2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
2AZAA 4YSPA 1AG6A 2FT8A 3NJLA 2JKWA 2ZONA 4KNSA 2HX8A 3PAZA 1KDJA 2PCYA 2FTAA 1E5YA 3N55A 5I6MA 2PCFA 8PAZA 2CUAA 3AW5A 1GS8A 2OJ1A 2YAHA 1V54B 3FYIB 2DWTA 2FQGA 2TSAA 2BWDA 2FQFA 1JZIA 1L9SA 3AY2A 4F2EA 1AG0A 3JTBA 4HALA 2UXGA 1A65A 1NDTA 1ET5A 3UGEA 4P5SA 3QJVB 1B3IA 1CUOA 1A4CA 4YSRA 1GYCA 5D4IA 1IC0A 2HX9A 1OOWA 2IWKA 4A2FA 4CSZA 3N2JA 1TKWA 2DWSA 3V9CA 1NPJA 4AX3A 1MDAA 1L9QA 2Y69B 1KBVA 1J9TA 4E9XA 1NZRA 4HIPA 1PZCA 3PXLA 3ABKB 3U25A 1XB8A 1L9PA 2BP0A 2DV6A 2HRGA 4DP0X 2PPDA 1NWOA 4AKQA 3X1NA 5I6NA 1ZIAA 3BQVA 4M4RB 5I28A 1NPNA 1E65A 2UXFA 3CDZA 4YVUA 5B1KA 5TK2A 4WKXA 1AIZA 4ENZA 4AKOA 1GY1A 2LLNA 3AG4B 1PZAA 1I53A 3H56A 1PNDA 1CYXA 2AFNA 4YL4A 2FT7A 2GC7C 2R7EB 4E9QA 1FA4A 1BXUA 2MTAA 2P80A 1L9RA 4G7SB 3S3CB 2B3IA 3TBCA 2BWIA 3ZX1A 1A4AA 1NTDA 4L0PB 1J5CA 4BWTA 1X9UA 3EH4B 5I6LA 3UAAA 9PCYA 1AS6A 4HHGA 2FWLB 1BQKA 2YAEA 2W88A 4YSEA 2PP8A 4HHWA 4G7RB 2BP8A 4Q8BA 1PAZA 1YLBB 3T71A 1AS8A 1GW0A 2YQBA 4DP5X 1ILSA 3QJTB 5AFAA 4E9VA 4E9TA 4G70B 2Y1AA 1SF3A 6PAZA 2UX6A 5B1BB 2HLEB 1HAWA 3QJRB 2PPEA 1WA2X 1ASOA 3FPYA 5I26A 4BWWA 2EIJB 3X1BA 1BXVA 2PPFA 2EILB 1JZEA 3SBRA 4GP8B 4BDVB 2WO2B 1WS8A 1PMYA 1SNRA 1A8ZA 1IUZA 1J9RA 3QQXA 3NYKA 4PAZA 3FT0A 5PCYA 2AVFA 2HX7A 2WSDA 3TBBA 2J55A 4MFHA 5TK4A 1NIBA 2Q5BA 2BHFA 4NERA 2DY2A 1EZLA 2IWEA 4YSUA 2OCCB 2ZWNA 4DP4X 1FFTB 4GP5B 4M3HA 3H4FA 3TA4D 1GY2A 3SBPA 2JXMA 4YSOA 3V9EA 1SFHA 1KGYE 4A68A 1SHXA 1WAEA 2EIMB 3GXUB 2BZCA 2EINB 1SDDA 4JHVA 4HAKA 3NJHA 3ASOB 5IY5B 3QPKA 1XMEB 2XLLA 3S8GB 2XYBA 2XV2A 4YVNA 2GBAA 3T9WA 1W8EA 2XUWA 3EH3B 2FQDA 1PF3A 4N4YB 1HAUA 1ZDSA 2FNWA 1SF5A 4KO7A 4DP2X 1BXAA 3T6ZA 1NWPA 1R1CA 1E67A 4NAJA 3NJFA 1JVLA 3UACA 5EHFA 2VW7A 3AZUA 1AZNA 4YSQA 1ZPUA 2YEVB 1J9SA 3NSYA 1L9TA 2TSBA 4HCFA 2CJ3A 1NIDA 4DP7X 5B3SB 2UXVA 1M56B 5ANHA 2ZXWB 3BVDB 4KOBA 1GR7A 2H3XC 3WG7B 4E9YA 2YARA 3QJSB 3NT0A 4YSSA 1A4BA 2QDVA 3T6VA 3ZDWA 5AKRA 3PLYA 5B7MA 3NP3A 2W8CA 1SHWA 2VM3A 4GY4A 3KW8A 3PPSA 3AG1B 3UAEA 2WO3B 6PCYA 1V10A 1MG2C 2J56A 4BWUA 1NIEA 3X1GA 2YAPA 4WTQA 3H4HA 1GS7A 4X4KA 2FQEA 1KV7A 2AANA 1PZBA 3X1FA 1MZYA 4P5RA 4JKNA 3TASA 4DP6X 1XB6A 2X88A 2X87A 4G7QB 1OF0A 1HFUA 1PY0A 4E9WA 1IKOP 1KCBA 2CAKA 2FJSA 1JXFA 1AZCA 4FAAB 3IBOA 1URIA 4F2FA 1KDIA 1CURA 3FU7A 1AR1B 3DTUB 1JZHA 3ZBMA 2VSMB 2VN3A 2I7SA 3AG3B 3NJIA 5FC9A 1AS7A 4A66A 3T6WA 1WS7A 2PP7A 4G71B 3HB3B 2IDQA 3QJUB 4KNUA 1EHKB 1JZJA 3FQYA 2XXGA 1PLAA 2YAQA 3FPXA 2OV0A 1JVOA 1T5KA 4Q89A 4F7KA 3FQ1A 2I7OA 5LDUA 1AZUA 3PAUA 4K9JA 1ILUA 5I6OA 2QDWA 3TU6A 1VLXA 1N70A 3OQRA 1FWXA 2XX1A 2IWFA 3RYMA 2CCWA 4N8UA 2IDUA 3ABMB 4PCYA 2Q9OA 4BXSV 1NINA 3NSCA 3HEIB 3IN2A 3GDCA 2YXWA 3FSAA 3NSDA 3X1EA 2RACA 3IE9A 1BQ5A 5B1AB 3PAVA 4GP4B 4A2EA 4AZUA 3SBQA 2YXVA 2EIKB 3GYRA 5B7EA 4DPCX 1ET7A 1XB3A 3FSVA 4DP9X 4KO5A 1W6LA 4AI7A 3FYEB 1BEXA 2CBPA 3PCYA 2PP9A 2BZ7A 4UANA 1AQ8A 1JOIA 2PLTA 3NP4A 3EF4A 1OCOB 2BW5A 2DYSB 3SQRA 2IH8A 3NJJA 2R7EA 2HZHA 2J5WA 1MZZA 1A3ZA 2GIMA 7PAZA 2JFCA 2VMJA 2BP0B 1GSKA 2AZUA 3FSZA 4UF7C 2HRHA 1OE1A 1KCWA 1CYWA 3NJGA 3CDZB 2VM4A 2I85A 2XVBA 4W9ZA 4YSTA 1RZPA 3EH5B 3MBWB 2CALA 3OMAB 1OCZB 2YAOA 3FU9A 2PPAA 2XU9A 1AACA 1KBWA 2A3TA 3ERXA 4TXVB 1RCYA 3NJNA 2GI0A 1TEGA 2XV0A 2P80D 4A2DA 4DPBX 5B1JC 4HZ1A 1AANA 2BO0A 3OD3A 4HCGA 3C75A 1WA0X 2QPDB 1QHQA 1V55B 5B7FA 1BQRA 1RKRA 1KYAA 3CVDA 1SFDA 1AZRA 1BAWA 1NIFA 1QNIA 4KO9A 2BP8B 2IDTA 5I6PA 4BDVA 1RZQA 3OMIB 2IH9A 3CVBA 4ZK8A 3OMNB 1J5DA 2XX0A 2VSKB 4HCIA 3OM3B 1QLEB 5A7EA 1ZDQA 1J9QA 2MRYA 3DIVA 1PNCA 1W6WA 1JXDA 3WNIA 2GB2A 4YSAA 2H47C 1ET8A 1N68A 3NJMA 5B1JA 1JERA 2N0MA 1ADWA 4DP8X 1ASQA 2PPCA 1L9OA 3DKHA 4E9SA 1NICA 4FA7B 1TU2A 2ZOOA 1DYZA 3ZIYA 2VW4A 3JT2A 4JHUA 1X9RA 3FQ2A 4UAHA 2IAAC 3ABLB 1OV8A 4A2GA 5AZUA 3ASNB 1JZGA 3CVCA 5E9NA 2YAFA 4BK5C 5I6KA 1UATA 2NRDA 1E5ZA 5I5JA 3D12B 5I5IA 3WKQA 3WNJA 4A67A 2H5UA 1SDDB 1OCCB 3EHBB 1ASPA 1PLBA 3FU8A 4KNTA 4E9RA 2XWZA 3L45A 1BYPA 1E30A 1OCRB 4GYBA 1JZFA 2VW6A 5F7BA 3WIAA 1CC3A 2UX7A 1M57B 2E86A 4QKTA 2GSMB 4KOCA 1WA1X 1F56A 3QJQB 4DPAX 1BYOA 1M9WA 3CZUB 1GS6X 2B08A 3FSWA 4YSCA 5F7AA 1AOZA 5D4HA 3CG8A 4CSPA 1AAJA 1SJMA 4AKPA 2QT6A 1PLCA 3WKPA 1PCSA 1JXGA 2UXTA 3AG2B 1MG3C 1ZIBA 1ZV2A 1OE3A 3KW7A 1ID2A 2FT6A 2YAMA 1ETJA 2IDSA 4QLWA 2XV3A 2J57A 2DYRB 1IBYA 3MX0B 5D4JA 4BXVA 3UABA 4NB7A 2XXFA 3NSFA 3S3BB 2IDFA 4KO6A 3S8FB 3T6XA 7PCYA 3FS9A 5PAZA 3UADA 5I5MA 1AZBA 4GXFA 3G5WA 4DP1X 1TEFA 3NJKA 4G72B 4A2HA 4W1TA 4RH4A 2QPEB 3X2QB 3IN0A 2HXAA 3ABGA 4EF3A 3IEAA 1OE2A 1NIAA 2GHZA 2GC4C 3S3DB 3WI9A 4YSDA 2BW4A 1IBZA 3FU7B 1DZ0A
chains in the Genus database with same CATH superfamily
