1XMOO

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xmoO00
4NXMO 1G1XB 1KUQA 1N32O 1F7YA 4DV5O 3R66A 2DJVA 4DV2O 4JI7O 1XMQO 4JI4O 1AILA 5IT9N 4X62O 4DR7O 2LW7A 4YY3O 4AQYO 2UXDO 4LF7O 1XMOO 4JI6O 4DR3O 4LF6O 4DV3O 2UUCO 2AGAA 4LFAO 4OX9O 3JAMN 4YHHO 2UU9O 1AB3A 4KHPO 2Z0AA 4JV5O 2UXCO 2UUBO 1IBLO 1N33O 4DR1O 1FYJA 5H5NA 4LF4O 1R6TA 1XNQO 1FKAO 4JI5O 1XEQA 5LMUO 2VQEO 4DR5O 4DR6O 4JI8O 1HNXO 4JI3O 1J5EO 3J80N 3O65A 4JI0O 3M8AA 4DV1O 3F5TA 5LL6Y 2ZKOA 4DR2O 4LFBO 1IBMO 4LFCO 4DR4O 4DV0O 3SDLA 2FKXA 1A32A 1I94O 5BY1A 4OPAA 1NS1A 2DOSA 3OTOO 2VQFO 1HNZO 4A5UB 4B3RO 1IBKO 4B3TO 5IWAO 2UXBO 4JI2O 1DK1A 4K0KO 4DV6O 4LF5O 4LF9O 4X64O 4GKJO 1XNRO 4DUZO 1FJGO 2F4VO 2N74A 3J81N 1YZBA 2UUAO 4X66O 4JYAO 3T1YO 1HR0O 2JRIA 4DV4O 5FLXN 3T1HO 4NXNO 4B3MO 4OPHA 3RT3C 4LF8O 1HNWO 5A2QN 1R1BA 4GKKO 2E5LO 3J7AU 1N34O 4B3SO 1D2DA 1X59A 4DV7O 2HHHO 4X65O 2ZM6O 5BR8O 5BXZA 4JI1O 5LMNO 1N36O 4DUYO
chains in the Genus database with same CATH superfamily
2Y0IA 4NXMO 4O4JB 4QJFB 4XDLA 3RN4A 4DR4B 2Q69A 1QR9A 3E86A 4QIWF 5JCOC 1AROP 2EIJB 1KQSU 1QLEB 3K5LA 4B3MB 2NR5A 4QPJA 1YTFD 4JASA 3G71V 4LF7O 1R3KC 2CAZC 3MAQA 3OW2U 4MVMA 1Q5OA 4K8XA 1Q6HA 3B40A 5JQGB 3VQWA 1GTOA 2F93B 4ZBMA 4WFEA 1XNRB 4EB6A 3E22A 4X65B 2QWPB 5EC1C 4FLXA 4FFBB 1R6TA 4IHJA 2KQXA 1XNQO 4MVSA 4WFGA 4WFAV 5LMUO 3HKDB 5BMVB 2FTKA 2HJFC 2DE0X 1TVKA 5J9PC 4NB5A 1IBMB 1FXKB 4AQYB 1BZKA 4LH6A 2EIKB 3LDCA 1KBHA 3R65A 3AG3B 1I5XA 3RBZA 4UUJC 2VRZA 5EYPB 2F66C 4HNAA 4RAIA 1G6UA 3CCRV 3K79A 4Z2WA 4MVQA 5F2VO 2OIGA 3UM7A 1FS0G 1NT2B 3FB7C 3ML0A 1VF6A 3DTUB 1WA8B 3D3QA 1VQPV 3N27A 5L3GA 2JK5C 4LF8B 4DW1A 4I4TA 2EZPA 1I94B 1Q90D 5B1OA 4L8JA 1TVKB 1N32B 1O9GA 2F4VB 3SGIA 4LF8O 3HKEB 4FM0A 1XREA 3PJSK 2P6JA 3K58A 4FMTA 4WBNA 1SZXA 3K04A 1OV9A 2P67A 4JI1O 3ZRSA 5JVDA 1GRJA 3ZJZA 3MHSC 2W0XA 4CZZA 3AK2A 4JI4O 5IT9N 5B1AC 2HLDG 1LR1A 2Y48A 4BIOA 5FL7G 5LGTA 4OX9O 4O4JA 2DN9A 5EIBC 4KHPO 2Y69C 4PA6A 1V9PA 2QM8A 4TT3G 4FLZA 1ZLZA 4NTYA 4UV8A 2BE3A 4AHCA 4Q20A 1NZ6A 3CCEV 1WNSA 4NXMB 2CGNA 2FMLA 5H6RA 3H01A 1PL0A 1H2MA 3OMIB 3UO2A 2Y0PA 1VF7A 2JGDB 5CB4B 2N05A 2IW5A 1JA8A 3TJTA 4LFCO 1YJNV 3X2QB 3F7YC 3FAVB 1EFRG 3IGAC 3RFRA 4CS3A 2F1MA 1NS1A 2KKWA 5KHKA 2DOSA 4PI2A 5CA3A 3KKYA 3QO7A 1VIBA 2FYUH 1Q82W 1H2LA 3DSQA 1M1KW 5EBWC 3E2EA 4UCTA 3JASA 1R6NA 2HP8A 2Q4PA 1SQBH 2EIKC 5FNVA 4U3JB 3ZRWB 3RT3C 2YXLA 2P4KA 3SPJA 4O4HB 1K3EA 4TV9A 1JFFA 1GK9A 5IYZB 1NR7A 3CJHA 4W4KA 1D5AA 3HKCB 1M9NA 1SQFA 5H6QA 4CH4A 4MW3A 4X88A 3HPLC 2JS3A 3RYFA 5KHHA 4LWSB 3FB5C 4KP4A 3G6EV 4WFHA 1K7DA 1FFTB 3ZIAG 2R9RB 2K1EA 1BQ0A 1RM1B 3TXSA 3E89A 3JARA 3HKCA 4UCSA 2M7WA 2GSMB 3ZHVA 2UUCO 4ASUG 4YHHO 4IIJB 4UB8Z 2YICA 5HFLA 4DK0A 1HDJA 1MG1A 4JV5O 3OE7G 1JMKC 1HNWB 2ZXWB 5DN6G 3DC5A 4YHHB 1YJWV 3ABKB 4DR3B 4LNUB 4O4LB 1R3LC 1SQGA 3CSXA 2YIBD 3E83A 1JR9A 4JI3O 2WLLA 2LP7A 2Q6AA 4DV1O 4UVAA 4GLXA 3L73H 2A9HA 3ZMZA 1PL4A 2XAFA 2QSAA 4JTDB 1SRYA 3D3IA 1S72V 3B4SA 5DM6V 5BY1A 3L74H 2VQFO 1RSOA 2JDIG 4K0KO 3L70H 4GKJO 1I08A 4K3AA 3WG7C 1VQ7V 4UCRA 1US6A 4TV8A 2YSUB 2Y4TA 1LNQA 4IT5A 4HYOA 4AILC 3JCZA 1DLBA 2A79B 3CRMA 5A2QN 1FAFA 2PF4E 2IH3C 1R3IC 1WAZA 4PI0A 1L8DA 1SF9A 4DUYB 2BTQA 2UXXA 3MDSA 1MABG 2ODMA 1AJQA 1WPXA 3AK3A 4DUZB 5KHIA 1FXVA 2ARHA 4LF7B 3K5OA 2YIBA 4GX2A 2XAGA 4JYYA 3K5MA 3W7TA 3SJCC 4I55B 1EZJA 5JVDB 3CC4V 4XDJA 4DV3O 1B06A 1NTMH 4J7KA 1BCCH 2CTQA 3GWOA 2XOKG 2WLJA 3BPZA 1SQVH 2LJ2A 4TV8B 3RYCB 4NKGB 1HWYA 4H37A 3T1YB 1NBMG 3AG1C 3CRAA 4DO2A 1Z5VA 3SYAA 3JD4A 3P3NA 5LL6Y 4UCUA 2RCVA 1V55C 2AZ2A 4HNAB 3B77A 4X8AA 4OXSA 5CBGA 3RGBA 1HNZB 5TISZ 4JI1B 3ZRVA 1WP7A 1Y74B 1ORQC 3LDDA 4DV3B 3CB2A 1S3JA 4I0XB 1PV0A 1M57C 1N33B 2WLIB 1GMGA 3M99B 5CBHA 4O4LA 2F4VO 5BMVA 1Y76A 4XBFA 3ASNC 2EJ7A 2IJJA 4GKJB 2ZR2A 1PNKA 5IJ0B 2ZR3A 2UXDB 1JVMA 5GTIZ 3OD4A 5KUKA 4QE7A 3E22B 1WJZA 2ZD9A 4CH6A 3CX5F 1BHBA 1IXMA 3L75H 1Q43A 3T4ZA 5BR8B 5LMNO 2C2AA 3K0GA 5J2TB 3OEEG 1M57B 4GUNA 3AG4B 1RM1C 1YCIA 2LW1A 4JI8B 1XQ8A 1KC8W 2PYJA 4B7EA 2UU9O 2DYSC 4QNHB 1X4TA 1Y76B 5LXTB 5KAFZ 2UUBO 4PD4F 2V4DA 3ZRWA 4DR1O 4FK5C 1SZTA 4MVZA 4LF4O 3JCUZ 2P06A 5KA6A 1MMMA 2A0LA 4TWKA 1NH2B 4HAMA 5L3FA 2VQEO 1OCRC 5K1PA 4DR5O 1YTFB 5J2TA 3SJQC 4J9ZB 1XILA 1Q8IA 4R6ZA 