1XMOO

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xmoO00
4LF4O 2DOSA 2JRIA 3RT3C 4AQYO 1I94O 4LFBO 4OX9O 2VQEO 2LW7A 4JI1O 1R6TA 4GKKO 4B3SO 4DV6O 5BR8O 2UXBO 5A2QN 3O65A 5IT9N 4JI5O 4YY3O 2FKXA 1N34O 5LL6Y 5BY1A 3R66A 4JI8O 4DV3O 1FYJA 1XMQO 4DR5O 1HNXO 2F4VO 5FLXN 4DV4O 4DR3O 4B3MO 4DR6O 4JV5O 4DR7O 4DV7O 3J7AU 1DK1A 3J80N 4NXMO 1XNQO 4LF7O 4X66O 4LFCO 5BXZA 4OPHA 5H5NA 4X64O 4X62O 4DV5O 1N36O 4DV0O 1A32A 4JI3O 3OTOO 4JI2O 2UUCO 4JI6O 3JAMN 4DV2O 4LF5O 4YHHO 2AGAA 5IWAO 2UXDO 4B3TO 3T1HO 2N74A 1X59A 1D2DA 1XNRO 1FJGO 3M8AA 1F7YA 2E5LO 1IBLO 1N33O 4JI7O 1KUQA 3F5TA 3J81N 2UU9O 4K0KO 1FKAO 1XEQA 2UUBO 1G1XB 4DV1O 4DUYO 2HHHO 1AILA 1HNZO 4B3RO 4DR1O 1YZBA 4DUZO 4KHPO 1XMOO 1R1BA 1AB3A 4X65O 4JI0O 3T1YO 4GKJO 4LF9O 4JI4O 1HR0O 1IBMO 4JYAO 4DR4O 2ZM6O 1N32O 2UUAO 2ZKOA 1IBKO 4LF8O 3SDLA 4NXNO 5LMUO 2Z0AA 4DR2O 1J5EO 4A5UB 2VQFO 4LFAO 4LF6O 2UXCO 1NS1A 1HNWO 5LMNO 4OPAA 2DJVA
chains in the Genus database with same CATH superfamily
1AR5A 2QSAA 2KG7A 3RT3C 4GX1A 1K73W 1KQSU 2AZ2A 2HEPA 3ABMC 1EZJA 1BL8A 5EYPB 5IYZA 2V4DA 3NXSA 3STZC 2N05A 1WLEA 1DTOA 3R66A 4UCVA 2PY5A 1XMQO 1FFTB 1VP7A 4ZOLB 4DR5O 1ZSPA 3AG2B 3RVYA 2AHZA 3JALB 2HVKC 4B7KA 3CRMA 1XNQO 3QVNA 1NJIW 4WCEV 4K3AA 2EILB 3JCUZ 2YIAA 2YXLA 4WFAV 3CSXA 2R70A 1S3JA 1FJGO 4I50A 5GTHZ 1AP6A 4JAVA 2HG5C 1YZBA 4JAUA 4IHJB 1XHXA 2Q68A 3D3IA 4LNUA 2LGQA 2P90A 4F4LA 1NU1H 3WG7B 1OCRB 1QQCA 4UCSA 2ZM6O 1KP3A 2YI8A 1AI5A 2RMKB 3X2QC 1RM1B 5KAIZ 2IW5A 3JALA 1S77D 2ZDIC 1N33B 4NVPA 3IC7A 1KKDA 2XAFA 4OXSA 1MSDA 3K59A 1VQ8V 2HVJC 2L35A 2IH1C 1VQ9V 1YIJV 3LSSA 4AHCA 1AJQA 2P7TC 2XAQA 5CA3A 2WAMA 4H44B 3RYCB 3OMNB 3C3TA 2WSSG 5IWAB 3CX5F 4J7JA 3GB7C 3STLC 3UM7A 4LFBO 1KB9F 4UB8Z 1K8AW 3HPLC 2GBOA 4GUNA 5LOVB 3L75H 2WLIB 5KX5A 4ZKIA 1W59A 2FL4A 3K5LA 2UUBB 2LP7A 1WP8A 4FFBA 5CA1A 1SQFA 2HJFC 4IHJA 4UVCA 1MMMA 4LP8A 2JEXA 1MZFA 3T1CA 5CBFA 2ATKC 4IYIA 2JS5A 1Q6HA 4WBNB 4JI4B 2ZE6A 1IBMB 4MTXA 4UCTA 1JVMA 1I94B 5JJEB 3ASNC 1SA0A 3JCZA 1DK1A 3D36C 1FPOA 3IGAC 2ZE5A 2JDIG 3P3NA 2Y0IA 3DGEA 4FM1A 4BW5A 4DV5O 5J2UA 4CS3A 2EIMB 1D5AA 2RJZA 1SQPH 4LF5O 5J9PC 3EXAA 4CZZA 1JQ0A 1OCOB 3A2FA 4RQFA 1XI1A 2YIDA 4DO2A 4DUYO 1GM9A 4PI2A 1SQVH 4UVAA 3I56V 5KMGB 4JTAB 3JYCA 1DGSA 2IJKA 1VQ7V 1Q90D 4WFHA 1L0NH 4JTCB 2QWNB 2BE3A 1D5NA 1NZ6A 1H2LA 2WLLA 3K04A 4X1YA 2BCCH 4O4JA 1VQ6V 4EEQA 4UVBA 1YHQV 2EIJC 5D5QA 3F5WC 3U0ZA 5E79Z 3BVOA 3MAQA 4X88A 3N2KB 3K08A 4HNAA 3KCXA 2QM4A 1UFIA 4GX2A 1G4YB 3ZMZA 3AG4B 2UU9B 3ZHRA 4X89A 2FKXA 1M57B 5LL6Y 4FK5C 3KKYA 3TETA 3B8NA 4CH3A 1XMOB 4RAIA 5JJNB 2D2CB 3CC2V 3SYQA 3G67A 3K5OA 2BTQA 3MD0A 3TJTA 1CXZB 1K34A 1AJNA 5LHHA 1YXBA 4IYHA 4X66O 4YXWG 2QTOA 2EIKC 4DXWA 3OEHG 4K35A 3NR7A 5GW7A 2IJHA 4X1IB 1OJHA 4JAAA 3WB0A 2KQXA 1OZ0A 2CAZC 4GYCB 2N74A 4ABMA 1XNRO 1F7YA 5KHJA 1N33O 3K57A 2DWEC 4K0KO 2P67A 1PNMA 4J7KA 1IVSA 2OIGA 3E86A 2IU0A 1PNLA 4FLZA 2LW1A 1ZL8B 1Z5WA 4O2AA 2ITDC 2E5LB 5A9GA 3SJQC 4NXMB 1LUVA 3ZRXA 1FXHA 3CC4V 2GV9A 3QTCA 3ZHTA 2AW9A 1ZX3A 3ETEA 2PYJA 3HKBB 4FZ1A 4DR1B 4DV0B 3ML0A 4X1IA 4E4EA 4LC1A 4L8JA 4X65B 2JVDA 4XBFA 5LMNO 1Q43A 2WLNA 1Q3EA 1AI6A 3LDCA 3ZS8C 2Q6AA 1I94O 2VQEO 4WFGA 3HKDA 4JI1O 1IBLB 5HFLA 2ZQMA 3ABUA 3MHSC 1K7DA 3U11A 1VQPV 2ZIMA 4Z2WA 4B3RB 4KHPB 4DV3O 1S5JA 4W4KA 1GM7A 2CGNA 3GWKC 2ZINA 4MVQA 5KA6A 3UT5A 1HNXO 4DR3O 4FIPC 4JV5O 1V9PA 4DR7O 1WNSA 1NR7A 1R3JC 1RM1C 1KYOF 4B7EA 5HFMA 1PP9H 1Y74B 5BMVA 1H2KA 4X62O 1SF9A 2X6BA 3E8FA 5JH7A 1SZXA 4KL1A 3RBZA 4BWAA 1R3IC 1ZUQA 2H8PC 1FD9A 3T1HO 2ZT9B 2RNBA 4FLTA 4X8AA 1BQZA 2P22C 3F5TA 4O2BB 2KSDA 2DN9A 1GH6A 3E35A 3WB2A 3N2GA 4UFZA 2XAHA 4IL6Z 2GUZB 1JMKC 1XMQB 1SKVA 4DR5B 1Q5OA 3B4SA 3QO8A 5B1BB 3UO2A 5KLVH 1XNQB 1PD3A 1B6QA 3ABKB 3EFFK 3K0DA 1MNGA 1VQMV 2CH7A 3JASB 4WFFA 1PL0A 2YDEA 2WA3A 2JRIA 1W2BU 1JJ2U 1QR9A 2LJ2A 2Y69C 2F43G 3CB2A 4CH6A 1FJGB 2LFSA 4UCRA 2LW7A 3EVKA 1R6TA 3AG7A 1FAFA 1OCOC 1VARA 2OYQA 2P5OA 1GM8A 4ICGA 1URFA 4UUJC 1WB8A 2C2AA 2GUZA 5CBGA 4FFKA 4FM2A 4F6EA 1GN3A 1Q6UA 1Y67A 1HWYA 2RN9A 2RCVA 4H0LB 4CS2A 3VQWA 3W7WA 2QM8A 1BCCH 4WFEA 3AK3A 1YF2A 3H1IH 3JASA 3M99B 3RWRD 3CPWU 2UUCO 3IC9A 4DV2O 4WFBV 2Q0AA 1L8DA 4TV8A 1NR1A 2Q9LA 2MK3A 1N8RW 4LFBB 1UPGA 2E5LO 3G80A 5IY5C 3QO5A 