4DR3O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr3O00
4JI7O 2UXCO 4X64O 4YY3O 1YZBA 4DV1O 2AGAA 4JI2O 4LF7O 1FYJA 4DV5O 4DR4O 4DR2O 1J5EO 2FKXA 1N32O 4X62O 4B3MO 2UU9O 4JI5O 3OTOO 2UUAO 2E5LO 1IBMO 4DV3O 2DOSA 1DK1A 3SDLA 1XMOO 4LFCO 1XEQA 1NS1A 5BY1A 1IBKO 4K0KO 1G1XB 4B3RO 1N34O 2UUCO 1IBLO 3RT3C 1XNQO 2ZKOA 4DV7O 5LL6Y 5FLXN 4KHPO 4JYAO 4AQYO 4DUZO 3T1YO 4JI8O 4LF4O 1HNWO 2LW7A 5LMUO 1XMQO 4LFAO 4DV0O 2ZM6O 5IWAO 1F7YA 4LF6O 1KUQA 4JI1O 3R66A 2UXDO 2VQFO 5LMNO 4JI4O 4DR3O 4YHHO 3T1HO 2HHHO 1XNRO 4DR7O 3J81N 4DV2O 1X59A 2JRIA 2UXBO 1FJGO 3JAMN 4OPHA 3J80N 4DUYO 4DR5O 1HNXO 4JI6O 2UUBO 5BR8O 1AB3A 1HNZO 2VQEO 3M8AA 1AILA 1FKAO 5H5NA 5IT9N 4X65O 4LF8O 4LF9O 1I94O 4A5UB 5BXZA 4B3TO 5A2QN 1R6TA 4X66O 4JV5O 1N36O 4DR6O 4LFBO 1N33O 4LF5O 4B3SO 4NXMO 3F5TA 1A32A 4DR1O 2Z0AA 4JI3O 4DV6O 3O65A 4NXNO 4OPAA 4DV4O 2F4VO 3J7AU 1R1BA 2N74A 1D2DA 4GKKO 2DJVA 4JI0O 4GKJO 4OX9O 1HR0O
chains in the Genus database with same CATH superfamily
3CSXA 3K9SA 2L35A 2OIGA 2ZR2A 2H94A 1RSOB 4UVAA 2AGAA 1G8MA 1KQSU 4LNUA 5BZBA 1IBKB 1GN4A 1N32O 4O4IA 1XOUA 3VQVA 3IAYA 1Z2GA 5EZYA 3K5MA 3FX7A 3RVZA 3WB0A 4BAYA 3JAWB 5EIBC 1QLEC 3STLC 4GLXA 2CAZC 3CCUV 1FFXB 1Q5OA 3FYIB 1MSWD 3OEEG 4HZ3A 4P9OA 3B09A 1NU1H 2XOKG 3F5WC 2F93B 2UUCO 1VQOV 1EZJA 2NR5A 5DECA 4RUEA 1OCCC 4KHPB 1Q43A 1SQFA 2AZ0A 2QDOA 4FM1A 3H1KH 2M6YA 4FFBA 3SYPA 3B4SA 3RW0A 2K9PA 5TISZ 4QGPA 3ZN0A 4MSWC 4DV2O 1VQ6V 5L3FA 1US6A 4MVMA 3ZJZA 4MS2A 4JGSA 1N8RW 4B3SB 1BCCH 2XAQA 3M8AA 4RWUA 1FPOA 1H8HG 2WLHA 4W4KA 2Y0PA 2CH7A 3EHBB 1DGSA 1DF4A 1PV0A 2YI9A 3H1IH 5K1XA 3RYCB 3B8MA 2P6JA 1H2LA 4J41A 1YHQV 5D5QA 1P84F 1Q82W 2ZXWC 2KG7B 3EXAA 4JI3O 5L3CA 2CE4A 2RDCA 4NXNO 1BS3A 1LUWA 3JAWA 1M56C 1FXKB 2UXXA 2ZE5A 3UT5B 3ZMSA 4QJFB 5KHGA 2OWOA 4MVQA 1R6KA 3QF7A 1H2MA 3X2QC 4YY3O 2YC0A 2NNUA 4CZZA 2GV9A 3FD9A 3SR2C 5KX5A 3BCCH 1K5QA 4X9QA 4DK0A 3SPIA 2OTJV 4J10A 4G28B 2KKWA 3G4SV 3OGIB 3ZHUA 5F2VO 1SZXA 2DOSA 4O2AB 1WNSA 2MW2B 4ZHQB 2QWOB 1PL0A 1XMOO 1EFRG 2EINC 2JJ2G 4JI3B 3SJQC 3S3XA 2OCCB 1YTFD 3CHXA 4DR2B 4YHHB 3OTFA 4DV7O 4UUJC 4KHPO 1VQ9V 2GUZA 4DUZO 5IYZA 5KHIA 2JEXA 4Z1VA 2WLNA 1BGYH 4LF9B 4GUNA 1YEWA 4WBNA 1BT8A 4TOIA 4XDKA 1QNMA 3WFVA 4JI4B 3ZRXA 4B3MB 1HW7A 2HHHO 3ZRWB 2P5OA 1P49A 1GM7A 5DN6G 4TSFG 2A0LA 3BPZA 1M57C 1HNXO 1YSCA 4WF9V 1J5EB 2FYUH 1NT2B 1WLEA 5LYJB 5H5NA 5CB4B 1H2SB 3W7TA 1M57B 1AP6A 1LUVA 3PJSK 4QIWF 4X89A 4I4TB 1WN7A 4JYAB 4LH7A 3ZEDA 3CD6V 1KU9A 2E5LB 4TQFA 2EBOA 2V1DA 2AW9A 5KX5B 1L8DA 1B3QA 5ITZB 1JX9A 4PV1B 5LHIA 1QBZA 4NTYA 1RPRA 4LF6B 1QHTA 2V7QG 3AG3C 4GKJO 2WLJA 5LXTB 4JI7O 2UXCO 2JJ1G 5K1PA 4X64O 5BMVB 4D6TH 1YZBA 2QJ1A 2KG7A 1T5EA 3UO3A 4LF7O 1WB8A 4UB8Z 2BTOA 3GWKC 1NR7A 3RYCA 3Q4HB 1M9NA 3BEHA 1X4TA 3CRQA 4AHCA 2FL4A 3BABA 5KHJA 3W7XA 2UUAO 5IE9A 2ADQB 1VP7A 3JYCA 4EFEA 5LOVA 3CRRA 1K5SA 2Q67A 1O9GA 1GTOA 3STZC 4GX1A 1OJHA 4F6RB 3QO8A 4FLYA 2EX3A 2BOBC 1SKVA 5DM6V 3CMAV 5JCOC 2Y69C 3KZIZ 3H1LH 3DC6A 2R70A 1OCOB 4PA3A 1XMQO 4WFGA 1FS0G 4YJ2A 2DYRC 3LNMB 5CB4A 1CPYA 3QO7A 2YXHA 1X59A 2JRIA 3ZMTA 1YJNV 3ICXA 1K9MW 2EIJC 3ABUA 4FLVA 3AG2C 1TUBB 4MVRA 1HNZO 1K4CC 4I50B 4RO2A 1RFYA 3L70H 3L73H 4X1YB 4X1YA 5B1BB 1JJ2U 1JOYA 2YUAA 5KHKA 4DV5B 4FVMA 3E83A 1R3KC 4LNUB 5GONA 3G6EV 1PNLA 4C7UA 3D8CA 4X88A 1BHAA 4OPAA 2ODMA 2RNBA 1R1BA 5IJ0B 3X2QB 4BW9A 3L74H 4GYCB 3ETGA 4GZRB 3JD4A 1B6QA 4LF8B 3ABKB 1JPXA 4UB6Z 2A3QA 3HKCB 1NTKH 1J5EO 1BQZA 3RYHA 4X62O 1N34B 2QE7G 4DV4B 4PA6A 3T2MA 5GONB 4CS2A 3OTOO 2UUAB 4X1KA 4TV8A 2JVDA 3RWRD 1JJOA 3HR0A 3G67A 1RM1B 4BW5A 1TAEA 4YJ3A 4PHZA 2ZE6A 4ZKIA 1MG1A 2VRZA 1GM9A 2P4KA 2QTSA 4ZI7B 4PELA 4UV9A 2XAGA 4AILC 4YXWG 4AQYO 2B9ZA 3TXQA 3BHPA 1RPOA 4FMTA 1OV9A 4DUZB 1Q86W 1SF9A 2ZM6O 2P67A 1VF6A 2ZIOA 2O57A 2DW4A 5KUMA 1H38A 3T1HO 1XNQB 4DR7O 3VQWA 3TK1A 5KLVH 2KB1A 4LWSA 4JI0B 2Q7HA 4TUYA 3T4ZA 4WFEA 5D5PA 1PP9H 5B1AC 3W7SA 2YIBA 4N21A 1RP3B 5IT9N 3SJBC 3OMNB 3QNEA 4BIUA 4FM0A 1MA1A 2F4VB 1TGOA 1V54C 4KUMA 1KD1W 4JYYA 1ENVA 2IJJA 1L1FA 1WB7A 1YITV 4NYKA 2IJHA 1YJ9V 1FAFA 4JTCB 5EYPA 4FFKA 4FLZA 4TT3G 3K04A 1N4CA 3E35A 1KYOF 2UUCB 4ZIBA 1D2DA 2DJVA 1GKFA 1N0NA 1GM8A 2XASA 4MTFA 2OT5A 4J9ZB 4GCZA 1AJQA 2XAFA 4OX9B 3JATA 3DSQA 1AI5A 4N23A 5IYZB 3KCYA 