4JPR A;  2Q73 A;  4JYY A;  1ARO P;  2V1D A;  5C93 A;  3K08 A;  1JQ0 A;  1IZ3 A;  2R70 A;  3ZS8 C;  4PV1 B;  3EVK A;  1Q6U A;  4WF9 V;  3SPC A;  3UO2 A;  4JV5 B;  4QG9 A;  2ETN A;  1K73 W;  1QR8 A;  5B3S C;  4YJ5 A;  1TAE A;  2AZ2 A;  3RYI B;  2GDS A;  4TSF G;  4FK5 C;  2F93 B;  2OIG A;  3OT7 A;  4O4L B;  1Q6H A;  2V4D A;  2WA4 A;  3ABM B;  3D3I A;  3ABK B;  3OGC C;  1FFX B;  2YSU B;  2RJZ A;  2JIZ G;  1J95 A;  4X1K A;  5L3D A;  1RP3 B;  2BSK B;  2NNU A;  1WNS A;  2KG7 A;  4H37 A;  1QLE C;  5C8Y A;  5JJJ B;  5FLX N;  3E83 A;  2IJH A;  2KKW A;  1KB9 F;  3JAT A;  1W59 A;  4LFC O;  1MSW D;  2MK3 A;  4UCR A;  3CP1 A;  1K7D A;  3H1L H;  1G1X B;  4TOI A;  2R9I A;  4XDK A;  4HBN A;  2PUS A;  4IHJ B;  4IL6 Z;  2L6L A;  3GVM A;  3JD0 A;  2OYQ A;  4PDL A;  4J7K A;  2QDO A;  2ZXW C;  1EFR G;  4B3M B;  2WAM A;  4TV8 A;  2QWN B;  1KP3 A;  4UV9 A;  4PI0 A;  2RNB A;  1GKF A;  1OCO C;  3BHP A;  4G27 B;  1PL4 A;  2EIN B;  4O2B A;  4UCO A;  2VQF O;  4LF6 O;  4B3S B;  1UFI A;  1XNQ O;  1F3X A;  5LXT A;  1JVM A;  2ZE6 A;  4DUZ B;  1S76 D;  3GR4 A;  4DV5 B;  2YXH A;  5BMV B;  2OIE A;  2UXD O;  4MVM A;  3E2E A;  3KZI Z;  2JGU A;  3A8T A;  1T5E A;  1COW G;  4GKJ B;  3T1H B;  3UKM A;  5J2U A;  5J2T B;  2AXT Z;  3SJQ C;  3ZJZ A;  1GO3 F;  3FFQ A;  3B8M A;  3JAW B;  4NVP A;  4L87 A;  4UCS A;  1K5S A;  2Y48 A;  4XBF A;  4LP8 A;  4MVU A;  5L3G A;  2Z0A A;  4E4E A;  4R7C A;  4QPK A;  3LDC A;  3L70 H;  4AQY B;  5CN0 A;  3X2Q B;  1N0N A;  3GG8 A;  4U3J A;  2D3O W;  4LF8 B;  4DR2 O;  4JI7 O;  3KCY A;  2OWO A;  4NTY A;  2Q69 A;  4JI1 O;  4JF3 A;  1IDS A;  4ASU G;  3T1Y B;  2QTO A;  4YJ2 A;  1SQV H;  2NLJ C;  2UXC O;  3CCL V;  1R3L C;  3T05 A;  2JS3 A;  3E86 A;  3VOU A;  4LF9 B;  1PM9 A;  2E76 B;  1G8M A;  3OW2 U;  3E8H A;  4X1K B;  5KUK A;  2ZE5 A;  4FLV A;  3GB7 C;  3R66 A;  2KG7 B;  3J80 N;  4RPP A;  5C8Y B;  1EBO A;  3ZRV A;  2KB1 A;  2PI5 A;  3JAT B;  2IJI A;  5JWP A;  2FKX A;  2F43 G;  4WFE A;  3ZHU A;  2YIA A;  2JEU A;  1K5Q A;  4U7O A;  4TWK A;  4TV8 B;  1N32 B;  2AGA A;  4KUM A;  1GH6 A;  5JH7 A;  3RW0 A;  1KMI Z;  3IC7 A;  3THO A;  4H0L B;  2XAG A;  1K9M W;  3T4Z A;  4O2B B;  3VQX A;  2LW1 A;  2VGI A;  1R3J C;  1UPG A;  1YIT V;  4DXW A;  5CA0 B;  2WLM A;  4YIP A;  5KUM A;  4B2D A;  4JAU A;  3ASO B;  5LXT B;  4BIO A;  2QKS A;  4BIU A;  3K5M A;  3BJT A;  3ABL B;  2PTM A;  1GK9 A;  4GX2 A;  4OGQ B;  3UM7 A;  2HHH B;  5LMN O;  3OTF A;  1NR7 A;  1YCI A;  1E1Q G;  5CBG A;  1I94 B;  4MVZ A;  4UVB A;  2Q4P A;  5J2U B;  1WP8 A;  1VQP V;  4FFB A;  1SER A;  1VAR A;  4JI3 O;  1BCC H;  3GWO A;  2JEX A;  4JPG A;  3H1K H;  3ZMT A;  4GKK O;  2UXB B;  5AG2 A;  4W4L A;  2EIN C;  4FVM A;  2ARH A;  1OZ0 A;  1FXV A;  3B8N A;  1L0L H;  4U3J B;  4NXM O;  4FLW A;  3QV7 A;  1QNM A;  5H2F Z;  1PNK A;  4O4H A;  3QV8 A;  5FNV A;  4ZBM A;  2NN4 A;  2QA4 V;  1VQO V;  1IBM B;  4UV8 A;  4YJ2 B;  2CTP