1NTKH

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
b'PKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntkH00
1EZVH 1SQPH 1NTZH 1P84F 3H1JH 1KB9F 1SQBH 1L0LH 3L75H 2BCCH 1L0NH 3L73H 1SQXH 3L71H 1KYOF 5KLVH 3CXHF 1PPJH 4PD4F 3L70H 3TGUH 3CWBH 3BCCH 2IBZH 3H1KH 2FYUH 3L72H 3H1IH 3CX5F 1SQQH 4D6TH 1BE3H 1SQVH 3H1HH 2A06H 1NTKH 3H1LH 1PP9H 1BCCH 1NTMH 1NU1H 3L74H 4U3FH 1BGYH
chains in the Genus database with same CATH superfamily
2OYQA 1H2NA 2A9HA 3K0GA 3P32A 2WLIB 3SJQC 2K1EA 1XILA 3G6EV 3OW2U 2R9AA 2GDSA 5K1XA 1P4RA 2JS5A 3E8FA 3CX5F 3G4SV 1GM7A 2GSMB 4DUZB 1AR4A 1WP8A 2YEVA 1IBLO 2HJDA 3DTUB 1I08A 4LNUB 4P9OA 4HZ3A 1F4NA 4YJ2B 1ZWIC 3BEHA 3TK1A 3I5DA 4GX1A 1B3QA 5K1PA 5H6RA 4X65O 4JI8B 2DWEC 3B2EE 4TOIA 2QM4A 4F6RA 1IXBA 4MVUA 5JCOC 2EILC 1R6TA 5BMVB 3ETGA 2ADQB 1HNZB 2IJKA 1B04A 4EB6A 3IFXA 3QTCA 3DGEA 2IU0A 3FB5C 5EZYA 5JH7B 4GUNA 5CBGA 3OMNB 2B9ZA 1HR0O 4BIUA 4ZI7B 1NTKH 2P7TC 2DYRB 1XEQA 1Q82W 4LF4O 4DR1B 2HHHB 2ZE8A 5IYCO 3K5NA 2UUBB 1XI1A 2JJ2G 2RN9A 3ZHQA 1K73W 3K9AA 2A3QA 4H33A 2RQ6A 3ZJZA 4DR7O 4PDLA 1FFTB 2Y4TA 4DV1B 4P2ZA 3OM3B 1MMMA 2ZKOA 2QGNA 3F5WC 2UXDO 2EINB 3CXHF 1SQGA 2GHYA 4LF6B 3ZMTA 1XBLA 1W2BU 1MZFA 3JSLA 1MABG 4FJCC 5IJ9B 3BPZA 3HKEB 1X4TA 3ZRWA 4B08A 3RVYA 3O9OA 4LH6A 1NZ6A 3K5LA 1N33B 1L0NH 2LGWA 4DV6O 1KYOF 2EJRA 2WLJA 2H94A 2X0LA 3FB7C 2HVKC 1FS0G 2DN9A 3K57A 4X89A 4JI0O 1H2SB 4AQYO 3OTOO 1JJOA 2XAFA 1I5XA 1QR9A 4RAIA 2VWJA 2XTAA 2UUAB 1NH2D 3AG7A 4FLWA 3J81N 1ENVA 3JAKA 3CRRA 2YS8A 4HNAB 4DV7O 1CP9A 3L71H 2CTQA 3OMAB 3CCSV 5IE9A 3AK3A 1QVFU 4NTXA 3JALB 4X88A 2ARHA 4ZIBA 4LF8O 4WFBV 4TV8A 4IIJB 1H8EG 1NTZH 2VQEO 1IURA 4CH5A 1Q43A 4R7CA 1Q3EA 1VQ7V 5CN0A 4GZRB 4JAVA 2BTQB 1Y74B 1JJ2U 3MHSC 1Z2GA 2YI9A 3ASOB 4JI6O 1Z5VA 1N36B 1XOUA 4TWKA 4DUYO 1I5YA 3H1HH 2A06H 4WFHA 3QG5A 3B40A 1MSDA 1KKDA 2YUAA 2QTSA 1K3EA 3UT5B 1IX9A 4B7EA 3ASOC 1BT8A 2MW2B 4TQDA 1SQBH 3W7UA 2Y4UA 1EZJA 4NVPA 5JQGB 3R65A 2EIJC 3AG2B 4TQFA 1ZSPA 1PPJH 4IL6Z 5JJNB 3L70H 3T1CA 5DN6G 5LHGA 3E89A 1U96A 2Q68A 4A5UB 2P67A 3H9VA 4G27B 1NR1A 2ZR2A 1TUBA 3H01A 4CZZA 2CDYA 1I94B 4QE7A 5IYDO 1NT2B 4DV0B 3CRMA 4BIOA 4X9QA 3T1YO 1SQPH 3ZMSA 2ZM6B 1XL6A 1TAEA 3AG4B 3CJHA 1FXHA 2WA4A 5A9GA 1FXKA 4FLYA 1WB8A 4NTWA 2N74A 4JYCA 3ZMUA 2IJHA 4TUYA 3P3PA 2UXBB 2DE0X 1GRJA 4MVQA 2AHZA 4J80A 3S3XA 4WFFA 3AG3C 4NXMB 4B7KA 1WB7A 2JGDB 5LGTA 4X66B 4I4TB 2B1IA 5A2QN 3B8NA 2L35A 4B3MB 3H1IH 5L3FA 2E75B 1NQTA 5LXTB 4JI8O 3EVKA 3H1LH 3WG7C 1Y4MA 4ZOLA 1Q86W 4TV9A 4O4LA 5CBHA 4F6RB 4CS4A 4J7ZA 3P3NA 2CUGA 2P22C 1HNZO 4FPPA 3JASA 3CPWU 1I0HA 1Y66A 2ZCEA 3BRCA 3RYFB 3J7AU 1BHBA 4JASA 1LR1A 1IBKB 4LFBB 1FYJA 2PYLA 3L75H 3K79A 1YJNV 4DRXA 2H3OA 1ZUQA 2HLDG 3CMEV 4FM2A 1Q7YW 2WLMA 4MVMA 2HHHO 3B8MA 4KP4A 2WLNA 1YJWV 5L3BA 1HNXB 2UXCO 3SJCC 2N04A 4WFEA 2ITDC 5ITZA 5EBLC 3JARB 4O2AA 1MOFA 2ZXWB 5H5NA 4I55A 4KUMA 1PKXA 5LP6B 3CCJV 1YI2V 1P7BA 4YJ3B 1K4DC 5DM6V 5B66Z 5H9CA 4DV1O 1E1QG 4ZBMA 3ZRVA 3R66A 4L8JA 1PNLA 2YDEA 2ZD9A 2ZXWC 3EHBB 4U7OA 1BL8A 5HFLA 3W7SA 4OGQB 5LP6C 4RWUA 3BAAA 1AROP 1NU1H 3E22B 1LUVA 4MS2A 3TCUA 4H13B 1V54C 1XUQA 5CA1B 4DK1A 4O2BB 2F1MA 4PHZA 3RT3C 4PD4F 1CXZB 3A0RA 1N33O 3JD3A 5GONA 3N2GA 4PJ0Z 4P30A 4WF9V 2JEUA 1ZX3A 4LC1A 3C3SA 3HKBA 3ZX6A 4XBFA 4WBNA 5KHIA 1PNKA 1XHZA 4AILC 5B5EZ 1DK1A 1V55C 2V1DA 1JFFB 2YIBD 5IYZA 2VWKA 4J9ZB 3FKSG 2NLJC 4GCZA 1VIBA 1Q5OA 3WB1A 4UCSA 1M9NA 1MG1A 2IM9A 3L73H 2DYSB 4QNHB 2GBOA 1E1RG 4DV5O 2B5UA 4TV8B 2PYJA 1M1KW 3WB0A 4YXWG 3CXCU 3ABKB 2DYSC 2QM7A 4LH7A 4Q6GA 4X1IA 3BVOA 1BZKA 2WAMA 3CS5A 5L3CA 1S5HC 4B3TB 4XDKA 2CH7A 1EBOA 4IGGA 5KA5A 1YEWA 1BQ0A 1YSCA 2ATKC 3SPHA 1S76D 3OE7G 3C3TA 4MVOA 4BAYA 3W7WA 1R3LC 4CH6A 4DV2O 4LF5B 1OCCB 3HB3B 3LUTB 2KQXA 2KG7B 4DR3B 3FAVA 3RGBA 5IY5B 4JF3A 1VQLV 4CH3A 4UUJC 1YF2A 4RQFA 2E3CA 1KB9F 3GWOA 5FL7G 3K58A 3SJBC 4K3AA 4DV0O 5GW7A 2QWQB 