1NTKH

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
PKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 23
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntkH00
3L72H 2FYUH 1NTMH 1PP9H 1NTKH 1BE3H 3H1JH 1BCCH 1L0NH 4PD4F 3BCCH 3CWBH 1BGYH 1SQQH 3L75H 3TGUH 1SQPH 2BCCH 3L74H 4D6TH 3L73H 1SQVH 1NU1H 2IBZH 1KYOF 1L0LH 5KLVH 1KB9F 3CX5F 3H1IH 1NTZH 2A06H 3H1HH 1EZVH 3L71H 1SQBH 1SQXH 4U3FH 3CXHF 1P84F 3L70H 3H1LH 1PPJH 3H1KH
chains in the Genus database with same CATH superfamily
3JARA 3G6EV 2KKWA 1J95A 3B8MA 4AILC 2UXBO 3R65A 1FKAO 2Q69A 1GN6A 4EKWA 1AJPA 5JQGA 2E5LO 2QTSA 2P4KA 4NVPA 1IBKB 5EZYB 3RVYA 1VF6A 2DN9A 2ZIMA 2FB5A 2WWWA 2F4VO 1VQ8V 1HNWB 3D36C 3H1LH 1PPJH 2NR5A 4ABMA 2ITDC 2WLNA 4X1YA 3JSLA 3G80A 3LDCA 4ZIBA 2YXLA 2HHHO 1M90W 2YIBA 4FFBB 2UXDO 2KG7A 2R70A 2D3OW 2BOCC 4P9OA 1ZSPA 3P30A 3ZHTA 1YCIA 3U0ZA 2ZE7A 3X2QB 2JJ1G 1B6QA 4X66B 2P5OA 1PP9H 1S77D 1G4YB 3AG4B 2YI8A 4CH5A 2WLJA 1ZL8A 2PI4A 5DECA 5KHHA 3ASNB 1Z5WA 2PYJA 2OTLV 2ZQMA 4CC5A 3K5NA 4UB8Z 5GW7A 4QGPA 2QWRB 1RPOA 1PNKA 4X20A 2IJKA 1MZFA 3D3QA 1H8HG 1RFYA 5EBMC 3ASOB 4YHHB 3OW2U 3N2KA 2WAMA 3MDSA 1VQ5V 1YHQV 4YJ3B 1ZLZA 2FL4A 3TJTA 2LP7A 2Z5UA 5EC1C 4G28B 1O9HA 5H9CA 3JATA 1NH2D 1E1QG 4DO2A 2Q5ZA 4UFZA 5IY5B 5KX5B 4K3AA 1WNSA 2CK3G 1H2MA 2JS5A 4JV5B 5LMNO 2WLLA 2BCCH 3LUTB 2MK3A 2ILMA 1NU1H 4DR1B 2X7RB 4AI8A 1BS3A 2YI9A 4MVRA 4NR1A 2ODMA 1JFFA 4ZOLB 4B3SO 5H5NA 2UXCO 3F5WC 2GTSA 2P22C 3OUSA 5IJ0A 1OCZC 1Y6XA 1Q3EA 3HKCA 1JA8A 2CTRA 2OT5A 3G67A 5KLVH 4JTCB 1N34B 4ZI7A 2YS8A 2PI5A 2H94A 1AI4A 4J41A 5BY1A 3CRQA 1FFXA 1K5SA 3ML0A 5LP6B 1S5HC 3L72H 5C8YB 4DRXA 1IBMB 4Q20A 5J2TA 4FJCC 5IJ9A 3GWKC 4DR5O 5F2VO 1VQLV 1XMQO 3W7TA 4JPRA 1IBLB 4O4LB 1BMFG 4UVCA 1TVKB 1EZJA 2XAGA 2AW9A 4LFAB 3RFRA 1Y76B 1SA0B 4EFBA 2Q7HA 3ABLB 4Z1VA 1K34A 4JI5O 1F4NA 2XAJA 2EULA 3RYHB 2QWQB 4F6EA 1DLBA 3EXAA 3K3WA 3JD3A 1DF5A 1ZAUA 4KFMA 4PDVA 4E2LA 4NTXA 1ZX3A 3E8GA 1AI5A 4PDMA 2E3CA 3KKYA 1YDXA 1XUQA 4KL1A 5LYJA 3VQVA 1V54C 4P2ZA 5KHIA 3SJBC 3FB6C 1NR7A 2BOBC 3AK3A 4LBEC 4DK0A 5KMGB 1T5EA 2VWKA 4FM1A 4ZHQB 1FJGB 4I55A 3QO7A 5LBQA 4X8AA 2NN4A 2RNBA 1VQNV 1LUWA 1HW7A 1MABG 3BA9A 5LGTA 4WF9V 3QVNA 4JTDB 3E83A 1YXBA 3CD6V 4MVQA 1FS0G 4TSFG 5GTIZ 4J7JA 4K8ZA 1M57C 4FLZA 1XMOB 2WPDG 5B5EZ 1L0LH 3RYFA 3SR2C 3K5OA 1VQOV 1IZ3A 1JPXA 1W59A 2XT9A 1VARA 3OMIB 4RO2A 3K0DA 1W0KG 3ETDA 3DXRA 1R3KC 3TXQA 2HVKC 4UVAA 4WFEA 4UVBA 4R6ZA 4K8XA 4JAUA 1I08A 2OCHA 4JV5O 3ZHRA 1AP5A 1LUVA 5LXTB 4DUYO 4HNAA 1W0JG 3F7YC 2KQXA 2CUGA 2ZDIC 4LNUB 4DR1O 1YTFB 3NR7A 1OZ0A 1P4RA 2L35A 4J9ZB 2ZNJA 4FLYA 3ZIAG 3HKEA 5BMVB 2IBZH 1VEWA 2GUZA 3OGCC 2CH7A 1SF9A 2LGQA 4MVZA 4BAYA 4AHCA 1F23A 2ZCEA 3UO3A 3T1CA 2V7QG 2Q0AA 1DGSA 1YJ9V 4OX9B 3D3IA 3DC6A 1K3EA 4JTAB 2ADQB 3L74H 2ZINA 1WAZA 3HKBB 2F66C 5H6RA 4XDLA 3ZRXA 1N8RW 4GX1A 4TOIA 3I56V 5EBLC 1IBLO 3CC7V 4EB6B 3L75H 2AHZA 1WPXA 4LFBO 5KHGA 3C3TA 4H33A 1VIBA 2XUMA 3CRRA 4LFAO 4KHPB 5EYPB 4NTYA 3AEIA 4CBCA 3CJHA 4MW8A 2XHBA 1S0VA 4JI4B 2EJ7A 4JYBA 2YICA 3O65A 4I4TB 1F51A 3N2GA 4X89A 2DYRB 3AG3C 3K59A 3K5LA 3CCJV 5CMUA 3FAVB 5HFMA 1HDJA 2QR4A 2ZR3A 2ADPA 3AG4C 4O2AA 2Q68A 1P49A 1I7FA 1S5JA 3N27A 4MSWC 3NXSA 4GKJB 1FPOA 2LFRA 4J7KA 1AVMA 1DTOA 3CE2A 1E79G 1ROPA 3AG1C 4O4JA 2E5LB 1ORQC 5EBWC 2ZXWC 3THOA 2LFSA 3CCSV 1L8DA 4JI7B 4DV5O 5CB4A 1Q43A 1XL4A 1UFIA 2OIGA 2Y0IA 3JARB 1PKXA 1H2SB 3RYCB 3ABUA 1LNQA 3ZN0A 2WA3A 5CA0A 3MHHC 3U11A 4UCVA 3BRCA 2HHHB 5JQGB 4IL6Z 2B1IA 2UXDB 1AI6A 2OIEA 4XBFA 2QKSA 1V9PA 1XDCA 2WLIA 1MSWD 1RP3B 4YY3B 4FK5C 3D36A 3JD4A 5JJJB 5LGUA 4DW1A 3ZCCA 4MT8A 1XL6A 4X1YB 2EX3A 3ZRWA 3CYOA 5IYBO 3LSQA 4NXNO 1TUBB 1V55B 4H37A 1VP7A 2QM8A 4O2BA 4QJFB 4NTWA 2EINC 2KSDA 2KG7B 4BIOA 1QBZA 3AG7A 2OWOA 4ASUG 3H1JH 1PD3A 4IHJB 2OYQA 3HKDA 1AR5A 4JI2B 3BAAA 1TGOA 5JCOC 2HJDA 1ZL8B 4WBNA 3IAYA 2Z3YA 2ZIOA 2LW7A 4LF7B 1TUEB 5A2QN 