2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
1EZLA 1BEXA 1J5CA 1WS8A 4G7SB 1AZUA 4K9JA 1ILSA 5I6OA 1NZRA 2B3IA 3UABA 2X87A 3IE9A 1ETJA 2IAAC 2YAPA 4HIPA 2FQGA 2VSMB 3X1EA 1TEGA 3JT2A 1W6LA 3QJTB 2UXGA 3QJVB 1KCBA 2FT6A 4F7KA 1V10A 1IC0A 4G7QB 2YXWA 1NINA 2PLTA 2P80D 2CCWA 3TBCA 1RZPA 2BHFA 1BXUA 1JZIA 5B7EA 1VLXA 1PCSA 3AY2A 4GP8B 4RH4A 2J5WA 1JXGA 2XUWA 2YAHA 1NTDA 4KO9A 5TK4A 1RCYA 2YXVA 9PCYA 1PLBA 2BW5A 2XV0A 2LLNA 2XV3A 2NRDA 1A65A 1GS8A 3OQRA 4G72B 2J55A 4HCGA 4P5SA 4PAZA 4YSAA 2CUAA 4GYBA 3QJQB 5A7EA 2AZAA 1AIZA 3NJHA 1PMYA 5I26A 4DP0X 3WI9A 1PZCA 3OMNB 4CSZA 4Q8BA 1ZV2A 1SNRA 3CDZA 4GP4B 2IH9A 4UAHA 2BP0B 2HZHA 3SBQA 3GYRA 1ET8A 4DP1X 2AZUA 2CBPA 4KO7A 1NIBA 4QKTA 4F2FA 2UX7A 2QDVA 3NJKA 3T6WA 1ZIAA 2GIMA 2IWEA 2AANA 2QDWA 1KBWA 3ZBMA 3S3DB 4DP7X 2EIKB 1GSKA 4AZUA 2HRHA 1OCCB 1AZNA 2A3TA 1BQKA 2YARA 2TSAA 2PP8A 2I7SA 3QJRB 1AS8A 1FA4A 1XB6A 4E9VA 4AI7A 5I28A 1OCZB 1RKRA 1SF5A 2QPEB 4WKXA 3CVDA 2GI0A 3EF4A 3CVBA 1OOWA 2VMJA 2YAMA 2E86A 3MX0B 3UADA 4BDVB 3NJGA 4AKOA 2Y1AA 3ZX1A 2W88A 3OM3B 1ADWA 4BXVA 1X9UA 2XXGA 3WKPA 1JZHA 3T71A 3T6VA 1MZYA 2VW6A 4HHWA 5B3SB 1GR7A 3FSZA 4A2FA 2PP9A 3NSYA 1OE3A 4CSPA 1JXDA 4KOBA 3X2QB 2ZOOA 5I5JA 1AANA 2PPDA 1HFUA 1AQ8A 3S8FB 3KW8A 1PNDA 3CZUB 5D4IA 1JZFA 3C75A 4FAAB 5F7AA 2UXFA 2FNWA 1JXFA 1YLBB 2XLLA 3FQ1A 3NJJA 1NPJA 4TXVB 1M9WA 3JTBA 1NIAA 1KV7A 1SFDA 2YAEA 3MBWB 3X1FA 3FSVA 3NYKA 4KO5A 4DP8X 1SDDB 4JHUA 2Q5BA 1E5YA 2CALA 2PCYA 3PAZA 2IWFA 1AG6A 1JERA 1PZBA 1SDDA 4KO6A 1BAWA 4DPBX 1J9RA 2DWSA 4YSRA 3KW7A 4EF3A 2BP8B 3V9CA 3BVDB 1W8EA 2FT8A 3IN0A 2EILB 2HX8A 2QPDB 3QPKA 3OMIB 1X9RA 2H47C 1AG0A 2IDTA 2CAKA 1PZAA 1AR1B 3NSFA 2J57A 4M4RB 2UXTA 1IUZA 1PNCA 1AS6A 4JHVA 4A2GA 3FS9A 4ENZA 2OCCB 3ABMB 2VM4A 5PAZA 1SFHA 4E9QA 2GBAA 3ASOB 2IDFA 3ZIYA 2BWDA 3FT0A 4HAKA 2AVFA 4GP5B 3FU7B 3NSCA 2DY2A 1BXAA 1NWOA 2JXMA 2YQBA 4HZ1A 2DWTA 1L9SA 3PPSA 3FU8A 4BDVA 2GC7C 2VW4A 1B3IA 3FYIB 2UX6A 4NAJA 4BXSV 2XU9A 7PCYA 1CURA 4DPCX 3ERXA 3ABLB 2CJ3A 5D4HA 1E5ZA 1AACA 4BWUA 1FFTB 1MG3C 2XX1A 4DP6X 1PY0A 3FPYA 5D4JA 2IH8A 5EHFA 1OE2A 1GY1A 3X1NA 2XV2A 2P80A 4Q89A 4HCIA 1XB8A 4NERA 1MZZA 1E67A 2JKWA 2IDQA 4QLWA 1SJMA 3OMAB 4YSPA 2VM3A 1BYPA 5B7FA 2WO2B 2J56A 4G70B 4DP5X 4YVNA 1E65A 3NJIA 3TA4D 4UANA 3BQVA 1ID2A 3AW5A 3HEIB 1KGYE 6PCYA 2FQEA 2YEVB 2XWZA 3WNJA 5B1BB 2BZCA 4E9SA 1J9TA 1OCRB 5I6NA 1ASQA 3IN2A 2BP8A 5I6LA 1AZCA 3AG4B 1JVLA 1N68A 3EH4B 3PLYA 1ET7A 1CYWA 3NJLA 1ET5A 2DV6A 3FYEB 3DIVA 5TK2A 1IBZA 1KYAA 2ZWNA 1AOZA 4UF7C 1ASPA 1T5KA 4DP4X 1N70A 3EHBB 1E30A 4AX3A 3N2JA 1ZDSA 3UAAA 2DYRB 2X88A 2YAQA 4A68A 1A4BA 5B1JC 2FQDA 3N55A 1M56B 5B1KA 2XX0A 4N8UA 1PAZA 4BWWA 2EINB 3NJNA 4MFHA 2IDSA 2UXVA 1KDJA 3WG7B 2GHZA 2HRGA 4YSUA 1NIEA 1V54B 1GS6X 1BQ5A 3RYMA 4YSQA 3G5WA 1L9OA 1DZ0A 4A2EA 2FQFA 4G7RB 2FWLB 3WIAA 4YSCA 3QJUB 1QLEB 1XB3A 1W6WA 1OE1A 1WS7A 2DYSB 1GYCA 3NJFA 1MG2C 1TU2A 2EIMB 2Y69B 4HALA 3EH5B 2VSKB 2H5UA 1DYZA 3H4HA 2BWIA 3IEAA 6PAZA 2VN3A 1L9TA 1JVOA 2OV0A 2TSBA 1SHXA 3UGEA 1NIFA 2RACA 3FQYA 3QQXA 7PAZA 5FC9A 3TU6A 1I53A 1OV8A 3DKHA 1XMEB 4KNSA 2ZXWB 3EH3B 1M57B 1JOIA 2H3XC 4DPAX 3NJMA 1ZDQA 2VW7A 4A2DA 4WTQA 1HAWA 4YSSA 4E9XA 1V55B 2XVBA 1IBYA 2EIJB 1ZIBA 1R1CA 2YAOA 1QNIA 1OCOB 1J9SA 5I6KA 1NIDA 1NPNA 2XYBA 4ZK8A 1BXVA 3ZDWA 4YSEA 3SQRA 4YSDA 2MRYA 1KDIA 1KBVA 3WNIA 2PP7A 3NSDA 4AKPA 3H4FA 2QT6A 1GY2A 3HB3B 4DP2X 5I5IA 3U25A 3IBOA 2PCFA 4DP9X 1AS7A 3GXUB 2R7EB 1AAJA 3T6XA 4YVUA 2OJ1A 1HAUA 5F7BA 3CDZB 1AZBA 3WKQA 2Q9OA 3FU7A 5B1AB 4BWTA 1JZEA 2I7OA 1CC3A 2R7EA 3UAEA 3D12B 2IDUA 1GS7A 3NP3A 4BK5C 3X1BA 1WA2X 1A8ZA 1CUOA 1L9RA 3T9WA 3FSWA 1WAEA 4KOCA 5AKRA 1EHKB 3GDCA 4YSTA 4G71B 2PPFA 4E9WA 3OD3A 2W8CA 3T6ZA 3PAVA 2PPEA 4A67A 1FWXA 4KNTA 3NT0A 2GC4C 5I6PA 2XXFA 3V9EA 2BZ7A 4AKQA 3AG3B 2YAFA 2PPCA 5AZUA 3AG2B 1NWPA 2BW4A 3PCYA 2HX7A 3ABGA 4N4YB 1PLCA 5B7MA 8PAZA 1ASOA 1URIA 4E9RA 1ZPUA 1WA1X 2I85A 4GXFA 1IKOP 3CVCA 4YL4A 3H56A 3PAUA 3SBRA 1AZRA 2JFCA 4GY4A 5PCYA 3X1GA 5B1JA 4E9TA 4E9YA 3TBBA 3S8GB 1NICA 4YSOA 1OF0A 3S3CB 4FA7B 1TEFA 3CG8A 1J9QA 1BYOA 3ABKB 3NP4A 4KNUA 4A66A 5I6MA 1JZGA 4HCFA 1J5DA 4X4KA 2FT7A 1A4AA 2HLEB 4HHGA 3FSAA 4M3HA 2GSMB 4W9ZA 1QHQA 2N0MA 3QJSB 2FTAA 3TASA 4A2HA 1CYXA 1ILUA 2PPAA 3FQ2A 1KCWA 1UATA 2WSDA 1SHWA 3ASNB 3S3BB 2GB2A 2HXAA 1L9PA 4W1TA 2BO0A 2B08A 3L45A 5LDUA 1BQRA 1MDAA 3SBPA 2AFNA 2MTAA 4NB7A 1A3ZA 5I5MA 2BP0A 1RZQA 3PXLA 1NDTA 2FJSA 5E9NA 3FPXA 3AG1B 1GW0A 3FU9A 4P5RA 4PCYA 4JKNA 1PF3A 3AZUA 2ZONA 4L0PB 1F56A 4F2EA 1PLAA 2HX9A 3UACA 5AFAA 1SF3A 1TKWA 3DTUB 2WO3B 1L9QA 1WA0X 2IWKA 5ANHA 5IY5B 1JZJA 1A4CA
chains in the Genus database with same CATH superfamily
