4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
5LL6Y 4NXNO 2UU9O 4LF6O 1IBMO 1R6TA 1FKAO 5BXZA 4A5UB 1FJGO 4GKKO 2UXCO 1XNQO 3M8AA 4JI1O 3JAMN 4JI2O 2ZKOA 2N74A 2AGAA 4B3SO 4JI5O 1J5EO 4DV4O 4KHPO 1G1XB 4DR6O 5IT9N 4JI4O 4GKJO 1N33O 3RT3C 3SDLA 2FKXA 1N34O 4JI0O 3O65A 4LF9O 1KUQA 1AB3A 4JV5O 1HR0O 1HNWO 4DR1O 4AQYO 4LF5O 4DR2O 4X65O 4X66O 4DV0O 2F4VO 2HHHO 2VQFO 1A32A 2UXDO 1HNZO 4YHHO 4DV5O 2VQEO 4JI7O 5BR8O 4JI6O 4JYAO 2DJVA 3F5TA 1XEQA 1YZBA 1F7YA 5H5NA 5FLXN 4NXMO 2ZM6O 1X59A 4DV1O 4K0KO 3T1HO 4DR4O 4LFCO 1R1BA 1NS1A 4DR3O 4X62O 3J80N 1HNXO 4B3RO 5IWAO 4LF7O 5A2QN 3T1YO 4DV3O 4X64O 3R66A 4LF8O 1FYJA 5LMUO 4B3MO 1N32O 4DR5O 2JRIA 1AILA 1DK1A 4LFBO 1IBLO 4DR7O 4B3TO 2E5LO 4OPHA 3OTOO 4OPAA 2Z0AA 1I94O 2UXBO 4OX9O 2UUAO 2UUCO 1XMOO 4JI3O 5BY1A 4DV7O 3J7AU 2UUBO 1IBKO 4DUYO 1D2DA 4YY3O 4DUZO 1XNRO 4DV2O 1N36O 1XMQO 5LMNO 4LF4O 3J81N 4LFAO 2DOSA 2LW7A 4JI8O 4DV6O
chains in the Genus database with same CATH superfamily
1GKFA 5L3FA 2FL4A 4OXSA 4DYLA 4RWUA 4IYIA 3ASOC 1IBMO 2IBZH 2ZR2A 3IJ4A 3T4ZA 4JI1O 3BPZA 1NT2B 4JASA 2DWDC 1NQTA 4UB8Z 1M56B 2F93B 1H2GA 1OCZB 2JIZG 4LF9O 2RN9A 2RMKB 4BIZA 5LGTA 4Q20A 2UXNA 3ZHSA 1XHZA 4I4TA 4MS2A 1O9HA 1H8HG 1JFFA 4PD4F 5KHHA 3LDEA 3JAKA 1EN6A 5KHGA 3L72H 3ABMC 3CHXA 3OM3B 4ZI7B 2UXDO 4PA9A 1J95A 5JVDB 3RWRD 5DM6V 1P49A 4FLTA 2Y4UA 1WA8A 3ZRWA 4NXMO 2LJ2A 4WBNB 3CCUV 3HKBA 3UO2A 1MG1A 1B04A 1VQ7V 2RJZA 3FD9A 2CTPA 4X62O 3J80N 1ROPA 4ASUG 2HHHB 3AEIA 3OAAG 4JTCB 4MTFA 4YHHB 2NR5A 2P90A 2Y4TA 1VQNV 4UCSA 4YJ2A 4JYAB 4DO2A 4EB6B 5B1OA 4DR7O 3KKYA 1HR0B 1Y4MA 1N0JA 2Q9LA 4BR6A 1OCRC 2P4KA 4UVCA 5B3SB 5FPRA 4RQFA 3AK2A 4X1YA 1D2DA 2QM4A 1VQ5V 2V1DA 1P4RA 4CZZA 4GX2A 1XL6A 4B3MB 2YIBA 4JI6B 1KC8W 2OTLV 2KB1A 2R72A 5BXZA 2YS8A 2DYRB 2E74B 4FM0A 3T1CA 2N74A 4JI5O 2UUCB 2Q0AA 3EHBB 3K5NA 3N2KA 4DV7B 2F43G 2YDEA 3F5WC 3WG7B 2LO1A 3JD3A 2QM7A 4IGGA 1DTOA 2W6IG 4GYCB 2GDSA 4FJCC 2ILMA 5KMGA 5B1AB 3CCMV 4O4HA 4DV0O 4PI2A 1Q86W 1NTMH 1I5XA 4I4TB 1SRYA 1M5IA 3RYCB 2HVJC 4XDKA 3H1JH 4GZRB 3CSXA 3I55V 3JALA 3ASOB 1NKDA 4JV5B 2ZNJA 1ENVA 4JYYA 4DR2B 4LFCO 1R1BA 1Y74B 4YJ3B 1K3EA 2B5UA 2FYUH 1NS1A 3OR6C 4J10A 3JCZA 4FLZA 4NVPA 2BOBC 2KG7B 2XTAA 5J2TA 1JPXA 4JTDB 5LA6A 4YIPA 5IJ9A 2JRIA 2UXXA 5IYZB 4CS2A 3CPWU 5KHJA 2HEPA 4YJ2B 4GCZA 5C8YB 1M90W 5GTIZ 2JDIG 1G4YB 3ABMB 1VQ4V 1OCCC 3QF7A 3OW2U 5F2VO 2UUBO 4DK1A 3AG4B 4YY3O 1TVKA 1VMGA 2ZDIC 1VQ6V 2QTOA 2XAFA 3B8MA 4KUMA 2AHYA 2QTSA 1WPBA 3L70H 2QKCA 5DECA 4GX0A 1K8AW 3T4DA 2BE3A 2E5LB 1SQGA 1BL8A 2M7WA 2PUSA 2AGAA 4MSWC 2LGQA 2QWNB 3GB7C 4I50A 1YJWV 3DXRA 1WP8A 1NTKH 1P84F 4DUYB 1P7GA 2Q68A 5EIBC 1SF9A 2XASA 2Q73A 2IU3A 4F4LA 4LFAB 4JZGA 3DSQA 1CEZA 3SPCA 4N21A 2FMLA 4I55B 2XAJA 2UXBB 3HKCA 3CS5A 3K03A 4TV8B 4FLXA 5BR8O 3KZIZ 2ZE7A 3N2GA 4J7JA 1K9MW 2H94A 5B5EZ 4JI0B 2WSSG 3ABLC 4TUYB 4ABMA 5L3BA 1GAXA 1H8EG 3JALB 2ZINA 5JQGA 4W4LA 2F23A 1NZ6A 1JCHA 2LFRA 2ZIOA 3SYPA 2R9RB 4WFEA 3JASB 3AG3C 2YUAA 4MVZA 3AK3A 3E2EA 2QSAA 2HG5C 3ZN1A 1KMIZ 4H13B 4BWAA 1Z5WA 5IJ9B 3W7SA 4J80A 4J7ZA 4JPRA 3ETEA 2QE7G 1S3JA 3ETQA 4HNAA 2OWOA 4X20A 1ORQC 4RAIA 2B9ZA 3TJTA 3CYOA 1YTFB 5H6RA 4ZHQB 4O2AA 4X1KA 1TVKB 4NXNO 1VQMV 2EJ7A 5J2UA 4I0XB 5LYJA 4FPPA 4K0KB 1EN5A 2ZKOA 3BFRA 4LNUA 3RYHB 2LGWA 3JD0A 4RQEA 1GO3F 1WJZA 1B3QA 4DUZB 4DV3B 4I50B 3SJAC 2P7TC 1EZJA 2B1GA 3UO3A 4ZOLB 4JI8B 4HAMA 2CUGA 2AXTZ 2UU9B 1OCCB 3L74H 4B3TB 2QWRB 2E75B 1QLNA 2QKSA 5EYPA 5KAFZ 1VF6C 2N04A 2PI5A 1M57C 3HKCB 4FZ0A 2HLDG 2BSKA 2DJVA 3FB6C 1N34B 1IZ3A 3K3WA 3VQVA 5B66Z 1V54C 5IE9A 1NVPB 1L1FA 2M6YA 3E22A 2YXHA 2P06A 5LHGA 4B7EA 4DR4O 3AG1C 3KG2A 3CCSV 3W7UA 1FJGB 3GWKC 3CC4V 5JQGB 5KA5A 1SA0A 2PI4A 3VOUA 1ZL8B 4LF8O 4I5SA 4DV5B 4JI4B 1SZTA 5B1BC 3LUTB 2Y0IA 1GH6A 1GRJA 2Q7GA 5JH7A 1AR5A 1YEWA 5GTHZ 5CB4B 4MVMA 5CA1B 5CA0A 5KHIA 1V9PA 3HPLC 1BZKA 1ZLZA 3X2QB 1CP9A 3CJHB 3UM7A 4HNAB 1OCOB 1AR1B 3BA8A 1I0HA 4X20B 3CWBH 4JGSA 1HNZB 4AHCA 3O9OA 1DGSA 2DQ0A 3STZC 1S5JA 1IVSA 2JJ1G 4X1KB 1R6TA 2UXCO 3TK1A 1XQ8A 5L3GA 1IXBA 5LHHA 1PPJH 4FLWA 3CD6V 4DV4O 5IT9N 1US6A 1YHQV 1FPOA 1HDJA 3E83A 3O65A 3IGAC 3JARA 5LP6C 4CH4A 3LDDA 2YSUB 5IY5B 4EFBA 2VQEB 4LBEC 1SQQH 2B1IA 2YEVB 1M4UA 4H33A 1AJQA 2VS0A 1U97A 1VQ8V 3ZN0A 4GKKB 