4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
5BXZA 1FYJA 2HHHO 4LF5O 4LFBO 2UXCO 5LMUO 4DR3O 4OX9O 4JI8O 4OPHA 4X65O 1N34O 4DV1O 2UUCO 1G1XB 4JI3O 1N33O 5IWAO 1I94O 2VQEO 2N74A 4GKKO 2ZKOA 4DV3O 2Z0AA 3M8AA 4B3RO 4B3TO 3O65A 1IBKO 3F5TA 1FJGO 3J7AU 3JAMN 4JI5O 2AGAA 5LL6Y 2ZM6O 1D2DA 2DJVA 2DOSA 4B3MO 1R6TA 4B3SO 4JYAO 3R66A 2UXBO 4DV0O 4KHPO 1YZBA 4LFCO 2LW7A 5LMNO 3T1HO 4LF4O 5H5NA 4NXNO 4X64O 3OTOO 4JI1O 4DV7O 4AQYO 1FKAO 4LFAO 4DUYO 4DR7O 1A32A 4JI6O 4DR4O 4DR2O 1HNZO 4OPAA 1HR0O 1R1BA 4JI2O 1AILA 1HNWO 4DR6O 1NS1A 2F4VO 1J5EO 2E5LO 1XEQA 4A5UB 4DV2O 2UUAO 3J81N 1AB3A 5IT9N 1HNXO 4DV5O 2UXDO 1F7YA 3SDLA 1XMOO 1XMQO 1KUQA 2VQFO 4K0KO 5BR8O 3RT3C 4LF7O 4YHHO 1DK1A 1X59A 3J80N 4X66O 5FLXN 4JI7O 4LF8O 4JI0O 2UUBO 4NXMO 2FKXA 4DR1O 4YY3O 1N36O 4X62O 4LF9O 5A2QN 4JI4O 1XNQO 4DV4O 1IBLO 5BY1A 4JV5O 1N32O 1IBMO 2UU9O 4DR5O 4DV6O 3T1YO 4DUZO 1XNRO 4LF6O 4GKJO 2JRIA
chains in the Genus database with same CATH superfamily
1FPOA 3MAQA 2JDIG 5J2TB 2ZNJA 1YSCA 1QNMA 4OPHA 2ITDC 4EFEA 1G1XB 2CDYA 2UUAB 2HR3A 1JJ2U 3IJ4A 4BW5A 1XL6A 5EBLC 3DSQA 2IJKA 4AILC 2MK3A 1H2KA 4PV1B 4MT8A 3EFFK 1PM9A 1DF5A 4RWUA 3MDSA 3EXAA 1JOYA 4J7ZA 2B5UA 3C3SA 3B77A 2ETNA 3CCUV 5L3FA 2CTQA 1YZBA 1NQTA 3B40A 1XBLA 5EK0A 1THZA 2UU9B 1H2NA 3VBBA 4NXNO 3BFRA 4GCZA 1DF4A 3FFQA 4LF5B 3ETEA 1W59A 2CH7A 1L0LH 1NS1A 1I08A 1NR7A 4UCUA 1F51A 2A3QA 2YIDA 5B1BC 3ZRWB 2JJ2G 4PI2A 4WFEA 2F93B 5K1XA 3OMAB 4KUMA 3ZMZA 4XDJA 3AK2A 1FJGB 4LH7A 3LUTB 4IIJB 3JALA 3HKCA 1DK1A 1VQKV 1KECA 3W7UA 2BOCC 2UUBO 3ZIAG 4K8ZA 4I50A 1K7DA 4GX5A 4X9QA 3RVZA 4X8AA 4BAYA 4JI4O 1H38A 1AP5A 3OM3B 1QQCA 2XAFA 1B6QA 5LP6B 2GTSA 3TK1A 3U0ZA 3K59A 1FXKA 2ZINA 5IYDO 1M4UA 1W0KG 5KLVH 1V55B 1YF2A 4J80A 2EINB 3E83A 2EILB 1J95A 1M57C 4LFBO 1Y66A 1YEWA 1MZFA 1GMGA 3E8GA 3R65A 4PDMA 2X6AA 5JCOC 2QSAA 3W7TA 1J5EB 3ML0A 4O4HA 3CRAA 1BHAA 3BABA 3CCRV 1S77D 5LXTA 2QKAA 1YCIA 2EULA 2ILMA 3ZHVA 1H8HG 4LF8B 2GTAA 1HDJA 2AXTZ 4B3SO 2PYLA 4LNUA 3D36C 4PI0A 2IJIA 1F4NA 1ZAUA 4MVUA 1K5SA 2IH3C 3K03A 2IU3A 1SQFA 4UUJC 1E1QG 1FKAO 3SYAA 1X4TA 2ZIMA 4TUYA 1E79G 4IGGA 4ZBMA 2EIMB 4UV9A 1AI6A 1D5NA 2AHZA 4OX9B 2IH1C 3JD4A 2ADPA 3K5OA 5FNVA 2RN9A 4B7EA 1XEQA 4DV2O 2YDEA 2CH7B 3QO5A 3N2KA 1BT8A 4O2AA 1HNXO 4UXNA 3RYCB 4NB5A 3SDLA 5C93A 1VQNV 3KCYA 1R73A 4K0KO 4JI5B 3SPGA 4U3FH 4JTAB 2YEVA 2HJFC 1YJNV 4JI0O 2FKXA 4CH6A 5EYPA 2IJHA 2DWEC 3K0GA 3HKCB 2BTOA 2HVKC 5IYBO 1M56B 2C2AA 1AI5A 3TGUH 2JJ1G 2KQXA 2E75B 1VP7A 1FXHA 3I5DA 1FS0G 3OTOB 1V55C 2EZOA 4TV8A 2N04A 2QA4V 2DQ0A 3NXSA 4MVRA 1FXKB 3SJCC 3U11A 4FZ0A 2PY5A 2CK3G 3AG2C 4PA6A 4JI3O 2JGDA 5CN0A 1CEZA 1SQBH 1ZL8A 4X20A 3OGIB 3WB1A 1UJWB 4B3TO 4O4HB 1XDCA 5LXTB 4Q20A 2WSSG 1R3KC 4U7OA 4X88A 1KBHA 4Z1MG 1NI8A 2ZE7A 4R7CA 4ZIBA 5LMNO 4I5SA 3RFRA 4LNUB 4PA4A 4DV6B 2XT9A 4LCUC 2ZQMA 3OR6C 2X0LA 4DUYO 4QPKA 1GK9A 3OW2U 1JJOA 4DR2O 3W7WA 3OFNG 3N2GA 4JI8B 3JAKA 1WJZA 2QTOA 5FPOA 2E5LO 1LUWA 2EJ7A 2YS8A 2YUAA 5CA3A 1BQZA 3K57A 5FNVB 1QR9A 1Q7YW 3K08A 4RQFA 2VQFO 4I7ZB 1WP7A 2DN9A 3N2KB 4FLTA 4O2AB 4U3JA 4XDKA 1NZ6A 4UCOA 3K5NA 2YIBD 1OCRB 2YIBA 4E2LA 1XNQO 2YEVB 2WLKA 4LFCB 1DGSA 3H9VA 3RW0A 4K8XA 3UCSC 3T1HB 1URFA 2ADQB 4JV5O 1JX9A 5EYPB 4H13B 4CS4A 2FL4A 3T1YO 2Y48A 1GAXA 1VQ5V 4LH6A 2HHHO 3VQXA 4O4LA 3CD6V 1HR0B 4NVPA 4JI2B 4ZOLA 1BHBA 5LBQA 3B4SA 3DGEA 5CA1A 5GTHZ 1H2LA 5KAFZ 4TV8B 3SPJA 2QE7G 5KX5A 3HPLC 2DYRB 4WCEV 4B3RO 5KA6A 2JGDB 5BR8B 1ZL8B 4X20B 3CPWU 3K5MA 5LHIA 1IDSA 2IU0A 1NU1H 2KB1A 2QWNB 3PN1A 4MTFA 2EIKB 4EEQA 4DXWA 1S5LZ 1OZ0A 2ZR2A 4KHPO 1HW7A 3SPHA 1WPXA 3OD4A 5B1NA 1VQ7V 4X64O 3IC7A 4LF6B 3GWKC 3ASNB 4QPJA 1XUQA 3DC6A 1R1BA 5H2FZ 3JATA 5JQGA 5FPRA 4A5UB 1GKFA 2ATKC 3N2GB 1XHZA 1AVMA 5LHHA 3JAKB 2UXDO 3AG4B 3CSXA 5IJ9A 1PD3A 2HVJC 1X59A 3UT5B 5FLXN 2EBOA 1US6A 2QWOB 3KKYA 2X6CA 4X62O 3X2QB 4U3JB 1YDXA 4NXNB 2XNDG 4DR5O 2JK5C 4NYKA 4WBNA 3CE2A 5GTIZ 2JRIA 3D3IA 4YJ2A 2UXCO 3Q4HA 1RP3B 4U7NA 1Q8IA 4BIUA 5L3DA 4O4LB 5DN6G 2VQEO 1PL4A 4ZOLB 4GKKO 1KB9F 3HKDA 3M8AA 3S3XA 5CA1B 3A2FA 3HB3B 2KSDA 3BPZA 2ARHA 1H2MA 2W6JG 3JAMN 5B66Z 1LNQA 5KX5B 2LGQA 3OUSA 3CYOA 1TGOA 3FB8C 2HFEC 5CBHA 2UUBB 4B3MO 2Q0AA 2EIKC 2GDSA 4I0XA 4XDLA 1M90W 5H6QA 4J7KA 4WF9V 3FD9A 1YVWA 5IE9A 