1MOFA

Coat protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
DLREVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECAFYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retrovirus envelope domain at 1.7 angstrom resolution.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
molecule keywords MOLONEY MURINE LEUKEMIA VIRUS P15
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mofA00
2X7RB 4FJCC 3M99B 1QR8A 1QR9A 4E2LA 2OT5A 3MHHC 4N21A 5HFMA 1K33A 2EBOA 4FK5C 4JF3A 5KA5A 1I5XA 5KA6A 3GWOA 1SZTA 1QBZA 3K9AA 2LP7A 1I5YA 1Y66A 5CMUA 5CN0A 1MG1A 3P30A 5HFLA 1Y4MA 3CP1A 3CYOA 2EZPA 4JGSA 5H9CA 1JQ0A 2EZOA 3B8NA 3H01A 4JPRA 1DF4A 3B77A 3B8MA 1ENVA 3MHSC 4G2KA 3WFVA 1DLBA 4FIPC 1QCEA 2MK3A 1DF5A 2P6JA 1JPXA 1EBOA 4N23A 2M7WA 1MOFA 1K34A 1F23A
chains in the Genus database with same CATH superfamily
3OMNB 4DR3B 3ETQA 4O4IA 4X1KB 3CC4V 1GN6A 2H3OA 1D5NA 4DR5O 2FYUH 4DUYO 4PA4A 1E1QG 2HHHB 3OTOB 2QGNA 4O2AB 4LF5O 1B06A 2EIKC 4MVSA 4LF6B 3W7WA 1NTZH 2LO1A 1KU9A 2CGNA 5K1XA 2XAGA 1RSOB 2RJZA 2NR5A 3FKSG 5CA3A 1E1RG 2ITCC 3OFNG 3LNNA 2BTQB 2FKXA 5IT9N 2YEVB 2WPDG 3KG2A 3ZHTA 2ZKOA 1GM9A 3SR2C 3AG4B 3VQYA 1R3KC 1S5JA 2Y4UA 1NJIW 2X6BA 5JCOC 4XDKA 4PJ0Z 1R6KA 5JWPA 3MD0A 4UVBA 4CC5A 2R9IA 2E3CA 4GX2A 1VARA 5A2QN 1S0VA 1SS3A 1PD3A 5LXTA 2VS0A 1G4YB 4JI3O 1MSWD 2ADQB 4JYAB 1B3QA 1HDJA 1HW7A 1NVPB 4AQYO 1KC8W 2W6JG 4DUZB 5LOVB 2UXNA 1PL4A 3AG1B 4NYKA 2OT5A 5JJEB 2Q69A 2ITDC 2B1GA 2HLDG 4X62B 4PDLA 3RYIA 1M5IA 3DC6A 2YIBA 3F7YC 5JQGA 2HR3A 5KLVH 3RYIB 3IAYA 1R1BA 1HNZB 3M8AA 1IURA 1GO3F 1M56C 1SQFA 2A06H 1GN2A 2N74A 2YIDA 1NU1H 2Q67A 4GKJB 3I56V 4WBNB 5IJ9B 4F6RB 4L8JA 2ZCEA 3ZRVA 2Q4PA 4J7KA 3JAWB 3TJTA 3B40A 1BSMA 3DTUB 2ZT9B 1AI4A 3G67A 3D3IA 5KUKA 3A2FA 1K4DC 4P30A 5CBGA 1THZA 1T5EA 4LP8A 1NKDA 1ZL8A 4LWSA 4B7KA 5CN0A 3SJQC 1YJNV 1XHXA 4DW1A 2R72A 1RPRA 3RGBA 3F5TA 2EZOA 4DV1B 3TXSA 3RVYA 4X20A 5EK0A 4X1KA 1Y76B 5BMVB 2BTQA 4UCSA 2KQXA 4J7JA 4LFAO 2Q9LA 4DK0A 4BAYA 1OCRB 3FB6C 3ZHQA 2E5LB 2A0LA 4CH3A 3WU2Z 1VQLV 2W0XA 1FFXA 1D5AA 1P49A 1B6QA 2NLJC 5CA1A 3MHSC 4PI0A 1GKFA 2E74B 4KL1A 4DV5O 1F23A 4WF9V 3JATA 3BRCA 5CBHA 4NXNO 1BS3A 2ZQMA 3K58A 1ORQC 2F4VB 1WPXA 1I5YA 4PA3A 4LF4O 1J5EB 1BQ0A 5D5PA 2GTAA 1Q43A 2WLJA 1KD1W 3H01A 3ZMSA 2AHZA 3ZRWB 2OCHA 4FM0A 2R70A 2W0FC 2LW1A 3HKCB 4UV9A 1AI7A 4CH4A 1L1FA 4LBEC 2YUAA 3H1KH 4UVAA 2VQFB 1SZXA 1FS0G 1YXBA 2V1DA 3JCZA 4DV3B 4X20B 4YXWG 1HNXO 2EIJC 4LF8B 4KHPO 2BE3A 2IH1C 1JMKC 4IYHA 5FLXN 3E22A 1ZUQA 2DOSA 1GAXA 3X2QC 3TK1A 1Q90D 2F93B 4K8ZA 4YY3O 1TUBB 1D2DA 2ZIMA 4BIOA 1YTFB 4GKJO 2YXHA 1SESA 5GTIZ 5B1BB 4I50B 2UUAB 4J80A 2GV9A 5JVDB 3G4SV 1KBHA 1US6A 4ZBMA 4DR7B 4MW8A 2IJIA 3EXAA 1YSCA 5IY5C 1NR1A 5LA6B 4LFCO 4RQFA 4JTDB 1P4RA 4J42A 5FPRA 5H6QA 3OR7C 3HKDB 5EBWC 1R6TA 4BIZA 2JRIA 1QLEC 4HBNA 4DR2O 5LYJA 2LGQA 3BABA 3KCXA 4R7CA 1SERA 5LMNB 1NI8A 2V4DA 5IJ9A 3UT5B 2HP8A 4J11A 1WAZA 3C3TA 4IHJB 3U10A 3JD4A 1ZAUA 1VEWA 1FPOA 1Z2GA 5EYPB 2EBOA 1K92A 3CXCU 3ZBHA 2QKCA 1KMIZ 1EN5A 3J7AU 4J41A 2ILMA 3DGEA 2EINB 3CJHA 2YIAA 3RYCA 1QVGU 4IIJB 1WP8A 1SC5B 3B77A 3WFVA 3OMIB 1V55B 5KHKA 1OHHG 4QE7A 5L3FA 1I0HA 2DYSB 3PN1A 1SQGA 3O9OA 4L87A 4JI8O 4N21A 2QE7G 5LYJB 1EZVH 3K3WA 4D6TH 3CSXA 2EJRA 3K57A 2OIEA 1XL6A 1OCCB 3JASB 4MTXA 3N27A 4GKKB 1M1KW 3RW0A 1YF2A 2PGGA 4OX9O 4DV1O 2FTKA 4JZGA 3ZHRA 2DN9A 4IIJA 4LF9O 5DECA 1NZ6A 3DC5A 4LFBO 2K1EA 1DGSA 1VMGA 4X1YB 2HJFC 3K0GA 2DW4A 1Y74B 3UM7A 2OIGA 4IHJA 4GLXA 2OTJV 2Q0OC 4JYYA 1URFA 2A7WA 1WA8B 1VQ8V 3FD9A 1WNSA 4H13B 4U7OA 5EZYB 4K3AA 4DUZO 3G71V 4YY3B 4WFEA 3OMAB 5DM6V 1RSOA 1Q5OA 5J9PC 4DV0O 5DEDA 4DR4O 3RFRA 4JYCA 4UFZA 1FD9A 2X6AA 1LUWA 2DQ3A 2GDSA 2EIJB 1Q82W 3BPZA 3C90A 2P6JA 4JV5O 3H1LH 2PI5A 1PNMA 5JVDA 4FK5C 2EJ7A 2JIZG 1QVFU 2ZINA 2WLIB 4WFFA 5CMUA 3PJSK 2WLLB 3SPJA 2EILC 4BWAA 2RQ6A 3JAKA 3OTFA 3EFFK 5LMNO 2ODMA 2Y4TA 4LF7O 1WPBA 2F66C 4TV8B 2YC0A 2X0LA 1W2BU 3LSQA 2LFRA 2KG7B 1K8AW 3LDCA 1NH2B 2CE4A 3N2KA 1JR9A 1JFFA 1QHTA 2QWQB 4FPPA 1H2LA 2DJVA 4H33A 1GK9A 2XT9A 2N05A 1IBLO 4JI7O 4BR6A 3CCVV 2EZPA 2CTQA 2Y48A 3ZX6A 2ZM6B 1F4NA 2XAFA 5EBMC 5C8YA 1TUBA 3ZRWA 2IJJA 2QM7A 5D5QA 3RN4A 2ZR3A 3HKEB 4B3TO 1P7BA 1XL4A 3GB7C 1I5XA 4B7EA 4FLVA 1N33B 1SA0B 4I9WA 2UXCB 1JQ0A 5GONA 5H6RA 2DE0X 1OV9A 1NTMH 3RBZA 1Q86W 1JCHA 1FJGO 2EULA 1L0NH 5KHHA 3D3QA 5J2UB 3Q4HA 2QEXV 4XBFA 3AEIA 3APQA 4LF4B 3P30A 3D8CA 4LR3A 5HFLA 2JJ1G 2FMLA 4G28B 1DF4A 3ML0A 4WFGA 1N8RW 3E89A 4ZHQA 3SYPA 2ZE7A 2A9HA 1VQ7V 4Z2WA 1K5QA 5IYCO 3RYFB 3CRRA 3L75H 3CMAV 2UXDO 3SYAA 1JA8A 2N04A 3W7TA 1SZTA 4PI2A 1R3JC 2R9RB 1F51A 1VF7A 5F2VO 5B3SB 5BMVA 3B8MA 1XNQO 2RMKB 2FB5A 1YI2V 3ETEA 2PYJA 3E8FA 1OCOC 4FZ1A 4AQYB 3EVKA 1I08A 2JGDB 4B3MB 4YHHO 3STZC 4PA7A 3BEHA 4PHZA 1VF5B 3QO8A 2Z5UA 4YIOA 1N36O 4LNUB 4RAIA 4MTGA 3W7UA 1MOFA 2CDYA 1QLNA 1WN7A 1BHAA 4UB8Z 2AHYA 1P7GA 4FZ0A 3CC7V 4FLUA 3WB2A 3VBBA 4GZRB 1S3JA 1UJWB 4WCEV 2YI8A 4WBNA 2JGUA 4TUYB 4X9QA 2KSDA 1P84F 4ICGA 2YIBD 1GN3A 4CH6A 1S77D 2HKOA 4HZ3A 4IT5A 2HEPA 2EX3A 5JQGB 5K1PA 1XBLA 1H8EG 2YDEA 1V54C 4DR3O 4TWKA 2HVKC 3CC2V 3THOA 1OCZC 5EYPA 2XOKG 2OYQA 2O57A 1TGOA 4DUYB 1XMOB 3E35A 5B1BC 3H9VA 4H44B 2AW9A 2JGDA 1IBMO 1DLBA 4JI0O 1GN4A 1EBOA 4JI1B 4ZIBA 3UKMA 4QNHB 3M7MX 3K06A 3LSUA 2PTMA 4NXNB 5GONB 1KP3A 3ZHUA 3LNMB 5E1AC 1MMMA 1QU7A 