4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
5LL6Y 1XMOO 4JI4O 4JI3O 4OPAA 3SDLA 3RT3C 4DR2O 1A32A 5FLXN 1DK1A 2HHHO 1YZBA 1IBLO 1N34O 4DV0O 2UXCO 5H5NA 4X64O 1IBKO 5BY1A 1NS1A 1R1BA 4LFBO 4JYAO 4A5UB 2DOSA 4JI7O 4B3TO 3O65A 3J81N 3T1HO 4NXMO 1I94O 2E5LO 4LF7O 1XNRO 4JI1O 4KHPO 1FYJA 4DUYO 3F5TA 4DV2O 3J80N 4DV7O 1J5EO 4DUZO 3R66A 4DR6O 2N74A 4DV3O 1N36O 4JI5O 1IBMO 4X62O 4LFAO 1KUQA 4DR4O 1R6TA 4NXNO 2UU9O 2AGAA 4DV5O 5IWAO 1G1XB 4DV1O 3J7AU 2LW7A 4B3SO 2UXDO 4OPHA 2VQEO 4OX9O 2ZM6O 5A2QN 4YY3O 2UUBO 4LF9O 1AILA 2FKXA 4K0KO 4LFCO 1X59A 1FKAO 1HNZO 1N32O 2UUAO 1XEQA 2VQFO 4DR3O 4B3RO 1HR0O 4AQYO 3M8AA 1XNQO 4DR5O 3JAMN 1HNXO 5BXZA 4JI0O 4B3MO 4DV4O 1FJGO 2F4VO 5LMNO 4DR1O 4JI2O 4LF6O 3T1YO 4LF8O 4DR7O 4LF4O 4LF5O 4X66O 2Z0AA 4JI8O 1D2DA 5IT9N 1XMQO 3OTOO 5LMUO 1AB3A 4X65O 4DV6O 4GKJO 4YHHO 2UXBO 5BR8O 4JI6O 2UUCO 1HNWO 2JRIA 1N33O 1F7YA 4GKKO 4JV5O 2ZKOA 2DJVA
chains in the Genus database with same CATH superfamily
2WLJA 3SR2C 1PP9H 2GTSA 1EN5A 1R73A 3ZMZA 1OCCC 2ITDC 3JD1A 1DLBA 3X2QB 3MHHC 1M9NA 4KHPB 2QGNA 5AG2A 5IWAB 3CCQV 3P30A 4X65B 2B9ZA 3LNMB 1SZXA 4LBEC 5B1AB 1SF9A 3TJTA 3ZHVA 5CA0A 3RYHA 5CB4B 3E22A 5A9GA 1YEWA 5EIBD 3J80N 3OR6C 3H1KH 3ABTA 4X88A 1I94B 4PA9A 4IT5A 1AR1B 2N05A 1EN4A 5BMVB 1SQPH 2IJJA 3CHXA 3CRCA 5IWAO 4DV1O 1K5QA 3CX5F 1PL0A 2FL4A 4RQEA 1G4YB 5GW7A 4DUYB 3LNNA 4IHJB 1VIBA 3OE7G 2PGGA 3OMAB 3JSLA 4H37A 1Q6IA 5KAFZ 1FXKC 3JALB 3JAKB 4JYYA 4P30A 5L3GA 4IHJA 2M7WA 1L1FA 4DV1B 1JR9A 3BRCA 1PNMA 5LA6B 4LF5O 2ZIMA 3OD4A 3EXAA 3TETA 2YEVB 5GONB 4DR1B 3ZIAG 1XMQO 4BIZA 4Q6GA 1K5SA 3G6EV 1B06A 2A0LA 2AXTZ 3AK3A 2Q68A 5KA6A 1WB7A 5D5QA 4L87A 4WFEA 2ZXWC 5EBLC 4JI3O 1PKXA 5IJ0A 1A32A 1Q5OA 4DYLA 2P06A 1KP3A 1R3IC 1O9GA 4UB6Z 4PELA 5JH7B 1GH6A 3H01A 3OR7C 1AI7A 2JVDA 4DR6O 2WLIA 4DV3O 1KUQA 2HVKC 1X4TA 2A06H 4H33A 1ZX3A 4UCUA 1XNRB 4WFAV 1NJIW 3JYCA 1FJGB 1BHBA 2B1GA 4X1KB 2X7RB 4F6EA 2P4VA 4UVCA 5DEDA 1LUVA 3QO5A 3DGEA 1VF6C 1GN3A 3K06A 1N33B 2QWQB 1J5EB 5DN6G 2OT5A 4R50A 5EBWC 1VQOV 1BMFG 2KSDA 1EBOA 4LF6O 4TSFG 3D36C 3LSSA 1AI5A 1F4NA 1XL6A 2BOCC 2QM7A 2Z0AA 1YJNV 3CCVV 2L35A 4W4LA 4BIUA 1XBLA 5LMNB 2QA4V 3L9DA 4GKJO 3AG3C 4JI6O 1QBZA 1HNWO 4GKKO 3HKBA 3VQWA 4PI2A 5JCOC 4X20B 2P6JA 1RSOB 4NKGB 3JD2A 4OXSA 1OCCB 4LF8B 2F93B 3ASOB 4EB6B 2EX3A 1YZBA 1IBLO 1PPJH 1N34O 3ETQA 1SQFA 4JASA 3ZEDA 2D3OW 1DF4A 1KBHA 4JYAO 4A5UB 1SZTA 2GSMB 1NR1A 3DC5A 3LSUA 2ZXWB 2OCCC 4WBNA 1UPGA 1HP8A 1ZTEA 1YCIA 3QF7A 4GKKB 1Y76A 1XNRO 3STZC 4FIPC 4MS2A 4CH5A 1SC5B 1M56C 3SYQA 3B8MA 4DV7O 2UU9B 5IY5C 4AQYB 4DUZO 3CJHA 5CA1A 2G38A 1GKFA 5CB4A 2YIAA 3LDCA 1E1RG 3C3TA 1AJQA 3ZBHA 2XT9A 3BEHA 4FZ0A 2BSKA 4UCVA 1G8MA 3HKEA 2EIMB 2YIBD 1GM8A 4LF9O 4JF3A 4U7OA 4I9QA 5GTHZ 4H0LB 2F66C 4X1KA 1K7DA 1MOFA 2QKAA 4AHCA 3ETEA 2UUAO 5EK0A 1XNQO 3EFFK 4X9QA 4DRXA 4DV6B 1YITV 3G80A 5LGTA 5IYDO 4JI0O 1FJGO 1MZEA 3JATA 5JQGB 2HHHB 2XASA 3T4DA 4FLVA 1QVGU 3I5DA 4MVUA 4DR3B 2AW9A 4J7KA 3C3SA 1SQBH 1XI1A 2E74B 3CJHB 1S76D 3CRAA 1IURA 4CH6A 1Z5VA 3VBBA 3CS5A 4O4JB 2WA3A 3CPWU 2Z5UA 2JIZG 1Q7YW 4O2BA 1BT8A 3UKMA 3BAAA 4X1IA 4TQDA 5JWPA 4O4IB 3K04A 1K34A 3CEIA 5HFLA 3RW0A 2XNDG 1GRJA 3X2QC 2QE7G 4I55B 1QR9A 1IBKO 4JI3B 2CH7B 1SQXH 1MMMA 4GX5A 4ASUG 4FM0A 1PD3A 2DYRB 4QE9A 3H1IH 1Q6UA 3LDDA 2YXLA 4MVSA 2Q8VA 2ATKC 4FPPA 2YIDA 4MTOA 5IE9A 5IYZB 3F7VC 2Y0IA 1CXZB 5TISZ 3ETGA 3Q4HA 5JJEB 4JI5O 4JI4B 4LR3A 1TUEB 1BE3H 2E76B 5CBFA 4NXNO 5IYBO 2AGAA 3THOA 3H9VA 2CGOA 2X6BA 2DMXA 5E1AC 2Q5ZA 1R3LC 2R9AA 3D36A 2BE3A 4DO2A 1WPBA 1N32O 2Y4UA 3AEIA 3WU2Z 1JMKC 3CD6V 2R72A 3JARA 3CCRV 4TV9B 1BCCH 1GN6A 1U97A 4DR7O 4LF4O 3OUSA 1R3KC 2HP8A 2WLLB 2XAGA 1VF7A 5EYPB 5IYZA 1M4UA 1M56B 1P7GA 3SJAC 4JGSA 4L8JA 1YXBA 4NTXA 2YEVA 5GONA 2LFSA 4QJFB 4YJ3A 2YI8A 1ZAUA 1JVMA 3OAAG 4RQFA 3AG2C 1NKDA 4WFBV 2FTKA 4MTFA 1G6UA 4DR7B 4O4JA 4MVMA 2QM8A 2QJ1A 2F95B 2LGQA 2NLJC 2ZQMA 4DV0O 3SJBC 1MNGA 4QPKA 5CMUA 3OTFA 1ZUQA 4DR4B 1V55C 1GM7A 1AR4A 2ZDIA 4Z2WA 3IFXA 1Y74B 3T1HO 3ABKB 3APOA 5JCOA 1H2KA 3LDEA 3SYPA 5JVDA 4PDMA 3ZMUA 3D3QA 3ZJZA 5DECA 2EIKC 5B1OA 4JTDB 1Y4MA 2ODMA 3ZRSA 3K0GA 4NTYA 2XAQA 5KAIZ 5D5PA 2GBOA 1DF5A 2UU9O 3JD0A 1GAXA 3DXRA 2QWNB 3UT5A 1KD1W 3G6BA 4FFKA 4YJ3B 1KKDA 3OEHG 