2A2QT 3H9HA 3KPNB 3RI5F 2WD0A 1IGIL 4PLKD 3NJLA 5ESVA 3KG2A 5GISL 5T5FA 1QR9A 4NXMO 2PCYA 3HR5A 1N32O 1W8NA 4HS8L 4YH6A 2XAJA 2JKLA 3JATB 2VDRB 3DX7B 5FFOA 3CE2A 3A67H 3ZUNC 2ZYRA 3SCMD 5KSAC 5HJBA 2P5EB 2OJ1A 3KYOA 3OR6A 5CMAA 4D8PA 1OGAA 2R0LH 3CU7A 4ZI7B 2FQFA 1XEQA 4ODHH 5IIEB 4H13C 4PA7A 1GIGH 2XOKG 4HK3N 1BOYA 2BSSB 3PDOB 4WU7B 2UXGA 3VXMB 3PP3K 2ZIMA 1AR4A 1ET5A 2WYZA 3UGEA 3UTTA 5C8JB 2E7BA 4JPIB 2XHBA 5LBSA 1N5YL 3MI6A 1SXZA 1E5BA 2QKIC 4KUZL 3TBYB 2XN9A 1YY9D 1OPGH 4DESA 3UTSE 4O4IB 2EICA 3WUWA 5B3JF 2PWFA 3K6SA 3RFZB 1WPXA 2F58L 1SM3L 2W9EL 4TSAL 2RHEA 3CXHF 4JI0O 4AYGA 4PJ9C 1YF2A 3LS5L 4AGPA 1C1EH 1I85A 4E9XA 5KSAA 3VH8G 4M1CC 4DR4B 2QVTA 4NQDA 5CBGA 3K6FA 4BELD 2NNRA 3NCCB 3WNOA 2DV6A 2ZWYA 2PPDA 3FNKA 3FOLA 4FEIA 3MREA 1WISA 5BW7C 3BQVA 4Z23A 4IDJL 1GZHA 1P4BL 1KXQA 2H6OA 2WLMA 4N90E 4WCYL 3TBTB 4KWUA 3V95A 2FR4B 3PL6D 4NZFA 3RP1A 2WXPA 3OZLA 3MV7A 3BH4A 2F5AH 1VADA 4KXBA 2QKIA 2P4AB 4ZUTB 3UO1L 4IW4C 4W4KA 3BPCB 3V0VB 1Q9WA 2CNZA 1U8KA 1F0LA 2FT7A 1J7VR 4J3SA 1Q9OB 2BM3A 4KJWD 3F7PC 5LB1A 3US1A 3S3CB 3VXUB 3ZX1A 4BD4A 1EDYA 2R2HB 1I3VA 4FZ0A 2XQBL 4QRTA 3OUSA 3X3FH 4KHXH 1RVFL 4Q6YA 3HKEB 4CAGA 1VQKV 1GOFA 3VQYA 3LV3A 1NLBH 2IWGA 1CFTA 2OYKA 3UAAA 1UWGL 2ZSWA 5L2KE 1I82A 2NUTB 4UM8B 5BW7A 2R2BA 1SC5B 2BNQE 3WHXA 4P23D 2YPVH 4AL8L 2GJ6B 2BSTB 1GM8A 2JELL 1LWJA 4XZ4A 1KBPA 4A38A 3DYPA 3KPSD 5IFJA 2Z3FA 3KGRA 1A21A 1FZMA 2CLRA 5DO2D 4U1GC 2J6WA 5G5DA 1TTGA 3FZUD 2UX6A 3CB2A 3D0LA 2EDWA 3ASNC 2X44D 1KBHA 4AW7A 5IHZB 1MY5A 3P30A 1WIUA 3HG1D 1D7CA 1MEXH 1WGVA 2V2XB 1S76D 3P4OA 1QFOA 1Y1DA 4D94A 1K6QH 1JZEA 3VNYA 2X9XA 4IU3B 3FTGA 4NYKA 1KIPB 4YIQA 3HC3L 1ZJBA 3HHSB 5A16A 2YPVA 4WHTA 4A7UA 3THMH 2QZQA 3BDBA 1Q6IA 2WSKA 3H9ZA 4N20A 3OKDA 2CPCA 2QM8A 4HWNA 4ES9A 5TK4A 1TPXB 1W91A 2IGTA 3OWRA 2W38A 4KKLC 1HWHB 4IHJB 5FUOL 3NSJA 4WUUD 4WI3A 1D2PA 4GRLB 2A99A 3HN5A 1HW7A 3CN3A 2JXMA 3DOSA 4OZFH 2WVTA 2C34A 1I7UB 1ACZA 2EINB 4MMZB 3NQKA 4BW9A 4JCWA 3P9MB 2EDEA 2KBGA 2DDQL 4MXWH 3S8GB 1WFMA 2NLJC 4L5FE 1HK6A 4U1HB 4G8IA 3KPMA 4X6DE 5AZEL 1GN4A 3PWPD 1AP5A 1HHHB 1BMZA 3JYBA 3NCBB 3KKYA 2AEPL 3D0AA 2O6PA 2VJ0A 3L1FA 5KBNC 2X9WA 2MMXA 4KHPB 5BZXA 4IBQA 4XOCA 3QO0A 1YCSA 2ZWKA 3RWJB 5KS9E 3MBXL 1PBYA 2G5UA 3VWJB 2X0LA 1QWUA 3BEHA 4MWFB 1A1NB 1U58B 2Q5ZA 2VZ3A 3NSYA 4JQIA 2HYMA 1NIDA 3ARGD 5I6XB 1MAKA 2OIEA 4HGWB 2K45A 4OZFA 4DFHA 1S9VA 3X2QC 1FZJA 3NN8B 1FGVL 5I1DA 1BG9A 2NLJA 2VZ1A 1TVDA 1S7XB 4EUPH 2LW3A 3KVQA 4UCRA 2NZIA 4X8CA 3REWB 2ARWA 3G80A 1FIEA 2I9TB 4V1DE 1XSOA 2GSGA 3NCYP 4LFBO 4XBFA 3WDHA 2BSBA 3MLXH 2AEQL 1BA9A 5B7MA 1I8IA 4AM0Q 3OGOE 3CCVV 3EFFK 3X11A 5H5NA 4X98B 4W9LC 1JXKA 4MD0B 5AKVA 2WO3B 3EGXB 3S88L 1CCZA 1HSAB 2AV1B 5IT9N 4M3KB 4X7CC 4Y2DC 5E4EC 1ZPLA 1WAAA 1VKXA 5F3BA 1KYFA 2HFFB 2IAMB 1UGKA 2FQEA 3VTAA 4IOSA 4JN1H 3BKYL 3CC5B 5CEZL 3U36A 1BMFG 2Z34A 3B9AA 1VACA 2JLLA 2DQ0A 1PY0A 5F71A 4Z3TA 1KNOB 2I69A 4XBEL 1UKQA 4LL4A 5HPMA 4FIPC 4EUPA 4R8WL 3F2LA 4RDBA 4RDQG 5D7JC 3GIVB 3H9SE 2PWEA 4X9IA 2GITB 3F6JA 3R0MA 5FA4B 1CXHA 3VU2A 3K71A 3MV8A 2QTVA 2OL3B 4QUOA 1QBLL 3EUDA 4CH6A 2IDQA 4K3EL 4XBMA 5FGBC 3RPKA 4MNGE 1II4E 4Y2DA 2OJEA 1LMKA 1PLAA 4AQ1C 2JIZG 4JQXC 4K23H 4F7TA 1AZUA 4L37A 5JHAA 3EJUA 3QHFL 4EQ3A 2FECL 1N0JA 1R73A 2AZ2A 5F2FA 5D9SA 1ZLWH 1KPUB 2IGLA 2NTFA 3JWDH 3RGVA 3QWOA 2IPUG 4NM4L 4ZOEA 1HYSD 5D7JA 3ARXA 3BAXA 5JIQA 1Q86W 4GSRA 3DTXB 3DX6B 2ZUUA 5F7NC 1KYOJ 2LOEA 2YJLA 3JWDC 3QDGE 1F3DH 3QFGA 3MLTB 4NJ9H 2PCFB 3CBKB 5KSUB 3TVMB 1CGWA 5E9DA 2EYTB 4HCRA 4GAGL 4PU2A 3ZRSA 1V3KA 2CE6A 2NNFA 4KAQL 5EBMB 5FGBA 5EZIH 3MLWH 1BQSA 4AQ1A 1KC5L 4U3XA 3ULVF 4AUUA 3G4SV 4JFSA 4JQXA 3FJTA 3LH8A 4K35A 1S7SB 2YXVA 2EJ7A 4WDIA 4OV6F 4DPCX 2B1IA 2P5PA 4GW5B 4J6RL 3L5HA 2WXFA 1OAZL 2OYLA 2BZ7A 3ZKXB 5B1CA 3F64A 3DV4A 1RMFH 3ZHVA 3KGUA 2PLTA 1S9YA 2UWEA 4X20B 5TH2A 3QAZC 2Q6WB 2FSDA 4RGOL 3ES6A 2YKLH 3EBHA 4P5KA 3DK0A 1YZZA 1HKFA 2E5LO 4KK9D 4QXUL 2YIDA 4DW1A 3A4FA 3L2LA 4JDTH 4JFYA 3FB7C 5TDPA 1K34A 2IU0A 1FAIH 2E27L 3L4CA 1FGNH 4Z8FL 3KPOB 4NZRH 2I85A 4PS7A 3C5JA 4W9ZA 4YR6A 4PPTA 2R2EB 2ZT9C 4PJCA 2C1PB 5D72H 5E70A 4OI7A 3MKGA 4DAGL 5J1SC 3CSXA 3E8UL 1OCZB 2MOGA 2YAOA 1HVXA 5F70A 3PQYD 1QR1B 2DQTH 3CS5A 1KBGL 1UVQA 5DS2A 4DGYL 2XV0A 4M6AA 1A1MB 4PBXA 5C92A 2YGQA 2KMWA 3W0WE 1HI6A 2AXGA 3I85A 3FB7A 3QIWC 4NIKB 4ZFGH 5IJVA 4YPGB 1FVDA 1KB9K 4GKNA 3Q7JA 1ZJAA 3AK2A 1NIFA 5JXEC 3TFKD 4IT5A 1NL0H 2C3HA 2CA4A 4PRNA 1JWSB 5CEXA 2OTJV 3DX4A 4OVUA 1G9ML 5CCGE 2A77L 4W4OC 5C2UB 1ZLVK 4TQHA 2LFRA 3WS3A 4I3RL 1WITA 5HYQB 4YE0A 2P90A 3L5IA 3UCSC 2ZKHL 3QUKA 1W6WA 2VR8A 4YSAA 4WUUE 1CFNA 5A2BA 1FCGA 1N68A 4G80B 3WFBH 4TMPA 4GKZB 1VGKA 4RGMC 1JGVH 5DFVC 4RDQF 5D7SL 5KYWB 3QNYB 2D3VA 5I30H 2PPCA 4XP4L 5TISZ 4NRYB 2CJUH 4D0CA 4HH9B 5DQJA 1DANT 2DQ3A 5JXEA 1NUGA 4QRUA 4N9GA 2J8OA 1T0NB 3BAWA 2F53B 4M62L 5KSVA 3S2CA 4W4OA 3IVKA 4Z3JA 4JL2A 1QFWH 5KJRH 3PWPE 2PGGA 1XZ0A 2VC2H 1OTUD 2WKOF 5CP7B 4ZQKA 1Q90A 1W0WA 1WC7B 5LHIA 5D7LE 3V6BR 3JASA 1E28A 1AHKA 4LLAA 4ZAKC 3S7GA 4WHCA 5DK2A 4BIKA 3L6FA 1PKOA 3KCWA 3OXRB 2K3TA 1I7FA 2J1ZA 1KJ2B 4GFTB 4Z0XB 4H25A 1GN3A 1U0QA 4POZD 5LGHH 4Q6GA 3WNJA 3LNGA 3O45A 1PL0A 1SDDB 2HWZL 2I5YH 2CJSA 4K3GA 1MIML 4P2RB 1VFMA 1O9HA 4YHIA 4Y4HC 3NIFE 2G75A 3EVKA 1C5CL 1M2VB 2RN9A 1CGUA 3HI5L 3CMOH 2R56H 1P5VB 3DSFL 5G4OA 1JZ8A 3RWHA 5I76A 1YQVL 3BYTA 3NACL 4WI7A 3DSNA 3CX5J 