3CXHF 4B08A 3T2MA 2Y69B 2YSUB 5LGTA 4OX9B 4U3JB 4OPHA 2QTSA 5GTHZ 4JAVA 4LF9B 1M4UA 1K3EA 2CK3G 3J80N 2D3OW 3FAVB 2XASA 3QNEA 4I50A 3GWOA 3G80A 3KCYA 2PUSA 4FM2A 1GH6A 4KHPB 1XNQB 3JSNA 1K73W 1SA0A 1AI5A 1S76D 1NS1A 3K5MA 1XHZA 3VQWA 3A0BZ 2IU0A 5DN6G 2KG7A 1JVMA 1VF6C 1GRJA 4YHHB 4ZHQB 4JASA 3ZN1A 5LHGA 2QA4V 1OCRC 3JALA 3K03A 3AK2A 4YJ2A 1N4CA 4BW5A 2C2AA 4FFBA 1SQVH 1UPGA 1WB7A 3M99B 2Q7GA 5B1AB 1ZLZA 1YITV 4AI8A 5LP6C 3UO3A 3DSQA 3RYHA 1KKCA 4FMTA 3BFRA 2WWWA 3CP1A 4DR1O 2Q68A 1WJZA 2WLMA 2YS8A 4X65B 4WFHA 4UCVA 1O9HA 2UUCO 5ITZB 2HG5C 3CHXA 3I5DA 4PDRA 2D2CB 3CPWU 4I0XB 1OJHA 4JYBA 1FFXB 4NR1A 1EZJA 1SQBH 2QKSA 3ETDA 4RUEA 5LL6Y 1YCIA 5FNVB 4DR1B 2DYSC 3JSLA 4PA9A 2ZIOA 4O4LB 3MDSA 5C93A 1HNWB 3CCUV 3S3WA 2YXLA 3UO2A 3SPGA 4JI2B 1HNXB 5CA0B 2LQTA 3SDLA 1NQTA 1H2SB 1Y66A 1AJQA 2E5LO 5IE9A 1NTKH 3RVZA 3ASNB 2JDIG 1FXHA 1W0JG 2XAJA 4NB5A 2R9AA 1Q7YW 2PY5A 4Q20A 1TUEB 2YI9A 3OEHG 3P3PA 3SPIA 1AP5A 3QF7A 4DV7O 3ZJZA 1JJOA 2GHYA 4A5UB 4RO2A 1WA8A 2XTAA 3AG2B 1QBZA 4MVQA 2LP7A 3FB5C 3JD1A 1Y74A 1YTFD 1BQZA 1QLEB 3BA8A 2QTOA 4GT1A 4J7ZA 1AROP 1E79G 3SYOA 5CBFA 3E8GA 5LMUO 3AG4C 4R50A 4DR2B 5EZYA 3ABLC 1EFRG 2P67A 1G6UA 4QPJA 5IYZA 4KUMA 2RCVA 2L6LA 1SQQH 1PNKA 4LF6O 2QKAA 1XNRB 3RYCB 1KKDA 3EHBB 4UVCA 1SF9A 2UXXA 3SYQA 4G2KA 3CCMV 4W4LA 1MA1A 2EINC 2KKWA 2ZXWC 4DR6O 2HFEC 2VRZA 1R73A 4CH5A 2ZD9A 1U96A 2NNUA 2W6IG 3K59A 3T1YB 5KA6A 3ABUA 4W4KA 4O4JA 4DK1A 2PZSA 1O9GA 4AHCA 5KUMA 4O4HB 2BCCH 2X6CA 3CWBH 5IWAO 3L73H 1N36B 1R3LC 3O65A 1K34A 2Q6AA 2UUBB 1CEZA 4CS4A 3IGAC 2YEVA 4Q6GA 1IX9A 2XAHA 4OXSA 2CTWA 5L3DA 1I7FA 1L0LH 4JGSA 1DTOA 3FFQA 1H2MA 1BL8A 1N0NA 4IGGA 3WB1A 1VF6A 4JI6B 1LNQA 4FIPC 1Q6HA 4O4LA 2CUGA 1HR0O 4LFCB 4BIUA 3QVNA 2UXDB 1SKVA 1XMQB 1XI1A 3LDEA 4I7ZB 2VQEB 1H8HG 5LA6A 4GX5A 3T1CA 1M56B 4U7NA 3NXSA 4TT3G 3ICXA 4LCUC 3B4SA 4NKGB 5AG2A 5H2FZ 1SQPH 2GTSA 3B8NA 2DWDC 3K0DA 5IDJA 4O2BB 3ZHSA 1N32B 1JPXA 3JALB 3OUFA 1YZBA 3CRAA 5LGUA 3JATB 4HNAA 2GUZB 1W59A 1KECA 1BHBA 1FJGB 2IJKA 3E83A 3ZHVA 5BZBA 1G1XB 2K9PA 3U0ZA 2M6YA 1MZFA 3KKYA 1HNWO 2P7TC 1M9NA 1TVKA 2UXBO 4P9PA 4JI2O 2ZNJA 4MVOA 1EN4A 2QWRB 1NR7A 3HPLC 2Q0AA 5B66Z 1AP6A 3TCUA 2E75B 3ABMB 1LUVA 5H9CA 3T4DA 1L8DA 4PDVA 3G6BA 2MK3A 3CMEV 4UV8A 2EIKB 1PNLA 3OGIB 1JJ2U 4FLWA 2ZDIA 5HFMA 4LFBB 2BSKA 1K33A 4FM1A 1WB8A 1FYJA 2XHBA 2VQFO 3ZIAG 4J9ZB 5J2TB 5IJ0B 4DV2B 1Q8IA 3FAVA 4B3SO 1WLEA 2ZE5A 3JD3A 1K4CC 4NTXA 2JEXA 4R6ZA 2F4VO 3CCRV 1K9MW 2B9ZA 2RN9A 1FKAO 5KMGA 1HP8A 2L35A 1YHQV 4HAMA 3JAWA 4LWSB 4PD4F 1BE3H 2UUCB 1QCEA 4CZZA 1V54B 1Z5WA 3ZRSA 1VQOV 4GYCB 4DV3O 3G6EV 4P2ZA 4LH7A 2VQEO 1IZ3A 3CCLV 4MVRA 5IY5B 1AJNA 4X1YA 1YJ9V 1MSDA 3WG7C 4X66B 3OTOO 2WSSG 2JS3A 4UCOA 5L3GA 3WG7B 2HJDA 4U3JA 1N32O 3P3NA 4TQDA 1H2NA 1OCOB 2IU3A 2Y69C 3CCJV 4MSWC 3A0RA 3STLC 4CBCA 4K35A 5H5NA 5IYZB 4X66O 4F6RA 3OD4A 1VQPV 2UXCO 4EKWA 4JTCB 5CB4A 4PDMA 4JI6O 3CRQA 3OEEG 5LOVA 1GTOA 1YEWA 2XUMA 2AXTZ 4JAAA 1FFTB 5JCOA 4E4EA 3CCQV 2UXBB 5EIBC 3NR7A 5IYDO 4I9QA 5LGNA 2CAZC 3RYFA 2IJHA 4ZOLB 1AI6A 2PI4A 4GKKO 1VQMV 2AZ2A 3T1HB 3K08A 2LJ2A 2Q7EA 3E86A 4O4IB 2ARHA 4E2LA 3P32A 1OCCC 2UUAO 5A9GA 1YJWV 4DR5B 3A8TA 2F23A 3JYCA 5JJNB 5LXTB 4CS3A 1VQKV 2MW2B 5B1AC 1EM1A 3RT3C 4DR7O 4B3RB 3BA9A 3HB3B 1IBKO 5CA0A 2M7WA 4DR6B 3L71H 4ZI7B 1ZWIC 3JD2A 3AG7A 1H2GA 3VOUA 2UU9B 1YDXA 1XMOO 1Y67A 2WA4A 3HKEA 1FXVA 2Y0PA 3LSSA 1MZEA 1XOUA 3SPCA 1VQ9V 4H37A 1K97A 4UXNA 5J2TA 1BT8A 3FYIB 4JI4B 3APOA 2LFSA 4X1IA 2PF4E 1KP2A 5ITZA 2QWPB 3SPHA 4Z1MG 1R6NA 3X2QB 1KUQA 3QG5A 1B04A 4XDJA 3MAQA 4O2AA 2CTPA 4B3SB 4X64B 3D36A 3SJAC 2GUZA 4R8CA 4D7TA 4BW9A 1Q3EA 4OGQB 3OE7G 1HR0B 4JI4O 1IVSA 3K04A 2IM9A 4GX0A 4FFBB 3ASNC 1V9PA 1GM8A 3H1HH 4LFAB 1SQXH 1F7YA 2WLKA 1JFFB 1RFYA 1X4TA 2VWKA 4JYAO 5KHIA 1IBLB 4DRXB 4JI7B 1XUQA 1M90W 4TV8A 5JH7A 1IBMB 4GX1A 3C3SA 2DWEC 3K5OA 3AG2C 5KHJA 3BHPA 2JS5A 3JAKB 4EFBA 3JAMN 1J95A 4EEQA 4I55A 4LF7B 1U97A 2WA3A 5LP6B 1Q81W 2EIMC 2OCCB 3B09A 5B1NA 1JX9A 2QDOA 3KZIZ 5C8YB 4N23A 2Q73A 3UQ8A 1QR9A 4DW0A 1KB9F 1BCCH 1R3IC 2Q5ZA 4MTOA 3ZS8C 1F4MA 1NT2B 2E76B 2JEUA 2P5OA 4YIPA 3ASOC 3ABKB 5LMUB 1ZL8B 2FL4A 2ZM6O 1QNMA 3W7XA 2QR4A 2ZXWB 4JAUA 5L3EA 3ZMTA 3SJBC 4QGPA 3ZRXA 5EC2C 4NTWA 5CB4B 3FYEB 1S5HC 1YIJV 3JARA 5KA5A 2V7QG 2H8PC 3IFXA 1V55C 4PA6A 1N33O 4TV9B 4PELA 4C7UA 1WP7A 3OUSA 3ZCCA 2RNBA 4Z1VA 3TETA 3L72H 4ZI7A 2P90A 1OZ0A 3CCSV 1I94O 4YJ3A 4DV6B 3CJHB 2ETNA 3IC9A 4GUNA 1PL0A 1IXMA 3GWKC 4I4TA 4X88A 4DYLA 5LBQA 3W7SA 1EN6A 4UCUA 1M57C 1ROPA 3LUTB 4TUYA 1RM1B 4MS2A 2CH7A 3QTCA 1M57B 3ABMC 1PKXA 4K0KO 2B5UA 3ABTA 5B3SC 3SJCC 2AZ0A 4UB6Z 1UFIA 5B5EZ 4MW3A 2VWJA 3U11A 1A32A 4XDLA 3OM3B 2IH3C 1H2KA 2ZE8A 2BOBC 5BR8B 4JI5B 1XILA 3QO7A 2IW5A 1K5SA 4FFKA 2P22C 1VQNV 3ZEDA 4EB6A 1H38A 4DV4B 5KX5B 4JI8B 4TV9A 4U3FH 4LH6A 4TQFA 2OTLV 1BGYH 3HKDA 2GBOA 1K7DA 3L74H 2QM8A 3F7VC 1YVWA 2EILB 3OW2U 4JI5O 2DYRB 4TSFG 3LDDA 3CD6V 4JI0B 4FJCC 5E79Z 1OCZB 1VQ6V 1KYOF 4H0LB 2QM4A 3CB2A 4FVMA 2DYRC 4B3TB 4K8XA 1TA8A 1AJPA 2PYLA 3VQXA 3TGUH 3CYOA 1HWYA 1Q6IA 3SYCA 3H1JH 4JPRA 3UT5A 3Q4HB 4QE9A 1DF5A 4DXWA 2Z0AA 3JCUZ 3HKBB 2XNDG 1IXBA 2QWNB 1PV0A 3E22B 4YJ2B 1FXKB 3N2GB 3R65A 2ADPA 5KMGB 3K9AA 1CPYA 4DV0B 4FLXA 5EIBD 3DXRA 3ABKC 1S72V 4DV2O 2A3QA 3L9DA 3N2GA 4JI1O 2ZE6A 4O2BA 2HVJC 4CS2A 5TISZ 3CS5A 4JV5B 2QSAA 3IC7A 2WAMA 5LHIA 