2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
5F7BA 1JZFA 4AZUA 1AS7A 4YSSA 1L9TA 3CZUB 1W6WA 2XWZA 3S8FB 2BWDA 2GB2A 1DZ0A 5B1JA 3AZUA 4G72B 1J5CA 1OCOB 2FT8A 2IDTA 2VSKB 3NJLA 1RKRA 1AANA 2AZUA 2VW6A 1NPJA 1GS6X 2X88A 1A4AA 1AS6A 1SF5A 4HCIA 3N55A 1IC0A 2BP8B 5I6OA 4G7QB 3PAZA 1L9SA 1WA1X 1EHKB 1PZCA 2RACA 1L9OA 5B1AB 1OV8A 4JHUA 2HX7A 2Q5BA 1FA4A 1CURA 4G70B 4YL4A 2B08A 1M56B 1KDIA 3S3DB 4WKXA 4GYBA 3FYEB 3H4HA 3OD3A 2IDQA 1JVLA 1CC3A 3ABMB 2PPFA 1GSKA 2PLTA 1PMYA 3EH3B 4DP4X 1IKOP 1ASQA 1OF0A 4KOCA 1ASPA 1PNCA 4GP8B 3NT0A 4M3HA 1GY2A 1RZPA 2OV0A 5FC9A 4DP1X 2NRDA 2UXFA 2VM3A 1SDDB 3MX0B 1XB6A 2DV6A 1KCBA 5A7EA 2HXAA 2J55A 1E67A 1ZDQA 2IAAC 4Q8BA 1KBVA 2I7OA 1N70A 2GC7C 2PP7A 1OCRB 2XLLA 3IN0A 1MZYA 3X1EA 2XV3A 2YAFA 1JZEA 2FT6A 3FSZA 2R7EA 4P5RA 5I6LA 2GSMB 2BWIA 3ASNB 1JZHA 2H47C 3IEAA 2EILB 4YVUA 2YXWA 1PNDA 2I85A 1J9RA 2HRHA 4BXVA 2P80D 1DYZA 7PAZA 1RZQA 2B3IA 4K9JA 2Q9OA 1BYPA 1N68A 1ILSA 4P5SA 2BHFA 4WTQA 2Y69B 3PPSA 4YSDA 3NYKA 1NWOA 3PXLA 3TU6A 2FT7A 1A4CA 2YARA 1VLXA 2CUAA 2IWEA 1KV7A 1AG6A 1E65A 5F7AA 3QJQB 3T6ZA 2GHZA 2XV2A 4HZ1A 3ZIYA 4A2HA 1FWXA 4HHWA 1B3IA 3DTUB 1NDTA 3HB3B 1ETJA 4BXSV 2BW4A 3SBQA 2HX8A 2UX6A 9PCYA 1J9QA 3UABA 3L45A 3X1FA 1X9UA 2IDSA 3N2JA 3ZDWA 1ET8A 2JFCA 3ABKB 1WA2X 2XX0A 2IWFA 3IBOA 3ZX1A 2VM4A 4G7SB 5B7FA 1ZDSA 3H4FA 1PZBA 2UXGA 4DP7X 3QQXA 4Q89A 5PAZA 4CSPA 3CVBA 3NJKA 1A3ZA 3GXUB 2AFNA 1KGYE 2FWLB 3QJSB 2TSBA 2PP8A 3U25A 1IBZA 4CSZA 1PLBA 4KOBA 4YSEA 2A3TA 3WNJA 5AFAA 1UATA 5I6MA 1L9RA 4NB7A 1ILUA 2R7EB 2IDFA 2PPEA 2GIMA 1YLBB 1TKWA 3V9CA 3WNIA 3CG8A 1XB3A 3QJTB 2CAKA 3TBBA 2ZWNA 1OCCB 1V55B 3FPYA 1HAWA 5EHFA 4YSOA 3PLYA 2FQEA 4HHGA 4YVNA 3ZBMA 1A4BA 4BWTA 1CYWA 1BEXA 1SHXA 1I53A 1OE3A 2E86A 2GC4C 2LLNA 2UXVA 5I6KA 2YAPA 1W8EA 1MG3C 2FTAA 3WKQA 4MFHA 1JXFA 1BXUA 1JERA 3JT2A 3TA4D 1CYXA 1AQ8A 1OOWA 2N0MA 4E9WA 4UANA 1NZRA 2XUWA 3NJMA 3NP3A 4A2GA 1XMEB 4E9XA 3RYMA 2P80A 1TU2A 4ENZA 2XXGA 3NJJA 4BDVA 4TXVB 3PAVA 3CVCA 2DY2A 1OCZB 3CVDA 4A67A 2QT6A 1QNIA 1SJMA 1ZIBA 3FQ2A 2AZAA 2VMJA 1ET7A 3GYRA 4GXFA 1KYAA 3UADA 1BQRA 1WAEA 4W9ZA 3NSDA 3CDZA 4G7RB 1HFUA 2BZ7A 3WG7B 3FU8A 4YSCA 3T71A 3AG3B 1M57B 3NJFA 3WKPA 5AZUA 1OE1A 1BQKA 2CJ3A 1HAUA 3FQ1A 3AG4B 7PCYA 4AKOA 1KDJA 1BXVA 2PCYA 1NIFA 1M9WA 2W8CA 1SHWA 5TK2A 4BK5C 2HX9A 1PAZA 5TK4A 1ZPUA 1BQ5A 4HAKA 4BWWA 1GW0A 2PPDA 5B3SB 4PCYA 1BYOA 2BZCA 1X9RA 2HZHA 3NJHA 4M4RB 5D4HA 5I26A 1URIA 1AZCA 3NJGA 2YEVB 1PLAA 4AKQA 3FSVA 5B7EA 1PCSA 1NICA 4G71B 4NERA 1AZBA 1KBWA 3KW8A 5E9NA 3FQYA 1SFDA 3WIAA 5LDUA 2BP0A 1MG2C 1JXDA 6PAZA 4PAZA 1PF3A 1J9TA 2HRGA 4E9RA 1L9PA 3EH4B 2EIJB 4AX3A 5D4JA 1JVOA 4KO5A 2OCCB 3TASA 2EIKB 1NINA 1TEFA 4DP2X 3QPKA 4RH4A 3CDZB 3S3CB 6PCYA 1F56A 3FS9A 3FU9A 1GYCA 5ANHA 1SNRA 4JHVA 3ERXA 4AI7A 4HALA 3T6WA 4GY4A 1AIZA 2EINB 2DYRB 3OMNB 1WS7A 1L9QA 2PP9A 3FPXA 4ZK8A 4N4YB 3SBPA 1NIDA 3MBWB 2GI0A 2UX7A 4JKNA 4KNUA 4EF3A 4GP5B 3AW5A 1OE2A 3OMIB 1PZAA 1WS8A 4F2FA 3DKHA 3AG2B 5I6NA 2YAMA 4L0PB 4BWUA 3ASOB 2IWKA 3QJRB 3AY2A 3S3BB 3X1GA 2HLEB 2VN3A 4A2FA 4A2DA 1V54B 3FU7A 4KNTA 1FFTB 2CBPA 1MZZA 4FA7B 2CALA 3H56A 8PAZA 5I5MA 4E9VA 2QDWA 4AKPA 2WSDA 1XB8A 1AR1B 4DPCX 2QPDB 2WO2B 2IH8A 3NP4A 4YSAA 2Y1AA 5IY5B 3NSCA 3V9EA 2XVBA 2BP0B 2JKWA 2TSAA 3T6XA 4F2EA 2XV0A 2AVFA 5PCYA 1TEGA 1NTDA 4X4KA 3NSFA 3OMAB 4F7KA 5D4IA 4W1TA 2X87A 3NJIA 1KCWA 2YXVA 3FSAA 4NAJA 4YSQA 3FT0A 1CUOA 2FQFA 1ZV2A 3C75A 1SF3A 5B1JC 3T9WA 2J5WA 2EIMB 1W6LA 3PAUA 3S8GB 3SBRA 4UAHA 2PPAA 1E5YA 5B7MA 1NPNA 4FAAB 1AZNA 1BXAA 3NSYA 2IH9A 5I6PA 4E9TA 1QHQA 1GS7A 3OM3B 2ZOOA 3X2QB 1ADWA 1WA0X 1SFHA 4DP8X 1J9SA 4HIPA 1E5ZA 2FQGA 2BO0A 5B1KA 3BQVA 2FJSA 1ASOA 1RCYA 2XX1A 4YSUA 4HCFA 2IDUA 4YSRA 4KO9A 4YSTA 3OQRA 4DP5X 3FYIB 3EHBB 1AACA 3ABLB 1MDAA 4A68A 3QJVB 4A2EA 4YSPA 4UF7C 2XYBA 3DIVA 3G5WA 4KO6A 1A65A 1ET5A 2DYSB 3D12B 4DP0X 3FU7B 4N8UA 4DPBX 4QKTA 4E9YA 2YAOA 3UAAA 3PCYA 2DWTA 1A8ZA 1JZGA 2VW7A 3AG1B 3UACA 4HCGA 1AS8A 1J5DA 3TBCA 3X1NA 2J57A 5I5JA 1AG0A 2CCWA 1ZIAA 2MRYA 3BVDB 1BAWA 2J56A 3EH5B 2BW5A 1AAJA 2YAQA 3UAEA 5B1BB 1PLCA 2VSMB 3EF4A 1ID2A 4QLWA 2H5UA 2XXFA 1EZLA 2QPEB 3IN2A 3X1BA 2VW4A 4DP9X 4BDVB 1AZRA 1GS8A 2I7SA 2YQBA 2QDVA 3WI9A 2BP8A 3ABGA 1R1CA 2JXMA 3T6VA 2WO3B 3HEIB 3QJUB 4A66A 1NIAA 2OJ1A 3JTBA 1AZUA 3KW7A 2DWSA 1E30A 1JZJA 1IUZA 3SQRA 1GY1A 3IE9A 1V10A 2ZXWB 4KO7A 2UXTA 4KNSA 1QLEB 2ZONA 2W88A 2PCFA 4E9SA 2MTAA 1IBYA 5I5IA 5AKRA 4DP6X 2GBAA 1NIBA 1T5KA 1NWPA 2XU9A 3NJNA 4E9QA 3GDCA 3FSWA 1AOZA 2YAHA 3UGEA 2YAEA 1PY0A 2FNWA 5I28A 1JXGA 1NIEA 1SDDA 1GR7A 2FQDA 2AANA 1JZIA 1JOIA 2PPCA 4GP4B 2H3XC 4DPAX
chains in the Genus database with same CATH superfamily