4CS4A 2X6CA 4O4LA 3GVMA 4I9WA 4U7NA 3SPJA 3PN1A 4JI2B 1TUBB 1AI6A 3D36C 3EVKA 3NXSA 1IXMA 2ETNA 3JATA 2YC0A 4P9OA 1L0NH 1KKCA 1Q5OA 3FYEB 3FB5C 4DR1B 3ZMZA 3WB0A 2ZIMA 1IX9A 5B3SC 2CTWA 1SERA 2E3CA 1FYJA 2EIJB 4TV9A 3L73H 1I08A 2EX3A 1CPYA 3CRRA 1Q3EA 1SQBH 1JX9A 1RFYA 1WNSA 3DTUB 1KKDA 3K04A 5H2FZ 4IYHA 4L8JA 1AJNA 1QU7A 1YDXA 2WAMA 4AQYB 3A8TA 2UUAO 1H2KA 4O2BB 4JI3O 3FX7A 2DYRC 1Q6UA 4Q6GA 3ABKB 2MW2B 3BVOA 1BS3A 4DV2O 2HKOA 4K8XA 4DV6O 4NTXA 1K34A 1AROP 1V54B 1XL4A 1XMQO 2GUZB 4RUFA 1TAEA 1LUWA 2ZR3A 5EZYB 2QWQB 2Y0PA 2EZPA 1I94B 5B1AC 1VQLV 1TUEB 3OE7G 2Q6AA 5B1BB 4KFMA 3SDLA 2N05A 3SJCC 3W7WA 1K92A 3OEHG 2YI9A 4DV6B 3JARB 1YJNV 2QKAA 4U3FH 1K33A 1GN6A 1K5SA 5JCOA 4QIWF 1V55C 4P2ZA 3ZHVA 2PYLA 2HP8A 4JI1B 3E86A 1JVMA 1AP6A 1N4CA 1QCEA 3RFRA 3CE2A 2OCCC 3R65A 5CBFA 1YVWA 1YJ9V 1BHBA 1W59A 3TXSA 2ZE6A 3OD4A 2BTQA 3ABTA 1AP5A 1MABG 3Q4HA 3U0ZA 4HYOA 1W0JG 4BAYA 1K73W 4DR3O 1XUQA 1FFTB 2QA4V 1SQFA 4J9YB 5LP6B 3HKEA 1Y76A 1MSDA 3AG4C 2A9HA 3VBBA 2ARHA 3JAWA 1KP2A 1IBLO 2DN9A 2WLIA 2PTMA 4NXMB 3RYIA 5LOVB 4MVSA 1I7FA 1HW7A 4JZ2A 3F7YC 1NH2B 1YF2A 2KKWA 3H1IH 3CB2A 3JD1A 3E8HA 2Y69C 3QVNA 4TWKA 3CXCU 2PY5A 1R6NA 3A2FA 5JWPA 4FM1A 2DOSA 3B4SA 4UFZA 5HFMA 1F4NA 1I5YA 3CCRV 1YSCA 3OR7C 3UT5B 2XNDG 3JAMN 3ZHRA 2GHYA 3P3NA 4N23A 4B3SO 3P3PA 4WFGA 1G1XB 3B77A 4GKJO 3OFNG 2CTRA 3SPHA 3K0DA 2AZ2A 1VF7A 5CBGA 4LF7B 2EINB 1H2LA 4X9QA 2JVDA 2JGDA 5KX5A 1Q82W 1HR0O 5IYDO 1QHTA 2PYJA 4IL6Z 4IHJA 5L3EA 1R6KA 2QEXV 3ZEDA 3SPIA 2WLMA 4JI5B 4WFFA 2BOCC 4B7KA 1M1KW 5IYCO 2CK3G 4JI7O 4JI6O 2JEXA 1Q43A 1YI2V 5FLXN 1IDSA 4MT8A 2YICA 4UCVA 1PL0A 2WLLA 3E8FA 5D5PA 2ADQB 3AK1A 2RCVA 4MW8A 4DV0B 2P5OA 4PDVA 1K97A 2JS3A 1OZ0A 4J41A 4P30A 1JFFB 4X64O 3E35A 3BY6A 3JAKB 5KLVH 4DR6B 1N32O 1MZEA 3VQYA 2X7RB 2DWEC 5B1NA 1Y6XA 4CBCA 1BSMA 1V55B 1WA8B 3JAWB 3ZRWB 2WLIB 2XAGA 2LFSA 4PDLA 4LFCB 1E79G 2OCCB 3HKBB 3JSLA 1PKXA 3J81N 3BCCH 1VEWA 3OMNB 3QO8A 2Q69A 1Q7YW 1QR9A 4DV1B 5KUKA 2F66C 4X1IA 2ZE5A 4UCUA 2UUBB 2ZNIA 2FKXA 1XI1A 2XOKG 3CRAA 4X1YB 5GONA 1GM7A 2HFEC 1B6QA 3ZMUA 4CH3A 2K9PA 1HNWO 4YIOA 3QO7A 1H2MA 2D3OW 4E2LA 1QLEC 4XDLA 4IHJB 1JQ0A 1PL4A 2Y48A 3TCUA 2F4VO 4OX9B 2Y69B 3C3SA 3ZHUA 5C93A 4MW3A 4FLYA 4Z1MG 4UVBA 1S5LZ 2RDCA 1D5AA 3N2KB 2ZM6O 2Q67A 4DW0A 4FFBA 1PNLA 2WLLB 5FNVA 4MTOA 1E1QG 5KMGB 2EIMC 5IWAO 1BT8A 1Z5VA 4O4HB 3X2QC 3DGEA 2G38A 5LBQA 1OCOC 4MVUA 4LFBO 3FB7C 1RM1C 3K5OA 1JA8A 3LNNA 4J42A 1WB7A 4LR3A 1QBZA 1EBOA 4LH7A 3CXHF 3OMIB 3OTOO 1S77D 2UXBO 2LP7A 1XMOO 4WFHA 1BGYH 3RN4A 4PELA 5BY1A 3I5DA 2WWWA 5K1PA 3IAYA 3L75H 1N36O 4FVMA 5LMNO 4LF4O 1KU9A 1E1RG 1XOUA 5J2TB 1WLEA 4F6RA 5LL6Y 2HJDA 5LA6B 1KECA 1KBHA 4BIUA 5IY5C 1MNGA 3APOA 4NYKA 1KD1W 3A0RA 2EJRA 2QM8A 4DRXA 1ZWIC 3RT3C 3ZMSA 2GBOA 4JAUA 1AR4A 4AILC 2Q7HA 2ZQMA 3BAAA 4QJFB 5J9PC 3L71H 4DR5B 3ZX6A 3H1KH 4KP4A 2A0LA 3K58A 4WFBV 5GONB 1QR8A 3ZJZA 4BIOA 1LUVA 4RO2A 1KB9F 2WLJA 4CC5A 2EILC 1T5EA 3MDSA 3DXRB 1AI7A 2EIJC 5JJEB 4JYBA 4K0KO 3HKDA 3FAVA 4PA4A 1YTFD 3WU2Z 1F4MA 1HNXO 4B3RO 3EFFK 1Z2GA 4DV3O 1RP3B 1GN4A 4FLVA 4ZBMA 4L87A 1HWYA 3ABKC 1PD3A 2A79B 4FIPC 5IJ0A 3G6BA 4LCUC 3N2GB 4B3TO 1QLEB 2R9AA 4DW1A 3G71V 1PV0A 1JR9A 3H1HH 1MSWD 4W4KA 3RGBA 3APQA 4JAVA 4FMTA 2OTJV 4X66B 4JF3A 3ETGA 1R3JC 4J7KA 2MK3A 3QNEA 3RVYA 1FD9A 4G2KA 2LW7A 3E89A 3AG7A 1NTZH 2CH7A 4U3JA 4K3AA 2KSDA 1FJGO 1YITV 3GWOA 3K06A 3K59A 2EIMB 5EBLC 4DXWA 5ITZA 2C2AA 5EBWC 4JI4O 1NVPD 1N33O 2W0XA 4EKWA 3M99B 3T1YB 1RM1B 1FXKA 1XILA 1BQ0A 3W7TA 1UPGA 1NU1H 1QVFU 3N27A 4LH6A 1Y66A 4O2AB 1RSOA 2Q5ZA 5EIBD 4X65O 4O4IA 1S76D 1AI5A 5LXTA 5CA3A 2DQ3A 1AJPA 4K35A 5J2UB 3MHHC 1HNZO 5LYJB 4UVAA 4DV4B 3E8BA 4UCTA 4OGQB 1KP3A 4LNUB 1Q6IA 1BCCH 2DMXA 1XEQA 5CMUA 4YXWG 2KQXA 4TQDA 3CP1A 2QGNA 2R9IA 3T1HO 1W2BU 5H9CA 1WAZA 1VQPV 3HKDB 1MA1A 3FAVB 1Q90D 4UXNA 1K4CC 2VWJA 3SJQC 4PJ0Z 3ZCCA 1G6UA 1N0NA 5LMUO 1JMKC 4D6TH 1IURA 1MOFA 5EYPB 2WA4A 4E4EA 4IT5A 2FB5A 1UJWB 2BCCH 1H2SB 3IC7A 2BSKB 3ZHTA 1ZSPA 3W7XA 4LF5B 3P30A 4WCEV 3E22B 2GTSA 1VQ9V 2EILB 3A0BZ 1SS3A 1NBMG 3H9VA 2Z5UA 2P67A 1NR1A 1XNRO 2VQFB 1WP7A 5GW7A 4GT1A 3S3XA 2VRZA 1SA0B 3PJSK 1S72V 2EINC 4QE9A 3SYQA 2XHBA 3U10A 2WLKA 4LF6O 1FAFA 1WPXA 2IJJA 2EULA 2AHZA 1XNQO 1YIJV 5JH7B 1PNMA 