2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
2PP8A 3ZIYA 4K9JA 2HRGA 4ZK8A 1AS7A 1OCRB 3S3BB 5I6KA 4QKTA 3NSFA 1SFHA 2XVBA 4YSOA 2YEVB 2E86A 2FWLB 4CSZA 3QPKA 1HFUA 4E9VA 1BEXA 1KDIA 3IE9A 1PZAA 2GI0A 3EHBB 5I6OA 2FQDA 1V55B 1CYXA 3ABMB 5B7FA 2VW4A 2DWSA 5B1BB 1PZBA 2VW7A 5ANHA 5PCYA 5AZUA 5PAZA 3H4FA 3SBPA 2B08A 1GY1A 1J5CA 1AQ8A 3AW5A 3N55A 1ASQA 2VN3A 3MX0B 4A2DA 4ENZA 1AACA 1JXGA 3FPYA 3ASNB 4BDVB 1IBYA 1GY2A 4KNTA 4DP8X 1OV8A 2XXFA 2YAFA 1ZDSA 3CVBA 2CAKA 4HCIA 4DP6X 2WO3B 1ZDQA 3ZBMA 4YL4A 3TBCA 1PNDA 2CCWA 3BQVA 3PAVA 4MFHA 2IWEA 2R7EA 1NWPA 1L9RA 2PPFA 3CZUB 1AZNA 2B3IA 2DV6A 4QLWA 3JT2A 1BAWA 3ERXA 3OMNB 5I5IA 1JERA 2XX0A 4GYBA 4KOCA 1JOIA 3FPXA 2CBPA 1NDTA 1JXDA 3QJRB 3TU6A 3X1GA 1DYZA 2Q5BA 3ABLB 1BXUA 4AX3A 4DPAX 4UAHA 5TK2A 1CURA 3PAZA 2IDTA 2P80D 2Q9OA 2FQEA 4YSQA 4GXFA 5FC9A 2X87A 1JZFA 2PP9A 1A4AA 4GP5B 3JTBA 2J5WA 1PAZA 2XV2A 4HIPA 3SBQA 1R1CA 4KO5A 1L9OA 2AZUA 3U25A 1FA4A 1CYWA 3NJJA 2IWKA 3X1FA 3HEIB 1E67A 3QJTB 4GY4A 4G72B 4YVUA 2BZ7A 2XXGA 1AG6A 3NJNA 1OE1A 5EHFA 3PPSA 2H47C 2DYSB 3IN2A 3FSAA 1GS6X 4P5RA 1JZEA 3FSWA 3AG2B 1ZV2A 3TASA 3WNJA 3BVDB 1SDDB 1MZYA 4F2EA 2I85A 4A2GA 1L9QA 1AZBA 4M3HA 4BDVA 1BYPA 1OE2A 1PLAA 1E5YA 4E9XA 1BQ5A 3EH3B 2YAEA 1NTDA 1W8EA 4HHWA 3FS9A 2OV0A 1SHXA 2MTAA 2HX7A 2QPDB 2AZAA 1ET5A 1PY0A 1JZIA 3CDZB 4FAAB 3AG3B 2YXWA 2CJ3A 3PCYA 1KCWA 4P5SA 2GSMB 1AS6A 3DKHA 1OF0A 1SHWA 4G71B 4KOBA 4WTQA 3T9WA 2TSAA 4BWWA 3ASOB 3WKQA 1DZ0A 4E9TA 4E9YA 3X1EA 3S8FB 3IN0A 4YSPA 1SF5A 2BW4A 2XV3A 4AKOA 3S3DB 3HB3B 2VM3A 2J55A 4BWUA 2W88A 4YSTA 2AFNA 5I5JA 2YARA 2Y1AA 1KCBA 2HXAA 2UXVA 1X9UA 1KBWA 1KYAA 4E9RA 1OCOB 1E5ZA 4G70B 2IWFA 3UACA 1HAUA 3H4HA 4HAKA 3NJKA 4X4KA 2AVFA 1WA0X 1A3ZA 1J9QA 4YSSA 1OOWA 3OD3A 1NIFA 2PP7A 3QJUB 1PLCA 1PCSA 4HCGA 2IAAC 5I5MA 2UX7A 2PPEA 1SF3A 2FJSA 1A4CA 2I7SA 2EIKB 5E9NA 1ASOA 1E65A 2A3TA 2YAQA 4WKXA 3FSVA 1B3IA 2FQFA 1IBZA 2IDQA 1QHQA 4A2HA 1X9RA 5D4JA 1JZHA 2UXGA 5I6PA 1KDJA 1ZPUA 3DTUB 4G7QB 5AKRA 5D4IA 1SDDA 4JHUA 1VLXA 3T6WA 2FT6A 3T6ZA 4HCFA 2XLLA 4DP7X 3OMIB 3X1NA 2YAPA 2BP0B 2FNWA 6PCYA 2ZONA 3X2QB 3OMAB 1I53A 4W9ZA 3FQ1A 3X1BA 3WIAA 4BK5C 3CDZA 3PLYA 4NERA 1TU2A 3UAEA 1WS7A 4CSPA 3FU9A 4NB7A 4DP9X 4YSAA 6PAZA 2EIMB 1NIAA 1GR7A 1NIBA 3WI9A 1GW0A 2BP8B 2HZHA 1OCZB 2FTAA 2GHZA 3WG7B 1YLBB 1EHKB 4A2EA 2VSKB 4E9WA 3ZDWA 4F2FA 1ET8A 4YVNA 4GP8B 2XYBA 4KO9A 2AANA 5B1KA 2GC4C 3IBOA 4KO7A 2W8CA 3NSYA 1OCCB 1J9RA 1URIA 2XX1A 3ABGA 3QJSB 4F7KA 3NP4A 3FYEB 1BQKA 2VM4A 2YAMA 1BXAA 1L9SA 3QQXA 4KNUA 1GYCA 4JHVA 9PCYA 2PPCA 2UX6A 2HX8A 3AZUA 3C75A 4DP5X 2ZXWB 1AR1B 2HX9A 7PAZA 3T71A 3FU7B 4UF7C 2Y69B 3OQRA 1NIEA 4KO6A 5I6MA 1AZRA 4AZUA 3QJQB 1GS8A 2P80A 2RACA 1M57B 4AKQA 1KV7A 2YQBA 2ZOOA 1EZLA 5I26A 3T6VA 5I6LA 5LDUA 2EIJB 3UGEA 5IY5B 2CALA 4KNSA 1QLEB 2QT6A 1BQRA 1J5DA 2XUWA 2H3XC 3KW8A 3NYKA 2PCYA 2XV0A 4NAJA 1NINA 2IDUA 5I6NA 1GS7A 4L0PB 2BWIA 1SJMA 3G5WA 1NPJA 1CUOA 1JZJA 3AY2A 3CVCA 3FT0A 3N2JA 2PCFA 1ZIAA 2BZCA 1AOZA 2JFCA 2BP0A 1IKOP 1ETJA 3CVDA 1PNCA 3SQRA 1KBVA 2PPAA 1AANA 2X88A 3NJLA 2WO2B 1WAEA 2HRHA 4YSDA 5F7AA 1A4BA 4TXVB 2CUAA 5AFAA 3WNIA 1ID2A 2VSMB 3T6XA 2BO0A 1JZGA 2IH8A 3NJFA 4Q8BA 3KW7A 4EF3A 2UXTA 3FU8A 2EINB 1N70A 2BHFA 5B1AB 2J56A 2BP8A 2IDFA 3IEAA 5D4HA 3UAAA 3TBBA 3EF4A 3OM3B 1XB3A 1W6LA 1AAJA 1T5KA 1XB6A 1OE3A 3GDCA 2GC7C 3NJMA 1NIDA 2FQGA 1AS8A 1WS8A 2ZWNA 1WA2X 1ILUA 2GBAA 4W1TA 4PCYA 4E9SA 1PMYA 4UANA 2NRDA 2QPEB 1SFDA 3S3CB 4N8UA 4HALA 3FU7A 2PPDA 1MG3C 4A67A 1XB8A 4G7RB 4RH4A 4AI7A 3NSCA 1IC0A 3ABKB 2QDWA 3TA4D 2LLNA 3PXLA 3FQYA 2H5UA 2MRYA 3NT0A 1L9PA 2IH9A 4G7SB 1W6WA 1N68A 1RCYA 2TSBA 4N4YB 3NSDA 4DPCX 2IDSA 4DP0X 4BXSV 1IUZA 2FT8A 4DPBX 1TEGA 1F56A 5F7BA 4DP1X 1AZUA 1RKRA 2GIMA 3UABA 1CC3A 1RZQA 2I7OA 2JXMA 2FT7A 5B7EA 7PCYA 1E30A 4YSCA 1TEFA 2BW5A 4AKPA 1PLBA 3ZX1A 2OJ1A 4FA7B 1PF3A 2VW6A 2YXVA 1BXVA 3D12B 2QDVA 1SNRA 3RYMA 1A65A 2J57A 1TKWA 3L45A 1J9TA 4BXVA 3GXUB 1JVOA 3MBWB 3NJGA 1NPNA 1M56B 1GSKA 1ET7A 2OCCB 1AIZA 4BWTA 4YSEA 5B1JC 1HAWA 1J9SA 1ASPA 3AG1B 3V9CA 3V9EA 3S8GB 1WA1X 1NICA 1RZPA 2XWZA 1ILSA 2EILB 4A68A 4HZ1A 1AG0A 2YAOA 4A2FA 2DWTA 2BWDA 3EH5B 1QNIA 1NWOA 3PAUA 5B3SB 5B1JA 1JVLA 3AG4B 3H56A 4HHGA 1V54B 1MDAA 2GB2A 1NZRA 2UXFA 1PZCA 2XU9A 3EH4B 5B7MA 3FYIB 3SBRA 4E9QA 1JXFA 2PLTA 1KGYE 1MZZA 2R7EB 2DYRB 3NP3A 2YAHA 3FQ2A 3CG8A 4YSUA 8PAZA 2WSDA 4M4RB 5I28A 4YSRA 3FSZA 4A66A 1L9TA 2VMJA 2JKWA 1AZCA 1UATA 3NJIA 1XMEB 4GP4B 1FFTB 3UADA 5TK4A 1V10A 1BYOA 4DP4X 4DP2X 4PAZA 3WKPA 2DY2A 4Q89A 1FWXA 2HLEB 2N0MA 1ADWA 1A8ZA 3GYRA 1MG2C 3QJVB 3DIVA 1ZIBA 3NJHA 4JKNA 5A7EA 1M9WA
chains in the Genus database with same CATH superfamily
