4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
1XNRO 4JV5O 1AB3A 5FLXN 2LW7A 2DJVA 4B3MO 4DR7O 4DR1O 4KHPO 4AQYO 4DV1O 1YZBA 1F7YA 4LF8O 3JAMN 2N74A 1XEQA 4K0KO 3M8AA 4LF7O 1G1XB 1A32A 2F4VO 1IBLO 4DR2O 4DR5O 4GKJO 5LMUO 4LF5O 4DUYO 3O65A 4DV0O 4X64O 1IBKO 4LF4O 4NXMO 2UUAO 5BXZA 2UXCO 1R6TA 1AILA 3OTOO 1J5EO 3RT3C 4DV6O 4JI8O 3SDLA 4DR6O 2UUBO 1FYJA 1HNWO 4OX9O 4OPHA 2UXBO 2VQEO 4DUZO 1HNZO 1N32O 5IWAO 2FKXA 3J7AU 2UUCO 5IT9N 3R66A 4GKKO 5LL6Y 4B3SO 3T1HO 1DK1A 4DV4O 1XMQO 4B3RO 4JI2O 1KUQA 1I94O 1HR0O 1N36O 1N34O 4DR3O 3T1YO 4X65O 1X59A 4DV7O 4JI5O 2UXDO 4JI6O 4JI3O 5LMNO 4X62O 2AGAA 4LF6O 4DV3O 3J81N 4LFBO 1N33O 2VQFO 4B3TO 5H5NA 1HNXO 5BY1A 5BR8O 4NXNO 2ZM6O 3F5TA 4A5UB 4JI4O 4OPAA 4JYAO 1FKAO 1XMOO 4LFAO 1NS1A 1IBMO 2Z0AA 4LF9O 4JI1O 2ZKOA 4YY3O 4LFCO 4JI0O 2HHHO 4JI7O 1XNQO 5A2QN 1R1BA 1D2DA 4DV2O 2JRIA 2E5LO 3J80N 4DR4O 4DV5O 4X66O 2UU9O 2DOSA 1FJGO 4YHHO
chains in the Genus database with same CATH superfamily
2CTWA 3LDEA 3SPGA 1AB3A 4FLWA 2WLHA 3MD0A 5IYDO 4I0XB 5EIBC 1QCEA 3VQVA 2RNBA 3CC2V 1M56B 3SR2C 3A8TA 2QE7G 4X8AA 1KMIZ 4LF7O 3M99B 1K4DC 5TISZ 4F4LA 1M93A 1S76D 2KQXA 3ICXA 2QEXV 3RFRA 1Y76A 3Q4HA 5B1AB 3U0ZA 3OTOO 1PD3A 2XAGA 2X6CA 4I0XA 2ZT9B 1N32B 5IWAB 4JYYA 3LDDA 3CE2A 4OGQB 3AEIA 2GV9A 2UXNA 3H1KH 3AG1B 4CC5A 2XAQA 2ZIMA 1KC8W 3D8CA 1AJPA 2ZE6A 4CH6A 3OEHG 4FVMA 2ZQMA 4CBCA 1AJNA 2GSMB 1KQSU 2PGGA 5CBHA 1PV0A 1Q82W 1S5LZ 3W7WA 3OD4A 4DR4B 3ZRXA 4RUFA 4RQEA 3DTUB 1M90W 3K5MA 3L72H 2BTOA 3TJTA 2N04A 1MA1A 5J2TB 3RVZA 5BY1A 1FXKC 3UT5B 1S3JA 4LFAB 5LXTB 4LF9B 1AI5A 4W4KA 2DN9A 3IC9A 4YY3B 3B4SA 4YIPA 3FAVA 4NVPA 4X66B 2CK3G 2JRIA 1FFXB 3CCQV 4DV5O 4K3AA 2OCCB 5J2TA 2QKSA 3WB2A 4U3FH 3UT5A 4DV1B 3ABKC 4FLTA 4GYCB 3HKEB 1KBHA 1OZ0A 1AI7A 3OMNB 5LXTA 2WAMA 1MZEA 4TQDA 4U7OA 5EC1C 3T2MA 1JR9A 1NBMG 4JAVA 1UPGA 5D5PA 2EIKB 2R9AA 2OYQA 1FD9A 3A2FA 3SJQC 1SESA 4U3JB 1FFXA 3OUFA 1YITV 4Q20A 3RW0A 1JA8A 3KG2A 4QJFB 1H2MA 5KAFZ 3HKEA 3SYQA 2ZIOA 1ZLZA 4FLZA 4DUZO 2V7QG 1SQPH 5EIBD 3E8GA 3J7AU 3JD2A 2XUMA 3CMAV 3BA9A 3T1HO 5IYBO 4U3JA 4FFBB 1I94O 3STZC 1XILA 4X62B 2OIGA 3E86A 4QE9A 1F4MA 5LMNO 2WLMA 2XTAA 1BZKA 4LFBO 2IJKA 1Q90D 2XAFA 4JV5B 4B08A 1JPXA 1OCRC 3CMEV 4JI4B 2EIMB 4FFBA 1P84F 4DW0A 2ZXWB 1YJ9V 2EINB 1IBMO 5JCOC 2HHHB 4H0LB 3H1LH 3OE7G 3UO2A 5IY5B 4ZI7B 3CXHF 2XHBA 2JJ1G 1JVMA 3GB7C 2GBOA 3OMIB 3KZIZ 5KA5A 1AI6A 1M5IA 3E35A 2UU9O 4RO2A 3APQA 4EEQA 1NVPD 2YDEA 3K03A 3BPZA 3SJBC 2YXHA 2E76B 4LF7B 4N21A 3QVNA 4ZOLB 5L3EA 1YSCA 3KCXA 3K9SA 4CS3A 3BVOA 4ZI7A 3E83A 4J42A 3OM3B 4PJ0Z 1H8EG 5B1BB 2Q67A 2W6IG 3OTOB 4XBFA 4DK1A 1W2BU 2IBZH 4FFKA 5LP6C 4BIUA 2B1GA 4I5SA 3TGUH 2OTLV 1THZA 1CPYA 4ZOLA 1P4RA 1HNZO 3RGBA 5KX5B 1RPOA 1US6A 3C3TA 4I55B 3KCYA 4PA9A 1DK1A 2QDOA 1BMFG 2WLNA 4D7SA 3ZJZA 1HR0O 1GRJA 4DR3O 3JSLA 4PV1B 2HLDG 4YIOA 4FM0A 3T1CA 3QF7A 1F51A 5L3FA 4CH5A 3X2QC 4MVUA 1XREA 2VRZA 3B2EE 1K9MW 1P49A 2XT9A 5KX5A 2F1MA 4I55A 5LOVB 4UCOA 2A79B 4FPPA 4U7NA 1RPRA 1DTOA 1SQXH 5HFLA 3FB6C 1RM1B 2QM4A 4OPAA 1M57C 1GN6A 1SF9A 1JJOA 3APOA 1H2NA 2H8PC 2KB1A 3CCJV 4LFCO 3DXRB 4EKWA 2KSDA 2LO1A 2P67A 4DV5B 3FB7C 3TETA 2IM9A 3J80N 4MS2A 1VQLV 2P4KA 2ITCC 1WNSA 5LOVA 1W0KG 3FYEB 4PA4A 1XI1A 5EZYB 2JS5A 1R6KA 3K59A 2QA4V 4WFBV 1DGSA 3DXRA 1KYOF 5KA6A 1PNLA 1M9NA 5JWPA 5LBQA 5B3SB 5H6QA 1BL8A 1MABG 4MVQA 4DV0O 2PYJA 2IJHA 2F95B 1YIJV 2PY5A 2ZE5A 4JI8O 4JZ2A 4UUJC 1FYJA 4LP8A 4OPHA 3B77A 4FM2A 1HDJA 1Q3EA 1MG1A 1OCOC 3CYOA 5FPOA 3G80A 2HJDA 1H2LA 5EZYA 3T1HB 4UV8A 4CH3A 2IH1C 1R73A 4KP4A 1I94B 4YJ2B 3GWOA 2CH7B 5IJ0B 5LHGA 4UVCA 2CAZC 4GZRB 1AR4A 1ZWIC 2N05A 4I50B 3UM7A 2MW2B 5LMNB 3E2EA 5KMGB 4JI6O 4LFBB 5KHKA 2A0LA 3L71H 1OCCC 2O57A 4Z2WA 4K35A 4ZKIA 1FJGB 4GUNA 3ZBHA 4LWSB 2ITDC 1Z5WA 5H5NA 1PL4A 3K06A 1YJNV 4YJ2A 2CH7A 5IJ0A 1S5HC 3H1JH 4I50A 4JI1O 1ZUQA 4BWAA 5KMGA 2Q8VA 5IYCO 2E3CA 4P9OA 2FYUH 2UU9B 2YI9A 4DR4O 3BRCA 1AVMA 1LR1A 2CE4A 1I7FA 5K1PA 4LNUB 4FLUA 2UXXA 1S72V 2DQ0A 3H1HH 4X1YB 4PDRA 1XEQA 5FNVB 1WP8A 2ZR3A 2AZ2A 2LFRA 1MSWD 5LMUO 1VQ5V 4LF5O 4NB5A 4PA7A 3S3XA 1QQCA 1BGYH 3ETQA 5KHHA 3L74H 1QNMA 3RT3C 1O9HA 1SQGA 3ASNC 5EYPB 1HNZB 1FS0G 2JK5C 3NR7A 2VQFB 1EN6A 4X1YA 1SZTA 1L0NH 4CZZA 5FNVA 4C7UA 1SA0B 3FD9A 4GKKO 