2UUAB 1J5EO 4KHPO 4JI3B 2QDOA 4ZIBA 5CA0B 3TETA 1SQVH 5DEDA 5JCOC 2JK5C 3IC9A 4WBNA 4DV2B 4NKGB 1GN3A 1PP9H 2AZ0A 1NI8A 1XMQB 1GM9A 4CH5A 4AQYO 1QNMA 3OT7A 1H2NA 2ITDC 4ICGA 4O4IB 1O9GA 3H01A 2GTAA 3JSNA 3WFVA 3ZRSA 5LXTB 4EB6A 4B08A 1GK9A 1BMFG 3LSQA 1IBKB 4G27B 4Z1VA 1F7YA 1G8MA 2L35A 1N8RW 2ATKC 3BEHA 4FK5C 1UFIA 2IH3C 1IBMB 2ZXWB 2YIAA 5IYBO 1P7BA 4O4LB 2IW5A 4MVOA 2IH1C 3KCYA 3SJBC 1DK1A 5AG2A 2ZT9B 4LF9B 1JJOA 2DYSC 5L3DA 5LGUA 3F7VC 3I56V 3JATB 1THZA 4WF9V 2PZSA 1OHHG 4R50A 3ETDA 1SKVA 3SYAA 3RBZA 4DR3B 2CGNA 3CRQA 3OGIB 3WB2A 2Q7EA 2UXDB 4ZKIA 1SESA 3K79A 5FPOA 3K9AA 2JEUA 2HVKC 4TV9B 1IBLB 4CH6A 3OTFA 2PF4E 3G80A 3UCSC 3RYCA 5D5QA 1L0LH 2YXLA 4LC1A 4R6ZA 2JS5A 4X62B 4U7OA 2NNUA 4UCOA 4X88A 2XAHA 1Y74A 4YJ3A 1LR1A 3AG2C 1COWG 4MVQA 3B40A 3LSSA 4DR7B 2KG7A 1ZUQA 2CDYA 1F51A 2X0LA 2HHHO 5IYZA 4PV1B 4B3SB 3ZS8C 4YHHO 4GKJB 1JJ2U 3RYFA 4JYAO 2IJHA 1YCIA 5C8YA 4NTYA 3RVZA 1X4TA 1NH2D 4XDJA 2XAQA 3CCJV 3ZRXA 2EBOA 2IJKA 1FS0G 2Q4PA 5E79Z 2A3QA 1SC5B 1VIBA 4LF7O 1K5QA 2IU0A 1R73A 4D7TA 4B3MO 3RW0A 4JI7B 5IDJA 3H1LH 3QG5A 5BMVA 1URFA 4MTGA 3SR2C 2W0FC 3ABUA 3LSUA 2ZD9A 3FYIB 2Z0AA 5CBHA 2P6JA 2UUCO 2BTQB 2BTOA 3S3WA 3Q4HB 4DV7O 4UB6Z 1MMMA 4X64B 3CC2V 1N32B 4R7CA 1F23A 4I55A 3HKEB 1KQSU 1Y76B 3ZIAG 1MZFA 3CCVV 2EIKC 1M93A 4TV8A 2X6AA 4GX1A 1DLBA 3RYIB 3EXAA 2H3OA 4DR6O 5KUMA 3SPGA 1AI4A 3K57A 4EFEA 3ML0A 4FM2A 4UCRA 4TUYA 2HR3A 4MTXA 1GN2A 2K1EA 1EZVH 3MAQA 2DYSB 4JV5O 5CN0A 1XBLA 3P32A 2QJ1A 4DR2O 4FFKA 4H44B 2QR4A 2OCHA 1VF5B 3BA9A 3NR7A 2FTKA 3JASA 4EEQA 2V7QG 3B2EE 1A32A 1L8DA 3BABA 5LHIA 3CRCA 4QPJA 2OYQA 4YY3B 3HR0A 3CEIA 4R8CA 3SGIA 3G67A 1FFXA 3RYFB 2E76B 5EC1C 1SQPH 1K4DC 4LWSA 1XHXA 4DV1O 1HNWB 2QWOB 5HFLA 2JGDB 5KX5B 4H37A 1YXBA 4QPKA 1WB8A 2OIGA 3OGCC 4ZHQA 5EC2C 3D3QA 2F4VB 3BHPA 2D2CB 1B06A 2PGGA 4I0XA 3AG2B 1R3IC 2E5LO 5BMVB 3RYHA 2ZM6B 3ZMVA 1DF4A 4OPAA 4OX9O 2JGUA 4MVRA 3K9SA 4P9PA 5DN6G 5TISZ 3J7AU 1QVGU 4GX5A 3G4SV 4DUYO 5IWAB 4ZOLA 1TA8A 2ITCC 2YIBD 4TT3G 2NN4A 4TQFA 1AVMA 5JJJB 4LFAO 5BR8B 2OT5A 1R3KC 3VQWA 4LFBB 2GSMB 1LNQA 1OCRB 3FKSG 2ZDIA 4FZ1A 3VQXA 2P22C 3OTOB 1XMOB 4QGPA 3ZMTA 1S0VA 3D3IA 4JAAA 3B09A 3KCXA 5FL7G 4JI0O 3UKMA 1N36B 1KUQA 2RQ6A 1TGOA 2YI8A 5LMNB 4LF4B 4UV8A 5KAIZ 2CAZC 5JJNB 2H8PC 5KHKA 4UV9A 4K8ZA 2R70A 4I7ZB 3FFQA 1ZL8A 5LGNA 2WLHA 3ZHQA 1R3LC 1RPOA 5E1AC 2LQTA 2F95B 4X1IB 4RUEA 3F5TA 2WA3A 4PI0A 5CB4A 5CA1A 3ASNC 3CCQV 4HZ3A 2AW9A 2EIKB 1FFXB 3CJHA 4NXNB 1HP8A 4PA7A 4LWSB 4TOIA 2Q8VA 3K5LA 2YIDA 5A9GA 3BRCA 3STLC 3R66A 3OUFA 4DR5O 2O57A 3CX5F 3ICXA 3MD0A 4QE7A 3ZBHA 3E8GA 2ADPA 4OPHA 2IM9A 3DC6A 4LP8A 1VQOV 2IJIA 4FFBB 3OUSA 1HNXB 4B3RB 5L3CA 5FNVB 4DUZO 1RPRA 2YEVA 3LNMB 1K7DA 4JI8O 2EZOA 1DF5A 5EBMC 2UU9O 2OIEA 1XREA 3T2MA 4FLUA 3SYCA 1TUBA 2QWPB 4A5UB 1BHAA 4I9QA 1FXKC 3M8AA 4CC6A 4BW5A 4DR4B 4AI8A 3CC7V 1Q81W 4H0LB 2L6LA 4GUNA 2HJFC 1N34O 4HBNA 4LF8B 4IIJA 1S5HC 1JOYA 2DE0X 5EK0A 2CGOA 2VWKA 2Q0OC 4F6RB 1SETA 3CCLV 4X66O 1U96A 1OJHA 3WB1A 1GM8A 4DK0A 2ZXWC 1VQKV 4DV5O 3CMAV 2ZCEA 4WFAV 1N33B 1FXVA 3K5MA 3ZRVA 1PM9A 1EN4A 3CCEV 5H6QA 1YZBA 4DRXB 4X8AA 4KXRA 4O2BA 1VF6A 4PA6A 2JJ2G 1ZAUA 3M7MX 4X65B 2UXCB 3K0GA 1OV9A 1Q8IA 3OMAB 1EFRG 3T1YO 2GUZA 3C90A 1M56C 4J11A 1OCZC 3ABLB 3JD4A 2ZE8A 4J9ZB 3C3TA 5EZYA 2ODMA 2V4DA 2CE4A 2F1MA 3B8NA 3T1HB 1VP7A 4O4JA 1EM1A 4JTAB 4PDMA 3AG3B 3A0HZ 1SQXH 2WPDG 3ASNB 5LMUB 3L9DA 3TGUH 2VQEO 1M9NA 4JYCA 1FKAO 4GKKO 5IJ0B 2RNBA 2YXYA 1Y67A 2XUMA 4JI2O 3UQ8A 3U11A 3MHSC 1FXHA 4GLXA 1GTOA 1CXZB 1XNRB 4Z2WA 1AB3A 4F6EA 2P4VA 4NTWA 5KA6A 3IFXA 4DR1O 4LF5O 4IIJB 1XDCA 5K1XA 1SZXA 4LF6B 2X6BA 4ZI7A 1PNKA 2CH7B 1XNQB 2WLNA 4U3JB 2LW1A 5LP6A 5JVDA 3JD2A 2VQFO 1J5EB 1KYOF 2A7WA 4UUJC 4KHPB 4NB5A 1BQZA 3D8CA 2GV9A 5ITZB 4PDRA 3CMEV 1VARA 1W0KG 5LOVA 1QQCA 5H5NA 4X89A 1X59A 1FXKB 3D36A 2W6JG 3CRMA 3JYCA 4PA3A 3HB3B 3FB8C 2DW4A 2XT9A 4NR1A 1RSOB 1M57B 1WN7A 3SYOA 4CS3A 5A2QN 2Z3YA 3QO5A 4PHZA 1BE3H 4TSFG 3OEEG 1AILA 3K08A 1Q6HA 3UT5A 3WG7C 2A06H 3QTCA 1D5NA 3AG1B 4G28B 2CTQA 1ZTEA 4C7UA 1H38A 3G6EV 1I94O 3LDCA 2NLJC 1NJIW 4BW9A 4QNHB 3JCUZ 1IBKO 4KL1A 3TXQA 4O4JB 3DC5A 1ZX3A 4D7SA 1NR7A 4XBFA 5BZBA 1GMGA 3THOA
chains in the Genus database with same CATH topology