1IXMA 4I0XA 5IYCO 4FLWA 1K8AW 1RPRA 4LH6A 5B1BB 1M9NA 1KBHA 2A7WA 4PDRA 3P32A 2QA4V 4GYCB 4X20B 1SRYA 2LGWA 2QE7G 5B1NA 2UU9O 4OX9O 1GN2A 2Y69C 2PGGA 1JMKC 4QE7A 3MAQA 1OJHA 1QHTA 1JR9A 5LOVB 3WG7C 2JEUA 5FPOA 4N21A 3GVMA 1K73W 2E75B 3VQWA 3JATB 3VBBA 2Q73A 1YZBA 5JH7A 2NNUA 2Y4TA 3B8NA 4B3SB 2LQTA 1PV0A 1SC5B 2DW4A 1S5LZ 3I55V 2QWPB 5C93A 4K0KB 2WLLB 3Q4HA 4KHPO 5DEDA 1NT2B 3FYIB 4CC6A 4B08A 3A0HZ 4JI4O 2PY5A 1JFFB 2P6JA 4CS2A 2QEXV 1NZ6A 1Y66A 3SJQC 1XNRB 5IJ0B 3CMAV 1YEWA 2GTAA 5FPRA 1R6TA 2AZ2A 5LHHA 4ZI7B 4DR4O 2BTOA 4GKJO 2R9RB 4JI5B 1EM1A 4YJ2A 1AR1B 5A9GA 1GM9A 1GRJA 1G1XB 1OCOC 3SPGA 2P90A 3ABMC 1R3JC 3AK2A 4DRXB 5IJ9B 3FX7A 4GKKB 1Y74A 2PF4E 4JI7O 4J42A 3OD4A 3OTOB 5B3SC 1F7YA 4FLVA 1KKDA 1H2KA 2JRIA 3CCQV 3K9SA 2C2AA 2Q7EA 1GM8A 3E8FA 3VQXA 4IYHA 3TCUA 4DYLA 2ZR2A 1H2GA 3AG2B 1BSMA 1JCHA 5JJNB 2VRZA 4HAMA 1SQBH 1R1BA 3SPJA 1KP2A 4YY3O 1Q8IA 3KG2A 1WN7A 2Y48A 2UUBB 3CCMV 2YIAA 3SYQA 4FM0A 1QVGU 4HYOA 2WLMA 2OCCC 4IIJA 1Q6HA 2HFEC 3D8CA 2R72A 2FTKA 3T2MA 3SDLA 1WA8B 3FB8C 1F4MA 1K92A 1M1KW 5E79Z 1S3JA 4QPKA 1XBLA 1XI1A 4LF9O 2JIZG 4L87A 1OV9A 4JI2O 2Q9LA 1COWG 1IVSA 1P7GA 1GH6A 3PJSK 5IYZA 3ZMTA 1XREA 4LF7O 3I5DA 2VS0A 4NB5A 4WFHA 1FXKA 1JOYA 4TV8A 2DMXA 3RYFB 4A5UB 4LFCO 4L8JA 4MTGA 4D7TA 3OT7A 2DYSB 1WLEA 2CGOA 1QLEC 1GN3A 4NYKA 4DUYB 2GV9A 4JI1B 3FB5C 5IT9N 3QG5A 3B4SA 5DN6G 2YIDA 2BTQA 1SZXA 1M56B 4LF6O 2WLKA 3CRCA 3F7VC 2CGNA 4H44B 4X62O 3K04A 3STZC 4ZKIA 4TQFA 1B3QA 1QR8A 2DJVA 4FM2A 1K5QA 2EIKB 4TUYA 3ZRVA 1PNMA 4PA6A 2EILC 1SETA 4K0KO 3JAKA 4HNAB 1KKCA 1AR4A 1BHAA 2ZDIA 3UM7A 3JASA 1OCRB 5JWPA 2XASA 3TXSA 3HKEB 1GKFA 3CXHF 3JD1A 1KMIZ 4QPJA 2RMKB 4UCOA 2CH7B 2P06A 1XNRO 1SKVA 3LSSA 2VQEB 4J80A 2LO1A 3RBZA 4LFBB 1M93A 2PUSA 3J7AU 4I5SA 4EEQA 4BIZA 1YVWA 2LW1A 2DQ0A 3CEIA 2ARHA 4Z2WA 2YEVA 1HNZB 2IW5A 1SERA 4LF8B 4GKKO 3A0RA 1OCCC 3ZHSA 1NJIW 3OTOO 2IH3C 1X59A 3WU2Z 1QQCA 3U10A 1DK1A 2F43G 3CPWU 1EZVH 3CJHB 4X1KB 1IXBA 5E1AC 5L3CA 2AZ0A 4FFBA 1NTMH 3N2GB 1D5NA 2YUAA 3ZRSA 4D7SA 2QKAA 4CH4A 4PHZA 2PZSA 3P3NA 1U97A 4R50A 2UUBO 4DR7B 4TQDA 1R3IC 4GX5A 4DV5B 2F1MA 3TK1A 3E35A 4O2AB 2QM4A 4K35A 1OHHG 4QIWF 4PDLA 1R6KA 3ABKB 1NQTA 5B1AC 1AROP 2A9HA 3JALB 2FMLA 5B1OA 4UCTA 1FXKC 3STLC 4NKGB 5KAIZ 5CB4B 1FD9A 2Q6AA 4YJ3A 3OMAB 1Q81W 4JI0B 2ZD9A 5CA0B 3QO8A 4DR6O 1U96A 1W2BU 4NXNB 2AGAA 2JGDA 2HVJC 1RM1C 1SQPH 2QSAA 5KX5A 2P4VA 4HZ3A 2HKOA 2WLIB 4FFKA 3RGBA 2W0FC 3RN4A 5K1XA 3H1HH 2ZE5A 3ETQA 4DV2B 4UV8A 4LCUC 2EZOA 1G6UA 4JI1O 3ZRWB 3CCRV 1NTKH 1X4TA 2N05A 4DV0B 3B2EE 1Z2GA 3B09A 4FLXA 3JAWA 2RJZA 4W4LA 4OPAA 5TISZ 4PA3A 4J7ZA 5BR8B 3ZS8C 3ZMVA 2UU9B 3T1YB 5JCOA 1K97A 3OEEG 5IE9A 4WBNB 1CXZB 2CTQA 2ITCC 1GO3F 4X1IA 1NI8A 1XHXA 5GONA 3BEHA 3M99B 1QNMA 5LP6A 1KYOF 4I0XB 5C8YA 3RYIB 4TV9A 1K9MW 3OEHG 3L71H 3H01A 3A0BZ 1JQ0A 4O4LA 2VQEO 1KQSU 3K03A 2EZPA 4DV3B 3ZN1A 2IM9A 1Y76A 3CWBH 3ETEA 1R6NA 2M7WA 3TGUH 4F6RB 2BE3A 1GTOA 4JF3A 3RYHA 3W7SA 4LF4O 2OTJV 3GB7C 3CX5F 5CA3A 3AG2C 1RSOA 4LWSB 2EIJB 4HBNA 4AQYO 4PA9A 2ZM6B 3IGAC 4B3RB 1FXVA 1HNZO 4MW3A 3T4DA 4LF8O 4UCRA 2JVDA 4RUFA 2M6YA 4FVMA 3RW0A 3X2QC 4O4HB 4I50A 1BE3H 4BR6A 3Q4HB 3M8AA 5KUKA 2ZNIA 3SGIA 3SPIA 1ENVA 4EFEA 4WFGA 1VQ6V 4DR4B 4OPHA 3E2EA 3ASNC 1SS3A 4ZHQA 1ZTEA 4QE9A 4JASA 1NS1A 3TETA 3RT3C 2IU0A 3SYAA 4PI2A 3UT5B 1P7BA 5CBGA 4DR7O 3ASOC 1KUQA 4FIPC 4UV9A 3C90A 3FKSG 4DV7B 1Q5OA 3BVOA 5D5QA 2XAQA 2RDCA 1K33A 1EN5A 3OUFA 4YJ2B 2UXNA 3CMEV 1BZKA 4FZ0A 4YXWG 3WB1A 1CP9A 2WLHA 3JAMN 5LA6A 5CA1A 1Z5VA 2ZE6A 4PD4F 3BCCH 5IY5C 3K5MA 4UCUA 1YJNV 5FL7G 4B7EA 1Q6UA 1I5XA 4U3JA 3CCLV 5LHGA 3ETGA 1HP8A 2MW2B 2W6IG 3ZHQA 1IURA 1YF2A 4JI0O 4PV1B 1GM7A 4G27B 3FFQA 4E4EA 3CC4V 3L70H 3IJ4A 1MNGA 1HNXO 4DV1O 4CH6A 4F4LA 1JVMA 4WFFA 1DF4A 1Q82W 4IGGA 2EIKC 1E1RG 3SPCA 4C7UA 4LF9B 3CB2A 3G6BA 5LXTA 1YTFD 1CPYA 4JZGA 4DV2O 5KA6A 1BQ0A 1V54B 1OCRC 4FZ1A 4DV0O 