4O2AB 4BW5A 4QPKA 1VQ8V 1W0JG 1HR0B 5AG2A 4DR3B 3MDSA 4MTGA 3TXQA 1YCIA 5L3GA 1SRYA 1NH2B 1Y67A 1GM7A 1NU1H 1QU7A 2H3OA 5EYPA 4DV7O 4JI5O 4G27B 3HB3B 1V54C 3FKSG 1SA0A 1NI8A 1LUVA 3OMAB 1PNKA 2YS8A 1HNXO 3HPLC 4O2AA 1VF6C 1P7BA 2BTQB 1B04A 2NLJC 3W7UA 1BQ0A 2DYSC 3AG4B 2EJRA 2YIDA 3VQWA 4LFCB 1SERA 4WFGA 5F2VO 3JD4A 3ZS8C 4X1IB 2JVDA 3CCSV 2QWOB 3R65A 4PDVA 3ZN1A 1D5NA 4GLXA 4FLVA 4JV5O 3K08A 2BTQA 1M4UA 2DE0X 2QWRB 1HW7A 2IU0A 1F4NA 4X89A 5JVDB 4WFAV 2N74A 2LFSA 3CC7V 4WCEV 2XAHA 5DEDA 4PA3A 1EBOA 1DF4A 3HKBB 4DV0B 4X1IA 3B8MA 4IYIA 4DUYO 4MTOA 4JF3A 4JI8B 4NXMO 2ATKC 1GN2A 1Q8IA 2CDYA 4DV6O 1GMGA 1NKDA 1H2SB 4O4IB 4DO2A 1ZTEA 1NTZH 3JD0A 5JVDA 5GTIZ 3TCUA 1XL4A 4FMTA 3HKCB 4LCUC 4H44B 3QO5A 1G4YB 1Q6UA 4ZHQB 4LBEC 5IT9N 1FAFA 3EFFK 5LL6Y 4JASA 1COWG 4B3SO 3HKBA 4PI0A 1Q43A 1K34A 3IFXA 3ABLB 1NR1A 4P2ZA 3LSSA 1AJQA 1MOFA 4JI6B 2WSSG 3I5DA 4O4IA 5H6RA 5B1OA 2LQTA 3CC4V 1JOYA 2CGNA 2Q9LA 4UCRA 3LSUA 4JI3O 3HKCA 2ZNIA 4ZHQA 3ETEA 4Q6GA 3SYPA 1OJHA 3OR6C 5BR8O 3QTCA 2EILC 3BA8A 1R3IC 5KHIA 3K3WA 2ARHA 5B1AC 4JI1B 3W7SA 4PDMA 4DYLA 5L3CA 1BE3H 1YF2A 3SYAA 2DMXA 1Y66A 2ADPA 3G6BA 4NR1A 3H9VA 1FXKB 3MHHC 1VEWA 4UFZA 4R6ZA 4X1KB 2C2AA 4JPRA 4K8XA 3ZRSA 1DF5A 2WLJA 2IW5A 5FLXN 3W7XA 2LW7A 1AI4A 2ZCEA 1W59A 1QBZA 2YC0A 3JAMN 4I7ZB 2ZNJA 2JGUA 4HBNA 2QTOA 4K0KO 5LMUB 4LF5B 3HR0A 4JYCA 5IE9A 3F7VC 1H2KA 4B3RB 3ABKB 2PF4E 2HR3A 1IBKO 4X1KA 2GHYA 2M7WA 2ODMA 3LNMB 4EB6B 1I0HA 5DN6G 1M1KW 1CP9A 1QR8A 2UXBO 5JQGB 3JSNA 4D6TH 3DSQA 4GKKB 1SQFA 2ZDIA 4WF9V 2UUCO 3CRAA 4J9YB 3BY6A 4YJ3B 4J7ZA 2R9IA 1EZJA 1JQ0A 2D2CB 3CCRV 3LNNA 4EB6A 2B1IA 2OCCC 4X65O 4JI5B 4DV7B 1HWYA 3D36C 2Y69B 2Q5ZA 5JQGA 3UCSC 4R7CA 1HNXB 4PD4F 1XOUA 4E4EA 1X4TA 3JARB 4YJ3A 2YEVB 4IGGA 4EFEA 2LW1A 2Q7EA 1AP5A 2ZD9A 3ZMSA 1FKAO 2ILMA 1XMOO 5KAIZ 1AP6A 3JD1A 5L3DA 3OAAG 3UQ8A 4JI0O 3OR7C 1PNMA 3AK2A 1BT8A 3JARA 2YEVA 1FJGO 1XNRO 2BCCH 2DJVA 4TUYB 4AHCA 5IYZB 1J95A 4AQYO 4J7KA 1MMMA 4TQFA 3JASB 1BS3A 4F6EA 2ZE8A 3OGCC 4DUYB 2H94A 4N23A 4NXMB 1VIBA 4BR6A 2EBOA 1GN3A 3ZN0A 4DV6B 3IJ4A 3I56V 2QWNB 2K1EA 3AG2B 1J5EO 4JAUA 3SDLA 4TUYA 2DWDC 5JCOA 1N0NA 2DYRC 4I4TB 5IYZA 2Z3YA 1IDSA 3LDCA 4Z1VA 3JASA 2VQEO 1GAXA 1GKFA 3E8BA 4UB8Z 4B3SB 1TUBB 1ROPA 3FYIB 1GH6A 2ZM6B 4H33A 3WU2Z 4NYKA 1S5JA 5LP6B 5KHGA 1GM9A 4D7TA 5CA0B 4FLXA 5K1XA 1FXVA 4NTYA 4I9QA 2JIZG 4PELA 4JI3B 3TXSA 1N4CA 4I4TA 1XNQB 1YVWA 4XDJA 3ABMB 1I5XA 5E79Z 2QGNA 4LF6O 1TUBA 2VQFO 5BR8B 2JDIG 3O9OA 3SPCA 4L8JA 1YXBA 4X88A 5LP6A 3CCEV 4FK5C 5B1BC 1AROP 1BSMA 4FJCC 4W4LA 2Q0OC 5CA0A 1QLEC 1U97A 1WPXA 2BSKB 2Z0AA 1Z2GA 3RYCB 2V1DA 2OWOA 1G8MA 2Z5UA 2JEXA 1B3QA 2RJZA 3D3QA 2PI4A 1KP2A 1M57B 2WLIB 2Q73A 3ASOC 3CP1A 2DQ3A 1D5AA 3K9AA 3CXCU 2WPDG 1BHBA 4GCZA 1K97A 4K0KB 1VQ4V 1XUQA 2CTPA 4GX5A 2F93B 4MVSA 2BSKA 5FL7G 4BIZA 1YTFB 3P3PA 1IBKB 3RWRD 3H01A 1VQ6V 5BXZA 5JJEB 3S3WA 2WLIA 2CGOA 2UUBO 2UXBB 3OTFA 4OX9O 1RM1C 4PHZA 5EC2C 2UUCB 2RN9A 4RUEA 3AK1A 4TV8B 4MVOA 3M7MX 3DGEA 4JYAB 2QM8A 2X7RB 3HKDB 4X65B 1JX9A 1KUQA 3E22B 1NJIW 3T1YO 2ZR2A 2AHYA 3MHSC 5EK0A 2QKAA 3C3SA 3SPIA 1Q6HA 3A0RA 2P7TC 4TV8A 5EBLC 1K8AW 4MVMA 3H1IH 3UO3A 2FB5A 1XMOB 3HKDA 2BE3A 1WN7A 2Y4UA 3E22A 1Q6IA 5H2FZ 3BEHA 4JI0B 4KFMA 2HVJC 2Q4PA 1VQ9V 3DC5A 5JJJB 3ZIAG 3FX7A 2YICA 3EVKA 2YI8A 3FB8C 4H13B 4B7EA 2E5LO 2QJ1A 1XNRB 3QO8A 1ZL8B 4HZ3A 4IL6Z 2RMKB 4AQYB 1GTOA 3G67A 2K9PA 4DR7O 1OHHG 1QVGU 1VQ7V 3CCMV 1TUEB 1ZX3A 5HFMA 2HFEC 3BHPA 4JGSA 3E89A 2XNDG 2WA4A 5CN0A 3WG7B 2OTJV 2HVKC 3FFQA 1IBLO 4DR5O 3ZHVA 5B5EZ 2Q0AA 4LWSA 1O9GA 2EX3A 1ZL8A 1J5EB 4GX2A 1V55C 3ETGA 1B6QA 3SPHA 3K5NA 1KU9A 2VQEB 2YIBA 2ETNA 2OT5A 2NN4A 3RYHB 1VF7A 2Q7GA 5GONB 3RN4A 2X6BA 1SQBH 4BAYA 3SPJA 2Y0IA 3ML0A 3ASNB 3JAWB 5IDJA 4B3RO 1Y6XA 5LHIA 3JD3A 3SYCA 1OCZC 3IAYA 3CCVV 3SJAC 4LNUA 5FPRA 5GW7A 4LF6B 1XQ8A 3RYHA 5H9CA 1VQPV 1JJ2U 1KECA 1E1QG 3T4ZA 3CJHB 5JH7B 2IJIA 2WWWA 3JAWA 1NTKH 1VQMV 4LH6A 3ZHTA 4UVAA 3VOUA 1V54B 3CSXA 2JS3A 3DC6A 2ZKOA 1SKVA 1JFFB 1VQOV 2B5UA 4XDLA 1Q5OA 4BW9A 1K5QA 3ZHUA 3N2KB 4JI7O 3CPWU 1R1BA 2P06A 2EIJC 2IJJA 3PN1A 4JYBA 2DYSB 4MT8A 1IXBA 1VQKV 1BCCH 4JTDB 1QHTA 1B06A 3CJHA 5JH7A 1IX9A 2A3QA 4CS2A 3LUTB 4RQFA 2BOBC 1WPBA 1F7YA 2F43G 1Y4MA 3EHBB 2VWKA 1UJWB 5ITZB 