4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
5BR8O 1IBLO 4DR4O 5LL6Y 2AGAA 4OPAA 1HNWO 5FLXN 4JI2O 4DR2O 1AILA 1XNQO 2UUCO 4DV5O 2JRIA 2Z0AA 4DV0O 1D2DA 4JV5O 4JI0O 2F4VO 4B3RO 4DV4O 3OTOO 4JI8O 1N32O 5LMUO 4LF6O 1AB3A 4JI6O 1XEQA 4JI4O 2UU9O 4OPHA 2FKXA 1N36O 4JI1O 1YZBA 2UXBO 4GKJO 4LFCO 4LF8O 4KHPO 2ZM6O 2E5LO 3T1HO 2DJVA 4YY3O 4NXMO 2UXDO 1DK1A 4B3SO 3J81N 3SDLA 4DUZO 4DV3O 4B3TO 4DV7O 4DR3O 1HNZO 4X65O 3R66A 3J80N 2VQEO 1XNRO 5IT9N 1IBKO 4DV6O 2HHHO 4NXNO 4LF4O 4LF9O 5BXZA 1N33O 3J7AU 2UXCO 4DV2O 3T1YO 4X64O 1IBMO 4LF7O 3RT3C 2DOSA 1FYJA 2UUBO 1I94O 1XMQO 4OX9O 4LF5O 1N34O 1FKAO 5A2QN 4DR7O 1R1BA 2VQFO 4DV1O 4A5UB 1KUQA 1R6TA 1XMOO 1G1XB 4LFBO 4LFAO 4DR5O 1F7YA 4K0KO 3O65A 4DUYO 3JAMN 3F5TA 4X66O 1A32A 5IWAO 2UUAO 1FJGO 5LMNO 5BY1A 4B3MO 3M8AA 1HR0O 4GKKO 1X59A 1HNXO 4JI7O 2N74A 2ZKOA 1NS1A 1J5EO 5H5NA 4DR1O 4YHHO 4X62O 2LW7A 4JI5O 4AQYO 4JI3O 4DR6O 4JYAO
chains in the Genus database with same CATH superfamily
2ITDC 2XNDG 1K3EA 4JI2O 4IYIA 5CBGA 2Q68A 5K1PA 4UCUA 2GTSA 3CC4V 4QPJA 1XOUA 1XUQA 4Z2WA 4RQFA 2BTQA 2D2CB 5C8YA 3L72H 4WBNB 1R6KA 3DXRB 2BTQB 1H2LA 4KFMA 4NXNB 1M57B 5L3GA 2R9IA 1JFFA 4PA9A 3A2FA 4KHPO 1AI7A 3E89A 2ZE5A 4IGGA 4NTYA 1IBLB 4J7ZA 4B3SO 4DUZO 1N0JA 1SQVH 1VMGA 2KG7B 4FFKA 2UXCB 5GTIZ 1WB7A 2EJRA 3OAAG 5BMVA 3CCQV 2YXYA 5TISZ 4U7NA 4DO2A 3K9AA 1CEZA 2FMLA 4DR6B 3CRMA 4LH6A 4QE7A 1AP5A 3FAVB 4LNUA 2W6JG 1FKAO 1VP7A 1SZXA 4X1KB 1M93A 4TV9B 2DE0X 3CSXA 4TQDA 5LP6C 4I0XB 5KA5A 3H01A 1VARA 4DK1A 4MVMA 1GK9A 3N2GB 1ZLZA 1LNQA 3A0RA 5EIBD 2ZR3A 5LOVB 1ORQC 4X65B 3N2KA 4DR1O 4DV3B 4NB5A 1FXKA 3LNMB 2JS5A 1HP8A 3RYHB 3T1CA 3BAAA 3JATA 4MS2A 4CS2A 2Q4PA 2OTJV 4X66B 3APQA 1FXKC 2PTMA 3ZEDA 1U97A 1AJQA 5H2FZ 3ZMZA 5KHHA 1RSOB 3RFRA 5CB4A 4MVUA 4I9WA 1RP3B 4OPHA 2UU9O 3G71V 1VQ9V 1JMKC 1N36O 1EZJA 2LFSA 4KXRA 4JTCB 1Q3EA 3E22A 3RWRD 4MSWC 5B1AB 2Q67A 3CXCU 3ABLB 2UUCB 3JD1A 3ETGA 3AG4B 4CC5A 1HNZO 4YXWG 3ZN1A 3TCUA 3CYOA 3SPGA 2JVDA 3CE2A 3R66A 1NT2B 3RN4A 3DTUB 4PV1B 3CC2V 2AW9A 3C3SA 2OTLV 2Q7HA 3CB2A 2PYLA 1S77D 4TV8B 2F95B 3ICXA 1US6A 3ZBHA 4O4IB 2DQ0A 1ZUQA 2YSUB 4PA6A 1Q6IA 5JCOA 1NR7A 1GKFA 3JARB 2YXLA 3H1JH 3OEEG 2BSKB 4H13B 4PHZA 4FLYA 1QLNA 3ML0A 2BOCC 3JAWA 4H0LB 2ZCEA 3CJHA 2B1IA 4LWSA 5A9GA 2ZE8A 5J9PC 1QVFU 4E2LA 2ZNJA 3OW2U 1K4CC 4WFAV 3OMNB 3D3IA 2LJ2A 1K4DC 4AQYO 1YITV 3L70H 4DV1B 3B77A 1TAEA 4J80A 1KB9F 4EKWA 5LYJB 4TUYA 4N21A 4DV4O 4I55B 5KHGA 1BHAA 1RPRA 1K34A 1Y76A 4UB6Z 2WLLB 1YF2A 3ZRWB 4X20B 2CUGA 1YXBA 4QE9A 5JQGA 2CDYA 3A0HZ 4Z1VA 5BMVB 4B3SB 4QGPA 3ABTA 4O2BB 1FXHA 1JPXA 3KCXA 2P22C 2QSAA 4U3JA 4DV7O 1OCRC 4KHPB 3C90A 1XNRO 1I94B 2CH7A 4CC6A 1FJGB 5L3DA 3ZRSA 4NXNO 1DTOA 4GX5A 4DUYB 1Q43A 4LF4B 1W2BU 1FD9A 4LF7O 1W0KG 2PGGA 3QO5A 5LHHA 3HR0A 5HFMA 2EIKC 3MAQA 2EIJC 4HBNA 1BS3A 4JF3A 4LF5O 3U0ZA 4MVOA 3K0GA 1KD1W 1PNMA 1TVKA 2VQFO 2QR4A 4ZBMA 1OCCC 1R3KC 1JA8A 5ITZA 1COWG 4PELA 2P06A 2CGOA 1Y76B 2PZSA 2WSSG 3SPCA 4U3JB 3M8AA 4LFAB 4GX2A 1Q82W 1J5EO 2EINC 4N23A 2QKSA 4ZIBA 4JI5O 4UV9A 4XDJA 1BGYH 4DR4O 1I08A 1KECA 5LL6Y 3T1YB 4LF8B 4MTFA 3CWBH 1NU1H 2K9PA 4DV5O 4X62B 1Y66A 2ZINA 2IJHA 1KU9A 3CD6V 3Q4HA 4JI4B 3P30A 3CP1A 2EILC 3W7SA 2DYRC 3E22B 3ABMC 4JTDB 4R6ZA 4JI4O 2IBZH 1RFYA 3Q4HB 2P90A 2ATKC 5JVDA 3OUFA 1O9HA 5LHGA 1YZBA 3CMAV 1WN7A 1SQPH 2NR5A 1AI5A 2DJVA 4DR4B 2V4DA 1V54C 2QWRB 1BQZA 2JGDB 3AK2A 1J5EB 1S3JA 3ZHRA 4LWSB 1MSDA 1AR4A 3IGAC 3L73H 2QGNA 3OGIB 2P5OA 1TGOA 1W59A 1N33O 2LFRA 4F6EA 3CCVV 5K1XA 2ZE7A 4UFZA 3ZHSA 1KKDA 4HYOA 4AHCA 4P2ZA 4JI8B 1VQ6V 3JALB 3K04A 2DWDC 2EX3A 4JI3B 2Q73A 3L9DA 3PN1A 4I5SA 3AK3A 1VQNV 3ZIAG 2AZ2A 3P32A 3CCRV 3AG7A 4MW3A 4DUYO 4JYBA 2EILB 3F5TA 4UVBA 5LMNO 1IVSA 5LA6A 3FFQA 5IJ0B 3HKDA 2V1DA 2X6BA 2K1EA 2ZIOA 4YHHO 2ZDIA 4X62O 3SJCC 2AHYA 1F23A 2OT5A 1VF5B 3EHBB 4JYAO 5IE9A 5JQGB 1D5NA 2ODMA 3DC6A 4QNHB 4HAMA 4X89A 3N2KB 2OCCB 3I55V 1IBMB 1R3IC 5HFLA 4MVQA 3OTOO 2JJ1G 4P9OA 1XILA 3JATB 3HPLC 4PDVA 2LW1A 2FKXA 5B1OA 4IIJA 3JYCA 1AR1B 4MTOA 1RPOA 1VQ7V 2ZDIC 3T1HO 2Q69A 4DV6B 1ZTEA 4P30A 3X2QC 2YIBD 1I5YA 2Q9LA 1H2SB 1LUVA 5FPOA 3JSNA 5L3FA 4JI1B 4ZI7A 4J9ZB 3AG4C 5JJJB 1WJZA 2AXTZ 4LF4O 1Y74B 4JAAA 5EIBC 2MW2B 1HNXB 3ABUA 3G80A 1I94O 1XMQO 4X20A 5FNVA 