2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
1OCZB 1NIEA 3H4HA 2VM3A 1JZGA 2VSKB 4E9SA 4KO6A 2AFNA 5B7EA 1WS7A 1ZPUA 3T6XA 3N55A 1KBVA 3PXLA 3FQYA 2XV3A 4UF7C 5B1KA 5B7MA 1HAWA 1WAEA 3AG1B 2IDFA 1ET5A 2BP8A 4HIPA 1DYZA 1AANA 3UGEA 3NJKA 5I6MA 2J55A 4GXFA 1HAUA 2YAQA 3OQRA 4E9RA 4FA7B 3FSWA 2YEVB 1JZJA 2IDQA 3JT2A 2BWIA 3NYKA 3AG4B 3GDCA 4BDVA 2ZWNA 1JOIA 1SF3A 4DP6X 1J9SA 5B3SB 2IDTA 1W8EA 2XUWA 3ABGA 4QLWA 2HLEB 5A7EA 2MTAA 2W8CA 4DPBX 1BXVA 4P5RA 5I6OA 3ABMB 2Q5BA 4E9QA 1E5YA 2DV6A 3IN2A 4HHWA 1AG6A 4MFHA 2FT6A 1OE3A 5D4HA 3ZIYA 4DPCX 5AKRA 1E30A 1L9TA 3NSDA 4DP1X 4CSZA 1IBZA 1NTDA 2QT6A 3AW5A 3QJTB 1T5KA 2VW4A 3CZUB 3TBBA 4A67A 3NJMA 4UAHA 1KCWA 4M3HA 2XX1A 2GSMB 1IUZA 4YVNA 2PPEA 1AIZA 1QNIA 4YSQA 1NINA 2IDSA 3CDZA 5AZUA 3FYEB 2CAKA 3FSAA 4M4RB 2AANA 1L9OA 3TBCA 1RCYA 1WA2X 2PCYA 2PPDA 2I85A 2EIMB 3FU7B 4E9TA 4L0PB 2ZONA 2FNWA 1L9RA 1XMEB 3KW8A 2R7EB 1FWXA 3WNIA 1E5ZA 3X1EA 3CVCA 2OV0A 1OE1A 4KOCA 2DWTA 1L9PA 3PAZA 2JFCA 3NT0A 1J5CA 1ZDSA 2LLNA 2UXTA 4JHUA 4KO5A 3TA4D 2HRGA 3GXUB 2BZCA 2XVBA 4ZK8A 1AZRA 2CCWA 4BXSV 1JVOA 4P5SA 1BYOA 4DP2X 1AZBA 3NJFA 1PAZA 2X88A 1UATA 2YAPA 1MZYA 1SHWA 2ZXWB 3KW7A 2OJ1A 4BWTA 4G7SB 3NJGA 2BP8B 4W9ZA 3OMIB 4UANA 2CUAA 2FQEA 2EINB 4BWUA 1GY2A 1NWPA 1HFUA 3BQVA 1AOZA 5EHFA 3H4FA 1FA4A 1JXDA 1AACA 1ZIAA 4DP5X 3NJNA 5D4JA 3QJRB 1BQRA 5I5JA 1URIA 2RACA 1M56B 1PLCA 4BDVB 1DZ0A 3NJJA 2HZHA 2GC7C 4YSDA 3EH3B 5B1JA 3UABA 1BXAA 1EZLA 1CYXA 1NWOA 4AKQA 4HALA 4N4YB 4WKXA 1R1CA 2XXGA 4A2FA 1OCCB 1CURA 5I6NA 4KO9A 2IWKA 2EIKB 2NRDA 2UXVA 3ABLB 1MG2C 3PPSA 3S8FB 2YAHA 3SBPA 2BP0A 3FPXA 1J9TA 1SDDA 2DYRB 1TU2A 1JZFA 3UAAA 2FT8A 2UX7A 4KOBA 4W1TA 2J56A 3T6WA 1KBWA 3OMNB 2Q9OA 4YSCA 1J5DA 1JZHA 3NJHA 1NIDA 3WI9A 4WTQA 1B3IA 2I7SA 1OE2A 5I26A 5D4IA 4A2HA 3NSCA 1W6WA 5B1BB 1IBYA 2B08A 2E86A 1M9WA 3T6ZA 2PPFA 3WIAA 2XU9A 4G7QB 3WKQA 2BO0A 1NIFA 3U25A 4YSTA 3WG7B 3FPYA 2FQGA 5I28A 3X2QB 1V10A 5LDUA 2YAMA 3X1NA 2VW7A 2HX8A 5I6PA 2XV2A 2PP8A 3FSVA 2EIJB 1OOWA 3SBQA 1L9SA 3IE9A 2GIMA 2GI0A 2FTAA 4GY4A 3MX0B 1XB3A 1J9QA 1SJMA 6PAZA 1PF3A 1JVLA 1N68A 1ASOA 4QKTA 1BYPA 3AG2B 1JZIA 3EH4B 4BK5C 2GB2A 1X9UA 3C75A 2WO3B 3SQRA 3DKHA 4KNUA 2BZ7A 2EILB 1XB8A 1F56A 3OD3A 1X9RA 2H47C 2CJ3A 2CALA 4EF3A 4AKOA 1PZCA 1RKRA 5I5IA 2P80D 3NP3A 1ETJA 1E65A 5AFAA 1OF0A 2BW4A 3AY2A 3QJQB 1W6LA 2JKWA 5F7BA 3SBRA 2YQBA 8PAZA 2FWLB 4GP5B 9PCYA 3X1BA 2J57A 2QPEB 1A4AA 2FT7A 3MBWB 1GS7A 1AS7A 4G70B 3PLYA 2FQFA 3X1GA 4HCFA 1PCSA 2FJSA 1CYWA 3PCYA 4F2FA 2QPDB 1ADWA 2YAOA 2B3IA 1SFDA 4HZ1A 2UXGA 4E9XA 3HEIB 1GSKA 2MRYA 2YAFA 4NAJA 2AVFA 3TASA 2WO2B 3CG8A 1GYCA 2QDWA 3UADA 3ZBMA 2VM4A 2Y1AA 2ZOOA 3IEAA 3QJVB 1BAWA 2IDUA 1GS6X 1XB6A 4YL4A 3UACA 2N0MA 1QLEB 1KV7A 1SDDB 2VMJA 1PNDA 2XX0A 7PCYA 1ZIBA 1ZDQA 3FU8A 4GP8B 3FS9A 2PP7A 3ERXA 4DP7X 3CVDA 1ET8A 1AS6A 1A8ZA 5F7AA 1ID2A 3N2JA 3V9CA 4X4KA 3QPKA 4JHVA 2YAEA 1BXUA 1WS8A 1N70A 1SFHA 1TEGA 1PMYA 2PP9A 2XWZA 1J9RA 1A3ZA 1CUOA 4E9VA 3DIVA 1AZNA 5B1AB 1WA0X 4GP4B 3S3BB 3JTBA 4G72B 4YVUA 2BWDA 1ILSA 3D12B 1PZBA 2FQDA 3T6VA 4DPAX 3HB3B 1RZQA 1ET7A 4HCIA 2Y69B 4A2DA 3QQXA 3L45A 1NICA 1OCOB 2YARA 4GYBA 2VN3A 4ENZA 1V55B 1SHXA 2PCFA 3ASOB 3S3CB 2HXAA 2XYBA 1MG3C 4KNSA 3PAUA 1BEXA 5FC9A 3ZDWA 2CBPA 3FT0A 2TSBA 5E9NA 1M57B 1QHQA 4AI7A 3AG3B 1AR1B 1GW0A 5I6KA 1JXGA 1NIAA 2P80A 4YSAA 3CDZB 1PLAA 1L9QA 1GR7A 1PY0A 2H5UA 1ILUA 4N8UA 6PCYA 3AZUA 3EHBB 4YSEA 3BVDB 5TK4A 1A4CA 1KYAA 1KCBA 4YSOA 4KNTA 3GYRA 3OM3B 3FQ1A 3ZX1A 2OCCB 2JXMA 4Q8BA 4YSUA 4E9YA 1IKOP 4HAKA 4CSPA 2GC4C 1BQKA 3ASNB 1ZV2A 4YSPA 4F2EA 2AZAA 4AKPA 1ASPA 1ASQA 1JERA 2YXVA 3QJUB 4G7RB 4Q89A 1KDIA 2AZUA 1AG0A 2VSMB 1KDJA 3FQ2A 2HX9A 1A65A 3UAEA 3ABKB 1AZCA 3TU6A 3WNJA 3WKPA 4TXVB 2BHFA 1A4BA 4F7KA 2DY2A 2HRHA 1AZUA 4E9WA 2J5WA 1OCRB 3G5WA 5ANHA 1GY1A 4YSRA 4PCYA 4HCGA 2XV0A 4RH4A 3OMAB 4DP9X 5I5MA 1WA1X 2H3XC 3V9EA 3FSZA 3EH5B 4A2GA 1AS8A 4NB7A 2IWFA 4AX3A 1NIBA 2GHZA 4G71B 1RZPA 4YSSA 4A66A 1NPJA 4PAZA 5IY5B 1V54B 3NJIA 1OV8A 3NP4A 4HHGA 4FAAB 7PAZA 5TK2A 1TEFA 1E67A 1MZZA 3H56A 1VLXA 5B1JC 1KGYE 2XXFA 3NSYA 4A68A 1SF5A 4BWWA 2QDVA 3IN0A 1SNRA 2PLTA 5PAZA 5I6LA 4AZUA 2I7OA 5PCYA 2VW6A 1PNCA 2BP0B 2TSAA 1EHKB 3IBOA 1NZRA 3X1FA 3T9WA 2IH9A 2PPAA 1GS8A 4DP4X 1AQ8A 2XLLA 2X87A 2PPCA 4K9JA 2DYSB 3CVBA 1FFTB 3S8GB 2A3TA 3S3DB 3FYIB 3PAVA 1I53A 3DTUB 1JZEA 2IAAC 3EF4A 3RYMA 4DP0X 4NERA 1IC0A 5B7FA 1AAJA 2UXFA 1PZAA 3T71A 4A2EA 1BQ5A 3FU7A 4JKNA 2DWSA 2HX7A 4DP8X 1NDTA 1PLBA 2YXWA 3NJLA 4BXVA 2R7EA 3QJSB 2IH8A 1MDAA 1TKWA 2IWEA 2W88A 3FU9A 2BW5A 1YLBB 1CC3A 3NSFA 4KO7A 2GBAA 1JXFA 2UX6A 2WSDA 1NPNA
chains in the Genus database with same CATH superfamily