1JFFA 1A32A 2JGDB 3N2KA 3G71V 1PM9A 3O65A 4HAMA 3ZMUA 1XHXA 2UUBB 1EZVH 4OX9B 2DWEC 4Z1MG 3B40A 1PP9H 4MW3A 4R50A 3VQYA 2YIAA 4MVRA 5ITZA 1Q81W 1K73W 2A9HA 2ADQB 3CCUV 2JGDA 3B8NA 5LHHA 1Q7YW 3T1YB 4ICGA 4UV9A 5E1AC 2A06H 4IYHA 1N36O 1N34O 4JZGA 5B66Z 2QM7A 2KG7B 5D5QA 2QWQB 4IIJB 2VWJA 3ZEDA 3ZRWB 3AG3C 1CXZB 1E79G 1KP3A 2IH3C 1NTMH 2AGAA 4PI2A 1IVSA 4DV3O 4TOIA 3U11A 1IXMA 3K0DA 2WA3A 4B3MB 2R70A 2ZM6O 3F5TA 4X9QA 1GN4A 3C90A 2KG7A 3OW2U 4IIJA 3UKMA 3ZRWA 4QNHB 3ZCCA 4NTXA 2E5LB 1XNQO 4MSWC 1M56C 1D2DA 2D3OW 2EILB 3TK1A 2DOSA 3U10A 4DR7B 4YHHO 4JTAB 3JCZA 3OUSA 4B7KA 3VBBA 4KHPO 5KUKA 3ABLC 3L73H 1QLNA 1NVPB 1IBLB 4LC1A 5LA6B 4DR5B 3FB5C 3W7TA 2PI5A 1VP7A 1N0JA 3AG1C 2E75B 2UUAO 2M6YA 1ENVA 5EBWC 4PA6A 1EFRG 1G6UA 5KHJA 4FZ0A 1HNWO 2CTQA 3FAVB 3K0GA 3F7YC 2KKWA 2R9RB 1PKXA 5LA6A 2DW4A 1NH2D 1FXKA 4BIOA 3JCUZ 4OXSA 1GM8A 4F6RB 1KKDA 5DM6V 1S77D 5LYJB 5CA3A 2RCVA 4TV9B 3E8FA 2Q7HA 3ZMVA 1YI2V 3ZHSA 2Q6AA 2BOCC 1H2GA 2ZDIC 5C93A 4ZIBA 2R72A 3CB2A 1WB8A 4J7JA 2QKCA 3A0BZ 4JYAO 1SQQH 1L1FA 4F6RA 5LYJA 4TV9A 1VF5B 3CRCA 5B1NA 4JI7B 1SETA 1SZXA 3ZX6A 4GX1A 3GVMA 1L8DA 1JMKC 4WBNB 3T4DA 1MZFA 2EIKC 3ZMZA 1K92A 2NNUA 2PTMA 1H8HG 3D36A 4QPJA 1LNQA 1R3LC 4DK0A 4LF8O 4GX0A 4NTWA 4TT3G 3CRRA 3M8AA 2Y69C 1OCRB 3K04A 2F4VO 2B9ZA 4DR2O 4KXRA 3MAQA 4WBNA 2JEUA 4X64O 2UXCO 1TGOA 4TSFG 3N2GB 4UCTA 4CC6A 5KUMA 4J11A 5BMVB 2WLLB 4L87A 4DRXB 4CH4A 1EM1A 2PZSA 2FKXA 1LUWA 1XDCA 3R66A 2ZINA 2XAJA 3IC7A 2NR5A 3SGIA 1YJWV 1N34B 1N36B 3L70H 4EFBA 4ABMA 2DYRB 4JI2O 3D3IA 1YDXA 4J9ZB 3N2GA 2EIMC 1SQVH 5BMVA 2UXDO 3CRQA 2WLLA 4DV3B 2ZXWC 1AR5A 1K5SA 2EINC 4DRXA 2PYLA 3OEEG 1Y74B 1FPOA 4B3TO 5IY5C 2AW9A 3CHXA 1SC5B 2YUAA 4NXNO 3CS5A 3OT7A 4RWUA 3L9DA 3AG2C 1NS1A 3SJCC 4ZBMA 2FTKA 3I55V 2YSUB 3F5WC 4DV2O 4YHHB 1UFIA 1Y74A 1URFA 1WB7A 3ETDA 3CX5F 3JATB 4KHPB 5CBGA 1QLEB 4QIWF 3P32A 3X2QB 5JJNB 3E8HA 2CTRA 5J2UB 1MNGA 5L3BA 4O4HB 2W6JG 5C8YB 3EXAA 2RDCA 1FFTB 4UVBA 1RP3B 1QR9A 4P9PA 2JJ2G 3PJSK 3ABMC 3CCLV 3ASOB 2UUAB 5CMUA 1XL6A 4GKJO 1JCHA 4LF4O 1F23A 2P22C 3BABA 5CB4B 3WFVA 1AR1B 3JATA 2OIEA 1YHQV 1HNWB 4DR6O 2EZOA 3OFNG 3ABTA 4DXWA 5J2UA 4O4HA 2E74B 5C8YA 3RYCA 1YEWA 3ABUA 3NXSA 3IGAC 3THOA 5GTHZ 1P7GA 4DV4O 1XMQO 3ZHQA 1TAEA 2Y0PA 4AI8A 3CD6V 1N8RW 5CB4A 1U96A 2P5OA 4G28B 1PPJH 1H38A 1HP8A 2XASA 2G38A 3QNEA 4UB6Z 4G2KA 3L75H 4NKGB 1MSDA 3K5LA 2QSAA 1N33O 1PL0A 5IJ9B 4O2BB 2Y48A 1ZAUA 4FIPC 2OCHA 3G4SV 1V9PA 1OCOB 4MVZA 1XHZA 3P3NA 1CEZA 1WJZA 2QTSA 4H37A 2P6JA 4IT5A 5A2QN 4JTCB 2GTAA 4HYOA 1K7DA 3LSQA 2IU3A 1TA8A 3JALB 3P30A 1R3KC 2FMLA 1ORQC 5B3SC 1TVKB 3VQXA 5IJ9A 4B3MO 4LF8B 4DR1O 4O2BA 1R6NA 4DUZB 1YZBA 2X0LA 2CUGA 1WP7A 1OCCB 2F4VB 4AILC 5CBFA 4ASUG 4O4JB 4DR2B 5KLVH 4TWKA 3RYFB 1WA8B 4X64B 1WAZA 5LGTA 2P4VA 4WFFA 2GUZB 1EN5A 2UXCB 2F66C 2XOKG 1SS3A 2PUSA 1I08A 3JALA 4FZ1A 2AHZA 3RVYA 4UXNA 1TVKA 2RQ6A 1IURA 2L35A 1NZ6A 4DW1A 2FL4A 3JAKB 2HEPA 1N32O 5IWAO 1KB9F 4O4JA 3K58A 4FLYA 4GT1A 3RYFA 1EN4A 1V55B 4J10A 1WA8A 4JI2B 3AG7A 1L0LH 1NR7A 1OV9A 2GUZA 2GTSA 2Y4TA 2VS0A 3GWKC 2V4DA 1Q86W 1IBMB 1E1RG 2AZ0A 2UXDB 1GO3F 3RYIB 1X59A 3RBZA 4KUMA 3CRMA 5CA1B 4B3TB 4UCUA 3JAKA 1RFYA 3KKYA 1WLEA 2HKOA 3BAAA 4YXWG 5A9GA 4NXNB 1KD1W 3QG5A 5DECA 3WG7C 4JAAA 4R8CA 1OCZB 3K5OA 4X20B 2YXLA 2W0XA 2Q69A 1RSOB 2LP7A 4WFHA 4LFAO 4LH7A 3RYIA 4LF9O 1DLBA 4P30A 4DV2B 4YY3O 5CA1A 1NQTA 1Z5VA 1BQZA 2HG5C 4I9WA 3K79A 4X66O 4UCSA 5GONA 4CS4A 2LGQA 4X20A 2GDSA 2LGWA 2QR4A 3ZMTA 1K33A 1YTFD 4DV1O 1RSOA 3WB0A 1S0VA 4MTFA 2EIJB 4UCVA 2A7WA 3BCCH 4GKJB 1G1XB 1FXHA 4HNAB 4O4LB 4LF4B 4QGPA 3ZHRA 5EBMC 3JYCA 4XDKA 3SYOA 2EZPA 4DR6B 1R6TA 1AILA 3CWBH 2P90A 1QVFU 4IHJB 1R3JC 3AK3A 4PDLA 2HP8A 4MW8A 2AXTZ 1VQNV 3OGIB 2LJ2A 1VARA 3B09A 1I5YA 4DV4B 1XMQB 5J9PC 1VF6A 4HNAA 4O4LA 4J80A 1GK9A 4QE7A 1NT2B 3WB1A 3K57A 2YXYA 1K3EA 2L6LA 4IHJA 4K8ZA 1K4CC 3AG4C 5BZBA 3A0HZ 4RAIA 4MTXA 2X6AA 3STLC 1N33B 1IZ3A 2Q68A 4X62O 3N27A 2QWPB 4E2LA 3CEIA 2ZE7A 2HJFC 3J81N 3G6EV 5LGUA 1XBLA 1ZSPA 3QO7A 3AG3B 2F23A 4A5UB 4JI4O 2WLKA 1KKCA 2EJ7A 1VMGA 4WFEA 4J41A 3ZRVA 2W0FC 2EULA 4FM1A 1T5EA 2MK3A 2HHHO 4LR3A 1Y76B 1BHAA 3Q4HB 2YIBD 4DR1B 4KL1A 3BFRA 5LGNA
chains in the Genus database with same CATH topology