1VQ5V 3C90A 5B1NA 4P2ZA 1R3IC 3ABLB 5JQGB 1XQ8A 3CS5A 3T1YB 4JI2B 4JAVA 4L8JA 3CRAA 4WCEV 4NR1A 3H1JH 3EVKA 1Y76B 4OXSA 1S5JA 1PNKA 4CS3A 2QWQB 1OCOC 4KL1A 5LL6Y 5B3SC 4PI2A 3HKBA 1WJZA 3AG1B 4LF6O 1NJIW 1Y66A 1SZTA 3K5NA 3BVOA 1LNQA 1SQGA 3ZRSA 1COWG 1QLEB 3RYIB 1MMMA 5LA6B 5J9PC 1QQCA 4R6ZA 2DQ3A 4U3JA 4MTXA 3SPGA 4DR4B 3RN4A 3T1CA 4E2LA 4FPPA 4JAAA 1WA8B 3CJHB 1VF6C 1KBHA 4H13B 4DR6O 4ZHQA 2WA3A 4X20B 1SA0B 5B66Z 5IJ9B 1HNWB 5JJNB 2F43G 4AI8A 1BSMA 2PI4A 3K5LA 3O65A 3K08A 2M7WA 1XHZA 1U96A 1AR5A 2F95B 3AK3A 4I9QA 1IBLB 4FLXA 5FNVB 3CC4V 1DF5A 1SRYA 4RQFA 1G4YB 2PTMA 1SS3A 3L71H 2ZINA 2WAMA 1AJPA 5IY5B 4HBNA 4DR2O 3CRCA 3CXHF 3H1HH 2X7RB 1ZLZA 4B3MO 4I50A 3Q4HA 1GN2A 2B1IA 3CCRV 2ZDIC 3G6BA 1ZAUA 4UXNA 3MDSA 4DRXA 3JCZA 1AI6A 1IBKO 2CTQA 2YDEA 2Q8VA 2A79B 2PY5A 2IH1C 2R72A 4U7NA 1IBLO 3FKSG 1GRJA 4RUFA 3LDDA 1WP8A 2QWRB 4JYAO 4UCVA 3T1YO 4NXMB 4JTAB 4JI6B 4X1IA 1V55B 1WPXA 2LW1A 5CA1A 2JGDA 1F7YA 2CUGA 5JVDA 4DR5B 5LHGA 2WLLA 2UXBO 3FB6C 1IBMB 4X20A 2AZ2A 3MHSC 3N27A 3CMEV 3WG7C 4PD4F 3IC7A 4X65O 4NKGB 4Q6GA 3ETQA 1BHBA 1N33B 1MSDA 2QWPB 2H3OA 1F23A 3CRMA 1R6TA 1AP5A 4LFBO 4O4HA 5BMVA 4CC5A 4NXMO 1RM1C 2HEPA 3L72H 4L87A 2Q0OC 4HNAA 3ZX6A 3BFRA 2DWDC 2EJ7A 3FAVB 2YIBD 5FNVA 2UXBB 4I55A 3TCUA 1QVGU 3PN1A 1S0VA 2ZE7A 2IM9A 1GO3F 3FB5C 2QM7A 4K35A 4J7KA 1CP9A 1KB9F 3CJHA 2R9IA 1K97A 2W0XA 4GT1A 3AK2A 1W0KG 4MTOA 1FJGB 1SESA 1DK1A 1QR9A 2IU0A 4DR6B 1XEQA 5BY1A 3CEIA 2GBOA 4PJ0Z 3JATB 3ZRVA 4F4LA 2DE0X 4R8CA 2HKOA 4TQDA 2BTQB 3ASOB 3TJTA 3W7UA 4FIPC 4JAUA 5LBQA 2FMLA 4JYCA 2JIZG 3JAKA 1L0LH 3VQYA 2NLJC 3ZHQA 5LMNB 4JI4O 2QEXV 5EYPB 4YHHO 4DUYB 2YXLA 5JJEB 1V9PA 1JQ0A 2DYSB 4LP8A 4JI6O 4I7ZB 5B5EZ 3HKDB 4MT8A 4ASUG 1FKAO 3K58A 2EZOA 5JQGA 4LF8O 5L3DA 1OCCB 5CA1B 1D5NA 1VQKV 1ZWIC 1R73A 3D3IA 2P90A 3ETEA 2F1MA 3F5TA 1PD3A 4NB5A 5JJJB 4DV4O 2ZCEA 1FXKA 1B04A 4QPKA 4DV0B 1CXZB 1F4NA 3OM3B 4DRXB 1PPJH 1VQ7V 1KP3A 3KKYA 3APQA 2UXNA 3MD0A 4O4JB 1F51A 2QA4V 1NI8A 5IYBO 1YTFB 4IHJB 1ZL8A 4PDVA 4DV1O 3M99B 5JCOA 2PI5A 2L6LA 4UCTA 2DYRB 1Q6IA 3EFFK 3AEIA 3F7VC 3WU2Z 3IC9A 3CCEV 2UXDB 1IX9A 2YXYA 2Y48A 2YEVB 2EULA 3JASB 1GN3A 3OUFA 4DV3O 3L75H 5CBFA 2WWWA 2GHYA 2ZXWB 3B40A 1H2GA 1RSOA 4H37A 1IXMA 2FB5A 2B1GA 2EILC 1I5XA 2EINB 2LJ2A 4DYLA 1PL4A 3NXSA 3N2GB 1E79G 2GTAA 2WLIA 4JASA 5EBMC 5LYJA 1KKCA 4KP4A 2Y4UA 2WSSG 2RMKB 1WP7A 2AXTZ 1IZ3A 3T4DA 3JAKB 2WLKA 4ZOLA 2QSAA 3E22A 1Z5VA 4UFZA 5LA6A 3JAMN 2HVJC 4DR5O 2OTLV 2Q4PA 4CH4A 4MVOA 4YJ3B 2JS5A 5KA6A 3ZHVA 1AILA 4TV8B 2PUSA 3IFXA 5FPOA 3HKBB 4JI7B 1HWYA 3ZCCA 2N05A 2CGOA 3R65A 4LFBB 1A32A 2WLIB 1Y76A 4DR3B 4UV8A 1XI1A 3ZMZA 2F23A 1SQPH 2HP8A 3UCSC 2UU9B 3TXSA 4WFHA 3SYAA 1I0HA 4H44B 4WFFA 2LP7A 3GB7C 4F6RA 3JARA 3BRCA 1VF5B 5AG2A 3CCVV 5LGNA 1EZVH 1VF7A 3OTOB 1VQPV 1L0NH 3WG7B 4B3RB 5B1OA 4LFCO 3FFQA 1VQLV 3JD0A 3E22B 3RFRA 4NVPA 3FB7C 3OR7C 1N34O 3QO5A 5KAIZ 1XNRB 2LQTA 1PM9A 3SJAC 4CBCA 2XAJA 1UJWB 1O9HA 3CXCU 3VOUA 1S5HC 3AK1A 4JI8O 2ZE8A 1QR8A 4H33A 2OIEA 3ABKC 3H9VA 4JI1O 2B5UA 4NTWA 3UKMA 1NZ6A 1YF2A 4GX0A 1KKDA 4I0XA 4JI5B 4EFBA 1OCZC 1MOFA 3C3TA 2P22C 4DUYO 2C2AA 3CCLV 4WFBV 3AG4B 3U10A 2XAHA 3D3QA 1Q6HA 3JASA 4NXNB 2YEVA 3K06A 5EIBD 5B1BC 3ML0A 3BA8A 1HNZB 5BXZA 3AG7A 5A2QN 3ZS8C 3P30A 3OEHG 3CP1A 1OCRC 1VEWA 3D36A 4O4JA 2EZPA 3B77A 2HVKC 2LFRA 5EC2C 2AHZA 1FXHA 4FZ0A 4JZ2A 5KAFZ 5IWAB 3CPWU 1VQMV 4ICGA 2F4VO 2OCHA 3ASNB 5J2TA 1XHXA 1YXBA 3U0ZA 2HG5C 2ZQMA 3TETA 2GUZB 3LSQA 3A0RA 4LR3A 1ZUQA 2HFEC 1IXBA 3K79A 4J42A 2QM4A 2CK3G 1JCHA 1FYJA 1NH2B 3W7WA 5J2UB 3RYHB 1OHHG 4XBFA 3K0DA 3HPLC 1P7BA 4I4TA 3ABMB 3BAAA 2ITDC 2KQXA 1IBMO 3SYQA 2P06A 2N04A 3BY6A 5IJ0A 1VQ8V 3CYOA 1SQQH 3APOA 4TWKA 2ZM6B 1WPBA 1W0JG 4CC6A 1E1RG 3CE2A 2IW5A 2CTRA 2NN4A 1Q6UA 1K8AW 3THOA 2VS0A 3D36C 4DV0O 2OYQA 4O2BB 5KA5A 1MZFA 2VQFB 2A06H 3CCSV 4DXWA 2PYJA 3I5DA 4IYIA 2PF4E 2IH3C 1UPGA 4FK5C 1Y74A 5BR8O 3A8TA 2QKAA 1JA8A 1AB3A 3E8GA 4XDLA 5H2FZ 1LR1A 3A0BZ 4JPRA 2ITCC 3E2EA 1QCEA 4X66O 5A9GA 4BIZA 1SQVH 4YIPA 1AVMA 2RQ6A 2Z0AA 4YIOA 4UVCA 2N74A 2XT9A 1ROPA 1TVKB 1J95A 2G38A 3KCXA 1NR1A 2ETNA 3A2FA 4O4HB 3K5OA 4DO2A 2QKCA 2JK5C 1JFFA 2FKXA 1YCIA 2F66C 2D2CB 4BR6A 2EJRA 4UCSA 1ORQC 2Q73A 3E86A 3RYFA 1EBOA 2X0LA 4X8AA 2UXCB 