1MOFA

Coat protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
DLREVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECAFYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MOLONEY MURINE LEUKEMIA VIRUS P15
publication title Retrovirus envelope domain at 1.7 angstrom resolution.
pubmed doi rcsb
source organism Moloney murine leukemia virus
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mofA00
4N21A 4N23A 2EZOA 3H01A 4JGSA 5CMUA 1Y66A 1QR9A 1Y4MA 1JPXA 5KA6A 5KA5A 1ENVA 1DLBA 2M7WA 3CP1A 5CN0A 4E2LA 1EBOA 3M99B 3B8NA 4JF3A 3MHHC 4FIPC 1DF4A 2MK3A 1QBZA 5HFLA 2LP7A 1QCEA 2OT5A 1MOFA 1K34A 3B8MA 4G2KA 3WFVA 1K33A 5HFMA 3CYOA 4FK5C 3K9AA 1F23A 1MG1A 2X7RB 4FJCC 1SZTA 1DF5A 3MHSC 4JPRA 2EZPA 2EBOA 1JQ0A 3B77A 3P30A 5H9CA 1I5YA 1I5XA 1QR8A 2P6JA 3GWOA
chains in the Genus database with same CATH superfamily
1M4UA 1Q3EA 2ILMA 3BPZA 4LF9B 1VQMV 3ZMVA 3BFRA 1SRYA 1WPBA 3H1IH 1NS1A 3CYOA 4DV7B 1EFRG 2YS8A 2ZR2A 2QTOA 5LOVB 1JFFB 1YTFB 5IYDO 2H94A 2IJIA 2GDSA 3L71H 1VQNV 3LSSA 2NNUA 1EN4A 4GKKB 3FB6C 3UO2A 2EINB 1SKVA 2JRIA 5CA1A 2QWNB 2PI4A 1B3QA 3FX7A 4TUYB 2FL4A 4MT8A 3K5LA 3AEIA 3C3TA 1VMGA 3FFQA 2CTRA 2FKXA 1SA0B 4DXWA 1P84F 2UXDB 5LMNB 1NQTA 2PGGA 5J2TB 4WFEA 1PV0A 5TISZ 3D8CA 3ZBHA 4I0XB 4ZOLA 5LP6A 3H1HH 4GZRB 1HNWO 3QO7A 3CCMV 5GONB 5JJJB 4QPKA 2EIMC 2QR4A 3RT3C 4DV3B 1WAZA 3ZHUA 5L3EA 1CPYA 4BW5A 4G27B 3H9VA 4NB5A 5IWAO 3D36A 2IM9A 3SPHA 5H9CA 2RQ6A 1D5NA 4NTYA 5LYJA 1K7DA 2CGOA 4GX5A 2L35A 3N2KA 5E1AC 5B1AB 3SJQC 3F7VC 5L3GA 1XMQB 1XBLA 2EIJB 3OEEG 5K1XA 4DR4B 2CUGA 4DUYO 2JJ1G 1NZ6A 2Q6AA 3H01A 5CMUA 1VF6C 3DC6A 2UUBB 4LFCO 2X6AA 1AP5A 3B8NA 4U3JA 4DV2B 3LNNA 4ZHQB 1F7YA 4TV8A 5JQGB 2HP8A 2B5UA 4GUNA 1ZLZA 2LW7A 3K5NA 1TUBB 2DE0X 4FFKA 4O2BB 2EZOA 1VP7A 2YIBA 4H0LB 2YEVA 2LO1A 2JEUA 3FAVB 4BIOA 3D3IA 3DTUB 3VQVA 1N36O 4DR5B 1KB9F 1BT8A 2X7RB 1XDCA 4C7UA 1IBMB 2BE3A 5JCOC 4B3MB 4LF7O 2UU9O 4EFEA 2WLLB 3A0HZ 3X2QC 1M57C 3RN4A 5KLVH 3RYHB 4DW1A 3FYEB 2Z5UA 4H33A 1GK9A 1M5IA 4AI8A 2PI5A 4PA9A 1QNMA 2JVDA 1WPXA 1OCCB 1P7BA 5BXZA 3CRMA 4LNUB 1FJGO 3SYQA 3ZN0A 4YY3O 3E35A 4YHHB 1D2DA 2IU0A 4QE7A 1SQQH 2ZDIC 4I4TA 5EIBC 1H8HG 3CRRA 4JGSA 3UT5A 2XUMA 3B40A 3THOA 2XAFA 2XTAA 4F6RB 4X9QA 5L3DA 2EULA 4WFHA 2GV9A 2HHHB 2UUCB 4FJCC 1PNLA 1QVGU 1GN6A 4X1KA 3K0DA 5B66Z 2KG7A 4OX9O 5IYZA 4TSFG 2OCCC 2ZINA 3RGBA 2X6CA 4IIJA 5ITZA 2R9RB 4JTAB 4P2ZA 4Q6GA 1PNMA 4EFBA 3W7SA 1XNRO 3CRAA 1ZL8B 5JVDA 1RSOB 2XAJA 3T2MA 1U96A 2JGUA 3AG1B 3F5TA 2Q7HA 2D2CB 2JS5A 1N8RW 1PP9H 4DUZO 4JI0O 5K1PA 5DEDA 1HNZB 1WJZA 4ABMA 3G6EV 1CP9A 5LGNA 2WLIB 1WB7A 4FMTA 1N0JA 3K06A 4IHJB 3KCXA 2ZNIA 4FM1A 2P4VA 4YIPA 2HEPA 3JD0A 5H5NA 4K0KB 4RUFA 1S0VA 