1NTKH

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
PKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntkH00
1SQPH 4U3FH 3H1KH 1L0LH 3CWBH 3L75H 1KB9F 2A06H 3L71H 3CX5F 1L0NH 1PPJH 2FYUH 3L70H 2IBZH 1SQXH 3H1IH 1NTMH 1EZVH 3H1JH 1NTKH 3H1LH 3L73H 1SQBH 4D6TH 3BCCH 1BE3H 1P84F 5KLVH 1SQQH 1NTZH 3L74H 3L72H 1SQVH 1NU1H 1BGYH 2BCCH 3TGUH 1PP9H 4PD4F 1BCCH 1KYOF 3CXHF 3H1HH
chains in the Genus database with same CATH superfamily
4UCRA 4R8CA 2NN4A 1VQ6V 2XAJA 3ZS8C 5DM6V 1K73W 3ZMTA 4FLVA 3G80A 5EC2C 2CTPA 2P90A 1X4TA 1JFFB 4FLZA 2UXDO 1QBZA 4I55A 1WB8A 4Z1VA 2PI4A 1HWYA 2Z0AA 1RPRA 4JYAB 4I50B 2ZXWC 2LP7A 1I08A 4TUYA 3KCYA 3EHBB 3JAKB 2HFEC 4TQDA 2ZE6A 4D7SA 3CXHF 4UB8Z 2KQXA 3CEIA 1NS1A 2YS8A 3OTFA 1GH6A 2FMLA 4DV6O 4LF8O 4XDLA 1VQLV 3JCUZ 4L87A 4LWSB 1L8DA 3T1HB 4JI6O 4J42A 1FXVA 1NI8A 2N74A 3HKEB 4J7JA 1Q5OA 4DR4B 1M56B 4PELA 3CE2A 3UQ8A 4P30A 3AEIA 4GKKO 3FX7A 3K03A 1G8MA 3E89A 2P06A 1H2LA 3SJCC 1GM9A 2WLHA 3T2MA 2ZXWB 2JS3A 3ZN0A 2R70A 3IC9A 5KMGB 5IWAO 2RDCA 2ILMA 3HKBA 3ZCCA 4CS2A 3WB2A 1ZTEA 2KSDA 5LMUO 4FPPA 1K34A 2ZQMA 4CH6A 2B5UA 4K0KB 2EJ7A 1R6TA 3K59A 3JALA 3BHPA 1MABG 4B08A 3P32A 2EX3A 2X0LA 2LO1A 2ZM6O 3BVOA 4X66O 3UO3A 3CHXA 3KCXA 3U0ZA 1X59A 4DV5B 1RPOA 1JVMA 3G71V 1FJGB 2YIBD 2WSSG 4DV4B 1SF9A 3TXQA 2K9PA 3W7WA 3BA8A 4DXWA 2GV9A 1SZXA 5LGUA 1S3JA 4OGQB 4X9QA 1GTOA 3CCRV 5JVDA 3JASB 1HR0O 2Q69A 1F4NA 2QJ1A 3CS5A 4DO2A 2B1GA 4N21A 1NVPB 1DLBA 4JYYA 1D2DA 4ZI7B 2OIGA 4RQFA 4LF4O 2UXCO 3DC5A 1AI6A 2B9ZA 3EFFK 1EN5A 4DR7B 2EIKC 3BAAA 2EIJC 4BIOA 5LXTA 3JD4A 1HNWO 1MSDA 2LW1A 3JD3A 2QWQB 4H13B 4E2LA 1WNSA 2QM7A 2EIMB 4O2AA 3OEHG 1Y76A 1Q6UA 2P5OA 4P2ZA 1G1XB 1WA8A 1KD1W 4QJFB 3QTCA 2R9RB 2JVDA 2Y69C 1WAZA 1DF4A 3SPGA 2QM4A 3OTOO 4X1IB 2HVJC 2FTKA 2JIZG 5CMUA 1WB7A 4ABMA 1FYJA 5BY1A 2UXDB 3AK3A 3ZIAG 2QKAA 5K1PA 2EIKB 1XEQA 4ICGA 4KUMA 1NT2B 3TETA 2EIJB 3HR0A 1LUWA 4RUFA 1BHAA 4K8ZA 1BQ0A 3SYQA 4FFBB 4B7KA 3AG2B 3ML0A 1YHQV 2CE4A 5TISZ 2BSKB 4LF8B 2GHYA 2F4VO 4OPAA 1QVFU 1TUBA 5EZYA 3CCSV 1K4DC 4JF3A 5KHKA 4LF5O 5KHGA 2R9AA 4O4LB 3ABTA 3D3QA 1SZTA 4DR1O 1BL8A 5GONA 4GKKB 3CCQV 2XAQA 3QO5A 2RNBA 5BR8O 3A8TA 2WWWA 1BGYH 1SA0A 2QTSA 5CA1A 2OTLV 4B3TB 1G6UA 1GO3F 3CPWU 3U10A 3WG7B 4LFBB 5IWAB 4GX1A 1PV0A 2R72A 5LHGA 1N34B 1H2KA 3IFXA 2XUMA 2EILB 2YC0A 1CP9A 2V7QG 1RSOA 1XNQO 1NZ6A 1WP8A 4XBFA 3A0BZ 4UV9A 3WB1A 4I0XB 3ZJZA 4X66B 4JI2O 2DYSB 4GYCB 3T4ZA 1NH2D 2UU9O 2JK5C 4FIPC 2CTQA 4R7CA 1JR9A 1I0HA 4BWAA 5L3EA 3CJHA 2GDSA 3RGBA 1I7FA 1BZKA 1F23A 1H8HG 5EIBD 1AR5A 2P4VA 3E22B 5IE9A 1KB9F 1N33O 1Y74A 4UVBA 5J2TB 3OM3B 2NR5A 4AHCA 1Q82W 1B04A 1MMMA 2WLLB 1XHXA 2IJJA 4X8AA 5LOVB 4JASA 5CA0A 2QKSA 4DV2B 3RYCA 5KA5A 4RO2A 4XDJA 1V55B 2L35A 2QA4V 2UXCB 3ZHTA 3FFQA 2RCVA 4WBNB 3B8MA 4C7UA 3T1CA 3CX5F 2JGDB 3RBZA 2EJRA 2OWOA 3K9SA 4EB6A 1FFXA 1HNWB 1S72V 5L3FA 2G38A 4QE7A 4YXWG 1VF7A 4DW0A 2HR3A 4TV8A 1P49A 3JAWA 1Z2GA 4JAAA 2A3QA 3C90A 2JRIA 2PYLA 1OCRC 1ZX3A 4O2BB 2E74B 2HEPA 2AZ0A 1AJNA 3OTOB 3CRAA 1D5NA 1Q6HA 4ZOLB 1HDJA 4QNHB 4FM0A 1OZ0A 5KX5B 3CC2V 1WJZA 3FAVA 3JARB 1Q81W 4EEQA 3I55V 3N2GB 4JZ2A 5LP6A 4FMTA 1NKDA 2HG5C 1VARA 1SRYA 5JH7B 2ZT9B 3F5TA 5LGNA 1KP2A 2IBZH 3VBBA 5DN6G 4DUZO 1SC5B 2HJDA 4JTCB 2BCCH 2CGNA 2YXLA 1XNRB 1OCRB 2XOKG 4LF5B 5GTHZ 1V54C 2CH7B 4I5SA 5LA6A 1XMQO 2K1EA 4X20B 3ZX6A 3T1YB 1RFYA 2A9HA 1XQ8A 1JFFA 1F7YA 5BR8B 1VQMV 3OR7C 4IHJA 4MTGA 3H01A 3VQVA 1CEZA 1NTKH 4DR2O 5LMNO 4I50A 4DR3B 4JGSA 3SPJA 1IURA 3NR7A 1KBHA 3RYFB 1R3JC 1Y6XA 1FXHA 2OCCB 1GM8A 1RP3B 2QGNA 3AG4C 1PM9A 3LSUA 4U3JB 1ZLZA 3HKCB 5JCOA 3L75H 2WLKA 4LWSA 3UKMA 4TQFA 3RW0A 5EYPB 2QR4A 3HKEA 2AHZA 3K5MA 3K5LA 1EM1A 1IBMB 4WFEA 3HKDB 5KA6A 4FLYA 4JI7O 3ZRWB 4ASUG 3UT5B 2F1MA 4JI2B 1IXBA 1TVKA 2YXYA 1NH2B 1HNZB 3STZC 3ASOC 3CMAV 1AB3A 1KKDA 3DC6A 2P22C 3G6BA 1SESA 3WB0A 3CCUV 3OMIB 2ODMA 2Q68A 5FLXN 