2CR3A 4ISVB 1PIGA 3MCLH 2X4QA 2VR6A 5SWZD 4PGJA 3C08H 3WDIA 1KPRB 3Q13A 3UAFA 4G5ZL 4G6JH 1UCTA 2OW7A 4MJ6A 2FJGA 4AEEA 3AZUA 1OAUH 4Z5RA 1SRYA 1J5OH 3EGSA 1ETB1 1T7XA 2Q20A 5KJ4A 3N27A 3TBTB 3DX4A 4PGCB 5I82A 4PJ9B 4QY8A 1AGDA 1RM1C 1AD9A 1QWUA 2OSLB 4Y88A 1FNEA 2GUZA 2K3HA 2EVFA 3QZOA 2L7QA 3EXJA 3ARSA 1R3LA 5E9DB 1I4FA 4Y16D 3HBZA 3OC5A 4TQPA 4JI5O 2OTWB 3QQ3B 1BLNA 2VDKH 3PAZA 4ODHL 4K3GA 1A7BA 4JHUA 2ENYA 3MZGB 3MV9E 1CURA 3UO1H 3CN3A 4BK5A 2IH1B 2X1PA 3DXAD 5E2WL 1EDHA 2P24A 4X6FB 1WB8A 4AM0A 4HZLA 5IGXH 5DO2D 4PRDA 2X40A 2E27H 4MJ5B 3MRRB 1URZA 2GW5A 2ZF9A 4D9QD 4KHPB 1HH6A 4NR1A 1ZCRA 4YUEH 1AJ7L 2C4FU 2FNBA 3CZFB 3D4CA 4H44C 2NY4D 1IGYA 3OF6D 4R5TA 4YDZA 2WQ8A 5C0CA 1OVZA 4MA3A 4UI2A 3RX5A 1INDL 4I5BA 5L7XL 4FZ8H 4QOKE 4LSUL 4QYOB 4AIZA 4NKDB 3JSNA 2F7OA 2KQNA 3MOAH 5K9QI 1MWOA 4XNMB 4ZOLA 1TVHB 2L4OA 4U4IA 2NDGA 1HXMB 3CCHB 1NTKH 5B38G 1TNNA 1LK2A 2XWEA 3IU3A 3I5DA 1AIFB 3KLAB 4PJCF 4PREB 3WNOA 2PETA 1NL0H 4Y9BA 1A7NH 4KK9C 3MREB 1F23A 1U42A 3CQFA 2NY0B 4YC2B 1MI5D 3CVIH 4EXKA 2Y7MA 3KM2A 2XLLA 3N1QC 3PQYE 3QA3A 1O9GA 2ZKYA 3S9DB 4CADA 1MCSA 4MKTA 3QO1A 3VD0A 5ERWA 2FO1A 2NLJA 3V0EA 4BA0A 3FH7A 1FRGL 3R06B 2DD8H 3CFDA 4N87A 3ZDXF 5TH2B 4LMQI 3OVUB 3IEAA 3PHQB 4UFZA 1NTMH 3RWHA 2VDQL 4UMSA 2Q8BL 3VYOA 4DO6A 3ULUE 3ZIAG 3A5VA 1MOFA 1A8JH 2P80D 4KK6C 1CWVA 5K39B 5KOVC 1OAZH 5CUSH 5GJTL 1CG9B 2B3IA 2W65A 3EBGA 3U1SH 1TJHH 1ILSA 4LKCB 4HU8A 1HC1A 1DFXA 3I84A 3MBXH 2KERA 1EAJA 5DJ2B 2A4ZA 3H2PA 4JFTA 2FD6H 3V4VA 2HHHO 4CMMB 3RVZA 1AC0A 4LGPB 1FJ1B 1TCRB 2RNBA 5GGRB 5C86A 5MEQA 1B3IA 3VXPA 3OTOO 2X38A 1I7UA 3QG7H 1RULL 1FL5B 3R7QA 4M5YH 5K33A 5D1ZI 3UABA 5KSBA 1EZVH 3QEGH 5CGTA 5GS0D 5DZNA 4HJEA 1IL1B 3MVSA 1KULA 5A6LA 5E4AA 2R0WL 4UVBA 4ACPA 1SEBB 2EUZA 3ULUH 4HKBA 2EDFA 1CVSC 4NO0D 3ZX1A 1F0LA 1ZXQA 4JL2A 2VZOA 2UXGA 3OHXC 4RGMC 4Q89A 4BK8A 1EO7A 1OCOC 2F1MA 3UBXA 2DW4A 1E2VA 4OKVB 3SO3B 3D0LA 2AFNA 5TDPA 4U0QB 1IKFH 2ITCA 1MHPL 2K4AA 3DHJA 5LBSL 1A4KA 1CD0A 2E76C 5MHSE 2BRRL 3PGCA 2VXQH 1I8LC 2FZ3B 3KYKH 4N90D 1L7IL 2ZWYA 3GSUB 4XC1H 4GKLA 4N0UB 4Z7QE 1BZOA 3R1GH 1C1EL 4G8AC 4C83B 2EAEA 1MABG 3ZN0A 1EIBA 1TKWA 2V7NA 3JZ7A 1RZGA 3HI1B 3LKRA 1UURA 3D6GA 5C07E 4HJSA 3S4SG 1I8KA 2YUWA 5D71L 2O5NA 5LNDA 1IAOA 3B2UD 2PO6B 4C57C 4YJ3A 1CQKA 4F7EB 1A4BA 1AQDB 1B0GA 2IPUK 2R9HC 1CYWA 2I26N 3Q8AA 4HT1H 4Y1AD 1A7QH 3QHTC 2HPTA 2X4RB 1O6VA 1CN4A 3ZPDA 1K72A 4PJAE 1FBIL 5MI0B 3GB7B 3NESA 4MFHA 2WLZA 2F4VO 5F0JB 1BZ7A 2Y48A 1DTUA 1KNOA 1R6VA 2L7JA 4B9KC 2AITA 2V17H 3U0TB 1AYRA 2HFFA 4N8CL 4XCYA 2WOYA 2I07B 4DR1B 3KHOA 3QZBA 4AVJA 3FKUS 3VQMA 1CMOA 3L5JA 1RZJC 4QXUL 4TLUA 1N64L 3N50A 2QBWA 3WEMA 3L08A 4A2GA 4FFYH 4E5XA 1GYAA 1DBJL 1S7UB 2IAND 3O3UN 4JLRA 5E8DH 1A6WL 4BDVA 4I4WB 4WHTA 3RNQA 3PAVA 3IFLH 4UZGA 1Q0XL 1K6QL 5K93A 3KLKA 4JDEB 2D7QA 3E8FA 4KX9A 4BSJA 3JTSB 5FGRA 1JA8A 1OGPA 1VQNV 2CHDA 1RZ8B 3FFDB 4M29A 1YPZA 1Z5WA 1WJZA 4A55A 1HFUA 3DA0A 3KYMA 2PZSA 3N04A 2DMKA 3NJFA 1Q6UA 2WVTA 4P2RD 4F37K 5IWAO 1L0LH 1WP8A 1IAIM 1KDJA 2FE0A 2QQQA 3BVOA 5AVWB 1ZHNA 4DK3A 2Y24A 1KIQA 4Y19B 4UINH 5F97E 1NH2B 5TK2A 1ZGLA 5I1GL 3TESA 1D5ZB 3QG6B 4JPSA 5EDXA 1FVEB 1KEMH 4HAKA 1D6VL 3IXTB 4LFCO 5IB4A 1RPOA 5A3IC 2GV9A 1G9MC 3BP6A 3QR1A 4MAZA 4NO3B 5F6IB 2OTPA 2QSCH 4ZOAA 2BSDA 1K4DA 3HAEB 3HB3C 1DBMH 4H20H 4KK9D 5SX5H 1Z2GA 4P5MA 3CFJB 1J87A 5D1QE 5IJ9B 3OB8A 2V9RA 4YK4B 4MVZA 1IGFH 1FPTL 2J2ZA 4ZRGA 1ND0A 1OGSA 2R0ZL 4L48A 1IARB 3AQYA 4KWUA 4OTXL 3HOGA 5EIIB 5J4MA 3LIZH 4KQ4L 3QJOA 2OMUA 4EB6A 3RZCA 2A7WA 2O5YH 3Q9QA 1NKGA 1XTLA 1PZ2A 4H5SB 4LF7B 1OZ0A 2OJZH 1RIHL 3RYCA 4J2QA 1YAIA 2I25N 5D7IF 1QO3B 4HWBL 3ARFB 2CUGA 1TU2B 4CC5A 3HNSL 4UOQA 2XKNB 1YC7A 5EUOF 3TCUA 1TTUA 4KK6D 3MRNA 4NDMB 3QUML 1FNSH 2JIXD 1WHOA 4KO5A 4XO4A 3KZIZ 1VADB 2ESVD 2JMRA 1BAFH 5HYEA 4AV0A 4ORGA 4XCEB 2BCKA 3INUH 3SJCC 5C0GB 4XXWC 5HY9A 4PRIB 3GHBL 1KXTB 1N2RA 3FO9A 3N0PB 4LVNB 3VGEA 1DQLL 3G4SV 4URTB 4M7KH 4JHVA 1ZLSH 2ZNWA 3DPBB 4ZO7A 1DBAL 4U2ZA 4LPVA 1WS7A 3OMNB 1R46A 2UY7B 5SX5K 3VD7A 1N10A 4D3CL 2OMWA 5JO5A 3LHPH 1FFOB 3BD5A 1EO8H 3FPXA 1FN4B 2IWGA 2VAAA 4Y4HC 1NIDA 4JG5A 5LGUA 3WD5H 3MBWB 3DTDA 4ERSL 1UXMA 1H3PL 1MFCL 5EU7E 1E4WH 1JCVA 1HEHC 4GP5B 3AW5A 4QHNB 1MG1A 3ZMEA 3C8KB 1WWAX 3LEXA 2CHWA 4F24A 1WS8A 3RIAK 2HFEC 4DVBA 1DUZA 4Z18A 4UDUB 3IDYC 4NNYB 3SDDA 4EN3A 1NGYA 2ZZUT 2C3VA 4MNGB 2HJFA 1XCQB 4OZIE 3KPRB 4IRSB 1IGJB 4U1JA 2FIKB 1M1SA 3BGFB 2KC0A 3WIIL 4DGIL 2QDWA 3GS7A 2B15A 3NABL 3RTLA 5I15L 4HKXB 2H1XA 4X8JB 3TNMA 2Y1AA 4YSAA 5C09E 1S9XB 4FLXA 3QNZA 1J05B 3G6DL 3KGSA 3ZHDA 4GKOA 5GRJH 3GLZA 2BJMH 3PP4H 2AVFA 3LD8C 3M7FB 2LLLA 2WBXA 3QS2A 3OKLA 5D6CA 5FA4A 3TF7C 5IIEA 4GAJL 4JO3L 2R9HD 3LQZA 4N2MA 2ZPKL 1U2YA 4LVOC 1H2GA 2XTJC 4DEPB 2AC0A 3LDEA 5BV7B 3V5DA 3ELQA 1EFXB 2FQFA 2BH0A 3ESOA 3QDHA 1U2HA 4FTVD 2QVTA 4XBGA 5AOMA 5EUKA 2HG5A 3RA7H 3TZVA 2FTKA 3F6IA 4I3GA 2EIMB 4NQDB 2X4SB 3LH8A 1U4FA 3QF7A 2CAZC 1AZNA 1KPVA 3NAAL 1H3TA 3VI3B 3QZWA 1SY6H 3PL6C 5LGJB 4XVOA 3VACA 3GMNA 4N2IA 3WB2A 3IJEA 4K07A 2EUWA 1YEEL 3WGVB 3JYCA 4RO2A 2AXGA 4HUKB 4TF4A 4AXWA 1TMQA 4IU2A 2GUOB 1ZE3H 3QJZA 2OX5B 2AP2A 3OXSA 1FYJA 4OQTH 5SWSD 1Q9OB 4H0LB 1X5LA 2VKXA 4I9WD 4P4KC 3CD4A 1AGBA 2XA3A 1IRAY 2K3TA 4X6CB 3QXDB 4U7NA 2BXZA 3ML9A 5AYTA 2AK4D 4ZPVA 5E79Z 3E2HB 3NCMA 1NMAL 4EDXA 5L2KE 1RJZB 2F61A 3RU8L 5IFHL 4DR2O 3P30A 2ITDC 2Q7EA 1CE6A 3D3VD 