1FD9A 1DLBA 3JARA 4DV5B 3AG7A 4FM2A 3OEEG 2GHYA 3MHHC 3D36A 2BCCH 2HG5C 3SGIA 4LFBB 1Q82W 4RUEA 1HNZO 5LA6A 3FB7C 1XOUA 1LUVA 1NBMG 2Y0IA 2OWOA 3J81N 4J10A 2LQTA 1JMKC 3CHXA 4L8JA 2P4KA 3JATB 5JQGB 2VS0A 1XMQO 3FAVA 2QWPB 4BW9A 1Q6UA 5IDJA 4P9PA 2MW2B 4R8CA 5J2UA 3FYIB 3P3PA 4B3SB 4JTCB 1NVPD 5IJ9B 1V54C 4LF9O 5B1BB 1NTMH 1JQ0A 1SF9A 1GO3F 1UFIA 4DYLA 3K04A 3VQVA 3LSSA 4PELA 1GTOA 1ROPA 3ZMUA 3CEIA 4RO2A 3GVMA 4FFBA 1RPRA 4WFFA 1K34A 3A0BZ 4WBNB 3BRCA 1Z2GA 3L73H 4DV1O 4FK5C 4YJ2B 4DV2B 1SQPH 1WPBA 1I94O 2FMLA 1HNXB 2Z0AA 3Q4HB 1OCZC 3OE7G 1K33A 3G71V 2LFRA 3WB2A 4K0KB 4F6EA 3TETA 4JZGA 1BMFG 1D2DA 1BL8A 2XUMA 2Y0PA 3HKDB 4JI0B 1M57B 2XOKG 3OGCC 4GX1A 4NR1A 1DTOA 2DQ3A 4JYAO 1XL4A 1GH6A 2GV9A 1S76D 5CA0A 2R9RB 3JSLA 3P3NA 2Q8VA 4UVCA 1WA8A 3E86A 2ZE5A 4MTOA 4I0XB 3HKBA 1VQ9V 2A9HA 2OTLV 4DV7O 4DR7O 1A32A 3JARB 2DMXA 2P90A 2O57A 2YC0A 5E79Z 3LSQA 3H1HH 4JI3B 3CCJV 3CRMA 3SYPA 5LA6B 2W0FC 4B3TB 3ABKC 2B1IA 3BHPA 4JGSA 3KCXA 3LSUA 2BE3A 3E8FA 2K1EA 2XAQA 5CBGA 3CMEV 1AJPA 2JS3A 1N36O 2F43G 3FAVB 5A2QN 4PA3A 5L3GA 2Q68A 5J2UB 5LMNB 2ZIOA 4IT5A 4I9WA 4UB6Z 1NVPB 3UO2A 2JVDA 3AG3B 4DUZO 2PYJA 3H1JH 1XI1A 4DUYB 2RNBA 1VARA 4GKJO 5J9PC 4DR2B 3BAAA 4AHCA 2H3OA 4MVMA 2E5LB 1NH2D 4X65O 3E8BA 4FFBB 5IYZA 5DECA 5CB4A 2N74A 4CC5A 1YJ9V 3C3TA 4PDRA 5JH7A 1VQMV 2UXXA 5EIBC 2VQFB 1P7GA 1LR1A 3RGBA 1XREA 5H9CA 1K73W 5K1PA 4DRXA 1NKDA 2OCCC 4Q6GA 4DW1A 3R66A 3QO8A 4DV0O 3AG2B 1OCCC 3D3QA 1XNQB 3GB7C 4CH5A 4FFKA 2GSMB 4JV5B 1JCHA 5L3BA 4LFAB 4UV8A 1WAZA 1RSOA 3T1YB 1EM1A 1WA8B 2XAJA 2PZSA 2HHHB 4GX0A 3UKMA 1IXBA 1IZ3A 1I0HA 3HKBB 1CP9A 4ABMA 4HYOA 1Y76A 3CXHF 2F4VO 3L72H 1EBOA 1K92A 1B3QA 3OT7A 4JAVA 3ABMC 4B08A 1QVFU 4B3RB 2WLMA 1MA1A 2H94A 4K35A 1XMOO 1CXZB 4TSFG 4JYCA 5KHJA 1YXBA 1I5XA 1K4CC 1SZXA 2DYSC 4KHPB 2JEUA 2WLLA 1P7BA 3I55V 5F2VO 4X64B 4GYCB 3EHBB 4FLWA 3AG3C 1AR5A 2HP8A 4TV9A 5B5EZ 3CJHA 1JVMA 2QDOA 4O2BA 1QCEA 5EZYA 3JALB 3VQWA 1N33O 3JD2A 5H6RA 2QTSA 3O9OA 4GX2A 2RQ6A 5LGTA 2UXDB 4I50B 4C7UA 1Q6IA 2RDCA 3CCVV 4XBFA 1IBKO 4N21A 1M5IA 1FXVA 5IYZB 4QE7A 5CB4B 5LYJA 3BCCH 5JH7B 2Q69A 2DJVA 2A0LA 1OCOC 2Q73A 3P30A 3JSNA 1WB7A 2WPDG 4X62B 3JD1A 1EN6A 1Z5WA 4DRXB 3T2MA 4KP4A 1GM8A 3MHSC 4DR5B 2LFSA 2CGOA 5IY5C 3CCQV 4AQYO 3WG7C 1QU7A 2UXCB 2ZR3A 2X7RB 1AILA 4RUFA 1SESA 3OAAG 1H8EG 4J42A 1IXMA 3ZHTA 1TVKA 2XASA 2VQEB 4GKKB 2VWKA 4DK1A 1Y76B 3N27A 3ETQA 3JD3A 4G28B 4NTWA 4P30A 1B04A 4JI7O 4B3MB 3D8CA 1H2SB 2QGNA 4NXMO 4DR1O 4YY3O 3ICXA 1NR1A 1TA8A 3RYFA 4CS2A 4TUYB 2Q9LA 2E74B 3B8NA 2EZPA 3DC5A 4HZ3A 4FLVA 4I9QA 3G6EV 2WLLB 3RVYA 2XHBA 1S3JA 1HNZB 3QNEA 2WLJA 3FB5C 2IM9A 1N34O 4JASA 4FLUA 3ZCCA 2OIEA 1ZUQA 3CJHB 4D7TA 1N8RW 2JIZG 4O2BB 1NJIW 4BIOA 2E76B 1XMQB 3T4ZA 2DE0X 5D5PA 4FIPC 1W2BU 4QNHB 3TCUA 3FYEB 2NR5A 3CX5F 2D3OW 1AR1B 2FTKA 2A7WA 4G2KA 5BMVA 4LF9B 1EN4A 2WA3A 4W4KA 2RJZA 5L3CA 5LYJB 2FYUH 3SJAC 1PP9H 4MS2A 4FLXA 1P49A 3PJSK 1BSMA 4Z2WA 4X1YA 2NNUA 3L70H 1VF6A 5JVDA 4FM1A 1VQ4V 2EIJC 4TOIA 4FLYA 2WWWA 5B3SB 3M99B 2EJRA 3L9DA 2WLIA 5CBFA 3KG2A 3F7VC 4DV1B 2P6JA 4WFAV 1K5QA 1SC5B 1I94B 3AG1C 2Q7GA 2NLJC 1IURA 3CWBH 3S3WA 1K8AW 3UQ8A 1TVKB 1MMMA 3SYCA 3G67A 1SERA 2QWQB 4P9OA 4JYAB 4I55A 2D2CB 1KC8W 1L0NH 4MTGA 1O9HA 4HAMA 4UB8Z 3W7SA 1KP3A 3A8TA 3E22A 2GUZA 3RYFB 4DV7B 4J11A 4AI8A 4TQDA 5KA5A 4DR7B 5KMGA 3IAYA 2OYQA 3FKSG 3LDEA 2CTRA 4DR3O 1QR8A 1FAFA 2AHYA 1V54B 1Q3EA 4EB6A 2IW5A 2F23A 3OEHG 4PA9A 4R50A 1SS3A 5GW7A 2P5OA 3OMIB 1TUEB 3APQA 3RYIA 4J9YB 4DO2A 1N36B 4QIWF 5EC1C 2ZXWC 1GN2A 5EIBD 2XAGA 2NN4A 1QBZA 2BOBC 3L71H 5BMVB 3BVOA 3SYOA 3K5LA 4LF4O 1OCZB 4HNAA 3I56V 4DUZB 2W0XA 1VQLV 2Q0OC 4GKJB 2V4DA 4LR3A 3W7XA 1B06A 5B3SC 1VQPV 4X1YB 4DR4O 2G38A 4YIPA 4OPAA 5JVDB 1HNWO 5GONA 4JAUA 4MTXA 3ZRXA 4O4IA 2M7WA 4X65B 1EFRG 4JI4B 3E2EA 2QM7A 1GM9A 1FFXA 2OT5A 3CC2V 1K9MW 1EZVH 1F7YA 3NR7A 1AI7A 3H1LH 1UPGA 2JEXA 5AG2A 4DW0A 4ZKIA 3RT3C 4FZ1A 4LF7O 4J9ZB 3SPCA 4J41A 4DV0B 5KHKA 1SKVA 4IHJA 4DV4O 3ZMTA 4IL6Z 4QJFB 1IBMO 4I55B 3ABKB 1RM1C 4CS3A 2KKWA 1QLEC 2CTWA 2QJ1A 3E22B 1KKDA 1Q43A 2GUZB 5LGNA 1K97A 5LMUO 2PUSA 2ZE6A 2F4VB 4MVQA 2LJ2A 1KP2A 4F4LA 5KMGB 3DXRA 3ASOC 5IWAO 4CZZA 1QVGU 3ZMSA 2YI9A 3JYCA 4GUNA 3P32A 4FM0A 4EB6B 3SR2C 1VQ6V 1HWYA 