3L73H 3CD6V 3N2GA 2JK5C 2L6LA 4TQDA 1NVPB 3BA8A 1XREA 5CB4B 2BTOA 2ZKOA 3CXHF 3KG2A 3JD2A 3ZX6A 4KUMA 2QA4V 4IYHA 2JGDA 2CDYA 2F4VB 5LMUB 2RJZA 2GUZA 4RAIA 1PL0A 2XHBA 5BY1A 4ZI7A 4DR7B 1RPOA 2CTPA 3OFNG 1FS0G 3ABMB 3ASNC 1DK1A 4QPJA 1EZVH 1LNQA 1MG1A 1NH2B 3RFRA 3MHSC 3ZMTA 3L75H 1AVMA 4B3SO 3ABKB 1BGYH 4FVMA 4DV1O 4LF4O 5C8YA 5IT9N 3JSLA 1J5EB 3ASOC 1YF2A 2ZR3A 5KHHA 1L0LH 1SETA 2B1IA 4CC6A 4X65B 2Q0AA 4YJ3A 2IW5A 1BQZA 1ZWIC 1Q6HA 4TWKA 2ZXWB 1V9PA 2H8PC 4UCRA 1GN3A 1URFA 2UUAB 4TV9A 2ITDC 4HZ3A 3OMAB 1WNSA 4PDLA 2YIAA 2IH3C 1AB3A 2CTQA 1ZAUA 2Q7GA 5KX5A 4J9YB 3RYCA 1Y4MA 2UXCB 4H13B 2X6BA 3APQA 5B1AC 1MOFA 2F23A 4PJ0Z 4U7OA 3EVKA 5LXTB 3OTOO 1MSWD 1SZTA 3HKCB 1H2MA 4P9PA 4NXMO 4BR6A 4N23A 2Q5ZA 5B1BC 4LBEC 5EYPB 3O9OA 2WLJA 2IJJA 1YI2V 3E22A 5EBMC 1WP7A 1I7FA 2F95B 1BE3H 1K33A 1B06A 4GKJB 3OAAG 2KQXA 4MVZA 1HWYA 1M1KW 4AQYB 3AK2A 1S5LZ 2OTJV 2XAQA 3WG7C 1FAFA 1JJOA 5H6QA 4J10A 2OIGA 5KUKA 3T1HO 3HKEB 5D5QA 1VF6A 3FB7C 3VQYA 2QKAA 1YVWA 1GAXA 2DWEC 3JAKA 3JATA 4UV8A 1OV9A 3L74H 2QWPB 5IJ0A 1I5YA 1VQKV 1P4RA 4FLTA 2VQEO 3SYAA 5CA0B 4JZ2A 1Q82W 3CWBH 3ZEDA 5CN0A 1F4NA 4WFBV 4X1IA 1Y74A 2W0XA 2MK3A 2JDIG 1IBLO 2ZE8A 1AR1B 2BSKA 3ABTA 1KECA 5B5EZ 1KKDA 3BAAA 4UB8Z 4I5SA 5BZBA 3QO5A 1XNQO 1JA8A 3TGUH 4PD4F 1W2BU 1ROPA 2W6JG 4J7ZA 4EEQA 5JCOA 5KA5A 1YITV 2V1DA 3APOA 3RYIA 2Y48A 1AI4A 3RYFB 3TXQA 1K34A 4FFBB 2LFRA 2PTMA 4EB6B 5KAFZ 3W7WA 5GW7A 3ZS8C 1J95A 2EILB 2OIEA 3U11A 1YTFD 1R1BA 1WA8A 2ZDIA 3M99B 3OR7C 4PA3A 1XQ8A 1MZEA 2JIZG 3WFVA 2RCVA 3VOUA 4JAUA 3F5WC 4L87A 3EXAA 1HNWB 4LWSB 4FM2A 5BMVA 1S5JA 4LP8A 3R65A 1AROP 3CC4V 4UVBA 1BS3A 3B8MA 1TVKA 4BW9A 1OCRB 2Z3YA 5EBWC 1FFXA 2CAZC 5LA6A 1I5XA 2AHYA 1PL4A 3U10A 4WBNA 2N05A 1EN5A 1DLBA 2ZE6A 4LC1A 4CBCA 3M7MX 3CMAV 2YIDA 1R3LC 5IYCO 2ZD9A 4X66O 4WFGA 3JCZA 3ABLB 4B3TO 2EJ7A 4DUYB 1ORQC 2KB1A 4D7SA 3SPJA 1X4TA 1ZUQA 3JASA 4PDVA 1K4CC 4LFCB 5L3BA 3FD9A 3LSUA 1P49A 2DYSC 2WSSG 3E86A 4IT5A 2Z0AA 3H1LH 2P06A 4JYYA 3CCUV 4QNHB 2A0LA 3SDLA 2K1EA 1G1XB 3J81N 5EC1C 1N34O 2OYQA 1QLEC 3UCSC 4WFAV 2PYLA 4NTXA 1GMGA 5CA3A 3MD0A 1DTOA 3K0GA 1L1FA 1N36B 4B3RO 4NXNO 3FB5C 3JSNA 2O57A 4DV0O 3BY6A 2LW1A 2WLMA 5J2TA 3JAMN 2UU9B 4LF7B 1N32O 3SGIA 4H44B 2BTQA 2G38A 3OMIB 1JPXA 1YJWV 1Y6XA 4U7NA 1IZ3A 4HYOA 1B6QA 4ZIBA 3MHHC 4ZOLB 5LP6B 1VQ9V 3CHXA 1FJGB 4W4KA 1GRJA 3HKBA 3AG4B 4YY3B 3VBBA 1N4CA 3JAWA 3CRQA 1THZA 1GM9A 1SESA 1SQPH 4RQFA 5B3SB 3CCSV 2E76B 1Y76A 3A2FA 3I55V 1HNXO 1MSDA 2IJHA 1H2NA 1OJHA 1V55C 3WB0A 4DR6O 1RP3B 1NR1A 3DSQA 4X89A 3VQWA 1E79G 1K9MW 3OTFA 4OX9B 5LYJB 3B77A 3RVYA 5HFLA 2EIKC 3BCCH 4LF9O 4K35A 3N2KB 1LUVA 1RPRA 5IJ9A 1XNRB 1KMIZ 1MZFA 2QSAA 4UCSA 2QGNA 3CJHB 1OCZC 1NTKH 