4MD4B 4PRPE 4YFEA 4XO9A 2VW7A 2EIJC 2BNUA 5HPOA 3S88L 4FLZA 2ZUSA 3DOHA 5I5JA 5I9QC 4Z77B 3OKNB 1RD6A 1DLHB 3VG0L 4HIQA 2JJ1G 2V2TA 5B1BB 4DV0O 1CGWA 3I3EA 3OUFA 2VR3A 3QAZB 4PLJC 1Q90D 5A3ID 4WUUB 3GGWB 5L3DA 3JUYA 2D31A 5L6YL 2VL5B 3T1FA 1KD1W 5FYLE 4IGGA 3THOA 2JXMA 3GBDA 4F2ME 4OGXL 2MTPA 1UJ3C 3KJ4B 1VQ5V 4M8RA 5IB2B 5ITFA 2GSGA 3H1IH 5FA3A 1G7IA 1A9VA 1CD9B 2E8ZA 2GVYA 2BOCC 4H8VA 2O30A 3AROA 5BRZA 1N0LA 4BWAA 2GI7A 1IUZA 1U3NA 2UUAO 5IT9N 2X0VA 4OZ4B 3DNKA 1AJPA 2VJ8A 4YIQB 4OJFH 3O8XC 4YLQT 3WL9A 1A66A 5CJ8A 1UCBH 2YRPA 1GZPA 3RPBA 2FX9H 2PCFA 4POYA 3VWKC 4I9QA 4XP4L 3MRPA 1DN2A 3DSNB 5KANI 5F7DA 4FXGB 3WAJA 5EF1A 1IAMA 3LZPA 2DB8A 3L3GA 5ALCL 5E8EB 4YHPA 3UGEA 2CSPA 4IL6Z 3GWOA 1BM3L 1Q72H 2C1OB 2EXTA 1KB9K 4OUUA 5GS1C 5TTRA 4LEEA 4ADIA 2ATAA 4IQHA 2DIAA 4NN7C 2G2PA 3DV6B 4IS6B 1IJ9A 1XF3A 4GP4B 4LSSL 3O45A 4Z7WE 1RJYA 3LB6D 4ZXBB 4LO9A 3IGFA 4NKIH 3A4AA 3ZO9A 5KYWB 3CZUB 2XWZA 1PLGH 4PRHD 5DJ6B 3HHSA 3MRLA 1J5CA 3N2KA 1MNGA 1I08A 1GMEA 3ESVF 1OO2A 4OD1H 5EU6D 4IGBB 4DR4O 2ZOUA 5B3NA 4X1KA 3K6SA 1OEZW 1D5NA 1EMTL 2OL3B 1L0YA 4L29A 4I50A 3D69A 3SDXA 4MWFA 1H8EG 2ADGA 3KXFE 4G7QB 1QR1A 4HJIA 2ADFL 1GM7A 4LGRB 2VQ1A 5HHPB 3I6GA 1OV8A 1L6PA 5IQ9B 1PFCA 4XN1A 4NRYA 2CM5A 3E1F1 3RNKB 1UB6A 2WWWA 1RZKH 2B08A 2WTRB 5I76B 1UB5B 4PV1B 1Y74B 4J42A 4JR9H 3ABLC 3D85B 3EUDA 1LO2H 3RL1B 5C97A 2V4DA 5I18H 1FAIL 4HBCL 2DI8A 1CCZA 2PLTA 2ZG1A 2YKKA 3BHBA 4LSDA 2XTJD 3PNWA 2CTQA 1HOCB 3MPCA 4TNVK 4R0LC 1IILE 3NIGE 3FU5A 5FC9A 2LV4A 2Z8SA 5C8YB 5DJAA 4Y9GA 2DQGH 1O9HA 4J7RA 1O6SA 2VLRE 4MA8L 3U9PH 3S34H 4AGOA 3PL6D 4B9GA 4MXQC 3SBWA 1YA5A 1X59A 2NX5D 4Q0XL 4G42A 1F2XK 3KD4A 1BZKA 3LN5A 4K7FA 1F4XL 1LLAA 1H5BB 4R8CA 1FHNA 3HZKA 3K2UH 1GTOA 2WTOA 1GAXA 3AGVA 2EYTA 1XD1A 1E1QG 3FRPA 1FVCB 2XV3A 3LQMA 4L3ED 4RA3A 5GS3A 4BSVA 2RJZA 3CRCA 1JWUB 4ZW7A 5JDJA 2ETNA 3FK3A 3P54A 5IESL 3O6FB 2QVKA 5F89A 3VTMA 4P2QE 4L8CB 1JGDB 5B1OA 3O4LA 5EA0L 3RWCA 3U9UB 3VXUB 2XYCA 4WO4A 2YC1A 3L4XA 4PJ5E 3K7UA 4M5TA 2NY1C 3B1UA 3QCUL 2HRHA 3KPTA 2XHBA 2GITA 3NRQA 4EI6B 1VFAA 4XPAL 4K9JA 3GRGA 3WJJA 2Q9OA 1BYPA 3VE0A 3FRUA 5F96H 2O61B 3H7BA 5EOQL 4EOWL 3N6YA 1D2DA 1YEKH 2DJVA 4X65O 2F58H 2IOMA 2R51A 3Q9PA 3QZWG 2A1WL 4UOW0 4ZO6A 2YIAA 1LUWA 2NW3B 1T1YA 4BQ6A 2P8PB 1E65A 2OSXA 3QJQB 2Q3AA 3U2JA 2NUPA 4J7ZA 5LN4A 4OZFH 4PLJD 5TE7H 4WDIB 2RDCA 4JV5B 5KG9B 2R4RL 43C9B 3ZE2B 4XH2A 4FQIL 3MV11 4P0DA 2P49B 1U21A 4MAYA 3MMEA 4ZMLA 4LDCA 1ONQB 1D5IL 1QNZH 3V52L 4XMLH 2AGAA 2RCSL 5LNEA 2CCVA 2AJYH 2IDSA 3HHMA 4CS3A 2H7WA 3CN1A 1Q9WB 4D0DA 1EN4A 3V4VH 2JFCA 1UEYA 3I75B 1ICTA 3ABKB 4H13C 4FCAA 3W1ZA 4JO4H 3QDJB 1MRFH 1QUPA 1WFTA 3SDAA 3LTVA 4QTHA 3H4FA 1P7GA 1H3XA 1K92A 5A2FA 1K4CA 2ICWJ 5D6DA 3G5YB 5E56A 3TWYA 1F86A 4NQUA 1XOUA 4ETQA 4TSFG 5HJGA 1NCCH 3O8XD 2TSBA 3GMRA 4HSQA 2EYSA 3HVDA 4FQJH 4H1LB 3S36H 1J1XL 4GKSA 4XO5A 5AVSB 3ZHNA 5FLVA 1M7UA 3ECBA 2ZXQA 4KKLC 4P3WA 3VWKD 4UQ3A 2EYRA 2X4NB 3GMLA 2UXXA 3F7YC 2PYEB 4GFTB 4MNHB 3RFZA 3DO7A 5E6SB 3A8TA 3BAYA 3UG3A 4DSYA 5ID1B 1PV0A 2CIKA 5CSBA 4IHOA 4YPGB 1UUNA 1M5IA 1ZWIB 1KYOJ 2JQAA 5GS2D 4PLKC 3T08A 5AWNL 3T2OA 1YN6A 1UD8A 2OTJV 2OLDA 3S97C 1QVOA 2H1PH 4K7PX 2YBGA 1QSEE 4PGBB 5GGVL 2J8OA 4ZO9A 4I18C 1B0WA 5IBTH 1J8SA 1C5DA 1U91A 3IK2A 3NH7H 2HH0L 3AWFA 4FE9A 5IP4A 1DK1A 2FTAA 4WGKA 2XJKA 4GIOA 1EZVY 3WHE0 2W0FA 5JYMA 1BXUA 3QXWA 1UWXH 4W9DC 1MQ8A 3DROA 2GBOA 2H32B 1FNFA 4P9OA 1THAA 3K6DA 5ADPL 3L71H 5C92A 1SQPH 25C8L 3O3BA 4RQQB 3FO2B 4KX7A 4DKDC 1S7VB 1FC1A 4M7LL 3VFWA 4N0CD 2VQFO 2IV9A 3GSNB 1E9PA 4Y5YC 1JFQL 1JNNH 1P4RA 4LCVA 2H94A 4AE0A 4JEGB 4LC1A 4WFEA 3DXAB 4NWTH 3VXME 5IEHB 3K6NA 3WNNA 1QTYT 4FOMA 1ZIBA 4WTXA 2WWMC 3G5ZA 2VMJA 4B3RB 5E00B 2WB1A 1JFHA 1Z7JA 4PJCE 3D33A 4J3TA 4RISH 1ZL8B 2GY7B 3WKYA 4PSPA 4X0NA 3G5XB 4R3SB 4XWOC 2NMSA 2CJ3A 4X9FA 5J6GB 3L5XL 3FW6A 2CR6A 5EO0B 1OZUA 1FAKT 3Q0HA 3ARGC 1JPSL 3ZDXE 3HKBB 1LO3L 2LW7A 2C9QA 3HG5A 1M6OB 5DSCB 2UXBO 2WLJA 1UWXK 2V3FA 2H8PC 3CV5A 3GT6A 4DKAA 3F83A 1Q94B 1WTGT 4JPWL 1PGRB 1WA8A 4MXQD 1QLEH 4HIXL 1MI5B 3FMGH 2EJRA 3T0EE 4LNUA 4C47A 3BGAA 4O5LL 4QPJA 1YY8A 5JLZA 4JQXC 2UXNA 4MJ2A 4OV6F 4FM0A 1AKJA 1X5KA 3Q4HA 3B2VH 4XCNA 4GQ9H 1NQTA 4XNQB 4ISVA 2YEZA 4ZODA 1SXNA 4P9HC 4FTDA 1MZFA 2FEEL 3G6EV 4XMKH 1WIUA 3T2QA 3K9SA 1JPEA 3ATAA 4HGWB 1DL7H 1JVKA 3NVQA 3S96A 3FQYA 3MLZH 2XAFA 5HHOE 3PFQA 4YE0A 2GPZA 3MZTA 3WFVA 2CHNA 3A67L 4OCWL 4AYBA 2IQAB 1KIRA 1NFAA 3EH4B 2Q7YB 1UWFA 2FO4B 3FFCE 3H1ZA 4B0MB 4K3DH 1YEHL 4OJYA 1D7CA 3R8BB 3S2AA 1N32O 4F9LA 3IDXH 1SN0A 5EG6C 1BDYA 3QFDB 1DUYA 1YEFH 1P4IL 3KPLA 2QEXV 1NI8A 5C3TA 3E3QE 5DS8A 5EZJB 4E36A 2VR7A 2FMLA 1WUZA 3ERXA 5FUOL 1BMZA 3S7GA 1TVKB 1M1XB 4B3TB 3FRPG 5LBQA 2NCEA 3R4RA 4LB8A 4MJ5A 4J39A 2M6YA 2OZ4A 1XZ0B 2Y2WA 5KVFH 1WK0A 2HSIA 4GI6A 3IT8D 4I77L 5EBMA 1KJVB 3QQ9C 2VXUH 1P4BH 4GBXA 4NO0B 1HDJA 1S9VB 2UX7A 4CVUA 4TQFA 1SGKA 4P30A 4YGAB 1M2VB 1ZHBA 5I2IA 4E42A 4XNMA 3QWOA 4KHTL 4U1LA 1RJLB 4L2YA 2WUCH 1HXMA 4FQ1L 4FXTA 1TO5A 4U3JB 5C08D 2JB6B 5D2NB 4YQXL 3K0DA 