3FB5A 3OF6A 4QNHB 4KMLB 4KOCA 4ZAKA 4HIXH 4CJ0A 3KL5A 4KHTH 2HLAA 2PF6A 1H9DA 2MFNA 1MLBA 3QYMA 2BSEA 4WGKA 3PWLB 3P2DA 4R7NA 2EXTA 3L73H 2CSPA 5T1KA 1ORQA 3PHQA 2UXNA 5D7IE 4FNTA 4OTXL 1TENA 1EGJH 2Y48A 4NO0D 4HWBL 3AM8C 3L7FA 5FKPB 4ETQA 3T0BA 4PCTA 4PGEA 5JOPE 5FV2A 4JM4L 1PY9A 4CBZA 1M7IB 2L3BA 3BKMH 3QEQE 4P2OC 4UB6Z 5IE9A 2X41A 4WNSA 2DJMA 1ACYL 1HSBA 1OZUA 4N6RB 3DO4A 5BMFL 4LIQE 2CA3A 1YEWA 1IBYA 1XILA 3ZQWA 1DBJL 5F9DC 3MZGB 5F8RC 3T6XA 7PCYA 3HC4L 5AKSA 1ADQA 1OT2A 2A5UA 2RQEA 1DVSA 5JUEL 3KM1A 3X12B 3MNVA 4U1IB 3GPSA 3L13A 5C0EB 3L95A 2EVGA 1HP8A 4KL1A 1NCAL 1A2YA 3AM8A 3SDCB 2BP3A 1A3LL 1XUQA 1X5IA 4E4EA 4K0KO 1EGJA 3UJJL 1EAOA 1MWOA 4D9LH 3MO1B 1SN2A 4P2OA 4DOHB 2P47B 2ICWJ 3LXBA 1JVKA 1NFIA 1G7QB 4Y4KB 5EH1A 3D0VB 3W7WA 4RMSA 5DO8A 2VR6A 4LDOB 1BZOA 4UQ2A 1R33A 3PDDA 1AG6A 3C6LC 2FT8A 4PJ9D 2CK0L 3AY4A 4JI1O 3JAWB 1UYWL 1WPBA 1KCUL 2FTAA 4G5ZH 3BVUA 3WL9A 3SYCA 1HXYA 1CICC 4XVTL 2X2JA 1QYGL 2FK9A 4OZIA 4OBSA 2V8LA 1DQKA 5DWPA 1SJHB 2JB6A 8PAZA 3V0FA 4YDKH 3LNFA 3GJEB 3ATAA 1WEJL 5L4FA 4JFXB 2WXLA 3V5HA 1H3VA 4DWHA 3QZWA 4S1SL 1WBZA 2GBOA 5EWIL 3AY2A 1R46A 5C0DA 3LEXB 3B43A 1UEYA 2OZ4H 3JBG7 1A65A 1MHHB 2OR9L 1NDTA 3CVHH 3RB7A 2J72A 3LS4L 1A4JA 1B3IA 2FSEB 3B5GA 3V4VB 5JW3H 3C6LA 5C8YB 2B20A 2EIZB 5BR8O 2A83A 5BVPL 3SGEI 1BWWA 2WBJB 1OP4A 1M9SA 4GI6A 4BH7A 1A9EA 3ZDZB 3B37A 5AW4B 1TKWA 2WXKA 4HF5L 1CICA 1NPJA 4NN7B 3HS0B 1FNFA 5F1IB 1ZUQA 3TN0C 1PNLA 2AZ0A 3Q13A 3TWYA 2NXZC 3UYPA 4NO2B 1NVPB 1IKFL 2LGWA 1BLNB 5FHAL 3I55V 5L4MA 4GSDH 4AILC 5HTSA 4AKQA 5TDOA 1S72V 5I6NA 4LCUB 1ZHKB 4DSYA 1MCBA 4DF9A 3ZY7A 5ID0B 2QGCA 5A40E 4KXDA 3ZZ1A 5JW4Q 3MBWA 1B0GB 2IOOA 2OZ4A 1KXVC 2XBDA 1TVHB 2APFA 2AVGA 4J3OH 1GYVA 3CK0H 5FYJH 4YXLH 4CVXA 2GC7C 2ZKOA 1H8NA 1JP5A 2R7EB 2ZYSA 4P57B 2J25A 4PJHE 3RY6C 4DUWA 2P80A 2EVHA 1BE3H 2FWOA 1ZWIC 1DFBH 2H26B 4KKBD 4MS8C 3RL2B 3TBCA 1YSCA 5HYJA 5LGNA 1UH2A 1JUFB 5LGUA 4HBCH 2BVQA 5SX4I 4OX9B 3HFFA 3UFIA 4GAYA 4W6WB 9PCYA 4P30A 4K3JL 4WI4A 1E6OH 1IGJA 4LLMA 4BK8A 3QIUB 2GSIA 2YAEA 3MUUA 4TQ8A 1LK2B 5T1LD 4WW1A 1RIHL 3LKQA 5D1ZD 1ZAUA 3NZUA 3IDJB 2NOYA 2AK4B 2I24N 3FHQA 3MLUH 3FB8C 4KKLD 1KXVA 3BA8A 5LHDA 1MVFA 1S9XB 4KNQA 3U7WH 1U95B 1AI1H 1TZHB 3KXFD 4DR2O 3P32A 2VQ1B 3ABLC 3RY6A 1ZWIA 3BC9A 4IIQB 4JKPH 1A9VA 3FU0A 5CN2A 3G5VA 2AGJH 4DQOL 4F3FA 5F9JB 2GUOB 5H4ZA 4YZFE 2JCWA 3IRZA 4O9HH 1I31A 2C8NA 4XMPH 1VENA 4PRPA 3MLRL 4YE4L 1VQPV 3DROB 1H6EA 3V79C 3ZZSA 3P0YL 5FM8A 2ZIDA 3FB8A 4MNQE 3MLZH 2ZX7A 2A6DA 4GSXA 5ETUB 4ZDHB 3B09A 3TT3H 3RBZA 2XNDG 4BUQA 1DQTA 3Q3GA 35C8H 4LP5A 4KMTL 1B4RA 4R0LC 4XAWL 5KBPA 2QV2A 4X6CE 1RFDH 5ILTL 4ANXA 5D93B 5K69A 4YSUA 4GG6F 3NFNA 1SVBA 4WKZB 2GTZB 5ID1A 4G3YH 2R70A 3G6EV 3TA4D 4MNHA 4W9HC 4OIFA 3CCHA 1E1RG 1KGYE 1SHXA 4A68A 1DE4A 4BKTC 1MI5D 1NPUA 4MVOA 3ICXA 3MRNB 5JQGB 4YBQC 4F15B 2F19L 5IROC 4JHVA 3B2UD 1RK0B 2OMXA 3HE6A 4PJXB 5C0BA 3W82A 5J9PA 3UCQA 1A7NL 1R0AL 1CVRA 2WLKA 5J6SA 1IGCH 1V7NH 2PTTB 4B7LA 2AGAA 4MGXA 1XCTA 1W8EA 3EH3B 1KTLA 3JUYA 3S2AA 2XQYA 2X70A 1RM1C 3JWOH 4R0LA 4N4YB 2BH0A 1QRNE 4U3SB 3IMVA 3SJVD 3VXPA 4JFED 3CE1A 4QGTA 3E1F1 3QEUB 3F04A 1KLFA 1QEXA 1E67A 3OR7C 3JWOC 4GBXC 1EBPA 2HT2C 1S3KH 2PXYC 4OCXH 3VFVA 3QYNA 1JX9A 2Y25A 4W6XB 1G7HB 4IBLT 4EZKA 3HLAB 3BAYA 1JV2A 3L3OB 3LKRA 1D7FA 4KTEL 5IROA 5JIHA 5GS0C 2F4VB 1CJYA 1IC7L 2Q0ZX 3MUZ1 1SY6A 3BLKA 2EDDA 5E08H 5DHVB 4GRLC 4QIWF 1ZANL 2H2SC 2H6PB 2HFGL 3VRJB 4QAWA 3LNHA 3DGCR 3TWCH 1Q1PA 4J3UA 3FH7A 2AW2A 3UTSA 1H15A 2O5XH 4TSBH 2H1XA 4B9ZA 2EINC 1MWAA 1RY7B 2BVYA 4W9DC 1F4WH 4OF8A 1LEKA 1QTYT 3KJ6H 1HL4A 3OR7A 4N1EA 1EQWA 4GBXA 1U6AH 4QPEA 2PXYA 4NZUL 1CB4A 4J8RB 4R96B 5BO1L 3RGHA 4S0SD 1KN4H 5AYTA 3ILPA 4N8VG 2AI0L 1C16B 1FV1A 3MNZA 2EE3A 1V10A 2HLFC 3QPXL 2D8KA 2VN7A 5HY9A 1E7VA 2B0SH 2ZOWA 2AJUL 3FTWA 1MCHA 2WXOA 3O4OB 4YFLI 3CQFA 1FPTH 1U8LB 2X6UA 2CUGA 3MV01 3BLBA 4JKNA 1I7TB 1L9NA 5ICXB 4RQEA 2F5BH 2WUBH 3H7BA 2CBMA 2CU9A 3Q6FB 2VL5B 4FLYA 3S3SA 2CXGA 25C8L 1KDIA 1JGIA 2JMRA 3IE4A 3KYKH 3QGVA 3UG4A 3F7KA 1Z5VA 1MJUL 2PMZA 3CFKB 1TDQA 4AQYB 1AJPA 2XVGA 4ZUUB 3T6WA 4Z7QB 5L2KA 5IVXF 5I0ZA 3L3KA 1U97A 2MEJB 5BZZA 1J1XH 1X5AA 2P46B 2D73A 2VGLM 4UMSA 2BNQA 5A2KH 4OIIL 4JY5L 5CP3H 1AXSA 1JVOA 4DZ8B 3EYQD 4TTDD 2I7OA 5AW1B 3RWJA 1XGQA 4Z5RA 5I17B 4L8CB 5KYYA 4QXTB 4HUMB 4YOKA 1O7DC 3GFUA 4Z7QF 3UOAB 3X14A 4Y8AA 1QI5A 1T3FA 3A6OA 3MJWA 2W0FB 1OHHG 1CDUA 1YPZF 1NCOA 2C7UB 2OMYB 3CFQA 1KFAL 3BDYL 1DJYA 3E1ZA 1J5EO 1AJ7L 2ZPKH 3CCRV 2CCWA 5CB4A 3O9WC 4N8UA 1DQDL 5DJ0B 5DR5L 5E1GA 5HHXL 3S3JA 5E7BA 2Q9OA 5A43C 4KQ0A 1GMEA 2YXWA 4YZWA 3X1EA 3PYCA 4MAUL 4TL4A 3S35X 4OKDA 1M53A 2AJ3B 3AXLA 3AFLA 4TNVF 2FCBA 5FW8A 1MSWD 4GP4B 4L5FH 3KWXA 2OMZA 5IOPB 4OM1H 4TUYB 3QRFM 4X98A 2QTSA 4DVRL 2F15A 2YGOA 4FHJA 3IGAC 2VITB 5CP3A 2IAND 3E86A 3FSVA 4JFHD 3RVXC 3N44B 4QGPA 3I75A 4AI7A 4TNGA 3ZE1E 4KFMA 5HYFA 3VQWA 3MSPA 3O9WA 3FBKA 3QIWD 4OT1L 3M17B 3PWUB 5F0LB 4JPVL 1FJGO 1AP2B 5K9JH 3WE6B 3QXDA 2J5WA 1KNOA 1FVCB 3ATFA 1RZKH 5AALA 3C8DA 4XVJL 2EUZA 