3L73H 2JS3A 2EZOA 1FKAO 2KB1A 4R50A 1R73A 4P9OA 5H6RA 3ZHQA 1JPXA 4I55B 3HKCB 4DR1O 1AI4A 1OCZB 4JTDB 1M57C 1F23A 4X65O 3WB1A 3A0RA 1HR0O 5EZYB 3CRQA 3E22B 1W0KG 1BHAA 3CCRV 3ABLB 3L72H 2YUAA 2LGWA 1RSOB 4MSWC 2VWJA 2UXCO 4DV5B 3JSLA 2ZXWC 2DMXA 1GN6A 3CJHA 1OCCC 2E3CA 1RPRA 3OGCC 1M90W 2M6YA 1RFYA 4LF9B 1XL4A 5C8YB 1EN5A 5IJ0A 5L3CA 1G8MA 1VMGA 3Q4HB 2DYSB 4CC6A 1JFFB 4DV6O 2WA4A 5FPRA 3H9VA 5LXTA 3AG3B 1SETA 3QF7A 3SYPA 5L3FA 1CPYA 3ZX6A 1B06A 3K0GA 4DUYB 1N0JA 2OT5A 3ZCCA 1TVKA 1FYJA 3E8BA 5JJJB 1IZ3A 1WA8B 4U3JA 4EB6B 2Q0OC 3F7VC 2B9ZA 2BTOA 3LUTB 2A06H 1NBMG 5L3DA 2W6JG 4LFCO 5FNVB 1P7GA 4H37A 5KHKA 3P3PA 3DC6A 1RSOA 3ZMSA 4JI3O 1VQNV 4NR1A 4FPPA 2ETNA 1VQLV 2DWDC 3BPZA 5EBWC 5GONB 1AJPA 4BIUA 3P32A 2X6CA 1M4UA 3FB6C 1NVPB 3RGBA 2VS0A 4MVZA 4JI7O 5CA0A 5LA6A 1I0HA 3JD1A 2BOCC 5J2TB 4IIJA 1Y76A 4ASUG 1HP8A 1H2MA 1H8HG 1BSMA 3CC7V 4O4LA 1DLBA 3JAWB 2L6LA 4MTGA 2QE7G 4Z1VA 1YDXA 4TT3G 1IBKO 1QU7A 3CRRA 5EYPA 5FNVA 1M5IA 1SZTA 3VQYA 4X66B 3P30A 1J5EO 3OFNG 4LCUC 1NS1A 1V55B 3E83A 1NH2B 4ZOLA 3O9OA 3GWOA 1NTKH 4F6RB 1XNRB 2PTMA 3KG2A 1XILA 3SR2C 1JR9A 1SRYA 3L9DA 4MT8A 4OGQB 1US6A 5KHHA 4K0KB 2GTSA 1HW7A 3GVMA 5BY1A 1MZEA 4XDKA 2JK5C 5E1AC 1GK9A 4PDRA 2CTQA 4P30A 5TISZ 1KD1W 1P49A 5JQGB 3HKEB 4EKWA 2YSUB 4PA4A 4FJCC 4DV4O 5KAFZ 1BGYH 1U96A 3CD6V 4DK0A 4FLYA 1KMIZ 4DRXB 4GKKB 5LYJB 1PL4A 5B1BC 4LH6A 3BEHA 2A0LA 2Q73A 2QKAA 5LMNB 4EFBA 3VQVA 2X7RB 3VQXA 1YITV 2VQEB 1S0VA 2K9PA 4JI1B 2OTJV 3RW0A 1Q81W 2E76B 4FLXA 2K1EA 5KHGA 3UQ8A 2JGDB 2YC0A 4DV3B 2Q67A 4LF9O 3RYCA 1HNXB 4DR3B 4JV5B 4J80A 1JCHA 3E8HA 4DR7B 2UUAO 1YTFD 1AP5A 1W0JG 4LF8O 4AILC 3FYEB 5LOVA 2WLIA 1TAEA 2Z5UA 1GN2A 2PZSA 4X62B 5BZBA 2VQFO 3ZRWB 4LFAO 2BOBC 2QKSA 2AZ0A 1FXKB 4MTOA 4WBNA 4UV9A 4KXRA 1I08A 3BA9A 3THOA 3T1HB 5B3SB 1P4RA 3KCYA 2UXBO 3K03A 2LO1A 1KP2A 4YY3O 3OEEG 3CCQV 1WN7A 5B1AB 3A0BZ 4JI8O 2EINB 4JASA 4J9YB 4ZHQB 2Q5ZA 2Q7GA 2F4VO 1K33A 4DR6O 5KHIA 4X9QA 4BR6A 2EBOA 3U10A 1E1RG 1XDCA 1EFRG 4X1KB 5LP6B 1WPXA 4NB5A 2A7WA 1SQBH 2P4VA 1TUBB 2BSKB 3ABLC 5KMGA 3JD4A 3FD9A 3IFXA 2UXDO 3A8TA 1V54C 3B09A 5H6QA 1KUQA 1JJOA 3CRAA 2DYRB 4UV8A 2QR4A 4X20B 2F95B 2YXHA 4JYBA 4DV1O 2HHHO 3ICXA 1EZVH 4P2ZA 3AG3C 4DUZO 3ZMVA 3CMAV 1N4CA 1K5QA 5GTIZ 4GKJO 3ZHUA 1VEWA 4ZHQA 1E79G 1LNQA 3JARB 3K79A 1N32O 1WB7A 1H2SB 3RYHB 3N2KA 4O4HB 3ZJZA 2DQ3A 5LP6A 5LMUO 4Z1MG 1N0NA 3IAYA 4QJFB 3BY6A 4O4IB 2F66C 2UUCB 1IDSA 2EJ7A 4DV2B 1GTOA 4Q20A 5IYCO 1NTMH 3BAAA 1KKCA 2JJ2G 1HDJA 4K8XA 2HJDA 4GKKO 5BR8O 3AG2C 2JGUA 4JI5O 3CEIA 2NR5A 5LGNA 4PA6A 4PDMA 2WLKA 2EILC 5H9CA 3CMEV 1LUWA 1OV9A 1SC5B 3FX7A 3ABMB 1HR0B 3JD3A 1XREA 1WJZA 2A9HA 1XHZA 2G38A 2IBZH 4I0XB 3ETDA 2DQ0A 1K3EA 1G6UA 2Q7EA 1A32A 2UXCB 4D7TA 3ZRSA 4O4IA 3UCSC 1AR1B 4J7ZA 1ZL8A 2UXXA 4B3TO 3CWBH 1WPBA 2KKWA 2QDOA 3WG7C 3OM3B 1OCRC 2E74B 1XQ8A 5EIBC 4IT5A 5IJ9B 3CCSV 4DV6B 3G6EV 3SYOA 3TXQA 2Q4PA 4JGSA 4GLXA 3HKBA 2Y48A 1AVMA 3SPJA 3E2EA 4J11A 3W7SA 4GT1A 4JYAO 4FLVA 4FVMA 1R6KA 4CS4A 1TA8A 2YIBA 3OUFA 4BIOA 1EN6A 4RWUA 3ETQA 3ZHSA 4LFCB 1ZLZA 3MDSA 4FLUA 3CYOA 4J10A 2HP8A 4RUFA 3ZBHA 4I4TB 3APQA 2QTSA 4JI3B 2CTPA 1Q8IA 2R72A 3K58A 1IURA 3X2QB 2YEVB 3N27A 3OR6C 4QE9A 2ZCEA 4OX9O 3BABA 3JSNA 1F4MA 4JI7B 3F7YC 4TV9B 2H94A 3ZMUA 2XOKG 2EX3A 4Q6GA 1VQKV 4UCUA 1Y74A 3LNMB 3ZRVA 4TUYB 3AG1B 4PHZA 2PF4E 5B1OA 2Q69A 1GO3F 4TWKA 3FKSG 3ASOB 2EIMC 1P7BA 3DTUB 3CCUV 1B04A 1IBKB 3SJBC 5B1NA 1QVGU 2ARHA 4O2BA 1BE3H 4HBNA 1J5EB 4I4TA 5EC2C 2YI9A 1MABG 1Q6IA 3I5DA 3FB7C 4MW8A 2YEVA 3APOA 3T4ZA 2D3OW 3JAKB 1KECA 4PDVA 5IYBO 1IX9A 1NQTA 1QR8A 5K1PA 1QVFU 2CUGA 1PPJH 4GX0A 5L3EA 5B3SC 4TOIA 2ODMA 1XEQA 2YS8A 1AILA 4TUYA 1HNZO 3B40A 3PN1A 4FLWA 1J95A 4YJ3B 5LHIA 1AB3A 1VIBA 2PYLA 4I9WA 3FB5C 3FAVB 5DM6V 2ZD9A 4DV4B 2EINC 1IXMA 3K9SA 4KUMA 1L1FA 1ZAUA 3LSQA 4MTFA 5L3GA 2ZKOA 2WLMA 2WWWA 2ZE8A 3DXRB 4NXNO 1JA8A 3WFVA 5D5PA 3OD4A 1IXBA 1S5LZ 4LWSB 1M56B 2PI5A 5LP6C 1F51A 3AG4C 4N21A 2HFEC 2OIEA 3VBBA 3S3WA 2P4KA 4G27B 4CC5A 3CRCA 2XTAA 1YSCA 5B66Z 4FM0A 4CH4A 4MS2A 4B3SO 4MVOA 4GZRB 4QGPA 1Q82W 1R6NA 4XDJA 4UXNA 2EIJB 3SPHA 1S72V 4JF3A 2PUSA 5LGTA 3RYFB 4E2LA 3ABTA 4U7NA 3CCLV 2KG7B 3AEIA 1K9MW 1RPOA 1KBHA 4LBEC 2UUAB 2W0XA 2N04A 4NYKA 2JEUA 3DXRA 2XT9A 4LF8B 