5LL6Y 4NXNO 2UU9O 4LF6O 1IBMO 1R6TA 1FKAO 5BXZA 4A5UB 1FJGO 4GKKO 2UXCO 1XNQO 3M8AA 4JI1O 3JAMN 4JI2O 2ZKOA 2N74A 2AGAA 4B3SO 4JI5O 1J5EO 4DV4O 4KHPO 1G1XB 4DR6O 5IT9N 4JI4O 4GKJO 1N33O 3RT3C 3SDLA 2FKXA 1N34O 4JI0O 3O65A 4LF9O 1KUQA 1AB3A 4JV5O 1HR0O 1HNWO 4DR1O 4AQYO 4LF5O 4DR2O 4X65O 4X66O 4DV0O 2F4VO 2HHHO 2VQFO 1A32A 2UXDO 1HNZO 4YHHO 4DV5O 2VQEO 4JI7O 5BR8O 4JI6O 4JYAO 2DJVA 3F5TA 1XEQA 1YZBA 1F7YA 5H5NA 5FLXN 4NXMO 2ZM6O 1X59A 4DV1O 4K0KO 3T1HO 4DR4O 4LFCO 1R1BA 1NS1A 4DR3O 4X62O 3J80N 1HNXO 4B3RO 5IWAO 4LF7O 5A2QN 3T1YO 4DV3O 4X64O 3R66A 4LF8O 1FYJA 5LMUO 4B3MO 1N32O 4DR5O 2JRIA 1AILA 1DK1A 4LFBO 1IBLO 4DR7O 4B3TO 2E5LO 4OPHA 3OTOO 4OPAA 2Z0AA 1I94O 2UXBO 4OX9O 2UUAO 2UUCO 1XMOO 4JI3O 5BY1A 4DV7O 3J7AU 2UUBO 1IBKO 4DUYO 1D2DA 4YY3O 4DUZO 1XNRO 4DV2O 1N36O 1XMQO 5LMNO 4LF4O 3J81N 4LFAO 2DOSA 2LW7A 4JI8O 4DV6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Y;  4NXN O;  2UU9 O;  4LF6 O;  1IBM O;  1R6T A;  1FKA O;  5BXZ A;  4A5U B;  1FJG O;  4GKK O;  2UXC O;  1XNQ O;  3M8A A;  4JI1 O;  3JAM N;  4JI2 O;  2ZKO A;  2N74 A;  2AGA A;  4B3S O;  4JI5 O;  1J5E O;  4DV4 O;  4KHP O;  1G1X B;  4DR6 O;  5IT9 N;  4JI4 O;  4GKJ O;  1N33 O;  3RT3 C;  3SDL A;  2FKX A;  1N34 O;  4JI0 O;  3O65 A;  4LF9 O;  1KUQ A;  1AB3 A;  4JV5 O;  1HR0 O;  1HNW O;  4DR1 O;  4AQY O;  4LF5 O;  4DR2 O;  4X65 O;  4X66 O;  4DV0 O;  2F4V O;  2HHH O;  2VQF O;  1A32 A;  2UXD O;  1HNZ O;  4YHH O;  4DV5 O;  2VQE O;  4JI7 O;  5BR8 O;  4JI6 O;  4JYA O;  2DJV A;  3F5T A;  1XEQ A;  1YZB A;  1F7Y A;  5H5N A;  5FLX N;  4NXM O;  2ZM6 O;  1X59 A;  4DV1 O;  4K0K O;  3T1H O;  4DR4 O;  4LFC O;  1R1B A;  1NS1 A;  4DR3 O;  4X62 O;  3J80 N;  1HNX O;  4B3R O;  5IWA O;  4LF7 O;  5A2Q N;  3T1Y O;  4DV3 O;  4X64 O;  3R66 A;  4LF8 O;  1FYJ A;  5LMU O;  4B3M O;  1N32 O;  4DR5 O;  2JRI A;  1AIL A;  1DK1 A;  4LFB O;  1IBL O;  4DR7 O;  4B3T O;  2E5L O;  4OPH A;  3OTO O;  4OPA A;  2Z0A A;  1I94 O;  2UXB O;  4OX9 O;  2UUA O;  2UUC O;  1XMO O;  4JI3 O;  5BY1 A;  4DV7 O;  3J7A U;  2UUB O;  1IBK O;  4DUY O;  1D2D A;  4YY3 O;  4DUZ O;  1XNR O;  4DV2 O;  1N36 O;  1XMQ O;  5LMN O;  4LF4 O;  3J81 N;  4LFA O;  2DOS A;  2LW7 A;  4JI8 O;  4DV6 O; 
#chains in the Genus database with same CATH topology
 1GKF A;  5L3F A;  2FL4 A;  4OXS A;  4DYL A;  4RWU A;  4IYI A;  3ASO C;  1IBM O;  2IBZ H;  2ZR2 A;  3IJ4 A;  3T4Z A;  4JI1 O;  3BPZ A;  1NT2 B;  4JAS A;  2DWD C;  1NQT A;  4UB8 Z;  1M56 B;  2F93 B;  1H2G A;  1OCZ B;  2JIZ G;  4LF9 O;  2RN9 A;  2RMK B;  4BIZ A;  5LGT A;  4Q20 A;  2UXN A;  3ZHS A;  1XHZ A;  4I4T A;  4MS2 A;  1O9H A;  1H8H G;  1JFF A;  4PD4 F;  5KHH A;  3LDE A;  3JAK A;  1EN6 A;  5KHG A;  3L72 H;  3ABM C;  3CHX A;  3OM3 B;  4ZI7 B;  2UXD O;  4PA9 A;  1J95 A;  5JVD B;  3RWR D;  5DM6 V;  1P49 A;  4FLT A;  2Y4U A;  1WA8 A;  3ZRW A;  4NXM O;  2LJ2 A;  4WBN B;  3CCU V;  3HKB A;  3UO2 A;  1MG1 A;  1B04 A;  1VQ7 V;  2RJZ A;  3FD9 A;  2CTP A;  4X62 O;  3J80 N;  1ROP A;  4ASU G;  2HHH B;  3AEI A;  3OAA G;  4JTC B;  4MTF A;  4YHH B;  2NR5 A;  2P90 A;  2Y4T A;  1VQN V;  4UCS A;  4YJ2 A;  4JYA B;  4DO2 A;  4EB6 B;  5B1O A;  4DR7 O;  3KKY A;  1HR0 B;  1Y4M A;  1N0J A;  2Q9L A;  4BR6 A;  1OCR C;  2P4K A;  4UVC A;  5B3S B;  5FPR A;  4RQF A;  3AK2 A;  4X1Y A;  1D2D A;  2QM4 A;  1VQ5 V;  2V1D A;  1P4R A;  4CZZ A;  4GX2 A;  1XL6 A;  4B3M B;  2YIB A;  4JI6 B;  1KC8 W;  2OTL V;  2KB1 A;  2R72 A;  5BXZ A;  2YS8 A;  2DYR B;  2E74 B;  4FM0 A;  3T1C A;  2N74 A;  4JI5 O;  2UUC B;  2Q0A A;  3EHB B;  3K5N A;  3N2K A;  4DV7 B;  2F43 G;  2YDE A;  3F5W C;  3WG7 B;  2LO1 A;  3JD3 A;  2QM7 A;  4IGG A;  1DTO A;  2W6I G;  4GYC B;  2GDS A;  4FJC C;  2ILM A;  5KMG A;  5B1A B;  3CCM V;  4O4H A;  4DV0 O;  4PI2 A;  1Q86 W;  1NTM H;  1I5X A;  4I4T B;  1SRY A;  1M5I A;  3RYC B;  2HVJ C;  4XDK A;  3H1J H;  4GZR B;  3CSX A;  3I55 V;  3JAL A;  3ASO B;  1NKD A;  4JV5 B;  2ZNJ A;  1ENV A;  4JYY A;  4DR2 B;  4LFC O;  1R1B A;  1Y74 B;  4YJ3 B;  1K3E A;  2B5U A;  2FYU H;  1NS1 A;  3OR6 C;  4J10 A;  3JCZ A;  4FLZ A;  4NVP A;  2BOB C;  2KG7 B;  2XTA A;  5J2T A;  1JPX A;  4JTD B;  5LA6 A;  4YIP A;  5IJ9 A;  2JRI A;  2UXX A;  5IYZ B;  4CS2 A;  3CPW U;  5KHJ A;  2HEP A;  4YJ2 B;  4GCZ A;  5C8Y B;  1M90 W;  5GTI Z;  2JDI G;  1G4Y B;  3ABM B;  1VQ4 V;  1OCC C;  3QF7 A;  3OW2 U;  5F2V O;  2UUB O;  4DK1 A;  3AG4 B;  4YY3 O;  1TVK A;  1VMG A;  2ZDI C;  1VQ6 V;  2QTO A;  2XAF A;  3B8M A;  4KUM A;  2AHY A;  2QTS A;  1WPB A;  3L70 H;  2QKC A;  5DEC A;  4GX0 A;  1K8A W;  3T4D A;  2BE3 A;  2E5L B;  1SQG A;  1BL8 A;  2M7W A;  2PUS A;  2AGA A;  4MSW C;  2LGQ A;  2QWN B;  3GB7 C;  4I50 A;  1YJW V;  3DXR A;  1WP8 A;  1NTK H;  1P84 F;  4DUY B;  1P7G A;  2Q68 A;  5EIB C;  1SF9 A;  2XAS A;  2Q73 A;  2IU3 A;  4F4L A;  4LFA B;  4JZG A;  3DSQ A;  1CEZ A;  3SPC A;  4N21 A;  2FML A;  4I55 B;  2XAJ A;  2UXB B;  3HKC A;  3CS5 A;  3K03 A;  4TV8 B;  4FLX A;  5BR8 O;  3KZI Z;  2ZE7 A;  3N2G A;  4J7J A;  1K9M W;  2H94 A;  5B5E Z;  4JI0 B;  2WSS G;  3ABL C;  4TUY B;  4ABM A;  5L3B A;  1GAX A;  1H8E G;  3JAL B;  2ZIN A;  5JQG A;  4W4L A;  2F23 A;  1NZ6 A;  1JCH A;  2LFR A;  2ZIO A;  3SYP A;  2R9R B;  4WFE A;  3JAS B;  3AG3 C;  2YUA A;  4MVZ A;  3AK3 A;  3E2E A;  2QSA A;  2HG5 C;  3ZN1 A;  1KMI Z;  4H13 B;  4BWA A;  1Z5W A;  5IJ9 B;  3W7S A;  4J80 A;  4J7Z A;  4JPR A;  3ETE A;  2QE7 G;  1S3J A;  3ETQ A;  4HNA A;  2OWO A;  4X20 A;  1ORQ C;  4RAI A;  2B9Z A;  3TJT A;  3CYO A;  1YTF B;  5H6R A;  4ZHQ B;  4O2A A;  4X1K A;  1TVK B;  4NXN O;  1VQM V;  2EJ7 A;  5J2U A;  4I0X B;  5LYJ A;  4FPP A;  4K0K B;  1EN5 A;  2ZKO A;  3BFR A;  4LNU A;  3RYH B;  2LGW A;  3JD0 A;  4RQE A;  1GO3 F;  1WJZ A;  1B3Q A;  4DUZ B;  4DV3 B;  4I50 B;  3SJA C;  2P7T C;  1EZJ A;  2B1G A;  3UO3 A;  4ZOL B;  4JI8 B;  4HAM A;  2CUG A;  2AXT Z;  2UU9 B;  1OCC B;  3L74 H;  4B3T B;  2QWR B;  2E75 B;  1QLN A;  2QKS A;  5EYP A;  5KAF Z;  1VF6 C;  2N04 A;  2PI5 A;  1M57 C;  3HKC B;  4FZ0 A;  2HLD G;  2BSK A;  2DJV A;  3FB6 C;  1N34 B;  1IZ3 A;  3K3W A;  3VQV A;  5B66 Z;  1V54 C;  5IE9 A;  1NVP B;  1L1F A;  2M6Y A;  3E22 A;  2YXH A;  2P06 A;  5LHG A;  4B7E A;  4DR4 O;  3AG1 C;  3KG2 A;  3CCS V;  3W7U A;  1FJG B;  3GWK C;  3CC4 V;  5JQG B;  5KA5 A;  1SA0 A;  2PI4 A;  3VOU A;  1ZL8 B;  4LF8 O;  4I5S A;  4DV5 B;  4JI4 B;  1SZT A;  5B1B C;  3LUT B;  2Y0I A;  1GH6 A;  1GRJ A;  2Q7G A;  5JH7 A;  1AR5 A;  1YEW A;  5GTH Z;  5CB4 B;  4MVM A;  5CA1 B;  5CA0 A;  5KHI A;  1V9P A;  3HPL C;  1BZK A;  1ZLZ A;  3X2Q B;  1CP9 A;  3CJH B;  3UM7 A;  4HNA B;  1OCO B;  1AR1 B;  3BA8 A;  1I0H A;  4X20 B;  3CWB H;  4JGS A;  1HNZ B;  4AHC A;  3O9O A;  1DGS A;  2DQ0 A;  3STZ C;  1S5J A;  1IVS A;  2JJ1 G;  4X1K B;  1R6T A;  2UXC O;  3TK1 A;  1XQ8 A;  5L3G A;  1IXB A;  5LHH A;  1PPJ H;  4FLW A;  3CD6 V;  4DV4 O;  5IT9 N;  1US6 A;  1YHQ V;  1FPO A;  1HDJ A;  3E83 A;  3O65 A;  3IGA C;  3JAR A;  5LP6 C;  4CH4 A;  3LDD A;  2YSU B;  5IY5 B;  4EFB A;  2VQE B;  4LBE C;  1SQQ H;  2B1I A;  2YEV B;  1M4U A;  4H33 A;  1AJQ A;  2VS0 A;  1U97 A;  1VQ8 V;  3ZN0 A;  4GKK B;  4CS4 A;  2X6C A;  4O4L A;  3GVM A;  4I9W A;  4U7N A;  3SPJ A;  3PN1 A;  4JI2 B;  1TUB B;  1AI6 A;  3D36 C;  3EVK A;  3NXS A;  1IXM A;  2ETN A;  3JAT A;  2YC0 A;  4P9O A;  1L0N H;  1KKC A;  1Q5O A;  3FYE B;  3FB5 C;  4DR1 B;  3ZMZ A;  3WB0 A;  2ZIM A;  1IX9 A;  5B3S C;  2CTW A;  1SER A;  2E3C A;  1FYJ A;  2EIJ B;  4TV9 A;  3L73 H;  1I08 A;  2EX3 A;  1CPY A;  3CRR A;  1Q3E A;  1SQB H;  1JX9 A;  1RFY A;  1WNS A;  3DTU B;  1KKD A;  3K04 A;  5H2F Z;  4IYH A;  4L8J A;  1AJN A;  1QU7 A;  1YDX A;  2WAM A;  4AQY B;  3A8T A;  2UUA O;  1H2K A;  4O2B B;  4JI3 O;  3FX7 A;  2DYR C;  1Q6U A;  4Q6G A;  3ABK B;  2MW2 B;  3BVO A;  1BS3 A;  4DV2 O;  2HKO A;  4K8X A;  4DV6 O;  4NTX A;  1K34 A;  1ARO P;  1V54 B;  1XL4 A;  1XMQ O;  2GUZ B;  4RUF A;  1TAE A;  1LUW A;  2ZR3 A;  5EZY B;  2QWQ B;  2Y0P A;  2EZP A;  1I94 B;  5B1A C;  1VQL V;  1TUE B;  3OE7 G;  2Q6A A;  5B1B B;  4KFM A;  3SDL A;  2N05 A;  3SJC C;  3W7W A;  1K92 A;  3OEH G;  2YI9 A;  4DV6 B;  3JAR B;  1YJN V;  2QKA A;  4U3F H;  1K33 A;  1GN6 A;  1K5S A;  5JCO A;  4QIW F;  1V55 C;  4P2Z A;  3ZHV A;  2PYL A;  2HP8 A;  4JI1 B;  3E86 A;  1JVM A;  1AP6 A;  1N4C A;  1QCE A;  3RFR A;  3CE2 A;  2OCC C;  3R65 A;  5CBF A;  1YVW A;  1YJ9 V;  1BHB A;  1W59 A;  3TXS A;  2ZE6 A;  3OD4 A;  2BTQ A;  3ABT A;  