1JFFA 3ZBHA 4L87A 1I7FA 1R6TA 4R6ZA 3ETGA 3E89A 1K3EA 3RYIB 3U10A 3SJBC 3SJQC 4IIJA 4FLZA 1AJNA 2XTAA 1Y67A 1ENVA 1JA8A 1KQSU 1IVSA 1OV9A 4JI1O 4BWAA 3K79A 3CMAV 1KKCA 2YXHA 4HNAB 4JTDB 2ZE8A 3RYHA 1VF6C 2OCCB 4PDLA 4DR6O 4UFZA 4GLXA 1R3IC 1OCCB 1N33B 3UO3A 5GONB 4O4IB 3FB6C 1XHXA 3RN4A 1IBKB 1P4RA 3IFXA 1Y74A 4NTXA 2DW4A 4YHHO 1FFXB 4WFGA 2DWDC 2Q7EA 1YHQV 3CRRA 1L1FA 1GN6A 5C8YA 5A9GA 2F1MA 5KHHA 3VQYA 3HKEA 2Q67A 1KYOF 5LGUA 1R6NA 3ABMB 3CC4V 1AI4A 1IBLO 2RMKB 1VF7A 1N32O 1SETA 5EBMC 2Y69C 4IHJB 5ITZA 4W4LA 4AQYB 2N05A 3KZIZ 1VQ8V 1XNRO 5BXZA 1BS3A 2L35A 1R6KA 4GZRB 2DYSB 5TISZ 3BEHA 5B1AC 2UUCO 1PL0A 1E1RG 1SZTA 1MABG 3O65A 3UM7A 3QVNA 4MVOA 1WB8A 3DXRB 1SQVH 3QF7A 2AZ2A 2ZDIA 2IBZH 4JI7B 1WP8A 2V7QG 4NXMB 2DOSA 4DR1B 1ORQC 3ABLB 4YY3B 3RYCA 2VWJA 2UXBO 1KD1W 1JFFB 4JF3A 3ZX6A 1F23A 3JCUZ 3CRCA 2F66C 1VMGA 2V1DA 2LW7A 3MD0A 3AEIA 2PI5A 1Q90D 2AW9A 1GN4A 3TXQA 4D6TH 4JZ2A 2E3CA 4JI6O 1EZJA 1WLEA 3OUFA 3JCZA 2CAZC 1OCOB 2PTMA 3SPIA 1N34B 1S72V 3WU2Z 2HJDA 3RYHB 1EN5A 1KU9A 5KUMA 4ZI7A 2R9IA 1PNKA 3T1CA 4DV5O 1MSWD 4DK0A 5CA0B 1W0JG 5IY5B 3CCMV 2L6LA 4MVSA 3WG7B 1P84F 4X66O 1GM7A 2WLNA 1Y74B 3ETDA 1SQXH 2QKSA 4PHZA 4RQEA 1Q86W 1HP8A 4FVMA 3ZS8C 1N4CA 5C8YB 1OJHA 1JR9A 4J7JA 4IYIA 4EKWA 3HKEB 1PNMA 1Y4MA 3THOA 4ASUG 3LNNA 4ICGA 3BY6A 3ZEDA 2BTQA 3WB0A 5ITZB 1S5JA 1BE3H 4KXRA 4UCTA 3IC9A 4X1KA 2YXYA 4FPPA 5LOVA 1SQGA 4UCVA 2ZKOA 4WFHA 4DV3O 2W6IG 4OGQB 3OTFA 2WAMA 4F6RA 2RCVA 1FFTB 1PKXA 1ZLZA 2ZM6O 2ZT9B 4KFMA 3ABLC 2OCHA 3K9AA 1MOFA 3FX7A 4I4TA 3B09A 2LGWA 3DTUB 4X1IA 1MNGA 1OHHG 5KHGA 3E8HA 4FMTA 4N23A 2YIAA 4IYHA 1NH2B 3M7MX 4LFAO 4X89A 4E4EA 2P7TC 4DR3B 1NT2B 2YXLA 3CCEV 5CMUA 3EVKA 4CC6A 2YSUB 2UUAO 2KG7A 4P2ZA 5IT9N 3BA9A 4LP8A 5LP6C 4PDVA 4UCRA 1TUBA 2BSKA 4B7KA 4UVAA 2GBOA 4O4JA 2EIJB 2LO1A 4H33A 1G6UA 3ZRSA 2EINC 4ZI7B 4LBEC 2EILC 1RSOB 2WLHA 1U97A 1QLNA 1Q5OA 2Q4PA 5EBWC 1IX9A 3C90A 3AG1B 3LDCA 5KAIZ 4MSWC 3K3WA 1VEWA 4LF4B 1T5EA 2UU9O 4CBCA 1AJQA 5IJ0A 2ZCEA 1ZSPA 4DR4B 4LF5O 2ZNIA 1HNWB 5BZBA 4CH3A 2P06A 5HFMA 4H0LB 2HEPA 1N0NA 4NKGB 2BTQB 2H8PC 2R70A 2Y4TA 4X1KB 2PI4A 2A06H 2VRZA 3F5TA 1FJGO 4MW8A 2ODMA 4LF7B 5LOVB 2AGAA 1H2GA 2OIGA 4OXSA 4GT1A 1MG1A 2AZ0A 2EIMC 4UCSA 4F6RB 2R9AA 2M6YA 2ZDIC 1G4YB 4TV9B 3K58A 4LWSA 4DV4B 1CPYA 4YXWG 3UT5A 1Q81W 3STLC 1IBMB 1WN7A 5EZYB 3ZJZA 4I4TB 4JYYA 3B2EE 3TXSA 4X1IB 2LW1A 2Q7HA 3CB2A 3G80A 4QE9A 5LMUB 2ZXWB 1J5EO 2R72A 1M56C 5IWAB 5L3EA 3CCSV 3E35A 3ZN1A 1RFYA 1JPXA 1SRYA 1TAEA 1SA0A 1KUQA 4BIZA 4RAIA 2KG7B 1YTFD 3ZN0A 3J80N 1VQOV 4LF8O 2PGGA 1FXKC 1TUBB 2BSKB 3T4DA 2QWRB 3K06A 4O4JB 2CE4A 3CP1A 1F4MA 3JAWA 3G4SV 3VOUA 3L75H 3RWRD 3AK1A 4G27B 3JASA 1SQQH 2JGUA 1COWG 5JJJB 5IYCO 4JI1B 3IGAC 1FYJA 4Z1VA 3TJTA 3K0DA 4DR6B 1ZTEA 5IJ0B 4OX9O 4KL1A 4MW3A 2CGNA 3A0RA 4PA7A 3H1IH 5B1OA 2Q5ZA 4TT3G 2QM4A 1N0JA 1BQ0A 1RM1B 2Y4UA 1QLEB 3J7AU 3ZHSA 1I5YA 4MVZA 4YHHB 4JI5O 2ITCC 3A0HZ 3CC7V 5DM6V 3STZC 5DEDA 1R3JC 3ZHUA 2Q6AA 4JPRA 1PV0A 1ZX3A 3ASOB 1IBLB 1N32B 3ZRVA 4JAAA 5HFLA 3JD0A 1YJWV 3OTOO 4LWSB 1XNRB 1D5AA 1YIJV 3ABTA 3QG5A 1BCCH 5FL7G 3B8MA 1ZWIC 1MSDA 3QTCA 1OCRC 2UUCB 3BA8A 3ABUA 3LDDA 2QR4A 3OR7C 4FJCC 3CS5A 1AB3A 1BGYH 2OTJV 3H01A 4YJ3A 3CXCU 4ZHQA 1GRJA 1WNSA 2YI8A 1SA0B 4QGPA 1BZKA 5KUKA 2UXBB 1Q6HA 4K3AA 2YICA 4NTYA 1NTZH 1YTFB 4H44B 2DYRC 3ZMVA 5BY1A 4LC1A 1G8MA 2WLIB 3CRQA 5J2TA 2EX3A 1M9NA 3JAWB 1AR4A 1K4DC 1M1KW 3HR0A 4DV6O 3OMNB 2P22C 5JCOA 2X6BA 1NTKH 1XQ8A 2P67A 4JI6B 1O9GA 3JASB 4PD4F 3K9SA 1VIBA 1AROP 4JI8O 3WFVA 2UXNA 3G6BA 2CUGA 4H37A 3APOA 3ZHQA 4WFBV 2JS5A 2HKOA 5D5QA 4TWKA 3H1KH 3QO7A 2Y69B 3CCLV 5LL6Y 1Z5VA 4X66B 4PJ0Z 3ASNC 1M93A 4BR6A 2WA4A 3ZHRA 2B1GA 5B1AB 2XAHA 1GN3A 5E1AC 4CH4A 2LP7A 3L74H 4LFCO 2F95B 1RPOA 4HBNA 2Z5UA 3T1HO 2PF4E 1MZEA 3AG4C 5H5NA 1VF5B 1L8DA 3AK3A 1XMOB 4YIOA 5JWPA 4D7SA 3F5WC 1PPJH 2P4VA 5EC2C 3ZRWA 2A79B 2QEXV 2HLDG 3RBZA 5LHGA 5JJNB 1R3LC 1HR0O 1U96A 1XILA 1YITV 4JI2O 3X2QC 1KMIZ 2CTPA 1QHTA 2K9PA 4DV3B 2Z3YA 2ZD9A 3SYQA 5BR8O 2IJJA 2B9ZA 2ZM6B 5KHIA 2QKCA 4JYBA 4TQFA 4YJ3B 4UVBA 1PNLA 1S5HC 5LP6A 5JJEB 1AP6A 1YI2V 2QM8A 4ZHQB 1S0VA 1Y6XA 3GWOA 4EFBA 3LNMB 2FB5A 1V9PA 3F7YC 4LF6O
chains in the Genus database with same CATH topology
5BXZA 1FYJA 2HHHO 4LF5O 4LFBO 2UXCO 5LMUO 4DR3O 4OX9O 4JI8O 4OPHA 4X65O 1N34O 4DV1O 2UUCO 1G1XB 4JI3O 1N33O 5IWAO 1I94O 2VQEO 2N74A 4GKKO 2ZKOA 4DV3O 2Z0AA 3M8AA 4B3RO 4B3TO 3O65A 1IBKO 3F5TA 1FJGO 3J7AU 3JAMN 4JI5O 2AGAA 5LL6Y 2ZM6O 1D2DA 2DJVA 2DOSA 4B3MO 1R6TA 4B3SO 4JYAO 3R66A 2UXBO 4DV0O 4KHPO 1YZBA 4LFCO 2LW7A 5LMNO 3T1HO 4LF4O 5H5NA 4NXNO 4X64O 3OTOO 4JI1O 4DV7O 4AQYO 1FKAO 4LFAO 4DUYO 4DR7O 1A32A 4JI6O 4DR4O 4DR2O 1HNZO 4OPAA 1HR0O 1R1BA 4JI2O 1AILA 1HNWO 4DR6O 1NS1A 2F4VO 1J5EO 2E5LO 1XEQA 4A5UB 4DV2O 2UUAO 3J81N 1AB3A 5IT9N 1HNXO 4DV5O 2UXDO 1F7YA 3SDLA 1XMOO 1XMQO 1KUQA 2VQFO 4K0KO 5BR8O 3RT3C 4LF7O 4YHHO 1DK1A 1X59A 3J80N 4X66O 5FLXN 4JI7O 4LF8O 4JI0O 2UUBO 4NXMO 2FKXA 4DR1O 4YY3O 1N36O 4X62O 4LF9O 5A2QN 4JI4O 1XNQO 4DV4O 1IBLO 5BY1A 4JV5O 1N32O 1IBMO 2UU9O 4DR5O 4DV6O 3T1YO 4DUZO 1XNRO 4LF6O 4GKJO 2JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXZ A;  1FYJ A;  2HHH O;  4LF5 O;  4LFB O;  2UXC O;  5LMU O;  4DR3 O;  4OX9 O;  4JI8 O;  4OPH A;  4X65 O;  1N34 O;  4DV1 O;  2UUC O;  1G1X B;  4JI3 O;  1N33 O;  5IWA O;  1I94 O;  2VQE O;  2N74 A;  4GKK O;  2ZKO A;  4DV3 O;  2Z0A A;  3M8A A;  4B3R O;  4B3T O;  3O65 A;  1IBK O;  3F5T A;  1FJG O;  3J7A U;  3JAM N;  4JI5 O;  2AGA A;  5LL6 Y;  2ZM6 O;  1D2D A;  2DJV A;  2DOS A;  4B3M O;  1R6T A;  4B3S O;  4JYA O;  3R66 A;  2UXB O;  4DV0 O;  4KHP O;  1YZB A;  4LFC O;  2LW7 A;  5LMN O;  3T1H O;  4LF4 O;  5H5N A;  4NXN O;  4X64 O;  3OTO O;  4JI1 O;  4DV7 O;  4AQY O;  1FKA O;  4LFA O;  4DUY O;  4DR7 O;  1A32 A;  4JI6 O;  4DR4 O;  4DR2 O;  1HNZ O;  4OPA A;  1HR0 O;  1R1B A;  4JI2 O;  1AIL A;  1HNW O;  4DR6 O;  1NS1 A;  2F4V O;  1J5E O;  2E5L O;  1XEQ A;  4A5U B;  4DV2 O;  2UUA O;  3J81 N;  1AB3 A;  5IT9 N;  1HNX O;  4DV5 O;  2UXD O;  1F7Y A;  3SDL A;  1XMO O;  1XMQ O;  1KUQ A;  2VQF O;  4K0K O;  5BR8 O;  3RT3 C;  4LF7 O;  4YHH O;  1DK1 A;  1X59 A;  3J80 N;  4X66 O;  5FLX N;  4JI7 O;  4LF8 O;  4JI0 O;  2UUB O;  4NXM O;  2FKX A;  4DR1 O;  4YY3 O;  1N36 O;  4X62 O;  4LF9 O;  5A2Q N;  4JI4 O;  1XNQ O;  4DV4 O;  1IBL O;  5BY1 A;  4JV5 O;  1N32 O;  1IBM O;  2UU9 O;  4DR5 O;  4DV6 O;  3T1Y O;  4DUZ O;  1XNR O;  4LF6 O;  4GKJ O;  2JRI A; 
#chains in the Genus database with same CATH topology
 1FPO A;  3MAQ A;  2JDI G;  5J2T B;  2ZNJ A;  1YSC A;  1QNM A;  4OPH A;  2ITD C;  4EFE A;  1G1X B;  2CDY A;  2UUA B;  2HR3 A;  1JJ2 U;  3IJ4 A;  4BW5 A;  1XL6 A;  5EBL C;  3DSQ A;  2IJK A;  4AIL C;  2MK3 A;  1H2K A;  4PV1 B;  4MT8 A;  3EFF K;  1PM9 A;  1DF5 A;  4RWU A;  3MDS A;  3EXA A;  1JOY A;  4J7Z A;  2B5U A;  3C3S A;  3B77 A;  2ETN A;  3CCU V;  5L3F A;  2CTQ A;  1YZB A;  1NQT A;  3B40 A;  1XBL A;  5EK0 A;  1THZ A;  2UU9 B;  1H2N A;  3VBB A;  4NXN O;  3BFR A;  4GCZ A;  1DF4 A;  3FFQ A;  4LF5 B;  3ETE A;  1W59 A;  2CH7 A;  1L0L H;  1NS1 A;  1I08 A;  1NR7 A;  4UCU A;  1F51 A;  2A3Q A;  2YID A;  5B1B C;  3ZRW B;  2JJ2 G;  4PI2 A;  4WFE A;  2F93 B;  5K1X A;  3OMA B;  4KUM A;  3ZMZ A;  4XDJ A;  3AK2 A;  1FJG B;  4LH7 A;  3LUT B;  4IIJ B;  3JAL A;  3HKC A;  1DK1 A;  1VQK V;  1KEC A;  3W7U A;  2BOC C;  2UUB O;  3ZIA G;  4K8Z A;  4I50 A;  1K7D A;  4GX5 A;  4X9Q A;  3RVZ A;  4X8A A;  4BAY A;  4JI4 O;  1H38 A;  1AP5 A;  3OM3 B;  1QQC A;  2XAF A;  1B6Q A;  5LP6 B;  2GTS A;  3TK1 A;  3U0Z A;  3K59 A;  1FXK A;  2ZIN A;  5IYD O;  1M4U A;  1W0K G;  5KLV H;  1V55 B;  1YF2 A;  4J80 A;  2EIN B;  3E83 A;  2EIL B;  1J95 A;  1M57 C;  4LFB O;  1Y66 A;  1YEW A;  1MZF A;  1GMG A;  3E8G A;  3R65 A;  4PDM A;  2X6A A;  5JCO C;  2QSA A;  3W7T A;  1J5E B;  3ML0 A;  4O4H A;  3CRA A;  1BHA A;  3BAB A;  3CCR V;  1S77 D;  5LXT A;  2QKA A;  1YCI A;  2EUL A;  2ILM A;  3ZHV A;  1H8H G;  4LF8 B;  2GTA A;  1HDJ A;  2AXT Z;  4B3S O;  2PYL A;  4LNU A;  3D36 C;  4PI0 A;  2IJI A;  1F4N A;  1ZAU A;  4MVU A;  1K5S A;  2IH3 C;  3K03 A;  2IU3 A;  1SQF A;  4UUJ C;  1E1Q G;  1FKA O;  3SYA A;  1X4T A;  2ZIM A;  4TUY A;  1E79 G;  4IGG A;  4ZBM A;  2EIM B;  4UV9 A;  1AI6 A;  1D5N A;  2AHZ A;  4OX9 B;  2IH1 C;  3JD4 A;  2ADP A;  3K5O A;  5FNV A;  2RN9 A;  4B7E A;  1XEQ A;  4DV2 O;  2YDE A;  2CH7 B;  3QO5 A;  3N2K A;  1BT8 A;  4O2A A;  1HNX O;  4UXN A;  3RYC B;  4NB5 