2GSMB 3L70H 3ZHTA 1H2LA 3CCQV 1YIJV 2ADQB 4LF5O 4UB6Z 2ZE7A 1Q8IA 5BR8O 1COWG 1BZKA 5CBGA 4DUZB 4X62O 1HW7A 2CE4A 4U3JB 3OT7A 1IXMA 3HB3B 3K3WA 3OEHG 4TV8B 4JI0B 2Q0OC 3CCRV 4IGGA 2DYRB 4O2AA 3G4SV 4X88A 4O2BA 2DOSA 4JI8O 1QBZA 2YUAA 3RW0A 1DGSA 4O4LA 4MTGA 1VQ4V 1VF5B 1WLEA 1MABG 2P5OA 2F66C 3DXRB 2WLLA 3CPWU 1SQBH 4LF8O 2GTAA 3Q4HA 4F6EA 3RYHA 3UM7A 3AG3C 4WCEV 1FXVA 3CEIA 4JTCB 3IFXA 4GT1A 4I50A 4CS3A 5JWPA 1R3IC 3ETQA 2EILC 4OPHA 3S3WA 2XT9A 4K8ZA 4DR1O 2DMXA 4B08A 4NYKA 1YEWA 4O4JB 5FL7G 4JI1O 1Q5OA 4I4TB 4UCTA 3A8TA 4CZZA 4ZKIA 1V54B 1I08A 2JEXA 1YHQV 1NVPD 3UT5B 4KHPO 4B3SB 4DV1B 4LF4B 3G80A 5JH7A 1H2SB 3ZJZA 2ZNJA 4J7JA 2DW4A 4UCVA 4RQEA 2XASA 4XBFA 2AXTZ 3PN1A 2W0FC 1SQGA 2AZ0A 4GCZA 1CEZA 1PNKA 3AG2B 1HDJA 4UVAA 3FB8C 2A7WA 2KG7B 2WWWA 3SPGA 4PA4A 4RWUA 1ZX3A 3K03A 4MW3A 2UXXA 4X8AA 1KD1W 1FPOA 3CCEV 2WAMA 2PUSA 1GH6A 1SQVH 2RDCA 5ITZB 1TGOA 4KFMA 4I7ZB 1NH2D 5JVDB 4BWAA 3J80N 2HJDA 1I94O 2ZT9B 4HBNA 4X64O 3DGEA 5FLXN 4B7KA 5CBHA 3HKDA 4JYAO 5EC2C 2CH7A 4JF3A 5J9PC 4DV6O 1AI7A 2HVJC 3E83A 1UPGA 4DV2O 3EHBB 3ZMSA 4BAYA 3OTOB 2ODMA 3ABLC 1B04A 1KU9A 4NXMB 4LFAO 4ICGA 1N33O 2WLIA 4I55A 5F2VO 3CMEV 1SS3A 4UVCA 4EKWA 2EINC 3CRCA 3TXSA 2V4DA 1RM1B 3K79A 3MDSA 5AG2A 3ZRVA 1XMOO 2DQ3A 4BIUA 4DRXB 4Q20A 4R7CA 1H38A 3JALB 5CB4A 2EZPA 4B7EA 2AW9A 4LH7A 4DV5O 3KKYA 3T1HB 5IY5B 1M90W 1WB8A 2JGDB 2QWRB 3P3NA 1Y67A 1FFTB 1YXBA 3L9DA 5LGUA 3OM3B 2WPDG 4ZI7B 1VQLV 4MSWC 1WN7A 4E4EA 2QEXV 1X59A 4IL6Z 2RMKB 1IVSA 1UJWB 2VQFO 1IBLB 4I9WA 3HR0A 1SF9A 1VQOV 4ASUG 4O4IA 1BL8A 3CX5F 4JAAA 5C8YB 2EX3A 2QWQB 1JCHA 3UKMA 3ZIAG 5JJNB 3ZCCA 4CC5A 1XNQB 3BA9A 4NTWA 1VQ5V 4DR2O 3ZMUA 1OHHG 3ZHVA 1EBOA 2Q4PA 3P32A 4MTXA 2Q67A 1LUWA 5LBQA 1KC8W 3SYPA 3JARA 1IX9A 4L8JA 5KMGA 1HP8A 1L8DA 5A9GA 1G6UA 4JTDB 2R70A 5KX5B 2EIJC 2YXHA 1IXBA 3RYCB 1H8EG 3K57A 5FNVA 5DECA 3OD4A 2ZM6O 3QF7A 3AG7A 4R6ZA 4PELA 5EZYB 5LL6Y 2QKCA 1VIBA 2EIMB 1MNGA 4OGQB 1XOUA 1NJIW 2R72A 1M56B 1AI6A 3OMNB 4ZBMA 3IJ4A 2XAHA 1VF7A 1VQPV 3QVNA 4O4HB 3E22B 1FXKB 1O9GA 4JYBA 1K97A 2F93B 4JZGA 2EJRA 4YJ2A 4DK0A 1FD9A 4G2KA 4TOIA 2E5LO 3K9AA 3HKEA 1GN4A 2XOKG 2JS3A 3B4SA 3AK3A 4OPAA 4XDKA 4HAMA 5L3FA 5KA6A 1QQCA 4TT3G 1OCOB 1OCCC 1FKAO 1PPJH 4JI6O 4DYLA 1GTOA 4X66B 4FLWA 2DJVA 1E1RG 2IU3A 3OUFA 4B3TB 3ZHRA 1NBMG 5H6RA 1VQ6V 1S77D 1Y74B 1K3EA 3K5OA 2PYJA 2B9ZA 3K58A 2BSKB 4DV4O 1JX9A 2QM7A 2QDOA 5LGTA 4JV5O 4JI2O 3ZN1A 1EN6A 4X1YB 1V54C 3G71V 4DR3O 3SPIA 4PDRA 3WU2Z 2AZ2A 3E8HA 1IURA 4HNAA 1BHAA 2EBOA 4FFBA 4K8XA 4IYIA 3RYIB 4PI2A 4XDLA 3X2QB 1N34B 1M57B 1IBKO 2HLDG 1W0JG 2FYUH 1BMFG 4GX0A 1Q7YW 1RFYA 3ZRWB 4WFFA 4B3RB 1R6TA 3AG1C 4MVMA 4NXNB 2Y4UA 1L0NH 1Z5VA 4DV0B 1EZJA 3LSQA 1YSCA 