4DR2O 2CTWA 4BIUA 3ZHSA 4DR4O 2L6LA 2ILMA 1Q86W 2CUGA 1AJNA 2VQEB 1SETA 3RYCA 1K8AW 2F23A 5LP6A 5HFMA 2ADPA 1HNZO 4UCOA 1GN3A 3A2FA 3IAYA 3M7MX 4JI2B 3ICXA 4DRXA 2XHBA 4TQFA 2UUBB 3K08A 1FJGO 2Q0OC 3GB7C 3A0BZ 4KHPB 3FYIB 1YITV 3T1YO 1Q6IA 5EBMC 4NXNO 1G4YB 4Z1MG 4ZI7B 1Q7YW 3WU2Z 1AP5A 1FJGB 3I56V 3J7AU 2YUAA 4UVBA 4TOIA 1ZL8B 3OEHG 4YIPA 4B3SO 1K9MW 1GN4A 2HHHO 2BOBC 2X6CA 3FB6C 5CBFA 3AEIA 4DR2B 2H94A 1QLNA 3CC7V 3JYCA 4JI5B 2DJVA 1NI8A 1YHQV 3E8HA 2QGNA 3DC6A 1TUBA 1AJPA 2YS8A 3E8BA 1KD1W 4LFAO 1NQTA 2HVJC 1OCCB 2E75B 4ABMA 1JJ2U 2KB1A 4LC1A 2D2CB 4E2LA 2UXCO 4UXNA 4GKKB 3LSSA 2E3CA 5CA0B 3E35A 1QHTA 3FKSG 1VQ8V 2QR4A 4U3FH 3K59A 2E5LB 3AG1B 4I4TB 3JAWA 3JATB 1NH2D 2Y4UA 5LMUB 1XHZA 5K1XA 4R50A 4H33A 1RPOA 2EIMC 3CP1A 1RP3B 3QO8A 3TGUH 1EM1A 4J7JA 4TQDA 2CTRA 3OMNB 2NLJC 1YJ9V 3ETQA 3RYIA 4FLVA 4RQFA 4TUYA 2B5UA 1OCZB 2P7TC 1I94O 4MSWC 4LNUA 3THOA 1KKCA 1RPRA 2GTAA 3ZMSA 3U0ZA 2X6AA 5IWAO 4GX0A 2W0FC 4LF5O 2AHYA 2Q8VA 1AP6A 3QVNA 4DR7B 3ETDA 4KXRA 5JWPA 3VQXA 2JS5A 2HVKC 3C3TA 4E4EA 1YDXA 1PM9A 1P84F 4FJCC 5B3SB 4H0LB 1OZ0A 4DV7B 3CXCU 2XNDG 2CH7A 3CCLV 3ZMTA 1XHXA 3S3XA 2GBOA 4DV7O 2EINB 3GVMA 4BWAA 4X65O 3UKMA 2P4VA 3JAKB 4I5SA 2ZM6O 2D3OW 5KHJA 2JEUA 2Y69B 3BA9A 1NJIW 4X62B 3E8GA 3CJHB 2X6BA 5JH7A 3P30A 4BR6A 2ZINA 1XMQO 5IWAB 1VARA 5EZYB 3VQYA 4ZOLB 2DYSB 4DR7O 3ZRXA 4U3JA 3N2GA 1THZA 2RQ6A 5JJJB 2L35A 4HZ3A 4UB6Z 3ZBHA 4UV9A 2Q73A 4FZ1A 3CCUV 4JAAA 5KAIZ 2B9ZA 1JPXA 2YXHA 2EX3A 4X9QA 4IYHA 3F7VC 3JD3A 3G6BA 5IJ9A 2V7QG 2M6YA 1AI6A 2Q7GA 2QWNB 3LDEA 5J2UB 4DV4B 2F95B 4GX5A 4NTWA 1H2KA 3CYOA 3IC7A 3O65A 1DF5A 4GCZA 1JQ0A 4P2ZA 2JGUA 3SPGA 1ZSPA 3ZN1A 3MHHC 4TV9B 4GX1A 2ZNJA 1Y67A 3CWBH 3JALB 2P90A 4PDMA 2UXCB 4B08A 4GZRB 3OTOO 4QPKA 1D5NA 1PD3A 5CA1A 3RYHA 2OCHA 2UUCB 2RJZA 4LF9O 1R6KA 3IFXA 5B5EZ 1YI2V 2KSDA 3E8FA 3VOUA 4W4LA 2N74A 4EFBA 4FLYA 5DEDA 1VP7A 4JYAO 4X66B 2A7WA 2EJRA 4DV4O 3K9AA 4OPHA 1JX9A 1P7GA 1N0NA 2IBZH 1QCEA 1FFXB 3FAVA 3ETGA 1GN2A 1F4MA 2OCCC 3BCCH 1DGSA 3SYPA 4DYLA 3W7XA 5J2UA 5BXZA 2ITDC 4TSFG 3H9VA 1WP8A 4ZIBA 4PA3A 2F43G 3FB8C 2QKCA 1BE3H 3CCVV 1URFA 4DR3O 1VQOV 2GUZB 5KX5B 3JAMN 3N2GB 4LF4B 5CN0A 4JYCA 1NU1H 1BHAA 2DWEC 2KG7B 2QE7G 1WN7A 4KFMA 1HR0B 2OTLV 4JI5O 1EBOA 5H2FZ 1MZFA 3JAKA 1VF5B 1KP2A 1MA1A 4RWUA 3G80A 1BMFG 3H1LH 1P49A 1K4DC 4EKWA 2IH1C 2LQTA 4WBNB 3FFQA 1CPYA 3FX7A 2ITCC 1AR4A 2GHYA 2HHHB 4L87A 1T5EA 1NVPD 1AVMA 3HKDA 3NR7A 4O2AA 3BY6A 4UFZA 4QE9A 3T2MA 4FFBA 4IHJB 1AR5A 5H9CA 2W6IG 5EBLC 1L0LH 4KUMA 1GM8A 2BCCH 2UUAO 4XDKA 3CRRA 4JZGA 4D7SA 4JAUA 2ZDIA 2YDEA 5A9GA 2LGWA 2CK3G 3F5WC 2QA4V 1NTZH 3JAWB 1TUEB 2H8PC 1N32O 1FXKA 4CC6A 1PNLA 3BABA 4DV6B 3EXAA 4K0KB 1R3JC 4O4IB 2PI4A 3NXSA 1ZAUA 3UT5B 4JI6O 4JYAB 2AGAA 2JEXA 2QWQB 1W2BU 4EB6B 4O2BA 4P30A 1PNMA 4WFBV 2PY5A 2Z0AA 1XL6A 1TUBB 1SKVA 1COWG 2ADQB 5H5NA 3OAAG 4JAVA 1V54C 1FKAO 2BSKB 4FLWA 3OR7C 4RQEA 5LA6B 5EK0A 4MTFA 1W0KG 2Q7HA 2IM9A 2YIAA 3J80N 3JSLA 5E1AC 2G38A 1V54B 1IVSA 3ZN0A 3F5TA 1N34B 2ZKOA 1S5LZ 3HB3B 3ABMB 3B8NA 2MW2B 4FPPA 3STZC 1ZUQA 5LHIA 1WPBA 1I7FA 3OUFA 3CCQV 3I5DA 3T1CA 4PDRA 4A5UB 4DRXB 1U97A 1PP9H 1DK1A 1K4CC 2YC0A 1TA8A 2JJ2G 3TCUA 1Y6XA 5C8YB 3OR6C 1XNRO 1N0JA 4RO2A 4DUZO 4D7TA 4MVRA 5LP6B 4DV1B 1YZBA 3AG7A 2XT9A 1K73W 1CXZB 4ZHQB 1VQLV 4X66O 1H2SB 1KMIZ 1LUWA 2E5LO 2BSKA 1N34O 3L71H 1BSMA 3ABMC 1VQ5V 1YEWA 2QEXV 3LUTB 2WPDG 5B1AB 1G1XB 1ZX3A 1VQMV 2B1IA 1QR8A 3APOA 4DV5O 5CMUA 2YEVA 2OTJV 1AILA 5LGNA 1K33A 1SC5B 5LXTA 3WG7B 2YI9A 2WLIA 5EIBD 3IC9A 3ZHUA 4LP8A 5GONB 4I0XA 2PI5A 3BHPA 5L3BA 5EC2C 4H44B 4X1KB 3SPIA 3BVOA 4FZ0A 2FB5A 1KKDA 2CE4A 3W7WA 1YVWA 5IE9A 1TAEA 2O57A 1GN6A 1FXHA 2CH7B 4I9QA 4JGSA 4BIZA 1BS3A 3KCYA 3CPWU 4IGGA 3ASOC 3FYEB 3LSUA 1FD9A 1AI7A 1WLEA 3M8AA 1B6QA 2JVDA 3N2KB 4B3TB 5ITZA 4IL6Z 5LHGA 4LFBO 1P4RA 4R7CA 3ZMUA 1VMGA 5IJ0A 4WCEV 2EULA 3PN1A 2QM4A 4N21A 4J7ZA 1SA0A 4G27B 4YJ2B 4P9PA 1BGYH 1OCZC 1W0JG 3JSNA 4J80A 4B3RO 1I0HA 1N8RW 4X64O 5L3CA 4CC5A 1Y74A 4CH5A 3BFRA 2WA4A 1OCOB 2H3OA 4YJ3A 2IJKA 2CDYA 1IZ3A 2NNUA 2ZE6A 2LFRA 3CEIA 1BQZA 1YF2A 1B3QA 5IDJA 2QKSA 3GWKC 2A06H 5LHHA 1FPOA 4LF5B 1XBLA 1NKDA 2QTSA 5CA0A 5BR8O 5LMNB 3B09A 1N36O 4LFBB 2XASA 2WLKA 1Y4MA 3CCMV 1V55B 3K5NA 2UUAB 2AHZA 