A;  3SDL A;  5C93 A;  1VQN V;  3KCY A;  1R73 A;  4K0K O;  4JI5 B;  3SPG A;  4U3F H;  4JTA B;  2YEV A;  2HJF C;  1YJN V;  4JI0 O;  2FKX A;  4CH6 A;  5EYP A;  2IJH A;  2DWE C;  3K0G A;  3HKC B;  2BTO A;  2HVK C;  5IYB O;  1M56 B;  2C2A A;  1AI5 A;  3TGU H;  2JJ1 G;  2KQX A;  2E75 B;  1VP7 A;  1FXH A;  3I5D A;  1FS0 G;  3OTO B;  1V55 C;  2EZO A;  4TV8 A;  2N04 A;  2QA4 V;  2DQ0 A;  3NXS A;  4MVR A;  1FXK B;  3SJC C;  3U11 A;  4FZ0 A;  2PY5 A;  2CK3 G;  3AG2 C;  4PA6 A;  4JI3 O;  2JGD A;  5CN0 A;  1CEZ A;  1SQB H;  1ZL8 A;  4X20 A;  3OGI B;  3WB1 A;  1UJW B;  4B3T O;  4O4H B;  1XDC A;  5LXT B;  4Q20 A;  2WSS G;  1R3K C;  4U7O A;  4X88 A;  1KBH A;  4Z1M G;  1NI8 A;  2ZE7 A;  4R7C A;  4ZIB A;  5LMN O;  4I5S A;  3RFR A;  4LNU B;  4PA4 A;  4DV6 B;  2XT9 A;  4LCU C;  2ZQM A;  3OR6 C;  2X0L A;  4DUY O;  4QPK A;  1GK9 A;  3OW2 U;  1JJO A;  4DR2 O;  3W7W A;  3OFN G;  3N2G A;  4JI8 B;  3JAK A;  1WJZ A;  2QTO A;  5FPO A;  2E5L O;  1LUW A;  2EJ7 A;  2YS8 A;  2YUA A;  5CA3 A;  1BQZ A;  3K57 A;  5FNV B;  1QR9 A;  1Q7Y W;  3K08 A;  4RQF A;  2VQF O;  4I7Z B;  1WP7 A;  2DN9 A;  3N2K B;  4FLT A;  4O2A B;  4U3J A;  4XDK A;  1NZ6 A;  4UCO A;  3K5N A;  2YIB D;  1OCR B;  2YIB A;  4E2L A;  1XNQ O;  2YEV B;  2WLK A;  4LFC B;  1DGS A;  3H9V A;  3RW0 A;  4K8X A;  3UCS C;  3T1H B;  1URF A;  2ADQ B;  4JV5 O;  1JX9 A;  5EYP B;  4H13 B;  4CS4 A;  2FL4 A;  3T1Y O;  2Y48 A;  1GAX A;  1VQ5 V;  4LH6 A;  2HHH O;  3VQX A;  4O4L A;  3CD6 V;  1HR0 B;  4NVP A;  4JI2 B;  4ZOL A;  1BHB A;  5LBQ A;  3B4S A;  3DGE A;  5CA1 A;  5GTH Z;  1H2L A;  5KAF Z;  4TV8 B;  3SPJ A;  2QE7 G;  5KX5 A;  3HPL C;  2DYR B;  4WCE V;  4B3R O;  5KA6 A;  2JGD B;  5BR8 B;  1ZL8 B;  4X20 B;  3CPW U;  3K5M A;  5LHI A;  1IDS A;  2IU0 A;  1NU1 H;  2KB1 A;  2QWN B;  3PN1 A;  4MTF A;  2EIK B;  4EEQ A;  4DXW A;  1S5L Z;  1OZ0 A;  2ZR2 A;  4KHP O;  1HW7 A;  3SPH A;  1WPX A;  3OD4 A;  5B1N A;  1VQ7 V;  4X64 O;  3IC7 A;  4LF6 B;  3GWK C;  3ASN B;  4QPJ A;  1XUQ A;  3DC6 A;  1R1B A;  5H2F Z;  3JAT A;  5JQG A;  5FPR A;  4A5U B;  1GKF A;  2ATK C;  3N2G B;  1XHZ A;  1AVM A;  5LHH A;  3JAK B;  2UXD O;  3AG4 B;  3CSX A;  5IJ9 A;  1PD3 A;  2HVJ C;  1X59 A;  3UT5 B;  5FLX N;  2EBO A;  1US6 A;  2QWO B;  3KKY A;  2X6C A;  4X62 O;  3X2Q B;  4U3J B;  1YDX A;  4NXN B;  2XND G;  4DR5 O;  2JK5 C;  4NYK A;  4WBN A;  3CE2 A;  5GTI Z;  2JRI A;  3D3I A;  4YJ2 A;  2UXC O;  3Q4H A;  1RP3 B;  4U7N A;  1Q8I A;  4BIU A;  5L3D A;  4O4L B;  5DN6 G;  2VQE O;  1PL4 A;  4ZOL B;  4GKK O;  1KB9 F;  3HKD A;  3M8A A;  3S3X A;  5CA1 B;  3A2F A;  3HB3 B;  2KSD A;  3BPZ A;  2ARH A;  1H2M A;  2W6J G;  3JAM N;  5B66 Z;  1LNQ A;  5KX5 B;  2LGQ A;  3OUS A;  3CYO A;  1TGO A;  3FB8 C;  2HFE C;  5CBH A;  2UUB B;  4B3M O;  2Q0A A;  2EIK C;  2GDS A;  4I0X A;  4XDL A;  1M90 W;  5H6Q A;  4J7K A;  4WF9 V;  3FD9 A;  1YVW A;  5IE9 A;  1FD9 A;  1DLB A;  3JAR A;  4DV5 B;  3AG7 A;  4FM2 A;  3OEE G;  2GHY A;  3MHH C;  3D36 A;  2BCC H;  2HG5 C;  3SGI A;  4LFB B;  1Q82 W;  4RUE A;  1HNZ O;  5LA6 A;  3FB7 C;  1XOU A;  1LUV A;  1NBM G;  2Y0I A;  2OWO A;  3J81 N;  4J10 A;  2LQT A;  1JMK C;  3CHX A;  4L8J A;  2P4K A;  3JAT B;  5JQG B;  2VS0 A;  1XMQ O;  3FAV A;  2QWP B;  4BW9 A;  1Q6U A;  5IDJ A;  4P9P A;  2MW2 B;  4R8C A;  5J2U A;  3FYI B;  3P3P A;  4B3S B;  4JTC B;  1NVP D;  5IJ9 B;  1V54 C;  4LF9 O;  5B1B B;  1NTM H;  1JQ0 A;  1SF9 A;  1GO3 F;  1UFI A;  4DYL A;  3K04 A;  3VQV A;  3LSS A;  4PEL A;  1GTO A;  1ROP A;  3ZMU A;  3CEI A;  4RO2 A;  3GVM A;  4FFB A;  1RPR A;  4WFF A;  1K34 A;  3A0B Z;  4WBN B;  3BRC A;  1Z2G A;  3L73 H;  4DV1 O;  4FK5 C;  4YJ2 B;  4DV2 B;  1SQP H;  1WPB A;  1I94 O;  2FML A;  1HNX B;  2Z0A A;  3Q4H B;  1OCZ C;  3OE7 G;  1K33 A;  3G71 V;  2LFR A;  3WB2 A;  4K0K B;  4F6E A;  3TET A;  4JZG A;  1BMF G;  1D2D A;  1BL8 A;  2XUM A;  2Y0P A;  3HKD B;  4JI0 B;  1M57 B;  2XOK G;  3OGC C;  4GX1 A;  4NR1 A;  1DTO A;  2DQ3 A;  4JYA O;  1XL4 A;  1GH6 A;  2GV9 A;  1S76 D;  5CA0 A;  2R9R B;  3JSL A;  3P3N A;  2Q8V A;  4UVC A;  1WA8 A;  3E86 A;  2ZE5 A;  4MTO A;  4I0X B;  3HKB A;  1VQ9 V;  2A9H A;  2OTL V;  4DV7 O;  4DR7 O;  1A32 A;  3JAR B;  2DMX A;  2P90 A;  