4YR6B 4KVCL 3IFPA 2WJ5A 2A83B 2JK5B 3CLEH 2F66C 3L5WB 3R65A 2NCEA 2ENYA 4RAUA 3ILPB 3GHPA 4L37B 3EUUA 4QJ4B 3QDGE 3T8MA 1GGCL 1YPZA 1SA0B 2XV3A 4JI5O 5JXAL 1BPLB 4X1YB 1NKOA 4DFHA 4D9RE 4P05A 4QIWF 1RUQL 1EDQA 1WAEA 2UXDO 3AG1B 1K85A 5EOCL 5FX3A 3OR6A 1QBMH 5AYTA 1JV2A 1Q9KB 1JFHA 4NEHB 4KWUA 1TCRA 1E8ZA 4IOIA 3KDMA 3CRAA 4GSRA 5FM5O 3JD1A 5ESQA 1SOKA 2QSCL 3DX9A 2UZYA 5HHOB 3UAJA 1I82A 2A9NL 3GMQB 4RGMC 1G6VK 2N7AA 3B7UX 3K59A 2WXGA 5A2LH 4KKZA 5GSRB 1LEGA 1XNQO 1BLIA 4MA8H 4I5BB 5BRZA 3BUBA 4DP6X 1IARB 2OK0L 5EOQH 1P1ZB 3QO5A 1SESA 4U4IA 4M48L 2JS5A 2B1OA 5K93A 5D93C 2EYTA 4LHUD 4B95C 2IFFL 1I8MB 2MTAA 3DIDA 3K81A 3SKJH 1FH5H 3VVVA 3W9EB 3VGFA 1M5IA 3ABMB 1QLFB 3O45B 4IYKA 4PCSA 5DD6B 5CIPH 5SWSA 1GZHC 3TLRA 3ESUF 5CIPA 4Y5VC 5JA9A 4Y4HD 3U9PL 1HR0B 4M7ZB 4WHTB 5E6YA 3G6AA 2JGDB 1I7UA 2X3AA 1K6QL 5ADPL 1G1OA 2CA4A 4WFEA 4X98B 1ZHBA 4J27A 4CC1A 1KCWA 2W1NA 1HP8A 1JGVL 3D39B 2OMNA 3AT9A 3PWNA 3UEQA 4R7CA 3FFCB 4U1JA 4IBSA 4JRYE 4TPRH 4KHPO 3ZMNA 4OZIB 1TOXA 2PETA 4WV1A 1F6AA 3E8UH 1HEZA 3HNSH 3OF6A 4F6RA 2DKMA 2ZF8A 4F7CA 2Q0OC 1OB1B 1HOEA 3BDXA 4LH6A 3GUFA 5DXWA 2R2EB 2PPDA 1J05B 5E8OA 1XAUA 4EIZC 5MEOA 2AKRA 2IADA 4K3EL 2XETA 1J0IA 1EGJL 2DF3A 1VQ8V 1SXZA 5LGTA 1BPVA 1FWXA 3BHPA 2AJXL 1ES0B 4OX9B 5HVHB 3HLKA 3JTSA 3CVCA 5DTFB 4Z0XB 4X99A 3FO1B 2LABA 3NT0A 3Q5OA 5L0QC 1MJUL 4XTRC 3RVWC 2WLJA 3VMPA 4OLVL 4A55A 4UQ3B 2DEWX 4P5SA 5DLLA 2IMNA 2LFEA 5E0FA 1YEEH 3IDUA 2W0XA 5C8YA 2YSSA 5CWSA 1A1NB 1AI1H 2GTSA 5I0ZA 4OLUL 1MCQA 2VB5A 4L18A 2QTEA 2A9CA 2JVDA 2OJ1A 1PAMA 4IJ3C 3K9AA 4G7SB 3CFQA 4NWUH 2P47B 2GUYA 5AL8A 1A4KA 4FLZA 1DLHB 1PSKH 3ZDZF 1CF1A 4FXGB 3AMLA 5EHFA 4FZ8L 4FFYL 32C2A 1ZIAA 3A47A 5KSVA 1YY9C 1QEXA 3QJRB 5D7SL 1X4XA 4AT6B 3L8QA 1DZ0A 2VRAA 5IR1A 3EH3B 1EBPA 3V6ZB 2WXRA 3MRFB 5IJKC 4G8GB 4KK5D 3A0OA 3P3YA 1Y07A 4FS0A 5DEDA 3R8QA 4ZFGH 3ML8A 3ZSTA 4KBPA 4AKQA 2AZ2A 5KJRH 2WCPA 3NJXA 4JR9H 4N4YB 4GW5B 4PRIE 5C70A 1YA5A 5ITBL 4ETQA 3BZFB 4WWID 5HBBA 4YXLL 1I75A 4DK3A 4XZUB 4POZD 1TZIA 2X6VA 4M8QA 2J5LC 2XN9B 3MUGA 2KH2B 4JE0A 4PYHA 2XA3A 4PJDA 3FO0L 1J9TA 1R3IC 3BAEH 1RUMH 2WOYA 5G5DA 3CJHB 1JZFA 3FL7A 4UT7L 4ZFOL 4XP9L 3QBTB 2WQWA 4L87A 2XUMA 1ZVSA 2NY3D 3MACH 3KYKL 2BIQA 3K6NA 1U8OB 5HYJA 3MYJB 4FC3E 3GBLA 2I9TA 1GH6A 2DBJA 4CADB 2B9BA 3HKBA 4NN7C 5KEZA 5A2JH 5B1BC 4Z2WA 4V1DE 1G9NC 1W72H 4GPVA 4DGYL 4GUNA 1W72A 2ATKB 1SEQH 3WKQA 1AZZC 4G9FE 3Q8FA 5LMNB 3O3DB 2BFVL 2C34A 4XWGL 2ADGA 4JI6O 3MOAH 4HX1A 3CSYB 5HVGB 3IXTB 3HS8A 3IMWA 3VRJB 3H7BB 2OR7A 5BO1L 5IFHL 4OUUA 3ZMSA 2XZAL 3IVKA 4AV5A 5DMKA 3MHZA 3DSQA 5J12C 1B0IA 4RMWA 3G5ZA 3FTYA 5C0JB 4XPAH 3B5HA 1I1AB 4LBEA 1ASOA 2F23A 2XNAA 3RZCB 2X3BA 4I0PD 4U1SA 1GC1H 4WFGE 5EU5A 5E4EC 2J8UE 5SWQB 4R4BB 2XG4B 4FZEL 2W9EH 1X7TA 2GJ6D 1LVEA 2CALA 1CE6B 3U2SB 3QRGH 4WY7L 2FSEB 3DVNB 4Z0XA 4PEEA 5GRVL 4U1LB 4IGGA 3BT0A 3DTXB 5GS2D 5GSVA 3WEXA 4XNMB 1RUPH 3QJQB 4ZFFB 4N3UA 1DCLA 3N43F 2YQBA 4CGUB 3T4AA 2CU9A 1YITV 4I2XA 2C9QA 2N59A 3MREB 5DC9B 2AJUL 4MKTA 3KPNA 5LP6A 2XBDA 3GXIA 3L4YA 3EJYD 3T2LA 5DJAA 4QRUB 1RHHA 2ENQA 4FYQA 2AJYH 1PCSA 2C3XA 4XNQB 4H8QA 3CXDH 3AS1A 3MRKA 1RZJC 3CYOA 4S1DD 1B0GA 2HVJA 1X7QA 3RA7L 4QJFB 4YBLB 1D5MA 3JALA 4U3HA 4L4TB 1VIBA 3RIFK 1HIMH 1UT2A 2OMBA 1ULVA 4XP5H 5GGQL 3Q1EA 3CC4V 1AROP 1DQQB 3O6KL 4CZZA 2KDGA 5LCVH 2AK1H 3WELA 2VLRA 1NEPA 4X20B 2NNFA 3MLWL 1GGBH 3LXUX 5DMGD 5LCVA 3UACA 2MQCA 1PNDA 4L3ED 4ODVH 3LD8C 2XY1A 4LMQI 2NY5L 3DOIA 1RSOA 5F44A 4X6DA 1UA6L 3ERXA 3ZL4H 4LAQH 1X6NA 2CRMA 4WUUE 2E6QA 1R17A 4AEFA 3WUZA 1C5BL 4XMKH 3MRMA 1HT6A 1U21A 1M56C 4PB9L 5C3LD 3P30L 3N9GL 5F0MB 4P57A 4S1DC 4H2CA 3SKNB 4YHNB 4DNLA 2PP9A 1XD0A 3GO1L 5GJSH 4R96A 4NJ9H 1MF2H 3KBHE 2X4UA 3L08A 1FYTA 4GP4B 5C3IA 1N8ZB 4HT1L 1Z5LA 4YVUA 3T6VA 5DMGC 2MKWA 3WJLC 4FL4B 4J6RL 4PRAA 3H1LH 4MTXA 1NCBL 3RKDD 3CC2V 1MCEA 3KPQB 1SEBB 4JHAH 5A6LA 2RTTA 2L8AA 3BWSA 4HH9A 4CL7A 1EO8H 4B9FA 1RUKL 2RH0A 4WUKH 4I13B 1AZVA 1PEZA 3S3CB 4BKLB 1JD9A 2H32H 2WIIA 1TQVA 4ZBMA 2YK1H 3FRPA 4MAYD 4RMTA 5FC9A 1I3RA 2CBPA 2H32A 1GJWA 4IDJL 5FGBA 5CCKH 4HU2A 4YXKL 4AI7A 1KCUL 2A38A 1AI5A 3OJDB 5EZJA 3ARFD 3WEOA 4Q9QL 4MMZC 1FD9A 2R9RB 4G6KH 4O4YH 1NCWH 4OFIA 2HTKD 2A9AA 1JGDA 1IILE 3GMLB 4RETB 4FIPC 2DJUA 1RQ5A 1SXAA 2DQFA 4HK3N 5AL0A 3V6BR 4DO4A 4HZ3A 3AREB 4PJXB 4V2CB 5I1GH 2A4CA 3ATEA 2YHGA 2ZIMA 4LF9O 1JPXA 5DUPL 2EE9A 2VR5A 1XHXA 4B7KA 4XMVA 1MWAL 3WL9B 4DEPB 3L5XL 1NLBH 3MRJA 5EEXA 4MAYC 4I55B 3J80N 1UOVA 5T5FH 3THMH 5F7FA 2R0LL 3QR1A 3EYOA 1A7QH 1AD9B 2IG2L 5HDQH 5T5FA 5TPWL 2BNRE 4NQVA 1E50A 1A65A 1HQ4B 4BBWA 4Z1PA 3FQ4A 4JAAA 3ARFC 3QB7C 4Q9BA 3QZNA 2BS71 4HIEB 5E8PB 1R1BA 3WKPA 4PV1B 4DR7B 5A2KH 5MEPB 2NW2A 2XTLA 5AW1B 1LWJA 2CHWA 1KB9K 2FBRA 3NIGF 3QFJA 5JUEH 4XB8A 4H88L 4HCGA 2FJGB 2ZKHL 3RI5K 1XF2A 2AJ3B 3TBWB 4Z7WA 2IJIA 3IFXA 1M7DB 2VQ1A 1AVAA 2XNDG 2Z34A 2DDQL 3I6LD 2I9LB 1SGKA 2YIBA 4Y9FA 3D9AH 2AGJH 1AFVH 5L7XH 4MWFB 1WWAX 4B3TB 2GCYB 2VLJD 2CMRL 4GKNA 1N36O 1IM3D 1UWXK 1C16B 1EM1A 1PM9A 3CFEB 4OZFH 3VGAC 1CGSL 4AX3A 2CO1A 4OZFA 4UNTA 1NIBA 3TBYB 2Q10A 1RZPA 3IDIA 4KI5C 4N2HA 5CLXA 4Y2DD 2Z7ZA 4NX0A 3TFBA 1WAZA 4L9LB 3CZLA 4GXVH 1K9MW 3DXAA 1OV8A 4O58L 3VRIB 2PYEA 4IEFA 5E4OA 1KELH 1L0XA 1VLXA 1MAKA 5B1JC 1UXLA 2V8LA 3K6SA 3GSRA 4LCUC 1AOHA 4G5ZL 1JGUH 5EU6A 1KIPB 3QO1A 2V3FA 1X59A 2YPLE 1IVSA 2CKBB 2OMUB 2UWEF 5DFWH 3S3WA 4M6MH 3GZOA 1JPTL 