A;  3FB8 C;  1SQB H;  3MHH C;  4X8A A;  2PY5 A;  1M4U A;  3PN1 A;  2EJ7 A;  1O9H A;  4Q6G A;  1NVP B;  2UU9 B;  1Q5O A;  3RWR D;  1F51 A;  5H6R A;  2YUA A;  4QE7 A;  2IBZ H;  1Y66 A;  5JCO A;  1WLE A;  3SPJ A;  4PHZ A;  1CP9 A;  1V9P A;  3PP7 A;  1OV9 A;  3LSU A;  5IWA O;  3OE7 G;  1VF6 C;  1VQ6 V;  2OTJ V;  1N34 B;  1WPX A;  4YHH B;  3MD0 A;  4DR4 B;  1HNX O;  1N8R W;  4JI2 O;  1XI1 A;  4CZZ A;  3L72 H;  3M7M X;  3H1H H;  3RBZ A;  4DO2 A;  4P2Z A;  2E3C A;  4LH6 A;  1PKL A;  2ZM6 O;  4KCU A;  5KA5 A;  1FD9 A;  1I7F A;  1R1B A;  5JH7 B;  1VQ9 V;  4CS2 A;  3FB6 C;  3SGI A;  3H1I H;  4MTX A;  2FTK A;  1VQ5 V;  2ITC C;  1XMQ B;  2EIK B;  1VQ4 V;  1E0U A;  1S72 V;  3HKC B;  4I5S A;  3WB1 A;  3A2F A;  4KCT A;  4K8Z A;  4FLU A;  3RFR A;  1HR0 B;  4DR7 B;  3DC5 A;  3HKD B;  2QWO B;  3AG4 C;  4JAA A;  2UUB B;  4DR1 O;  4KRZ A;  2L35 A;  3SR2 C;  1SQG A;  3CX5 F;  3C3T A;  4HYO A;  4IIJ A;  2GTS A;  1R6N A;  3O65 A;  3AG2 B;  4OPA A;  3FD9 A;  4FFB B;  3W7S A;  3HQO A;  3QV6 A;  3CCQ V;  3AG3 B;  3CC4 V;  1SRY A;  3SJC C;  1W2B U;  4K0K O;  2O57 A;  2YEV A;  3JD2 A;  5IY5 C;  2UUC B;  2A06 H;  3CC7 V;  2DYR B;  3JSL A;  1KKC A;  1YJN V;  5K1P A;  2IW5 A;  2RDC A;  4RQE A;  4DR5 B;  2Q68 A;  3ASO C;  5FNV B;  3RN4 A;  4TQF A;  3ABL C;  1EM1 A;  5EC2 C;  4UXN A;  4X66 O;  1DTO A;  4J9Y B;  3BRC A;  1X4T A;  1AJN A;  3QVN A;  4AIL C;  2WPD G;  3SRH A;  1LR1 A;  4PA3 A;  2VGB A;  1GM8 A;  3QNE A;  2Y0P A;  4I9Q A;  3DSQ A;  2A7W A;  1HNW O;  1KBH A;  4A5U B;  4JYC A;  5CMU A;  3U0Z A;  1BHA A;  3L71 H;  3JAS A;  2F4V B;  1K4D C;  1OCC B;  5IJ0 B;  4HZ3 A;  4G28 B;  4CS4 A;  2XAQ A;  4QJF B;  3SJB C;  5BR8 O;  4JI5 O;  4KHP B;  4Z1V A;  1T5A A;  3J81 N;  3FYI B;  1PV0 A;  3BY6 A;  1BL8 A;  3P30 A;  4O4I A;  3ML0 A;  2YID A;  4DR3 B;  1EZJ A;  2HR3 A;  3ETG A;  1NVP D;  1VQL V;  1YXB A;  1YTF D;  4JI6 O;  3LSS A;  5FPO A;  3RYI A;  3FAV A;  2QTS A;  3OFN G;  3BAB A;  3JAR B;  3KCX A;  4CC5 A;  4QE9 A;  1TVK A;  3FX7 A;  1YSC A;  3ICX A;  5KHJ A;  5JJN B;  5CBH A;  4OPH A;  1L0N H;  4X9Q A;  2YC0 A;  3JSN A;  4IIJ B;  2KSD A;  4DV0 O;  5KHH A;  4TV9 A;  3RVY A;  4ABM A;  3SYA A;  1R73 A;  3OAA G;  4BW5 A;  2Q5Z A;  5JJE B;  3QV9 A;  5LMU O;  5EBW C;  4LR3 A;  1EN6 A;  1NU1 H;  3BCC H;  2YEV B;  1XRE A;  1HNZ B;  1OCR B;  1SQX H;  2N74 A;  1RPR A;  1JMK C;  1VEW A;  2EIK C;  2Q9L A;  4DV3 O;  1M93 A;  2LFR A;  4B3T B;  1P84 F;  3ZRX A;  3R65 A;  1N4C A;  4WFB V;  4BIZ A;  1L1F A;  2HJD A;  2Q7G A;  1IUR A;  4MTG A;  1N36 O;  1Y6X A;  4E2L A;  4PDR A;  5A9G A;  5J9P C;  3M8A A;  1XOU A;  2ZR3 A;  4DUY B;  1F7Y A;  2UUA O;  3E8B A;  2B1I A;  2JJ1 G;  1SET A;  3SRD A;  3AG3 C;  1SS3 A;  2E5L B;  3JAS B;  2EZP A;  4JI8 B;  4JI4 B;  1DGS A;  4CH6 A;  2DWE C;  4FM0 A;  2ADQ B;  2QWP B;  1GRJ A;  4MTF A;  2DYR C;  4G1N A;  1JA8 A;  5LL6 Y;  4LF7 B;  2EIL C;  1US6 A;  