3LSUA 5JWPA 3ZRXA 1J95A 2R72A 4JTCB 1H2LA 3RVZA 1N8RW 2O57A 3CJHB 4EKWA 4W4KA 2DWDC 5CA3A 1WA8A 5KUKA 4TUYB 4I9QA 4O4JB 3JATA 1XMQB 3ML0A 4NXMO 1NR7A 1Y76B 1K7DA 5FNVA 1TUEB 3LNMB 4MW8A 1R6NA 1AI4A 4X66O 4PDVA 3VQYA 4JAUA 4QPJA 4ABMA 4B3MO 2X6CA 4ASUG 2MK3A 4CC5A 5LMNO 4GKKB 4UCRA 2Q7GA 4UV9A 1VQNV 3HKDA 2PZSA 4NR1A 3CRCA 3K5MA 1WJZA 3FFQA 1O9HA 4UCVA 4X1YA 1OCZB 1Q8IA 5H6QA 4UVAA 2YIAA 1SA0A 3CE2A 1GO3F 4B3SB 3ABMC 3GB7C 2NN4A 2IW5A 1RM1C 1VARA 4ZHQA 1QNMA 2A7WA 3RYIA 3CCQV 1IBKO 4LFBO 1JOYA 1Y6XA 3ZN0A 5LA6B 1OJHA 2P6JA 1QVGU 2RMKB 4D6TH 4JI7B 3CP1A 2AXTZ 2EULA 4RQEA 2Y0PA 5LGUA 3G71V 1HNXO 1W0JG 3ETDA 4NXNB 4TSFG 4R6ZA 4O4HA 3Q4HB 5C8YA 4K8XA 1FJGB 2YXLA 2YIBA 1SESA 1BE3H 4D7TA 1WLEA 2ODMA 5KAFZ 5BY1A 5B1AB 3TXSA 3U11A 3K5OA 1M4UA 1SF9A 1Q6UA 1VQPV 1G4YB 1E79G 1X59A 3ABLB 4NB5A 4JI5O 4DR6B 5B1AC 5J2TA 4X20A 3GVMA 2PI5A 4K0KB 2UXNA 3CD6V 1AI7A 5KMGB 2FKXA 3OR7C 2DJVA 3A8TA 3N27A 4UCUA 2XOKG 1W59A 3CEIA 1HNWB 3VBBA 3KKYA 1DGSA 2CGOA 2Q5ZA 4JI4B 2JK5C 2DYRC 4B3RB 4K35A 3CC4V 5B3SB 3RBZA 4JYBA 4X1KA 1AB3A 3DXRA 3HR0A 3PN1A 4EEQA 1ZL8B 2BOCC 1VP7A 2HP8A 1F7YA 4MTOA 2E74B 3U0ZA 4FLXA 1R73A 1GMGA 4DR5B 2VRZA 3BY6A 1YTFD 5IJ0B 2D2CB 3TXQA 1FXVA 3ZHSA 4OPHA 1YIJV 3VOUA 2EINC 5LGNA 4FZ1A 1G1XB 3QVNA 4LCUC 1XDCA 1FFXA 4L87A 4JV5B 1QCEA 2Q0OC 4LF9B 2GUZA 4FFBA 1WP7A 3K3WA 4O4IA 3CWBH 3AK2A 3ICXA 3ETQA 4RO2A 3WFVA 2YC0A 2M7WA 2EBOA 3RFRA 4IHJB 4PA7A 1S77D 1SERA 4LF5O 4I0XB 1N0JA 1JCHA 4UVBA 4JGSA 4DW1A 4J42A 2GV9A 2DQ3A 2JIZG 2IJJA 5BZBA 2KKWA 2FTKA 5DEDA 1V9PA 3CC7V 4U3JA 2FL4A 3K59A 2LFRA 3L72H 1RSOB 3ZHVA 1ORQC 4YHHB 1FPOA 3B4SA 2UU9B 1N34B 5CMUA 5CBFA 2Z0AA 2V7QG 1VF5B 1JVMA 2ZDIA 1N4CA 1TA8A 4HBNA 1EN4A 5LOVA 1D5AA 1K34A 4JI3B 4UB6Z 3RYHB 1ZTEA 3N2KA 4IYHA 1XMQO 1DF4A 4NYKA 1YXBA 2IH3C 5FPRA 2ETNA 2QJ1A 2GTSA 3FB6C 2Y69B 3W7XA 5EK0A 1H8HG 1AJPA 1YHQV 3FB8C 5FNVB 3SPJA 1HDJA 4YIPA 5DECA 5CB4B 1KECA 2YI8A 4R8CA 4GYCB 2DOSA 5J2UB 1QHTA 2P5OA 1AP6A 4DR2B 4GKKO 4MTFA 4PI2A 5JVDA 3OGIB 1XNRB 5LYJB 1WN7A 4QGPA 1VQ8V 1M5IA 1KU9A 3AG2C 1NTMH 1B6QA 1JA8A 3ZHUA 1D2DA 3CCVV 3K03A 3E8HA 3HKCA 2LP7A 4B3SO 2PUSA 1J5EB 2ZNIA 3B09A 5J9PC 3ZMZA 1IDSA 3SYOA 3AG4C 1LNQA 5BR8B 5IDJA 4J7KA 1WAZA 1IBMB 4I50A 2AZ2A 3T2MA 5EYPA 2C2AA 4JI7O 4EFEA 3F7YC 4DUZO 2HEPA 4UCTA 2UUCB 1BSMA 1A32A 2CE4A 3D3IA 4DV4B 3D8CA 2YEVB 1HP8A 3P30A 1AI5A 3JD2A 2FYUH 2R9IA 3IC7A 2WLLA 2GTAA 5CA0A 4NXNO 1K8AW 5KAIZ 4G2KA 4MT8A 4PI0A 1YVWA 1Q6IA 1PL4A 4GT1A 3UO2A 3IC9A 4X8AA 2ZIOA 4AI8A 1OCOB 2HG5C 2QKAA 2LQTA 1VF6C 4CH4A 2ZNJA 3D36C 3RN4A 2Y48A 2CAZC 4KXRA 3CB2A 4EB6B 2W0XA 4DR6O 2KSDA 5EZYB 3L9DA 3ZS8C 5J2TB 4MSWC 3K0DA 1JMKC 4DYLA 4K0KO 3LDDA 4TT3G 2W6JG 2CTWA 1GM9A 3AG1B 3LSQA 2XNDG 1PNMA 1HNWO 3IGAC 1M90W 2ZE5A 1HW7A 4JI1B 3SDLA 4DR1O 2WLIA 3A0BZ 5EC1C 1NBMG 3E35A 4GX0A 4JI4O 4B3RO 2ZIMA 3F5TA 4W4LA 3AG1C 1RP3B 1BGYH 2EIKB 1JR9A 3OMIB 2UUBO 3OUFA 1GM8A 3QO8A 1S72V 1KKCA 4LNUA 3T4DA 2ZT9B 4YJ2A 4QE9A 3LSSA 5JCOA 4DR5O 2XASA 4N23A 1WPXA 4PA6A 4F4LA 4GX5A 1MNGA 4LF6O 5JJEB 4X65B 1VMGA 1XMOB 2D3OW 1VQKV 1O9GA 4H44B 3ETEA 4LFAB 1U97A 1H2GA 3FD9A 4UFZA 3ZRWB 5IYBO 4JV5O 3A0HZ 3CMAV 1R3KC 3QF7A 3DC6A 2XAGA 4FFBB 5JH7A 4OX9B 1KUQA 1YITV 2YICA 3HPLC 1WPBA 3KZIZ 1YJ9V 5KHKA 1HR0B 4ZI7A 3NR7A 3JSNA 2UUAO 1SQFA 2H8PC 2LW7A 4I5SA 2DQ0A 2L6LA 1GKFA 3RW0A 3ZBHA 2BSKA 4WFAV 2QR4A 3OEEG 2Q0AA 3ZHTA 2Q4PA 3JAKB 1I7FA 2EIMB 2LFSA 5AG2A 4PA9A 4I9WA 4YHHO 4Q20A 2UU9O 4JZGA 1N34O 3JD0A 4JYAB 2QWRB 4LF7B 4UXNA 3CC2V 4IT5A 4JPRA 3CHXA 3OAAG 2F23A 5D5PA 1SQVH 3CRQA 4JI3O 1YCIA 2UXDB 3I56V 1NI8A 1EN6A 1FKAO 1EZVH 2DMXA 1N36O 1SETA 2K9PA 3CCMV 1L0LH 5IJ9A 4BW9A 3ABKC 2JVDA 4BW5A 1BQZA 3OT7A 2YIDA 3ZEDA 4PELA 4JTDB 3S3WA 1ZLZA 3SYAA 2N05A 2Q7EA 3QO7A 4XDLA 4CBCA 1AI6A 5EIBC 2P4KA 1SKVA 1WNSA 5L3DA 1XNRO 4WCEV 2JRIA 1OCCC 1I94O 1RPOA 4JI0B 4AQYB 1TUBB 3CCEV 1M57B 1JPXA 4FVMA 