4TWKA 1VQ9V 1R6NA 3NXSA 2HEPA 4LCUC 1VF6A 5L3DA 4FLWA 4UV8A 1S5JA 4MVZA 2EIJC 1K4CC 4CS4A 2ZR3A 1YIJV 2R9RB 4JPRA 1KMIZ 3JSNA 4I4TA 5EC2C 1YVWA 5LXTB 4TUYA 1IX9A 4RO2A 4TV9A 4JI8O 3L73H 4LF9B 2HLDG 1ROPA 5KUKA 3OUFA 1L0LH 4YIPA 4JZGA 1TAEA 2UXCB 5IY5B 1Y76B 1RSOA 2DYRC 5JJNB 2NR5A 1RPRA 2V4DA 4ZI7B 4JI4O 2F4VB 4HNAA 4OPAA 5FNVB 3RVYA 3OTOB 2HHHO 2B5UA 1BS3A 1I7FA 3N2GA 1WA8B 4WCEV 2DOSA 1Y74A 3LSQA 2RNBA 4X89A 1OCOC 5KX5B 2ZM6B 2JJ2G 4TV8A 2IJKA 2ARHA 4KXRA 4RWUA 2W0XA 2DW4A 1SRYA 1L0NH 1TGOA 2YDEA 1P4RA 3CC2V 3SPCA 1OJHA 1BHAA 3RYHB 5CA0B 4X62O 2F43G 2P67A 1J95A 1OZ0A 1HDJA 4X8AA 5LBQA 2P90A 3K57A 1I5YA 2JDIG 1OCRB 1UFIA 2LW7A 1XHZA 3E8GA 1I0HA 2NNUA 3CMEV 1AILA 4CZZA 1QLEB 1QLEC 4QNHB 4DR5O 4O4HB 4TUYB 4K35A 1PNKA 1F4MA 1VF5B 2QWRB 4JAAA 3FD9A 1S3JA 1NH2D 4KL1A 4LF8O 4F4LA 4LFAB 5ITZB 4XBFA 3SYAA 1KYOF 3SJQC 2CTWA 3FAVA 1B6QA 3BY6A 1AJNA 1M5IA 4JTCB 1YTFD 4HNAB 4H13B 1WB8A 5EBMC 1JQ0A 2K1EA 2UXBO 3OM3B 3A0HZ 3HKDB 3ML0A 4JV5O 1NI8A 2IJIA 2DJVA 5H9CA 4PA7A 1VARA 4JI7B 2YIBA 1RM1C 4PI0A 1O9HA 2HVJC 4X1YA 1EN6A 4TT3G 4DUZB 3HPLC 1D5AA 4B7KA 4ZKIA 3U11A 1TVKA 4GCZA 5H5NA 4X64O 1KKCA 3RFRA 3AG4C 3AK1A 4I50B 3UO3A 2K9PA 2Q67A 3AG3B 3E86A 4K0KB 3ZHQA 4WBNB 5BR8B 1Q81W 1N34B 4LNUB 4O4HA 2QM4A 3JD4A 5L3CA 2XOKG 1GMGA 2DQ3A 1FPOA 3IGAC 3JASB 3W7TA 1PNLA 3K59A 3UT5B 4GX0A 5KHIA 3BA9A 2ZCEA 4QIWF 1HWYA 2ZNIA 2CK3G 2VQEO 1Q82W 1KU9A 4KP4A 5BMVA 3A0BZ 2XTAA 1XEQA 1Y67A 4LF4B 1SERA 3QO8A 2IJHA 4JAVA 3SGIA 5ITZA 4IYIA 3WB2A 3P32A 5KHKA 4FM2A 5KMGB 3F7YC 3A0RA 3OW2U 1ZWIC 2MK3A 1AR5A 1AP5A 3CCMV 1S5LZ 3I55V 3JAKA 5KUMA 3RN4A 2QSAA 2W0FC 3PN1A 3UCSC 1EFRG 2BTOA 3DSQA 3A2FA 3ZRWA 4YHHO 4E2LA 4O4IA 3JAWB 3HKDA 5EC1C 2BCCH 4ZI7A 4DV4B 3W7UA 2IW5A 3AG1C 4ZIBA 4ICGA 3T1YB 2Q73A 2ETNA 3ABLC 4G2KA 3AG4B 4I7ZB 4CH3A 3MAQA 2VWJA 2AHZA 4HZ3A 4FLUA 1NTMH 1GTOA 2NN4A 2WLLA 3ASOC 4TV8B 1NS1A 4PA6A 3CRMA 4B3TO 5EZYB 1VQLV 4PA4A 2ILMA 3K5NA 2OYQA 4W4KA 1FYJA 4DUYO 2WA4A 1US6A 2VS0A 5GTIZ 1R6KA 1AP6A 1AI4A 3K79A 1QU7A 3CCSV 3H1LH 4FMTA 1B3QA 1VQ8V 2LQTA 1G1XB 3FB8C 3S3XA 2UXDO 1XUQA 2BSKB 1AVMA 3PJSK 4J7ZA 4LP8A 2WWWA 5L3EA 2H3OA 1XMQB 2DWEC 2KG7A 2YSUB 3E2EA 4DR3O 4B3RO 4LNUA 5CN0A 2DN9A 2X0LA 2WLHA 1HW7A 4I0XA 4G27B 3JCZA 2AHYA 1AI6A 4NYKA 3OT7A 4X66O 4G28B 4J80A 1THZA 4BW5A 1BQ0A 2QWOB 3VQVA 3RGBA 1MA1A 1FS0G 1ZL8B 5LOVA 1FXHA 3OTOO 4EB6A 5DM6V 5LHHA 1NZ6A 2C2AA 4ZOLA 3FB5C 2RMKB 3N2KB 2E5LB 3G4SV 4NXMB 4I50A 4LFBB 4MT8A 4WFHA 2QTSA 4F6RB 4DV7B 2BTQA 4JI1B 3EHBB 1IXMA 4F6RA 1P84F 5JVDB 3AG2B 1R1BA 2WLNA 4YXWG 4I5SA 1H8EG 4QGPA 2QEXV 2F23A 2DYSC 1OCZB 3D8CA 2EZOA 2ADPA 1IBLB 4DK0A 4Z1MG 3HKCA 3F5TA 1H2LA 3ZS8C 1NH2B 3BABA 2DWDC 5H6RA 4LWSB 2IH1C 3K9AA 1XNQB 2JEXA 2UUAB 2PY5A 2KKWA 2CTPA 3ZHTA 2RQ6A 3CB2A 3P3NA 1Y66A 5F2VO 4O2BB 3DTUB 3T1CA 4ZBMA 3RYFA 4LF7B 4K3AA 5A2QN 2UUBO 1F23A 2X6CA 5C93A 4FLZA 1JA8A 3ASNB 1VQKV 2EILB 1W0KG 2Q9LA 1U96A 3JAMN 2YC0A 2Q0OC 4WF9V 3ZRXA 4ZHQA 2UUCB 4J7JA 1GN4A 3CRRA 1LR1A 5FL7G 1H38A 1WA8A 3OGIB 4D7TA 4FLTA 3SYCA 2EJRA 2PZSA 1NVPB 3SPHA 1SQGA 2CAZC 4U3FH 1MSWD 3STLC 1V54B 3BFRA 2UUCO 4NTWA 3QG5A 1SA0A 4DR5B 3HKEB 4P9OA 3SPJA 2OIGA 1ENVA 1CPYA 1M57B 3K5OA 5CA1B 5IYCO 4UCSA 1Z2GA 4O2AB 3M7MX 1KB9F 1R3JC 2UXCO 3NR7A 5H6QA 3AG1B 5JH7A 4UCOA 4LFBO 2PUSA 2PTMA 4J11A 2JS3A 3OMNB 4IGGA 5LA6A 1RM1B 3K03A 4BW9A 3HB3B 4B3SB 2Y4TA 5LHIA 4I55A 1K8AW 2D2CB 2KQXA 1J5EO 1YTFB 4RUEA 1BSMA 2YUAA 4CS3A 4X20A 4XDKA 1S5HC 5LOVB 4PHZA 1JFFA 2P5OA 3DXRB 1EZJA 3OGCC 5FPOA 1QQCA 1FXKB 2Z3YA 3E8HA 5B1BB 1K92A 4KUMA 3WG7B 3R65A 1NBMG 1SETA 2FMLA 1XHXA 2EIMC 2P7TC 2RDCA 4EFBA 1MABG 4B7EA 2W6IG 4JI2O 2GHYA 3ZHUA 2EZPA 2E75B 4NB5A 2ADQB 5L3BA 2LW1A 5KHGA 1XMOB 3CYOA 1TA8A 2WSSG 2EINB 3VOUA 1XREA 3KCYA 3U10A 1PL4A 1Q86W 5J2UA 1OCZC 3ZMSA 3GB7C 3GVMA 5KA5A 2OCCB 4EEQA 2GTAA 3SPGA 4IYHA 5B1AC 4B3TB 1AJPA 1BL8A 4PDLA 3SDLA 1QR8A 5LP6B 1ZSPA 1YJWV 2IU0A 1V9PA 3L74H 3OMIB 2HR3A 1PM9A 3ABLB 4DW1A 5K1PA 1K97A 1S72V 2Y0PA 2DE0X 2BOBC 4HYOA 1M93A 3AK2A 4KHPO 5B3SB 1W0JG 2XUMA 4DV2O 3O9OA 3OFNG 1NU1H 4FZ1A 2IH3C 4FFBA 3JD3A 2N74A 4MTXA 4EFEA 2IU3A 4LWSA 1IBMO 1N32B 3HKBB 2ZINA 1YI2V 4AI8A 1XQ8A 4FJCC 1IVSA 4K8XA 3J7AU 5KHHA 4B3SO 2H8PC 4NR1A 4HAMA 4JI2B 1IXBA 1NTZH 3A8TA 