5J7CC 2A1WH 4HJTA 2AAAA 1D5IH 1R24A 1SVBA 3CC7V 4ELMF 5AYUL 5J1SC 2VZ3A 5DHMC 4NWTL 5FPIA 3VWKD 2P8PB 5PCYA 3GS0A 5LKNA 1BM7A 1OAKL 3OB0H 4TL5A 1DQDL 4Y9EA 2BLFA 3PS6A 1SRYA 3T9WA 2LVCA 4I0PB 3ULVD 3WFHA 1OALA 1FO0H 5TD4A 1I5XA 2IGTA 3DX8A 3CHXA 3QHFH 2DYSB 3K2UL 5BXFB 5I2IA 2GJ6B 4OCYH 1MKFA 3ZGHA 3V6OA 5KHIA 4B3MO 2XQYA 3HE6A 3ZO9A 2FB5A 1BF2A 1U93A 3ZJZA 3CC1A 4IU3A 1XIWA 2BSKA 3NFSL 4GAJL 4L5FL 3ROLA 3QIWD 1PX3A 2DH3A 5H2BB 5B1AC 4AYFB 1DQJB 4MXWL 5LGUA 3NXSA 2YMTA 2Z92A 1KENL 1CL7L 4TQPA 3L4XA 1RV6X 4ZMZA 1XHHA 2CK3G 1JPGA 1KTKE 4AW7A 5LL6Y 4AY0A 2BHYA 5BUPA 2EC8A 1FF5A 1PLGL 1PDKA 2BW5A 1MXDA 4RIRA 3QORA 3TNMA 3ULVC 1ITBB 1N5AA 5I75B 5C0DA 1BAFH 4K5LA 3QYCA 3VD4A 4MJ2A 4GCZA 3GT6A 3WTYA 3GHBH 1D2DA 4WGVB 4U3SA 1MOFA 4FQXD 5CLZA 5CEZE 2F5BH 2GBVA 2J88L 1BT8A 4OB5H 4WKZA 4YNYB 5F3HB 2NUTA 4X6CB 5B7MA 4X4ZA 3EYSL 3C6LD 1UZ6F 1E0OB 3IFLH 4JI5B 3NEOA 2NQDA 3UJIH 4M1CC 4S1SH 4OZGB 2UXDB 3F5WB 2X1WL 4N8CL 4PD4J 3JUZA 3QWRA 5MERA 1H8NA 2Z7UA 4UTAA 3KWTA 1WAAE 1MFAL 3N1FC 1UKSA 4KUZL 4WWKD 4HJGB 1H9DA 1NGYA 2CR3A 4KJQD 1U8NB 3LNIA 5B4MD 4K8RD 2IDQA 4PVBA 1ZK9A 4J4PD 3L95A 5BVJB 2AV1A 4IRJB 4UDUB 2BTOA 2OMZA 2V7HA 5A16B 2F5AH 5KSAD 4FQXC 2GTQA 4WI3A 1GAFH 2XUWA 4L1DA 3ABGA 3RWGA 3T2NH 1XNQB 4PN6A 1JYXA 3ABKC 1N67A 4M43H 4Z1MG 5T5NG 1CE1L 4YC2C 5ABDE 3ARZA 4JO4H 3TO4D 2NXYC 1FHGA 2KUTA 2QPUA 3VH8G 4HUVB 3PWLA 3CMAV 3W0WB 3NGBB 4ODWB 4QTHA 3HUJF 4JFFD 3BUYA 4WWKC 5AKRA 1L9TA 1ZHNA 2KPNA 4PGCB 1WSST 5TE6H 4QRRA 1DVFD 2BZDA 4P99A 4YFLI 3CDYA 5DN6G 1AC0A 3VQ1C 2EKSB 2Z3FA 5EUKB 4RMSA 3VFSA 4G43B 4LLQB 2WXPA 5I66B 3ULUE 5DD1L 1U97A 3FHQA 3RUGB 1JBJA 3GMNA 2FECL 1D6VH 1PIGA 3GMRA 1DSFL 4G8FB 4JRXE 5C0CE 3ZKQD 4KHPB 1O5PA 4GAYA 2AANA 4K94L 1T20B 1JCVA 2W0LA 4JLRA 4LCWA 1H3VA 5ANMA 3V7AG 4PA4A 3CFDB 1JMKC 5IIEB 4BKTC 1I4FA 2YD6A 1FL3A 2CZNA 2EDFA 3O2VL 3QWQB 4JFEA 1K2DA 1VFBB 1YZBA 4BUQA 1MVUA 4H2AA 2EXTA 5A6IA 2P7TB 3BUTA 3MCKB 3NPSB 3BN9D 4JDVB 4TYUA 4XVTL 1NMBH 1ONQB 1MCIA 3C8DA 2FIKB 3DXRB 1AXTH 1H3TA 2JFCA 4EDXB 4QHKI 2WJ7A 1ZLUH 5HGAA 3RWJA 2P26A 2C1PB 2XSKA 1MSWD 4BXSV 4HAGA 4PB0L 2OI9B 4AQAB 1CU4H 4ELDA 1PL4A 3ZMRA 4YDNA 4FD0A 4MMXB 4AGLA 4WTZA 3TIEB 3LRGA 4R8WL 5D9SA 4BWTA 3NJGA 2VLJB 2XRAH 5FW8A 5JA8B 4R3SB 3A0BZ 3G9VA 1M1XB 3AB0B 4X8XA 4ZMVA 1AOZA 3MV7A 2I25N 1R9FA 2D7PA 4Y2DB 1CCZA 1Q1PA 1Y18A 3L3IB 3AGVA 2OX5B 5D4JA 2FL5B 3H01A 5L2KD 3O3AA 2CLZA 1BQRA 2PKDA 1URIA 5KAQF 2FR4A 1VP7A 3LN9A 1ZLZA 4AYDC 2FB4L 4JG1L 5LXTA 4DQOL 1CLCA 5DFTA 2LTQB 2YOCA 3VNZA 4CSTA 5FYKD 1SS3A 5LLIC 2Q9LA 3TN0D 4Z7VF 4XB3A 2ZM6O 5DHVH 1U3HC 1VGEL 4GBXC 1F5WA 5DHVA 2O5NA 4JHWH 2ITCB 4MVZA 3N2KA 3T1HO 2UY6B 2FX8H 5DS8B 3II1A 1JPFA 3OEHG 4BUGA 1B0RB 3QFDB 3VWKB 4IIQB 1Q90D 4OCRH 1FN4B 4I0XA 2Z35A 3O9WD 3O2DH 2BSRA 4DGIL 2BP0A 1HNFA 1Q94A 4PJ7E 3O2DA 4KI5F 1INQB 5G2NA 4J23A 1SM3L 2F7OA 3TO2A 3VRLF 3OAAG 4KOBA 3QDGA 1KXVA 4X6FB 5IFJB 1IGIH 3W39A 2MTPA 3LKPB 2WVVB 2ITEA 3BWAB 1I3GL 3GTTA 4Y4KC 3U2IA 1VQPV 1FFOA 1E9PA 3FQUA 3TN0C 5I73B 3QIWB 3RL2B 5M7QA 4JJOA 1ZVNA 2OYKA 1W6WA 4J3OG 4J39A 2HH0H 3CZGA 4J3VA 1UD5A 8FABB 5ETUA 4F1SA 4UYPA 3LXAA 4JM4L 1J5IA 5GGRA 3RIAF 2R1YB 1S6NA 1S7TB 4F7MB 2YRZA 3NQKA 2FQGA 1HNZB 3RX7A 2CE6A 4XBGB 4H0IA 3MVSA 1S7QB 3UIYA 2IPTL 4FQLH 5GIRB 5DDHA 1SDAB 3ETDA 5IF0A 1EQWA 3A22A 3GVMA 4NKMB 1GSMA 2GG1A 3QUXB 2UUBB 1SJMA 5IB2B 2HR3A 4KVNL 5AZEL 6PAZA 4LOVA 4XC1L 4U2ZA 5HHXH 3SBWC 3UTTD 5ITZA 3MV8D 3X3GL 2F58H 4GZRB 4RFNC 2CUIA 2ITDA 3GMMA 3FTXA 2ORBH 5E03A 1O7DC 2G5UA 3T08A 4N6QA 2X1PA 1EEYA 5F7DA 4AOFA 3H9HB 4DW2L 4DO2A 3HIZA 3ULVF 2IOOA 4LNUA 4DJMA 1H6EA 3NAAL 1RJYB 2ZG1A 4N9GB 1OTSC 2QKIB 1L7IH 2AK4A 2IQAB 3FOMA 4JRYA 4DETA 4Y9CA 5GRYA 2V4LA 3P9MB 5KSAB 2YS8A 3VSVA 1MUJB 2QPEB 3FCBA 5I1EL 3HKCA 1YNTF 1Z3GH 2EDLA 2D2OA 3QQ3A 1AS7A 3D50A 1U95A 4U7MA 1TENA 3STZB 4O02L 3R7QA 4HCFA 4HCRA 1A9EB 3TO4B 1BLNB 3ZDZE 5CZKA 5BZBA 4X8JA 3FQNB 2LR4A 1WHOA 1WZAA 1NOLA 3EGSB 4I87A 2DL9A 1GN6A 1TUBA 3F58H 4JFFB 1NTKH 3EGXB 3KXFA 2AHZA 1XUQA 3IEAA 3MRLB 4OCWL 1DVFB 4AZ8B 4Z7OB 3HG0A 1BAWA 1D5XA 1Q0XL 4OZIE 4I1PA 2Q8BL 4YL4A 4E5XA 3T1FA 2QWNB 5KJ7E 4DN3L 4GX0A 2A74C 7PCYA 3E8FA 1GAXA 1DO6A 1DJZA 3FONB 4PBDA 3A6CH 2GITB 4TV3A 4X80H 4JS7A 4XAWH 5D71H 3BIAX 1MVYA 5JHLL 1NFDF 2VWEE 4U49A 1A66A 2AV7B 2NNCA 3C8HA 1Y66A 5F9WB 3CGTA 4HIXL 5JYMA 3GLDA 3VDCA 3PP3H 1J11A 4LSPL 3CCLV 3D85A 1KTRL 3QK0A 3ZRFC 1ENVA 4RWHA 5BXZA 2ICWB 4KY1H 2FTKA 3AK1A 2W60B 3RWRD 3MCLL 2FNBA 3UJJH 5KBLA 3Q5TA 4ANVA 5CM1A 2FQDA 4RSYA 5ERWA 5A2IH 3REVA 1GM9A 4RUFA 1F3RB 4UCUA 4FTVB 3P9LA 3WKML 3JATB 4NCC2 4DTGH 4Y4FD 2ZCKH 3LXBA 3WN5B 4PUBH 5D5MB 4GYBA 4QHMB 3QAZC 2ARJA 2HFEC 3WNPA 3MBEA 1V55B 2VUKA 3AAZB 4PRIA 3OTOB 4ZOLB 3QCTH 5DJ6A 3WAJA 2PUQT 2HPOA 3MA9L 4LF8O 3P1VA 1WZKA 2BM3A 3AG3B 3MRPA 4LB8A 4ODXB 5AKTA 1VQ5V 4FQ1L 3KVQA 4JDTH 4BFGA 2VDRL 1ACYL 2DQTH 4ZD3H 1JPST 2ISDA 1MCWM 4XGZB 2RFXA 5H94B 2ZWKA 4HA1A 2X4QA 3FTGB 2DD8L 4U7NA 2Y9RT 4LCCC 5IBLD 5AOZA 4GSDH 4NQQA 4FX5A 3QYMA 1ILUA 4U4BA 3K08A 5E6IB 4X7CC 1QFHA 5E2TH 