3B2VH 4H88H 4JM2D 2F1AA 3MJ6A 1IXBA 5JVDB 4QRSB 4RRPA 5G4MA 2NNAB 2P5OA 5HHQB 5EF1A 1BF2A 3L13A 3TK1A 2CXKA 3FB6B 4KY1H 5EOQL 5C08A 2C26A 3KGTA 4GQPH 2O5NA 4ABVA 4ZQTA 5I1EH 4U4IA 1SFHA 2NQ3A 1H2KA 1P4LA 1C5BH 1C5CH 1USQA 4B3MB 2JEUA 2ADGA 4LMQI 3BP7B 2QTSA 5EU6A 3GI9L 3HC4H 5GZOA 1L7IL 3CSXA 3GWOA 4YJ3A 4JQVA 3L4TA 4YS4A 1JZ2A 3QAZC 4L5FH 4FTVA 1PPJH 2AS5M 5EO0A 2R69A 4NQCB 1Q1JH 4Z3EA 2IU0A 4E42B 4HJ0D 4NKIL 4NTYA 1EEYA 3L4WA 2HRPL 4MCMA 3PJSK 3H9HB 1DJSA 5J0BA 4PN6A 1FNSH 3MX0B 3ULUC 2BOLA 4YLQT 3BPLB 1AACA 5MEOA 4TQ8A 2NYZA 5F1KC 1S5HC 2B2XH 4LLUB 3KWWA 2BOBB 2CH7B 4PV8A 1MCSA 4NBYB 1D5IH 3CVBA 4HH9B 4HCIA 1IGFL 4NRXA 4DR3O 4S0TD 5I0YA 4YL9A 5AUMA 3OGCC 1LP9E 2UZYA 1NBVH 2Z5UA 2J6EH 4ZW7A 1INEL 4JPSA 3FX7A 1KBGH 4ZXBC 3D33A 3I9GH 2L7UA 2VDKL 3LN4A 3NPSB 4GKLA 3F04A 4F20A 2J1YA 4N3TA 1WRFA 1VFAA 5LMNB 3JT2A 5E23A 2BVTA 4FNLL 4PS4H 4G2AA 1LR1A 2P8LA 5TH2A 1TTBA 4AXWB 3MJGX 1QW8A 5L2JB 2WNXA 3DURA 1NBYA 1AY1L 3IM1A 4DPAX 3HKEB 5AOIA 4KMQA 1XVSA 3LZRA 4HFUH 3G5YB 1G7LB 1ACCA 4CN6A 4UTBL 3D9AL 1QWNA 4CS3A 2Y23A 4OR1A 5DGQA 5K1NA 1RAMA 2ESVA 3MOQA 3PV6A 5E8OB 1E5AA 2CGRL 4JR9L 3I6GA 4X83A 2Q7YB 2UXCO 2CHDA 2QTVA 4K23L 1AD0B 4DV0B 2WNWA 3C60D 2CK3G 1IGYB 5JQGA 4JMXA 3RVWD 3SBQA 3ZZ1A 1KFGA 2C3VA 3GSQA 4YC2C 2JKNA 3C5JA 3ISWA 4EDWH 4E2LA 3NJJA 4UQIM 2MIZA 1V55C 1YEFH 1M7DA 2IWKA 3NCYP 4PREB 5F44A 3TO2B 3WO3B 1E67A 1OVZA 4AGNA 4BUHA 1AQDA 4WFAV 3AQZA 4G8FB 2EH8H 5KVGL 3BUQA 2DYSB 1D9KD 4N0YH 4IHOA 1RFDH 4KKCD 3MGOB 4GRWE 3RJQB 2DWYA 3H9ZA 2ZQMA 3WMQA 2PO6D 4XMPH 1F4NA 1FI8C 1H19A 4KRPB 3IDNB 3RX8A 2R2HB 4RMUA 5T1LA 1MZYA 2HJKB 1BPLB 3UBHA 5ITFA 2G9KA 3OR6C 4GLRI 2Q0ZX 4RAHA 5KUMA 3K57A 1XCQB 1BYPA 1U42A 2R4SL 5CB4A 4F3FB 1E6OL 3UPAA 2MQCA 1FRGH 4JGMA 1R17A 4KV5F 4JI0O 1IM9B 3L5WB 4PJ8A 4XPGL 3D4GA 3WE6A 1ET5A 2XTSA 3MCKB 1DSWA 4HLZG 4IYIA 4MAYA 1WJ3A 4LLQA 2BHUA 3S5LA 4ABQA 1K5WA 4RZCB 4CZZA 3QUZA 3DHMA 4JUTA 1Z9SA 3AJ7A 3QI9C 5BZWB 4Z7WF 1CF8H 4YJ2A 3MXVL 1I3VA 1DQMH 1LP9B 4N2KA 1DF4A 1XGYL 1NCUA 4LF8B 2IBZX 3RWDA 2V3EA 4YK4B 1ZHNB 1DZ0A 4E9TA 1QEWA 7FABH 4FFVC 3X1EA 3STLB 3S8FB 1NAMH 2DBLL 1UZ6E 3TCTA 3C5ZB 1SF5A 4WAFA 5AVYB 3VFGL 4R8WH 2VXTL 5L3GA 1CICB 2NLJB 5JWPA 4M8QB 3S3DB 1XSKA 2YPVA 1DN2A 2WLJA 5IW6A 4KQ3H 3S36H 2CIIA 5J6GB 4XNAA 1MQ8A 3RQ3A 2WQRA 5GSVA 3UG4A 4JKMA 1X9UA 3D6GA 4EFBA 2UZXA 4GKSB 3MFFA 3WCYA 4ENED 4W4OC 5EBMC 3LH2H 3EW3B 3BABA 1HEZA 3ARFB 2Q87A 4RMTA 2K9FB 1SUJA 5FUCC 4TRPL 3KWXA 2GHYA 1SOSA 1NANH 2AHYA 1Y66A 1HKFA 2MNUA 3GGWB 2VMCA 3TETA 4U2ZA 3I2CH 4PUBH 3L4VA 3GNML 4B9YA 5FNVA 2EYRB 4QTFA 4YHHB 3I6LD 4F8PA 2YKKA 4H8HA 2NZ9D 4QAMB 4ZUVB 1XF5B 2DWDA 5JMOC 1W59A 5ESVA 1BD2D 1LEGB 4X89A 1X5FA 3ZE0F 1P69B 2DLFL 1JV5A 1QI5A 1CK0H 2IU3A 1IGIL 3ML0A 1BFSA 2JNZA 3OPZH 4P2OD 3RIAF 4AZ8A 4GRWB 1RJYA 4POYA 2VDLL 4D7BA 3K72A 5J1AB 3C09C 5CS7A 5FYJU 1PFCA 2W07A 4KMTH 2FX9H 3U6XA 4OZ4B 1W9XA 1CXIA 4HQQL 4BINA 4OZIF 3WIAA 4GQ9H 2V2TA 3CRQA 3M7MX 2DQCH 4MQ7A 3WDHA 3IFLH 3K1DA 4JHAL 2WPGA 4IRJA 3CD4A 5E9DE 5C0DB 4DP9X 3VFWB 5E8DH 5JJNB 1CG9B 1WGVA 3D0VA 1WFOA 2FSDA 3OGOE 2PR4L 3TBYA 1NCIA 5FKPA 4G42B 5I16B 3D50A 3VFMB 4K9EH 2GHZA 4NQEE 4HKZA 3BAEH 3O3BA 4LHUD 3QW9A 4DWHA 3WG7B 4P2YA 2ZX6A 4JNXA 1FDLH 2GUOA 4AIEA 1WB8A 5CJXC 4ZFFB 2ZCHH 4IBWA 4GKKB 4XXDA 2F7QA 4BFOA 4G27B 3FB8C 1YQVH 4IEFA 5CN3A 1N6QH 2KI6A 3Q1SL 4XH2A 3PWUA 1HHJB 1ZHLB 2VJXA 1PNLA 2ZPKH 5L9DH 1JHTA 2VUYA 3FTGB 5FB8B 5LHGA 2DQHH 1OCCB 3SZKC 5GIRA 2HG5B 1MHCB 3CPUA 5EZLB 1S7UA 1X6NA 3DXAE 2B9BA 4NKDB 1R5VB 1GIGH 1AR2A 2PPCA 2ZXWB 2X4TB 3B9KA 3JWOC 25C8H 2EICA 2P4AB 2V8LA 3ATDA 3B37A 3ZKSD 1QR1B 1KB5B 1HHKA 1I1AC 4X65B 3NDYE 4M48H 3UP1A 3LEVH 4HWBA 3JT0A 1TVHB 1J11A 3JWNC 2R2EB 2CU9A 1EXUB 4KQ0A 5DMYA 2FBJL 2BY2A 2Y48A 2IMNA 4QXTB 1EN4A 5D2LF 1FO0B 5D6DA 4J3SA 4XDKA 2DQMA 4KZDH 2EIJB 1JDDA 2GTWA 1JD7A 2C9AA 4NQXA 1NLDH 2HTKC 2VXVH 5CGTA 1BQRA 2GJZA 5JNYA 1IBKB 2CK0L 3GSNB 1ZSPA 1SJEA 2CA3A 5GGRB 2IDUA 3JCZA 3V95A 4HNAA 5CKGA 2BWIA 4UQ2B 3MREB 3ZHTA 1JZJA 1GAFH 2QV4A 3WSQH 4PJGB 1KBVA 4XI5C 2ZF9A 4HC1L 5CZVL 3LDEA 1IXMA 4OLVH 5BMVB 2NYYC 5D8JL 1A6WH 3OT7A 4OGXL 4PJ0Z 4P46D 5AZEH 3FO0H 3WNIA 1RZKH 5LUMA 3T6XA 1AI4A 4K8RC 2BO0A 1IAIM 1ZHKA 4Z7AA 2IH8A 4LSRL 1PYWB 4OQ1A 1V27A 4NYLB 5H94A 3UAFA 5I0WA 2MJWA 1GOFA 4LZKA 4DV1O 2EDXA 4L37A 4M6OH 2WSKA 5T1KD 5EU5B 3U83A 3IGLA 3DOSB 4XTRD 5KS9A 4KBPA 4DGWC 1O5DT 2JKRM 5E9DB 1ACYL 2OX5B 4I0KA 2EE3A 3GEFA 4FKKA 1NCBL 5MEPB 1PL4A 3T4AC 4LKXA 4UT6H 4Y5XC 3KZIZ 2E7HA 4RFNB 3RX7A 4LWSB 4G8GE 2AXGB 4G9FD 3GDCA 4NQEB 1G7MB 1W91A 4FIPC 3RGVC 3MLXH 3IC9A 2HP8A 1AKJB 4X20B 3ZS8C 3QUYB 1WS8A 3ZBHA 3EH2A 1U3HC 3BD3A 4PCYA 3MLYL 1EZVH 2KLSA 4FLOA 4PRID 5HBBA 3LB6D 1X5AA 2CHXA 1JFFA 1YY8A 5KANI 1UENA 2QQKL 4ZO8A 3TF4A 1I7RA 1IIKA 3N2GA 3DXAB 4I18C 1XNQO 2VERN 2CLVB 1MRFL 1D5NA 3X12B 5MEND 1MH5A 4KGJA 3PHSA 5C0GA 1BIHA 2YBGA 3ARDC 4CSTA 2MRYA 1MREH 3SYCA 1L9PA 1LO2L 1BW8A 1MWAA 4QXGH 4XP5L 5I1LB 2E9GA 1TZAA 4EIGB 1THZA 2QWPB 1DK1A 1TJGL 1H5BA 3QIUC 1H3UA 2YZ8A 4X6FA 3SKUD 2B0SH 1V05A 4KTDH 1BMWA 4Y8AA 4D94A 1S7QA 4L3CB 1Z2GA 4IOFD 5D2NE 3TBWA 2OQJA 4GKJB 3L2LA 5FYLL 5HHMD 1DTUA 1W72H 3MUGA 3RWEA 1CC3A 3A23A 2FIRT 4HUUA 4TSAL 1IC4H 1MELA 5AD0B 3U4BH 5KJ7E 5GGRY 1X5GA 3QDMD 3W7TA 4N25A 1S7RA 5DRZA 4X66B 4WKZA 5EIIB 3JWDL 3ZMNA 4HU8A 1U95A 4LNRB 4FULA 4G6AC 4DV7B 5IJKA 3MYJB 2J6WA 3GXUB 3FFDA 5I8OL 4HPOL 