5AB2A 2NNFA 4QHLB 1MXDA 5EEZA 4FKEA 4DUXA 2CJTA 1EAQA 5HDLA 2VZUA 5JW3H 1OP4A 3X1EA 3IVKA 2FQGA 4OZHB 5I1AA 4B5ZA 4N1HB 2OXGB 1V10A 2XNDG 1IC0A 4HJ1A 4Y8AA 2ZP0T 1MREH 4P2YA 3HNSH 4O4YH 4KKZA 2X09A 4Y4HC 1W72L 1WGVA 4IJ3B 4XDKA 4DK1A 2E7BA 4KP4A 1CE1L 1HZHH 4RH4A 2B5IB 4PGEB 2OMXB 1CE6B 2BX5A 3W11D 4YQXL 5F9JA 3I2CH 3RBGA 2BVQA 5DMJB 4LP8A 3SKMA 5AVSB 2GY5A 3HC2A 2CH8A 4AW7A 3V0JA 3WSQH 2LU5A 4Q4EA 5EEYA 1CIUA 3VVWA 3HR5A 5MERB 4MMZB 3FRUA 4PJAF 1H2LA 3VG9C 5L0QC 2WB7A 5K39A 2FJUB 3EBGA 1UA7A 4PBWD 3IXAB 4HX1A 1VIBA 2V17H 1LXMA 1YDXA 1G4MA 4G9DB 2IFGA 3C87A 3P4OA 2OYLA 1J12A 2UYLB 4FADA 5J4MA 1B6DA 4LIQH 2QQNH 1WE5A 5C0IA 3SGIA 4ZBJA 5I0DA 5JW4Q 3DXRA 3N2KA 3B9KC 3MV7B 5DD3H 4LK4A 3RZCD 1G1CA 3L71H 3PABA 4JCMA 2V7NB 3JV4B 5HGBA 4FULA 1D5XB 3NJKA 4CKVX 1E4JA 3IJ9A 3JWDH 1CXEA 1ZIAA 3KNBA 4HKJA 4P2RE 1O5DT 2P24B 5LGJA 4YUEL 4U3JB 5ICYA 2VZOA 4H33A 1S7SB 4NO2A 2CHDA 3CZNA 4LHQB 4Y4FB 1GYVA 1XGTB 2HRLA 4WI0B 4YPGB 3NH7L 5DHVH 4JZOB 2Y0IA 2V0AA 4N0FB 1FA4A 1XB6A 3GI9L 2GJ6B 3U4BL 1M2VB 4LF9B 1UTDA 1Q82W 1NUDA 1XR8A 5HYSB 4W4KA 3MFFB 2EIMC 2ENYA 3KCXA 3SDDB 4S1DD 1H8HG 2RA1A 4URTB 2FAUA 2K45A 3FUEA 5D72L 1A7PH 2EKSA 1AJNA 1PD6A 1F1DA 2O6CA 3IMUA 3MA9L 2XTJE 3ZMVA 1FGVL 2OTUA 3C5ZD 4UV7L 2OL3B 5ALBH 3US9A 1MNGA 2XWDA 4LOUC 2GJRA 4HHWA 1HWYA 4NRZB 2NY6C 5DJXA 1RZJH 1E4KA 5GGTL 2PP9A 2YUWA 5SX4H 3FCSA 4AGMA 3HAEH 4MD5B 1E27A 1N2RB 5I0YA 2X7LA 5T5NF 1HWHB 3SKNA 2AJUH 5H37G 3WB0A 1FVCA 1HFUA 1IRAY 1ETZA 3F6IA 4WUUA 2Q87A 3UTPE 5H8DA 3V4PB 4LCCC 2B0SL 4XX5A 3K71B 3L3JA 5EU7E 3LQZA 4OGYH 1CD1B 4ERSL 1A3RL 4TXVB 3V10A 5I74C 5E9DE 5BR8O 3VO0A 4N85A 5LMUB 3K71A 1FFXB 1M71A 2OT5A 3DBXB 3UJTL 3UMNA 4MAYA 5C2BH 3AXLB 43CAA 5JORA 5D2NE 3MACL 2ZCHH 3D51A 1GGYA 2FX9H 2APTA 4PGZA 1YITV 1PZBA 3ASWA 3U30B 2DL2A 4PRNA 4I3GA 3VFVB 4BK5A 3CZLA 1W0WB 3QUKA 4NO0D 1RHFA 2P22C 3X13B 1SLXA 1XSIA 5JDSA 4ETYA 1G6RH 3FRPG 2CRMA 2QSTA 3O3EA 1IKFL 4OQTH 1UKTA 3CBKB 4J3BA 1AZZC 1BOGA 3KYKH 2PCXA 5IW1A 5L6YL 3CPLA 4L8DA 3AU1B 3GDBA 2BVOB 3QJHA 4G8GE 5D5MB 3VTTA 1IUZA 3QP3A 4WDIA 3BP7A 4JI4O 1X7TA 4HOWA 1IBMB 1IDSA 2DQEH 3QEQB 3B8YA 4YC2B 1XF2A 4JNXA 3SOTA 2OCCB 4DV2B 1CGVA 1FVDA 3FT4A 3CBJB 3TT3H 4UUJB 5EUOF 1G7IA 2GJJA 2XSKA 2HG0A 3W9DA 2P5WE 1Y66A 2E9BA 3FONA 1FYTE 3PDOB 3G9VA 2ZD0A 2OK0L 5DZ9A 4YZFF 4PI2A 5CGTA 5CKGA 4EN2A 2VMEA 1BQ0A 4J7ZA 3BJLA 1UD4A 4NAJA 4UOJA 1WJ3A 4JX0A 3L1EA 1JFFB 4Y4KB 1ORQC 1I8IA 3HZYA 5EZYB 1E5ZA 1H15A 1ZLEA 1MG3C 1AHKA 2MNWA 3D3VB 4ZW7A 2JIXA 5KAQF 2HP4A 3PNWB 3JAKA 1MAMH 1KGIA 2Q7GA 2QFPA 4LB8A 4GBXA 1I8IB 3HZYB 3ZDYF 5CCKH 1VACB 1KLUA 4NLAA 1TZOA 2BNQE 3PREA 2DAVA 4HPYH 1RY7B 4ZD3L 2GUYA 2BVYA 4PWJA 2ADPA 1J8HE 3VFPB 1D5ZA 1F45A 3L95A 4TUOB 4TVPL 3LKOB 4BCYA 5IJDC 3BZDA 3MLUH 3VRIA 2V5MA 1HEHC 1O6VA 7FABH 2JGDB 1SEQL 4L1DA 1T7XA 3QCVL 3PGCA 4X9BA 4UBDC 4BFEA 4HUCA 4MJIE 5JOFA 2GFBA 2B59B 4RWYH 3VWKD 1ETA1 3A4AA 4BBWA 1ZL8A 4BFRA 4O5LL 4R2GC 2ZYHA 1SQXH 4C4UA 2H4EA 1N6VA 4HW6A 5I76A 2AXGA 5LLIC 5IT2H 4C4KO 1G7MA 3R06B 5JYLA 5IB1B 1JNNH 1V3LA 4Z7WF 1Z5WA 3HR0A 3VXMB 2B59A 4LFHD 1WSST 1R6KA 1T1WA 2D7QA 2KLRA 1YJNV 1HR0O 1U8LA 5MENE 3SQBB 4Z77A 5T1DH 3DGGA 4JO4H 4PRPA 5GGSY 3UAAA 4BELD 2H2SD 1FNHA 4PWHA 3OLDA 3SQBA 1KLFB 2QEJA 1F6AA 1DVFA 1VEWA 5JXAL 4BSWB 2V5RA 4S1QL 4PJ7F 1EJOL 4KITB 1BT8A 4WI8A 3GGWA 3KPOB 4JPWL 3VQ2C 3X3GL 3OB8A 4ALAC 2D9QB 2X1QA 4LSTL 1LYQA 4LFBB 1J9CT 4PDLA 2F1BA 1DE4A 5F89B 2OR9H 5JQIB 4S1SL 4BAYA 4DO5A 2NY2B 4UCRA 1UXWB 4N21A 4MVUA 1NJ9B 2XA3A 4OZ4A 1YYLH 5ACLA 4NJ9H 3QIWA 4XP6L 4G7RB 1CICA 3RUGE 4IOIA 2EZOA 1JZ6A 1TMCB 5E8NA 3CWBH 1QOKA 3R8BB 4DWHA 4GX1A 3QDJB 4MMZC 2XIDA 1YEJL 3VG9B 3MLRH 4ODXA 4LLAA 2YRZA 4M5YL 1D5RA 2UWEE 3E8BA 3EH5B 3M45A 1FE8L 3ZR5A 4JO3H 1CPUA 3GS4A 1OK8A 2VQTA 1N5AB 4GB9A 5IVNA 3W9EA 1NCCH 1KWKA 5J1TC 2Y2TA 1DF4A 1FBIH 1TA8A 3EJQA 4ODXB 1RZIB 4M00A 1I85C 3ABUA 1I94B 4E5XB 2H8PB 5FECB 3CFKB 4B3RB 3VM7A 3S98A 1SOQA 7PAZA 5DRNB 5FC9A 3W37A 1NEZA 1MCHA 1QLFA 2VABA 3DKHA 4DVRL 3UO8B 2H3XC 2EDQA 1GMGA 4RWUA 3QAZB 3SCMD 3TF4A 2X9YA 1JMXA 1QFWM 5ANME 3MRCB 3M1OA 1ZSHA 2UWEF 1M2OA 1HAWA 3C5SA 5DRNA 1I7RB 1INDL 2K9UA 2K3HA 3ZMTA 3QIBB 2IALA 3KJ6H 4JUTA 2KI6A 1Z6JT 4Q56A 5DFVD 5EBLA 3I9GL 1HNYA 3RQ3A 3WU1A 1UOLA 5H4YA 3BVTA 3VXUB 1A6UH 1DQMH 3C6SA 3GJEB 1SHMA 2O5NA 2BHZA 4LCCA 5DEGB 3IRZA 5DS8A 4OTXH 2VT0A 1Y18A 3P02A 4R7DB 3DURB 4WO4D 4UVBA 5GS2D 1T0PB 3JYBA 5LBGA 2PP7A 3NSDA 3HS9A 1UZ6F 4HEME 2LP7A 1TO4A 2H0EA 4XDLA 2ITEA 1TQCB 2P5WA 5J9PA 4E41D 3FQNA 3BZEA 1MCRA 1RSYA 3QS2A 1QRNB 3IMBA 4PG9B 2X6CA 4OZHF 3VD0A 4M43H 3HI5L 5GGRA 3K5NA 1XNQB 3P0GB 3W81A 4LNRB 1RIHH 1MFMA 4ADIA 2P5ED 2L7UA 1WICA 3D30A 5FO7B 4I1PA 3MAWA 4IHBA 4M3KB 3GD1C 1QI5A 2WQSA 1PX4A 1TNMA 3GKWH 1QSFB 4OH2A 1OAQL 1U8IB 1PJWA 2NXYD 3BPCA 5B39G 5IMMB 3FB8B 1MHEB 1TJMA 1F86A 1A1OB 3ILQC 1JZ7A 5JW3L 3HS8A 2V4DA 5BZBA 1SY6L 2C8NA 4G71B 1RM1C 3Q5TA 4DR6O 2W8CA 3RDTD 1GC1C 4B9PA 1RMFL 1MHEA 1XMOB 2HH0L 3G5ZB 2Q67A 4XMLH 1IO4C 1FSKB 2WQAA 2WBJA 4DR1B 3HTLX 4EO5A 5C86A 2CU9A 2WXRA 2K9FB 3KD4A 4UM9A 4KK6C 5CHNA 2EIEA 3E2EA 4EBQL 4WFHD 1WFMA 5A6LA 3ABGA 1UJWB 4HWEL 2JTYA 4X0KB 3TFKD 1Q7YW 1GKEA 2QHRL 2IO5A 1WPBA 3F85A 4M48H 2NY5C 3C5ZA 3D4YA 2Q68A 3QXAA 1CZ8H 3F62A 2XNAA 4UB8Z 4PRBA 1A64A 4ONHA 3ABMC 3L70H 3T4AA 3RBZA 3QZPA 2IWGA 4PDRA 1G5GA 4FQCL 5IW6A 1KCVL 1V7NL 1HXYA 3CHXA 1OPOA 3QZWA 3G6DL 1DFBH 2ITCB 