2MNUA 1AIFA 4PREA 3IRPX 1H2SB 1W8OA 5KJ7E 2PGGA 4Q20A 2BTQB 1SM3L 2KKQA 2FJHB 4KKLD 5E8OA 4EO5A 1ZAGA 4OF8A 2DQFB 2WSPA 2F8VA 4P57B 2RMKB 5H9CA 5FO2A 4LIQE 3WFEH 5D7KE 5CM1A 1ETZB 4TSBH 4XCFH 4XOEA 4K23H 4LF9B 3NSCA 3QORA 1KZQA 4H40A 4X9HA 4FF9A 4BH8A 3CSPA 4KAQL 1CBJA 1W72H 5D4IA 4Y1AB 2A9ML 3WG7C 4LFAB 4UNTA 5E2VH 3DI2B 3TURA 1WLHA 2IGLA 2M83A 3TYGH 1ADQH 2P5WD 4YSQA 3H9SE 2EDTA 3ARRA 3RT3C 3QQ4A 4PG9B 4OT1H 2R2CA 3CN4A 1YEIH 4Y5XC 3VU1A 3GXIA 1SF3A 4ZD3L 4ONHB 2L0DA 1RM1B 4PJGA 2MW2B 3VFTA 1VQLV 5J6HB 1JQ0A 4L5FH 3E6HA 4JPVH 1QFWI 1NDMB 3WIFA 3CRRA 3SJVD 2ZIMA 4FQ2L 5EC2C 1FJ1A 4WF7A 4DV7B 3JWNE 2PR9A 4RFOH 1KQSU 4ZX3A 4K8ZA 3JV5A 2EIEA 3VVVA 1E5ZA 4FLYA 4OGYH 3T8MA 1I1AC 3R19A 5CHNB 3EO0B 5HPMB 3FONB 2VXTH 3ZKQD 1CTNA 1NC2A 5H5NA 1VEWA 2A77L 3DARA 2WWMD 3OQRA 2UU9B 1E90A 1OTTC 3FYIB 1NCDL 4FYSA 3SOBL 2WXLA 5KAFZ 1CFBA 1ZT1A 1GL4B 1GGUA 4YSPA 1ZS8A 4H44B 1MIEL 1P7QD 3FN3A 4P2RB 1JF1B 2Z3FA 4QD2E 4UQAA 2CR0A 4O2AB 1LD9A 1S6NA 1LEIB 4XWOD 3IYLW 5DVLA 1DQVA 1UH4A 3P4MA 4Z7OB 4H8WH 3DXRA 3CIAA 5C6PB 3HNVH 1HINH 2IXQA 3VD4A 4HCGA 5ITBL 2LO1A 3ARGD 3B9AA 3KPSE 4PBVC 1NKDA 3JWNH 3GSUA 3MRFB 2DE0X 5ELIA 1ZIAA 4X20B 4MNQE 4JAMB 4Q14A 1NGXB 4YHIB 5D7IE 4L9LC 3UAEA 2CA4A 3UPCA 3HI1A 5BZBA 5EUOE 3IN2A 1PYWB 3L2MA 3MLWL 4WEBL 4XBEL 1R6NA 4DVRL 4QJ4B 4YDJB 5ICYB 3CZSA 5KHKA 3WFCH 1GS8A 1CZ8L 2I7SA 2YQBA 3W39B 3WI9A 1Z5LB 3U9WA 1AQDA 2DS4A 3ABZA 2ADIB 3SODB 2G0KA 4Y8DC 2G3XA 3T6VA 4ES8A 4C4UA 1N7MH 1F00I 4QRQA 4DR7B 3GB7A 4KTEH 1TTBA 2WTPA 3MNWB 1YTFB 4HKJB 4GIPD 1VFBB 4JVPA 3GXFA 4AQOA 1LTXA 1INQB 3GK8L 2Z64C 2ADYA 3IFOB 4G6FD 4KXAA 2QGCA 1DEEA 2CKBA 3IDGA 1Z9MA 1PL0A 2PF4E 4GT0A 3ZDZB 3OJVC 1NR7A 2P06A 2ZONA 1I8MB 3I3BA 2H26A 5CZRA 3N41B 2ID5A 3APOA 4AT6B 1IBGH 1JJOA 3NJNA 2KG7B 3E22B 4DZBA 4BR6A 4NUQA 1DHKA 2E7MA 3BESR 3VFVA 2YJLA 4R7DB 2BVOB 4L4TE 2AMUA 3VTTA 3W5MA 1B4LA 2JQMA 5FYKD 3N9GL 3APMA 3I6SA 5E51A 4XMTA 3KYOB 3ARQA 1BMFG 1MW1A 1D5AA 1R3IH 5IE9A 4OU3A 1Y7VA 3KAAA 1SJVA 3MBEA 5GSVA 3BVWA 3EJJX 1FV1B 1RZFL 2P5EE 3RKPA 3V0GA 4LF6B 2Y1YA 4LLWB 4X6CF 3QQ9D 2C4XA 5H37G 2Z8VC 2HWZL 4NO2B 5EN3A 4GSXA 2R72A 3FULA 4FQCH 3VGGA 3UPRB 4RGMB 3OHXB 5EBLC 4G11A 4X7FC 3V6FB 1OCOB 4DRXB 4BIKA 4M6OL 4BFGA 2EE9A 4AJVA 2WB7A 1D5ZA 3TETA 1US6A 1XR9A 3FXIC 4LEXH 5L4MA 4HFWB 4FM2A 1DVUA 4W9JC 4XP6L 2E76B 3IXTA 1FXHA 2BNQA 3G6JA 4V33A 4NZJA 1TQTA 4FA6A 1P7HL 2DF3A 4QLRA 1CGTA 3VFRA 2E9BA 4ZUUB 4DV4O 3CFJA 1MAML 5IJ9A 5G5DB 1TXKA 1L3NA 4JI7O 5D70L 3SJBC 1BX2B 2DBLL 1ZT7A 3C60D 4OM0L 3PP3H 4JFFA 4K94H 1VERA 3AREA 4IYIA 4JDZB 1NCHA 5D96C 3TV3H 3MLRL 3CXDH 2O57A 3EHBC 1XMWA 4LCWE 2LU4A 1CBVL 2Z93B 5JA8B 1DSFH 4JFQB 5KVEH 4YLCA 2GTWA 2BVUA 1BT8A 3U7WL 5JW3L 2Y7QA 1S5HC 5CJOH 3QC6X 4FG2A 4JHZA 3ZOAA 4D6TH 1U97A 4WJ5A 1N33B 5HGHB 4NDMA 4FFTA 1NZ6A 1ASPA 4QRFA 2R70A 1TYJA 1VADA 4WFGE 4PYGA 5IYCO 5JJJB 1SZXA 2NRDA 3RWEB 4FL4C 1FFNA 1KKCA 3OKDA 3D4GA 4UIMA 2WSKA 2E8YA 4TNEA 2WBKA 2WLLA 3IGUA 3NCFB 4TLSA 2CLVA 5E2JA 4OZGA 4ZI7B 1KBVA 3DRTA 4BUHA 3QR2A 1KCUL 1OGTB 4HWZB 3RB7A 4PI0A 4DK5A 3MUJA 1I1AD 4ZS7H 2CGRH 4DKTA 3ETGA 5SWSB 1QBAA 3UXFA 5FFLA 2F1BA 3BKYL 4HPOH 2QWOB 3MBWA 4F7PB 4JS7A 3PP3K 1VPOL 3II3A 2D7NA 1K5QA 1OTTD 4FHJA 2BWIA 1G9NL 5A16B 5TPWH 3FAWA 1CXHA 1GZQB 5DI8B 2AK4B 4CVZB 2WXNA 5EBWA 3VVWA 3EYFB 3GMOB 3HE6D 1AVMA 3HN5A 3T3PB 4HW6A 4KC3B 4IIJB 4XMPL 32C2B 3BT2L 3HMWH 4DR6O 3D3VB 4DV6O 4TRPL 3RGVC 1U8PB 2AQQA 4H8PA 1XCQA 1HYRC 4P5SA 5FHBH 3O9WA 4IRSA 1IGJA 1F1AA 5HDQH 4HGMA 4TVUA 1TSHA 3B5HA 3BD4A 3VQXA 1VLXA 3GSWA 1T0NB 4HEME 4HKXA 1TA8A 1LYQA 1XH3B 2JJTC 5I19H 2CZNA 5D7LA 1J05A 3HB3B 1EX0A 3MYZA 5FNVB 1D5BB 3N5AA 5EH1A 2NXYC 2HTLC 2A74C 4RWHA 2XWBB 3KWWB 3G71V 1HI6B 1MNNA 4WY7L 3ML8A 4LL9A 4XE0A 4Y2DC 1FL3B 3BCDA 3W9DA 1AYOA 1GZHA 1A1MB 1NPUA 3N2JA 4K4KA 1Z5YD 5FCUL 2Q6AA 1ET8A 4G3YL 2B14A 3FCSA 4K9EH 1PPIA 4Y9FA 5B7FA 1GGTA 1CD1B 1HHKB 3K3QA 3F64A 3K91A 4XAWH 4MSWC 2X4SA 3N3EA 2L35A 2YA1A 5EIQA 3GXUB 3Q3GB 1RIVH 3SR2C 2K6YA 3C9NB 3LS4L 3VI3A 5AQ0A 35C8H 2EXSA 5B5EZ 1PSKL 5HVGB 4JI6O 1NAML 4ZOCA 4TUKL 4BZ2L 1BMWA 3WNJA 3IJ9A 2K6ZA 4ICXA 3SYCA 2YMXL 2QM4A 1T2QL 2R7EB 4F9PA 4ZFQA 4B95C 4ZTPH 2GIMA 4WW1B 5ICZB 3GUTB 2XT9A 3UKMA 1L3WA 1MW0A 3BVTA 1AD0B 3AGWA 4XGZB 2D0GA 4BH7A 1UA6H 4DK1A 5DJXB 1BD2D 1P1VA 5TE4H 3F3HA 1CGSL 4O2EA 1NH6A 2JB5L 2V2WA 5C93A 4Y4HB 4YVNA 2Y7LA 4RNRA 2CBQA 4ODUA 4P3CH 5FLUA 4LHUD 1BEXA 1E4KC 4PRHB 2GC4C 4AL8H 3D2TA 5J57B 1JX9A 2R0KL 4FXKA 5EU6B 5BVJA 2HFEB 3EFOA 4Z77A 2QLYA 2P7TA 1AQ8A 1T04B 1DLHA 3IDYB 3OR6A 4NKOA 4IYHA 4TKWA 4XP9H 2EDBA 3SPGA 3UTTB 1QCEA 1Q43A 3VRIB 1R5VB 4YMPA 1RUPL 3GGWA 4LOVA 1WB7A 4JM2A 4QRRE 4BFNA 3WU1A 5IV2B 5E7FA 3CVCA 3QEHB 4X5LA 1MEXH 1NCBL 1L9MA 3F7PC 3P0GB 3ZE2F 4U6TA 5EZYA 4M6NL 5LMNB 1AP5A 2XQ0A 1QACA 2VDRH 5IB2A 3X13B 4ADGA 2CXKA 3H9VA 2WW8A 3LD8B 5CCHE 2I5YL 4WTWA 3U0ZA 3EHBD 4BFBD 4JX0A 4ANKA 5AVVB 4KY1H 4GQRA 4JYCA 3FO0H 2BS71 4OZ4A 4X5PA 5FGCE 1Q82W 4LVOB 1E4JA 2XTJB 2C26A 5JWPA 2A6IA 1BQLH 4XB7A 1CFMA 4XAKE 4PJ7B 1T5XB 4XNUL 