5IY5C 5LHIA 3ASNB 4GKJB 2ZM6O 1XHXA 4H0LB 1J5EO 1FXKB 1M57C 1PM9A 4UV8A 1IXMA 2UXBO 3CRAA 3ASNC 3JALA 3OUSA 1Q6HA 3JAMN 3THOA 2VQFB 3T1HB 5BR8O 5KLVH 1N0NA 1EN5A 4DK0A 1CPYA 4IIJA 1FXKC 1N32B 1PD3A 1SZTA 2BTOA 5KX5A 2UUCO 2BTQA 4LWSA 1QBZA 3MD0A 3K04A 4DV4O 1TGOA 3BHPA 4MVSA 4CC6A 1YZBA 4JAAA 2ZE7A 2Q67A 3UT5A 5KHJA 2RNBA 4BIZA 4DW0A 1MZEA 4ZOLB 4J41A 1OV9A 4TV9B 4E4EA 4O4LB 5LMUB 3IAYA 1VQ4V 1PP9H 1M93A 1DLBA 1BCCH 2OCCB 3JYCA 1H38A 3JASB 3APQA 1UJWB 1QU7A 1F4MA 1OCZC 2BOBC 3E2EA 3T4ZA 1KD1W 2W6IG 1F51A 1L1FA 1HWYA 5KHGA 1JQ0A 2WLKA 1FD9A 2PF4E 3E86A 2AHYA 3AK1A 4DRXB 4J10A 4HAMA 4JI1O 3C90A 4FK5C 5EBWC 3NXSA 2QWPB 3ZRSA 2A0LA 2F95B 5KHHA 4JI2B 2EZOA 1NH2B 4FFKA 5ITZB 3CYOA 2Q69A 4O2AB 5F2VO 2JGDA 2XAQA 3KG2A 1VQMV 2YXYA 1KQSU 4I55B 3O65A 1D5NA 1W0KG 4I4TA 2JDIG 5EIBD 3CCUV 2JGUA 1SC5B 4X62B 1F23A 1KP3A 1K9MW 5LXTA 1VF6A 3SPCA 2EILB 2AZ0A 3D36A 1AJQA 3DSQA 4UB8Z 3SYQA 1XMOO 2F4VB 1Y67A 3RWRD 3CSXA 1GTOA 3M7MX 4LFAO 2QE7G 4DV3B 5EBMC 2RCVA 1AR5A 2QEXV 2HR3A 4U3FH 3ABLC 3L74H 4DXWA 4PDRA 3ZCCA 1BMFG 4FM1A 3K9SA 4MTXA 3RYFA 4OX9O 5GONB 3N2GB 4YY3B 1VQ5V 3OR6C 4PA3A 3H1KH 3M99B 2M6YA 3I55V 2OT5A 4FZ0A 1PV0A 1DTOA 1GN3A 1K33A 3HKBB 1Q90D 3OEHG 3OTFA 3BA9A 2OTJV 2ZR3A 5B3SC 2BSKB 4WBNB 3GWKC 5LBQA 3RYCA 1QR8A 1NVPB 2X6BA 2UXCB 1AILA 5IYZB 3JARA 1R3JC 4X64B 5LP6A 4E2LA 1SQQH 1YDXA 4YJ3A 2ITCC 4MTGA 2QWNB 1P49A 4JYAO 4LF7O 2F43G 2CK3G 4JZ2A 4FLZA 1S5LZ 3FYEB 4BWAA 5GTIZ 4QJFB 2BCCH 1K5SA 2OTLV 1LUWA 3E8BA 2Q9LA 1AJNA 3E22A 1THZA 4X1IB 1GN4A 3M8AA 4B3TO 5KA6A 5CA1A 2EZPA 3JAWA 2CH7B 4O2BA 1CEZA 3ZHRA 3SPGA 2WLHA 2WSSG 2OWOA 1IZ3A 4XDJA 4DR3O 1SQXH 1XL4A 3FAVB 3FYIB 3OGCC 3ABUA 4JTAB 2XHBA 3TGUH 2DW4A 4LR3A 3FX7A 1KP2A 1RPRA 3UM7A 3WU2Z 2EJ7A 4H37A 2JJ1G 4AHCA 4FM0A 4GKJO 2R9RB 2IU3A 4DO2A 1JFFA 1AVMA 2AGAA 2OCHA 2ZQMA 1OZ0A 3BFRA 1BS3A 1WA8B 5LHHA 2VQFO 3T1HO 1Z5WA 1ZAUA 3JATB 3VQXA 1N32O 3VQVA 4DV5B 1S5JA 1VQOV 3LDEA 2Z3YA 2PY5A 1Q81W 3B77A 5KX5B 4LWSB 2HJFC 3UO3A 4FMTA 2R70A 1XNQB 2Y69C 4LFCB 1MSWD 3KCXA 3U10A 2Q7HA 2EIJB 3HKDB 1PL0A 1SZXA 2HFEC 2QTOA 4J7JA 2QDOA 4LBEC 1L8DA 4DV2B 2KG7A 1US6A 4X1YB 4GLXA 5LMUO 5IT9N 2HVJC 1QLEB 2P90A 5EC2C 3SPIA 1UFIA 1TVKA 1SA0B 2X7RB 1GK9A 1K92A 5KUMA 4Z1MG 2QSAA 1NVPD 4IYIA 1QLEC 3WB2A 3UCSC 4ZHQB 4CS2A 4OPAA 3BA8A 3RYIB 3JCZA 4PDMA 4CS3A 3E83A 5H2FZ 5IWAB 1SS3A 1FAFA 3AG3B 1RFYA 3K08A 1GN6A 4HYOA 4LP8A 4O4JA 1URFA 4JI2O 3IJ4A 3ZIAG 1UPGA 1Y76A 4PA4A 3G67A 1VQ9V 3QO5A 3STZC 3UQ8A 1FJGO 1OHHG 2F66C 4O4HB 2XAJA 2PI4A 5C8YB 2NR5A 3WG7B 4X62O 4RUEA 2RJZA 4ICGA 3SYCA 1R1BA 2CTPA 2E5LB 4YIOA 3J80N 4DR4B 1OCOC 5LMNB 1M56B 4KFMA 5B1BB 1T5EA 2F4VO 1XREA 2JEXA 3QNEA 2QWOB 2ZINA 2CGNA 4R50A 3G80A 4KHPB 4DV3O 4X20B 3UKMA 1M56C 4NKGB 5B1BC 2FMLA 4J11A 4NTYA 4KL1A 1KC8W 2Y0IA 1GAXA 5FLXN 5B1NA 2G38A 4YY3O 3CCLV 5GTHZ 3MDSA 4MVZA 2LJ2A 1R3IC 2FB5A 2QKCA 3AEIA 2WA3A 1BHAA 5LA6A 2XAHA 3CCRV 4K8ZA 1K97A 5TISZ 1QLNA 3A2FA 4X1KB 1G8MA 3DXRB 3BCCH 2IBZH 2WPDG 1IBLB 2EIKC 4FIPC 2LO1A 3DC5A 2PGGA 3RYCB 1AP5A 1XQ8A 2ILMA 2F93B 3APOA 3ZMVA 4X64O 3Q4HA 3SJAC 2Z5UA 3ZN1A 2X6AA 5BMVA 2LGQA 2WWWA 4MVRA 1VQ6V 2V4DA 1V54B 3E8GA 4LF9O 3OFNG 4ZKIA 1FFXB 2GUZB 3LNNA 2CTRA 3SGIA 4Z1VA 4O4IB 4JI5B 2P06A 4FLTA 3SYPA 3JAWB 2OIGA 2PTMA 5KMGA 4U7NA 4D7SA 1G6UA 2EX3A 4P9PA 2QA4V 4EFBA 4LF4B 4F6EA 4I7ZB 4OXSA 3STLC 3JCUZ 1P84F 1V55B 4U3JB 2XUMA 2QM8A 1COWG 2Q8VA 2LW1A 4UVCA 1ZL8A 2Q6AA 3LDCA 1H2KA 4J9YB 1NJIW 4DR7B 4WFGA 2EIMC 5LOVB 5IJ0A 1AR1B 5B1OA 3F7VC 3N2KB 2XT9A 4C7UA 5HFMA 1K5QA 1NKDA 3TJTA 2ZDIC 3EXAA 2BE3A 3W7TA 3HKEA 4QPKA 1P7GA 2UXXA 5LL6Y 4UCOA 2ZE6A 1R6KA 2P4VA 2JS3A 3JD1A 1XNQO 4DV6B 4LFCO 1K4CC 4DR2O 2IH1C 1OCRB 4IHJA 3PJSK 1DF5A 1VEWA 1JX9A 5JVDB 3OTOB 4I0XA 2YXHA 5FPOA 1EM1A 3VQWA 2YSUB 1H2MA 1OCRC 2AW9A 5C93A 4HNAA 4FLVA 3BABA 4G28B 3HKCB 2HKOA 4DV7B 1B06A 1TVKB 3EFFK 1VF7A 1RSOA 1GH6A 3H1JH 1EFRG 4MW3A 4LF8B 1IBMO 1S3JA 4GX2A 4JYYA 4BR6A 5IWAO 1NS1A 4I50B 2NNUA 3OD4A 3X2QB 5EYPB 2VQEB 2ADPA 4Z2WA 3RYHA 1Y74A 1KBHA 2A79B 1KMIZ 2QKSA 2WLLB 4QIWF 4JI6B 3X2QC 5E79Z 1IVSA 5CA0B 1MA1A 4PV1B 4DUYB 2Q73A 5L3GA 1S0VA 5JJJB 2RDCA 2KB1A 5BXZA 5CB4A 5E1AC 5JQGA 1QQCA 2E76B 3K06A 3D3QA 3MHHC 5J2UA 4FLUA 1YTFB 4N21A 1ROPA 2E5LO 4DR4O 5D5QA 5L3EA 5LYJA 2VS0A 3KCYA 3ABTA 3SR2C 1GN2A 3ABMB 4KHPO 1RM1B 2W0FC 2OCCC 3MAQA 2B1GA 4RUFA 3T1YB 3JD4A 2IJIA 2OIEA 3G6BA 3TETA 1SRYA