4O4IA 5BMVA 4KP4A 1K7DA 4MTFA 5LP6C 1N4CA 1WP8A 1N0JA 4LR3A 2VQFO 2IJIA 2R9IA 1BGYH 1KC8W 2IJHA 3QF7A 4I9QA 3CXCU 5L3FA 4LFCB 1GAXA 5BR8O 3T1YO 4JI3O 1VQ4V 1D2DA 3N2KB 2RCVA 4LH7A 5IYZB 4JGSA 3ABLC 1NKDA 2Q0OC 4JI6B 3T1HB 5LL6Y 1I94O 1VQ9V 3HKBA 3BFRA 1TAEA 4FLTA 2L6LA 1BCCH 4LF6B 1M57B 1YI2V 2PTMA 4X62B 5KAFZ 4EB6A 5J2UA 1HR0B 1NH2B 2QWOB 4UXNA 1KP3A 3JCUZ 3K57A 5GTHZ 2H3OA 4DV3O 2XOKG 3ZJZA 4DV4O 3HR0A 5FLXN 1VQKV 2BTQB 1PL0A 1YSCA 5AG2A 2HR3A 3CS5A 3UQ8A 1NR1A 3OE7G 2ZM6O 4B3RO 1SESA 5ITZA 1XILA 1YJWV 3FAVA 2E76B 1H38A 1NTZH 2O57A 4PA7A 2DWEC 2A06H 1SZTA 2QWNB 2PYLA 2IJJA 3HKCB 2FKXA 2X6AA 1QCEA 2JJ2G 2HP8A 3JASB 2QTOA 4JYCA 4XDJA 5LMUB 1YIJV 1KU9A 3K08A 1J5EO 3ABKC 3HB3B 1FFXB 1XHZA 4PA4A 2CDYA 3E22A 1D5AA 1MG1A 3JYCA 1A32A 5J2TB 1QLNA 4R8CA 3DGEA 1ZWIC 4P30A 3RYCA 4BW5A 5EIBD 4DV7O 3WB0A 2F23A 2DQ3A 2UUAO 4IYIA 4ICGA 3JSNA 3MD0A 4KUMA 3EFFK 2YEVB 4DR3B 2EIMB 4MTXA 3SJAC 4GX0A 3G4SV 2H8PC 1I0HA 2YIBD 1K4CC 3IC9A 4MVSA 5D5PA 1WPBA 2QJ1A 5LYJB 3KCXA 2W6JG 1TUBA 4RQFA 4B3MB 3AG3B 2BSKA 2CTPA 3WB2A 4IHJA 1BL8A 2YC0A 4I55B 4QNHB 2WSSG 2A3QA 2P67A 5IWAO 2FYUH 1VQ7V 3J80N 3PN1A 4OXSA 1MZEA 2Q7GA 2KB1A 2N74A 3L73H 4BWAA 4FMTA 3E8HA 4DR6B 5LGNA 3AG1B 5FNVA 4X64B 4LP8A 2V1DA 4JYYA 2ZXWB 1N33B 4RWUA 4GX2A 2NLJC 2YXHA 5LOVA 4D6TH 4DV6B 4B3TB 2ZKOA 1URFA 3A8TA 1Q86W 4JI6O 3T1HO 5JJEB 1VF5B 3DXRB 3JD2A 2JGDB 3OGIB 1GN4A 2EIJC 2DYRC 4I9WA 4MVOA 4NXMB 4LC1A 3OAAG 3S3XA 3O9OA 2Y0PA 1N36O 1HR0O 4JI8B 2N04A 4JAAA 4PI0A 5L3DA 1AI7A 1GK9A 5JVDA 1KB9F 2AHYA 4Z1MG 2EJRA 1VF7A 2EINB 1JJOA 3JAWB 1M4UA 1IDSA 2GUZB 4CH3A 1WB7A 2QKCA 1YITV 5H6QA 1HWYA 2QDOA 3ZBHA 4JYAO 2F95B 2HJFC 1BT8A 3CCVV 4PJ0Z 1SQVH 2GBOA 1I5YA 2XAFA 3BPZA 5IYDO 2GSMB 2GHYA 1FFTB 3CC2V 4X1IB 1M5IA 5LMUO 5GONB 5L3BA 4LF4B 1SQXH 2LJ2A 4X65O 5EIBC 1KECA 1L1FA 4FPPA 1N32B 1QU7A 3QNEA 4TV9B 4AQYB 5EZYA 3GWOA 1VF6C 4TWKA 2Q67A 2IU3A 5J9PC 2Y69B 5BXZA 3UO2A 3ZMZA 4RQEA 1XNQB 5EK0A 1Q90D 3AK1A 3WG7B 2ZE8A 4U7NA 2ATKC 1V55C 1QVFU 3MHSC 4YIOA 1RSOB 2CTWA 1MA1A 1TA8A 1IBKO 4DR3O 1VMGA 2ZT9B 3VOUA 4P9PA 3W7XA 3EHBB 1HNWO 4MS2A 3T4ZA 4YIPA 4I50B 1R73A 1Y67A 3LSUA 5H2FZ 2XTAA 4J10A 2VWJA 1MMMA 3H1KH 1US6A 4B3MO 1WA8A 5KHJA 3BY6A 3CP1A 3DSQA 2CAZC 1H8EG 2R9AA 2GDSA 3JCZA 4O4JB 4UCSA 4FLUA 5CBFA 3BHPA 4LF5B 5B1BC 5K1PA 2ETNA 4X66O 3ZHUA 4MTOA 1PNLA 1PM9A 3B77A 4WCEV 1K4DC 3FB7C 4DUZB 1OCOB 2DOSA 2A0LA 3OR6C 4X64O 3ABMB 2G38A 1N33O 3RWRD 3OR7C 1HNXB 3SJCC 4DV1B 2B9ZA 5LA6B 5CA1B 2X6CA 4WFBV 3LDEA 4DW0A 3R66A 4H13B 4YHHO 3ABTA 1WB8A 5B3SB 3IFXA 3QO5A 4U3JB 3VQYA 3K06A 1EFRG 2DWDC 1WJZA 3CRMA 4H0LB 4DV6O 4B3TO 1KD1W 2CE4A 2V4DA 3S3WA 3UKMA 5L3EA 1AJNA 4CS4A 4O2BB 3OM3B 2WA4A 4ZOLA 4NXMO 3E86A 2VQFB 3QTCA 2A79B 3ZMUA 1EN6A 3HKDB 4JI8O 1BQZA 3HPLC 4U7OA 2JGUA 3SYPA 4RUEA 2EBOA 2OCCB 4JI3B 1R3LC 2E74B 1AB3A 1SQQH 3KCYA 4O4IB 1I94B 1Q6IA 1QR9A 3K9AA 2UUCB 2XNDG 1FYJA 3ZX6A 3UCSC 3WFVA 3ZEDA 5IDJA 4DXWA 5EC2C 3LNMB 1FXHA 1TVKA 2QM7A 3BA8A 1N34O 1SA0A 5KUMA 4DV4B 1XQ8A 2UXXA 3F5TA 4XDKA 1Y4MA 3ICXA 1IBMO 3SYOA 1N32O 2YDEA 1XOUA 2EIMC 5JH7B 1JX9A 5J2UB 3C3SA 4OGQB 2XAHA 3OTFA 1PL4A 1NBMG 1WP7A 3FD9A 1QLEB 2Y4UA 1XNQO 4GT1A 2D2CB 4TT3G 4X1KA 5HFLA 4DR2B 1S72V 4X88A 3FYEB 1J5EB 2RN9A 3CSXA 5KMGA 1NVPB 3IC7A 5ITZB 3W7WA 1LR1A 4KXRA 2YXYA 1OCZB 4GLXA 2EILB 4GUNA 5B66Z 3CCEV 3G71V 4RAIA 2AXTZ 2UXBB 3ZHVA 1AJQA 2B1GA 2UUAB 1VQMV 1SQFA 1FJGO 3JALA 3E22B 2Z0AA 2RQ6A 1B04A 4LF5O 4I7ZB 2B5UA 4J9YB 1L0NH 1Y74B 2F4VB 2DYSC 3CHXA 4IT5A 3DC5A 1JJ2U 3KZIZ 3APQA 4GCZA 4WFAV 4DUZO 2X6BA 1UJWB 3SPHA 1M56C 3ZMSA 1MSDA 1XMOO 2X0LA 2W0XA 1OCCB 4R7CA 4MVUA 4J11A 3APOA 5IWAB 2HG5C 2HLDG 4IIJB 4LNUA 2DE0X 5CN0A 1FAFA 3M7MX 4Q6GA 4JZ2A 4GZRB 2BSKB 3L9DA 3DTUB 1ZUQA 4X9QA 3LNNA 1GMGA 3CRAA 2K9PA 1BHBA 3JD0A 3J81N 1SQGA 3P3PA 3W7UA 1B06A 3LDDA 2JEXA 1IX9A 2QGNA 1UPGA 5KHKA 5B1AB 2P7TC 1XEQA 5FNVB 4CS3A 3RYIA 1H2NA 2UUCO 1N0NA 4BIUA 3E89A 5DM6V 1FXKB 1THZA 4TV8B 4DK1A 1EN4A 1MOFA 3BABA 2K1EA 5CBHA 1N36B 3H1IH 1EBOA 3OFNG 5LMNB 2JS3A 4W4KA 2JDIG 4F6RA 3A2FA 5EYPA 2F93B 4ZBMA 3CCUV 3B40A 4PELA 2Q4PA 2YSUB 4B7KA 4CZZA 1RM1B 4LWSA 2Q8VA 4I4TA 4N23A 1H2LA 3OMNB 3E8BA 3H9VA 1VQPV 2UXCB 4G2KA 4BW9A 1S76D 4O4HA 3K0GA 4TUYB 1O9GA 4JYAB 5KA5A 1G8MA 3JAKB 4U3FH 5BZBA 1Q7YW 1NVPD 5JVDB 1AP6A 4JAVA 4DR2O 3EVKA 3RVZA 5L3GA 3K79A 4UB6Z 4X65B 1AILA 1CEZA 2IH1C 2HEPA 4DR5B 1XMQB 3UT5A 4UUJC 2JK5C 5LHIA 3K58A 1P84F 4MVMA 3SYCA