5IYZB 1SESA 4OPHA 5H5NA 2OCCB 2M7WA 3LDDA 1O9GA 1K5SA 3OAAG 2XNDG 4I55A 3OTOO 2VQFB 3HKCA 4LFAB 4JI2O 4JI6O 3JAMN 3CHXA 3UO3A 1JOYA 3UKMA 4B3MB 4FMTA 5EZYA 2ZR3A 2Y4UA 1D2DA 3CXCU 1BT8A 3C3SA 5EK0A 1NVPD 2HKOA 3PJSK 4JYYA 3E22A 5LHGA 2UXBB 5CBHA 1GN4A 3TK1A 4PDLA 4MVRA 4QPJA 4YY3B 4B08A 1MSWD 3OMAB 2FB5A 5JCOA 3OW2U 4CH5A 4JI0O 4JI8B 3E8GA 3MHHC 3W7UA 5FPOA 5C8YA 2IJIA 1GRJA 4R8CA 2F4VB 5EBLC 4DR6B 1LR1A 4I50B 1K4DC 3H01A 3ZN0A 3Q4HA 1Q86W 1JFFA 1EBOA 1BQ0A 3CCEV 1SS3A 5JVDB 1NKDA 5IDJA 5CB4B 3CXHF 4LNUB 4DW0A 3SJAC 1WA8A 1QLNA 4EB6A 1NH2D 4LF4O 2V1DA 2UXDB 2ZR2A 2GDSA 5EIBD 5AG2A 1BZKA 4I9QA 1JX9A 3O65A 4MVMA 1I7FA 2MW2B 4DV1B 3IJ4A 1NI8A 1ZWIC 2HHHB 3AK1A 4DUZB 1VQ4V 1MG1A 5F2VO 4GKJB 5GONA 3SPCA 1YJ9V 1PKXA 4JPRA 2QWQB 4AQYB 2ADQB 1N32B 1MOFA 3J80N 2QKCA 2Q8VA 2CK3G 5KX5B 5LMUB 4GX5A 5J2TA 3QG5A 1T5EA 4MW3A 4X64O 5JVDA 4FFBB 1VF5B 5CA1B 1PV0A 3I55V 5CB4A 1EM1A 2FMLA 1SQQH 1BHBA 2WPDG 1SA0B 3JAWA 2QEXV 2DE0X 4NKGB 3HB3B 2VRZA 5BR8B 1ENVA 2EJRA 3OT7A 4JI5B 1YJWV 3H1JH 1ZTEA 3ABKC 5J2UB 2Z3YA 2WLHA 5KUKA 3AG1C 4YHHB 2FYUH 4TSFG 1E1QG 4KP4A 4DR4O 3BFRA 3CCVV 1H2NA 5LGUA 4F6RA 1YJNV 3ASOC 3HR0A 1QLEB 3JD0A 2R9IA 2NN4A 2Y0PA 4DR2O 4J42A 1WAZA 2F1MA 3BRCA 3LSUA 1K92A 4LF6O 3SGIA 3AK2A 1QHTA 2Y4TA 3G4SV 3T1YB 2ITCC 5DEDA 1K4CC 5JQGA 3HKEA 4J9ZB 1Y4MA 3FFQA 4B3TB 2WLLB 1FS0G 1QCEA 4X1YB 4PA3A 4DRXA 2EZPA 4FZ0A 5LYJA 4O4JB 1BS3A 4PV1B 2CGOA 1N34O 4PELA 3M7MX 1THZA 4C7UA 3QO7A 1UJWB 2Y69B 4YIOA 1M93A 1SERA 4B3MO 4MVSA 4JYAB 4DV7O 2GTAA 3J7AU 4HNAB 3B2EE 3JATB 4LF7O 4DYLA 3WU2Z 1FFXB 2JGDA 3DSQA 1H8EG 1CP9A 1N36O 1M56C 2BTQB 1YTFB 1F4NA 1OCZC 4LR3A 1QBZA 5DECA 1OHHG 4OX9B 1XUQA 1AROP 4YIPA 1QNMA 3BHPA 3J81N 1COWG 4H33A 2CTWA 2CTRA 3H1KH 5LBQA 2OWOA 1R3LC 4EFEA 1GKFA 4HYOA 4QIWF 3RN4A 3ZRWA 1VF6A 2F23A 4JZ2A 2HLDG 5JCOC 3E89A 4PA9A 1AI7A 1FXKA 1P84F 5IY5B 2LQTA 3D8CA 4R7CA 3JATA 1SQXH 3BCCH 3B77A 4QNHB 2PGGA 3SDLA 3SPGA 1XL6A 2GSMB 3ZN1A 2DYSC 1FFXA 1TGOA 2EULA 4YJ2B 2OCCC 1VQOV 3RYIB 5ITZB 1FXVA 4J41A 4O2AB 2WLJA 4AQYO 1L0LH 2LFRA 4X1KA 3FB8C 4LH7A 3VOUA 4KFMA 3L74H 1Z5VA 2ZXWB 3K9AA 1OCCB 1TUBA 4PI0A 3SYAA 2BSKA 1HNZB 1M1KW 5JWPA 4NTXA 3W7TA 2AXTZ 4BAYA 1VQ5V 1SQGA 4GCZA 5B5EZ 3LNNA 3HKDB 3L71H 3TGUH 4BIZA 1ROPA 3K3WA 2QA4V 1NTZH 3K5MA 2YIBD 4NXNB 4X20A 1PM9A 4YJ2A 3QNEA 4CBCA 3RYIA 1RP3B 4UCOA 2P06A 5ITZA 3A0HZ 4RQEA 3UT5B 4YHHO 5IWAO 3JARA 3RYHA 2F93B 4O4HA 2AHYA 3SYCA 4B3SB 2RQ6A 2X0LA 5BMVB 2UUBO 2QWPB 5JH7B 1BMFG 1Q7YW 4G28B 5EBMC 3FYIB 3T1YO 4RO2A 3TCUA 4JI4O 1IBMO 1V55C 2UXNA 4G2KA 2YICA 1K97A 3OGIB 1H2GA 1I5YA 2ZNJA 4R6ZA 5C93A 2XASA 3N2GB 5FL7G 1O9HA 4I5SA 4RUEA 2YXYA 3OTOB 3CE2A 4JZGA 4JI2B 3K06A 4JI6B 4TQDA 1PNKA 2B5UA 2XHBA 3TXSA 2DOSA 4DW1A 1MA1A 2JIZG 2OCHA 2QWOB 5DN6G 2JJ1G 4I0XA 4HAMA 3OTFA 2QWRB 1ORQC 5A2QN 1Z2GA 3CS5A 4MVUA 4PA7A 2CH7B 3R65A 4ZBMA 3SJCC 1HNWB 4XDLA 2OTLV 4JI0B 1B3QA 1GAXA 2QJ1A 2HR3A 1S5HC 3OR7C 4H13B 3RVZA 1YVWA 3RFRA 4AI8A 1M9NA 2W6IG 1TUEB 3T2MA 3ZEDA 2O57A 4N23A 1QLEC 5IJ9A 2ZNIA 3S3XA 3EHBB 3JD2A 2NNUA 4I7ZB 3CCMV 2P6JA 1XBLA 2B1GA 1U97A 2AGAA 1R3KC 3D3QA 4LF4B 2ILMA 3M8AA 2CE4A 3K5NA 2XUMA 4ZIBA 4L87A 2QGNA 2UU9O 2R9AA 2X6AA 4IGGA 2NLJC 1XMOO 3ETGA 3L70H 2ZIOA 4PJ0Z 4U7OA 4BW9A 3BA8A 3ASNB 1VF6C 4TV8B 2ZDIA 1X4TA 3DC5A 5K1XA 5CN0A 2IH3C 4D6TH 1FXKC 4NTYA 4P9PA 4TV9A 2Z0AA 2Q7HA 3CCJV 4JYCA 4X64B 5CMUA 5EC1C 5KA5A 3G71V 1YI2V 5KUMA 1NT2B 2IU3A 4OPAA 2DJVA 3CP1A 1DF4A 3OMIB 5B1AC 2ZM6B 2R9RB 5IE9A 2XAGA 1YCIA 2DW4A 4PD4F 3H1HH 5IT9N 1WP7A 1Y66A 3C90A 2A79B 3CJHB 3T4DA 2GHYA 2XAJA 5FLXN 5IJ0B 2W0FC 3D36A 3SPIA 4K8ZA 4DR4B 2ADPA 3JAKA 4NXMO 4UB6Z 3B8MA 5BXZA 5LXTB 4DR2B 4W4LA 5L3BA 4ZI7B 2E75B 2A3QA 4TQFA 4DV0O 2DYRC 1TVKB 4LF6B 4YJ3A 2V7QG 2QM7A 3KZIZ 4U3JB 3FAVA 4U3FH 3ZHVA 1X59A 1CEZA 1IBLO 2ZE7A 1GMGA 2PI4A 2IJJA 1G1XB 2IM9A 4LWSA 3OE7G 1N34B 4B3RO 4QE7A 4KHPO 1R1BA 2RDCA 1V54B 1YEWA 4D7SA 4DK1A 4NTWA 4LF5B 3G6BA 2B1IA 2H3OA 3LDEA 3ZIAG 3ZMTA 1DF5A 1KU9A 1Y6XA 1KC8W 3OUSA 4DV7B 1XOUA 5CA0B 5LA6B 3W7XA 5IYDO 2EIKB 4QPKA 4LF7B 1S76D 4IIJB 4WF9V 5H2FZ 2VWKA 1Y76B 2CDYA 4A5UB 4ZI7A 1I5XA 2FTKA 1AR4A 1VF7A 1N36B 3RYFA 1H38A 1EN4A 1HNWO 3H1LH 4O4LB 4HZ3A
chains in the Genus database with same CATH topology