2X6AA 3FKSG 5IDJA 1N0NA 2WAMA 3JCUZ 3K5LA 2BTQB 3I56V 1HNZO 4NXNB 1H8HG 4I9WA 4AQYO 3TXSA 4JAUA 2EILC 4UCRA 1QVFU 5B1NA 4IL6Z 4DV4O 4YHHB 2CGNA 2P4KA 2VWKA 4IIJA 4BIOA 4JTAB 3L72H 4OGQB 1I5XA 5J2UB 4JI0B 1E79G 4DV6O 4P9PA 4IIJB 4TOIA 2RJZA 3CE2A 2KB1A 5LXTA 1RFYA 1KQSU 4JYBA 2LGWA 5KX5A 1W59A 2ZKOA 3VQXA 4GX2A 4X64B 1XILA 3E83A 3RT3C 4JZ2A 1LNQA 3T4ZA 3T2MA 3TK1A 1OHHG 1Q6HA 2JK5C 1SKVA 2PF4E 3ETDA 4D7SA 3E22B 3B8NA 2B1IA 1VQNV 5E79Z 3FFQA 2OIEA 4X62B 4J41A 4JV5B 1URFA 3K08A 4EKWA 4BWAA 3GWKC 4DW0A 2OCHA 4DR2B 1S0VA 4YY3B 4FFBB 2ZE8A 3P3PA 3WFVA 1VQ5V 1JPXA 3BCCH 1GN2A 3EVKA 3FAVB 4NVPA 2QDOA 4LFAO 2P22C 4KFMA 2RCVA 2F1MA 1QLNA 4I4TB 2GDSA 3ZHSA 2EIJB 4LH7A 1N8RW 3E35A 4I0XB 1WAZA 1EZVH 4JYCA 4OPHA 4PDRA 4OX9O 2EULA 1K33A 4UB8Z 3QVNA 1WPXA 1WJZA 3B4SA 2OWOA 4O4LB 2E3CA 3RWRD 3ASNC 4TQFA 4O2AA 2LJ2A 2Y69C 4MVQA 3M8AA 2KG7B 2Q7HA 3SJCC 4GKJB 3WG7C 3CC7V 3JATB 5JQGA 3W7XA 2CTRA 3CSXA 3UO2A 2UXBB 4J9ZB 3CWBH 1K4DC 2HJFC 2H94A 3S3WA 4CC5A 2QWPB 4GZRB 4BR6A 1WLEA 2RN9A 4CBCA 4LF6B 3CP1A 4J10A 5IT9N 1YSCA 1NTKH 1N4CA 3ABKC 3IC7A 4UUJC 3QO7A 3ZMTA 1MG1A 1V55B 1NR7A 5IJ9B 5EIBC 1LUWA 4Q20A 2PI4A 2A7WA 4WFGA 4R7CA 4ZHQB 3WB0A 2JGUA 2PYJA 1K73W 1YJ9V 3APQA 4DR2O 3TGUH 5K1XA 3G67A 3AG7A 1TUBA 5J2TA 4DV3B 2WLKA 4UCTA 4PD4F 4LF5B 4PA3A 1Q90D 2Q69A 2A3QA 3BA8A 3N2KA 1AROP 3DC6A 4NXMO 2E5LO 1Q3EA 1P49A 1UJWB 3IJ4A 4MW3A 3MHSC 1JOYA 1NT2B 1VMGA 3BPZA 3RYCA 2JGDB 1TUBB 4UXNA 2FB5A 2Q7GA 3KKYA 4DR4O 4PDVA 5B66Z 4FVMA 4JYAB 2UXNA 5BZBA 4DV0B 2FYUH 1NVPD 4D6TH 3HR0A 4YY3O 2WLIB 1VQPV 2Q0AA 3ZX6A 5FPRA 2HJDA 5C8YB 1NQTA 4GUNA 1FKAO 4CS2A 2VQFO 4GLXA 4DR6B 1IZ3A 2EJ7A 2YI9A 2ZE5A 2YICA 2WPDG 2ZT9B 3G71V 1CEZA 4DR1O 4P2ZA 2UXDB 3ZCCA 3UM7A 2QKCA 5LYJB 3LUTB 1HNZB 5CA3A 2GV9A 1B04A 3CXHF 4ZOLB 3CCJV 1F51A 1SQVH 3KZIZ 1L8DA 3C90A 5IJ0B 3ZMVA 3TXQA 3KG2A 2YS8A 4OX9B 2Q4PA 1XL4A 1S77D 4B08A 4PJ0Z 5EZYA 2HFEC 2JRIA 1Q43A 1N33O 1EM1A 3K0DA 3CC4V 1QCEA 2LFRA 3FB6C 4C7UA 1XMOO 3N2GB 2CH7A 4CC6A 1SS3A 5FLXN 1P7BA 1M57C 1YDXA 4FLXA 3MD0A 1VEWA 1YHQV 4YJ2A 5LYJA 3CCUV 1VQMV 3ZHRA 2GUZB 2MW2B 1I08A 5J2TB 1KC8W 3E8BA 1QHTA 2CTQA 4LH6A 3CRQA 4DXWA 2QR4A 2CE4A 1Y6XA 2R9IA 4U3JA 1N36O 2ZE6A 5KLVH 1R6TA 2CDYA 3CMAV 4LC1A 1IBKB 2ZDIC 4U3JB 4DV2B 1JFFB 3BHPA 5HFMA 4FK5C 3K9SA 1SESA 4FM1A 2ZNJA 4XDLA 1VQ6V 1XOUA 1HNXO 3B09A 3ZN1A 2WLMA 2XAFA 3FYEB 1BQZA 4B3MO 2JJ1G 3OEEG 3F5WC 5B1BC 1GO3F 4U7NA 4E4EA 3SYOA 1ORQC 1MZFA 1XDCA 2ITCC 2QTOA 3JAWA 4YIOA 4JI5B 1JJOA 2EIKB 3M99B 1ZL8A 4UFZA 3L70H 2V1DA 1D2DA 2CUGA 4DK1A 1AB3A 1GM9A 3H1HH 2W6JG 4X65O 5LHGA 3W7SA 5BR8O 1ZLZA 4HBNA 2XAHA 1F7YA 1E1QG 5CBHA 4MVOA 1TVKB 5LL6Y 3FX7A 5IJ9A 2LP7A 4MTGA 1IBMB 1OCOB 3UQ8A 4Z1VA 1QNMA 4RUFA 2IBZH 2JGDA 4X1YB 3E8FA 4QPJA 3RYIB 3K3WA 5LMUB 5J9PC 2N04A 4YJ2B 4X1IB 4JI7O 3FYIB 3O65A 2ZE7A 2AZ2A 2GUZA 1FD9A 2L6LA 1WNSA 1I94O 4GYCB 3IAYA 4LF7O 2OTLV 2VQEB 3RYIA 3JASA 4R6ZA 3QTCA 3R66A 4QE7A 2VQFB 3MDSA 4O4LA 2YXYA 4WFFA 4LFCB 4PV1B 2PI5A 1COWG 4BAYA 1SA0B 2LO1A 1RPOA 3CXCU 1FFXA 2Y69B 2M6YA 4K0KO 3B2EE 4DV5B 1X59A 3RYCB 1T5EA 2ZD9A 4N21A 2O57A 1FAFA 4UV9A 1HR0O 1KP2A 3U0ZA 1HNWB 3L71H 2A79B 4N23A 1WP7A 3IC9A 4XDJA 5BXZA 5JJJB 1RP3B 2F4VO 5LMNO 1H2MA 3RBZA 2QKSA 3FB7C 3RVZA 2Q7EA 4MW8A 3ZRWB 4J42A 3ABMB 1M90W 3BVOA 5C8YA 2HG5C 4H44B 5B5EZ 5EYPA 2PYLA 3ZN0A 2V7QG 1N0JA 2JS5A 1IDSA 2R70A 3RYFB 5LGNA 5KMGA 2VRZA 4K8ZA 3JARB 4R8CA 1CP9A 1WN7A 3E89A 1D5NA 1JCHA 3JALA 1JJ2U 5LGUA 1DGSA 2DQ0A 1DK1A 1Z5WA 5FNVA 2XHBA 1GK9A 3QNEA 4MVRA 4MSWC 3HKCB 1K3EA 5BY1A 5LP6C 1V54C 4GX1A 3J81N 4ABMA 2Q6AA 4JI6B 3N27A 1H2NA 1VQ7V 2IM9A 4JI1O 3TCUA 3CCLV 1M1KW 1Q8IA 2UUBB 1BGYH 2EBOA 2JEUA 3SPIA 3ABMC 1H2SB 1PV0A 2UXXA 4UVBA 1HR0B 3W7WA 3D3IA 3L75H 2EINC 3H1JH 5H2FZ 1FXKA 3K5MA 4DV5O 2XAJA 3T1HB 1WP8A 5CBGA 4DRXB 3CCEV 4J9YB 2ZM6O 2YXHA 4AILC 4X66B 3VQYA 3K58A 2FKXA 1N36B 1H2GA 4LFCO 2OTJV 1FFTB 1W2BU 2HKOA 2ZIOA 3B40A 3ZRVA 2AZ0A 1SQQH 2Y48A 3GWOA 3ICXA 3KCXA 1BZKA 1K9MW 2ZR2A 1DTOA 3ABUA 2A9HA 4B3RB 1FXVA 3T1YO 4CH4A 1OCRC 1MSDA 1OV9A 1JX9A 1VQ4V 3Q4HB 4FLYA 5L3FA 5B3SC 3WB1A 4UVAA 4B3MB 1FFXB 3B77A 5LMUO 2DYSB 1HNXB 1VP7A 5LP6A 1YF2A 4GT1A 4JI8B 5KHJA 1KECA 4RAIA
chains in the Genus database with same CATH topology