2Z5U A;  2ZIN A;  5KAF Z;  4N21 A;  4X62 B;  1PP9 H;  4O4I B;  1PL0 A;  4FFK A;  1KUQ A;  5B1O A;  4DV2 O;  1XNR O;  1GAX A;  4LF4 B;  4UCU A;  5L3F A;  1B04 A;  3ASN C;  4DV4 B;  3FAV B;  5EBM C;  3HPL C;  3UQ8 A;  2OTL V;  1N33 O;  4U3F H;  2Y69 B;  2ZNI A;  2M7W A;  4N23 A;  1TVK B;  1NTK H;  5JCO C;  1QVG U;  2DJV A;  1SC5 B;  4AI8 A;  1RSO A;  1S5J A;  2LGW A;  3A0R A;  3Q4H A;  1OCC C;  4F4L A;  2F23 A;  1Q86 W;  3SYC A;  4LFA B;  5IE9 A;  3WG7 B;  4TV9 B;  3ZHT A;  4MVR A;  4P9P A;  5LHG A;  4JV5 O;  5D5P A;  2XHB A;  4F6R A;  3N2K A;  3QO8 A;  5CA3 A;  3H9V A;  2XT9 A;  1PKN A;  3CRQ A;  4J41 A;  1SZX A;  2DW4 A;  3W7T A;  5IJ9 B;  3G4S V;  1HDJ A;  1UJW B;  1MSD A;  4GX5 A;  4RQF A;  1ZLZ A;  1H2N A;  3S3X A;  2G38 A;  1SA0 A;  1TUE B;  3LDD A;  1SES A;  3STL C;  1E1R G;  4K35 A;  2QKA A;  2VRZ A;  2Z3Y A;  1E0T A;  1OCZ C;  3JYC A;  3RYH A;  3I56 V;  2ZDI C;  3OUS A;  4J7J A;  1NTM H;  3WB2 A;  5CA0 A;  4DK0 A;  4BR6 A;  3K5O A;  3OGI B;  5GW7 A;  2E28 A;  5GTH Z;  1Q7Y W;  1I5Y A;  3QO5 A;  1NKD A;  4B3M O;  1NS1 A;  1AP6 A;  1QHT A;  4PA6 A;  1CXZ B;  3F5W C;  4PA7 A;  1B3Q A;  2F95 B;  2HVJ C;  2WWW A;  1ZL8 A;  1AI5 A;  5B1N A;  4EFB A;  3OD4 A;  3P3P A;  3CXH F;  1JJO A;  2P4K A;  2PYJ A;  1OCR C;  2BTO A;  3VQV A;  3TK1 A;  3F7Y C;  4B3S O;  1PPJ H;  3E22 A;  3IGA C;  3RYC A;  3MA8 A;  4MS2 A;  2WA3 A;  2OCC B;  4DUZ O;  4TQD A;  4DV5 O;  3E35 A;  1K4C C;  5LGU A;  4DV7 B;  4UCT A;  2X6B A;  4DR6 B;  1H2L A;  4NXN B;  3ZHQ A;  5B1A B;  2EJR A;  4GKJ O;  3T1H O;  3CS5 A;  3CCS V;  4YJ3 A;  1FPO A;  1XHZ A;  4DRS A;  1RSO B;  3Q4H B;  2HVK C;  2OCH A;  2RCV A;  2HEP A;  3QTC A;  1DLB A;  4IYI A;  1F23 A;  1ZX3 A;  4AQY O;  3K0D A;  4EKW A;  4LF8 O;  3ZIA G;  4F6R B;  1N0J A;  3N2K B;  2YS8 A;  1JJ2 U;  1A5U A;  1Q43 A;  4I50 A;  1QBZ A;  4CH3 A;  3T1Y O;  2BTQ A;  1KC8 W;  3ZMS A;  3S3W A;  3K06 A;  1NI8 A;  4JAS A;  4QNH B;  1MZE A;  3L9D A;  1P4R A;  4NKG B;  4LF9 O;  1SA0 B;  2FL4 A;  1JX9 A;  3G2G A;  2GV9 A;  2Y69 C;  2Q6A A;  3ABM C;  3OTO B;  2JRI A;  3ABK C;  2QE7 G;  3KG2 A;  4WFF A;  4J80 A;  3CCU V;  3RYH B;  3GQY A;  3RGB A;  3HKC A;  2R9R B;  1BE3 H;  2BCC H;  2XND G;  1AR5 A;  1YVW A;  2YDE A;  2YI9 A;  3HKD A;  3WG7 C;  4FJC C;  4HNA A;  2ZNJ A;  3MAQ A;  3AG7 A;  3L73 H;  3QF7 A;  4KXR A;  2ILM A;  1W0K G;  3A0B Z;  1N32 O;  4HYW A;  1ZL8 B;  1O9G A;  4FLT A;  4I7Z B;  3RYF A;  1NT2 B;  4QG8 A;  1DF4 A;  2CUG A;  4WFH A;  1FYJ A;  4YY3 B;  2P5O A;  1Q90 D;  1J5E B;  1WB8 A;  3DTU B;  3E22 B;  3RYC B;  4JZ2 A;  3KTX A;  4I0X A;  5DED A;  1HP8 A;  4DYL A;  3VQY A;  3MDS A;  3ZHR A;  1K3E A;  5IT9 N;  2HHH O;  3T0T A;  4FZ0 A;  1MNG A;  3G80 A;  1TUB B;  1I94 O;  1WA8 A;  5GON A;  1H2G A;  4U7N A;  1XBL A;  4YJ3 B;  3CWB H;  2IH1 C;  5IYD O;  1JPX A;  1YTF B;  5LP6 B;  1U96 A;  1AI7 A;  3JAL B;  3E0W A;  3I55 V;  2DQ3 