1NJIW 4DV7B 3JCUZ 4LFBB 3G4SV 1K97A 3ETEA 1DF4A 4X8AA 4PI2A 1E1RG 1B6QA 2EIMB 1F4NA 1YI2V 5L3BA 5KLVH 1M56B 4Z1MG 1S5LZ 3ZMTA 2DYSB 5IWAO 4NTXA 1E1QG 1G4YB 1MG1A 2JEXA 1BE3H 4DV0B 1JOYA 4B3RB 2P4VA 1X59A 1HNXO 4ZKIA 1QLEC 1OCOC 1NKDA 5BZBA 1ENVA 2QM8A 2LP7A 2EZPA 3VQVA 4RUFA 1N0NA 3B2EE 1YDXA 2WLIA 1M57C 1TA8A 3CX5F 3ZCCA 1XBLA 1XL4A 4KP4A 5LMUO 3AG1B 3M7MX 1VQOV 4JI6O 2L35A 2UXDB 2OIGA 4ZOLB 4GKJB 3CJHB 3TGUH 2E5LO 1YSCA 3APOA 3JAWB 4TV8A 5KMGA 3ASNB 2HJDA 5EK0A 3RBZA 3SJAC 2JGDA 1K73W 4FFBB 5CA1B 1JCHA 5LA6B 1IBKB 5LMUB 3FKSG 1SRYA 2B9ZA 5BXZA 1B06A 4GYCB 2RCVA 1YJWV 2DYSC 5ITZB 1WNSA 4PA3A 4PA7A 4YJ2A 2F1MA 4AQYB 3VQWA 1SKVA 2KSDA 2IJKA 3WFVA 2JK5C 3ABMB 4L87A 5JH7A 5B1BB 2WLJA 5KX5A 1UJWB 3CMEV 1XQ8A 1MSWD 1MZEA 1O9GA 2VWKA 2YICA 3JD4A 3CCJV 3FX7A 4TT3G 4FPPA 5BY1A 5EBLC 1AI6A 2OCCC 1IDSA 4JYYA 4B3TB 3KG2A 4PDRA 2A06H 4BIOA 4I50B 4DUZB 2IU0A 4ICGA 3HKBA 1IBLO 5B3SB 4DR2O 1XNQO 4U7OA 2JRIA 3ZMVA 3L71H 4DR1B 2HKOA 4EFEA 2XAJA 1FPOA 4JYCA 2XAGA 3KKYA 4RAIA 2JDIG 4WBNA 4UV8A 4R7CA 4RUEA 4H37A 1F51A 3O9OA 3H1LH 2QWNB 4JI1O 2WLNA 4PI0A 2GV9A 3UT5B 2A79B 4BW5A 2QA4V 3ETDA 4FK5C 1DK1A 3J81N 1EBOA 5EBWC 3T1HB 5GTHZ 1DF5A 1QCEA 4PJ0Z 3SYPA 4TV9A 1K92A 1BL8A 3J80N 2WPDG 1IBKO 2UUAB 2Y69B 2KG7A 4E4EA 3SYAA 2ZM6B 3BY6A 1XHXA 1IBMO 2RQ6A 4MTXA 2H3OA 2F4VB 4WFHA 3SJQC 2EIMC 2W0XA 5CA0A 4LF6B 1LR1A 2QWQB 5J2TA 4DR7O 3LSSA 2ZXWC 3OD4A 2WLIB 2OYQA 4YJ3A 5EBMC 2VQFB 3W7XA 1WB8A 1JQ0A 3AG3B 1S72V 1NQTA 4X1KA 2C2AA 3FYIB 2HEPA 3LSQA 1AVMA 2WAMA 2NNUA 5B1AC 3MD0A 4RO2A 1E79G 1PL0A 4DR6O 3H1HH 1FFTB 3F7YC 3AG2C 5FLXN 4J7KA 1OZ0A 1FS0G 2Z0AA 1MA1A 1JVMA 1ZSPA 2UXXA 4JI0O 3OM3B 1NTMH 4WFFA 2QWOB 1Q86W 5KUMA 3BA8A 3CRCA 4OGQB 2Q7EA 2KB1A 1S76D 3IFXA 3RYIA 5DECA 5J2TB 3GB7C 1EN5A 1FXKB 1ROPA 2GUZA 3K57A 1N4CA 4OXSA 3B8NA 3A8TA 3JD0A 5B66Z 1R6NA 5L3EA 1VIBA 4KUMA 1BSMA 2ZR2A 1L0NH 1AR5A 1AP6A 3SJBC 1SETA 3UQ8A 4CH5A 4RQEA 3WB2A 4YY3B 3U11A 4UVCA 1IXBA 4GT1A 3SGIA 4FM0A 4R50A 2EIKB 2WLKA 4YJ3B 3RT3C 1V9PA 2X6AA 2R9AA 3AG2B 4FLTA 4TSFG 1GAXA 1DGSA 4KL1A 1K9MW 2L6LA 3PJSK 2Q8VA 1BHBA 3QO8A 4QIWF 2BE3A 3DSQA 2W0FC 1PNLA 1Q6UA 1D5AA 1XNQB 4LFAO 2DW4A 1OCZB 1F7YA 4ABMA 4K0KO 3LDEA 2Z5UA 1A32A 3CCLV 1JJOA 2HLDG 1PPJH 2WLLA 5KAFZ 4O4HB 3B40A 4D7SA 1P4RA 4J7JA 2HVKC 1M56C 1F4MA 2CE4A 5LXTB 2FL4A 4FZ0A 2P67A 3ABKB 2Y4UA 4MT8A 1B3QA 1AROP 1FFXB 4UCSA 1CP9A 3CS5A 1H2KA 3UCSC 2AZ0A 2UUCO 1QLEB 1MABG 5KHJA 3E8FA 4WFEA 3JAKA 4CS3A 3JALA 1KKCA 4B7KA 1N32O 2Q0OC 1VQ4V 3UT5A 1PP9H 5H9CA 5IDJA 3GWOA 3K06A 5IYZB 1K8AW 1Q8IA 3JAKB 1XNRB 2UXBO 1SQQH 4LFCO 4K8ZA 1YVWA 3WB0A 2V7QG 4YIPA 4I9QA 5BR8B 5EC1C 2EULA 1GRJA 4DR7B 4B3TO 4DR3O 2RMKB 4BW9A 4FM1A 1OJHA 2XAHA 1Q7YW 3SPIA 3E35A 2G38A 2A0LA 1N8RW 1BQ0A 1H8HG 2E5LB 4DV4B 1IURA 1W0JG 3UM7A 1U96A 4FJCC 3I56V 1WP7A 3HKCA 2HP8A 3WG7C 1YEWA 3STZC 1WLEA 2F93B 1H38A 2OCHA 5KHIA 4CZZA 5A2QN 1L8DA 5GW7A 2YEVA 3K0DA 4B7EA 3GWKC 4DV1O 1RM1B 2QKAA 4A5UB 2QEXV 3FAVA 1KUQA 5LBQA 2F23A 2ZD9A 1SC5B 3N2GA 3TK1A 4JZ2A 1URFA 1K5SA 3E83A 5B5EZ 1PM9A 4J42A 3N27A 4AILC 4K35A 2M7WA 2Q5ZA 2N04A 2X0LA 3AG1C 4FFBA 1XHZA 3H1IH 4JV5B 3T2MA 1SA0A 4WFBV 5GONB 4O4LB 1R3JC 4JI7O 1GTOA 1QNMA 4IL6Z 1NH2D 1THZA 3ZRWA 2YIDA 4HZ3A 3RVZA 4JAUA 4DV2B 4DR3B 2F66C 3BABA 2KQXA 1IXMA 1PNKA 3CRAA 2YIBA 4UB8Z 4IT5A 4PA4A 4DRXA 3K3WA 3T4ZA 3JASB 4TQFA 3B8MA 3HKDB 1OCRB 4MVZA 4ZHQB 4WF9V 4NXMB 1R3LC 4UCVA 4DW0A 1P49A 2YS8A 2ZIMA 2VQEB 5CBFA 2ZE6A 2GDSA 1YJ9V 2PUSA 2FYUH 3FB8C 4LF5B 1VQLV 1ZL8A 4QPKA 1TVKB 1P7GA 2JEUA 2VS0A 5J2UA 4QJFB 3SDLA 4ZHQA 3K5MA 5JWPA 4PDLA 1G6UA 5KUKA 4R8CA 1BZKA 5KA6A 1GN4A 2W6IG 4MTGA 2VQEO 3EXAA 2JIZG 2R72A 4F6RB 4DV6O 5IWAB 1SZTA 4DR2B 2DOSA 3E8GA 5CA1A 4C7UA 3BEHA 5LGTA 3OTOB 2QTSA 3NXSA 2IH1C 4X1IA 1VQ5V 1NTKH 1R6TA 3D8CA 4IHJB 3U10A 3OR6C 1XMOO 3ZRVA 2RN9A 1M1KW 3VQXA 4UVAA 4H33A 4JI7B 4F4LA 5KX5B 2OWOA 3ZHUA 1XI1A 1I0HA 1XDCA 4B3MO 5JVDB 2QWPB 4O4LA 2YEVB 2PYJA 4Q6GA 1RM1C 2ZKOA 4XDKA 1CPYA 2DYRB 2EJ7A 2CGNA 3ZRXA 3W7TA 3S3XA 3RYCA 1TUBB 4NYKA 4Q20A 5B1NA 1DLBA 3BRCA 1QR9A 4GZRB 3D36C 1JJ2U 2A7WA 1V55C 2XOKG 3JD2A 4TOIA 2ARHA 3BA9A 4LH7A 4B3RO 4JI8O 3JASA 1AB3A 4UCOA 4BR6A 4UUJC 4O2BA 1BCCH 1XMOB 5EYPA 4I4TA 3STLC 3ASNC 3P3NA 1M5IA 3OEHG 3D3QA 