1XNRO 4JV5O 1AB3A 5FLXN 2LW7A 2DJVA 4B3MO 4DR7O 4DR1O 4KHPO 4AQYO 4DV1O 1YZBA 1F7YA 4LF8O 3JAMN 2N74A 1XEQA 4K0KO 3M8AA 4LF7O 1G1XB 1A32A 2F4VO 1IBLO 4DR2O 4DR5O 4GKJO 5LMUO 4LF5O 4DUYO 3O65A 4DV0O 4X64O 1IBKO 4LF4O 4NXMO 2UUAO 5BXZA 2UXCO 1R6TA 1AILA 3OTOO 1J5EO 3RT3C 4DV6O 4JI8O 3SDLA 4DR6O 2UUBO 1FYJA 1HNWO 4OX9O 4OPHA 2UXBO 2VQEO 4DUZO 1HNZO 1N32O 5IWAO 2FKXA 3J7AU 2UUCO 5IT9N 3R66A 4GKKO 5LL6Y 4B3SO 3T1HO 1DK1A 4DV4O 1XMQO 4B3RO 4JI2O 1KUQA 1I94O 1HR0O 1N36O 1N34O 4DR3O 3T1YO 4X65O 1X59A 4DV7O 4JI5O 2UXDO 4JI6O 4JI3O 5LMNO 4X62O 2AGAA 4LF6O 4DV3O 3J81N 4LFBO 1N33O 2VQFO 4B3TO 5H5NA 1HNXO 5BY1A 5BR8O 4NXNO 2ZM6O 3F5TA 4A5UB 4JI4O 4OPAA 4JYAO 1FKAO 1XMOO 4LFAO 1NS1A 1IBMO 2Z0AA 4LF9O 4JI1O 2ZKOA 4YY3O 4LFCO 4JI0O 2HHHO 4JI7O 1XNQO 5A2QN 1R1BA 1D2DA 4DV2O 2JRIA 2E5LO 3J80N 4DR4O 4DV5O 4X66O 2UU9O 2DOSA 1FJGO 4YHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  4JV5 O;  1AB3 A;  5FLX N;  2LW7 A;  2DJV A;  4B3M O;  4DR7 O;  4DR1 O;  4KHP O;  4AQY O;  4DV1 O;  1YZB A;  1F7Y A;  4LF8 O;  3JAM N;  2N74 A;  1XEQ A;  4K0K O;  3M8A A;  4LF7 O;  1G1X B;  1A32 A;  2F4V O;  1IBL O;  4DR2 O;  4DR5 O;  4GKJ O;  5LMU O;  4LF5 O;  4DUY O;  3O65 A;  4DV0 O;  4X64 O;  1IBK O;  4LF4 O;  4NXM O;  2UUA O;  5BXZ A;  2UXC O;  1R6T A;  1AIL A;  3OTO O;  1J5E O;  3RT3 C;  4DV6 O;  4JI8 O;  3SDL A;  4DR6 O;  2UUB O;  1FYJ A;  1HNW O;  4OX9 O;  4OPH A;  2UXB O;  2VQE O;  4DUZ O;  1HNZ O;  1N32 O;  5IWA O;  2FKX A;  3J7A U;  2UUC O;  5IT9 N;  3R66 A;  4GKK O;  5LL6 Y;  4B3S O;  3T1H O;  1DK1 A;  4DV4 O;  1XMQ O;  4B3R O;  4JI2 O;  1KUQ A;  1I94 O;  1HR0 O;  1N36 O;  1N34 O;  4DR3 O;  3T1Y O;  4X65 O;  1X59 A;  4DV7 O;  4JI5 O;  2UXD O;  4JI6 O;  4JI3 O;  5LMN O;  4X62 O;  2AGA A;  4LF6 O;  4DV3 O;  3J81 N;  4LFB O;  1N33 O;  2VQF O;  4B3T O;  5H5N A;  1HNX O;  5BY1 A;  5BR8 O;  4NXN O;  2ZM6 O;  3F5T A;  4A5U B;  4JI4 O;  4OPA A;  4JYA O;  1FKA O;  1XMO O;  4LFA O;  1NS1 A;  1IBM O;  2Z0A A;  4LF9 O;  4JI1 O;  2ZKO A;  4YY3 O;  4LFC O;  4JI0 O;  2HHH O;  4JI7 O;  1XNQ O;  5A2Q N;  1R1B A;  1D2D A;  4DV2 O;  2JRI A;  2E5L O;  3J80 N;  4DR4 O;  4DV5 O;  4X66 O;  2UU9 O;  2DOS A;  1FJG O;  4YHH O; 
#chains in the Genus database with same CATH topology
 2CTW A;  3LDE A;  3SPG A;  1AB3 A;  4FLW A;  2WLH A;  3MD0 A;  5IYD O;  4I0X B;  5EIB C;  1QCE A;  3VQV A;  2RNB A;  3CC2 V;  1M56 B;  3SR2 C;  3A8T A;  2QE7 G;  4X8A A;  1KMI Z;  4LF7 O;  3M99 B;  1K4D C;  5TIS Z;  4F4L A;  1M93 A;  1S76 D;  2KQX A;  3ICX A;  2QEX V;  3RFR A;  1Y76 A;  3Q4H A;  5B1A B;  3U0Z A;  3OTO O;  1PD3 A;  2XAG A;  2X6C A;  4I0X A;  2ZT9 B;  1N32 B;  5IWA B;  4JYY A;  3LDD A;  3CE2 A;  4OGQ B;  3AEI A;  2GV9 A;  2UXN A;  3H1K H;  3AG1 B;  4CC5 A;  2XAQ A;  2ZIM A;  1KC8 W;  3D8C A;  1AJP A;  2ZE6 A;  4CH6 A;  3OEH G;  4FVM A;  2ZQM A;  4CBC A;  1AJN A;  2GSM B;  1KQS U;  2PGG A;  5CBH A;  1PV0 A;  1Q82 W;  1S5L Z;  3W7W A;  3OD4 A;  4DR4 B;  3ZRX A;  4RUF A;  4RQE A;  3DTU B;  1M90 W;  3K5M A;  3L72 H;  2BTO A;  3TJT A;  2N04 A;  1MA1 A;  5J2T B;  3RVZ A;  5BY1 A;  1FXK C;  3UT5 B;  1S3J A;  4LFA B;  5LXT B;  4LF9 B;  1AI5 A;  4W4K A;  2DN9 A;  3IC9 A;  4YY3 B;  3B4S A;  4YIP A;  3FAV A;  4NVP A;  4X66 B;  2CK3 G;  2JRI A;  1FFX B;  3CCQ V;  4DV5 O;  4K3A A;  2OCC B;  5J2T A;  2QKS A;  3WB2 A;  4U3F H;  3UT5 A;  4DV1 B;  3ABK C;  4FLT A;  4GYC B;  3HKE B;  1KBH A;  1OZ0 A;  1AI7 A;  3OMN B;  5LXT A;  2WAM A;  1MZE A;  4TQD A;  4U7O A;  5EC1 C;  3T2M A;  1JR9 A;  1NBM G;  4JAV A;  1UPG A;  5D5P A;  2EIK B;  2R9A A;  2OYQ A;  1FD9 A;  3A2F A;  3SJQ C;  1SES A;  4U3J B;  1FFX A;  3OUF A;  1YIT V;  4Q20 A;  3RW0 A;  1JA8 A;  3KG2 A;  4QJF B;  1H2M A;  5KAF Z;  3HKE A;  3SYQ A;  2ZIO A;  1ZLZ A;  4FLZ A;  4DUZ O;  2V7Q G;  1SQP H;  5EIB D;  3E8G A;  3J7A U;  3JD2 A;  2XUM A;  3CMA V;  3BA9 A;  3T1H O;  5IYB O;  4U3J A;  4FFB B;  1I94 O;  3STZ C;  1XIL A;  4X62 B;  2OIG A;  3E86 A;  4QE9 A;  1F4M A;  5LMN O;  2WLM A;  2XTA A;  1BZK A;  4LFB O;  2IJK A;  1Q90 D;  2XAF A;  4JV5 B;  4B08 A;  1JPX A;  1OCR C;  3CME V;  4JI4 B;  2EIM B;  4FFB A;  1P84 F;  4DW0 A;  2ZXW B;  1YJ9 V;  2EIN B;  1IBM O;  5JCO