5J2UA 1M93A 3HPLC 1K5QA 2MW2B 1F23A 3GWKC 1N32B 5KHKA 4FZ0A 2IBZH 1R6NA 4JASA 5IE9A 4MTFA 5FPOA 4P30A 1KKCA 1HR0O 3A0BZ 4LF6O 2R9AA 2ITCC 3CP1A 4GLXA 1IDSA 2OCHA 2WLHA 5HFMA 4X20A 1LR1A 4D7TA 4LR3A 4LFBO 4MVRA 1A32A 5IWAB 3F7YC 5EBLC 3NXSA 4J11A 5KHIA 5BMVB 3C3SA 2BCCH 4JI4O 1WP8A 3CB2A 3U0ZA 2AHZA 4QIWF 4UCUA 2BOCC 4GX1A 1HNXB 1TVKB 1PD3A 4DK1A 1NTMH 4TQFA 1FFXB 1SERA 4PA7A 2PY5A 1AP6A 1Z5WA 4DR6B 1Z2GA 3CC2V 4WBNB 4I9QA 2B1GA 2UXBO 4JPRA 3I56V 2FB5A 3P30A 2Q9LA 1NI8A 3R66A 1NKDA 5LOVA 3MAQA 3G67A 1JFFA 4CH5A 5IY5C 3W7TA 1XEQA 4R50A 2DN9A 3QG5A 2OTLV 4LF5B 3ABMC 5BR8B 3EFFK 4JI7O 2UXNA 2NLJC 3JASB 2QTSA 2Y0IA 3T1YO 4X62B 3ABKC 4YXWG 2YICA 4N21A 4KP4A 4TUYA 4JI5O 5CA1B 2ARHA 1AJPA 2FMLA 4JI8B 3M8AA 3DC5A 2P67A 3BEHA 2ZXWC 3JD3A 1GM8A 1Q90D 4NR1A 5EK0A 1SA0A 2ZIOA 3RVZA 2HR3A 1O9HA 3STZC 2LQTA 2BOBC 3CXCU 5B1NA 4YIOA 1QR8A 4QGPA 2QJ1A 3BVOA 4I0XA 4LF8B 3O65A 4J7KA 4QE9A 4E2LA 1SQXH 1PM9A 4JI3O 4FIPC 2N04A 4OXSA 2BTQB 5GONA 1VARA 3ASNB 5LHIA 5E79Z 4PHZA 1YJ9V 2P90A 3IC7A 2ADPA 3LDEA 2YIBD 1S76D 3OGCC 4DR1B 3ASOB 2GTSA 1R3JC 2HG5C 2Q69A 2LFSA 1CXZB 3HKBB 1DF4A 4F4LA 3JAWB 2XNDG 4JI1B 1YZBA 5C93A 1M56C 3CS5A 3WB1A 3A0RA 1K5SA 1XL4A 2LGQA 2XAGA 1Q86W 2W6IG 4KHPB 1Y76B 3P3PA 4CH4A 1FXKC 2QE7G 2A9HA 2WLKA 2ZCEA 3TJTA 1E1QG 3D3QA 2Q7EA 2HKOA 2Q68A 1XILA 3JD4A 3JYCA 3RBZA 2A06H 2OT5A 3CJHA 1QLNA 1K92A 4DV7O 4GYCB 5IJ9B 3H1KH 4ZHQA 3CCJV 4J80A 1H2KA 5JQGA 1I94B 3NR7A 4UUJC 5B1BB 4X64B 1QR9A 1XI1A 5GTIZ 2HVKC 3ETDA 4FLZA 4JYAB 4GKKO 1OCOC 1MA1A 3SJCC 1TUBA 4DV6B 1XHXA 2E74B 4RUEA 2IH1C 3JD1A 4MVUA 3GVMA 3OGIB 3FAVA 5JJEB 1Q6IA 1U97A 1F4MA 4O2AB 2YEVB 3ZRXA 4LFAB 1K4DC 1N33B 3W7UA 4W4LA 1JR9A 3WG7B 1XHZA 3G6BA 2LJ2A 4O4LB 4Z2WA 2QWOB 1P7GA 2YSUB 4H37A 3DXRA 2UXDO 5LMNO 5H2FZ 5B1OA 1XMOB 2YI8A 4PV1B 4DO2A 3T4DA 3K08A 1UFIA 3Q4HB 4LNUA 3H1JH 1GM7A 4UFZA 3LNMB 4DV5B 2GBOA 3AK1A 3OUSA 4I50B 4BIZA 1KQSU 4DV3O 3N27A 3E89A 4O4JA 3OW2U 1AJNA 3OE7G 1M9NA 3OR6C 4F6RA 2DWDC 1JQ0A 1JVMA 2A3QA 2YXYA 4JAVA 4G28B 1YCIA 3BHPA 1PKXA 1H2GA 1KBHA 5KHJA 4MVQA 4NVPA 2VQFB 3W7XA 1N0NA 1AR5A 4X1KB 3RWRD 3ICXA 5JH7B 1OCRC 3T4ZA 3TCUA 3LUTB 5IYZB 1ZL8A 1RSOA 1XMQO 1KYOF 1S3JA 2P4KA 2NN4A 4IIJB 4DR2B 4DR4O 3UO3A 4A5UB 5IYBO 1SQFA 3SYCA 1KP2A 2UUBO 3TETA 1AJQA 3ZMZA 1AI5A 1JJ2U 1BHBA 5KUMA 3K5MA 1QHTA 2Y69B 3T1CA 3SYOA 3E8GA 4FM0A 4FZ1A 4GX2A 1BQ0A 2ZM6B 3HKDB 3S3XA 2CH7B 2P6JA 3GWOA 4WF9V 2N74A 3CE2A 1TAEA 3K04A 4IHJA 1QU7A 4KL1A 2VWKA 3SPCA 2R9IA 1NT2B 2CK3G 2E75B 3SR2C 4RO2A 4DR5O 4LCUC 4I55B 3GB7C 1IBMO 1SZXA 4B3MO 4DRXA 3N2GB 3E8FA 3JALA 2VWJA 1OZ0A 2HFEC 3ABUA 3B09A 3ZHSA 2PF4E 1FXHA 1F51A 2YI9A 2E5LB 2D3OW 5FPRA 2IJKA 2WA4A 2KKWA 2GUZB 4YHHO 4MTOA 2WA3A 3ETEA 3LDCA 2VQEB 3KCYA 1VQ7V 5A2QN 1NTZH 1KUQA 3CCVV 2DYSB 4JI6B 5LP6C 1T5EA 3VQXA 3BRCA 3AG4C 1I0HA 1MMMA 2PZSA 1VQ8V 3JCUZ 2HHHO 2UUCO 3E2EA 1XUQA 3K59A 1Q81W 5B3SC 3B2EE 4U3FH 1EM1A 4YJ3B 1AILA 4FPPA 1Y66A 1NR7A 4DV4B 1GKFA 1QLEB 3CSXA 4O4IB 2KSDA 3D36C 2RN9A 4MVOA 4JI2B 4JV5B 4TV9B 4DR3B 2P22C 1G4YB 4UCOA 4Z1MG 1TUEB 4CS2A 3QTCA 2GHYA 2H3OA 4J9ZB 4PDMA 1IBKB 5LXTA 1YDXA 4R8CA 3HKCA 3JARB 5KMGB 1GO3F 4UV9A 2HJFC 5DM6V 4AILC 2FTKA 5EYPA 5EZYA 5FNVB 3ZRSA 1HNZO 5GTHZ 2QM4A 2ZE5A 4QJFB 3IC9A 1S72V 1VEWA 3IAYA 5D5PA 5L3CA 4CH6A 4K3AA 1FYJA 5CBFA 2WLNA 1HR0B 2ETNA 4LF6B 2DYRC 2K9PA 1ENVA 4K0KO 2DQ0A 3UQ8A 4JYCA 4O4HA 3STLC 1FXKA 1V55B 2X0LA 4LFBB 3IGAC 2CTWA 3TK1A 4MVSA 4JI4B 4LH6A 2Q73A 2EIKB 2C2AA 5KAIZ 3L72H 1K73W 4YJ2B 2ZQMA 5KHGA 4PA6A 3C90A 3QNEA 2F4VO 1SC5B 4DW0A 5LMUO 5EIBD 1JMKC 3KZIZ 4MS2A 2JJ2G 1OCZB 1XL6A 4DR7O 5CA0A 2V7QG 2Y0PA 3JAKB 2CGNA 3JATB 4D6TH 5IDJA 5IJ0B 3E8BA 1R3KC 4AHCA 1YJNV 2UXBB 4Z1VA 1W59A 1S5HC 3LDDA 1ZTEA 4X1IB 1Q6UA 1J5EO 4X65O 2LP7A 4JI7B 1QVFU 2QM8A 3T1YB 1GN2A 2UUAO 3RYFA 4X1YA 2RNBA 5LHGA 2YXLA 4FLYA 4NKGB 2A79B 1D5AA 4JI5B 2YC0A 3PJSK 4EB6A 3CCLV 2Q8VA 4KXRA 4UXNA 2Y4TA 2UXCO 3AG2C 4HNAB 4J41A 3BABA 1JOYA 1US6A 2YDEA 3AG3B 1Q43A 2LGWA 3FYIB 4FK5C 2OWOA 3ZRWA 3FKSG 2NR5A 4FLXA 3I5DA 1AR4A 2AGAA 1TA8A 3QO8A 1KP3A 1WA8B 4CH3A 1W0KG 1BSMA 4FLUA 5J2UB 4J42A 4JI3B 4FLVA 4LWSA 3K9SA 2VS0A 3SJBC 2Y69C 3ZHQA 1QCEA 2F1MA 2ATKC 2M6YA 4MW8A 1ZSPA 3J7AU 4GKJO 1DF5A 5DN6G 1BCCH 2F43G 1K8AW 3SJAC 4PI0A 5LHHA 4AQYO 2OCCB 1R6KA 4X20B 2ZIMA 3WB2A 2M7WA 1R73A 1G8MA 4XDJA 4P9OA 2VRZA 1RM1C 5LA6B 4CS4A 2E3CA 2P7TC 3ETGA 2QKSA 3CC7V 1NU1H 3ML0A
chains in the Genus database with same CATH topology
2OTJV 2WLIA 2XAQA 4UUJC 5B1BB 3CMEV 3WG7C 4UVCA 1QR9A 1VQMV 3ZMVA 4EKWA 2HVKC 3ETDA 2EINC 1OCOC 5H6QA 1SRYA 5KUKA 4RUEA 1RM1B 3K79A 2IH1C 3JD1A 3FB7C 4MVUA 3CYOA 3ZRVA 1EFRG 2DQ3A 4BIUA 4Q20A 4R7CA 2ZR2A 2DWEC 2QTOA 1H38A 1F4MA 1YTFB 2YEVB 4UV8A 3ZRXA 2H94A 1K4DC 2IJIA 5IYDO 1I5YA 2EZPA 3W7UA 1VQKV 1P4RA 3LSSA 1VQNV 3SYAA 2NNUA 3WG7B 1Q82W 3FB6C 2EINB 5CN0A 1F4NA 4WFBV 5IY5B 1M90W 2YSUB 4H37A 2MK3A 2JDIG 1AR1B 5B1OA 3ABTA 1KECA 1FFTB 2PI4A 1KKDA 4DO2A 5LGUA 3OM3B 4I5SA 5BZBA 3QO5A 4MT8A 3T4DA 2WPDG 3AEIA 3K08A 1VQLV 1W2BU 1ROPA 1GM7A 4MSWC 2W6JG 3LNMB 5KA5A 1YITV 2QEXV 3OUSA 2V1DA 4DXWA 1UJWB 2Y48A 1NQTA 1AI4A 4I9WA 4BIZA 1KQSU 4WFEA 1K34A 2LFRA 1VQOV 4ASUG 1BL8A 3E89A 3ZIAG 1JCHA 3UKMA 3OW2U 3ZCCA 1AJNA 3OE7G 1M9NA 3OR6C 2DWDC 1JQ0A 3W7WA 1JVMA 5GW7A 4JAVA 1J95A 4G28B 1VQ5V 2EILB 1PKXA 1H2GA 3QO7A 1YTFD 4MVQA 3CCMV 3ZMUA 1OHHG 4QPKA 1EBOA 2ZDIA 3M99B 3P32A 3OR7C 2Q67A 4MTXA 3W7XA 2EIMC 4PA3A 5LBQA 1KC8W 3SYPA 5L3EA 2JIZG 