2EIJB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 63
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eijB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eijB02
4KNTA 2YAPA 1IBZA 4AI7A 1JERA 1OCOB 2PP8A 3IN2A 4MFHA 4AZUA 2QDVA 4YSRA 1JXDA 2AANA 2QPDB 2YXWA 2XX0A 3GXUB 2XV2A 1XMEB 1W6LA 2W88A 4BWWA 1BYPA 3AG4B 1E5YA 1AG0A 3AZUA 1EHKB 3JTBA 2PPAA 3OD3A 2A3TA 1ETJA 1GS8A 4JHVA 1GR7A 3NJNA 4NB7A 4P5SA 9PCYA 4Q8BA 2OCCB 3ABGA 4YSSA 1AZNA 1GY2A 1XB3A 2VMJA 1AZRA 3ABMB 1IC0A 4HCGA 4YSPA 1PLBA 1AIZA 2PPCA 1MZYA 2HRHA 2EINB 1HAWA 1SDDB 1OE1A 4DP6X 3ZBMA 3V9EA 1AZUA 2JKWA 2IH9A 4A2GA 4YSQA 3NJGA 4GXFA 3WKPA 4YVUA 2ZXWB 3CDZA 1NPNA 1SHXA 3UGEA 1RZPA 1HFUA 3S8GB 2WO2B 2FT7A 4A68A 3FYIB 1RKRA 2IAAC 2PLTA 1AANA 3X1NA 1SF5A 3PAUA 1IBYA 1N68A 1NIEA 3G5WA 2UXGA 1TU2A 1DZ0A 3S8FB 4DP5X 3SQRA 1A4AA 2VSKB 4KO5A 4YSOA 1TEGA 3EH4B 3QJUB 1BQ5A 1R1CA 6PAZA 1JZIA 3NJMA 3WG7B 2TSAA 3D12B 1L9TA 1ZIBA 3FU9A 1ILSA 1J9SA 2JFCA 1BEXA 3IEAA 3PXLA 2AZUA 2BWDA 1AS6A 3UADA 1NPJA 1PZAA 1PZCA 3QJQB 1KDIA 3OMIB 4KNSA 1SF3A 2Q9OA 1JZEA 1JXFA 1AR1B 2J5WA 1BAWA 1WA2X 2MTAA 3X1FA 4YSAA 1WA0X 1W6WA 1MG3C 3KW8A 4F2FA 1SHWA 3IE9A 1QNIA 4G7RB 4PAZA 1X9UA 3T6VA 5B1JC 1FWXA 1V10A 4A66A 1M56B 3X2QB 1JVLA 5IY5B 2DWSA 2XXGA 4KOCA 5E9NA 3KW7A 3TASA 2XU9A 2QPEB 3GDCA 5I28A 4G70B 4G71B 3SBPA 3QJTB 2EIKB 2YARA 4E9SA 4E9XA 2IWFA 3ASNB 2NRDA 3NJIA 4UF7C 1W8EA 1URIA 3QQXA 1J5DA 3CZUB 4YSEA 1J9QA 2FT6A 2VM4A 1PF3A 4DP2X 2GSMB 1CC3A 3AG2B 1A4BA 2B08A 1V54B 2IWKA 3SBRA 4G72B 2YAFA 2DY2A 3TU6A 1DYZA 4YL4A 1XB8A 1SNRA 3H4HA 3UABA 2XVBA 4W1TA 1L9QA 1JZFA 2FT8A 1KCBA 1NINA 1AAJA 1ET8A 1AACA 3T6ZA 1JZGA 3WI9A 4HCIA 4DPBX 3PAVA 3T71A 3FSAA 4GP5B 4CSZA 1MDAA 1A8ZA 1V55B 3NP4A 4E9QA 1PNDA 2UXTA 1ASOA 2OJ1A 2W8CA 3OM3B 1A3ZA 1NTDA 1PLCA 2N0MA 1QHQA 1KCWA 2TSBA 4KOBA 2J57A 2IH8A 3TBBA 4G7SB 2DWTA 4E9VA 3FSWA 2YAQA 2UX7A 1GSKA 3OMNB 2XX1A 1GS6X 4RH4A 7PCYA 3FS9A 5I6PA 2FQEA 4DPCX 4E9YA 3FSVA 4YSUA 1JVOA 1ET5A 4NERA 3ZX1A 3AG1B 1OE3A 4A67A 4HALA 1KV7A 5I6LA 2GC4C 2HZHA 3ERXA 3DIVA 3N2JA 2Y1AA 1GW0A 1BQRA 2FQFA 2UXFA 4F2EA 1NDTA 2VM3A 3AY2A 2HX8A 2XLLA 2R7EA 5I5MA 3NJHA 2EIMB 4F7KA 1E65A 2XYBA 4KO9A 1BXAA 1KDJA 5F7AA 1ID2A 2E86A 1GYCA 1M9WA 1OF0A 1RCYA 2GHZA 2I7SA 2PP9A 4DP7X 3N55A 5B3SB 4A2DA 5B1AB 3WNJA 4TXVB 3FYEB 4P5RA 5ANHA 2PP7A 1GS7A 2BW4A 4A2EA 3CG8A 1AZCA 3OQRA 3T6XA 2J56A 3EH5B 3ZIYA 5B1KA 3EH3B 5I26A 2GBAA 2Y69B 1T5KA 4GP8B 1PZBA 1JXGA 2BP8A 2XV0A 3H4FA 1JZJA 3IN0A 4DP0X 1KYAA 3FPXA 1AS7A 4PCYA 3SBQA 3PCYA 1X9RA 3ASOB 2B3IA 1M57B 1IUZA 1KBWA 5B7EA 1HAUA 1UATA 5EHFA 1ZPUA 2I7OA 3QJVB 4AKPA 3NYKA 4HHGA 3JT2A 4FA7B 2ZWNA 1RZQA 1F56A 4HHWA 3UAEA 1PNCA 3WKQA 2J55A 3CVCA 1PAZA 4JKNA 4KO7A 5F7BA 2GIMA 2H5UA 3RYMA 5TK4A 5I6OA 2YAEA 3PPSA 1OCCB 2HRGA 5PAZA 1JOIA 4DP8X 1J5CA 4BXVA 4W9ZA 1NIFA 2QDWA 4BXSV 2CALA 5FC9A 1BQKA 1NZRA 4GYBA 4L0PB 3T9WA 3TBCA 6PCYA 4HZ1A 5LDUA 1AZBA 4DP9X 2BP0A 2GB2A 2X88A 3FT0A 3BQVA 2YEVB 3EHBB 1ASPA 5I5IA 3MBWB 1PMYA 2DYRB 1L9PA 4M3HA 3X1EA 4YSCA 4YVNA 4QLWA 1BXVA 1GY1A 4N4YB 4BWUA 2AZAA 4BK5C 5AFAA 1EZLA 5TK2A 2Q5BA 4YSDA 2UX6A 4BDVA 4HCFA 1PLAA 1OCRB 4NAJA 1J9RA 3AG3B 3NSYA 4M4RB 4E9WA 2PCFA 1KBVA 3NT0A 3NSDA 3T6WA 1PY0A 2HX7A 2PPFA 1KGYE 1TEFA 4WTQA 4CSPA 2P80D 1NICA 4AX3A 2BP0B 1NIAA 2FQGA 3QJSB 2FWLB 1MG2C 2HX9A 2EIJB 3DTUB 3QPKA 4KNUA 5B7MA 2H47C 3TA4D 1IKOP 3WIAA 3HEIB 3DKHA 3NJFA 1WS8A 1SFHA 4FAAB 2CUAA 2JXMA 3PLYA 2BW5A 2IDQA 2FNWA 4WKXA 3CVDA 2EILB 1AS8A 3CVBA 2WO3B 1ILUA 3S3BB 2IDSA 2IDTA 4DP1X 5D4JA 4HAKA 1J9TA 1ASQA 1A4CA 2HXAA 2WSDA 2YQBA 4E9TA 1YLBB 2YAHA 3NJKA 4JHUA 3X1BA 2X87A 4EF3A 2XXFA 5AZUA 4UAHA 3FSZA 3IBOA 1NWPA 2PPDA 1CYWA 5PCYA 3ZDWA 3FQ1A 1I53A 2YAOA 4GY4A 1OE2A 2MRYA 1OOWA 1NIBA 3NSFA 5I6NA 1QLEB 5D4IA 2LLNA 1AG6A 3BVDB 1OCZB 5I6MA 2IDFA 3HB3B 2FJSA 3V9CA 2BHFA 2AVFA 4G7QB 1FA4A 1ZIAA 4UANA 1ZDQA 3NJLA 2CJ3A 2CBPA 1ET7A 1L9OA 2VW4A 4DP4X 1OV8A 1TKWA 2CAKA 3L45A 1E67A 2PPEA 5B1JA 1L9SA 3X1GA 2AFNA 4E9RA 2PCYA 3FQYA 5I5JA 2OV0A 1L9RA 1PCSA 2GC7C 2RACA 4AKOA 4AKQA 4BWTA 4N8UA 1SFDA 3ABLB 3PAZA 1WS7A 3NJJA 3S3CB 4A2HA 3H56A 2XV3A 2BP8B 1FFTB 1ADWA 2DYSB 3NSCA 2UXVA 2ZOOA 1VLXA 3C75A 2VW6A 3UACA 4ZK8A 2DV6A 2IWEA 4K9JA 1BYOA 4GP4B 2FQDA 1WAEA 5AKRA 3FPYA 4ENZA 2XWZA 2H3XC 4HIPA 1ZDSA 4A2FA 1AQ8A 1ZV2A 2VN3A 2BZCA 2YXVA 8PAZA 4BDVB 1SDDA 1WA1X 1NIDA 5B7FA 5D4HA 3UAAA 1CUOA 3WNIA 3NP3A 3FU7B 3QJRB 4DPAX 3OMAB 2VSMB 2IDUA 2P80A 1CYXA 3FU8A 5B1BB 2GI0A 2XUWA 1CURA 3AW5A 3S3DB 1SJMA 1N70A 5A7EA 3FQ2A 2ZONA 2QT6A 2HLEB 1AOZA 3ABKB 3EF4A 7PAZA 3GYRA 5I6KA 1MZZA 2BO0A 2BWIA 3MX0B 4X4KA 1NWOA 3U25A 1A65A 1JZHA 2BZ7A 3CDZB 4Q89A 1B3IA 2VW7A 2CCWA 1E5ZA 2YAMA 3FU7A 4KO6A 1XB6A 4YSTA 4QKTA 2FTAA 1E30A 1BXUA 2R7EB 2I85A
chains in the Genus database with same CATH superfamily