4LF4O 2DOSA 2JRIA 3RT3C 4AQYO 1I94O 4LFBO 4OX9O 2VQEO 2LW7A 4JI1O 1R6TA 4GKKO 4B3SO 4DV6O 5BR8O 2UXBO 5A2QN 3O65A 5IT9N 4JI5O 4YY3O 2FKXA 1N34O 5LL6Y 5BY1A 3R66A 4JI8O 4DV3O 1FYJA 1XMQO 4DR5O 1HNXO 2F4VO 5FLXN 4DV4O 4DR3O 4B3MO 4DR6O 4JV5O 4DR7O 4DV7O 3J7AU 1DK1A 3J80N 4NXMO 1XNQO 4LF7O 4X66O 4LFCO 5BXZA 4OPHA 5H5NA 4X64O 4X62O 4DV5O 1N36O 4DV0O 1A32A 4JI3O 3OTOO 4JI2O 2UUCO 4JI6O 3JAMN 4DV2O 4LF5O 4YHHO 2AGAA 5IWAO 2UXDO 4B3TO 3T1HO 2N74A 1X59A 1D2DA 1XNRO 1FJGO 3M8AA 1F7YA 2E5LO 1IBLO 1N33O 4JI7O 1KUQA 3F5TA 3J81N 2UU9O 4K0KO 1FKAO 1XEQA 2UUBO 1G1XB 4DV1O 4DUYO 2HHHO 1AILA 1HNZO 4B3RO 4DR1O 1YZBA 4DUZO 4KHPO 1XMOO 1R1BA 1AB3A 4X65O 4JI0O 3T1YO 4GKJO 4LF9O 4JI4O 1HR0O 1IBMO 4JYAO 4DR4O 2ZM6O 1N32O 2UUAO 2ZKOA 1IBKO 4LF8O 3SDLA 4NXNO 5LMUO 2Z0AA 4DR2O 1J5EO 4A5UB 2VQFO 4LFAO 4LF6O 2UXCO 1NS1A 1HNWO 5LMNO 4OPAA 2DJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  2DOS A;  2JRI A;  3RT3 C;  4AQY O;  1I94 O;  4LFB O;  4OX9 O;  2VQE O;  2LW7 A;  4JI1 O;  1R6T A;  4GKK O;  4B3S O;  4DV6 O;  5BR8 O;  2UXB O;  5A2Q N;  3O65 A;  5IT9 N;  4JI5 O;  4YY3 O;  2FKX A;  1N34 O;  5LL6 Y;  5BY1 A;  3R66 A;  4JI8 O;  4DV3 O;  1FYJ A;  1XMQ O;  4DR5 O;  1HNX O;  2F4V O;  5FLX N;  4DV4 O;  4DR3 O;  4B3M O;  4DR6 O;  4JV5 O;  4DR7 O;  4DV7 O;  3J7A U;  1DK1 A;  3J80 N;  4NXM O;  1XNQ O;  4LF7 O;  4X66 O;  4LFC O;  5BXZ A;  4OPH A;  5H5N A;  4X64 O;  4X62 O;  4DV5 O;  1N36 O;  4DV0 O;  1A32 A;  4JI3 O;  3OTO O;  4JI2 O;  2UUC O;  4JI6 O;  3JAM N;  4DV2 O;  4LF5 O;  4YHH O;  2AGA A;  5IWA O;  2UXD O;  4B3T O;  3T1H O;  2N74 A;  1X59 A;  1D2D A;  1XNR O;  1FJG O;  3M8A A;  1F7Y A;  2E5L O;  1IBL O;  1N33 O;  4JI7 O;  1KUQ A;  3F5T A;  3J81 N;  2UU9 O;  4K0K O;  1FKA O;  1XEQ A;  2UUB O;  1G1X B;  4DV1 O;  4DUY O;  2HHH O;  1AIL A;  1HNZ O;  4B3R O;  4DR1 O;  1YZB A;  4DUZ O;  4KHP O;  1XMO O;  1R1B A;  1AB3 A;  4X65 O;  4JI0 O;  3T1Y O;  4GKJ O;  4LF9 O;  4JI4 O;  1HR0 O;  1IBM O;  4JYA O;  4DR4 O;  2ZM6 O;  1N32 O;  2UUA O;  2ZKO A;  1IBK O;  4LF8 O;  3SDL A;  4NXN O;  5LMU O;  2Z0A A;  4DR2 O;  1J5E O;  4A5U B;  2VQF O;  4LFA O;  4LF6 O;  2UXC O;  1NS1 A;  1HNW O;  5LMN O;  4OPA A;  2DJV A; 
#chains in the Genus database with same CATH topology
 1AR5 A;  2QSA A;  2KG7 A;  3RT3 C;  4GX1 A;  1K73 W;  1KQS U;  2AZ2 A;  2HEP A;  3ABM C;  1EZJ A;  1BL8 A;  5EYP B;  5IYZ A;  2V4D A;  3NXS A;  3STZ C;  2N05 A;  1WLE A;  1DTO A;  3R66 A;  4UCV A;  2PY5 A;  1XMQ O;  1FFT B;  1VP7 A;  4ZOL B;  4DR5 O;  1ZSP A;  3AG2 B;  3RVY A;  2AHZ A;  3JAL B;  2HVK C;  4B7K A;  3CRM A;  1XNQ O;  3QVN A;  1NJI W;  4WCE V;  4K3A A;  2EIL B;  3JCU Z;  2YIA A;  2YXL A;  4WFA V;  3CSX A;  2R70 A;  1S3J A;  1FJG O;  4I50 A;  5GTH Z;  1AP6 A;  4JAV A;  2HG5 C;  1YZB A;  4JAU A;  4IHJ B;  1XHX A;  2Q68 A;  3D3I A;  4LNU A;  2LGQ A;  2P90 A;  4F4L A;  1NU1 H;  3WG7 B;  1OCR B;  1QQC A;  4UCS A;  2ZM6 O;  1KP3 A;  2YI8 A;  1AI5 A;  2RMK B;  3X2Q C;  1RM1 B;  5KAI Z;  2IW5 A;  3JAL A;  1S77 D;  2ZDI C;  1N33 B;  4NVP A;  3IC7 A;  1KKD A;  2XAF A;  4OXS A;  1MSD A;  3K59 A;  1VQ8 V;  2HVJ C;  2L35 A;  2IH1 C;  1VQ9 V;  1YIJ V;  3LSS A;  4AHC A;  1AJQ A;  2P7T C;  2XAQ A;  5CA3 A;  2WAM A;  4H44 B;  3RYC B;  3OMN B;  3C3T A;  2WSS G;  5IWA B;  3CX5 F;  4J7J A;  3GB7 C;  3STL C;  3UM7 A;  4LFB O;  1KB9 F;  4UB8 Z;  1K8A W;  3HPL C;  2GBO A;  4GUN A;  5LOV B;  3L75 H;  2WLI B;  5KX5 A;  4ZKI A;  1W59 A;  2FL4 A;  3K5L A;  2UUB B;  2LP7 A;  1WP8 A;  4FFB A;  5CA1 A;  1SQF A;  2HJF C;  4IHJ A;  4UVC A;  1MMM A;  4LP8 A;  2JEX A;  1MZF A;  3T1C A;  5CBF A;  2ATK C;  4IYI A;  2JS5 A;  1Q6H A;  4WBN B;  4JI4 B;  2ZE6 A;  1IBM B;  4MTX A;  4UCT A;  1JVM A;  1I94 B;  5JJE B;  3ASN C;  1SA0 A;  3JCZ A;  1DK1 A;  3D36 C;  1FPO A;  3IGA C;  2ZE5 A;  2JDI G;  3P3N A;  2Y0I A;  3DGE A;  4FM1 A;  4BW5 A;  4DV5 O;  5J2U A;  4CS3 A;  2EIM B;  1D5A A;  2RJZ A;  1SQP H;  4LF5 O;  5J9P C;  3EXA A;  4CZZ A;  1JQ0 A;  1OCO B;  3A2F A;  4RQF A;  1XI1 A;  2YID A;  4DO2 A;  4DUY O;  1GM9 A;  4PI2 A;  1SQV H;  4UVA A;  3I56 V;  5KMG B;  4JTA B;  3JYC A;  1DGS A;  2IJK A;  1VQ7 V;  1Q90 D;  4WFH A;  1L0N H;  4JTC B;  