4JI7O 2DW4A 4HBNA 4JPRA 3ZCCA 1ZTEA 1GKFA 3A8TA 4AQYO 1IBLB 2UXDO 1WB7A 4RUFA 2V1DA 2ZM6B 3OT7A 2UU9B 1PPJH 2WAMA 4NTXA 4LFAB 3ABKC 1SS3A 2LFSA 2EILB 3EFFK 5IY5B 1HW7A 2DQ0A 5LYJA 1QNMA 3ASNB 3OMAB 1R73A 1DF4A 1XI1A 1Y66A 2HG5C 1QVFU 2BTQB 4JI8O 3G67A 3BEHA 1MZEA 3STLC 1J5EO 3QG5A 1UJWB 2WLLB 3ZHTA 2Q68A 3TXQA 1IBKB 3K03A 1M93A 3DXRB 3CE2A 1EN4A 3RYHB 3AK1A 3K9SA 3B2EE 1A32A 2AW9A 2VWJA 2R9AA 3ZX6A 1IXBA 2YI8A 3OM3B 5ITZB 1IBKO 1FXKC 5C93A 4DV6O 4IIJA 4WF9V 1RSOB 3OFNG 1OCRB 4LBEC 5KMGB 3UO3A 2PYLA 1M90W 4X1YA 4LWSA 4LF6B 5LGUA 1S5HC 5FLXN 1E1QG 2Q5ZA 3TK1A 4LF9B 1L0NH 1XNQB 1OHHG 3AG2C 3JD2A 3WB2A 1Q81W 1YSCA 3EHBB 4DV0B 4FM1A 2YEVB 3VBBA 2GDSA 3ABLB 3IJ4A 4N23A 3SR2C 1W59A 1E1RG 1QLEC 1TGOA 2LW7A 4YY3O 3C3SA 1Z5WA 5KHGA 3H1JH 3SYQA 2RNBA 4DR6B 1RFYA 4ICGA 3X2QC 4Z1VA 3D36C 2HFEC 4YXWG 2EZOA 3HKBA 2CTPA 1N33O 1G8MA 3K3WA 4CBCA 2AZ0A 1WB8A 5L3DA 2ZE7A 4MW8A 4BW9A 4DV5B 1VF6C 1IX9A 3O9OA 1KYOF 3MD0A 4BW5A 2OCCB 2JGDA 4Q6GA 3ZEDA 5IYZA 5C8YA 4FFKA 2ETNA 3EVKA 3ZHQA 4DK1A 1Q6UA 3H1KH 4IYIA 3CD6V 5FPOA 3SDLA 2WLHA 4JTAB 4QGPA 3A0HZ 2N04A 4TUYB 2QKAA 3RYIB 3Q4HB 1QU7A 4MVOA 5BZBA 4JI0B 4U7NA 1OCOC 1DTOA 2WLMA 1JOYA 1EN6A 1GO3F 3QO5A 3U10A 1M56C 1QBZA 2DYRC 1J5EB 4I50A 2GV9A 4GT1A 4C7UA 3JATA 4F6RB 4JZ2A 1I5YA 5AG2A 5LBQA 1R1BA 3HR0A 3RVYA 2P22C 3OGCC 3TETA 1PKXA 2LGQA 1SERA 4H13B 4UCVA 5LOVA 1D2DA 1X59A 4O2BB 4FM2A 4CH3A 3AG4C 1ENVA 2VS0A 2RN9A 4ZKIA 4DUYO 4J10A 3HKEA 1BL8A 4NXNB 2BTOA 1VQNV 1OJHA 1F7YA 3CHXA 2Z5UA 4X20B 2FL4A 4NVPA 3R66A 1P7BA 4JTCB 3AG2B 4K35A 2QWRB 1K97A 4EEQA 1L1FA 1F4NA 3T4DA 4LF6O 5KUMA 4I50B 5IYBO 1YIJV 1WA8A 3H1HH 3SPCA 3L9DA 1KB9F 4RUEA 3C90A 5KLVH 2NN4A 4K8ZA 4FLUA 5IYCO 1KP3A 1ZL8A 5B3SC 3Q4HA 4J11A 4R8CA 4JI6B 1KU9A 4MS2A 2PGGA 4ZI7A 2RMKB 2WSSG 4X20A 4PDVA 4FLTA 4MTOA 4JI0O 2E76B 3P3PA 3ETEA 4B7KA 4LCUC 3ABTA 5LOVB 2HR3A 2W6JG 3ABUA 5B1BB 2B1GA 4JF3A 4F6RA 3N2KA 1CP9A 2UXBO 1XMQB 2ZCEA 4OGQB 3DGEA 4U7OA 3ASOB 4MTXA 3K06A 2DQ3A 4JI3B 3CRCA 2CGOA 4P9OA 3HKBB 3W7UA 1HP8A 4OX9B 1K92A 2R9IA 3L72H 3T1HO 3OGIB 1K5SA 2IU0A 2KG7A 3U11A 1UFIA 2JIZG 1UPGA 3KG2A 2Q67A 2YIDA 2Q9LA 2A3QA 2ZDIC 2VQFB 5KX5A 3WB0A 3B8MA 5GW7A 2XTAA 4J42A 1H38A 1E79G 4FIPC 4DV2O 2QJ1A 1VQ9V 4F4LA 2R72A 1S5JA 2VWKA 1VQ4V 3RYFB 5JQGA 4WFFA 2AXTZ 5KA5A 4DR5B 4X1YB 1AB3A 2LO1A 5KMGA 1FFXA 1SQXH 1F51A 4LR3A 4DR1B 1JFFB 3T1HB 3LNMB 3W7SA 3CS5A 1GAXA 5D5QA 2ZT9B 4ZHQA 2HEPA 2OYQA 4GYCB 1IDSA 2QWOB 1HNXO 3ZMVA 1SESA 4NR1A 2ATKC 3CMAV 3S3WA 1S77D 3DXRA 2UXBB 5CA1B 5GTHZ 4I7ZB 1Z2GA 1IBMO 2DYRB 2OT5A 1VQ6V 4KL1A 2XAQA 1VEWA 4PA7A 3KZIZ 4B3TO 1AR1B 1J95A 1MOFA 1QQCA 3I55V 5LA6A 1K5QA 4X89A 3J81N 5IJ9B 2JRIA 1HNXB 1GM9A 1S76D 1SQQH 1XOUA 4B3MO 5B1BC 3VQVA 1HNWO 1MSDA 3SPHA 3K0DA 3CCJV 1AI4A 3BRCA 1NTKH 4X1IB 3K57A 2K9PA 3UT5A 2XAJA 1KUQA 4O4IA 5EZYA 3CC2V 4PELA 5B1NA 4I55A 5E79Z 5JH7B 3D36A 4J9YB 4LH7A 1VQKV 2IJIA 1MNGA 5LYJB 3A0RA 4DV2B 4PJ0Z 4YJ3B 2DMXA 1XL4A 3APQA 4JYBA 1CEZA 3RW0A 3JD1A 2HJDA 4FVMA 5LP6C 2MK3A 4B3SB 3CXHF 2DWDC 4G2KA 1H8EG 4J41A 4MTGA 2Q7EA 1O9HA 1EZVH 2ZIMA 1MSWD 4B3RB 3RVZA 4O2AB 4X64B 3ABLC 2EILC 1H2GA 2X7RB 3FD9A 2XUMA 3ZHRA 4DV0O 2UXNA 3G4SV 1ZWIC 2FKXA 4DW0A 3WFVA 3AG3C 3ZS8C 2ZE5A 4LFCB 2ZQMA 2YXYA 1NR1A 5EYPA 2BOCC 2RDCA 3CRQA 3RWRD 1OCCC 2ZIOA 2XAHA 1M5IA 5JJNB 1JJOA 4PDLA 1GH6A 3H1IH 4AI8A 1F23A 4G28B 1K34A 3D8CA 1N4CA 5FPRA 3BAAA 3UCSC 1LUVA 4YJ2A 4PHZA 4I9WA 4EFEA 1SA0B 4MVUA 2JJ1G 4CS4A 1QVGU 1YXBA 2EIJC 2GUZA 2WLNA 2X0LA 4X1IA 3UQ8A 2QDOA 1U96A 2QM7A 2ZXWC 4YIOA 3JARB 1XDCA 3SJBC 1GM7A 4F6EA 2OWOA 1Q3EA 1ROPA 1B04A 4JI4B 4X62O 3JD0A 3SJAC 3LNNA 1JCHA 1XMOO 2R70A 3QF7A 4X1KA 3WB1A 2IJHA 4DXWA 1M56B 1IBLO 5GONA 3OTFA 1H2NA 1FYJA 2IU3A 4O4HA 4CS2A 1XEQA 3SYCA 1XMOB 4D6TH 5FNVB 1IURA 2Q0AA 1N36B 2P5OA 4DR6O 3SYOA 3JASB 3P32A 3BA8A 1XUQA 5IYDO 1EN5A 4PV1B 4BAYA 4MT8A 5JJEB 1M4UA 2HKOA 3JALA 2EINC 2QTOA 2PUSA 3LSQA 1S0VA 1H8HG 2ZNIA 4JV5B 2GTSA 5L3EA 4OPAA 4YY3B 4PA4A 3QTCA 3CMEV 4JI2O 2ZE8A 5CB4A 1BT8A 1NVPB 2PZSA 3OTOB 1KECA 5DECA 4JI7B 2WWWA 5B66Z 4UVCA 1AI5A 1SQPH 1HR0O 3KCXA 5IY5C 2E74B 5D5PA 4NYKA 4GKKO 2Z3YA 2EIMB 2PTMA 2OIEA 2WA3A 3QNEA 3CCSV 3OUSA 2EBOA 4PA9A 5JCOA 4ZOLA
chains in the Genus database with same CATH topology