1H8EG 2ITCC 1N32O 3CCMV 2IJIA 1N33B 5H6QA 4X1KB 4I9WA 1S77D 2DWEC 3CMEV 4B3SB 2F43G 1N36O 2XAFA 4O4JA 1ZWIC 1H2MA 1ZL8A 1VMGA 1YITV 3DTUB 2AHYA 3CD6V 4OX9O 2QWNB 3DGEA 1Q7YW 2Q7EA 3F7YC 1JQ0A 4YY3B 4RAIA 4KP4A 1QLNA 1R1BA 1U96A 1PNKA 2L6LA 4W4LA 2PUSA 3C3TA 4G2KA 4GX5A 4PI0A 4CS3A 4TSFG 1NR1A 4FM2A 2Z5UA 4DV1O 1FPOA 1SQGA 3SJAC 5J9PC 2ZNJA 5C8YA 2ZCEA 4D7TA 3L9DA 3EVKA 4EFEA 1K8AW 4J11A 1OV9A 4YJ2A 3H1IH 2ZE8A 1Q90D 4X65B 5CBFA 1EZJA 4QPKA 1QCEA 3UM7A 3RYHA 2JS5A 2WLJA 3K06A 1EZVH 3G4SV 5IYZB 1SQBH 2GTSA 2BTQB 4B3MB 1IVSA 1NU1H 2Q8VA 1YVWA 3BA9A 1AVMA 3E8BA 3B09A 1ZSPA 3W7UA 4LFCB 4AILC 5JQGA 1M56C 2W0XA 4HBNA 1GKFA 4NR1A 3H9VA 4DV0B 2CK3G 5KAFZ 1N8RW 2IJHA 4HZ3A 4DV7B 4FLUA 1BSMA 1M5IA 2ZINA 4X1IA 2RMKB 4YJ3B 1J5EO 1LUVA 4J7ZA 4PDLA 2VWJA 4WFHA 2FYUH 3E86A 3HB3B 2QEXV 5B66Z 1VQ5V 4JPRA 4CBCA 1PNLA 2EBOA 4JI0O 4PA9A 1MSWD 5B3SB 3ABUA 2C2AA 4O4LA 4UXNA 2IH1C 3H1JH 4RUEA 4J9YB 2ADQB 1YIJV 2EINB 3FB6C 4E4EA 5JWPA 1S5HC 5KUMA 3K58A 3S3WA 3ZRVA 1XILA 2CAZC 4JZGA 3FB7C 3LDEA 1GN2A 2CGOA 1Q8IA 2H3OA 2KG7A 1Q86W 2RN9A 4FJCC 1N32B 1QVGU 1I5XA 5JJJB 3K57A 4BAYA 4O4IA 1AI7A 5FNVB 1YJ9V 4YHHB 3CCEV 4R50A 2ZKOA 2B1IA 1NQTA 2Q9LA 1F4MA 4GZRB 2BOBC 2LGQA 4I0XA 1GK9A 4OX9B 3AG7A 3CC4V 2MW2B 2DWDC 1EN6A 4LH6A 2XNDG 5ITZA 2YI8A 4MSWC 1JJOA 2YIBA 1S76D 4PDVA 2EIMC 4GKJO 5E1AC 1FD9A 1VQPV 2UUCO 5C93A 2XT9A 4NTYA 3IC7A 2HP8A 4FLXA 2X6BA 2DMXA 1PL0A 4DV1B 1MA1A 1U97A 4FZ1A 1IBLB 3APQA 5J2TA 1S5LZ 1VF6C 1Y67A 4JI4O 1KU9A 2HVKC 2YIAA 3APOA 5B1OA 2CTRA 1OCZB 2ETNA 4TV9B 3VQYA 5LOVA 4MVSA 3BEHA 1VQKV 1SQVH 1WLEA 1JX9A 4K3AA 3B40A 2BOCC 3TGUH 4A5UB 4FLWA 3N2KB 3LUTB 3K3WA 1GN4A 3AG2C 3G67A 5FL7G 1PPJH 2ITDC 3K0DA 2XASA 2A0LA 4NXNB 4LF6O 3K08A 1JA8A 1FXKB 2WLNA 4IL6Z 3BRCA 1VP7A 4AI8A 4EFBA 5BMVB 4I4TB 1K5SA 4J7KA 4FM1A 2PI5A 1XMOO 1SQPH 4IT5A 1AROP 5F2VO 4BW9A 2H8PC 3ZMSA 5FPRA 3QO7A 2QE7G 4ZKIA 4Z2WA 2VQEO 1TGOA 4I55B 1GM7A 2ZDIC 4JI3O 3WG7C 4KXRA 4WCEV 5KX5A 4UCTA 3FD9A 3JARA 4DV6B 4FLTA 4JI6B 3N2GA 5IJ0B 3S3XA 3CSXA 3E8HA 3GWKC 4DYLA 3BABA 3GB7C 2QDOA 2EILC 2N04A 4O4HA 2EULA 4H44B 3L73H 1YXBA 2RQ6A 1AJQA 1QR8A 2DYRC 1M93A 2DYSC 2CH7A 4LF9O 1P7GA 4N23A 3ZHRA 4F6EA 3RWRD 4X20A 4CC6A 1E79G 2GUZA 3CWBH 3ASNB 4IYIA 5CN0A 4DR6O 2YEVB 3E35A 3SJQC 4FK5C 2Q73A 1IZ3A 4GCZA 1Z5VA 3OR6C 2P4KA 1MZFA 5LMUB 2E5LO 3W7XA 3ABKB 5LYJA 1CPYA 5CBHA 3ZHUA 3RYFA 2IJKA 3MAQA 1K9MW 2ADPA 3BY6A 1E1RG 4IYHA 4NKGB 4DV3O 1L0LH 3OMNB 3JALB 2ZM6B 2DYRB 1FS0G 4KL1A 2HHHO 1V55C 1B06A 3K9AA 4MTXA 1R3KC 2KKWA 3ZRWA 2KB1A 1NR7A 1PP9H 2F93B 3UT5A 5H6RA 5IYBO 3RFRA 2HKOA 1KYOF 1TAEA 5CB4B 1AILA 1H2NA 5IJ9A 1PNMA 3H1KH 4LC1A 1UPGA 4CH4A 1YTFD 4UCVA 3LNNA 1GN3A 1PL4A 1HR0B 4GKJB 2IW5A 1US6A 1Q3EA 3CYOA 5JVDB 4JTAB 1E1QG 4NB5A 4RWUA 4IIJA 4NTWA 3T4DA 1S5JA 2DE0X 3P3NA 2M6YA 4X1KA 4LF4B 1YCIA 4JI1O 1EBOA 2W6IG 1N0JA 2DN9A 4LP8A 4B3RO 2YI9A 4OXSA 4P9PA 2FL4A 4PJ0Z 2QKCA 4BW5A 1SKVA 3ZMZA 4YIPA 1O9GA 4MVOA 1DTOA 1MOFA 2DW4A 1Y76B 2LFRA 4J9ZB 3Q4HA 3IAYA 4Q20A 3OMAB 1NTMH 4QPJA 2PTMA 3HPLC 3JSNA 3OUSA 4U7NA 3JD1A 1FAFA 2OYQA 1XI1A 2GTAA 3SPCA 1URFA 3R65A 2E3CA 4X62O 4F6RA 5EK0A 2DQ3A 2Q7GA 1K33A 2YIDA 3LSSA 2OCCC 4UCOA 5IYZA 5D5QA 4MW8A 2BTQA 3R66A 3BCCH 2F4VB 5J2UB 2UUAO 2CTWA 3DSQA 1TUBB 1KUQA 1EN4A 4DR1B 2QWRB 5L3DA 2JJ2G 3NXSA 2OTJV 4K8XA 3OGIB 4L8JA 2N05A 3ZN1A 3TCUA 3WU2Z 1YZBA 3D8CA 4NVPA 1SA0B 5KHIA 4LF7O 3JAKA 4JYAO 4DR6B 3ETGA 3QF7A 1R3IC 1GMGA 2Y48A 4WFBV 5EIBC 3F5WC 5EBLC 4CH5A 1RM1B 1XNQB 3JCZA 3DXRB 4ZHQB 3ZHVA 5IDJA 4DV3B 1Q6IA 5HFMA 1YSCA 4DK0A 4RQEA 1PD3A 4DR4O 1RSOB 1KC8W 5AG2A 4HNAB 4I7ZB 2NNUA 1XREA 2XAHA 2UU9B 3QNEA 5LL6Y 2YDEA 1THZA 2AZ2A 5KMGA 4UV8A 2Q0AA 3MHHC 3OFNG 4YIOA 1YTFB 2QWOB 3OEEG 3CJHB 1YJWV 3G6EV 2X7RB 5JJEB 3SYAA 3J7AU 4GUNA 3SDLA 2GBOA 1GRJA 5IYCO 1R6NA 3QO8A 1R73A 1N0NA 5H5NA 2PY5A 3FB8C 3TJTA 4WFGA 5CA0B 3AG1B 4JI1B 3VQXA 5FNVA 