2QWN B;  2BE3 A;  1D5N A;  1NZ6 A;  1H2L A;  2WLL A;  3K04 A;  4X1Y A;  2BCC H;  4O4J A;  1VQ6 V;  4EEQ A;  4UVB A;  1YHQ V;  2EIJ C;  5D5Q A;  3F5W C;  3U0Z A;  5E79 Z;  3BVO A;  3MAQ A;  4X88 A;  3N2K B;  3K08 A;  4HNA A;  3KCX A;  2QM4 A;  1UFI A;  4GX2 A;  1G4Y B;  3ZMZ A;  3AG4 B;  2UU9 B;  3ZHR A;  4X89 A;  2FKX A;  1M57 B;  5LL6 Y;  4FK5 C;  3KKY A;  3TET A;  3B8N A;  4CH3 A;  1XMO B;  4RAI A;  5JJN B;  2D2C B;  3CC2 V;  3SYQ A;  3G67 A;  3K5O A;  2BTQ A;  3MD0 A;  3TJT A;  1CXZ B;  1K34 A;  1AJN A;  5LHH A;  1YXB A;  4IYH A;  4X66 O;  4YXW G;  2QTO A;  2EIK C;  4DXW A;  3OEH G;  4K35 A;  3NR7 A;  5GW7 A;  2IJH A;  4X1I B;  1OJH A;  4JAA A;  3WB0 A;  2KQX A;  1OZ0 A;  2CAZ C;  4GYC B;  2N74 A;  4ABM A;  1XNR O;  1F7Y A;  5KHJ A;  1N33 O;  3K57 A;  2DWE C;  4K0K O;  2P67 A;  1PNM A;  4J7K A;  1IVS A;  2OIG A;  3E86 A;  2IU0 A;  1PNL A;  4FLZ A;  2LW1 A;  1ZL8 B;  1Z5W A;  4O2A A;  2ITD C;  2E5L B;  5A9G A;  3SJQ C;  4NXM B;  1LUV A;  3ZRX A;  1FXH A;  3CC4 V;  2GV9 A;  3QTC A;  3ZHT A;  2AW9 A;  1ZX3 A;  3ETE A;  2PYJ A;  3HKB B;  4FZ1 A;  4DR1 B;  4DV0 B;  3ML0 A;  4X1I A;  4E4E A;  4LC1 A;  4L8J A;  4X65 B;  2JVD A;  4XBF A;  5LMN O;  1Q43 A;  2WLN A;  1Q3E A;  1AI6 A;  3LDC A;  3ZS8 C;  2Q6A A;  1I94 O;  2VQE O;  4WFG A;  3HKD A;  4JI1 O;  1IBL B;  5HFL A;  2ZQM A;  3ABU A;  3MHS C;  1K7D A;  3U11 A;  1VQP V;  2ZIM A;  4Z2W A;  4B3R B;  4KHP B;  4DV3 O;  1S5J A;  4W4K A;  1GM7 A;  2CGN A;  3GWK C;  2ZIN A;  4MVQ A;  5KA6 A;  3UT5 A;  1HNX O;  4DR3 O;  4FIP C;  4JV5 O;  1V9P A;  4DR7 O;  1WNS A;  1NR7 A;  1R3J C;  1RM1 C;  1KYO F;  4B7E A;  5HFM A;  1PP9 H;  1Y74 B;  5BMV A;  1H2K A;  4X62 O;  1SF9 A;  2X6B A;  3E8F A;  5JH7 A;  1SZX A;  4KL1 A;  3RBZ A;  4BWA A;  1R3I C;  1ZUQ A;  2H8P C;  1FD9 A;  3T1H O;  2ZT9 B;  2RNB A;  4FLT A;  4X8A A;  1BQZ A;  2P22 C;  3F5T A;  4O2B B;  2KSD A;  2DN9 A;  1GH6 A;  3E35 A;  3WB2 A;  3N2G A;  4UFZ A;  2XAH A;  4IL6 Z;  2GUZ B;  1JMK C;  1XMQ B;  1SKV A;  4DR5 B;  1Q5O A;  3B4S A;  3QO8 A;  5B1B B;  3UO2 A;  5KLV H;  1XNQ B;  1PD3 A;  1B6Q A;  3ABK B;  3EFF K;  3K0D A;  1MNG A;  1VQM V;  2CH7 A;  3JAS B;  4WFF A;  1PL0 A;  2YDE A;  2WA3 A;  2JRI A;  1W2B U;  1JJ2 U;  1QR9 A;  2LJ2 A;  2Y69 C;  2F43 G;  3CB2 A;  4CH6 A;  1FJG B;  2LFS A;  4UCR A;  2LW7 A;  3EVK A;  1R6T A;  3AG7 A;  1FAF A;  1OCO C;  1VAR A;  2OYQ A;  2P5O A;  1GM8 A;  4ICG A;  1URF A;  4UUJ C;  1WB8 A;  2C2A A;  2GUZ A;  5CBG A;  4FFK A;  4FM2 A;  4F6E A;  1GN3 A;  1Q6U A;  1Y67 A;  1HWY A;  2RN9 A;  2RCV A;  4H0L B;  4CS2 A;  3VQW A;  3W7W A;  2QM8 A;  1BCC H;  4WFE A;  3AK3 A;  1YF2 A;  3H1I H;  3JAS A;  3M99 B;  3RWR D;  3CPW U;  2UUC O;  3IC9 A;  4DV2 O;  4WFB V;  2Q0A A;  1L8D A;  4TV8 A;  1NR1 A;  2Q9L A;  2MK3 A;  1N8R W;  4LFB B;  1UPG A;  2E5L O;  3G80 A;  5IY5 C;  3QO5 A;  3L73 H;  2JS3 A;  2EZO A;  1FKA O;  2KB1 A;  4R50 A;  1R73 A;  4P9O A;  5H6R A;  3ZHQ A;  1JPX A;  4I55 B;  3HKC B;  4DR1 O;  1AI4 A;  1OCZ B;  4JTD B;  1M57 C;  1F23 A;  4X65 O;  3WB1 A;  3A0R A;  1HR0 O;  5EZY B;  3CRQ A;  3E22 B;  1W0K G;  1BHA A;  3CCR V;  3ABL B;  3L72 H;  2YUA A;  2LGW A;  1RSO B;  4MSW C;  2VWJ A;  2UXC O;  4DV5 B;  3JSL A;  2ZXW C;  2DMX A;  1GN6 A;  3CJH A;  1OCC C;  2E3C A;  1RPR A;  3OGC C;  1M90 W;  2M6Y A;  1RFY A;  4LF9 B;  1XL4 A;  5C8Y B;  1EN5 A;  5IJ0 A;  5L3C A;  1G8M A;  1VMG A;  3Q4H B;  2DYS B;  4CC6 A;  1JFF B;  4DV6 O;  2WA4 A;  5FPR A;  3H9V A;  5LXT A;  3AG3 B;  1SET A;  3QF7 A;  3SYP A;  5L3F A;  1CPY A;  3ZX6 A;  1B06 A;  3K0G A;  4DUY B;  1N0J A;  2OT5 A;  3ZCC A;  1TVK A;  1FYJ A;  3E8B A;  5JJJ B;  1IZ3 A;  1WA8 B;  4U3J A;  4EB6 B;  2Q0O C;  3F7V C;  2B9Z A;  2BTO A;  3LUT B;  2A06 H;  1NBM G;  5L3D A;  2W6J G;  4LFC O;  5FNV B;  1P7G A;  4H37 A;  5KHK A;  3P3P A;  3DC6 A;  1RSO A;  3ZMS A;  4JI3 O;  1VQN V;  4NR1 A;  4FPP A;  2ETN A;  1VQL V;  2DWD C;  3BPZ A;  5EBW C;  5GON B;  1AJP A;  4BIU A;  3P32 A;  2X6C A;  1M4U A;  3FB6 C;  1NVP B;  3RGB A;  2VS0 A;  4MVZ A;  4JI7 O;  5CA0 A;  5LA6 A;  1I0H A;  3JD1 A;  2BOC C;  5J2T B;  4IIJ A;  1Y76 A;  4ASU G;  1HP8 A;  1H2M A;  1H8H G;  1BSM A;  3CC7 