4IL6Z 3FBKA 1E42A 2Y5QA 3K2UL 3L2MA 3FTZA 4PW4A 2Y69C 5IROD 3DHUA 5CXPA 5C0ND 2I26N 2NY4D 1J0ZA 4NQVB 1MCKA 4Y4KD 3TOPA 3WHE1 3N41B 3SGJA 1MKFA 4UTCA 3L3JB 3ZKMD 3S96A 5DHVA 5C09A 4MA1B 3APFA 4FX5A 2OMWA 1GGIL 4RDBA 1ZSDB 2J1KA 4XAWH 4X6CA 4LF6B 3ETTA 4E41A 5MEOA 2HXAA 4ZTOH 5CCGE 3FRPB 3OAUH 2DQUL 5C09B 4CC5A 4O9HL 5HVGB 1BZDA 4Y9EA 2V2XA 2YUZA 1RXLA 4GQZA 2XVKA 3GHBH 1JJOA 4OF3A 3US1A 1QSEB 1ZS2A 5FUZL 3T0BA 4G1MA 1HQRB 4FXKA 5D72H 2AKRA 1HINH 3UO1H 2B4CH 4ODHH 4Q0XL 4HUWA 3T4DA 2IAMA 4PP2B 2VDRH 3OB0H 1WAZA 3MQIA 4TSFG 1S7TA 4UAOC 3LV3A 5ALBL 1EAOA 1QBBA 1EV2E 1F11A 4OLWH 3GK8H 3F7PC 2Q2LA 1CWVA 2PYEB 2UY7B 3HPJB 4HUVB 1F56A 3CC1A 2PXYB 5E6SB 1E7VA 5T1MB 2FATL 2Z7YA 2JJUA 2ZOTA 4FFYL 4OF8A 3WY3A 4ETQB 3FQ4A 5KJRH 2HR3A 4HBNA 1WA0X 3IMRA 3P0YL 4R5XA 2GBUA 4QD2E 3WHE0 2HFEC 3MOAH 5F7EL 4AE1A 3BSZA 2K8MA 4XE5B 4M9OA 3QHFL 1XZ0B 5GISH 1QFPA 5IBTL 1FZMA 4HSCX 1V54C 2QWNB 1MZFA 3EYOB 2D0GA 2VQ1A 3EGSA 4KKBD 3MUUA 5CILH 5CA1A 4PJ5A 3ILDA 1SJEB 3VQWA 2UXGA 5KAIZ 2VDQH 1SLWA 3MLXL 1ZWIB 1PNLA 1CBVH 2NXZC 2J72A 4UB0L 1JHKL 1IT9L 3IJEA 3ZTEA 1XH2A 1R3HA 2EVHA 1A9EB 2OI9B 4L8BB 3IU3B 4L3CB 4W68A 3SN6N 1H6UA 2XUWA 1H15B 4KL1A 2DWYA 4XNQB 3HA0A 2N7SA 4HUMB 4ODTH 4OF6A 4PJGB 5HHOE 3IJEB 1AI6A 2YN5A 2YXVA 4EPSA 1GRJA 5F0JB 2EEFA 2LLNA 1MAKA 1GS8A 4HCGA 4YBLB 4ZSOE 1SOSA 3DSFH 4QMEA 3S0PA 4JRXA 5L4JA 1S7QB 1RV6X 4RQEA 2VDPB 3O4LB 1NOFA 3BHBB 1C5DB 3OMNB 4UCVA 2GJPA 3EFDL 1XGPA 3O2VH 2YQGA 4AQEA 1U3HD 1A7RH 1MJ8H 3IAYA 3ULVE 3LUTB 3VFWB 3VRIB 1NBMG 4LFBO 3GSNH 3SBQA 1WBYA 5F3HB 2EACA 3S4SA 3VWKA 4HXAH 3BSZH 2WLLA 5H9CA 3RHWK 3FT3B 4QE9A 5EA0L 2XPZA 1K72A 3WMSA 1N6QH 25C8L 2CBPA 3X3GH 2YLKA 4FTVE 4JFZL 4POZC 2ZXWC 4WSJA 4NTYA 2ICWI 2WM0A 3UJIL 4BW9A 4FHJA 4LLDB 3FU5A 3RGVB 1S5IL 4G7VH 3BGFB 1L4IA 3KYKL 4AOFA 3HRZC 1OT1A 4XPGH 1UWGH 4R96B 4Y5YB 1X5AA 1JZ8A 1LP9F 2VLRE 2BSSA 3T0VA 1OT2A 4LH6A 5D5PA 2H8PC 4O2EA 1XHZA 1YEJH 3V4VB 3TZVD 2K1MA 3MFGB 5TE7H 2LFGA 3NQIA 1MFUA 2WBJD 4UTBL 1U8HB 3LVTA 2ZM6B 4U6XA 4FFKA 2LAGB 3OUSA 4FTVA 4XNUH 3ZHTA 2A83B 4JFOA 1FN4A 4LDCA 2F6AA 4ZUWB 1CFTB 1K4CB 1XXFC 3W2DL 3T0EA 1RPQA 3BJ91 1KXQA 4MDIA 5AZEL 5ES4B 5GZOD 2OK0H 2RQ8A 3MLTB 2SEBB 1DUYB 2DQJH 2R4SL 1XGUA 5F9OH 3KLAA 5HY9A 1CICD 4JDZB 4JFOB 4OR1A 1FN4B 3UG3A 5AVXB 2BNUB 1MRCL 5MI0B 4LCUC 5F9JB 4DESA 2XVLA 2CTWA 4LVEA 4NKDB 4W9IC 3S8FB 3IJ8A 1G5AA 3J7HA 1KC8W 4L3AA 1Y0LB 5BRPA 5D7KE 2Z8WC 5LGTA 1S9YB 1ZHBB 3WNOA 5D6CA 3BUYA 5C0EA 1T03L 2ADJA 1JNNL 1OK0A 2FNWA 1MI5B 2UXFA 3C8DA 3L4VA 3NK3A 3QNXB 1UA6H 1JPGA 2BK8A 5C6WH 2I5YL 2VTFA 4BIZA 1KTLB 3R66A 2W60B 3QG6A 2FJGA 3MCG1 1SDDB 1RZIA 1UXLA 3AG3C 2PW1B 2ADJB 4AWJC 4RETB 1GGCL 4FFBA 2A6KB 3FNKA 1T22B 4V33A 1KACB 2CMRH 2YA1A 4NQEA 2CCLA 3ZSTA 4HC1A 2FJGB 3N91A 1SDDA 2OTJV 3QB7C 4YXKL 1RIHL 4U3SB 2GUOB 1QVOB 2PO6A 1U2CA 5DRZA 4KI1A 4UIMB 1RK1B 4H7VA 2ZXQA 1U4FA 1PS3A 5KSBE 4Q6IC 2B4CC 3C2SA 3IDGB 4ICXA 1HH9B 4H20H 3Q8AA 4NSKA 3RTQD 5BW7C 3OKNA 2CDEB 1IAOB 5D1QC 5LCVA 4QHMA 4A6YL 4JHAL 3UTTB 1MW0A 1AR4A 5B3JE 4AIZB 2Y4SA 4BZ2H 5T1KD 3TVMB 3D85B 2BH0A 2V3EA 1CL7H 1Z9NA 1F3JA 5IBLD 3JAMN 5B4MC 2DM2A 3L9RB 3UTTA 2J8UB 4IDLA 4OKVB 4JREC 4XOCA 3WNKA 2VQ4A 3EJZC 4PUBH 5F3FA 3VYPA 2VR6A 3VGDA 2E9GA 3SY0B 3LPPA 1U8OA 4P46A 4Q9CA 3INUL 4IRSC 5L9DH 5C0BE 4XGZA 2B1OA 5FM8A 2ZXEB 3IWVA 4P4KC 1PL4A 4I77L 4JE0A 3US0A 4LSTH 4NRZA 5GZOA 1HHJB 2IU3A 3ZKMC 1J5OL 2DKSA 2Q6AA 1R5IB 2CJ3A 3VXRA 3S3XA 1RLWA 5H37A 2BNRE 3SIKA 1G6UA 4G8AC 4N9GB 5TDNA 2V7HA 4XTRD 5I8KL 4JR9H 4K8ZA 2P80A 3ZDYB 1THCA 4WCYL 1UCBH 1JV2B 2CA3A 2IDQA 3QWRD 4S0TD 5JIIA 5E56A 5FO8B 2HFEA 1G87A 2ZOUA 3BAYA 4NXMO 1CDGA 1GGBL 1Y74B 1BWWA 4Z3GA 2O5XH 3EXAA 2XZZA 2XASA 3E8FA 1JFQL 1KGYE 4QHNB 4IKIA 1E5AA 4KRNA 3F83A 3NG5A 4LF8O 3GO1L 3D3VE 6PCYA 3D33A 2FJFB 4PB9H 3ZX6A 3DMMA 3NIFB 4NCC2 5FFGA 1NGWB 1MJJA 2VDKL 1J95A 2WVSA 3TN0B 1XBLA 4DRXA 2EBOA 3ZQ9A 1N34O 2MCAA 1H3UA 4G9FA 4X4MA 3PLYA 1NPUA 3GJFH 1SZTA 3UAJD 3TX4A 3N1FC 4Z7AA 5C0NC 1Y6XA 4P2QE 1AOHA 4ILDA 1WBZA 3TBYB 5CBEA 1OCZC 4I0XB 2ZWNA 1SS3A 4UV8A 1YNKL 5D55A 4U3HA 3TYGH 3B5GA 4PRDB 2NQCA 4U1NA 4K71B 5JPMB 1R5WA 4L0ZA 1IGCL 3KLHC 1OSEA 1KPUB 1QTYT 3QUZA 4FQJL 5CP7A 1ZVYA 4X6EA 3VQXA 1YMMB 1W15A 1GRWA 2VR3A 3ES6A 5EBMB 4N8UA 1BVNT 1CDCA 4UMSA 1NR7A 2VXSH 3DNKA 3P3RA 4OJEH 1Q6IA 5I9QC 2E47A 2WWKO 5I16B 4ZMZA 4WF9V 2UY6A 3HMXA 2UXVA 3V5KA 3MJ7B 4ZAKB 5DZJA 3EFFK 1V54B 3MRGB 2F19L 4NYLB 3KBEA 3ME0A 4M48L 5D2LA 5BR8B 4TNFA 3SCMB 3OWEA 4LSVH 1XR9A 1L9OA 1PU0A 1UB5A 4KH9A 4UT6A 4QRRE 1KGCE 2X3AA 5HYQB 4U3CA 4DVBA 5C08B 3D3VA 4D7SA 1P7QB 4LASL 3HPJA 2PYEA 2ZDIA 4NCDA 2UUDH 2ICWA 3OSVA 1ZJBA 3VXQB 5JVDA 4F7TA 1VACA 1J0KA 4P3WA 3UC0L 4AVKA 4ZUVA 1ZKAA 5I1LA 2E46A 4OX9O 1BZ7A 4ODTL 5CA0A 3ORJA 3P4NA 1UH4A 4Q6KA 5BMFL 4I9QA 2OIEA 1SF9A 4R6UA 4LLYA 5HGAA 3ULUF 2DTML 1JGLH 1HILA 5BRZE 2FSEB 2P8PB 1X5FA 2X4SA 1SDYA 5AB1A 1X5GA 1FFOB 4MLSA 3NIGF 5AZ2H 2YEVA 1ED3A 2ZXWB 5ALCL 1CLCA 1R3LB 4ZUSA 4CW1A 2FSEA 2FYYA 2P8PA 2WP3O 3CFQA 4FQCH 1EO5A 2NXZD 2VXQA 2CUGA 1YYML 4JFUA 