1UOKA 3D39B 5KOVC 1E8XA 4NOBA 1QKZH 2XN2A 1CLYL 3QUYB 5ACZB 1KIUA 3WEMA 2OS7A 1FZKA 1CYWA 4GI9A 4K3AA 2GKIA 5C0RH 3GTNA 5FDWA 3IGAA 3LDBB 4X7SH 4ZT1A 4LCIH 2CTRA 3TVMC 1XGUA 1SDYA 1O6TA 3D4GA 4QF1A 4X6DA 5ERWA 2CALA 5EBMC 2DQHL 5I1IL 3ZT6A 3KXFE 3MLYH 2MPAL 3FT9A 5DFVD 2XU9A 1AACA 1YYLL 3MYJB 4QRPE 3QR2A 3NJNA 4TPRL 1UTDA 2QQKH 2XA3A 4FLHA 1HWYA 4TVPD 4ZUVB 1I4FB 4JB9L 5DD1L 1SMOA 1EEUA 4H20H 4Z76B 4UTAL 5F3HB 5KS9A 5GJTL 1MLCB 4KKPA 3VJ6B 3TNMA 2V7NB 2WSPA 5SWQA 2X4NA 4NJAH 4Z7VF 4X5RA 1R24B 4Z77B 1GKFA 5B7FA 3KJ4C 1HL9A 2QMJA 1BAWA 1MPAL 4BQ6A 5HDRA 4AG4H 4LF4B 4MS2A 4KI5F 4L4TD 1YJDC 5E5RB 3MLSL 2BNRB 2H7WA 2UY7A 5EBMA 2CDGA 2MJWA 3OMNB 5IQNA 2AHIA 2FRGP 1VHPA 4GQPH 3FFCD 5DK0B 4FEMA 3KWTA 2YI8A 3QQDA 1CFVL 4JI5O 1T7ZA 2YIAA 4KK5C 3WNIA 3Q06A 1FCCA 2F2HA 3NJMA 3CTTA 2VISA 1UD6A 3PG2A 5EG6C 3P54A 3DVFA 3EYFB 1F5WA 3NFPB 3G04A 2CR6A 2X89D 2Q3ZA 4A7TA 4YEFA 3A6BH 4Y4HD 1X5FA 3ZVVA 4YLCA 3FUNA 5BRZB 2VLLB 2ADIB 3FUHA 3DKHA 4NCC1 3ET9F 1ZS2A 1JWUB 4GQZA 1XI1A 1MHPH 1JTTA 1CLOH 1J0HA 2WSSG 2FBJH 3MJ9A 4XGZB 3ZIYA 1LEGB 4P4RB 5E4IA 2FVNA 1T20A 3OJDA 5D7KD 5IJVB 1N3NA 2A6IA 2ZYIA 4YDVB 1OO2A 5BOJA 5AVXB 2VDKH 1WWCA 3BVXA 5JO5A 2B39A 1GGBL 3EGDB 3SJVE 2IVFC 3H9SA 1EMTH 4QCIB 4XP5L 1FE8L 2XG4B 1NLDL 3OKMB 1R9FA 1KLGA 1H6FA 3V6ZB 1U36A 5KVFE 4JANA 4PJGF 4DNLA 3L4TA 2QSCL 4IEFB 2GFBA 3V0EA 1M90W 5C6WH 4NXKA 4XHJD 3H3PL 3RY5A 3DURB 1XGYH 2N0KA 3IBEA 5DHYB 4R50A 3DGGA 5FW6A 1RURL 1J8HD 3EHBD 3VGDA 4B3RO 2FL5A 3C6SA 1W15A 1D5XB 2QELA 5F3FA 1YJNV 1A9BB 1M57B 2CLZB 4S1QH 3B5TA 5C0JB 1JNHA 3PGCB 1IB5A 3UBXB 1GW6A 2IMMA 4IHBA 1UJWB 4BZ1H 4M6NL 5JMOC 3QDGA 1WZMA 3W9DB 2YR3A 4ZX4A 2WXIA 3OB8A 3CZUB 5FO9B 1NJ9A 5D2NB 2XKSA 4LOEA 4O4JA 1AY1L 1NCIA 2ZUWA 3D85D 4F33A 3LIZH 2VXVH 1L0QA 4KJQC 5G55A 3R0NA 4LXFA 1RJZA 4MW3A 1TCRB 3B7TA 5DJZA 5HGAB 1XSJA 5KANG 1NU1H 1VSCA 5FUCE 2D03L 5E2UL 1WCQA 3QDME 4J10A 1CZ8H 4J8QA 1J05A 1Z32X 2Q0AA 3QNYA 4PJAB 4XNZB 4IK6A 1URZA 3KW7A 3FAVB 2EEDA 4H26B 4HUXB 1N34B 2EAEA 1VIWA 1XCQA 2MSPA 2CZNA 4KI1A 4BCZA 1S78C 5IMLB 1BECA 4LSUH 2DYRB 1G5AA 5D4JA 2OR8A 4PY7A 4PRHD 5D5MB 1LUWA 2PYEE 1VQOV 4XNDA 1KY7A 5I73B 2VLRB 3ULUL 3KPPA 4BAYA 4PJAF 3S34H 2CHDA 2QTEA 3QFJB 3GMNA 1DSWA 1KACB 5LCVH 1FHNA 4TQIA 5DN6G 1NH2D 2OXHB 4MMXB 5GPRA 2CR0A 1MZFA 4JASA 4P49A 5EB9A 3R8BB 3FCBA 3LIZA 1CFQA 1G6RA 1IFRA 3WAJA 5K39A 3LSOA 2DQGL 3VI4B 1P6FA 2EDLA 2X28A 5GQBA 4LQ1A 4A5UB 1WSST 4CMMA 2OYQA 5J11B 2DWDB 3T3PE 4OZGB 4NNPH 1F1AA 4LGRB 5HYJD 3TN0D 1JN6B 2JKWA 5DMGD 4GMTL 3GSUB 4X6BB 3ROOB 3EOAA 5GZNC 1RK1A 3W0WA 3QJHA 4LL1A 1GGIL 4J9ZB 1M1SA 2VDLB 4QLRA 3UZEC 3N55A 1JA8A 1QPXA 4FQLH 1TYRA 3VE0B 2WGNB 4OZGF 1YMHB 3KPRE 3GB7C 1V54B 3IC9A 4GXUM 3DHMA 1I1CA 2IANE 1JZIA 2P5ED 4OCLC 3UPCA 1YN7A 3BWUC 4YWGH 3ETEA 4FHKA 3TGUH 3LX9A 3E2EA 3RWEB 2G60H 1NMCB 3C60B 1HINH 4Y5VB 5DEJA 5T3ZD 3QJVB 1B6QA 1G1KA 1TZOA 3BE1L 3VXMD 1DO6A 4R7DA 3VOUA 3ZJZA 4H1LA 1FDLL 3SDXE 2LT9A 1UQSA 1NDGA 5GZNA 4ISVB 4XX1G 5AENA 4F6EA 4CSZA 4Y4KC 3UZEA 1AVMA 4B27A 3WUZA 5IFHH 4CMHC 1F8TL 3MACH 3O2VH 1RHHA 2WQUA 2XWEA 4X4XA 1ZT7B 5L6YL 2RD0A 3LQAH 4NNYA 4ZW6A 1C12B 1T66D 2CRIA 5D1XB 3GB7A 1Q72H 5CGYC 3BPZA 2XPGA 3LQAC 3BT0A 2HAZA 3BGFB 4UB0L 1YEIL 5DZVA 2YA1A 3PJSK 2BJML 4GFXA 4XH2B 1NCWH 3A67L 4E68A 5E1AB 1RJCA 5D7LA 3JSLA 3GZQA 3D5OF 1QTPA 3JD4A 3T4AC 3UH8A 2R0LL 3JWNE 5FCSH 3KPLA 3KNBA 3GKWH 1I1AB 1ZT1A 4QRRA 5J6HB 1KFGA 4XP1H 3VFNA 4DK5A 3BSHA 2XXCB 1T2JA 2VXUH 4TQDA 4L0PB 3LXUX 4MMYA 3VXUD 5BXFB 4HWZA 3FKSG 1P84K 3WNNA 5LOVA 1PZ2A 2ADFH 3DC6A 4BQ8A 3FRPB 5T33L 4S0HA 5LDSA 1XGTA 3G6AB 5KVDE 5AB9A 1EEZA 2DN7A 3CWGA 2W92A 2NPLX 3CDGB 2QWNB 3HS0C 3FFCE 4I55B 2VDMB 1GZQB 2UXBB 3MCYA 3U11A 1U91A 2YXYA 2GJ6D 4ONHA 3OKOA 1BL8A 3T4AA 4E5XA 3CFIC 2IJ0C 4HJ0C 4I50A 4JFPA 4QY8B 1PEZA 1I1FB 4NQXA 3IXAB 4HX1A 2VRKA 1KEGL 4CH3A 4OFDA 2ENSA 3RYHA 3D2UB 3T8XA 1BIIA 3MGTA 2PETA 4HQQH 2WQ8A 4B3SB 2EILB 4M8RA 4FP8H 1F86A 2C3XA 3QEQA 2KDGA 3BPOB 3GINA 1T4KA 2P06A 4M7LT 4Z7UE 1ZGLP 1DQQA 2CGOA 3CFEA 4FFBB 3SGJC 1PMYA 4LBAA 2MCPL 2PF4E 4M48H 3OZKA 4BJLA 1RZGA 4NQSA 4KHXL 3V6OC 4X0NA 1KJMA 3X3FL 5FM5M 4PR5A 1S7QA 3APDA 1NLBL 3RWRD 2H0PA 1UCBH 2DQ6A 3I9AA 4NERA 4O4LA 4H44B 4R3SB 4TUKL 5GS0D 3W5MA 2IQAA 4NRZB 2IBBA 2OCCB 5L4IA 1O5DT 4LEOB 4GRLD 1QLRB 2PY5A 2F74A 4Q9QL 2VUKA 5AOIA 3LRLA 1FG2A 4K9EH 4IIQC 3TYFA 4PV8B 3WEOA 3O2DL 4JE0A 3O6KL 1T0MA 3CFBB 3FO2A 2JJWA 1DJSA 1AGBB 3V6OA 4MA3A 3K5LA 2DMKA 3WD5H 4DQAA 3KZ8A 5JJEB 3GHEL 5DVPA 5C71A 2HVKB 3LSUA 2G9HB 5BZDB 5FV1L 3INUH 1R3JB 1K6QL 1QSEE 4JO4H 4A6YH 1WICA 1YHPA 1HESA 3BP6A 5J4MA 1I08A 3T6ZA 5IB1B 5IGXH 3U30B 1PG7W 2OSXA 2G3MA 4YLBA 5HDOA 3E7JA 5I1JH 4FFKA 3AZUA 5IQ9A 2D0GA 1IC5H 3DBXA 1XIWB 3VWJD 2Z92A 1I9EA 2JSFA 3D18B 3PXJA 1XTLA 1OANA 2MTPA 3QI9C 1WQVT 1A47A 4FXLA 5B3SB 1C5DB 1RZ7H 4PS4H 2V9TA 4ZBMA 4RNRA 3TIEA 2H3XC 4NO3B 1FL5A 1AYOA 3BVWA 1NUFA 4B5ZA 1CBVH 1L5GA 2LGNA 3QJSB 3QE5A 5E8PA 4LCWE 4HH8A 1PQZB 4FTVE 4QHMB 1E9OB 3UQ8A 3CMEV 1E7UA 2E7HA 2YXLA 4RAHA 3F01A 4EI0A 2JK5C 