4NXMO 1G1XB 1KUQA 1N32O 1F7YA 4DV5O 3R66A 2DJVA 4DV2O 4JI7O 1XMQO 4JI4O 1AILA 5IT9N 4X62O 4DR7O 2LW7A 4YY3O 4AQYO 2UXDO 4LF7O 1XMOO 4JI6O 4DR3O 4LF6O 4DV3O 2UUCO 2AGAA 4LFAO 4OX9O 3JAMN 4YHHO 2UU9O 1AB3A 4KHPO 2Z0AA 4JV5O 2UXCO 2UUBO 1IBLO 1N33O 4DR1O 1FYJA 5H5NA 4LF4O 1R6TA 1XNQO 1FKAO 4JI5O 1XEQA 5LMUO 2VQEO 4DR5O 4DR6O 4JI8O 1HNXO 4JI3O 1J5EO 3J80N 3O65A 4JI0O 3M8AA 4DV1O 3F5TA 5LL6Y 2ZKOA 4DR2O 4LFBO 1IBMO 4LFCO 4DR4O 4DV0O 3SDLA 2FKXA 1A32A 1I94O 5BY1A 4OPAA 1NS1A 2DOSA 3OTOO 2VQFO 1HNZO 4A5UB 4B3RO 1IBKO 4B3TO 5IWAO 2UXBO 4JI2O 1DK1A 4K0KO 4DV6O 4LF5O 4LF9O 4X64O 4GKJO 1XNRO 4DUZO 1FJGO 2F4VO 2N74A 3J81N 1YZBA 2UUAO 4X66O 4JYAO 3T1YO 1HR0O 2JRIA 4DV4O 5FLXN 3T1HO 4NXNO 4B3MO 4OPHA 3RT3C 4LF8O 1HNWO 5A2QN 1R1BA 4GKKO 2E5LO 3J7AU 1N34O 4B3SO 1D2DA 1X59A 4DV7O 2HHHO 4X65O 2ZM6O 5BR8O 5BXZA 4JI1O 5LMNO 1N36O 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM O;  1G1X B;  1KUQ A;  1N32 O;  1F7Y A;  4DV5 O;  3R66 A;  2DJV A;  4DV2 O;  4JI7 O;  1XMQ O;  4JI4 O;  1AIL A;  5IT9 N;  4X62 O;  4DR7 O;  2LW7 A;  4YY3 O;  4AQY O;  2UXD O;  4LF7 O;  1XMO O;  4JI6 O;  4DR3 O;  4LF6 O;  4DV3 O;  2UUC O;  2AGA A;  4LFA O;  4OX9 O;  3JAM N;  4YHH O;  2UU9 O;  1AB3 A;  4KHP O;  2Z0A A;  4JV5 O;  2UXC O;  2UUB O;  1IBL O;  1N33 O;  4DR1 O;  1FYJ A;  5H5N A;  4LF4 O;  1R6T A;  1XNQ O;  1FKA O;  4JI5 O;  1XEQ A;  5LMU O;  2VQE O;  4DR5 O;  4DR6 O;  4JI8 O;  1HNX O;  4JI3 O;  1J5E O;  3J80 N;  3O65 A;  4JI0 O;  3M8A A;  4DV1 O;  3F5T A;  5LL6 Y;  2ZKO A;  4DR2 O;  4LFB O;  1IBM O;  4LFC O;  4DR4 O;  4DV0 O;  3SDL A;  2FKX A;  1A32 A;  1I94 O;  5BY1 A;  4OPA A;  1NS1 A;  2DOS A;  3OTO O;  2VQF O;  1HNZ O;  4A5U B;  4B3R O;  1IBK O;  4B3T O;  5IWA O;  2UXB O;  4JI2 O;  1DK1 A;  4K0K O;  4DV6 O;  4LF5 O;  4LF9 O;  4X64 O;  4GKJ O;  1XNR O;  4DUZ O;  1FJG O;  2F4V O;  2N74 A;  3J81 N;  1YZB A;  2UUA O;  4X66 O;  4JYA O;  3T1Y O;  1HR0 O;  2JRI A;  4DV4 O;  5FLX N;  3T1H O;  4NXN O;  4B3M O;  4OPH A;  3RT3 C;  4LF8 O;  1HNW O;  5A2Q N;  1R1B A;  4GKK O;  2E5L O;  3J7A U;  1N34 O;  4B3S O;  1D2D A;  1X59 A;  4DV7 O;  2HHH O;  4X65 O;  2ZM6 O;  5BR8 O;  5BXZ A;  4JI1 O;  5LMN O;  1N36 O;  4DUY O; 
#chains in the Genus database with same CATH topology
 2Y0I A;  4NXM O;  4O4J B;  4QJF B;  4XDL A;  3RN4 A;  4DR4 B;  2Q69 A;  1QR9 A;  3E86 A;  4QIW F;  5JCO C;  1ARO P;  2EIJ B;  1KQS U;  1QLE B;  3K5L A;  4B3M B;  2NR5 A;  4QPJ A;  1YTF D;  4JAS A;  3G71 V;  4LF7 O;  1R3K C;  2CAZ C;  3MAQ A;  3OW2 U;  4MVM A;  1Q5O A;  4K8X A;  1Q6H A;  3B40 A;  5JQG B;  3VQW A;  1GTO A;  2F93 B;  4ZBM A;  4WFE A;  1XNR B;  4EB6 A;  3E22 A;  4X65 B;  2QWP B;  5EC1 C;  4FLX A;  4FFB B;  1R6T A;  4IHJ A;  2KQX A;  1XNQ O;  4MVS A;  4WFG A;  4WFA V;  5LMU O;  3HKD B;  5BMV B;  2FTK A;  2HJF C;  2DE0 X;  1TVK A;  5J9P C;  4NB5 A;  1IBM B;  1FXK B;  4AQY B;  1BZK A;  4LH6 A;  2EIK B;  3LDC A;  1KBH A;  3R65 A;  3AG3 B;  1I5X A;  3RBZ A;  4UUJ C;  2VRZ A;  5EYP B;  2F66 C;  4HNA A;  4RAI A;  1G6U A;  3CCR V;  3K79 A;  4Z2W A;  4MVQ A;  5F2V O;  2OIG A;  3UM7 A;  1FS0 G;  1NT2 B;  3FB7 C;  3ML0 A;  1VF6 A;  3DTU B;  1WA8 B;  3D3Q A;  1VQP V;  3N27 A;  5L3G A;  2JK5 C;  4LF8 B;  4DW1 A;  4I4T A;  2EZP A;  1I94 B;  1Q90 D;  5B1O A;  4L8J A;  1TVK B;  1N32 B;  1O9G A;  2F4V B;  3SGI A;  4LF8 O;  3HKE B;  4FM0 A;  1XRE A;  3PJS K;  2P6J A;  3K58 A;  4FMT A;  4WBN A;  1SZX A;  3K04 A;  1OV9 A;  2P67 A;  4JI1 O;  3ZRS A;  5JVD A;  1GRJ A;  3ZJZ A;  3MHS C;  2W0X A;  4CZZ A;  3AK2 A;  4JI4 O;  5IT9 N;  5B1A C;  2HLD G;  1LR1 A;  2Y48 A;  4BIO A;  5FL7 G;  5LGT A;  4OX9 O;  4O4J A;  2DN9 A;  5EIB C;  4KHP O;  2Y69 C;  4PA6 A;  1V9P A;  2QM8 A;  4TT3 G;  4FLZ A;  1ZLZ A;  4NTY A;  4UV8 A;  2BE3 A;  4AHC A;  4Q20 A;  1NZ6 A;  3CCE V;  1WNS A;  4NXM B;  2CGN A;  2FML A;  5H6R A;  3H01 A;  1PL0 A;  1H2M A;  3OMI B;  3UO2 A;  2Y0P A;  1VF7 A;  2JGD B;  5CB4 B;  2N05 A;  2IW5 A;  1JA8 A;  3TJT A;  4LFC O;  1YJN V;  3X2Q B;  3F7Y C;  3FAV B;  1EFR G;  3IGA C;  3RFR A;  4CS3 A;  2F1M A;  1NS1 A;  2KKW A;  5KHK A;  2DOS A;  4PI2 A;  5CA3 A;  3KKY A;  3QO7 A;  1VIB A;  2FYU H;  1Q82 W;  1H2L A;  3DSQ A;  1M1K W;  5EBW C;  3E2E A;  4UCT A;  3JAS A;  1R6N A;  2HP8 A;  2Q4P A;  1SQB H;  2EIK C;  5FNV A;  4U3J B;  3ZRW B;  3RT3 C;  2YXL A;  2P4K A;  3SPJ A;  4O4H B;  1K3E A;  4TV9 A;  1JFF A;  1GK9 A;  5IYZ B;  1NR7 A;  3CJH A;  4W4K A;  1D5A A;  3HKC B;  1M9N A;  1SQF A;  5H6Q A;  4CH4 A;  4MW3 A;  4X88 A;  3HPL C;  2JS3 A;  3RYF A;  5KHH A;  4LWS B;  3FB5 C;  4KP4 A;  3G6E V;  4WFH A;  1K7D A;  1FFT B;  3ZIA G;  2R9R B;  2K1E A;  1BQ0 A;  1RM1 B;  3TXS A;  3E89 A;  3JAR A;  3HKC A;  4UCS A;  2M7W A;  2GSM B;  3ZHV A;  2UUC O;  4ASU G;  4YHH O;  4IIJ B;  4UB8 Z;  2YIC A;  5HFL A;  4DK0 A;  1HDJ A;  1MG1 A;  4JV5 O;  3OE7 G;  1JMK C;  1HNW B;  2ZXW B;  5DN6 G;  3DC5 A;  4YHH B;  1YJW V;  3ABK B;  4DR3 B;  4LNU B;  4O4L B;  1R3L C;  1SQG A;  3CSX A;  2YIB D;  3E83 A;  1JR9 A;  4JI3 O;  2WLL A;  2LP7 A;  2Q6A A;  4DV1 O;  4UVA A;  4GLX A;  3L73 H;  2A9H A;  3ZMZ A;  1PL4 A;  2XAF A;  2QSA A;  4JTD B;  1SRY A;  3D3I A;  1S72 V;  3B4S A;  5DM6 V;  5BY1 A;  3L74 H;  2VQF O;  1RSO A;  2JDI G;  4K0K O;  3L70 H;  4GKJ O;  1I08 A;  4K3A A;  3WG7 C;  1VQ7 V;  4UCR A;  1US6 A;  4TV8 A;  2YSU B;  2Y4T A;  1LNQ A;  4IT5 A;  4HYO A;  4AIL C;  3JCZ A;  1DLB A;  2A79 B;  3CRM A;  5A2Q N;  1FAF A;  2PF4 E;  2IH3 C;  1R3I C;  1WAZ A;  4PI0 A;  1L8D A;  1SF9 A;  4DUY B;  2BTQ A;  2UXX A;  3MDS A;  1MAB G;  2ODM A;  1AJQ A;  1WPX A;  3AK3 A;  4DUZ B;  5KHI A;  1FXV A;  2ARH A;  4LF7 B;  3K5O A;  2YIB A;  4GX2 A;  2XAG A;  4JYY A;  3K5M A;  3W7T A;  3SJC C;  4I55 B;  1EZJ A;  5JVD B;  3CC4 V;  4XDJ A;  4DV3 O;  1B06 A;  1NTM H;  4J7K A;  1BCC H;  2CTQ A;  3GWO A;  2XOK G;  2WLJ A;  3BPZ A;  1SQV H;  2LJ2 A;  4TV8 B;  3RYC B;  4NKG B;  1HWY A;  4H37 A;  3T1Y B;  1NBM G;  3AG1 C;  3CRA A;  4DO2 A;  1Z5V A;  3SYA A;  3JD4 A;  3P3N A;  5LL6 Y;  4UCU A;  2RCV A;  1V55 C;  2AZ2 A;  4HNA B;  3B77 A;  4X8A A;  4OXS A;  5CBG A;  3RGB A;  1HNZ B;  5TIS Z;  4JI1 B;  3ZRV A;  1WP7 A;  1Y74 B;  1ORQ C;  3LDD A;  4DV3 B;  3CB2 A;  1S3J A;  4I0X B;  1PV0 A;  1M57 C;  1N33 B;  2WLI B;  1GMG A;  3M99 B;  5CBH A;  4O4L A;  2F4V O;  5BMV A;  1Y76 A;  4XBF A;  3ASN C;  2EJ7 A;  2IJJ A;  4GKJ B;  2ZR2 A;  1PNK A;  5IJ0 B;  2ZR3 A;  2UXD B;  1JVM A;  5GTI Z;  3OD4 A;  5KUK A;  4QE7 A;  3E22 B;  1WJZ A;  2ZD9 A;  4CH6 A;  3CX5 F;  1BHB A;  1IXM A;  3L75 H;  1Q43 A;  3T4Z A;  5BR8 B;  5LMN O;  2C2A A;  3K0G A;  5J2T B;  3OEE G;  1M57 B;  4GUN A;  3AG4 B;  1RM1 C;  1YCI A;  2LW1 A;  4JI8 B;  1XQ8 A;  1KC8 W;  2PYJ A;  4B7E A;  2UU9 O;  2DYS C;  4QNH B;  1X4T A;  1Y76 B;  5LXT B;  5KAF Z;  2UUB O;  4PD4 F;  2V4D A;  3ZRW A;  4DR1 O;  4FK5 C;  1SZT A;  4MVZ A;  4LF4 O;  3JCU Z;  2P06 A;  5KA6 A;  1MMM A;  2A0L A;  4TWK A;  1NH2 B;  4HAM A;  5L3F A;  2VQE O;  1OCR C;  5K1P A;  4DR5 O;  1YTF B;  5J2T A;  3SJQ C;  4J9Z B;  1XIL A;  1Q8I A;  4R6Z A;  4DR2 O;  2CTW A;  4BIU A;  3ZHS A;  4DR4 O;  2L6L A;  2ILM A;  1Q86 W;  2CUG A;  1AJN A;  2VQE B;  1SET A;  3RYC A;  1K8A W;  2F23 A;  5LP6 A;  5HFM A;  2ADP A;  1HNZ O;  4UCO A;  1GN3 A;  3A2F A;  3IAY A;  3M7M X;  4JI2 B;  3ICX A;  4DRX A;  2XHB A;  4TQF A;  2UUB B;  3K08 A;  1FJG O;  2Q0O C;  3GB7 C;  3A0B Z;  4KHP B;  3FYI B;  1YIT V;  3T1Y O;  1Q6I A;  5EBM C;  4NXN O;  1G4Y B;  4Z1M G;  4ZI7 B;  1Q7Y W;  3WU2 Z;  1AP5 A;  1FJG B;  3I56 V;  3J7A U;  2YUA A;  4UVB A;  4TOI A;  1ZL8 B;  3OEH G;  4YIP A;  4B3S O;  1K9M W;  1GN4 A;  2HHH O;  2BOB C;  2X6C A;  3FB6 C;  5CBF A;  3AEI A;  4DR2 B;  2H94 A;  1QLN A;  3CC7 V;  3JYC A;  4JI5 B;  2DJV A;  1NI8 A;  1YHQ V;  3E8H A;  2QGN A;  3DC6 A;  1TUB A;  1AJP A;  2YS8 A;  3E8B A;  1KD1 W;  4LFA O;  1NQT A;  2HVJ C;  1OCC B;  2E75 B;  4ABM A;  1JJ2 U;  2KB1 A;  4LC1 A;  2D2C B;  4E2L A;  2UXC O;  4UXN A;  4GKK B;  3LSS A;  2E3C A;  5CA0 B;  3E35 A;  1QHT A;  3FKS G;  1VQ8 V;  2QR4 A;  4U3F H;  3K59 A;  2E5L B;  3AG1 B;  4I4T B;  3JAW A;  3JAT B;  1NH2 D;  2Y4U A;  5LMU B;  1XHZ A;  5K1X A;  4R50 A;  4H33 A;  1RPO A;  2EIM C;  3CP1 A;  1RP3 B;  3QO8 A;  3TGU H;  1EM1 A;  4J7J A;  4TQD A;  2CTR A;  3OMN B;  2NLJ C;  1YJ9 V;  3ETQ A;  3RYI A;  4FLV A;  4RQF A;  4TUY A;  2B5U A;  1OCZ B;  2P7T C;  