C;  2HHH B;  4H0L B;  3H1L H;  3OE7 G;  3UO2 A;  5IY5 B;  4ZI7 B;  3CXH F;  2XHB A;  2JJ1 G;  1JVM A;  3GB7 C;  2GBO A;  3OMI B;  3KZI Z;  5KA5 A;  1AI6 A;  1M5I A;  3E35 A;  2UU9 O;  4RO2 A;  3APQ A;  4EEQ A;  1NVP D;  2YDE A;  3K03 A;  3BPZ A;  3SJB C;  2YXH A;  2E76 B;  4LF7 B;  4N21 A;  3QVN A;  4ZOL B;  5L3E A;  1YSC A;  3KCX A;  3K9S A;  4CS3 A;  3BVO A;  4ZI7 A;  3E83 A;  4J42 A;  3OM3 B;  4PJ0 Z;  1H8E G;  5B1B B;  2Q67 A;  2W6I G;  3OTO B;  4XBF A;  4DK1 A;  1W2B U;  2IBZ H;  4FFK A;  5LP6 C;  4BIU A;  2B1G A;  4I5S A;  3TGU H;  2OTL V;  1THZ A;  1CPY A;  4ZOL A;  1P4R A;  1HNZ O;  3RGB A;  5KX5 B;  1RPO A;  1US6 A;  3C3T A;  4I55 B;  3KCY A;  4PA9 A;  1DK1 A;  2QDO A;  1BMF G;  2WLN A;  4D7S A;  3ZJZ A;  1HR0 O;  1GRJ A;  4DR3 O;  3JSL A;  4PV1 B;  2HLD G;  4YIO A;  4FM0 A;  3T1C A;  3QF7 A;  1F51 A;  5L3F A;  4CH5 A;  3X2Q C;  4MVU A;  1XRE A;  2VRZ A;  3B2E E;  1K9M W;  1P49 A;  2XT9 A;  5KX5 A;  2F1M A;  4I55 A;  5LOV B;  4UCO A;  2A79 B;  4FPP A;  4U7N A;  1RPR A;  1DTO A;  1SQX H;  5HFL A;  3FB6 C;  1RM1 B;  2QM4 A;  4OPA A;  1M57 C;  1GN6 A;  1SF9 A;  1JJO A;  3APO A;  1H2N A;  2H8P C;  2KB1 A;  3CCJ V;  4LFC O;  3DXR B;  4EKW A;  2KSD A;  2LO1 A;  2P67 A;  4DV5 B;  3FB7 C;  3TET A;  2IM9 A;  3J80 N;  4MS2 A;  1VQL V;  2P4K A;  2ITC C;  1WNS A;  5LOV A;  1W0K G;  3FYE B;  4PA4 A;  1XI1 A;  5EZY B;  2JS5 A;  1R6K A;  3K59 A;  2QA4 V;  4WFB V;  1DGS A;  3DXR A;  1KYO F;  5KA6 A;  1PNL A;  1M9N A;  5JWP A;  5LBQ A;  5B3S B;  5H6Q A;  1BL8 A;  1MAB G;  4MVQ A;  4DV0 O;  2PYJ A;  2IJH A;  2F95 B;  1YIJ V;  2PY5 A;  2ZE5 A;  4JI8 O;  4JZ2 A;  4UUJ C;  1FYJ A;  4LP8 A;  4OPH A;  3B77 A;  4FM2 A;  1HDJ A;  1Q3E A;  1MG1 A;  1OCO C;  3CYO A;  5FPO A;  3G80 A;  2HJD A;  1H2L A;  5EZY A;  3T1H B;  4UV8 A;  4CH3 A;  2IH1 C;  1R73 A;  4KP4 A;  1I94 B;  4YJ2 B;  3GWO A;  2CH7 B;  5IJ0 B;  5LHG A;  4UVC A;  2CAZ C;  4GZR B;  1AR4 A;  1ZWI C;  2N05 A;  4I50 B;  3UM7 A;  2MW2 B;  5LMN B;  3E2E A;  5KMG B;  4JI6 O;  4LFB B;  5KHK A;  2A0L A;  3L71 H;  1OCC C;  2O57 A;  4Z2W A;  4K35 A;  4ZKI A;  1FJG B;  4GUN A;  3ZBH A;  4LWS B;  2ITD C;  1Z5W A;  5H5N A;  1PL4 A;  3K06 A;  1YJN V;  4YJ2 A;  2CH7 A;  5IJ0 A;  1S5H C;  3H1J H;  4I50 A;  4JI1 O;  1ZUQ A;  4BWA A;  5KMG A;  2Q8V A;  5IYC O;  2E3C A;  4P9O A;  2FYU H;  2UU9 B;  2YI9 A;  4DR4 O;  3BRC A;  1AVM A;  1LR1 A;  2CE4 A;  1I7F A;  5K1P A;  4LNU B;  4FLU A;  2UXX A;  1S72 V;  2DQ0 A;  3H1H H;  4X1Y B;  4PDR A;  1XEQ A;  5FNV B;  1WP8 A;  2ZR3 A;  2AZ2 A;  2LFR A;  1MSW D;  5LMU O;  1VQ5 V;  4LF5 O;  4NB5 A;  4PA7 A;  3S3X A;  1QQC A;  1BGY H;  3ETQ A;  5KHH A;  3L74 H;  1QNM A;  3RT3 C;  1O9H A;  1SQG A;  3ASN C;  5EYP B;  1HNZ B;  1FS0 G;  2JK5 C;  3NR7 A;  2VQF B;  1EN6 A;  4X1Y A;  1SZT A;  1L0N H;  4CZZ A;  5FNV A;  4C7U A;  1SA0 B;  3FD9 A;  4GKK O;  4O2A B;  4BW5 A;  4QPK A;  1VQ8 V;  1W0J G;  1HR0 B;  5AG2 A;  4DR3 B;  3MDS A;  4MTG A;  3TXQ A;  1YCI A;  5L3G A;  1SRY A;  1NH2 B;  1Y67 A;  1GM7 A;  1NU1 H;  1QU7 A;  2H3O A;  5EYP A;  4DV7 O;  4JI5 O;  4G27 B;  3HB3 B;  1V54 C;  3FKS G;  1SA0 A;  1NI8 A;  1LUV A;  3OMA B;  1PNK A;  2YS8 A;  1HNX O;  3HPL C;  4O2A A;  1VF6 C;  1P7B A;  2BTQ B;  1B04 A;  2NLJ C;  3W7U A;  1BQ0 A;  2DYS C;  3AG4 B;  2EJR A;  2YID A;  3VQW A;  4LFC B;  1SER A;  4WFG A;  5F2V O;  3JD4 A;  3ZS8 C;  4X1I B;  2JVD A;  3CCS V;  2QWO B;  3R65 A;  4PDV A;  3ZN1 A;  1D5N A;  4GLX A;  4FLV A;  4JV5 O;  3K08 A;  2BTQ A;  1M4U A;  2DE0 X;  2QWR B;  1HW7 A;  2IU0 A;  1F4N A;  4X89 A;  5JVD B;  4WFA V;  2N74 A;  2LFS A;  3CC7 V;  4WCE V;  2XAH A;  5DED A;  4PA3 A;  1EBO A;  1DF4 A;  3HKB B;  4DV0 B;  4X1I A;  3B8M A;  4IYI A;  4DUY O;  4MTO A;  4JF3 A;  4JI8 B;  4NXM O;  2ATK C;  1GN2 A;  1Q8I A;  2CDY A;  4DV6 O;  1GMG A;  1NKD A;  1H2S B;  4O4I B;  4DO2 A;  1ZTE A;  1NTZ H;  3JD0 A;  5JVD A;  5GTI Z;  3TCU A;  1XL4 A;  4FMT A;  3HKC B;  4LCU C;  4H44 B;  3QO5 A;  1G4Y B;  1Q6U A;  4ZHQ B;  4LBE C;  5IT9 N;  1FAF A;  3EFF K;  5LL6 Y;  4JAS A;  1COW G;  4B3S O;  3HKB A;  4PI0 A;  1Q43 A;  1K34 A;  3IFX A;  3ABL B;  1NR1 A;  4P2Z A;  3LSS A;  1AJQ A;  1MOF A;  