3OKOB 2OW6A 5F0PB 2Q5ZA 3DSNA 4ZAKA 4FXGA 1UXSA 1H2LA 4MQ7A 4Z7VA 2QM7A 3OGCA 5JW4R 3JAKB 1NOLA 3PL6B 4KVPA 3TJHC 4HUXB 3BGMA 4U1KB 4KGJA 5CINL 3SY6A 1O0VA 3FSOA 5DK2B 2GG1A 2NX5B 5C0AE 5IJKA 3D5OF 4YXHH 3D7PA 3IPEA 3DYPA 1BYOA 1YHPA 3FHAA 2WMPB 3DV6A 4M1GH 3BXNB 4LU5L 2PXYA 4TV9A 3FB7C 1HK6A 3O11A 1XF5B 4L3EB 2DDQH 4OCSL 2VS0A 4MBRA 4P4KB 4V2BA 1OAQL 3MXWH 4XVTH 2H0EA 1IEBA 4F3FB 1NLDL 5JHLA 4H26A 5T1LD 4EIBA 1FCGA 3HZMB 4NBYB 4YBHA 4YR6B 3VSTA 4H88L 4E41D 2WXHA 1L5GA 1ZK5A 3SCMA 1AR4A 1IU1A 5IFAH 4MAUL 1BFOA 1M1KW 3IFPB 2ITDB 3O81A 5T3XD 1MJ7H 5MEND 2EIJB 2BSBA 5D4JA 2EDYA 1BMGA 1J0KA 1JVOA 3LXUX 5I9QB 3RGVD 5DUML 4AEHH 4LRNL 1HIML 1MNUH 3ZRFC 2DQUH 1INEL 1NFKA 5D93C 1NINA 1TQWA 5FXCH 2G4GA 3ZMNA 3RNKA 1HSBB 2IG2L 1XNRB 4QRUB 4HD5A 1SXBA 2XWXA 3VXRE 4MVSA 3EO9L 4E2OA 3WY1A 2NXYD 2HTLD 1LO0H 1UA3A 4HALA 2GBVA 3D85A 2YA0A 5IROC 2VQUA 2IU0A 2A9HA 1AI1L 1SQFA 1AIZA 1D5MB 1FO0B 1V55C 4HXBH 4Y2DD 1BL8A 3W57A 1UJ3B 1VA9A 3AUWB 2ZKHL 2XVGA 2W5PA 4MA7L 3A0BZ 4LF5O 3BP4B 2Y4SA 3ESUF 3FTVA 3LXCA 3OTTA 4N8VB 5AW0B 3VSVA 3T1CA 1HOCA 1BSIA 5I6XC 2BOCB 3FQXA 1WISA 5SV4A 2UY6A 2O6FA 1KBPA 3Q2NA 2ZJSH 2VZ1A 3ZRXA 4JI8B 3IDNA 3O8XB 2OZ4H 4PWHA 4XP1H 3W5NA 1N9PA 2Z91B 4GEJA 2XKSA 4BRJA 1B9KA 3ATDA 4YHNA 3VWKB 3X11B 4A2FA 1LHZA 2A6JB 2YQGA 4NRZA 4FA7B 4E9VA 2I9LB 4NSKB 1PBYA 3GKWH 4NOBA 5ECJE 4Z3JA 2I69A 1KYOK 4QDGA 5GS1B 3D07A 1FVCA 4PB9H 4DT2A 4M3JA 2QV2A 4F7CA 4HG4J 1T2JA 4MBOA 4NN7B 2FL4A 3O6FA 1YECL 2XVBA 2PCPB 2TSAA 2V3DA 4G6KL 4LLVA 4KJQC 4YHLH 3CVHB 4P2OA 3VNZA 3HPJA 1NCWL 3PV7A 3JATA 4YGVB 2N04A 2DWEC 4BSWB 1GOGA 4W9FC 1ACZA 3EDJA 1WBZA 4OF5A 2A79B 4O4HB 2O61A 4JFEE 4ONFL 4O9HH 3KPQB 4XWGL 2IFFL 4WI8A 1YYML 5GZOC 1J9CT 2BNRA 3KL0A 5D7HA 3OWEA 4JFDD 3B2MA 4MD0A 2CHXA 4N1EA 2NW3A 2P8PA 1NPNA 3NA9L 4AMXA 3VFNA 5IT2L 1LO5B 1QHQA 2FWSA 1GS7A 5IM7B 4ZFZB 5A2IH 2ZOOA 1J8HA 3POHA 3U0WL 1NUFA 2DZEA 3MV01 5BPPA 5JMRA 1DJHA 2JELH 3SGKA 2DQHH 3BWAA 1FGNH 4K8RC 4OSUH 4QHKI 1UWYA 4WGWB 4YHKL 5SWQA 5BMVB 1OQXA 3AS3A 4HJGA 2VWJA 3FBQA 5E5RB 4NFDA 4JYAO 1I3RB 5DJDB 1Q9WA 2XX1A 1E2WA 5DHMC 4QNHB 4KRMB 3QDJA 3ABLB 3QO7A 3BI9X 1FORL 1F3JA 3DJZA 4N0UE 5DMGD 1PIFA 3KJ6L 3P73B 5JIKA 1IBMB 3IPFA 3WLBB 3BMWA 2EH7L 3A0RA 5E08L 2YQ2A 3VQWA 4JUTA 1NANI 4R0LB 5B39A 1HQ4B 1GYVA 1OIOA 3DHUA 4UT6A 1C5BL 2HKFH 2PYFB 3V0IA 1KFAH 4Z6AT 3UACA 3MO1A 3ETQA 4KP4A 4N6RB 2TRHA 4B9PA 4MNHA 3UT5B 5F1IB 5HFLA 4APXA 2OI9C 3BUYA 1JGUL 1JHKH 1NC4D 1ZMYA 1XMOO 3MRMB 4HZAA 4YPGA 5E94B 4MMZC 5HGDB 3TJHD 1H9DA 1ZWIA 1BA9A 5DWPA 5C71A 2CPCA 3DO4A 5H94B 2HKHH 2CO1A 4QXGL 2A9BA 3MYJB 4DN4H 3QUYC 4HFUH 2MPAH 3KCYA 4X1IB 2J8UB 3M8AA 1QASA 2R2HB 4JO2H 2OMZB 4Z7UE 1EHXA 3IJYA 4XN9A 4QHMB 1RI8A 4K5OA 4CU7A 3TVMC 3QH3B 2AQ2A 4TM9A 2ZWLT 1HEJC 1C5CL 5DLLA 3DX2A 1MREL 2NY1B 2YD9A 4HCRL 3PWPA 3FB8C 4NO5B 5GPRA 4GG8A 4XNBA 4OLZH 1YCSA 3PJNA 1KJ2L 2DLIA 3F05A 3GWKC 5BQDA 5LUMA 3G7TA 2B2XL 2D9QB 2GBAA 3AU1A 4P9MH 3SN6N 1I1YB 2WWNA 3DXAA 5T5NG 3FUMA 1AR1C 5BO1H 1JCHA 2YAEA 3OLEA 3QFJD 4HHAA 3VFGH 5KJRH 2CKBH 4FNLH 4Y19E 2X7LA 2GABA 3I3DA 1I8IB 4QIWF 2AANA 1CXLA 5IROD 2RAMA 1JHTA 4A6YA 3G5XA 1YO4A 2VMDA 3WE6B 1BCIA 5LB1A 3M17B 3BKMH 1JZFA 4H13B 2XZQH 2WQWA 5J6GA 1COBA 4KXCA 1O5DT 3OPUA 4NYLA 3HMXA 1KGCE 5DYOA 3RB5A 4BINA 4Z7OF 4B7IA 1MA1A 4EZJA 3OLIA 5DSCA 5JPMC 1DQJB 1N12A 4KV5F 4AEIL 2DWDC 3O0LA 4P05A 3V6BR 5TF1H 5G4OA 4GYCB 3O4OC 2B1HL 5F9JB 1EGJL 1NBVH 4LBAA 4ODVH 2D3OW 3GIVB 1DEDA 3F7YB 1HHJA 1XGYH 4AK2A 3D3QA 4RWUA 2AQPA 2O5ZL 3MA7B 4JQVA 3GLEA 3NACH 3GDBA 2W9DH 1KECA 3PJLA 3UTSD 4MCZB 4RFNC 4IMLB 3WEXB 5ILTL 4NQEA 1NQBA 1N36O 2LGWA 4D0BB 2KBGA 1J0HA 4TPRL 2AZ0A 3O41A 1M4KA 4I18B 4KJQD 5AYUL 3FL7A 2ZE7A 1AGCB 3ZHFA 4OPAA 3D06A 1E9QA 4MQXC 4O2FA 5AKVA 1JVLA 3ZJAA 4KMQA 2P5WB 4U7OA 4PRIE 1TVDA 3BW9A 1OTUC 4R26H 1KCLA 3TYFB 1VDGA 2I60L 3HS8A 4PJ8A 2DQCH 2Z8WC 1U41A 4HIHA 2WXJA 4X4YB 3RYHB 1OAKH 3M1BB 4P48A 1XGQB 3STZA 5GZOD 3NSJA 3CCUV 3ZDZF 2CCLA 4BFKA 4TULL 2J6EL 3MRBA 3VQVA 3QFDA 4LEOB 3SJVB 1FH5H 3MX0B 3HG1A 3V7MA 1G0XA 3N41F 1KCBA 4HUWB 1ML0A 4UOJA 3O2VL 3FUEA 1CFVH 3DX6B 4XX5A 1FLRH 1KTCA 4MKMA 1A1OB 2ZIOA 3W7TA 4UT7H 1A3LH 4K8RD 4Y5YB 3HLAB 3IFNH 4XBPA 2ZCKH 1TUBA 2PWDA 4O4YH 5EEYA 1WQVT 3BABA 3REWA 1BF2A 3V0VB 1KJVA 2BDNH 3VXSE 4MNGE 5BQ7B 5CA1A 3KPRE 3OKKA 4JI3B 1I5YA 2HLDG 3WUWA 2AQ3A 4ZW3A 4FG4A 4JN1L 1WPCA 3L3IA 2ORBH 3BSZA 1U8CA 4P23C 3VI4B 3APFA 1OW0C 3TO2B 3HS0A 3FU0A 5DGRA 1EZSA 2BFVH 7PAZA 2WUBL 1U3JA 1GIGL 3ARGB 3L3OA 2BTQA 3IB4A 2FJHA 2BVQA 1NCAL 1HILA 5T1MA 2X09A 5BZWA 2YARA 2A6DB 1EJ8A 2H8PB 4KUMA 3FTUA 4JFPB 4A7SA 3BHPA 4UB6Z 2PW2A 4DOHB 5CMAA 5ACMA 2ATKA 2EXWC 2YIDA 2CO2A 4UZUA 1KLUA 2V33A 2FYYA 2J88L 4NQDE 3BFWA 1CDYA 3QUYD 3I50L 5L4IA 4XPGL 5HYSB 3QCVH 5F0MB 3WTVA 4LF8B 3GNML 4PJ6A 3U4BH 3LEYH 4XN8A 3JYBA 2VM4A 1KXQE 3TVMD 3NZUA 5DD3L 4TS6A 1IBDA 1F4HA 4IOSD 1BVZA 5DEFB 5CFHA 4D9RE 1JGLH 4G6FB 5B39G 5J6HA 1A3ZA 2EDNA 2ZYHA 1OSEA 2DQEL 1BWWA 3K80A 3VU2A 4J8RB 4NB5A 4QHKJ 3HC2A 2VWEE 4R4FL 1YMMA 2PP8A 4X6CE 3DOSB 