1I94 O;  4MSW C;  4LNU A;  3THO A;  1KKC A;  1RPR A;  2GTA A;  3ZMS A;  3U0Z A;  2X6A A;  5IWA O;  4GX0 A;  2W0F C;  4LF5 O;  2AHY A;  2Q8V A;  1AP6 A;  3QVN A;  4DR7 B;  3ETD A;  4KXR A;  5JWP A;  3VQX A;  2JS5 A;  2HVK C;  3C3T A;  4E4E A;  1YDX A;  1PM9 A;  1P84 F;  4FJC C;  5B3S B;  4H0L B;  1OZ0 A;  4DV7 B;  3CXC U;  2XND G;  2CH7 A;  3CCL V;  3ZMT A;  1XHX A;  3S3X A;  2GBO A;  4DV7 O;  2EIN B;  3GVM A;  4BWA A;  4X65 O;  3UKM A;  2P4V A;  3JAK B;  4I5S A;  2ZM6 O;  2D3O W;  5KHJ A;  2JEU A;  2Y69 B;  3BA9 A;  1NJI W;  4X62 B;  3E8G A;  3CJH B;  2X6B A;  5JH7 A;  3P30 A;  4BR6 A;  2ZIN A;  1XMQ O;  5IWA B;  1VAR A;  5EZY B;  3VQY A;  4ZOL B;  2DYS B;  4DR7 O;  3ZRX A;  4U3J A;  3N2G A;  1THZ A;  2RQ6 A;  5JJJ B;  2L35 A;  4HZ3 A;  4UB6 Z;  3ZBH A;  4UV9 A;  2Q73 A;  4FZ1 A;  3CCU V;  4JAA A;  5KAI Z;  2B9Z A;  1JPX A;  2YXH A;  2EX3 A;  4X9Q A;  4IYH A;  3F7V C;  3JD3 A;  3G6B A;  5IJ9 A;  2V7Q G;  2M6Y A;  1AI6 A;  2Q7G A;  2QWN B;  3LDE A;  5J2U B;  4DV4 B;  2F95 B;  4GX5 A;  4NTW A;  1H2K A;  3CYO A;  3IC7 A;  3O65 A;  1DF5 A;  4GCZ A;  1JQ0 A;  4P2Z A;  2JGU A;  3SPG A;  1ZSP A;  3ZN1 A;  3MHH C;  4TV9 B;  4GX1 A;  2ZNJ A;  1Y67 A;  3CWB H;  3JAL B;  2P90 A;  4PDM A;  2UXC B;  4B08 A;  4GZR B;  3OTO O;  4QPK A;  1D5N A;  1PD3 A;  5CA1 A;  3RYH A;  2OCH A;  2UUC B;  2RJZ A;  4LF9 O;  1R6K A;  3IFX A;  5B5E Z;  1YI2 V;  2KSD A;  3E8F A;  3VOU A;  4W4L A;  2N74 A;  4EFB A;  4FLY A;  5DED A;  1VP7 A;  4JYA O;  4X66 B;  2A7W A;  2EJR A;  4DV4 O;  3K9A A;  4OPH A;  1JX9 A;  1P7G A;  1N0N A;  2IBZ H;  1QCE A;  1FFX B;  3FAV A;  3ETG A;  1GN2 A;  1F4M A;  2OCC C;  3BCC H;  1DGS A;  3SYP A;  4DYL A;  3W7X A;  5J2U A;  5BXZ A;  2ITD C;  4TSF G;  3H9V A;  1WP8 A;  4ZIB A;  4PA3 A;  2F43 G;  3FB8 C;  2QKC A;  1BE3 H;  3CCV V;  1URF A;  4DR3 O;  1VQO V;  2GUZ B;  5KX5 B;  3JAM N;  3N2G B;  4LF4 B;  5CN0 A;  4JYC A;  1NU1 H;  1BHA A;  2DWE C;  2KG7 B;  2QE7 G;  1WN7 A;  4KFM A;  1HR0 B;  2OTL V;  4JI5 O;  1EBO A;  5H2F Z;  1MZF A;  3JAK A;  1VF5 B;  1KP2 A;  1MA1 A;  4RWU A;  3G80 A;  1BMF G;  3H1L H;  1P49 A;  1K4D C;  4EKW A;  2IH1 C;  2LQT A;  4WBN B;  3FFQ A;  1CPY A;  3FX7 A;  2ITC C;  1AR4 A;  2GHY A;  2HHH B;  4L87 A;  1T5E A;  1NVP D;  1AVM A;  3HKD A;  3NR7 A;  4O2A A;  3BY6 A;  4UFZ A;  4QE9 A;  3T2M A;  4FFB A;  4IHJ B;  1AR5 A;  5H9C A;  2W6I G;  5EBL C;  1L0L H;  4KUM A;  1GM8 A;  2BCC H;  2UUA O;  4XDK A;  3CRR A;  4JZG A;  4D7S A;  4JAU A;  2ZDI A;  2YDE A;  5A9G A;  2LGW A;  2CK3 G;  3F5W C;  2QA4 V;  1NTZ H;  3JAW B;  1TUE B;  2H8P C;  1N32 O;  1FXK A;  4CC6 A;  1PNL A;  3BAB A;  4DV6 B;  3EXA A;  4K0K B;  1R3J C;  4O4I B;  2PI4 A;  3NXS A;  1ZAU A;  3UT5 B;  4JI6 O;  4JYA B;  2AGA A;  2JEX A;  2QWQ B;  1W2B U;  4EB6 B;  4O2B A;  4P30 A;  1PNM A;  4WFB V;  2PY5 A;  2Z0A A;  1XL6 A;  1TUB B;  1SKV A;  1COW G;  2ADQ B;  5H5N A;  3OAA G;  4JAV A;  1V54 C;  1FKA O;  2BSK B;  4FLW A;  3OR7 C;  4RQE A;  5LA6 B;  5EK0 A;  4MTF A;  1W0K G;  2Q7H A;  2IM9 A;  2YIA A;  3J80 N;  3JSL A;  5E1A C;  2G38 A;  1V54 B;  1IVS A;  3ZN0 A;  3F5T A;  1N34 B;  2ZKO A;  1S5L Z;  3HB3 B;  3ABM B;  3B8N A;  2MW2 B;  4FPP A;  3STZ C;  1ZUQ A;  5LHI A;  1WPB A;  1I7F A;  3OUF A;  3CCQ V;  3I5D A;  3T1C A;  4PDR A;  4A5U B;  4DRX B;  1U97 A;  1PP9 H;  1DK1 A;  1K4C C;  2YC0 A;  1TA8 A;  2JJ2 G;  3TCU A;  1Y6X A;  5C8Y B;  3OR6 C;  1XNR O;  1N0J A;  4RO2 A;  4DUZ O;  4D7T A;  4MVR A;  5LP6 B;  4DV1 B;  1YZB A;  3AG7 A;  2XT9 A;  1K73 W;  1CXZ B;  4ZHQ B;  1VQL V;  4X66 O;  1H2S B;  1KMI Z;  1LUW A;  2E5L O;  2BSK A;  1N34 O;  3L71 H;  1BSM A;  3ABM C;  1VQ5 V;  1YEW A;  2QEX V;  3LUT B;  2WPD G;  5B1A B;  1G1X B;  1ZX3 A;  1VQM V;  2B1I A;  1QR8 A;  3APO A;  4DV5 O;  5CMU A;  2YEV A;  2OTJ V;  1AIL A;  5LGN A;  1K33 A;  1SC5 B;  5LXT A;  3WG7 B;  2YI9 A;  2WLI A;  5EIB D;  3IC9 A;  3ZHU A;  4LP8 A;  5GON B;  4I0X A;  2PI5 A;  3BHP A;  5L3B A;  5EC2 C;  4H44 B;  4X1K B;  3SPI A;  3BVO A;  4FZ0 A;  2FB5 A;  1KKD A;  2CE4 A;  3W7W A;  1YVW A;  5IE9 A;  1TAE A;  2O57 A;  1GN6 A;  1FXH A;  2CH7 B;  4I9Q A;  4JGS A;  4BIZ A;  1BS3 A;  3KCY A;  3CPW U;  4IGG A;  