5E5RB 3V8OA 3LMJL 2E27H 1QFWL 4AQOA 4JPVL 4MKMA 3QK0A 4JBSA 2GCYB 5EU5A 2ZUTA 3W0WA 2Z5UA 1RZGB 1JPXA 1W2KT 3NPSC 4MZ2A 5AENA 4GRWF 4K73A 1GTFA 3UERA 3ZMEA 1K34A 2XYBA 1ODUA 1BXVA 1M6UA 4Z1MG 1U3JA 1BPVA 2F58H 2VL4A 1UFIA 4KJWD 4RA3A 4KTEL 4KROC 4YSDA 5FHAL 1WFTA 1S7QA 3L4UA 1Q9OB 4JM0A 4NZ8A 4J3OH 3UXFA 5KG9A 1YSOA 5CKAA 2V5SA 1TETL 3ARDC 3ZN6A 1SQMA 4ELDA 1KTDA 1O6SA 1NCDH 4MVBD 4W9EC 3GPEA 2NX5A 5HHME 4CAGA 2Z31D 4LQFH 3Q06A 1MY5A 4FD0A 4LF7O 3D5OF 1EHNA 4OLUH 1HEJC 4QWWD 4DV5O 2QVMA 4AEIH 2RHEA 1NFDE 3HG1E 2R39A 4LWSB 3HAEB 5F3HA 3M7FB 4DNLA 4H8VA 2E76B 5EBLC 5GISL 2AK4E 3O8XD 4OKDA 5DA0B 2FIKB 1FL5B 4YHMH 1NCAH 3FO9A 4ODHL 1RL1A 4NKOA 2IH1A 1EHKB 4MT8A 1U33A 1SUJA 1Q81W 1PYWB 3QCUH 3Q3GA 4U6HA 2O6PA 3G5VB 4WW2B 2AXJA 1OAUH 2ID5A 2O6FA 2RN9A 2CDYA 4JI0O 1N59B 1VERA 1J10A 3MUY1 4B3VA 2C7UA 1NFDB 2HJFC 2JRIA 5E2UH 4IU3A 2AITA 5K59F 3CFDA 1RUQL 3Q3GB 2O6EA 4U6HB 2MCPL 4A63A 1J8HA 4ELMF 4P5TB 3LZPA 3TZVC 3JVGA 4X1KB 1A3RH 3O2DH 1YN7A 1SN2A 3NN8B 1WA1X 3S36X 2ZWLT 3TH4T 4NWTH 3S7GA 4HH8A 3SBRA 4L1SA 5EOCH 4R2GB 2JKXA 2A9BA 1G9EA 2QJDA 3EFDH 4PRPD 3LS4H 4F6RA 3A6OA 4NM4L 4YIQA 3KXFB 2VDOL 5KTEL 4NZRL 4DGIH 1GN2A 2XWBA 4W81A 4LF9O 2GV9A 1I7UB 3FTXA 5DFVC 3FQXA 3V0DA 2CGNA 4X9FA 4HXAL 1RURL 4AQ1A 1UD8A 2DW4A 3GJEA 1VEMA 4JDTH 2NNRA 3WE6B 2WUBL 4IIZA 2XWBB 2YPLD 5E8OA 4NKIH 4NNYB 3PN1A 2KPNA 4A2HA 2OXHB 4HU8A 1KCWA 1TCMA 4GUOA 4XO8A 1HNGA 1YEKH 1XNRB 1RU9L 2A77L 2R70A 2FK9A 4G8GB 1FNGA 2VN4A 4DUWA 5GGVY 1NGQH 4HV8A 3MGTA 5FHBL 4Z7QB 4NHUA 5KBPA 5J6GB 2ALWA 3MOBL 2ICCA 2PW1A 4J27A 2DIEA 3Q13A 4CVUA 3K6NA 5HGDB 2HMIC 2ZE8A 4G8GA 4P2OC 4JMXA 4IKJA 2LU3A 2F74A 4JY4B 1SRDA 4LF3B 1QCEA 1EXUB 4P3DA 4ZJ9A 3S4SG 2P9RA 3V95A 5KS9A 1KB5B 4Y89A 4RNRA 3QUZD 4UYQA 3ABLC 1EWHA 3TJHC 2BOBB 4HIXL 3L9DA 5CLYA 4OZFA 3TFKC 3IDGA 3CBRA 3LZRA 4JFZH 4PCTA 4XN2A 1NGYA 3THOA 1QHOA 2EDNA 5HD8C 4RQQA 3MJ9H 5LMUO 2HJFA 4XNZB 4HFUL 1RZJL 4P46D 4NUPA 3M1CA 3EJRA 5HHVH 1QLRA 3L6FA 1FJGO 4LCWA 3UACA 1G7JA 1X3DA 3O8XB 4U6VH 3A8TA 2PYJA 2AV7B 3GZQA 1JV5B 1I1CA 4S2SB 4JFFB 3LKQA 4PJCE 4XVUC 5LA6A 4QRRD 1I3UA 3T3MF 3HOGA 1A4CA 2RMNA 4DR4B 1VFBA 3MLSL 4JRXE 4H0HB 1BEXA 3D4CA 4GO8A 2NY1C 1KLGB 1XGQB 5F1IA 1HHHA 2WZAA 5EO1B 4R7XA 1LE5A 3BKYL 4X5XA 5GS0L 4FG4A 1E4XH 4PPTA 5C07B 2ZCHL 4MJHA 4TPRL 1RULL 3ZHRA 3LD8C 3QCVH 1NINA 3L3OA 5DK2B 2KH2B 1MQKH 3TBCA 2R9AA 4MDJB 3C6LD 3RIFF 2H2PC 1OOAA 3UYOD 3H9SE 3HKDB 1ZHLB 2VDPH 5KUKA 2AGAA 1SOXA 5IT2L 3I50H 2X4OB 2DYPD 1PLBA 1ZV9A 5IM7B 4JZJC 4P5SA 1HL5A 1VQNV 1AYOA 4XR8C 4GYBA 2W0FB 2J8HA 1KJVA 4UOW0 3WY2A 1T89C 4DR5B 1I75A 2CBMA 2R69A 4PRNB 2XN9A 1CVSC 1ZX3A 1DL7L 1RZKC 4ADJA 1K92A 3HE7A 4Q8BA 1FCGA 3MVSA 3PGDB 2W0FA 5DXWA 1OM3H 5JDSB 2JMRA 4X9QA 2YKLL 1DBML 1FHNA 4S1QH 1WVZA 3P30A 4JPWH 3MNDA 5AOZA 5DD1H 3VW3L 4G6ML 4XHJD 4HGWB 2AZUA 4DUYB 4CVWA 3OZ9H 3M07A 4IBWA 3U0WL 4QKTA 1S7VB 3N2GA 4HZLA 5IB4B 5CN2A 2R72A 5K9OA 3F3HA 2MHAA 2YMOA 3QISA 1GGTA 4XP9L 3BP7B 1Z9OA 2YPVH 1UXSB 3BKJH 1EHAA 2EO7A 3JWOC 2ZDIC 1S7VA 2PTUA 2TSAA 1E28A 3FU0A 3R18A 2GY7B 2IGFH 2OSYA 4GBXD 1JNHA 2AERT 3T1YB 2M1KA 3O2DA 2F8XC 2AGJH 1CL7L 5DRXB 2Y2WA 4JQXA 5DS2A 3ZRXA 1R5WB 4G42B 3SDDD 5CEXA 4KJPD 1T5XA 2F9BT 2CK2A 4X5PA 1NMBL 2JI3A 2WAHA 4AQYB 1IM9B 3G6AA 4B3SB 1PY4A 3NIFF 2KQXA 3QDGB 4AT6A 4K2UH 5ADOL 4YBHA 1UGKA 5DGRA 2WOBA 1E6OH 1F4AA 2H45A 4X1IA 1R3KC 1B9ZA 1M56C 2YUVA 4ODVL 2DS4A 4K0OA 2FL4A 4L05A 3I3DA 3T4YB 3LCYA 4GKNA 1KPVB 1KWGA 1YJDC 4JFDA 3CHPA 1KC5H 2B1AL 2W07B 3GS0A 4CSPA 2BY1A 2V6HA 3EO1B 3BPOC 1M7UA 1TJIH 4QRTA 5ETUB 4HD5A 4BFFA 1B4LA 5D96C 3X2QB 1G7QA 2J88L 3OF6D 3KJ6L 2ETWA 1OZ0A 1NLBL 3BPNB 3VGFA 4TV9A 1JF6A 1T7YA 3MV9E 3ZT5A 5FM4A 4TUOA 4FA6A 3HB3D 3OHXA 4POZD 4BV1A 3JTBA 4MVQA 3L13A 1UD2A 1K9MW 2VJ0A 3NPZB 1FJ1A 3VI3B 2D2CC 3POHA 1ZLVH 3VWKC 3OHXB 3DSNB 3BAEH 1JN6B 2IWFA 4ZMXA 5I76B 2YPLE 5F7UA 3STLA 4AITA 2WLLB 3RWGA 1PW3A 3VFSB 4HMEA 2FO8A 2X6VA 3B34A 3QEQE 1PIGA 3QQ4A 2ESVB 1IE5A 2HKAA 4AEIL 5DZAA 4WNSA 2CR6A 2K3TA 5DUPH 4MXWH 2HT3C 4WK0B 1WFIA 3JATB 1W8EA 2NUPA 4BKLA 4JM4H 4PS7A 2DQGH 5L88H 3EYSL 3SCMC 2IEPA 3JXAA 4UNIA 4Z7VB 3V2AR 4C56E 4TULH 4BSWA 1OGPA 3D25B 1OCWH 2H0JA 3EO9L 3W39B 3PQYE 5EIBC 2P24A 3PGFH 4LCIH 3EBIA 4B9ZA 2Z31A 4G43B 3EG9B 2BOCA 1R3KA 1FNSL 2X2UA 3DX2A 3WJMB 5KAQG 1SUHA 3ASOB 4N0FA 2UXDB 2BHUA 2CO6A 3FMGL 1YTFB 2P28B 5EN3A 1MCWM 5JZ7D 4JDEA 5LCVL 2ZUQC 5C6PB 4LL9A 2XT1B 3NSCA 4MDIB 3MXWH 4BFIA 4UT7H 5KYUA 1UD5A 3MFFA 3Q6GL 2EXSA 1Y1UA 2NTFB 5E4IA 3K03A 2CO6B 4ZFOL 2MTPA 2UWEA 1NT2B 1W0JG 4W6YB 5FGCB 4D0DA 5JXEC 2WYZA 3RI5K 5C93A 2CO1A 3LS4L 1FLRL 4F24A 1AACA 4DT2A 4JHWL 1D5BB 1C8PA 3TFBA 1Z9PA 35C8H 5DDHA 3MLWH 3QZBA 3RWCA 1RUML 1KSRA 4Q20A 1E8XA 2BSED 3OLGA 1TVKB 3VFRB 2F1EA 3CAFA 1RURH 4HCIA 5DC9B 4GAFB 3S6CA 2CQVA 1OHHG 4FFZA 3ECUA 4LF4O 4OTXL 4HNAB 4HIEA 5K1PA 3CCMV 1GAFH 3EJCA 3GMMA 3WUZA 1XF3B 4N22A 4KROB 1JXKA 2IBZH 2IQ9H 4J3OG 4JAAA 1A4JB 1ZE3C 2DQUH 2MCG1 1LGVA 5FHBH 5AG2A 4WTZA 2VAAA 3NESA 4XPBL 4HUXB 4E9SA 5BS0E 1MHHB 3WTTA 3IJ4A 1S6NA 