4GKJO 4DYLA 3QO7A 2QM4A 4GUNA 1L0LH 3FD9A 1AJNA 2Y48A 2UXDO 2ZNIA 3K58A 4JI6B 4WFGA 1YTFD 1NR1A 3OFNG 4LFCB 5IJ9B 1NI8A 3ASOB 4GLXA 3GVMA 4O2AA 3FB6C 2GBOA 4FZ1A 5GONA 2LGQA 2HHHO 1K7DA 2CTQA 2LGWA 3RYCB 4FLXA 2QM7A 1Y74A 3F5WC 5J2UB 4I7ZB 1P7BA 4JGSA 4LNUB 5E79Z 1VF7A 3CRQA 2E74B 1N36B 2BTOA 5LP6A 5F2VO 1G1XB 3ZMSA 3T4DA 3OMAB 1XREA 4FLUA 2EZOA 3IAYA 4JI5B 4X66O 1AI4A 2LQTA 1RSOA 3CHXA 1HR0O 3E8BA 2HVJC 4HNAB 5LHIA 2PY5A 1PV0A 4AI8A 2A3QA 2NLJC 4H44B 3BPZA 2DWEC 4I0XA 2MK3A 3D36A 2Q0AA 2YI9A 4JV5O 1EM1A 3MHSC 4ZI7B 3X2QB 5IYCO 1UFIA 5LMNB 4UCRA 3CCUV 4O4JA 3B4SA 2XTAA 3IC7A 4LF7B 3ZN0A 1V55B 4LF8O 4B08A 3SYOA 3RYIB 3VBBA 2DQ3A 4CS4A 3IC9A 5LGUA 5EC2C 3CC7V 1HNWB 1UPGA 3EFFK 3W7UA 2LO1A 1ZWIC 3RGBA 2JGUA 2XASA 4JZGA 4FM2A 1Y4MA 4O4IA 1VEWA 4J10A 1N33B 2UXCO 1KC8W 4JASA 1MOFA 3QG5A 1QQCA 4JYAB 2O57A 1IX9A 4K8XA 3DXRA 4ZOLA 5JCOC 4EEQA 1G8MA 2UXBB 3OUSA 3RW0A 1T5EA 5LOVA 3FB5C 1YJNV 1LUWA 3S3WA 1NZ6A 3CCEV 2RJZA 5DN6G 1NVPD 1S5JA 5JH7B 2IJIA 2JJ2G 5IYDO 1QVGU 1FJGO 3KCYA 1EFRG 3R65A 4GCZA 3LDCA 1KMIZ 2N74A 3AEIA 1X4TA 2LW7A 4DXWA 1YIJV 3G67A 4W4KA 2HR3A 5EZYA 4EB6A 2DMXA 1AILA 2BCCH 2WA3A 1WAZA 2FB5A 1D2DA 1VQ8V 3M99B 5CMUA 5D5PA 4NKGB 5KAIZ 2VWJA 2F4VO 2D3OW 4X1YA 4TUYB 1P84F 2BSKA 2IW5A 4DR5B 1XEQA 5L3CA 2XUMA 1I7FA 3L74H 1WA8A 3NR7A 4FLVA 3W7WA 1OCOB 2HFEC 3MDSA 3THOA 3AG3C 3L75H 2NN4A 2IJJA 4MVRA 3QF7A 2QE7G 3H9VA 4UXNA 1J95A 2FTKA 5LYJA 2WWWA 2BOBC 1HNZB 2PI5A 3CEIA 4G28B 2CTPA 1FAFA 3KZIZ 5H6RA 2QJ1A 4LF9O 4CBCA 2HJFC 1VF6C 2XT9A 3T1YO 2E76B 1GO3F 1R73A 3K9SA 2CH7B 2UUBO 2VRZA 2ZQMA 4OX9O 4CH6A 3BCCH 4DRXB 5KHKA 3E8HA 1OV9A 3HKCB 1Z2GA 2B1GA 3I5DA 1SQGA 3ETQA 1VQPV 5CA0B 1ZX3A 3H1KH 4J9YB 2YXHA 4LC1A 3CCMV 1QU7A 4LFBO 3G6BA 3UO2A 2EINB 3JAMN 1NVPB 1VQMV 3HKEA 4GX0A 4BIZA 4G27B 4LCUC 3RYHA 4F6RA 4FIPC 5EYPB 4D7TA 2GHYA 1K5QA 5IYBO 1SA0B 2WA4A 4FLWA 5C8YB 3LUTB 4DW1A 2E3CA 5IY5B 2AGAA 2EIJB 5CBHA 5LGNA 4J41A 1GMGA 3DC5A 2HHHB 2XAQA 1H2NA 2Q7GA 3BVOA 4O4HA 1YHQV 1OCCB 2ETNA 4G2KA 2P4KA 2WLMA 1ZAUA 3JSLA 1OHHG 5C93A 1SESA 1M90W 1FFXA 4YIOA 4GX1A 2Y0PA 1NBMG 1GN3A 3SYCA 5LXTA 3WU2Z 5CB4B 1FXVA 2N05A 4HNAA 4DV3O 1H8EG 2ILMA 4LR3A 4X65O 4X1YB 2ZXWB 2HG5C 2Q6AA 2QDOA 1YTFB 2PF4E 2YIAA 4JPRA 3B09A 4WCEV 4XBFA 2R9RB 3LSUA 4XDLA 3OMIB 3JD3A 1NH2B 2ADQB 2XHBA 4BIUA 1N32B 4P9PA 1HWYA 1HDJA 1JR9A 2WLHA 1GN2A 4NVPA 1QHTA 2Y0IA 1KBHA 1WPBA 4LBEC 4BWAA 5DEDA 5AG2A 2Y4TA 1V54B 1ZL8B 2X7RB 3K79A 4U3FH 2UU9B 2IH3C 5IJ9A 5CA3A 1BT8A 2CAZC 4LP8A 1KP3A 2Y69C 4FMTA 3EVKA 3JARA 4GKKB 3LDDA 2P6JA 1OCZC 1Z5VA 4W4LA 1M9NA 4TWKA 4K0KB 1SQXH 5BR8O 4I4TB 1H2MA 1HNWO 2KKWA 2GSMB 4EFBA 1WP8A 4OX9B 1KYOF 2F43G 3ZJZA 5EZYB 4EB6B 4MVSA 1XMQB 4IYHA 4K3AA 3JCZA 1GM7A 3CPWU 1QR8A 2X6CA 3OE7G 3FYEB 3ZX6A 4X9QA 2QTOA 4NTWA 1JX9A 1CXZB 1JFFB 2E75B 3ABLC 2B5UA 1KP2A 1Y67A 4IIJB 5B1BC 1L1FA 2EBOA 3K03A 3UKMA 2CTRA 4ASUG 4YY3O 4NXMO 1XL6A 1SS3A 2JS3A 4DV5B 4O4JB 1TUEB 3QVNA 1SQBH 3G6EV 2QKCA 3E2EA 3TXQA 3HB3B 1S0VA 4CH4A 5IT9N 3HKBB 1H2GA 4L8JA 4I50A 3J7AU 3TXSA 2M6YA 4DV2O 1PD3A 2YDEA 5JJNB 3MHHC 1FYJA 3FB7C 2YI8A 4PD4F 3CXHF 3ZMUA 5B3SC 2AHZA 4MW8A 1GH6A 3SYQA 4JAVA 1MZFA 3RYFA 1GM8A 3UO3A 1N34O 3BHPA 3LNNA 4D6TH 1Q6HA 5FNVB 3TETA 3AK1A 4YHHB 3ABKC 3BFRA 1Q81W 3ZS8C 1PL4A 2RDCA 3OT7A 3O65A 1TUBA 1K33A 1HW7A 1QBZA 5IY5C 5LP6B 5H6QA 3A0BZ 1B04A 1M4UA 4X88A 3VOUA 1VQKV 1I5XA 5FL7G 3K5OA 5H5NA 2XAFA 3IJ4A 1MMMA 3SPJA 5D5QA 4JI3O 3QTCA 5JJEB 3OTFA 3CRRA 3K59A 2CTWA 4OPAA 3E86A 3CCSV 2GUZB 3OGCC 4DV0O 3ZHTA 4RWUA 1Y6XA 1N34B 1IZ3A 2PI4A 4LF6O 3HKEB 4NR1A 4FVMA 2DN9A 5CN0A 2ZT9B 1GN6A 4JI0B 5IYZA 3K5NA 4UCTA 1MNGA 4BAYA 2ZM6O 3DGEA 1YCIA 1KQSU 1Q5OA 5FPRA 1SF9A 4J11A 1NTZH 1PKXA 2UUBB 2YUAA 1VF6A 1Z5WA 3ASOC 1BMFG 1EN4A 5IJ0A 4LF9B 4PDMA 4YJ2B 2GTAA 2RNBA 3OR7C 2UXNA 4CH3A 2CK3G 4X64B 2A9HA 2YC0A 3C3TA 3K08A 4JI2B 2IU3A 4X64O 5E1AC 3SPHA 4B3MB 1GM9A 2P7TC 3K5LA 3RYFB 5DM6V 4IHJA 2IM9A 1Q90D 3QNEA 3F7VC 3SR2C 4X1IB 4O2AB 1R1BA 5KMGB 1S5HC 4JTAB 1SQFA 2ITCC 1WPXA 1EN6A 1WA8B 2ADPA 1HR0B 4DR5O 2H8PC 1AJPA 2Z3YA 3WB1A 3ZHVA 3ZHQA 2UUAO 1EZVH 2R70A 3P3PA 4I55A 4DK0A 4GKKO 3TJTA 1NS1A 2H94A 3VQYA 1SERA 4FLZA 2OIEA 3RVYA 3WG7B
chains in the Genus database with same CATH topology