chains in the Genus database with same CATH topology
1EZVH 1SQPH 1NTZH 1P84F 3H1JH 1KB9F 1SQBH 1L0LH 3L75H 2BCCH 1L0NH 3L73H 1SQXH 3L71H 1KYOF 5KLVH 3CXHF 1PPJH 4PD4F 3L70H 3TGUH 3CWBH 3BCCH 2IBZH 3H1KH 2FYUH 3L72H 3H1IH 3CX5F 1SQQH 4D6TH 1BE3H 1SQVH 3H1HH 2A06H 1NTKH 3H1LH 1PP9H 1BCCH 1NTMH 1NU1H 3L74H 4U3FH 1BGYH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV H;  1SQP H;  1NTZ H;  1P84 F;  3H1J H;  1KB9 F;  1SQB H;  1L0L H;  3L75 H;  2BCC H;  1L0N H;  3L73 H;  1SQX H;  3L71 H;  1KYO F;  5KLV H;  3CXH F;  1PPJ H;  4PD4 F;  3L70 H;  3TGU H;  3CWB H;  3BCC H;  2IBZ H;  3H1K H;  2FYU H;  3L72 H;  3H1I H;  3CX5 F;  1SQQ H;  4D6T H;  1BE3 H;  1SQV H;  3H1H H;  2A06 H;  1NTK H;  3H1L H;  1PP9 H;  1BCC H;  1NTM H;  1NU1 H;  3L74 H;  4U3F H;  1BGY H; 
#chains in the Genus database with same CATH topology
 2OYQ A;  1H2N A;  2A9H A;  3K0G A;  3P32 A;  2WLI B;  3SJQ C;  2K1E A;  1XIL A;  3G6E V;  3OW2 U;  2R9A A;  2GDS A;  5K1X A;  1P4R A;  2JS5 A;  3E8F A;  3CX5 F;  3G4S V;  1GM7 A;  2GSM B;  4DUZ B;  1AR4 A;  1WP8 A;  2YEV A;  1IBL O;  2HJD A;  3DTU B;  1I08 A;  4LNU B;  4P9O A;  4HZ3 A;  1F4N A;  4YJ2 B;  1ZWI C;  3BEH A;  3TK1 A;  3I5D A;  4GX1 A;  1B3Q A;  5K1P A;  5H6R A;  4X65 O;  4JI8 B;  2DWE C;  3B2E E;  4TOI A;  2QM4 A;  4F6R A;  1IXB A;  4MVU A;  5JCO C;  2EIL C;  1R6T A;  5BMV B;  3ETG A;  2ADQ B;  1HNZ B;  2IJK A;  1B04 A;  4EB6 A;  3IFX A;  3QTC A;  3DGE A;  2IU0 A;  3FB5 C;  5EZY A;  5JH7 B;  4GUN A;  5CBG A;  3OMN B;  2B9Z A;  1HR0 O;  4BIU A;  4ZI7 B;  1NTK H;  2P7T C;  2DYR B;  1XEQ A;  1Q82 W;  4LF4 O;  4DR1 B;  2HHH B;  2ZE8 A;  5IYC O;  3K5N A;  2UUB B;  1XI1 A;  2JJ2 G;  2RN9 A;  3ZHQ A;  1K73 W;  3K9A A;  2A3Q A;  4H33 A;  2RQ6 A;  3ZJZ A;  4DR7 O;  4PDL A;  1FFT B;  2Y4T A;  4DV1 B;  4P2Z A;  3OM3 B;  1MMM A;  2ZKO A;  2QGN A;  3F5W C;  2UXD O;  2EIN B;  3CXH F;  1SQG A;  2GHY A;  4LF6 B;  3ZMT A;  1XBL A;  1W2B U;  1MZF A;  3JSL A;  1MAB G;  4FJC C;  5IJ9 B;  3BPZ A;  3HKE B;  1X4T A;  3ZRW A;  4B08 A;  3RVY A;  3O9O A;  4LH6 A;  1NZ6 A;  3K5L A;  1N33 B;  1L0N H;  2LGW A;  4DV6 O;  1KYO F;  2EJR A;  2WLJ A;  2H94 A;  2X0L A;  3FB7 C;  2HVK C;  1FS0 G;  2DN9 A;  3K57 A;  4X89 A;  4JI0 O;  1H2S B;  4AQY O;  3OTO O;  1JJO A;  2XAF A;  1I5X A;  1QR9 A;  4RAI A;  2VWJ A;  2XTA A;  2UUA B;  1NH2 D;  3AG7 A;  4FLW A;  3J81 N;  1ENV A;  3JAK A;  3CRR A;  2YS8 A;  4HNA B;  4DV7 O;  1CP9 A;  3L71 H;  2CTQ A;  3OMA B;  3CCS V;  5IE9 A;  3AK3 A;  1QVF U;  4NTX A;  3JAL B;  4X88 A;  2ARH A;  4ZIB A;  4LF8 O;  4WFB V;  4TV8 A;  4IIJ B;  1H8E G;  1NTZ H;  2VQE O;  1IUR A;  4CH5 A;  1Q43 A;  4R7C A;  1Q3E A;  1VQ7 V;  5CN0 A;  4GZR B;  4JAV A;  2BTQ B;  1Y74 B;  1JJ2 U;  3MHS C;  1Z2G A;  2YI9 A;  3ASO B;  4JI6 O;  1Z5V A;  1N36 B;  1XOU A;  4TWK A;  4DUY O;  1I5Y A;  3H1H H;  2A06 H;  4WFH A;  3QG5 A;  3B40 A;  1MSD A;  1KKD A;  2YUA A;  2QTS A;  1K3E A;  3UT5 B;  1IX9 A;  4B7E A;  3ASO C;  1BT8 A;  2MW2 B;  4TQD A;  1SQB H;  3W7U A;  2Y4U A;  1EZJ A;  4NVP A;  5JQG B;  3R65 A;  2EIJ C;  3AG2 B;  4TQF A;  1ZSP A;  1PPJ H;  4IL6 Z;  5JJN B;  3L70 H;  3T1C A;  5DN6 G;  5LHG A;  3E89 A;  1U96 A;  2Q68 A;  4A5U B;  2P67 A;  3H9V A;  4G27 B;  1NR1 A;  2ZR2 A;  1TUB A;  3H01 A;  4CZZ A;  2CDY A;  1I94 B;  4QE7 A;  5IYD O;  1NT2 B;  