3WFVA 1CPYA 4BW5A 1OCRC 4G27B 3T4ZA 3VOUA 3TCUA 3LUTB 4JAUA 3F5WC 4JTDB 2EIJC 3D36A 1H8EG 1S3JA 4L87A 3SPHA 5H9CA 5IYBO 4R6ZA 3SYCA 4PELA 1KP2A 4LP8A 1K7DA 3R65A 1AROP 1AJQA 3ZMZA 3TETA 3CC4V 1AI5A 4GX5A 2EIMB 4UVBA 1JJ2U 1BHBA 5KUMA 1NJIW 2Y69B 3B8MA 5E1AC 1M56B 5B1AB 3T1CA 3SJQC 3SYOA 3F7VC 5L3GA 1OCRB 2Z3YA 3E8GA 5EBWC 1AI6A 3OMNB 2EIJB 4ZBMA 4GX2A 3OEEG 2XAHA 1VQPV 2JJ1G 1I5XA 2AHYA 2P6JA 3GWOA 2Q6AA 4WF9V 1FXKB 3H01A 5CMUA 3K04A 1DLBA 2X6AA 4LC1A 4JYBA 3SPCA 4CBCA 3B8NA 1K97A 2EJRA 3CMAV 2R9IA 2CK3G 5IYCO 1R3LC 2ZD9A 4G2KA 4WFGA 4RO2A 3K9AA 2B5UA 3JCZA 3ABLB 4LCUC 3GB7C 2XOKG 1ORQC 2KB1A 3SPJA 2EZOA 4PDVA 1K4CC 4XDKA 4HAMA 5L3FA 5L3BA 3E8FA 5KA6A 2YEVA 2JEUA 4TT3G 3D3IA 2DYSC 1OCOB 1OZ0A 2HFEC 1OCCC 3ABUA 3DTUB 1FXHA 1GTOA 1E1RG 2WSSG 1F51A 3E86A 2IU3A 2D3OW 3OUFA 3CCUV 4QNHB 2X7RB 2IJKA 1NBMG 2A0LA 5H6RA 2WLLB 2K1EA 4MTOA 1VQ6V 1S77D 3ETEA 3X2QC 3LDCA 1M57C 1K3EA 5EC1C 1VQ7V 1QLEC 3FYEB 4WFAV 2Z5UA 4H33A 1GK9A 1GMGA 5CA3A 2PI5A 4PA9A 3CCVV 1JX9A 2QM7A 2DYSB 3MD0A 1WPXA 1OCCB 1DTOA 3K0GA 1L1FA 5LGTA 3ZN1A 3FB5C 1V54C 3G71V 1P7BA 3BY6A 3SPIA 4PDRA 2WLMA 3E8HA 3AG4C 3SYQA 3ZN0A 1BHAA 1VQ8V 3E35A 3E2EA 2IU0A 2EBOA 4QE7A 2ZDIC 1Q81W 1H8HG 5B3SC 3OMIB 4XDLA 3X2QB 1M57B 2HLDG 4FPPA 4JGSA 1Y66A 1NR7A 1W0JG 1BMFG 1JPXA 1YJWV 1GKFA 1QLEB 4U7NA 4GX0A 4HYOA 1B6QA 1Q7YW 3MHHC 3ZRWB 2XAFA 4WFFA 4MVOA 3AG1C 4MVMA 1EZJA 5L3DA 3LSQA 1YSCA 1VQ9V 1G4YB 3HPLC 1K5QA 4WFHA 4Z1MG 1F23A 3AG4B 3VBBA 4FJCC 1PNLA 1QVGU 1THZA 1GM9A 1SESA 1TUEB 1R6NA 3K0DA 2GHYA 4J9ZB 4RQFA 4PDMA 5B3SB 4JASA 4TSFG 2OCCC 4MTFA 4R8CA 3CCSV 4P30A 2X6CA 1GO3F 2ITCC 2R9RB 3CP1A 4JTAB 4P2ZA 3I55V 4UV9A 3W7SA 1PNMA 2HJFC 2IJHA 1V55C 2XAJA 3T2MA 5DM6V 2FTKA 3AG1B 3ZRSA 2WLHA 5HFMA 1NR1A 4MVRA 4QJFB 4X89A 1E79G 3F7YC 1S72V 1N8RW 5EBLC 1K9MW 3NXSA 3B77A 5L3CA 3RVYA 5HFLA 2EIKC 5CBFA 2WLNA 2AHZA 4QIWF 1RPRA 2DYRC 2BOCC 1ENVA 4GX1A 1PD3A 2DQ0A 4JYCA 3STLC 1FXKA 1OCZC 2GSMB 4PA7A 1SERA 1V55B 2X0LA 3CCQV 1YIJV 3G6EV 1CP9A 3IGAC 5LGNA 3CC2V 1COWG 2WLIB 2B1GA 4FMTA 3TK1A 3K06A 4JPRA 4MVSA 3I56V 5CBGA 3P30A 2EIKB 2C2AA 1IXMA 3HB3B 1K73W 3K3WA 2ZQMA 3OEHG 3JD0A 4PA6A 1NKDA 3QNEA 3CCRV 2DYRB 4RUFA 5IY5C 1S0VA 3G4SV 4X88A 3W7TA 4MS2A 2JJ2G 3CD6V 4R50A 2JK5C 1OCZB 1XL6A 1NVPB 1QBZA 2V7QG 3RW0A 2OTLV 3ABMC 5IDJA 3E8BA 1R3KC 3EFFK 4MTGA 2UXNA 1VQ4V 2NLJC 1YJNV 3KG2A 3JD2A 4KUMA 1WLEA 2QA4V 3ABKC 1MABG 1S5HC 4YXWG 3LDDA 4N21A 4KP4A 4RAIA 2WLLA 3CPWU 1PL0A 1AJPA 1RPOA 2P67A 3BEHA 3UM7A 2ZXWC 2LP7A 3OFNG 3AG3C 1FS0G 3ABMB 3ASNC 3JD3A 4WCEV 1GM8A 1FXVA 4QPJA 5EK0A 4JTCB 1LNQA 3RVZA 2HR3A 3IFXA 2QM8A 1MG1A 4GT1A 1NH2B 1QVFU 3STZC 3MHSC 3ZMTA 2BOBC 5LHGA 3CXCU 3ABKB 1R3IC 5B1NA 2EILC 1QR8A 