3K5OA 3RYCB 3ICXA 4MVRA 3QG5A 5KHHA 3STLC 4DV5O 4DRXB 4B3RB 3SYPA 2A7WA 1BHBA 3B4SA 3I5DA 3B8NA 5B1AB 1FJGO 3CCVV 4DV4O 3C3SA 4WFFA 3WFVA 2VQFO 3ZRSA 1Z5WA 3KZIZ 1SS3A 3VQWA 5CBGA 1Y4MA 3SJBC 4NXMO 3A0HZ 1VQ8V 3JASA 1K5QA 1NTZH 3UO2A 1D5AA 1KP3A 3JAWB 1KECA 2ARHA 3FKSG 1XL6A 4ZI7A 2AW9A 4X1YB 2WA3A 1I5YA 1ROPA 4TV9A 1L1FA 4X64O 1IBKO 1GAXA 2VRZA 1QU7A 2WLMA 4UCUA 4PA7A 1NJIW 4X62B 1YF2A 1BQZA 1AI4A 5DEDA 4HAMA 4CS4A 3AG3B 1VQ4V 3B77A 4MTOA 5A9GA 3JYCA 3LDCA 4X88A 4DUZB 2UUAB 3FB5C 2LQTA 2EZOA 3A2FA 5B3SC 4DUYO 3L74H 1XMQB 5BMVA 1BS3A 3JATB 1B3QA 4I4TA 1AJPA 1VF6A 2P6JA 2PF4E 1B6QA 1QLEB 3OD4A 2UXNA 2EINC 1K4CC 4DR2B 5LMNB 5DECA 2PGGA 4IHJB 4LF7B 3U11A 2Y0IA 4FFBA 3OT7A 3CRCA 2WPDG 1R3LC 5IY5B 2BSKA 5KAIZ 1V9PA 5IJ0A 3IJ4A 2MK3A 3SPIA 1OCOC 3K0GA 2XHBA 1OCCB 1ZAUA 4JV5O 2UXXA 4JI7B 3K5NA 3LDDA 2ZIOA 2WLIB 1XBLA 1S0VA 1JCHA 5CA3A 2FKXA 3OUFA 1TVKB 1WPBA 2Q0OC 1AP5A 2DOSA 2ZDIA 3O9OA 5JJNB 4B3TO 1XUQA 3CRMA 3A0RA 5FPOA 2YEVA 3SPHA 1LR1A 2Y4TA 4LFBO 3D36C 3W7TA 1AP6A 3AK1A 1VQ7V 1SQQH 2YICA 2E76B 3BFRA 1N34O 1OCOB 2Q4PA 3ZRXA 1AR1B 3K79A 4CC5A 1N36B 1OCZC 2NLJC 3M99B 5BXZA 4R6ZA 5LBQA 4O4JB 5KUKA 3ETEA 2DJVA 3SYOA 2W6JG 1ZL8B 5KHJA 3JSLA 5HFLA 3H1LH 1MZEA 3X2QC 2O57A 2BTOA 4TWKA 3FYIB 1QNMA 2XTAA 4G28B 1FKAO 2VWKA 3AK2A 3OGCC 2YUAA 5CB4A 1I94O 2QWPB 1Y66A 3E2EA 1G4YB 2CDYA 2VQFB 1K7DA 2EZPA 1DK1A 1FXKC 3E22A 4NXMB 4DR5O 2Q6AA 1XL4A 1M9NA 1VIBA 2QSAA 2WLLA 5K1XA 3LSQA 3RT3C 5C8YB 4LFAO 1KMIZ 3M7MX 2Y4UA 1DGSA 4UUJC 4YJ2B 4UFZA 4H37A 2WA4A 3X2QB 4DV2O 1Q43A 4DK1A 3RYIB 2A06H 4X64B 3ZHSA 4WBNA 4MVZA 1IBKB 3GVMA 2JGDA 1UFIA 3N27A 3RYHB 3L70H 4QE9A 2V1DA 2PYJA 4GT1A 1SQXH 3VOUA 4LH7A 1K3EA 1XHZA 1QHTA 2ZD9A 4KHPO 4PD4F 4XDKA 5EBMC 4PA4A 4LNUB 4Q6GA 1SQFA 5LHIA 5JQGB 2F66C 2BE3A 4DUYB 5IYDO 1ORQC 4O2BA 2UXBO 4IGGA 3JD0A 1M90W 5KLVH 3ASNC 2WAMA 1J5EB 3L72H 3CP1A 4ZOLA 3J81N 4TUYB 1IX9A 4LR3A 1P4RA 4BR6A 2IU0A 1QQCA 1M1KW 2QM8A 1W0JG 3ABKC 5GW7A 4Z1MG 4MVQA 3RVZA 5B1NA 1EFRG 5JH7A 5B5EZ 2Y0PA 4EKWA 5LGTA 4J10A 4JI8O 1TA8A 2UUBO 1IXMA 3ZMVA 3E8GA 4JI0B 4PI2A 5J2UA 1BE3H 2YXHA 2F95B 5L3CA 5B1BC 1K97A 1W59A 4GLXA 3OW2U 3KKYA 3CCLV 4JV5B 2Y69B 2LJ2A 5L3BA 1XNRO 1ZUQA 4GX2A 4P9OA 1O9HA 1IDSA 1BT8A 4H0LB 3GWOA 5D5PA 2E75B 3T1YO 2Q5ZA 1KKCA 1KQSU 2JJ1G 1H2GA 1H2SB 2YSUB 3ZHQA 5IT9N 3HKBB 3O65A 2P7TC 1LNQA 1CXZB 3ETDA 4HYOA 4DR3O 3OAAG 2JEUA 3ZBHA 1VQNV 1BMFG 4U3JA 4X89A 3HKCA 2KG7B 1HW7A 1L0NH 4TOIA 5B1BB 5EYPA 4NTXA 2PZSA 3DXRA 4ZHQA 3ABLC 3HKDA 2H94A 4NYKA 4JYBA 1QR9A 4O4IB 4G27B 2IM9A 1HP8A 4JTDB 1IBMO 4HNAA 1VEWA 1HNXO 2P67A 2V4DA 2W0FC 1HNZO 4PDRA 4LCUC 5ITZB 2UUCB 1I94B 1F51A 5H9CA 3W7SA 3F7VC 4DR5B 1R6KA 4JI5O 1FFTB 3M8AA 4JI4B 3ABLB 1H38A 1OJHA 2QTOA 3UCSC 4WFAV 2X6CA 4LFAB 4B3SO 3THOA 2FB5A 4MVUA 1W0KG 4PA3A 2F23A 3MHSC 3P30A 2AGAA 5LXTB 5GTIZ 4FFKA 1YDXA 3QVNA 4DRXA 1UJWB 4U3FH 4YY3O 4DW1A 4AQYO 4O2AB 4LF6B 1P7BA 4KHPB 4QIWF 3JAMN 3ABMC 1WA8B 2ZNIA 1JPXA 3SR2C 3OE7G 1XMOB 4FVMA 1AI5A 2JEXA 2IU3A 2UXBB 2LW7A 2Q67A 2VQEB 1WPXA 3E8FA 4X1YA 4JI3B 4X65O 1NBMG 3ZMUA 1VF5B 2OCHA 1M4UA 3FYEB 3CCJV 4LBEC 4H33A 4ZBMA 1BCCH 4KFMA 2IH3C 4TT3G 4B3MO 4CH3A 5EZYB 3ABMB 1RM1C 4UB6Z 4JI8B 2UUBB 2VS0A 4QGPA 4MW3A 2A79B 2ZE5A 4LFCO 3MDSA 4O4HB 2XAGA 3I56V 2Z3YA 1WP7A 5GONB 4PHZA 1W2BU 2HLDG 2OT5A 3SGIA 4LF9B 3J80N 3RN4A 4DV0O 5BZBA 1COWG 3JATA 4DV7O 5CA1B 4YJ3A 4W4KA 1SERA 1DF5A 3LNMB 2GUZB 1M57C 4OPHA 2E5LB 2OIEA 3CRRA 4CZZA 3EXAA 2HJFC 5H2FZ 4PDMA 2ZR3A 4D6TH 3T1HO 4J80A 4ZIBA 5LYJB 2ZR2A 4UVAA 4J41A 1JOYA 3H1HH 1TUEB 2ATKC 2ZIMA 3AG1C 3BPZA 2HHHB 3L71H 2JDIG 1V54B 1JJ2U 1AR4A 3E83A 1YEWA 2JGUA 2WLIA 2R9IA 4PV1B 4GX0A 5EBWC 3P3PA 1M57B 5B1AC 1HNXB 3RVYA 4F4LA 4FZ0A 5IJ9B 2GSMB 2M7WA 1PKXA 4MVMA 4K0KO 3D3IA 4JAUA 1Y74B 3CC7V 1YI2V 3AG4B 2CUGA 1P84F 4JI5B 1K92A 3TXSA 4IIJB 1XOUA 1N4CA 2D2CB 3JD2A 1JMKC 5A2QN 4YHHO 3CB2A 4WF9V 1MG1A 2X6AA 3AG3C 5L3GA 4MTFA 5E79Z 1VQ9V 4EB6B 1FFXB 5EC1C 3MD0A 5LP6C 3ASOB 4BIZA 4AQYB 3D36A 4TV8B 3TK1A 1YJNV 3CXCU 1VQOV 1ENVA 4UCSA 3ZEDA 1XDCA 3Q4HB 1NVPD 3PN1A 2LGWA 4U7OA 3B2EE 1IBLO 1SETA 1QLEC 4B7EA 2LFSA 3PJSK 2D3OW 4BIUA 4JYCA 2Q7HA 1GN6A 3SYCA 1T5EA 1MNGA 4PA6A 3ETQA 4DR7O 3FAVB 3K04A 2RJZA 3KG2A 3RYIA 4F6RB 4JAVA 3CRQA 3N2KA 2DQ0A 5LP6B 1OHHG 5IY5C 2ZE7A 4UVCA 5LHHA 3IGAC 4K35A 2AXTZ 1WN7A 1FXKA 4MS2A 5JCOC 4MT8A 4NXNO 1OCCC 1A32A 1J95A 4I9QA 4LNUA 5LA6B