A;  2UXB O;  2ATK C;  4X64 B;  4QPJ A;  3T2M A;  3CPW U;  3CCM V;  1GN2 A;  4MVS A;  4LBE C;  5CB4 B;  4KP4 A;  1XMO B;  2HLD G;  1YJW V;  1NZ6 A;  4LWS A;  4BW9 A;  1IBK B;  1BZK A;  2PGG A;  3ABT A;  5IJ0 A;  1XL4 A;  3E0V A;  3IS4 A;  1BQZ A;  4R8C A;  2B9Z A;  4I50 B;  3X2Q C;  2OCC C;  4GLX A;  4CS3 A;  2BTQ B;  2QM8 A;  5D5Q A;  1IBM O;  1BHB A;  2MW2 B;  4YXW G;  4MW8 A;  1H38 A;  3SYQ A;  4QGC A;  4CC6 A;  2UU9 O;  4R6Z A;  5LGN A;  1FS0 G;  2ZR2 A;  2A0L A;  2DOS A;  3K3W A;  3AG1 B;  1S5H C;  2YXL A;  5EYP A;  1VQN V;  3ZHV A;  3JAR A;  3E8G A;  5EC1 C;  2RN9 A;  4ZOL A;  3P32 A;  4KCW A;  3W7W A;  4DRX A;  3HQN A;  1NBM G;  3U2Z A;  5EBL C;  1JFF A;  3ZED A;  4I9W A;  2IM9 A;  4YHH O;  1N34 O;  1ZTE A;  1Q6I A;  2ITD C;  3B2E E;  3OR6 C;  4DR4 O;  1F4M A;  4HNA B;  3KHD A;  4LFB B;  2CK3 G;  1GN4 A;  1FXK B;  1S3J A;  1FJG B;  3ZCC A;  2WSS G;  1IXB A;  3IFX A;  5KLV H;  3RYF B;  2WLK A;  2CH7 A;  3CCE V;  1U97 A;  2DMX A;  3LNN A;  4LF5 B;  2LO1 A;  2DYS B;  4JI0 B;  1M56 B;  1M5I A;  2W0F C;  4B3R B;  1SQQ H;  3FKS G;  2EUL A;  3HKB A;  4I0X B;  4KL1 A;  2JS5 A;  3CJH A;  1HR0 O;  3T07 A;  4DR7 O;  2RQ6 A;  3CMA V;  4DW1 A;  2RMK B;  1WJZ A;  2C2A A;  4WFA V;  3ZN0 A;  2UUB O;  1A49 A;  5LGT A;  2LP7 A;  2ODM A;  5L3C A;  3T4D A;  1Y76 A;  1V55 B;  1WA8 B;  3M99 B;  5GON B;  5ITZ A;  4P9O A;  1AJP A;  3A0H Z;  4PEL A;  3K9A A;  1AI4 A;  4OX9 B;  5H9C A;  3FYE B;  3JD1 A;  5KHG A;  3LSQ A;  4DV6 B;  3B40 A;  1K92 A;  4X65 B;  2VQE B;  3JAK A;  1XQ8 A;  1VP7 A;  2Y0I A;  1G6U A;  1M9N A;  3TCU A;  4FLX A;  2UUC O;  1URF A;  5LBQ A;  5B3S B;  4FXJ A;  2Q0O C;  4LWS B;  1S0V A;  1M1K W;  3OM3 B;  4DV1 B;  4TT3 G;  1KP2 A;  3CRR A;  3E89 A;  4DR5 O;  1Y4M A;  3OMA B;  1V54 B;  3SDL A;  3CCJ V;  5FPR A;  4MVQ A;  1VF7 A;  3L74 H;  3FB5 C;  4G2K A;  1QLE B;  2QEX V;  1BS3 A;  1KU9 A;  1ZJH A;  4QG6 A;  1FAF A;  5EYP B;  1S77 D;  1QLN A;  2P22 C;  5IYC O;  4WBN A;  2IJJ A;  4ZOL B;  5GTI Z;  1B6Q A;  1GN6 A;  3CE2 A;  3UCS C;  3TXQ A;  1GM7 A;  4DRX B;  2F4V O;  2ZXW B;  3BPZ A;  1IBL B;  1JFF B;  5KA6 A;  4UFZ A;  1CEZ A;  2DWD C;  4KHP O;  5B5E Z;  3EOE A;  3ZN1 A;  1VF5 B;  1QCE A;  4Z2W A;  1NH2 B;  1OCO B;  2IU0 A;  2LGQ A;  4FM1 A;  1FFT B;  4RUE A;  4DR3 O;  2K1E A;  2R72 A;  3W7X A;  1HWY A;  2PZS A;  4JYA B;  2CH7 B;  2Q7H A;  3B09 A;  4GT1 A;  1S5L Z;  3LUT B;  1I0H A;  3MHS C;  1A32 A;  1VP8 A;  4FXF A;  4MSW C;  1SF9 A;  5IJ9 A;  1YI2 V;  3ZMU A;  3AG1 C;  3BA8 A;  3HKB B;  3CJH B;  3SYP A;  4MW3 A;  2XOK G;  1K97 A;  2AHY A;  5BY1 A;  2K9P A;  1EN5 A;  4CH4 A;  1GM9 A;  2FML A;  1R6K A;  2XAF A;  1Y76 B;  5ITZ B;  4MTO A;  2VGG A;  1XDC A;  3H6O A;  3ETQ A;  2Q7E A;  1AB3 A;  4O2A A;  4IGG A;  3AG2 C;  3K0G A;  3N25 A;  3OR7 C;  4FM2 A;  4PI2 A;  3JAK B;  2HJF C;  4PA9 A;  1HNZ O;  2A9H A;  3ZX6 A;  1Q81 W;  2EIM B;  4B3T O;  