5BR8O 1IBLO 4DR4O 5LL6Y 2AGAA 4OPAA 1HNWO 5FLXN 4JI2O 4DR2O 1AILA 1XNQO 2UUCO 4DV5O 2JRIA 2Z0AA 4DV0O 1D2DA 4JV5O 4JI0O 2F4VO 4B3RO 4DV4O 3OTOO 4JI8O 1N32O 5LMUO 4LF6O 1AB3A 4JI6O 1XEQA 4JI4O 2UU9O 4OPHA 2FKXA 1N36O 4JI1O 1YZBA 2UXBO 4GKJO 4LFCO 4LF8O 4KHPO 2ZM6O 2E5LO 3T1HO 2DJVA 4YY3O 4NXMO 2UXDO 1DK1A 4B3SO 3J81N 3SDLA 4DUZO 4DV3O 4B3TO 4DV7O 4DR3O 1HNZO 4X65O 3R66A 3J80N 2VQEO 1XNRO 5IT9N 1IBKO 4DV6O 2HHHO 4NXNO 4LF4O 4LF9O 5BXZA 1N33O 3J7AU 2UXCO 4DV2O 3T1YO 4X64O 1IBMO 4LF7O 3RT3C 2DOSA 1FYJA 2UUBO 1I94O 1XMQO 4OX9O 4LF5O 1N34O 1FKAO 5A2QN 4DR7O 1R1BA 2VQFO 4DV1O 4A5UB 1KUQA 1R6TA 1XMOO 1G1XB 4LFBO 4LFAO 4DR5O 1F7YA 4K0KO 3O65A 4DUYO 3JAMN 3F5TA 4X66O 1A32A 5IWAO 2UUAO 1FJGO 5LMNO 5BY1A 4B3MO 3M8AA 1HR0O 4GKKO 1X59A 1HNXO 4JI7O 2N74A 2ZKOA 1NS1A 1J5EO 5H5NA 4DR1O 4YHHO 4X62O 2LW7A 4JI5O 4AQYO 4JI3O 4DR6O 4JYAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  1IBL O;  4DR4 O;  5LL6 Y;  2AGA A;  4OPA A;  1HNW O;  5FLX N;  4JI2 O;  4DR2 O;  1AIL A;  1XNQ O;  2UUC O;  4DV5 O;  2JRI A;  2Z0A A;  4DV0 O;  1D2D A;  4JV5 O;  4JI0 O;  2F4V O;  4B3R O;  4DV4 O;  3OTO O;  4JI8 O;  1N32 O;  5LMU O;  4LF6 O;  1AB3 A;  4JI6 O;  1XEQ A;  4JI4 O;  2UU9 O;  4OPH A;  2FKX A;  1N36 O;  4JI1 O;  1YZB A;  2UXB O;  4GKJ O;  4LFC O;  4LF8 O;  4KHP O;  2ZM6 O;  2E5L O;  3T1H O;  2DJV A;  4YY3 O;  4NXM O;  2UXD O;  1DK1 A;  4B3S O;  3J81 N;  3SDL A;  4DUZ O;  4DV3 O;  4B3T O;  4DV7 O;  4DR3 O;  1HNZ O;  4X65 O;  3R66 A;  3J80 N;  2VQE O;  1XNR O;  5IT9 N;  1IBK O;  4DV6 O;  2HHH O;  4NXN O;  4LF4 O;  4LF9 O;  5BXZ A;  1N33 O;  3J7A U;  2UXC O;  4DV2 O;  3T1Y O;  4X64 O;  1IBM O;  4LF7 O;  3RT3 C;  2DOS A;  1FYJ A;  2UUB O;  1I94 O;  1XMQ O;  4OX9 O;  4LF5 O;  1N34 O;  1FKA O;  5A2Q N;  4DR7 O;  1R1B A;  2VQF O;  4DV1 O;  4A5U B;  1KUQ A;  1R6T A;  1XMO O;  1G1X B;  4LFB O;  4LFA O;  4DR5 O;  1F7Y A;  4K0K O;  3O65 A;  4DUY O;  3JAM N;  3F5T A;  4X66 O;  1A32 A;  5IWA O;  2UUA O;  1FJG O;  5LMN O;  5BY1 A;  4B3M O;  3M8A A;  1HR0 O;  4GKK O;  1X59 A;  1HNX O;  4JI7 O;  2N74 A;  2ZKO A;  1NS1 A;  1J5E O;  5H5N A;  4DR1 O;  4YHH O;  4X62 O;  2LW7 A;  4JI5 O;  4AQY O;  4JI3 O;  4DR6 O;  4JYA O; 
#chains in the Genus database with same CATH topology
 2ITD C;  2XND G;  1K3E A;  4JI2 O;  4IYI A;  5CBG A;  2Q68 A;  5K1P A;  4UCU A;  2GTS A;  3CC4 V;  4QPJ A;  1XOU A;  1XUQ A;  4Z2W A;  4RQF A;  2BTQ A;  2D2C B;  5C8Y A;  3L72 H;  4WBN B;  1R6K A;  3DXR B;  2BTQ B;  1H2L A;  4KFM A;  4NXN B;  1M57 B;  5L3G A;  2R9I A;  1JFF A;  4PA9 A;  3A2F A;  4KHP O;  1AI7 A;  3E89 A;  2ZE5 A;  4IGG A;  4NTY A;  1IBL B;  4J7Z A;  4B3S O;  4DUZ O;  1N0J A;  1SQV H;  1VMG A;  2KG7 B;  4FFK A;  2UXC B;  5GTI Z;  1WB7 A;  2EJR A;  3OAA G;  5BMV A;  3CCQ V;  2YXY A;  5TIS Z;  4U7N A;  4DO2 A;  3K9A A;  1CEZ A;  2FML A;  4DR6 B;  3CRM A;  4LH6 A;  4QE7 A;  1AP5 A;  3FAV B;  4LNU A;  2W6J G;  1FKA O;  1VP7 A;  1SZX A;  4X1K B;  1M93 A;  4TV9 B;  2DE0 X;  3CSX A;  4TQD A;  5LP6 C;  4I0X B;  5KA5 A;  3H01 A;  1VAR A;  4DK1 A;  4MVM A;  1GK9 A;  3N2G B;  1ZLZ A;  1LNQ A;  3A0R A;  5EIB D;  2ZR3 A;  5LOV B;  1ORQ C;  4X65 B;  3N2K A;  4DR1 O;  4DV3 B;  4NB5 A;  1FXK A;  3LNM B;  2JS5 A;  1HP8 A;  3RYH B;  3T1C A;  3BAA A;  3JAT A;  4MS2 A;  4CS2 A;  2Q4P A;  2OTJ V;  4X66 B;  3APQ A;  1FXK C;  2PTM A;  3ZED A;  1U97 A;  1AJQ A;  5H2F Z;  3ZMZ A;  5KHH A;  1RSO B;  3RFR A;  5CB4 A;  4MVU A;  4I9W A;  1RP3 B;  4OPH A;  2UU9 O;  3G71 V;  1VQ9 V;  1JMK C;  1N36 O;  1EZJ A;  2LFS A;  4KXR A;  4JTC B;  1Q3E A;  3E22 A;  3RWR D;  4MSW C;  5B1A B;  2Q67 A;  3CXC U;  3ABL B;  2UUC B;  3JD1 A;  3ETG A;  3AG4 B;  4CC5 A;  1HNZ O;  4YXW G;  3ZN1 A;  3TCU A;  3CYO A;  3SPG A;  2JVD A;  3CE2 A;  3R66 A;  1NT2 B;  3RN4 A;  3DTU B;  4PV1 B;  3CC2 V;  2AW9 A;  3C3S A;  2OTL V;  2Q7H A;  3CB2 A;  2PYL A;  1S77 D;  4TV8 B;  2F95 B;  3ICX A;  1US6 A;  3ZBH A;  4O4I B;  2DQ0 A;  1ZUQ A;  2YSU B;  4PA6 A;  1Q6I A;  5JCO A;  1NR7 A;  1GKF A;  3JAR B;  2YXL A;  3H1J H;  3OEE G;  2BSK B;  4H13 B;  4PHZ A;  4FLY A;  1QLN A;  3ML0 A;  2BOC C;  3JAW A;  4H0L B;  2ZCE A;  3CJH A;  2B1I A;  4LWS A;  5A9G A;  2ZE8 A;  5J9P