4GW1B 4KNTA 4O2FB 4F8QA 2VR4A 2EZ0C 4JX0A 5TDNB 3C6EA 3EYQD 2YD9A 3UTSA 1OCOB 2AJUL 4F5CA 2G0LA 2Z0UA 4JZNB 3KWUA 5AW5B 3UROR 3UZEA 1RZ8B 5AD0A 4XP4L 4YSRA 3GM0A 5C0DA 1X4XA 1IC7H 4ACPA 3K2MC 1CGYA 2VRKA 1W72L 3U0ZA 2UXDB 4HMCA 2DLEA 5A2IH 1UM4L 4PJ5E 5FUOL 2DE0X 1BYPA 1OL0A 2B1AH 2BY2A 2BIPA 2NY6B 3OKDA 5KMGA 1ZA6A 2YOCA 4ZMXA 5L4JA 1AKJA 1EV2E 4LCYB 2AXFA 4ETQB 4F91B 1OY3B 3OLGA 4ZTOL 1N6UA 3ZJAA 4JNXA 5BVPH 4XNQA 5FDWB 4PJEB 3CXHK 2AJZA 1WBZA 5HGAB 2XTJC 5E9AA 3NJVA 3FQNB 1U8OB 3PABA 4LDLB 3M7FB 4TKWA 3NIFF 1OCOC 5EV7A 5E08L 2VQUA 5A2BA 4NTWA 1MH5A 1GY2A 4LAJH 4FMVA 4X9HA 4XVOA 3GIVB 3LX9A 1MZYA 1F4NA 2HJFB 3QQ4A 1HAWA 4R7DA 5DVLA 2PWEA 1ZHKA 2F4VB 1Q72L 3WDJA 3SGJA 1IEBA 1ACYL 2JI2A 3ULSA 4X9IA 3C6LA 2XBZA 2YBRB 2VDOB 4UYQA 4BUHA 3UT5B 1BWWA 5J56B 1NPNA 2LP7A 2X40A 3I6GA 1I5YA 1S8DA 3N1MC 3DO7A 3B9KD 4JI6B 1W9XA 4PJXF 5CU9A 4WIQA 3PHOB 5CAYB 12E8L 1KIPB 3H9SA 3KGTA 4H5SB 5E5LA 5E8EB 3X1NA 4HKJA 3N43F 4P9OA 1EXUB 1NIEA 5CSBA 5LKNA 2R1WA 35C8H 1TO4A 4QRPB 1AXSA 2EDQA 4PLJC 3R4DA 3EGSB 1R6VA 3E1F1 4HIQA 1WP6A 1R3IL 5FLXN 1BCIA 1YNTA 2D7TH 4YSOA 1XEUA 4QHUA 1PY4A 4AMWA 1ZLZA 5EOQH 5FW7A 2ZWKA 1MIEL 3FH5A 3QUYD 1XO8A 1OAZH 1WQVT 5HD8C 3B2EE 5KVFL 4N6RB 1Z9PA 4LNRA 3O3AB 5EU4B 5FGCB 2CH8A 4KUZH 3OHXB 1PZAA 3BD3A 3D09A 1QSVA 2J5LB 4ICWA 4AJYV 4YJ2B 5IWLA 3FUHA 5LXVA 4S1SL 3WFHB 3D2UB 4Z8FH 5D96C 2CH7A 1S3RA 4P9HC 4ZNEE 2MTAA 3JD2A 1WA0X 4XI5C 1QLEL 3K6FA 1TZ8A 5J1SC 2AJVL 1VADA 3IE9A 3L08A 3Q5TA 2EYTA 3D0VB 3FT9A 1T22A 1D3CA 5EO9A 4LFHG 3TGUH 3WFHA 3DSNB 2F08A 2O5XH 3DX6B 4X6CB 3VFSB 1OP3H 1B06A 3G6BA 3LEVL 2P44B 3QO5A 4G70B 4N0CC 1R3KA 3SBPA 4NZ8A 3NABH 1PP9H 4UOZA 2CGZA 3PWVB 4IBSA 1OZUA 4UF7C 2B15A 1W8EA 3IT8D 3OR6A 3GF8A 1FVEA 2AJSH 1GOHA 5L0QB 4LNUB 2SEBA 4MVOA 2Y3AA 3RGVA 4UT7H 3UTZA 4EOWH 3ZQXA 5HPMB 3TH4T 5J7CC 4OJFL 1A4BA 2E6PA 4FKKA 4Y4HD 4JG1H 5BRZD 2ADIB 2OMUA 5AAMC 1RUKL 2CDYA 4LARH 1KIPA 2ZIDA 3H9SB 4HSQA 1IEAA 3WKYA 3AM8A 4RESB 2QV2A 1NAML 2B59A 2GK0A 2DH2A 3NRPA 1T21A 2W6JG 1AAJA 5EYPA 3C87A 2QMJA 1DQLL 1YJDH 4FLRA 1X3DA 8FABB 4CL7A 5GTIZ 1UWEL 3L17A 4NZDA 3FFCE 4RGND 3SGJC 1IVTA 1OM3L 4NQCE 3GUTA 2W60B 5D6CA 3T71A 4BFFA 3L13A 1MDAA 1RZKC 1V55B 3FD9A 1YEHH 4JL2A 5E0QA 2YC0A 1AQKH 1IDSA 2XZCH 2ZWLT 1O9WA 3JV6A 5IQNA 4JI2B 3VXOA 1PLCA 2HVBA 3ZRCC 4X1IB 1KYDA 3FULA 4CVZB 1UKQA 1QO3A 1FXVA 3ES6B 3P4OB 5EC2B 2JB5H 1GSKA 3GVMA 3O9WC 3ZKMC 4E42B 4E9YA 5K1XA 5GW7A 1AKJB 1JVOA 35C8L 4I0XA 5D5MA 2XTJD 4OF3A 3OKDB 5D1XD 1OE3A 4Y5XC 3IJSB 1KF9B 4UINL 5I24A 2H0FA 1LEKA 3RTQC 1KIRB 2XN9D 3ERXA 2J6WA 3VVVA 3SJBC 2QHLA 5I2IA 3CVHH 4DKDC 1JVKA 5DURD 4P3DB 1TPXC 1PV0A 4U1GC 4N9GA 1A02N 1QSEE 5CKAA 1KYUA 5IG7B 4X99A 2N7SA 1KDJA 3IM1A 1CR9H 1Q1JH 4DP7X 5C07A 4R4BA 4DKTA 1REIA 1JV5A 3DJSA 4GRWF 5A3ID 5T5NF 4Z77A 1UT1A 4MMYB 2JCCB 5MP6H 3ZHSA 5TF0A 4KL1A 3AJ7A 1XX9C 3T3MB 4DO5A 4KHXL 2KDGA 4LMQE 2XAHA 3WGVB 4A2EA 1N36B 4PJ5B 2FHCA 3BW9A 2QWOB 4PTUA 3ZN0A 3EH5B 3HMWH 4FP8L 3RE0A 3HZMB 5JXAH 3QI9D 1SEBB 1JZJA 2A0LD 1S9WA 5CN3A 1F2XK 4FQQA 3TBTB 3E6FB 3SBQA 4KTYA 5T3XD 3RZCB 5MERA 3ASOB 3SJVD 4EVNB 2G3XA 3TVMB 3CVHB 3CZJA 1X5YA 2NY7H 2LFGA 4QRBA 1DUZB 1YEHL 3EXLA 3V4UL 5E6ZA 4JPVL 3MU3A 3EOTL 4NZRL 2VXTH 2NZ1A 5C0IB 1IKFL 3T1HO 1ND0A 3QUXD 3STLB 1E6OL 2ZOKA 1HNWB 3ISRA 5KJ4A 5C07E 1NC4D 3B7YA 5IBTL 3UYOD 4B9CA 3QG7L 4WWNA 3FN0H 4X6BA 5EFIB 5JHAA 4ZX4A 1OAUL 2FJHB 5BV7L 3OGCC 3FT3B 2LJ2A 1M7DA 3KDMB 3ZYJA 4KO7A 3O6LH 2XA3A 1TZGL 2ID5A 3GSXB 1I1FB 2ADPA 4G9DA 2NY3D 2Z1PA 4H13C 1ZKAA 4XX5A 4FLUA 5D7IE 4ZMOA 1ZTXL 3Q13A 3J27A 5AAWC 5DS8B 4HWBL 2LLLA 5LDUA 1F8TL 3UQ8A 2E74B 4NQCA 5CD3A 5K1NA 4G27B 2P5OA 4MMZC 1CP9A 5D1QA 4KKAD 1A25A 4Q6KA 5D2LB 3TBYA 4IMLB 1BVOA 1HWHB 2Q20A 4MAYA 4GX5A 2VQTA 4CKQA 1SYSA 4P5TB 4C47A 3ZKMD 1V54C 1AC0A 4I0CC 1N2RA 2N3JA 2Y1VA 1JAEA 3JTTA 5AFAA 2CCVA 2HJLB 4OFIA 1MWAH 5J3HC 5C7XL 1PYWA 1AP5A 4MQ7B 1J8KA 1UWGL 2NQDA 1S7QB 4U6XB 1OCRB 1M4KA 1KB5B 3HR6A 3FU0A 2X2UA 1T3FA 1ACYH 3JT0A 3PPEA 2GITB 3G5YB 4Z1VA 5BMVB 5JA8B 3DSFL 2E8ZA 3NSDA 5BXFB 1JJOA 3FQXB 4P2AA 3LV3A 5IJKC 1N4XL 4L0YA 1Z5HA 1UACH 2FKXA 1TEFA 5GS1C 1J5OH 4F6RB 1ECZA 2ENQA 7FABL 2AJVH 1U95A 1KXQA 3WKNA 4LQ1A 1K34A 1QR4A 3ZUNC 3NSJA 2YMTA 2H47C 3TA4D 1UA7A 4U1KA 1JZ6A 4J7RA 5DDHB 3OXRA 1MAMH 4AQAB 3HI5H 2OX5B 3MODH 3CZFB 3GC3A 3QYCA 3BH8B 3BDYH 4RRPM 1EEZB 1CFBA 4UQ3A 4L1TA 1GGYA 1GPOH 5C6PB 5L6YH 4J3OF 3QEHA 2VWJA 5JOFB 1C08A 1IBLB 1KPRB 3CLFH 4OLXH 4DR7B 4M7LH 3VWKB 5ABDE 1AI1L 2JVUA 3FDWA 4YIQB 3TO2B 2V7NA 5I1HH 2Y06L 4LLAA 4AGMA 2K3HA 4KKZA 3BKCL 3TCXA 4OI7A 1P7HL 5DEGB 4P5TC 2UYLA 2XXFA 4UBDC 5EU3A 1MW3A 1ZWIC 1G1CA 3ARTA 3KM2A 3N40F 4HPYL 3LKNA 1BP3B 4LCCB 1AC6A 4QYOB 4A7QA 4JFOB 2CKBB 1NIBA 5I6NA 1KZYA 1BEYH 5D4IA 1M2OA 3TESA 5DJ2B 5JA9A 1B0RA 2RGSA 3X2QC 4JZOB 4S1QH 4MASA 4AEHH 4JPKL 4DV7B 3ETSA 4XMPL 3VG0H 2IBGA 3GI9L 3U7AA 1CDJA 3VD2A 2LU3A 1F6FB 4G59C 4AK2A 4P5KA 4KUCD 1V7NH 3GMQB 3ABMC 3G67A 5DK2B 5F6HI 1DN0A 2XPGB 4L4VB 1LL1A 4PJIA 2QLYA 4WNQB 1JNLH 2YA2A 3GSWB 5F89B 1IBGH 3VD3A 3ISWA 3PWUB 5T3XL 2E27H 1X5GA 3UX9B 2FO8A 1QBBA 4U6YB 2ESVE 4NP4L 2DN7A 2YFNA 4FQXB 5DHVB 4PJ8C 3NH7H 3P9WB 1DQTA 4LE8A 4U49A 3LEXA 5IBUG 4DH2A 4AW4A 1EUTA 2DQCL 4X42A 1WD8A 1S3KL 1T7VA 4R2GB 1QLRA 1FFTB 4BA8A 1ADWA 5HPMA 2UXVA 1YO4A 3KXFB 2OYQA 