4JI6 B;  2WSS G;  3I5D A;  4O4I A;  5H6R A;  5B1O A;  2LQT A;  3CC4 V;  1JOY A;  2CGN A;  2Q9L A;  4UCR A;  3LSU A;  4JI3 O;  3HKC A;  2ZNI A;  4ZHQ A;  3ETE A;  4Q6G A;  3SYP A;  1OJH A;  3OR6 C;  5BR8 O;  3QTC A;  2EIL C;  3BA8 A;  1R3I C;  5KHI A;  3K3W A;  2ARH A;  5B1A C;  4JI1 B;  3W7S A;  4PDM A;  4DYL A;  5L3C A;  1BE3 H;  1YF2 A;  3SYA A;  2DMX A;  1Y66 A;  2ADP A;  3G6B A;  4NR1 A;  3H9V A;  1FXK B;  3MHH C;  1VEW A;  4UFZ A;  4R6Z A;  4X1K B;  2C2A A;  4JPR A;  4K8X A;  3ZRS A;  1DF5 A;  2WLJ A;  2IW5 A;  5FLX N;  3W7X A;  2LW7 A;  1AI4 A;  2ZCE A;  1W59 A;  1QBZ A;  2YC0 A;  3JAM N;  4I7Z B;  2ZNJ A;  2JGU A;  4HBN A;  2QTO A;  4K0K O;  5LMU B;  4LF5 B;  3HR0 A;  4JYC A;  5IE9 A;  3F7V C;  1H2K A;  4B3R B;  3ABK B;  2PF4 E;  2HR3 A;  1IBK O;  4X1K A;  2GHY A;  2M7W A;  2ODM A;  3LNM B;  4EB6 B;  1I0H A;  5DN6 G;  1M1K W;  1CP9 A;  1QR8 A;  2UXB O;  5JQG B;  3JSN A;  4D6T H;  3DSQ A;  4GKK B;  1SQF A;  2ZDI A;  4WF9 V;  2UUC O;  3CRA A;  4J9Y B;  3BY6 A;  4YJ3 B;  4J7Z A;  2R9I A;  1EZJ A;  1JQ0 A;  2D2C B;  3CCR V;  3LNN A;  4EB6 A;  2B1I A;  2OCC C;  4X65 O;  4JI5 B;  4DV7 B;  1HWY A;  3D36 C;  2Y69 B;  2Q5Z A;  5JQG A;  3UCS C;  4R7C A;  1HNX B;  4PD4 F;  1XOU A;  4E4E A;  1X4T A;  3JAR B;  4YJ3 A;  2YEV B;  4IGG A;  4EFE A;  2LW1 A;  2Q7E A;  1AP5 A;  2ZD9 A;  3ZMS A;  1FKA O;  2ILM A;  1XMO O;  5KAI Z;  1AP6 A;  3JD1 A;  5L3D A;  3OAA G;  3UQ8 A;  4JI0 O;  3OR7 C;  1PNM A;  3AK2 A;  1BT8 A;  3JAR A;  2YEV A;  1FJG O;  1XNR O;  2BCC H;  2DJV A;  4TUY B;  4AHC A;  5IYZ B;  1J95 A;  4AQY O;  4J7K A;  1MMM A;  4TQF A;  3JAS B;  1BS3 A;  4F6E A;  2ZE8 A;  3OGC C;  4DUY B;  2H94 A;  4N23 A;  4NXM B;  1VIB A;  4BR6 A;  2EBO A;  1GN3 A;  3ZN0 A;  4DV6 B;  3IJ4 A;  3I56 V;  2QWN B;  2K1E A;  3AG2 B;  1J5E O;  4JAU A;  3SDL A;  4TUY A;  2DWD C;  5JCO A;  1N0N A;  2DYR C;  4I4T B;  5IYZ A;  2Z3Y A;  1IDS A;  3LDC A;  4Z1V A;  3JAS A;  2VQE O;  1GAX A;  1GKF A;  3E8B A;  4UB8 Z;  4B3S B;  1TUB B;  1ROP A;  3FYI B;  1GH6 A;  2ZM6 B;  4H33 A;  3WU2 Z;  4NYK A;  1S5J A;  5LP6 B;  5KHG A;  1GM9 A;  4D7T A;  5CA0 B;  4FLX A;  5K1X A;  1FXV A;  4NTY A;  4I9Q A;  2JIZ G;  4PEL A;  4JI3 B;  3TXS A;  1N4C A;  4I4T A;  1XNQ B;  1YVW A;  4XDJ A;  3ABM B;  1I5X A;  5E79 Z;  2QGN A;  4LF6 O;  1TUB A;  2VQF O;  5BR8 B;  2JDI G;  3O9O A;  3SPC A;  4L8J A;  1YXB A;  4X88 A;  5LP6 A;  3CCE V;  4FK5 C;  5B1B C;  1ARO P;  1BSM A;  4FJC C;  4W4L A;  2Q0O C;  5CA0 A;  1QLE C;  1U97 A;  1WPX A;  2BSK B;  2Z0A A;  1Z2G A;  3RYC B;  2V1D A;  2OWO A;  1G8M A;  2Z5U A;  2JEX A;  1B3Q A;  2RJZ A;  3D3Q A;  2PI4 A;  1KP2 A;  1M57 B;  2WLI B;  2Q73 A;  3ASO C;  3CP1 A;  2DQ3 A;  1D5A A;  3K9A A;  3CXC U;  2WPD G;  1BHB A;  4GCZ A;  1K97 A;  4K0K B;  1VQ4 V;  1XUQ A;  2CTP A;  4GX5 A;  2F93 B;  4MVS A;  2BSK A;  5FL7 G;  4BIZ A;  1YTF B;  3P3P A;  1IBK B;  3RWR D;  3H01 A;  1VQ6 V;  5BXZ A;  5JJE B;  3S3W A;  2WLI A;  2CGO A;  2UUB O;  2UXB B;  3OTF A;  4OX9 O;  1RM1 C;  4PHZ A;  5EC2 C;  2UUC B;  2RN9 A;  4RUE A;  3AK1 A;  4TV8 B;  4MVO A;  3M7M X;  3DGE A;  4JYA B;  2QM8 A;  2X7R B;  3HKD B;  4X65 B;  1JX9 A;  1KUQ A;  3E22 B;  1NJI W;  3T1Y O;  2ZR2 A;  2AHY A;  3MHS C;  5EK0 A;  2QKA A;  3C3S A;  3SPI A;  1Q6H A;  3A0R A;  2P7T C;  4TV8 A;  5EBL C;  1K8A W;  4MVM A;  3H1I H;  3UO3 A;  2FB5 A;  1XMO B;  3HKD A;  2BE3 A;  1WN7 A;  2Y4U A;  3E22 A;  1Q6I A;  5H2F Z;  3BEH A;  4JI0 B;  4KFM A;  2HVJ C;  2Q4P A;  1VQ9 V;  3DC5 A;  5JJJ B;  3ZIA G;  3FX7 A;  2YIC A;  3EVK A;  2YI8 A;  3FB8 C;  4H13 B;  4B7E A;  2E5L O;  2QJ1 A;  1XNR B;  3QO8 A;  1ZL8 B;  4HZ3 A;  4IL6 Z;  2RMK B;  4AQY B;  1GTO A;  3G67 A;  2K9P A;  4DR7 O;  1OHH G;  1QVG U;  1VQ7 V;  3CCM V;  1TUE B;  1ZX3 A;  5HFM A;  2HFE C;  3BHP A;  4JGS A;  3E89 A;  2XND G;  2WA4 A;  5CN0 A;  3WG7 B;  2OTJ V;  2HVK C;  3FFQ A;  1IBL O;  4DR5 O;  3ZHV A;  5B5E Z;  2Q0A A;  4LWS A;  1O9G A;  2EX3 A;  1ZL8 A;  1J5E B;  4GX2 A;  1V55 C;  3ETG A;  1B6Q A;  3SPH A;  3K5N A;  1KU9 A;  2VQE B;  2YIB A;  2ETN A;  2OT5 A;  2NN4 A;  3RYH B;  1VF7 A;  2Q7G A;  5GON B;  3RN4 A;  2X6B A;  1SQB H;  4BAY A;  3SPJ A;  2Y0I