C;  1QVF U;  4E2L A;  2ZNJ A;  3OW2 U;  1K4C C;  4WFA V;  3OMN B;  3D3I A;  2LJ2 A;  1K4D C;  4AQY O;  1YIT V;  3L70 H;  4DV1 B;  3B77 A;  1TAE A;  4J80 A;  1KB9 F;  4EKW A;  5LYJ B;  4TUY A;  4N21 A;  4DV4 O;  4I55 B;  5KHG A;  1BHA A;  1RPR A;  1K34 A;  1Y76 A;  4UB6 Z;  2WLL B;  1YF2 A;  3ZRW B;  4X20 B;  2CUG A;  1YXB A;  4QE9 A;  5JQG A;  2CDY A;  3A0H Z;  4Z1V A;  5BMV B;  4B3S B;  4QGP A;  3ABT A;  4O2B B;  1FXH A;  1JPX A;  3KCX A;  2P22 C;  2QSA A;  4U3J A;  4DV7 O;  1OCR C;  4KHP B;  3C90 A;  1XNR O;  1I94 B;  2CH7 A;  4CC6 A;  1FJG B;  5L3D A;  3ZRS A;  4NXN O;  1DTO A;  4GX5 A;  4DUY B;  1Q43 A;  4LF4 B;  1W2B U;  1FD9 A;  4LF7 O;  1W0K G;  2PGG A;  3QO5 A;  5LHH A;  3HR0 A;  5HFM A;  2EIK C;  3MAQ A;  2EIJ C;  4HBN A;  1BS3 A;  4JF3 A;  4LF5 O;  3U0Z A;  4MVO A;  3K0G A;  1KD1 W;  1PNM A;  1TVK A;  2VQF O;  2QR4 A;  4ZBM A;  1OCC C;  1R3K C;  1JA8 A;  5ITZ A;  1COW G;  4PEL A;  2P06 A;  2CGO A;  1Y76 B;  2PZS A;  2WSS G;  3SPC A;  4U3J B;  3M8A A;  4LFA B;  4GX2 A;  1Q82 W;  1J5E O;  2EIN C;  4N23 A;  2QKS A;  4ZIB A;  4JI5 O;  4UV9 A;  4XDJ A;  1BGY H;  4DR4 O;  1I08 A;  1KEC A;  5LL6 Y;  3T1Y B;  4LF8 B;  4MTF A;  3CWB H;  1NU1 H;  2K9P A;  4DV5 O;  4X62 B;  1Y66 A;  2ZIN A;  2IJH A;  1KU9 A;  3CD6 V;  3Q4H A;  4JI4 B;  3P30 A;  3CP1 A;  2EIL C;  3W7S A;  2DYR C;  3E22 B;  3ABM C;  4JTD B;  4R6Z A;  4JI4 O;  2IBZ H;  1RFY A;  3Q4H B;  2P90 A;  2ATK C;  5JVD A;  3OUF A;  1O9H A;  5LHG A;  1YZB A;  3CMA V;  1WN7 A;  1SQP H;  2NR5 A;  1AI5 A;  2DJV A;  4DR4 B;  2V4D A;  1V54 C;  2QWR B;  1BQZ A;  2JGD B;  3AK2 A;  1J5E B;  1S3J A;  3ZHR A;  4LWS B;  1MSD A;  1AR4 A;  3IGA C;  3L73 H;  2QGN A;  3OGI B;  2P5O A;  1TGO A;  1W59 A;  1N33 O;  2LFR A;  4F6E A;  3CCV V;  5K1X A;  2ZE7 A;  4UFZ A;  3ZHS A;  1KKD A;  4HYO A;  4AHC A;  4P2Z A;  4JI8 B;  1VQ6 V;  3JAL B;  3K04 A;  2DWD C;  2EX3 A;  4JI3 B;  2Q73 A;  3L9D A;  3PN1 A;  4I5S A;  3AK3 A;  1VQN V;  3ZIA G;  2AZ2 A;  3P32 A;  3CCR V;  3AG7 A;  4MW3 A;  4DUY O;  4JYB A;  2EIL B;  3F5T A;  4UVB A;  5LMN O;  1IVS A;  5LA6 A;  3FFQ A;  5IJ0 B;  3HKD A;  2V1D A;  2X6B A;  2K1E A;  2ZIO A;  4YHH O;  2ZDI A;  4X62 O;  3SJC C;  2AHY A;  1F23 A;  2OT5 A;  1VF5 B;  3EHB B;  4JYA O;  5IE9 A;  5JQG B;  1D5N A;  2ODM A;  3DC6 A;  4QNH B;  4HAM A;  4X89 A;  3N2K B;  2OCC B;  3I55 V;  1IBM B;  1R3I C;  5HFL A;  4MVQ A;  3OTO O;  2JJ1 G;  4P9O A;  1XIL A;  3JAT B;  3HPL C;  4PDV A;  2LW1 A;  2FKX A;  5B1O A;  4IIJ A;  3JYC A;  1AR1 B;  4MTO A;  1RPO A;  1VQ7 V;  2ZDI C;  3T1H O;  2Q69 A;  4DV6 B;  1ZTE A;  4P30 A;  3X2Q C;  2YIB D;  1I5Y A;  2Q9L A;  1H2S B;  1LUV A;  5FPO A;  3JSN A;  5L3F A;  4JI1 B;  4ZI7 A;  4J9Z B;  3AG4 C;  5JJJ B;  1WJZ A;  2AXT Z;  4LF4 O;  1Y74 B;  4JAA A;  5EIB C;  2MW2 B;  1HNX B;  3ABU A;  3G80 A;  1I94 O;  1XMQ O;  4X20 A;  5FNV A;  1NJI W;  4DV7 B;  3JCU Z;  4LFB B;  3G4S V;  1K97 A;  3ETE A;  1DF4 A;  4X8A A;  4PI2 A;  1E1R G;  1B6Q A;  2EIM B;  1F4N A;  1YI2 V;  5L3B A;  5KLV H;  1M56 B;  4Z1M G;  1S5L Z;  3ZMT A;  2DYS B;  5IWA O;  4NTX A;  1E1Q G;  1G4Y B;  1MG1 A;  2JEX A;  1BE3 H;  4DV0 B;  1JOY A;  4B3R B;  2P4V A;  1X59 A;  1HNX O;  4ZKI A;  1QLE C;  1OCO C;  1NKD A;  5BZB A;  1ENV A;  2QM8 A;  2LP7 A;  2EZP A;  3VQV A;  4RUF A;  1N0N A;  3B2E E;  1YDX A;  2WLI A;  1M57 C;  1TA8 A;  3CX5 F;  3ZCC A;  1XBL A;  1XL4 A;  4KP4 A;  5LMU O;  3AG1 B;  3M7M X;  1VQO V;  4JI6 O;  2L35 A;  2UXD B;  2OIG A;  4ZOL B;  4GKJ B;  3CJH B;  3TGU H;  2E5L O;  1YSC A;  3APO A;  3JAW B;  4TV8 A;  5KMG A;  3ASN B;  2HJD A;  5EK0 A;  3RBZ A;  3SJA C;  2JGD A;  1K73 W;  4FFB B;  5CA1 B;  1JCH A;  5LA6 B;  1IBK B;  5LMU B;  3FKS G;  1SRY A;  2B9Z A;  5BXZ A;  1B06 A;  4GYC B;  2RCV A;  1YJW V;  2DYS C;  5ITZ B;  1WNS A;  4PA3 A;  4PA7 A;  4YJ2 A;  2F1M A;  4AQY B;  3VQW A;  1SKV A;  2KSD A;  2IJK A;  3WFV A;  2JK5 C;  3ABM B;  4L87 A;  5JH7 A;  5B1B B;  2WLJ A;  5KX5 A;  1UJW B;  3CME V;  1XQ8 A;  1MSW D;  1MZE A;  1O9G A;  2VWK A;  2YIC A;  3JD4 A;  3CCJ V;  3FX7 A;  4TT3 G;  4FPP A;  5BY1 A;  5EBL C;  1AI6 A;  2OCC C;  1IDS A;  4JYY A;  4B3T B;  3KG2 A;  4PDR A;  2A06 H;  