chains in the Genus database with same CATH topology
3L72H 2FYUH 1NTMH 1PP9H 1NTKH 1BE3H 3H1JH 1BCCH 1L0NH 4PD4F 3BCCH 3CWBH 1BGYH 1SQQH 3L75H 3TGUH 1SQPH 2BCCH 3L74H 4D6TH 3L73H 1SQVH 1NU1H 2IBZH 1KYOF 1L0LH 5KLVH 1KB9F 3CX5F 3H1IH 1NTZH 2A06H 3H1HH 1EZVH 3L71H 1SQBH 1SQXH 4U3FH 3CXHF 1P84F 3L70H 3H1LH 1PPJH 3H1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 H;  2FYU H;  1NTM H;  1PP9 H;  1NTK H;  1BE3 H;  3H1J H;  1BCC H;  1L0N H;  4PD4 F;  3BCC H;  3CWB H;  1BGY H;  1SQQ H;  3L75 H;  3TGU H;  1SQP H;  2BCC H;  3L74 H;  4D6T H;  3L73 H;  1SQV H;  1NU1 H;  2IBZ H;  1KYO F;  1L0L H;  5KLV H;  1KB9 F;  3CX5 F;  3H1I H;  1NTZ H;  2A06 H;  3H1H H;  1EZV H;  3L71 H;  1SQB H;  1SQX H;  4U3F H;  3CXH F;  1P84 F;  3L70 H;  3H1L H;  1PPJ H;  3H1K H; 
#chains in the Genus database with same CATH topology
 3JAR A;  3G6E V;  2KKW A;  1J95 A;  3B8M A;  4AIL C;  2UXB O;  3R65 A;  1FKA O;  2Q69 A;  1GN6 A;  4EKW A;  1AJP A;  5JQG A;  2E5L O;  2QTS A;  2P4K A;  4NVP A;  1IBK B;  5EZY B;  3RVY A;  1VF6 A;  2DN9 A;  2ZIM A;  2FB5 A;  2WWW A;  2F4V O;  1VQ8 V;  1HNW B;  3D36 C;  3H1L H;  1PPJ H;  2NR5 A;  4ABM A;  2ITD C;  2WLN A;  4X1Y A;  3JSL A;  3G80 A;  3LDC A;  4ZIB A;  2YXL A;  2HHH O;  1M90 W;  2YIB A;  4FFB B;  2UXD O;  2KG7 A;  2R70 A;  2D3O W;  2BOC C;  4P9O A;  1ZSP A;  3P30 A;  3ZHT A;  1YCI A;  3U0Z A;  2ZE7 A;  3X2Q B;  2JJ1 G;  1B6Q A;  4X66 B;  2P5O A;  1PP9 H;  1S77 D;  1G4Y B;  3AG4 B;  2YI8 A;  4CH5 A;  2WLJ A;  1ZL8 A;  2PI4 A;  5DEC A;  5KHH A;  3ASN B;  1Z5W A;  2PYJ A;  2OTL V;  2ZQM A;  4CC5 A;  3K5N A;  4UB8 Z;  5GW7 A;  4QGP A;  2QWR B;  1RPO A;  1PNK A;  4X20 A;  2IJK A;  1MZF A;  3D3Q A;  1H8H G;  1RFY A;  5EBM C;  3ASO B;  4YHH B;  3OW2 U;  3N2K A;  2WAM A;  3MDS A;  1VQ5 V;  1YHQ V;  4YJ3 B;  1ZLZ A;  2FL4 A;  3TJT A;  2LP7 A;  2Z5U A;  5EC1 C;  4G28 B;  1O9H A;  5H9C A;  3JAT A;  1NH2 D;  1E1Q G;  4DO2 A;  2Q5Z A;  4UFZ A;  5IY5 B;  5KX5 B;  4K3A A;  1WNS A;  2CK3 G;  1H2M A;  2JS5 A;  4JV5 B;  5LMN O;  2WLL A;  2BCC H;  3LUT B;  2MK3 A;  2ILM A;  1NU1 H;  4DR1 B;  2X7R B;  4AI8 A;  1BS3 A;  2YI9 A;  4MVR A;  4NR1 A;  2ODM A;  1JFF A;  4ZOL B;  4B3S O;  5H5N A;  2UXC O;  3F5W C;  2GTS A;  2P22 C;  3OUS A;  5IJ0 A;  1OCZ C;  1Y6X A;  1Q3E A;  3HKC A;  1JA8 A;  2CTR A;  2OT5 A;  3G67 A;  5KLV H;  4JTC B;  1N34 B;  4ZI7 A;  2YS8 A;  2PI5 A;  2H94 A;  1AI4 A;  4J41 A;  5BY1 A;  3CRQ A;  1FFX A;  1K5S A;  3ML0 A;  5LP6 B;  1S5H C;  3L72 H;  5C8Y B;  4DRX A;  1IBM B;  4Q20 A;  5J2T A;  4FJC C;  5IJ9 A;  3GWK C;  4DR5 O;  5F2V O;  1VQL V;  1XMQ O;  3W7T A;  4JPR A;  1IBL B;  4O4L B;  1BMF G;  4UVC A;  1TVK B;  1EZJ A;  2XAG A;  2AW9 A;  4LFA B;  3RFR A;  1Y76 B;  1SA0 B;  4EFB A;  2Q7H A;  3ABL B;  4Z1V A;  1K34 A;  4JI5 O;  1F4N A;  2XAJ A;  2EUL A;  3RYH B;  2QWQ B;  4F6E A;  1DLB A;  3EXA A;  3K3W A;  3JD3 A;  1DF5 A;  1ZAU A;  4KFM A;  4PDV A;  4E2L A;  4NTX A;  1ZX3 A;  3E8G A;  1AI5 A;  4PDM A;  2E3C A;  3KKY A;  1YDX A;  1XUQ A;  4KL1 A;  5LYJ A;  3VQV A;  1V54 C;  4P2Z A;  5KHI A;  3SJB C;  3FB6 C;  1NR7 A;  2BOB C;  3AK3 A;  4LBE C;  4DK0 A;  5KMG B;  1T5E A;  2VWK A;  4FM1 A;  4ZHQ B;  1FJG B;  4I55 A;  3QO7 A;  5LBQ A;  4X8A A;  2NN4 A;  2RNB A;  1VQN V;  1LUW A;  1HW7 A;  1MAB G;  