2DD8H 1MI5D 2HKHL 3IGAB 3S35X 2PYFA 3TH3T 4M03A 1W16A 2NYZA 4P59L 3HG1D 1F8TL 2DIJA 4KVNL 5CZXD 3UROR 3FQXB 3IPEA 2G5BA 3V0VB 3QW9A 1F90H 3UZEA 1PPJH 3SBWA 3K2KA 4I3RH 4GRWH 1KYAA 4S1DC 2FX8H 1OSPL 4L1BA 4UF7C 4HJEA 4IOSD 1ACZA 1N70A 3BE1H 4I3SL 1EHXA 4CSSA 1U8JB 1AJPA 4JVWA 4AZ8B 1IZJA 1NCGA 3N2JA 5GIRB 1VPOL 2JB5L 4HJUA 4DCQB 5B1JC 5A2FA 1OT4A 2BXZA 5I18H 3NIDF 2XX0A 3ZQXA 4J3WA 4EKXA 2BVOA 1I1RA 5M95B 4IBTA 3P3TA 1T5EA 1EEQA 3MI6A 3PHQB 3QRGL 1JK8B 1XL4A 1AP2A 1EDQA 1KTJA 5DEJA 1WITA 3QUMB 4GUPB 4YSUA 4RNRB 4NP4H 1I82A 4Z7OE 2ZNJA 1Q9LA 1U2YA 2ZKMX 5LN8A 3EAKA 5EBGA 5EOCL 4MQSB 3UFIA 1CO1A 4N2MA 3H42H 2CDGB 3PY9A 2IC2A 2LTQC 1NGYB 3BYTA 1Y7VA 1XUQA 4GMTH 5B66Z 4Y4FC 5CIPH 4JZJB 3UP6A 1BA9A 1CDBA 3QJUB 3CXDL 2K6WA 1OHQA 1XB3A 5CLWA 3O2WL 4XHQA 4LCYB 1RI8A 2V7HB 1U8NA 4XAKD 3E35A 2A6DB 2A9ML 4NQCA 2RFXB 4NIYE 2EIMB 3JTSB 3MREB 4Z0BH 4RIRA 2D4FA 5E1QA 4QY8B 2VSKB 1CLOL 4ABMA 3HC4H 3ZRSA 1B4TA 5KBMA 3WFZA 5C0RL 4FERA 1SXSA 2HLFD 2NY3C 1CU4H 1FYTD 1IGIH 1M1XB 2R23A 5IB2B 3K9SA 1SZNA 2EDFA 4WHYH 1MSDA 5D5MF 5H2FZ 4ZTOL 1GZHA 4ABVA 3TU6A 2KKQA 4PLKD 2ZPKH 3F7RA 1XIWD 1L5GA 3D0VA 4FPPA 4OGZA 4FCHA 1ECZA 1MJUH 3CZSA 1G9NL 2J1WA 5HJ3B 3FB7C 3PAYA 3UGUA 2BC4B 3LNNA 1DBMH 2N7AA 2V37A 3J07A 3LRSA 2YSSA 5SWSD 4EBQH 3TO4C 4YL9A 4NO5A 1HINL 5BJTA 5AOJA 3I6GB 1FVEA 5IWLA 1S7XA 2NNAB 5EO0A 5AUMA 1OCOB 1LUWA 1J9SA 3QIUA 4N5EC 4MMXA 4X5WB 1NPNA 4HA1A 4YHPB 4HCRL 1OL0A 4ZK8A 4BEIA 1GZQA 3ZIAG 4QHKJ 1Q0XL 4G7VL 4L3EB 2XQYK 3FTGB 4X6DA 4IOSA 5FYKU 3F5WA 3VXSB 5KYXA 4L18A 2V5TA 5AW3B 1UM6L 1GY2A 4FHBD 1OARH 4CNIA 4Y1AB 4Y2NA 5F7MC 1HCVA 3IBOA 2IPTL 2OYQA 3H55A 1XT5A 1J0IA 1VDGA 3OTFA 3ARGA 1DSWA 3I6KA 5I1DA 4WUUD 4YHOH 4YHYC 5IHUL 1R3IH 1THAA 2IBZX 3MODL 4JVPA 2ERJC 2CLRA 4HAFA 1UXMA 3FU7A 3AG7A 1FQ9C 1S9XB 3R7QA 2O5YL 5G4NA 3BCDA 4XO5A 1KLFA 2EILC 2EDRA 4KY2A 3P3SA 4LPTA 1WCBA 3JT0A 3RZWA 3ABZA 2F1MA 4K55A 4H26B 4RRPM 5D7LA 1X44A 1PEWA 3HNTH 1RULH 1ZJAA 4I5SA 5J57B 4Z7VE 3HI6L 1JHLL 4E0RB 3NT0A 4K4KA 2G4GA 2RCSH 2OCCC 4ODSL 4JK0D 1NVPD 3FOLB 2JB6A 3EGSB 2Y23A 4ELMB 3FO2B 4JFPA 3GBNL 2APWA 4HK3N 2CH7B 1U93A 3OAZK 1XBRA 2WKGA 2UVFA 4HUUB 1SYVA 1K2DA 2HJKB 4QEGA 5FS5A 4L48A 3TN0C 5HJBA 1T20B 4LDLB 4OFQA 3QJOA 4FP8H 5D7HA 1A7RL 3A23A 3MRJB 4XVJH 3O3AA 2L3BA 1P53A 4JFDD 4F58H 2QADC 1BZ9A 3O11A 5ERWB 4LBEC 2WBJC 2GCYA 5EU5B 3W0WB 5J89A 2HUEA 3CPUA 2VISA 5EA0H 3SJVA 5DSCB 1NEZB 4PTTA 3GBLA 5EIIB 3W7WA 1BFOB 3WDIA 4HF5L 3FSAA 1BVKA 5AKVA 2KBGA 3GWOA 2PYED 4WZ9A 2N0MA 3TNMA 1ORQB 1HNXO 3T0ED 3VD2A 3PWNB 2IADA 2G2PA 5HDQH 3P0VL 3BD4A 1O6SB 4XPGL 1INEH 3GHEL 5EWIH 4Z7QF 3SODB 2F7IA 2L0DA 5KJ4A 5E1AA 5E4EB 3DOSA 2GITA 5GJTH 1E50A 4MTXA 2JIXD 5DVMA 3GMLB 1GTOA 3X12A 3AG4C 5CUSH 3DC6A 3K7UA 4PJ8B 1JE6A 3SE9H 3D4GA 5J9PC 3JD2A 4J6IA 5JYMA 1CGYA 2QPUA 3RKDD 4OJAA 4OGAC 3B9KD 3D39A 2O6DA 2CSPA 4PGDA 4OUUA 1FLTX 4LSSH 1I1AC 4A55A 1E2WA 3FPXA 4KJQC 2WINB 3SGEH 5F9OL 4DGWC 4IRJA 3ALXA 3OXSA 3PHSA 2OYKA 3GSQB 5C7XL 3AZUA 4L0PB 3V4VA 4Q9BA 2R29L 1VGKA 3O6KH 1NFDA 4GW1A 4LSPH 5DT1L 2HMID 3UZQA 3N1QC 4WUKL 3ZMUA 4MJ5A 5IMKA 1IJ9A 4L2LA 2C1PA 2UU9B 4FTVB 4MBOA 5I8KH 3RL2A 3WGVB 1MW1A 3F05A 3V0GA 1U9KA 2YPKB 3V6OA 2GIYA 2WGNB 3UZQB 4B53A 2Q69A 4K3AA 3W0WD 2WC7A 1NBQA 1EBPA 4MJIA 2V4LA 2NW2A 5HD8D 4FMKA 1CLVA 2FO1A 4KKCC 3GB7C 1W6LA 4O2FA 3BWAB 3G6JB 2JKNA 2YXWA 4MJIB 2KT6A 2NZ1A 4H44B 1ZHBA 4Z7VF 1E4XI 2EC9U 2DEXX 2WQWA 4M6OH 3WG7C 4UQ3B 5HJDA 5JXED 1QW9A 2IANE 1LUVA 3T4AB 3V0WL 3MNWA 3QEQD 2IFFH 4ENEC 2AK1L 2V7QG 3QG6B 1JYXA 1CF8H 3TBVB 2Z8RA 4OM1L 5DLML 5L3BA 3N43F 2APXA 2CUAA 4FCAA 3EYQD 1AGFA 4FNSA 5FYLH 3REWB 2A6KA 5T8IA 1HSAA 4D9LL 1JGEA 3RILA 3RUGF 3MJ9A 2IJIA 1EZVH 2CJUL 5E5MA 3TVMA 1YEDB 3DIFA 4L4VE 5T3ZD 4K3HA 5CJXA 5DRZB 1QTPA 4YO0A 4N6RA 2BFVL 2ZAIA 2F74B 1PG7H 1R3IC 4PA7A 4HPOH 3DV6B 4TTDC 1ZTMA 2OMZA 1YEDA 3DIFB 4HLZH 4XPHH 2VZ3A 3D87B 2P5EB 3GYRA 4K94L 3NEEA 1RSFA 4XNXH 5KVFE 3CSGA 5ITFA 2CLVB 4J3SA 2NT1A 1AGBA 2CIKB 2BPBA 3MZTA 4LDOB 4R7CA 4JPKL 4O02L 5LCVH 3TYFB 2Q8BH 3X13A 4RQQB 2DL9A 3EDJA 4UTAH 3T6WA 3BEVB 2GIMA 3WB1A 3QO7A 4AM0Q 3QUXA 2LW7A 2QDWA 4QPJA 1S9KC 3F8UB 1AGBB 2B3RA 4G6FD 1NTMH 2FBOJ 4NN6B 4R90H 5C2BL 3CCHA 1E2VA 2YUXA 1MHCA 2ZOWA 3DI2B 3EYSH 5E4AA 1KUMA 1CLYL 1OTUD 2EEAA 3MBEB 4JTCB 4L3ED 3CXDH 3PV7A 4GSUA 1KCUL 4UZSA 3EO9H 3CPWU 4M1CC 4B3MO 1F1AA 2WPDG 5E9DD 4DCQA 2UY7A 1T66C 2JCCB 4EIGB 5BMFH 1LQBC 1P9MC 3QI9D 3AAZA 1X9LA 3SJCC 1BSMA 4RGMB 2JK5C 5IROC 4P2RB 4U1LB 4F9LC 4ETQA 4XI5D 1GGBH 2YR3A 1IGIL 2Q0ZX 4P30A 1OAYH 5INDB 4J7JA 1IBGL 2VLKD 3C8KA 3EKCA 4UB6Z 4JAUA 2AW9A 4I9WA 3FONB 3OTOB 5EV7A 1X4ZA 4GBXC 3FB7A 1WTGT 3D48R 5DJ6A 3IPBA 2OBGA 3VFUA 1HOEA 5A7BA 5IJVA 5GRWA 5IFHL 3DRQB 1LDPH 1LWJA 2WXMA 5HVHC 1QASA 4OT1L 2OP4H 2VH5L 4UV9A 3VWJB 4NC1E 5L4MA 4MZIA 5CSZB 1KYOK 1AIFB 5A2JH 2CWRA 1PNDA 1NKGA 2ZX5A 4YEEA 3QHZL 4S11A 4PJCF 1YNLH 3WLBA 4DR6B 1Z3GL 5I6XC 1YMHA 4MTMA 3S34H 1T04A 3PWVA 4F57L 4JFDE 3HI1B 4DR1O 1NCNA 4M6AA 1F90L 2F58L 4QHNA 4LEXL 5SX5H 1R6NA 3NAAL 4HCRH 1KV7A 4MQ7B 