1NS1A 2Q9LA 2LGQA 4HYOA 5C93A 5GTIZ 4LFCB 2QM8A 2FTKA 5L3BA 4GKKB 2BSKA 4JYBA 4I9WA 5E1AC 4TUYB 4LFAB 1IVSA 1KECA 1KMIZ 3U11A 2X6AA 2LW7A 4PDMA 2IBZH 1I7FA 3G80A 2EIKB 4FFBB 4ABMA 5CN0A 1FXVA 1AJNA 1M1KW 3HKEA 2XTAA 4LH6A 3AG4C 4UCOA 1Y74B 4U3JB 1GH6A 4E4EA 2UUBB 5CA0A 5H6QA 4PI0A 4MVSA 2Q6AA 4GX2A 2XNDG 1VMGA 4FLTA 4A5UB 1K34A 2Q68A 2EIJB 3B8NA 4KXRA 4MTGA 2YIDA 1K3EA 3N2KB 1AI4A 3ZMVA 1THZA 3ASOC 2IU3A 5B3SB 1I5YA 4MVZA 4B3SO 4DW1A 1TUBA 5CA0B 1M4UA 1SQBH 4K8ZA 2Q69A 1Z5WA 2QKSA 2VWJA 3K3WA 1VIBA 1N32B 1QVFU 3JCUZ 3JSLA 1ZSPA 5LP6B 4LBEC 3N2GA 4JI1B 1SC5B 1Q90D 5IY5C 2BSKB 4I55B 1URFA 3DXRA 3QVNA 4I5SA 4CS4A 2W6JG 4R7CA 4CH3A 4P30A 1M5IA 5KMGB 4LCUC 2Z3YA 1P7GA 3OFNG 4K0KO 2BE3A 1TA8A 1ZTEA 3VBBA 3ABTA 1QLNA 3LSUA 1H2NA 1S3JA 4J11A 1OCRB 3K0GA 4IHJA 2R9RB 1JFFB 1MNGA 2OCCC 3ETDA 2VWKA 2Q5ZA 1S72V 4UCRA 1AROP 2LGWA 3QTCA 3E89A 4QNHB 1KUQA 3P3NA 2ZIMA 5LMNO 4YJ2B 2QTOA 4DR3O 4J7JA 4HAMA 1TVKA 4GX5A 2WLLB 3SYCA 3J81N 2YI8A 3AG3B 3JALA 2WA4A 2UUBO 1NTMH 2A7WA 4AQYB 1DLBA 2JEUA 2HR3A 2ATKC 1BL8A 1I94O 4PA7A 4QPJA 3JSNA 4CH5A 4D7SA 4JZGA 1ZX3A 1K33A 1N33O 4LF5O 4B7KA 4TV9B 4J7ZA 1HNXB 5IYDO 1N0JA 5FL7G 4H0LB 4K3AA 3I56V 4DW0A 2EILB 3OAAG 2X6BA 2YIAA 4RAIA 1FFXA 2Q7GA 4Q20A 3KG2A 1R3JC 4TV9A 5IYCO 3BA9A 5LXTA 3RGBA 5KMGA 2Y0IA 1Y4MA 2KSDA 2WPDG 3ZN1A 1VQNV 4UVBA 2EIMB 1R3LC 5H9CA 4G27B 4FM2A 1BMFG 3ZHTA 4MW8A 5EK0A 3DXRB 1YJWV 4WFAV 4GKJB 4JI5O 4PDRA 3H01A 1VARA 3MAQA 4DV1B 3SDLA 1N36B 4QE7A 1M90W 4B7EA 3P32A 1M93A 5JWPA 4F6EA 2GSMB 2CTWA 4B3TB 2LO1A 1JR9A 3ABLC 1P4RA 2QWNB 5LGUA 5EBWC 4NTXA 3RT3C 2X6CA 4IIJB 3AG1C 5EC1C 4MW3A 5J2UA 4FZ1A 4EKWA 1FD9A 5HFMA 1MABG 4LF4O 4BIOA 1HNWO 2ILMA 2ADPA 1AR4A 4LFAO 4LC1A 3ZRWA 3FAVA 1S76D 1XL4A 5IWAO 5KUKA 3I55V 4O2BA 2RN9A 3WB2A 2BOCC 4G2KA 3UT5A 4EB6A 3QG5A 2ZNJA 5JH7A 2E76B 3OW2U 5C8YA 3FYEB 1HDJA 1Q8IA 2JS3A 3HKEB 4K0KB 2Y4TA 4UCUA 1FFTB 3A0HZ 1K4DC 4JV5O 2E3CA 1SQXH 4O2AA 3L9DA 2GDSA 3CCJV 4J9YB 1PNMA 4LF7B 4DV6O 5E79Z 4I0XB 1XBLA 4K8XA 1QU7A 3OD4A 1M56B 1W59A 4JTDB 5KHHA 3ZMUA 2RJZA 2RCVA 3VQXA 4R50A 1G6UA 1NTZH 1Y67A 2QR4A 3CCMV 5LOVB 4IT5A 4DR4O 1XREA 5GW7A 1S77D 3OMIB 1NH2D 3SGIA 1OCZB 3LSSA 4O4LA 4IL6Z 4PDLA 2P7TC 4DV6B 1H2KA 2MK3A 3OMAB 2W0FC 4X62B 1SETA 5EZYB 2IJIA 2PYLA 4X65B 2ZKOA 3JD2A 4CH6A 1K73W 4YY3B 4X66B 2JGDB 2Z5UA 3MHHC 1NQTA 5LMUO 1XMQB 1GK9A 3SPHA 4X1IB 5LGTA 3R66A 1WAZA 3CB2A 5H6RA 1SERA 3OT7A 2E74B 3ABMC 4EEQA 2YSUB 2ZD9A 4OPHA 1F4MA 1BZKA 2ZNIA 4DK1A 4LF4B 4IYHA 3RYFB 3LDCA 1Y6XA 2W6IG 3IGAC 1AR1B 1Q81W 1S5LZ 1BE3H 1JVMA 1K7DA 4LF9O 3TGUH 4BWAA 4B3TO 3G71V 4O4LB 1XL6A 2YICA 1JMKC 1TUEB 2E75B 2A9HA 2ARHA 1HR0B 2DWEC 5L3EA 5LMUB 1D5AA 1YVWA 1AI7A 2YS8A 3UM7A 3DGEA 4DR1B 3SJCC 4X1KB 1CEZA 5ITZA 2GTSA 2IJKA 4GKKO 1OZ0A 2DN9A 4JV5B 4OX9O 5CBGA 1IDSA 5GTHZ 2R9AA 3DC5A 2K1EA 4IIJA 2CGNA 3ZHSA 3E8FA 4P9PA 2JGUA 2EIKC 1SA0A 5IJ9A 3ZHRA 2LFSA 1EN5A 2Q7EA 1NVPB 3JD3A 1GAXA 3HB3B 1WA8A 2UU9O 3ZBHA 1BQ0A 2E5LO 2Q0AA 5C8YB 4JF3A 4JI8B 1NKDA 3F7YC 4FJCC 1G1XB 1NBMG 4B3RO 3RYIA 2DQ0A 2CTPA 2BCCH 3ZIAG 3OR6C 1GMGA 3N2KA 4HNAB 1XNQO 4LF5B 3FB8C 4XDJA 2WLMA 4X64B 1UFIA 5FPRA 1HP8A 2HLDG 3RBZA 3E8BA 1YI2V 3CC2V 3UQ8A 4RQEA 4ZOLB 3LUTB 4D7TA 4KFMA 2DYSC 2ZT9B 2VQFO 1DTOA 2D3OW 1XNRO 2PZSA 3C3SA 1FJGO 3J80N 5IDJA 2QGNA 3O9OA 1XMOB 4FLUA 3AG2B 3IJ4A 4ZBMA 3JALB 1N36O 3OGCC 3SPCA 3HKDA 1XUQA 1KP2A 4DR1O 5J2TB 5LP6C 4U7OA 4J80A 3OUSA 4IGGA 3J7AU 2XUMA 1H8EG 3M7MX 4Z1MG 1FXKC 1XILA 1ZL8B 1HR0O 2HHHB 1IURA 3RVYA 4U3FH 1VQ4V 1KC8W 1B06A 4JI2O 4DV5O 2AHYA 2CH7B 2XHBA 1NVPD 2ZDIA 3E8HA 1EN4A 3GWOA 4PA9A 4W4LA 4O4IB 2PGGA 1MZEA 4PA4A 2P4VA 3CCQV 1U97A 2HJFC 1R6NA 1XDCA 4B08A 3CX5F 2VQEB 2H8PC 1W2BU 1Q7YW 3UO2A 4DV7B 3K9AA 3ASNC 1I94B 3JD1A 4LWSB 4MVUA 1V55C 1V54B 4DV2B 3GVMA 5FLXN 5HFLA 1EN6A 1K92A 4QE9A 5LP6A 3B2EE 3OE7G 5BR8B 4DV3B 3P3PA 3CC7V 1I08A 1GN6A 1YIJV 2EIMC 2UXDO 4ZI7A 5JH7B 1YDXA 5B1AB 5DEDA 5CA3A 5EBLC 2BTQA 4EB6B 3K59A 4WBNB 3LDEA 2VQEO 5CMUA 4Z2WA 2HJDA 3DTUB 5CBHA 3NR7A 2ZR3A 2V4DA 3JARB 1EM1A 3WB1A 3SYOA 3K57A 1Q3EA 1PKXA 1E1QG 2CDYA 2Y69B 3HKCA 5L3GA 3K03A 5LHHA 3SPJA 3LNNA 4FLWA 3T1HB 4DR7B 2DMXA 2JDIG 5JVDB 4OGQB 3S3WA 4JI0O 3CWBH
chains in the Genus database with same CATH topology