1IX9 A;  3BVO A;  4X1I A;  2QR4 A;  4H33 A;  4J7Z A;  4I55 A;  3OEE G;  5EIB D;  5JVD A;  1PKY A;  3WB0 A;  1DK1 A;  5IYZ A;  3HR0 A;  2EZO A;  3L75 H;  3PJS K;  1WPB A;  2YXY A;  5KAI Z;  3F7V C;  3CRM A;  4X89 A;  1K33 A;  1V55 C;  3AK2 A;  1YZB A;  4K3A A;  4CBC A;  4DUY O;  1YHQ V;  3TXS A;  3QO7 A;  4RAI A;  1AQF A;  2P7T C;  1M57 B;  1EN4 A;  1VF6 A;  4WBN B;  5L3E A;  3J7A U;  4NB5 A;  2E5L O;  1LNQ A;  2Y4U A;  4FZ1 A;  3CD6 V;  3CSX A;  1IXM A;  4JI4 O;  3N27 A;  4JI8 O;  2CDY A;  4LFC B;  3D36 A;  1A3X A;  1JCH A;  2V7Q G;  5KX5 A;  2FB5 A;  2E74 B;  2ZKO A;  5LYJ A;  2ZIM A;  3CCR V;  4LF7 O;  2E75 B;  4EB6 A;  3ETD A;  1F4N A;  4X62 O;  3BEH A;  3CRC A;  1V54 C;  2YIB D;  4LF4 O;  3AK3 A;  4PJ0 Z;  2XAH A;  1RFY A;  4GX1 A;  1VQ8 V;  3BJF A;  4DV4 O;  1LUV A;  2VQF B;  2F1M A;  4LF6 B;  1IVS A;  3P3N A;  1Y74 A;  2QM4 A;  2EIJ B;  4GUN A;  1P7G A;  3JCU Z;  3C90 A;  4RUF A;  1YEW A;  1XNQ B;  1OJH A;  5H6Q A;  4MT8 A;  4JYB A;  3U11 A;  2CGO A;  3RT3 C;  3K79 A;  1W0J G;  1D5A A;  3EHB B;  1MA1 A;  2UXD B;  1RM1 B;  4Z1M G;  4O4J A;  3N2G A;  4JTC B;  4LFA O;  1Z5V A;  2CGN A;  2WLJ A;  1NH2 D;  1AR4 A;  3BFR A;  3D8C A;  4X88 A;  1JR9 A;  2CTR A;  2GUZ A;  4O2A B;  3NXS A;  1XUQ A;  2JK5 C;  4PA4 A;  1TGO A;  2LW7 A;  3NR7 A;  1VQ7 V;  2AZ0 A;  2GTA A;  2N05 A;  2F66 C;  1ZSP A;  3HB3 B;  5LHI A;  2ZT9 B;  5KMG B;  1SZT A;  1KQS U;  3EXA A;  4X1I B;  2Q0A A;  4H13 B;  5JVD B;  4I55 B;  2Y4T A;  2W6I G;  4DR2 B;  4JI7 B;  4WCE V;  1AVM A;  4PD4 F;  4JI1 B;  1GMG A;  5IYZ B;  4J10 A;  3E8F A;  4OXS A;  2WLL A;  4LCU C;  2UXC B;  1TA8 A;  2D2C B;  1BGY H;  3C3S A;  5CA1 A;  4L8J A;  1KYO F;  1THZ A;  4FMT A;  4LNU A;  2PYL A;  2ZIO A;  1PNL A;  1I08 A;  1YJ9 V;  2XAS A;  3LNM B;  1TUB A;  3APO A;  4QIW F;  3JCZ A;  2H94 A;  4RWU A;  2JDI G;  2JGD A;  2X0L A;  4ICG A;  1ENV A;  4WFG A;  5LP6 A;  2P4V A;  5KX5 B;  3TET A;  3CEI A;  4UUJ C;  3JAL A;  2BE3 A;  5LYJ B;  3ZBH A;  4I4T A;  1A3W A;  2LFS A;  3JD4 A;  1R6T A;  2P6J A;  2EIM C;  1B06 A;  1SKV A;  3DC6 A;  4JZG A;  3SPI A;  4EB6 B;  4HAM A;  5CB4 A;  1H8H G;  1X59 A;  4JTA B;  5BXZ A;  4JGS A;  4HYV A;  5IDJ A;  2EX3 A;  3CB2 A;  3G6E V;  3K57 A;  4RO2 A;  4DV7 O;  4DR6 O;  4NXN O;  2ZCE A;  5A2Q N;  1Y74 B;  4BWA A;  3CRA A;  3K5N A;  3AG4 B;  2VS0 A;  5TIS Z;  1P7B A;  2ZE7 A;  3UT5 A;  2ZQM A;  1Y67 A;  3SRK A;  4B7K A;  1M57 C;  2QWQ B;  3K58 A;  4XDJ A;  1YIJ V;  1H2K A;  4LH7 A;  3AK1 A;  5B66 Z;  1M90 W;  1VQM V;  4UVC A;  4O4J B;  5LMN B;  1H2S B;  1MAB G;  3N2G B;  2YIC A;  1AR1 B;  4NR1 A;  3HKE A;  1DF5 A;  5B1B B;  1VIB A;  2HP8 A;  2GUZ B;  4IP7 A;  1ZAU A;  2QKC A;  3F5T A;  3ZMZ A;  1BMF G;  5IY5 B;  3JAM N;  4JI3 B;  1GTO A;  4GKK B;  4UB6 Z;  1FXK A;  3LDE A;  4X20 A;  2QSA A;  2FYU H;  1MZF A;  2Q67 A;  1KKD A;  1KD1 W;  1XHX A;  2X7R B;  3B4S A;  2WLH A;  4R50 