1I3RB 3BIKA 3SZ6A 3ULVH 3H54A 5ITBH 4YXKH 3VRJB 3BWUC 1YF2A 5GSVA 2PYFA 1TITA 4ISVB 1F3DH 4J3SA 1B04A 4NN6B 1X44A 1YIJV 3MLUH 1Y18B 4O2EB 5DEJA 4BSVB 1R3KC 3KPPB 1T5XB 2XWZA 4R84A 5DJZB 3U9UB 3S3JA 1X9LA 1HHIB 3MV9B 1BOYA 4A2FA 5B8CB 4LLVA 1G6RB 4M8UA 4XB3A 1SJHA 4M4PA 3WJLC 3E38A 1MFEL 2WUCL 2YXVA 4PWJA 4LQFL 4TSBL 5GRJH 2F8VA 4O4IA 3MJ8B 5TE7H 3IMRA 3HS0A 2C1PA 5DJAB 2WCPA 2HVKA 4UYPA 4XC1L 3N5AA 3QNZB 2H3OA 1MFUA 3P0YL 4QGYA 2DLFH 3AUVA 4OIBA 5B1BB 1JGUH 2X6CA 3HRPA 5ANMA 2XUWA 5HBBA 3S3DB 3Q43A 4ISVA 2BZDA 2AV7B 1HNYA 3BXNA 3HG2A 4LCUB 4X5PA 1VQ4V 1AGFB 3GMRB 1RH8A 2V2WA 5B3SC 2Y2YA 5JNYB 3JALB 1HHHA 2QPFA 4JO2L 4CS4A 3GBLA 4JFDE 2VKXA 5DI8A 3FB8B 4MJHA 4WI0A 1XL4A 4ZI7B 1LO2H 4L5FL 4HFWA 2BWIA 2QFPA 5SWZB 4DV7O 4N0YH 1X6NA 3PL6B 3LDBB 4FFVD 1Z9MA 4RUEA 2C9XA 2JJTA 3QZWB 3BD5A 3HFML 1JBJA 3K5NA 4OPHA 3K2IA 4B7KA 1DANU 4F80A 2FTAA 2W0FC 2DQFB 1RUMH 1EO8H 1E6JH 3PWUA 4NS0A 4ZOAA 1UM6L 1N0JA 5DRZB 3UOAB 3VYNA 4IBYA 3GRWH 1QHOA 5BV7H 4AENB 1OGPA 3A6CH 4Q20A 4X20A 4GKNB 1DN0B 1KY6A 5EU6E 1PZDA 2JK5A 4HG4K 1SYVB 2NW3B 2QADB 2I27N 25C8H 4P5KB 4JK0D 1NGXB 3BP7A 5T33H 5EIIG 2JIXD 3GMLB 2HPTA 1YQ2A 2NXYD 1ORSA 3A2FA 1UURA 2Y72A 4K4KA 2ATKA 3EJRA 1U96A 3MJWA 4V11A 2Y0SA 4QXVA 4ZS6C 5GJSL 1QVOB 4N2HA 2BSEA 2GJ6A 4GBXD 2COQA 3DUSA 3EYVB 1BJ1J 4NHCL 5MI0C 2O6PA 2WBJD 3BSZH 1UOVA 2C7UA 3SKJL 5F9WC 5MEQB 2A3TA 1WGVA 1IU1A 1T7XA 2O5ZH 1Z1WA 3ZVVA 1ETZB 1L0LH 4XOCA 4PA4A 3FX7A 4YHMH 4X4YB 1H2NA 5CA3A 3DO3A 3F7QA 4IGBA 4KJWC 3BT2H 1VENA 2G9HB 2NR6A 2H3NA 3QJXA 4YSPA 3RWDA 5I0WA 1PLBA 3MGTA 5IFAL 1UWGH 3S3XA 1KKCA 4ALAC 1SDDB 2X1PA 2ZCHL 5J6GB 1PSKL 4NO3A 1DEEB 1FYTE 1YEIH 3LEYH 3QG6B 3LS5L 4UM9A 3HG1B 4XXDB 1RM1B 1MFDL 2P8LB 3BH8A 2KHAA 3WIHH 4EXPX 4GKSB 4WCYH 4EZLA 3IU4L 4YWGH 3TPUA 4TL5A 4R97C 2AXGB 4WW1A 4A68A 4KRPB 2FJUB 5SWSB 2FUTA 5MEOA 4H8PA 4A6YH 1IM9A 1BFOB 3OKYA 3SOTA 2HT3D 4LU5H 4FZ0A 2FWUA 3T0EE 4G43B 3CAFA 3G5YA 4I0PD 2QVMA 4DP5X 3MCLL 5CJXA 1C5CL 2HHHO 1ORQC 3WXVH 2GAZA 1F00I 5IB5B 4PJEE 4MQ7A 2F53B 3LDDA 2CDEA 2NY4D 3Q1SL 3WG7B 3ZBHA 3MBEB 4ERSL 1PFOA 2JIXB 4IOFC 4NZRH 4DGIH 2GT9A 5AW8B 1US6A 3FC8A 4YDKH 2E4TA 1AS6A 2EUXA 3GZPA 1EBAA 2Y3NA 4MAYB 1BQHB 3BUTA 4G9FB 3ZDZE 1W15A 1RZGA 2LV4A 4KHTH 1HNWO 4FG6D 4BUQA 1MNGA 5JORB 4NQCB 5CD3B 3SJVE 5I1AB 2R9HC 1XCQB 2A9MH 4IL6Z 2NY5C 3B5TA 4N90D 1Q9LB 4U6TA 4EI6A 4P2RB 1I0HA 2RIKA 4TQDA 1DQVA 4AVHA 5E8NB 3NFNA 5FXCH 5IW1A 4Q52A 5GGVY 5B38B 1E1RG 3TIEB 4JDEB 4ZAKD 1SQQH 1YTFB 1VEMA 5BZXA 2HWZL 2XWEA 4TQPA 1J18A 5F1KC 1G0DA 1YN6A 3Q9PA 4OQTH 4GLRI 2FIKA 4WF7A 2RCSL 3DX1A 4OLYL 2EIKB 4H1LA 1ONQA 2FLMA 4DGVH 2IWFA 1YY9D 4H40A 2R4RL 3LXBA 4NC0B 4Q7DA 3E22B 1WCBB 5BO1H 3EGDB 5L2KB 3QUXA 4NM8H 1I1AD 1FFRA 5CCKL 2ZCEA 4C55A 2PWGA 5EUOB 3N0PB 4G6FD 3N42F 1DVFD 3HBPA 1ZA3A 1ODUA 5T1KD 3UZQB 2H26B 5C0AA 4A6YB 4X66B 3X14B 2CDFB 1DJHA 2Q3XA 3DDFA 4K3AA 5ICYB 1DYZA 3HZMA 1SVBA 5ID0B 3QAZC 2NLJB 4HCRL 2VSDA 1YYML 1XNRB 1DQDH 1JWMA 3IMTA 2OSLA 1PCXA 1WIOA 3Q2CA 4FM2A 5CHNB 4G9FE 4XE5B 1UD5A 1U3HD 5F71A 3LQZB 1AR4A 2YIAA 3MZGB 3CC2V 5FCUH 1INEH 4M6NL 5IJ9A 4L2LA 5IFJA 1MCNA 2IBZY 2D8KA 1FNGB 2XASA 3CFKA 3UAJC 3FSAA 3DC5A 5IJ0B 4R4ND 5FOBA 2MOGA 1NLBH 1JXKA 2AEQL 4PRPD 3EOBB 1BM7A 3QJFA 4UQIM 3G6JE 1AYOA 4D9RE 2JLPA 4YOKA 3AEIA 2DYSC 4MSWB 2BNRE 3TFKC 3DGGA 2ODMA 5DZ9A 4LHUG 2FO4A 3M1BA 1E8WA 4BQCA 1XBRA 3PRZA 5FNVA 3BO8A 1A6AB 4NO0B 3B09A 4YBQD 3CFEA 2BIIA 1K2DB 4DR1B 1UWXH 3B5GA 4DUYO 2H32H 2IPUG 2NW2A 5CZKA 4N8CH 2UZIH 1A1MA 3ZDXB 1AHMA 1ZV5A 5D7JA 3V6OA 1XCTB 3CFCH 1G5AA 5C97A 2HZHA 2DQHH 1AXIB 5TTRA 1FRGH 4NGHL 3QT2A 5BR8B 1UH3A 5EOCH 3U7WH 5LUMA 3Q8EA 3GMOB 4BV1A 3L3JA 4AZ8A 3NZHH 2O93L 1FE8H 2XLLA 4RWYL 3KPSA 3H3KA 1SRYA 4R3SA 1DBKH 3N3EA 1XF5B 4WUUD 4DFIA 4JTCB 4Y2NA 5IUCA 5J1TC 3BX7C 4GRMB 1FC1A 5F7AA 4GUPA 4KJPC 2XWJB 4DUZO 4OM0L 4Z7QF 2F1MA 4DV2B 2ITEA 4FQHB 4L3CA 1W0JG 5E2JA 2DF3A 5AYQA 3VJ6A 5CEZD 1PD6A 4PRDA 2DL2A 2MW2B 3JCZA 5KG9B 5I1IL 1OWRM 2EABA 4G2KA 2DEWX 3RHWF 3TA3A 3BUYB 2BVYA 2XN2A 4J3VA 1NGPL 4WQOA 1YJWV 2JJVA 2O30A 1GC1H 2HRPH 2ADIA 1NGZB 1EHXA 3FFQA 1NUFA 4GSQA 2FO4B 2M1KA 1IAIH 1IM3A 3LKRB 1UASA 2CZNA 3ILDA 3PCYA 1ZJBA 1AP6A 2KLTA 3CDGB 3NAAL 4H33A 4KZCA 1ZPUA 3QJFB 4QAMB 4XO5A 4JV5O 5KVFH 3TK1A 2DWDC 3MV8D 3MYJA 1EHNA 1YEFL 1UT9A 2O4EA 2ZWNA 3EHBC 4L8JA 1I1YB 1QHPA 3BDXA 4C58B 4WFFD 1AO7D 3O0RH 5AVQB 4W4KA 3RBGA 3P9LA 2BXYA 4EPSA 2PTTA 5CMUA 2UXBO 2VL4A 1ZHNB 4GO6B 4BQBA 1GM8A 1AR2A 2H5UA 2X3AA 3C5ZA 4YE4L 4FXGA 3WEMA 2VR5A 4P9HH 5I8EB 4ZSOB 1JF1A 1DQIA 1RZ7H 2A0LC 1YEDB 1IM3B 1SLWA 5IYZA 1LO0L 2H0EA 3ESMA 4X62O 3ZX6A 3I85A 3LKRA 5I1EL 4IMKA 4IS6B 3K74B 2WXOA 1AGBA 5I16A 3UKMA 4DV6O 4DP9X 2FGWH 4GW5A 1S7SA 3EFDL 3IDXH 2VNCA 3QDGB 4TVUA 1IVSA 4Z0BH 3S2AA 3LQAL 3M07A 1Y76B 1MNUH 2YJLA 3EO9L 5F9JB 1Z3RA 4EZMA 4PRDB 1DLHB 1WF5A 4XZ4A 4B3TO 1W0WA 2VE6B 3GTVA 1WUZA 2XOKG 1M1SA 1KLGB 1U8QB 5EU6B 4HWEL 4LLWB 4YXWG 1QKZH 1E4KA 1PFCA 3FBQA 2HFGL 2N56A 4Q4IA 5HDBB 1IZ3A 5K69A 5TQ0H 2VAAB 4JI6O 4LNRB 3ICXA 3KPRA 1KBGH 3WEOA 1NCIA 2VB5A 2XTLA 