2O57 A;  2YC0 A;  5E79 Z;  3LSQ A;  3H1H H;  4JI3 B;  3CCJ V;  3CRM A;  3SYP A;  5LA6 B;  2W0F C;  4B3T B;  3ABK C;  2B1I A;  3BHP A;  4JGS A;  3KCX A;  3LSU A;  2BE3 A;  3E8F A;  2K1E A;  2XAQ A;  5CBG A;  3CME V;  1AJP A;  2JS3 A;  1N36 O;  2F43 G;  3FAV B;  5A2Q N;  4PA3 A;  5L3G A;  2Q68 A;  5J2U B;  5LMN B;  2ZIO A;  4IT5 A;  4I9W A;  4UB6 Z;  1NVP B;  3UO2 A;  2JVD A;  3AG3 B;  4DUZ O;  2PYJ A;  3H1J H;  1XI1 A;  4DUY B;  2RNB A;  1VAR A;  4GKJ O;  5J9P C;  4DR2 B;  3BAA A;  4AHC A;  2H3O A;  4MVM A;  2E5L B;  1NH2 D;  4X65 O;  3E8B A;  4FFB B;  5IYZ A;  5DEC A;  5CB4 A;  2N74 A;  4CC5 A;  1YJ9 V;  3C3T A;  4PDR A;  5JH7 A;  1VQM V;  2UXX A;  5EIB C;  2VQF B;  1P7G A;  1LR1 A;  3RGB A;  1XRE A;  5H9C A;  1K73 W;  5K1P A;  4DRX A;  1NKD A;  2OCC C;  4Q6G A;  4DW1 A;  3R66 A;  3QO8 A;  4DV0 O;  3AG2 B;  1OCC C;  3D3Q A;  1XNQ B;  3GB7 C;  4CH5 A;  4FFK A;  2GSM B;  4JV5 B;  1JCH A;  5L3B A;  4LFA B;  4UV8 A;  1WAZ A;  1RSO A;  3T1Y B;  1EM1 A;  1WA8 B;  2XAJ A;  2PZS A;  2HHH B;  4GX0 A;  3UKM A;  1IXB A;  1IZ3 A;  1I0H A;  3HKB B;  1CP9 A;  4ABM A;  4HYO A;  1Y76 A;  3CXH F;  2F4V O;  3L72 H;  1EBO A;  1K92 A;  1B3Q A;  3OT7 A;  4JAV A;  3ABM C;  4B08 A;  1QVF U;  4B3R B;  2WLM A;  1MA1 A;  2H94 A;  4K35 A;  1XMO O;  1CXZ B;  4TSF G;  4JYC A;  5KHJ A;  1YXB A;  1I5X A;  1K4C C;  1SZX A;  2DYS C;  4KHP B;  2JEU A;  2WLL A;  1P7B A;  3I55 V;  5F2V O;  4X64 B;  4GYC B;  3EHB B;  4FLW A;  3AG3 C;  1AR5 A;  2HP8 A;  4TV9 A;  5B5E Z;  3CJH A;  1JVM A;  2QDO A;  4O2B A;  1QCE A;  5EZY A;  3JAL B;  3VQW A;  1N33 O;  3JD2 A;  5H6R A;  2QTS A;  3O9O A;  4GX2 A;  2RQ6 A;  5LGT A;  2UXD B;  4I50 B;  4C7U A;  1Q6I A;  2RDC A;  3CCV V;  4XBF A;  1IBK O;  4N21 A;  1M5I A;  1FXV A;  5IYZ B;  4QE7 A;  5CB4 B;  5LYJ A;  3BCC H;  5JH7 B;  2Q69 A;  2DJV A;  2A0L A;  1OCO C;  2Q73 A;  3P30 A;  3JSN A;  1WB7 A;  2WPD G;  4X62 B;  3JD1 A;  1EN6 A;  1Z5W A;  4DRX B;  3T2M A;  4KP4 A;  1GM8 A;  3MHS C;  4DR5 B;  2LFS A;  2CGO A;  5IY5 C;  3CCQ V;  4AQY O;  3WG7 C;  1QU7 A;  2UXC B;  2ZR3 A;  2X7R B;  1AIL A;  4RUF A;  1SES A;  3OAA G;  1H8E G;  4J42 A;  1IXM A;  3ZHT A;  1TVK A;  2XAS A;  2VQE B;  4GKK B;  2VWK A;  4DK1 A;  1Y76 B;  3N27 A;  3ETQ A;  3JD3 A;  4G28 B;  4NTW A;  4P30 A;  1B04 A;  4JI7 O;  4B3M B;  3D8C A;  1H2S B;  2QGN A;  4NXM O;  4DR1 O;  4YY3 O;  3ICX A;  1NR1 A;  1TA8 A;  3RYF A;  4CS2 A;  4TUY B;  2Q9L A;  2E74 B;  3B8N A;  2EZP A;  3DC5 A;  4HZ3 A;  4FLV A;  4I9Q A;  3G6E V;  2WLL B;  3RVY A;  2XHB A;  1S3J A;  1HNZ B;  3QNE A;  2WLJ A;  3FB5 C;  2IM9 A;  1N34 O;  4JAS A;  4FLU A;  3ZCC A;  2OIE A;  1ZUQ A;  3CJH B;  4D7T A;  1N8R W;  2JIZ G;  4O2B B;  1NJI W;  4BIO A;  2E76 B;  1XMQ B;  3T4Z A;  2DE0 X;  5D5P A;  4FIP C;  1W2B U;  4QNH B;  3TCU A;  3FYE B;  2NR5 A;  3CX5 F;  2D3O W;  1AR1 B;  2FTK A;  2A7W A;  4G2K A;  5BMV A;  4LF9 B;  1EN4 A;  2WA3 A;  4W4K A;  2RJZ A;  5L3C A;  5LYJ B;  2FYU H;  3SJA C;  1PP9 H;  4MS2 A;  4FLX A;  1P49 A;  3PJS K;  1BSM A;  4Z2W A;  4X1Y A;  2NNU A;  3L70 H;  1VF6 A;  5JVD A;  4FM1 A;  1VQ4 V;  2EIJ C;  4TOI A;  4FLY A;  2WWW A;  5B3S B;  3M99 B;  2EJR A;  3L9D A;  2WLI A;  5CBF A;  3KG2 A;  3F7V C;  4DV1 B;  2P6J A;  4WFA V;  1K5Q A;  1SC5 B;  1I94 B;  3AG1 C;  2Q7G A;  2NLJ C;  1IUR A;  3CWB H;  3S3W A;  1K8A W;  3UQ8 A;  1TVK B;  1MMM A;  3SYC A;  3G67 A;  1SER A;  2QWQ B;  4P9O A;  4JYA B;  4I55 A;  2D2C B;  1KC8 W;  1L0N H;  4MTG A;  1O9H A;  4HAM A;  4UB8 Z;  3W7S A;  1KP3 A;  3A8T A;  3E22 A;  2GUZ A;  3RYF B;  4DV7 B;  4J11 A;  4AI8 A;  4TQD A;  5KA5 A;  4DR7 B;  5KMG A;  3IAY A;  2OYQ A;  3FKS G;  3LDE A;  2CTR A;  4DR3 O;  1QR8 A;  1FAF A;  2AHY A;  1V54 B;  1Q3E A;  4EB6 A;  2IW5 A;  2F23 A;  3OEH G;  4PA9 A;  4R50 A;  1SS3 A;  5GW7 A;  2P5O A;  3OMI B;  1TUE B;  3APQ A;  3RYI A;  4J9Y B;  4DO2 A;  1N36 B;  4QIW F;  5EC1 C;  2ZXW C;  1GN2 A;  5EIB D;  2XAG A;  2NN4 A;  1QBZ A;  2BOB C;  3L71 H;  5BMV B;  3BVO A;  3SYO A;  3K5L A;  4LF4 O;  1OCZ B;  4HNA A;  3I56 V;  4DUZ B;  2W0X A;  1VQL V;  2Q0O C;  4GKJ B;  2V4D A;  4LR3 A;  3W7X A;  1B06 A;  5B3S C;  1VQP V;  4X1Y B;  4DR4 O;  2G38 