4BIO A;  4I50 B;  4DUZ B;  2IU0 A;  4ICG A;  3HKB A;  1IBL O;  5B3S B;  4DR2 O;  1XNQ O;  4U7O A;  2JRI A;  3ZMV A;  3L71 H;  4DR1 B;  2HKO A;  4EFE A;  2XAJ A;  1FPO A;  4JYC A;  2XAG A;  3KKY A;  4RAI A;  2JDI G;  4WBN A;  4UV8 A;  4R7C A;  4RUE A;  4H37 A;  1F51 A;  3O9O A;  3H1L H;  2QWN B;  4JI1 O;  2WLN A;  4PI0 A;  2GV9 A;  3UT5 B;  2A79 B;  4BW5 A;  2QA4 V;  3ETD A;  4FK5 C;  1DK1 A;  3J81 N;  1EBO A;  5EBW C;  3T1H B;  5GTH Z;  1DF5 A;  1QCE A;  4PJ0 Z;  3SYP A;  4TV9 A;  1K92 A;  1BL8 A;  3J80 N;  2WPD G;  1IBK O;  2UUA B;  2Y69 B;  2KG7 A;  4E4E A;  3SYA A;  2ZM6 B;  3BY6 A;  1XHX A;  1IBM O;  2RQ6 A;  4MTX A;  2H3O A;  2F4V B;  4WFH A;  3SJQ C;  2EIM C;  2W0X A;  5CA0 A;  4LF6 B;  1LR1 A;  2QWQ B;  5J2T A;  4DR7 O;  3LSS A;  2ZXW C;  3OD4 A;  2WLI B;  2OYQ A;  4YJ3 A;  5EBM C;  2VQF B;  3W7X A;  1WB8 A;  1JQ0 A;  3AG3 B;  1S72 V;  1NQT A;  4X1K A;  2C2A A;  3FYI B;  2HEP A;  3LSQ A;  1AVM A;  2WAM A;  2NNU A;  5B1A C;  3MD0 A;  4RO2 A;  1E79 G;  1PL0 A;  4DR6 O;  3H1H H;  1FFT B;  3F7Y C;  3AG2 C;  5FLX N;  4J7K A;  1OZ0 A;  1FS0 G;  2Z0A A;  1MA1 A;  1JVM A;  1ZSP A;  2UXX A;  4JI0 O;  3OM3 B;  1NTM H;  4WFF A;  2QWO B;  1Q86 W;  5KUM A;  3BA8 A;  3CRC A;  4OGQ B;  2Q7E A;  2KB1 A;  1S76 D;  3IFX A;  3RYI A;  5DEC A;  5J2T B;  3GB7 C;  1EN5 A;  1FXK B;  1ROP A;  2GUZ A;  3K57 A;  1N4C A;  4OXS A;  3B8N A;  3A8T A;  3JD0 A;  5B66 Z;  1R6N A;  5L3E A;  1VIB A;  4KUM A;  1BSM A;  2ZR2 A;  1L0N H;  1AR5 A;  1AP6 A;  3SJB C;  1SET A;  3UQ8 A;  4CH5 A;  4RQE A;  3WB2 A;  4YY3 B;  3U11 A;  4UVC A;  1IXB A;  4GT1 A;  3SGI A;  4FM0 A;  4R50 A;  2EIK B;  2WLK A;  4YJ3 B;  3RT3 C;  1V9P A;  2X6A A;  2R9A A;  3AG2 B;  4FLT A;  4TSF G;  1GAX A;  1DGS A;  4KL1 A;  1K9M W;  2L6L A;  3PJS K;  2Q8V A;  1BHB A;  3QO8 A;  4QIW F;  2BE3 A;  3DSQ A;  2W0F C;  1PNL A;  1Q6U A;  1D5A A;  1XNQ B;  4LFA O;  2DW4 A;  1OCZ B;  1F7Y A;  4ABM A;  4K0K O;  3LDE A;  2Z5U A;  1A32 A;  3CCL V;  1JJO A;  2HLD G;  1PPJ H;  2WLL A;  5KAF Z;  4O4H B;  3B40 A;  4D7S A;  1P4R A;  4J7J A;  2HVK C;  1M56 C;  1F4M A;  2CE4 A;  5LXT B;  2FL4 A;  4FZ0 A;  2P67 A;  3ABK B;  2Y4U A;  4MT8 A;  1B3Q A;  1ARO P;  1FFX B;  4UCS A;  1CP9 A;  3CS5 A;  1H2K A;  3UCS C;  2AZ0 A;  2UUC O;  1QLE B;  1MAB G;  5KHJ A;  3E8F A;  4WFE A;  3JAK A;  4CS3 A;  3JAL A;  1KKC A;  4B7K A;  1N32 O;  2Q0O C;  1VQ4 V;  3UT5 A;  1PP9 H;  5H9C A;  5IDJ A;  3GWO A;  3K06 A;  5IYZ B;  1K8A W;  1Q8I A;  3JAK B;  1XNR B;  2UXB O;  1SQQ H;  4LFC O;  4K8Z A;  1YVW A;  3WB0 A;  2V7Q G;  4YIP A;  4I9Q A;  5BR8 B;  5EC1 C;  2EUL A;  1GRJ A;  4DR7 B;  4B3T O;  4DR3 O;  2RMK B;  4BW9 A;  4FM1 A;  1OJH A;  2XAH A;  1Q7Y W;  3SPI A;  3E35 A;  2G38 A;  2A0L A;  1N8R W;  1BQ0 A;  1H8H G;  2E5L B;  4DV4 B;  1IUR A;  1W0J G;  3UM7 A;  1U96 A;  4FJC C;  3I56 V;  1WP7 A;  3HKC A;  2HP8 A;  3WG7 C;  1YEW A;  3STZ C;  1WLE A;  2F93 B;  1H38 A;  2OCH A;  5KHI A;  4CZZ A;  5A2Q N;  1L8D A;  5GW7 A;  2YEV A;  3K0D A;  4B7E A;  3GWK C;  4DV1 O;  1RM1 B;  2QKA A;  4A5U B;  2QEX V;  3FAV A;  1KUQ A;  5LBQ A;  2F23 A;  2ZD9 A;  1SC5 B;  3N2G A;  3TK1 A;  4JZ2 A;  1URF A;  1K5S A;  3E83 A;  5B5E Z;  1PM9 A;  4J42 A;  3N27 A;  4AIL C;  4K35 A;  2M7W A;  2Q5Z A;  2N04 A;  2X0L A;  3AG1 C;  4FFB A;  1XHZ A;  3H1I H;  4JV5 B;  3T2M A;  1SA0 A;  4WFB V;  5GON B;  4O4L B;  1R3J C;  4JI7 O;  1GTO A;  1QNM A;  4IL6 Z;  1NH2 D;  1THZ A;  3ZRW A;  2YID A;  4HZ3 A;  3RVZ A;  4JAU A;  4DV2 B;  4DR3 B;  2F66 C;  3BAB A;  2KQX A;  1IXM A;  1PNK A;  3CRA A;  2YIB A;  4UB8 Z;  4IT5 A;  4PA4 A;  4DRX A;  3K3W A;  3T4Z A;  3JAS B;  4TQF A;  3B8M A;  3HKD B;  1OCR B;  4MVZ A;  4ZHQ B;  4WF9 V;  4NXM B;  1R3L C;  4UCV A;  4DW0 A;  1P49 A;  2YS8 A;  2ZIM A;  2VQE B;  5CBF A;  2ZE6 A;  2GDS A;  1YJ9 V;  2PUS A;  2FYU H;  3FB8 C;  4LF5 B;  1VQL V;  1ZL8 A;  4QPK A;  1TVK B;  1P7G A;  2JEU A;  2VS0 A;  5J2U A;  4QJF B;  3SDL A;  4ZHQ A;  3K5M A;  5JWP A;  4PDL A;  1G6U A;  5KUK A;  4R8C A;  1BZK A;  5KA6 A;  1GN4 A;  2W6I G;  4MTG A;  2VQE O;  3EXA A;  2JIZ G;  2R72 A;  4F6R B;  4DV6 O;  5IWA B;  1SZT A;  4DR2 B;  2DOS A;  3E8G A;  5CA1 A;  4C7U