3P3SA 5EWIL 5FYLD 4OLZH 4ZPVB 1BOYA 3KXFE 5DS8A 3KVDD 4EVNA 3UT5A 1UWYA 2OYPA 3OF6D 1H8EG 1H38A 4FLTA 4Y5VA 4JN1H 3LQAL 1J9SA 1NCAH 5D7SL 1C08A 4U3SB 4EN2A 2E3VA 4NO5B 5LQBL 2WVVA 3RVVC 1IC1A 2IQAB 3PJLA 5E6UB 4A68A 4AC4A 5AEAA 2Y22A 3HS9A 2BWDA 3EH5B 5B1JA 2NSMA 3US1A 3ZMVA 3RWCA 1JVLA 4KI5D 1L8DA 2VXSL 1PZCA 3L4YA 1N5YL 1JFQL 1SMOA 3HFMH 1G0YR 2YGNA 1BMFG 4G8GB 3LQZA 4R2GC 3MV8E 5HDQL 1KIPB 2Q86A 4E9QA 1DEEA 3KDMA 3HBPA 1DVUA 4IU3B 2PLTA 1KGYE 4RFEA 4IM8A 3M7OA 1S7TA 2ZXDA 1TJXA 3UZVB 3H9SE 4UVCA 1BHGA 1UATA 4NFBA 4J2XA 4FTVD 4MA1C 4YFEA 3K6DA 3UP6A 4ZFOL 2HVBA 1ZXKA 1TQWA 5TPWH 3D06A 2OI9C 5CBAB 5ALBH 5HI5D 2F93B 1D5MA 1NFKA 2HVKB 4ELKB 1KJ2A 2OMNA 4GW4A 4NENB 2JJTA 1XAKA 3HRPA 1RJZB 3IDJB 1XCXA 3PXHA 5IW1B 2Y7QA 3MRHB 4NWUH 4NM8H 4Z3HA 2EULA 5EN2A 4Q74A 3GO1L 5I66B 1QSFD 5D2NB 4L29A 1TQBB 3ETSA 3SE9L 2QQQA 5LG1A 1T20B 3S3BB 5DVLA 4N22A 2XXCB 1LVEA 3NSFA 4U7NA 5EBGA 4JG5A 4B08A 2D7TH 3EOTH 4PCKA 4CSZA 1K2DA 5IQ9B 1NBCA 1ZLWH 1MHPH 1BBDL 4G5ZL 5KW9H 1IGML 2QVIA 3IGAB 4YHIB 3PUUA 2ZKHH 5ABAA 2CE4A 5E1GA 4F2MA 1CVSC 5I6OA 2ZNIA 4DKTA 3FB5A 4GI8A 3D8CA 4FFKA 1JF1A 5HI4D 3UPCA 1CYXA 1RJLA 1ZOXA 3BD5A 4XZ4A 2LV4A 2YGVA 3NFNB 3VE0B 3DJRA 2VW7A 5ACMA 5BS0E 3AG4C 4YX2L 3ZDZF 3BN9C 3MLRH 4HK3N 3IMVA 3KXFB 4R26L 1J5CA 4AEEA 1CD8A 4F9PA 1JXGA 3LH9A 1CU4L 2ESVD 4AUUA 2I25N 3HC0A 3B2DC 4K8ZA 2ICWA 3AB0C 4D3CL 3V0VA 3CQQA 5J6HB 5DTFB 5KN5A 1HNFA 1DVZA 1ZDSA 1AD9B 1OXYA 1KC5L 3O81A 4UIKL 4JKPL 4O4LA 3ILPB 4N2IA 1WIUA 3LDCA 4YDJB 4JFTA 1XIWB 4O2BB 2ZF8A 2C7FA 5HI3D 2P8MB 3AT0A 1DO6A 2O1AA 2I9LA 3FC8A 2Z4TA 3RYIB 4HJTA 1WD8A 3ZYOA 2GJ6A 5L6YL 4P3WA 1XSJA 3MV8B 4JFED 4MXQC 2VH5H 4OCRH 2O6CA 1N26A 4WHDA 4I48B 4Y5YA 5E00B 3CLWA 4OCMC 2PNDA 2X3AA 4Q9BA 5I17A 1IBHA 3QULB 3ZKMD 3H9SB 5T1LD 1DQKA 4FXGB 1M7IA 4J80A 1U8HA 2PW2B 3B9VA 1CURA 1F3JA 2VS0A 1Z5LA 1GK9A 3DBXB 4U6YA 1S77D 4LP5A 4E41B 3T8VA 3K9SA 2ITCA 2KMWA 2XVLA 3ZU8A 4PJ8D 4NQSB 1RIHH 3B77A 5JVDA 4N26A 2X2UA 4QRSA 5I15H 2NNAA 3CWBH 4CMHC 5CM1A 3I3EA 1I3RB 5DK0B 4EEEA 5HHQA 4MAYD 5A2CA 1OWRM 3PABB 3FB6A 1F4XL 1FD9A 2XV2A 4K3JL 3FN9A 3QUZD 2AZUA 3KG5A 4ICGA 3EBIA 3Q2VA 1XH2A 3NAAH 5KX5B 2IM9A 2DWXA 5G4NA 4L5FE 4DGVL 4UYQA 4XP6H 3W7WA 3BP7A 3RNKB 3ZKQD 1GGUA 2XBDA 3VSQA 3F01A 1AMXA 1A9VA 2P8PB 4Q2ZB 1A7PH 5DQJB 3CCHB 1JS4A 1WWAX 1TZOA 3L4XA 3D36C 3AG2B 3ASNC 1XQ4A 4NQCA 4Y4KB 4D9RE 2Y6TE 4E42A 1EX0A 1WC7B 4KXCA 5T1DL 1F45A 3H9HA 3REVB 3BRCA 2I85A 1S3KH 3MX0A 4AJ0A 4A2GA 2YPKB 1RMFL 4I88A 3U0WL 4LAJH 3WFCL 3IGFA 15C8H 1KZYA 2BIMA 3OKKB 2V2WB 4LLUA 5BS0B 4P2AA 1FYHB 2CH7A 2BOBA 1MKFA 3CBKB 3EH3B 4NAQA 2IQ9H 5FW8A 4HH9A 4A7GF 1YPZF 3RDJA 4RMBA 3S5ZA 3CDZB 1RZGB 5LG6A 3AG3B 1HE7A 4AI8A 2CJ3A 3CK0H 4KRNA 4H0GA 3ZL1A 4O51B 1RFYA 1E4JA 3BLKA 1I8KB 3PGFH 3SGJA 3T0VA 3T2PA 2GPZA 1NCOA 4E9LA 4YHKL 1SVZA 3KL3A 4UQDA 4HJIA 2R0LL 4DKFL 2ZP0T 4AXWA 1D6VL 5E6IC 1OPGH 5L2JA 3F5WC 1LL1A 1PU0A 4KHPB 2BW4A 2Z34A 3FTVA 1KEGH 4GUQA 1KY7A 4XMXA 5F7UA 4BWUA 1KV3A 1JI2A 3TN0D 1QRNE 3HKEA 3TH3T 3CVIL 5CGYC 4MLIA 3G5YA 4HIJB 1G7LA 3F65A 2A74C 4N1EA 1CFQB 1FH2A 4PIRF 3HZMB 2F8VA 2DQDH 2CG9X 4U0RC 1KYAA 5E8OA 2Z7YA 4OF7A 3B6SB 4M6MH 1JPXA 4HPYL 3UACA 3VQ2C 2Q7YA 6CGTA 4DR2O 3ZDZE 4OFKA 1AD0A 1GM9A 2QWRB 1MWOA 2EDOA 4IRJD 1LMIA 3R1GL 4GO6B 5IT2L 3CMOH 1IGYA 5F7YC 1F02I 1Q90D 2VDNH 4XP4H 3E2HC 3P30H 4J3UA 4ODXB 3TJEH 5I24A 4PREA 1UFIA 2XAGA 3TO2A 4X7EC 5J56B 5AOJA 4FADA 1Q94B 1XF3B 3EG9B 4M7ZB 4OM1L 1CN4A 2VC2H 4R0LC 4Y89A 2DYRC 4G8FA 5FUOH 1I3GL 2ATPB 4XNZC 1JVKA 1B4JH 1MJUH 3MGOA 3QIWD 1YYLL 2ADJB 1X3DA 1VQ8V 2KLTA 1AI6A 3CLFL 4ODSH 4P30A 1TLKA 2EH7L 4HWBL 3RVUC 3VGFA 2Q73A 3IDNA 2R2HA 5AKRA 3O9OA 2HJKA 2X5PA 2M6YA 3VD5A 1J05B 2J25A 1SJHB 1UM4L 3N0AA 3MJ7B 3OKEB 5F0MB 1XCQA 1JG9A 3WO4C 1WUNT 2MEJB 4HKXB 4F3FA 2NZIA 3X2QB 4MMXB 5HSFA 4TTDD 3L5WA 1IM9A 3B9KD 3S37X 2WBXA 4W9JC 3T8MA 3MCKA 2ITFA 2VDOL 3P0YL 4M7LL 3CC2V 4RZCA 4GG8B 4XOEA 5BZWA 3LYRA 3RFZC 2EIMB 1NGPL 1NIAA 2V4DA 1GR7A 1E4XL 2NY4B 4BK5A 1U97A 2IXQB 3HUJF 5AKTA 1NIBA 1LP9A 1NOAA 4WGWB 3V4PL 5E99H 5CJOL 3I50H 1ZHNA 1WWCA 3OUFA 1GM7A 3BOVA 4WIQA 4IGGA 1FAIL 5DZOA 2WBWB 3STLA 2AQTA 4OCNC 3C5ZA 3OB0H 4QYAA 4A2EA 4BRVA 4E9WA 1LGVA 1JPSH 1I8MB 3GIVB 1T1WB 1CICA 1QFWI 1KB9J 2NLJA 4M8QA 2NY2B 4KUMA 1OTTD 2Y06L 2LVEA 3MZGB 4XP1H 4KO7A 3S35H 4HG4K 2EEDA 5B5EZ 4WI0B 4WJG3 5J6GA 1FGVH 1K7DA 3ZO0A 5HVHC 3F7YC 1MFDL 3ABGA 4M4PA 1A14H 4M1DH 3FYEB 2CUIA 5FLVA 4D7PA 1TSHA 5DJ6B 4GKSA 1EHXA 3ZR6A 1X44A 4NKQB 5EUKB 5AVZB 3UEZA 5EEYA 4RAVB 4OI9A 3P4OB 3ARFA 5FWQA 1B0GB 3GBNH 2LABA 5AVWB 4UM9D 4UF7C 3BFWA 5HHOB 1U2CA 4NFCA 5I6MA 4BM7A 2DTSA 2MOQA 3GGWA 2K8MA 4HJSA 1AXSB 4ZX5A 4C54A 4DV6B 3GBMH 5ABDE 2EYRA 4H26B 5EEXA 4GT1A 2VXQH 4M5TA 1DLBA 2ZOOA 2VRZA 3IVKB 1G6UA 4ZUVA 1XF5A 4AQYB 2V8MA 2ILMA 1CLOH 1LEGA 4JFQB 2UUAO 1CZ8L 2XUWA 1ZHBB 4RLDA 2ZOLB 3WKYA 4X0KA 2WBJC 5IMMB 1MWAL 1USZA 3N06B 3N1FC 3B9EA 5J1AA 2W94A 2BZCA 2WPDG 1AOZA 2AV7B 2LGQA 3N1QC 3LRSB 5EC2C 1QSEE 3WIHH 1TTCA 1G1KA 4OZ4A 3E0GA 5CBFA 4J28A 4ZD3H 1IL1B 4XNDA 