4JI7O 2UXCO 4X64O 4YY3O 1YZBA 4DV1O 2AGAA 4JI2O 4LF7O 1FYJA 4DV5O 4DR4O 4DR2O 1J5EO 2FKXA 1N32O 4X62O 4B3MO 2UU9O 4JI5O 3OTOO 2UUAO 2E5LO 1IBMO 4DV3O 2DOSA 1DK1A 3SDLA 1XMOO 4LFCO 1XEQA 1NS1A 5BY1A 1IBKO 4K0KO 1G1XB 4B3RO 1N34O 2UUCO 1IBLO 3RT3C 1XNQO 2ZKOA 4DV7O 5LL6Y 5FLXN 4KHPO 4JYAO 4AQYO 4DUZO 3T1YO 4JI8O 4LF4O 1HNWO 2LW7A 5LMUO 1XMQO 4LFAO 4DV0O 2ZM6O 5IWAO 1F7YA 4LF6O 1KUQA 4JI1O 3R66A 2UXDO 2VQFO 5LMNO 4JI4O 4DR3O 4YHHO 3T1HO 2HHHO 1XNRO 4DR7O 3J81N 4DV2O 1X59A 2JRIA 2UXBO 1FJGO 3JAMN 4OPHA 3J80N 4DUYO 4DR5O 1HNXO 4JI6O 2UUBO 5BR8O 1AB3A 1HNZO 2VQEO 3M8AA 1AILA 1FKAO 5H5NA 5IT9N 4X65O 4LF8O 4LF9O 1I94O 4A5UB 5BXZA 4B3TO 5A2QN 1R6TA 4X66O 4JV5O 1N36O 4DR6O 4LFBO 1N33O 4LF5O 4B3SO 4NXMO 3F5TA 1A32A 4DR1O 2Z0AA 4JI3O 4DV6O 3O65A 4NXNO 4OPAA 4DV4O 2F4VO 3J7AU 1R1BA 2N74A 1D2DA 4GKKO 2DJVA 4JI0O 4GKJO 4OX9O 1HR0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 O;  2UXC O;  4X64 O;  4YY3 O;  1YZB A;  4DV1 O;  2AGA A;  4JI2 O;  4LF7 O;  1FYJ A;  4DV5 O;  4DR4 O;  4DR2 O;  1J5E O;  2FKX A;  1N32 O;  4X62 O;  4B3M O;  2UU9 O;  4JI5 O;  3OTO O;  2UUA O;  2E5L O;  1IBM O;  4DV3 O;  2DOS A;  1DK1 A;  3SDL A;  1XMO O;  4LFC O;  1XEQ A;  1NS1 A;  5BY1 A;  1IBK O;  4K0K O;  1G1X B;  4B3R O;  1N34 O;  2UUC O;  1IBL O;  3RT3 C;  1XNQ O;  2ZKO A;  4DV7 O;  5LL6 Y;  5FLX N;  4KHP O;  4JYA O;  4AQY O;  4DUZ O;  3T1Y O;  4JI8 O;  4LF4 O;  1HNW O;  2LW7 A;  5LMU O;  1XMQ O;  4LFA O;  4DV0 O;  2ZM6 O;  5IWA O;  1F7Y A;  4LF6 O;  1KUQ A;  4JI1 O;  3R66 A;  2UXD O;  2VQF O;  5LMN O;  4JI4 O;  4DR3 O;  4YHH O;  3T1H O;  2HHH O;  1XNR O;  4DR7 O;  3J81 N;  4DV2 O;  1X59 A;  2JRI A;  2UXB O;  1FJG O;  3JAM N;  4OPH A;  3J80 N;  4DUY O;  4DR5 O;  1HNX O;  4JI6 O;  2UUB O;  5BR8 O;  1AB3 A;  1HNZ O;  2VQE O;  3M8A A;  1AIL A;  1FKA O;  5H5N A;  5IT9 N;  4X65 O;  4LF8 O;  4LF9 O;  1I94 O;  4A5U B;  5BXZ A;  4B3T O;  5A2Q N;  1R6T A;  4X66 O;  4JV5 O;  1N36 O;  4DR6 O;  4LFB O;  1N33 O;  4LF5 O;  4B3S O;  4NXM O;  3F5T A;  1A32 A;  4DR1 O;  2Z0A A;  4JI3 O;  4DV6 O;  3O65 A;  4NXN O;  4OPA A;  4DV4 O;  2F4V O;  3J7A U;  1R1B A;  2N74 A;  1D2D A;  4GKK O;  2DJV A;  4JI0 O;  4GKJ O;  4OX9 O;  1HR0 O; 
#chains in the Genus database with same CATH topology
 3CSX A;  3K9S A;  2L35 A;  2OIG A;  2ZR2 A;  2H94 A;  1RSO B;  4UVA A;  2AGA A;  1G8M A;  1KQS U;  4LNU A;  5BZB A;  1IBK B;  1GN4 A;  1N32 O;  4O4I A;  1XOU A;  3VQV A;  3IAY A;  1Z2G A;  5EZY A;  3K5M A;  3FX7 A;  3RVZ A;  3WB0 A;  4BAY A;  3JAW B;  5EIB C;  1QLE C;  3STL C;  4GLX A;  2CAZ C;  3CCU V;  1FFX B;  1Q5O A;  3FYI B;  1MSW D;  3OEE G;  4HZ3 A;  4P9O A;  3B09 A;  1NU1 H;  2XOK G;  3F5W C;  2F93 B;  2UUC O;  1VQO V;  1EZJ A;  2NR5 A;  5DEC A;  4RUE A;  1OCC C;  4KHP B;  1Q43 A;  1SQF A;  2AZ0 A;  2QDO A;  4FM1 A;  3H1K H;  2M6Y A;  4FFB A;  3SYP A;  3B4S A;  3RW0 A;  2K9P A;  5TIS Z;  4QGP A;  3ZN0 A;  4MSW C;  4DV2 O;  1VQ6 V;  5L3F A;  1US6 A;  4MVM A;  3ZJZ A;  4MS2 A;  4JGS A;  1N8R W;  4B3S B;  1BCC H;  2XAQ A;  3M8A A;  4RWU A;  1FPO A;  1H8H G;  2WLH A;  4W4K A;  2Y0P A;  2CH7 A;  3EHB B;  1DGS A;  1DF4 A;  1PV0 A;  2YI9 A;  3H1I H;  5K1X A;  3RYC B;  3B8M A;  2P6J A;  1H2L A;  4J41 A;  1YHQ V;  5D5Q A;  1P84 F;  1Q82 W;  2ZXW C;  2KG7 B;  3EXA A;  4JI3 O;  5L3C A;  2CE4 A;  2RDC A;  4NXN O;  1BS3 A;  1LUW A;  3JAW A;  1M56 C;  1FXK B;  2UXX A;  2ZE5 A;  3UT5 B;  3ZMS A;  4QJF B;  5KHG A;  2OWO A;  4MVQ A;  1R6K A;  3QF7 A;  1H2M A;  3X2Q C;  4YY3 O;  2YC0 A;  2NNU A;  4CZZ A;  2GV9 A;  3FD9 A;  3SR2 C;  5KX5 A;  3BCC H;  1K5Q A;  4X9Q A;  4DK0 A;  3SPI A;  2OTJ V;  4J10 A;  4G28 B;  2KKW A;  3G4S V;  3OGI B;  3ZHU A;  5F2V O;  1SZX A;  2DOS A;  4O2A B;  1WNS A;  2MW2 B;  4ZHQ B;  2QWO B;  1PL0 A;  1XMO O;  1EFR G;  2EIN C;  2JJ2 G;  4JI3 B;  3SJQ C;  3S3X A;  2OCC B;  1YTF D;  3CHX A;  4DR2 B;  4YHH B;  3OTF A;  4DV7 O;  4UUJ C;  4KHP O;  1VQ9 V;  2GUZ A;  4DUZ O;  5IYZ A;  5KHI A;  2JEX A;  4Z1V A;  2WLN A;  1BGY H;  4LF9 B;  4GUN A;  1YEW A;  4WBN A;  1BT8 A;  4TOI A;  4XDK A;  1QNM A;  3WFV A;  4JI4 B;  3ZRX A;  4B3M B;  1HW7 A;  2HHH O;  3ZRW B;  2P5O A;  1P49 A;  1GM7 A;  5DN6 G;  4TSF G;  