1JHTA 1T1YA 5TE4H 3WIIH 4G83A 4HKXA 3L17A 2QHLA 3TVMD 1T04B 3PWVB 2MNJB 3EO0A 5CJOL 3WXVH 1H8EG 1OW0A 2GPZA 1G7PB 4XCNA 3II3A 1EGJH 2MOVA 1BP3B 2IPTH 2NW3A 1AG6A 2JDIG 5EU3A 2MQ0A 3U6RA 4WHCA 1OWRM 2EDYA 4XP5H 5KJ7E 2E4FA 4XNZC 1QSFE 1MAML 2HKHH 2BSKA 3C60D 5HJ3A 1Q1PA 2RB8A 2FTKA 1Z2GA 4G5AA 1KIQB 1P4UA 1RJYB 5I71B 1HJBC 2FYVA 3W7TA 5KBLA 3MRKB 1QI3A 3PDGA 2VWKA 1USZA 3DVFA 3O41B 1HNWO 3I6GA 4U4IA 2NY5L 4N5ED 4X6EB 1AKJB 4HP5A 5A43C 1P0SE 3ZKQD 2QDOA 1IC4L 4P9MH 4XBEH 5HYEA 1YAZA 4L1TA 1AROP 1GKOA 3HN8A 4M4RB 4CGTA 5I16A 1R24A 4Y4HA 4GUQA 3B3IA 2FSDA 1VQMV 2C4FU 4CZZA 4X5RA 5HFMA 4LPCA 5A6IA 3HMWL 1F6AB 4ZO7A 1X7SA 3FU7B 1CU4L 2NY3B 4GP5B 4KJYA 1DVTA 3QUGA 1NWOA 2JXMA 2YQBA 4HZ1A 3TCLB 5IHHA 2Q10A 3LS5H 32C2A 3FU8A 1E4HA 2EVJA 2B7DT 3ZY7A 1BL8A 2ZUWA 4R4NC 1NJ9A 5JA8B 1K5NA 3CCUV 3U48A 3T0EB 2WSKA 4QNPF 5IKCA 2IGLA 1JUFB 3Q43A 3H9SA 1NGPH 4FOMA 4XCEB 1U3HC 2IH8A 3NIFE 2R51A 1XNRO 3GXFA 3TT3L 3FB5B 3CCEV 1W0KG 4DUYO 1YG9A 4QE7A 1DCEA 1Z0MA 4X7FC 4WSKA 1JZ2A 1UQSA 1F2QA 1D7BA 3NCBB 4PJBE 1SJMA 3KL5A 2J56A 4LPUA 4CJ1A 2ILLA 3GRBA 4MLIA 1IKFH 1WBXA 3HW7A 5FPOA 1J1OH 3UBFA 5HDQL 2F54B 5HP5A 4NJ9L 1ITCA 4NO3A 1YN6A 4XP6H 3V7AG 3MRPA 2Z92A 4ZZKA 2X41A 3WO4C 3H1ZA 4O4JB 3OKMB 1X4YA 1UYWH 4U1KB 2PGGA 3KJ4C 4KHTL 4XCCH 4L29B 5LAXB 2R69L 4PA9A 3QQ4B 1DJZA 1GYAA 2DJ4A 2BP8A 3SJVD 1EFRG 3AG4B 3OKMA 4U1KA 4JM2F 3F7KA 5CUSL 5T3ZE 2VO5A 5IR1A 1CYWA 1I7RA 3A6BL 2YC1B 1M5IA 3EGXB 4PTTB 5DVLA 5EIIA 4FQ1H 4WKZB 2NR5A 5TK2A 2WUCL 1NBZB 3OFNG 5ICYB 1VJSA 1T5KA 3C6SB 4KUCD 4F1ZA 4EN3D 3SDAD 3DECA 4NSKB 5F44A 1HE8A 4HEMA 2LHAA 1M2VA 2JSFA 2QJ1A 2YEZB 1SEQH 4FK5C 4RMTA 1C7SA 3LAFA 3RL1B 4B97A 3G5XA 3ESPA 2WZ0A 2CXGA 4NO0B 1U92B 3DX4A 1VESA 4ZMOA 3ULUH 1NS1A 3FQRA 2Q76B 5IHUH 3NUKA 4HEPG 3K4ZA 1FZKB 3L9RA 2VGLM 4Q2ZA 5I1IH 2CG9X 1AP6A 3VG0L 3WG7B 1DEEB 4QTHB 3AWEA 3X2QC 3OJVC 2V2WA 4DKEH 2XCMC 5KHGA 3CUPA 2OW6A 2HJLB 3B9DA 4LEEA 2BNQB 4OFKA 4C55A 4B7LA 2GQHA 4IU3B 5ACZB 4NM4H 2GEQA 3FCSB 1U3HA 3CRQA 4TVPH 4K8RL 2IM9A 3N0PB 1QLEB 1FZJB 4IBQA 2D8KA 1YTFD 4MXQC 4XO9A 5CINH 1WS7A 5HDOA 1M93A 3NRFA 5EC2C 4U1IB 1ECYA 4XCYB 3LPGA 3NN8A 3QUZC 4YBQD 3VFRA 3WCYA 4GLRH 4XXDB 5TQ0H 2C1PB 2HFTA 1FZJA 5H37H 1IGTB 1MCPH 1OCCC 1JOYA 3CFJB 1B0WA 3PNRB 4DR2B 4ZOLB 2JCCF 3EYVA 4G5ZL 4HPHA 3IAQA 2A7WA 1K5SA 4XWOC 2N1TE 2WXIA 1KFGA 2OZ4L 1PZ2A 4J7RA 1NIFA 1DEDA 4O4HA 5AG9A 3P9LA 4N2HA 3C5ZB 2Y0SA 1RP9A 3D2TA 1BXXA 3L3KB 3RU8H 1OV8A 3QVAA 5BOZG 4FMTA 3NABH 4OFVA 1IX9A 2BFVH 5IHZB 4M7KH 3AK2A 2CO3A 3DXAB 4F58L 5GJTL 4JASA 3SE4A 4A2DA 3QF7A 4PBVC 3MLRL 2XN0A 3P32A 3MRRB 2MCMA 3V0IA 2X9XA 2YAOA 3LDBB 5GZNA 1MIEH 2C3GA 5J2TA 4DR4O 2E7CA 5I6KA 2NY4C 3B2UD 1A14L 1MJ7L 1N33B 4H1LB 4JPKH 4XN7A 3NACH 2F53E 4JFXA 3RY5A 2EO1A 1TZIA 2FWOB 3MROB 4RUEA 3OKKB 2OMYA 3QZLA 3U4EB 4WBNB 4YLQT 3ZMRA 1YEEH 1HXKA 2J6EA 3B9EA 3R1GL 3ZE1E 1RZ8B 1NDGA 2QT6A 3HB3B 1A7NH 2R9HC 2K9PA 1EXUA 3FTYA 4JQXC 4UWQB 1SQQH 5FCSH 1SQBH 3CC4V 4I0XA 1B2YA 1AAJA 3RZCB 3T6XA 4B3TO 4AVIA 1JNJA 2DQFA 2G75A 1MH5A 5BZWB 2CIIA 2XT9A 1FG9C 4K2UL 5EZLA 3TCUA 4XXCC 4QJFB 1UFGA 3ETBF 1JPSH 5LBSH 3RZCA 4UOQA 4R7NB 3D12B 4JO3L 4HCRA 3DX3A 4LF4B 2OX5A 3GZOA 4JRWA 1LMIA 2IDUA 4XTRC 2WAMA 5I30H 3LZQA 3TC9A 2BP3A 2XG5B 4QDGA 4IRSA 3U46B 1LE9A 5EBWA 4HJ0C 4KQ3H 4B9YA 5EEXA 5BNXD 4ORZC 4GH7B 3V5KB 5FGSA 3GJFK 4A67A 4B50A 4WFFE 3SY6A 3SE8L 1QO3B 2PXYA 1E8YA 1UB5B 4GSRA 1UH2A 5EB9A 2HT4C 3MV8B 4FQLH 4GMSH 1HDMA 3CJHA 3ECVA 3DXAD 1QBLL 4U2YA 3ULAB 4RFOL 1DO5A 1MLBB 1SLVA 1ZT7A 3ILEA 2B4CL 4Q0XH 4AGNA 5B7MA 3WB2A 2EUXA 5J5EA 5I8CB 3K8MA 5KYNA 2R56H 1OVZA 3TXSA 3GMNB 1HIML 4G2AA 5FA4B 3ROOB 4HDIA 3CK0H 1DL7H 1AQDA 3JVFC 5INDA 1SXAA 3GRWA 3TBBA 4LKXA 4OF7A 3OR6A 4HULB 1YQVH 2BVTA 2H6OA 4HWBA 2VXQH 3VMPA 1PV0A 2ZUVA 3MBXH 4Y9FA 2NZ9C 5DZVA 4KUMA 1CTMA 1VZHA 2WBXA 2XPYA 4FJ6A 4Z1PA 2DQTL 4OCWH 4L8BA 1QUPA 4K94H 4XNXL 4UNTA 5DUPL 5FUCC 2VM9A 5TDPA 4CW1B 3UJJL 3ZMZA 1J11A 1DN0B 4M61A 3NTCH 4TF4A 4AHCA 2AK1H 4UT9L 2Z4TA 4GQ9L 4J2QA 3S88L 4LCWD 1H5BB 2MH4A 4J1UB 3BH8A 2W9EH 4W4LA 2YRBA 1P1ZB 3WTUA 2VDQL 4CUCA 5DQ9A 5JQGA 4QPKA 4DKDC 5KMGB 4W1TA 5FW6A 5C0AB 3ARFD 3NCYS 5C9JB 1S9XA 1K5WA 4PWGA 5EU3B 1N18A 4HS3A 2BWQA 5KMGA 2K8QA 4D9RD 4H0IA 3HMWH 2FL5A 1WLEA 1C1EL 1LEKA 2IOOA 2GTSA 2Q8AH 2JK5B 1ZRUA 3UYPA 3G04A 3QFJA 3U7YH 1OAYL 4KKBC 4EB6A 2QTSA 3TURA 5D2NA 2CR3A 4JKNA 1F4WL 3OAUL 5M94B 4MMYB 3QFJB 5DWPA 4HWBH 3T0XA 1NGZA 4BZ1H 4EDXB 3EOBA 5I1EH 3JSSA 3MX0A 5JNYA 4M4RA 3JYCA 3WFCH 4XMXA 1NCHA 2FLBT 3T1FA 5C8YA 3GSUB 1KT2B 4GRWB 3OPZH 3W9EB 3MCKB 4O2EB 4HUUA 3D6GA 1SYVB 5E7FA 1F13A 2QQQA 1N59A 1PZ5B 1U8CA 3RVZA 1QKZL 1XCTA 4Y8DC 3HVDA 4I5BA 8FABA 1YNTF 5EOQL 1VQKV 2VDRL 1KN4L 4JANB 2B3IA 2F54D 5I6OA 4BGLA 2X87A 1VHPA 3RBSA 3H2QA 5I74B 2ZQMA 1N12A 4XMPL 1JIBA 5DHYB 3HKZA 4ZYKB 4JQIA 1CFMA 1FDLL 1UZGA 2PLTA 2P80D 3KYOB 2KKWA 3MHSC 2BSTB 4PS4H 2ENSA 1DQJB 3HS0B 3TIDA 3Q1EA 2PABA 3Q44A 1A25A 4LOVA 5B7EA 1LEIB 2PTMA 1KFAH 3RIAF 4BK8A 4FLVA 1QSFD 5D1XB 2EXYD 4P5TD 4XNYH 5EH1A 2CO7A 1ZANH 