3WNMA 2CCLA 4HKJB 3DX3A 2GUYA 5C0DA 4D0BB 1TVBB 4OCWH 1PDKB 1MIMH 4NN7C 4EFEA 3VFWA 3VYNA 3BPOC 1CG9A 2Y3NA 2J88H 2YGOA 3KPSE 4G42A 2X4UB 5I16A 3VFMA 1OP4A 3PPEA 1F1DA 2MH4A 2IGFL 5GGVL 2FZ3B 5AWNH 5IIEB 4ZFFA 1NAMB 4ISVB 4JHBA 4EUPH 1M1XB 3BIKB 3LKRB 1MCJA 4LOEA 4LOVA 1PZ5B 3DI3B 4JY5H 1HHJA 2JIXB 1R73A 1ZHLA 1AGDB 2KZKA 4RFOL 3RZCC 4LCUC 5DURD 3FTGA 3K6NA 1KKCA 2NY3C 5FB8A 2HG5A 5BW7A 1MHCA 4Z7NB 1ILUA 4JPKH 3Q5YA 5GS0C 5EZLA 1S7WB 4NKDA 1KJVB 5DZVA 1R5VA 1I9EA 4J3OD 3ZN1A 4UANA 4AUJA 1K3ZA 5CIPH 1YZBA 2X4TA 1NCCH 1UTDA 2YEZB 5GZNC 2L04A 3VSUA 1KB5A 3EFFK 2LGWA 2VRKA 4LBEB 3VH8G 3NCJL 4AL8H 1TVHA 4PJ5E 5DRXB 1J95A 3FH7A 3LQMA 2NNFA 2R2EA 3NSCA 3PWNB 4FG4A 4OBSA 4H13C 1EXUA 4QRTB 4XVSL 2I24N 4QXTA 4UT7L 3KEHA 3ELQA 1IFHH 1Q38A 4UV4H 1AP2B 1IT9L 3S96B 2YK1H 1J5OL 1I82A 3EO9H 3LUTB 1A6AB 2NY1B 3MTXA 2ICWI 2Z93B 3O9WB 4BXSV 4YJZL 5J1SC 1EMTH 3GSNA 1CI3M 4XVJL 1MFEL 1JDAA 3P9MB 4TN9A 2IPUK 5GGRA 3VXSE 1PZUB 4ZJ9A 3UAJC 2ZX5A 1A7QL 3MREA 3LKPB 4UQ2A 4QTIH 1FL3B 2HFGH 4L1HA 4AW7A 7PCYA 1CYGA 4N23A 2DQGH 4K8RH 2EDQA 2ZG1A 4J3BA 5E1IA 4XRCB 1QVFU 1SM3H 4PJGA 1HU8A 1OGTB 2ODMA 4DHLA 1X4XA 5IESL 1PZ3A 1SQGA 3GFUA 8CGTA 5BMVA 2FEDD 2Q2LA 4KUZH 1R6NA 3O6MH 1A8JH 4QRPB 4OJDH 4FRWA 1WP6A 3BA9A 1KP3A 1QSEB 4H7VA 3D39E 1PYWA 3NEEA 2G3XA 4NYLA 5C86A 3K5OA 1M56B 4XDLA 4JEGB 1X4TA 2EJRA 5EU5A 1VGEL 2OCCB 1NVPD 1OK0A 1KUMA 3DOSA 1AIZA 3F7LA 4XCCH 5CP3H 3IKKA 5SX5K 3WGUB 3RGBA 3R66A 5E9DA 4G8IB 3RBZA 2OX5A 1EFQA 1PKOA 5DD1L 5AVQB 5MEPA 1S3JA 3LPWA 3KPSB 4OIAA 4NQDE 3SDAC 4K7PX 2VABB 4LWSA 3OMZA 4JO1L 5EUOE 2AXGA 1OP3K 4NQEA 2IFFH 3MOAL 1G7MA 4DPRA 2DWTA 3ZHNA 2BK8A 3O6LH 3QO8A 1AKJA 4KP4A 4XHJC 4X20A 3QUYA 1BZKA 1P9MA 5D55A 3TCLB 4J42A 3I84A 1ZVSB 2QPFA 3AWGA 2CKBH 4QIRA 3PF2A 3SDLA 2YPLB 4DVBB 1ZCRA 1VIBA 4JKKA 1MZZA 5E5LA 1BYNA 2P5EE 1WZAA 4Y4HC 3IKCB 1KTCA 3DXAA 4YSUA 3CFNA 2CLVA 3KS0J 3RAJL 3ZL4L 4YSRA 3ZHUA 3TXQA 4Q20A 3Q43A 3X12A 5AYUH 1AZCA 1WHOA 4PJ7E 2NN4A 4PRHE 4F57H 5JOPE 3RN4A 1A3LH 5D7KD 1U8KB 2AGJL 5I1LA 5H37A 4H0LB 3G9VA 3FRPB 5TF0A 1K85A 3VTMA 3NRQA 4I89A 2HH0L 4RWYH 4JI7O 1D6EB 3PL6C 2DDQL 4TNEA 3ECBB 2WLHA 2VR7A 2AZ0A 4L3CA 1S6NA 4U6TA 3DYMA 2IVFC 3ILQD 4A37A 4DV3O 1TR7A 4P5TC 3RIKA 3H3KA 2A5UA 4P23C 5D1ZC 5IB1B 5IMLB 2JRIA 2WO4A 1KP2A 3VXSB 3IT8D 4XBPB 1AS7A 4FJZA 5FW7A 3VNZA 5B1CA 1Z5HA 5EIIA 2J5LC 4H0HB 3LIZL 5ESQB 3HC2A 4LNRA 5GJSL 3ZE1E 1IRAY 5DFTA 5CINH 2GJ6D 3MYJA 2EEXA 1JZ7A 3HNVL 2X4RB 1A6ZB 2F1BA 2J8OA 4RNRB 4KVNH 4I50B 3PRZA 1Y1UA 4WI9A 4ZPVA 5GGTH 1Q81W 2Y0PA 1DBAL 4MVQA 4CS2A 2ETWA 1FHGA 4XHQA 5DGRA 5GISH 3TYGL 1HXYB 4OU3A 2H4EA 3BEVB 3D39B 2XQYA 2O93L 1HHHB 1M57C 2F7RA 1EANA 2XY1A 3SIKA 4U3SA 4MJ5B 4NO5A 1UZ8B 3AXIA 2IQAA 3VU2A 2Q4PA 4MJIE 5DO2D 3WJLA 4L8DB 3ULUF 3DLQR 3T0EC 1LUVA 3VYOA 3HZVB 4K71C 4PJ9B 4TF4A 3GXDA 4JV5B 1J0JA 5EA0L 4X7TB 4NQDB 1JGUL 2JWYA 1WYJA 2OMVB 3E6FB 4G8GA 4NO0D 5EUOB 3T8XB 5DUPL 1KIPA 4ZT1A 1IJNA 4IU3A 2F8XC 1JI1A 5C0BE 2ROYA 4E36A 2X9ZA 1YMHB 1YNLH 5KSVB 4JY6B 1UUSA 4QR7A 3CZUB 3UZVA 5H8DA 1FXKC 5EEUA 5I2IB 4EE2A 2HLFD 3OMNB 2LHAA 4HJ0C 4QHNB 5DJZB 2P5EB 4NQCD 2YQGA 4L3FA 2D7OA 2X7LB 4OF3A 1MA1A 4G5AA 1XNRB 1OARL 3TBVB 5BZDB 2BVQB 2Z7ZA 3X1GA 5CBAA 1YYMH 2W92A 4PJ7B 3H42H 2VXUH 4HDIB 3UEQA 2HVKA 4ELKA 1IEBB 1I94B 4NENA 1TZHB 1RJZA 3IDJA 3NCXA 4AJYV 5IW1A 1W72B 3MRHA 1O9VA 5BXFB 3ECUA 5KVEH 3B8YA 3NBNA 1ADQL 1JZFA 2BSDA 3L9RB 5J4MA 3ULVD 5I66A 1NU1H 1PGRB 5I18L 4UFZA 2A38A 3V0HA 5D2NA 1BEYL 1FZOB 1UD2A 1T20A 5CO1A 3KM1A 2D31B 1L0QA 4HIEB 2VISB 3QCUH 5FYJH 2ED6A 1I7ZB 3K03A 1H6UA 2XWDA 3P9WB 5IQ9A 4FHJA 4QKXB 5CD3B 5ITBL 1B4RA 2C9XA 5GJTH 1J1PH 4YHIA 3IGAA 2W0FC 2DM4A 2VN4A 5D70H 2Z3YA 3V0WL 2I27N 4P5RA 3ZE1B 2Z31B 5J1TC 3QUML 2XTJE 1D5XB 3NFNA 3D85B 4R9HA 3VE0A 4LPTA 3TA3B 1SXBA 2WOBA 1EN5A 1DL7H 4X7DC 5E2WH 3KXFA 2UVEA 1ERNA 1PG7X 5KWYC 3TCUA 3ICXA 4JG0H 5IROC 3JSSA 3B1UA 3D25A 4TVPH 3HTLX 4X5LA 1F1AA 3U79A 3C60C 5J6HA 1M3JA 5DTFA 3RVWC 1WAAF 1AD9A 3MXWL 3ILPA 1FKAO 5TE7H 3ZEDA 1G1YA 4MJIB 4FABL 3LDDA 3O2WL 1OAQL 4YDJA 1XIWA 4NP4H 1KCWA 4O2BA 4N8PA 1FIGH 2YXLA 1L0NH 2P8MA 2XZAH 2F18A 3MOBH 4LFHG 3RYIA 1D9KC 3VGBA 1LILA 2NZ1A 3MHSC 3P9LB 2RN9A 3SGEH 5JHLH 3CYOA 3D18B 1UH2A 3CX2A 4KKCC 4RDQF 5KSBE 2IAMB 3MV8A 4FFBB 2GG1A 2PO6C 3DSFH 3LXCA 4I48A 5E00A 5C0BB 1DJYA 1A0QL 4HMCA 1N4XL 1WO2A 3IN0A 3ZSTA 4Z1PA 3VQWA 4IYHA 3QULA 3CXHK 3H9SA 2ZE8A 1DBML 4FXGA 2PW2A 1NBMG 4QE7A 3HI6L 3RX9A 2OJZH 1QSVA 2Z64C 3FUMA 3AUWB 3TM6A 4QOKB 1DQQB 2YARA 4PBVC 2X9YA 5DD3L 2YUVA 1R3LB 3P0VL 2ZYIA 4HBNA 3DBXA 3R4RA 2B1HL 4E41A 1KBWA 3VVWA 2ZE7A 1IM9D 1COBA 1UFUA 4NQSA 3HE7B 3TWYA 3H4HA 1I3RA 1LMKA 5DK0A 2ZDIA 1QTYT 3QO1B 1JFHA 4GI9A 4H44C 1E8ZA 5BVPL 3PABA 2OZ4L 5GS1B 1G0XA 1S9VB 3RP1A 4JFZL 3KJ6L 4FEMA 3W39B 4F6RB 1V3KA 3AG7A 1PLCA 5KX5A 2WTOA 2H3KA 2DH3A 4B95C 5IBTL 4D8OA 3DNKA 3RNKA 5EORL 2I7SA 4G83A 2R0WL 3ARRA 2OXHB 3MVSA 4HZLA 5CLYA 2P8PA 4FFZH 4Q2ZA 1ZANH 1B3IA 1U4EA 3C5ZD 2ZIMA 3CCHA 4FNRA 2AEQL 4GOSA 4S2SB 5DQJA 1TTRA 3FU5A 3CWGA 3GM8A 2FO4B 