4DV0 B;  3CRM A;  4BIO A;  4X9Q A;  3T1Y O;  1SQP H;  3ZMS A;  2ZM6 B;  1XL6 A;  1TAE A;  3AG4 B;  3CJH A;  1FXH A;  2WA4 A;  5A9G A;  1FXK A;  4FLY A;  1WB8 A;  4NTW A;  2N74 A;  4JYC A;  3ZMU A;  2IJH A;  4TUY A;  3P3P A;  2UXB B;  2DE0 X;  1GRJ A;  4MVQ A;  2AHZ A;  4J80 A;  3S3X A;  4WFF A;  3AG3 C;  4NXM B;  4B7K A;  1WB7 A;  2JGD B;  5LGT A;  4X66 B;  4I4T B;  2B1I A;  5A2Q N;  3B8N A;  2L35 A;  4B3M B;  3H1I H;  5L3F A;  2E75 B;  1NQT A;  5LXT B;  4JI8 O;  3EVK A;  3H1L H;  3WG7 C;  1Y4M A;  4ZOL A;  1Q86 W;  4TV9 A;  4O4L A;  5CBH A;  4F6R B;  4CS4 A;  4J7Z A;  3P3N A;  2CUG A;  2P22 C;  1HNZ O;  4FPP A;  3JAS A;  3CPW U;  1I0H A;  1Y66 A;  2ZCE A;  3BRC A;  3RYF B;  3J7A U;  1BHB A;  4JAS A;  1LR1 A;  1IBK B;  4LFB B;  1FYJ A;  2PYL A;  3L75 H;  3K79 A;  1YJN V;  4DRX A;  2H3O A;  1ZUQ A;  2HLD G;  3CME V;  4FM2 A;  1Q7Y W;  2WLM A;  4MVM A;  2HHH O;  3B8M A;  4KP4 A;  2WLN A;  1YJW V;  5L3B A;  1HNX B;  2UXC O;  3SJC C;  2N04 A;  4WFE A;  2ITD C;  5ITZ A;  5EBL C;  3JAR B;  4O2A A;  1MOF A;  2ZXW B;  5H5N A;  4I55 A;  4KUM A;  1PKX A;  5LP6 B;  3CCJ V;  1YI2 V;  1P7B A;  4YJ3 B;  1K4D C;  5DM6 V;  5B66 Z;  5H9C A;  4DV1 O;  1E1Q G;  4ZBM A;  3ZRV A;  3R66 A;  4L8J A;  1PNL A;  2YDE A;  2ZD9 A;  2ZXW C;  3EHB B;  4U7O A;  1BL8 A;  5HFL A;  3W7S A;  4OGQ B;  5LP6 C;  4RWU A;  3BAA A;  1ARO P;  1NU1 H;  3E22 B;  1LUV A;  4MS2 A;  3TCU A;  4H13 B;  1V54 C;  1XUQ A;  5CA1 B;  4DK1 A;  4O2B B;  2F1M A;  4PHZ A;  3RT3 C;  4PD4 F;  1CXZ B;  3A0R A;  1N33 O;  3JD3 A;  5GON A;  3N2G A;  4PJ0 Z;  4P30 A;  4WF9 V;  2JEU A;  1ZX3 A;  4LC1 A;  3C3S A;  3HKB A;  3ZX6 A;  4XBF A;  4WBN A;  5KHI A;  1PNK A;  1XHZ A;  4AIL C;  5B5E Z;  1DK1 A;  1V55 C;  2V1D A;  1JFF B;  2YIB D;  5IYZ A;  2VWK A;  4J9Z B;  3FKS G;  2NLJ C;  4GCZ A;  1VIB A;  1Q5O A;  3WB1 A;  4UCS A;  1M9N A;  1MG1 A;  2IM9 A;  3L73 H;  2DYS B;  4QNH B;  2GBO A;  1E1R G;  4DV5 O;  2B5U A;  4TV8 B;  2PYJ A;  1M1K W;  3WB0 A;  4YXW G;  3CXC U;  3ABK B;  2DYS C;  2QM7 A;  4LH7 A;  4Q6G A;  4X1I A;  3BVO A;  1BZK A;  2WAM A;  3CS5 A;  5L3C A;  1S5H C;  4B3T B;  4XDK A;  2CH7 A;  1EBO A;  4IGG A;  5KA5 A;  1YEW A;  1BQ0 A;  1YSC A;  2ATK C;  3SPH A;  1S76 D;  3OE7 G;  3C3T A;  4MVO A;  4BAY A;  3W7W A;  1R3L C;  4CH6 A;  4DV2 O;  4LF5 B;  1OCC B;  3HB3 B;  3LUT B;  2KQX A;  2KG7 B;  4DR3 B;  3FAV A;  3RGB A;  5IY5 B;  4JF3 A;  1VQL V;  4CH3 A;  4UUJ C;  1YF2 A;  4RQF A;  2E3C A;  1KB9 F;  3GWO A;  5FL7 G;  3K58 A;  3SJB C;  4K3A A;  4DV0 O;  5GW7 A;  2QWQ B;  3LSU A;  5JWP A;  3ZRX A;  1J95 A;  2R72 A;  4JTC B;  1H2L A;  3RVZ A;  1N8R W;  2O57 A;  3CJH B;  4EKW A;  4W4K A;  2DWD C;  5CA3 A;  1WA8 A;  5KUK A;  4TUY B;  4I9Q A;  4O4J B;  3JAT A;  1XMQ B;  3ML0 A;  4NXM O;  1NR7 A;  1Y76 B;  1K7D A;  5FNV A;  1TUE B;  3LNM B;  4MW8 A;  1R6N A;  1AI4 A;  4X66 O;  4PDV A;  3VQY A;  4JAU A;  4QPJ A;  4ABM A;  4B3M O;  2X6C A;  4ASU G;  2MK3 A;  4CC5 A;  5LMN O;  4GKK B;  4UCR A;  2Q7G A;  4UV9 A;  1VQN V;  3HKD A;  2PZS A;  4NR1 A;  3CRC A;  3K5M A;  1WJZ A;  3FFQ A;  1O9H A;  4UCV A;  4X1Y A;  1OCZ B;  1Q8I A;  5H6Q A;  4UVA A;  2YIA A;  1SA0 A;  3CE2 A;  1GO3 F;  4B3S B;  3ABM C;  3GB7 C;  2NN4 A;  2IW5 A;  1RM1 C;  1VAR A;  4ZHQ A;  1QNM A;  2A7W A;  3RYI A;  3CCQ V;  1IBK O;  4LFB O;  1JOY A;  1Y6X A;  3ZN0 A;  5LA6 B;  1OJH A;  2P6J A;  1QVG U;  2RMK B;  4D6T H;  4JI7 B;  3CP1 A;  2AXT Z;  2EUL A;  4RQE A;  2Y0P A;  5LGU A;  3G71 V;  1HNX O;  1W0J G;  3ETD A;  4NXN B;  4TSF G;  4R6Z A;  4O4H A;  3Q4H B;  5C8Y A;  4K8X A;  1FJG B;  2YXL A;  2YIB A;  1SES A;  1BE3 H;  4D7T A;  1WLE A;  2ODM A;  5KAF Z;  5BY1 A;  5B1A B;  3TXS A;  3U11 A;  3K5O A;  1M4U A;  1SF9 A;  1Q6U A;  1VQP V;  1G4Y B;  1E79 G;  1X59 A;  3ABL B;  4NB5 A;  4JI5 O;  4DR6 B;  5B1A