2Y22A 4YAQB 2XAJA 1R9FA 3HE7A 3FBKA 5BV7H 1UVQA 2OSWA 5LA6B 5JOFB 3B5TA 5GGTA 3QJHA 5I1CH 2ZUYA 2XWJA 3EO0A 3U83A 1FKAO 1ILUA 2NW2A 4ELME 5I1KL 3FONA 3QYNA 4LLYB 2VKWA 3ZW3A 4HWEL 3ZHUA 4BQ9A 2EJ1A 3OXRA 3UERA 1DF4A 1XB3A 4UQEA 4ETYA 3VH8G 5LBSA 4A7GA 1K5SA 4DKEL 3UH8A 1SZNA 2CE6A 3CZGA 3BPZA 5GGUB 3PLYA 1J5EB 4L1TA 2EE6A 4Z0XA 4O2AA 1SMDA 1G9ML 2F19L 4HJJH 4FADA 3TJPA 2HRPH 2G9HB 1B88A 4RAVA 1SN5A 4WUUE 2F95B 4KY2A 5LXTA 5DD6B 2JDIG 4NEHB 3VFUA 4AGQA 1MQKL 3QW9A 1U8MA 3MRFA 3HG4A 2Q87A 4Z1PA 4X20A 2DQJL 3S35H 1NGXA 3QUGA 3QI9A 5ENWA 1NEZB 1U9KA 4DW2L 1AROP 2J6WA 5F9OL 4CC6A 1XMQB 4FJYA 1EN5A 4JPKL 3UTPD 2XUWA 4O02B 1XSOA 2BSKA 1PYWA 4AJ0A 2YPVL 3KBEA 3QHZL 4YL9A 2G75A 3BFRA 3MJGX 3NMEA 3W39A 2GJ6D 3GZOA 1Z5LA 4GKJB 1G87A 2QT6A 4R4BB 3BZ4B 2GHYA 3BYTA 2QGDA 2RTTA 5INDA 3LCYA 3GRWH 2YPLB 4UILH 1ED3B 4WNQB 3D3IA 3P0VH 3PHSA 1XX9C 5DD5L 1G6VK 1CXFA 1WAEA 3MNWA 4MDRA 4OD2B 4Y5VA 4NCC1 1NKRA 4DYLA 3JV0A 2WO4A 4LKXA 4G8FB 3WG7B 1RV6X 4YBQC 4MQXD 4K2UL 1YN7A 1R3LC 3GEFA 4JI0O 3IFOA 1OTUD 1GGBH 1AP2B 4FI6A 2H6OA 5C2BH 3VD5A 3ZTCC 2DWYA 2SEBA 4N5EC 1IVSA 1BJMA 4PH8A 1HR0O 4Y5XB 1NIFA 2DLGA 1FXKA 3HKDA 5I30L 2YXYA 5J6SA 4G7VL 6FABH 3O6LL 4BK5C 1NT2B 2UXDO 3EG9A 5TK4A 2EE2A 4FQLL 1ZRUA 5EC2B 3T1YO 5ESQB 2ALAA 1YQ2A 5F7EL 4PJFF 3NRPA 3OKMB 4K0KO 4LLUB 3WNPA 5I1HH 4NUJB 1GW0A 1IEAB 3DVNB 4ZBJA 1RLBA 3DX1A 1I1AB 3OG4B 2YXMA 4JY5L 1WBYB 2B0SH 1FV1A 2IDCA 4M4RB 2P4KA 1G7QA 1QFWH 1XSIA 4LLWA 4UB0H 2QKCA 1PLAA 4G7YL 1SESA 3L3JB 1UOLA 3T5WA 4OX9B 1NSNL 4DGWC 1QVFU 4YJZL 2OTUB 4X4XA 3UPRA 5D1XB 5CBGA 3OHXA 3EJSA 5FK9B 1ORQC 4NAQA 4D7BA 5AAPA 4PHXA 2BVYA 5B3JF 3EXAA 4U1HB 3NTCL 3IMTA 1I9JL 1BQHB 4YHZL 5AVYB 2YS4A 1S7TB 4XE5B 3WFZA 5LGHL 3FD9A 1FE8L 4MXVF 2VWKA 4N0FB 3A23A 1FNAA 2Y2TA 1TTFA 1DSWA 5I1DB 1FZOB 3BN9C 5I71C 5JHLH 2FWOA 5EEWA 3LZFL 5CB4B 4RIRB 2IC2A 4NC1C 4C54A 2HRLA 4HOZA 1PX3A 1IBBA 1A9BB 1BX2A 4Q9RL 2NLJC 4L9LB 4HXAL 4L1DA 2WXIA 3SE9L 1GJIA 5BVPH 4HOWA 3JWOL 4JDZA 1MCEA 1E6JH 4TSAL 2EXWD 2QFRA 5JZ7C 4PS8A 3RFRA 3QUMA 5TDOA 4R6UA 2AAVA 3SKMB 4DGVH 4JFQA 1DGSA 1CLOH 2HT3C 5H6QA 1MY5A 1I3UA 3RURA 1T80A 1B90A 1KXVA 2EH8L 4Z95H 5CJ5A 3WUWG 4P49A 2Q10A 3SBPA 3L9DA 1TENA 1B4JH 3L70H 1MWAA 3S3XA 3HG2A 3FDWA 1CE1L 4YJ2B 4EF3A 4RUEA 4HF5L 2O72A 2CDFA 4PJ7F 4ZJ9A 5E8PA 2XUMA 4PP2A 4Z7NB 2AI0L 5ACZB 3BLKA 1R47A 2B1AL 5K59F 3RUGB 2IPTH 3T1HO 3VXUE 4WFFD 4HWZA 2CBPA 4WUKL 3LPWA 4BFJA 1FH2A 3F2LA 4M62L 4ZX5A 4AKPA 1XB8A 4JFHE 3VG9C 4Q6KA 4AC2A 1TUPA 3EH2A 1DVXA 4ZMWA 4NQCB 5DEDA 4TMPA 5E6ZA 3E7JA 5A16A 3QUXA 3QEQD 1BD2B 4NM4H 1KB5A 2XN9A 4CVZA 3IETB 2AV7A 3BEHA 1RHHB 4KDTA 4F7KA 1IFHH 4IHJA 3MRCA 4LHUB 2OYPA 5C8JB 1IM9D 2X87A 5EOTA 2MFNA 4YHOH 2WN3A 2BY2A 32C2A 5EU4B 1H8HG 3ZE2E 3A4DA 3GINA 2XPZA 3ME0A 4KH9A 4NC2B 4OFKA 4TTGA 3KH4A 2QR0A 5EBLB 1UA7A 4PJXA 5T3ZE 3TJTA 4FLSA 4LSPL 1E6OH 1PNMA 2OR8A 3RIFF 3PAUA 1ULVA 1M7IA 5DR5L 4L1LA 3K08A 2VABA 1T0OA 5I6PA 3ILEA 4R96A 5EV7A 1RLWA 1FNGB 2NYYC 5GGQH 2P45B 4NXNO 2FQGA 3IKCB 1J1OH 1G9HA 3PNRB 3BAXA 1WWWX 1YEGH 2P44B 1DANT 3KLQA 1FL3A 2K7QA 4NIYE 2W80C 4Y2OB 3CCLV 5J2TB 1RCYA 2AF2A 2ED6A 3EOBA 5D96B 4RGOH 1A6AA 1T4KA 3N43F 1RK7A 1PM9A 3M86A 3TH4T 5JORB 3EHBB 2PYEE 5A1AA 1AACA 5EU5B 2BSEA 4DP9X 2WANA 2QKIA 4PJHF 1KSRA 3JASB 3SO5A 2G9KA 1S5HB 1FZJA 2W0PA 1WF5A 1KKDA 4AC4A 5T3ZH 3W0WA 1TOXA 2G2RB 2ENPA 2KL6A 3KL5A 4JKPL 1GN2A 3M1OA 3FAVB 4N5ED 1JV5B 2XIDA 3FB5A 1J5DA 2AK1L 1W0YT 1KELH 1S7QA 2J57A 4I48B 4FL4B 4KQ3L 3SPCA 2GFBB 5SWZE 2ZXEB 2XZAH 5IBUG 4F6RB 5I1AB 4X5RA 1EXHA 4R90L 4X7EC 1EHAA 3B7TA 5BR8O 4AGPA 2VSMB 4LSVH 2YWZA 2ZCHL 2QEJA 4X1YB 1AD0A 3OTFA 2J21A 2RR3A 4QKXB 4QRAA 4UT6H 5DJXA 2G2NA 4FNSA 3BAIA 4LWSB 1IC7L 2Y6SC 4NKMB 2WKOA 5C0CD 4XXCC 5ACLA 4Y4HA 4JDTH 1DJYA 5I8EA 3WFDH 3ROLA 2IGFL 1Z9SB 2IIJA 1T5WB 3NFSH 4UTAL 5I1EL 5C3LD 2F53A 4YFDB 1LP9F 4BZ1L 1THCA 3RWGB 2Q7GA 4C4BA 5IVXB 5C6TH 3UG5A 1JRHH 2D7PA 4E41B 3AT9A 4JANB 4PDLA 3MJ8A 3ZRCC 1V10A 2X6MA 2K8MA 4KO7A 3UTTA 4RLDA 4N2NA 5MENB 4PJEF 5I0ZA 3RGVB 4KKZA 4I3SL 3LS5H 4I3RL 4BFOA 3R65A 1G6UA 1F58L 1U58B 3KNBB 5ADOL 1MAJA 3CLWA 4LK4A 3BN9D 1QFUH 1DJIA 2MNWA 4OJAA 1KENL 5EN2A 1SLUA 3RZCC 1KGJA 5IWLA 3D8MA 3O3DA 5FUCC 1MHHA 2NXYB 5I28A 2A74B 2VDLL 1H8OA 3US1A 4OF6A 5JZ7D 4XX1E 5IY5C 3QYCA 2ZXCA 5JUEL 1A7RL 5E5UB 5IZ7A 4JASA 1JTOA 1JOIA 4Y2DB 4B9JA 1DQIA 2LHAA 1OARH 2HT3D 3REVB 4NT6B 3MGOA 2ZG3A 5DF0A 4LLQB 1MI5E 1SEQL 1T0PB 4FPPA 3BP5B 3LNEA 2Y9RT 1ITCA 2PWEA 4HQQL 4MSWB 4YS4A 4J80A 3MRDA 1AANA 1P4UA 5LGNA 4G80B 1RUKH 3JAWA 2R4SH 3ZKSD 2X88A 4X99A 4A6YH 3ULVL 1DQDL 3H9YA 4U1KA 1OP9A 3N55A 1O9WA 2MHAB 3PWLB 5CIPB 4F8NA 3BE1L 1F4WL 4ENEC 2F43G 4L1SA 2WMPA 1PZCA 3BXNA 2V0AA 4WJKB 1AFVL 3EJCA 3V0HA 3CSTA 3TONA 4GX0A 2AJSH 1GVIA 3KDMA 4P4KA 3SDCC 2R1WB 3L81A 2JI2A 4LAQL 1XEDA 4WKZB 2ZG2A 5E2TL 1RIUL 3CPUA 3RGHA 1TQBC 1SJEA 4LCIH 1KN4H 2J8UF 4LSQH 3SKJH 2GK2A 4PM1A 3FYEB 1DLFH 5FYJL 4G5ZH 3ILDA 3SDDC 3H2QA 2ZWKA 4EN3C 4TQDA 1Y0LA 2AW9A 2DYSC 2Q2EB 4X6DA 2HJFC 1PMYA 3ML0A 3PHAA 1E7UA 3L7FB 4NJ9H 