4Y4KA 2BSTB 5I6PA 3Q6FB 3CFUA 1WC7A 3REVA 2L6LA 4UQEA 1MXDA 3LJ3A 4R4BB 4Y16B 2YHGA 1FN4B 1VPOH 3NTCH 5EU3B 4ENEC 3BEHA 2WQ8A 2YPKA 1MFBL 1WD9A 2XTJB 2FCBA 2Z0UA 4AMWA 1IV8A 2BP0B 2V2WA 3OKKA 5BS0A 4JHWH 5DMIH 1AIFB 5IT9N 3PV7A 3QJZA 2HKHH 2WOYA 1ZX3A 4FE9A 5EH1A 2LW3A 3ARFD 2O57A 2JEXA 2XZQH 1LJMA 3CDZA 5ILTH 1RZGA 2YBRB 3E8VA 1EDHA 2KDYA 4X9GA 5FF6B 3LN5B 3E8HA 4IJTA 4JFSA 5IBLC 1MCRA 3AU0A 3IDYB 5FGSA 4O51A 2CAZC 1I8KA 2C1OB 1RUKH 2X1OA 1DCLA 3UTSE 4GQRA 1ZY9A 4PBWD 2W80C 2KYIA 2ERJB 2ZXAA 1HOEA 2BP8B 3IK2A 3ZTDC 2DM7A 5INDB 1UWFA 3RWIB 3BYYA 5KAIZ 4P8QA 2QM8A 2XN1A 2N4IA 4OLXL 1C8PA 2ENPA 4X8CA 4G6FD 2YLHA 2DJ4A 2RJZA 3WY2A 2P7TC 4AIOA 5KSBB 1JZ8A 3UIYA 1XMQB 2NR6D 3U1SL 4L8SB 4ONGH 3CVHH 2Q2EB 3ISRA 3P4MB 2AANA 5B1KA 3BUDA 5AL8A 3HRZC 4HIJA 1N36O 1OZ0A 1UVQB 3UQ8A 3ABTA 3AY4A 4N2FA 3X14B 2MOGA 5L4JA 3NP4A 4WV1B 1CFQA 2V7QG 3HZMA 1I9IH 1BAFH 2ZUUA 5FFGA 3RY6A 3VX0A 3B6SA 1UC6A 1H2MA 3JVGC 3C75A 2BHZA 4PCTA 4OCXH 3TPUB 1XF2B 4ZS6C 4YIQB 1AGBB 1VF5B 3DVGB 3L7FB 5JOEA 2Y69B 1BJ8A 4J2QA 4KO6A 2JGDB 3KYAA 5B3NA 4ODXA 3O0RH 4GKOA 2X2HA 5SV3A 3AQYA 3F05A 3S3SA 2HSIA 1Q94A 1XF3A 3BP6B 3EG9A 4PV1C 5HJBA 1REIA 1G94A 1L6XA 3HG1E 2ATPA 3SKJH 4APXB 2HJFB 2NCEA 1MNNA 4ETYA 5LDUA 3N42F 2OFQA 4QHMB 4MAUH 4KNSA 1GKEA 2ADJA 3RL2A 1CMOA 1J5DA 3M1CA 4LLWB 3NYKA 1WFIA 1HNXO 2B4CL 2WJ7A 3S37L 5GTIZ 2KH2B 1GS7A 3IAQA 4NZUL 3ZL2A 2XJKA 4ANWA 1GMGA 1J05A 2UXDB 1SJHA 4WW2F 5HHVL 3MJ7A 3N9GL 3OKEA 4ZOCA 3VA6A 1ETJA 4KPHL 3GB7B 3ZTNL 4HKXA 2B5UA 4MMXA 1MCBA 5KBPA 2YI9A 4WNSA 1FFQA 3BGAA 3GF8A 3GSNL 4OJYA 2OZNA 1V7NL 3ZRWB 2WK2A 2J6EA 2HLDG 4H2CA 4QF1B 5J13C 4GG8A 2A6KB 1JZGA 1VQ7V 1WEJH 4WEBH 5TF1L 4Q8BA 3LKOB 4NNPH 3ETEA 5JUEL 1R24B 3FTUA 3KPNB 2IXQA 4DQAA 2J56A 5TJWK 4FNUA 3ZMRA 1KXHA 2LTQB 3O4OB 5D4HA 3EYSL 3D4YA 1EAPB 4PP2B 4YDIH 3CSPA 1AH1A 5KTEH 4IGBC 1URZA 5DC4B 3UTSB 5BCAA 1I8MA 3GIVA 1T1WA 5L88L 5B21A 5DJDB 5JH7B 1K6QH 2GC7C 3L08A 2OLDA 4WI0A 1T1ZB 4AEIH 3DUUB 5GRWA 1BCIA 4L1SA 5LGHH 5DVNA 5KYYB 1N8RW 4YC2B 4P46C 4PH8A 4PWGA 5DJ6A 4GUPB 1ZK5A 5EUKA 2BOCC 1UZGA 5DU7A 3IRCA 3UJJH 3T6QC 4RAVA 3P4OA 1B0GA 1YMME 3EFOB 2VO5A 5HHOA 2X0LA 2EXTA 5EIQA 3ZQWA 1A66A 2VDNB 4LF3B 1RZJH 4XTRC 1RERA 5ICXB 5A2LH 4NI3A 1VQMV 5IWAO 1AXSA 1UASA 4H8QA 1SS3A 3ABKB 3ZK0A 4AI7A 1A22B 1AXTH 3HCVB 1E4HA 4H26A 3JSLA 5E9DD 1Y1DA 5L8LB 5LCVH 2VC2B 2VUKA 3IVKA 1UJ3B 3V8CA 3R7QA 4M1CD 3VW3H 4JTAB 2FGWH 4LCWB 1M90W 2XKNB 3KLLA 1RCYA 1LEIB 1NUDA 4DPCX 3BWAB 2XHNA 2A4CA 1BAGA 3QORC 4JFQA 3V7MA 5KA5A 5BNXD 1Q9KB 2LLGA 3OLDA 4NQED 4NI6A 4X4YB 1ZHBA 1RUPH 3W81A 3HG1B 2ZOLA 1RKRA 1KCVH 2E75B 3QUYD 3LB6C 1ULVA 2DQJL 4DUVA 5AW5B 5IMMA 3P3YA 2APFA 3L4CA 3QC6X 5ECJE 4DK1A 5IUCA 1Y74B 2LU4A 2AV7A 3LRSA 5IV2B 5K59F 4R7XA 5CBGA 4PY8I 4YDKH 1IL1A 2OSXA 5FECB 2CTRA 2R2BB 9CGTA 2DI8A 4BFBD 1TYRA 1A25A 1OSPH 3DXAD 2J8UF 4HKJA 2MK3A 5ADPL 1JRHL 4D0BA 1TVBA 3EOAB 3VFVB 1PDKA 3QHFL 5BR8B 1CGYA 4N2HA 2B1IA 3SJQC 1F13A 2AXFB 3IDXL 3U7YL 1QYGH 2LQRA 2X4UA 2CM6A 4X6BB 1I5XA 4MVOA 1D7FA 1WIPA 3IBEA 1XI1A 4GBXD 3ZHLA 3VOUA 5I6XB 4IOFC 2FZ3A 5FM4A 5IIEA 2EO1A 4N2GA 1C16B 1NAMA 2NW3B 4ISVA 2ICWJ 1M1XA 1ZXQA 2XAQA 3BIKA 3RWFB 5JR1H 3LKRA 2NQDA 1PZ5A 5LN4A 1PIGA 1TAEA 1HE8A 1YTFD 1QPXA 2EDEA 3L71H 2JIXA 4HZ1A 5JA9A 1AGDA 1QWHA 3JWNE 1IBDA 4PB0H 3PAUA 3VFTB 1KGJA 4IKLA 5FUZH 5JXEA 4DR5O 3HNSH 3T77B 4OM0H 2QHRH 3SE3A 1S7WA 4YUEH 1KJVA 3NGBB 1GGCL 2F5AL 1KCSH 4BQCA 3O2DH 1C9SA 1FXVA 1JXFA 2W5PA 2YEZA 1JBJA 3K3WA 4Z7VF 1NMBL 1RURL 5GSRB 3CG8A 3MZTA 5EIBC 4LBEA 5I28A 3ZT7A 5DRXA 1CGSL 4BUGA 4F7MB 1TT6A 3PWNA 4UILL 2X6UA 3H3PL 4QRTA 4U1GB 4PJXF 1VZGA 1YMMB 1K92A 3GI8L 3ML8A 4LVEA 1MXGA 2W59A 2LVCA 4JRYE 4K15A 3HHMA 1BYOA 4LEXH 1AP2A 2J7LA 3S96A 3MRGB 1A3QA 3APOA 3GUFA 1A6AA 3O9WA 2Z93A 3C09B 2N0MA 1ADWA 4X7SL 1EZVX 3P9MA 4OIIH 4CJ0A 3NVQA 4U2YA 3QJVB 5HJGA 4J39A 4JKNA 3LKPA 5EK0A 1FL3A 1RIVL 2N56A 4C4KT 2QVTA 3RY5A 4ZMVA 2Q8BL 3QIBD 4G8GD 1WGOA 4XRCA 1ENVA 4UCSA 1OAZH 1OGTA 1OD9A 2HAZA 3T08A 5GZOC 3CHPA 4AHCA 2AXTZ 3HLAB 4IRZL 4JQVC 4R90H 2RHEA 2XVBA 1NEUA 4QRPA 4FEIA 4E9VA 1QHPA 3H54A 1QSEA 3AS3A 4EIBA 2AJSL 1ZLEA 5H2FZ 3CXHJ 4B9CA 4UIMB 4K7PL 4N8VB 3P4NB 2CNZA 2D03H 4JDTL 4B6ZA 1JZ4A 3Q8CA 4ZMYA 4G8IA 4YDVB 2EDLA 1FVDB 4BCXA 4PLNC 4WLCA 4FCHA 1EZSA 3QG7L 5CGBA 3KPSA 1GY1A 4FYQA 1GGIL 1V9PA 5AW8B 4EUPB 2CDEB 2VABA 4A2DA 4ENZA 3SOBH 1R9FA 3FPYA 1CFVL 1KYOK 2B8OT 2EO9A 3F7QA 4X6CF 1CS6A 1F90L 2PXYB 4IMLB 5T33H 2OCJA 4QPJA 2V5RA 5CBEB 3WD5H 1BVZA 3CHQA 3TCLA 1TITA 1KIQB 1ZVSA 5DZJA 2Y36L 1CFBA 3TH4T 1HQRB 4LR3A 1A7OH 4DV2B 2FLBT 2V9QA 4FYRA 2YPLA 1PNDA 1Y6MR 1N18A 4YL4A 4DVBA 4MFHA 4Y9GA 5CIPB 3IKCA 4WNQB 2ICES 2E76B 2WXFA 3VWJD 4URKA 2J1ZA 3W9EB 3VGHA 3M17B 4DR4O 4Y4FD 3A8TA 2EUVA 3NSXA 1NFAA 1AO7D 1H3PH 1FJGO 4V1DD 1EGJH 1U8KA 2VCOA 4LSUL 4X64O 2K78A 1JOIA 2XVKA 2PUSA 2JQAA 4FZ1A 3FRPA 4KOCA 5EZOL 5KMGB 3O2VL 5H5NA 1QBLH 1O75A 1D6EA 4HXBH 1IC5L 3ECBA 3VXQB 1DDTA 4JRYB 3ZDXE 3L72H 3C08H 2DLIA 4NEHB 3PFUA 4JY4B 5CLTA 2YUWA 3RT3C 3OEEG 4M1GH 2XWCA 2X87A 