1NR7A 3J8F7 3GGWB 4WZ9A 5K33A 3E80A 1AMXA 2B5UA 5BVJA 5C2BH 5BPPA 2YICA 2XWTA 3GSVA 4N5UA 4EQ2A 1AR1D 3GJEA 3VI3F 1LVEA 1NH2D 3AREC 4JMXA 3T6WA 2F4VO 3V6ZB 1BMFG 1Q0XL 2CK0H 2QDOA 4UVCA 2MH4A 5BMFL 2XIIA 2IMMA 3T3PB 1SN2A 3EF7A 4O5LH 1M7IB 3DV6A 2OYKA 4ENED 1W72H 3OXSB 5DGRA 4YQXH 4Z7UA 1VQOV 2B1AL 4UMGA 5A40E 5JORA 1N12A 3I6GB 1JUFA 2HT2C 3C5ZD 3OLEA 3SCMC 3T1YB 3SKOA 4GAYA 2VUOA 2CUAA 4JM4H 4K7PH 3PLYA 4K55A 1RZGB 4NQDA 2NY6D 4K5PA 5EZJA 4ANWA 4EIZC 1H2MA 2JKNA 1OAKH 4FFBB 3PXHA 2I5YL 4OFYA 3JD1A 2IW5A 1R6NA 5I1GL 1DGSA 4PUBH 4Q6YA 4OGAC 5JUEL 4QOKB 1HNXB 3L3HA 5A2AA 3W56A 1B6UA 2F53A 1WEJH 5DK3A 1RJYA 5IK3B 3VI3B 2OXHB 4NUPA 1A21A 1XZ0A 3OPZL 2YAHA 1JZ2A 1PKQB 2R72A 4ZBJA 2X87A 3ARED 4P46C 4UAHA 1UGNA 4PJEA 5ALBL 3E35A 3O6MH 1D5NA 4ZW6A 4DW1A 5IHWA 1VA9A 4I77H 1ZA6B 4IRJD 2EILC 4QHPA 3DUHA 3H6JA 4JCMA 3DVFA 4MNQE 4NAQA 4PRBB 1JHKL 4YXHL 4M62H 2EADA 4K3DH 4W4OC 3PU7A 4PGDB 5ID0A 2AQSA 2DQHL 2HLAB 3TPUB 1HDMA 2A6DB 1TQCB 1R5WB 2WVTA 3ARFD 5I74C 3U7WL 1OLLA 4B96A 1R3JA 3NJLA 3E2HB 2PCFB 3D4YA 1C9SA 3B8SA 4XXDA 1K3IA 1L9OA 2VW4A 3AS2A 3CSYA 1P5UA 2UUBB 1JSYA 3M88A 4U1IB 4X64B 1NAMB 3KCYA 3E3QC 2VXQA 2CGNA 3EGDA 2ZICA 1VFAA 1F6LL 1ZXKA 4Z5RA 5FLVA 1VQ6V 3I02B 1EERB 3BT2L 1A2YB 1BZ7A 3EYOB 3WTYA 1AH1A 4P2QD 1URZA 1P5VB 1JMXA 1YN6B 4P99A 4DXWA 4HQQL 4JDEA 4X6DE 5AW6B 1XILA 1WS7A 4HH9A 3DBSA 3O3BA 4WFED 3EXAA 4JASA 1B4LA 3VXMA 2ROXA 4P2RA 3ZRVA 2ZP0T 5DFVC 5JW5A 4O2AA 4K0OA 2BE3A 3DUSB 3EYVA 2V3FA 2ZOOA 2VDML 4Z8FL 2GJ6B 2WUBH 4DPRA 3VW3L 3VFRA 3W5NA 2VW6A 2QQLL 3ZMRA 4NQUA 3RURA 4F15B 2ZD9A 2YPLE 3OJDB 3WYRA 1BV8A 4B3RO 2EEXA 2JJSA 3VSUA 1XBDA 2R4SH 3F7VB 1KGJA 4Q97A 3VGHA 4BZ1H 1O7SA 3GSUB 2MFNA 3UIZA 5J2TB 2JV6A 5EZIH 5KN5B 1J1OH 1A6PA 3TS8A 1BMZA 5C7ZA 1OANA 2R0KL 5D7JD 1JPEA 2VJ8A 3O3DB 1Q9OB 3MFGB 4OQTA 1MRFL 5IB5A 3BJ91 1NFKA 4KROD 3V6FA 5T5FA 2Y36H 2MQGA 3TBWB 5BO1L 5BS0E 1FJGO 3ZN1A 5CZVH 2EP6A 4I3RL 3TJHC 1BOGA 1MJ8L 4HBQA 3GJFK 5CO1A 2NDGA 4GG6F 1ZSDB 4B3MB 1QI4A 3BVTA 2CJTA 4GX0A 4XMPH 4Z7VA 4P3WA 3JALA 3S9DB 5ABZA 1SZTA 2IFFL 2ZKYA 2IDCA 1IQWL 7PAZA 3MX0B 3BXNB 1JL8A 1M9SA 2YMXH 1TVHB 1P84J 4MXWL 1SQPH 4XXWA 4M29A 3Q2WA 1YECH 4HLEA 2Z31C 3RPBA 1IV8A 5KYYB 3U0TB 4M6OH 4FC3E 5T1JA 4QJ5B 3SKNB 5FB8A 1NM9A 4O4IB 4NUGL 5IMLB 4HXBL 5AVUB 5D5QA 4J4PD 4ELME 3B40A 1I9IL 1USQA 4UOJA 5GZNC 5LGNA 1T5WB 4OLUH 2GSIA 1UCBL 2CK0L 5BMFH 2NSQA 4X62B 3H7BA 1JXDA 4JN1L 5C0AD 1J12A 3BVOA 2E76C 2UY7A 2YXWA 4ZJ9A 5CJQH 3BRGC 2XV2A 5EN3A 5MEQA 3VGGA 3QRFM 1F02I 1YEGL 5L3BA 1MAML 2CJUH 2IPTH 2W65B 5CGYD 3QEGL 4PY7A 2ZX6A 4UT6A 3AZUA 3UTTB 2AEOA 2QZQA 1A6TA 4HF5L 5EPMA 3RAJL 2X4QB 1T1YB 2YEZA 2ATKB 1AE6H 5B3JF 2HFGH 2QLVB 1HC1A 2NY2C 4K8RH 3M7MX 4DEPB 3IGAB 1KPVA 4GEJA 5DHYB 1JPXA 1OPGH 1XB3A 3I9IA 4WEBH 5T3XH 3ABMB 2CHDA 5IT2H 1CF1A 2YUAA 3LZFH 4AENA 5F89A 2VMFA 3LRHA 1H3VA 3CMEV 1MIMH 1N3NA 2EDRA 4PJIB 5MEPB 4AVJA 5H37G 2GSGA 1CDCA 5AVZB 2ORBL 2DOCA 1TZIB 4YHYC 3CHPA 3KR3H 1RUQH 1I7FA 3P3NA 1OSEA 2IPUK 2W95A 2OTWA 3JV5A 3O41B 4GPVA 1OT2A 4IIQA 4IRJC 4DCQA 2DIEA 4MZ3A 2W0PA 5C9JB 5SWZA 2HA1A 4Z2WA 4DV2O 1LDSA 4ZI7A 2YFOA 1G9HA 2ZSWB 3CSPA 3QZNA 4GQ9H 5EOTA 3ZTJH 1KENL 1MCBA 5DSCB 4TUKL 1QASA 3N41F 3GB7C 3S4SB 5EC2C 2X4OA 3ARYA 3D39D 4M56A 3TM6A 1EFXA 2OP4H 1NOLA 4IRZL 4WUUE 1TU2A 5FHAL 1JR9A 2UYLB 2EVGA 1N59A 3AY4A 3FB7C 5C0CB 2Y6TE 3P77A 4GG8B 5EH1A 4TVPE 3EH4B 5INDB 5KJRL 3FMGH 5F72S 3RVUD 1JZIA 3HJEA 4FZ8L 4LF9B 1J0ZA 1DQQA 3VD1A 1MJ7H 1ROCA 3QUMB 3KGSA 4QTHB 1KPRA 2A9BA 1H6FA 2BS8A 3KBEA 4LLQB 5K39B 3ARGD 1WRFA 2W91A 1GJUA 3IGAA 3EBIA 1YCIA 3G6EV 3U0WH 3KPMB 1RIVL 3CFJA 3N85L 3B3IA 5C0BA 1RU9H 1NLBL 3EGXB 1NLDL 4JGUA 1F97A 1SDYA 2Q9OA 4HZAA 1J8HA 1GZQA 1NCTA 3HRZC 2Y0IA 1E9OB 3HZKA 1W6WA 3KBFA 1IGFH 3CN1A 4ZXBD 3T0BA 2NY0C 2WVVB 1IBMB 4P0DA 5LGTA 1NM4A 3O9WD 4O00A 1DFBL 4X7EC 3U30B 1V10A 3N9GL 5D6DA 2IAMA 1NCWL 1LP9B 3D25B 4F8LA 4OZGA 1VPOL 4AV0A 5FF6B 3PL6C 2HP8A 2HT2D 1M7XA 4Z7UE 2OZ4L 3RVWC 2ZD0A 4A7VA 3LS5H 2WVSA 4C56A 3KR3L 1MRCH 3K71B 4AVKA 3EJYD 5CEZE 1WBYB 5JW4R 4LF8B 4LRIA 4L4VA 5HHOA 3OPZH 4MAYC 1CLOH 5DK2A 3ZZSA 1HZHH 1SA0A 3GLAA 4HJJH 3BKJL 4IMLA 2XC8A 4GG6E 3V0GA 3AG2B 3DX0A 1NUGA 4N3TA 1YEEL 4XP9H 1PLGL 2FB4L 3KXFE 4JFXB 3IJEA 3MVSA 4L8DA 1B0RB 4H44B 4JO5A 5DS8A 3BP6A 5CBGA 2VM9A 4XB8A 2WXQA 2QWRB 2QGCA 2DQJL 4DR6O 2IV9A 2DBJA 1Q9KA 1W72B 4JY6B 4YLCA 4O4LA 4RZKA 1OSPL 1Q5OA 5HHQA 4KUCF 5JZ7C 1RZJH 4HUVB 2Y1YA 4FLQA 1MJ7L 4NQVA 5DEGA 1Q9OA 3K57A 3MREB 2CRZA 3WB0A 4FG0A 1G7MB 3O4LD 1DVFC 4DO4A 1UUSA 1ZLDA 2EIKC 5J2TA 5KN5A 4WFGD 4XN7A 1PJ9A 1WFTA 1F58L 1MRDL 2OJ1A 2ARWA 2Q7YA 5JCOA 5LCVH 3RX5A 1IAII 2B14A 4LSRH 3QYNA 4LRNL 3FH8A 3FO0L 3A23A 3T65A 1Y0LA 2ARJQ 5EC1A 4M5YH 4Q9QL 2EYSA 5CMAA 3S7GA 1CLZL 1P7KA 4KI5E 3CUPB 1X9QA 3KZIZ 1ET5A 4PRAB 4O2AB 5EWIL 4A39A 1S7VB 1EHLH 4NCDA 1R3JC 3F5WA 1NEZB 5B39A 3VXMB 1WVZA 3GSNA 4N2KA 1B0IA 2XKSA 4I9WE 4DVBA 4F6RA 3WFDH 4HH9B 2NNUA 4NQSB 3PREA 1N67A 4P2RE 3LMJL 7CGTA 2Y1AA 3IDNA 4AYID 5JHDA 1A7BA 2AW2A 1SKVA 3BRFA 5JPNA 5H5NA 1TNNA 3H2PA 3DV4B 