C;  5J2T A;  4X20 A;  3GVM A;  2PI5 A;  4K0K B;  2UXN A;  3CD6 V;  1AI7 A;  5KMG B;  2FKX A;  3OR7 C;  2DJV A;  3A8T A;  3N27 A;  4UCU A;  2XOK G;  1W59 A;  3CEI A;  1HNW B;  3VBB A;  3KKY A;  1DGS A;  2CGO A;  2Q5Z A;  4JI4 B;  2JK5 C;  2DYR C;  4B3R B;  4K35 A;  3CC4 V;  5B3S B;  3RBZ A;  4JYB A;  4X1K A;  1AB3 A;  3DXR A;  3HR0 A;  3PN1 A;  4EEQ A;  1ZL8 B;  2BOC C;  1VP7 A;  2HP8 A;  1F7Y A;  4MTO A;  2E74 B;  3U0Z A;  4FLX A;  1R73 A;  1GMG A;  4DR5 B;  2VRZ A;  3BY6 A;  1YTF D;  5IJ0 B;  2D2C B;  3TXQ A;  1FXV A;  3ZHS A;  4OPH A;  1YIJ V;  3VOU A;  2EIN C;  5LGN A;  4FZ1 A;  1G1X B;  3QVN A;  4LCU C;  1XDC A;  1FFX A;  4L87 A;  4JV5 B;  1QCE A;  2Q0O C;  4LF9 B;  2GUZ A;  4FFB A;  1WP7 A;  3K3W A;  4O4I A;  3CWB H;  3AK2 A;  3ICX A;  3ETQ A;  4RO2 A;  3WFV A;  2YC0 A;  2M7W A;  2EBO A;  3RFR A;  4IHJ B;  4PA7 A;  1S77 D;  1SER A;  4LF5 O;  4I0X B;  1N0J A;  1JCH A;  4UVB A;  4JGS A;  4DW1 A;  4J42 A;  2GV9 A;  2DQ3 A;  2JIZ G;  2IJJ A;  5BZB A;  2KKW A;  2FTK A;  5DED A;  1V9P A;  3CC7 V;  4U3J A;  2FL4 A;  3K59 A;  2LFR A;  3L72 H;  1RSO B;  3ZHV A;  1ORQ C;  4YHH B;  1FPO A;  3B4S A;  2UU9 B;  1N34 B;  5CMU A;  5CBF A;  2Z0A A;  2V7Q G;  1VF5 B;  1JVM A;  2ZDI A;  1N4C A;  1TA8 A;  4HBN A;  1EN4 A;  5LOV A;  1D5A A;  1K34 A;  4JI3 B;  4UB6 Z;  3RYH B;  1ZTE A;  3N2K A;  4IYH A;  1XMQ O;  1DF4 A;  4NYK A;  1YXB A;  2IH3 C;  5FPR A;  2ETN A;  2QJ1 A;  2GTS A;  3FB6 C;  2Y69 B;  3W7X A;  5EK0 A;  1H8H G;  1AJP A;  1YHQ V;  3FB8 C;  5FNV B;  3SPJ A;  1HDJ A;  4YIP A;  5DEC A;  5CB4 B;  1KEC A;  2YI8 A;  4R8C A;  4GYC B;  2DOS A;  5J2U B;  1QHT A;  2P5O A;  1AP6 A;  4DR2 B;  4GKK O;  4MTF A;  4PI2 A;  5JVD A;  3OGI B;  1XNR B;  5LYJ B;  1WN7 A;  4QGP A;  1VQ8 V;  1M5I A;  1KU9 A;  3AG2 C;  1NTM H;  1B6Q A;  1JA8 A;  3ZHU A;  1D2D A;  3CCV V;  3K03 A;  3E8H A;  3HKC A;  2LP7 A;  4B3S O;  2PUS A;  1J5E B;  2ZNI A;  3B09 A;  5J9P C;  3ZMZ A;  1IDS A;  3SYO A;  3AG4 C;  1LNQ A;  5BR8 B;  5IDJ A;  4J7K A;  1WAZ A;  1IBM B;  4I50 A;  2AZ2 A;  3T2M A;  5EYP A;  2C2A A;  4JI7 O;  4EFE A;  3F7Y C;  4DUZ O;  2HEP A;  4UCT A;  2UUC B;  1BSM A;  1A32 A;  2CE4 A;  3D3I A;  4DV4 B;  3D8C A;  2YEV B;  1HP8 A;  3P30 A;  1AI5 A;  3JD2 A;  2FYU H;  2R9I A;  3IC7 A;  2WLL A;  2GTA A;  5CA0 A;  4NXN O;  1K8A W;  5KAI Z;  4G2K A;  4MT8 A;  4PI0 A;  1YVW A;  1Q6I A;  1PL4 A;  4GT1 A;  3UO2 A;  3IC9 A;  4X8A A;  2ZIO A;  4AI8 A;  1OCO B;  2HG5 C;  2QKA A;  2LQT A;  1VF6 C;  4CH4 A;  2ZNJ A;  3D36 C;  3RN4 A;  2Y48 A;  2CAZ C;  4KXR A;  3CB2 A;  4EB6 B;  2W0X A;  4DR6 O;  2KSD A;  5EZY B;  3L9D A;  3ZS8 C;  5J2T B;  4MSW C;  3K0D A;  1JMK C;  4DYL A;  4K0K O;  3LDD A;  4TT3 G;  2W6J G;  2CTW A;  1GM9 A;  3AG1 B;  3LSQ A;  2XND G;  1PNM A;  1HNW O;  3IGA C;  1M90 W;  2ZE5 A;  1HW7 A;  4JI1 B;  3SDL A;  4DR1 O;  2WLI A;  3A0B Z;  5EC1 C;  1NBM G;  3E35 A;  4GX0 A;  4JI4 O;  4B3R O;  2ZIM A;  3F5T A;  4W4L A;  3AG1 C;  1RP3 B;  1BGY H;  2EIK B;  1JR9 A;  3OMI B;  2UUB O;  3OUF A;  1GM8 A;  3QO8 A;  1S72 V;  1KKC A;  4LNU A;  3T4D A;  2ZT9 B;  4YJ2 A;  4QE9 A;  3LSS A;  5JCO A;  4DR5 O;  2XAS A;  4N23 A;  1WPX A;  4PA6 A;  4F4L A;  4GX5 A;  1MNG A;  4LF6 O;  5JJE B;  4X65 B;  1VMG A;  1XMO B;  2D3O W;  1VQK V;  1O9G A;  4H44 B;  3ETE A;  4LFA B;  1U97 A;  1H2G A;  3FD9 A;  4UFZ A;  3ZRW B;  5IYB O;  4JV5 O;  3A0H Z;  3CMA V;  1R3K C;  3QF7 A;  3DC6 A;  2XAG A;  4FFB B;  5JH7 A;  4OX9 B;  1KUQ A;  1YIT V;  2YIC A;  3HPL C;  1WPB A;  3KZI Z;  1YJ9 V;  5KHK A;  1HR0 B;  4ZI7 A;  3NR7 A;  3JSN A;  2UUA O;  1SQF A;  2H8P C;  2LW7 A;  4I5S A;  2DQ0 A;  2L6L A;  1GKF A;  3RW0 A;  3ZBH A;  2BSK A;  4WFA V;  2QR4 A;  3OEE G;  2Q0A A;  3ZHT A;  2Q4P A;  3JAK B;  1I7F A;  2EIM B;  2LFS A;  5AG2 A;  4PA9 A;  4I9W A;  4YHH O;  4Q20 A;  