3BA9 A;  5LGT A;  4WF9 V;  3QVN A;  4JTD B;  3E83 A;  1YXB A;  3CD6 V;  4MVQ A;  1FS0 G;  4TSF G;  5GTI Z;  4J7J A;  4K8Z A;  1M57 C;  4FLZ A;  1XMO B;  2WPD G;  5B5E Z;  1L0L H;  3RYF A;  3SR2 C;  3K5O A;  1VQO V;  1IZ3 A;  1JPX A;  1W59 A;  2XT9 A;  1VAR A;  3OMI B;  4RO2 A;  3K0D A;  1W0K G;  3ETD A;  3DXR A;  1R3K C;  3TXQ A;  2HVK C;  4UVA A;  4WFE A;  4UVB A;  4R6Z A;  4K8X A;  4JAU A;  1I08 A;  2OCH A;  4JV5 O;  3ZHR A;  1AP5 A;  1LUV A;  5LXT B;  4DUY O;  4HNA A;  1W0J G;  3F7Y C;  2KQX A;  2CUG A;  2ZDI C;  4LNU B;  4DR1 O;  1YTF B;  3NR7 A;  1OZ0 A;  1P4R A;  2L35 A;  4J9Z B;  2ZNJ A;  4FLY A;  3ZIA G;  3HKE A;  5BMV B;  2IBZ H;  1VEW A;  2GUZ A;  3OGC C;  2CH7 A;  1SF9 A;  2LGQ A;  4MVZ A;  4BAY A;  4AHC A;  1F23 A;  2ZCE A;  3UO3 A;  3T1C A;  2V7Q G;  2Q0A A;  1DGS A;  1YJ9 V;  4OX9 B;  3D3I A;  3DC6 A;  1K3E A;  4JTA B;  2ADQ B;  3L74 H;  2ZIN A;  1WAZ A;  3HKB B;  2F66 C;  5H6R A;  4XDL A;  3ZRX A;  1N8R W;  4GX1 A;  4TOI A;  3I56 V;  5EBL C;  1IBL O;  3CC7 V;  4EB6 B;  3L75 H;  2AHZ A;  1WPX A;  4LFB O;  5KHG A;  3C3T A;  4H33 A;  1VIB A;  2XUM A;  3CRR A;  4LFA O;  4KHP B;  5EYP B;  4NTY A;  3AEI A;  4CBC A;  3CJH A;  4MW8 A;  2XHB A;  1S0V A;  4JI4 B;  2EJ7 A;  4JYB A;  2YIC A;  3O65 A;  4I4T B;  1F51 A;  3N2G A;  4X89 A;  2DYR B;  3AG3 C;  3K59 A;  3K5L A;  3CCJ V;  5CMU A;  3FAV B;  5HFM A;  1HDJ A;  2QR4 A;  2ZR3 A;  2ADP A;  3AG4 C;  4O2A A;  2Q68 A;  1P49 A;  1I7F A;  1S5J A;  3N27 A;  4MSW C;  3NXS A;  4GKJ B;  1FPO A;  2LFR A;  4J7K A;  1AVM A;  1DTO A;  3CE2 A;  1E79 G;  1ROP A;  3AG1 C;  4O4J A;  2E5L B;  1ORQ C;  5EBW C;  2ZXW C;  3THO A;  2LFS A;  3CCS V;  1L8D A;  4JI7 B;  4DV5 O;  5CB4 A;  1Q43 A;  1XL4 A;  1UFI A;  2OIG A;  2Y0I A;  3JAR B;  1PKX A;  1H2S B;  3RYC B;  3ABU A;  1LNQ A;  3ZN0 A;  2WA3 A;  5CA0 A;  3MHH C;  3U11 A;  4UCV A;  3BRC A;  2HHH B;  5JQG B;  4IL6 Z;  2B1I A;  2UXD B;  1AI6 A;  2OIE A;  4XBF A;  2QKS A;  1V9P A;  1XDC A;  2WLI A;  1MSW D;  1RP3 B;  4YY3 B;  4FK5 C;  3D36 A;  3JD4 A;  5JJJ B;  5LGU A;  4DW1 A;  3ZCC A;  4MT8 A;  1XL6 A;  4X1Y B;  2EX3 A;  3ZRW A;  3CYO A;  5IYB O;  3LSQ A;  4NXN O;  1TUB B;  1V55 B;  4H37 A;  1VP7 A;  2QM8 A;  4O2B A;  4QJF B;  4NTW A;  2EIN C;  2KSD A;  2KG7 B;  4BIO A;  1QBZ A;  3AG7 A;  2OWO A;  4ASU G;  3H1J H;  1PD3 A;  4IHJ B;  2OYQ A;  3HKD A;  1AR5 A;  4JI2 B;  3BAA A;  1TGO A;  5JCO C;  2HJD A;  1ZL8 B;  4WBN A;  3IAY A;  2Z3Y A;  2ZIO A;  2LW7 A;  4LF7 B;  1TUE B;  5A2Q N;  1IXM A;  4I0X A;  5IYC O;  4FLW A;  1K8A W;  1RPR A;  4LH6 A;  5B1B B;  1M9N A;  1KBH A;  2A7W A;  4PDR A;  3P32 A;  2QA4 V;  4GYC B;  4X20 B;  1SRY A;  2LGW A;  2QE7 G;  5B1N A;  2UU9 O;  4OX9 O;  1GN2 A;  2Y69 C;  2PGG A;  1JMK C;  4QE7 A;  3MAQ A;  1OJH A;  1QHT A;  1JR9 A;  5LOV B;  3WG7 C;  2JEU A;  5FPO A;  4N21 A;  3GVM A;  1K73 W;  2E75 B;  3VQW A;  3JAT B;  3VBB A;  2Q73 A;  1YZB A;  5JH7 A;  2NNU A;  2Y4T A;  3B8N A;  4B3S B;  2LQT A;  1PV0 A;  1SC5 B;  2DW4 A;  1S5L Z;  3I55 V;  2QWP B;  5C93 A;  4K0K B;  2WLL B;  3Q4H A;  4KHP O;  5DED A;  1NT2 B;  3FYI B;  4CC6 A;  4B08 A;  3A0H Z;  4JI4 O;  2PY5 A;  1JFF B;  2P6J A;  4CS2 A;  2QEX V;  1NZ6 A;  1Y66 A;  3SJQ C;  1XNR B;  5IJ0 B;  3CMA V;  1YEW A;  2GTA A;  5FPR A;  1R6T A;  2AZ2 A;  5LHH A;  4ZI7 B;  4DR4 O;  2BTO A;  4GKJ O;  2R9R B;  4JI5 B;  1EM1 A;  4YJ2 A;  1AR1 B;  5A9G A;  1GM9 A;  1GRJ A;  1G1X B;  1OCO C;  3SPG A;  2P90 A;  3ABM C;  1R3J C;  3AK2 A;  4DRX B;  5IJ9 B;  3FX7 A;  4GKK B;  1Y74 A;  2PF4 E;  4JI7 O;  4J42 A;  3OD4 A;  3OTO B;  5B3S C;  1F7Y A;  4FLV A;  1KKD A;  1H2K A;  2JRI A;  3CCQ V;  3K9S A;  2C2A A;  2Q7E A;  1GM8 A;  3E8F A;  3VQX A;  4IYH A;  3TCU A;  4DYL A;  2ZR2 A;  1H2G A;  3AG2 B;  1BSM A;  1JCH A;  5JJN B;  2VRZ A;  4HAM A;  1SQB H;  1R1B A;  3SPJ A;  1KP2 A;  4YY3 O;  1Q8I A;  3KG2 A;  1WN7 A;  2Y48 A;  2UUB B;  3CCM V;  2YIA A;  3SYQ A;  4FM0 A;  1QVG U;  4HYO A;  2WLM A;  2OCC C;  4IIJ A;  1Q6H A;  2HFE C;  3D8C A;  2R72 A;  2FTK A;  3T2M A;  3SDL A;  1WA8 B;  3FB8 C;  1F4M A;  1K92 A;  1M1K W;  5E79 Z;  1S3J A;  4QPK A;  1XBL A;  1XI1 A;  4LF9 O;  2JIZ G;  4L87 A;  1OV9 A;  4JI2 O;  2Q9L A;  1COW G;  1IVS A;  1P7G A;  1GH6 A;  3PJS K;  5IYZ A;  3ZMT A;  1XRE A;  4LF7 O;  3I5D A;  2VS0 A;  4NB5 A;  4WFH A;  1FXK A;  1JOY A;  4TV8 A;  2DMX A;  3RYF B;  4A5U B;  4LFC O;  4L8J A;  4MTG A;  4D7T A;  3OT7 A;  2DYS B;  1WLE A;  2CGO A;  1QLE C;  1GN3 A;  4NYK A;  4DUY B;  2GV9 A;  4JI1 B;  3FB5 C;  5IT9 N;  3QG5 A;  3B4S A;  5DN6 G;  2YID A;  2BTQ A;  1SZX A;  1M56 B;  4LF6 O;  2WLK A;  3CRC A;  3F7V C;  2CGN A;  4H44 B;  4X62 O;  3K04 A;  3STZ C;  4ZKI A;  4TQF A;  1B3Q A;  1QR8 A;  2DJV A;  4FM2 A;  1K5Q A;  2EIK B;  4TUY A;  3ZRV A;  1PNM A;  4PA6 A;  2EIL C;  1SET A;  4K0K O;  3JAK A;  4HNA B;  1KKC A;  1AR4 A;  1BHA A;  2ZDI A;  3UM7 A;  3JAS A;  1OCR B;  5JWP A;  2XAS A;  3TXS A;  3HKE B;  1GKF A;  3CXH F;  3JD1 A;  1KMI Z;  4QPJ A;  2RMK B;  4UCO A;  2CH7 B;  2P06 A;  1XNR O;  1SKV A;  3LSS A;  2VQE B;  4J80 A;  2LO1 A;  3RBZ A;  4LFB B;  1M93 A;  2PUS A;  3J7A U;  4I5S A;  4EEQ A;  4BIZ A;  1YVW A;  2LW1 A;  2DQ0 A;  3CEI A;  2ARH A;  4Z2W A;  2YEV A;  1HNZ B;  2IW5 A;  1SER A;  4LF8 B;  4GKK O;  3A0R A;  1OCC C;  3ZHS A;  1NJI W;  3OTO O;  2IH3 C;  1X59 A;  3WU2 Z;  1QQC A;  3U10 A;  1DK1 A;  2F43 G;  3CPW U;  1EZV H;  3CJH B;  4X1K B;  1IXB A;  5E1A C;  5L3C A;  2AZ0 A;  4FFB A;  1NTM H;  3N2G B;  1D5N A;  2YUA A;  3ZRS A;  4D7S A;  2QKA A;  4CH4 A;  4PHZ A;  2PZS A;  3P3N A;  1U97 A;  4R50 A;  2UUB O;  4DR7 B;  4TQD A;  1R3I C;  4GX5 A;  4DV5 B;  2F1M A;  3TK1 A;  3E35 A;  4O2A B;  2QM4 A;  4K35 A;  1OHH G;  4QIW F;  4PDL A;  1R6K A;  3ABK B;  1NQT A;  5B1A C;  1ARO P;  2A9H A;  3JAL B;  2FML A;  5B1O A;  4UCT A;  1FXK C;  3STL C;  4NKG B;  5KAI Z;  5CB4 B;  1FD9 A;  2Q6A A;  4YJ3 A;  3OMA B;  1Q81 W;  4JI0 B;  2ZD9 A;  5CA0 B;  3QO8 A;  4DR6 O;  1U96 A;  1W2B U;  4NXN B;  2AGA A;  2JGD A;  2HVJ C;  1RM1 C;  1SQP H;  2QSA A;  5KX5 A;  2P4V A;  4HZ3 A;  2HKO A;  2WLI B;  4FFK A;  3RGB A;  2W0F C;  3RN4 A;  5K1X A;  3H1H H;  2ZE5 A;  3ETQ A;  4DV2 B;  4UV8 A;  4LCU C;  2EZO A;  1G6U A;  4JI1 O;  3ZRW B;  3CCR V;  1NTK H;  1X4T A;  2N05 A;  4DV0 B;  3B2E E;  1Z2G A;  3B09 A;  4FLX A;  3JAW A;  2RJZ A;  4W4L A;  4OPA A;  5TIS Z;  4PA3 A;  4J7Z A;  5BR8 B;  3ZS8 C;  3ZMV A;  2UU9 B;  3T1Y B;  5JCO A;  1K97 A;  3OEE G;  5IE9 A;  4WBN B;  1CXZ B;  2CTQ A;  2ITC C;  1GO3 F;  4X1I A;  1NI8 A;  1XHX A;  5GON A;  3BEH A;  3M99 B;  1QNM A;  5LP6 A;  1KYO F;  4I0X B;  5C8Y A;  3RYI B;  4TV9 A;  1K9M W;  3OEH G;  3L71 H;  3H01 A;  3A0B Z;  1JQ0 A;  4O4L A;  2VQE O;  1KQS U;  3K03 A;  2EZP A;  4DV3 B;  3ZN1 A;  2IM9 A;  1Y76 A;  3CWB H;  3ETE A;  1R6N A;  2M7W A;  3TGU H;  4F6R B;  2BE3 A;  1GTO A;  4JF3 A;  3RYH A;  3W7S A;  4LF4 O;  2OTJ V;  3GB7 C;  3CX5 F;  5CA3 A;  3AG2 C;  1RSO A;  4LWS B;  2EIJ B;  4HBN A;  4AQY O;  4PA9 A;  2ZM6 B;  3IGA C;  4B3R B;  1FXV A;  1HNZ O;  4MW3 A;  3T4D A;  4LF8 O;  4UCR A;  2JVD A;  4RUF A;  2M6Y A;  4FVM A;  3RW0 A;  3X2Q C;  4O4H B;  4I50 A;  1BE3 H;  4BR6 A;  3Q4H B;  3M8A A;  5KUK A;  2ZNI A;  3SGI A;  3SPI A;  1ENV A;  4EFE A;  4WFG A;  1VQ6 V;  4DR4 B;  4OPH A;  3E2E A;  3ASN C;  1SS3 A;  4ZHQ A;  1ZTE A;  4QE9 A;  4JAS A;  1NS1 A;  3TET A;  3RT3 C;  2IU0 A;  3SYA A;  4PI2 A;  3UT5 B;  1P7B A;  5CBG A;  4DR7 O;  3ASO C;  1KUQ A;  4FIP C;  4UV9 A;  3C90 A;  3FKS G;  4DV7 B;  1Q5O A;  3BVO A;  5D5Q A;  2XAQ A;  2RDC A;  1K33 A;  1EN5 A;  3OUF A;  4YJ2 B;  2UXN A;  3CME V;  1BZK A;  4FZ0 A;  4YXW G;  3WB1 A;  1CP9 