1AP5 A;  1MAB G;  3Q4H A;  3U0Z A;  4HYO A;  1W0J G;  4BAY A;  1K73 W;  4DR3 O;  1XUQ A;  1FFT B;  2QA4 V;  1SQF A;  4J9Y B;  5LP6 B;  3HKE A;  1Y76 A;  1MSD A;  3AG4 C;  2A9H A;  3VBB A;  2ARH A;  3JAW A;  1KP2 A;  1IBL O;  2DN9 A;  2WLI A;  2PTM A;  4NXM B;  3RYI A;  5LOV B;  4MVS A;  1I7F A;  1HW7 A;  4JZ2 A;  3F7Y C;  1NH2 B;  1YF2 A;  2KKW A;  3H1I H;  3CB2 A;  3JD1 A;  3E8H A;  2Y69 C;  3QVN A;  4TWK A;  3CXC U;  2PY5 A;  1R6N A;  3A2F A;  5JWP A;  4FM1 A;  2DOS A;  3B4S A;  4UFZ A;  5HFM A;  1F4N A;  1I5Y A;  3CCR V;  1YSC A;  3OR7 C;  3UT5 B;  2XND G;  3JAM N;  3ZHR A;  2GHY A;  3P3N A;  4N23 A;  4B3S O;  3P3P A;  4WFG A;  1G1X B;  3B77 A;  4GKJ O;  3OFN G;  2CTR A;  3SPH A;  3K0D A;  2AZ2 A;  1VF7 A;  5CBG A;  4LF7 B;  2EIN B;  1H2L A;  4X9Q A;  2JVD A;  2JGD A;  5KX5 A;  1Q82 W;  1HR0 O;  5IYD O;  1QHT A;  2PYJ A;  4IL6 Z;  4IHJ A;  5L3E A;  1R6K A;  2QEX V;  3ZED A;  3SPI A;  2WLM A;  4JI5 B;  4WFF A;  2BOC C;  4B7K A;  1M1K W;  5IYC O;  2CK3 G;  4JI7 O;  4JI6 O;  2JEX A;  1Q43 A;  1YI2 V;  5FLX N;  1IDS A;  4MT8 A;  2YIC A;  4UCV A;  1PL0 A;  2WLL A;  3E8F A;  5D5P A;  2ADQ B;  3AK1 A;  2RCV A;  4MW8 A;  4DV0 B;  2P5O A;  4PDV A;  1K97 A;  2JS3 A;  1OZ0 A;  4J41 A;  4P30 A;  1JFF B;  4X64 O;  3E35 A;  3BY6 A;  3JAK B;  5KLV H;  4DR6 B;  1N32 O;  1MZE A;  3VQY A;  2X7R B;  2DWE C;  5B1N A;  1Y6X A;  4CBC A;  1BSM A;  1V55 B;  1WA8 B;  3JAW B;  3ZRW B;  2WLI B;  2XAG A;  2LFS A;  4PDL A;  4LFC B;  1E79 G;  2OCC B;  3HKB B;  3JSL A;  1PKX A;  3J81 N;  3BCC H;  1VEW A;  3OMN B;  3QO8 A;  2Q69 A;  1Q7Y W;  1QR9 A;  4DV1 B;  5KUK A;  2F66 C;  4X1I A;  2ZE5 A;  4UCU A;  2UUB B;  2ZNI A;  2FKX A;  1XI1 A;  2XOK G;  3CRA A;  4X1Y B;  5GON A;  1GM7 A;  2HFE C;  1B6Q A;  3ZMU A;  4CH3 A;  2K9P A;  1HNW O;  4YIO A;  3QO7 A;  1H2M A;  2D3O W;  4E2L A;  1QLE C;  4XDL A;  4IHJ B;  1JQ0 A;  1PL4 A;  2Y48 A;  3TCU A;  2F4V O;  4OX9 B;  2Y69 B;  3C3S A;  3ZHU A;  5C93 A;  4MW3 A;  4FLY A;  4Z1M G;  4UVB A;  1S5L Z;  2RDC A;  1D5A A;  3N2K B;  2ZM6 O;  2Q67 A;  4DW0 A;  4FFB A;  1PNL A;  2WLL B;  5FNV A;  4MTO A;  1E1Q G;  5KMG B;  2EIM C;  5IWA O;  1BT8 A;  1Z5V A;  4O4H B;  3X2Q C;  3DGE A;  2G38 A;  5LBQ A;  1OCO C;  4MVU A;  4LFB O;  3FB7 C;  1RM1 C;  3K5O A;  1JA8 A;  3LNN A;  4J42 A;  1WB7 A;  4LR3 A;  1QBZ A;  1EBO A;  4LH7 A;  3CXH F;  3OMI B;  3OTO O;  1S77 D;  2UXB O;  2LP7 A;  1XMO O;  4WFH A;  1BGY H;  3RN4 A;  4PEL A;  5BY1 A;  3I5D A;  2WWW A;  5K1P A;  3IAY A;  3L75 H;  1N36 O;  4FVM A;  5LMN O;  4LF4 O;  1KU9 A;  1E1R G;  1XOU A;  5J2T B;  1WLE A;  4F6R A;  5LL6 Y;  2HJD A;  5LA6 B;  1KEC A;  1KBH A;  4BIU A;  5IY5 C;  1MNG A;  3APO A;  4NYK A;  1KD1 W;  3A0R A;  2EJR A;  2QM8 A;  4DRX A;  1ZWI C;  3RT3 C;  3ZMS A;  2GBO A;  4JAU A;  1AR4 A;  4AIL C;  2Q7H A;  2ZQM A;  3BAA A;  4QJF B;  5J9P C;  3L71 H;  4DR5 B;  3ZX6 A;  3H1K H;  4KP4 A;  2A0L A;  3K58 A;  4WFB V;  5GON B;  1QR8 A;  3ZJZ A;  4BIO A;  1LUV A;  4RO2 A;  1KB9 F;  2WLJ A;  4CC5 A;  2EIL C;  1T5E A;  3MDS A;  3DXR B;  1AI7 A;  2EIJ C;  5JJE B;  4JYB A;  4K0K O;  3HKD A;  3FAV A;  4PA4 A;  1YTF D;  3WU2 Z;  1F4M A;  1HNX O;  4B3R O;  3EFF K;  1Z2G A;  4DV3 O;  1RP3 B;  1GN4 A;  4FLV A;  4ZBM A;  4L87 A;  1HWY A;  3ABK C;  1PD3 A;  2A79 B;  4FIP C;  5IJ0 A;  3G6B A;  4LCU C;  3N2G B;  4B3T O;  1QLE B;  2R9A A;  4DW1 A;  3G71 V;  1PV0 A;  1JR9 A;  3H1H H;  1MSW D;  4W4K A;  3RGB A;  3APQ A;  4JAV A;  4FMT A;  2OTJ V;  4X66 B;  4JF3 A;  3ETG A;  1R3J C;  4J7K A;  2MK3 A;  3QNE A;  3RVY A;  1FD9 A;  4G2K A;  2LW7 A;  3E89 A;  3AG7 A;  1NTZ H;  2CH7 A;  4U3J A;  4K3A A;  2KSD A;  1FJG O;  1YIT V;  3GWO A;  3K06 A;  3K59 A;  2EIM B;  5EBL C;  4DXW A;  5ITZ A;  2C2A A;  5EBW C;  4JI4 O;  1NVP D;  1N33 O;  2W0X A;  4EKW A;  3M99 B;  3T1Y B;  1RM1 B;  1FXK A;  1XIL A;  1BQ0 A;  3W7T A;  1UPG A;  1NU1 H;  1QVF U;  3N27 A;  4LH6 A;  1Y66 A;  4O2A B;  1RSO A;  2Q5Z A;  5EIB D;  4X65 O;  4O4I A;  1S76 D;  1AI5 A;  5LXT A;  5CA3 A;  2DQ3 A;  1AJP A;  4K35 A;  5J2U B;  3MHH C;  1HNZ O;  5LYJ B;  4UVA A;  4DV4 B;  3E8B A;  4UCT A;  4OGQ B;  1KP3 A;  4LNU B;  1Q6I A;  1BCC H;  2DMX