1KCBA 5EN3A 4PRPE 4YSOA 4QHNB 1P7KB 2CO3A 4Y4FC 3VYOA 5HHME 3RTLA 3D2UB 5FOBA 3CPUA 3D09A 4PGEA 1AC6A 4NPKA 4F24A 4V1DA 3P4MB 3R06B 2VZTA 4YSPA 4QYAA 2V5YA 1BMFG 2YXVA 3MOQA 4G7RB 3M17A 3MGTB 1BQHG 3BH9B 4MJHA 4ALAH 5HPOA 2WWNA 3MNVA 1WDAA 3CE2A 5AOMA 4UV9A 3E6FB 4B3SB 4N0RA 1V7NH 3P77A 5EU7E 3RPIA 4WO4D 1NS1A 1L0YA 4UIMA 1A4BA 2KHAA 5C0EA 1VCBC 2HRHA 3D25A 3DGGB 3NCXA 4WW1A 5IBLC 5BW7C 3WE6B 3GUTA 1QTYT 2F7IA 1KB5L 5JCOA 1EXUB 1T4KB 3D0LA 2FJHB 3UG5A 2QR0A 4Q6GA 1HXKA 1TR7A 7TAAA 3E35A 1HJBC 3JAKA 1TZHB 3VSQA 1K8IA 4FEIA 2XQBH 4JX0A 3S4SB 2QA4V 1BQLL 1YN6A 3FB5B 3FB7C 1FIGL 3OUFA 1S7VA 2B59A 4FEMA 4DN4H 3C5SA 4YDKL 4Z7NB 5J89A 3LMJH 5D7LE 2X41A 1Z9LA 3F62A 4FNSA 3HG3A 1N36B 1LWRA 1ZT4A 2QQLL 4QAMB 5FGSA 4JREB 4JY5H 1JNJA 2Z31B 4X89A 2OP4L 2OKMA 3DLQR 3JWDL 2HG5C 3MQIA 3T6QC 5GS0D 4AENB 1MZZA 3ZIMA 1BZOA 2VIRA 1R47A 5KHKA 3WSQH 1KC5L 2QTOA 3TJTA 4JYCA 3B1TA 1F13A 2ERJB 4NRXA 3UTPD 3OLDA 1NKRA 4OJFH 3G6DH 4O51A 4PJ8C 4JBSA 4FYRA 5KN5A 3ZMZA 4AUYA 1ZS8A 4N22A 1S7UB 2MOQA 3APFA 5K9JH 1TA8A 3QVAA 2DQGH 1KLFB 2D7QA 5AD0A 4GFXA 3ZUNC 5J11C 1TGOA 5E7FA 5AVTB 4LLYB 4H5SA 1TU2B 2J12B 3UPRB 3MV8B 4AXWA 3VFPB 1PZDA 2H1PL 3UJTH 3W38A 3HRZB 4X7SH 1T0NA 2YC1B 1QNMA 3H3PH 3V10A 4Z78A 1H6FA 3CZJA 5IG7A 5D7IA 4LOEA 2ADYA 4MNGE 3LEVH 4GUPA 2PWGA 2XXCB 5GS0C 3ECVA 4PLKD 1SLVA 3GEFA 2YPKA 1XGUA 3NIFB 1G6RH 5LHHA 3MPCA 1XV8A 1G6RA 4XCYA 3S2AA 4PI2A 1M4UA 4FABH 1KGCD 1HS6A 3O8XD 4IRSC 5I1JH 1ZLSL 1LE5A 3UC0H 1S7RA 3GEWB 5TGBB 1KXTB 4MSWB 3D1MC 1AXSB 3FU7A 3Q5YA 4WUUA 2X2IA 3CFMA 3S2CA 4I5SA 2ZCLH 5KYYA 1FNSL 4MAUL 2PWFA 3NSFA 4DW1A 4DKTA 1WYJA 1IC4L 1I9IH 2WB1A 3S5LB 2WSDA 3BVNB 3CFCL 3HEIB 5D7JA 4QT5B 4N8VB 5H6RA 2CHZA 2CBQA 3S7GA 1R0AH 1TVBB 4WEBH 4PLNC 2YIAA 1MFCL 1OW0C 3N55A 4JPVH 3FQYA 4WQOA 5DJCA 2WZPD 3WTVA 2P8MA 4YLBA 2NZ1A 3VE0A 1FE8H 1KY6A 5DR5H 3KPLB 2EO1A 3FUJA 1SETA 1F3JA 1NKGA 2G4GA 2K9FB 2NY6D 4N1CA 3EZ8A 1ZT1B 3CZSA 3KLSA 4GMSL 5JPNB 1PY4A 3UTZA 4AMKH 1E2ZA 4G8IA 3TCLA 1RZKH 5JH7A 1QBML 4KQ3H 4R9HA 1NCTA 1DUYA 4E41D 2YAQA 4HPYL 5HGBA 3LRHA 1R5IB 4ZYKA 4OH2A 4JFXB 4E9RA 4EXPX 1YQVL 5T3XH 3L16A 5IVZA 5K1XA 1P2CA 3NIGE 4JFPA 2DI8A 2VRZA 3BW9A 4LOUC 4ZMYA 1KC8W 3LIZL 1LMKA 4JM2D 4Y1AB 2GT9A 3BIKB 4QLRA 3SJVA 1K4CA 2WWWA 3NQIA 1U8IB 4XN8A 4E2OA 1A1MA 3M1OA 2YXLA 4DRXB 2NY6C 2KZWA 4UIKL 1U8CB 3A24A 3MRBB 2H3OA 5SX5K 3LPPA 1E4HA 1E8YA 3SDYH 2JDIG 4WK4B 1JFFB 1T83A 1OF2A 4PBWD 2E46A 2OMXA 2ED7A 3T0AA 3G5XB 3QJHA 1UM5H 2VXUH 4HLJA 3ZIYA 4B7IA 1QSFB 4Z5RB 5GISL 4RBPH 1T66D 1QZNA 2EUXA 1ZHLA 4OSUH 4YHPA 4U1HB 1XFPA 3ZHFA 1FFQA 3BX7C 3O0RL 5E2UH 2XVLA 1RZFH 1N12A 2MPAL 2UWEE 4U1NB 2C5DC 3LHPH 4L8SB 4Y19A 2R29H 1MQKL 3DSNA 1KUMA 3OPUA 3A67L 1DBKH 2R29A 3V2AR 1QHPA 2COVD 4JDEA 4NXKA 4XMLH 5EIQA 1BG9A 2DIAA 2IDSA 2G3MA 3GSUA 4HG4J 5DJXA 1H3PL 4ZOEA 2ZXEB 4X4XB 4I48B 3WIFA 3HI1B 3TWCH 1IX2A 2WANA 5DVMA 1EV2E 3TWYA 3NABH 2V3DA 5L4IA 3OKLA 2I07B 2VDKB 2W0FC 3FU5A 1K3EA 3UTSD 5SWZD 1U3NA 1RZGA 1TKWB 1IXMA 1NCJA 1ZUQA 3T3PF 1L7TH 1S7XB 4V11A 3DUSA 1KLGA 4WO4B 5JORB 5IJVB 1Z2KA 4IGBA 1ZDSA 4KHTL 2LU4A 3GXUB 3GGWA 1WFUA 4MCNA 2XVBA 1PQZA 2VXQL 5BPPA 4DH2A 4FADA 2XJKA 4BGLA 1B3QA 2GKIA 3H9ZA 4CW1B 5FYJL 3L3DA 4AITA 5IVXB 3TBTB 3QUKA 3AMKA 4Q0XL 4X50A 5EIIA 2ZSWA 1JZ3A 4GLXA 2BP8B 5K39B 3Q2NA 1GYUA 1LGVA 3RNKA 5CA3A 2ZYRA 3LKQB 5HFMA 2B1HH 2PWHA 1MRCL 2F74B 5D6DC 4J8RB 3L3GA 2D03L 3NZ8A 5I82A 1PJWA 3EO1B 2OJZL 2WUCH 2Y23A 2B1IA 2J2ZA 2VC2H 1XGYH 4ODUB 1HCYA 1WWCA 4PTUB 5GW7A 3Q01A 4XCCH 3RURA 3X11B 5JHDD 1B6UA 1UZ6E 3MBWA 5DZNA 4B53A 4NP4L 4RRPG 4GI6A 2XWEA 2IAND 2Y36H 3D69A 4JZJB 1IGYA 1Y74B 2Q3XA 3DGCR 4OZHB 1A6UH 3SE6A 5BUAA 4K55A 1TQBC 3WLBB 4ZFGL 5IQ9B 2WNXA 1GGUA 2AXFA 4HALA 1NBQA 3RWEB 3CFUA 4XX1E 4LASH 3D3IA 2ZM6B 3FF7A 1QR1A 1N8RW 3SKMB 3EYFB 2H94A 3MAQA 4LVEA 3MO1A 1YTFB 2GJ6E 2YD0A 1KT2B 1L0PA 2BIIA 2IWKA 1VHPA 3JSSA 1UYWH 2UXVA 3ESPA 4FI7A 5CP3A 5IKCA 4RAVB 4F8LA 3S8FB 1S9VA 4W9FC 1CI5A 2YEQA 4MHHG 1AR4A 4N28A 1DBMH 1HXYB 5JOPD 2C3WA 5CEZH 4PI0A 1M7XA 5DRWA 4HS3A 1IX9A 1PZ2A 1YJ9V 2DB8A 1UJ3C 1U3YA 1G7QA 1HHHA 4KY2A 4OD1H 1GJUA 2XKNB 3T65A 3K74B 4G1MB 4DVRH 3O8XB 3LS5H 1U92B 1M9WA 5AAWA 4QRQA 3ES6B 5IJ9A 1JDCA 4JPRA 2VDLH 4E68A 1WAAA 2Y5EA 4JO8A 3RQ3A 3ZY7A 1QWNA 3FCUB 1GZPA 2XJLA 5AZ2L 3FO2A 3UZVB 1ESOA 4YHLH 5JJNB 2VW7A 3RJQB 2ZCEA 1GM7A 2SODB 2PP8A 2ICWJ 1KGWA 3FQXB 1G7JA 1HSBA 3QUHA 2CA3A 2CBOA 1L9SA 2VZUA 4UQCA 4NRYA 4LPTA 4L3EE 5D1XB 2X3CA 4KUCD 5CUSH 3VG9B 1ORQC 5J6HA 2BOBC 1UADC 1I7FA 3L3KA 5T1KA 3UBHA 1AKPA 2ZP9A 5FFGA 1QUPA 3DA0A 1BMGA 1TMCB 5GZOA 4F93B 1JZIA 3DYOA 5DS2A 1KTLA 2O4EA 3CWBH 3OG6B 1GC1L 3GJFH 4P4KC 1UD3A 2DWXA 3VJ6A 3KJ6L 4BIKA 2WSKA 4ZPVA 3GJFA 3RE0A 2QPSA 2BZ7A 2EILB 3TNNB 4XAKD 1SQMA 1M1KW 4IW4C 4U3XA 4Q4IA 2W9EL 4E41B 3ME0A 3JWNC 4ENED 4Q2ZA 4UM9A 5IW1B 4F27A 3F7YB 3RVTD 3LKSB 3DVGB 5F3FA 1T1XB 3K4DA 4XNUH 1H5BA 1A6WH 1DFBL 4J7KA 3TK1A 4JM2B 2WMPB 5CJQH 5E5UB 1N26A 4KXAA 1HWWA 1MFVA 2JQZA 1U8KA 3F12B 3BFQG 1FV1B 4JRXA 5C0CA 2G2RB 4NM8L 1UB6B 1GHFH 1FAFA 