V;  4O4L A;  1DLB A;  3JAW B;  2L6L A;  4MTG A;  2QE7 G;  4Z1V A;  1YDX A;  4TT3 G;  1IBK O;  1QU7 A;  3CRR A;  5EYP A;  5FNV A;  1M5I A;  1SZT A;  3VQY A;  4X66 B;  3P30 A;  1J5E O;  3OFN G;  4LCU C;  1NS1 A;  1V55 B;  3E83 A;  1NH2 B;  4ZOL A;  3O9O A;  3GWO A;  1NTK H;  4F6R B;  1XNR B;  2PTM A;  3KG2 A;  1XIL A;  3SR2 C;  1JR9 A;  1SRY A;  3L9D A;  4MT8 A;  4OGQ B;  1US6 A;  5KHH A;  4K0K B;  2GTS A;  1HW7 A;  3GVM A;  5BY1 A;  1MZE A;  4XDK A;  2JK5 C;  5E1A C;  1GK9 A;  4PDR A;  2CTQ A;  4P30 A;  5TIS Z;  1KD1 W;  1P49 A;  5JQG B;  3HKE B;  4EKW A;  2YSU B;  4PA4 A;  4FJC C;  4DV4 O;  5KAF Z;  1BGY H;  1U96 A;  3CD6 V;  4DK0 A;  4FLY A;  1KMI Z;  4DRX B;  4GKK B;  5LYJ B;  1PL4 A;  5B1B C;  4LH6 A;  3BEH A;  2A0L A;  2Q73 A;  2QKA A;  5LMN B;  4EFB A;  3VQV A;  2X7R B;  3VQX A;  1YIT V;  2VQE B;  1S0V A;  2K9P A;  4JI1 B;  2OTJ V;  3RW0 A;  1Q81 W;  2E76 B;  4FLX A;  2K1E A;  5KHG A;  3UQ8 A;  2JGD B;  2YC0 A;  4DV3 B;  2Q67 A;  4LF9 O;  3RYC A;  1HNX B;  4DR3 B;  4JV5 B;  4J80 A;  1JCH A;  3E8H A;  4DR7 B;  2UUA O;  1YTF D;  1AP5 A;  1W0J G;  4LF8 O;  4AIL C;  3FYE B;  5LOV A;  2WLI A;  1TAE A;  2Z5U A;  1GN2 A;  2PZS A;  4X62 B;  5BZB A;  2VQF O;  3ZRW B;  4LFA O;  2BOB C;  2QKS A;  2AZ0 A;  1FXK B;  4MTO A;  4WBN A;  4UV9 A;  4KXR A;  1I08 A;  3BA9 A;  3THO A;  3T1H B;  5B3S B;  1P4R A;  3KCY A;  2UXB O;  3K03 A;  2LO1 A;  1KP2 A;  4YY3 O;  3OEE G;  3CCQ V;  1WN7 A;  5B1A B;  3A0B Z;  4JI8 O;  2EIN B;  4JAS A;  4J9Y B;  4ZHQ B;  2Q5Z A;  2Q7G A;  2F4V O;  1K33 A;  4DR6 O;  5KHI A;  4X9Q A;  4BR6 A;  2EBO A;  3U10 A;  1E1R G;  1XDC A;  1EFR G;  4X1K B;  5LP6 B;  1WPX A;  4NB5 A;  2A7W A;  1SQB H;  2P4V A;  1TUB B;  2BSK B;  3ABL C;  5KMG A;  3JD4 A;  3FD9 A;  3IFX A;  2UXD O;  3A8T A;  1V54 C;  3B09 A;  5H6Q A;  1KUQ A;  1JJO A;  3CRA A;  2DYR B;  4UV8 A;  2QR4 A;  4X20 B;  2F95 B;  2YXH A;  4JYB A;  4DV1 O;  2HHH O;  3ICX A;  1EZV H;  4P2Z A;  3AG3 C;  4DUZ O;  3ZMV A;  3CMA V;  1N4C A;  1K5Q A;  5GTI Z;  4GKJ O;  3ZHU A;  1VEW A;  4ZHQ A;  1E79 G;  1LNQ A;  3JAR B;  3K79 A;  1N32 O;  1WB7 A;  1H2S B;  3RYH B;  3N2K A;  4O4H B;  3ZJZ A;  2DQ3 A;  5LP6 A;  5LMU O;  4Z1M G;  1N0N A;  3IAY A;  4QJF B;  3BY6 A;  4O4I B;  2F66 C;  2UUC B;  1IDS A;  2EJ7 A;  4DV2 B;  1GTO A;  4Q20 A;  5IYC O;  1NTM H;  3BAA A;  1KKC A;  2JJ2 G;  1HDJ A;  4K8X A;  2HJD A;  4GKK O;  5BR8 O;  3AG2 C;  2JGU A;  4JI5 O;  3CEI A;  2NR5 A;  5LGN A;  4PA6 A;  4PDM A;  2WLK A;  2EIL C;  5H9C A;  3CME V;  1LUW A;  1OV9 A;  1SC5 B;  3FX7 A;  3ABM B;  1HR0 B;  3JD3 A;  1XRE A;  1WJZ A;  2A9H A;  1XHZ A;  2G38 A;  2IBZ H;  4I0X B;  3ETD A;  2DQ0 A;  1K3E A;  1G6U A;  2Q7E A;  1A32 A;  2UXC B;  4D7T A;  3ZRS A;  4O4I A;  3UCS C;  1AR1 B;  4J7Z A;  1ZL8 A;  2UXX A;  4B3T O;  3CWB H;  1WPB A;  2KKW A;  2QDO A;  3WG7 C;  3OM3 B;  1OCR C;  2E74 B;  1XQ8 A;  5EIB C;  4IT5 A;  5IJ9 B;  3CCS V;  4DV6 B;  3G6E V;  3SYO A;  3TXQ A;  2Q4P A;  4JGS A;  4GLX A;  3HKB A;  2Y48 A;  1AVM A;  3SPJ A;  3E2E A;  4J11 A;  3W7S A;  4GT1 A;  4JYA O;  4FLV A;  4FVM A;  1R6K A;  4CS4 A;  1TA8 A;  2YIB A;  3OUF A;  4BIO A;  1EN6 A;  4RWU A;  3ETQ A;  3ZHS A;  4LFC B;  1ZLZ A;  3MDS A;  4FLU A;  3CYO A;  4J10 A;  2HP8 A;  4RUF A;  3ZBH A;  4I4T B;  3APQ A;  2QTS A;  4JI3 B;  2CTP A;  1Q8I A;  2R72 A;  3K58 A;  1IUR A;  3X2Q B;  2YEV B;  3N27 A;  3OR6 C;  4QE9 A;  2ZCE A;  4OX9 O;  3BAB A;  3JSN A;  1F4M A;  4JI7 B;  3F7Y C;  4TV9 B;  2H94 A;  3ZMU A;  2XOK G;  2EX3 A;  4Q6G A;  1VQK V;  4UCU A;  1Y74 A;  3LNM B;  3ZRV A;  4TUY B;  3AG1 B;  4PHZ A;  2PF4 E;  5B1O A;  2Q69 A;  1GO3 F;  4TWK A;  3FKS G;  3ASO B;  2EIM C;  1P7B A;  3DTU B;  3CCU V;  1B04 A;  1IBK B;  3SJB C;  5B1N A;  1QVG U;  2ARH A;  4O2B A;  1BE3 H;  4HBN A;  1J5E B;  4I4T A;  5EC2 C;  2YI9 A;  1MAB G;  1Q6I A;  3I5D A;  3FB7 C;  4MW8 A;  2YEV A;  3APO A;  3T4Z A;  2D3O W;  3JAK B;  1KEC A;  4PDV A;  5IYB O;  1IX9 A;  1NQT A;  1QR8 A;  5K1P A;  1QVF U;  2CUG A;  1PPJ H;  4GX0 A;  5L3E A;  5B3S C;  4TOI A;  2ODM A;  1XEQ A;  2YS8 A;  1AIL A;  4TUY A;  1HNZ O;  3B40 A;  3PN1 A;  4FLW A;  1J95 A;  4YJ3 B;  5LHI A;  1AB3 A;  1VIB