chains in the Genus database with same CATH topology
1SQPH 4U3FH 3H1KH 1L0LH 3CWBH 3L75H 1KB9F 2A06H 3L71H 3CX5F 1L0NH 1PPJH 2FYUH 3L70H 2IBZH 1SQXH 3H1IH 1NTMH 1EZVH 3H1JH 1NTKH 3H1LH 3L73H 1SQBH 4D6TH 3BCCH 1BE3H 1P84F 5KLVH 1SQQH 1NTZH 3L74H 3L72H 1SQVH 1NU1H 1BGYH 2BCCH 3TGUH 1PP9H 4PD4F 1BCCH 1KYOF 3CXHF 3H1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP H;  4U3F H;  3H1K H;  1L0L H;  3CWB H;  3L75 H;  1KB9 F;  2A06 H;  3L71 H;  3CX5 F;  1L0N H;  1PPJ H;  2FYU H;  3L70 H;  2IBZ H;  1SQX H;  3H1I H;  1NTM H;  1EZV H;  3H1J H;  1NTK H;  3H1L H;  3L73 H;  1SQB H;  4D6T H;  3BCC H;  1BE3 H;  1P84 F;  5KLV H;  1SQQ H;  1NTZ H;  3L74 H;  3L72 H;  1SQV H;  1NU1 H;  1BGY H;  2BCC H;  3TGU H;  1PP9 H;  4PD4 F;  1BCC H;  1KYO F;  3CXH F;  3H1H H; 
#chains in the Genus database with same CATH topology
 4UCR A;  4R8C A;  2NN4 A;  1VQ6 V;  2XAJ A;  3ZS8 C;  5DM6 V;  1K73 W;  3ZMT A;  4FLV A;  3G80 A;  5EC2 C;  2CTP A;  2P90 A;  1X4T A;  1JFF B;  4FLZ A;  2UXD O;  1QBZ A;  4I55 A;  1WB8 A;  4Z1V A;  2PI4 A;  1HWY A;  2Z0A A;  1RPR A;  4JYA B;  4I50 B;  2ZXW C;  2LP7 A;  1I08 A;  4TUY A;  3KCY A;  3EHB B;  3JAK B;  2HFE C;  4TQD A;  2ZE6 A;  4D7S A;  3CXH F;  4UB8 Z;  2KQX A;  3CEI A;  1NS1 A;  2YS8 A;  3OTF A;  1GH6 A;  2FML A;  4DV6 O;  4LF8 O;  4XDL A;  1VQL V;  3JCU Z;  4L87 A;  4LWS B;  1L8D A;  3T1H B;  4JI6 O;  4J42 A;  1FXV A;  1NI8 A;  2N74 A;  3HKE B;  4J7J A;  1Q5O A;  4DR4 B;  1M56 B;  4PEL A;  3CE2 A;  3UQ8 A;  4P30 A;  3AEI A;  4GKK O;  3FX7 A;  3K03 A;  1G8M A;  3E89 A;  2P06 A;  1H2L A;  3SJC C;  1GM9 A;  2WLH A;  3T2M A;  2ZXW B;  2JS3 A;  3ZN0 A;  2R70 A;  3IC9 A;  5KMG B;  5IWA O;  2RDC A;  2ILM A;  3HKB A;  3ZCC A;  4CS2 A;  3WB2 A;  1ZTE A;  2KSD A;  5LMU O;  4FPP A;  1K34 A;  2ZQM A;  4CH6 A;  2B5U A;  4K0K B;  2EJ7 A;  1R6T A;  3K59 A;  3JAL A;  3BHP A;  1MAB G;  4B08 A;  3P32 A;  2EX3 A;  2X0L A;  2LO1 A;  2ZM6 O;  3BVO A;  4X66 O;  3UO3 A;  3CHX A;  3KCX A;  3U0Z A;  1X59 A;  4DV5 B;  1RPO A;  1JVM A;  3G71 V;  1FJG B;  2YIB D;  2WSS G;  4DV4 B;  1SF9 A;  3TXQ A;  2K9P A;  3W7W A;  3BA8 A;  4DXW A;  2GV9 A;  1SZX A;  5LGU A;  1S3J A;  4OGQ B;  4X9Q A;  1GTO A;  3CCR V;  5JVD A;  3JAS B;  1HR0 O;  2Q69 A;  1F4N A;  2QJ1 A;  3CS5 A;  4DO2 A;  2B1G A;  4N21 A;  1NVP B;  1DLB A;  4JYY A;  1D2D A;  4ZI7 B;  2OIG A;  4RQF A;  4LF4 O;  2UXC O;  3DC5 A;  1AI6 A;  2B9Z A;  3EFF K;  1EN5 A;  4DR7 B;  2EIK C;  3BAA A;  2EIJ C;  4BIO A;  5LXT A;  3JD4 A;  1HNW O;  1MSD A;  2LW1 A;  3JD3 A;  2QWQ B;  4H13 B;  4E2L A;  1WNS A;  2QM7 A;  2EIM B;  4O2A A;  3OEH G;  1Y76 A;  1Q6U A;  2P5O A;  4P2Z A;  1G1X B;  1WA8 A;  1KD1 W;  4QJF B;  3QTC A;  2R9R B;  2JVD A;  2Y69 C;  1WAZ A;  1DF4 A;  3SPG A;  2QM4 A;  3OTO O;  4X1I B;  2HVJ C;  2FTK A;  2JIZ G;  5CMU A;  1WB7 A;  4ABM A;  1FYJ A;  5BY1 A;  2UXD B;  3AK3 A;  3ZIA G;  2QKA A;  5K1P A;  2EIK B;  1XEQ A;  4ICG A;  4KUM A;  1NT2 B;  3TET A;  2EIJ B;  3HR0 A;  1LUW A;  4RUF A;  1BHA A;  4K8Z A;  1BQ0 A;  3SYQ A;  4FFB B;  4B7K A;  3AG2 B;  3ML0 A;  1YHQ V;  2CE4 A;  5TIS Z;  2BSK B;  4LF8 B;  2GHY A;  2F4V O;  4OPA A;  1QVF U;  1TUB A;  5EZY A;  3CCS V;  1K4D C;  4JF3 A;  5KHK A;  4LF5 O;  5KHG A;  2R9A A;  4O4L B;  3ABT A;  3D3Q A;  1SZT A;  4DR1 O;  1BL8 A;  5GON A;  4GKK B;  