5L3BA 5IJ0A 1TVKB 4WFBV 4LF5B 3VQVA 4EFEA 1VP7A 4X62O 5BY1A 1Y76A 1SETA 5B1OA 1BZKA 4MTFA 1XNRO 3DXRB 4MT8A 4ASUG 3R66A 3L70H 1NBMG 2RDCA 3SGIA 4JF3A 5FL7G 2G38A 1J5EO 3BY6A 4B3MO 2CTRA 1S5LZ 1VIBA 3HKCA 2OWOA 2F95B 5BR8O 5BXZA 3CCEV 3HKBA 4TOIA 1RM1C 4DV6O 1AR4A 3I55V 1IDSA 5EC1C 1Q6UA 2B1IA 4IYIA 3BVOA 1GM7A 4JI3B 2JK5C 4HNAB 4RUFA 4QJFB 2P4KA 2WLLA 2ATKC 1MABG 5CA1B 1DK1A 3CE2A 2X7RB 1XEQA 3ASOB 5KX5A 1PP9H 1XMQO 3UCSC 3ZMVA 3AK1A 1GMGA 1BMFG 1G8MA 2GSMB 3HR0A 3FB8C 4I4TB 4NTYA 3T4ZA 1FAFA 4I5SA 3JD0A 4ZOLA 4DV5B 3H1IH 4QPKA 3AK3A 1COWG 3K5LA 1CP9A 4GCZA 4G27B 1XREA 5IWAB 1ZX3A 2AGAA 4RQEA 4CC6A 4KFMA 2WLHA 1XDCA 4F4LA 3CX5F 3OT7A 1W0KG 4B3RO 4EB6B 2A79B 2NN4A 3RWRD 4NVPA 1QR8A 4O4HA 3OAAG 3JARB 2Z3YA 1Z5VA 1ZSPA 4LNUA 4YJ3B 4O4JB 1NVPD 2DMXA 1N34O 5L3CA 1VQ5V 1ZTEA 1FXKC 4KXRA 2Q8VA 2ZDIC 3ETGA 3BAAA 1XQ8A 2F43G 3OR6C 3JASA 4RWUA 4NXMB 1KQSU 1IBKB 3ABLB 1X59A 1AILA 2EIMB 2OCCC 4UUJC 5JJJB 1SRYA 4X8AA 5EBLC 3E2EA 2ZNIA 2QWOB 1MG1A 4UCTA 2CH7B 1N34B 1QQCA 1NH2D 4I55B 1AB3A 5J2UA 4UCRA 5IYBO 1M93A 4K0KB 4NXMO 3AG3B 3F5WC 4J9YB 4FLZA 2UUBO 3A0HZ 3AG3C 3E8BA 4X89A 1Y6XA 2XAQA 1Y4MA 1VQ4V 2H94A 4KP4A 3K5NA 3ZMZA 4D7SA 3AG1C 2WLNA 5KAIZ 1HNZO 2JVDA 2LW7A 2BTOA 4PV1B 3FX7A 2F1MA 4HYOA 3ZN0A 3BCCH 4OPAA 3T1YO 3MHHC 1JOYA 4DV4O 1PPJH 4JZ2A 2DQ0A 2LGWA 1CXZB 4DO2A 3K9SA 2Q7HA 4I0XA 2BSKB 3OGCC 4ABMA 4LF8O 3B2EE 3K79A 1MNGA 5GW7A 2CGOA 1I94B 2BOCC 3FB7C 2IBZH 3N2KB 4WFAV 2YICA 5LHHA 4X1IB 5KHGA 5FNVA 5JH7B 2UU9O 3RYHB 4DR4B 1LR1A 1RP3B 4MVZA 3S3XA 1TAEA 1RPOA 4FLTA 4X65O 3CRMA 5LP6A 2JJ2G 2WLIA 1PM9A 3GVMA 2QJ1A 4J10A 4MVMA 3E8HA 4F6EA 1N0JA 3CRCA 4LC1A 1AR1B 2YXYA 1AVMA 3IJ4A 1AR5A 4DV7B 1FXKA 2HHHO 4P9OA 2KB1A 3WB0A 3QO5A 4DRXA 3CEIA 3D36C 2ZR2A 3J81N 5KAFZ 4X64O 4IL6Z 4FLYA 4QIWF 1ENVA 2Y0IA 2P06A 4AILC 2P4VA 4JTAB 4MVUA 3TXQA 3T1HO 5FPOA 3ZMUA 4ZKIA
chains in the Genus database with same CATH topology
1W2BU 3LSQA 2LFRA 2Q6AA 3OMNB 1K8AW 3LDCA 1NH2B 1CEZA 3CC4V 3IGAC 4FPPA 2YEVA 1PL0A 2XAHA 1IXMA 1E1QG 4OXSA 4PA4A 4X88A 4H33A 5LBQA 1GK9A 3W7SA 5L3DA 1M57C 3CCVV 1ROPA 2EZPA 2Y48A 3LUTB 4JGSA 2EIKC 1DTOA 1F4NA 2XAFA 4MS2A 4MVSA 5EBMC 1BL8A 1RM1B 3ZRWA 2IJJA 1R3LC 3W7WA 1LNQA 4FIPC 1M57B 2QM7A 2XAGA 3ABMC 1PKXA 2ZR3A 4BIUA 2B5UA 3ABTA 5B3SC 3FKSG 3LDEA 1E1RG 5CA3A 2ITCC 1P7BA 3OFNG 1H8HG 4MW3A 1XL4A 3GB7C 4GX5A 1I5XA 2YEVB 2WPDG 3KG2A 1GM9A 3T1CA 1M56B 4U7NA 3NXSA 4TT3G 4LCUC 4XDLA 3AG4B 3OM3B 4I9WA 2IH3C 1R3KC 1JQ0A 3B8NA 2DWDC 2X6BA 3K0DA 5IDJA 1NJIW 4XDKA 2BOBC 5H6RA 1JPXA 1R6KA 4ZKIA 3OUFA 3RBZA 3QO7A 1Q86W 2IW5A 1JCHA 5LGUA 1K5SA 3MD0A 4UVBA 2R9IA 1KECA 1VQNV 1H38A 1BHBA 2IJKA 2QEXV 4XBFA 3AEIA 4GX2A 3E83A 3P30A 2OTLV 5HFLA 2JJ1G 1S0VA 1PD3A 5BZBA 1K7DA 1G4YB 1MSWD 4G28B 1DF4A 2QM8A 3F7VC 3ML0A 4WFGA 1N8RW 3E89A 2EILB 3SYPA 1NVPB 3OW2U 2A9HA 2W6JG 1KC8W 1VQ7V 2DYRB 4TSFG 3LDDA 3CD6V 2UXNA 4FJCC 3AG1B 1OCZB 2P7TC 1M9NA 2OT5A 1K5QA 1VQ6V 5IYCO 4P9PA 2Q69A 3CMAV 2ITDC 4MVOA 3SYAA 2DYRC 3W7TA 1SZTA 1NR7A 2B1GA 2HLDG 3HPLC 1R3JC 2R9RB 3TCUA 1F51A 4PDLA 1AJPA 3ABMB 3CYOA 1HWYA 3F7YC 3SYCA 5H9CA 3T4DA 5B3SB 4JPRA 4PDVA 3B8MA 2HR3A 1YI2V 3ETEA 4QE9A 2MK3A 1DF5A 4DXWA 3E8FA 1OCOC 4UV8A 1GO3F 3CMEV 2EIKB 1PNLA 1JJ2U 1M56C 2XNDG 2ZDIA 5HFMA 1K33A 2Q67A 1FXKB 3R65A 3I56V 3ZIAG 4J9ZB 3K9AA 3STZC 1CPYA 4PA7A 3BEHA 3ZRVA 3ABKC 3QO8A 1S72V 1WLEA 2Z5UA 3DTUB 3JD3A 4RAIA 2HVJC 4MTGA 1AI4A 3W7UA 3D3IA 1MOFA 1QLNA 5KUKA 1BHAA 1K4DC 4P30A 5CBGA 1K4CC 2AHYA 2JEXA 3IC7A 4R6ZA 2WAMA 5LHIA 3CCRV 1THZA 3CC7V 1K9MW 5L3BA 4LP8A 1NKDA 3VBBA 1S3JA 1UJWB 4WCEV 5CN0A 4WFBV 3SJQC 1YJNV 1YHQV 4HAMA 5B1OA 1RPRA 1SETA 4MTFA 1S77D 2EZOA 4MT8A 3RVYA 2HKOA 4HZ3A 5EK0A 4ASUG 1QCEA 4CZZA 1V54B 3ZRSA 1NBMG 1VQOV 3G6EV 4P2ZA 1H8EG 1V54C 4BAYA 4TWKA 2HVKC 4JF3A 3CC2V 1OCRB 3FB6C 2A0LA 5FL7G 3CCLV 1VQLV 4MVRA 5IY5B 1AJNA 1OCZC 2XOKG 3BY6A 1YJ9V 3WG7C 3E35A 5B1BC 2WSSG 1B6QA 2NLJC 3MHSC 1DLBA 1GKFA 5L3GA 3WG7B 1EBOA 1F23A 3UKMA 4WF9V 3CCEV 4QNHB 1RM1C 5CBHA 3K06A 3I55V 5EC1C 2ZQMA 1OCOB 2B1IA 2IU3A 2Y69C 1ORQC 1KP3A 1WPXA 3CCJV 4MSWC 3LNMB 3A0RA 5E1AC 1GM7A 1I5YA 4PA3A 3STLC 4CBCA 3T2MA 2JK5C 2Y69B 2WLJA 2YSUB 5LGTA 4RUFA 4QJFB 1KD1W 3H01A 1VQPV 3ZMSA 2AHZA 4EKWA 4JTCB 2WLLA 3ZRWB 2ATKC 1MABG 4JAVA 2W0FC 4PDMA 4UV9A 1AI7A 2X7RB 3ASOB 3OEEG 1L1FA 1K3EA 1GTOA 4LBEC 2CK3G 4UVAA 2D3OW 1FS0G 2V1DA 2XASA 3QNEA 1FFTB 3JCZA 3ZMVA 3CCQV 4YXWG 1GMGA 5IYDO 2EIJC 1BMFG 3GWOA 1G8MA 5LGNA 2IH1C 2GSMB 2IJHA 3FB8C 3X2QC 1AI6A 2PI4A 3TK1A 1K73W 3T4ZA 1VQMV 1AI5A 4I5SA 1S76D 3JD0A 3K08A 3E86A 2IU0A 5DN6G 1JVMA 4E2LA 3P32A 1OCCC 1YTFB 4QPKA 1YJWV 1COWG 1SESA 5B1BB 4JASA 1CP9A 3ZN1A 4GCZA 3G4SV 4G27B 5LHGA 4ZBMA 2QA4V 1OCRC 3JYCA 1VQKV 4MW8A 2IJIA 3K03A 4RQEA 1YSCA 5IY5C 1NR1A 4KFMA 2WLHA 5B1AC 4F4LA 3HB3B 4RQFA 4JTDB 1P4RA 2C2AA 4BW5A 1W0KG 2M7WA 2A79B 5B1AB 3M99B 1QR8A 1ZWIC 3JD2A 3OAAG 5H6QA 3OR7C 1H2GA 2Z3YA 1YITV 5EBWC 3VOUA 4BIZA 1NVPD 1QLEC 4FMTA 5L3CA 1VQ5V 2WWWA 4R7CA 1SERA 1FXVA 3CP1A 3LSSA 2Q68A 1FXKC 2WLMA 2ZDIC 1VQ9V 3SPCA 3ETGA 2F43G 4H37A 3OR6C 4WFHA 1K97A 4UXNA 3FYIB 1KQSU 2HG5C 4PDRA 3ABLB 2LFSA 2EIMB 2OCCC 3JD4A 4UUJC 3CPWU 1KP2A 1SRYA 4JYBA 2EBOA 1K92A 3SPHA 4X8AA 3CXCU 4Z1MG 1R6NA 5EBLC 3X2QB 3E2EA 1EZJA 2QKSA 1MG1A 3ETDA 4RUEA 3DGEA 2EINB 4XDJA 1NH2D 1QVGU 2DYSC 3B77A 3WFVA 3OMIB 3D36A 1V55B 