A;  3BEH A;  5LGT A;  3OTO B;  2QTS A;  3NXS A;  2IH1 C;  4X1I A;  1VQ5 V;  1NTK H;  1R6T A;  3D8C A;  4IHJ B;  3U10 A;  3OR6 C;  1XMO O;  3ZRV A;  2RN9 A;  1M1K W;  3VQX A;  4UVA A;  4H33 A;  4JI7 B;  4F4L A;  5KX5 B;  2OWO A;  3ZHU A;  1XI1 A;  1I0H A;  1XDC A;  4B3M O;  5JVD B;  2QWP B;  4O4L A;  2YEV B;  2PYJ A;  4Q6G A;  1RM1 C;  2ZKO A;  4XDK A;  1CPY A;  2DYR B;  2EJ7 A;  2CGN A;  3ZRX A;  3W7T A;  3S3X A;  3RYC A;  1TUB B;  4NYK A;  4Q20 A;  5B1N A;  1DLB A;  3BRC A;  1QR9 A;  4GZR B;  3D36 C;  1JJ2 U;  2A7W A;  1V55 C;  2XOK G;  3JD2 A;  4TOI A;  2ARH A;  3BA9 A;  4LH7 A;  4B3R O;  4JI8 O;  3JAS A;  1AB3 A;  4UCO A;  4BR6 A;  4UUJ C;  4O2B A;  1BCC H;  1XMO B;  5EYP A;  4I4T A;  3STL C;  3ASN C;  3P3N A;  1M5I A;  3OEH G;  3D3Q A;  4GKJ O;  4DYL A;  3QO7 A;  2QM4 A;  4GUN A;  1L0L H;  3FD9 A;  1AJN A;  2Y48 A;  2UXD O;  2ZNI A;  3K58 A;  4JI6 B;  4WFG A;  1YTF D;  1NR1 A;  3OFN G;  4LFC B;  5IJ9 B;  1NI8 A;  3ASO B;  4GLX A;  3GVM A;  4O2A A;  3FB6 C;  2GBO A;  4FZ1 A;  5GON A;  2LGQ A;  2HHH O;  1K7D A;  2CTQ A;  2LGW A;  3RYC B;  4FLX A;  2QM7 A;  1Y74 A;  3F5W C;  5J2U B;  4I7Z B;  1P7B A;  4JGS A;  4LNU B;  5E79 Z;  1VF7 A;  3CRQ A;  2E74 B;  1N36 B;  2BTO A;  5LP6 A;  5F2V O;  1G1X B;  3ZMS A;  3T4D A;  3OMA B;  1XRE A;  4FLU A;  2EZO A;  3IAY A;  4JI5 B;  4X66 O;  1AI4 A;  2LQT A;  1RSO A;  3CHX A;  1HR0 O;  3E8B A;  2HVJ C;  4HNA B;  5LHI A;  2PY5 A;  1PV0 A;  4AI8 A;  2A3Q A;  2NLJ C;  4H44 B;  3BPZ A;  2DWE C;  4I0X A;  2MK3 A;  3D36 A;  2Q0A A;  2YI9 A;  4JV5 O;  1EM1 A;  3MHS C;  4ZI7 B;  3X2Q B;  5IYC O;  1UFI A;  5LMN B;  4UCR A;  3CCU V;  4O4J A;  3B4S A;  2XTA A;  3IC7 A;  4LF7 B;  3ZN0 A;  1V55 B;  4LF8 O;  4B08 A;  3SYO A;  3RYI B;  3VBB A;  2DQ3 A;  4CS4 A;  3IC9 A;  5LGU A;  5EC2 C;  3CC7 V;  1HNW B;  1UPG A;  3EFF K;  3W7U A;  2LO1 A;  1ZWI C;  3RGB A;  2JGU A;  2XAS A;  4JZG A;  4FM2 A;  1Y4M A;  4O4I A;  1VEW A;  4J10 A;  1N33 B;  2UXC O;  1KC8 W;  4JAS A;  1MOF A;  3QG5 A;  1QQC A;  4JYA B;  2O57 A;  1IX9 A;  4K8X A;  3DXR A;  4ZOL A;  5JCO C;  4EEQ A;  1G8M A;  2UXB B;  3OUS A;  3RW0 A;  1T5E A;  5LOV A;  3FB5 C;  1YJN V;  1LUW A;  3S3W A;  1NZ6 A;  3CCE V;  2RJZ A;  5DN6 G;  1NVP D;  1S5J A;  5JH7 B;  2IJI A;  2JJ2 G;  5IYD O;  1QVG U;  1FJG O;  3KCY A;  1EFR G;  3R65 A;  4GCZ A;  3LDC A;  1KMI Z;  2N74 A;  3AEI A;  1X4T A;  2LW7 A;  4DXW A;  1YIJ V;  3G67 A;  4W4K A;  2HR3 A;  5EZY A;  4EB6 A;  2DMX A;  1AIL A;  2BCC H;  2WA3 A;  1WAZ A;  2FB5 A;  1D2D A;  1VQ8 V;  3M99 B;  5CMU A;  5D5P A;  4NKG B;  5KAI Z;  2VWJ A;  2F4V O;  2D3O W;  4X1Y A;  4TUY B;  1P84 F;  2BSK A;  2IW5 A;  4DR5 B;  1XEQ A;  5L3C A;  2XUM A;  1I7F A;  3L74 H;  1WA8 A;  3NR7 A;  4FLV A;  3W7W A;  1OCO B;  2HFE C;  3MDS A;  3THO A;  3AG3 C;  3L75 H;  2NN4 A;  2IJJ A;  4MVR A;  3QF7 A;  2QE7 G;  3H9V A;  4UXN A;  1J95 A;  2FTK A;  5LYJ A;  2WWW A;  2BOB C;  1HNZ B;  2PI5 A;  3CEI A;  4G28 B;  2CTP A;  1FAF A;  3KZI Z;  5H6R A;  2QJ1 A;  4LF9 O;  4CBC A;  2HJF C;  1VF6 C;  2XT9 A;  3T1Y O;  2E76 B;  1GO3 F;  1R73 A;  3K9S A;  2CH7 B;  2UUB O;  2VRZ A;  2ZQM A;  4OX9 O;  4CH6 A;  3BCC H;  4DRX B;  5KHK A;  3E8H A;  1OV9 A;  3HKC B;  1Z2G A;  2B1G A;  3I5D A;  1SQG A;  3ETQ A;  1VQP V;  5CA0 B;  1ZX3 A;  3H1K H;  4J9Y B;  2YXH A;  4LC1 A;  3CCM V;  1QU7 A;  4LFB O;  3G6B A;  3UO2 A;  2EIN B;  3JAM N;  1NVP B;  1VQM V;  3HKE A;  4GX0 A;  4BIZ A;  4G27 B;  4LCU C;  3RYH A;  4F6R A;  4FIP C;  5EYP B;  4D7T A;  2GHY A;  1K5Q A;  5IYB O;  1SA0 B;  2WA4 A;  4FLW A;  5C8Y B;  3LUT B;  4DW1 A;  2E3C A;  5IY5 B;  2AGA A;  2EIJ B;  5CBH A;  5LGN A;  4J41 A;  1GMG A;  3DC5 A;  2HHH B;  2XAQ A;  1H2N A;  2Q7G A;  3BVO A;  4O4H A;  1YHQ V;  1OCC B;  2ETN A;  4G2K A;  2P4K A;  2WLM A;  1ZAU A;  3JSL A;  1OHH G;  5C93 A;  1SES A;  1M90 W;  1FFX A;  4YIO A;  4GX1 A;  2Y0P A;  1NBM G;  1GN3 A;  3SYC A;  5LXT A;  3WU2 Z;  5CB4 B;  1FXV A;  2N05 A;  4HNA A;  4DV3 O;  1H8E G;  2ILM A;  4LR3 A;  4X65 O;  4X1Y B;  2ZXW B;  2HG5 C;  2Q6A A;  2QDO A;  1YTF B;  2PF4 E;  2YIA A;  4JPR A;  3B09 A;  4WCE V;  4XBF A;  2R9R B;  3LSU A;  4XDL A;  3OMI B;  3JD3 A;  