3ASO C;  3FYE B;  3LSU A;  1FD9 A;  1AI7 A;  1WLE A;  3M8A A;  1B6Q A;  2JVD A;  3N2K B;  4B3T B;  5ITZ A;  4IL6 Z;  5LHG A;  4LFB O;  1P4R A;  4R7C A;  3ZMU A;  1VMG A;  5IJ0 A;  4WCE V;  2EUL A;  3PN1 A;  2QM4 A;  4N21 A;  4J7Z A;  1SA0 A;  4G27 B;  4YJ2 B;  4P9P A;  1BGY H;  1OCZ C;  1W0J G;  3JSN A;  4J80 A;  4B3R O;  1I0H A;  1N8R W;  4X64 O;  5L3C A;  4CC5 A;  1Y74 A;  4CH5 A;  3BFR A;  2WA4 A;  1OCO B;  2H3O A;  4YJ3 A;  2IJK A;  2CDY A;  1IZ3 A;  2NNU A;  2ZE6 A;  2LFR A;  3CEI A;  1BQZ A;  1YF2 A;  1B3Q A;  5IDJ A;  2QKS A;  3GWK C;  2A06 H;  5LHH A;  1FPO A;  4LF5 B;  1XBL A;  1NKD A;  2QTS A;  5CA0 A;  5BR8 O;  5LMN B;  3B09 A;  1N36 O;  4LFB B;  2XAS A;  2WLK A;  1Y4M A;  3CCM V;  1V55 B;  3K5N A;  2UUA B;  2AHZ A;  4JI7 O;  2DW4 A;  4HBN A;  4JPR A;  3ZCC A;  1ZTE A;  1GKF A;  3A8T A;  4AQY O;  1IBL B;  2UXD O;  1WB7 A;  4RUF A;  2V1D A;  2ZM6 B;  3OT7 A;  2UU9 B;  1PPJ H;  2WAM A;  4NTX A;  4LFA B;  3ABK C;  1SS3 A;  2LFS A;  2EIL B;  3EFF K;  5IY5 B;  1HW7 A;  2DQ0 A;  5LYJ A;  1QNM A;  3ASN B;  3OMA B;  1R73 A;  1DF4 A;  1XI1 A;  1Y66 A;  2HG5 C;  1QVF U;  2BTQ B;  4JI8 O;  3G67 A;  3BEH A;  1MZE A;  3STL C;  1J5E O;  3QG5 A;  1UJW B;  2WLL B;  3ZHT A;  2Q68 A;  3TXQ A;  1IBK B;  3K03 A;  1M93 A;  3DXR B;  3CE2 A;  1EN4 A;  3RYH B;  3AK1 A;  3K9S A;  3B2E E;  1A32 A;  2AW9 A;  2VWJ A;  2R9A A;  3ZX6 A;  1IXB A;  2YI8 A;  3OM3 B;  5ITZ B;  1IBK O;  1FXK C;  5C93 A;  4DV6 O;  4IIJ A;  4WF9 V;  1RSO B;  3OFN G;  1OCR B;  4LBE C;  5KMG B;  3UO3 A;  2PYL A;  1M90 W;  4X1Y A;  4LWS A;  4LF6 B;  5LGU A;  1S5H C;  5FLX N;  1E1Q G;  2Q5Z A;  3TK1 A;  4LF9 B;  1L0N H;  1XNQ B;  1OHH G;  3AG2 C;  3JD2 A;  3WB2 A;  1Q81 W;  1YSC A;  3EHB B;  4DV0 B;  4FM1 A;  2YEV B;  3VBB A;  2GDS A;  3ABL B;  3IJ4 A;  4N23 A;  3SR2 C;  1W59 A;  1E1R G;  1QLE C;  1TGO A;  2LW7 A;  4YY3 O;  3C3S A;  1Z5W A;  5KHG A;  3H1J H;  3SYQ A;  2RNB A;  4DR6 B;  1RFY A;  4ICG A;  3X2Q C;  4Z1V A;  3D36 C;  2HFE C;  4YXW G;  2EZO A;  3HKB A;  2CTP A;  1N33 O;  1G8M A;  3K3W A;  4CBC A;  2AZ0 A;  1WB8 A;  5L3D A;  2ZE7 A;  4MW8 A;  4BW9 A;  4DV5 B;  1VF6 C;  1IX9 A;  3O9O A;  1KYO F;  3MD0 A;  4BW5 A;  2OCC B;  2JGD A;  4Q6G A;  3ZED A;  5IYZ A;  5C8Y A;  4FFK A;  2ETN A;  3EVK A;  3ZHQ A;  4DK1 A;  1Q6U A;  3H1K H;  4IYI A;  3CD6 V;  5FPO A;  3SDL A;  2WLH A;  4JTA B;  4QGP A;  3A0H Z;  2N04 A;  4TUY B;  2QKA A;  3RYI B;  3Q4H B;  1QU7 A;  4MVO A;  5BZB A;  4JI0 B;  4U7N A;  1OCO C;  1DTO A;  2WLM A;  1JOY A;  1EN6 A;  1GO3 F;  3QO5 A;  3U10 A;  1M56 C;  1QBZ A;  2DYR C;  1J5E B;  4I50 A;  2GV9 A;  4GT1 A;  4C7U A;  3JAT A;  4F6R B;  4JZ2 A;  1I5Y A;  5AG2 A;  5LBQ A;  1R1B A;  3HR0 A;  3RVY A;  2P22 C;  3OGC C;  3TET A;  1PKX A;  2LGQ A;  1SER A;  4H13 B;  4UCV A;  5LOV A;  1D2D A;  1X59 A;  4O2B B;  4FM2 A;  4CH3 A;  3AG4 C;  1ENV A;  2VS0 A;  2RN9 A;  4ZKI A;  4DUY O;  4J10 A;  3HKE A;  1BL8 A;  4NXN B;  2BTO A;  1VQN V;  1OJH A;  1F7Y A;  3CHX A;  2Z5U A;  4X20 B;  2FL4 A;  4NVP A;  3R66 A;  1P7B A;  4JTC B;  3AG2 B;  4K35 A;  2QWR B;  1K97 A;  4EEQ A;  1L1F A;  1F4N A;  3T4D A;  4LF6 O;  5KUM A;  4I50 B;  5IYB O;  1YIJ V;  1WA8 A;  3H1H H;  3SPC A;  3L9D A;  1KB9 F;  4RUE A;  3C90 A;  5KLV H;  2NN4 A;  4K8Z A;  4FLU A;  5IYC O;  1KP3 A;  1ZL8 A;  5B3S C;  3Q4H A;  4J11 A;  4R8C A;  4JI6 B;  1KU9 A;  4MS2 A;  2PGG A;  4ZI7 A;  2RMK B;  2WSS G;  4X20 A;  4PDV A;  4FLT A;  4MTO A;  4JI0 O;  2E76 B;  3P3P A;  3ETE A;  4B7K A;  4LCU C;  3ABT A;  5LOV B;  2HR3 A;  2W6J G;  3ABU A;  5B1B B;  2B1G A;  4JF3 A;  4F6R A;  3N2K A;  1CP9 A;  2UXB O;  1XMQ B;  2ZCE A;  4OGQ B;  3DGE A;  4U7O A;  3ASO B;  4MTX A;  3K06 A;  2DQ3 A;  4JI3 B;  3CRC A;  2CGO A;  4P9O A;  3HKB B;  3W7U A;  1HP8 A;  4OX9 B;  1K92 A;  2R9I A;  3L72 H;  3T1H O;  3OGI B;  1K5S A;  2IU0 A;  2KG7 A;  3U11 A;  1UFI A;  2JIZ G;  1UPG A;  3KG2 A;  2Q67 A;  2YID A;  2Q9L A;  2A3Q A;  2ZDI C;  2VQF B;  5KX5 A;  3WB0 A;  3B8M A;  5GW7 A;  2XTA A;  4J42 A;  1H38 A;  1E79 G;  4FIP C;  4DV2 O;  2QJ1 A;  1VQ9 V;  4F4L A;  2R72 A;  1S5J A;  2VWK A;  1VQ4 V;  3RYF B;  5JQG A;  4WFF A;  2AXT Z;  5KA5 A;  4DR5 