A;  2PYL A;  4I9W A;  3FB5 C;  3FAV B;  5DM6 V;  2ZD9 A;  4DV4 B;  2EIN C;  1IXM A;  3K9S A;  4KUM A;  1L1F A;  1ZAU A;  3LSQ A;  4MTF A;  5L3G A;  2ZKO A;  2WLM A;  2WWW A;  2ZE8 A;  3DXR B;  4NXN O;  1JA8 A;  3WFV A;  5D5P A;  3OD4 A;  1IXB A;  1S5L Z;  4LWS B;  1M56 B;  2PI5 A;  5LP6 C;  1F51 A;  3AG4 C;  4N21 A;  2HFE C;  2OIE A;  3VBB A;  3S3W A;  2P4K A;  4G27 B;  4CC5 A;  3CRC A;  2XTA A;  1YSC A;  5B66 Z;  4FM0 A;  4CH4 A;  4MS2 A;  4B3S O;  4MVO A;  4GZR B;  4QGP A;  1Q82 W;  1R6N A;  4XDJ A;  4UXN A;  2EIJ B;  3SPH A;  1S72 V;  4JF3 A;  2PUS A;  5LGT A;  3RYF B;  4E2L A;  3ABT A;  4U7N A;  3CCL V;  2KG7 B;  3AEI A;  1K9M W;  1RPO A;  1KBH A;  4LBE C;  2UUA B;  2W0X A;  2N04 A;  4NYK A;  2JEU A;  3DXR A;  2XT9 A;  4LF8 B;  5IYZ B;  1SES A;  4OPH A;  5H5N A;  2OCC B;  2M7W A;  3LDD A;  1O9G A;  1K5S A;  3OAA G;  2XND G;  4I55 A;  3OTO O;  2VQF B;  3HKC A;  4LFA B;  4JI2 O;  4JI6 O;  3JAM N;  3CHX A;  3UO3 A;  1JOY A;  3UKM A;  4B3M B;  4FMT A;  5EZY A;  2ZR3 A;  2Y4U A;  1D2D A;  3CXC U;  1BT8 A;  3C3S A;  5EK0 A;  1NVP D;  2HKO A;  3PJS K;  4JYY A;  3E22 A;  5LHG A;  2UXB B;  5CBH A;  1GN4 A;  3TK1 A;  4PDL A;  4MVR A;  4QPJ A;  4YY3 B;  4B08 A;  1MSW D;  3OMA B;  2FB5 A;  5JCO A;  3OW2 U;  4CH5 A;  4JI0 O;  4JI8 B;  3E8G A;  3MHH C;  3W7U A;  5FPO A;  5C8Y A;  2IJI A;  1GRJ A;  4R8C A;  2F4V B;  5EBL C;  4DR6 B;  1LR1 A;  4I50 B;  1K4D C;  3H01 A;  3ZN0 A;  3Q4H A;  1Q86 W;  1JFF A;  1EBO A;  1BQ0 A;  3CCE V;  1SS3 A;  5JVD B;  1NKD A;  5IDJ A;  5CB4 B;  3CXH F;  4LNU B;  4DW0 A;  3SJA C;  1WA8 A;  1QLN A;  4EB6 A;  1NH2 D;  4LF4 O;  2V1D A;  2UXD B;  2ZR2 A;  2GDS A;  5EIB D;  5AG2 A;  1BZK A;  4I9Q A;  1JX9 A;  3O65 A;  4MVM A;  1I7F A;  2MW2 B;  4DV1 B;  3IJ4 A;  1NI8 A;  1ZWI C;  2HHH B;  3AK1 A;  4DUZ B;  1VQ4 V;  1MG1 A;  5F2V O;  4GKJ B;  5GON A;  3SPC A;  1YJ9 V;  1PKX A;  4JPR A;  2QWQ B;  4AQY B;  2ADQ B;  1N32 B;  1MOF A;  3J80 N;  2QKC A;  2Q8V A;  2CK3 G;  5KX5 B;  5LMU B;  4GX5 A;  5J2T A;  3QG5 A;  1T5E A;  4MW3 A;  4X64 O;  5JVD A;  4FFB B;  1VF5 B;  5CA1 B;  1PV0 A;  3I55 V;  5CB4 A;  1EM1 A;  2FML A;  1SQQ H;  1BHB A;  2WPD G;  1SA0 B;  3JAW A;  2QEX V;  2DE0 X;  4NKG B;  3HB3 B;  2VRZ A;  5BR8 B;  1ENV A;  2EJR A;  3OT7 A;  4JI5 B;  1YJW V;  3H1J H;  1ZTE A;  3ABK C;  5J2U B;  2Z3Y A;  2WLH A;  5KUK A;  3AG1 C;  4YHH B;  2FYU H;  4TSF G;  1E1Q G;  4KP4 A;  4DR4 O;  3BFR A;  3CCV V;  1H2N A;  5LGU A;  4F6R A;  1YJN V;  3ASO C;  3HR0 A;  1QLE B;  3JD0 A;  2R9I A;  2NN4 A;  2Y0P A;  4DR2 O;  4J42 A;  1WAZ A;  2F1M A;  3BRC A;  3LSU A;  1K92 A;  4LF6 O;  3SGI A;  3AK2 A;  1QHT A;  2Y4T A;  3G4S V;  3T1Y B;  2ITC C;  5DED A;  1K4C C;  5JQG A;  3HKE A;  4J9Z B;  1Y4M A;  3FFQ A;  4B3T B;  2WLL B;  1FS0 G;  1QCE A;  4X1Y B;  4PA3 A;  4DRX A;  2EZP A;  4FZ0 A;  5LYJ A;  4O4J B;  1BS3 A;  4PV1 B;  2CGO A;  1N34 O;  4PEL A;  3M7M X;  1THZ A;  4C7U A;  3QO7 A;  1UJW B;  2Y69 B;  4YIO A;  1M93 A;  1SER A;  4B3M O;  4MVS A;  4JYA B;  4DV7 O;  2GTA A;  3J7A U;  4HNA B;  3B2E E;  3JAT B;  4LF7 O;  4DYL A;  3WU2 Z;  1FFX B;  2JGD A;  3DSQ A;  1H8E G;  1CP9 A;  1N36 O;  1M56 C;  2BTQ B;  1YTF B;  1F4N A;  1OCZ C;  4LR3 A;  1QBZ A;  5DEC A;  1OHH G;  4OX9 B;  1XUQ A;  1ARO P;  4YIP A;  1QNM A;  3BHP A;  3J81 N;  1COW G;  4H33 A;  2CTW A;  2CTR A;  3H1K H;  5LBQ A;  2OWO A;  1R3L C;  4EFE A;  1GKF A;  4HYO A;  4QIW F;  3RN4 A;  3ZRW A;  1VF6 A;  2F23 A;  4JZ2 A;  2HLD G;  5JCO C;  3E89 A;  4PA9 A;  1AI7 A;  1FXK A;  1P84 F;  5IY5 B;  2LQT A;  3D8C A;  4R7C A;  3JAT A;  1SQX H;  3BCC H;  3B77 A;  4QNH B;  2PGG A;  3SDL A;  3SPG A;  1XL6 A;  2GSM B;  3ZN1 A;  2DYS C;  1FFX A;  1TGO A;  2EUL A;  4YJ2 B;  2OCC C;  1VQO V;  3RYI B;  5ITZ B;  1FXV A;  4J41 A;  4O2A B;  2WLJ A;  4AQY O;  1L0L H;  2LFR A;  4X1K A;  3FB8 C;  4LH7 A;  3VOU A;  4KFM A;  3L74 H;  1Z5V A;  2ZXW B;  3K9A A;  1OCC B;  1TUB A;  4PI0 A;  3SYA A;  2BSK A;  1HNZ B;  1M1K W;  5JWP A;  4NTX A;  3W7T A;  2AXT Z;  4BAY A;  1VQ5 V;  1SQG A;  4GCZ A;  5B5E Z;  3LNN A;  3HKD B;  3L71 H;  3TGU H;  4BIZ A;  1ROP A;  3K3W A;  2QA4 V;  1NTZ H;  3K5M A;  2YIB D;  4NXN B;  