A;  4K8X A;  1YDX A;  3K03 A;  1K34 A;  3OTO O;  5HFL A;  2EIJ C;  4NXM B;  3I5D A;  4Q20 A;  3ME3 A;  4EEQ A;  3SPH A;  1MG1 A;  2QWR B;  2NR5 A;  2WLL B;  1L8D A;  3OUF A;  2ZE8 A;  3ZRS A;  3VBB A;  1T57 A;  4B7E A;  3VQW A;  5BZB A;  2DE0 X;  2WLI A;  5CA1 B;  1RM1 C;  4LNU B;  2ZD9 A;  2KQX A;  4KS0 A;  4GCZ A;  1D5N A;  2B5U A;  4QGP A;  2JVD A;  1MMM A;  3GWK C;  3CC2 V;  4GYC B;  4TUY A;  1NTZ H;  4ZIB A;  4FIP C;  3UO3 A;  2JGD B;  5HFM A;  4MVO A;  2UXX A;  3WFV A;  4JTD B;  5IWA B;  4IT5 A;  3OEH G;  4YY3 O;  1Z2G A;  3TJT A;  4I4T B;  1J5E O;  3DXR A;  3CYO A;  5L3B A;  1KEC A;  1HNX B;  4JI2 B;  4D6T H;  3OMN B;  1PD3 A;  5LA6 A;  1YF2 A;  2PF4 E;  2P90 A;  2ZM6 B;  1PNM A;  1HW7 A;  5KHK A;  3IAY A;  5DN6 G;  2WLN A;  4YNG A;  4WJ8 A;  4ZI7 A;  5JQG A;  3K5L A;  1PKX A;  2CAZ C;  2LQT A;  2YIB A;  1AJQ A;  3UT5 B;  3QTG A;  5B1A C;  3TGU H;  4BAY A;  2QJ1 A;  4FPP A;  4GZR B;  3CCV V;  4DR1 B;  2BOB C;  4X64 O;  3D36 C;  1XMO O;  1IBK O;  2XTA A;  1NQT A;  3HKE B;  4J42 A;  1AP5 A;  1Z5W A;  2N04 A;  4D7T A;  4C7U A;  3JD3 A;  3ZMV A;  3W7U A;  2CTW A;  5FL7 G;  4H44 B;  4X20 B;  4K0K B;  1F3W A;  3ZRW A;  2IU3 A;  1XEQ A;  5H5N A;  5LOV A;  4IMA A;  3AEI A;  3CME V;  2QGN A;  3ABU A;  1WP7 A;  2ZDI A;  1Q8I A;  2GBO A;  3ETE A;  1I5X A;  2UXN A;  4DW0 A;  1XMQ O;  5F2V O;  1WN7 A;  4PDM A;  1ORQ C;  1FXH A;  3SPG A;  1XIL A;  1WAZ A;  4YIO A;  1SQP H;  4ZHQ A;  2QM7 A;  4X66 B;  3AAG A;  3ZHS A;  2WLI B;  1QQC A;  4J9Z B;  4CH5 A;  2G50 A;  4AHC A;  1VQK V;  3G6B A;  4LFB O;  1AIL A;  5EZY A;  1HNW B;  1JOY A;  5B1B C;  2AW9 A;  1FJG O;  2IJK A;  1E79 G;  4TUY B; 
#chains in the Genus database with same CATH homology
 3OR7 C;  1AI5 A;  5B1N A;  5IYB O;  2EIL B;  2HJF C;  4PA9 A;  5LHH A;  1ZWI C;  1OCR C;  2EIN C;  1OZ0 A;  2A9H A;  1Q81 W;  3TK1 A;  1FXV A;  3SYO A;  3B8N A;  3CXC U;  3F7Y C;  2EIM B;  4H33 A;  3IGA C;  3T1C A;  3OEE G;  1PNK A;  1XL6 A;  4MS2 A;  3ASN B;  4ZBM A;  3G71 V;  2OCC B;  5E1A C;  2QA4 V;  2HKO A;  3E35 A;  1VQO V;  4UV8 A;  2EZO A;  2XAJ A;  3PJS K;  1K4C C;  5LGU A;  3FB8 C;  2EBO A;  3MHH C;  4X8A A;  2X6B A;  3F7V C;  1R3K C;  1NVP B;  4X89 A;  5B1A B;  1K33 A;  1V55 C;  2EJR A;  2PI4 A;  1F51 A;  3CCS V;  5H6R A;  4CBC A;  1YHQ V;  1G4Y B;  4UVA A;  4QE7 A;  2OT5 A;  3QO7 A;  1Y66 A;  4RAI A;  1WLE A;  2P7T C;  1M57 B;  4JAV A;  3DGE A;  1ROP A;  1NJI W;  3SPJ A;  5L3E A;  1CP9 A;  1LNQ A;  3CD6 V;  1IXM A;  4P30 A;  2HVK C;  4GX0 A;  3D36 A;  3OE7 G;  1JCH A;  1VQ6 V;  2B1G A;  2V7Q G;  1DLB A;  2IH3 C;  3EFF K;  1F23 A;  1WPX A;  2OTJ V;  2DQ0 A;  5CBF A;  3CCR V;  3MD0 A;  3K0D A;  1N8R W;  4EKW A;  1QR9 A;  4CZZ A;  3ZIA G;  1K8A W;  3RBZ A;  4KFM A;  4DO2 A;  3ETD A;  1F4N A;  2P67 A;  2W6J G;  4P2Z A;  1JJ2 U;  1NR1 A;  3BEH A;  2JJ2 G;  1QBZ A;  1V54 C;  5KA5 A;  1KC8 W;  4LC1 A;  3ZMS