A;  4YIP A;  4OPA A;  5JVD B;  1HNW O;  5GON A;  4JAU A;  4MTX A;  3ZRX A;  4O4I A;  2M7W A;  4X65 B;  1EFR G;  4JI4 B;  3E2E A;  2QM7 A;  1GM9 A;  1FFX A;  2OT5 A;  3CC2 V;  1K9M W;  1EZV H;  1F7Y A;  3NR7 A;  1AI7 A;  3H1L H;  1UPG A;  2JEX A;  5AG2 A;  4DW0 A;  4ZKI A;  3RT3 C;  4FZ1 A;  4LF7 O;  4J9Z B;  3SPC A;  4J41 A;  4DV0 B;  5KHK A;  1SKV A;  4IHJ A;  4DV4 O;  3ZMT A;  4IL6 Z;  4QJF B;  1IBM O;  4I55 B;  3ABK B;  1RM1 C;  4CS3 A;  2KKW A;  1QLE C;  2CTW A;  2QJ1 A;  3E22 B;  1KKD A;  1Q43 A;  2GUZ B;  5LGN A;  1K97 A;  5LMU O;  2PUS A;  2ZE6 A;  2F4V B;  4MVQ A;  2LJ2 A;  1KP2 A;  4F4L A;  5KMG B;  3DXR A;  3ASO C;  5IWA O;  4CZZ A;  1QVG U;  3ZMS A;  2YI9 A;  3JYC A;  4GUN A;  3P32 A;  4FM0 A;  4EB6 B;  3SR2 C;  1VQ6 V;  1HWY A;  1JFF A;  3ZBH A;  4L87 A;  1I7F A;  1R6T A;  4R6Z A;  3ETG A;  3E89 A;  1K3E A;  3RYI B;  3U10 A;  3SJB C;  3SJQ C;  4IIJ A;  4FLZ A;  1AJN A;  2XTA A;  1Y67 A;  1ENV A;  1JA8 A;  1KQS U;  1IVS A;  1OV9 A;  4JI1 O;  4BWA A;  3K79 A;  3CMA V;  1KKC A;  2YXH A;  4HNA B;  4JTD B;  2ZE8 A;  3RYH A;  1VF6 C;  2OCC B;  4PDL A;  4DR6 O;  4UFZ A;  4GLX A;  1R3I C;  1OCC B;  1N33 B;  3UO3 A;  5GON B;  4O4I B;  3FB6 C;  1XHX A;  3RN4 A;  1IBK B;  1P4R A;  3IFX A;  1Y74 A;  4NTX A;  2DW4 A;  4YHH O;  1FFX B;  4WFG A;  2DWD C;  2Q7E A;  1YHQ V;  3CRR A;  1L1F A;  1GN6 A;  5C8Y A;  5A9G A;  2F1M A;  5KHH A;  3VQY A;  3HKE A;  2Q67 A;  1KYO F;  5LGU A;  1R6N A;  3ABM B;  3CC4 V;  1AI4 A;  1IBL O;  2RMK B;  1VF7 A;  1N32 O;  1SET A;  5EBM C;  2Y69 C;  4IHJ B;  5ITZ A;  4W4L A;  4AQY B;  2N05 A;  3KZI Z;  1VQ8 V;  1XNR O;  5BXZ A;  1BS3 A;  2L35 A;  1R6K A;  4GZR B;  2DYS B;  5TIS Z;  3BEH A;  5B1A C;  2UUC O;  1PL0 A;  1E1R G;  1SZT A;  1MAB G;  3O65 A;  3UM7 A;  3QVN A;  4MVO A;  1WB8 A;  3DXR B;  1SQV H;  3QF7 A;  2AZ2 A;  2ZDI A;  2IBZ H;  4JI7 B;  1WP8 A;  2V7Q G;  4NXM B;  2DOS A;  4DR1 B;  1ORQ C;  3ABL B;  4YY3 B;  3RYC A;  2VWJ A;  2UXB O;  1KD1 W;  1JFF B;  4JF3 A;  3ZX6 A;  1F23 A;  3JCU Z;  3CRC A;  2F66 C;  1VMG A;  2V1D A;  2LW7 A;  3MD0 A;  3AEI A;  2PI5 A;  1Q90 D;  2AW9 A;  1GN4 A;  3TXQ A;  4D6T H;  4JZ2 A;  2E3C A;  4JI6 O;  1EZJ A;  1WLE A;  3OUF A;  3JCZ A;  2CAZ C;  1OCO B;  2PTM A;  3SPI A;  1N34 B;  1S72 V;  3WU2 Z;  2HJD A;  3RYH B;  1EN5 A;  1KU9 A;  5KUM A;  4ZI7 A;  2R9I A;  1PNK A;  3T1C A;  4DV5 O;  1MSW D;  4DK0 A;  5CA0 B;  1W0J G;  5IY5 B;  3CCM V;  2L6L A;  4MVS A;  3WG7 B;  1P84 F;  4X66 O;  1GM7 A;  2WLN A;  1Y74 B;  3ETD A;  1SQX H;  2QKS A;  4PHZ A;  4RQE A;  1Q86 W;  1HP8 A;  4FVM A;  3ZS8 C;  1N4C A;  5C8Y B;  1OJH A;  1JR9 A;  4J7J A;  4IYI A;  4EKW A;  3HKE B;  1PNM A;  1Y4M A;  3THO A;  4ASU G;  3LNN A;  4ICG A;  3BY6 A;  3ZED A;  2BTQ A;  3WB0 A;  5ITZ B;  1S5J A;  1BE3 H;  4KXR A;  4UCT A;  3IC9 A;  4X1K A;  2YXY A;  4FPP A;  5LOV A;  1SQG A;  4UCV A;  2ZKO A;  4WFH A;  4DV3 O;  2W6I G;  4OGQ B;  3OTF A;  2WAM A;  4F6R A;  2RCV A;  1FFT B;  1PKX A;  1ZLZ A;  2ZM6 O;  2ZT9 B;  4KFM A;  3ABL C;  2OCH A;  3K9A A;  1MOF A;  3FX7 A;  4I4T A;  3B09 A;  2LGW A;  3DTU B;  4X1I A;  1MNG A;  1OHH G;  5KHG A;  3E8H A;  4FMT A;  4N23 A;  2YIA A;  4IYH A;  1NH2 B;  3M7M X;  4LFA O;  4X89 A;  4E4E A;  2P7T C;  4DR3 B;  1NT2 B;  2YXL A;  3CCE V;  5CMU A;  3EVK A;  4CC6 A;  2YSU B;  2UUA O;  2KG7 A;  4P2Z A;  5IT9 N;  3BA9 A;  4LP8 A;  5LP6 C;  4PDV A;  4UCR A;  1TUB A;  2BSK A;  4B7K A;  4UVA A;  2GBO A;  4O4J A;  2EIJ B;  2LO1 A;  4H33 A;  1G6U A;  3ZRS A;  2EIN C;  4ZI7 B;  4LBE C;  2EIL C;  1RSO B;  2WLH A;  1U97 A;  1QLN A;  1Q5O A;  2Q4P A;  5EBW C;  1IX9 A;  3C90 A;  3AG1 B;  3LDC A;  5KAI Z;  4MSW C;  3K3W A;  1VEW A;  4LF4 B;  1T5E A;  2UU9 O;  4CBC A;  1AJQ A;  5IJ0 A;  2ZCE A;  1ZSP A;  4DR4 B;  4LF5 O;  2ZNI A;  1HNW B;  5BZB A;  4CH3 A;  2P06 A;  5HFM A;  4H0L B;  2HEP A;  1N0N A;  4NKG B;  2BTQ B;  2H8P C;  2R70 A;  2Y4T A;  4X1K B;  2PI4 A;  2A06 H;  2VRZ A;  3F5T A;  1FJG O;  4MW8 A;  2ODM A;  4LF7 B;  5LOV B;  2AGA A;  1H2G A;  2OIG A;  4OXS A;  4GT1 A;  1MG1 A;  2AZ0 A;  2EIM C;  4UCS A;  4F6R B;  2R9A A;  2M6Y A;  2ZDI C;  1G4Y B;  4TV9 B;  3K58 A;  4LWS A;  4DV4 B;  