3C2AH 1TFHA 3QDME 2BCKA 1E65A 4QRSB 2OSYA 2H6PA 3B37A 1G9NH 1RUPH 2XPYA 3S48A 1OF0A 1XH3B 3VXPB 1A7QL 3MHZA 1YN7A 3CH1A 4P2CG 2Y06H 1R3LC 4JTAB 3BWZA 4Z7UF 2I9LB 1R5WA 4FMTA 2V0AA 2XZZA 4G6KL 4ZIBA 4GAAA 5EIQA 3SGKC 5EUOE 5G55A 3F5WC 1YEGH 4OZFH 3D05A 3BH4A 3ATEA 4U6VL 3T8MA 3ETBJ 4BH8B 1X5LA 2YD8A 2X1QA 1C12B 2ZNIA 3KBPA 3CSFA 4UTBL 4MNGA 1VCBC 1J48A 1NC2A 3V0VA 1MCCA 5FUCE 1INEL 2Q73A 2XOTA 3JWDH 4R6ZA 2NX5D 3DBXB 2HT3C 2DRUA 1QO3B 3ES6A 2P49B 3GJFH 3KM1A 3MRQA 3O9WA 3IRPX 1V05A 1A7OH 1J8RA 1IBMO 4PM1A 5EU7E 3RWHA 1E42A 1KBWA 2NNRA 1LWJA 2ZOLB 3GSXA 3KJ6H 1RV6X 4FNSA 1M7DB 4CSTA 5CGBA 3IJ7A 4Y1AE 4AQ1C 2WY3B 5IFHH 1GRWA 3L9DA 1TT6A 5E95B 2RAMA 1DVFA 2AXJA 2X10A 3T08A 2PI4A 3ZXAC 5ALCL 4JPIB 1ZT4A 4HISA 3EBHA 2QTOA 1DUZA 2JEXA 1DR9A 4EVNA 3IJ8A 4YN3A 1PIFA 5HI4D 1A3RL 3E6FA 1NIFA 4J3OG 1NFIB 4FQLH 5D9SB 3RWCB 5IF0B 2CTWA 4XNUL 1XWVA 1I9EA 3D7PA 4Y2DA 3TBCA 4FFZL 1D7BA 3RL1B 2BP0A 4QO1B 1V5JA 2X88A 3BW9B 1HCFX 2B2XL 2ALWA 3U36A 4N3UA 2R0WL 4A1RA 1OTUD 1R6KA 1AQDB 1D6VL 1TTRA 1JHKH 4MDJB 4XZUB 3OHMB 3OKNA 5J5EA 3PJLA 1ED3B 2GIYA 3DRTA 1FVEB 2PMZA 1L0PA 4KRMB 2Y4UA 1CYGA 3PWVA 2VDKL 4GQRA 4Z78B 1OP5K 4N0UA 3TJTA 4OT1L 1F58H 3BAKA 5SWZD 3LRLA 5JW3L 2WLIA 3GSOA 1L9MA 3IDIA 5IEKA 4HKZB 3TFKD 4F8TA 3BKML 1R3KB 4LSRL 4FTVE 1NCGA 1G7LB 5LMUB 5LN4A 4EN3D 2WBJC 2YPLD 4NB5A 3ALXA 3IRCA 4RDQF 1NLDH 2ZG1A 4E41A 4HK3N 1PX3A 3FT2A 4F2MB 4UI2A 4ZW5A 43CAA 4DV0O 4G6AD 4K8XA 1I5XA 4NJAH 3UPCA 5T33L 3FB7A 4UZGA 5IP4A 2CLRA 3P3UA 4ZPVA 1CT8A 5LHGA 1NIAA 3BAEH 2QADD 4ODTL 3K46A 4GSXA 2HX9A 2EIJB 3QPKA 4LBAA 4ES8A 3K1DA 5D5MB 3TH3T 4U2YA 5IYZB 4JJ5B 43CAB 2GHYA 3A4DA 1ZHLB 1MFAH 2JXMA 3SQOL 3RIKA 4XMTA 1MZFA 2A73B 3MMEB 1I7UA 4IRZH 3OHXA 4N0UE 4PWIA 3L81A 3SDDA 3GSQA 3HUJB 5A6IA 5KAQF 2HYMA 1R3IH 3L54A 2BIQA 3KPSE 2IDSA 2ZUYA 1GKEA 1DANT 1TSHA 2BPBA 3CFNA 5J2UB 5CP3A 1RUPL 3IDIB 5EN2B 5EOQL 2R9HD 4QRRD 5I1LA 2A7WA 5E2TH 3L9BA 1DF5A 3FQWB 4MAUH 4KVPA 5DT1H 1IAOB 5DXWA 2OYMA 2AQQA 4GUNA 1HL4A 2YPKB 3D3VE 4GLRH 4U1NB 5CLXA 5TDOA 2F7PA 4ZFZB 1FO0H 3LH8A 4TVPD 1KUQA 1RXLA 3QDJB 5EORH 3VWKD 5BQ7A 3N40P 1F6AB 3P0YH 4KDVA 3C09B 3BUQA 1ZLSH 1KN2L 3WY4A 5I1CH 1O5PA 4BCZA 2PZSA 1JCKA 3RL1A 2EDWA 3U0PA 3MNVB 3P54A 4AL8H 2EXYD 1J0YA 3EIFA 5E5MA 5AOKA 1NFIA 3HC3H 5MHSD 4PJGF 4PRNB 3DVNB 3UT5A 1ZDQA 1B2WL 4JHBA 4LO9A 4OV5A 2Z0AA 5ESVB 2FJFA 1ID5I 3IMSA 3T0DA 4KROC 4DP4X 2SEBB 4MMXC 4WFHD 4HMDA 4JPIA 5FAAA 3DVGB 1EZUA 2C1OA 1VACB 2WHVA 5B1JA 2OV0A 2JKLA 1JWUB 3VFPB 1MH5B 5D70L 5TFSH 5F8QC 1XXFC 1FL3B 4BWTA 5E2UL 1P4BH 5ACLA 1JZDC 1PEZA 5CGMA 3FRUA 2D9CA 4JVUA 1BFTA 2BVEA 4PJ8A 4WEUD 3S88L 3DYPA 2BP8B 5ES4B 2DMHA 1W91A 1HYSC 1T0MA 4XP4H 2EH8H 3VXQB 4FZ1A 4XPFH 2X4SA 4UVBA 4NBZB 1HH9A 2ZUSA 5FYJU 4PJ8D 3UACA 4X5XA 5E2VL 4UZSA 3TWCL 1CT8B 3F7YB 4B3RB 1N6VA 5DURB 3FB7B 4DR7O 5JVDA 5JH7A 4DUWA 4LCUC 5KW9H 5GGSB 5LAXA 4M3JA 4LU5L 3WO4B 1INQB 5F88B 3AG3C 5ENWB 4DUXA 1BF2A 3K04A 1D5IH 1YVLA 4NRZB 3UYRL 3BZDA 1HILB 5TDNA 1J5IA 2WZPD 5ACMA 3GT6A 1B3QA 1WHOA 3Q0HA 5KYWB 2J1KA 4IU3A 4OLVL 1RFDH 1FNGA 1SY6A 1SHSA 2QHRH 5IMOA 4JI1O 2R23B 4RAUA 4Z78A 3NP3A 3Q48A 1A3LL 2GHWB 4BZ1A 5SX4I 2OMZA 3ROLA 1MIML 2X1XR 5IROC 1ROWA 1JGEB 4H88L 4TUJA 1MEXL 2C9PA 5HP5A 4HSAC 3NDYE 1R0AH 4QRPA 2I9TA 4LEEA 4AGQA 1FL6B 4Y89A 5DJDB 3U36B 3V55A 4B9FA 2JJSC 3GHPA 1EXUA 2Q10A 5A2LH 1EQWA 3WUWA 3RZCD 3OKOB 4FMKA 5F7LB 2HLEB 1KIQA 1P4LB 2Y5QA 2H26A 5C0AB 2EYSB 2JKJA 2OSWA 2Z8VC 3THOA 1PL4A 1JN6B 3EJPA 2ZNWA 2CXGA 4Z0XA 3IPBA 3VMOA 3B9EA 5LMNO 4W9LC 1Q38A 4QKTA 3ULSB 3WDIA 1NCDH 4KV5F 3U4KA 4NNXA 3VXUB 2CRYA 3WLWC 3HHSA 3MNDA 2V7QG 1BFVL 1QX1A 4RRPG 2ZIOA 4NFBA 1E3ZA 2DQTL 3M8AA 4NVPA 1S9VB 3CFDA 5D2NE 1U6AL 4F58L 3ZMZA 3VFWB 2XZAH 4XP1L 4UNVA 1NC4B 1TVBA 4LLUA 4TULL 4XCEA 2CMRH 2YRPA 1WBZB 1XMQB 2Y5EA 4LSPH 4M7KL 5K93A 4IDLA 3BN9C 4X8JB 1S2EA 4MNGB 3T3MF 4LCYA 2VH5H 1VIBA 2CTRA 3JSLA 4CS2A 1OP3K 1JTPA 4Y9EA 3MRKA 2HMIC 1V7NL 3T3PF 5DC4B 4IYKA 3MC0A 1NMAL 4XN8A 4G9FA 2HTLC 3ZHNA 2APFA 5FA4B 1J10A 4V1DA 4ZUWA 3CH1B 4UWQB 2VDPL 1HNZB 2DIBA 1TMQA 5C09D 1QR1B 3VXPA 2BSKB 2R1YB 3BCFA 5IBLD 2W0KA 4KAQH 4UV4H 4R6UA 4QTIH 1FV1A 3GEWB 5L4IA 2AEIT 1NCUA 3H6AA 4YNYB 5JPNB 1KTLB 3QO1A 1I4FB 5KBNC 4HGWB 4PBVC 2V5MA 1RZFH 3O2WL 3IXTA 4F2ME 1R5VA 2YDEA 1KIUA 2A9NL 3O2DA 2DM4A 4DFHA 5I15L 2HT4C 2WLMA 1JTTA 2Q76A 3HZKB 5HYJE 5KZCD 3DXAB 4Q2ZB 1MHEA 1H9DA 4MW8A 5HFMA 1LD9B 3P4MA 4HS8L 4Y4FA 4ZDHB 2XNAB 2GIXA 4N2MA 3B34A 3T65B 1XGPB 4WF9V 4JFWA 3F00A 5GGQL 1IC1A 3SE4C 5BCAA 2K0RA 1A1NA 4DV6B 5IB3A 3CFQA 1NPUA 3NIFE 4DR3B 4QRPE 1RPRA 4JW3A 3VH8A 2A6KA 2H3NB 2P5PA 3RWDB 4HK0A 5I30H 4JVWA 1FCGA 2P1YA 3HI6L 1SMDA 2VDLB 4OCYL 4I18A 2PO6C 4Z1PA 4ZOLB 3GBMH 4P9MH 3K0DA 2MSPA 2IQAA 3CCHB 1PZSA 1EFXB 1W72A 1NANI 1SF3A 4LFCB 3ESOA 3PP3K 2X4OB 4N85A 2P4KA 2VQFO 4FYTA 4I1RA 3DIDA 3X1FA 4Y0GA 1AQHA 2Y25A 3RUGE 5T3ZD 3KW8A 3ROOA 1AGEB 3HNTH 2NCEA 1Q7YW 3OR7A 5FX3A 1E8YA 3BP4B 1JHLH 2M26A 1Y6NR 1QFWH 2YMXL 3B2MA 5FS5A 3SY6A 4EIUA 3D69B 2ICEA 3CQFA 3TURA 4Y4KB 4E9XA 4IIQC 5D2NA 4LCWE 3KL0A 