5LL6Y 1XMOO 4JI4O 4JI3O 4OPAA 3SDLA 3RT3C 4DR2O 1A32A 5FLXN 1DK1A 2HHHO 1YZBA 1IBLO 1N34O 4DV0O 2UXCO 5H5NA 4X64O 1IBKO 5BY1A 1NS1A 1R1BA 4LFBO 4JYAO 4A5UB 2DOSA 4JI7O 4B3TO 3O65A 3J81N 3T1HO 4NXMO 1I94O 2E5LO 4LF7O 1XNRO 4JI1O 4KHPO 1FYJA 4DUYO 3F5TA 4DV2O 3J80N 4DV7O 1J5EO 4DUZO 3R66A 4DR6O 2N74A 4DV3O 1N36O 4JI5O 1IBMO 4X62O 4LFAO 1KUQA 4DR4O 1R6TA 4NXNO 2UU9O 2AGAA 4DV5O 5IWAO 1G1XB 4DV1O 3J7AU 2LW7A 4B3SO 2UXDO 4OPHA 2VQEO 4OX9O 2ZM6O 5A2QN 4YY3O 2UUBO 4LF9O 1AILA 2FKXA 4K0KO 4LFCO 1X59A 1FKAO 1HNZO 1N32O 2UUAO 1XEQA 2VQFO 4DR3O 4B3RO 1HR0O 4AQYO 3M8AA 1XNQO 4DR5O 3JAMN 1HNXO 5BXZA 4JI0O 4B3MO 4DV4O 1FJGO 2F4VO 5LMNO 4DR1O 4JI2O 4LF6O 3T1YO 4LF8O 4DR7O 4LF4O 4LF5O 4X66O 2Z0AA 4JI8O 1D2DA 5IT9N 1XMQO 3OTOO 5LMUO 1AB3A 4X65O 4DV6O 4GKJO 4YHHO 2UXBO 5BR8O 4JI6O 2UUCO 1HNWO 2JRIA 1N33O 1F7YA 4GKKO 4JV5O 2ZKOA 2DJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Y;  1XMO O;  4JI4 O;  4JI3 O;  4OPA A;  3SDL A;  3RT3 C;  4DR2 O;  1A32 A;  5FLX N;  1DK1 A;  2HHH O;  1YZB A;  1IBL O;  1N34 O;  4DV0 O;  2UXC O;  5H5N A;  4X64 O;  1IBK O;  5BY1 A;  1NS1 A;  1R1B A;  4LFB O;  4JYA O;  4A5U B;  2DOS A;  4JI7 O;  4B3T O;  3O65 A;  3J81 N;  3T1H O;  4NXM O;  1I94 O;  2E5L O;  4LF7 O;  1XNR O;  4JI1 O;  4KHP O;  1FYJ A;  4DUY O;  3F5T A;  4DV2 O;  3J80 N;  4DV7 O;  1J5E O;  4DUZ O;  3R66 A;  4DR6 O;  2N74 A;  4DV3 O;  1N36 O;  4JI5 O;  1IBM O;  4X62 O;  4LFA O;  1KUQ A;  4DR4 O;  1R6T A;  4NXN O;  2UU9 O;  2AGA A;  4DV5 O;  5IWA O;  1G1X B;  4DV1 O;  3J7A U;  2LW7 A;  4B3S O;  2UXD O;  4OPH A;  2VQE O;  4OX9 O;  2ZM6 O;  5A2Q N;  4YY3 O;  2UUB O;  4LF9 O;  1AIL A;  2FKX A;  4K0K O;  4LFC O;  1X59 A;  1FKA O;  1HNZ O;  1N32 O;  2UUA O;  1XEQ A;  2VQF O;  4DR3 O;  4B3R O;  1HR0 O;  4AQY O;  3M8A A;  1XNQ O;  4DR5 O;  3JAM N;  1HNX O;  5BXZ A;  4JI0 O;  4B3M O;  4DV4 O;  1FJG O;  2F4V O;  5LMN O;  4DR1 O;  4JI2 O;  4LF6 O;  3T1Y O;  4LF8 O;  4DR7 O;  4LF4 O;  4LF5 O;  4X66 O;  2Z0A A;  4JI8 O;  1D2D A;  5IT9 N;  1XMQ O;  3OTO O;  5LMU O;  1AB3 A;  4X65 O;  4DV6 O;  4GKJ O;  4YHH O;  2UXB O;  5BR8 O;  4JI6 O;  2UUC O;  1HNW O;  2JRI A;  1N33 O;  1F7Y A;  4GKK O;  4JV5 O;  2ZKO A;  2DJV A; 
#chains in the Genus database with same CATH topology
 2WLJ A;  3SR2 C;  1PP9 H;  2GTS A;  1EN5 A;  1R73 A;  3ZMZ A;  1OCC C;  2ITD C;  3JD1 A;  1DLB A;  3X2Q B;  3MHH C;  1M9N A;  4KHP B;  2QGN A;  5AG2 A;  5IWA B;  3CCQ V;  3P30 A;  4X65 B;  2B9Z A;  3LNM B;  1SZX A;  4LBE C;  5B1A B;  1SF9 A;  3TJT A;  3ZHV A;  5CA0 A;  3RYH A;  5CB4 B;  3E22 A;  5A9G A;  1YEW A;  5EIB D;  3J80 N;  3OR6 C;  3H1K H;  3ABT A;  4X88 A;  1I94 B;  4PA9 A;  4IT5 A;  1AR1 B;  2N05 A;  1EN4 A;  5BMV B;  1SQP H;  2IJJ A;  3CHX A;  3CRC A;  5IWA O;  4DV1 O;  1K5Q A;  3CX5 F;  1PL0 A;  2FL4 A;  4RQE A;  1G4Y B;  5GW7 A;  4DUY B;  3LNN A;  4IHJ B;  1VIB A;  3OE7 G;  2PGG A;  3OMA B;  3JSL A;  4H37 A;  1Q6I A;  5KAF Z;  1FXK C;  3JAL B;  3JAK B;  4JYY A;  4P30 A;  5L3G A;  4IHJ A;  2M7W A;  1L1F A;  4DV1 B;  1JR9 A;  3BRC A;  1PNM A;  5LA6 B;  4LF5 O;  2ZIM A;  3OD4 A;  3EXA A;  3TET A;  2YEV B;  5GON B;  4DR1 B;  3ZIA G;  1XMQ O;  4BIZ A;  4Q6G A;  1K5S A;  3G6E V;  1B06 A;  2A0L A;  2AXT Z;  3AK3 A;  2Q68 A;  5KA6 A;  1WB7 A;  5D5Q A;  4L87 A;  4WFE A;  2ZXW C;  5EBL C;  4JI3 O;  1PKX A;  5IJ0 A;  1A32 A;  1Q5O A;  4DYL A;  2P06 A;  1KP3 A;  1R3I C;  1O9G A;  4UB6 Z;  4PEL A;  5JH7 B;  1GH6 A;  3H01 A;  3OR7 C;  1AI7 A;  2JVD A;  4DR6 O;  2WLI A;  4DV3 O;  1KUQ A;  2HVK C;  1X4T A;  2A06 H;  4H33 A;  1ZX3 A;  4UCU A;  1XNR B;  4WFA V;  1NJI W;  3JYC A;  1FJG B;  1BHB A;  2B1G A;  4X1K B;  2X7R B;  4F6E A;  2P4V A;  4UVC A;  5DED A;  1LUV A;  3QO5 A;  3DGE A;  1VF6 C;  1GN3 A;  3K06 A;  1N33 B;  2QWQ B;  1J5E B;  5DN6 G;  2OT5 A;  4R50 A;  5EBW C;  1VQO V;  1BMF G;  2KSD A;  1EBO A;  4LF6 O;  4TSF G;  3D36 C;  3LSS A;  1AI5 A;  1F4N A;  1XL6 A;  2BOC C;  2QM7 A;  2Z0A A;  1YJN V;  3CCV V;  2L35 A;  4W4L A;  4BIU A;  1XBL A;  5LMN B;  2QA4 V;  3L9D A;  4GKJ O;  3AG3 C;  4JI6 O;  1QBZ A;  1HNW O;  4GKK O;  3HKB A;  3VQW A;  4PI2 A;  5JCO C;  4X20 B;  2P6J A;  1RSO B;  4NKG B;  3JD2 A;  4OXS A;  1OCC