4PA9A 1OHHG 4QE7A 5L3FA 4R8CA 5IYBO 5C93A 3OE7G 3CCUV 2DYSB 3AG3B 3K04A 4L87A 3SPGA 3F5WC 4J9YB 4N21A 4GX0A 2QE7G 3K3WA 3ASNC 1GM8A 2EJRA 3AG3C 1NQTA 3E8BA 1Y66A 1AJQA 1XL6A 2WLKA 4X89A 1OCCB 4MTXA 2XAQA 1M1KW 1Y4MA 3RVZA 3ASNB 2H94A 3RW0A 1VQ4V 2JDIG 4KP4A 1FXHA 1W0JG 3ZMZA 3AG1C 2WLNA 2XAJA 1Q7YW 2FTKA 1M90W 4Q20A 1TUEB 4GX1A 4HYOA 2DWEC 3ZN0A 3OEHG 3SPIA 3AG2C 3ZJZA 2K1EA 3MHHC 1JOYA 2GHYA 2DQ0A 4RO2A 1J95A 2HJFC 3K0GA 4DO2A 2DW4A 3AG2B 1QBZA 4MVQA 2LP7A 3FB5C 3JD1A 3OGCC 3UM7A 3K79A 2OTJV 5GW7A 1YTFD 1QLEB 2BOCC 1Q81W 1VQ8V 2EIMC 2OCCB 2QTOA 3FB7C 4GT1A 5B1NA 4U7OA 1JX9A 4WFAV 1AROP 3G71V 4N23A 4WFEA 1E79G 5LHHA 3SYOA 5CBFA 1QR9A 3OMAB 5DM6V 3E8GA 1R3IC 3AG4C 4MTOA 5J9PC 1F4MA 2JEUA 4MVZA 4R50A 1RPOA 3ASOC 3ABKB 4JYCA 3ABLC 1EFRG 2P67A 2X6AA 4QPJA 4KUMA 3W7XA 2ZXWB 2DQ3A 1PNKA 4JAUA 5L3EA 2JJ2G 2WLIA 3ZMTA 2EIJB 1Q82W 1KKDA 3EHBB 4UVCA 2UXXA 5EC2C 3SYQA 4G2KA 3ZRXA 4MVMA 3CCMV 2ZXWC 2EINC 2P6JA 3FYEB 3E8HA 1S5HC 2HFEC 1YIJV 5KA5A 1R73A 4LC1A 2ZD9A 2V7QG 2PI5A 1PNMA 2H8PC 2NNUA 3IFXA 1AR1B 1V55C 4PA6A 4FK5C 2W6IG 2JIZG 1QVFU 5KA6A 3ABUA 1FXKA 4PELA 4P9OA 2KB1A 2WLIB 4WFFA 5CMUA 3OUSA 3QO5A 3ZCCA 3PJSK 2WLLB 3SPJA 2ZR2A 2EILC 5KUMA 3EFFK 3TETA 2X6CA 4QIWF 2P90A 1ENVA 1OZ0A 3CCSV 4JTAB 4MVUA 3ZMUA 2X0LA 1K34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7R B;  4FJC C;  3M99 B;  1QR8 A;  1QR9 A;  4E2L A;  2OT5 A;  3MHH C;  4N21 A;  5HFM A;  1K33 A;  2EBO A;  4FK5 C;  4JF3 A;  5KA5 A;  1I5X A;  5KA6 A;  3GWO A;  1SZT A;  1QBZ A;  3K9A A;  2LP7 A;  1I5Y A;  1Y66 A;  5CMU A;  5CN0 A;  1MG1 A;  3P30 A;  5HFL A;  1Y4M A;  3CP1 A;  3CYO A;  2EZP A;  4JGS A;  5H9C A;  1JQ0 A;  2EZO A;  3B8N A;  3H01 A;  4JPR A;  1DF4 A;  3B77 A;  3B8M A;  1ENV A;  3MHS C;  4G2K A;  3WFV A;  1DLB A;  4FIP C;  1QCE A;  2MK3 A;  1DF5 A;  2P6J A;  1JPX A;  1EBO A;  4N23 A;  2M7W A;  1MOF A;  1K34 A;  1F23 A; 
#chains in the Genus database with same CATH topology
 3OMN B;  4DR3 B;  3ETQ A;  4O4I A;  4X1K B;  3CC4 V;  1GN6 A;  2H3O A;  1D5N A;  4DR5 O;  2FYU H;  4DUY O;  4PA4 A;  1E1Q G;  2HHH B;  3OTO B;  2QGN A;  4O2A B;  4LF5 O;  1B06 A;  2EIK C;  4MVS A;  4LF6 B;  3W7W A;  1NTZ H;  2LO1 A;  1KU9 A;  2CGN A;  5K1X A;  2XAG A;  1RSO B;  2RJZ A;  2NR5 A;  3FKS G;  5CA3 A;  1E1R G;  2ITC C;  3OFN G;  3LNN A;  2BTQ B;  2FKX A;  5IT9 N;  2YEV B;  2WPD G;  3KG2 A;  3ZHT A;  2ZKO A;  1GM9 A;  3SR2 C;  3AG4 B;  3VQY A;  1R3K C;  1S5J A;  2Y4U A;  1NJI W;  2X6B A;  5JCO C;  4XDK A;  4PJ0 Z;  1R6K A;  5JWP A;  3MD0 A;  4UVB A;  4CC5 A;  2R9I A;  2E3C A;  4GX2 A;  1VAR A;  5A2Q N;  1S0V A;  1SS3 A;  1PD3 A;  5LXT A;  2VS0 A;  1G4Y B;  4JI3 O;  1MSW D;  2ADQ B;  4JYA B;  1B3Q A;  1HDJ A;  1HW7 A;  1NVP B;  4AQY O;  1KC8 W;  2W6J G;  4DUZ B;  5LOV B;  2UXN A;  1PL4 A;  3AG1 B;  4NYK A;  2OT5 A;  5JJE B;  2Q69 A;  2ITD C;  2B1G A;  2HLD G;  4X62 B;  4PDL A;  3RYI A;  1M5I A;  3DC6 A;  2YIB A;  3F7Y C;  5JQG A;  2HR3 A;  5KLV H;  3RYI B;  3IAY A;  1R1B A;  1HNZ B;  3M8A A;  1IUR A;  1GO3 F;  1M56 C;  1SQF A;  2A06 H;  1GN2 A;  2N74 A;  2YID A;  1NU1 H;  2Q67 A;  4GKJ B;  3I56 V;  4WBN B;  5IJ9 B;  4F6R B;  4L8J A;  2ZCE A;  3ZRV A;  2Q4P A;  4J7K A;  3JAW B;  3TJT A;  3B40 A;  1BSM A;  3DTU B;  2ZT9 B;  1AI4 A;  3G67 A;  3D3I A;  5KUK A;  3A2F A;  1K4D C;  4P30 A;  5CBG A;  1THZ A;  1T5E A;  4LP8 A;  1NKD A;  1ZL8 A;  4LWS A;  4B7K A;  5CN0 A;  3SJQ C;  1YJN V;  1XHX A;  4DW1 A;  2R72 A;  1RPR A;  3RGB A;  3F5T A;  2EZO A;  4DV1 B;  3TXS A;  3RVY A;  4X20 A;  5EK0 A;  4X1K A;  1Y76 B;  5BMV B;  2BTQ A;  4UCS A;  2KQX A;  4J7J A;  4LFA O;  2Q9L A;  4DK0 A;  4BAY A;  1OCR B;  3FB6 C;  3ZHQ A;  2E5L B;  2A0L A;  4CH3 A;  3WU2 Z;  1VQL V;  2W0X A;  1FFX A;  1D5A A;  1P49 A;  1B6Q A;  2NLJ C;  5CA1 A;  3MHS C;  4PI0 A;  1GKF A;  2E74 B;  4KL1 A;  4DV5 O;  1F23 A;  4WF9 V;  3JAT A;  3BRC A;  5CBH A;  4NXN O;  1BS3 A;  2ZQM A;  3K58 A;  1ORQ C;  2F4V B;  1WPX A;  1I5Y A;  4PA3 A;  4LF4 O;  1J5E B;  1BQ0 A;  5D5P A;  2GTA A;  1Q43 A;  2WLJ A;  1KD1 W;  3H01 A;  3ZMS A;  2AHZ A;  3ZRW B;  2OCH A;  4FM0 A;  2R70 A;  2W0F C;  2LW1 A;  3HKC B;  4UV9 A;  1AI7 A;  4CH4 A;  1L1F A;  4LBE C;  2YUA A;  3H1K H;  4UVA A;  2VQF B;  1SZX A;  1FS0 G;  1YXB A;  2V1D A;  3JCZ A;  4DV3 B;  4X20 B;  4YXW G;  1HNX O;  2EIJ C;  4LF8 B;  4KHP O;  2BE3 A;  2IH1 C;  1JMK C;  4IYH A;  5FLX N;  3E22 A;  1ZUQ A;  2DOS A;  1GAX A;  3X2Q C;  3TK1 A;  1Q90 D;  2F93 B;  4K8Z A;  4YY3 O;  1TUB B;  1D2D A;  2ZIM A;  4BIO A;  1YTF B;  4GKJ O;  2YXH A;  1SES A;  5GTI Z;  5B1B B;  4I50 B;  2UUA B;  4J80 A;  2GV9 A;  5JVD B;  3G4S V;  1KBH A;  1US6 A;  4ZBM A;  4DR7 B;  4MW8 A;  2IJI A;  3EXA A;  1YSC A;  5IY5 C;  1NR1 A;  5LA6 B;  4LFC O;  4RQF A;  4JTD B;  1P4R A;  4J42 A;  5FPR A;  5H6Q A;  3OR7 C;  3HKD B;  5EBW C;  1R6T A;  4BIZ A;  2JRI A;  1QLE C;  4HBN A;  4DR2 O;  5LYJ A;  2LGQ A;  3BAB A;  3KCX A;  4R7C A;  1SER A;  5LMN B;  1NI8 A;  2V4D A;  5IJ9 A;  3UT5 B;  2HP8 A;  4J11 A;  1WAZ A;  3C3T A;  4IHJ B;  3U10 A;  3JD4 A;  1ZAU A;  1VEW A;  1FPO A;  1Z2G A;  5EYP B;  2EBO A;  1K92 A;  3CXC U;  3ZBH A;  2QKC A;  1KMI Z;  1EN5 A;  3J7A U;  4J41 A;  2ILM A;  3DGE A;  2EIN B;  3CJH A;  2YIA A;  3RYC A;  1QVG U;  4IIJ B;  1WP8 A;  1SC5 B;  3B77 A;  3WFV A;  3OMI B;  1V55 B;  5KHK A;  1OHH G;  4QE7 A;  5L3F A;  1I0H A;  2DYS B;  3PN1 A;  1SQG A;  3O9O A;  4L87 A;  4JI8 O;  4N21 A;  2QE7 G;  5LYJ B;  1EZV H;  3K3W A;  4D6T H;  3CSX A;  2EJR A;  3K57 A;  2OIE A;  1XL6 A;  1OCC B;  3JAS B;  4MTX A;  3N27 A;  4GKK B;  1M1K W;  3RW0 A;  1YF2 A;  2PGG A;  4OX9 O;  4DV1 O;  2FTK A;  4JZG A;  3ZHR A;  2DN9 A;  4IIJ A;  4LF9 O;  5DEC A;  1NZ6 A;  3DC5 A;  4LFB O;  2K1E A;  1DGS A;  1VMG A;  4X1Y B;  2HJF C;  3K0G A;  2DW4 A;  1Y74 B;  3UM7 A;  2OIG A;  4IHJ A;  4GLX A;  2OTJ V;  2Q0O C;  4JYY A;  1URF A;  2A7W A;  1WA8 B;  1VQ8 V;  3FD9 A;  1WNS A;  4H13 B;  4U7O A;  5EZY B;  4K3A A;  4DUZ O;  3G71 V;  4YY3 B;  4WFE A;  3OMA B;  5DM6 V;  1RSO A;  1Q5O A;  5J9P C;  4DV0 O;  5DED A;  4DR4 O;  3RFR A;  4JYC A;  4UFZ A;  1FD9 A;  2X6A A;  1LUW A;  2DQ3 A;  2GDS A;  2EIJ B;  1Q82 W;  3BPZ A;  3C90 A;  2P6J A;  4JV5 O;  3H1L H;  2PI5 A;  1PNM A;  5JVD A;  4FK5 C;  2EJ7 A;  2JIZ G;  1QVF U;  2ZIN A;  2WLI B;  4WFF A;  5CMU A;  3PJS K;  2WLL B;  3SPJ A;  2EIL C;  4BWA A;  2RQ6 A;  3JAK A;  3OTF A;  3EFF K;  5LMN O;  2ODM A;  2Y4T A;  4LF7 O;  1WPB A;  2F66 C;  4TV8 B;  2YC0 A;  2X0L A;  1W2B U;  3LSQ A;  2LFR A;  2KG7 B;  1K8A W;  3LDC A;  1NH2 B;  2CE4 A;  3N2K A;  1JR9 A;  1JFF A;  1QHT A;  2QWQ B;  4FPP A;  1H2L A;  2DJV A;  4H33 A;  1GK9 A;  2XT9 A;  2N05 A;  1IBL O;  4JI7 O;  4BR6 A;  3CCV V;  2EZP A;  2CTQ A;  2Y48 A;  3ZX6 A;  2ZM6 B;  1F4N A;  2XAF A;  5EBM C;  5C8Y A;  1TUB A;  3ZRW A;  2IJJ A;  2QM7 A;  5D5Q A;  3RN4 A;  2ZR3 A;  3HKE B;  4B3T O;  1P7B A;  1XL4 A;  3GB7 C;  1I5X A;  4B7E A;  4FLV A;  1N33 B;  1SA0 B;  4I9W A;  2UXC B;  1JQ0 A;  5GON A;  5H6R A;  2DE0 X;  1OV9 A;  1NTM H;  3RBZ A;  1Q86 W;  1JCH A;  1FJG O;  2EUL A;  1L0N H;  5KHH A;  3D3Q A;  5J2U B;  3Q4H A;  2QEX V;  4XBF A;  3AEI A;  3APQ A;  4LF4 B;  3P30 A;  3D8C A;  4LR3 A;  5HFL A;  2JJ1 G;  2FML A;  4G28 B;  1DF4 A;  3ML0 A;  4WFG A;  1N8R W;  3E89 A;  4ZHQ A;  3SYP A;  2ZE7 A;  2A9H A;  1VQ7 V;  4Z2W A;  1K5Q A;  5IYC O;  3RYF B;  3CRR A;  3L75 H;  3CMA V;  2UXD O;  3SYA A;  1JA8 A;  2N04 A;  3W7T A;  1SZT A;  4PI2 A;  1R3J C;  2R9R B;  1F51 A;  1VF7 A;  5F2V O;  5B3S B;  5BMV A;  3B8M A;  1XNQ O;  2RMK B;  2FB5 A;  1YI2 V;  3ETE A;  2PYJ A;  3E8F A;  1OCO C;  4FZ1 A;  4AQY B;  3EVK A;  1I08 A;  2JGD B;  4B3M B;  4YHH O;  3STZ C;  4PA7 A;  3BEH A;  4PHZ A;  1VF5 B;  3QO8 A;  2Z5U A;  4YIO A;  1N36 O;  4LNU B;  4RAI A;  4MTG A;  3W7U A;  1MOF A;  2CDY A;  1QLN A;  1WN7 A;  1BHA A;  4UB8 Z;  2AHY A;  1P7G A;  4FZ0 A;  3CC7 V;  4FLU A;  3WB2 A;  3VBB A;  4GZR B;  1S3J A;  1UJW B;  4WCE V;  2YI8 A;  4WBN A;  2JGU A;  4TUY B;  4X9Q A;  2KSD A;  1P84 F;  4ICG A;  2YIB D;  1GN3 A;  4CH6 A;  1S77 D;  2HKO A;  4HZ3 A;  4IT5 A;  2HEP A;  2EX3 A;  5JQG B;  5K1P A;  1XBL A;  1H8E G;  2YDE A;  1V54 C;  4DR3 O;  4TWK A;  2HVK C;  3CC2 V;  3THO A;  1OCZ C;  5EYP A;  2XOK G;  2OYQ A;  2O57 A;  1TGO A;  4DUY B;  1XMO B;  3E35 A;  5B1B C;  3H9V A;  4H44 B;  2AW9 A;  2JGD A;  1IBM O;  1DLB A;  4JI0 O;  1GN4 A;  1EBO A;  4JI1 B;  4ZIB A;  3UKM A;  4QNH B;  3M7M X;  3K06 A;  3LSU A;  2PTM A;  4NXN B;  5GON B;  1KP3 A;  3ZHU A;  3LNM B;  5E1A C;  1MMM A;  1QU7 A;  3CXH F;  4B08 A;  3T2M A;  2Y69 B;  2YSU B;  5LGT A;  4OX9 B;  4U3J B;  4OPH A;  2QTS A;  5GTH Z;  4JAV A;  4LF9 B;  1M4U A;  1K3E A;  2CK3 G;  3J80 N;  2D3O W;  3FAV B;  2XAS A;  3QNE A;  4I50 A;  3GWO A;  3G80 A;  3KCY A;  2PUS A;  4FM2 A;  1GH6 A;  4KHP B;  1XNQ B;  3JSN A;  1K73 W;  1SA0 A;  1AI5 A;  1S76 D;  1NS1 A;  3K5M A;  1XHZ A;  3VQW A;  3A0B Z;  2IU0 A;  5DN6 G;  2KG7 A;  1JVM A;  1VF6 C;  1GRJ A;  4YHH B;  4ZHQ B;  4JAS A;  3ZN1 A;  5LHG A;  2QA4 V;  1OCR C;  3JAL A;  3K03 A;  3AK2 A;  4YJ2 A;  1N4C A;  4BW5 A;  2C2A A;  4FFB A;  1SQV H;  1UPG A;  1WB7 A;  3M99 B;  2Q7G A;  5B1A B;  1ZLZ A;  1YIT V;  4AI8 A;  5LP6 C;  3UO3 A;  3DSQ A;  3RYH A;  1KKC A;  4FMT A;  3BFR A;  2WWW A;  3CP1 A;  4DR1 O;  2Q68 A;  1WJZ A;  2WLM A;  2YS8 A;  4X65 B;  4WFH A;  4UCV A;  1O9H A;  2UUC O;  5ITZ B;  2HG5 C;  3CHX A;  3I5D A;  4PDR A;  2D2C B;  3CPW U;  4I0X B;  1OJH A;  4JYB A;  1FFX B;  4NR1 A;  1EZJ A;  1SQB H;  2QKS A;  3ETD A;  4RUE A;  5LL6 Y;  1YCI A;  5FNV B;  4DR1 B;  2DYS C;  3JSL A;  4PA9 A;  2ZIO A;  4O4L B;  3MDS A;  5C93 A;  1HNW B;  3CCU V;  3S3W A;  2YXL A;  3UO2 A;  3SPG A;  4JI2 B;  1HNX B;  5CA0 B;  2LQT A;  3SDL A;  1NQT A;  1H2S B;  1Y66 A;  1AJQ A;  2E5L O;  5IE9 A;  1NTK H;  3RVZ A;  3ASN B;  2JDI G;  1FXH A;  1W0J G;  2XAJ A;  4NB5 A;  2R9A A;  1Q7Y W;  2PY5 A;  4Q20 A;  1TUE B;  2YI9 A;  3OEH G;  3P3P A;  3SPI A;  1AP5 A;  3QF7 A;  4DV7 O;  3ZJZ A;  1JJO A;  2GHY A;  4A5U B;  4RO2 A;  1WA8 A;  2XTA A;  3AG2 B;  1QBZ A;  4MVQ A;  2LP7 A;  3FB5 C;  3JD1 A;  1Y74 A;  1YTF D;  1BQZ A;  1QLE B;  3BA8 A;  2QTO A;  4GT1 A;  4J7Z A;  1ARO P;  1E79 G;  3SYO A;  5CBF A;  3E8G A;  5LMU O;  3AG4 C;  4R50 A;  4DR2 B;  5EZY A;  3ABL C;  1EFR G;  2P67 A;  1G6U A;  4QPJ A;  5IYZ A;  4KUM A;  2RCV A;  2L6L A;  1SQQ H;  1PNK A;  4LF6 O;  2QKA A;  1XNR B;  3RYC B;  1KKD A;  3EHB B;  4UVC A;  1SF9 A;  2UXX A;  3SYQ A;  4G2K A;  3CCM V;  4W4L A;  