3LPGA 4KOCA 4QF1A 1TSRA 3MJ9L 2P7TA 2CO7B 3QQNA 4ZX3A 1OGTB 3QIWD 2IALA 1KP2A 1RFDL 2QHRL 3G5ZB 4G71B 1D5MA 4IMKC 1A22B 2QVTA 3HMXH 2DWYA 1JCVA 1MFDH 1A7PL 2WV3A 2FX8L 1IQDB 3R0NA 1FE8L 3DTXB 2F1EA 4JGJA 5EZOL 1G6RL 4V2CB 5DC2A 4Q9CA 3QNXB 2I25N 1PY9A 2EKJA 1N7ML 4MVMA 2HVKC 1UGKA 2X7RB 3UAFA 2FT6A 1T0NB 2UXCB 1CZ8H 2OL3B 3NSXA 2FD6L 4Y4KC 5GZOA 1CC3A 4WENB 1T1YA 1FL5A 1V7MH 2XWBA 4WTWA 1F90H 5E99H 5FGSA 2FX9L 4RZCB 4IKIA 2GJ6E 2YHGA 3QORB 2ZXBA 2WVVA 3GKWH 1B4TA 1A32A 2AEWA 5HI5D 3CDYA 1USZA 1X7QA 2BDNH 3H4HA 5E6IA 3HKEA 2AITA 4UT9A 3S5LA 3RVZA 1OCWH 1J8HB 1GZQB 3QIBC 4KX9A 4ZPTA 2PUSA 4ANXA 2XG4A 4L1HA 3U30C 4JGNA 2EIDA 4L0ZA 1U8MB 3CC5B 2HVKB 1CDYA 1ZT1A 1ZT7A 1OAQH 4DR1O 3HZVB 3PGCA 2RJZA 3PFQA 3HS0B 5IKCA 1MKFA 4MD0B 4YDKL 4LLQA 5KVGL 3ET9F 1JV2A 3TGXA 1RZJC 4AQ8C 5B8CA 1TDQA 4HJTA 3BUDA 2C3VB 3FO1B 3D18B 3FFCB 2ADGB 1IGYA 1NUNB 1X5IA 2QQKL 4U0RB 3M17B 5IESH 1CD9B 4KOBA 2J57A 1K5NA 4PLJD 3GWJA 1P1ZA 3VI4F 2QM7A 2BP3A 1FNLA 1P2CB 3F7YC 1CGSL 2NYYC 2EVHA 2FQEA 4RQEA 3MRJA 3TBVB 4N6QA 1IGTB 1UYWL 2R69H 4C8XA 3BABA 2R2EB 1G9MH 3M1CA 3AREB 4NUJB 4IM8A 1MFCH 4HALA 2HG5C 1BOGB 1TLKA 4XHQA 2GY5A 3FCSA 5A6MA 4DCQB 1SQVH 2FTKA 1HESA 3CN0A 1QBAA 2FJGA 3RKDC 4YJZL 2FX7L 3AG7A 2GY7B 3O41A 3UEQA 5JQGA 5GIRA 1GW0A 3SDDD 4U0RC 1D6VH 1P84K 4XMLL 4NKIH 3NCJH 1SS3A 1R46A 3WNKA 2VR9A 1DQML 2EX3A 3GM8A 4APXA 5C8YB 2BVOA 5CBAA 5I75B 2VDRH 4K5NA 2AW9A 3NCWA 2IAMD 3GIZH 2E86A 4ZHQB 3U1SL 4JLRA 1W8OA 1ICTA 2FYUH 2LHAA 3GXPA 3AG1C 2ICES 3RU8L 3UC0H 4WTXA 4MGXA 5A3IC 4A2DA 3T2NH 1AMYA 3WNJA 1ZGLA 2XWXA 2VXQL 2IG2L 4BD4A 3UAJA 4YXLH 3W5MA 3C8DA 1QA9B 5F21B 2HFEA 2C7FA 2ATAA 3MA7B 5FYJD 5C6TH 4UBDD 2GUZA 4LHUD 3EYFA 3QUGA 3L1GA 3EH3B 4YGVA 3IPFA 4JRXB 2HJKB 4GSDH 5BRQA 4C56E 1WJ3A 4S1RH 3OWEA 2RTTA 1FXHA 3GK8H 3H55A 4QPJA 1HL5A 2UY7B 2GBOA 1OVZA 2J88L 3MSPA 3V52H 3KPTA 4QMEA 4OKVB 1GN6A 4P2OA 3FQTB 1D7DA 4UVAA 3UO2A 4XDLA 1BPVA 5D1QC 2I60L 1T1XA 2K3TA 5FV1L 3ARDC 3VWKA 4DGIL 2GCYB 4X80H 3SOBL 3BSHA 4AE0A 1ETA1 4URTB 2X4TB 5E8DH 1RIHL 3U0TA 4UCSA 3MRRB 1M7UA 1P5UB 2X89D 4IJ3C 1MF2H 4UQ3B 2OTJV 2EXSA 4LEOB 2EH7H 4OKDA 3BISA 2QTEA 3RL2B 1SY6H 1U8KB 1UQSA 3BOVA 3C60B 5C0AE 1K3ZA 5F7DA 3IETB 4XAKD 1IAKA 3VNYA 5IIEA 4MD5B 1XR9A 4YDIH 1R0AL 3CFCL 3UJJL 3SPVB 3PGFL 5A2FA 4KFZC 4LB8A 1F4AA 2KG7B 2CGOA 1EN4A 1EFQA 3L73H 1OHZA 4CGTA 1A66A 2G5BB 1KJ2H 2GW5A 4U1SB 4G1MA 3LN4B 3TV3H 4C7UA 3WHXB 2F53D 5HYJD 3LYRA 4OZHB 4XDJA 3ZK0A 3FB5C 1PG7W 5JXEA 2DDQH 3HA0A 3KHQA 4BWUA 2Q68A 5IK3A 5KW9L 2VLJA 3OUSA 3T0WA 4X9GA 5IWAB 5BXZA 2MHAA 4HU8A 3UERA 1KT2A 5GRJL 3IMBA 2VDNB 5DJYA 5D7SL 4NKMA 3FQUB 4LBEA 4NDMB 4R97B 4Q9QH 1R3LA 3CC1A 2PETA 2Z8WC 1K4CC 2VABA 1N0XL 3MLRL 4FZEH 2A5UA 4PA7A 1D6EB 5E2UH 3ZZ1A 4AQYO 1VGKB 4JN1H 4QHMA 3FF8A 3MDSA 1GL4B 1GGTA 2FWLB 4IGBD 3S88H 3VFRB 1HIMH 4FNPA 3V52L 2M8XA 3FB5A 1GIGL 1QUPA 4FADA 4Z3TA 1CGVA 3LHPH 4I9WA 5I0DA 4L4TB 1DTUA 4I1PA 3AS1A 4ES9A 1ZY9A 2CUIA 3HZ3A 2CCLA 5F3HB 4CNIB 3FOLA 4LDCA 1L0YA 4Y5VB 5DMGC 2E9GA 3FKUS 1UWYA 2Z7WA 4JY5L 1JG9A 4LWSA 4WBNA 3A0BZ 4ODUA 4RETB 4RMVA 5I1DA 3C90A 3LIZH 4YY3O 1B9ZA 1MUJA 2OBGA 4JO4H 4F27A 4HIJB 5AWNL 2Y2WA 2FCBA 3STLA 2FX8H 1TIUA 2LE9A 3AUWB 4OVUA 4TV9A 4HNAB 1K3EA 3V4LA 2PNDA 4WW2A 5D4JA 2YEQA 2VAAA 2FEEL 4K5OA 3NBNA 2F8XC 1NAMA 2E3CA 2DD8L 4QAWA 2Y7OA 3B77A 1NKOA 4LGPB 1UB5A 2WPGA 2HVJB 4J6IA 5D7LA 5D5MF 3IBOA 1QLFA 3K5SA 5IJCC 4M8VA 5DZVA 3IDUA 1J05A 3MRLA 4HWBA 5DRWB 5LYJA 4MBOA 2QKIA 4I3RH 2NNAA 1CDGA 4MD4B 2MCPL 4MVRA 5I16B 2XVLA 4YIPA 1BG9A 3S98A 3ECBA 1LO5B 1MPAL 2FJSA 4UTAL 4YHHO 4FERA 4J3UA 1HHJB 4B0MB 4XMZA 2I60H 2Z7UA 5BVPL 4TN9A 5DZJA 3QUKA 4IRJB 3DGEA 2X2HA 2JGUA 1NCHA 3TCLA 2Z3FA 3CN2A 3DDGA 5T1MB 1XZ0B 1E67A 4LF5B 2NY5L 3MV8A 2C9RA 4HP5A 2VZ1A 3FZUD 1I7TA 3IFLL 1FO0B 2X4UB 1BZKA 2WCSA 1WZLA 1RJYB 4M43H 3HNVL 5F0JB 1JX9A 4OCRH 5AAMA 6FABL 4J9ZB 3I5DA 4YX2L 4MNQD 2D03L 1ZRUA 3GBNL 2AK4D 1A6ZA 5KVEL 2O61B 2IMNA 1S78D 3FU6A 1BAGA 1SFDA 2IBZX 2ZUQB 3S37H 1GGBH 4XO3A 1LEKB 3AY4C 3BHBB 3OKEB 2FATL 4A2HA 1RIVH 1RPKA 1Q6HA 2JJUA 3EOAA 4NM4H 4GAYB 2BVQA 2X9WA 1NGPH 3CJJA 4QTFA 4XNXL 1JUFB 4J4PC 4YHNA 3ZTJG 4QRQB 4IGGA 1QLEC 4XPHL 5F9AC 4GX2A 3COOA 3CZNA 5I15H 2G2RA 1BIHA 5F7WC 3ABTA 4FPPA 1U2YA 3KL5A 4KK6D 1U36A 3OQ3B 2B1HL 4ENZA 1D5ZA 2PW2B 4XMLH 3V5KA 1CLVA 1GAXA 2BINA 1U2CA 3GZQA 4HIPA 1I7RB 5DD5H 4ZOBA 2WA3A 1MXGA 2XWTB 3GSVB 4OGZA 5FO9A 3GGWA 4OCNC 3KPSB 4M93B 1ZK9A 4ONFL 1EGJA 5JIHA 3RYHB 3W9DA 1TTCA 4OLYH 3G6DH 3RGVC 4L1SA 3DURA 5H4YA 3CX2A 3BPLC 2ZUXA 2NNXA 1PKQE 2R4RH 3GBDA 5GZOC 4CW1B 4FQLL 1YRKA 1UOWA 5ICZB 3VXUD 4GFTB 2GK0B 2YIHA 5AENA 2G2RB 5F9JA 4P23B 4BCXA 1OARL 1LO4H 1A1MB 5A7EA 5C0BD 1E5BA 1IEAB 5LG6A 2VLKD 2BSTB 4NCC1 1CF8L 1LQSR 3GMMB 3W7SA 4HMEA 3X11A 4C59B 3RFZB 3ABKB 3CLWA 4IS6A 1K4DC 2B4CL 3HLKA 4FLWA 1DBML 1RLBA 3NN8A 5I6KA 1S7RB 3WJMB 4Y5YC 2CLZA 3GRWA 1H38A 1FGVH 3SJQC 3PWJB 4LIQE 3T0XA 1OCWL 2YAMA 2WYTA 5I75C 3FONA 5FOBB 1PPJH 5AW3B 2NTFA 4CKVX 1E30A 1AI6A 2YOAA 2DLGA 4UTCA 5DCCA 2YXHA 3I75B 4F9PA 4AIEA 3ESUF 1MWOA 