A;  3ML0 A;  3ASN B;  3JAW B;  5IDJ A;  4B3R O;  1Y6X A;  5LHI A;  3JD3 A;  3SYC A;  1OCZ C;  3IAY A;  3CCV V;  3SJA C;  4LNU A;  5FPR A;  5GW7 A;  4LF6 B;  1XQ8 A;  3RYH A;  5H9C A;  1VQP V;  1JJ2 U;  1KEC A;  1E1Q G;  3T4Z A;  3CJH B;  5JH7 B;  2IJI A;  2WWW A;  3JAW A;  1NTK H;  1VQM V;  4LH6 A;  3ZHT A;  4UVA A;  3VOU A;  1V54 B;  3CSX A;  2JS3 A;  3DC6 A;  2ZKO A;  1SKV A;  1JFF B;  1VQO V;  2B5U A;  4XDL A;  1Q5O A;  4BW9 A;  1K5Q A;  3ZHU A;  3N2K B;  4JI7 O;  3CPW U;  1R1B A;  2P06 A;  2EIJ C;  2IJJ A;  3PN1 A;  4JYB A;  2DYS B;  4MT8 A;  1IXB A;  1VQK V;  1BCC H;  4JTD B;  1QHT A;  1B06 A;  3CJH A;  5JH7 A;  1IX9 A;  2A3Q A;  4CS2 A;  3LUT B;  4RQF A;  2BOB C;  1WPB A;  1F7Y A;  2F43 G;  1Y4M A;  3EHB B;  2VWK A;  1UJW B;  5ITZ B;  1JFF A;  1A32 A;  2JGD B;  3N2K A;  3G71 V;  1PM9 A;  3O65 A;  4HAM A;  3ZMU A;  1XHX A;  2UUB B;  1EZV H;  4OX9 B;  2DWE C;  4Z1M G;  3B40 A;  1PP9 H;  4MW3 A;  4R50 A;  3VQY A;  2YIA A;  4MVR A;  5ITZ A;  1Q81 W;  1K73 W;  2A9H A;  2ADQ B;  3CCU V;  2JGD A;  3B8N A;  5LHH A;  1Q7Y W;  3T1Y B;  4ICG A;  4UV9 A;  5E1A C;  2A06 H;  4IYH A;  1N36 O;  1N34 O;  4JZG A;  5B66 Z;  2QM7 A;  2KG7 B;  5D5Q A;  2QWQ B;  4IIJ B;  2VWJ A;  3ZED A;  3ZRW B;  3AG3 C;  1CXZ B;  1E79 G;  1KP3 A;  2IH3 C;  1NTM H;  2AGA A;  4PI2 A;  1IVS A;  4DV3 O;  4TOI A;  3U11 A;  1IXM A;  3K0D A;  2WA3 A;  4B3M B;  2R70 A;  2ZM6 O;  3F5T A;  4X9Q A;  1GN4 A;  3C90 A;  2KG7 A;  3OW2 U;  4IIJ A;  3UKM A;  3ZRW A;  4QNH B;  3ZCC A;  4NTX A;  2E5L B;  1XNQ O;  4MSW C;  1M56 C;  1D2D A;  2D3O W;  2EIL B;  3TK1 A;  2DOS A;  3U10 A;  4DR7 B;  4YHH O;  4JTA B;  3JCZ A;  3OUS A;  4B7K A;  3VBB A;  4KHP O;  5KUK A;  3ABL C;  3L73 H;  1QLN A;  1NVP B;  1IBL B;  4LC1 A;  5LA6 B;  4DR5 B;  3FB5 C;  3W7T A;  2PI5 A;  1VP7 A;  1N0J A;  3AG1 C;  2E75 B;  2UUA O;  2M6Y A;  1ENV A;  5EBW C;  4PA6 A;  1EFR G;  1G6U A;  5KHJ A;  4FZ0 A;  1HNW O;  2CTQ A;  3FAV B;  3K0G A;  3F7Y C;  2KKW A;  2R9R B;  1PKX A;  5LA6 A;  2DW4 A;  1NH2 D;  1FXK A;  4BIO A;  3JCU Z;  4OXS A;  1GM8 A;  4F6R B;  1KKD A;  5DM6 V;  1S77 D;  5LYJ B;  5CA3 A;  2RCV A;  4TV9 B;  3E8F A;  2Q7H A;  3ZMV A;  1YI2 V;  3ZHS A;  2Q6A A;  2BOC C;  1H2G A;  2ZDI C;  5C93 A;  4ZIB A;  2R72 A;  3CB2 A;  1WB8 A;  4J7J A;  2QKC A;  3A0B Z;  4JYA O;  1SQQ H;  1L1F A;  4F6R A;  5LYJ A;  4TV9 A;  1VF5 B;  3CRC A;  5B1N A;  4JI7 B;  1SET A;  1SZX A;  3ZX6 A;  4GX1 A;  3GVM A;  1L8D A;  1JMK C;  4WBN B;  3T4D A;  1MZF A;  2EIK C;  3ZMZ A;  1K92 A;  2NNU A;  2PTM A;  1H8H G;  3D36 A;  4QPJ A;  1LNQ A;  1R3L C;  4DK0 A;  4LF8 O;  4GX0 A;  4NTW A;  4TT3 G;  3CRR A;  3M8A A;  2Y69 C;  1OCR B;  3K04 A;  2F4V O;  2B9Z A;  4DR2 O;  4KXR A;  3MAQ A;  4WBN A;  2JEU A;  4X64 O;  2UXC O;  1TGO A;  4TSF G;  3N2G B;  4UCT A;  4CC6 A;  5KUM A;  4J11 A;  5BMV B;  2WLL B;  4L87 A;  4DRX B;  4CH4 A;  1EM1 A;  2PZS A;  2FKX A;  1LUW A;  1XDC A;  3R66 A;  2ZIN A;  2XAJ A;  3IC7 A;  2NR5 A;  3SGI A;  1YJW V;  1N34 B;  1N36 B;  3L70 H;  4EFB A;  4ABM A;  2DYR B;  4JI2 O;  3D3I A;  1YDX A;  4J9Z B;  3N2G A;  2EIM C;  1SQV H;  5BMV A;  2UXD O;  3CRQ A;  2WLL A;  4DV3 B;  2ZXW C;  1AR5 A;  1K5S A;  2EIN C;  4DRX A;  2PYL A;  3OEE G;  1Y74 B;  1FPO A;  4B3T O;  5IY5 C;  2AW9 A;  3CHX A;  1SC5 B;  2YUA A;  4NXN O;  3CS5 A;  3OT7 A;  4RWU A;  3L9D A;  3AG2 C;  1NS1 A;  3SJC C;  4ZBM A;  2FTK A;  3I55 V;  2YSU B;  3F5W C;  4DV2 O;  4YHH B;  1UFI A;  1Y74 A;  1URF A;  1WB7 A;  3ETD A;  3CX5 F;  3JAT B;  4KHP B;  5CBG A;  1QLE B;  4QIW F;  3P32 A;  3X2Q B;  5JJN B;  3E8H A;  2CTR A;  5J2U B;  1MNG A;  5L3B A;  4O4H B;  2W6J G;  5C8Y B;  3EXA A;  2RDC A;  1FFT B;  4UVB A;  1RP3 B;  1QR9 A;  4P9P A;  2JJ2 G;  3PJS K;  3ABM C;  3CCL V;  3ASO B;  2UUA B;  5CMU A;  1XL6 A;  4GKJ O;  1JCH A;  4LF4 O;  1F23 A;  2P22 C;  3BAB A;  5CB4 B;  3WFV A;  1AR1 B;  3JAT A;  2OIE A;  1YHQ V;  1HNW B;  4DR6 O;  2EZO A;  3OFN G;  3ABT A;  4DXW A;  5J2U A;  4O4H A;  2E74 B;  5C8Y A;  3RYC A;  1YEW A;  3ABU A;  3NXS A;  3IGA C;  3THO A;  5GTH Z;  1P7G A;  4DV4 O;  1XMQ O;  3ZHQ A;  1TAE A;  2Y0P A;  4AI8 A;  3CD6 V;  1N8R W;  5CB4 A;  1U96 A;  