2X1OA 3WIFA 4MXWL 4A6YA 4X0KB 3STZB 1SF9A 1UADC 2Y7SA 3ZRWA 1TSRA 1YDXA 2SEBB 5IW1A 3JD3A 5GGSY 3Q8EA 1MG2C 1CDJA 2X40A 5E0FA 3VG0H 4HLZH 4JPSA 3QI9A 4PGJA 3OLGA 1OTTD 4OZHB 5DWUL 5KOMC 4M61B 3VFUB 2NY5H 4ZODA 4X99B 3IPFA 5KA5A 2IAMD 3D25A 4APXB 1JXFA 1U8JA 4OH2A 1TVKA 4AM0B 4KVNL 5JQGA 2NY5C 3L3OC 1URIA 5AL0A 1VA9A 3HG2A 1D5IH 2W6JG 4ZTPH 3MFFA 4WU5A 1EZSA 2DTSA 2EABA 2JK5A 3WKML 3D6GA 5IMMA 2JEUA 4RIRB 5C3IA 2I7SA 1AS7A 1R5VA 2CUHA 4GRWB 1EBAA 4BH8B 3STLB 3QJUB 1ZHBA 1XQ8A 2P5EE 4IKIA 1U92A 5JJNB 2N3JA 4AXWA 1Y18A 4HKJA 4AEEA 4HU8A 3MRBA 3M7FB 3MLXL 4LKXA 5B3JE 5JPNB 1WTLA 3AJ7A 3VRIB 5EOTA 2Z31C 4KPHH 4FQXB 1UB6A 32C2A 1SXSA 4GOSA 1N70A 2ED6A 2DMGA 3RVVC 5IVZB 4M02A 3IKCB 5B39A 3O4OC 4DR6B 1QVGU 1HOCA 3WJLC 4JO3H 2VMDA 3IKKA 3KS0H 2XTJB 1IM3A 5CKAA 3VXQA 1MAJA 3BLPX 2RCVA 3BN9C 5DRNB 4XCCL 4J7ZA 5FB8B 1AKJB 3WSQL 1CWVA 3TVMD 5I9QB 3EYOA 4P5TB 3K57A 2WV3A 3LH9A 5EBGA 4FM1A 5ESAA 2Z31A 1F2XK 4MNQA 5GIRA 4FFVD 3MXWH 1XB3A 1K7DA 4OGAC 4MSWC 5D5PA 5EU6B 3R8QA 1I7ZA 2NZ1A 5DT1L 3CPWU 3ZEDA 2Y2YA 4FQ1H 5DJ2B 4CW1B 5EK0A 3WJLA 3FQNB 5IJDC 3BPNC 1FNGA 3VDBA 2IQ9H 4X6CA 4F20A 3CD6V 2FYVA 2APBA 3A2FA 1QPKA 5KEZA 1I75A 2GIMA 2JJVA 2COVD 4JEGB 4M1GL 4YXHL 3K74B 5ADPH 5EUOA 1QFPA 3U4KA 1A5FL 1I8KB 4OD2A 4XNMB 2VE6A 4WTZA 4C55A 1PG7X 3X17A 1R34A 4RRPM 1Y74A 5FYKE 4MSWA 4FXTA 3SJQC 4KTGA 1DHKA 3QP3A 1FYHB 5MP6L 2B16A 3PU7A 1DBAL 5D6CA 1MRFH 3MLWL 4FQJH 1HX0A 3AS3A 4PWFA 3FQWB 4Q2ZA 5TPWL 3VW3H 1QRNA 3CD4A 5B38B 3V0WL 5L2JB 1G9NC 4XPBL 1U8MB 3ZDXB 1K9MW 1JGUH 5F88B 3POCA 5B1JC 5E2VL 4KZCA 1D6VH 4P9HH 4XPAH 2D2OA 2C7UA 3OD3A 2Y36L 3SHSA 1HXMA 2QLYA 1P7KB 1TQBC 2HLDG 4KO9A 2VXTH 1P69B 5I6PA 3BHBA 4KUMA 3DIFA 3VWKC 2AQTA 1KIRA 4HIIA 1NGYB 3O4LB 3E22B 3NH7L 2FO1A 4N2DA 3QUML 4AEHH 5I16A 4GQRA 3ZT7A 4C8XA 4ZFZA 3BH9B 4JDTL 3QUYC 5L7XH 2MRYA 3BUBA 2VLME 2GB2A 3HZMA 4O4HB 2PO6B 2QBWA 3CZLA 3LDBC 4HHAA 3WFEH 5B1JA 4TUOB 1JERA 4DO4A 3T1HB 2IH1B 4N0FB 2ALWA 4GLRH 3ZHSA 2JCCA 3GMRA 3OVUB 4KK8D 2P8MA 2P43B 4LLUA 2J4WL 5CA0A 2FX8H 4JI3B 4PG9B 1QHPA 1RUKH 5F7EH 2Q4PA 4NT6A 3QYCA 3VWKA 3P3PA 1MHCA 4GO6B 4YL9A 1T03H 4OLWL 3UC0H 3B9DA 1ENVA 3SYAA 1KGCD 4UQDA 1L8DA 2R1YA 3LJ3A 5GGRB 2F53D 3HUJF 5HI5D 1PJ9A 1XNRO 3RVWD 2ETNA 1CF8L 5AZUA 3HNTL 3VXOA 2ZXWC 4XR8C 4JM2B 4O02B 3NABH 5E6IC 2NXYB 2XBZA 1BDYA 2JVUA 5LMNO 3CFNA 3DBSA 3K8KA 1LO5B 2VABB 1SXAA 1BW8A 2EIEA 3B2EE 2YSTA 4M93B 3G5XA 2E3CA 4KVPA 3WO4B 1G8MA 1KCVL 4JN2B 4PA3A 4U1LA 2D7MA 4W9GC 2DEXX 2EDMA 4PRAB 5C7XH 5CLZA 4ZOAA 3WFBL 5EORL 2WC7A 2J1WA 3ULUF 4P2RD 4XCFL 4PGDA 4N21A 1KJVA 2Z4QA 4H5SA 4BSVA 4LU5H 5HYEA 5I30L 2B7DT 3HVNA 4Y1AA 5GRJL 3U0PB 5E6YA 4UOZA 1RUQL 3BGMA 4X4ZA 1Q9LA 1WA1X 1Y6NR 5E6IA 1CE6B 4LF3B 1F56A 1DR9A 1E2VA 3UO3A 2Q9LA 2IPKA 2M6YA 4PHZA 4M3JA 4MA7H 2Z0AA 3GMOB 4NPYB 3UJTL 2EYRA 5C86A 4DKAA 3K8LA 4NUJA 4UQ3B 5F7AA 3BCFA 3BZ4B 3LMJH 1S5IH 2QWRB 1SEQH 5F1OB 3AG3C 5A3ID 4BUGA 4ZMTA 5TGBB 3IAPA 4LVOB 5DD3H 2I25N 2A9CA 3VFPA 1XMQB 1XBLA 4HMEA 5I75B 1FZOA 5CSZB 1T5WB 2AF2A 5CLXA 1BD2E 2Y0SA 4G8EB 3T77B 2QM7A 1N6UA 2ADIA 1A66A 2R9RB 4TUJB 1BQLH 1TMCB 4H7VA 1XGPB 2I5YL 4CH4A 2XICA 4NQVB 2XXFA 3UABA 1ZA3B 4GKKB 4APQA 3S8FB 1AYRA 4NB5A 2WYHA 4A2LA 4G42B 3CCSV 3B8NA 1BZKA 3L5WB 1IGYA 1NKGA 2R56L 5TDNB 1EHNA 1M57C 2J1KA 5DZLA 2WQSA 4P05A 2BCKA 1GN2A 2W94A 5FOJA 4IOFC 3DX0A 5DDHA 4E42A 3EFFB 5KTEL 4AIEA 4M43L 4HIXL 4HJJH 3ARYA 3FT4A 4GXVH 3SDCD 3TBWA 1NGXB 5D2NC 5GRUH 4IEFA 2NDFA 1TTCA 1X6NA 1N36B 3QQ3A 2DMBA 2NZ9C 4QRPA 1EN6A 4TL5A 4MVSA 3HMXL 4I87A 3FU7B 4Y4KD 4AT6A 2X4OB 3ULVE 4JVPA 4JHWL 2A6KA 4A37A 4JMXA 2J21A 1RK7A 2QV4A 3P73A 4XB3A 4GRMA 3O2WL 5CZRA 4HXAH 1HEJC 4B7IA 1OCOC 4WI5A 1BX2B 3CHPA 1Y0LB 1CXFA 1T21A 3QWNA 4KU1A 1ECYA 4WV1C 1CFSA 4HWEL 4BYHA 1GM7A 4JY6B 1GAFL 1RZIB 2VJ8A 4FULA 1E0OB 4LSQL 3FDWA 2WOBA 3MJGX 4HS3A 4LRIC 5KN5A 1YMMB 5DD0L 2P6JA 3GMQB 4NKQB 4X5XB 5INCB 2XDHA 1OT4A 1EPFA 2BC4B 4F37F 4P5SA 3CN4A 3RYIA 1DQJB 2K6WA 4K7PY 1NCJA 2CRYA 2VQTA 5KVFH 3GUTB 5TE7H 1LO3H 5B1OA 2GJJA 3RX9A 1XWVA 1MVYA 5CILH 5DJCA 3B7YA 1R1BA 2WBJD 4HNAB 1HDMA 4J3VA 3LD8B 1MDAA 1KELH 1KTBA 4JR9H 3FO9B 4QXGH 4K8XA 3ZN1A 5AOJA 4F27A 2FMLA 4NTXA 2BMKA 2Y2TA 4MD5B 4DEPB 1ZOXA 5GW7A 4XMTA 2X1QA 3DXAE 4WV1A 3PV6B 1JJOA 5F9OL 5J1AB 3MNMA 4FQIH 4BHUI 3DETD 4LRIA 4W6YB 1NVPD 2G38A 4H8WC 1WA8A 1P4LB 2MQCA 4G5ZL 5TE4L 3OLEA 3OT7A 4PD4F 1D5ZB 4N0CD 1A3RH 5CJOH 3CDCA 2IMNA 1ROWA 1JZ2A 3OWEA 5T3XD 4LAJH 3TNNA 2G9KA 4FMFA 5F7FA 2P7TA 1Y6MR 1IFGA 4NC1E 3SE3A 4PP2B 3CVHL 1M42A 3EXAA 3UMTA 4XO5A 5FUCC 2Q8VA 4MVQA 3F3HA 5DMJB 5ICZB 4YIPA 3G3LA 2FWLB 1S7RB 2JWYA 4XP6H 4ANKA 4Z7OF 3IDXH 5BMVB 1OWRM 4NHUA 4LAQL 2YD6A 3QIUD 1GL4B 1PAZA 5L3GA 3ESOA 3T09A 2CO7A 4RMWA 3PWJA 2Y7MA 3LQMA 3HKDB 4BFRA 2YPKA 4K3DH 1HL5A 4WFAV 2AK4D 3B7UX 2EKJA 5JOFB 2TRYA 4R7LA 2YRLA 2JJTC 3GXTA 2B2XH 3QDJB 4F9LA 5SWZB 4EBQH 3DJZA 1MW3A 1ASOA 3LKPB 1IC4H 3TH2T 2CJTA 5H37H 2CIKB 3LQZA 2GDSA 3CCMV 1ZSDB 3Q2VA 3QDMA 1OM3L 4RESB 4Y9FA 1J10A 3SEPA 3I50H 3GSXA 3G6JB 3I74A 2VLKB 3BMVA 4O5LL 3JARB 