5DQ9B 4MDJA 1OF0A 4F58L 2MQGA 1MVUB 1JHLH 3BWZA 3BX7C 3T4YA 3VXOB 3K0WA 1S3KL 4M3HA 4JFDB 5IYBO 2CO7B 1RMFH 2PKDA 2FSDA 1PZ5B 2VM3A 5DEGB 3V4UH 4AVKA 4ZFGH 1SDDB 4OV5A 3CWBH 3UCQA 4NXMO 5C9KA 3NCWA 1EH9A 1IGTB 5E9AA 4ZPTA 2NYYD 5TD4A 2WLIA 4K73A 3RZWA 5ES4B 3DHPA 1JSYA 5CP7B 3WN6A 4FS0A 3AQDA 3N0AA 4UQ9A 4XNYL 2GC7C 3QAQA 5E1HB 4NXSA 4ZKIA 1KTBA 2OMTB 3I2CH 1FO0A 4U3HA 5D2NE 4WI0B 4AYEC 2MK3A 5IOKA 2VDPB 1YEJH 3DV4A 4PTUB 5F7HA 4PJHA 1RK1B 3BP4A 4N90E 3CJJA 5KX5B 1AJ7H 3TZVC 2HG5C 1UXWB 3WXVL 5JW3H 3CN2A 5I6LA 2B1OA 5CEXB 3DO3A 2O1AA 4AZ8B 2ED9A 3QIBA 4MB5A 5GS0H 4XPBL 1CYGA 3O8XA 2J73A 3KYNB 1S5IL 1VSCA 1UT9A 1DYZA 3MCG1 4J9ZB 1U6AL 1IC5L 2YIHA 4FEIA 5JQGA 1P4LA 2XN0A 3RBSA 3JCUZ 3GFUA 5EBGA 1GN3A 3EFFA 4TTDC 4Y1AE 1D7BA 4TUJA 1SLXA 4F92B 3DX0A 4H8WC 1BJ8A 3AK3A 1NC4B 5IJVB 1ZLUH 2ZCLL 4NBXB 1AG6A 4QF1B 4GSUA 3BAKA 3BSZH 3I55V 4B9ZA 4HHWA 1VF6A 4FNUA 4E4EA 2JGDB 2C9SA 1K8DB 2F9BT 5AYQA 1HESA 1JD7A 2QWPB 1IGCH 4HX1B 2E5EA 2F54A 5JVDB 2Y6SD 3FB7B 5HDWA 1U93A 4X5WB 3N44B 1AP6A 1DBBL 3DVFA 2F5AL 5IMOB 4O4JB 2IANE 2VITB 3KVDD 5E6YA 2VDQH 1U8QA 3BMVA 4YDLC 4UB8Z 3HFML 2WLMA 4YHHB 3IDIB 5KMGA 4MS6A 4Z78B 4G7SB 5J9PA 3V6OC 3L6FB 4KTDL 5GJTH 2XACC 4QAWA 3R0NA 1X4YA 2DQTH 2R15A 1DDTA 5IK3B 2EUVA 4PUBL 4PMEA 2ATPB 1EAQA 4JKWA 2DKUA 3QJSB 3X12A 4WWOA 4RETB 4ZFZA 4H2CA 4UIKL 3QUHA 4C59B 5FB8A 1P2CA 4AYFA 4X9GA 1NGZA 2Q3XA 4P2RE 3NA4A 1WAAF 3NQIA 1A5FH 1UATA 5D93B 1SOQA 2CMRL 5BMVA 1UOWA 2W0XA 5ALBL 4Z7OE 3QFJB 1I3RA 3S5YA 3V0FA 4BD4A 2ZP9A 1YLBB 3QHFL 3RZCD 3ZDYB 4KV5E 2OK0H 2FL5A 1OAJA 4L4VA 4AQZA 2Y4UA 4G9DB 4JO5A 1I1FA 3ZRVA 4X5XB 1V55B 1Y76A 1MFBL 5GGTH 3WLBA 2QLVB 5L3GA 1MCBA 4FMKA 2OQJA 4D9QE 2N4IA 2B1GA 1R3IC 4KKNA 3VFMA 2E86A 1HHHA 4BIOA 5CA0B 5I6XB 1MG3C 1Q0YL 2PYFA 3HKFA 3JD4A 1JNLH 1MIMH 1RZIA 4LARL 3QG5A 5KBNC 3P11H 1XCWA 1GAFH 3CHOA 3CXFA 3MRMA 4LLDA 4P9HL 3JT0A 5E94A 4ZHQB 4XOCA 4O4IB 1DCLA 2F1AA 4LOEA 4IIQA 4R7XA 4GT1A 4IRZL 3UAJA 1OM3H 2XCMC 4JFEA 2DY2A 4X1IA 4KK8C 4DAGH 4D8PB 3UTSB 1F6LL 2CDEA 3ZDZE 1MJUH 1YYCA 1UD6A 4OFYA 3H3BC 2ESVE 5KSVA 4ZI8A 2WAMA 5FKAA 5CSZB 4MTOA 3AABA 3QO5A 4F80A 1SBBA 1KT2B 3DGDA 4K94C 3LKPB 3CDZA 2DWEB 3N91A 4PJDB 2EILC 2Y07H 3LQAL 3SDDD 5FYKL 2BOLA 4EN3D 3BDYH 1MLCA 2NDFA 4FRWA 1WC7B 1BQ0A 2D03L 5ID0A 4EXPX 4JGSA 2X6UA 4XMZA 2Z7WA 1N64H 1J86A 4QE9A 3MJ6A 3WNMA 1DBJH 3ZYZA 4D9LL 4L8DA 4WRLA 4ZFOB 4KVNL 1EZJA 3ZBHA 3Q5YA 4HK0A 1QFOA 2NTFB 2FBJL 2VH5L 5FO8A 3EUUA 4EFBA 3K06A 1MELA 3CUPB 2PPDA 3X17A 2QVMA 2QTSA 4TNFA 2DEXX 3VWJA 2YSSB 1BSMA 4GAFB 5DK0B 4QJFB 4ELKA 2CKNA 5D4HA 1OGAA 3Q8CA 3CCMV 3UZVB 1Q0EA 3APDA 5EOCJ 3MRQA 3H3PL 5GSRA 2RD0A 5I24A 3TZVD 1RUML 2NZ9C 5KYUB 3SHSA 3RL2A 4N2GA 1MF2L 1KBWA 3EOYG 3FQWA 3V4PB 1OOAA 1VEMA 2BP0A 4JVUA 4N6QA 3EVKA 1HQRB 1YY9D 4Z2WA 1PKQA 2MKWA 3NZ8B 3LRSB 3SBWC 3WTUA 1JD9A 2LABA 1JZ3A 1F4YH 1XH1A 5F9JA 5FOBB 5KN5B 2V9QA 1PFOA 1ZA6B 3U4EB 1Y1UA 2HLAB 3GIVA 4QGYA 1D6VH 3ELAT 4ZQKA 1KUMA 3BEVA 5AB9A 3WKML 2OI9B 2YLHA 2AQNA 3DK0A 4UTBL 1X4ZA 4MMZB 4L37A 4FTVE 2F66C 1E42A 1NANH 5JR1L 3E35A 4IMLA 1F56A 2XOTA 2JKTM 3P4OA 2DLFL 3CH8A 1XGPB 4WO4C 3QXUA 4Y4FA 3QUYB 2LVCA 4YX2L 4KQ4H 2HUEA 3Q1SH 3BH8A 3ZXAC 1UHVA 3RJDA 3AK2A 1K2DB 3HC0A 1AXSA 3PXHA 1EEUA 1SYSB 3WJJC 1XF2A 1S46A 2GCYB 3TVMB 1YQVH 1MVFA 1FNHA 3VXTB 3CC5A 1M7DB 2A9NL 5LJYH 3IGKA 5SWSE 4GO6B 3QUMH 4I9WE 3FB8B 4U1IB 3RJOA 4LEOA 2G38A 1CFTB 1BJ1J 4F33B 2AGJH 2IWKA 4HUWA 2FDBP 1QBZA 2FLRT 5IQ7H 5J1AA 1GCYA 2LLGA 3DX6A 5AW3B 4XZ4A 2UZYB 1MWAH 2AK4E 3TL5A 3FU7A 3L4TA 4Y5YA 2HFGL 5F7KC 2MNJB 3HLAA 3SOTA 5KSAA 3W7UA 5I5MA 2QQKH 3H56A 1KB3A 4L8SC 4MD5B 1SUJA 3OV6A 5F1OB 2MIZA 4UM8B 2CGZA 3O6MH 2BCMA 1QQCA 3D3VE 1AR1B 4NP4L 3HKZA 43CAB 4C4KT 4RSYA 3MXVH 2QVFB 5HHNB 1URFA 3C5XA 5JJEB 4JGNA 2NY6C 3VYPA 5BRZD 1K4CC 1EBPA 2JKWA 5D6DC 1SJXA 2VLKE 9CGTA 2NNFA 1KIUA 3QWRA 5PCYA 4LCCC 4CH5A 5E23A 1IURA 1MFCH 2DM3A 3LMJH 4IK6A 4DH2A 4G8GA 4EVNA 2JIZG 2FSEB 3ZKXC 4FM1A 3VI4A 1YJWV 1S7XA 4K7PL 5C3IA 5LG1A 5D5MA 4WSJA 2Q73A 4ODSH 3RFZC 3K9AA 3B9DA 1ZHKB 4ZS6C 5G4MA 4HPHA 2OIGA 2K6WA 3DC0A 1SA0A 1MLBA 2HTKC 1KB5H 3IWVA 1WAZA 4FQHB 1HXYA 4PG2C 4Q9BA 3ULSB 3DSFL 1ROCA 4AL8C 5JPMB 1UFIA 2DWDB 2C9VA 1K34A 2WC7A 2WINA 4WI3A 4FAAB 3O4OB 3WIIH 1QTSA 4JB9H 3CBRA 3SGJA 2JI3A 2JCWA 4XDJA 4OVVA 1WA0X 2VT0A 4ZMYA 1IM3A 3FTWA 1ZANL 2DQMA 1MCOH 4X6BA 1J9SA 1HJCA 2BO0A 3OKEB 1N8OE 4FP8H 2GJ6B 3E6FB 2ZE8A 4UT9L 2PTMA 1S7RA 4KK8D 4X2UA 1TG8A 1H19A 2AV1A 1KUQA 4PEEA 5ANMB 3I9GL 1JN6B 1A1NA 4RFNB 1ASOA 1GMIA 4WGVB 4YSTA 2R56L 1M71B 1WBXA 1CDGA 1JDAA 1WHPA 2DLTA 3FUHA 4PJFE 3UTQB 4PGEA 5BUAA 3STBA 2DLHA 1WUNT 1VKXA 2XYBA 1AE6H 5FCSH 4UQBA 3UZQA 4JI1B 1U8KA 1QFHA 3D12B 4JHWH 4N8UA 2L04A 5KYNA 1UTDA 1T6BX 1CFSA 5B38B 1HL9A 2PR4L 2DWTA 1DQMH 4JREC 4O51A 2A06H 2HEPA 1G5AA 3DOSA 5DQJA 3CH1A 4KTYA 1TJIL 3SIKA 1U96A 3IGLA 1OD9A 4Z7NF 1H6TA 4IT5A 5J2UA 5LA6A 4FKKA 4JFXB 5E2UL 4MZIA 1OALA 4NN5C 4AYID 3APCA 1KBBA 3RUGF 4X62O 1JZ5A 3MRGB 2ZX5A 4PRHE 3TFBA 1JPFA 1WWBX 5B3JE 5DZJA 3EOAB 3VD3A 2XBZA 