A;  1XEQ A;  5CMU A;  4YXW G;  2KQX A;  4TQD A;  3CP1 A;  2QGN A;  2R9I A;  3T1H O;  1W2B U;  5H9C A;  1WAZ A;  1VQP V;  3HKD B;  1MA1 A;  3FAV B;  1Q90 D;  4UXN A;  1K4C C;  2VWJ A;  3SJQ C;  4PJ0 Z;  3ZCC A;  1G6U A;  1N0N A;  5LMU O;  1JMK C;  4D6T H;  1IUR A;  1MOF A;  5EYP B;  2WA4 A;  4E4E A;  4IT5 A;  2FB5 A;  1UJW B;  2BCC H;  1H2S B;  3IC7 A;  2BSK B;  3ZHT A;  1ZSP A;  3W7X A;  4LF5 B;  3P30 A;  4WCE V;  3E22 B;  2GTS A;  1VQ9 V;  2EIL B;  3A0B Z;  1SS3 A;  1NBM G;  3H9V A;  2Z5U A;  2P67 A;  1NR1 A;  1XNR O;  2VQF B;  1WP7 A;  5GW7 A;  4GT1 A;  3S3X A;  2VRZ A;  1SA0 B;  3PJS K;  1S72 V;  2EIN C;  4QE9 A;  3SYQ A;  2XHB A;  3U10 A;  2WLK A;  4LF6 O;  1FAF A;  1WPX A;  2IJJ A;  2EUL A;  2AHZ A;  1XNQ O;  1YIJ V;  5JH7 B;  1PNM A;  2UUA B;  1J5E O;  4KHP O;  4JI3 B;  2QDO A;  4ZIB A;  5CA0 B;  3TET A;  1SQV H;  5DED A;  5JCO C;  2JK5 C;  3IC9 A;  4WBN A;  4DV2 B;  4NKG B;  1GN3 A;  1PP9 H;  2AZ0 A;  1NI8 A;  1XMQ B;  1GM9 A;  4CH5 A;  4AQY O;  1QNM A;  3OT7 A;  1H2N A;  2ITD C;  4ICG A;  4O4I B;  1O9G A;  3H01 A;  2GTA A;  3JSN A;  3WFV A;  3ZRS A;  5LXT B;  4EB6 A;  4B08 A;  1GK9 A;  1BMF G;  3LSQ A;  1IBK B;  4G27 B;  4Z1V A;  1F7Y A;  1G8M A;  2L35 A;  1N8R W;  2ATK C;  3BEH A;  4FK5 C;  1UFI A;  2IH3 C;  1IBM B;  2ZXW B;  2YIA A;  5IYB O;  1P7B A;  4O4L B;  2IW5 A;  4MVO A;  2IH1 C;  3KCY A;  3SJB C;  1DK1 A;  5AG2 A;  2ZT9 B;  4LF9 B;  1JJO A;  2DYS C;  5L3D A;  5LGU A;  3F7V C;  3I56 V;  3JAT B;  1THZ A;  4WF9 V;  2PZS A;  1OHH G;  4R50 A;  3ETD A;  1SKV A;  3SYA A;  3RBZ A;  4DR3 B;  2CGN A;  3CRQ A;  3OGI B;  3WB2 A;  2Q7E A;  2UXD B;  4ZKI A;  1SES A;  3K79 A;  5FPO A;  3K9A A;  2JEU A;  2HVK C;  4TV9 B;  1IBL B;  4CH6 A;  3OTF A;  2PF4 E;  3G80 A;  3UCS C;  3RYC A;  5D5Q A;  1L0L H;  2YXL A;  4LC1 A;  4R6Z A;  2JS5 A;  4X62 B;  4U7O A;  2NNU A;  4UCO A;  4X88 A;  2XAH A;  1Y74 A;  4YJ3 A;  1LR1 A;  3AG2 C;  1COW G;  4MVQ A;  3B40 A;  3LSS A;  4DR7 B;  2KG7 A;  1ZUQ A;  2CDY A;  1F51 A;  2X0L A;  2HHH O;  5IYZ A;  4PV1 B;  4B3S B;  3ZS8 C;  4YHH O;  4GKJ B;  1JJ2 U;  3RYF A;  4JYA O;  2IJH A;  1YCI A;  5C8Y A;  4NTY A;  3RVZ A;  1X4T A;  1NH2 D;  4XDJ A;  2XAQ A;  3CCJ V;  3ZRX A;  2EBO A;  2IJK A;  1FS0 G;  2Q4P A;  5E79 Z;  2A3Q A;  1SC5 B;  1VIB A;  4LF7 O;  1K5Q A;  2IU0 A;  1R73 A;  4D7T A;  4B3M O;  3RW0 A;  4JI7 B;  5IDJ A;  3H1L H;  3QG5 A;  5BMV A;  1URF A;  4MTG A;  3SR2 C;  2W0F C;  3ABU A;  3LSU A;  2ZD9 A;  3FYI B;  2Z0A A;  5CBH A;  2P6J A;  2UUC O;  2BTQ B;  2BTO A;  3S3W A;  3Q4H B;  4DV7 O;  4UB6 Z;  1MMM A;  4X64 B;  3CC2 V;  1N32 B;  4R7C A;  1F23 A;  4I55 A;  3HKE B;  1KQS U;  1Y76 B;  3ZIA G;  1MZF A;  3CCV V;  2EIK C;  1M93 A;  4TV8 A;  2X6A A;  4GX1 A;  1DLB A;  3RYI B;  3EXA A;  2H3O A;  4DR6 O;  5KUM A;  3SPG A;  1AI4 A;  3K57 A;  4EFE A;  3ML0 A;  4FM2 A;  4UCR A;  4TUY A;  2HR3 A;  4MTX A;  1GN2 A;  2K1E A;  1EZV H;  3MAQ A;  2DYS B;  4JV5 O;  5CN0 A;  1XBL A;  3P32 A;  2QJ1 A;  4DR2 O;  4FFK A;  4H44 B;  2QR4 A;  2OCH A;  1VF5 B;  3BA9 A;  3NR7 A;  2FTK A;  3JAS A;  4EEQ A;  2V7Q G;  3B2E E;  1A32 A;  1L8D A;  3BAB A;  5LHI A;  3CRC A;  4QPJ A;  2OYQ A;  4YY3 B;  3HR0 A;  3CEI A;  4R8C A;  3SGI A;  3G67 A;  1FFX A;  3RYF B;  2E76 B;  5EC1 C;  1SQP H;  1K4D C;  4LWS A;  1XHX A;  4DV1 O;  1HNW B;  2QWO B;  5HFL A;  2JGD B;  5KX5 B;  4H37 A;  1YXB A;  4QPK A;  1WB8 A;  2OIG A;  3OGC C;  4ZHQ A;  5EC2 C;  3D3Q A;  2F4V B;  3BHP A;  2D2C B;  1B06 A;  2PGG A;  4I0X A;  3AG2 B;  1R3I C;  2E5L O;  5BMV B;  3RYH A;  2ZM6 B;  3ZMV A;  1DF4 A;  4OPA A;  4OX9 O;  2JGU A;  4MVR A;  3K9S A;  4P9P A;  5DN6 G;  5TIS Z;  3J7A U;  1QVG U;  4GX5 A;  3G4S V;  4DUY O;  5IWA B;  4ZOL A;  1TA8 A;  2ITC C;  2YIB D;  4TT3 G;  2NN4 A;  4TQF A;  1AVM A;  5JJJ B;  4LFA O;  5BR8 B;  2OT5 A;  1R3K C;  3VQW A;  4LFB B;  2GSM B;  1LNQ A;  1OCR B;  3FKS G;  2ZDI A;  4FZ1 A;  3VQX A;  2P22 C;  3OTO B;  1XMO B;  4QGP A;  3ZMT A;  1S0V A;  3D3I A;  4JAA A;  3B09 A;  3KCX A;  5FL7 G;  4JI0 O;  3UKM A;  1N36 B;  1KUQ A;  2RQ6 A;  1TGO A;  2YI8 A;  5LMN B;  4LF4 B;  4UV8 A;  5KAI Z;  2CAZ C;  5JJN B;  2H8P C;  5KHK A;  4UV9 A;  