A;  2WLH A;  3JAM N;  5LA6 A;  5CA1 A;  1Z5V A;  2ZE6 A;  4PD4 F;  3BCC H;  5IY5 C;  3K5M A;  4UCU A;  1YJN V;  5FL7 G;  4B7E A;  1Q6U A;  1I5X A;  4U3J A;  3CCL V;  5LHG A;  3ETG A;  1HP8 A;  2MW2 B;  2W6I G;  3ZHQ A;  1IUR A;  1YF2 A;  4JI0 O;  4PV1 B;  1GM7 A;  4G27 B;  3FFQ A;  4E4E A;  3CC4 V;  3L70 H;  3IJ4 A;  1MNG A;  1HNX O;  4DV1 O;  4CH6 A;  4F4L A;  1JVM A;  4WFF A;  1DF4 A;  1Q82 W;  4IGG A;  2EIK C;  1E1R G;  3SPC A;  4C7U A;  4LF9 B;  3CB2 A;  3G6B A;  5LXT A;  1YTF D;  1CPY A;  4JZG A;  4DV2 O;  5KA6 A;  1BQ0 A;  1V54 B;  1OCR C;  4FZ1 A;  4DV0 O;  4O4I A;  5BMV A;  4KP4 A;  1K7D A;  4MTF A;  5LP6 C;  1N4C A;  1WP8 A;  1N0J A;  4LR3 A;  2VQF O;  2IJI A;  2R9I A;  1BGY H;  1KC8 W;  2IJH A;  3QF7 A;  4I9Q A;  3CXC U;  5L3F A;  4LFC B;  1GAX A;  5BR8 O;  3T1Y O;  4JI3 O;  1VQ4 V;  1D2D A;  3N2K B;  2RCV A;  4LH7 A;  5IYZ B;  4JGS A;  3ABL C;  1NKD A;  2Q0O C;  4JI6 B;  3T1H B;  5LL6 Y;  1I94 O;  1VQ9 V;  3HKB A;  3BFR A;  1TAE A;  4FLT A;  2L6L A;  1BCC H;  4LF6 B;  1M57 B;  1YI2 V;  2PTM A;  4X62 B;  5KAF Z;  4EB6 A;  5J2U A;  1HR0 B;  1NH2 B;  2QWO B;  4UXN A;  1KP3 A;  3JCU Z;  3K57 A;  5GTH Z;  2H3O A;  4DV3 O;  2XOK G;  3ZJZ A;  4DV4 O;  3HR0 A;  5FLX N;  1VQK V;  2BTQ B;  1PL0 A;  1YSC A;  5AG2 A;  2HR3 A;  3CS5 A;  3UQ8 A;  1NR1 A;  3OE7 G;  2ZM6 O;  4B3R O;  1SES A;  5ITZ A;  1XIL A;  1YJW V;  3FAV A;  2E76 B;  1H38 A;  1NTZ H;  2O57 A;  4PA7 A;  2DWE C;  2A06 H;  1SZT A;  2QWN B;  2PYL A;  2IJJ A;  3HKC B;  2FKX A;  2X6A A;  1QCE A;  2JJ2 G;  2HP8 A;  3JAS B;  2QTO A;  4JYC A;  4XDJ A;  5LMU B;  1YIJ V;  1KU9 A;  3K08 A;  1J5E O;  3ABK C;  3HB3 B;  1FFX B;  1XHZ A;  4PA4 A;  2CDY A;  3E22 A;  1D5A A;  1MG1 A;  3JYC A;  1A32 A;  5J2T B;  1QLN A;  4R8C A;  3DGE A;  1ZWI C;  4P30 A;  3RYC A;  4BW5 A;  5EIB D;  4DV7 O;  3WB0 A;  2F23 A;  2DQ3 A;  2UUA O;  4IYI A;  4ICG A;  3JSN A;  3MD0 A;  4KUM A;  3EFF K;  2YEV B;  4DR3 B;  2EIM B;  4MTX A;  3SJA C;  4GX0 A;  3G4S V;  2H8P C;  1I0H A;  2YIB D;  1K4C C;  3IC9 A;  4MVS A;  5D5P A;  1WPB A;  2QJ1 A;  5LYJ B;  3KCX A;  2W6J G;  1TUB A;  4RQF A;  4B3M B;  3AG3 B;  2BSK A;  2CTP A;  3WB2 A;  4IHJ A;  1BL8 A;  2YC0 A;  4I55 B;  4QNH B;  2WSS G;  2A3Q A;  2P67 A;  5IWA O;  2FYU H;  1VQ7 V;  3J80 N;  3PN1 A;  4OXS A;  1MZE A;  2Q7G A;  2KB1 A;  2N74 A;  3L73 H;  4BWA A;  4FMT A;  3E8H A;  4DR6 B;  5LGN A;  3AG1 B;  5FNV A;  4X64 B;  4LP8 A;  2V1D A;  4JYY A;  2ZXW B;  1N33 B;  4RWU A;  4GX2 A;  2NLJ C;  2YXH A;  5LOV A;  4D6T H;  4DV6 B;  4B3T B;  2ZKO A;  1URF A;  3A8T A;  1Q86 W;  4JI6 O;  3T1H O;  5JJE B;  1VF5 B;  3DXR B;  3JD2 A;  2JGD B;  3OGI B;  1GN4 A;  2EIJ C;  2DYR C;  4I9W A;  4MVO A;  4NXM B;  4LC1 A;  3OAA G;  3S3X A;  3O9O A;  2Y0P A;  1N36 O;  1HR0 O;  4JI8 B;  2N04 A;  4JAA A;  4PI0 A;  5L3D A;  1AI7 A;  1GK9 A;  5JVD A;  1KB9 F;  2AHY A;  4Z1M G;  2EJR A;  1VF7 A;  2EIN B;  1JJO A;  3JAW B;  1M4U A;  1IDS A;  2GUZ B;  4CH3 A;  1WB7 A;  2QKC A;  1YIT V;  5H6Q A;  1HWY A;  2QDO A;  3ZBH A;  4JYA O;  2F95 B;  2HJF C;  1BT8 A;  3CCV V;  4PJ0 Z;  1SQV H;  2GBO A;  1I5Y A;  2XAF A;  3BPZ A;  5IYD O;  2GSM B;  2GHY A;  1FFT B;  3CC2 V;  4X1I B;  1M5I A;  5LMU O;  5GON B;  5L3B A;  4LF4 B;  1SQX H;  2LJ2 A;  4X65 O;  5EIB C;  1KEC A;  1L1F A;  4FPP A;  1N32 B;  1QU7 A;  3QNE A;  4TV9 B;  4AQY B;  5EZY A;  3GWO A;  1VF6 C;  4TWK A;  2Q67 A;  2IU3 A;  5J9P C;  2Y69 B;  5BXZ A;  3UO2 A;  3ZMZ A;  4RQE A;  1XNQ B;  5EK0 A;  1Q90 D;  3AK1 A;  3WG7 B;  2ZE8 A;  4U7N A;  2ATK C;  1V55 C;  1QVF U;  3MHS C;  4YIO A;  1RSO B;  2CTW A;  1MA1 A;  1TA8 A;  1IBK O;  4DR3 O;  1VMG A;  2ZT9 B;  3VOU A;  4P9P A;  3W7X A;  3EHB B;  1HNW O;  4MS2 A;  3T4Z A;  4YIP A;  4I50 B;  1R73 A;  1Y67 A;  3LSU A;  5H2F Z;  2XTA A;  4J10 A;  2VWJ A;  1MMM A;  3H1K