4X20 A;  1PM9 A;  4YJ2 A;  3QNE A;  4CBC A;  3RYI A;  1RP3 B;  4UCO A;  2P06 A;  5ITZ A;  3A0H Z;  4RQE A;  3UT5 B;  4YHH O;  5IWA O;  3JAR A;  3RYH A;  2F93 B;  4O4H A;  2AHY A;  3SYC A;  4B3S B;  2RQ6 A;  2X0L A;  5BMV B;  2UUB O;  2QWP B;  5JH7 B;  1BMF G;  1Q7Y W;  4G28 B;  5EBM C;  3FYI B;  3T1Y O;  4RO2 A;  3TCU A;  4JI4 O;  1IBM O;  1V55 C;  2UXN A;  4G2K A;  2YIC A;  1K97 A;  3OGI B;  1H2G A;  1I5Y A;  2ZNJ A;  4R6Z A;  5C93 A;  2XAS A;  3N2G B;  5FL7 G;  1O9H A;  4I5S A;  4RUE A;  2YXY A;  3OTO B;  3CE2 A;  4JZG A;  4JI2 B;  3K06 A;  4JI6 B;  4TQD A;  1PNK A;  2B5U A;  2XHB A;  3TXS A;  2DOS A;  4DW1 A;  1MA1 A;  2JIZ G;  2OCH A;  2QWO B;  5DN6 G;  2JJ1 G;  4I0X A;  4HAM A;  3OTF A;  2QWR B;  1ORQ C;  5A2Q N;  1Z2G A;  3CS5 A;  4MVU A;  4PA7 A;  2CH7 B;  3R65 A;  4ZBM A;  3SJC C;  1HNW B;  4XDL A;  2OTL V;  4JI0 B;  1B3Q A;  1GAX A;  2QJ1 A;  2HR3 A;  1S5H C;  3OR7 C;  4H13 B;  3RVZ A;  1YVW A;  3RFR A;  4AI8 A;  1M9N A;  2W6I G;  1TUE B;  3T2M A;  3ZED A;  2O57 A;  4N23 A;  1QLE C;  5IJ9 A;  2ZNI A;  3S3X A;  3EHB B;  3JD2 A;  2NNU A;  4I7Z B;  3CCM V;  2P6J A;  1XBL A;  2B1G A;  1U97 A;  2AGA A;  1R3K C;  3D3Q A;  4LF4 B;  2ILM A;  3M8A A;  2CE4 A;  3K5N A;  2XUM A;  4ZIB A;  4L87 A;  2QGN A;  2UU9 O;  2R9A A;  2X6A A;  4IGG A;  2NLJ C;  1XMO O;  3ETG A;  3L70 H;  2ZIO A;  4PJ0 Z;  4U7O A;  4BW9 A;  3BA8 A;  3ASN B;  1VF6 C;  4TV8 B;  2ZDI A;  1X4T A;  3DC5 A;  5K1X A;  5CN0 A;  2IH3 C;  4D6T H;  1FXK C;  4NTY A;  4P9P A;  4TV9 A;  2Z0A A;  2Q7H A;  3CCJ V;  4JYC A;  4X64 B;  5CMU A;  5EC1 C;  5KA5 A;  3G71 V;  1YI2 V;  5KUM A;  1NT2 B;  2IU3 A;  4OPA A;  2DJV A;  3CP1 A;  1DF4 A;  3OMI B;  5B1A C;  2ZM6 B;  2R9R B;  5IE9 A;  2XAG A;  1YCI A;  2DW4 A;  4PD4 F;  3H1H H;  5IT9 N;  1WP7 A;  1Y66 A;  3C90 A;  2A79 B;  3CJH B;  3T4D A;  2GHY A;  2XAJ A;  5FLX N;  5IJ0 B;  2W0F C;  3D36 A;  3SPI A;  4K8Z A;  4DR4 B;  2ADP A;  3JAK A;  4NXM O;  4UB6 Z;  3B8M A;  5BXZ A;  5LXT B;  4DR2 B;  4W4L A;  5L3B A;  4ZI7 B;  2E75 B;  2A3Q A;  4TQF A;  4DV0 O;  2DYR C;  1TVK B;  4LF6 B;  4YJ3 A;  2V7Q G;  2QM7 A;  3KZI Z;  4U3J B;  3FAV A;  4U3F H;  3ZHV A;  1X59 A;  1CEZ A;  1IBL O;  2ZE7 A;  1GMG A;  2PI4 A;  2IJJ A;  1G1X B;  2IM9 A;  4LWS A;  3OE7 G;  1N34 B;  4B3R O;  4QE7 A;  4KHP O;  1R1B A;  2RDC A;  1V54 B;  1YEW A;  4D7S A;  4DK1 A;  4NTW A;  4LF5 B;  3G6B A;  2B1I A;  2H3O A;  3LDE A;  3ZIA G;  3ZMT A;  1DF5 A;  1KU9 A;  1Y6X A;  1KC8 W;  3OUS A;  4DV7 B;  1XOU A;  5CA0 B;  5LA6 B;  3W7X A;  5IYD O;  2EIK B;  4QPK A;  4LF7 B;  1S76 D;  4IIJ B;  4WF9 V;  5H2F Z;  2VWK A;  1Y76 B;  2CDY A;  4A5U B;  4ZI7 A;  1I5X A;  2FTK A;  1AR4 A;  1VF7 A;  1N36 B;  3RYF A;  1H38 A;  1EN4 A;  1HNW O;  3H1L H;  4O4L B;  4HZ3 A; 
#chains in the Genus database with same CATH homology
 4LF4 O;  2DOS A;  2JRI A;  3RT3 C;  4AQY O;  1I94 O;  4LFB O;  4OX9 O;  2VQE O;  2LW7 A;  4JI1 O;  1R6T A;  4GKK O;  4B3S O;  4DV6 O;  5BR8 O;  2UXB O;  5A2Q N;  3O65 A;  5IT9 N;  4JI5 O;  4YY3 O;  2FKX A;  1N34 O;  5LL6 Y;  5BY1 A;  3R66 A;  4JI8 O;  4DV3 O;  1FYJ A;  1XMQ O;  4DR5 O;  1HNX O;  2F4V O;  5FLX N;  4DV4 O;  4DR3 O;  4B3M O;  4DR6 O;  4JV5 O;  4DR7 O;  4DV7 O;  3J7A U;  1DK1 A;  3J80 N;  4NXM O;  1XNQ O;  4LF7 O;  4X66 O;  4LFC O;  5BXZ A;  4OPH A;  5H5N A;  4X64 O;  4X62 O;  4DV5 O;  1N36 O;  4DV0 O;  1A32 A;  4JI3 O;  3OTO O;  4JI2 O;  2UUC O;  4JI6 O;  3JAM N;  4DV2 O;  4LF5 O;  4YHH O;  2AGA A;  5IWA O;  2UXD O;  4B3T O;  3T1H O;  2N74 A;  1X59 A;  1D2D A;  1XNR O;  1FJG O;  3M8A A;  1F7Y A;  2E5L O;  1IBL O;  1N33 O;  4JI7 O;  1KUQ A;  3F5T A;  3J81 N;  2UU9 O;  4K0K O;  1FKA O;  1XEQ A;  2UUB O;  1G1X B;  4DV1 O;  4DUY O;  2HHH O;  1AIL A;  1HNZ O;  4B3R O;  4DR1 O;  1YZB A;  4DUZ O;  4KHP O;  1XMO O;  1R1B A;  1AB3 A;  4X65 O;  4JI0 O;  3T1Y O;  4GKJ O;  4LF9 O;  4JI4 O;  1HR0 O;  1IBM O;  4JYA O;  4DR4 O;  2ZM6 O;  1N32 O;  2UUA O;  2ZKO A;  1IBK O;  4LF8 O;  3SDL A;  4NXN O;  5LMU O;  2Z0A A;  4DR2 O;  1J5E O;  4A5U B;  2VQF O;  4LFA O;  4LF6 O;  2UXC O;  1NS1 A;  1HNW O;  5LMN O;  4OPA A;  2DJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...