3S3SA 4AL8C 2O93L 5AOJA 1RZ8A 3ZE2B 4MX7B 5F1OB 2VZVA 1U41A 2W6JG 5D70L 2ZJSL 3FT4B 4KDVA 3UCQA 4IMLB 3I75B 3HAEH 5A6MA 4LLMA 1H3WM 3HAEA 5KBKA 2XAFA 2VS0A 2J21A 1FP5A 2LGWA 2ZOOA 3O6FC 3RVTC 2AEWA 2FJUB 4WSKA 2WXJA 2Q7GA 5LCVL 3CQQA 2OYMA 4OBRA 3V95A 3OR7C 4QXUH 1GGBL 2N0MA 2BRRL 3ARBC 1JYWA 3ZRWA 2D4DA 4P2AA 3KL0A 1YEFL 5ICZB 1NBYA 1UACL 1JWSB 4HUWB 4MMYB 3U7AA 1F90L 3MRRB 2R8SH 3G6JF 5EN2A 5C0BE 4LAQL 3WTSA 3RRQA 5EZYB 1Q1JH 1WISA 4ZIBA 2WTOA 4NO0A 5F9JA 1HVXA 1JHLH 2X2JA 5IB4A 3L1OH 3D06A 3FCGA 2EX3A 4KI5E 2Q73A 1XGTA 5SX4H 1I8IA 3NCJH 5DYOB 4JANA 3Q06A 1QRNB 1AZNA 4X5RA 2CLVA 3D0VB 1MF2L 3CBKB 2WTRA 3S3BB 3LH9A 4HS6B 5ALCH 2LGNA 1N19A 3ZRXA 1RUAL 3GQFA 3IXAA 1YEHL 2FGWH 1JGIA 4BQ8A 3BEWB 3UPCA 3MFFB 1RZQA 1F6LL 2E75C 1GO3F 3I6LE 1NICA 2GSGB 4OCSH 4JHAL 1DBBL 2FWOA 4EB6B 3X3FL 4P48A 2Y4TA 2VLJE 5B8CB 4XXDB 4JY6B 3CIQA 1SLUA 3K0GA 3TA3A 2TSBA 3OHXB 4YHKL 3KLLA 2C9RA 1UM6H 1CLVA 3S98A 4MZ3A 4MS6A 4J1UA 1JXGA 1I8KB 4LF8B 2IBZX 4PJ7A 1YJDC 3HKDA 1ED3A 3LPFA 3U1PA 1OP5K 1KIUA 3CQFA 3QC6X 3U4EB 4CMMA 1D7DA 1EK3A 1SMOA 1WBXB 4R0LC 3EHBB 4HIHB 4RFOH 2KI6A 2SEBB 4PWEA 1A4CA 1IBFA 4Z7UF 2DLEA 5JHDB 4QWWC 4GKJO 4Z3EA 4LRNH 5F7MC 4DCQA 1YNKL 5DGRA 1O6VA 1ZGLP 1NBVL 5KWYC 3HTLX 4WF9V 3BI9X 1WEJH 3BFOA 3ZE0F 1MFUA 4P3CH 4EZKA 4W9KC 5CSZA 4U31A 3ULVE 1MAJA 4YR6A 3B2EE 1WBYA 2A83A 4J8QA 2JK5A 3INUL 5JIKA 4KAQH 3L5WA 3ILPA 4GKKO 1PZ5A 5LO7A 3HJ0A 4J10A 2VSDA 5HHVL 3NRPA 4GRLB 1TTGA 2MEJB 1LQSR 3G80A 1ML0A 5FHBH 5JUEL 1WFTA 4FP8H 5G55A 2QHRL 3C5ZD 1LE9B 3OJVC 3NCMA 3M99B 2CGRL 4I18C 4FJCC 4WW2B 4QXTB 5FUZH 2ZXAA 1AFVL 3PHOB 3PQYB 1WP6A 5HHOA 4G8EB 5E56A 2HFTA 2E59A 4OLEA 4Z7AA 4OVUA 1X5KA 1IBBA 1BFVL 2QGBA 5GSRA 2MQGA 4I5BA 4D0DB 5FECA 4FFWD 3NP4A 7CGTA 1QEWB 3BAWA 4POUB 2NX5E 3D8MA 5DEGB 2YJQA 5T3ZD 2QFRA 4M3JA 4A2LA 4KZCA 4NZFA 3O45A 5IESH 3C5ZC 4LQFL 5DD6A 4FM2A 4J3WA 2B5UA 3GSWB 3L5JA 2CWRA 5EEUA 1EMTL 4FPPA 2PLTA 5IBTH 1E7VA 3KPSD 3VXSE 2XIIA 4WHTA 4NNYB 1MJ8H 4P9HH 2JGDA 1KPVB 3ETQA 1PKQB 4F2MB 3STBA 3WS3A 1G9EA 3BN3B 4X98A 1AQKL 5I1IH 3S5ZA 2XLLA 3PE9A 1OTTD 3D39A 1FO0L 4FFWC 4HW6A 4PG2A 4NUJA 3UL4A 2E7LA 5AVSB 3S3DB 2KSDA 1E9QA 4XP1H 4P5TD 1UEYA 2VLLB 3HZVA 3IK2A 4M56A 2H3NA 1UD2A 4OZIA 4PS3A 1DQLH 4R7DA 4PJ9D 5JOEA 4PV9B 2R2EA 4JI0B 1ZLVK 1J05A 3T71A 2ZXCA 3LHAA 2CO6B 3BJLA 5ISZB 2AERT 5HY9A 2XN2A 2J1XA 5EEVA 1RP9A 3PUCA 1ES0A 4JZGA 3D5OF 3HI6L 2EULA 1GZQB 3I6GA 2W88A 5DTFA 4ZAKB 4ZI7B 3CSXA 4JFFE 3Q8BA 1A3RL 4UDTB 4XXWC 2H7WA 3L5HA 4KO7A 5FR3A 3SDCA 1WO2A 2ZUQC 4FGMA 1KJ2H 3MODH 2H8PB 4F20A 4LIQE 1KJ2A 3G3LA 3L48A 4P5TC 4BCZA 4UQ3A 4YFLF 3ZYJA 8CGTA 4TSCL 3P0VL 4ZS6D 1GRJA 4LPVA 4JI3O 2HKHH 4XMXA 1HAWA 4GO8A 5MEQB 3BEVB 3KVDD 3FUNA 3LNGA 1CLYL 4KXZH 3IFLL 4ZO7A 1FORH 4KXBA 4DR3B 1NSNH 5FUOL 1VFUA 4LCVA 1DLHA 5I8KL 3ZHVA 3JUYA 4AQ8A 5B3JF 5HPMB 2AAVA 4S1SL 4UT9H 3M7OA 2JV6A 4GXFA 1DO5A 4B08A 4LWSB 1FBIL 3JV0A 3FB6C 3M86A 4UT9A 5HI5D 2F8XC 5HHNB 1XI1A 3ESVF 5FA3B 2FMLA 2B4CH 5IB3A 4KJWD 2P48B 3K5NA 3INOA 4TUYB 3AG4C 2KERA 4IBYA 4RLDA 1NCUA 1G1XB 3ZYZA 2OSWA 4AQZA 2F95B 5FLXN 2YA0A 3RWFB 3MRFA 2WBJB 5KUMA 5D5ME 3LSQA 4ZS6C 3VQXA 1G9MC 4PRPA 5K59F 4R2GB 1SHMA 5L3GA 2X1XR 3KH3A 1SJHA 2O5ZH 4M43L 4DPBX 5IV2B 3IJSA 5I8EA 5IUSA 4P5RA 3BZFA 4GRWF 1CGUA 4XVJL 2BDNL 1BMWA 3BKMH 3NDZE 2YIDA 2H0EA 1A64A 3DOSA 3KZ8A 4BUHA 1TIUA 1FL6A 4JHBA 5HI5C 3G6EV 1YXBA 4XPHH 2PO6D 4O4JB 3BMVA 4JQXA 1A6ZB 3NSDA 3E8BA 2O6EA 4BH8A 4DP1X 2QT6A 1Z9NA 4HETA 4UVCA 3C9NA 4W9GC 3GINA 3HG1B 3KLQA 1YDPB 3B9KB 5L2KE 4PA6A 1AP2B 1E6JL 2H26A 1YEDB 4CADA 4ELKB 4ZS7H 2MFNA 4HOXA 1PNKA 1FH2A 3NRQA 1QNIA 5F9OH 5FYKE 2JKJA 1KLUB 3B4SA 3CDZA 5AZUA 3RY6C 3GXNA 2VN6A 3KYOB 5C7ZA 2HVKB 1MNUH 1OAXH 3FSAA 1OXYA 3BPOC 4LFHG 3VI4F 1B2WH 4KKLD 1OM3L 3O3DA 4YGVB 5ALBH 3CRCA 4EFBA 2R2BB 3VWJD 4H4NA 2VDNB 3CRRA 2EIMB 3CSYA 3IXTA 4QRAA 2V33A 3K79A 3KYNA 4L0PB 2PO6C 3L5IA 3MV01 3H7BA 3IFNL 1Z9PA 4KTEH 5D7LA 3KW8A 3GRBA 2HSIA 4QMEA 3E1F1 5D5QA 3HC3L 1E4XL 1JI2A 2A9MH 1NMBL 1OE1A 1ZLDA 4PVMA 2DMGA 2FBOJ 2APWA 4JHUA 2IQ9L 2WD0A 3L1EA 4CJ1A 1KCLA 4OLYL 5BV7H 1T6VN 3RZCA 3GTVA 5IHUH 4OY9A 2BJMH 2R69L 1BVOA 4YDIH 3AT0A 5SWQA 4YHZL 1CU4L 4R4BA 2ARWA 1MY5A 2XG4A 5CD3B 1R75A 4KKLC 4Z7NE 2OULB 1PZUB 3NA4A 5EIBD 3OG4B 2J73A 5F8RC 1H2MA 3U2SA 1CE6A 1O7DE 5KYXB 2FSEA 4OGQC 1HZLA 4XBFA 1QW9A 3PWUB 3F3HA 4OU3A 4G1EB 4PJGB 4U1LA 3DTXA 1X5ZA 3G04B 4HC1H 4XNMA 4ZFFA 1THCA 5MENB 4CILA 4HC1A 2EEFA 4N68A 3BVUA 1AKJB 4XPGL 3F7VB 3BKCH 3UPAA 1OSPH 2Z4QA 3MREA 1F4AA 1Z5WA 1JGEA 4O2BB 1RU9H 2ZE0A 4LHUA 4JPIB 3SGKA 4XOCA 1R3KA 5A3ID 4N2OA 4YXWG 4R90L 4XI5D 1PYWB 4XCEB 4CC0A 1I08A 4ZUUB 3BOVA 4NPYA 3K04A 1YDXA 2BC4B 2EUVA 4JO3L 1CYXA 3UTTE 4PP2B 4Y4HA 3FHEA 4L4TA 4EUPH 3HCVB 4PDLA 3BXNB 1BECA 1YAIA 3N42B 5E6SB 5F96H 3V0AC 3DX4A 3S96B 1EA9C 1GOGA 1ETZA 4X20A 3QXAB 2J5LB 4JMNA 4OCRL 4G6AD 3QZMA 3I6SA 2C9XA 3V5DB 1KJMA 1IC5L 1RPKA 2HFGL 2DN9A 1C9SA 3SZKC 3I3EA 4WZ9A 2QJ1A 2WQAA 4XI5C 4XN5A 3K80A 4PJ9B 1M6UA 5I26A 2TRHA 2WKOF 3X13A 2L3BA 4ZXBD 5B1BB 2E86A 