4MKTA 4I18B 2CUIA 3K91A 4EEEA 5DUPL 2CG9X 2J88L 5L3EA 4HBCL 2H32H 4IOIA 2R9HC 3QQXA 4U1JA 5PCYA 1SXCA 4UNVA 2PYEA 2HX7A 3TBBA 1Y67A 1WBXB 5IVOA 3WXVL 3QTCA 3QVNA 2AEWA 2JQZA 2NR6C 2QMKA 3G6JF 4OJAA 2F23A 2ALAA 3BZFB 1R4XA 4L8BB 1U8HA 4UTCA 4YEEA 5LA6A 1BJ8A 2XG5B 3QS2A 4KQ4L 4M6OH 1NOFA 3VD7A 2X7RB 3TF7C 1LE5B 2CE4A 1BEYH 1JHTB 3ARFC 1LD9B 4RAVB 3EBAA 3L3JA 2OMWB 2PW2A 3HG0A 3VCLB 4X1IB 2BZCA 5J12B 1NAKH 3SY0A 5GONB 1SETA 3MAQA 1T04A 2WUCL 5SV4A 1JWMB 5LGJB 4JKPL 2ENPA 4DK3A 1FNLA 2H4EA 4JAVA 3DLQR 3EBIA 1N26A 4LF5O 1H8OA 1IU1A 3FRPA 1DBMH 1QQDA 2DYPA 4U31A 5DD6A 2XUWA 1WIOA 3AADB 2NR6A 2H32A 1OP9A 4UYQA 2QGDA 4QRSB 1XBDA 3COOA 3N40P 4X9FA 1SXBA 4NP4H 4KO7A 3VI3F 4Z3GA 1I3GL 2P5WE 3ARFA 3SDDA 4B7EA 4HW6A 5C6PB 3KPRA 3TJEH 4NXNO 1JVLA 4UBDC 2DIJA 3TT3L 2HTKC 4P9OA 4YSQA 1JZDC 5F7KC 2YEVB 3AMKA 2DW5A 2CHXA 2VO8A 1YEEH 3FCSA 3F7YC 3VA2C 1XF5B 5GGTA 1L0YA 4DVBB 3JWNH 1V7MH 3BVDB 1R3KB 1FLTX 2OCCC 5EO9B 4YNYB 1OAUL 4G3YL 4ZFFA 1J8KA 3VFOB 4HV8A 3EG9B 3PGFL 4NENB 3SDXA 1OF2A 5IEHA 4PWEA 4B95C 5HGHB 3MRDA 4JV5O 3MJ7A 1A4BA 5EA0H 3ECVA 2GTWA 3GMPA 5D8JL 3V4PB 4FZ8H 2F8IA 3P4NA 3WTTA 3GMLA 4K71B 4Q52A 4FF9A 4GEJA 5KVDH 4QTHB 4F7PA 1O7SA 2ID5A 4NS0A 1NFDF 5C9KA 4OIBA 4B3TO 1SDAB 3CN2A 4UIMA 5DJDB 3F7YA 3AB0B 5BJTB 3TEYA 1JPGB 3T65B 2EZPA 2BVOA 3KL3A 1TR7A 4P46B 3RU8H 5IB5A 1BVKA 1T1YA 2APVA 3KBEA 4PCKA 3U30C 1MZYA 2HVJB 3PNWA 1TJIH 4G7QB 1CGYA 1A7PL 1XHZA 3EO0A 4XN7A 4OCXL 2FJSA 1YEFL 3LKNA 4G43B 1AZCA 4LBEC 2ERJC 3O11A 4JPQA 5GGSA 3O3AA 4F7EA 2A0LD 5EPMB 3VG9C 3ZHRA 4TLSA 2A1WL 2BERA 4JKWA 2WVUA 1HJCA 5HP5A 1MCWM 3HJEA 4ODXA 2F8OA 1QSZA 2KL6A 5F1KC 2AQPA 4MD4A 3TWCL 3VFTA 3F6LA 1CLVA 1MZEA 5CCKL 2ZKMX 1C8PA 3ZDYB 2OV0A 4GKJO 1T5KA 3ZTJH 1F4WL 3E89A 5TF1H 3VYPA 1JL8A 5I2IA 4DN3H 1LEIA 5KBMA 3RNQB 1MFEL 4GS7C 2N04A 1EEYA 4LBEA 3OKLA 1VLXA 1A25A 1PZ5A 1NKRA 2W81C 3BD5A 2MHAA 3RYMA 4DV4B 2DLTA 3DUHA 3ZMSA 3P9LB 1IMHC 1VAHA 1G7LB 4QAMB 3EW3B 2HJKB 1QLEL 3K79A 1DJIA 2WCGA 1MF2H 4MAYC 3E35A 1R47A 2QEXV 1ITBB 3DVGB 5ISZB 3IYLW 1NGPH 1K9TA 2EBOA 4DW0A 2L7EA 3GSVB 1TJGL 3SYPA 4Z7UA 3KYKL 2R69L 3T4YB 4KH9A 5HDBB 4AZUA 4NKMA 1P7GA 3CJHB 1AGFB 4ORGA 2AJSL 5C08B 3ZHUA 1ZLWK 4OJEH 5C09B 4HG4J 1AOHA 2VDOH 2JS5A 4UCUA 2Y5QA 1LE9A 5EO0A 5HVHC 2AABL 2VAJA 4I7ZC 5SV3A 2VLJE 1YAZA 3DJSA 2NYYC 1S8DA 4X2UA 3BGAA 5JPNC 2Z0BA 1F4AA 1IKNA 1LP9B 1QSFB 3DVNA 3FUJA 1M7DA 1RL1A 3GSOB 4FQXC 3L4ZA 3RWFB 4FG6C 4WBNA 3AVEA 1NC4B 3SDYL 3OUFA 2BP0B 2IGFH 3AU1B 1PZUB 2PI5A 1GM9A 1XGRB 4LLDA 3EDKA 2ATKC 4QMEA 2E7CA 1WP6A 2WCSA 1JFFA 3D39D 3FCTA 5CLYA 5F1NA 1THCA 4D8OA 2B59A 3GHBL 3QUYD 2ZSVB 1LP9F 4FQCL 3JD0A 4PJDF 5AVVB 3UT5B 1OSYA 5LAXB 1ETA1 1QSEA 2J8UF 4EB6B 2FJHA 4JFVA 1ZVHA 3LRHA 2X6AA 4L5FL 4YHYC 2YK1H 3L2MA 5F7UA 1WK0A 3IMUA 4Y88A 1JF1B 2ICEB 2JEXA 1S7TB 1BM3H 2GK0A 1CGXA 4W9JC 3WLBB 3U2SB 3NOIA 5HI4D 4AQ8C 1CO1A 1A64A 4KI5D 1XR9B 1L6ZA 3P77A 3QHTC 4GG8A 1K5WA 4MX7A 3MRRA 4QIRA 4HCGA 3T1YB 2ATKA 3EJSA 1SLUA 2QLVB 5JLZB 2I27N 1MFAH 3VFWA 3APFA 2X3BA 2HHHB 4XVOA 2V1DA 1MABG 3GXMA 2ZAHA 3C5ZA 3IJHB 5IM7B 5K9KB 2J71A 1MCCA 4S2SA 2JTYA 1RZKL 3LEVH 4GG6E 4LCWA 4FOMA 2XX0A 2NY4C 3KWWA 2BNRD 4CADA 4QHKJ 7FABL 1RSFA 4FXKB 4MT8A 4B3MO 1DEEA 2VDRH 3RDTB 1CR9H 5CXPA 5I74C 3II1A 3FF7A 4IDLA 4XMKL 1KSRA 4JI7B 3WGVB 1IX2A 2XWBA 4LCIL 1WLEA 4K7PX 2ZOKA 3WIHH 3V5DB 1G7IA 3MLYL 4R4NC 4IMLA 5DJ8B 3HZYB 4U6XB 1T2QH 3N27A 1KXTA 2DBJA 1KBKA 1JK9A 3ZLQC 3HRPA 3RL1A 5DVLA 3ZL1A 5BRZD 2QQKL 4PB0H 1TGOA 2B9BA 3H2WA 1SZXA 1XCXA 5H94A 3S5ZA 3E80A 3WNKA 4K8RH 3ZOAA 5IB4A 2H1PL 2YWYA 3CH1B 3P3RA 2FIRT 5CEZE 1RPKA 4NJAL 4M7ZB 5HGGS 5C0FB 4XNMA 5TE6H 4NQCE 3CSBA 3HNVH 3P9WB 2XXMB 2YAFA 4KUCD 4OF6A 4AJYV 2OR7A 3BAIA 3HPLB 4AG4L 5MP6H 4K5OA 1Z5LA 4NTYA 1XEUA 3RN4A 1B2WH 1VQ8V 2C1OB 3ZKMC 4NFBA 3OW2U 4MQXC 1FAFA 5AOLA 2H5UA 3OKNA 3EJZC 4Y89A 3T6QC 5LXTA 1GZPB 4DV6O 3WIHA 4GPVA 2MPVA 3SGIA 3PABB 4MVBC 3WOVA 3LN5B 3FRUB 1K8DA 1BMWA 3H1IH 4JI2O 2QJDA 1CVSC 4H88L 5I71B 3VD3A 4HSAC 5AVZB 4XBGB 2J7LA 5FOBA 3IJ4A 2NW3A 4HIJA 4OFQA 3N42B 4J3OG 2N1TE 1LWRA 3B2MA 3FQRA 8CGTA 4GXUN 5JORA 2FBJL 5FK9A 5M94B 1YNTB 1Q0XH 1NANI 1XT5A 4WY7H 3U4BL 1BYOA 2Y22A 4JFDD 2ORBH 1B6UA 1RJYB 1Q4NX 3BUYB 5CD3A 2D4FA 3BEVB 1RIVH 1WZLA 3F7QA 3NZ8A 3W11C 1U2CA 3F12A 1BOGA 2VDKL 4AKPA 3DX8B 5FYKH 4JDEB 5E5LA 1EMTL 2NXYC 2N1KA 4RZCB 2G3XA 1PCSA 3WKPA 1Z6JT 1M71A 1AJNA 2QHRL 4DV3B 4RFNC 3FF8A 5FO8A 5HSFA 4MTFA 1UD5A 3SGKC 5IVXE 4ELKA 4X64O 5GHWH 4PG9A 4UTAH 5AVTB 1L0LH 3NZSA 1KPRA 2L7QA 4ASUG 5BV7L 5KVMC 4D0BB 1XGYL 4NQUA 1G1CA 1FD9A 1UUSA 3C5XA 4PREA 3JSNA 4PLOB 1CEZA 1JVMA 2D4DA 4KO6A 1BF5A 1N4XH 5HHOE 2X4UA 4R5XA 2HMIC 5AAWC 1F45A 1UKSA 4HJEA 2VLRD 1YEGL 3ARBC 5B8CB 5BUAA 3HZVA 4EXPX 2NUPB 3QFJD 4YBLC 4A2HA 4AITA 1C8QA 4S1QL 4AQZA 1YPZE 4XPHL 4N5UA 4WWKD 4BFEA 1AZZC 5DUBB 4BZ1L 5DURB 2AHYA 4R4FH 4KGJA 1VF5C 1PSKL 3G08B 3SGKA 1QRKA 3IU3B 2YD7A 3CCQV 4UILH 1TQTA 1D5MB 2E3VA 4JPWL 1P6WA 4GX5A 2X1PA 3BESR 5DK3A 3G5ZA 4LHUB 4LVOC 4UTAA 2P8LA 2X7LB 1IQWH 4KV5F 1CZ8L 1JGLL 