1MA1 A;  2EIN C;  2KKW A;  2ZXW C;  4DR6 O;  2HFE C;  2VRZ A;  1R73 A;  4CH5 A;  2ZD9 A;  1U96 A;  2NNU A;  2W6I G;  3K59 A;  3T1Y B;  5KA6 A;  3ABU A;  4W4K A;  4O4J A;  4DK1 A;  2PZS A;  1O9G A;  4AHC A;  5KUM A;  4O4H B;  2BCC H;  2X6C A;  3CWB H;  5IWA O;  3L73 H;  1N36 B;  1R3L C;  3O65 A;  1K34 A;  2Q6A A;  2UUB B;  1CEZ A;  4CS4 A;  3IGA C;  2YEV A;  4Q6G A;  1IX9 A;  2XAH A;  4OXS A;  2CTW A;  5L3D A;  1I7F A;  1L0L H;  4JGS A;  1DTO A;  3FFQ A;  1H2M A;  1BL8 A;  1N0N A;  4IGG A;  3WB1 A;  1VF6 A;  4JI6 B;  1LNQ A;  4FIP C;  1Q6H A;  4O4L A;  2CUG A;  1HR0 O;  4LFC B;  4BIU A;  3QVN A;  2UXD B;  1SKV A;  1XMQ B;  1XI1 A;  3LDE A;  4I7Z B;  2VQE B;  1H8H G;  5LA6 A;  4GX5 A;  3T1C A;  1M56 B;  4U7N A;  3NXS A;  4TT3 G;  3ICX A;  4LCU C;  3B4S A;  4NKG B;  5AG2 A;  5H2F Z;  1SQP H;  2GTS A;  3B8N A;  2DWD C;  3K0D A;  5IDJ A;  4O2B B;  3ZHS A;  1N32 B;  1JPX A;  3JAL B;  3OUF A;  1YZB A;  3CRA A;  5LGU A;  3JAT B;  4HNA A;  2GUZ B;  1W59 A;  1KEC A;  1BHB A;  1FJG B;  2IJK A;  3E83 A;  3ZHV A;  5BZB A;  1G1X B;  2K9P A;  3U0Z A;  2M6Y A;  1MZF A;  3KKY A;  1HNW O;  2P7T C;  1M9N A;  1TVK A;  2UXB O;  4P9P A;  4JI2 O;  2ZNJ A;  4MVO A;  1EN4 A;  2QWR B;  1NR7 A;  3HPL C;  2Q0A A;  5B66 Z;  1AP6 A;  3TCU A;  2E75 B;  3ABM B;  1LUV A;  5H9C A;  3T4D A;  1L8D A;  4PDV A;  3G6B A;  2MK3 A;  3CME V;  4UV8 A;  2EIK B;  1PNL A;  3OGI B;  1JJ2 U;  4FLW A;  2ZDI A;  5HFM A;  4LFB B;  2BSK A;  1K33 A;  4FM1 A;  1WB8 A;  1FYJ A;  2XHB A;  2VQF O;  3ZIA G;  4J9Z B;  5J2T B;  5IJ0 B;  4DV2 B;  1Q8I A;  3FAV A;  4B3S O;  1WLE A;  2ZE5 A;  3JD3 A;  1K4C C;  4NTX A;  2JEX A;  4R6Z A;  2F4V O;  3CCR V;  1K9M W;  2B9Z A;  2RN9 A;  1FKA O;  5KMG A;  1HP8 A;  2L35 A;  1YHQ V;  4HAM A;  3JAW A;  4LWS B;  4PD4 F;  1BE3 H;  2UUC B;  1QCE A;  4CZZ A;  1V54 B;  1Z5W A;  3ZRS A;  1VQO V;  4GYC B;  4DV3 O;  3G6E V;  4P2Z A;  4LH7 A;  2VQE O;  1IZ3 A;  3CCL V;  4MVR A;  5IY5 B;  1AJN A;  4X1Y A;  1YJ9 V;  1MSD A;  3WG7 C;  4X66 B;  3OTO O;  2WSS G;  2JS3 A;  4UCO A;  5L3G A;  3WG7 B;  2HJD A;  4U3J A;  1N32 O;  3P3N A;  4TQD A;  1H2N A;  1OCO B;  2IU3 A;  2Y69 C;  3CCJ V;  4MSW C;  3A0R A;  3STL C;  4CBC A;  4K35 A;  5H5N A;  5IYZ B;  4X66 O;  4F6R A;  3OD4 A;  1VQP V;  2UXC O;  4EKW A;  4JTC B;  5CB4 A;  4PDM A;  4JI6 O;  3CRQ A;  3OEE G;  5LOV A;  1GTO A;  1YEW A;  2XUM A;  2AXT Z;  4JAA A;  1FFT B;  5JCO A;  4E4E A;  3CCQ V;  2UXB B;  5EIB C;  3NR7 A;  5IYD O;  4I9Q A;  5LGN A;  2CAZ C;  3RYF A;  2IJH A;  4ZOL B;  1AI6 A;  2PI4 A;  4GKK O;  1VQM V;  2AZ2 A;  3T1H B;  3K08 A;  2LJ2 A;  2Q7E A;  3E86 A;  4O4I B;  2ARH A;  4E2L A;  3P32 A;  1OCC C;  2UUA O;  5A9G A;  1YJW V;  4DR5 B;  3A8T A;  2F23 A;  3JYC A;  5JJN B;  5LXT B;  4CS3 A;  1VQK V;  2MW2 B;  5B1A C;  1EM1 A;  3RT3 C;  4DR7 O;  4B3R B;  3BA9 A;  3HB3 B;  1IBK O;  5CA0 A;  2M7W A;  4DR6 B;  3L71 H;  4ZI7 B;  1ZWI C;  3JD2 A;  3AG7 A;  1H2G A;  3VOU A;  2UU9 B;  1YDX A;  1XMO O;  1Y67 A;  2WA4 A;  3HKE A;  1FXV A;  2Y0P A;  3LSS A;  1MZE A;  1XOU A;  3SPC A;  1VQ9 V;  4H37 A;  1K97 A;  4UXN A;  5J2T A;  1BT8 A;  3FYI B;  4JI4 B;  3APO A;  2LFS A;  4X1I A;  2PF4 E;  1KP2 A;  5ITZ A;  2QWP B;  3SPH A;  4Z1M G;  1R6N A;  3X2Q B;  1KUQ A;  3QG5 A;  1B04 A;  4XDJ A;  3MAQ A;  4O2A A;  2CTP A;  4B3S B;  4X64 B;  3D36 A;  3SJA C;  2GUZ A;  4R8C A;  4D7T A;  4BW9 A;  1Q3E A;  4OGQ B;  3OE7 G;  1HR0 B;  4JI4 O;  1IVS A;  3K04 A;  2IM9 A;  4GX0 A;  4FFB B;  3ASN C;  1V9P A;  1GM8 A;  3H1H H;  4LFA B;  1SQX H;  1F7Y A;  2WLK A;  1JFF B;  1RFY A;  1X4T A;  2VWK A;  4JYA O;  5KHI A;  1IBL B;  4DRX B;  4JI7 B;  1XUQ A;  1M90 W;  4TV8 A;  5JH7 A;  1IBM B;  4GX1 A;  3C3S A;  2DWE C;  3K5O A;  3AG2 C;  5KHJ A;  3BHP A;  2JS5 A;  3JAK B;  4EFB A;  3JAM N;  1J95 A;  4EEQ A;  4I55 A;  4LF7 B;  1U97 A;  2WA3 A;  5LP6 B;  1Q81 W;  2EIM C;  2OCC B;  3B09 A;  5B1N A;  1JX9 A;  2QDO A;  3KZI Z;  5C8Y B;  4N23 A;  2Q73 A;  3UQ8 A;  1QR9 A;  4DW0 A;  1KB9 F;  1BCC H;  1R3I C;  2Q5Z A;  4MTO A;  3ZS8 C;  1F4M A;  1NT2 B;  2E76 B;  2JEU A;  2P5O A;  4YIP A;  3ASO C;  3ABK B;  5LMU B;  1ZL8 B;  2FL4 A;  2ZM6 O;  1QNM A;  3W7X A;  2QR4 A;  2ZXW B;  4JAU A;  5L3E A;  3ZMT A;  3SJB C;  4QGP A;  3ZRX A;  5EC2 C;  4NTW A;  5CB4 B;  3FYE B;  1S5H C;  1YIJ V;  3JAR A;  5KA5 A;  2V7Q G;  2H8P C;  3IFX A;  1V55 C;  4PA6 A;  1N33 O;  4TV9 B;  4PEL A;  4C7U A;  1WP7 A;  3OUS A;  3ZCC A;  2RNB A;  4Z1V A;  3TET A;  3L72 H;  4ZI7 A;  2P90 A;  1OZ0 A;  3CCS V;  1I94 O;  4YJ3 A;  4DV6 B;  3CJH B;  2ETN A;  3IC9 A;  4GUN A;  1PL0 A;  1IXM A;  3GWK C;  4I4T A;  4X88 A;  4DYL A;  5LBQ A;  3W7S A;  1EN6 A;  4UCU A;  1M57 C;  1ROP A;  3LUT B;  4TUY A;  1RM1 B;  4MS2 A;  2CH7 A;  3QTC A;  1M57 B;  3ABM C;  1PKX A;  4K0K O;  2B5U A;  3ABT A;  5B3S C;  3SJC C;  2AZ0 A;  4UB6 Z;  1UFI A;  5B5E Z;  4MW3 A;  2VWJ A;  3U11 A;  1A32 A;  4XDL A;  3OM3 B;  2IH3 C;  1H2K A;  2ZE8 A;  2BOB C;  5BR8 B;  4JI5 B;  1XIL A;  3QO7 A;  2IW5 A;  1K5S A;  4FFK A;  2P22 C;  1VQN V;  3ZED A;  4EB6 A;  1H38 A;  4DV4 B;  5KX5 B;  4JI8 B;  4TV9 A;  4U3F H;  4LH6 A;  4TQF A;  2OTL V;  1BGY H;  3HKD A;  2GBO A;  1K7D A;  3L74 H;  2QM8 A;  3F7V C;  1YVW A;  2EIL B;  3OW2 U;  4JI5 