B;  4LF8 B;  2F93 B;  3ASO B;  4EB6 B;  2EX3 A;  1YZB A;  1IBL O;  1PPJ H;  1N34 O;  3ETQ A;  1SQF A;  4JAS A;  3ZED A;  2D3O W;  1DF4 A;  1KBH A;  4JYA O;  4A5U B;  1SZT A;  2GSM B;  1NR1 A;  3DC5 A;  3LSU A;  2ZXW B;  2OCC C;  4WBN A;  1UPG A;  1HP8 A;  1ZTE A;  1YCI A;  3QF7 A;  4GKK B;  1Y76 A;  1XNR O;  3STZ C;  4FIP C;  4MS2 A;  4CH5 A;  1SC5 B;  1M56 C;  3SYQ A;  3B8M A;  4DV7 O;  2UU9 B;  5IY5 C;  4AQY B;  4DUZ O;  3CJH A;  5CA1 A;  2G38 A;  1GKF A;  5CB4 A;  2YIA A;  3LDC A;  1E1R G;  3C3T A;  1AJQ A;  3ZBH A;  2XT9 A;  3BEH A;  4FZ0 A;  2BSK A;  4UCV A;  1G8M A;  3HKE A;  2EIM B;  2YIB D;  1GM8 A;  4LF9 O;  4JF3 A;  4U7O A;  4I9Q A;  5GTH Z;  4H0L B;  2F66 C;  4X1K A;  1K7D A;  1MOF A;  2QKA A;  4AHC A;  3ETE A;  2UUA O;  5EK0 A;  1XNQ O;  3EFF K;  4X9Q A;  4DRX A;  4DV6 B;  1YIT V;  3G80 A;  5LGT A;  5IYD O;  4JI0 O;  1FJG O;  1MZE A;  3JAT A;  5JQG B;  2HHH B;  2XAS A;  3T4D A;  4FLV A;  1QVG U;  3I5D A;  4MVU A;  4DR3 B;  2AW9 A;  4J7K A;  3C3S A;  1SQB H;  1XI1 A;  2E74 B;  3CJH B;  1S76 D;  3CRA A;  1IUR A;  4CH6 A;  1Z5V A;  3VBB A;  3CS5 A;  4O4J B;  2WA3 A;  3CPW U;  2Z5U A;  2JIZ G;  1Q7Y W;  4O2B A;  1BT8 A;  3UKM A;  3BAA A;  4X1I A;  4TQD A;  5JWP A;  4O4I B;  3K04 A;  1K34 A;  3CEI A;  5HFL A;  3RW0 A;  2XND G;  1GRJ A;  3X2Q C;  2QE7 G;  4I55 B;  1QR9 A;  1IBK O;  4JI3 B;  2CH7 B;  1SQX H;  1MMM A;  4GX5 A;  4ASU G;  4FM0 A;  1PD3 A;  2DYR B;  4QE9 A;  3H1I H;  1Q6U A;  3LDD A;  2YXL A;  4MVS A;  2Q8V A;  2ATK C;  4FPP A;  2YID A;  4MTO A;  5IE9 A;  5IYZ B;  3F7V C;  2Y0I A;  1CXZ B;  5TIS Z;  3ETG A;  3Q4H A;  5JJE B;  4JI5 O;  4JI4 B;  4LR3 A;  1TUE B;  1BE3 H;  2E76 B;  5CBF A;  4NXN O;  5IYB O;  2AGA A;  3THO A;  3H9V A;  2CGO A;  2X6B A;  2DMX A;  5E1A C;  2Q5Z A;  1R3L C;  2R9A A;  3D36 A;  2BE3 A;  4DO2 A;  1WPB A;  1N32 O;  2Y4U A;  3AEI A;  3WU2 Z;  1JMK C;  3CD6 V;  2R72 A;  3JAR A;  3CCR V;  4TV9 B;  1BCC H;  1GN6 A;  1U97 A;  4DR7 O;  4LF4 O;  3OUS A;  1R3K C;  2HP8 A;  2WLL B;  2XAG A;  1VF7 A;  5EYP B;  5IYZ A;  1M4U A;  1M56 B;  1P7G A;  3SJA C;  4JGS A;  4L8J A;  1YXB A;  4NTX A;  2YEV A;  5GON A;  2LFS A;  4QJF B;  4YJ3 A;  2YI8 A;  1ZAU A;  1JVM A;  3OAA G;  4RQF A;  3AG2 C;  1NKD A;  4WFB V;  2FTK A;  4MTF A;  1G6U A;  4DR7 B;  4O4J A;  4MVM A;  2QM8 A;  2QJ1 A;  2F95 B;  2LGQ A;  2NLJ C;  2ZQM A;  4DV0 O;  3SJB C;  1MNG A;  4QPK A;  5CMU A;  3OTF A;  1ZUQ A;  4DR4 B;  1V55 C;  1GM7 A;  1AR4 A;  2ZDI A;  4Z2W A;  3IFX A;  1Y74 B;  3T1H O;  3ABK B;  3APO A;  5JCO A;  1H2K A;  3LDE A;  3SYP A;  5JVD A;  4PDM A;  3ZMU A;  3D3Q A;  3ZJZ A;  5DEC A;  2EIK C;  5B1O A;  4JTD B;  1Y4M A;  2ODM A;  3ZRS A;  3K0G A;  4NTY A;  2XAQ A;  5KAI Z;  5D5P A;  2GBO A;  1DF5 A;  2UU9 O;  3JD0 A;  1GAX A;  3DXR A;  2QWN B;  3UT5 A;  1KD1 W;  3G6B A;  4FFK A;  4YJ3 B;  1KKD A;  3OEH G;  4TWK A;  1VQ9 V;  1R6N A;  3NXS A;  2HEP A;  4LCU C;  1VF6 A;  5L3D A;  4FLW A;  4UV8 A;  1S5J A;  4MVZ A;  2EIJ C;  1K4C C;  4CS4 A;  2ZR3 A;  1YIJ V;  2R9R B;  4JPR A;  1KMI Z;  3JSN A;  4I4T A;  5EC2 C;  1YVW A;  5LXT B;  4TUY A;  1IX9 A;  4RO2 A;  4TV9 A;  4JI8 O;  3L73 H;  4LF9 B;  2HLD G;  1ROP A;  5KUK A;  3OUF A;  1L0L H;  4YIP A;  4JZG A;  1TAE A;  2UXC B;  5IY5 B;  1Y76 B;  1RSO A;  2DYR C;  5JJN B;  2NR5 A;  1RPR A;  2V4D A;  4ZI7 B;  4JI4 O;  2F4V B;  4HNA A;  4OPA A;  5FNV B;  3RVY A;  3OTO B;  2HHH O;  2B5U A;  1BS3 A;  1I7F A;  3N2G A;  1WA8 B;  4WCE V;  2DOS A;  1Y74 A;  3LSQ A;  2RNB A;  4X89 A;  1OCO C;  5KX5 B;  2ZM6 B;  2JJ2 G;  4TV8 A;  2IJK A;  2ARH A;  4KXR A;  4RWU A;  2W0X A;  2DW4 A;  1SRY A;  1L0N H;  1TGO A;  2YDE A;  1P4R A;  3CC2 V;  3SPC A;  1OJH A;  1BHA A;  3RYH B;  5CA0 B;  4X62 O;  2F43 G;  2P67 A;  1J95 A;  1OZ0 A;  1HDJ A;  4X8A A;  5LBQ A;  2P90 A;  3K57 A;  1I5Y A;  2JDI G;  1OCR B;  1UFI A;  2LW7 A;  1XHZ A;  3E8G A;  1I0H A;  2NNU A;  3CME V;  1AIL A;  4CZZ A;  1QLE B;  1QLE C;  4QNH B;  4DR5 O;  4O4H B;  4TUY B;  4K35 A;  1PNK A;  1F4M A;  1VF5 B;  2QWR B;  4JAA A;  3FD9 A;  1S3J A;  1NH2 D;  4KL1 A;  4LF8 O;  4F4L A;  4LFA B;  5ITZ B;  4XBF A;  3SYA A;  1KYO F;  3SJQ C;  2CTW A;  3FAV A;  