1HHGB 2CMRL 5I75C 2ZONA 5ESQA 1INEH 4ZW7A 5M7QA 4HUVA 5AAWA 1D2OA 1VFBA 3ARBA 4X62O 4K7PH 4YDZA 2XNAA 2KB1A 5DJXA 1F4NA 4J4PC 4KX9A 5HGDB 5E4AA 3MXVL 1N59B 3K5NA 1UZGA 3CFCL 4LSUL 4DN4L 3LKOA 4UCFA 1KBBA 1BHGA 1E3FA 1ZLSH 3NEEA 5E6ZA 2CRZA 3C5SA 3S34L 3FQUA 3R06B 5LCVL 3MMEA 4Z1MG 1JFHA 1M1XA 4G2AA 3BXNB 4HFWB 3MJ6A 1OEZW 3UZQA 3C60D 4AK1A 2XWXA 4YSRA 5AVYB 1I0HA 5E5UB 1RQ5A 4ZUSA 5D1QC 4NNXA 1EFRG 1J88A 4G9FB 5DJYB 4J4PA 3KAAA 3U46A 2LW7A 3B9VA 4NPKA 3FAWA 4UCTA 1PZCA 4JI4O 3UIZA 2I60H 2XQ0A 3FO1B 1DN2A 4R90L 2H0FA 1B0WA 5KG9A 5D1XD 1I5YA 1Q1JH 4G42A 4Z7NB 1JPXA 3O6LL 4YVUA 2OQJB 4YY3B 4E2OA 2KUTA 4DUZB 1PZAA 1R5IB 1I53A 4FQLL 4M7KL 4LOUD 2ESVE 5FAAA 5J2UA 1NKOA 5D7HA 4X1KB 4Z7VE 4HUUA 3T2NH 3CC7V 1HNWO 3B7SA 4JKLA 5DQ9A 1FA4A 5D1QA 5MENA 4Z7WB 1UZ8A 2V33A 1I1YA 3ZKNC 2NY3B 2F0CA 4GSQA 1I1AD 1S3RA 4YHHO 2CBOA 4QO1B 1S5LZ 3M1BA 1IQDB 4BWTA 2YUAA 1CF1A 1TVBA 3EOBB 3NPSC 5A1AA 2OI9C 3BX7C 5DU7A 1YNLH 4AENB 3NCEB 1DVFC 1R3HB 4HDIA 2ITCC 2Z91B 2P24A 1E9QB 2DEWX 2OBGA 4GW1A 3CH8A 3CX2A 1F13A 2XI9A 5AVQB 3CLEL 1FLRH 2BNRE 3MACL 5TQ2L 3DHJA 4DEPC 4UV4H 4BUHA 3SQOH 3TS8A 3B3IA 2GABA 2OL3H 3OKEA 4KQ3L 5KYUB 5DYOA 3QCTH 5I8CA 4OD3L 2PPEA 4KBPA 3L9YA 3V5KA 3SGDH 4E0RA 1P9MC 1DQJA 3TT1L 2OTUB 1VGEH 2DEYX 4RQQB 4DV2B 1AIFA 1Y7VA 2P52A 3L9DA 1AGDB 2XFXA 3G6DL 1QNMA 2JJ2G 4PVBA 1DVFA 3D2UD 2ITCA 1K73W 3FOMB 1SEBA 4EVNB 1BD2A 3GKWL 3MRJA 2DPKA 4BDVB 3WAKA 4OM0H 4L9LB 3ULVH 1BHAA 4WFBV 1NCBH 1SNRA 1WZ1L 5A2CA 4PJGE 2YD0A 2FO8A 3EYSL 3BH8A 4OQTH 3FULA 3ULVC 3APCA 4PJBB 1KTRL 5FUZL 5C0CB 4BRVA 4U3HA 2GUZA 4QD2E 1CI5A 3QUZB 4UBDD 4JTAB 4JJHA 1NBVL 4AC2A 2Q5BA 1H2MA 2OMNA 5EU5B 1G7PA 1P9MA 1VEMA 2BSRB 1GRWA 4JRFA 3SPGA 2G5RA 4RWUA 1KIQA 2OSLA 5DEGA 1UZ6F 3A6CH 3W9EB 4P0DA 4X8GA 1GY2A 3IWUA 3BWSA 5E99H 3CFDB 1N33B 5F93C 4IS6A 4KKNA 1E27A 4ADGA 2VDPB 2XQYK 3QFDB 2G5BB 4CGUB 5DMKA 4HAKA 3IT8D 3QO1B 5KSBB 3MRKA 5FNVA 1PS3A 3PGDA 2VDQB 3S3PA 4ZW8A 1IBMB 3EADA 3HNSH 1UXWA 1ZA6B 3RWIA 5C0AE 1BBDL 3UPRB 3EZJB 4OQTA 4RX4A 1Q81W 3FSOA 4K07A 3TLRA 3WJMA 1IV8A 4JFDE 5DXWA 1IBLO 3T0XA 5BOPA 4BKSC 4XXWC 4YO0A 5I1AA 2PYFA 3QCVL 3DO7B 5CZXC 1FL3B 1R1CA 4P48A 1GJIA 1YECL 1RP3B 3C09C 2IPTH 2QWPB 1U3HC 5LO7A 3HRZC 4QOKB 5FLVA 1J9SA 2ZUYA 3C12A 1XFPA 4W70A 1QUNA 3B4SA 3T0WA 4PJAE 3GNMH 1CD1B 3QRGH 1IM9B 1XIWD 3IXTB 2CIKA 2XWTB 1BFOB 4WHDA 4X8AA 4YFEA 1UOWA 1KXHA 1JR9A 4QHUB 3HKCA 4IU2A 5LGYA 4HJIA 1MCDA 4GIPD 4M8QA 5JHDB 1HR0B 1QD0A 2K9FB 4NGHL 4LWSB 2ZG2A 3B9KB 4BA8A 4I5BB 1KEMH 4K9EL 3L8QA 4OZ4A 3MX0A 1LILA 3FB6B 4XXWA 5DRZA 4UCOA 3PLYA 2DWEB 4NC1C 3NP3A 4UT6L 2RGSA 3GBML 4UZSA 3DXAA 4Y4FC 1U3HA 2V7HB 3L74H 1M6OB 3HRZA 3OKYA 1FO0H 5E8EB 1JGDA 1A4KA 4DO5A 4CJ1A 4JO4L 3F62A 1UJ3B 2P42B 2RCSH 4Y9BA 3IMSA 3RIFF 1KULA 2E9JA 3ZRXA 5JR1L 4F6RB 1VCAA 1ZT4B 1AD0B 5F7DB 4DP6X 5EZOH 1S5JA 1S7WB 5I1JL 1IKOP 3ORJA 5JCOC 4ESKA 1BIHA 5GONA 3VGEA 1CURA 3KMDA 1IC5L 1Q7YW 3RY4A 3QNZA 4XO3A 1D5AA 4AQAA 3P3SA 2FO4B 4GCZA 2VN3A 1RZ7L 4Y4FA 4AGLA 1R3KC 1ZL8B 1CFBA 3F7VC 2IADA 2VR7A 4FQHB 4I88A 1CGTA 2OA9A 4KXZI 2ILMA 3LHPH 5EF1A 3C9NA 4MJ5A 3D9AH 1NOLA 1OB1B 4UM9B 2XXGA 4WW2B 3I6GB 3E83A 4Q89A 3JV6A 1H3WM 2WLJA 2XWDA 1CTMA 2VZUA 3AS0A 2NY7H 5JCOA 4FYSA 4HZLA 4FQXD 4PGCB 2QVIA 1MJ8H 4X89A 3BKCH 1MFBH 4XMZA 3VG0L 4EN3C 4WW2F 1JSYA 4PJIB 1UXSA 2O4EA 2IDUA 4Y19B 5E8DH 1FSKC 4L1SA 2A4ZA 3Q6GL 1DJWA 1FN4B 3F7VA 4N23A 3SJCC 4FLVA 5L3FA 3IN2A 1F41A 2GPZA 1GYUA 4R6UA 2BK8A 3CX5F 1C08B 1XEDA 4GX1A 2XTJD 3IE9A 1BQHB 4GKLA 1BQ5A 2R0WH 4M5YH 1AKJD 5KMGA 4OCWH 5CN3A 3HCVA 1Z66A 1RSOA 2B5IB 4P5TD 2ITFA 2ZKXA 4B7KA 5CINH 2ZCHH 2ARJB 3BN3B 5AVWB 5B7EA 4MQ7B 1IGIH 4KTYA 3RZCB 5C07B 1M1KW 1VQ9V 3PCYA 5DEFA 2HFEA 4EN3A 4CS4A 5M95B 4Y9CA 1VRSA 5EU6D 3VSUA 3DX9B 5JHLH 2DL2A 4I9QA 4PGBB 4LNUB 4UT9L 2E74C 2CKBB 2M83A 4KPHL 2HT4C 1NAML 4PJ7B 3TBSA 3CSYB 1IJ9A 3RYCB 4ZFOA 7PAZA 4KFZC 1U8IA 5FL7G 1DF5A 1KGUA 1B0IA 3QJXA 43C9A 3LVEA 5ES4B 2YSSA 5CNHA 3NJGA 4JYBA 4JO3L 1PEWA 2Z35B 1MOEA 4DV0B 3AQYA 3S4SG 4B97A 4FCAA 2NNUA 1GO3F 4JI8B 1K2DA 5DVKA 4KUZH 1H2SB 2OTLV 1IX9A 5C9JA 2QSTA 2OTWB 4WO4B 4LPYA 1VPOL 2GCYA 4OFKA 1HXKA 3IDIA 4J42A 2F58H 1SM3H 4NC2B 3GSNB 3PJSB 4TSAH 1G0XA 2P5WA 3LS5H 3V7AG 2E0PA 4QYOA 3JAMN 4Z1PA 3WXWL 3HG4A 3M8AA 4FNLL 3RTLA 3TZVB 8FABA 1DUZB 3QC6X 4KRMB 1W72L 5E0QA 1BJ1J 1XH0A 2BO0A 3QJFA 2XVLA 4F57L 3P9LA 1QW9A 2C3VB 4IDJH 1P4BH 2VQ4A 1HZLA 3JD2A 3SQBA 4ELMF 4WCYH 4LLWB 3W1ZA 2YO3A 2JKNA 4J7JA 3SDAA 3GHPA 4KKRA 3CZNA 3CZSA 1OALA 3IMTA 3QIBC 3UO1H 2EIMC 2O93L 4WCEV 2VXQL 5AG2A 3B6SB 4XCYB 2D0HA 1CFMA 4G7YL 4HCIA 4UNIA 3S5YA 3O4LD 4X66O 4BE5A 5ITZA 3GLEA 1IEAB 1EXHA 1FBIL 1G4YB 3FT2A 1P84F 3L9BA 3VM7A 1VQNV 2PO6D 3MNWB 3WNLA 4UZUA 4PJ5B 1KCLA 4A1RA 4WI9A 1MRFL 4FQJL 4AWJC 2OYPA 3WCYA 3DSQA 1TZIB 3SKOB 4GT1A 1YN6A 3QIBA 5KHJA 3MRMA 1JGUL 5ITFB 4AL8C 1QI4A 3KPQB 4FYQA 5DS8A 1NC4A 4XX1E 3EH2A 3EO1B 3T0EC 2KQNA 3O65A 2ZKWA 1YEJL 4J2XA 1JK8A 5KLVH 1IBBA 4FKHA 4MDIA 1WZAA 3JAKA 2D2CC 4OF7A 1F18A 1TZAA 2JGDA 2HKAA 4JM2D 4WI2A 5DZOA 3VX1A 4NCC2 