4YHNA 3SKNA 4BHUI 5I8OH 1XT5A 4CJ0A 2C3HA 3FOLA 4NTWA 1PD1A 1FPTH 3FW6A 3Q6GL 2CJSA 2JWYA 2P4AB 4QRPD 1MCOH 3TS8A 2GTZB 3GJEB 4FLWA 2VDOB 1LEKB 3ARGC 3P40A 3KPQA 3OAZK 3WHXB 2HJKA 4BM7A 4XN1A 4W81A 1AO7E 4GY4A 4YDJB 1PPJH 4ONFH 3TBSA 3WXVL 3MA7B 4ZXBC 4ACTA 5K1JA 3K6IA 3BAAA 1IQDB 3EH4B 2GB2A 3DROA 4GFTB 2IALA 2WOBA 1ETB1 4QPKA 3VXMD 3T3PE 1ROPA 2Q6AA 4KNUA 4JUSA 4M6OL 1C5CH 1CMOA 1FAIH 4AEHL 1R3IH 2MOVA 1LR1A 3H9YA 4P2RB 2E6JA 3GMLA 3WXWL 3HBGA 1XNRO 3KM2A 1NBZB 3K5LA 4PJXA 2P80D 1UVQB 1NCHA 1OCWH 2FX9L 4PLJD 3FNKA 3GS4A 4N8PA 1M2OA 2JI2A 5HXMA 4QJ3B 2BW4A 2OYQA 4AWJC 4LVHC 3ATBA 1LK3H 4MQXD 3X1BA 3LNDA 3RKPA 4I55A 1Z3GL 5DZJA 2VR9A 4NQDD 4PU2A 4RGNB 3TCUA 2ODHA 3PLYA 3UAJD 3CMGA 4EQ3A 1YYLH 4PA7A 3P11L 1HQ4A 2DMBA 4LF6O 3HI5H 4EEQA 2B20A 3ZL1A 1PU0A 3S3XA 5MEPA 3L4CA 2WO2B 5LBQA 1N34O 2GSIB 3F58L 4NUMA 1FYJA 3ZDXB 1A5FH 2FJGA 3VBBA 4UQBA 2AJ3A 1JAEA 3QIUD 4PRHD 1M7DA 1WVZA 1Q9WB 3TBWA 2ZG2A 2I9LA 4N6RB 3OR6C 4LCYA 4PDRA 1ZTXE 1QLEB 3EXAA 2XX0A 4MWFA 2OPCA 4ODBD 2GCYA 1CO1A 1ZT7B 1MSDA 3D4YA 3TXAA 1FNLA 1C16A 5D71L 4MVOA 3A6CL 3CFEA 3D4ZA 5HJ3B 1J5OL 4PJEB 1S7WB 4G3YH 2OFQA 3UAJC 3TBYA 1MSPA 5F0PB 4MA7L 3HUJB 4KRNA 2Y22A 4WFED 4L9LA 3AQDA 1T5WB 1ZD6A 2YUAA 5EA0H 3QPKA 3VRIA 5CGTA 1Z9MA 3FBKA 1TEGA 4U1IB 4QJ5B 1DJSA 1L3NA 3VWJB 3ULAB 4AYEC 3TF7C 4X9BA 2W0KA 2WAHA 3EDDA 1LP9E 3F83A 4P04A 3BH4A 4UTBL 1VF6A 1A3LH 1KIPA 2WZAA 4UB0L 3JTBA 3S5YA 3T0DA 5CBGA 2OMUA 3BSHA 3QIUC 4FFBB 3D12B 2Q7AA 2O26U 1QYGL 4R50A 4AVIA 2CNYA 4X65O 1XH2A 1EAPB 3QEQB 4HCIA 1A32A 1KXQA 1QP1A 1IAIL 4LKCA 2BX5A 4R26L 1M2VB 2P8PA 4ZMWA 1OCOB 4HXBH 4EE2A 1N64L 3B6SA 4ENZA 5KVEH 3W7TA 2WWMC 3ASOB 4I0PA 2HXAA 4MYWB 2AQSA 1HI6A 4ZNEE 2YBGA 3QCTL 4F58H 2PN5A 3T2QA 4BFJA 5BXFA 2DMHA 3E6HB 1QHQA 4K3JH 1A6TB 2GJ6A 4J7ZA 3O2WH 1AR1C 3WEMA 3CHSA 1BHBA 3FMGH 3JWOL 2WCGA 4ZTEA 1BA9A 2NY0D 4JO1L 4YSAA 1YEGL 5KJ4A 5GS2H 1PLAA 4UQ2B 4WV1C 3FKSG 4A7SA 1IMHC 2R0ZL 5H2BA 4AYFA 1DQJA 1F51A 3BKYH 3QCUL 4LMQE 3WJJA 4AE0A 3UTPE 5TK4A 4QHKJ 5E2TL 4XNAA 2OYPA 3B37A 1KP3A 1NJ9B 2BSSB 5BY1A 3DIFA 3VFGL 2GW5A 4FMTA 5I17A 2MJWA 1I8LC 1NDMB 3UO2A 2IH1B 2KMWA 1KWGA 5CN3A 5IOPB 4JZNA 4KKRA 4KGJA 4ALAL 3FQ2A 3V4VH 1IC7L 1L6ZA 3V4VA 2ZICA 1G43A 2NY0C 5LA6B 1H0DB 4MXQD 4C83B 2QGDA 1MJ7H 1N32O 5B38B 2NY2B 1R33A 3SY0A 3UXFA 2RJMA 4YDVA 5F3HA 2G2PA 4YNYA 2DBLH 1CL7I 4XMWA 4ZMXA 1DN2A 3H2WA 1HE8A 4L3EA 4Z7VB 2XAQA 3MGOB 4DUXA 1BIIA 2VDPB 5AB1A 1TO4A 3SPIA 3F5WA 4LFCO 1CXIA 4HZAA 1M93A 3QDHA 3SGDI 2WYTA 3FSZA 3SYPA 1BIHA 5J13B 2XQBL 4HJGA 1S9XB 2AMGA 2F61A 3V79C 2PW2B 3C2AH 3S35L 1U8NA 3HS9A 1HJCA 4LVOC 3ZT7A 2HYMA 1FJ1B 4NJAL 3JCUZ 4IRJA 3VXRB 4UDUA 4DN4L 1ZWIA 3AC0A 2D3VA 2V9RA 5H6QA 1NPJA 4ZW8A 1HTYA 3KPRD 4YZFF 3VTMA 4D7TA 4AV4A 3WFBL 3BZ4B 4MXQC 3CRMA 4RWUA 2B77A 5CMAB 5HYJD 1SLXA 1E3FA 4KRPB 2IPUG 4NDMA 4LCIH 1UWGH 2WXOA 4LCUB 5EPMB 2RQ8A 3QXVA 3G6JE 2FYYA 3NVQA 3QVNA 3VQYA 1J1OL 3G6DL 3SDAD 4HUVA 2F19H 4JFOB 2ADPA 2HTLC 3IN0A 3W0WA 2BVQB 2RDCA 2XWRA 4NKIH 4ODWA 5JW4N 1E6OL 4HEME 2DN7A 2VITB 2VW6A 4KX8A 4X64O 1MFEL 4XNYH 3IBOA 1BZ7A 5I0DA 4U33A 4X5PA 3UG3A 1RY7B 4DP4X 2UXCO 3UJTL 2W65B 2EKSA 3NIDB 1OZ0A 2YRBA 4TULH 5EUKA 5KVFE 3VXMB 3H42L 3B2MA 4G43A 2YD9A 4I50A 3M1CA 5I66A 3LEVL 3QG7H 3RYCA 1JJOA 3RUGA 2BNQB 4DR5B 5DHEA 4G8FA 2WKLA 4O2EB 4EFEA 5CCGE 2CDFA 1UZ8B 1T20A 2Y48A 4ORZC 3SDAC 5E4IA 2B2XL 4PWHA 3ZE2E 1I7TB 5IIEA 4XXCA 4AG4L 4HNAA 2J1KA 1VFBA 4EZLA 1FGVH 2ADIB 4XO8A 4BRVA 4ZTOL 3T04D 3SE4A 4NQDB 4JDVA 4N0YL 1MABG 1KEMH 5ID1B 1TVHB 1ONQA 1CF8H 1GTOA 2R23A 2AW9A 1NZ6A 3ARUA 2FIKA 3GFUA 3KPMB 5F1IB 5I1AB 5H35A 4EDXA 4I3RL 4NXSA 1K92A 3V4UH 2YKLL 3WIHL 2VISB 1ZJBA 1GPOL 2C1PA 2NR6D 1OCZB 3SN6N 3QPQC 4Z7UE 4KRMB 4D7PA 1UCBH 4AQAA 1NVPD 4LBEC 3QG5A 4O4IB 2PTTB 1YNTB 2X28A 2OIGA 3GMOB 5AVUB 2E5LO 2PR4H 3EOTH 3TV3L 3TIEA 1F4MA 1GC1C 4KKBD 2DM7A 3ZE0E 5ECGA 3KGSA 1J48A 1HZHH 4N0UE 4KROD 2VLJA 4AW4A 2DLHA 3IGKA 3MXWL 2HFFB 4R3SA 3B2VL 2XG5B 3O11B 4M1GL 4MBRA 1M1XA 5E94B 1P7QB 1WPCA 4JFTA 4Y2DA 1JCKA 2VLRD 3L3IA 3UTSE 2G60L 2X0WA 2OX5A 3L6FB 2FL5A 2X4PB 1J88A 5DWUH 5SWZE 3OB8A 3ASNC 4XH2B 3T4AC 3FX7A 1WT5A 4OFKA 4ZDHA 3Q48A 4HFWB 2HCZX 1YPZF 4WHDA 5LP6C 1AJPA 1A7NH 2Y2YA 2DIEA 1A21A 3UZEA 5KANG 3I50L 1GMGA 3TH2T 4ZFZB 4PJIB 2ITCA 2Y6SC 1SDYA 3L13A 1N10A 4KKBC 5HYEA 1E9OB 4YC2B 3CD4A 3CHRA 2JNZA 2XZQH 4KROC 2CNZA 3QNZA 5C0AD 1B0RA 3QFDA 3VWKA 4IIQA 2DV6A 4TNWK 1HW7A 4K9EH 2UXBO 1PBYA 1FN4A 5AQ0A 3NESA 1CDGA 1FZJB 1ZHKB 2COQA 3EGDB 4N2KA 3TYFB 4ABQA 4PRDB 1FIEA 4JEGB 1INQA 1R5WB 1RFDL 1ZV5A 3N41F 1GXEA 5DT1H 2DLGA 1RK1B 2J1YA 4PR5B 3M88A 5ENWB 3SJCC 2R4RL 4X6FA 1JYVA 2E76B 3RIAK 5IFJA 3GSXB 2O5XL 2WBXA 2DEXX 2RNBA 2YBRA 4FLHA 2WVVA 3BWAA 4R5VA 3P3RA 2YS4A 4L3CB 2CPCA 1NH2D 3CCUV 1BDYA 1KD1W 1WFOA 3J27A 3QIWA 1XR9B 2PPEA 4YL9A 2IANE 3FU0A 2FBJL 3N27A 3FT3A 3LX9A 2HMID 3BE1L 3HC0B 4LSVL 5FLUA 1N5YH 4FQQB 4NKDB 2ED6A 1C5DB 3LS4L 4K73A 4XVUC 5AVWB 3V52H 3OWRA 3HNTL 1S7TA 4F7MA 2H2SD 1IURA 4XBGA 4IYIA 2HUHA 2VXSL 1NT2B 1XCTB 4N25A 1XMEB 3UBXG 