1NUFA 4ORZC 5IMLA 5IB1A 2K3HA 1EXHA 1VHPA 3VXSA 4XBPA 1K4CB 3HLKA 3WUZA 1XIWD 1KYUA 3X3GL 3SDDD 4HIPA 2B3RA 3BVVA 1BQHB 4LEEA 1E9PB 2G4EA 2JI3A 2OMXB 5ESQA 3KD4A 2OBGA 3CUPB 5K33A 3OUSA 1MW3A 3MV8D 2ZCKL 1H2SB 1A6ZA 2O26U 2X4RA 4RNRA 5EZPA 3CSGA 4I50A 2OK0L 1LO5B 4XMUA 2VDRH 3V4UH 2IIJA 1FVCB 4TNWK 3ZKMC 5EG6C 1GHFL 1SY6H 3WY3A 1HXYA 3H9SD 1MSPA 3BEVA 4BA8A 3D39A 2DM2A 5INCB 1HHHA 1QVGU 3IJHB 1KCUH 4KK6D 5KEZA 2IV8A 3D2UB 2AJ3B 4UT6A 1QLNA 4MJ5A 1UZ8A 4Y1TA 2WXJA 4PBDA 1ETA1 5EZJB 4L8DA 3UKMA 1YJDL 2DQUL 3HZVA 4MAYC 1YEEL 3QZWG 4PJ9A 1XBRA 5I9QB 5KHJA 1QFUH 1UCBL 2NYKA 4LARL 4X7TA 4NQDA 2W9DH 1JCHA 4L8BB 3E6FA 1MEXL 2OMVA 3LPOA 5EUOA 1QATA 1T03H 1BZ8A 3T8XA 1RJCA 2CKBB 3ESPA 2YXWA 4P2QE 4UOW0 5C07B 4YZWA 2E7LC 3ARDB 4NJAH 4IRSB 1BJ1H 1GZQB 1VJSA 1E50A 1HKLH 1YMHA 1ZL8B 4WTQA 5KSVA 1V8HA 4JY6A 2V7NB 3UG3A 3P2BA 4F92B 1AE6H 3WKMH 5I2IA 3BPNC 1YECH 4QHNA 5DJZA 3ZT5A 4X80H 2P5EA 3FKSG 2APBA 2A0LD 4KU1A 4Y4KD 2X7LA 1NLBL 3VJ6B 1JSYA 4DW2L 1P84K 3TBVA 5BZDA 2BVQA 4P9ML 4LQFL 2YA2A 2XC8A 4XMVA 3EJZD 4PJ7A 4TS6A 4HDIA 1JGIA 2QKIB 2W88A 4XC3L 5KVEE 4CN1A 1IEBA 1EBOA 4BYHA 1TZHA 1J10A 4JTCB 1FV1B 5AZ2L 2R4RL 5BS0D 1W72A 5BXFA 5IK3B 3K2MC 1NTZH 4TVUA 3L9RA 4FLWA 2IWFA 5FYJE 4UTAL 3L54A 5J8OA 3ZDXB 4JRXE 2ZP9A 1FZOA 4MTFA 5CEZL 1NGXB 4X8JB 4GAAA 5CD5D 2D31A 4UVAA 4ZBJA 4HIEA 4H40A 4PB9L 2VISA 3QR0A 2DWDC 3L5HA 1I7ZA 4HCGA 2K1EA 4JPVH 4ZFZB 5CD3A 1CQYA 4HT1L 5C6TH 4X1YB 2KT6A 2EJ1A 5F7WC 1R6KA 4RGOH 1PG7L 3QXTA 2RD0A 3DPBB 4TL4A 3S48A 2NXZB 5IGXH 2Z31A 5JQHC 1XD1A 4FI8A 4AYSA 2RJMA 2VLLB 2R8SL 1D5XA 1F6AB 1OB1B 3D85A 4TVPE 3TA3A 1I5YA 3FQXB 3TOPA 1HW7A 1NMAL 5CN0A 2Y4TA 2YGQA 2Q10A 2WZ0A 5E1HB 5DMJB 1Q0XH 1JYXA 2JB5L 3EDFA 2PWHA 5E5RB 1JGEB 4C56E 5IHBA 1JPTL 4L9DA 1CXZB 3OBAA 3TESA 4DR3B 2LW7A 1CL7L 3MLSH 1ZGLM 4O4JB 4UNIA 1KTDB 3C6LB 4U1KB 4MJIA 3PLYA 2EVHA 3RE0A 4YE4L 1ID5I 3A4AA 2OR8A 4DGIH 4HOXA 3CCVV 4OLUH 3P9LA 3MNWB 3D18A 3DC5A 2IAMA 4FFBA 4P2QB 1MFNA 3BDXA 5HFLA 1SKVA 3K5NA 5C0BA 1PX4A 4M7KH 1C8QA 3WXVH 2WXMA 1TYJA 1GSMA 1ET8A 2FTKA 1T4WA 1RU9L 2EIDA 5DR5H 4KO9A 1UUNA 2M7WA 4OGZA 4ALAH 4QOKA 4LDEB 2FHBA 3W0WE 1DQQA 4M7LT 5CJQL 1HINL 1URIA 1R3LA 2AXHA 3B9KC 2A83B 4N1CA 4F7KA 1OP9A 3MBXH 3N2KB 2UXCB 3EJPA 4UT9L 3HE7A 5C0CE 4S1RL 2NSXA 5EOCL 5LYJB 3QO1A 3X17A 1VZIA 2VITB 4OFDA 4H8WH 1QR9A 5D6DC 5GS1A 2PGGA 3OQRA 4HFUL 1S9VA 4W9HC 3W39A 1EDYA 2VQFO 1AQKL 4F6RA 1AZRA 2NY4D 1GC1L 3ZR5A 3SE4A 1S72V 3PWLB 2XRAL 3Q8AA 3ZRFC 1KJ3H 4KJYB 3Q0HA 3TT3H 5MEQB 4JREB 4JRXB 2OXHA 2GTSA 5DUML 5TQ0H 3R8BB 1JL8A 4OCYL 4ZUUB 3ULSB 3G4SV 1XCTB 4S2SA 1OTTC 3NQKA 4O4HB 1UXSB 1RM1C 5I1HH 2FO4A 3CZKA 2BSTA 5G4OA 2F66C 1QTPA 3Q6FA 3LSOB 4Z9KB 4OZIB 1L6ZA 3TNNB 4TSBL 4B60A 4R4BA 3VQ1C 4Y16A 1SVBA 1FN4A 4KHXL 5EU3A 2XPZA 1RHHB 3CVCA 3O3AB 4RSVA 1PPIA 3K2UL 2MPAL 5KVDH 2BP0A 3EGDB 1KC8W 1QRND 4JI0B 1RFDL 4FMFA 4JW3A 1AIFA 3WUWA 4YH6A 4YFDB 2YIDA 2X6AA 1V7MH 2R9HD 4LLMB 4YQXL 2HRHA 3MRLB 4JM0A 3ZTEA 5B3JF 1NANI 4XMPL 1A4BA 4ONFH 5GRUL 4B41A 4R6UA 4ZMWA 4L2YA 2YBRA 4N9GB 4R7DB 3WJMB 3HMXL 1ZLUH 2V7HB 1R3IC 4C56B 3LN5A 5FF6A 2R29H 4LIQH 2QMKA 3QJXA 2DQIL 1RD6A 2C1OA 4QTHB 3BH8B 3RGHA 1E6JL 4WTXA 2BHFA 4QHKI 2BP8A 4UZUA 5INDA 3C3TA 4TLSA 3RWIA 4G3YH 5TE4H 4JYAO 5CJ8A 1XB3A 3DBSA 4G6MH 1HWYA 1AAJA 5KSBA 5EZYB 1I7UB 3EGXB 4LSTL 4WO4B 3LEYL 1SMDA 3P4MA 4I55B 5DJXB 4Z5RB 4CMHB 4IQHA 2WQAA 1N64L 1QPPA 2HG0A 1KFAL 1ES0B 1UVQA 3LNEA 4P59L 3THML 3F58L 3X14A 1MAMH 3QT2A 2WA3A 4K0KO 4R4FH 4WV1A 5G55A 1YEHL 2R1YB 4M8UA 4B9PA 4Z7OF 1NAML 1PMYA 2VLMD 5D2LB 1SFDA 3TPUA 2O5XH 2OSYA 4YIQA 2IH3C 4NR1A 1AGBA 3W0WB 3DVGA 3L7FA 1QKZH 4GT7A 1LLAA 2WCPA 2JGDA 2IPKB 5A6LA 2NTFB 3V2AR 3ECVA 4FQPA 4RH4A 4DK3A 5F1NB 1H5BC 5C0CB 3BP6A 2GTAA 2XWTB 3QR2A 3KPOB 3FQYA 3U4AA 2H5UA 4RBPK 2ZCLL 4M6AA 1SGKA 4ZSOE 2X4PB 4APXA 2HJFA 3EDDA 1CTMA 4XNYH 1A6TB 3S35X 3EJYC 4QHMA 1E28B 2AXWA 1LO4H 3LSUA 3CHOA 4LLWA 1NQTA 2JIXD 4A39A 4YZFF 2OWOA 4DP1X 1JR9A 1AZUA 4ZFGL 3BN3B 5GGQH 1ITCA 1R5IB 2ICEB 2K70A 4J3OC 5B7EA 3APNA 2DB8A 3K81A 3RPIB 2EDFA 4Z0XB 5HDLA 5C70A 3GB7A 3HMWL 4JYBA 5IJKC 3NN8B 1UGNA 3KLHD 1NCDH 2OXGB 1HHGB 3ZT6A 1HIML 2EO7A 3QVNA 4GRLB 3LZFH 3T3ME 5EDSA 2IH1B 3ZRWA 1CK0L 4HF5H 2Y2WA 5ES4B 4HKBB 4QF1A 1EBAA 2ZR3A 5CCKL 3ENEA 1U41A 2A6KA 1RK7A 1TNNA 4Y5VC 2ZG2A 3LKOA 1N7MH 4PJBF 4P4KD 3QO7A 1R24A 2FO1A 3KPNA 4R96B 5IQMA 1RUMH 2VB5A 2LFSA 3FQNB 4JL1A 3DDGA 5IHHA 4XPTH 2DQCL 4PP2A 1EAPA 1A5FH 1MFUA 2Q7NA 2NY1D 5FPRA 3O9WD 5B1JC 4L1LA 3X13B 3UTSA 1QU7A 1G5AA 1AQMA 3QFDB 4OD3L 5CR1A 5DJDA 5JH7A 1ZVNA 3LMJH 3OKNB 2QJ1A 2A9BA 2ZJSL 3CVHB 3KGSA 2NR5A 4X65O 4CC6A 4XVTL 2X1WL 1TNMA 5B3SB 1T1ZA 1CGXA 2ZP8A 3DUUA 4R84A 2FYUH 3JD3A 3DUHA 3VRLE 5KYYA 3RTQB 3EH4B 5DFVD 3FYIB 2CTPA 1XQ8A 1EJOL 3GJFH 4GUPA 2ZCHL 3CRRA 4PY8J 1QAWA 5IVOA 5E2VH 1EJ6A 3EFOA 2DYRB 1CGVA 2NMSA 1QSED 5L9DL 4LF3A 3P30A 2DQHL 5ICXA 5TISZ 4A6YH 1DLFH 2X4OB 1ZLSH 3HKCB 3HCVA 2WMPB 3LS4L 3MO1B 2DPKA 2YN3A 1UJ3A 2JJTC 2YKLH 4UXNA 4LCWA 2XKNA 4DP2X 3LNHA 1LEIA 3C2AH 1GH7A 4JJ5B 