3CCQ V;  2XAQ A;  3QO5 A;  2RNB A;  5BR8 O;  3A8T A;  2WWW A;  1BGY H;  1SA0 A;  2QTS A;  5CA1 A;  2OTL V;  4B3T B;  1G6U A;  1GO3 F;  3CPW U;  3U10 A;  3WG7 B;  4LFB B;  5IWA B;  4GX1 A;  1PV0 A;  2R72 A;  5LHG A;  1N34 B;  1H2K A;  3IFX A;  2XUM A;  2EIL B;  2YC0 A;  1CP9 A;  2V7Q G;  1RSO A;  1XNQ O;  1NZ6 A;  1WP8 A;  4XBF A;  3A0B Z;  4UV9 A;  3WB1 A;  4I0X B;  3ZJZ A;  4X66 B;  4JI2 O;  2DYS B;  4GYC B;  3T4Z A;  1NH2 D;  2UU9 O;  2JK5 C;  4FIP C;  2CTQ A;  4R7C A;  1JR9 A;  1I0H A;  4BWA A;  5L3E A;  3CJH A;  2GDS A;  3RGB A;  1I7F A;  1BZK A;  1F23 A;  1H8H G;  5EIB D;  1AR5 A;  2P4V A;  3E22 B;  5IE9 A;  1KB9 F;  1N33 O;  1Y74 A;  4UVB A;  5J2T B;  3OM3 B;  2NR5 A;  4AHC A;  1Q82 W;  1B04 A;  1MMM A;  2WLL B;  1XHX A;  2IJJ A;  4X8A A;  5LOV B;  4JAS A;  5CA0 A;  2QKS A;  4DV2 B;  3RYC A;  5KA5 A;  4RO2 A;  4XDJ A;  1V55 B;  2L35 A;  2QA4 V;  2UXC B;  3ZHT A;  3FFQ A;  2RCV A;  4WBN B;  3B8M A;  4C7U A;  3T1C A;  3CX5 F;  2JGD B;  3RBZ A;  2EJR A;  2OWO A;  3K9S A;  4EB6 A;  1FFX A;  1HNW B;  1S72 V;  5L3F A;  2G38 A;  4QE7 A;  4YXW G;  1VF7 A;  4DW0 A;  2HR3 A;  4TV8 A;  1P49 A;  3JAW A;  1Z2G A;  4JAA A;  2A3Q A;  3C90 A;  2JRI A;  2PYL A;  1OCR C;  1ZX3 A;  4O2B B;  2E74 B;  2HEP A;  2AZ0 A;  1AJN A;  3OTO B;  3CRA A;  1D5N A;  1Q6H A;  4ZOL B;  1HDJ A;  4QNH B;  4FM0 A;  1OZ0 A;  5KX5 B;  3CC2 V;  1WJZ A;  3FAV A;  3JAR B;  1Q81 W;  4EEQ A;  3I55 V;  3N2G B;  4JZ2 A;  5LP6 A;  4FMT A;  1NKD A;  2HG5 C;  1VAR A;  1SRY A;  5JH7 B;  2ZT9 B;  3F5T A;  5LGN A;  1KP2 A;  2IBZ H;  3VBB A;  5DN6 G;  4DUZ O;  1SC5 B;  2HJD A;  4JTC B;  2BCC H;  2CGN A;  2YXL A;  1XNR B;  1OCR B;  2XOK G;  4LF5 B;  5GTH Z;  1V54 C;  2CH7 B;  4I5S A;  5LA6 A;  1XMQ O;  2K1E A;  4X20 B;  3ZX6 A;  3T1Y B;  1RFY A;  2A9H A;  1XQ8 A;  1JFF A;  1F7Y A;  5BR8 B;  1VQM V;  3OR7 C;  4IHJ A;  4MTG A;  3H01 A;  3VQV A;  1CEZ A;  1NTK H;  4DR2 O;  5LMN O;  4I50 A;  4DR3 B;  4JGS A;  3SPJ A;  1IUR A;  3NR7 A;  1KBH A;  3RYF B;  1R3J C;  1Y6X A;  1FXH A;  2OCC B;  1GM8 A;  1RP3 B;  2QGN A;  3AG4 C;  1PM9 A;  3LSU A;  4U3J B;  1ZLZ A;  3HKC B;  5JCO A;  3L75 H;  2WLK A;  4LWS A;  3UKM A;  4TQF A;  3RW0 A;  5EYP B;  2QR4 A;  3HKE A;  2AHZ A;  3K5M A;  3K5L A;  1EM1 A;  1IBM B;  4WFE A;  3HKD B;  5KA6 A;  4FLY A;  4JI7 O;  3ZRW B;  4ASU G;  3UT5 B;  2F1M A;  4JI2 B;  1IXB A;  1TVK A;  2YXY A;  1NH2 B;  1HNZ B;  3STZ C;  3ASO C;  3CMA V;  1AB3 A;  1KKD A;  3DC6 A;  2P22 C;  3G6B A;  1SES A;  3WB0 A;  3CCU V;  3OMI B;  2ODM A;  2Q68 A;  5FLX N;  1H8E G;  2ITC C;  1N32 O;  3CCM V;  2IJI A;  1N33 B;  5H6Q A;  4X1K B;  4I9W A;  1S77 D;  2DWE C;  3CME V;  4B3S B;  2F43 G;  1N36 O;  2XAF A;  4O4J A;  1ZWI C;  1H2M A;  1ZL8 A;  1VMG A;  1YIT V;  3DTU B;  2AHY A;  3CD6 V;  4OX9 O;  2QWN B;  3DGE A;  1Q7Y W;  2Q7E A;  3F7Y C;  1JQ0 A;  4YY3 B;  4RAI A;  4KP4 A;  1QLN A;  1R1B A;  1U96 A;  1PNK A;  2L6L A;  4W4L A;  2PUS A;  3C3T A;  4G2K A;  4GX5 A;  4PI0 A;  4CS3 A;  4TSF G;  1NR1 A;  4FM2 A;  2Z5U A;  4DV1 O;  1FPO A;  1SQG A;  3SJA C;  5J9P C;  2ZNJ A;  5C8Y A;  2ZCE A;  4D7T A;  3L9D A;  3EVK A;  4EFE A;  1K8A W;  4J11 A;  1OV9 A;  4YJ2 A;  3H1I H;  2ZE8 A;  1Q90 D;  4X65 B;  5CBF A;  1EZJ A;  4QPK A;  1QCE A;  3UM7 A;  3RYH A;  2JS5 A;  2WLJ A;  3K06 A;  1EZV H;  3G4S V;  5IYZ B;  1SQB H;  2GTS A;  2BTQ B;  4B3M B;  1IVS A;  1NU1 H;  2Q8V A;  1YVW A;  3BA9 A;  1AVM A;  3E8B A;  3B09 A;  1ZSP A;  3W7U A;  4LFC B;  4AIL C;  5JQG A;  1M56 C;  2W0X A;  4HBN A;  1GKF A;  4NR1 A;  3H9V A;  4DV0 B;  2CK3 G;  5KAF Z;  1N8R W;  2IJH A;  4HZ3 A;  4DV7 B;  4FLU A;  1BSM A;  1M5I A;  2ZIN A;  4X1I A;  2RMK B;  4YJ3 B;  1J5E O;  1LUV A;  4J7Z A;  4PDL A;  2VWJ A;  4WFH A;  2FYU H;  3E86 A;  3HB3 B;  2QEX V;  5B66 Z;  1VQ5 V;  4JPR A;  4CBC A;  1PNL