2A0L A;  3BPZ A;  1M57 C;  1HNX O;  1YSC A;  4WF9 V;  1J5E B;  2FYU H;  1NT2 B;  1WLE A;  5LYJ B;  5H5N A;  5CB4 B;  1H2S B;  3W7T A;  1M57 B;  1AP6 A;  1LUV A;  3PJS K;  4QIW F;  4X89 A;  4I4T B;  1WN7 A;  4JYA B;  4LH7 A;  3ZED A;  3CD6 V;  1KU9 A;  2E5L B;  4TQF A;  2EBO A;  2V1D A;  2AW9 A;  5KX5 B;  1L8D A;  1B3Q A;  5ITZ B;  1JX9 A;  4PV1 B;  5LHI A;  1QBZ A;  4NTY A;  1RPR A;  4LF6 B;  1QHT A;  2V7Q G;  3AG3 C;  4GKJ O;  2WLJ A;  5LXT B;  4JI7 O;  2UXC O;  2JJ1 G;  5K1P A;  4X64 O;  5BMV B;  4D6T H;  1YZB A;  2QJ1 A;  2KG7 A;  1T5E A;  3UO3 A;  4LF7 O;  1WB8 A;  4UB8 Z;  2BTO A;  3GWK C;  1NR7 A;  3RYC A;  3Q4H B;  1M9N A;  3BEH A;  1X4T A;  3CRQ A;  4AHC A;  2FL4 A;  3BAB A;  5KHJ A;  3W7X A;  2UUA O;  5IE9 A;  2ADQ B;  1VP7 A;  3JYC A;  4EFE A;  5LOV A;  3CRR A;  1K5S A;  2Q67 A;  1O9G A;  1GTO A;  3STZ C;  4GX1 A;  1OJH A;  4F6R B;  3QO8 A;  4FLY A;  2EX3 A;  2BOB C;  1SKV A;  5DM6 V;  3CMA V;  5JCO C;  2Y69 C;  3KZI Z;  3H1L H;  3DC6 A;  2R70 A;  1OCO B;  4PA3 A;  1XMQ O;  4WFG A;  1FS0 G;  4YJ2 A;  2DYR C;  3LNM B;  5CB4 A;  1CPY A;  3QO7 A;  2YXH A;  1X59 A;  2JRI A;  3ZMT A;  1YJN V;  3ICX A;  1K9M W;  2EIJ C;  3ABU A;  4FLV A;  3AG2 C;  1TUB B;  4MVR A;  1HNZ O;  1K4C C;  4I50 B;  4RO2 A;  1RFY A;  3L70 H;  3L73 H;  4X1Y B;  4X1Y A;  5B1B B;  1JJ2 U;  1JOY A;  2YUA A;  5KHK A;  4DV5 B;  4FVM A;  3E83 A;  1R3K C;  4LNU B;  5GON A;  3G6E V;  1PNL A;  4C7U A;  3D8C A;  4X88 A;  1BHA A;  4OPA A;  2ODM A;  2RNB A;  1R1B A;  5IJ0 B;  3X2Q B;  4BW9 A;  3L74 H;  4GYC B;  3ETG A;  4GZR B;  3JD4 A;  1B6Q A;  4LF8 B;  3ABK B;  1JPX A;  4UB6 Z;  2A3Q A;  3HKC B;  1NTK H;  1J5E O;  1BQZ A;  3RYH A;  4X62 O;  1N34 B;  2QE7 G;  4DV4 B;  4PA6 A;  3T2M A;  5GON B;  4CS2 A;  3OTO O;  2UUA B;  4X1K A;  4TV8 A;  2JVD A;  3RWR D;  1JJO A;  3HR0 A;  3G67 A;  1RM1 B;  4BW5 A;  1TAE A;  4YJ3 A;  4PHZ A;  2ZE6 A;  4ZKI A;  1MG1 A;  2VRZ A;  1GM9 A;  2P4K A;  2QTS A;  4ZI7 B;  4PEL A;  4UV9 A;  2XAG A;  4AIL C;  4YXW G;  4AQY O;  2B9Z A;  3TXQ A;  3BHP A;  1RPO A;  4FMT A;  1OV9 A;  4DUZ B;  1Q86 W;  1SF9 A;  2ZM6 O;  2P67 A;  1VF6 A;  2ZIO A;  2O57 A;  2DW4 A;  5KUM A;  1H38 A;  3T1H O;  1XNQ B;  4DR7 O;  3VQW A;  3TK1 A;  5KLV H;  2KB1 A;  4LWS A;  4JI0 B;  2Q7H A;  4TUY A;  3T4Z A;  4WFE A;  5D5P A;  1PP9 H;  5B1A C;  3W7S A;  2YIB A;  4N21 A;  1RP3 B;  5IT9 N;  3SJB C;  3OMN B;  3QNE A;  4BIU A;  4FM0 A;  1MA1 A;  2F4V B;  1TGO A;  1V54 C;  4KUM A;  1KD1 W;  4JYY A;  1ENV A;  2IJJ A;  1L1F A;  1WB7 A;  1YIT V;  4NYK A;  2IJH A;  1YJ9 V;  1FAF A;  4JTC B;  5EYP A;  4FFK A;  4FLZ A;  4TT3 G;  3K04 A;  1N4C A;  3E35 A;  1KYO F;  2UUC B;  4ZIB A;  1D2D A;  2DJV A;  1GKF A;  1N0N A;  1GM8 A;  2XAS A;  4MTF A;  2OT5 A;  4J9Z B;  4GCZ A;  1AJQ A;  2XAF A;  4OX9 B;  3JAT A;  3DSQ A;  1AI5 A;  4N23 A;  5IYZ B;  3KCY A;  1VQ5 V;  3C90 A;  5B1N A;  4P2Z A;  1R3I C;  3ABL B;  5JQG B;  1XQ8 A;  3CS5 A;  3T1Y B;  4JI2 B;  4JAV A;  4L8J A;  3CRA A;  4WCE V;  4NR1 A;  3H1J H;  3EVK A;  1Y76 B;  4OXS A;  1S5J A;  1PNK A;  4CS3 A;  2QWQ B;  1OCO C;  4KL1 A;  5LL6 Y;  5B3S C;  4PI2 A;  3HKB A;  1WJZ A;  3AG1 B;  4LF6 O;  1NJI W;  1Y66 A;  1SZT A;  3K5N A;  3BVO A;  1LNQ A;  1SQG A;  3ZRS A;  1COW G;  1QLE B;  3RYI B;  1MMM A;  5LA6 B;  5J9P C;  1QQC A;  4R6Z A;  2DQ3 A;  4U3J A;  4MTX A;  3SPG A;  4DR4 B;  3RN4 A;  3T1C A;  4E2L A;  4FPP A;  4JAA A;  1WA8 B;  3CJH B;  1VF6 C;  1KBH A;  4H13 B;  4DR6 O;  4ZHQ A;  2WA3 A;  4X20 B;  1SA0 B;  5B66 Z;  5IJ9 B;  1HNW B;  5JJN B;  2F43 G;  4AI8 A;  1BSM A;  2PI4 A;  3K5L A;  3O65 A;  3K08 A;  2M7W A;  1XHZ A;  1U96 A;  1AR5 A;  2F95 B;  3AK3 A;  4I9Q A;  1IBL B;  4FLX A;  5FNV B;  3CC4 V;  1DF5 A;  1SRY A;  4RQF A;  1G4Y B;  2PTM A;  1SS3 A;  3L71 H;  2ZIN A;  2WAM A;  1AJP A;  5IY5 B;  4HBN A;  4DR2 O;  3CRC A;  3CXH F;  3H1H H;  2X7R B;  1ZLZ A;  4B3M O;  4I50 A;  3Q4H A;  1GN2 A;  2B1I A;  3CCR V;  2ZDI C;  3G6B A;  1ZAU A;  4UXN A;  3MDS A;  4DRX A;  3JCZ A;  1AI6 A;  1IBK O;  2CTQ A;  2YDE A;  2Q8V A;  2A79 B;  2PY5 A;  2IH1 C;  2R72 A;  4U7N A;  1IBL O;  3FKS G;  1GRJ A;  4RUF A;  3LDD A;  1WP8 A;  2QWR B;  4JYA