2A79B 3PJSK 3CCLV 3ASOC 2ZR3A 4QE9A 1SETA 2B1IA 4UXNA 4E2LA 3AG2C 4FIPC 2IW5A 1ZWIC 4TWKA 1JOYA 5FL7G 2ZXWB 4OXSA 3AG3B 3ASNB 4CZZA 5LHIA 2H8PC 4ZKIA 1V54B 3FYIB 4FK5C 2JEXA 3ZRWA 3FKSG 1YHQV 1NVPD 1YJ9V 2ITDC 3QO8A 3OMAB 4HZ3A 2P90A 3IC7A 1KP3A 4PDLA 2IH3C 3LDEA 3ZJZA 1W0KG 1S76D 2DW4A 3OGCC 4J9YB 4RQEA 1Y4MA 2XASA 3ASOB 4XBFA 1R3JC 2W0FC 2HG5C 2Q69A 4GCZA 2LFSA 1CEZA 2X6BA 1PNKA 3AG2B 1DF4A 4F4LA 2XNDG 2Y69C 4UVAA 5B1AC 1M56C 1QCEA 5C93A 3FB8C 1MOFA 2ATKC 3SPGA 2WWWA 4U7OA 4PA4A 3K03A 4MW3A 3A0RA 2UXXA 4MW8A 4X8AA 1K5SA 1XL4A 2XAGA 1Q86W 1KD1W 2W6IG 1MSWD 3CCEV 2WAMA 1SZTA 1DF5A 5DN6G 4P9PA 4KFMA 2F43G 1K8AW 1FXKC 1NH2D 5LHHA 4N23A 5B1BC 4LBEC 2QE7G 2A9HA 2OCCB 2WLKA 1R6KA 1E1QG 3DGEA 2WLJA 2M7WA 5CBHA 1R73A 1G8MA 2HKOA 2Q68A 3JD4A 4XDJA 5EC2C 4JF3A 5J9PC 4P9OA 2IJJA 3JYCA 5EBMC 1YI2V 1AI7A 2HVJC 3E83A 3RBZA 1RM1C 2OT5A 2P7TC 3ETGA 2QKSA 3EHBB 3CC7V 1K33A 3ZMSA 3ML0A 4BAYA 3ABLC 1QLNA 1K92A 3OAAG 4MVZA 3CCJV 1HWYA 1M1KW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N21 A;  4N23 A;  2EZO A;  3H01 A;  4JGS A;  5CMU A;  1Y66 A;  1QR9 A;  1Y4M A;  1JPX A;  5KA6 A;  5KA5 A;  1ENV A;  1DLB A;  2M7W A;  3CP1 A;  5CN0 A;  4E2L A;  1EBO A;  3M99 B;  3B8N A;  4JF3 A;  3MHH C;  4FIP C;  1DF4 A;  2MK3 A;  1QBZ A;  5HFL A;  2LP7 A;  1QCE A;  2OT5 A;  1MOF A;  1K34 A;  3B8M A;  4G2K A;  3WFV A;  1K33 A;  5HFM A;  3CYO A;  4FK5 C;  3K9A A;  1F23 A;  1MG1 A;  2X7R B;  4FJC C;  1SZT A;  1DF5 A;  3MHS C;  4JPR A;  2EZP A;  2EBO A;  1JQ0 A;  3B77 A;  3P30 A;  5H9C A;  1I5Y A;  1I5X A;  1QR8 A;  2P6J A;  3GWO A; 
#chains in the Genus database with same CATH topology
 1M4U A;  1Q3E A;  2ILM A;  3BPZ A;  4LF9 B;  1VQM V;  3ZMV A;  3BFR A;  1SRY A;  1WPB A;  3H1I H;  1NS1 A;  3CYO A;  4DV7 B;  1EFR G;  2YS8 A;  2ZR2 A;  2QTO A;  5LOV B;  1JFF B;  1YTF B;  5IYD O;  2H94 A;  2IJI A;  2GDS A;  3L71 H;  1VQN V;  3LSS A;  2NNU A;  1EN4 A;  4GKK B;  3FB6 C;  3UO2 A;  2EIN B;  1SKV A;  2JRI A;  5CA1 A;  2QWN B;  2PI4 A;  1B3Q A;  3FX7 A;  4TUY B;  2FL4 A;  4MT8 A;  3K5L A;  3AEI A;  3C3T A;  1VMG A;  3FFQ A;  2CTR A;  2FKX A;  1SA0 B;  4DXW A;  1P84 F;  2UXD B;  5LMN B;  1NQT A;  2PGG A;  5J2T B;  4WFE A;  1PV0 A;  5TIS Z;  3D8C A;  3ZBH A;  4I0X B;  4ZOL A;  5LP6 A;  3H1H H;  4GZR B;  1HNW O;  3QO7 A;  3CCM V;  5GON B;  5JJJ B;  4QPK A;  2EIM C;  2QR4 A;  3RT3 C;  4DV3 B;  1WAZ A;  3ZHU A;  5L3E A;  1CPY A;  4BW5 A;  4G27 B;  3H9V A;  4NB5 A;  5IWA O;  3D36 A;  2IM9 A;  3SPH A;  5H9C A;  2RQ6 A;  1D5N A;  4NTY A;  5LYJ A;  1K7D A;  2CGO A;  4GX5 A;  2L35 A;  3N2K A;  5E1A C;  5B1A B;  3SJQ C;  3F7V C;  5L3G A;  1XMQ B;  1XBL A;  2EIJ B;  3OEE G;  