2R7EB 5GIRA 2DM2A 1LO4L 3BCDA 3LH8A 1RVFH 1AQMA 1TJGH 5TTRA 4UILL 3HB3D 5JOPE 4TQ8A 1F41A 2LLNA 3Q1SL 5IB2A 4MCMA 3J2PA 3ZHSA 5CCJA 1OP3K 1QVOB 2Z91B 2NN4A 2HMIC 2O5YL 2E7BA 5EYPB 1MHPH 1T22B 1DVQA 3C6LA 4FJ6A 5FGBC 3IMTA 2NNXA 4G11A 4JPQA 3VXQB 1U58A 4OW6A 4TV8B 1F11B 2WZ0A 1UKQA 2OMWB 4DV7O 4RGOL 1U6AL 2QWOB 1XMOB 2Y7OA 3MRDB 5FYLE 4EN3B 1TCMA 4K8RH 1HNGA 2UY7A 1PKOA 1RJYA 2XT1B 3ICXA 4GQ9L 1DDHB 2HWZH 4J4PA 4N9GA 2B1HL 3JWNE 5DQDH 5F6HJ 1KOAA 2YSTA 1QRKA 2ZXDA 3H4FA 2IQAA 3WHE0 1QR8A 6FABL 3KPPA 4I4WB 5DD0H 5KSAA 3QEHA 1MLCB 5DD5H 1IGFL 1MUJA 2NNAB 2WUCL 3QP3A 3QZLA 2DQDH 1WLEA 1B3JA 2NY4C 3THOA 4XPTH 4YWGL 4LU5H 4YO0B 5GRUL 4BDVB 2VOTA 5DEFB 5B3JE 4YSDA 43CAA 3KGUA 1A9EA 3TO4A 5BMFH 4RZKA 3FQNA 1MFDL 3U0WL 5GJTL 3N85H 4P8QA 5FEBA 4K8XA 2I60H 1RFYA 4IL6Z 4K5MA 4XP4L 3WFVA 3EGSA 2P24B 1I94O 2EH8H 2VGLM 3KNBB 4JFFA 2WO4A 3CUPB 3EGXA 3P4NA 2XXMB 3MRLA 4J80A 1M7IB 1DVFA 4AZ8A 2RBLA 5EU6D 2EIKC 3N2GB 3BAXA 3WENA 5C0GB 1CDBA 4LIQH 4MJ5A 3V55A 3V4LA 1L8DA 2BFGA 3IRPX 4WI0B 1MI5B 3FPXA 1BJ8A 1J8HD 3RYIB 2F4VB 1J87A 2OW6A 4KJYA 5CJ8A 3FONA 2XTJD 4MD4B 4LSQH 4P3DB 3QDAA 2CXKA 3FUIA 4NGHL 3P0YL 2AV7A 3DRQB 5L9DH 5LMUO 4P2OD 1MCDA 4A38A 1JWMB 3WI9A 3P9WB 2IDCA 2PXYD 4C4UA 3KE0A 4UV7H 2VQ4A 4KKNA 2OR9H 3CVIH 4XO3A 1MRFH 5KVGE 2CM6A 4HFUL 2PPFA 3WIAA 5INDB 4PBXA 2ICEB 1BZ9B 5JTWA 2ICWA 2F7PA 3O6MH 2VDLL 4LEBA 3U46B 4PJDF 3U4BH 3KS0J 1G1YA 4ZTPH 4R4FH 2CO7A 1P6AB 4QGPA 2M2DA 1A9VA 2C8NA 3WN5A 5D5MA 4QHMA 4Q9RH 3PDOB 1ERNA 4PGBB 5CJ5A 2E0PA 2YUVA 3CBRA 3VI4E 3AAZA 1WGOA 2VL5B 3MRHB 4ZOLA 3QORD 3BVXA 1X4TA 4NN6C 3D3VB 2QSQA 1BZQK 4ODXA 2X6BA 3AG2B 4YDLC 4QRTB 1KIRA 5HDBB 1VRSA 5FKAB 3U1QA 5H94A 3V6OC 2OM5A 3CN1A 1K34A 3HE6C 1IKNA 2JCCB 3P2TA 1XIWC 5KSUB 3FTGA 2CQVA 3ZKSD 4UQ9A 2IIJA 3OKDB 3MI6A 4EF3A 1VQMV 3KG5A 4ZMOA 1EXGA 1Q43A 5L2KA 3PV7A 3K4AA 4FA6A 3AUWB 1P7KA 1MJJB 1DTUA 1FNAA 4JO2H 4QHNA 5I1CL 3ULUL 3D2UA 1U3JA 1CFBA 3DUHA 3SBRA 1XO8A 3P4MA 3KHQA 3L1FA 1WRFA 2FEJA 4Q6IB 3MGTA 3QORC 1GHFL 3BH9A 4HIJA 5CBAA 3QEUB 2QQKH 3QJXA 5JXEA 3F7LA 2FQFA 5J06A 1PG7H 3E6FA 4XPFL 3T77B 4WFHA 3D48R 5C0AB 4PJAE 4Y5XB 4CH3A 4ADIA 1Q90A 2ATAA 3UO8B 1MW3A 2F18A 3O9WA 3K57A 4LF6B 1EBAA 3DGGA 1XL6A 1QWHA 3WE6A 4LF7B 4NO2A 1UB5B 3U30B 1KUQA 3UBGA 2VM4A 4X4ME 2Y1AA 1T4KA 5I19H 2FJHA 3DV4B 1O75A 4MRCA 1R3LB 4BZ2H 3S3JA 3TETA 3MLZL 4BZ2A 2EINC 4M6NL 1TZHA 4MQ7B 3QUZB 3GC3A 3S4SA 3UZQB 3FB5A 1EZUA 1MRDL 1IBHA 1QWUA 1DANU 3HFML 2P3YA 3VVWA 1CFTA 4XWOD 4B27A 4L4VD 5DQJA 5EF0A 3L70H 4PGJA 4OF7A 3KR3L 4Q9CA 2CG9X 2OXHB 3N2JA 3WUWA 2Z31A 4E9LA 1BXUA 3ZRSA 3CCEV 4JAMB 4NAMA 4AENA 3D7PA 5LNGA 3FAWA 2XWZA 3GWOA 2DICA 5EWIH 5I0XA 4J2QA 1ZANL 1KCVL 3RWCB 5E6ZA 5FAAA 4ABUA 2Y7MA 1X7SA 3BGFB 3LKOB 1OIOA 1P5UC 3H1IH 2OZ4H 3HB3B 2FGWL 4ERSH 2DM4A 2OZ4A 2MSPA 4MZ2A 1S7UA 3DX0A 4X6DF 4A2DA 3L45A 1AGEB 1KLFA 4LARL 1LNQA 3FQRA 4ETYA 4XWOC 4X65B 4LLYA 1IDSA 2HFEB 3UTTA 3ET9F 3MV8A 4IOSA 4FQHA 4PG9B 3VFPA 4LDEB 2DWDB 3HRZA 1MG3C 2YC1A 4ZSOB 4BWAA 5EF2A 3DUUA 4D9LL 4PJGE 3FT0A 3KLHC 3NZUA 3K5MA 4ODTL 2FJFB 2E9JA 2N74A 3B2XA 4HULB 1FFRA 4G6JL 5AAPA 3IDJB 1WC7B 4PS4H 2NQCA 3DDFA 2X4OB 2N7SA 5C0IB 5T3ZE 2YUZA 1GR7A 4ZOCA 1J0HA 3ETBF 2WXIA 4N8UA 1KXTA 4MSWA 1AXSA 3AZUA 5AG8A 3G7TA 5JQ6L 3WG7C 5LJYH 4NC0B 4G80B 1IFRA 1MCRA 3LZLA 1E5AA 3DBSA 3KPSE 4X66O 5IE9A 2P5EB 4LQ1A 1NMAH 3MV7D 5D7HA 3QJUB 1JCHA 1N18A 3BVNA 3IKCB 1DTOA 1K5NB 2AZUA 4H20H 4I89A 5IUCA 2VSMB 4QT5A 3JV4B 4N8VA 4TSBL 1ZLWK 2L7EA 3HR5B 5CFHA 4NHUB 1XGQA 1TVBA 3L9YA 4XOBA 5CU9A 4X7EC 5DMIH 2BHFA 4F80A 3GIVB 4JZ2A 3O3UN 3JSNA 2DY2A 3KPLA 3BAIA 4O5LH 2J5WA 1K7DA 1GY1A 1J8HB 5JPNA 1Q5OA 3WIIL 1N32B 3APOA 2XTJB 2WLIA 3HMWL 3MLUH 1HL4A 4UT6H 1OLZA 2XASA 1NCIA 2EZOA 4UT6A 2MCPL 3MLSH 2K1MA 1L9MA 5E8EB 1GKFA 3PYCA 5KYWB 4P2OB 3W9DB 2BSTB 1R5IA 3CPWU 2PXYB 4JFXA 4LSUL 3BQUD 4E36A 1KPUB 4QD2E 3QPXH 4J3OD 4IHOB 3MJ8B 2QFPA 1D2OA 4Y1AA 1H38A 5DFVD 3BIKA 1BHGA 3MJ9L 1RZIB 1TEFA 3VSUA 4DRXA 3GK8H 2WSSG 3H56A 3ZE1B 2E27L 4HXAH 1U8CA 2CDEB 3AFLA 3LZPA 4Y1TA 3MRBA 4IKJA 4Z7WF 5JMRA 4K3DH 1O9ZA 4YX2H 4WHCA 1JFFA 3CCHA 3DWTA 3GMPB 4OD2B 4EMZA 3N44B 4OGZA 1E7UA 5BOZG 2ZWLT 4MBOA 4Z5RA 1QTPA 2J8OA 4HV8B 1OZUA 1AILA 4DV6B 3C60B 3RTQD 5IJCC 4UCRA 2ESVB 4U1HA 2C3GA 1NZRA 1YNLH 1RK0B 4ZFOB 2LLGA 1T7ZA 2CBMA 1KXVC 4U1NA 1W91A 4L8SA 1OGTB 5LXGH 4XDKA 1NDGB 5EIIG 1SPDA 5HI4D 4FF9A 4PJHB 1DBJH 1JZEA 3GS7A 3LQMA 1ZTXH 4UQAA 1EFXD 2X4SB 3DETD 1N6UA 1W15A 4X4XA 3RW0A 1HDJA 4I48A 5I71C 3HI1A 3QH3B 4HJJL 2D3NA 2K7QA 4F91B 4A2EA 4I8DA 1T3FB 4KZEL 2I07A 2XBZA 1QFWL 3N1PC 4F4LA 2V7NB 1TXKA 3OL2A 4Z77B 5I16B 5ADOL 2BSED 3DJRA 5SV4A 1TKWA 5A2QN 2JCWA 2P8LB 4JF3A 5I74C 1R6VA 3VG0L 2K78A 1S7XA 3ZDXE 2WWKT 2WW8A 2GBAA 1LP9A 1JXJA 2AK4D 1TYRA 1XSJA 4DUZO 3KJ4B 3DX3A 3M7MX 4XNXL 3VH8B 5L88H 2AQQA 5D1QB 2KZBA 4AJ0A 3EYUL 3BRCA 2R9HC 1F1GA 3VGGA 4CW1A 1NR1A 1VPOH 2X9XA 2Y1VA 4PJEE 1IBLB 3AXIA 4WJ5B 3LEXB 1DVXA 3V0WL 1JZDC 4G6ML 3CB2A 2BP8A 5FV2A 5K39A 4K7PX 5I6OA 3CN0A 1DEEB 4P06A 4YZWA 3LKQA 5DC0A 2XC8A 