O;  4UCV A;  3T1Y O;  4NXM B;  4JTA B;  4JI6 B;  4X1I A;  1V55 B;  1WPX A;  2LW1 A;  5CA1 A;  2JGD A;  1F7Y A;  2CUG A;  5JVD A;  4DR5 B;  5LHG A;  2WLL A;  2UXB O;  3FB6 C;  1IBM B;  4X20 A;  2AZ2 A;  3MHS C;  3N27 A;  3CME V;  3WG7 C;  4PD4 F;  3IC7 A;  4X65 O;  4NKG B;  4Q6G A;  3ETQ A;  1BHB A;  1N33 B;  1MSD A;  2QWP B;  2H3O A;  1F23 A;  3CRM A;  1R6T A;  1AP5 A;  4LFB O;  4O4H A;  5BMV A;  4CC5 A;  4NXM O;  1RM1 C;  2HEP A;  3L72 H;  4L87 A;  2Q0O C;  4HNA A;  3ZX6 A;  3BFR A;  2DWD C;  2EJ7 A;  3FAV B;  2YIB D;  5FNV A;  2UXB B;  4I55 A;  3TCU A;  1QVG U;  3PN1 A;  1S0V A;  2ZE7 A;  2IM9 A;  1GO3 F;  3FB5 C;  2QM7 A;  4K35 A;  4J7K A;  1CP9 A;  1KB9 F;  3CJH A;  2R9I A;  1K97 A;  2W0X A;  4GT1 A;  3AK2 A;  1W0K G;  4MTO A;  1FJG B;  1SES A;  1DK1 A;  1QR9 A;  2IU0 A;  4DR6 B;  1XEQ A;  5BY1 A;  3CEI A;  2GBO A;  4PJ0 Z;  3JAT B;  3ZRV A;  4F4L A;  2DE0 X;  4R8C A;  2HKO A;  4TQD A;  2BTQ B;  3ASO B;  3TJT A;  3W7U A;  4FIP C;  4JAU A;  5LBQ A;  2FML A;  4JYC A;  2JIZ G;  3JAK A;  1L0L H;  3VQY A;  2NLJ C;  3ZHQ A;  5LMN B;  4JI4 O;  2QEX V;  5EYP B;  4YHH O;  4DUY B;  2YXL A;  5JJE B;  1V9P A;  1JQ0 A;  2DYS B;  4LP8 A;  4JI6 O;  4I7Z B;  5B5E Z;  3HKD B;  4MT8 A;  4ASU G;  1FKA O;  3K58 A;  2EZO A;  5JQG A;  4LF8 O;  5L3D A;  1OCC B;  5CA1 B;  1D5N A;  1VQK V;  1ZWI C;  1R73 A;  3D3I A;  2P90 A;  3ETE A;  2F1M A;  3F5T A;  1PD3 A;  4NB5 A;  5JJJ B;  4DV4 O;  2ZCE A;  1FXK A;  1B04 A;  4QPK A;  4DV0 B;  1CXZ B;  1F4N A;  3OM3 B;  4DRX B;  1PPJ H;  1VQ7 V;  1KP3 A;  3KKY A;  3APQ A;  2UXN A;  3MD0 A;  4O4J B;  1F51 A;  2QA4 V;  1NI8 A;  5IYB O;  1YTF B;  4IHJ B;  1ZL8 A;  4PDV A;  4DV1 O;  3M99 B;  5JCO A;  2PI5 A;  2L6L A;  4UCT A;  2DYR B;  1Q6I A;  3EFF K;  3AEI A;  3F7V C;  3WU2 Z;  3IC9 A;  3CCE V;  2UXD B;  1IX9 A;  2YXY A;  2Y48 A;  2YEV B;  2EUL A;  3JAS B;  1GN3 A;  3OUF A;  4DV3 O;  3L75 H;  5CBF A;  2WWW A;  2GHY A;  2ZXW B;  3B40 A;  1H2G A;  1RSO A;  4H37 A;  1IXM A;  2FB5 A;  2B1G A;  2EIL C;  1I5X A;  2EIN B;  2LJ2 A;  4DYL A;  1PL4 A;  3NXS A;  3N2G B;  1E79 G;  2GTA A;  2WLI A;  4JAS A;  5EBM C;  5LYJ A;  1KKC A;  4KP4 A;  2Y4U A;  2WSS G;  2RMK B;  1WP7 A;  2AXT Z;  1IZ3 A;  3T4D A;  3JAK B;  2WLK A;  4ZOL A;  2QSA A;  3E22 A;  1Z5V A;  4UFZ A;  5LA6 A;  3JAM N;  2HVJ C;  4DR5 O;  2OTL V;  2Q4P A;  4CH4 A;  4MVO A;  4YJ3 B;  2JS5 A;  5KA6 A;  3ZHV A;  1AIL A;  4TV8 B;  2PUS A;  3IFX A;  5FPO A;  3HKB B;  4JI7 B;  1HWY A;  3ZCC A;  2N05 A;  2CGO A;  3R65 A;  4LFB B;  1A32 A;  2WLI B;  1Y76 A;  4DR3 B;  4UV8 A;  1XI1 A;  3ZMZ A;  2F23 A;  1SQP H;  2HP8 A;  3UCS C;  2UU9 B;  3TXS A;  4WFH A;  3SYA A;  1I0H A;  4H44 B;  4WFF A;  2LP7 A;  3GB7 C;  4F6R A;  3JAR A;  3BRC A;  1VF5 B;  5AG2 A;  3CCV V;  5LGN A;  1EZV H;  1VF7 A;  3OTO B;  1VQP V;  1L0N H;  3WG7 B;  4B3R B;  5B1O A;  4LFC O;  3FFQ A;  1VQL V;  3JD0 A;  3E22 B;  3RFR A;  4NVP A;  3FB7 C;  3OR7 C;  1N34 O;  3QO5 A;  5KAI Z;  1XNR B;  2LQT A;  1PM9 A;  3SJA C;  4CBC A;  2XAJ A;  1UJW B;  1O9H A;  3CXC U;  3VOU A;  1S5H C;  3AK1 A;  4JI8 O;  2ZE8 A;  1QR8 A;  4H33 A;  2OIE A;  3ABK C;  3H9V A;  4JI1 O;  2B5U A;  4NTW A;  3UKM A;  1NZ6 A;  1YF2 A;  4GX0 A;  1KKD A;  4I0X A;  4JI5 B;  4EFB A;  1OCZ C;  1MOF A;  3C3T A;  2P22 C;  4DUY O;  2C2A A;  3CCL V;  4WFB V;  3AG4 B;  3U10 A;  2XAH A;  3D3Q A;  1Q6H A;  3JAS A;  4NXN B;  2YEV A;  3K06 A;  5EIB D;  5B1B C;  3ML0 A;  3BA8 A;  1HNZ B;  5BXZ A;  3AG7 A;  5A2Q N;  3ZS8 C;  3P30 A;  3OEH G;  3CP1 A;  1OCR C;  1VEW A;  3D36 A;  4O4J A;  2EZP A;  3B77 A;  2HVK C;  2LFR A;  5EC2 C;  2AHZ A;  1FXH A;  4FZ0 A;  4JZ2 A;  5KAF Z;  5IWA B;  3CPW U;  1VQM V;  4ICG A;  2F4V O;  2OCH A;  3ASN B;  5J2T A;  1XHX A;  1YXB A;  3U0Z A;  2HG5 C;  2ZQM A;  3TET A;  2GUZ B;  3LSQ A;  3A0R A;  4LR3 A;  1ZUQ A;  2HFE C;  1IXB A;  3K79 A;  4J42 A;  2QM4 A;  2CK3 G;  1JCH A;  1FYJ A;  1NH2 B;  3W7W A;  5J2U B;  3RYH B;  1OHH G;  4XBF A;  3K0D A;  3HPL C;  1P7B A;  4I4T A;  3ABM B;  3BAA A;  2ITD C;  2KQX A;  1IBM O;  3SYQ A;  2P06 A;  2N04 A;  3BY6 A;  5IJ0 A;  1VQ8 V;  3CYO A;  1SQQ H;  3APO A;  4TWK A;  2ZM6 B;  1WPB A;  1W0J G;  4CC6 