3UTSA 4KO9A 5J6HA 3HS0A 3TIDB 1YNLL 4BK4A 5I17A 2WLNA 2IADB 1S9YA 4UOZA 4IU2B 2UZYA 3W2DH 4PY8J 1MNUL 3NJHA 2NY5H 3IU4L 5E1AB 3Q4HA 1AI5A 5EOTB 3IDMB 1F4NA 4PR5A 4OLWL 5T5FL 4UILH 3QC5X 1BIHA 1U42A 2UXNA 1X5ZA 3IDNA 3MV7A 2ESVA 4NN7C 4MNQD 4OSUH 4PU2A 4J6RH 4KTDL 3UTPD 1QA9B 2FATH 1LMKA 4F9PC 5CCJA 4GINA 3CZFB 4DZBB 3E22A 3NZHH 1A9BB 2HZHA 4UU9B 4ZXBB 1GOGA 4YOKA 2VLMD 4PA4A 1IBBA 3D8MA 2O57A 4MA7H 3GSRA 3ZOAA 1U3YA 4X62O 4IGBD 4CS4A 4NXNO 1A9BA 1UM4H 1XGTA 1N26A 5BZDB 1DVFD 1QFWI 1CXHA 2DMXA 2X4UB 3UTZB 4Y2LA 2DWDC 2IWEA 3DX7B 4DSYA 3ARVA 3K8LA 3ZBMA 3QRLA 2HVBA 5DCCA 3FFDB 3R4RA 4MSWC 3RB5A 4XWOD 3K57A 2HJDA 5CEZH 3QR0A 3O45B 3RN4A 5IT9N 1DVFC 3BD5A 5IHWA 5JW4M 3O9WD 4N8CH 3N44F 4G8FB 3CFMA 2F53A 5JIQA 3QE5A 4PP1C 3CHQA 1D9KD 4U3JA 4ZG1A 2WJ7A 3C09B 3D06A 1RKRA 1SF5A 4GW5A 4OKVA 1UC6A 5L4FA 2IW5A 1YDPA 2DQ6A 2EDBA 3EF4A 3D7PA 4N0CC 3UYRL 2AQ1A 3LNFA 4FFYA 1QRND 3CN1A 3VBBA 2H1PH 2Y1AA 3K72A 4LU5L 2NY6D 5LQBH 4S2SA 4JPIB 3S3JA 1VFAA 1CTNA 1IEAA 4NUJA 1SDAB 1PNMA 1X9UA 4LF5B 4CN1A 5CFAA 3IFOA 1BF8A 2ARJA 1FV1A 4JFHD 4V2BA 3WXWH 4F8TA 1QEXA 4OM0L 4X7TA 4ZMNA 2BSRA 2E9WA 1P2CA 1NCOA 3D9AH 4DIXA 3WOVA 1VIWA 3TJPA 2EE2A 2XQBL 2X1XR 5I5JA 3CP1A 1R5IA 2YEQA 2C9XA 1P4IH 4WFED 2BSRB 3DC5A 1KGWA 1H2SB 1P2CB 3U4AA 4BFBD 1MXGA 5E4EC 3NRQA 3EJYD 4L3EE 2OW7A 4KXRA 1EIBA 2R0KL 2P5EE 4MB3A 3WNMA 3M86A 3QXWA 2QVIA 3TPKA 1NPJA 1I3GH 1JTOA 4F9LA 1NIAA 5EU4B 2CHNA 2OIGA 4NIKB 3B8NA 1RERA 3HE6B 4IBZA 5FAAA 1OTTC 1YEEL 3KWXA 3R1GH 4QHPA 1WISA 2Q5BA 5IM7A 1C9SA 3QNYB 2XFXA 1EERB 4KQ4H 3EW3B 5EUOA 2AHZA 1I1FA 1D6VH 1UWEH 3KCPB 4N3UA 4IGBB 4B0MM 4OGQB 2VC2H 4X80H 5IESL 4G1MB 1LNQA 1EAPB 4JVUA 4NN5B 4WJ5A 1EJ8A 3A6CL 4PJXE 5IYDO 5HVWA 3V9CA 4MNGA 4IGBA 3BVDB 5AEAA 1HHGA 4KFZC 1SJVA 2X4PA 3U9PH 4J10A 2W6IG 3CCJV 3DYPA 1GXEA 3N41F 3D52A 2LFEA 3QEQA 4OIFA 1XF2B 2E8YA 1T4KB 1JFQH 5CEYA 2YXMA 1DVUA 1NKRA 4KGJA 4XC1L 5E8PB 3CX5K 2Q7AA 5CWSA 2XY1A 1PFCA 3ULVD 4MKTA 4KZEL 3QUMA 4GUPA 1A7QH 1HT6A 4XMKL 3WELA 4FM2A 1FAKT 2VM4A 3ZUCA 4ESKA 2D0FA 5TQ0L 3FD9A 3CD4A 4QRUB 3KM1A 2CDGA 2ZE0A 1QU7A 3KG2A 2XJKA 2HUHA 2YRPA 4FTVD 4G5ZH 4IJ3C 7TAAA 3GMRB 5IJKC 1H2NA 4JHAH 1TPXC 4R7NA 1BF5A 4R26L 2DI8A 2OJZH 1ZWIA 3TYGL 2DWTA 5ACMA 4HFWB 1BLNA 1SN0A 1SBBA 4QAWA 1C5BL 1GH7A 2FDBP 3RPIB 1Q9WA 1G9NH 4DPCX 5JHBA 2EEBA 4ZHQB 2YICA 1OZUA 3ABLB 2AJ3A 1KPRA 2WPGA 2ATAA 3RY6A 5IFJA 4KK5D 1KEGL 1JPTH 4WFHA 3ZDZF 1FPTL 4HF5H 4OIBA 1OE2A 3BUIA 1HE7A 4IYIA 4WTWA 5EYPA 1K6QH 4PBXA 1TTAA 4UXNA 3EJTA 3TBWA 4PGJA 2ZP8A 2YGVA 2W92A 5IFJB 2G3ZA 2JIXB 4BSVA 3BO8A 4AYFB 2VDKB 4G70B 4ZFOA 4BKSC 3LYRA 5AVRB 5AW5B 5KW9H 1DTOA 2GFBB 3QDJE 3PF2A 4XOBA 5FYKE 3D09A 2Q6WB 5GS1B 1IURA 2FQEA 2YEVB 2FBRA 2XWZA 2Z7ZA 2BZCA 5B1BB 5B1OA 1QEWB 4UDUB 2JJSC 2JKSA 5FM5O 3V5DB 1AH1A 3RWIB 4GSQA 4A37A 1V7ML 4X5WA 4WW1A 1XH0A 4F8NA 3KPPB 5T5FA 1DANT 4I87A 3MV9D 1J05A 2ZJSH 2NDFA 4UDUA 3RTQA 2DWEC 2J20A 3I2CL 2XN9D 4TS6A 5DJYB 5T3XH 4PJGF 5CZRA 4Z7NB 5KBDA 2AMGA 1AKJA 3N9GH 4PWEA 1Y76B 4FZ8L 4M61B 4PGBA 2CBQA 3U7YL 1S0VA 4DKTA 4NQCD 4QCIA 3D18A 3GUTA 5J1AA 4QXTA 1QR4A 1EUUA 4X65O 1AB3A 5ABDE 3VXRE 4PGBB 2YAQA 4P5KA 3ZZQA 3B6SA 5HI5C 4M6MH 1GMIA 1IFRA 2WVVB 3HG2A 1KTDB 2QKIC 3B56A 1PAZA 2QL1A 4GS7C 1PNKA 3ETBJ 3NJNA 1J5HA 2VR5A 5HYIA 4KBPA 2LW1A 1LJMA 3QUYD 5I0VA 5DD3L 2Z31B 1A6AB 4MZ3A 5LL6Y 4I18C 4XC3L 1BFTA 4YFLI 5FHAH 3ZHUA 3LRLA 1KZYA 4XVJL 1OLZA 3LH9A 3Q01A 3ESVF 1MIMH 2GG1A 4OZFH 1NLDH 3GI8L 1YPZA 4JGUA 5TF1L 4EXKA 1DE4B 3H9HB 2X6AA 4ABUA 4FQHA 2ITCC 2FEDC 1MG2C 2B1IA 1TU2A 3B3BA 1D2OA 3MRFB 1CS6A 4TV8B 5DO2C 2EYRA 2HSIA 2BWIA 3LEVL 1MCOL 3ARYA 3QDJA 2V8LA 4QOKE 3O3AB 1KIRA 1IGML 3ARGD 4JRYE 5E6ID 1KB9F 3UBXI 2GJ6D 4P5TA 2C5DC 2F54A 4I5BB 4N24A 2ZKWA 1TMQA 1TVKA 3P2TA 2FD6L 4O2CB 4PJIB 4Y1AD 4WFEE 4UV7H 4RISH 5FNVA 3CK0L 4R97C 4HZ3A 5IY5C 2G0KA 4DOHE 3ARGC 4L29A 4ZPTA 1VP7A 1OF2B 3M8OL 3QQ9D 4HWNA 1FO0L 5D2NC 5CBAB 1FJGB 5CZVH 3ARXA 1RK1A 1GYUA 1WCQA 3KXFA 1YA5A 3RFZA 4OV5B 2W0KA 4W4NA 3BVOA 1MCEA 4LLUB 1GTNA 1HNFA 2XKNA 4QHUA 1WV7T 4PJ9A 4HUNB 4PG9A 3M1BA 1VFMA 1X5KA 5L8LB 4YPJA 1K97A 1YNTB 5DF0A 1WT5A 3PHOB 3TGUH 4A7QA 3I02A 5KN5A 1MUJA 5IOPB 5K39B 1F4WH 5CEZL 3JASB 5E8EA 5JXEA 5C7ZA 4NZRH 4DH2A 2XBTA 1AO7E 4WO4C 2OJ1A 4OGAD 3S3SA 3RX9A 3WAJA 1WFOA 1IMHC 2UYLA 3H1JH 3E2HB 4K3GA 4JY4A 4LF3A 1TTGA 5KSUB 3U7WH 1USQA 1NZ6A 3IBEA 3AB0C 4UU9A 3DJ9A 2X28A 1JGUL 3MRIA 4YNYB 4C83B 4MMXC 3LN4B 2D7NA 2GSGB 2Y06L 3NA9H 4KOCA 3AQDA 4MXQD 3HMXL 3PWJA 1XHXA 4O4IA 4JLRA 1MRFH 3O4LD 3N40F 4WHTA 1NCDL 3D9AL 4CC1A 3Q7JA 1X6LA 5FO2A 1WZLA 4FG0A 4WI0A 4YPGA 1L9NA 5J3HC 4KX9A 5I66B 1FZOB 3CH1B 5D1XC 4EFEA 3KPMA 5IBUG 3AG2B 1VMGA 4ONHB 1XR8B 2LQTA 4N90D 5HYSA 3MYJA 5LWYH 2XETA 4APQD 5LA6B 2X89A 3MGAA 5GRJL 3CVCA 1AMYA 1GGUA 4W9DC 1P6FA 2X2HA 3BWUC 2HEPA 4CA4A 1JWMA 2J71A 1U96A 1AZRA 1IGYB 4DV4B 3M88A 3ZS8C 1HNZB 3D07A 3Q8CA 4P46C 4UQ3A 3V4PH 1HHHB 4B3EA 4MJ2A 1KCSH 1M1XA 5B38B 4KXBA 1KIUB 4DRXB 3RG1C 5GGTH 2HG5B 3BZ4B 3VXPB 2VC2L 4URKA 3ZT7A 4P57B 2MCPH 3SDCA 4TM9A 