3RGBA 1ETZA 3CUPA 5LYJA 2NXYD 1L4IA 2B77A 1BBJB 3UROR 4LEXL 1WWBX 4FXKC 5L7XL 1YG9A 2XCMC 3HC3H 2O61A 4V33A 3RDJA 1UB5B 3DX2A 3IJYB 2C9PA 3ZTEA 2F7PA 3Q8BA 3AG1C 1S7TA 4GYBA 3WFEL 1U8NB 1RLWA 5DSCA 4DV7O 4O2BA 4IJ3B 4ZJ9A 3ARDB 4I4WA 4X5QA 3T0EA 1KF9B 3PY9A 4MVZA 5IJ0B 3ZT5A 2VTFA 3VD9A 4Y16B 2B15A 2GSMB 2EE0A 3M7OA 1ROCA 2X2HA 4X1YA 1M3IA 2H9GB 4LLYA 1UM6H 3LKSA 4Q97A 1T03L 1U8QB 2WLLA 3UC0L 2AXFB 4WFFD 3FHAA 4HAFA 1CLZH 3ML0A 3CHOA 4LF9B 2Y7OA 5JYMA 4M7ZC 4H2CA 2WQRA 5I1CL 3C6EA 5BS0B 1KMIZ 2QT6A 1LDPL 3NABL 4LPTA 1DN0A 2X10A 2WJ7A 2R51A 2ZWZA 1WNSA 2X4QA 4RGNB 1YDPB 1ZIBA 3HBPA 3MRCB 3MZTA 1ID2A 4PV1C 4L1TA 1SXNA 2WWMC 2EH7L 4QT5B 2VLJA 4J23A 2FEEL 3MLVL 4FK5C 3CFJA 4J6IA 4NI3A 2K1EA 5E6RB 3WELA 4X65B 4P4KB 5ICYB 2NNAB 3OTTA 3S3BB 4G8FB 5PAZA 5I5MA 2UU9B 5I71C 2YUZA 2ZF9A 3ZHFA 1PPJH 4LU5L 1UM5L 3ESMA 3SKJH 4IL6Z 1R3LC 3UCRA 1U3JA 1FGVH 1ULVA 4D9QD 5G4NA 2XIBA 4RZKA 2WZ6A 2A9NH 2DQUH 4HBQA 3T8VA 1NIAA 3SPVB 4J39A 4WRLA 2PW1B 1HKLL 1MOFA 5KX5A 3AREB 4XBPA 4KY2A 4UT7L 4YSPA 5AOMA 1QVFU 4DR1O 3LN5A 5DD3L 4B9PA 1I8AA 2ZWSA 1UFUA 3D3VE 4EI6A 5KAQG 1MNGA 1OOAA 1OGTA 2XTJE 1B9KA 3S88H 1OKEA 2LAAA 2Q7GA 5E5MA 1E5YA 2ATPA 3N43B 4MRBA 1V8HA 4FNPA 4X5WB 3ZPDA 3K5RA 5I6MA 2FWSA 1DLHA 1R3LA 3HN3A 5IK3A 3ZMNA 5INDB 3BKYH 2BVPA 2HTLC 5SWSE 4JHAH 5CEZH 2KQMA 3N41F 2YRZA 4MJ6A 3N04A 3KWUA 4DXWA 2QQNL 4JRXE 5H2BB 5G2NA 1QPPA 4XBEH 3A4EA 3OX8B 4GG6A 1N7ML 1P1ZA 3A47A 3JTBA 4I48B 3N1QC 1KYDA 4U1KA 1OCWL 5T5NG 1U8PB 3N43F 3IPEA 5IKCA 1YMMD 2EP6A 2Y0PA 1SA0B 1A4CA 4ONGL 2YSUB 4HJJL 3L3DB 1OOWA 2BY2A 2O30A 4HK0B 4DZBA 4LCYB 3FO0L 4K3HA 1PZ3A 1CXEA 1SYSB 3BD3A 1URLA 4YK4B 3TL5A 3PUCA 4PDLA 3GJFA 5FWRA 1XB8A 3FTZA 4JPKH 3QHFH 3CJJA 1AHWB 4JLRB 4ONOA 3RGVD 1NC2D 5EU3B 2UXFA 4HXAL 4I2XB 4WKXA 4AKOA 4GJTB 1C7SA 3VACA 4NQCA 1T6BX 3ABZA 3WY2A 4IMKA 1RPOA 4KDWA 3CN0A 1FYTE 1IAOB 4J3WA 4XI5D 3G9VA 5EU4A 2WZPA 4GAGH 4KAQH 1X6LA 4XZUB 5LBGA 3T1FA 1YZBA 3JTTA 1CQYA 1V3LA 1FFXB 2BWIA 1KC5H 4P3CH 1N6VA 2WINB 4WENB 3C8KA 4JK0D 3ZQXA 4X8XA 4Z0BL 5IW6A 1ZHNA 2OMUA 5DUJA 4BFOA 4G1EB 4AC4A 4I1RA 1AS6A 5HYSG 2NQ3A 5LMUB 4YSEA 1P7QB 2M2DA 4QXGL 3U6RB 1ANUA 1KELL 1M5IA 4IIJA 4JR9L 3TA3A 1CMOA 4FLXA 3VD4A 4FXGC 3ZMVA 2PYJA 1FIGH 4NOFA 1ND0B 5FLUA 5GS3A 2EDJA 2I07B 1BAGA 3GSWB 2ROYA 4PJEF 4RVBA 2Y2WA 3FPYA 3S5LB 2H8PB 1HNXO 4OSUH 3QDJD 1TITA 2GT9B 2X9ZA 1BFVH 3MR9B 5SWZD 4WFHE 1A3RL 3HUJE 3X1BA 1B4TA 4AGOA 4AH2A 3W7XA 1BZQK 1W0VB 1VARA 3QORA 5BQ7A 4UOW1 1W9XA 2EE2A 3MVSA 2XT9A 2YPLB 1FH2A 2WO2B 1AP6A 3E8UH 4X7FC 1OCCC 2NYZA 5IVXA 1KTDA 1NMAL 1VFAB 2VLKD 2R2CA 2WP3T 3P4MB 1FL6A 4FXGA 1KBGH 3HAEB 3B2DC 5SX5H 4HS6A 2F54E 2CM5A 2KZKA 1OLLA 1JRHH 1JNJA 4O58H 3F05A 5HHOA 3H2PA 4FVMA 4I0KA 1QZ1A 3DC0A 5JVDA 4CILA 3ULUE 1U42A 5GSRB 5KAQF 2WK2A 1YPZA 3K72B 4DP4X 3OQ3B 4K3DL 2WXHA 2ENQA 6FABL 1TU2B 3V9EA 1U30A 4JDZB 5CA1B 1BVLB 1NEZB 1SUJA 4P2AA 3T2MA 2B2XL 4ODUA 1OV9A 4I3RH 5F0MB 4QO1A 2AK1L 1IC4L 3CXFA 5BRPA 2XKNB 1G9MC 5IJ9B 3BO8A 2XV2A 4ZX3A 1HQ4B 4TV8A 2BOBB 2KKQA 4IGBB 4X88A 4U1SB 1R3HA 4R2GB 3EJQA 5EIIG 2G30A 3ESUF 3I50L 5D7SH 3DDFA 3FQ4A 3SBWA 4JDVA 3JCUZ 4XP4H 4WO0A 4YC2B 1XF2B 1ZGLB 1AO7B 3E9UA 4XOBA 2WXGA 4KKCC 2GBUA 1AMXA 4BFJA 1YHQV 3HJ0A 3L81A 3O8XB 4XRCA 3OXSA 1ZPUA 3EDEA 5FGCE 3BY6A 4PCSA 5I0XA 1B06A 3IJSB 4HPOL 1BJ1H 2NW2B 4X83A 3OEHG 4CH5A 4L0YA 5MEPB 2GTQA 3NT0A 1JPST 5GGUB 5CD5D 4JZJC 3BABA 2V4LA 3TTSA 5IBUB 2R27A 4ZTOH 3BJLA 3SYOA 2LAGB 2ARHA 4U49A 1F3JA 3GEFA 4LMQE 4RFEA 5EDXA 2VDNH 3AT0A 2IJKA 2HWZH 4YAQA 2CD0A 4IGGA 4JAMB 1P2CB 2FDBP 1MIMH 3JV4A 3MRPA 3F5WB 2ZR2A 4NXMB 1UWYA 4HUWB 4HD9A 2ZUQC 1H8SA 1N32B 3UAEA 1C5CH 1Q94A 1UURA 4BWUA 3A0RA 2DAVA 1RJLA 5ITBH 2OMTB 1FFOB 1IGTA 1TXKA 1YQVH 3DMMB 3NACH 4WTXA 4ALAL 4FFYL 4HJSA 1OK0A 1S9WA 2ESVA 1HE8A 3HMWH 2YQ2A 4P46D 3DTDA 4YUEL 4YHPB 4U7NA 4O2FB 5LBQA 2QSAA 4C83B 4Z7VA 3DRQA 4N8VA 4JZJA 3QULB 1T22A 4ATTA 4N2OA 3BFQG 5MEOB 1CGVA 3HPJB 1YEEL 4N2GA 1J86A 3B40A 4OTXH 4GT0A 3BP4B 4LEEA 2DJSA 4TVPL 4HWBH 1N0LA 2NX5B 3KYNB 3KDPB 2Z7YA 4JM4H 4Y1SA 3BMWA 3RX8A 3H01A 3TV3H 2Y69C 4JI0B 1M7UA 1TQSA 1KPVB 5CWSB 4FHBD 5EA0L 3GWJA 2JS3A 3MCLL 2DWEC 4WZ9A 3RHWK 4FN0A 3T0DA 3T0VA 4EIBA 1EFQA 1DBJH 1ED3A 3H9HB 4QOKA 3N1MC 7TAAA 3ZCCA 3OQRA 3HC4H 1SN0A 4J3XA 1HEHC 2Y5TA 2DRUA 4AGQA 1NJIW 2DM3A 5JUEH 1CG9A 1SS3A 2KDYA 3QZNA 3L70H 3RU8L 1P6AB 3U48A 4DR7O 4KH2A 1NINA 1A3LH 4ZOLA 3KYOB 3KH3A 3OR6B 2GK2A 3HKZA 5CMAB 4D8PB 1OGAB 2VZOA 4O2CA 4HWBA 2WIIA 2WGXA 4UDUA 3TONA 3V52L 5ISZD 1AI6A 3FX7A 4AE0A 4ZO8A 3REVA 1A1OA 2NSMA 2FEDD 4PJGA 4LHQB 1AXTL 3GLDA 3UTTB 3UTZA 2CK0H 5C08D 1UYWH 5C09D 2BTQA 2XN9B 4TRPL 2LW1A 4UANA 1KCUH 1JOIA 1Y6KR 3WUWB 3HHMA 3K6SB 4OJCA 1QYGH 4OCSH 1F02I 4Z7OE 4JKKA 3NK3A 1IIIA 2B9AA 1V05A 4Y8DC 4LP8A 4NAMA 4LFCO 5KSAB 1A3ZA 2QTOA 3ML8A 2A9DA 4NQDB 1QSFD 2P1YA 4I77H 5D70L 2OAAA 2JFCA 3IS0X 1HHJA 4H13B 3FOLB 4MB3A 1NC4D 4RMTA 5DM6V 4HFUH 5C6TL 1HEZA 3OAZK 4CN6A 1A6WH 3LS4H 1MF2L 3E9TA 2QADC 3MV7B 3NQIA 3PDGA 5C0AA 1VADB 4AIXA 3QH3A 5BVJA 4H37A 4XNYL<