A;  1VQ9 V;  3K06 A;  2XAH A;  3FB6 C;  3ZRW B;  1CPY A;  4JAS A;  4GX1 A;  1VQ8 V;  4MTX A;  2FTK A;  1VQ5 V;  2ITC C;  1OCZ B;  2EIK B;  4QNH B;  1VQ4 V;  1S72 V;  1P4R A;  3H01 A;  4I5S A;  1JX9 A;  2Y69 C;  2EIJ B;  2Q6A A;  3ABM C;  4RUF A;  2X6A A;  1H8E G;  3ABK C;  5H6Q A;  3FB7 C;  4XDL A;  4MT8 A;  2QE7 G;  3KG2 A;  4JYB A;  4WFF A;  3CCU V;  3K79 A;  1W0J G;  1RPO A;  2R9R B;  3AG4 C;  3EHB B;  2X6C A;  1RM1 B;  2XND G;  4Z1M G;  2A79 B;  4JTC B;  4HYO A;  5EK0 A;  1R6N A;  2WLJ A;  1NH2 D;  3WG7 C;  3AG2 B;  4FJC C;  4X88 A;  3W7S A;  3NXS A;  3CCQ V;  1W0K G;  3AG3 B;  3CC4 V;  3STZ C;  1QVF U;  1SRY A;  2HG5 C;  2JK5 C;  3B77 A;  1OHH G;  4PA4 A;  5DM6 V;  1W2B U;  1FXK C;  2AHZ A;  1DF4 A;  2YEV A;  4WFH A;  3JD2 A;  5IY5 C;  1VQ7 V;  3CC7 V;  2DYR B;  3HB3 B;  5LHI A;  1YJN V;  1SZT A;  4PDV A;  2IW5 A;  1KQS U;  3DTU B;  4RQE A;  1MOF A;  2W6I G;  4WCE V;  2BOC C;  2GSM B;  2Q68 A;  3ASO C;  4ZKI A;  2DYS C;  1GMG A;  3OMI B;  1M56 C;  3ABL C;  1R3I C;  1AI6 A;  4OXS A;  2H8P C;  3E8F A;  2WLL A;  5EC2 C;  4LCU C;  4UXN A;  1DTO A;  1K3E A;  2HFE C;  4J9Y B;  1AJN A;  1Q82 W;  2WPD G;  1THZ A;  4FMT A;  3K04 A;  1H2G A;  1PNL A;  4U7N A;  4PA3 A;  1YJ9 V;  2XAS A;  1GM8 A;  2IH1 C;  3QNE A;  3RVZ A;  2GHY A;  3LNM B;  5IYD O;  1JPX A;  4JPR A;  1YTF B;  4JYC A;  5CMU A;  4QIW F;  1AI7 A;  1BHA A;  3JCZ A;  1ARO P;  2V1D A;  2H94 A;  5C93 A;  3K08 A;  3I55 V;  2DQ3 A;  2JDI G;  1JQ0 A;  2ATK C;  2X0L A;  4QPJ A;  3T2M A;  3CPW U;  1K4D C;  1OCC B;  3CCM V;  1ENV A;  4MVS A;  4HZ3 A;  4WFG A;  3TET A;  4G28 B;  4UUJ C;  4LBE C;  4KP4 A;  2XAQ A;  2HLD G;  4QJF B;  4WF9 V;  1YJW V;  3SPC A;  2LFS A;  3JD4 A;  3ABT A;  2P6J A;  2EIM C;  1K73 W;  1XL4 A;  3SPI A;  4HAM A;  3FYI B;  1QR8 A;  3BY6 A;  5B3S C;  1H8H G;  4R8C A;  1BL8 A;  4JTA B;  3P30 A;  4JGS A;  3X2Q C;  2OCC C;  5IDJ A;  3ML0 A;  1EZJ A;  2QM8 A;  1BHB A;  3G6E V;  2HR3 A;  4TSF G;  4FK5 C;  3ETG A;  4RO2 A;  4YXW G;  1NVP D;  4MW8 A;  3ABM B;  3D3I A;  1VQL V;  1H38 A;  3ABK B;  3SYQ A;  3OGC C;  2YSU B;  1YTF D;  3LSS A;  4R6Z A;  5LGN A;  1FS0 G;  2ZR2 A;  2A0L A;  2JIZ G;  1J95 A;  3OFN G;  3K3W A;  3AG4 B;  3AG1 B;  5L3D A;  1P7B A;  4QE9 A;  1S5H C;  2NNU A;  2ZQM A;  4H37 A;  1VQN V;  1QLE C;  1YSC A;  1M57 C;  3E8G A;  3E83 A;  4XDJ A;  2IJH A;  5EC1 C;  1YIJ V;  3P32 A;  5CBH A;  3W7W A;  1M90 W;  1VQM V;  1NBM G;  4UVC A;  1MSW D;  2MK3 A;  3CP1 A;  5EBL C;  1K7D A;  1MAB G;  4I9W A;  2R9I A;  4XDK A;  2ITD C;  3OR6 C;  1AR1 B;  1F4M A;  3JD0 A;  1DF5 A;  4PDL A;  2CK3 G;  2ZXW C;  5B1B B;  1FXK B;  3RVY A;  3SYA A;  1EFR G;  1S3J A;  1R73 A;  3ZMZ A;  2WAM A;  1BMF G;  2WSS G;  3IFX A;  3OAA G;  3ZCC A;  5IY5 B;  4BW5 A;  1GTO A;  1KP3 A;  2WLK A;  4UV9 A;  1FXK A;  3LDE A;  5EBW C;  1GKF A;  1OCO C;  4G27 B;  3CCE V;  2YEV B;  1OCR B;  2EIN B;  1RPR A;  