2L04A 2W95A 4R7LA 4XNYL 3PWLA 5DMIH 3TV3L 2Y7LA 2EX3A 1ZHLA 1W2BU 3CVHB 4G8EA 3ZT6A 2QQLL 3BEHA 3DPDA 5IB3A 2AK4A 3BZ4A 3FRPA 4WEBH 2NUTB 3TJEH 3GTVA 1CDJA 3WS6A 4DEWA 2EIZA 1XL6A 3U1SH 1FG2A 5GGRY 5ESQA 1CLYH 5ENWA 4I88A 4XODA 2JQMA 3UX9B 3ZTJG 3C6LC 1MH5B 5BZWA 4NXSA 1G9ML 2QWQB 5HHOB 4GJTB 5LHGA 2CJSA 3FTGA 4X6DB 5FO9A 3OVUB 5ESQB 5GQBA 1LTXA 2UXBB 3GINA 2FX9L 5ENWB 5EG6C 4OZIB 1IAIM 3P9MB 1JZ5A 3MGOB 1A6VH 4KMTL 3L7EB 3C5JA 1VKXA 2BP0A 2BY3A 2G4EA 2X4RB 4F5CE 3CLEL 1S7UA 4U6YB 3SCMA 1F23A 4HU2A 3U7AA 1NC4B 4PJHE 5C6TL 1H19A 4IRSB 4OY9A 1TTRA 4U1HB 5EU7C 2QQKL 5BO1L 3U46A 5MENA 4NJAH 4MNGB 2G9HB 5L2JB 4JUSA 2AAVA 1TR7A 4P5RA 5BV7B 5EFIA 3IMWA 5AVTB 3G80A 4Z7WB 2X5PA 4K9EL 1T0NA 2CGRH 4JO5A 2Z7UA 4DZ8A 4G8IB 1RK0A 5IQOA 3ESNA 1OM3L 2VRQA 4KZ0A 4F7TB 3GXTA 3LNHA 2VZSA 4WRLA 4YK4C 3DHJA 5CEZD 1MCBA 3LSQA 1L9QA 1TLKA 2N3JA 4LNUB 4GCZA 1WZAA 2ENQA 3WEAA 1F1GA 4LEXH 2ED8A 2WA4A 3UTOA 4I2XB 1SBSH 4JFYA 3WHXA 1J5CA 3IDYB 2DYRC 1A6ZB 1BAFL 1KENL 4ZOBA 1B4RA 4EIBA 3BPZA 3R19A 3OR6B 3K08A 1KUQA 1IXMA 4NVPA 2DM4A 3N1GC 2CH7A 3VAEA 3WD5L 2IGFL 2XPGA 4MJJA 4F15C 3N3EA 4RUFA 3EYOA 3NDYE 4LAJH 4AJWA 1OGTB 1T0OA 1WTLA 3CYOA 4JRXB 1S5LZ 5EZYA 4NX0A 3UO3A 2CRZA 1XGRA 5C09E 4AVJA 4EIUA 4HXBH 3CCLV 2QZ5A 3ZE0F 4DN3H 3NFPB 1A65A 3JAKB 4R4BA 3DO4A 2P4VA 4MVZA 4X6DF 4JDVA 2QKIB 4O02A 4JGSA 3WEXA 3VA2C 3OE7G 4ANWA 5JOPD 4P23C 4XN1A 2EZPA 3SE3C 4CVZB 4ZS7H 2BOLA 2NX5B 1BGXL 4AMWA 4LVHB 3ZHKA 2DN7A 4TNVF 3TK1A 4NQDB 4P9OA 2WQVA 3DUUB 2LAAA 4WWKC 2YUAA 3LKOA 2K4AA 4XZUB 3FJTA 2ZWSA 3CFBA 3OAZH 4Z7UF 1IEBA 4B7IA 3AS3A 1HSBA 3EOTH 3CXFA 4N8VG 1EBOA 1ZHNA 2CRYA 4Z9KB 1RFDH 2XV6B 4MA8L 4MA3B 4AC4A 5KANI 5CF3A 3I75B 3WN5A 4IBLT 3K6OA 4KO7A 4PRIA 4JG0L 3G08A 1IBFA 3O6FC 3ZDZB 3U9UA 5H35B 1AO7D 4JPSA 1ETB1 1O9WA 1WIPA 1BE3H 4NBZB 2LOEA 3FT3A 4R26H 1QYGH 4XX1E 4AENA 4WI3A 1ZLZA 5AKSA 2EE3A 4JFQA 4QCIB 1E5UI 2YD4A 3D18B 3SDYH 3GUTB 4Y9GA 5EPMA 1TKWB 3CHOA 4R3SA 5C0CD 1SQVH 5H35A 3T0DA 1KBGL 2APSA 4IDJL 4GT0A 1XF5A 5DFTA 4YDIL 5CU9A 1RSOB 5EFIB 4AE0A 1R47A 4JFQB 4BRJA 1FAFA 4LSUL 2Y1VA 4ZQKB 4FLOA 3SGJC 4R96A 4Y5YA 2GI0A 3MJ8A 1R46A 5FYJD 4MJ5B 1AP5A 5AD0A 4UT6L 3UC2A 4AKOA 1GO3F 3OAAG 4WJKB 2W88A 3P3UA 4F8QA 1XAUA 3MNZA 2BSCA 1TXKA 3KE0A 4QRSB 5L88L 1DLFH 3E8UH 1QATA 2VIRB 4DV0B 5FYKH 4MWFB 4F93B 4KTYA 2W5PA 3T71A 1CXLA 1AKPA 3GBML 2RR3A 4JKWA 5B1AC 1A1NA 1XMQO 1IBKO 1NMCB 1GR7A 3TT1L 1TQSA 3PP4H 4AQAB 1AXTL 1P5UA 1JXDA 5AAPA 4YQXH 4YHHO 2ZOOA 4P06A 1N33O 4MWFA 1MVFA 4BQ8A 2SEBA 3LQAL 1N3NA 2IJKA 1VEPA 2CGZA 4JYAO 4XN9A 5F93C 1DVQA 1HWWA 1M3IA 1MFEL 3NIDE 4NO3B 5I8EA 4BA0A 4UFZA 5T3XL 2X05A 3SDXF 1RPKA 3OC8A 4Z7UB 1T7VA 4HWEH 1M9WA 3IXAA 4HX1B 1O0VA 1TVBB 1IGFL 4U0RB 4IGGA 4IIJA 4NHUB 1IC5H 1JWSA 5D6CB 4NNXB 4DUVA 3BKJL 1DDTA 3F12A 3SO5A 1CJYA 3MRQB 4W9GC 1D5IL 12E8H 3E8GA 4AV5A 2B5UA 3QPQC 4CSTA 2BIPA 4BD4A 2VAAB 3G6DH 1RIUH 1KJ2A 1MFNA 4PP1D 4YXHL 1VQOV 3E86A 1BJ8A 3G5YB 3MRQA 4QTFA 4YSRA 1FFNB 2JI2A 1QWHA 1CFVL 3A0OA 5FV2A 1NAKH 1OGAD 4H13C 4OLXH 2YA0A 3J80N 5C0BA 5T1JA 5I30L 5EN2B 3I9GH 1B3JA 5LGJB 4FNLL 4GAGL 4K7PH 2HX8A 3LZLA 5DD0L 4YWGL 3VQMA 5INCA 3ASNC 4J3UA 15C8H 2WNXA 4JZOA 5DHXB 4NHCL 3RTQC 1B04A 4I4WA 5HJGA 1EEYA 5C07D 1FFRA 4X8JA 2BJML 3O8XA 4TL4A 3TEZA 1MFCH 4L1HA 1NUFA 1BVNP 1OP3K 3QUXB 3SDDA 1ONQA 2BVPA 1ZA6A 4YN3A 1G9NC 1CD0A 2GK0A 4QRFA 2Z35A 1BF2A 4KMQA 2NXZB 4JFFD 4JKPH 4J42A 5B4MD 2YXHA 1WUZA 1JYVA 1HJCA 3GHBL 3K5RA 1P6AB 5D1ZC 2AP2A 4XNMB 4N6QA 4LOFA 1HIMH 4OJDH 3L72H 3DC0A 1A22B 5JPNC 1WC7B 4OAWB 2L6LA 1N0LB 2XIBA 4AV0A 4XPFH 5DRWB 4DXWA 1RHHA 1HK6A 3E6FA 1KY7A 2DDQH 1B0GB 1YEIL 1MWAL 4U1MB 4I0PB 3NZ8A 5A16B 7PCYA 1MNNA 1CURA 4HJJL 4OAWA 1NLDL 3GI8H 2J73A 4JG9A 1HL9A 1CGUA 1ZT1B 3ALWA 1FORH 4EKJA 1G4YB 2XAQA 2QR0A 5DJ6B 3FFOA 5EHFA 4U1MA 3LRHA 3NZ8B 3C6LB 1P7QD 3BY6A 1ES0B 1G0DA 3ELAT 4P07A 3WSQL 5D1XD 4GNKB 1LO4L 2EDXA 3GIVB 3MRLB 2AJSH 4X0KA 2IAMD 4JM4L 4APQC 3FQUB 2ICEA 1A1MA 3I6LE 1X59A 3PUUA 3AGWA 2IOIA 4BZ2A 3HI1A 5KS9E 1JWMB 2P47B 2E7DA 3O3DA 4PRBB 3OHMB 2CTPA 4MTGA 2CXKA 2WWMD 3P77B 1XMOO 4W9LC 2NY0B 2NMSA 1V7NH 3PS6A 4JO8A 4KXAA 2HT2C 1FO0H 2EULA 1KXQE 2C1OB 3BMWA 3QZWB 4JFXB 3MDJA 1I1AA 4MHHI 1K8IA 2BC4A 5HHNB 1FS0G 4RESB 4MNQB 3VXPA 1YEHL 2ZM6O 2QPFA 4MJID 2P7TC 1HU8A 3FYEB 3ZHSA 2F7OA 4OJFL 4ZX5A 4KDTA 3TN0A 1K3IA 2XWEA 4FJYA 3WTVA 3T8XB 1NC2A 3ABKC 1ZV5A 2WTRA 4JI3O 4N1CA 2IQ9L 5EBMA 5HI4D 3K0GA 4GRLB 3AK3A 1NEPA 5E7BA 5BUGA 5DRXA 1GGIH 2QKSA 1PLGH 4MRBA 1QFHA 2FH6A 1Q8IA 3ATEA 3ZHNA 3BCCH 1Z5YD 3BKCL 1GJIA 2R8SH 5L4IA 3UTQB 4U1NB 3VXUE 2V9TA 3GSNL 5L0QB 1XR9B 1KTKE 2X40A 3B43A 3CIAA 2DMCA 4QT5A 5MI0C 1FXVA 3VOUA 3FW6A 3G7TA 1I85A 4PRHA 3PL6C 3SPVB 5LUMA 4ZSOA 2P7TA 3WY1A 3IK2A 5KSVA 2AKRB 4IIQA 4PRAA 1JCHA 2Y4TA 1TENA 1WCBB 2FJHA 3HZ3A 4JY5L 4QUOA 2F95B 2BCKB 4FHKA 4H88L 3SPVA 5DURD 5KVDL 1W6WA 5J2UB 3QDMD 2N01B 2RALA 4AMXA 4FLYA 1MLBA 2H41A 4PV9B 3NJFA 2LR4A 1BJMA 3S5LG 3GXDA 4DVBB 3FAWA 1V5JA 2ED7A 2Z9TA 4PW9A 2JJTA 1G7LB 4LNUA 1WPCA 3U2IA 3O3BA 5DMGD 2H3NB 2YK1L