A;  1E1R G;  3CE2 A;  2IW5 A;  2CTR A;  2NN4 A;  1Q6U A;  1K8A W;  3THO A;  2VS0 A;  3D36 C;  4DV0 O;  2OYQ A;  4O2B B;  5KA5 A;  1MZF A;  2VQF B;  2A06 H;  3CCS V;  4DXW A;  2PYJ A;  3I5D A;  4IYI A;  2PF4 E;  2IH3 C;  1UPG A;  4FK5 C;  1Y74 A;  5BR8 O;  3A8T A;  2QKA A;  1JA8 A;  1AB3 A;  3E8G A;  4XDL A;  5H2F Z;  1LR1 A;  3A0B Z;  4JPR A;  2ITC C;  3E2E A;  1QCE A;  4X66 O;  5A9G A;  4BIZ A;  1SQV H;  4YIP A;  1AVM A;  2RQ6 A;  2Z0A A;  4YIO A;  4UVC A;  2N74 A;  2XT9 A;  1ROP A;  1TVK B;  1J95 A;  2G38 A;  3KCX A;  1NR1 A;  2ETN A;  3A2F A;  4O4H B;  3K5O A;  4DO2 A;  2QKC A;  2JK5 C;  1JFF A;  2FKX A;  1YCI A;  2F66 C;  2D2C B;  4BR6 A;  2EJR A;  4UCS A;  1ORQ C;  2Q73 A;  3E86 A;  3RYF A;  1EBO A;  2X0L A;  4X8A A;  2UXC B;  1NS1 A;  2Q9L A;  2LGQ A;  4HYO A;  5C93 A;  5GTI Z;  4LFC B;  2QM8 A;  2FTK A;  5L3B A;  4GKK B;  2BSK A;  4JYB A;  4I9W A;  5E1A C;  4TUY B;  4LFA B;  1IVS A;  1KEC A;  1KMI Z;  3U11 A;  2X6A A;  2LW7 A;  4PDM A;  2IBZ H;  1I7F A;  3G80 A;  2EIK B;  4FFB B;  4ABM A;  5CN0 A;  1FXV A;  1AJN A;  1M1K W;  3HKE A;  2XTA A;  4LH6 A;  3AG4 C;  4UCO A;  1Y74 B;  4U3J B;  1GH6 A;  4E4E A;  2UUB B;  5CA0 A;  5H6Q A;  4PI0 A;  4MVS A;  2Q6A A;  4GX2 A;  2XND G;  1VMG A;  4FLT A;  4A5U B;  1K34 A;  2Q68 A;  2EIJ B;  3B8N A;  4KXR A;  4MTG A;  2YID A;  1K3E A;  3N2K B;  1AI4 A;  3ZMV A;  1THZ A;  3ASO C;  2IU3 A;  5B3S B;  1I5Y A;  4MVZ A;  4B3S O;  4DW1 A;  1TUB A;  5CA0 B;  1M4U A;  1SQB H;  4K8Z A;  2Q69 A;  1Z5W A;  2QKS A;  2VWJ A;  3K3W A;  1VIB A;  1N32 B;  1QVF U;  3JCU Z;  3JSL A;  1ZSP A;  5LP6 B;  4LBE C;  3N2G A;  4JI1 B;  1SC5 B;  1Q90 D;  5IY5 C;  2BSK B;  4I55 B;  1URF A;  3DXR A;  3QVN A;  4I5S A;  4CS4 A;  2W6J G;  4R7C A;  4CH3 A;  4P30 A;  1M5I A;  5KMG B;  4LCU C;  2Z3Y A;  1P7G A;  3OFN G;  4K0K O;  2BE3 A;  1TA8 A;  1ZTE A;  3VBB A;  3ABT A;  1QLN A;  3LSU A;  1H2N A;  1S3J A;  4J11 A;  1OCR B;  3K0G A;  4IHJ A;  2R9R B;  1JFF B;  1MNG A;  2OCC C;  3ETD A;  2VWK A;  2Q5Z A;  1S72 V;  4UCR A;  1ARO P;  2LGW A;  3QTC A;  3E89 A;  4QNH B;  1KUQ A;  3P3N A;  2ZIM A;  5LMN O;  4YJ2 B;  2QTO A;  4DR3 O;  4J7J A;  4HAM A;  1TVK A;  4GX5 A;  2WLL B;  3SYC A;  3J81 N;  2YI8 A;  3AG3 B;  3JAL A;  2WA4 A;  2UUB O;  1NTM H;  2A7W A;  4AQY B;  1DLB A;  2JEU A;  2HR3 A;  2ATK C;  1BL8 A;  1I94 O;  4PA7 A;  4QPJ A;  3JSN A;  4CH5 A;  4D7S A;  4JZG A;  1ZX3 A;  1K33 A;  1N33 O;  4LF5 O;  4B7K A;  4TV9 B;  4J7Z A;  1HNX B;  5IYD O;  1N0J A;  5FL7 G;  4H0L B;  4K3A A;  3I56 V;  4DW0 A;  2EIL B;  3OAA G;  2X6B A;  2YIA A;  4RAI A;  1FFX A;  2Q7G A;  4Q20 A;  3KG2 A;  1R3J C;  4TV9 A;  5IYC O;  3BA9 A;  5LXT A;  3RGB A;  5KMG A;  2Y0I A;  1Y4M A;  2KSD A;  2WPD G;  3ZN1 A;  1VQN V;  4UVB A;  2EIM B;  1R3L C;  5H9C A;  4G27 B;  4FM2 A;  1BMF G;  3ZHT A;  4MW8 A;  5EK0 A;  3DXR B;  1YJW V;  4WFA V;  4GKJ B;  4JI5 O;  4PDR A;  3H01 A;  1VAR A;  3MAQ A;  4DV1 B;  3SDL A;  1N36 B;  4QE7 A;  1M90 W;  4B7E A;  3P32 A;  1M93 A;  5JWP A;  4F6E A;  2GSM B;  2CTW A;  4B3T B;  2LO1 A;  1JR9 A;  3ABL C;  1P4R A;  2QWN B;  5LGU A;  5EBW C;  4NTX A;  3RT3 C;  2X6C A;  4IIJ B;  3AG1 C;  5EC1 C;  4MW3 A;  5J2U A;  4FZ1 A;  4EKW A;  1FD9 A;  5HFM A;  1MAB G;  4LF4 O;  4BIO A;  1HNW O;  2ILM A;  2ADP A;  1AR4 A;  4LFA O;  4LC1 A;  3ZRW A;  3FAV A;  1S76 D;  1XL4 A;  5IWA O;  5KUK A;  3I55 V;  4O2B A;  2RN9 A;  3WB2 A;  2BOC C;  4G2K A;  3UT5 A;  4EB6 A;  3QG5 A;  2ZNJ A;  5JH7 A;  2E76 B;  3OW2 U;  5C8Y A;  3FYE B;  1HDJ A;  1Q8I A;  2JS3 A;  3HKE B;  4K0K B;  2Y4T A;  4UCU A;  1FFT B;  3A0H Z;  1K4D C;  4JV5 O;  2E3C A;  1SQX H;  4O2A A;  3L9D A;  2GDS A;  3CCJ V;  4J9Y B;  1PNM A;  4LF7 B;  4DV6 O;  5E79 Z;  4I0X B;  1XBL A;  4K8X A;  1QU7 A;  3OD4 A;  1M56 B;  1W59 A;  4JTD B;  5KHH A;  3ZMU A;  2RJZ A;  2RCV A;  3VQX A;  4R50 A;  1G6U A;  1NTZ H;  1Y67 A;  2QR4 A;  3CCM V;  5LOV B;  4IT5 A;  4DR4 O;  1XRE A;  5GW7 A;  1S77 D;  3OMI B;  1NH2 D;  3SGI A;  1OCZ B;  3LSS A;  4O4L A;  4IL6 Z;  4PDL A;  2P7T C;  4DV6 B;  1H2K A;  2MK3 A;  3OMA B;  2W0F C;  4X62 B;  1SET A;  5EZY B;  2IJI A;  2PYL A;  4X65 B;  2ZKO A;  3JD2 A;  4CH6 A;  