2UU9 O;  4JZG A;  1N34 O;  3JD0 A;  4JYA B;  2QWR B;  4LF7 B;  4UXN A;  3CC2 V;  4IT5 A;  4JPR A;  3CHX A;  3OAA G;  2F23 A;  5D5P A;  1SQV H;  3CRQ A;  4JI3 O;  1YCI A;  2UXD B;  3I56 V;  1NI8 A;  1EN6 A;  1FKA O;  1EZV H;  2DMX A;  1N36 O;  1SET A;  2K9P A;  3CCM V;  1L0L H;  5IJ9 A;  4BW9 A;  3ABK C;  2JVD A;  4BW5 A;  1BQZ A;  3OT7 A;  2YID A;  3ZED A;  4PEL A;  4JTD B;  3S3W A;  1ZLZ A;  3SYA A;  2N05 A;  2Q7E A;  3QO7 A;  4XDL A;  4CBC A;  1AI6 A;  5EIB C;  2P4K A;  1SKV A;  1WNS A;  5L3D A;  1XNR O;  4WCE V;  2JRI A;  1OCC C;  1I94 O;  1RPO A;  4JI0 B;  4AQY B;  1TUB B;  3CCE V;  1M57 B;  1JPX A;  4FVM A;  5IY5 C;  5LHI A;  3ASN B;  4GKJ B;  2ZM6 O;  1XHX A;  4H0L B;  1J5E O;  1FXK B;  1M57 C;  1PM9 A;  4UV8 A;  1IXM A;  2UXB O;  3CRA A;  3ASN C;  3JAL A;  3OUS A;  1Q6H A;  3JAM N;  3THO A;  2VQF B;  3T1H B;  5BR8 O;  5KLV H;  1N0N A;  1EN5 A;  4DK0 A;  1CPY A;  4IIJ A;  1FXK C;  1N32 B;  1PD3 A;  1SZT A;  2BTO A;  5KX5 A;  2UUC O;  2BTQ A;  4LWS A;  1QBZ A;  3MD0 A;  3K04 A;  4DV4 O;  1TGO A;  3BHP A;  4MVS A;  4CC6 A;  1YZB A;  4JAA A;  2ZE7 A;  2Q67 A;  3UT5 A;  5KHJ A;  2RNB A;  4BIZ A;  4DW0 A;  1MZE A;  4ZOL B;  4J41 A;  1OV9 A;  4TV9 B;  4E4E A;  4O4L B;  5LMU B;  3IAY A;  1VQ4 V;  1PP9 H;  1M93 A;  1DLB A;  1BCC H;  2OCC B;  3JYC A;  1H38 A;  3JAS B;  3APQ A;  1UJW B;  1QU7 A;  1F4M A;  1OCZ C;  2BOB C;  3E2E A;  3T4Z A;  1KD1 W;  2W6I G;  1F51 A;  1L1F A;  1HWY A;  5KHG A;  1JQ0 A;  2WLK A;  1FD9 A;  2PF4 E;  3E86 A;  2AHY A;  3AK1 A;  4DRX B;  4J10 A;  4HAM A;  4JI1 O;  3C90 A;  4FK5 C;  5EBW C;  3NXS A;  2QWP B;  3ZRS A;  2A0L A;  2F95 B;  5KHH A;  4JI2 B;  2EZO A;  1NH2 B;  4FFK A;  5ITZ B;  3CYO A;  2Q69 A;  4O2A B;  5F2V O;  2JGD A;  2XAQ A;  3KG2 A;  1VQM V;  2YXY A;  1KQS U;  4I55 B;  3O65 A;  1D5N A;  1W0K G;  4I4T A;  2JDI G;  5EIB D;  3CCU V;  2JGU A;  1SC5 B;  4X62 B;  1F23 A;  1KP3 A;  1K9M W;  5LXT A;  1VF6 A;  3SPC A;  2EIL B;  2AZ0 A;  3D36 A;  1AJQ A;  3DSQ A;  4UB8 Z;  3SYQ A;  1XMO O;  2F4V B;  1Y67 A;  3RWR D;  3CSX A;  1GTO A;  3M7M X;  4LFA O;  2QE7 G;  4DV3 B;  5EBM C;  2RCV A;  1AR5 A;  2QEX V;  2HR3 A;  4U3F H;  3ABL C;  3L74 H;  4DXW A;  4PDR A;  3ZCC A;  1BMF G;  4FM1 A;  3K9S A;  4MTX A;  3RYF A;  4OX9 O;  5GON B;  3N2G B;  4YY3 B;  1VQ5 V;  3OR6 C;  4PA3 A;  3H1K H;  3M99 B;  2M6Y A;  3I55 V;  2OT5 A;  4FZ0 A;  1PV0 A;  1DTO A;  1GN3 A;  1K33 A;  3HKB B;  1Q90 D;  3OEH G;  3OTF A;  3BA9 A;  2OTJ V;  2ZR3 A;  5B3S C;  2BSK B;  4WBN B;  3GWK C;  5LBQ A;  3RYC A;  1QR8 A;  1NVP B;  2X6B A;  2UXC B;  1AIL A;  5IYZ B;  3JAR A;  1R3J C;  4X64 B;  5LP6 A;  4E2L A;  1SQQ H;  1YDX A;  4YJ3 A;  2ITC C;  4MTG A;  2QWN B;  1P49 A;  4JYA O;  4LF7 O;  2F43 G;  2CK3 G;  4JZ2 A;  4FLZ A;  1S5L Z;  3FYE B;  4BWA A;  5GTI Z;  4QJF B;  2BCC H;  1K5S A;  2OTL V;  1LUW A;  3E8B A;  2Q9L A;  1AJN A;  3E22 A;  1THZ A;  4X1I B;  1GN4 A;  3M8A A;  4B3T O;  5KA6 A;  5CA1 A;  2EZP A;  3JAW A;  2CH7 B;  4O2B A;  1CEZ A;  3ZHR A;  3SPG A;  2WLH A;  2WSS G;  2OWO A;  1IZ3 A;  4XDJ A;  4DR3 O;  1SQX H;  1XL4 A;  3FAV B;  3FYI B;  3OGC C;  3ABU A;  4JTA B;  2XHB A;  3TGU H;  2DW4 A;  4LR3 A;  3FX7 A;  1KP2 A;  1RPR A;  3UM7 A;  3WU2 Z;  2EJ7 A;  4H37 A;  2JJ1 G;  4AHC A;  4FM0 A;  4GKJ O;  2R9R B;  2IU3 A;  4DO2 A;  1JFF A;  1AVM A;  2AGA A;  2OCH A;  2ZQM A;  1OZ0 A;  3BFR A;  1BS3 A;  1WA8 B;  5LHH A;  2VQF O;  3T1H O;  1Z5W A;  1ZAU A;  3JAT B;  3VQX A;  1N32 O;  3VQV A;  4DV5 B;  1S5J A;  1VQO V;  3LDE A;  2Z3Y A;  2PY5 A;  1Q81 W;  3B77 A;  5KX5 B;  4LWS B;  2HJF C;  3UO3 A;  4FMT A;  2R70 A;  1XNQ B;  2Y69 C;  4LFC B;  1MSW D;  3KCX A;  3U10 A;  2Q7H A;  2EIJ B;  3HKD B;  1PL0 A;  1SZX A;  2HFE C;  2QTO A;  4J7J A;  2QDO A;  4LBE C;  1L8D A;  4DV2 B;  2KG7 A;  1US6 A;  4X1Y B;  4GLX