1B6Q A;  3BY6 A;  1AJN A;  1M5I A;  4JTC B;  1YTF D;  4HNA B;  4H13 B;  1WB8 A;  5EBM C;  1JQ0 A;  2K1E A;  2UXB O;  3OM3 B;  3A0H Z;  3HKD B;  3ML0 A;  4JV5 O;  1NI8 A;  2IJI A;  2DJV A;  5H9C A;  4PA7 A;  1VAR A;  4JI7 B;  2YIB A;  1RM1 C;  4PI0 A;  1O9H A;  2HVJ C;  4X1Y A;  1EN6 A;  4TT3 G;  4DUZ B;  3HPL C;  1D5A A;  4B7K A;  4ZKI A;  3U11 A;  1TVK A;  4GCZ A;  5H5N A;  4X64 O;  1KKC A;  3RFR A;  3AG4 C;  3AK1 A;  4I50 B;  3UO3 A;  2K9P A;  2Q67 A;  3AG3 B;  3E86 A;  4K0K B;  3ZHQ A;  4WBN B;  5BR8 B;  1Q81 W;  1N34 B;  4LNU B;  4O4H A;  2QM4 A;  3JD4 A;  5L3C A;  2XOK G;  1GMG A;  2DQ3 A;  1FPO A;  3IGA C;  3JAS B;  3W7T A;  1PNL A;  3K59 A;  3UT5 B;  4GX0 A;  5KHI A;  3BA9 A;  2ZCE A;  4QIW F;  1HWY A;  2ZNI A;  2CK3 G;  2VQE O;  1Q82 W;  1KU9 A;  4KP4 A;  5BMV A;  3A0B Z;  2XTA A;  1XEQ A;  1Y67 A;  4LF4 B;  1SER A;  3QO8 A;  2IJH A;  4JAV A;  3SGI A;  5ITZ A;  4IYI A;  3WB2 A;  3P32 A;  5KHK A;  4FM2 A;  5KMG B;  3F7Y C;  3A0R A;  3OW2 U;  1ZWI C;  2MK3 A;  1AR5 A;  1AP5 A;  3CCM V;  1S5L Z;  3I55 V;  3JAK A;  5KUM A;  3RN4 A;  2QSA A;  2W0F C;  3PN1 A;  3UCS C;  1EFR G;  2BTO A;  3DSQ A;  3A2F A;  3ZRW A;  4YHH O;  4E2L A;  4O4I A;  3JAW B;  3HKD A;  5EC1 C;  2BCC H;  4ZI7 A;  4DV4 B;  3W7U A;  2IW5 A;  3AG1 C;  4ZIB A;  4ICG A;  3T1Y B;  2Q73 A;  2ETN A;  3ABL C;  4G2K A;  3AG4 B;  4I7Z B;  4CH3 A;  3MAQ A;  2VWJ A;  2AHZ A;  4HZ3 A;  4FLU A;  1NTM H;  1GTO A;  2NN4 A;  2WLL A;  3ASO C;  4TV8 B;  1NS1 A;  4PA6 A;  3CRM A;  4B3T O;  5EZY B;  1VQL V;  4PA4 A;  2ILM A;  3K5N A;  2OYQ A;  4W4K A;  1FYJ A;  4DUY O;  2WA4 A;  1US6 A;  2VS0 A;  5GTI Z;  1R6K A;  1AP6 A;  1AI4 A;  3K79 A;  1QU7 A;  3CCS V;  3H1L H;  4FMT A;  1B3Q A;  1VQ8 V;  2LQT A;  1G1X B;  3FB8 C;  3S3X A;  2UXD O;  1XUQ A;  2BSK B;  1AVM A;  3PJS K;  4J7Z A;  4LP8 A;  2WWW A;  5L3E A;  2H3O A;  1XMQ B;  2DWE C;  2KG7 A;  2YSU B;  3E2E A;  4DR3 O;  4B3R O;  4LNU A;  5CN0 A;  2DN9 A;  2X0L A;  2WLH A;  1HW7 A;  4I0X A;  4G27 B;  3JCZ A;  2AHY A;  1AI6 A;  4NYK A;  3OT7 A;  4X66 O;  4G28 B;  4J80 A;  1THZ A;  4BW5 A;  1BQ0 A;  2QWO B;  3VQV A;  3RGB A;  1MA1 A;  1FS0 G;  1ZL8 B;  5LOV A;  1FXH A;  3OTO O;  4EB6 A;  5DM6 V;  5LHH A;  1NZ6 A;  2C2A A;  4ZOL A;  3FB5 C;  2RMK B;  3N2K B;  2E5L B;  3G4S V;  4NXM B;  4I50 A;  4LFB B;  4MT8 A;  4WFH A;  2QTS A;  4F6R B;  4DV7 B;  2BTQ A;  4JI1 B;  3EHB B;  1IXM A;  4F6R A;  1P84 F;  5JVD B;  3AG2 B;  1R1B A;  2WLN A;  4YXW G;  4I5S A;  1H8E G;  4QGP A;  2QEX V;  2F23 A;  2DYS C;  1OCZ B;  3D8C A;  2EZO A;  2ADP A;  1IBL B;  4DK0 A;  4Z1M G;  3HKC A;  3F5T A;  1H2L A;  3ZS8 C;  1NH2 B;  3BAB A;  2DWD C;  5H6R A;  4LWS B;  2IH1 C;  3K9A A;  1XNQ B;  2JEX A;  2UUA B;  2PY5 A;  2KKW A;  2CTP A;  3ZHT A;  2RQ6 A;  3CB2 A;  3P3N A;  1Y66 A;  5F2V O;  4O2B B;  3DTU B;  3T1C A;  4ZBM A;  3RYF A;  4LF7 B;  4K3A A;  5A2Q N;  2UUB O;  1F23 A;  2X6C A;  5C93 A;  4FLZ A;  1JA8 A;  3ASN B;  1VQK V;  2EIL B;  1W0K G;  2Q9L A;  1U96 A;  3JAM N;  2YC0 A;  2Q0O C;  4WF9 V;  3ZRX A;  4ZHQ A;  2UUC B;  4J7J A;  1GN4 A;  3CRR A;  1LR1 A;  5FL7 G;  1H38 A;  1WA8 A;  3OGI B;  4D7T A;  4FLT A;  3SYC A;  2EJR A;  2PZS A;  1NVP B;  3SPH A;  1SQG A;  2CAZ C;  4U3F H;  1MSW D;  3STL C;  1V54 B;  3BFR A;  2UUC O;  4NTW A;  3QG5 A;  1SA0 A;  4DR5 B;  3HKE B;  4P9O A;  3SPJ A;  2OIG A;  1ENV A;  1CPY A;  1M57 B;  3K5O A;  5CA1 B;  5IYC O;  4UCS A;  1Z2G A;  4O2A B;  3M7M X;  1KB9 F;  1R3J C;  2UXC O;  3NR7 A;  5H6Q A;  3AG1 B;  5JH7 A;  4UCO A;  4LFB O;  2PUS A;  2PTM A;  4J11 A;  2JS3 A;  3OMN B;  4IGG A;  5LA6 A;  1RM1 B;  3K03 A;  4BW9 A;  3HB3 B;  4B3S B;  2Y4T A;  5LHI A;  4I55 A;  1K8A W;  2D2C B;  2KQX A;  1J5E O;  1YTF B;  4RUE A;  1BSM A;  2YUA A;  4CS3 A;  4X20 A;  4XDK A;  1S5H C;  5LOV B;  4PHZ A;  1JFF A;  2P5O A;  3DXR B;  1EZJ A;  3OGC C;  5FPO A;  1QQC A;  1FXK B;  2Z3Y A;  3E8H A;  5B1B B;  1K92 A;  4KUM A;  3WG7 B;  3R65 A;  1NBM G;  1SET A;  2FML A;  1XHX A;  2EIM C;  2P7T C;  2RDC A;  4EFB A;  1MAB G;  4B7E A;  2W6I G;  4JI2 O;  2GHY A;  3ZHU A;  2EZP A;  2E75 B;  4NB5 A;  2ADQ B;  5L3B A;  2LW1 A;  5KHG A;  1XMO B;  3CYO A;  1TA8 