A;  2EBO A;  4JI0 O;  4PA9 A;  1MSW D;  5B3S B;  3ABU A;  2C2A A;  4O4L A;  4UXN A;  2IH1 C;  3H1J H;  4RUE A;  4J9Y B;  2ADQ B;  1YIJ V;  2EIN B;  3FB6 C;  4E4E A;  5JWP A;  1S5H C;  5KUM A;  3K58 A;  3S3W A;  3ZRV A;  1XIL A;  2CAZ C;  4JZG A;  3FB7 C;  3LDE A;  1GN2 A;  2CGO A;  1Q8I A;  2H3O A;  2KG7 A;  1Q86 W;  2RN9 A;  4FJC C;  1N32 B;  1QVG U;  1I5X A;  5JJJ B;  3K57 A;  4BAY A;  4O4I A;  1AI7 A;  5FNV B;  1YJ9 V;  4YHH B;  3CCE V;  4R50 A;  2ZKO A;  2B1I A;  1NQT A;  2Q9L A;  1F4M A;  4GZR B;  2BOB C;  2LGQ A;  4I0X A;  1GK9 A;  4OX9 B;  3AG7 A;  3CC4 V;  2MW2 B;  2DWD C;  1EN6 A;  4LH6 A;  2XND G;  5ITZ A;  2YI8 A;  4MSW C;  1JJO A;  2YIB A;  1S76 D;  4PDV A;  2EIM C;  4GKJ O;  5E1A C;  1FD9 A;  1VQP V;  2UUC O;  5C93 A;  2XT9 A;  4NTY A;  3IC7 A;  2HP8 A;  4FLX A;  2X6B A;  2DMX A;  1PL0 A;  4DV1 B;  1MA1 A;  1U97 A;  4FZ1 A;  1IBL B;  3APQ A;  5J2T A;  1S5L Z;  1VF6 C;  1Y67 A;  4JI4 O;  1KU9 A;  2HVK C;  2YIA A;  3APO A;  5B1O A;  2CTR A;  1OCZ B;  2ETN A;  4TV9 B;  3VQY A;  5LOV A;  4MVS A;  3BEH A;  1VQK V;  1SQV H;  1WLE A;  1JX9 A;  4K3A A;  3B40 A;  2BOC C;  3TGU H;  4A5U B;  4FLW A;  3N2K B;  3LUT B;  3K3W A;  1GN4 A;  3AG2 C;  3G67 A;  5FL7 G;  1PPJ H;  2ITD C;  3K0D A;  2XAS A;  2A0L A;  4NXN B;  4LF6 O;  3K08 A;  1JA8 A;  1FXK B;  2WLN A;  4IL6 Z;  3BRC A;  1VP7 A;  4AI8 A;  4EFB A;  5BMV B;  4I4T B;  1K5S A;  4J7K A;  4FM1 A;  2PI5 A;  1XMO O;  1SQP H;  4IT5 A;  1ARO P;  5F2V O;  4BW9 A;  2H8P C;  3ZMS A;  5FPR A;  3QO7 A;  2QE7 G;  4ZKI A;  4Z2W A;  2VQE O;  1TGO A;  4I55 B;  1GM7 A;  2ZDI C;  4JI3 O;  3WG7 C;  4KXR A;  4WCE V;  5KX5 A;  4UCT A;  3FD9 A;  3JAR A;  4DV6 B;  4FLT A;  4JI6 B;  3N2G A;  5IJ0 B;  3S3X A;  3CSX A;  3E8H A;  3GWK C;  4DYL A;  3BAB A;  3GB7 C;  2QDO A;  2EIL C;  2N04 A;  4O4H A;  2EUL A;  4H44 B;  3L73 H;  1YXB A;  2RQ6 A;  1AJQ A;  1QR8 A;  2DYR C;  1M93 A;  2DYS C;  2CH7 A;  4LF9 O;  1P7G A;  4N23 A;  3ZHR A;  4F6E A;  3RWR D;  4X20 A;  4CC6 A;  1E79 G;  2GUZ A;  3CWB H;  3ASN B;  4IYI A;  5CN0 A;  4DR6 O;  2YEV B;  3E35 A;  3SJQ C;  4FK5 C;  2Q73 A;  1IZ3 A;  4GCZ A;  1Z5V A;  3OR6 C;  2P4K A;  1MZF A;  5LMU B;  2E5L O;  3W7X A;  3ABK B;  5LYJ A;  1CPY A;  5CBH A;  3ZHU A;  3RYF A;  2IJK A;  3MAQ A;  1K9M W;  2ADP A;  3BY6 A;  1E1R G;  4IYH A;  4NKG B;  4DV3 O;  1L0L H;  3OMN B;  3JAL B;  2ZM6 B;  2DYR B;  1FS0 G;  4KL1 A;  2HHH O;  1V55 C;  1B06 A;  3K9A A;  4MTX A;  1R3K C;  2KKW A;  3ZRW A;  2KB1 A;  1NR7 A;  1PP9 H;  2F93 B;  3UT5 A;  5H6R A;  5IYB O;  3RFR A;  2HKO A;  1KYO F;  1TAE A;  5CB4 B;  1AIL A;  1H2N A;  5IJ9 A;  1PNM A;  3H1K H;  4LC1 A;  1UPG A;  4CH4 A;  1YTF D;  4UCV A;  3LNN A;  1GN3 A;  1PL4 A;  1HR0 B;  4GKJ B;  2IW5 A;  1US6 A;  1Q3E A;  3CYO A;  5JVD B;  4JTA B;  1E1Q G;  4NB5 A;  4RWU A;  4IIJ A;  4NTW A;  3T4D A;  1S5J A;  2DE0 X;  3P3N A;  2M6Y A;  4X1K A;  4LF4 B;  1YCI A;  4JI1 O;  1EBO A;  2W6I G;  1N0J A;  2DN9 A;  4LP8 A;  4B3R O;  2YI9 A;  4OXS A;  4P9P A;  2FL4 A;  4PJ0 Z;  2QKC A;  4BW5 A;  1SKV A;  3ZMZ A;  4YIP A;  1O9G A;  4MVO A;  1DTO A;  1MOF A;  2DW4 A;  1Y76 B;  2LFR A;  4J9Z B;  3Q4H A;  3IAY A;  4Q20 A;  3OMA B;  1NTM H;  4QPJ A;  2PTM A;  3HPL C;  3JSN A;  3OUS A;  4U7N A;  3JD1 A;  1FAF A;  2OYQ A;  1XI1 A;  2GTA A;  3SPC A;  1URF A;  3R65 A;  2E3C A;  4X62 O;  4F6R A;  5EK0 A;  2DQ3 A;  2Q7G A;  1K33 A;  2YID A;  3LSS A;  2OCC C;  4UCO A;  5IYZ A;  5D5Q A;  4MW8 A;  2BTQ A;  3R66 A;  3BCC H;  2F4V B;  5J2U B;  2UUA O;  2CTW A;  3DSQ A;  1TUB B;  1KUQ A;  1EN4 A;  4DR1 B;  2QWR B;  5L3D A;  2JJ2 G;  3NXS A;  2OTJ V;  4K8X A;  3OGI B;  4L8J A;  2N05 A;  3ZN1 A;  3TCU A;  3WU2 Z;  1YZB A;  3D8C A;  4NVP A;  1SA0 B;  5KHI A;  4LF7 O;  3JAK A;  4JYA O;  4DR6 B;  3ETG A;  3QF7 A;  1R3I C;  1GMG A;  2Y48 A;  