5J3HC 3BWAA 1E8WA 5F7NC 1Q9KA 1XL4A 3Q4HB 2VR4A 4X4YA 1FLTX 3A2FA 5JOFB 5B1NA 4R50A 1E27B 3GS7A 3HG1A 4S1QL 4ZSOB 5FKAB 2JF1A 4FA8A 4YHYC 1CDHA 1PQZB 4QUOA 4MTXA 3ARGB 3CZJA 1FFNB 2OL3L 1SERA 1NL0L 2FD6L 1ZKAA 2BHYA 2V9UA 4UM8B 1Y74A 3SEPA 4Q6IB 3QEGH 3B2EE 5HDRA 3M88A 4HISA 5IV2A 2DIJA 4B3SO 1XDCA 4BGLA 1TETL 1UM5L 1YAIA 5FECA 4PJHE 2R2BA 4TVSa 3H2QA 4GXVL 4PJIE 4UCOA 2R9IA 3INOA 3FB5C 2XZZA 4NFDA 3EOAA 3VFVA 3DV4B 1SBSL 3GS4A 4DV1B 1P84J 1KDIA 5L7XL 1I8IB 2CH8A 2AXFA 2ORBH 3IE9A 1HWWA 2CJTA 4YDMA 5MP6H 3LPFA 4RZKA 4X5XB 3AG1C 3DK0A 2CPUA 4NKGB 5EBLB 4X6BA 3T3MB 2JTDA 1GN2A 4F9PC 3FQTB 3BRDA 3L3DB 4PJ5D 3CJHB 2AJUH 5E6RB 4OZGE 4QT5B 1C16A 1T7VA 3FO0L 4D7TA 5PAZA 5HYIA 2NW3A 1Y4MA 5IFJB 3SBPA 1CD0A 2FJHB 3RWFA 3N55A 2E74C 1P5UB 2L7EA 2YD7A 1WBZB 2VN3A 5ITZB 1VEOA 5DSCB 2DAVA 4JM2F 1G4RA 3HVDA 2I9TB 3VFTA 3GBDA 3T77A 4LHUG 5H6RA 3VXSD 3BW9B 5DHDA 1VF7A 4YDLB 3WS6A 4H20L 4S0HA 3HHRB 2YXMA 4P9HH 2ZAHA 3QZBA 4BZ2L 1CTNA 1RZ7H 2APWA 3QZPA 1XNQB 4MKTA 3ZSSA 1B88A 3A6OA 3GDBA 5GSRA 4MMZB 1HS6A 2QSQA 2ZD0A 4GX2A 3D0LB 2WC7A 3KPLB 4F7MA 4CNIB 2ZYHA 4OLYL 1BVOA 1JERA 1YMMA 4CVWA 1ZJAA 4GYBA 2VXQA 4XO3A 4UNVA 4E0RB 3D39D 3WNOA 1IBFA 1NGZB 2YMTA 3IPEA 2WBJB 3MRGA 1LK3L 1RPKA 4A7QA 5DO2C 1ED3B 2AEWA 2ITCC 2F54E 2HT3C 4ABMA 1AFVL 1DVXA 2BS71 2P80D 5ACZB 5KSAB 5I76B 4PJ9D 1MRDH 3FB6C 1OPOA 4N2LA 1V3MA 4NQDD 2RAMA 1P6AB 3JTTB 2DOSA 4HGKC 4AT6B 4NN7B 1P4BH 1JMXA 4FM1A 2EEFA 3WIHA 3UG5A 2B0SL 4YNYB 2AZ2A 3VMOA 1R1CA 3HLAA 3N44F 1L9OA 4KO5A 4TLUA 1C5DB 5IKCB 3FQRB 1CYWA 2L7QA 3MV01 1UWEH 2HLFC 5EB9A 1EK3A 3UO8B 3LZLA 5ISZE 1AG6A 5CJXA 1OE1A 1IC4L 1MF2L 2H47C 5CILL 5IHZB 1GGBL 2HPOA 2P5ED 4PJHB 4UIMA 3NH7H 1SYSB 4PJIB 4N8VA 3P4NA 5BZXA 1KZQA 3BPLC 4YDVA 3QG6B 4PRHD 2ZICA 1FVDA 3L48A 4JJOA 5TDNB 5DMGD 4XPBL 3N43F 5DZAA 2D9CA 5JOPD 2BOBC 4P48A 2MCMA 4V2CB 4EUPA 4HUCA 2CDEA 2F8IA 3ULVC 1ODAA 4FQJL 4CC4A 1CLYH 1TZIB 3K0GA 2GUZB 4OZGB 2CCVA 3EXLA 1NSNH 1J87A 1PLAA 1WBYB 2PXYA 3NXSA 2J4WH 2R39A 4IMLA 5CBEA 1QBML 4LRNL 3TEYA 4WTWA 5KJRH 4KUCD 3SGJC 1W8EA 2VWEC 1KIQA 2A1WH 1QQCA 3MDJA 3NPSC 3B5GA 4TNGA 2AZAA 4U6HB 4Z7IA 1HQRA 1NCAL 1NJ9B 5HHXH 1BLIA 2ZUVA 1DANT 4I2XE 5CIPA 2GSMB 2FL4A 3SO3B 4ZKIA 4WNQA 4I3RH 1Q1PA 3W9EA 4X8XA 3M17A 4YO0B 1XGQB 4M5YL 2Z31D 1G9MH 3GRBA 3MCG1 2J73A 3ETQA 1L0XA 2NNXA 3UXFA 1QLEL 3FDWA 5AD0A 5JW4Q 3K1KC 3TA3D 4ODVL 1U58B 4NJ9L 5KMGA 3HB3B 3R06B 4NSKB 5M7QA 4HBCH 4HS3B 4HS8H 1KT2B 2E6QA 4P9OA 3CXDL 4PLKD 3VXQA 4JRYA 3RU8H 1GOHA 2CGNA 3ETGA 4QXUH 1S5IH 3M1BB 4FQIL 1M2VB 4JY4A 1BHBA 4Z7UE 4HOZA 1EERB 4JI6O 1OAXL 5E08H 1K4CA 3P3UA 4N0CD 4HIXL 2KZBA 4PGCB 5FK9B 5ALBL 4N2DA 4G6JH 4MDRA 4XMLL 1T21B 1BQHA 2ZKXA 3WE1A 1E9PA 1RH8A 2OMXA 1LDPL 3CUPA 4WF7A 5DD5H 2IAMD 2V3DA 3T0EE 1SF3A 5I8CB 4WK0B 4GJTB 5GQBA 1LO5A 3E8UH 5C0BD 4PA3A 3MMEB 4KRPC 3MBEB 1YEKH 1FVCA 3BQUD 3VI3E 5JIMA 4JAMB 3JVFC 1I1RA 4FTDA 5CP3A 4MT8A 1EFXB 3RX5A 5ISZB 5INCA 1J18A 3N04A 4J4PD 3IJHA 4M5ZH 1LQSR 4K5MA 1DVSA 3EOTL 3D2UA 2AJ3A 3APFA 4DEPB 5BOJA 3LPGA 5I75B 2ZKHL 4NQUA 5EZJA 2RTTA 3HZKB 2XLLA 4L4VD 2XAJA 1TG8A 1XR9B 3WTYA 1RIUH 3I3BA 4FQHB 5KYNA 3RA7H 4L8BA 4PY7B 1HILB 4BK5C 4Z8FL 2WUCH 3MLRL 1B3JA 4NERA 2CKBA 4O58H 5C07A 1ND0B 4S1SH 4GW5B 3ARDA 4IRSA 3JCUZ 1G8MA 2MCPL 4AMKH 1ICTA 1XX9C 4YK4C 1GZQA 1JJUA 4KKAD 3STLC 1TZGL 1ZL8A 1EXGA 2ARJB 1J0ZA 1DR9A 2V7NA 4HZ3A 2HLAB 2HN7B 2IFGA 2NLJC 1CICC 4I2XB 4DNLA 2BLFA 1WLEA 2WY3B 4DR1O 5DZNA 6TAAA 1YEGH 3L75H 2WXQA 3VJ6A 5BRZE 1HZKA 4TM9A 4DFHA 3BZEB 1NBZB 3RUGF 4F2FA 4JCLA 1M1KW 5AW1B 3JXAA 1T66D 1JHLH 3UDWA 2QADB 2QKIA 3NACL 2XYBA 5CU9A 5LXGH 1NOFA 3U9WA 3BRFA 5TFSH 2XTJD 5K5YA 1FV1A 1TTGA 2BFVH 2WP3T 2VL5B 3ARFC 3ALWA 1FH5H 3TT1H 2F0CA 5IK3A 3FBQA 4V33A 3CQPA 1BREA 1F58L 3BSGA 3PNWB 4PGJA 3RVZA 4TT3G 3ESNA 2Y07L 4RRPM 3MV7E 1NGXA 1IQDB 3K46A 4IBZA 4X8JA 3QWOB 2ENJA 4EN3B 5EO1B 3CEIA 5I19H 4ZFZA 1EEUA 5I8KL 3MACH 4X1YA 4FI7A 2YI8A 1M57B 1RIHL 5JTWA 2CSPA 2TRYA 3S3WA 3DPBA 5GGTA 2VDRB 3QXVA 1U6AH 2RCSL 1R33A 2XWJB 3DGGB 2VLLA 2XOTA 4GAJL 3WTUA 4IK7A 1F6AA 1OB1A 3T0EB 4IBYA 3K4AA 3X3FH 3FQXA 2DN9A 5TDOB 3WNPA 1XHZA 4NC0B 4NNXB 3VI3B 2Z8RA 1BMZA 1Z9PA 4JO2H 2WWOA 5CLWA 1D5BB 3N2JA 3FT0A 1KTKE 3GXIA 3ULUL 1JGEA 3LNNA 3GMRB 3DV6B 3SQRA 4F7CB 2QPUA 4Z95H 3NIFF 4O4JA 2NNRA 1DVTA 3T4DA 1KTDA 3C6LA 3IMTA 5EU7E 2FNBA 4U1KA 3ZE2E 4GSDH 5LBSL 5DT1L 4UB0L 2ZWYA 1CDJA 1HL4A 1AKPA 4XX1G 3WG7C 4BIZA 2FATH 4LFAO 1GN4A 3OKYA 3NJFA 5E2UL 4WFHE 4KY2A 4X62O 3MNWA 3C8HA 3RL1B 4PRPE 2IGLA 1ZLWK 3QRGH 4JPWL 4P2QA 3VX1A 2K7QA 3ULUD 3WTVA 1S5LZ 3ZX6A 3KLDA 1H3GA 3QG5A 2YD8A 1PD3A 1OCCC 3ARTA 3VXTB 1OJHA 2HG5C 4JFHE 1KB9F 2WA4A 5KJ4A 1G0DA 2DQTH 3T1YO 1A9BB 4ZOBA 1N8OE 5F88B 2ZXWC 4BIUA 4AYFB 5BRZB 2A9AA 1S46A 2VDPH 1VA9A 3N40P 2A83A 2K4WA 4ICWA 4ZXBD 5DD0H 4KWUA 3RVTC 5JMRA 4BBWA 1BJMA 2HT2D 4HJJL 3N2KA 3ILEA 4DR2B 3F6JA 2YSUB 4TNVK 1PL3A 3CMAV 5CHNB 4PS8A 4WHCA 5LYJA 3REWB 3S3CB 5A2QN 2VITA 4HFWB 5CBHA 1X7TA 4TULH 5CLXA 3SPJA 5JQIB 2K1MA 2EIJC 3PWLA 1XILA 4JE4B 2N74A 2XWBB 4OV6F 4DAGH 