1CPY A;  4YXW G;  3UT5 A;  1Q81 W;  3STL C;  1IBM B;  1WN7 A;  5EZY B;  3ZJZ A;  4I4T B;  4JYY A;  3B2E E;  3TXS A;  4X1I B;  2LW1 A;  2Q7H A;  3CB2 A;  3G80 A;  4QE9 A;  5LMU B;  2ZXW B;  1J5E O;  2R72 A;  1M56 C;  5IWA B;  5L3E A;  3CCS V;  3E35 A;  3ZN1 A;  1RFY A;  1JPX A;  1SRY A;  1TAE A;  1SA0 A;  1KUQ A;  4BIZ A;  4RAI A;  2KG7 B;  1YTF D;  3ZN0 A;  3J80 N;  1VQO V;  4LF8 O;  2PGG A;  1FXK C;  1TUB B;  2BSK B;  3T4D A;  2QWR B;  3K06 A;  4O4J B;  2CE4 A;  3CP1 A;  1F4M A;  3JAW A;  3G4S V;  3VOU A;  3L75 H;  3RWR D;  3AK1 A;  4G27 B;  3JAS A;  1SQQ H;  2JGU A;  1COW G;  5JJJ B;  5IYC O;  4JI1 B;  3IGA C;  1FYJ A;  4Z1V A;  3TJT A;  3K0D A;  4DR6 B;  1ZTE A;  5IJ0 B;  4OX9 O;  4KL1 A;  4MW3 A;  2CGN A;  3A0R A;  4PA7 A;  3H1I H;  5B1O A;  2Q5Z A;  4TT3 G;  2QM4 A;  1N0J A;  1BQ0 A;  1RM1 B;  2Y4U A;  1QLE B;  3J7A U;  3ZHS A;  1I5Y A;  4MVZ A;  4YHH B;  4JI5 O;  2ITC C;  3A0H Z;  3CC7 V;  5DM6 V;  3STZ C;  5DED A;  1R3J C;  3ZHU A;  2Q6A A;  4JPR A;  1PV0 A;  1ZX3 A;  3ASO B;  1IBL B;  1N32 B;  3ZRV A;  4JAA A;  5HFL A;  3JD0 A;  1YJW V;  3OTO O;  4LWS B;  1XNR B;  1D5A A;  1YIJ V;  3ABT A;  3QG5 A;  1BCC H;  5FL7 G;  3B8M A;  1ZWI C;  1MSD A;  3QTC A;  1OCR C;  2UUC B;  3BA8 A;  3ABU A;  3LDD A;  2QR4 A;  3OR7 C;  4FJC C;  3CS5 A;  1AB3 A;  1BGY H;  2OTJ V;  3H01 A;  4YJ3 A;  3CXC U;  4ZHQ A;  1GRJ A;  1WNS A;  2YI8 A;  1SA0 B;  4QGP A;  1BZK A;  5KUK A;  2UXB B;  1Q6H A;  4K3A A;  2YIC A;  4NTY A;  1NTZ H;  1YTF B;  4H44 B;  2DYR C;  3ZMV A;  5BY1 A;  4LC1 A;  1G8M A;  2WLI B;  3CRQ A;  5J2T A;  2EX3 A;  1M9N A;  3JAW B;  1AR4 A;  1K4D C;  1M1K W;  3HR0 A;  4DV6 O;  3OMN B;  2P22 C;  5JCO A;  2X6B A;  1NTK H;  1XQ8 A;  2P67 A;  4JI6 B;  1O9G A;  3JAS B;  4PD4 F;  3K9S A;  1VIB A;  1ARO P;  4JI8 O;  3WFV A;  2UXN A;  3G6B A;  2CUG A;  4H37 A;  3APO A;  3ZHQ A;  4WFB V;  2JS5 A;  2HKO A;  5D5Q A;  4TWK A;  3H1K H;  3QO7 A;  2Y69 B;  3CCL V;  5LL6 Y;  1Z5V A;  4X66 B;  4PJ0 Z;  3ASN C;  1M93 A;  4BR6 A;  2WA4 A;  3ZHR A;  2B1G A;  5B1A B;  2XAH A;  1GN3 A;  5E1A C;  4CH4 A;  2LP7 A;  3L74 H;  4LFC O;  2F95 B;  1RPO A;  4HBN A;  2Z5U A;  3T1H O;  2PF4 E;  1MZE A;  3AG4 C;  5H5N A;  1VF5 B;  1L8D A;  3AK3 A;  1XMO B;  4YIO A;  5JWP A;  4D7S A;  3F5W C;  1PPJ H;  2P4V A;  5EC2 C;  3ZRW A;  2A79 B;  2QEX V;  2HLD G;  3RBZ A;  5LHG A;  5JJN B;  1R3L C;  1HR0 O;  1U96 A;  1XIL A;  1YIT V;  4JI2 O;  3X2Q C;  1KMI Z;  2CTP A;  1QHT A;  2K9P A;  4DV3 B;  2Z3Y A;  2ZD9 A;  3SYQ A;  5BR8 O;  2IJJ A;  2B9Z A;  2ZM6 B;  5KHI A;  2QKC A;  4JYB A;  4TQF A;  4YJ3 B;  4UVB A;  1PNL A;  1S5H C;  5LP6 A;  5JJE B;  1AP6 A;  1YI2 V;  2QM8 A;  4ZHQ B;  1S0V A;  1Y6X A;  3GWO A;  4EFB A;  3LNM B;  2FB5 A;  1V9P A;  3F7Y C;  4LF6 O; 
#chains in the Genus database with same CATH homology
 5BXZ A;  1FYJ A;  2HHH O;  4LF5 O;  4LFB O;  2UXC O;  5LMU O;  4DR3 O;  4OX9 O;  4JI8 O;  4OPH A;  4X65 O;  1N34 O;  4DV1 O;  2UUC O;  1G1X B;  4JI3 O;  1N33 O;  5IWA O;  1I94 O;  2VQE O;  2N74 A;  4GKK O;  2ZKO A;  4DV3 O;  2Z0A A;  3M8A A;  4B3R O;  4B3T O;  3O65 A;  1IBK O;  3F5T A;  1FJG O;  3J7A U;  3JAM N;  4JI5 O;  2AGA A;  5LL6 Y;  2ZM6 O;  1D2D A;  2DJV A;  2DOS A;  4B3M O;  1R6T A;  4B3S O;  4JYA O;  3R66 A;  2UXB O;  4DV0 O;  4KHP O;  1YZB A;  4LFC O;  2LW7 A;  5LMN O;  3T1H O;  4LF4 O;  5H5N A;  4NXN O;  4X64 O;  3OTO O;  4JI1 O;  4DV7 O;  4AQY O;  1FKA O;  4LFA O;  4DUY O;  4DR7 O;  1A32 A;  4JI6 O;  4DR4 O;  4DR2 O;  1HNZ O;  4OPA A;  1HR0 O;  1R1B A;  4JI2 O;  1AIL A;  1HNW O;  4DR6 O;  1NS1 A;  2F4V O;  1J5E O;  2E5L O;  1XEQ A;  4A5U B;  4DV2 O;  2UUA O;  3J81 N;  1AB3 A;  5IT9 N;  1HNX O;  4DV5 O;  2UXD O;  1F7Y A;  3SDL A;  1XMO O;  1XMQ O;  1KUQ A;  2VQF O;  4K0K O;  5BR8 O;  3RT3 C;  4LF7 O;  4YHH O;  1DK1 A;  1X59 A;  3J80 N;  4X66 O;  5FLX N;  4JI7 O;  4LF8 O;  4JI0 O;  2UUB O;  4NXM O;  2FKX A;  4DR1 O;  4YY3 O;  1N36 O;  4X62 O;  4LF9 O;  5A2Q N;  4JI4 O;  1XNQ O;  4DV4 O;  1IBL O;  5BY1 A;  4JV5 O;  1N32 O;  1IBM O;  2UU9 O;  4DR5 O;  4DV6 O;  3T1Y O;  4DUZ O;  1XNR O;  4LF6 O;  4GKJ O;  2JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...