A;  2WSS G;  2EIN B;  3VOU A;  1XRE A;  3KCY A;  3U10 A;  1PL4 A;  1Q86 W;  5J2U A;  1OCZ C;  3ZMS A;  3GB7 C;  3GVM A;  5KA5 A;  2OCC B;  4EEQ A;  2GTA A;  3SPG A;  4IYH A;  5B1A C;  4B3T B;  1AJP A;  1BL8 A;  4PDL A;  3SDL A;  1QR8 A;  5LP6 B;  1ZSP A;  1YJW V;  2IU0 A;  1V9P A;  3L74 H;  3OMI B;  2HR3 A;  1PM9 A;  3ABL B;  4DW1 A;  5K1P A;  1K97 A;  1S72 V;  2Y0P A;  2DE0 X;  2BOB C;  4HYO A;  1M93 A;  3AK2 A;  4KHP O;  5B3S B;  1W0J G;  2XUM A;  4DV2 O;  3O9O A;  3OFN G;  1NU1 H;  4FZ1 A;  2IH3 C;  4FFB A;  3JD3 A;  2N74 A;  4MTX A;  4EFE A;  2IU3 A;  4LWS A;  1IBM O;  1N32 B;  3HKB B;  2ZIN A;  1YI2 V;  4AI8 A;  1XQ8 A;  4FJC C;  1IVS A;  4K8X A;  3J7A U;  5KHH A;  4B3S O;  2H8P C;  4NR1 A;  4HAM A;  4JI2 B;  1IXB A;  1NTZ H;  3A8T A;  2X6A A;  3FKS G;  5IDJ A;  1N0N A;  2WAM A;  3JCU Z;  3K5L A;  2BTQ B;  3I56 V;  1HNZ O;  4NXN B;  1H8H G;  4I9W A;  4AQY O;  3TXS A;  4JAU A;  2EIL C;  4UCR A;  1QVF U;  5B1N A;  4IL6 Z;  4DV4 O;  4YHH B;  2CGN A;  2P4K A;  2VWK A;  4IIJ A;  4BIO A;  4JTA B;  3L72 H;  4OGQ B;  1I5X A;  5J2U B;  4JI0 B;  1E79 G;  4DV6 O;  4P9P A;  4IIJ B;  4TOI A;  2RJZ A;  3CE2 A;  2KB1 A;  5LXT A;  1RFY A;  1KQS U;  4JYB A;  2LGW A;  5KX5 A;  1W59 A;  2ZKO A;  3VQX A;  4GX2 A;  4X64 B;  1XIL A;  3E83 A;  3RT3 C;  4JZ2 A;  1LNQ A;  3T4Z A;  3T2M A;  3TK1 A;  1OHH G;  1Q6H A;  2JK5 C;  1SKV A;  2PF4 E;  3ETD A;  4D7S A;  3E22 B;  3B8N A;  2B1I A;  1VQN V;  5E79 Z;  3FFQ A;  2OIE A;  4X62 B;  4J41 A;  4JV5 B;  1URF A;  3K08 A;  4EKW A;  4BWA A;  3GWK C;  4DW0 A;  2OCH A;  4DR2 B;  1S0V A;  4YY3 B;  4FFB B;  2ZE8 A;  3P3P A;  3WFV A;  1VQ5 V;  1JPX A;  3BCC H;  1GN2 A;  3EVK A;  3FAV B;  4NVP A;  2QDO A;  4LFA O;  2P22 C;  4KFM A;  2RCV A;  2F1M A;  1QLN A;  4I4T B;  2GDS A;  3ZHS A;  2EIJ B;  4LH7 A;  1N8R W;  3E35 A;  4I0X B;  1WAZ A;  1EZV H;  4JYC A;  4OPH A;  4PDR A;  4OX9 O;  2EUL A;  1K33 A;  4UB8 Z;  3QVN A;  1WPX A;  1WJZ A;  3B4S A;  2OWO A;  4O4L B;  2E3C A;  3RWR D;  3ASN C;  4TQF A;  4O2A A;  2LJ2 A;  2Y69 C;  4MVQ A;  3M8A A;  2KG7 B;  2Q7H A;  3SJC C;  4GKJ B;  3WG7 C;  3CC7 V;  3JAT B;  5JQG A;  3W7X A;  2CTR A;  3CSX A;  3UO2 A;  2UXB B;  4J9Z B;  3CWB H;  1K4D C;  2HJF C;  2H94 A;  3S3W A;  4CC5 A;  2QWP B;  4GZR B;  4BR6 A;  1WLE A;  2RN9 A;  4CBC A;  4LF6 B;  3CP1 A;  4J10 A;  5IT9 N;  1YSC A;  1NTK H;  1N4C A;  3ABK C;  3IC7 A;  4UUJ C;  3QO7 A;  3ZMT A;  1MG1 A;  1V55 B;  1NR7 A;  5IJ9 B;  5EIB C;  1LUW A;  4Q20 A;  2PI4 A;  2A7W A;  4WFG A;  4R7C A;  4ZHQ B;  3WB0 A;  2JGU A;  2PYJ A;  1K73 W;  1YJ9 V;  3APQ A;  4DR2 O;  3TGU H;  5K1X A;  3G67 A;  3AG7 A;  1TUB A;  5J2T A;  4DV3 B;  2WLK A;  4UCT A;  4PD4 F;  4LF5 B;  4PA3 A;  1Q90 D;  2Q69 A;  2A3Q A;  3BA8 A;  3N2K A;  1ARO P;  3DC6 A;  4NXM O;  2E5L O;  1Q3E A;  1P49 A;  1UJW B;  3IJ4 A;  4MW3 A;  3MHS C;  1JOY A;  1NT2 B;  1VMG A;  3BPZ A;  3RYC A;  2JGD B;  1TUB B;  4UXN A;  2FB5 A;  2Q7G A;  3KKY A;  4DR4 O;  4PDV A;  5B66 Z;  4FVM A;  4JYA B;  2UXN A;  5BZB A;  4DV0 B;  2FYU H;  1NVP D;  4D6T H;  3HR0 A;  4YY3 O;  2WLI B;  1VQP V;  2Q0A A;  3ZX6 A;  5FPR A;  2HJD A;  5C8Y B;  1NQT A;  4GUN A;  1FKA O;  4CS2 A;  2VQF O;  4GLX A;  4DR6 B;  1IZ3 A;  2EJ7 A;  2YI9 A;  2ZE5 A;  2YIC A;  2WPD G;  2ZT9 B;  3G71 V;  1CEZ A;  4DR1 O;  4P2Z A;  2UXD B;  3ZCC A;  3UM7 A;  2QKC A;  5LYJ B;  3LUT B;  1HNZ B;  5CA3 A;  2GV9 A;  1B04 A;  3CXH F;  4ZOL B;  3CCJ V;  1F51 A;  1SQV H;  3KZI Z;  1L8D A;  3C90 A;  5IJ0 B;  3ZMV A;  3TXQ A;  3KG2 A;  2YS8 A;  4OX9 B;  2Q4P A;  1XL4 A;  1S77 D;  4B08 A;  4PJ0 Z;  5EZY A;  2HFE C;  2JRI A;  1Q43 A;  1N33 O;  1EM1 A;  3K0D A;  3CC4 V;  1QCE A;  2LFR A;  3FB6 C;  4C7U A;  1XMO O;  3N2G B;  2CH7 A;  4CC6 A;  1SS3 A;  5FLX N;  1P7B A;  1M57 C;  1YDX A;  4FLX A;  3MD0 A;  1VEW A;  1YHQ V;  4YJ2 A;  5LYJ A;  3CCU V;  1VQM V;  3ZHR A;  2GUZ B;  2MW2 B;  1I08 A;  5J2T B;  1KC8 W;  3E8B A;  1QHT A;  2CTQ A;  4LH6 A;  3CRQ A;  4DXW A;  2QR4 A;  2CE4 A;  1Y6X A;  2R9I A;  4U3J A;  1N36 O;  2ZE6 A;  5KLV H;  1R6T A;  2CDY A;  3CMA V;  4LC1 A;  1IBK B;  2ZDI C;  4U3J B;  4DV2 B;  1JFF B;  3BHP A;  5HFM A;  4FK5 C;  3K9S A;  