4KJYA 5TQ2H 5MEQA 4JRXA 3MV7B 4XXWA 4QHKJ 5C8YB 3MA9L 4ELME 2BERA 5C2UB 3OW2U 1MQKH 4GKNB 1KULA 4NRZB 4ZUUA 3ULSA 5HYQB 3JV5A 3BUPA 4BFJA 4ZOLB 1XCTA 4PJEF 3UTSD 4N4YB 1ZS8B 1P0SE 2O5ZL 4O4HA 1UXSA 4LL1A 5D7EA 1IILE 2NY5C 4KKLD 1OHZA 3T65B 4K3EH 4L3EE 3ZUNC 3IRZA 2ARWA 3QBTB 4OZIA 3LSOA 5KVDE 4M61B 4EQ2A 3TNNA 2AW2A 4Q4IA 4HAMA 1DSFH 1U8IB 4IBLT 4XNUL 5A16B 1RHHA 3O3AA 2QQLL 1B4JL 2FEEI 2Y0SA 3LNDA 3EGDA 1G9NC 4FQ1L 4Y9BA 3VG9B 4MNQE 4TUKH 5C0AE 4LIQE 4LLMA 3MRLA 4ODSL 1NFDF 3THOA 1GTNA 3CZEA 4X4ME 1EHNA 4N9GA 4R7DA 3QWRA 3WJMA 2NXYC 1OCOC 2V7HA 4C56A 1HNWO 3LRMA 3WNKA 2Q8AL 1L1FA 3CMEV 4M1CC 3OG6B 1NPNA 4QTHA 4CBCA 1OM9A 1TPXC 3BH8A 4WUKL 3EGSB 5JHLA 3MD0A 1SN2A 3ZE2B 1GCFA 2CWRA 2VO8A 4RFNC 3U0PB 2ETNA 4BWTA 3D1MC 2OMWB 4PJAF 3AS1A 3IAYA 2DW5A 1P9MC 3CLEH 2BSRB 3IB4A 4PRPB 3HG1D 3V9EA 5EZYA 1I7UA 1NICA 3EGXA 4WO4A 4YXHL 2EILB 5IMKB 2XDHA 2CDFB 3U6RB 4XP9H 4I55A 1FG9C 4IMKA 5DJXA 5JO5B 4Z5RA 1ES0A 5SX5H 1QI3A 4HHGA 5C3TA 3V6BR 2XN2A 4ZI8A 5GS2D 1IDSA 1FGNL 2R1YA 3WYRA 1L3NA 4H8VA 3VI4F 3VXUE 1JP5A 3EH1A 4DGYL 4PJFE 3JBG7 1S9WB 5D2LA 4ANXA 4W6XB 3W0WA 1WSST 3DC6A 1OP3H 1RP8A 1KMIZ 3NP3A 4OGQB 4FFVD 4KX8A 3S35L 4BFRA 1KEMH 2IPKA 5F7DB 2NTFA 1QCEA 3I75B 3D36A 1WTGT 2WANA 5F1NA 5I1IH 5C0CA 3OZKA 2O6DA 2XWTA 3KPOA 3L5XL 2N7AA 2ADFL 3TEWA 3WFBH 6FABH 4JB9L 4POZC 5CZXD 3IMRA 2X4PA 2FEEL 3QGVA 4FFZA 2PABA 1A6TA 4NT6B 1XSOA 3FQ4A 2UUAB 1E28A 3E9TA 3TS8A 4N3UA 3BSZL 1A8ZA 3CCUV 1L3WA 1MFCL 4ELMB 2FYVA 4KI5F 2WSPA 2R0KH 1IBBA 2I5YH 3U46B 3DIVA 4I0PB 2ICEA 1FL6B 1R5IA 2BX5A 3BZDA 1J8KA 5FEBA 3HR5B 3RPIA 4AH2B 3GKWH 5A2IH 4Z0XA 4L3EB 4U3JB 4DR6O 4DSYA 1YY9C 3NN8A 4ZTPH 3GBLA 3EZJB 1A7RH 2OXGA 1HHGA 2JV6A 4TOYL 5KBKA 4GRLA 1UOKA 2IH1A 2R0ZH 3BEWB 3MNVB 4YSOA 3DX1A 4HIHB 2HVJC 4TPRH 4HKBA 2DMKA 1GPOL 1BEXA 3LS5L 4MNQB 5C0AB 2P49B 3KL5A 4M6NH 3OC8A 1YMMD 2DQ3A 1OSZB 4KVCH 4R96A 5AKSA 4A38A 3WIHL 2HWZL 2PF6A 3GM0A 2DD8L 2H1PH 2ENYA 3FQNA 3MLVH 1SZXA 4JO3H 5AG8A 3IMBA 2FHCA 2ZAGA 3WJLC 3VTAA 2EXWC 2DWSA 1PZBA 4YAQB 3X13A 3MLUH 4GMSL 3C3SA 2B9AA 3QFDA 4OCWL 4XPAH 4M7JH 2EABA 1CE1H 1UB6B 3T4YB 3FULA 5LOVB 1ASQA 3OKNA 4GEIA 5EBWB 3EYQC 1LYQA 1MRCH 1TF4A 3CVHA 2J88L 35C8H 1BQSA 2OW6A 4AYGA 3FUJA 4CC5A 1Q0YH 1OM3H 1EAQA 3NFSH 3NQIA 5D96B 3RTQA 3LN9A 3BGMB 3FNKA 4O4YL 5J12B 1JE6A 4AK1A 5LN8A 5ADOL 3FCBA 1AYRA 1I08A 4EBQH 4GAGL 4BSWB 1NWPA 1BFVH 4ODTL 2PTMA 3JWOL 2JIZG 1AZNA 2B3IA 2DMCA 2X4OA 2IC2A 3F2LA 4UCTA 4PJFB 1Z3RA 4OI8A 3STBA 3HKCA 2WMPA 2HVKC 3MO1A 4JO5A 3I85A 5DJ0B 3JYCA 3MUJA 4WY7L 1ZEAH 5EZIL 2WXKA 3SN6N 2BRQA 3TU6A 2QWNB 4HOMA 4XVUC 4JJ5A 4Y7OC 3ABLB 5L3BA 4X6DE 1AOHA 3Q4HA 3OB0K 1DBBH 3VXPB 5JOFA 1E27A 5D2NC 4ZSOA 1N67A 1TQBC 5FKAA 1SXCA 1PQZA 2PXYD 1DEDA 1MHEB 4CADB 3ARGA 1FFNA 4JRWA 1KTRL 4UM8A 3NZ8B 4Q6IA 2MMXA 5IFAH 4NXSA 3EO9L 2HKFL 5DWUH 5CUSL 4NGHH 3IGAC 5B39B 3OR7B 1J1OL 4L0ZA 5SV4A 1FA4A 2XWXA 4PSPA 2QA4V 3Q6GH 4AY0A 1MOEA 2HP4A 3DV4A 4N20A 3AQDA 1MCLA 4QTIL 1W8NA 5T8IA 1GZHA 1X9LA 1I8IA 1PNMA 2DICA 4K8RL 4N68A 3BDYH 4X5XA 3QRBA 5IYBO 4MA7H 5EBLA 4NQQA 1CBVH 1SOQA 3FQTA 3MLWL 2QL1A 1GVIA 3L3DA 3CJHA 2XKUA 1ACXA 3UJTH 2W0LA 1FSKC 5KBNC 4QT5A 1NCTA 3CCSV 5IFJA 3D3VD 5T5FH 5BV7H 2OSWA 3U9PH 4M3KB 2FJHA 4HYTB 4XI5D 2V33A 4JRYD 4I77L 1P5UA 4UINL 1WBZA 4PV9B 5ITZA 5LDSA 5DSCA 3L17A 2AEOA 3TONA 3CFMA 2GHWB 1M4KA 2NYYD 1S78C 3OVUB 2I9TA 1XIWC 4K8RD 1U96A 1E5YA 2AQNA 2F19H 4P06A 3EXJA 4OZHE 3BW9A 1P7GA 3P0GB 4RISH 3GJFB 1MABG 2H45A 1EJ8A 3ZMUA 1CD1B 3BAWA 5DO8A 3QS2A 1K72A 5A2BA 1YEJL 2NX5E 4YHNB 5IVXB 4F91B 4MMZA 2GIYA 3D0LA 2D3OW 3KPLA 2A9MH 3QORB 4FXGC 4A6YB 2H6OA 4AQAB 4K94C 4BWWA 4CNIA 4MXVE 2AW9A 2OTWB 4J3OG 4E0RA 2P5WE 5DK2B 5EU6E 4JI7B 5LCVA 2OP4L 4Q9CA 1NGZA 5H4YA 2WBJA 1BVNT 1U3HD 3D2UD 1ED3A 4IDJH 3RHWF 2VR3A 4RETB 1H15B 4YSTA 4DV3B 4LF7O 1B6QA 2DS4A 2H6UA 5AW3B 4OV5B 4NUGL 5ACZA 4Z78B 2ZDIC 3WFEL 5KSAA 5I76A 1ANUA 3KAAA 3WGVB 2HKOA 5F71A 3BD4A 3BJLA 4J7RA 3BWZA 4X6DB 1QFWM 3JTTA 3P3TA 4GRMB 4AT6A 3S9DB 5DLML 2VKXA 3ARDD 5IQOA 3B1TA 3H3BC 1F3DH 1L0YA 4YNYA 2RBLA 2ZIDA 5IKCA 3FQRA 2WLIB 2ZE6A 1IIIA 3AG2C 5K9JL 3CE1A 3ECWA 2P6JA 3DDFA 1QHTA 1I9JH 3VH8B 4XCFH 4YHML 2WQSA 4GKZB 1JVMA 4Z1MG 5IHZA 2YAQA 4PJHA 3VG0H 3MJ9H 5T3XL 1SYSA 4PJIA 1IBZA 3WFHB 3A6BH 2HA1A 1DE4B 3I9AA 4ORGB 3QG6A 1JZHA 4LSSH 3W82A 1F4WH 3AGVA 3MDSA 1H6TA 5TDNA 5KA6A 3E83A 4UU9B 4Y8DC 1VSCA 1FE8H 1BL8A 5IJ0B 3D4CA 4NZTL 1TZIA 2GUZA 4OZGA 3AG3C 3P77B 2CMRL 4YHLH 1F11B 1WBYA 5TGBB 4AIZB 5BPPA 3KLSA 1E42A 3OJMB 4U6HA 2NOYA 1NJ9A 3VWKB 3OGIB 3O2DA 3E8FA 3BX7C 4QRRE 2XASA 1C1EL 4G6KH 1FJ1B 3NCEB 4B9IA 1U2HA 3IMUA 4OZHB 4YO0A 1W0JG 1TQTA 1XGQA 4N2BA 5AAPA 3CZNA 2AEIT 2JK5B 2FTAA 2G75B 3RVVD 3APCA 1JNLH 5F6HI 4MW3A 1A7NL 1AI1H 1MJ7H 1BIIB 1HL9A 1RK0A 2NX5B 3AY4C 1U58A 3IYLW 3VRJB 1X5MA 2G2RB 2LU3A 3GSWB 4OLWL 3CN1A 3R06A 4NSKA 5FA3B 4HS3A 5DVOA 1KT2A 2J1WA 4AGQA 3FAXA 1M9SA 2Z8VC 2P5WB 4JFFB 3M1BA 1M2VA 4AQOA 3VGGA 1BQKA 2VM4A 4FXKB 4PMFA 1BXAA 2D7QA 1BQLL 4M7ZC 4Q4EA 3LNFA 1ZA3B 1AR1B 4PGCA 5FK9A 7PAZA<