1P1VA 2DQUH 2I85A 2R7EB 3MV8B 4DERA 4DAGH 3APQA 3NTCH 5KJRH 4DHLA 5ANME 2DQCH 1WC7B 3CSBA 4D0CB 2PP8A 1R17A 2APWA 4OUOA 4YDJA 1RIUL 2JKXA 2XX0A 1J0IA 1LO5A 2ADFL 4JFDD 1WZMA 1K4DA 4EEQA 3BVVA 4NQEB 3GWKC 5F7KC 2E9WA 3WY1A 3GMMA 1NDGB 3QULB 5LYJB 2N74A 4TQEL 1BA9A 3GJFA 4XP9L 5EU6D 3TA3B 1FPTH 2MJWA 5B3JE 1UXWA 3T0VA 1T4KB 3JTBA 4MJ4A 1EXHA 2O5YH 2O72A 1E8XA 3EZJB 2XQBH 2PYED 3B6SB 4P5SA 4FQHA 3H3PL 3QUXB 4A7TA 4YSSA 4JG0H 5HPOA 4MT8A 2AK1L 5E70A 5T5FH 2IADA 3WTSA 1KGUA 4OF6A 4CGUB 1OAXL 5AZ2H 5JQIB 4XVJL 1BREA 2AHYA 4YBQC 3BEVA 3SODB 5CZVL 5DRXA 2XZQL 4A2GA 1FO0L 4OI8A 3B7UX 1RIHH 2O6FA 3GMOA 4KJQD 4B5EA 4FFYH 5IW1B 2ZCKH 1AXSB 1D5ZB 2NNFA 3VM5A 1NDMA 4YVUA 4MS6A 3RVXC 2R1WB 2NR5A 3IGLA 3DUUA 4I13B 4DVRH 1TYJA 3ZYZA 1WP7A 3EFOB 4KTDH 3S8GB 3TWCH 2B7DT 1BXXA 3LB6C 2H6OA 2IAAC 4DUZB 1AANA 4R50A 2EDHA 4FFYA 3WUWG 2PKDA 5GGSY 1ANUA 1EJ6A 1DJIA 3NPZB 5T1LD 5KSUB 3MUJA 4IBVA 3QFJB 1YYLH 3K0WA 2BDNL 2W9LA 2ZG3A 1FD9A 2C4XA 4BRJA 1Z9LA 1EVTC 1A6ZB 1KCUL 2F58L 4JBSA 4Y4KD 3GBNH 3CCEV 5KVEH 1CWVA 1M9NA 4JFTA 3F2LA 5KS9B 2VXTL 3AROA 3I84A 1DN2A 3IEAA 3PXLA 3C3TA 4QIRA 5ERWA 4MNQA 5FLUA 4DK6A 3BKMH 4DUYB 4OCLC 2R27A 3QAQA 5LBSH 3UYPB 3C5JB 2BWQA 3V95A 1RLWA 2BNRD 2YC1B 2Q7GA 3ILQC 3IU3A 3MCKB 3RI5F 2BNUA 4MVBC 1V8HA 2AXFB 2WGXA 1BAWA 1I75A 5CHNA 2GYSA 4LP8A 1GTOA 1FVCA 2NSMA 3SCMB 3QFGA 4AL8L 3D06A 4TPRH 3SGEI 4NSKA 4WW1B 1QNIA 4N0YL 5D8JL 1IAKB 5DMIL 4MNGE 4ZS7L 1UD2A 4GO8A 4YDVB 1JPFA 3X14A 5E4EC 2R0WH 3TASA 5D1ZD 3TF4A 4I9QA 5L3FA 3NEOA 4NO2B 4BQ8A 2QPEB 5BUGA 4TNWF 1ESOA 5T1KA 1QKZL 1EPFA 1DJWA 3IDJA 5DD3L 3SDCB 5FYJE 3WN5A 4EBQL 4HNAA 4L3EE 1KB5H 2E75B 2H9GB 3MUUA 4Y8AA 4JFEB 3VD7A 5LDSA 1AI1H 3ASNB 3NJIA 1XNRO 1I85C 4FQ1L 2PR4H 5AOZA 1ZLEA 3CWGA 4LWSB 3MRHA 3T1FA 5DQ9A 5I1DB 4YO0A 3V6BR 1PPIA 4X66O 2GJ6D 4XNXH 3KH4A 2X05A 1V54B 5MENA 5EOCJ 3ZE0B 1T04A 4LEXH 2DY2A 1Q4NX 2YPLB 3QEGH 4S2SB 2EJ7A 2YUVA 3O65A 4XPHH 1XB8A 5A7BA 5ETUB 1DQJB 1EZJA 4Q14A 4CZZA 5A2QN 3W39A 5I1AA 3BAEL 4ODTH 5TJWK 4W9FC 2QGNA 3RY6A 2HRLA 1VGKA 1OHHG 4L9DA 4E5XG 1KC5L 1XR8B 3A5VA 5HY9A 3GS4A 3M6DA 3K06A 1R3LB 1DL7H 1MW2A 4K7PL 5GS0C 4JFQB 1WN7A 3MRGA 3T6ZA 2YGNA 3EJZD 5HTSA 4HXBH 1KELL 1BVKB 5K9JH 3MBEA 3P0VH 1KXVA 4P2YA 3LRSA 2AJUH 1JFHA 4PHXA 4ABQA 4XVSL 3SDLA 4AE1A 2GTSA 4X6FB 3BQUB 4FRWA 3OEHG 2CO6A 1U97A 4JDZB 3PDOA 3AT9A 2WNXA 2TSBA 1KCWA 4W9GC 3TBBA 4G7SB 3WD5H 3VX0A 1QRNE 1WAAE 4G7VH 4XC3H 2G5BA 2V5TA 4BE6A 3AREA 3INUL 3G6JB 3O4OC 1SOQA 2WNGA 3HKZA 3Q05A 4WFHA 2XA8L 1K8DA 2GBTA 3BYTA 3TBVA 3QAZB 2HB0A 1MCDA 4FI7A 4G3YH 4FM1A 4A67A 1RVFL 4MD5A 4MQSB 4JQXC 4NXKA 1P1ZB 4OLWH 1G87A 4DR6B 2IJHA 1K5NB 4JPKH 1B3JA 3H3PH 2ZAHA 4OFVA 3N2JA 3UTQA 4RFEB 3FFCA 5DS1A 1D9KD 5I0YA 3IK2A 1BQRA 2C3VA 2I69A 3FO1A 3LKSB 1MFNA 4UM9B 5HHVH 3TBSB 2C1PB 2EDBA 3EAKA 4RISH 3VXMD 2I5YH 5E94B 5L2KE 1YJDC 3RP1A 3WL9B 4FNLL 1RJLA 2F5AH 2R56H 4P9ML 2DWXA 5I1GH 2AQ3A 3PGCB 1U6AH 5IYBO 1G6RA 4JVPA 3U83A 2DWDA 3CCRV 1YDPA 2V3DA 5DJZA 3VTMA 3FQTA 3K8LA 2IGFL 4OCWH 4GG6B 1F3JA 5IQ9A 3DRQB 4JCLA 1S7XA 3FYEB 3HKEB 2PYFB 3CX5J 1ES0A 3LOWA 4P5RA 3V4PL 4WO4D 1WIUA 4P2OD 2AHZA 3QXTA 1XIWA 3TVMD 2LW1A 5B1KA 1E4HA 4LF6B 1IFRA 4N0FA 2Y69B 4RZCA 3ZDYB 4EKJA 4J27A 5CJBA 1QLRB 1JI2A 4DEWA 5FM5M 1EMTH 1PZBA 3CP1A 4O4HB 3FPXA 3K08A 1DBMH 2GVYA 2UY6A 3BPOC 2Q0ZX 2CWRA 4ODWA 4OZGE 1X9RA 4DK1A 3KS0H 4XPTL 5HHXL 4EUPG 3BKYH 3DTXA 2V2TB 4GS7C 4TLUA 1K73W 1EAOA 4G7YH 3ZDZF 5ISZB 3OX8A 3HZYB 4HK3J 2BX5A 2Y4SA 2LO1A 3QJHA 2DYPB 5I23A 1OW0C 1T83C 4HJJL 5JW4M 1K33A 3IU4H 4YWGL 3HE6D 1B88A 4DW0A 5GSRA 1OCCB 1J5CA 1JOIA 4KQ3H 1L3WA 4MRCA 2DWEC 2H6UA 3FCSB 4ZW8A 4ZOCA 4V1DD 1MJJA 1BQKA 5E1AA 4KY1L 4PRHA 1MJ8H 4D8PB 4HZ1A 5DI8B 3H9HB 3RIAF 3HKBB 1AYRA 1IGTA 2GB2A 4ZS7H 5F9DC 5A2JH 5EEVA 4KQ4H 2CKBA 3O2DH 5GISH 1ASPA 3ARZA 4ADGA 1KLFB 1TAEA 2Q0OC 2DYRB 4M3HA 3DVIA 3FHAA 4JDTL 1YY8B 3HPLB 4JFPB 1FBIH 2EQDA 1P4UA 1NMAH 4RIRB 5ANMB 5TF1H 5EO0A 4PJDE 1UT2A 4C83A 1QFHA 4MB5A 3G04B 3CS5A 3ZDZB 2A74A 2YZ1A 5CUSH 1J8SA 1EZLA 3ARGB 3E8VA 4BZ1L 2Y69C 5DUMH 1J9CT 4BZ2L 3GXDA 4WFHE 1VQ9V 2BOBC 1X7TA 3VFVA 3QEHB 4K94H 3M8OL 2XTAA 2WBJA 3NVQA 5AEAA 2D03H 2XG4B 5BS0A 2D0FA 5CP7B 2XNAA 4KFMA 2OX5A 1FJ1B 1VP7A 5LOVB 1QBLL 5T3ZL 1MG2C 4IHJB 2A6IA 4I3GA 3D1MC 2AABH 3HR5B 4PGEA 3QORA 5C0EB 3EOYG 5HJGA 5CJOL 5K9OA 1HJCA 3LV3B 2ZM6B 3C9NA 2XVGA 2DW5A 5ACZA 4TS6A 2E6QA 4RWYH 3CXDH 3I2CH 1S5IL 3DTDA 4U3HA 2CO6B 4JM2F 4A5UB 1E7VA 1OTSC 5JMRA 1IAIM 3EDFA 1URFA 4X7DC 4FTVD 4KKPA 2CXKA 2ZG2A 2R70A 1BVKA 3G5ZA 5D1ZI 1JZ3A 1ASQA 2IXQA 3LNEA 3ECUA 4XVJH 5CCKH 2OSXA 2WQWA 1RK1A 4I3SL 5EO1A 4PTTB 3EJUA 4RQQB 5D1XB 2RALA 4EB6B 3L3OB 1AXTL 4M1CD 2VXSH 1XR8A 3HKFA 4LVHC 5D2LA 5GRZA 5FL7G 1D5BB 4N8CL 3TCTA 3VMPA 3FUMA 3OR7B 1AG6A 3SGDH 5JPMA 2KBGA 4FQJH 4PWKA 4GKZB 1FP5A 4L8SB 1DQJA 1J0KA 2J4WL 3WFDL 3HB3B 5F6IB 5EEWA 4K5LA 4ZFOB 1KJMB 3JWDC 4ZAKB 3STLC 2IPTL 4PLKC 3T2OA 2ZKXA 5HJ3B 3KH3A 3LZPA 3RJDA 3RB5A 4MTOA 3GXFA 3I9GH 3KVPA 4XHJC 4ICGA 3QTCA 4FQXD 2DLIA 1OV8A 1TKWA 1BIIA 4OCXL 3V4PA 4TNWK 5E24E 3BY6A 