2Q67 A;  1KKD A;  1KD1 W;  2EIK C;  2X7R B;  2DYS B;  2WLH A;  4R50 A;  1M56 B;  3K03 A;  1K34 A;  2LFR A;  2W0F C;  2EIJ C;  5HFL A;  4Q20 A;  3FKS G;  3SPH A;  1JVM A;  1MG1 A;  3ZRX A;  2JEX A;  3R65 A;  1S76 D;  3CMA V;  2WLL B;  3OUF A;  4WFB V;  2C2A A;  4WFA V;  4BIZ A;  3ZN0 A;  1L1F A;  3ZRS A;  3VBB A;  5LGT A;  2LP7 A;  4MVM A;  4MTG A;  5L3C A;  3E2E A;  5BZB A;  1RM1 C;  2WLI A;  4E2L A;  4PDR A;  3T4D A;  1V55 B;  1COW G;  3M99 B;  2ZD9 A;  5J9P C;  4P9O A;  1AJP A;  4PEL A;  4GCZ A;  3UKM A;  2ZR3 A;  3K9A A;  3SJQ C;  3ZJZ A;  1GO3 F;  3B8M A;  2B5U A;  4L87 A;  3E8B A;  1AI4 A;  2B1I A;  2JJ1 G;  1SET A;  5H9C A;  1K5S A;  2Y48 A;  4XBF A;  3AG3 C;  3FYE B;  3JD1 A;  4LP8 A;  3LSQ A;  3CC2 V;  1K92 A;  4MVU A;  5L3G A;  2EZP A;  4R7C A;  4FIP C;  5HFM A;  4MVO A;  2DWE C;  2UXX A;  4JTD B;  3WFV A;  3OEH G;  1M9N A;  4QPK A;  3TCU A;  3LDC A;  5LBQ A;  5B3S B;  4MTF A;  2DYR C;  1S0V A;  1M1K W;  5CN0 A;  3X2Q B;  3CYO A;  5L3B A;  3OM3 B;  1KEC A;  4TT3 G;  1KP2 A;  2D3O W;  3E89 A;  2EIL C;  3OMN B;  2Z5U A;  1PD3 A;  1Y4M A;  3OMA B;  4N21 A;  2Q69 A;  4JF3 A;  1V54 B;  1PL0 A;  2P90 A;  4ASU G;  1PNM A;  5B1O A;  2QTO A;  3CCJ V;  2NLJ C;  3CCL V;  5DN6 G;  5L3F A;  2WLN A;  4MVQ A;  1R3L C;  3ASN C;  5EBM C;  2OTL V;  3HPL C;  3FB5 C;  4G2K A;  1QLE B;  3E86 A;  3VOU A;  2QEX V;  2Y69 B;  1PKX A;  1G8M A;  3OW2 U;  3E8H A;  5KUK A;  2M7W A;  4N23 A;  3GB7 C;  1AJQ A;  1S77 D;  1QVG U;  5B1A C;  1QLN A;  4BAY A;  4FPP A;  1EBO A;  5IYC O;  3ZRV A;  2KB1 A;  3A0R A;  2IJJ A;  2PI5 A;  1B6Q A;  3CCV V;  2IJI A;  2BOB C;  1GM7 A;  2ZXW B;  1OCC C;  4F4L A;  2F43 G;  5KA6 A;  1Q86 W;  1CEZ A;  3SYC A;  2DWD C;  3WG7 B;  4WFE A;  1NQT A;  3ZN1 A;  4MVR A;  4P9P A;  5LHG A;  2JEU A;  1K5Q A;  1QCE A;  4U7O A;  1NH2 B;  1OCO B;  2IU0 A;  5CA3 A;  3QO8 A;  4TWK A;  4KUM A;  3JD3 A;  2DW4 A;  1FFT B;  4RUE A;  3ZMV A;  3W7T A;  2K1E A;  5FL7 G;  3W7U A;  3W7X A;  1HWY A;  3RW0 A;  3IC7 A;  3ZRW A;  3G4S V;  2IU3 A;  1UJW B;  2XAG A;  1K9M W;  4GT1 A;  3LUT B;  3T4Z A;  3AEI A;  3CME V;  3MHS C;  1R3J C;  3ABU A;  4GX5 A;  4RQF A;  2ZDI A;  4MSW C;  1TUE B;  3ETE A;  4DXW A;  1YI2 V;  3LDD A;  1I5X A;  1SES A;  1YIT V;  2WLM A;  2UXN A;  1E1R G;  3STL C;  3ZMU A;  5KUM A;  3AG1 C;  2Z3Y A;  4JAU A;  3ASO B;  4PDM A;  1ORQ C;  1FXH A;  1OCZ C;  3SPG A;  3JYC A;  2QKS A;  4BIU A;  3I56 V;  2ZDI C;  3OUS A;  3ABL B;  3SYP A;  4MW3 A;  2XOK G;  1K97 A;  2AHY A;  1GK9 A;  2QM7 A;  4GX2 A;  3AAG A;  3UM7 A;  1GM9 A;  2WLI B;  1R6K A;  2XAF A;  1NR7 A;  5GW7 A;  4J9Z B;  1E1Q G;  5CBG A;  4MTO A;  4MVZ A;  4UVB A;  1Q7Y W;  1VQK V;  1I5Y A;  3QO5 A;  1VQP V;  1JOY A;  5B1B C;  1NKD A;  1SER A;  2IJK A;  4PA6 A;  1E79 G;  3F5W C;  4PA7 A;  2HVJ C;  3GWO A;  3AG2 C;  3K0G A;  2WWW A;  3ZMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...