3QZNA 5EU6E 2JWYA 1IAII 1J7VR 4MXVE 2W9LA 1UZ8B 2ROXA 4ZMPA 5GGUA 3P3PA 3PIQB 5KS9E 3VA6A 4GCZA 3HC4L 2EDLA 3ROOA 5IHUL 1B3JA 4F93B 5I66A 4EIUA 4BAYA 2VQTA 5IB1B 1E8YA 2NZ9D 2Q0OC 2R29L 1CLZH 3BIKA 5IFHH 3JALB 2IGTA 4P23B 5T5FL 5EEZA 2YPKB 2WPDG 4S1QH 2YOAA 4FLQA 4IBVA 3QULA 3VG0H 3ESPA 1SBSL 2W88A 3T4DA 3C5SB 2XPGB 4NZ8A 2R23B 2ZX6A 3VD9A 3VB8A 3DJTA 2XTJE 2MCPL 4EKXA 1JYWA 4MDIA 3B7YA 5DJCB 1J12A 4TNWF 4A7TA 5JDSB 4PJ7E 2DQIH 3BZ4A 3U10A 3CLEL 1I9IL 1PY0A 4YDIH 3QCTL 4R97C 1KCRH 2YPLA 3SPIA 3GIZL 1JUFB 1Y18A 2J72A 3O4LD 4WNQA 5K59E 4KRPC 3J7HA 3MJ9L 4WO4D 1LVEA 4OD2A 2KLSA 3WN5C 4V11A 5IKCB 5JHDA 2VR5A 5T33L 5DRXB 4B9IA 2NX5E 4CVWA 4ODBD 3K8KA 2HLFD 2QMKA 5FGSA 4F9LC 1SQXH 4OIFA 4LLMA 5HBBA 1UFGA 4L3EE 4K3EH 4L9DA 4POUB 4OLUL 3MFFA 2AZUA 3TNNB 1T03L 5EC2A 1G8MA 1GS6X 1R3HB 2CWRA 3FFOA 4HUUB 3S2CA 3F04A 3OKMA 1MHEB 4NUJA 4MAYD 3DVNA 3S4SB 3O0RH 1NAKH 4NKQB 3X2QC 2RIKA 3OZ9L 3WFHA 3BEWB 5EBMC 1DJSA 1TIUA 1PQZA 4FZ0A 1E5AA 3CFCH 3IDUA 4JY4B 5C0DA 1B2WH 2WYIA 4GBXC 4DNLA 2JCCA 2VRAA 4DTGL 4HZ3A 5IMKA 3CC1A 4YL4A 5AW5B 2V8LA 4LSSH 5A2KH 4MVRA 3KPPA 3QEQB 3SDAD 4CJ1A 3T2PA 3P9LB 2K1EA 2NY6D 1MFMA 5D1XA 3CSBA 1A47A 4OAWA 3GSVB 3RDTC 1IM9B 4Z0BL 5AALA 1KN2H 5FDWA 2VLJB 5DMKA 5IVXF 1BQHA 1SXSA 1MH5A 3EH3B 1NMBL 4U05A 4JI2B 4MLSA 3CU7A 4J3XA 1WEJL 5I1DA 4DR3B 1N8ZB 2YGOA 1G6RB 4RIRA 2OV0A 3V9FA 2HTKD 5L4FA 1CK0L 3EJUA 3ZZLA 2ZUWA 5D55A 2Z4QA 2ZF8A 3B09A 1KPUB 2K4WA 2AXWA 2PABA 4R7NA 3HAEG 3QORC 4QUOA 2ZE6A 4AUJA 5I73C 2HXAA 3VX1A 3GBLA 1G7MB 5G55A 2XWTB 5EO1B 3U7AA 5LMUO 3KZ8A 3VJ6B 3GHPA 3LEVL 1OSYA 4ORZC 2X4QB 4KKQA 5EIIG 1E7VA 3QT2A 4LH6A 2L7UA 1BEYH 1YAZA 4MJ6B 2FJGB 5CCKL 4XDKA 4Z5RB 3CBKB 5F3HA 3EGSB 4EQ2A 3FSZA 2XZCH 4JPQA 2QPFA 1AGDB 2E3VA 1AD9B 2Z1PA 4QY8B 3BAJA 4W6XB 4G43A 1RFDL 2H47C 4FZEL 5D9SA 1HHIA 4K5NA 4B3TO 1LEGA 4G6MH 1R3LB 2ZOLB 3LH2L 1I4FB 3FZUD 1RUQH 2Q69A 1U8IA 3BJ91 1FO0H 5L2JA 4B7EA 1BLNB 2HKAA 3ZR5A 5ACZA 5DD0H 5CWSB 2MOQA 4Y0GA 4RMBA 3SZ6A 1LP9E 1MFDH 4OGQC 3OJDA 3U4KA 4WFED 2Q7HA 3RIKA 2W6IG 4AM0B 1A4CA 3IVKA 4LDOB 3K03A 4HZLB 3QTCA 4J1UA 4NZFA 5F7AA 5GRUL 4EZKA 5C0RL 3VFOA 4R7LA 4NQCA 1SQBH 5LNGA 2B3RA 4L4JA 4YWGH 3C08L 2BW4A 4PJEE 4G6JL 5C0CB 1IX9A 4O4LA 2UX6A 4N25A 5ESAA 4MA3B 1OAUL 4MLIA 5FF6A 1J5OL 4I5BB 5C7XH 1IC4H 3JV4A 4AIZB 1EHNA 4WNSA 3GC3A 5C8JA 5LYJB 3ZIMA 3P32A 1QI3A 1KC5L 4AG4H 1EUUA 3ZZ1A 2GTAA 4JAVA 3RRQA 5IVNA 4ZOLB 3VAEA 4FI7A 1ORQB 1XH2A 1UT2A 2CGYA 4MB4A 3GSOA 3VRJA 2VDKL 4CSPA 2IW5A 3IU3B 3E86A 4EOWH 2Z7UA 1IQWH 3MUGA 4KZEL 2Z7YA 4N8PA 1F90H 4YIOA 3UO1L 3U25A 7CGTA 1OPGH 4PS4H 5I71B 15C8H 3D2UA 4P2ZA 2ALWA 4YSEA 1AKJD 3S5LA 4CADB 5IGXL 3V0JA 3IKCA 3P3YA 3QO1B 2E27L 5ERWB 1I82A 2VQEO 2NLJB 3ESMA 3T3MB 3E8VA 3CFDB 3EYSH 2FCBA 2IDFA 4MTFA 5J2TA 1U2CA 3GJEA 4YUEL 5FDYA 1T20A 3NCJH 3V52H 3T8XB 1H3UA 4DV7O 1R75A 3WNIA 5LHGA 3RWHB 1HOEA 5JORA 1KU9A 4FZ8L 4KRPD 1NAMA 1PJ9A 5CCJA 1W80A 3FPYA 5IW6B 1HAWA 3K4AA 1DVFC 2W65B 3EFFK 3ABMC 3NJVA 1I53A 3AXIA 2LLNA 4OCXH 4YY3B 5IOPA 5E8NA 1Z2KA 3MI6A 1KCKA 1JV5A 2QTOA 1NL0L 3V4VB 2ZOKA 1JPTH 2EDXA 1J1XH 2GFBA 2J8UE 3HG3A 5MEQB 3CVIL 3VXPB 1OOWA 4F6RA 1XQ4A 5I1AA 1I7UB 4CS4A 2X3CA 4IBZA 3CS5A 2OPCA 2LTQC 3D1MC 3NP3A 3CXHK 3EO1A 3MBEC 1CFQA 4AV5A 2UXCO 2DD8L 1NM9A 2X1XR 3CHQA 4NZTH 1F42A 2XG5A 2Y06H 3FJTA 4HKBB 3VG9B 1U95B 4GBXD 4JN2A 2YRZA 3DDGA 1SJMA 3UEQA 2AEWA 1UD2A 3VXQA 4JM4H 4KBPA 3N44F 1OAZL 5CUSL 3UBXB 4ZMOA 3LNNA 4M5ZH 2AZ2A 3UADA 2Q0AA 3NSDA 2H1LM 3D0LB 3U1SL 1TJHL 3Q43A 5TDPB 3KBHE 2CK3G 3POCA 4NQSA 4I55A 1A4KB 2F18A 3ETSA 3MBXL 3PGCB 3U1PA 4I2XA 4FG6C 2F5BH 4UMGA 5D2LA 5KHJA 5KVGH 1N6QH 2NY0D 2X12A 2CBMA 1BXVA 3FT2B 3TH2T 3C5ZA 1EAPA 2FECI 2F93B 1TKWB 1UKQA 2V7NB 2VR9A 4M5YL 3ES6B 5DZPA 3VD1A 3AREC 5HJ3B 3LN4B 3QEGL 4A7VA 2WIIA 4EPSA 4UUJA 1I8KB 1OB1B 3CCQV 1JFQH 1MFAH 3QORD 1QX1A 2OYMA 3RX7A 5DUBA 2A74A 3WJLA 5E1AC 3CMEV 4BE5A 3ULUL 4YJ3B 1FZKA 4EZMA 1B0GB 2NNUA 4PCYA 1BVOA 2BSRB 2D3JA 3PE9A 5C08E 3ZDYF 1UG9A 5E1QA 3N85H 3REVA 1BZ7B 3PXJA 3EGXA 5BRQA 2WXQA 1NJ9A 1IKFL 1QD0A 2VE6B 3BP5A 4AIEA 5IJDC 1V3JA 1Q6IA 2VXQL 4M48H 4AGNA 4NNPH 4MSWA 3KYKL 1TQSA 4DW1A 3DIFA 1EJOH 4XC1L 4MZ2A 1YF2A 4JLRB 1MG2C 2PI4A 3QIUC 4BGLA 1U8JA 3R1GL 1J9TA 2NSQA 4WHTB 1KCVH 1OB0A 3BPCA 1M9SA 2MHAA 4JVWA 4JKMA 4P4RA 3PF2A 4BA8A 4TQHA 1EXGA 4M6ML 1S9KC 1RERA 1XGUA 2DQ3A 2EDWA 2P5WE 4J3BA 2QELA 2LFSA 3F7RA 4C55A 1NC2D 1WVZA 4W93A 1YPZB 3ZX6A 4BKLA 4WAFA 2WNWA 4RGNC 4WKZA 1VCBC 3KYMB 1F13A 5EBWC 3VDBA 1A14H 1QHTA 2VERA 5HGGS 3SJVE 4EAEA 4ZFOL 1QYGH 1BW8A 1WAAE 1OCCC 2NY3C 3V5HA 2BFGA 5DQ9A 4PJDF 3O9WC 4JKNA 3BGFC 5EF3A 1MVUA 3QDGA 1V7NH 4FFYL 4OCWH 4V1DE 5FM5O 4F37F 3MOQA 2WJ5A 5CLXA 1JGVH 1YEHH 2R69H 3IFLL 5DTFA 1DQQA 2YD2A 2VC2H 4F8QA 1JZ4A 4P5MB 3S3BB 4DV3B 2VN3A 3FQNA 4XPHH 2B39A 1N33O 1ND0B 4NN6C 5E6IA 3F12A 3HI6H 1GZHC 4N3TA 2OMTA 3PABA 1HSAB 2OMUB 5E5MA 3RZCB 4NOFA 1ZVYA 5KYXA 4YFLF 3WDJA 3PDOA 4PCKA 2D3NA 1F7YA 5KX5A 3RYCB 1U8OA 5IY5B 1MRCH 3ARBA 4L8JA 4G28B 1EXUA 5CEXA 1HZLA 3NIFB 2YIBA 2JV6A 4GNKB 1KMG