O;  2DYR B;  4TSF G;  3LDD A;  3CD6 V;  4JI0 B;  4FJC C;  5E79 Z;  1OCZ B;  1VQ6 V;  1KYO F;  4H0L B;  2QM4 A;  3CB2 A;  4FVM A;  2DYR C;  4B3T B;  4K8X A;  1TA8 A;  1AJP A;  2PYL A;  3VQX A;  3TGU H;  3CYO A;  1HWY A;  1Q6I A;  3SYC A;  3H1J H;  4JPR A;  3UT5 A;  3Q4H B;  4QE9 A;  1DF5 A;  4DXW A;  2Z0A A;  3JCU Z;  3HKB B;  2XND G;  1IXB A;  2QWN B;  1PV0 A;  3E22 B;  4YJ2 B;  1FXK B;  3N2G B;  3R65 A;  2ADP A;  5KMG B;  3K9A A;  1CPY A;  4DV0 B;  4FLX A;  5EIB D;  3DXR A;  3ABK C;  1S72 V;  4DV2 O;  2A3Q A;  3L9D A;  3N2G A;  4JI1 O;  2ZE6 A;  4O2B A;  2HVJ C;  4CS2 A;  5TIS Z;  3CS5 A;  4JV5 B;  2QSA A;  3IC7 A;  2WAM A;  5LHI A;  5L3B A;  5IJ0 A;  1TVK B;  4WFB V;  4LF5 B;  3VQV A;  4EFE A;  1VP7 A;  4X62 O;  5BY1 A;  1Y76 A;  1SET A;  5B1O A;  1BZK A;  4MTF A;  1XNR O;  3DXR B;  4MT8 A;  4ASU G;  3R66 A;  3L70 H;  1NBM G;  2RDC A;  3SGI A;  4JF3 A;  5FL7 G;  2G38 A;  1J5E O;  3BY6 A;  4B3M O;  2CTR A;  1S5L Z;  1VIB A;  3HKC A;  2OWO A;  2F95 B;  5BR8 O;  5BXZ A;  3CCE V;  3HKB A;  4TOI A;  1RM1 C;  4DV6 O;  1AR4 A;  3I55 V;  1IDS A;  5EC1 C;  1Q6U A;  2B1I A;  4IYI A;  3BVO A;  1GM7 A;  4JI3 B;  2JK5 C;  4HNA B;  4RUF A;  4QJF B;  2P4K A;  2WLL A;  2ATK C;  1MAB G;  5CA1 B;  1DK1 A;  3CE2 A;  2X7R B;  1XEQ A;  3ASO B;  5KX5 A;  1PP9 H;  1XMQ O;  3UCS C;  3ZMV A;  3AK1 A;  1GMG A;  1BMF G;  1G8M A;  2GSM B;  3HR0 A;  3FB8 C;  4I4T B;  4NTY A;  3T4Z A;  1FAF A;  4I5S A;  3JD0 A;  4ZOL A;  4DV5 B;  3H1I H;  4QPK A;  3AK3 A;  1COW G;  3K5L A;  1CP9 A;  4GCZ A;  4G27 B;  1XRE A;  5IWA B;  1ZX3 A;  2AGA A;  4RQE A;  4CC6 A;  4KFM A;  2WLH A;  1XDC A;  4F4L A;  3CX5 F;  3OT7 A;  1W0K G;  4B3R O;  4EB6 B;  2A79 B;  2NN4 A;  3RWR D;  4NVP A;  1QR8 A;  4O4H A;  3OAA G;  3JAR B;  2Z3Y A;  1Z5V A;  1ZSP A;  4LNU A;  4YJ3 B;  4O4J B;  1NVP D;  2DMX A;  1N34 O;  5L3C A;  1VQ5 V;  1ZTE A;  1FXK C;  4KXR A;  2Q8V A;  2ZDI C;  3ETG A;  3BAA A;  1XQ8 A;  2F43 G;  3OR6 C;  3JAS A;  4RWU A;  4NXM B;  1KQS U;  1IBK B;  3ABL B;  1X59 A;  1AIL A;  2EIM B;  2OCC C;  4UUJ C;  5JJJ B;  1SRY A;  4X8A A;  5EBL C;  3E2E A;  2ZNI A;  2QWO B;  1MG1 A;  4UCT A;  2CH7 B;  1N34 B;  1QQC A;  1NH2 D;  4I55 B;  1AB3 A;  5J2U A;  4UCR A;  5IYB O;  1M93 A;  4K0K B;  4NXM O;  3AG3 B;  3F5W C;  4J9Y B;  4FLZ A;  2UUB O;  3A0H Z;  3AG3 C;  3E8B A;  4X89 A;  1Y6X A;  2XAQ A;  1Y4M A;  1VQ4 V;  2H94 A;  4KP4 A;  3K5N A;  3ZMZ A;  4D7S A;  3AG1 C;  2WLN A;  5KAI Z;  1HNZ O;  2JVD A;  2LW7 A;  2BTO A;  4PV1 B;  3FX7 A;  2F1M A;  4HYO A;  3ZN0 A;  3BCC H;  4OPA A;  3T1Y O;  3MHH C;  1JOY A;  4DV4 O;  1PPJ H;  4JZ2 A;  2DQ0 A;  2LGW A;  1CXZ B;  4DO2 A;  3K9S A;  2Q7H A;  4I0X A;  2BSK B;  3OGC C;  4ABM A;  4LF8 O;  3B2E E;  3K79 A;  1MNG A;  5GW7 A;  2CGO A;  1I94 B;  2BOC C;  3FB7 C;  2IBZ H;  3N2K B;  4WFA V;  2YIC A;  5LHH A;  4X1I B;  5KHG A;  5FNV A;  5JH7 B;  2UU9 O;  3RYH B;  4DR4 B;  1LR1 A;  1RP3 B;  4MVZ A;  3S3X A;  1TAE A;  1RPO A;  4FLT A;  4X65 O;  3CRM A;  5LP6 A;  2JJ2 G;  2WLI A;  1PM9 A;  3GVM A;  2QJ1 A;  4J10 A;  4MVM A;  3E8H A;  4F6E A;  1N0J A;  3CRC A;  4LC1 A;  1AR1 B;  2YXY A;  1AVM A;  3IJ4 A;  1AR5 A;  4DV7 B;  1FXK A;  2HHH O;  4P9O A;  2KB1 A;  3WB0 A;  3QO5 A;  4DRX A;  3CEI A;  3D36 C;  2ZR2 A;  3J81 N;  5KAF Z;  4X64 O;  4IL6 Z;  4FLY A;  4QIW F;  1ENV A;  2Y0I A;  2P06 A;  4AIL C;  2P4V A;  4JTA B;  4MVU A;  3TXQ A;  3T1H O;  5FPO A;  3ZMU A;  4ZKI A; 
#chains in the Genus database with same CATH homology
 1W2B U;  3LSQ A;  2LFR A;  2Q6A A;  3OMN B;  1K8A W;  3LDC A;  1NH2 B;  1CEZ A;  3CC4 V;  3IGA C;  4FPP A;  2YEV A;  1PL0 A;  2XAH A;  1IXM A;  1E1Q G;  4OXS A;  4PA4 A;  4X88 A;  4H33 A;  5LBQ A;  1GK9 A;  3W7S A;  5L3D A;  1M57 C;  3CCV V;  1ROP A;  2EZP A;  2Y48 A;  3LUT B;  4JGS A;  2EIK C;  1DTO A;  1F4N A;  2XAF A;  4MS2 A;  4MVS A;  5EBM C;  1BL8 A;  1RM1 B;  3ZRW A;  2IJJ A;  1R3L C;  3W7W A;  1LNQ A;  4FIP C;  1M57 B;  2QM7 A;  2XAG A;  3ABM C;  1PKX A;  2ZR3 A;  4BIU A;  2B5U A;  3ABT A;  5B3S C;  3FKS G;  3LDE A;  1E1R G;  5CA3 A;  2ITC C;  1P7B A;  3OFN G;  1H8H G;  4MW3 A;  1XL4 A;  3GB7 C;  4GX5 A;  1I5X A;  2YEV B;  2WPD G;  3KG2 A;  1GM9 A;  3T1C A;  1M56 B;  4U7N A;  3NXS A;  4TT3 G;  4LCU C;  4XDL A;  3AG4 B;  3OM3 B;  4I9W A;  2IH3 C;  1R3K C;  1JQ0 A;  3B8N A;  2DWD C;  2X6B A;  3K0D A;  5IDJ A;  1NJI W;  4XDK A;  2BOB C;  5H6R A;  1JPX A;  1R6K A;  4ZKI A;  3OUF A;  3RBZ A;  3QO7 A;  1Q86 W;  2IW5 A;  1JCH A;  5LGU A;  1K5S A;  3MD0 A;  4UVB A;  2R9I A;  1KEC A;  1VQN V;  1H38 A;  1BHB A;  2IJK A;  2QEX V;  4XBF A;  3AEI A;  4GX2 A;  3E83 A;  3P30 A;  2OTL V;  5HFL A;  2JJ1 G;  1S0V A;  1PD3 A;  5BZB A;  1K7D A;  1G4Y B;  1MSW D;  4G28 B;  1DF4 A;  2QM8 A;  3F7V C;  3ML0 A;  4WFG A;  1N8R W;  3E89 A;  2EIL B;  3SYP A;  1NVP B;  3OW2 U;  2A9H A;  2W6J G;  1KC8 W;  1VQ7 V;  2DYR B;  4TSF G;  3LDD A;  3CD6 V;  2UXN A;  4FJC C;  3AG1 B;  1OCZ B;  2P7T C;  1M9N A;  2OT5 A;  1K5Q A;  1VQ6 V;  5IYC O;  4P9P A;  2Q69 A;  3CMA V;  2ITD C;  4MVO A;  3SYA A;  2DYR C;  3W7T A;  1SZT A;  1NR7 A;  2B1G A;  2HLD G;  3HPL C;  1R3J C;  2R9R B;  3TCU A;  1F51 A;  4PDL A;  1AJP A;  3ABM B;  3CYO A;  1HWY A;  3F7Y C;  3SYC A;  5H9C A;  3T4D A;  