H;  1US6 A;  4B3M O;  1WA8 A;  5KHJ A;  3BY6 A;  3CP1 A;  3DSQ A;  2CAZ C;  1H8E G;  2R9A A;  2GDS A;  3JCZ A;  4O4J B;  4UCS A;  4FLU A;  5CBF A;  3BHP A;  4LF5 B;  5B1B C;  5K1P A;  2ETN A;  4X66 O;  3ZHU A;  4MTO A;  1PNL A;  1PM9 A;  3B77 A;  4WCE V;  1K4D C;  3FB7 C;  4DUZ B;  1OCO B;  2DOS A;  2A0L A;  3OR6 C;  4X64 O;  3ABM B;  2G38 A;  1N33 O;  3RWR D;  3OR7 C;  1HNX B;  3SJC C;  4DV1 B;  2B9Z A;  5LA6 B;  5CA1 B;  2X6C A;  4WFB V;  3LDE A;  4DW0 A;  3R66 A;  4H13 B;  4YHH O;  3ABT A;  1WB8 A;  5B3S B;  3IFX A;  3QO5 A;  4U3J B;  3VQY A;  3K06 A;  1EFR G;  2DWD C;  1WJZ A;  3CRM A;  4H0L B;  4DV6 O;  4B3T O;  1KD1 W;  2CE4 A;  2V4D A;  3S3W A;  3UKM A;  5L3E A;  1AJN A;  4CS4 A;  4O2B B;  3OM3 B;  2WA4 A;  4ZOL A;  4NXM O;  3E86 A;  2VQF B;  3QTC A;  2A79 B;  3ZMU A;  1EN6 A;  3HKD B;  4JI8 O;  1BQZ A;  3HPL C;  4U7O A;  2JGU A;  3SYP A;  4RUE A;  2EBO A;  2OCC B;  4JI3 B;  1R3L C;  2E74 B;  1AB3 A;  1SQQ H;  3KCY A;  4O4I B;  1I94 B;  1Q6I A;  1QR9 A;  3K9A A;  2UUC B;  2XND G;  1FYJ A;  3ZX6 A;  3UCS C;  3WFV A;  3ZED A;  5IDJ A;  4DXW A;  5EC2 C;  3LNM B;  1FXH A;  1TVK A;  2QM7 A;  3BA8 A;  1N34 O;  1SA0 A;  5KUM A;  4DV4 B;  1XQ8 A;  2UXX A;  3F5T A;  4XDK A;  1Y4M A;  3ICX A;  1IBM O;  3SYO A;  1N32 O;  2YDE A;  1XOU A;  2EIM C;  5JH7 B;  1JX9 A;  5J2U B;  3C3S A;  4OGQ B;  2XAH A;  3OTF A;  1PL4 A;  1NBM G;  1WP7 A;  3FD9 A;  1QLE B;  2Y4U A;  1XNQ O;  4GT1 A;  2D2C B;  4TT3 G;  4X1K A;  5HFL A;  4DR2 B;  1S72 V;  4X88 A;  3FYE B;  1J5E B;  2RN9 A;  3CSX A;  5KMG A;  1NVP B;  3IC7 A;  5ITZ B;  3W7W A;  1LR1 A;  4KXR A;  2YXY A;  1OCZ B;  4GLX A;  2EIL B;  4GUN A;  5B66 Z;  3CCE V;  3G71 V;  4RAI A;  2AXT Z;  2UXB B;  3ZHV A;  1AJQ A;  2B1G A;  2UUA B;  1VQM V;  1SQF A;  1FJG O;  3JAL A;  3E22 B;  2Z0A A;  2RQ6 A;  1B04 A;  4LF5 O;  4I7Z B;  2B5U A;  4J9Y B;  1L0N H;  1Y74 B;  2F4V B;  2DYS C;  3CHX A;  4IT5 A;  3DC5 A;  1JJ2 U;  3KZI Z;  3APQ A;  4GCZ A;  4WFA V;  4DUZ O;  2X6B A;  1UJW B;  3SPH A;  1M56 C;  3ZMS A;  1MSD A;  1XMO O;  2X0L A;  2W0X A;  1OCC B;  4R7C A;  4MVU A;  4J11 A;  3APO A;  5IWA B;  2HG5 C;  2HLD G;  4IIJ B;  4LNU A;  2DE0 X;  5CN0 A;  1FAF A;  3M7M X;  4Q6G A;  4JZ2 A;  4GZR B;  2BSK B;  3L9D A;  3DTU B;  1ZUQ A;  4X9Q A;  3LNN A;  1GMG A;  3CRA A;  2K9P A;  1BHB A;  3JD0 A;  3J81 N;  1SQG A;  3P3P A;  3W7U A;  1B06 A;  3LDD A;  2JEX A;  1IX9 A;  2QGN A;  1UPG A;  5KHK A;  5B1A B;  2P7T C;  1XEQ A;  5FNV B;  4CS3 A;  3RYI A;  1H2N A;  2UUC O;  1N0N A;  4BIU A;  3E89 A;  5DM6 V;  1FXK B;  1THZ A;  4TV8 B;  4DK1 A;  1EN4 A;  1MOF A;  3BAB A;  2K1E A;  5CBH A;  1N36 B;  3H1I H;  1EBO A;  3OFN G;  5LMN B;  2JS3 A;  4W4K A;  2JDI G;  4F6R A;  3A2F A;  5EYP A;  2F93 B;  4ZBM A;  3CCU V;  3B40 A;  4PEL A;  2Q4P A;  2YSU B;  4B7K A;  4CZZ A;  1RM1 B;  4LWS A;  2Q8V A;  4I4T A;  4N23 A;  1H2L A;  3OMN B;  3E8B A;  3H9V A;  1VQP V;  2UXC B;  4G2K A;  4BW9 A;  1S76 D;  4O4H A;  3K0G A;  4TUY B;  1O9G A;  4JYA B;  5KA5 A;  1G8M A;  3JAK B;  4U3F H;  5BZB A;  1Q7Y W;  1NVP D;  5JVD B;  1AP6 A;  4JAV A;  4DR2 O;  3EVK A;  3RVZ A;  5L3G A;  3K79 A;  4UB6 Z;  4X65 B;  1AIL A;  1CEZ A;  2IH1 C;  2HEP A;  4DR5 B;  1XMQ B;  3UT5 A;  4UUJ C;  2JK5 C;  5LHI A;  3K58 A;  1P84 F;  4MVM A;  3SYC A; 
#chains in the Genus database with same CATH homology
 3L72 H;  2FYU H;  1NTM H;  1PP9 H;  1NTK H;  1BE3 H;  3H1J H;  1BCC H;  1L0N H;  4PD4 F;  3BCC H;  3CWB H;  1BGY H;  1SQQ H;  3L75 H;  3TGU H;  1SQP H;  2BCC H;  3L74 H;  4D6T H;  3L73 H;  1SQV H;  1NU1 H;  2IBZ H;  1KYO F;  1L0L H;  5KLV H;  1KB9 F;  3CX5 F;  3H1I H;  1NTZ H;  2A06 H;  3H1H H;  1EZV H;  3L71 H;  1SQB H;  1SQX H;  4U3F H;  3CXH F;  1P84 F;  3L70 H;  3H1L H;  1PPJ H;  3H1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...