A;  5LMU O;  5IT9 N;  2HVJ C;  1QLE B;  2P90 A;  5EC2 C;  3SPI A;  1UFI A;  1TVK A;  1SA0 B;  2X7R B;  1GK9 A;  1K92 A;  5KUM A;  4Z1M G;  2QSA A;  1NVP D;  4IYI A;  1QLE C;  3WB2 A;  3UCS C;  4ZHQ B;  4CS2 A;  4OPA A;  3BA8 A;  3RYI B;  3JCZ A;  4PDM A;  4CS3 A;  3E83 A;  5H2F Z;  5IWA B;  1SS3 A;  1FAF A;  3AG3 B;  1RFY A;  3K08 A;  1GN6 A;  4HYO A;  4LP8 A;  4O4J A;  1URF A;  4JI2 O;  3IJ4 A;  3ZIA G;  1UPG A;  1Y76 A;  4PA4 A;  3G67 A;  1VQ9 V;  3QO5 A;  3STZ C;  3UQ8 A;  1FJG O;  1OHH G;  2F66 C;  4O4H B;  2XAJ A;  2PI4 A;  5C8Y B;  2NR5 A;  3WG7 B;  4X62 O;  4RUE A;  2RJZ A;  4ICG A;  3SYC A;  1R1B A;  2CTP A;  2E5L B;  4YIO A;  3J80 N;  4DR4 B;  1OCO C;  5LMN B;  1M56 B;  4KFM A;  5B1B B;  1T5E A;  2F4V O;  1XRE A;  2JEX A;  3QNE A;  2QWO B;  2ZIN A;  2CGN A;  4R50 A;  3G80 A;  4KHP B;  4DV3 O;  4X20 B;  3UKM A;  1M56 C;  4NKG B;  5B1B C;  2FML A;  4J11 A;  4NTY A;  4KL1 A;  1KC8 W;  2Y0I A;  1GAX A;  5FLX N;  5B1N A;  2G38 A;  4YY3 O;  3CCL V;  5GTH Z;  3MDS A;  4MVZ A;  2LJ2 A;  1R3I C;  2FB5 A;  2QKC A;  3AEI A;  2WA3 A;  1BHA A;  5LA6 A;  2XAH A;  3CCR V;  4K8Z A;  1K97 A;  5TIS Z;  1QLN A;  3A2F A;  4X1K B;  1G8M A;  3DXR B;  3BCC H;  2IBZ H;  2WPD G;  1IBL B;  2EIK C;  4FIP C;  2LO1 A;  3DC5 A;  2PGG A;  3RYC B;  1AP5 A;  1XQ8 A;  2ILM A;  2F93 B;  3APO A;  3ZMV A;  4X64 O;  3Q4H A;  3SJA C;  2Z5U A;  3ZN1 A;  2X6A A;  5BMV A;  2LGQ A;  2WWW A;  4MVR A;  1VQ6 V;  2V4D A;  1V54 B;  3E8G A;  4LF9 O;  3OFN G;  4ZKI A;  1FFX B;  2GUZ B;  3LNN A;  2CTR A;  3SGI A;  4Z1V A;  4O4I B;  4JI5 B;  2P06 A;  4FLT A;  3SYP A;  3JAW B;  2OIG A;  2PTM A;  5KMG A;  4U7N A;  4D7S A;  1G6U A;  2EX3 A;  4P9P A;  2QA4 V;  4EFB A;  4LF4 B;  4F6E A;  4I7Z B;  4OXS A;  3STL C;  3JCU Z;  1P84 F;  1V55 B;  4U3J B;  2XUM A;  2QM8 A;  1COW G;  2Q8V A;  2LW1 A;  4UVC A;  1ZL8 A;  2Q6A A;  3LDC A;  1H2K A;  4J9Y B;  1NJI W;  4DR7 B;  4WFG A;  2EIM C;  5LOV B;  5IJ0 A;  1AR1 B;  5B1O A;  3F7V C;  3N2K B;  2XT9 A;  4C7U A;  5HFM A;  1K5Q A;  1NKD A;  3TJT A;  2ZDI C;  3EXA A;  2BE3 A;  3W7T A;  3HKE A;  4QPK A;  1P7G A;  2UXX A;  5LL6 Y;  4UCO A;  2ZE6 A;  1R6K A;  2P4V A;  2JS3 A;  3JD1 A;  1XNQ O;  4DV6 B;  4LFC O;  1K4C C;  4DR2 O;  2IH1 C;  1OCR B;  4IHJ A;  3PJS K;  1DF5 A;  1VEW A;  1JX9 A;  5JVD B;  3OTO B;  4I0X A;  2YXH A;  5FPO A;  1EM1 A;  3VQW A;  2YSU B;  1H2M A;  1OCR C;  2AW9 A;  5C93 A;  4HNA A;  4FLV A;  3BAB A;  4G28 B;  3HKC B;  2HKO A;  4DV7 B;  1B06 A;  1TVK B;  3EFF K;  1VF7 A;  1RSO A;  1GH6 A;  3H1J H;  1EFR G;  4MW3 A;  4LF8 B;  1IBM O;  1S3J A;  4GX2 A;  4JYY A;  4BR6 A;  5IWA O;  1NS1 A;  4I50 B;  2NNU A;  3OD4 A;  3X2Q B;  5EYP B;  2VQE B;  2ADP A;  4Z2W A;  3RYH A;  1Y74 A;  1KBH A;  2A79 B;  1KMI Z;  2QKS A;  2WLL B;  4QIW F;  4JI6 B;  3X2Q C;  5E79 Z;  1IVS A;  5CA0 B;  1MA1 A;  4PV1 B;  4DUY B;  2Q73 A;  5L3G A;  1S0V A;  5JJJ B;  2RDC A;  2KB1 A;  5BXZ A;  5CB4 A;  5E1A C;  5JQG A;  1QQC A;  2E76 B;  3K06 A;  3D3Q A;  3MHH C;  5J2U A;  4FLU A;  1YTF B;  4N21 A;  1ROP A;  2E5L O;  4DR4 O;  5D5Q A;  5L3E A;  5LYJ A;  2VS0 A;  3KCY A;  3ABT A;  3SR2 C;  1GN2 A;  3ABM B;  4KHP O;  1RM1 B;  2W0F C;  2OCC C;  3MAQ A;  2B1G A;  4RUF A;  3T1Y B;  3JD4 A;  2IJI A;  2OIE A;  3G6B A;  3TET A;  1SRY A; 
#chains in the Genus database with same CATH homology
 1EZV H;  1SQP H;  1NTZ H;  1P84 F;  3H1J H;  1KB9 F;  1SQB H;  1L0L H;  3L75 H;  2BCC H;  1L0N H;  3L73 H;  1SQX H;  3L71 H;  1KYO F;  5KLV H;  3CXH F;  1PPJ H;  4PD4 F;  3L70 H;  3TGU H;  3CWB H;  3BCC H;  2IBZ H;  3H1K H;  2FYU H;  3L72 H;  3H1I H;  3CX5 F;  1SQQ H;  4D6T H;  1BE3 H;  1SQV H;  3H1H H;  2A06 H;  1NTK H;  3H1L H;  1PP9 H;  1BCC H;  1NTM H;  1NU1 H;  3L74 H;  4U3F H;  1BGY H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...