B;  4X1Y B;  1AB3 A;  2LO1 A;  5KMG A;  1FFX A;  1SQX H;  1F51 A;  4LR3 A;  4DR1 B;  1JFF B;  3T1H B;  3LNM B;  3W7S A;  3CS5 A;  1GAX A;  5D5Q A;  2ZT9 B;  4ZHQ A;  2HEP A;  2OYQ A;  4GYC B;  1IDS A;  2QWO B;  1HNX O;  3ZMV A;  1SES A;  4NR1 A;  2ATK C;  3CMA V;  3S3W A;  1S77 D;  3DXR A;  2UXB B;  5CA1 B;  5GTH Z;  4I7Z B;  1Z2G A;  1IBM O;  2DYR B;  2OT5 A;  1VQ6 V;  4KL1 A;  2XAQ A;  1VEW A;  4PA7 A;  3KZI Z;  4B3T O;  1AR1 B;  1J95 A;  1MOF A;  1QQC A;  3I55 V;  5LA6 A;  1K5Q A;  4X89 A;  3J81 N;  5IJ9 B;  2JRI A;  1HNX B;  1GM9 A;  1S76 D;  1SQQ H;  1XOU A;  4B3M O;  5B1B C;  3VQV A;  1HNW O;  1MSD A;  3SPH A;  3K0D A;  3CCJ V;  1AI4 A;  3BRC A;  1NTK H;  4X1I B;  3K57 A;  2K9P A;  3UT5 A;  2XAJ A;  1KUQ A;  4O4I A;  5EZY A;  3CC2 V;  4PEL A;  5B1N A;  4I55 A;  5E79 Z;  5JH7 B;  3D36 A;  4J9Y B;  4LH7 A;  1VQK V;  2IJI A;  1MNG A;  5LYJ B;  3A0R A;  4DV2 B;  4PJ0 Z;  4YJ3 B;  2DMX A;  1XL4 A;  3APQ A;  4JYB A;  1CEZ A;  3RW0 A;  3JD1 A;  2HJD A;  4FVM A;  5LP6 C;  2MK3 A;  4B3S B;  3CXH F;  2DWD C;  4G2K A;  1H8E G;  4J41 A;  4MTG A;  2Q7E A;  1O9H A;  1EZV H;  2ZIM A;  1MSW D;  4B3R B;  3RVZ A;  4O2A B;  4X64 B;  3ABL C;  2EIL C;  1H2G A;  2X7R B;  3FD9 A;  2XUM A;  3ZHR A;  4DV0 O;  2UXN A;  3G4S V;  1ZWI C;  2FKX A;  4DW0 A;  3WFV A;  3AG3 C;  3ZS8 C;  2ZE5 A;  4LFC B;  2ZQM A;  2YXY A;  1NR1 A;  5EYP A;  2BOC C;  2RDC A;  3CRQ A;  3RWR D;  1OCC C;  2ZIO A;  2XAH A;  1M5I A;  5JJN B;  1JJO A;  4PDL A;  1GH6 A;  3H1I H;  4AI8 A;  1F23 A;  4G28 B;  1K34 A;  3D8C A;  1N4C A;  5FPR A;  3BAA A;  3UCS C;  1LUV A;  4YJ2 A;  4PHZ A;  4I9W A;  4EFE A;  1SA0 B;  4MVU A;  2JJ1 G;  4CS4 A;  1QVG U;  1YXB A;  2EIJ C;  2GUZ A;  2WLN A;  2X0L A;  4X1I A;  3UQ8 A;  2QDO A;  1U96 A;  2QM7 A;  2ZXW C;  4YIO A;  3JAR B;  1XDC A;  3SJB C;  1GM7 A;  4F6E A;  2OWO A;  1Q3E A;  1ROP A;  1B04 A;  4JI4 B;  4X62 O;  3JD0 A;  3SJA C;  3LNN A;  1JCH A;  1XMO O;  2R70 A;  3QF7 A;  4X1K A;  3WB1 A;  2IJH A;  4DXW A;  1M56 B;  1IBL O;  5GON A;  3OTF A;  1H2N A;  1FYJ A;  2IU3 A;  4O4H A;  4CS2 A;  1XEQ A;  3SYC A;  1XMO B;  4D6T H;  5FNV B;  1IUR A;  2Q0A A;  1N36 B;  2P5O A;  4DR6 O;  3SYO A;  3JAS B;  3P32 A;  3BA8 A;  1XUQ A;  5IYD O;  1EN5 A;  4PV1 B;  4BAY A;  4MT8 A;  5JJE B;  1M4U A;  2HKO A;  3JAL A;  2EIN C;  2QTO A;  2PUS A;  3LSQ A;  1S0V A;  1H8H G;  2ZNI A;  4JV5 B;  2GTS A;  5L3E A;  4OPA A;  4YY3 B;  4PA4 A;  3QTC A;  3CME V;  4JI2 O;  2ZE8 A;  5CB4 A;  1BT8 A;  1NVP B;  2PZS A;  3OTO B;  1KEC A;  5DEC A;  4JI7 B;  2WWW A;  5B66 Z;  4UVC A;  1AI5 A;  1SQP H;  1HR0 O;  3KCX A;  5IY5 C;  2E74 B;  5D5P A;  4NYK A;  4GKK O;  2Z3Y A;  2EIM B;  2PTM A;  2OIE A;  2WA3 A;  3QNE A;  3CCS V;  3OUS A;  2EBO A;  4PA9 A;  5JCO A;  4ZOL A; 
#chains in the Genus database with same CATH homology
 4NXM O;  1G1X B;  1KUQ A;  1N32 O;  1F7Y A;  4DV5 O;  3R66 A;  2DJV A;  4DV2 O;  4JI7 O;  1XMQ O;  4JI4 O;  1AIL A;  5IT9 N;  4X62 O;  4DR7 O;  2LW7 A;  4YY3 O;  4AQY O;  2UXD O;  4LF7 O;  1XMO O;  4JI6 O;  4DR3 O;  4LF6 O;  4DV3 O;  2UUC O;  2AGA A;  4LFA O;  4OX9 O;  3JAM N;  4YHH O;  2UU9 O;  1AB3 A;  4KHP O;  2Z0A A;  4JV5 O;  2UXC O;  2UUB O;  1IBL O;  1N33 O;  4DR1 O;  1FYJ A;  5H5N A;  4LF4 O;  1R6T A;  1XNQ O;  1FKA O;  4JI5 O;  1XEQ A;  5LMU O;  2VQE O;  4DR5 O;  4DR6 O;  4JI8 O;  1HNX O;  4JI3 O;  1J5E O;  3J80 N;  3O65 A;  4JI0 O;  3M8A A;  4DV1 O;  3F5T A;  5LL6 Y;  2ZKO A;  4DR2 O;  4LFB O;  1IBM O;  4LFC O;  4DR4 O;  4DV0 O;  3SDL A;  2FKX A;  1A32 A;  1I94 O;  5BY1 A;  4OPA A;  1NS1 A;  2DOS A;  3OTO O;  2VQF O;  1HNZ O;  4A5U B;  4B3R O;  1IBK O;  4B3T O;  5IWA O;  2UXB O;  4JI2 O;  1DK1 A;  4K0K O;  4DV6 O;  4LF5 O;  4LF9 O;  4X64 O;  4GKJ O;  1XNR O;  4DUZ O;  1FJG O;  2F4V O;  2N74 A;  3J81 N;  1YZB A;  2UUA O;  4X66 O;  4JYA O;  3T1Y O;  1HR0 O;  2JRI A;  4DV4 O;  5FLX N;  3T1H O;  4NXN O;  4B3M O;  4OPH A;  3RT3 C;  4LF8 O;  1HNW O;  5A2Q N;  1R1B A;  4GKK O;  2E5L O;  3J7A U;  1N34 O;  4B3S O;  1D2D A;  1X59 A;  4DV7 O;  2HHH O;  4X65 O;  2ZM6 O;  5BR8 O;  5BXZ A;  4JI1 O;  5LMN O;  1N36 O;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...