4K8Z A;  2R70 A;  4I7Z B;  3FFQ A;  1ZL8 A;  5LGN A;  2WLH A;  3ZHQ A;  1R3L C;  1RPO A;  5E1A C;  2LQT A;  2F95 B;  4X1I B;  4RUE A;  3F5T A;  2WA3 A;  4PI0 A;  5CB4 A;  5CA1 A;  3ASN C;  3CCQ V;  4HZ3 A;  2AW9 A;  2EIK B;  1FFX B;  3CJH A;  4NXN B;  1HP8 A;  4PA7 A;  4LWS B;  4TOI A;  2Q8V A;  3K5L A;  2YID A;  5A9G A;  3BRC A;  3STL C;  3R66 A;  3OUF A;  4DR5 O;  2O57 A;  3CX5 F;  3ICX A;  3MD0 A;  4QE7 A;  3ZBH A;  3E8G A;  2ADP A;  4OPH A;  2IM9 A;  3DC6 A;  4LP8 A;  1VQO V;  2IJI A;  4FFB B;  3OUS A;  1HNX B;  4B3R B;  5L3C A;  5FNV B;  4DUZ O;  1RPR A;  2YEV A;  3LNM B;  1K7D A;  4JI8 O;  2EZO A;  1DF5 A;  5EBM C;  2UU9 O;  2OIE A;  1XRE A;  3T2M A;  4FLU A;  3SYC A;  1TUB A;  2QWP B;  4A5U B;  1BHA A;  4I9Q A;  1FXK C;  3M8A A;  4CC6 A;  4BW5 A;  4DR4 B;  4AI8 A;  3CC7 V;  1Q81 W;  4H0L B;  2L6L A;  4GUN A;  2HJF C;  1N34 O;  4HBN A;  4LF8 B;  4IIJ A;  1S5H C;  1JOY A;  2DE0 X;  5EK0 A;  2CGO A;  2VWK A;  2Q0O C;  4F6R B;  1SET A;  3CCL V;  4X66 O;  1U96 A;  1OJH A;  3WB1 A;  1GM8 A;  4DK0 A;  2ZXW C;  1VQK V;  4DV5 O;  3CMA V;  2ZCE A;  4WFA V;  1N33 B;  1FXV A;  3K5M A;  3ZRV A;  1PM9 A;  1EN4 A;  3CCE V;  5H6Q A;  1YZB A;  4DRX B;  4X8A A;  4KXR A;  4O2B A;  1VF6 A;  4PA6 A;  2JJ2 G;  1ZAU A;  3M7M X;  4X65 B;  2UXC B;  3K0G A;  1OV9 A;  1Q8I A;  3OMA B;  1EFR G;  3T1Y O;  2GUZ A;  3C90 A;  1M56 C;  4J11 A;  1OCZ C;  3ABL B;  3JD4 A;  2ZE8 A;  4J9Z B;  3C3T A;  5EZY A;  2ODM A;  2V4D A;  2CE4 A;  2F1M A;  3B8N A;  3T1H B;  1VP7 A;  4O4J A;  1EM1 A;  4JTA B;  4PDM A;  3AG3 B;  3A0H Z;  1SQX H;  2WPD G;  3ASN B;  5LMU B;  3L9D A;  3TGU H;  2VQE O;  1M9N A;  4JYC A;  1FKA O;  4GKK O;  5IJ0 B;  2RNB A;  2YXY A;  1Y67 A;  2XUM A;  4JI2 O;  3UQ8 A;  3U11 A;  3MHS C;  1FXH A;  4GLX A;  1GTO A;  1CXZ B;  1XNR B;  4Z2W A;  1AB3 A;  4F6E A;  2P4V A;  4NTW A;  5KA6 A;  3IFX A;  4DR1 O;  4LF5 O;  4IIJ B;  1XDC A;  5K1X A;  1SZX A;  4LF6 B;  2X6B A;  4ZI7 A;  1PNK A;  2CH7 B;  1XNQ B;  2WLN A;  4U3J B;  2LW1 A;  5LP6 A;  5JVD A;  3JD2 A;  2VQF O;  1J5E B;  1KYO F;  2A7W A;  4UUJ C;  4KHP B;  4NB5 A;  1BQZ A;  3D8C A;  2GV9 A;  5ITZ B;  4PDR A;  3CME V;  1VAR A;  1W0K G;  5LOV A;  1QQC A;  5H5N A;  4X89 A;  1X59 A;  1FXK B;  3D36 A;  2W6J G;  3CRM A;  3JYC A;  4PA3 A;  3HB3 B;  3FB8 C;  2DW4 A;  2XT9 A;  4NR1 A;  1RSO B;  1M57 B;  1WN7 A;  3SYO A;  4CS3 A;  5A2Q N;  2Z3Y A;  3QO5 A;  4PHZ A;  1BE3 H;  4TSF G;  3OEE G;  1AIL A;  3K08 A;  1Q6H A;  3UT5 A;  3WG7 C;  2A06 H;  3QTC A;  1D5N A;  3AG1 B;  4G28 B;  2CTQ A;  1ZTE A;  4C7U A;  1H38 A;  3G6E V;  1I94 O;  3LDC A;  2NLJ C;  1NJI W;  4BW9 A;  4QNH B;  3JCU Z;  1IBK O;  4KL1 A;  3TXQ A;  4O4J B;  3DC5 A;  1ZX3 A;  4D7S A;  1NR7 A;  4XBF A;  5BZB A;  1GMG A;  3THO A; 
#chains in the Genus database with same CATH homology
 5LL6 Y;  4NXN O;  2UU9 O;  4LF6 O;  1IBM O;  1R6T A;  1FKA O;  5BXZ A;  4A5U B;  1FJG O;  4GKK O;  2UXC O;  1XNQ O;  3M8A A;  4JI1 O;  3JAM N;  4JI2 O;  2ZKO A;  2N74 A;  2AGA A;  4B3S O;  4JI5 O;  1J5E O;  4DV4 O;  4KHP O;  1G1X B;  4DR6 O;  5IT9 N;  4JI4 O;  4GKJ O;  1N33 O;  3RT3 C;  3SDL A;  2FKX A;  1N34 O;  4JI0 O;  3O65 A;  4LF9 O;  1KUQ A;  1AB3 A;  4JV5 O;  1HR0 O;  1HNW O;  4DR1 O;  4AQY O;  4LF5 O;  4DR2 O;  4X65 O;  4X66 O;  4DV0 O;  2F4V O;  2HHH O;  2VQF O;  1A32 A;  2UXD O;  1HNZ O;  4YHH O;  4DV5 O;  2VQE O;  4JI7 O;  5BR8 O;  4JI6 O;  4JYA O;  2DJV A;  3F5T A;  1XEQ A;  1YZB A;  1F7Y A;  5H5N A;  5FLX N;  4NXM O;  2ZM6 O;  1X59 A;  4DV1 O;  4K0K O;  3T1H O;  4DR4 O;  4LFC O;  1R1B A;  1NS1 A;  4DR3 O;  4X62 O;  3J80 N;  1HNX O;  4B3R O;  5IWA O;  4LF7 O;  5A2Q N;  3T1Y O;  4DV3 O;  4X64 O;  3R66 A;  4LF8 O;  1FYJ A;  5LMU O;  4B3M O;  1N32 O;  4DR5 O;  2JRI A;  1AIL A;  1DK1 A;  4LFB O;  1IBL O;  4DR7 O;  4B3T O;  2E5L O;  4OPH A;  3OTO O;  4OPA A;  2Z0A A;  1I94 O;  2UXB O;  4OX9 O;  2UUA O;  2UUC O;  1XMO O;  4JI3 O;  5BY1 A;  4DV7 O;  3J7A U;  2UUB O;  1IBK O;  4DUY O;  1D2D A;  4YY3 O;  4DUZ O;  1XNR O;  4DV2 O;  1N36 O;  1XMQ O;  5LMN O;  4LF4 O;  3J81 N;  4LFA O;  2DOS A;  2LW7 A;  4JI8 O;  4DV6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...