4WFB V;  5EIB C;  3F5W C;  5EBL C;  4CH5 A;  1RM1 B;  1XNQ B;  3JCZ A;  3DXR B;  4ZHQ B;  3ZHV A;  5IDJ A;  4DV3 B;  1Q6I A;  5HFM A;  1YSC A;  4DK0 A;  4RQE A;  1PD3 A;  4DR4 O;  1RSO B;  1KC8 W;  5AG2 A;  4HNA B;  4I7Z B;  2NNU A;  1XRE A;  2XAH A;  2UU9 B;  3QNE A;  5LL6 Y;  2YDE A;  1THZ A;  2AZ2 A;  5KMG A;  4UV8 A;  2Q0A A;  3MHH C;  3OFN G;  4YIO A;  1YTF B;  2QWO B;  3OEE G;  3CJH B;  1YJW V;  3G6E V;  2X7R B;  5JJE B;  3SYA A;  3J7A U;  4GUN A;  3SDL A;  2GBO A;  1GRJ A;  5IYC O;  1R6N A;  3QO8 A;  1R73 A;  1N0N A;  5H5N A;  2PY5 A;  3FB8 C;  3TJT A;  4WFG A;  5CA0 B;  3AG1 B;  4JI1 B;  3VQX A;  5FNV A;  3K5O A;  3RYC B;  3ICX A;  4MVR A;  3QG5 A;  5KHH A;  3STL C;  4DV5 O;  4DRX B;  4B3R B;  3SYP A;  2A7W A;  1BHB A;  3B4S A;  3I5D A;  3B8N A;  5B1A B;  1FJG O;  3CCV V;  4DV4 O;  3C3S A;  4WFF A;  3WFV A;  2VQF O;  3ZRS A;  1Z5W A;  3KZI Z;  1SS3 A;  3VQW A;  5CBG A;  1Y4M A;  3SJB C;  4NXM O;  3A0H Z;  1VQ8 V;  3JAS A;  1K5Q A;  1NTZ H;  3UO2 A;  1D5A A;  1KP3 A;  3JAW B;  1KEC A;  2ARH A;  3FKS G;  1XL6 A;  4ZI7 A;  2AW9 A;  4X1Y B;  2WA3 A;  1I5Y A;  1ROP A;  4TV9 A;  1L1F A;  4X64 O;  1IBK O;  1GAX A;  2VRZ A;  1QU7 A;  2WLM A;  4UCU A;  4PA7 A;  1NJI W;  4X62 B;  1YF2 A;  1BQZ A;  1AI4 A;  5DED A;  4HAM A;  4CS4 A;  3AG3 B;  1VQ4 V;  3B77 A;  4MTO A;  5A9G A;  3JYC A;  3LDC A;  4X88 A;  4DUZ B;  2UUA B;  3FB5 C;  2LQT A;  2EZO A;  3A2F A;  5B3S C;  4DUY O;  3L74 H;  1XMQ B;  5BMV A;  1BS3 A;  3JAT B;  1B3Q A;  4I4T A;  1AJP A;  1VF6 A;  2P6J A;  2PF4 E;  1B6Q A;  1QLE B;  3OD4 A;  2UXN A;  2EIN C;  1K4C C;  4DR2 B;  5LMN B;  5DEC A;  2PGG A;  4IHJ B;  4LF7 B;  3U11 A;  2Y0I A;  4FFB A;  3OT7 A;  3CRC A;  2WPD G;  1R3L C;  5IY5 B;  2BSK A;  5KAI Z;  1V9P A;  5IJ0 A;  3IJ4 A;  2MK3 A;  3SPI A;  1OCO C;  3K0G A;  2XHB A;  1OCC B;  1ZAU A;  4JV5 O;  2UXX A;  4JI7 B;  3K5N A;  3LDD A;  2ZIO A;  2WLI B;  1XBL A;  1S0V A;  1JCH A;  5CA3 A;  2FKX A;  3OUF A;  1TVK B;  1WPB A;  2Q0O C;  1AP5 A;  2DOS A;  2ZDI A;  3O9O A;  5JJN B;  4B3T O;  1XUQ A;  3CRM A;  3A0R A;  5FPO A;  2YEV A;  3SPH A;  1LR1 A;  2Y4T A;  4LFB O;  3D36 C;  3W7T A;  1AP6 A;  3AK1 A;  1VQ7 V;  1SQQ H;  2YIC A;  2E76 B;  3BFR A;  1N34 O;  1OCO B;  2Q4P A;  3ZRX A;  1AR1 B;  3K79 A;  4CC5 A;  1N36 B;  1OCZ C;  2NLJ C;  3M99 B;  5BXZ A;  4R6Z A;  5LBQ A;  4O4J B;  5KUK A;  3ETE A;  2DJV A;  3SYO A;  2W6J G;  1ZL8 B;  5KHJ A;  3JSL A;  5HFL A;  3H1L H;  1MZE A;  3X2Q C;  2O57 A;  2BTO A;  4TWK A;  3FYI B;  1QNM A;  2XTA A;  4G28 B;  1FKA O;  2VWK A;  3AK2 A;  3OGC C;  2YUA A;  5CB4 A;  1I94 O;  2QWP B;  1Y66 A;  3E2E A;  1G4Y B;  2CDY A;  2VQF B;  1K7D A;  2EZP A;  1DK1 A;  1FXK C;  3E22 A;  4NXM B;  4DR5 O;  2Q6A A;  1XL4 A;  1M9N A;  1VIB A;  2QSA A;  2WLL A;  5K1X A;  3LSQ A;  3RT3 C;  5C8Y B;  4LFA O;  1KMI Z;  3M7M X;  2Y4U A;  1DGS A;  4UUJ C;  4YJ2 B;  4UFZ A;  4H37 A;  2WA4 A;  3X2Q B;  4DV2 O;  1Q43 A;  4DK1 A;  3RYI B;  2A06 H;  4X64 B;  3ZHS A;  4WBN A;  4MVZ A;  1IBK B;  3GVM A;  2JGD A;  1UFI A;  3N27 A;  3RYH B;  3L70 H;  4QE9 A;  2V1D A;  2PYJ A;  4GT1 A;  1SQX H;  3VOU A;  4LH7 A;  1K3E A;  1XHZ A;  1QHT A;  2ZD9 A;  4KHP O;  4PD4 F;  4XDK A;  5EBM C;  4PA4 A;  4LNU B;  4Q6G A;  1SQF A;  5LHI A;  5JQG B;  2F66 C;  2BE3 A;  4DUY B;  5IYD O;  1ORQ C;  4O2B A;  2UXB O;  4IGG A;  3JD0 A;  1M90 W;  5KLV H;  3ASN C;  2WAM A;  1J5E B;  3L72 H;  3CP1 A;  4ZOL A;  3J81 N;  4TUY B;  1IX9 A;  4LR3 A;  1P4R A;  4BR6 A;  2IU0 A;  1QQC A;  1M1K W;  2QM8 A;  1W0J G;  3ABK C;  5GW7 A;  4Z1M G;  4MVQ A;  3RVZ A;  5B1N A;  1EFR G;  5JH7 A;  5B5E Z;  2Y0P A;  4EKW A;  5LGT A;  4J10 A;  4JI8 O;  1TA8 A;  2UUB O;  1IXM A;  3ZMV A;  3E8G A;  4JI0 B;  4PI2 A;  5J2U A;  1BE3 H;  2YXH A;  2F95 B;  5L3C A;  5B1B C;  1K97 A;  1W59 A;  4GLX