2P5O A;  4G28 B;  1PPJ H;  1H38 A;  1HP8 A;  2XAS A;  2G38 A;  3QNE A;  4UB6 Z;  4G2K A;  3L75 H;  4NKG B;  1MSD A;  3K5L A;  2QSA A;  1N33 O;  1PL0 A;  5IJ9 B;  4O2B B;  2Y48 A;  1ZAU A;  4FIP C;  2OCH A;  3G4S V;  1V9P A;  1OCO B;  4MVZ A;  1XHZ A;  3P3N A;  1CEZ A;  1WJZ A;  2QTS A;  4H37 A;  2P6J A;  4IT5 A;  5A2Q N;  4JTC B;  2GTA A;  4HYO A;  1K7D A;  3LSQ A;  2IU3 A;  1TA8 A;  3JAL B;  3P30 A;  1R3K C;  2FML A;  1ORQ C;  5B3S C;  1TVK B;  3VQX A;  5IJ9 A;  4B3M O;  4LF8 B;  4DR1 O;  4O2B A;  1R6N A;  4DUZ B;  1YZB A;  2X0L A;  2CUG A;  1WP7 A;  1OCC B;  2F4V B;  4AIL C;  5CBF A;  4ASU G;  4O4J B;  4DR2 B;  5KLV H;  4TWK A;  3RYF B;  1WA8 B;  4X64 B;  1WAZ A;  5LGT A;  2P4V A;  4WFF A;  2GUZ B;  1EN5 A;  2UXC B;  2F66 C;  2XOK G;  1SS3 A;  2PUS A;  1I08 A;  3JAL A;  4FZ1 A;  2AHZ A;  3RVY A;  4UXN A;  1TVK A;  2RQ6 A;  1IUR A;  2L35 A;  1NZ6 A;  4DW1 A;  2FL4 A;  3JAK B;  2HEP A;  1N32 O;  5IWA O;  1KB9 F;  4O4J A;  3K58 A;  4FLY A;  4GT1 A;  3RYF A;  1EN4 A;  1V55 B;  4J10 A;  1WA8 A;  4JI2 B;  3AG7 A;  1L0L H;  1NR7 A;  1OV9 A;  2GUZ A;  2GTS A;  2Y4T A;  2VS0 A;  3GWK C;  2V4D A;  1Q86 W;  1IBM B;  1E1R G;  2AZ0 A;  2UXD B;  1GO3 F;  3RYI B;  1X59 A;  3RBZ A;  4KUM A;  3CRM A;  5CA1 B;  4B3T B;  4UCU A;  3JAK A;  1RFY A;  3KKY A;  1WLE A;  2HKO A;  3BAA A;  4YXW G;  5A9G A;  4NXN B;  1KD1 W;  3QG5 A;  5DEC A;  3WG7 C;  4JAA A;  4R8C A;  1OCZ B;  3K5O A;  4X20 B;  2YXL A;  2W0X A;  2Q69 A;  1RSO B;  2LP7 A;  4WFH A;  4LFA O;  4LH7 A;  3RYI A;  4LF9 O;  1DLB A;  4P30 A;  4DV2 B;  4YY3 O;  5CA1 A;  1NQT A;  1Z5V A;  1BQZ A;  2HG5 C;  4I9W A;  3K79 A;  4X66 O;  4UCS A;  5GON A;  4CS4 A;  2LGQ A;  4X20 A;  2GDS A;  2LGW A;  2QR4 A;  3ZMT A;  1K33 A;  1YTF D;  4DV1 O;  1RSO A;  3WB0 A;  1S0V A;  4MTF A;  2EIJ B;  4UCV A;  2A7W A;  3BCC H;  4GKJ B;  1G1X B;  1FXH A;  4HNA B;  4O4L B;  4LF4 B;  4QGP A;  3ZHR A;  5EBM C;  3JYC A;  4XDK A;  3SYO A;  2EZP A;  4DR6 B;  1R6T A;  1AIL A;  3CWB H;  2P90 A;  1QVF U;  4IHJ B;  1R3J C;  3AK3 A;  4PDL A;  2HP8 A;  4MW8 A;  2AXT Z;  1VQN V;  3OGI B;  2LJ2 A;  1VAR A;  3B09 A;  1I5Y A;  4DV4 B;  1XMQ B;  5J9P C;  1VF6 A;  4HNA A;  4O4L A;  4J80 A;  1GK9 A;  4QE7 A;  1NT2 B;  3WB1 A;  3K57 A;  2YXY A;  1K3E A;  2L6L A;  4IHJ A;  4K8Z A;  1K4C C;  3AG4 C;  5BZB A;  3A0H Z;  4RAI A;  4MTX A;  2X6A A;  3STL C;  1N33 B;  1IZ3 A;  2Q68 A;  4X62 O;  3N27 A;  2QWP B;  4E2L A;  3CEI A;  2ZE7 A;  2HJF C;  3J81 N;  3G6E V;  5LGU A;  1XBL A;  1ZSP A;  3QO7 A;  3AG3 B;  2F23 A;  4A5U B;  4JI4 O;  2WLK A;  1KKC A;  2EJ7 A;  1VMG A;  4WFE A;  4J41 A;  3ZRV A;  2W0F C;  2EUL A;  4FM1 A;  1T5E A;  2MK3 A;  2HHH O;  4LR3 A;  1Y76 B;  1BHA A;  3Q4H B;  2YIB D;  4DR1 B;  4KL1 A;  3BFR A;  5LGN A; 
#chains in the Genus database with same CATH homology
 1XNR O;  4JV5 O;  1AB3 A;  5FLX N;  2LW7 A;  2DJV A;  4B3M O;  4DR7 O;  4DR1 O;  4KHP O;  4AQY O;  4DV1 O;  1YZB A;  1F7Y A;  4LF8 O;  3JAM N;  2N74 A;  1XEQ A;  4K0K O;  3M8A A;  4LF7 O;  1G1X B;  1A32 A;  2F4V O;  1IBL O;  4DR2 O;  4DR5 O;  4GKJ O;  5LMU O;  4LF5 O;  4DUY O;  3O65 A;  4DV0 O;  4X64 O;  1IBK O;  4LF4 O;  4NXM O;  2UUA O;  5BXZ A;  2UXC O;  1R6T A;  1AIL A;  3OTO O;  1J5E O;  3RT3 C;  4DV6 O;  4JI8 O;  3SDL A;  4DR6 O;  2UUB O;  1FYJ A;  1HNW O;  4OX9 O;  4OPH A;  2UXB O;  2VQE O;  4DUZ O;  1HNZ O;  1N32 O;  5IWA O;  2FKX A;  3J7A U;  2UUC O;  5IT9 N;  3R66 A;  4GKK O;  5LL6 Y;  4B3S O;  3T1H O;  1DK1 A;  4DV4 O;  1XMQ O;  4B3R O;  4JI2 O;  1KUQ A;  1I94 O;  1HR0 O;  1N36 O;  1N34 O;  4DR3 O;  3T1Y O;  4X65 O;  1X59 A;  4DV7 O;  4JI5 O;  2UXD O;  4JI6 O;  4JI3 O;  5LMN O;  4X62 O;  2AGA A;  4LF6 O;  4DV3 O;  3J81 N;  4LFB O;  1N33 O;  2VQF O;  4B3T O;  5H5N A;  1HNX O;  5BY1 A;  5BR8 O;  4NXN O;  2ZM6 O;  3F5T A;  4A5U B;  4JI4 O;  4OPA A;  4JYA O;  1FKA O;  1XMO O;  4LFA O;  1NS1 A;  1IBM O;  2Z0A A;  4LF9 O;  4JI1 O;  2ZKO A;  4YY3 O;  4LFC O;  4JI0 O;  2HHH O;  4JI7 O;  1XNQ O;  5A2Q N;  1R1B A;  1D2D A;  4DV2 O;  2JRI A;  2E5L O;  3J80 N;  4DR4 O;  4DV5 O;  4X66 O;  2UU9 O;  2DOS A;  1FJG O;  4YHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...