1OSZB 4LLMA 4HEMA 4ILDA 1R1BA 3PIQB 2H9GA 3VU1A 2QTSA 5I0VA 4UCUA 3FQYA 5I5JA 1OAZL 3FTUA 1FJGB 4AKOA 3LXAA 4F57L 1XF3B 4CU6A 4OCWL 1CLCA 2NXYC 3MGOB 5MERB 4BFRA 3RZCA 3V4PH 4UB0H 3ARSA 1I9IH 3H85A 3OSKA 1R24A 5HHPA 1EZSA 3ZE2B 1YVWA 4YDVA 3NZ8B 3BZEB 4L48A 1OPOA 4Y19A 3WUWB 3OXRB 4OJCA 3HAEG 2FB5A 1BVNP 1KIUB 3ZKND 1GAFL 3D0LA 4XMWA 1G6UA 1AD9A 1WAEA 3D50A 1PL3A 4Z77B 4LH7A 2LAAA 5BRPA 4YY3B 1WDAA 4ZMWA 1ZGLM 4YAQB 1A4JB 3E8FA 1DBKL 2EDYA 5FYLE 1WT5C 5IW3A 5KS9A 4L8SC 4ZFQA 1UEYA 3IPEA 3FU3A 3GEFA 4X1KB 4N9GB 9CGTA 4W9IC 1EM1A 3C3SA 1S7TA 1VZIA 5IT2L 4UMSA 3VFUA 3TT3L 1VF6C 4DPAX 1QR1A 3MLSH 4E41E 3RWIB 3GPSA 2X9YA 3F12A 4L87A 3QNFA 5KYXA 1VARA 4OGYL 1CURA 1J88A 1U8JA 4DT2A 1JRHH 2EE3A 3TBYB 1U33A 2R8SH 3MLWL 1ZVHA 4NXMO 2LGQA 4PDRA 1T0MB 2WJ5A 1RL1A 3MRNB 2G75A 5EC1C 4LF7B 2J88H 3GYRA 2QKCA 3E0GA 3ARDA 3VWKC 3VAEA 1NS1A 4RX4A 4Y16B 3US9A 2VLJD 1B3IA 2IGLA 3VFPA 1P7QB 1U3YA 2L6LA 1RURH 3VTTA 4YX2H 3K8MA 3TZVB 4G80B 3FF7A 3P3PA 2D2CC 4FYSA 3WFBH 5GGQH 3RVXD 1WGOA 4X50A 1J8HD 5FPIA 3H2QA 4RAVB 2UZYA 1NEPA 1VFUA 4Q6GA 3QWQB 3L4UA 3AU1A 3N42B 1AHKA 4XH2B 2YAPA 2WTOA 3N04A 2IADB 4GBXB 4AI7A 4FDWA 3JAWA 5L2JA 4ZW7A 4B9YA 2ZKMX 3BPLB 5EYPB 1NJ9A 4XVUD 4PRNA 5CD5D 2HKFL 4Z7NB 7FABH 4FX5A 1O5DT 1AZZC 1CBVH 4JHWH 2KZWA 1SEBA 2V9RA 1TGOA 4P23C 4DJMA 3OKOA 2JB6A 3WTTA 2UXBB 2WSSG 4LF3B 2R29H 1F90L 2OMUB 4M5ZL 1MOEA 5C6WH 3ULAB 1OP9A 3APOA 3SDAA 3ME0B 1DBAH 5DC9B 3ULUH 4N1HB 2P67A 4GBXC 5I28A 4LNUA 2WM0A 4ELKA 1JV5B 1UKSA 1F11B 3OR6B 5ADOL 1QSFA 5EBWA 1NCWH 4PJBB 2AEPL 1A3LH 5HHMD 2WYZA 5HGBA 2K7QA 4NXNB 4W81A 3I75A 1N10A 4OQTL 5EBMC 4NZUH 3VWJC 5IVNA 5IMKB 4X8AA 5EU5B 2A73A 1AOHA 3EADA 4Z3JA 4NKOA 1TVKA 4CDHA 3S5YA 1P49A 4D9QE 3PWJA 3KYNB 1TZGH 4W70A 3AT0A 2OMYB 3NIGB 1OM9A 4Z7WB 2QPUA 1K8IA 2DTML 3D51A 5F3FA 2PLTA 3NZUA 4L4TE 1SM3H 2ZWZA 2ED8A 4MSWC 2FSEA 3B2UC 1OHQA 3MHSC 2EC8A 4FFTA 4YDNA 5ISZE 2LQRA 4FQXC 5E1HB 4BWAA 2BVTA 2WQSA 3ZGHA 1QEWA 5EC2A 3MXVH 2FEDD 3MNZA 2VSKB 1KXTA 3B2DC 2A83A 3IFLH 4M43L 1CE6A 2VLRA 1R1CA 3G5VA 4M8QB 1A3QA 4NWUL 4M6NH 1A5FH 5D1QE 1KSRA 4LEBA 2R1XA 1UCBH 1IC4L 3A0OA 3NCJL 4X5WA 4JQIL 3HBGA 3QDMA 2YXYA 3QDJD 3QI9C 1YNTB 2BS71 4HJGB 5IJVB 3UGXA 1I7RA 5DMJB 5DWPA 5AZEL 2WWMD 3OMIB 1FFNB 3BZ5A 2FR4A 2LOEA 4QWWC 4IOIB 4AVIA 4W6XB 2BTOA 1T4WA 2HMID 1QNZL 1LMKA 3HS8A 4PJAF 4H5SA 3A4FA 5BOJA 1ADQH 1BVNT 1HN1A 3U0PB 3LKPB 4AHCA 3D07A 5IF0A 2OIGA 3S36L 1HYSD 4ELMF 3NESA 4BIKA 3O2VL 4LSQH 1U58B 2AK1H 1WBXB 4L8CA 2FR4B 1KJVB 5BQDA 3JARA 4D7TA 2DWSA 3QI9B 4GS7B 3KW7A 4MLIA 5E00A 4ZFZA 4DIXA 1YJ9V 2XU9A 1PQZA 1IAOA 5FECA 4KAQL 1PSKH 1RHHB 2ADJB 2BCMA 2OS7A 4JO4L 2O61A 1DVFB 4OIFA 2HJFA 3OAYH 3L1OH 2J8UE 2X38A 5JUEH 2OJEB 1VQ5V 1QR8A 1HWGB 1FO0A 1OK8A 3OG6B 4B27A 4IDJL 4DQOH 1TCMA 3AG4C 4ZTEA 1U8OA 3PABB 5F7EH 4YSEA 1J9QA 3MMEA 3D39E 2Q7HA 4NENA 1WICA 2AVGA 3WE1A 1OIOA 5JJEB 4YHIB 3IFXA 2IGFH 3BP5B 1YUHB 4JJ5A 1UFUA 4FZEL 5AVRB 2H94A 1QSFE 3V0WH 1XFPA 4ZODA 3V4VH 1TR7A 2PGGA 2CE6A 1GM7A 4YXLL 4ZPVB 4PJGB 4ZMYA 1JYNA 2YN5A 3CX5K 2XAJA 2OMBA 2VC2B 3CXHJ 4MXWH 3D2UA 1JIBA 4A7GA 4BFJA 2YS4A 5D7LB 3RWIA 4XAWH 4H8WH 4EIBA 2ENSA 5LQBH 4IK7A 5LCVA 1WFIA 2H6PB 2OCCC 3QGVA 2Z65C 1G7LA 5EU4A 2IOOA 2JS3A 3WV0A 3Q8AA 4NQDD 3DV4A 2VR7A 4XP5L 1RUQL 5IB1B 4PJBA 4F37F 1JZ8A 4PJFF 4ZD3H 4CH5A 4FTVA 3SGIA 1QTYT 4QHUB 1HSAB 3KBHE 1NOFA 4QRUB 4YEEA 3SJAC 3OZ9L 5DTFA 4ZX6A 2IH8A 1U92A 1EJFA 4JO3L 3NCCB 3CFUA 3BWAA 2YRLA 5FUCC 5JLZB 4MLSA 3DLQR 3VDCA 4XAKE 3F83A 2IQ9L 3MTXA 1R24B 5HHPB 3UZVA 3RGVD 1GJWA 4FFZH 4BIUA 4U3JB 2BY0A 5D9SA 1P5UC 4LCWB 1H3PH 3C8HA 2GFBB 5KWYC 4JG0L 4F7PA 3DIVA 2FSDA 4JRLA 4X83A 2YRZA 4HBCH 3EFFB 1CFSB 1NBYB 1EGJH 4QPEA 2Z4QA 4PMEA 3N2GB 1JJ2U 1I8KA 1PAMA 3DJRA 4BJLA 5F9OL 4PJGE 1G7MA 3E9TA 4LQFH 3C6LD 5CCGE 4B7LA 3NR7A 1X4ZA 3EO0A 4X6EB 1SRDA 2I7SA 2X4RB 2XZAL 1RCYA 4WW2F 2GHZA 4LF8O 2PP9A 4IBTA 3K81A 3WFEH 4TULH 2GJZA 5E9DB 1TENA 4MMZA 4OZHA 3LSSA 1JWSB 2W9EH 1F1AA 3FQNA 3MRQB 4M5SA 4N28A 3DBXA 3O9WB 1GGBL 3DECA 2DYPD 2G75B 2JCCF 1NQTA 4FULA 4BR6A 4LSDA 4FFWC 4ANVA 5AVWB 4UDUB 2KT6A 1CVSC 2JGDA 3FJTA 2B4CC 4O5LL 4OZ4A 5CLZA 3IN0A 1UPGA 1IQWH 2BVUA 4YQXL 2D7TL 1MPAH 1OM3H 3CD6V 3F12B 3UTPD 1YN7B 1Z32X 3Q8FA 1THAA 2Z92A 1VQLV 1XIWD 4O9HH 4KITB 4PVNA 4F92B 4N21A 4PJCB 3MRMB 2IPKB 3O0LA 4AEIH 5ADPH 4R26L 2YKLL 4P49A 4NM8L 4AILC 4LSVL 4X7TA 4ODHL 1M1KW 4NQCD 1NH6A 3QWRD 2QR0A 2E75C 1CXZB 4F1ZA 4ZUUA 4AH2B 5KJ7E 2BFVH 2D7PA 3HPJA 4ZXBA 5IVXB 3P0GB 4D7SA 1O0VA 3K79A 2FL4A 2DLFL 2P8PB 2Z6FA 3ARBB 3KPNA 4BXSV 1T03L 4XDKA 1JF6A 1TQTA 2A6IB 4IHJA 2EIMC 4L0PB 5DUBB 5KTEL 4QUOA 2RMKB 4JRXA 4Y9GA 1T7ZA 3CUPA 2GUZB 2ZUWA 3EJZC 4L8BA 5KA6A 3NZ8A 4WY7L 3BZEA 1QA9A 3L7FA 4PI2A 1PDKA 1C8QA 3ARQA 3QNYB 4KTEL 1L9PA 5CMAB 3ZTDC 5C0RL 2QQLH 1FZJA 3MV7D 4OV6F 2Q8AL 1C16B 2DEYX 3KPMA 4G2AA 4OD3L 4KTGA 2X4NA 2F74A 2XIDA 5K39A 4RBPH 4WWKB 4PLNC 1R19A 1A5FL 4ZHQA 4B3SO 3ZHRA 5K9QG 4Q6IA 3TNMA 3FKSG 1KLUB 2UX6A 3HI6H 3OAZH 3VXNA 4BDVA 4RMTA 5KVDH 1PLAA 1EFXD 2BSSB 4FI6A 3NSYA 2YS8A 1C7TA 1GGUA 5IVOA