A;  3OW2 U;  3KKY A;  3CCL V;  4JV5 B;  2Y69 B;  2LJ2 A;  5L3B A;  1XNR O;  1ZUQ A;  4GX2 A;  4P9O A;  1O9H A;  1IDS A;  1BT8 A;  4H0L B;  3GWO A;  5D5P A;  2E75 B;  3T1Y O;  2Q5Z A;  1KKC A;  1KQS U;  2JJ1 G;  1H2G A;  1H2S B;  2YSU B;  3ZHQ A;  5IT9 N;  3HKB B;  3O65 A;  2P7T C;  1LNQ A;  1CXZ B;  3ETD A;  4HYO A;  4DR3 O;  3OAA G;  2JEU A;  3ZBH A;  1VQN V;  1BMF G;  4U3J A;  4X89 A;  3HKC A;  2KG7 B;  1HW7 A;  1L0N H;  4TOI A;  5B1B B;  5EYP A;  4NTX A;  2PZS A;  3DXR A;  4ZHQ A;  3ABL C;  3HKD A;  2H94 A;  4NYK A;  4JYB A;  1QR9 A;  4O4I B;  4G27 B;  2IM9 A;  1HP8 A;  4JTD B;  1IBM O;  4HNA A;  1VEW A;  1HNX O;  2P67 A;  2V4D A;  2W0F C;  1HNZ O;  4PDR A;  4LCU C;  5ITZ B;  2UUC B;  1I94 B;  1F51 A;  5H9C A;  3W7S A;  3F7V C;  4DR5 B;  1R6K A;  4JI5 O;  1FFT B;  3M8A A;  4JI4 B;  3ABL B;  1H38 A;  1OJH A;  2QTO A;  3UCS C;  4WFA V;  2X6C A;  4LFA B;  4B3S O;  3THO A;  2FB5 A;  4MVU A;  1W0K G;  4PA3 A;  2F23 A;  3MHS C;  3P30 A;  2AGA A;  5LXT B;  5GTI Z;  4FFK A;  1YDX A;  3QVN A;  4DRX A;  1UJW B;  4U3F H;  4YY3 O;  4DW1 A;  4AQY O;  4O2A B;  4LF6 B;  1P7B A;  4KHP B;  4QIW F;  3JAM N;  3ABM C;  1WA8 B;  2ZNI A;  1JPX A;  3SR2 C;  3OE7 G;  1XMO B;  4FVM A;  1AI5 A;  2JEX A;  2IU3 A;  2UXB B;  2LW7 A;  2Q67 A;  2VQE B;  1WPX A;  3E8F A;  4X1Y A;  4JI3 B;  4X65 O;  1NBM G;  3ZMU A;  1VF5 B;  2OCH A;  1M4U A;  3FYE B;  3CCJ V;  4LBE C;  4H33 A;  4ZBM A;  1BCC H;  4KFM A;  2IH3 C;  4TT3 G;  4B3M O;  4CH3 A;  5EZY B;  3ABM B;  1RM1 C;  4UB6 Z;  4JI8 B;  2UUB B;  2VS0 A;  4QGP A;  4MW3 A;  2A79 B;  2ZE5 A;  4LFC O;  3MDS A;  4O4H B;  2XAG A;  3I56 V;  2Z3Y A;  1WP7 A;  5GON B;  4PHZ A;  1W2B U;  2HLD G;  2OT5 A;  3SGI A;  4LF9 B;  3J80 N;  3RN4 A;  4DV0 O;  5BZB A;  1COW G;  3JAT A;  4DV7 O;  5CA1 B;  4YJ3 A;  4W4K A;  1SER A;  1DF5 A;  3LNM B;  2GUZ B;  1M57 C;  4OPH A;  2E5L B;  2OIE A;  3CRR A;  4CZZ A;  3EXA A;  2HJF C;  5H2F Z;  4PDM A;  2ZR3 A;  4D6T H;  3T1H O;  4J80 A;  4ZIB A;  5LYJ B;  2ZR2 A;  4UVA A;  4J41 A;  1JOY A;  3H1H H;  1TUE B;  2ATK C;  2ZIM A;  3AG1 C;  3BPZ A;  2HHH B;  3L71 H;  2JDI G;  1V54 B;  1JJ2 U;  1AR4 A;  3E83 A;  1YEW A;  2JGU A;  2WLI A;  2R9I A;  4PV1 B;  4GX0 A;  5EBW C;  3P3P A;  1M57 B;  5B1A C;  1HNX B;  3RVY A;  4F4L A;  4FZ0 A;  5IJ9 B;  2GSM B;  2M7W A;  1PKX A;  4MVM A;  4K0K O;  3D3I A;  4JAU A;  1Y74 B;  3CC7 V;  1YI2 V;  3AG4 B;  2CUG A;  1P84 F;  4JI5 B;  1K92 A;  3TXS A;  4IIJ B;  1XOU A;  1N4C A;  2D2C B;  3JD2 A;  1JMK C;  5A2Q N;  4YHH O;  3CB2 A;  4WF9 V;  1MG1 A;  2X6A A;  3AG3 C;  5L3G A;  4MTF A;  5E79 Z;  1VQ9 V;  4EB6 B;  1FFX B;  5EC1 C;  3MD0 A;  5LP6 C;  3ASO B;  4BIZ A;  4AQY B;  3D36 A;  4TV8 B;  3TK1 A;  1YJN V;  3CXC U;  1VQO V;  1ENV A;  4UCS A;  3ZED A;  1XDC A;  3Q4H B;  1NVP D;  3PN1 A;  2LGW A;  4U7O A;  3B2E E;  1IBL O;  1SET A;  1QLE C;  4B7E A;  2LFS A;  3PJS K;  2D3O W;  4BIU A;  4JYC A;  2Q7H A;  1GN6 A;  3SYC A;  1T5E A;  1MNG A;  4PA6 A;  3ETQ A;  4DR7 O;  3FAV B;  3K04 A;  2RJZ A;  3KG2 A;  3RYI A;  4F6R B;  4JAV A;  3CRQ A;  3N2K A;  2DQ0 A;  5LP6 B;  1OHH G;  5IY5 C;  2ZE7 A;  4UVC A;  5LHH A;  3IGA C;  4K35 A;  2AXT Z;  1WN7 A;  1FXK A;  4MS2 A;  5JCO C;  4MT8 A;  4NXN O;  1OCC C;  1A32 A;  1J95 A;  4I9Q A;  4LNU A;  5LA6 B; 
#chains in the Genus database with same CATH homology
 1SQP H;  4U3F H;  3H1K H;  1L0L H;  3CWB H;  3L75 H;  1KB9 F;  2A06 H;  3L71 H;  3CX5 F;  1L0N H;  1PPJ H;  2FYU H;  3L70 H;  2IBZ H;  1SQX H;  3H1I H;  1NTM H;  1EZV H;  3H1J H;  1NTK H;  3H1L H;  3L73 H;  1SQB H;  4D6T H;  3BCC H;  1BE3 H;  1P84 F;  5KLV H;  1SQQ H;  1NTZ H;  3L74 H;  3L72 H;  1SQV H;  1NU1 H;  1BGY H;  2BCC H;  3TGU H;  1PP9 H;  4PD4 F;  1BCC H;  1KYO F;  3CXH F;  3H1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...