1SES A;  4FM1 A;  2ZNJ A;  4XDL A;  1VQ6 V;  1XOU A;  1HNX O;  3B09 A;  3ZN1 A;  2WLM A;  2XAF A;  3FYE B;  1BQZ A;  4B3M O;  2JJ1 G;  3OEE G;  3F5W C;  5B1B C;  1GO3 F;  4U7N A;  4E4E A;  3SYO A;  1ORQ C;  1MZF A;  1XDC A;  2ITC C;  2QTO A;  3JAW A;  4YIO A;  4JI5 B;  1JJO A;  2EIK B;  3M99 B;  1ZL8 A;  4UFZ A;  3L70 H;  2V1D A;  1D2D A;  2CUG A;  4DK1 A;  1AB3 A;  1GM9 A;  3H1H H;  2W6J G;  4X65 O;  5LHG A;  3W7S A;  5BR8 O;  1ZLZ A;  4HBN A;  2XAH A;  1F7Y A;  1E1Q G;  5CBH A;  4MVO A;  1TVK B;  5LL6 Y;  3FX7 A;  5IJ9 A;  2LP7 A;  4MTG A;  1IBM B;  1OCO B;  3UQ8 A;  4Z1V A;  1QNM A;  4RUF A;  2IBZ H;  2JGD A;  4X1Y B;  3E8F A;  4QPJ A;  3RYI B;  3K3W A;  5LMU B;  5J9P C;  2N04 A;  4YJ2 B;  4X1I B;  4JI7 O;  3FYI B;  3O65 A;  2ZE7 A;  2AZ2 A;  2GUZ A;  1FD9 A;  2L6L A;  1WNS A;  1I94 O;  4GYC B;  3IAY A;  4LF7 O;  2OTL V;  2VQE B;  3RYI A;  3JAS A;  4R6Z A;  3QTC A;  3R66 A;  4QE7 A;  2VQF B;  3MDS A;  4O4L A;  2YXY A;  4WFF A;  4LFC B;  4PV1 B;  2PI5 A;  1COW G;  4BAY A;  1SA0 B;  2LO1 A;  1RPO A;  3CXC U;  1FFX A;  2Y69 B;  2M6Y A;  4K0K O;  3B2E E;  4DV5 B;  1X59 A;  3RYC B;  1T5E A;  2ZD9 A;  4N21 A;  2O57 A;  1FAF A;  4UV9 A;  1HR0 O;  1KP2 A;  3U0Z A;  1HNW B;  3L71 H;  2A79 B;  4N23 A;  1WP7 A;  3IC9 A;  4XDJ A;  5BXZ A;  5JJJ B;  1RP3 B;  2F4V O;  5LMN O;  1H2M A;  3RBZ A;  2QKS A;  3FB7 C;  3RVZ A;  2Q7E A;  4MW8 A;  3ZRW B;  4J42 A;  3ABM B;  1M90 W;  3BVO A;  5C8Y A;  2HG5 C;  4H44 B;  5B5E Z;  5EYP A;  2PYL A;  3ZN0 A;  2V7Q G;  1N0J A;  2JS5 A;  1IDS A;  2R70 A;  3RYF B;  5LGN A;  5KMG A;  2VRZ A;  4K8Z A;  3JAR B;  4R8C A;  1CP9 A;  1WN7 A;  3E89 A;  1D5N A;  1JCH A;  3JAL A;  1JJ2 U;  5LGU A;  1DGS A;  2DQ0 A;  1DK1 A;  1Z5W A;  5FNV A;  2XHB A;  1GK9 A;  3QNE A;  4MVR A;  4MSW C;  3HKC B;  1K3E A;  5BY1 A;  5LP6 C;  1V54 C;  4GX1 A;  3J81 N;  4ABM A;  2Q6A A;  4JI6 B;  3N27 A;  1H2N A;  1VQ7 V;  2IM9 A;  4JI1 O;  3TCU A;  3CCL V;  1M1K W;  1Q8I A;  2UUB B;  1BGY H;  2EBO A;  2JEU A;  3SPI A;  3ABM C;  1H2S B;  1PV0 A;  2UXX A;  4UVB A;  1HR0 B;  3W7W A;  3D3I A;  3L75 H;  2EIN C;  3H1J H;  5H2F Z;  1FXK A;  3K5M A;  4DV5 O;  2XAJ A;  3T1H B;  1WP8 A;  5CBG A;  4DRX B;  3CCE V;  4J9Y B;  2ZM6 O;  2YXH A;  4AIL C;  4X66 B;  3VQY A;  3K58 A;  2FKX A;  1N36 B;  1H2G A;  4LFC O;  2OTJ V;  1FFT B;  1W2B U;  2HKO A;  2ZIO A;  3B40 A;  3ZRV A;  2AZ0 A;  1SQQ H;  2Y48 A;  3GWO A;  3ICX A;  3KCX A;  1BZK A;  1K9M W;  2ZR2 A;  1DTO A;  3ABU A;  2A9H A;  4B3R B;  1FXV A;  3T1Y O;  4CH4 A;  1OCR C;  1MSD A;  1OV9 A;  1JX9 A;  1VQ4 V;  3Q4H B;  4FLY A;  5L3F A;  5B3S C;  3WB1 A;  4UVA A;  4B3M B;  1FFX B;  3B77 A;  5LMU O;  2DYS B;  1HNX B;  1VP7 A;  5LP6 A;  1YF2 A;  4GT1 A;  4JI8 B;  5KHJ A;  1KEC A;  4RAI A; 
#chains in the Genus database with same CATH homology
 5LL6 Y;  1XMO O;  4JI4 O;  4JI3 O;  4OPA A;  3SDL A;  3RT3 C;  4DR2 O;  1A32 A;  5FLX N;  1DK1 A;  2HHH O;  1YZB A;  1IBL O;  1N34 O;  4DV0 O;  2UXC O;  5H5N A;  4X64 O;  1IBK O;  5BY1 A;  1NS1 A;  1R1B A;  4LFB O;  4JYA O;  4A5U B;  2DOS A;  4JI7 O;  4B3T O;  3O65 A;  3J81 N;  3T1H O;  4NXM O;  1I94 O;  2E5L O;  4LF7 O;  1XNR O;  4JI1 O;  4KHP O;  1FYJ A;  4DUY O;  3F5T A;  4DV2 O;  3J80 N;  4DV7 O;  1J5E O;  4DUZ O;  3R66 A;  4DR6 O;  2N74 A;  4DV3 O;  1N36 O;  4JI5 O;  1IBM O;  4X62 O;  4LFA O;  1KUQ A;  4DR4 O;  1R6T A;  4NXN O;  2UU9 O;  2AGA A;  4DV5 O;  5IWA O;  1G1X B;  4DV1 O;  3J7A U;  2LW7 A;  4B3S O;  2UXD O;  4OPH A;  2VQE O;  4OX9 O;  2ZM6 O;  5A2Q N;  4YY3 O;  2UUB O;  4LF9 O;  1AIL A;  2FKX A;  4K0K O;  4LFC O;  1X59 A;  1FKA O;  1HNZ O;  1N32 O;  2UUA O;  1XEQ A;  2VQF O;  4DR3 O;  4B3R O;  1HR0 O;  4AQY O;  3M8A A;  1XNQ O;  4DR5 O;  3JAM N;  1HNX O;  5BXZ A;  4JI0 O;  4B3M O;  4DV4 O;  1FJG O;  2F4V O;  5LMN O;  4DR1 O;  4JI2 O;  4LF6 O;  3T1Y O;  4LF8 O;  4DR7 O;  4LF4 O;  4LF5 O;  4X66 O;  2Z0A A;  4JI8 O;  1D2D A;  5IT9 N;  1XMQ O;  3OTO O;  5LMU O;  1AB3 A;  4X65 O;  4DV6 O;  4GKJ O;  4YHH O;  2UXB O;  5BR8 O;  4JI6 O;  2UUC O;  1HNW O;  2JRI A;  1N33 O;  1F7Y A;  4GKK O;  4JV5 O;  2ZKO A;  2DJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...