5B3S B;  4JPR A;  4PDV A;  3B8M A;  2HR3 A;  1YI2 V;  3ETE A;  4QE9 A;  2MK3 A;  1DF5 A;  4DXW A;  3E8F A;  1OCO C;  4UV8 A;  1GO3 F;  3CME V;  2EIK B;  1PNL A;  1JJ2 U;  1M56 C;  2XND G;  2ZDI A;  5HFM A;  1K33 A;  2Q67 A;  1FXK B;  3R65 A;  3I56 V;  3ZIA G;  4J9Z B;  3K9A A;  3STZ C;  1CPY A;  4PA7 A;  3BEH A;  3ZRV A;  3ABK C;  3QO8 A;  1S72 V;  1WLE A;  2Z5U A;  3DTU B;  3JD3 A;  4RAI A;  2HVJ C;  4MTG A;  1AI4 A;  3W7U A;  3D3I A;  1MOF A;  1QLN A;  5KUK A;  1BHA A;  1K4D C;  4P30 A;  5CBG A;  1K4C C;  2AHY A;  2JEX A;  3IC7 A;  4R6Z A;  2WAM A;  5LHI A;  3CCR V;  1THZ A;  3CC7 V;  1K9M W;  5L3B A;  4LP8 A;  1NKD A;  3VBB A;  1S3J A;  1UJW B;  4WCE V;  5CN0 A;  4WFB V;  3SJQ C;  1YJN V;  1YHQ V;  4HAM A;  5B1O A;  1RPR A;  1SET A;  4MTF A;  1S77 D;  2EZO A;  4MT8 A;  3RVY A;  2HKO A;  4HZ3 A;  5EK0 A;  4ASU G;  1QCE A;  4CZZ A;  1V54 B;  3ZRS A;  1NBM G;  1VQO V;  3G6E V;  4P2Z A;  1H8E G;  1V54 C;  4BAY A;  4TWK A;  2HVK C;  4JF3 A;  3CC2 V;  1OCR B;  3FB6 C;  2A0L A;  5FL7 G;  3CCL V;  1VQL V;  4MVR A;  5IY5 B;  1AJN A;  1OCZ C;  2XOK G;  3BY6 A;  1YJ9 V;  3WG7 C;  3E35 A;  5B1B C;  2WSS G;  1B6Q A;  2NLJ C;  3MHS C;  1DLB A;  1GKF A;  5L3G A;  3WG7 B;  1EBO A;  1F23 A;  3UKM A;  4WF9 V;  3CCE V;  4QNH B;  1RM1 C;  5CBH A;  3K06 A;  3I55 V;  5EC1 C;  2ZQM A;  1OCO B;  2B1I A;  2IU3 A;  2Y69 C;  1ORQ C;  1KP3 A;  1WPX A;  3CCJ V;  4MSW C;  3LNM B;  3A0R A;  5E1A C;  1GM7 A;  1I5Y A;  4PA3 A;  3STL C;  4CBC A;  3T2M A;  2JK5 C;  2Y69 B;  2WLJ A;  2YSU B;  5LGT A;  4RUF A;  4QJF B;  1KD1 W;  3H01 A;  1VQP V;  3ZMS A;  2AHZ A;  4EKW A;  4JTC B;  2WLL A;  3ZRW B;  2ATK C;  1MAB G;  4JAV A;  2W0F C;  4PDM A;  4UV9 A;  1AI7 A;  2X7R B;  3ASO B;  3OEE G;  1L1F A;  1K3E A;  1GTO A;  4LBE C;  2CK3 G;  4UVA A;  2D3O W;  1FS0 G;  2V1D A;  2XAS A;  3QNE A;  1FFT B;  3JCZ A;  3ZMV A;  3CCQ V;  4YXW G;  1GMG A;  5IYD O;  2EIJ C;  1BMF G;  3GWO A;  1G8M A;  5LGN A;  2IH1 C;  2GSM B;  2IJH A;  3FB8 C;  3X2Q C;  1AI6 A;  2PI4 A;  3TK1 A;  1K73 W;  3T4Z A;  1VQM V;  1AI5 A;  4I5S A;  1S76 D;  3JD0 A;  3K08 A;  3E86 A;  2IU0 A;  5DN6 G;  1JVM A;  4E2L A;  3P32 A;  1OCC C;  1YTF B;  4QPK A;  1YJW V;  1COW G;  1SES A;  5B1B B;  4JAS A;  1CP9 A;  3ZN1 A;  4GCZ A;  3G4S V;  4G27 B;  5LHG A;  4ZBM A;  2QA4 V;  1OCR C;  3JYC A;  1VQK V;  4MW8 A;  2IJI A;  3K03 A;  4RQE A;  1YSC A;  5IY5 C;  1NR1 A;  4KFM A;  2WLH A;  5B1A C;  4F4L A;  3HB3 B;  4RQF A;  4JTD B;  1P4R A;  2C2A A;  4BW5 A;  1W0K G;  2M7W A;  2A79 B;  5B1A B;  3M99 B;  1QR8 A;  1ZWI C;  3JD2 A;  3OAA G;  5H6Q A;  3OR7 C;  1H2G A;  2Z3Y A;  1YIT V;  5EBW C;  3VOU A;  4BIZ A;  1NVP D;  1QLE C;  4FMT A;  5L3C A;  1VQ5 V;  2WWW A;  4R7C A;  1SER A;  1FXV A;  3CP1 A;  3LSS A;  2Q68 A;  1FXK C;  2WLM A;  2ZDI C;  1VQ9 V;  3SPC A;  3ETG A;  2F43 G;  4H37 A;  3OR6 C;  4WFH A;  1K97 A;  4UXN A;  3FYI B;  1KQS U;  2HG5 C;  4PDR A;  3ABL B;  2LFS A;  2EIM B;  2OCC C;  3JD4 A;  4UUJ C;  3CPW U;  1KP2 A;  1SRY A;  4JYB A;  2EBO A;  1K92 A;  3SPH A;  4X8A A;  3CXC U;  4Z1M G;  1R6N A;  5EBL C;  3X2Q B;  3E2E A;  1EZJ A;  2QKS A;  1MG1 A;  3ETD A;  4RUE A;  3DGE A;  2EIN B;  4XDJ A;  1NH2 D;  1QVG U;  2DYS C;  3B77 A;  3WFV A;  3OMI B;  3D36 A;  1V55 B;  4PA9 A;  1OHH G;  4QE7 A;  5L3F A;  4R8C A;  5IYB O;  5C93 A;  3OE7 G;  3CCU V;  2DYS B;  3AG3 B;  3K04 A;  4L87 A;  3SPG A;  3F5W C;  4J9Y B;  4N21 A;  4GX0 A;  2QE7 G;  3K3W A;  3ASN C;  1GM8 A;  2EJR A;  3AG3 C;  1NQT A;  3E8B A;  1Y66 A;  1AJQ A;  1XL6 A;  2WLK A;  4X89 A;  1OCC B;  4MTX A;  2XAQ A;  1M1K W;  1Y4M A;  3RVZ A;  3ASN B;  2H94 A;  3RW0 A;  1VQ4 V;  2JDI G;  4KP4 A;  1FXH A;  1W0J G;  3ZMZ A;  3AG1 C;  2WLN A;  2XAJ A;  1Q7Y W;  2FTK A;  1M90 W;  4Q20 A;  1TUE B;  4GX1 A;  4HYO A;  2DWE C;  3ZN0 A;  3OEH G;  3SPI A;  3AG2 C;  3ZJZ A;  2K1E A;  3MHH C;  1JOY A;  2GHY A;  2DQ0 A;  4RO2 A;  1J95 A;  2HJF C;  3K0G A;  4DO2 A;  2DW4 A;  3AG2 B;  1QBZ A;  4MVQ A;  2LP7 A;  3FB5 C;  3JD1 A;  3OGC C;  3UM7 A;  3K79 A;  2OTJ V;  5GW7 A;  1YTF D;  1QLE B;  2BOC C;  1Q81 W;  1VQ8 V;  2EIM C;  2OCC B;  2QTO A;  3FB7 C;  4GT1 A;  5B1N A;  4U7O A;  1JX9 A;  4WFA V;  1ARO P;  3G71 V;  4N23 A;  4WFE A;  1E79 G;  5LHH A;  3SYO A;  5CBF A;  1QR9 A;  3OMA B;  5DM6 V;  3E8G A;  1R3I C;  3AG4 C;  4MTO A;  5J9P C;  1F4M A;  2JEU A;  4MVZ A;  4R50 A;  1RPO A;  3ASO C;  3ABK B;  4JYC A;  3ABL C;  1EFR G;  2P67 A;  2X6A A;  4QPJ A;  4KUM A;  3W7X A;  2ZXW B;  2DQ3 A;  1PNK A;  4JAU A;  5L3E A;  2JJ2 G;  2WLI A;  3ZMT A;  2EIJ B;  1Q82 W;  1KKD A;  3EHB B;  4UVC A;  2UXX A;  5EC2 C;  3SYQ A;  4G2K A;  3ZRX A;  4MVM A;  3CCM V;  2ZXW C;  2EIN C;  2P6J A;  3FYE B;  3E8H A;  1S5H C;  2HFE C;  1YIJ V;  5KA5 A;  1R73 A;  4LC1 A;  2ZD9 A;  2V7Q G;  2PI5 A;  1PNM A;  2H8P C;  2NNU A;  3IFX A;  1AR1 B;  1V55 C;  4PA6 A;  4FK5 C;  2W6I G;  2JIZ G;  1QVF U;  5KA6 A;  3ABU A;  1FXK A;  4PEL A;  4P9O A;  2KB1 A;  2WLI B;  4WFF A;  5CMU A;  3OUS A;  3QO5 A;  3ZCC A;  3PJS K;  2WLL B;  3SPJ A;  2ZR2 A;  2EIL C;  5KUM A;  3EFF K;  3TET A;  2X6C A;  4QIW F;  2P90 A;  1ENV A;  1OZ0 A;  3CCS V;  4JTA B;  4MVU A;  3ZMU A;  2X0L A;  1K34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...