1K73 W;  4YY3 B;  4X66 B;  2JGD B;  2Z5U A;  3MHH C;  1NQT A;  5LMU O;  1XMQ B;  1GK9 A;  3SPH A;  4X1I B;  5LGT A;  3R66 A;  1WAZ A;  3CB2 A;  5H6R A;  1SER A;  3OT7 A;  2E74 B;  3ABM C;  4EEQ A;  2YSU B;  2ZD9 A;  4OPH A;  1F4M A;  1BZK A;  2ZNI A;  4DK1 A;  4LF4 B;  4IYH A;  3RYF B;  3LDC A;  1Y6X A;  2W6I G;  3IGA C;  1AR1 B;  1Q81 W;  1S5L Z;  1BE3 H;  1JVM A;  1K7D A;  4LF9 O;  3TGU H;  4BWA A;  4B3T O;  3G71 V;  4O4L B;  1XL6 A;  2YIC A;  1JMK C;  1TUE B;  2E75 B;  2A9H A;  2ARH A;  1HR0 B;  2DWE C;  5L3E A;  5LMU B;  1D5A A;  1YVW A;  1AI7 A;  2YS8 A;  3UM7 A;  3DGE A;  4DR1 B;  3SJC C;  4X1K B;  1CEZ A;  5ITZ A;  2GTS A;  2IJK A;  4GKK O;  1OZ0 A;  2DN9 A;  4JV5 B;  4OX9 O;  5CBG A;  1IDS A;  5GTH Z;  2R9A A;  3DC5 A;  2K1E A;  4IIJ A;  2CGN A;  3ZHS A;  3E8F A;  4P9P A;  2JGU A;  2EIK C;  1SA0 A;  5IJ9 A;  3ZHR A;  2LFS A;  1EN5 A;  2Q7E A;  1NVP B;  3JD3 A;  1GAX A;  3HB3 B;  1WA8 A;  2UU9 O;  3ZBH A;  1BQ0 A;  2E5L O;  2Q0A A;  5C8Y B;  4JF3 A;  4JI8 B;  1NKD A;  3F7Y C;  4FJC C;  1G1X B;  1NBM G;  4B3R O;  3RYI A;  2DQ0 A;  2CTP A;  2BCC H;  3ZIA G;  3OR6 C;  1GMG A;  3N2K A;  4HNA B;  1XNQ O;  4LF5 B;  3FB8 C;  4XDJ A;  2WLM A;  4X64 B;  1UFI A;  5FPR A;  1HP8 A;  2HLD G;  3RBZ A;  3E8B A;  1YI2 V;  3CC2 V;  3UQ8 A;  4RQE A;  4ZOL B;  3LUT B;  4D7T A;  4KFM A;  2DYS C;  2ZT9 B;  2VQF O;  1DTO A;  2D3O W;  1XNR O;  2PZS A;  3C3S A;  1FJG O;  3J80 N;  5IDJ A;  2QGN A;  3O9O A;  1XMO B;  4FLU A;  3AG2 B;  3IJ4 A;  4ZBM A;  3JAL B;  1N36 O;  3OGC C;  3SPC A;  3HKD A;  1XUQ A;  1KP2 A;  4DR1 O;  5J2T B;  5LP6 C;  4U7O A;  4J80 A;  3OUS A;  4IGG A;  3J7A U;  2XUM A;  1H8E G;  3M7M X;  4Z1M G;  1FXK C;  1XIL A;  1ZL8 B;  1HR0 O;  2HHH B;  1IUR A;  3RVY A;  4U3F H;  1VQ4 V;  1KC8 W;  1B06 A;  4JI2 O;  4DV5 O;  2AHY A;  2CH7 B;  2XHB A;  1NVP D;  2ZDI A;  3E8H A;  1EN4 A;  3GWO A;  4PA9 A;  4W4L A;  4O4I B;  2PGG A;  1MZE A;  4PA4 A;  2P4V A;  3CCQ V;  1U97 A;  2HJF C;  1R6N A;  1XDC A;  4B08 A;  3CX5 F;  2VQE B;  2H8P C;  1W2B U;  1Q7Y W;  3UO2 A;  4DV7 B;  3K9A A;  3ASN C;  1I94 B;  3JD1 A;  4LWS B;  4MVU A;  1V55 C;  1V54 B;  4DV2 B;  3GVM A;  5FLX N;  5HFL A;  1EN6 A;  1K92 A;  4QE9 A;  5LP6 A;  3B2E E;  3OE7 G;  5BR8 B;  4DV3 B;  3P3P A;  3CC7 V;  1I08 A;  1GN6 A;  1YIJ V;  2EIM C;  2UXD O;  4ZI7 A;  5JH7 B;  1YDX A;  5B1A B;  5DED A;  5CA3 A;  5EBL C;  2BTQ A;  4EB6 B;  3K59 A;  4WBN B;  3LDE A;  2VQE O;  5CMU A;  4Z2W A;  2HJD A;  3DTU B;  5CBH A;  3NR7 A;  2ZR3 A;  2V4D A;  3JAR B;  1EM1 A;  3WB1 A;  3SYO A;  3K57 A;  1Q3E A;  1PKX A;  1E1Q G;  2CDY A;  2Y69 B;  3HKC A;  5L3G A;  3K03 A;  5LHH A;  3SPJ A;  3LNN A;  4FLW A;  3T1H B;  4DR7 B;  2DMX A;  2JDI G;  5JVD B;  4OGQ B;  3S3W A;  4JI0 O;  3CWB H; 
#chains in the Genus database with same CATH homology
 4JI7 O;  2UXC O;  4X64 O;  4YY3 O;  1YZB A;  4DV1 O;  2AGA A;  4JI2 O;  4LF7 O;  1FYJ A;  4DV5 O;  4DR4 O;  4DR2 O;  1J5E O;  2FKX A;  1N32 O;  4X62 O;  4B3M O;  2UU9 O;  4JI5 O;  3OTO O;  2UUA O;  2E5L O;  1IBM O;  4DV3 O;  2DOS A;  1DK1 A;  3SDL A;  1XMO O;  4LFC O;  1XEQ A;  1NS1 A;  5BY1 A;  1IBK O;  4K0K O;  1G1X B;  4B3R O;  1N34 O;  2UUC O;  1IBL O;  3RT3 C;  1XNQ O;  2ZKO A;  4DV7 O;  5LL6 Y;  5FLX N;  4KHP O;  4JYA O;  4AQY O;  4DUZ O;  3T1Y O;  4JI8 O;  4LF4 O;  1HNW O;  2LW7 A;  5LMU O;  1XMQ O;  4LFA O;  4DV0 O;  2ZM6 O;  5IWA O;  1F7Y A;  4LF6 O;  1KUQ A;  4JI1 O;  3R66 A;  2UXD O;  2VQF O;  5LMN O;  4JI4 O;  4DR3 O;  4YHH O;  3T1H O;  2HHH O;  1XNR O;  4DR7 O;  3J81 N;  4DV2 O;  1X59 A;  2JRI A;  2UXB O;  1FJG O;  3JAM N;  4OPH A;  3J80 N;  4DUY O;  4DR5 O;  1HNX O;  4JI6 O;  2UUB O;  5BR8 O;  1AB3 A;  1HNZ O;  2VQE O;  3M8A A;  1AIL A;  1FKA O;  5H5N A;  5IT9 N;  4X65 O;  4LF8 O;  4LF9 O;  1I94 O;  4A5U B;  5BXZ A;  4B3T O;  5A2Q N;  1R6T A;  4X66 O;  4JV5 O;  1N36 O;  4DR6 O;  4LFB O;  1N33 O;  4LF5 O;  4B3S O;  4NXM O;  3F5T A;  1A32 A;  4DR1 O;  2Z0A A;  4JI3 O;  4DV6 O;  3O65 A;  4NXN O;  4OPA A;  4DV4 O;  2F4V O;  3J7A U;  1R1B A;  2N74 A;  1D2D A;  4GKK O;  2DJV A;  4JI0 O;  4GKJ O;  4OX9 O;  1HR0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...