3L75H 5EO1B 1AANA 4L4VB 4HIIA 5E95B 4DUWA 4J8RA 5I6MA 2J55A 1GKOA 5I18L 3LZNA 3SPVA 3D36A 3EO1A 1GTNA 4FA7B 2FATH 3AU1A 3B2PA 4PTUA 2GUZB 2B4CL 3X11A 4H44C 4Z76A 4YE4L 5GS0H 2FO4A 1BVZA 2K9UA 2DEYX 4JZJA 3WGUB 3MZTA 3HC4H 1P1VA 1R3JB 4FG2A 4JKKA 3IDYC 1CLZH 1VQ7V 5IQ9A 4HISA 3WLBA 4N2IA 4DAGH 1H8SA 2P5PA 3EJPA 5E9DE 2VJXA 3FB8A 2O5ZL 4ZMQA 3SKMA 3EYFA 5EORH 2WCSA 4OKVB 2ZUSA 4N0CD 1OCRC 1T2QL 2X1QA 5GGVY 1S78D 1KT2A 3ETGA 2JLPA 1AIFB 2EDEA 3SQOH 4RNRB 4RAVA 4IJTA 4YZFE 5IHBA 2A6IB 5E1IA 4DPCX 4TWKA 2R27A 1HXYA 2UXBB 4I7ZB 4KFMA 4DGVH 4ZODA 2D3LA 3QJTB 4JV5B 1QO3B 3CZNA 2JELH 1TSRA 1RZ7H 3D51A 3QDME 2XX1A 1Y1DA 3CDFA 3MRCA 3I02B 2XKNA 4G1MA 3RX5A 1XQ8A 1COWG 3O8XA 3T3MF 3IDGB 1U92A 5IY5C 4OF6A 1FXKB 4Z76B 3ES6A 3OZ9L 4JFHD 3CCSV 2IPKB 4PFEA 1QSEE 2QMKA 3BWZA 2GPZA 3LN4B 3G9AB 1MNGA 4N0CC 1MPAL 4XBPB 2ADJB 1S78C 4BKSC 1S8DA 3OTFA 3BSZH 4XO5A 2YDEA 3UZVA 2WLNA 3BSZA 3KEDA 2PCXA 3FQXA 2G0KA 3ECWA 2VXVH 4NP9A 1MCFA 5TF1H 1RL1A 2Z0AA 2WZPA 5IM7B 4NKOB 2BZCA 4TV9B 2LW3A 4FOMA 2A7WA 4R7NB 4DGUA 5ICYB 3PNWB 1IT9L 5D2LB 3FAVB 3QTCA 1SJEB 3GKWL 5LBSH 4OZ4B 1QBZA 1CT8B 5D1ZI 5C09B 5LBSA 2BJML 1GN3A 4HJEA 4YK4C 3HN5A 4HEMA 2X88A 1QW8A 3TNNA 3IJYB 5DRZB 1DQMH 2ZXWB 4E41A 4TUJA 1J95A 4TN9A 5IW1A 4W9ZA 3F7YA 2H2PD 4OLXH 5KVFH 3BD5A 3BQUB 3PGCB 3LKSA 3DVGA 3CRQA 1T1XA 4QRPE 5CJOH 5C6PB 4DV7B 1SOSA 4UINH 4FMVA 4JM2A 4ISVB 1AGCA 4S1RL 5C9JB 3GI9H 3TH4T 5F7UA 1MG1A 2V9TA 4I77H 1FV1A 1UFGA 2R83A 3ZRVA 2G2RA 5HDOA 1ZEAH 5ABZA 5GRVK 1A3QA 2YRLA 1MWAB 4WIQA 4QNPF 4P59L 3I55V 3JZ7A 3BZDA 4LEOA 2WXNA 4F57L 4MX7A 5TE4H 1HH9B 4WNQB 1UD6A 1AJQA 1AB3A 2CK0H 3CTTA 3QQ4A 4TOYH 1N4XL 2XA8H 3FT4A 3QIBB 1KYOF 4WFBV 2WYHA 1BE3H 3AROA 3I75A 5EC1B 3Q0HA 2XXGA 3C87A 1K73W 1IGCH 2G5BB 3RTQB 5LUMA 1RMFL 3L3JB 4F15B 3SDXB 3MD0A 3UYPB 1I94B 5JCOC 4MJIB 5IHLB 1FG2B 5LHIA 4MJ6B 5DGQA 1OGAB 3MROA 1XX9C 1KCSL 1M6OA 1LJMA 1HEHC 2FT8A 3SCMD 4PHXA 1JWSA 4HUWA 3WB0A 4HBCH 2J56A 4MMYA 1KBWA 3MRRA 1PTZA 4GAGL 2OSYA 4AV0A 5J6GB 4U3CA 5EOCJ 3SY6A 5IREA 5EZYA 5AW3B 4N23A 2QE7G 1B3IA 1SQFA 4N0UA 4JFDD 4NQDE 4JPKL 4BCYA 4C57C 4AHCA 5LMUB 1MREH 3T6ZA 3ZIAG 4TSAL 4BA8A 5BMVB 5DYOA 2XU9A 3SO5A 1SYSB 5GGUA 3VW3H 3D0VA 5E5MB 5TFSH 3UTSA 1FPTL 2MMXA 2OS7A 3D52A 4HS6A 4N85A 1ACCA 2QKCA 1SXCA 3PHQB 4DEWA 2WC7A 2X42A 4ASUG 2OSXA 4AMXA 5LDUA 5DJ2B 3UBFA 3BEWA 2HX8A 4Z7QB 3MFFA 4PRHE 1OANA 5I0VA 3X17A 4PJ6A 3N06B 1BHAA 3F8UB 2ED8A 3G5VA 2VLKB 5ECJE 4EB6A 1VFAB 1IGJA 4LEXL 2ZKXA 4Y16B 5B8CA 4XXDA 2BY3A 4JY6A 1J9QA 2ZIDA 2VJ8A 3ZUCA 4BQ9A 1PF3A 1NFKA 5DLMH 3OHXA 5D96C 5I1HL 3LNNA 3UYRL 4O2CB 4WFEE 3EZJB 1J5EB 3MRQB 3MV9B 3ARTA 3CZKA 5D7JD 1ZLVH 2QVFB 2R0WH 3ZL2A 1I8KA 2Q5ZA 4FLSA 5EBMB 3MXVH 1RULL 2JB5L 3UOAB 1F4YL 1IJNA 5CINH 1C5CL 4QAWA 1VADB 2HN7B 3MFGB 3OAYK 3ARDD 1R3IL 1C08A 1LDSA 2HA1A 4JN1L 4CVXA 2B9ZA 2ZX9A 4HBQA 2ZE5A 2SEBA 3HRPA 4HIHA 4X1KB 2N05A 3HR0A 2WQVA 4DK6A 1V9PA 5C08D 5JHDA 1SBSH 4KQ4L 3LH2H 4KX7A 3VI3E 2C7UB 3U6XS 3U1SL 3D33A 4F37F 1IKFL 1VERA 1WK0A 2HP4A 2BOLA 3D07A 5M95B 3HS0B 1G9NL 4MA1C 5FM5M 5FM8A 4PJFB 1CYWA 3PCYA 5D7JC 2YAOA 1AGDB 5EBLB 1DSYA 3OZLA 4E9XA 3B9VA 1ITCA 3AGWA 3C08L 1ID5I 4NKQB 3SJVD 15C8L 3Q9PA 2AVFA 5GONB 5H37G 1T6BX 1I8UA 2D7TH 2XKSA 2B14A 2QDWA 1A7OH 3PFUA 4LLWB 4YUEH 1KBKA 2DLTA 3O6FB 1DVYA 4AM0A 4HOZA 4NXMO 2BY0A 3UDWA 3OR7B 4WW2A 2DJVA 2EICA 2FUQA 3MZGB 5CN0A 4OKDA 1KV7A 3ARBB 1SDDB 1RZKC 3F00A 1DJYA 4GRWB 3BH8B 2BERA 4QXWA 4BIUA 4G8EA 4HUXA 1A6AB 4IK6A 5J4MA 5ELIA 2Z4TA 3U82B 3MCYA 3QI9B 4EBQL 5GGTL 1OD7A 1JHKL 5AOIA 4MAZA 3S37X 3VTTA 1B9ZA 4NOFA 4WEMB 5DEGA 5LVEA 1HDMB 1X5XA 1DVUA 3VFNB 4UB8Z 5D2NB 2XPYA 4L3AA 1JN6B 1OAZH 5AVYB 5IQ7L 1SQQH 2QTSA 3FN0H 1BQHB 3ZBHA 1K72A 3QQNA 5DSCA 4U1GB 4HQQH 3RY5A 1PZBA 2XWCA 4X1IB 2AQTA 2CJUH 3GSWA 4TLUA 3RDTB 4F5CE 1T83C 4NENB 1UXMA 1DJXA 1YECH 4YY3B 2E75B 1K3ZA 4B3EA 2P4VA 3IAPA 4N5ED 3ZYIA 4M62H 4NNYA 1KPVA 4GW1B 4QO1B 4GUQA 4HMCA 4UOW0 1PKQA 5E08H 1E43A 4W9LC 1JV5B 2A73A 4N86A 4YHMH 1N6QL 1BOGB 1RZJL 3JARB 1P84K 4PW9A 3STLB 1EVTC 2L7JA 1G94A 2A6DB 1F8TL 4LSRL 4K15A 3CK0L 2ZNIA 2BHZA 3G5YB 3IJHB 1MFBH 3GF8A 3DHUA 1HH6B 1D9KD 3KPRE 3LB6D 3CC5A 3O81A 1NIAA 4O4LB 1U8MB 3FMGL 5HYJE 1U33A 4HJIA 1Q6IA 4YHYC 1DL7H 1BW8A 3LEYH 1SZXA 4DXWA 1YEJH 3BYYA 1NAML 4GMTL 3LIUA 2DE0X 3F05A 5F88B 6PCYA 3CCQV 1MAML 3PABB 1S46A 1IFGA 5FB8A 5FHAL 5DJDB 1HCFX 2EYSB 3GYRA 5DK2B 2AXWA 4ZAKA 1GZQA 4ZI7A 3TEZA 3EYQD 1CG9B 5AW5B 5E1AA 3HE7D 1OT4A 2JJVA 3B40A 1T7VA 5KTEL 4DYLA 5JHAA 1FRGL 4FG4A 4IRZL 4TUOB 3TPUB 4X66B 2H8PA 4IGBC 4QOKD 2L35A 2DKUA 5EFIA 5LHGA 3HKZA 4WJKB 2HLAB 3LB6C 4M3KB 3PJSB 5DUMH 1JPSL 2HJFB 3II2A 4KH9A 4XC3H 2AZ0A 2H9GB 3CDGB 2HRLA 4JN2B 1AXIB 4N1EA 4TXVB 4JFWA 3WLWD 3FFOA 4AQEA 4PIRF 5E2WH 2DBLL 5I30H 2B1AH 3BEVA 5B39G 3S3PA 2HKOA 1FDLH 3RX9A 3SCMB 3OMAB 1H2NA 3JD3A 5HPMA 1W0JG 4XCFL 4D9RD 2H3XC 5L8KB 2XCMC 4LWSA 1OKEA 4LP5A 5TH2B 4M6AA 3EYQC 4WFFA 2W6IG 4FFZH 3HE7C 4S1QH 4KHXL 4JFDB 3ZTCC 5I8CB 1QQDB 4FFZA 4M9OA 5F6IB 4TUYA 4TQFA 1JF6A 2Y1ZA 3K2KA 1INDL 3PG