1NH2 B;  2ADQ B;  2XHB A;  4BIU A;  1N32 B;  4P9P A;  1HWY A;  1HDJ A;  1JR9 A;  2WLH A;  1GN2 A;  4NVP A;  1QHT A;  2Y0I A;  1KBH A;  1WPB A;  4LBE C;  4BWA A;  5DED A;  5AG2 A;  2Y4T A;  1V54 B;  1ZL8 B;  2X7R B;  3K79 A;  4U3F H;  2UU9 B;  2IH3 C;  5IJ9 A;  5CA3 A;  1BT8 A;  2CAZ C;  4LP8 A;  1KP3 A;  2Y69 C;  4FMT A;  3EVK A;  3JAR A;  4GKK B;  3LDD A;  2P6J A;  1OCZ C;  1Z5V A;  4W4L A;  1M9N A;  4TWK A;  4K0K B;  1SQX H;  5BR8 O;  4I4T B;  1H2M A;  1HNW O;  2KKW A;  2GSM B;  4EFB A;  1WP8 A;  4OX9 B;  1KYO F;  2F43 G;  3ZJZ A;  5EZY B;  4EB6 B;  4MVS A;  1XMQ B;  4IYH A;  4K3A A;  3JCZ A;  1GM7 A;  3CPW U;  1QR8 A;  2X6C A;  3OE7 G;  3FYE B;  3ZX6 A;  4X9Q A;  2QTO A;  4NTW A;  1JX9 A;  1CXZ B;  1JFF B;  2E75 B;  3ABL C;  2B5U A;  1KP2 A;  1Y67 A;  4IIJ B;  5B1B C;  1L1F A;  2EBO A;  3K03 A;  3UKM A;  2CTR A;  4ASU G;  4YY3 O;  4NXM O;  1XL6 A;  1SS3 A;  2JS3 A;  4DV5 B;  4O4J B;  1TUE B;  3QVN A;  1SQB H;  3G6E V;  2QKC A;  3E2E A;  3TXQ A;  3HB3 B;  1S0V A;  4CH4 A;  5IT9 N;  3HKB B;  1H2G A;  4L8J A;  4I50 A;  3J7A U;  3TXS A;  2M6Y A;  4DV2 O;  1PD3 A;  2YDE A;  5JJN B;  3MHH C;  1FYJ A;  3FB7 C;  2YI8 A;  4PD4 F;  3CXH F;  3ZMU A;  5B3S C;  2AHZ A;  4MW8 A;  1GH6 A;  3SYQ A;  4JAV A;  1MZF A;  3RYF A;  1GM8 A;  3UO3 A;  1N34 O;  3BHP A;  3LNN A;  4D6T H;  1Q6H A;  5FNV B;  3TET A;  3AK1 A;  4YHH B;  3ABK C;  3BFR A;  1Q81 W;  3ZS8 C;  1PL4 A;  2RDC A;  3OT7 A;  3O65 A;  1TUB A;  1K33 A;  1HW7 A;  1QBZ A;  5IY5 C;  5LP6 B;  5H6Q A;  3A0B Z;  1B04 A;  1M4U A;  4X88 A;  3VOU A;  1VQK V;  1I5X A;  5FL7 G;  3K5O A;  5H5N A;  2XAF A;  3IJ4 A;  1MMM A;  3SPJ A;  5D5Q A;  4JI3 O;  3QTC A;  5JJE B;  3OTF A;  3CRR A;  3K59 A;  2CTW A;  4OPA A;  3E86 A;  3CCS V;  2GUZ B;  3OGC C;  4DV0 O;  3ZHT A;  4RWU A;  1Y6X A;  1N34 B;  1IZ3 A;  2PI4 A;  4LF6 O;  3HKE B;  4NR1 A;  4FVM A;  2DN9 A;  5CN0 A;  2ZT9 B;  1GN6 A;  4JI0 B;  5IYZ A;  3K5N A;  4UCT A;  1MNG A;  4BAY A;  2ZM6 O;  3DGE A;  1YCI A;  1KQS U;  1Q5O A;  5FPR A;  1SF9 A;  4J11 A;  1NTZ H;  1PKX A;  2UUB B;  2YUA A;  1VF6 A;  1Z5W A;  3ASO C;  1BMF G;  1EN4 A;  5IJ0 A;  4LF9 B;  4PDM A;  4YJ2 B;  2GTA A;  2RNB A;  3OR7 C;  2UXN A;  4CH3 A;  2CK3 G;  4X64 B;  2A9H A;  2YC0 A;  3C3T A;  3K08 A;  4JI2 B;  2IU3 A;  4X64 O;  5E1A C;  3SPH A;  4B3M B;  1GM9 A;  2P7T C;  3K5L A;  3RYF B;  5DM6 V;  4IHJ A;  2IM9 A;  1Q90 D;  3QNE A;  3F7V C;  3SR2 C;  4X1I B;  4O2A B;  1R1B A;  5KMG B;  1S5H C;  4JTA B;  1SQF A;  2ITC C;  1WPX A;  1EN6 A;  1WA8 B;  2ADP A;  1HR0 B;  4DR5 O;  2H8P C;  1AJP A;  2Z3Y A;  3WB1 A;  3ZHV A;  3ZHQ A;  2UUA O;  1EZV H;  2R70 A;  3P3P A;  4I55 A;  4DK0 A;  4GKK O;  3TJT A;  1NS1 A;  2H94 A;  3VQY A;  1SER A;  4FLZ A;  2OIE A;  3RVY A;  3WG7 B; 
#chains in the Genus database with same CATH homology
 5BR8 O;  1IBL O;  4DR4 O;  5LL6 Y;  2AGA A;  4OPA A;  1HNW O;  5FLX N;  4JI2 O;  4DR2 O;  1AIL A;  1XNQ O;  2UUC O;  4DV5 O;  2JRI A;  2Z0A A;  4DV0 O;  1D2D A;  4JV5 O;  4JI0 O;  2F4V O;  4B3R O;  4DV4 O;  3OTO O;  4JI8 O;  1N32 O;  5LMU O;  4LF6 O;  1AB3 A;  4JI6 O;  1XEQ A;  4JI4 O;  2UU9 O;  4OPH A;  2FKX A;  1N36 O;  4JI1 O;  1YZB A;  2UXB O;  4GKJ O;  4LFC O;  4LF8 O;  4KHP O;  2ZM6 O;  2E5L O;  3T1H O;  2DJV A;  4YY3 O;  4NXM O;  2UXD O;  1DK1 A;  4B3S O;  3J81 N;  3SDL A;  4DUZ O;  4DV3 O;  4B3T O;  4DV7 O;  4DR3 O;  1HNZ O;  4X65 O;  3R66 A;  3J80 N;  2VQE O;  1XNR O;  5IT9 N;  1IBK O;  4DV6 O;  2HHH O;  4NXN O;  4LF4 O;  4LF9 O;  5BXZ A;  1N33 O;  3J7A U;  2UXC O;  4DV2 O;  3T1Y O;  4X64 O;  1IBM O;  4LF7 O;  3RT3 C;  2DOS A;  1FYJ A;  2UUB O;  1I94 O;  1XMQ O;  4OX9 O;  4LF5 O;  1N34 O;  1FKA O;  5A2Q N;  4DR7 O;  1R1B A;  2VQF O;  4DV1 O;  4A5U B;  1KUQ A;  1R6T A;  1XMO O;  1G1X B;  4LFB O;  4LFA O;  4DR5 O;  1F7Y A;  4K0K O;  3O65 A;  4DUY O;  3JAM N;  3F5T A;  4X66 O;  1A32 A;  5IWA O;  2UUA O;  1FJG O;  5LMN O;  5BY1 A;  4B3M O;  3M8A A;  1HR0 O;  4GKK O;  1X59 A;  1HNX O;  4JI7 O;  2N74 A;  2ZKO A;  1NS1 A;  1J5E O;  5H5N A;  4DR1 O;  4YHH O;  4X62 O;  2LW7 A;  4JI5 O;  4AQY O;  4JI3 O;  4DR6 O;  4JYA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...