5K1X A;  4DR4 B;  2CUG A;  4DUY O;  2JJ1 G;  1NZ6 A;  2Q6A A;  3H01 A;  5CMU A;  1VF6 C;  3DC6 A;  2UUB B;  4LFC O;  2X6A A;  1AP5 A;  3B8N A;  4U3J A;  4DV2 B;  3LNN A;  4ZHQ B;  1F7Y A;  4TV8 A;  5JQG B;  2HP8 A;  2B5U A;  4GUN A;  1ZLZ A;  2LW7 A;  3K5N A;  1TUB B;  2DE0 X;  4FFK A;  4O2B B;  2EZO A;  1VP7 A;  2YIB A;  4H0L B;  2YEV A;  2LO1 A;  2JEU A;  3FAV B;  4BIO A;  3D3I A;  3DTU B;  3VQV A;  1N36 O;  4DR5 B;  1KB9 F;  1BT8 A;  2X7R B;  1XDC A;  4C7U A;  1IBM B;  2BE3 A;  5JCO C;  4B3M B;  4LF7 O;  2UU9 O;  4EFE A;  2WLL B;  3A0H Z;  3X2Q C;  1M57 C;  3RN4 A;  5KLV H;  3RYH B;  4DW1 A;  3FYE B;  2Z5U A;  4H33 A;  1GK9 A;  1M5I A;  4AI8 A;  2PI5 A;  4PA9 A;  1QNM A;  2JVD A;  1WPX A;  1OCC B;  1P7B A;  5BXZ A;  3CRM A;  4LNU B;  1FJG O;  3SYQ A;  3ZN0 A;  4YY3 O;  3E35 A;  4YHH B;  1D2D A;  2IU0 A;  4QE7 A;  1SQQ H;  2ZDI C;  4I4T A;  5EIB C;  1H8H G;  3CRR A;  4JGS A;  3UT5 A;  2XUM A;  3B40 A;  3THO A;  2XAF A;  2XTA A;  4F6R B;  4X9Q A;  5L3D A;  2EUL A;  4WFH A;  2GV9 A;  2HHH B;  2UUC B;  4FJC C;  1PNL A;  1QVG U;  1GN6 A;  4X1K A;  3K0D A;  5B66 Z;  2KG7 A;  4OX9 O;  5IYZ A;  4TSF G;  2OCC C;  2ZIN A;  3RGB A;  2X6C A;  4IIJ A;  5ITZ A;  2R9R B;  4JTA B;  4P2Z A;  4Q6G A;  1PNM A;  4EFB A;  3W7S A;  1XNR O;  3CRA A;  1ZL8 B;  5JVD A;  1RSO B;  2XAJ A;  3T2M A;  1U96 A;  2JGU A;  3AG1 B;  3F5T A;  2Q7H A;  2D2C B;  2JS5 A;  1N8R W;  1PP9 H;  4DUZ O;  4JI0 O;  5K1P A;  5DED A;  1HNZ B;  1WJZ A;  4ABM A;  3G6E V;  1CP9 A;  5LGN A;  2WLI B;  1WB7 A;  4FMT A;  1N0J A;  3K06 A;  4IHJ B;  3KCX A;  2ZNI A;  4FM1 A;  2P4V A;  4YIP A;  2HEP A;  3JD0 A;  5H5N A;  4K0K B;  4RUF A;  1S0V A;  3L73 H;  3CD6 V;  3N2G A;  2JK5 C;  2L6L A;  4TQD A;  1NVP B;  3BA8 A;  1XRE A;  5CB4 B;  2BTO A;  2ZKO A;  3CXH F;  3KG2 A;  3JD2 A;  3ZX6 A;  4KUM A;  2QA4 V;  4IYH A;  2JGD A;  2CDY A;  2F4V B;  5LMU B;  2RJZ A;  2GUZ A;  4RAI A;  1PL0 A;  2XHB A;  5BY1 A;  4ZI7 A;  4DR7 B;  1RPO A;  2CTP A;  3OFN G;  1FS0 G;  3ABM B;  3ASN C;  1DK1 A;  4QPJ A;  1EZV H;  1LNQ A;  1MG1 A;  1NH2 B;  3RFR A;  3MHS C;  3ZMT A;  3L75 H;  1AVM A;  4B3S O;  3ABK B;  1BGY H;  4FVM A;  4DV1 O;  4LF4 O;  5C8Y A;  5IT9 N;  3JSL A;  1J5E B;  3ASO C;  1YF2 A;  2ZR3 A;  5KHH A;  1L0L H;  1SET A;  2B1I A;  4CC6 A;  4X65 B;  2Q0A A;  4YJ3 A;  2IW5 A;  1BQZ A;  1ZWI C;  1Q6H A;  4TWK A;  2ZXW B;  1V9P A;  2H8P C;  4UCR A;  1GN3 A;  1URF A;  2UUA B;  4TV9 A;  2ITD C;  4HZ3 A;  3OMA B;  1WNS A;  4PDL A;  2YIA A;  2IH3 C;  1AB3 A;  2CTQ A;  1ZAU A;  2Q7G A;  5KX5 A;  4J9Y B;  3RYC A;  1Y4M A;  2UXC B;  4H13 B;  2X6B A;  3APQ A;  5B1A C;  1MOF A;  2F23 A;  4PJ0 Z;  4U7O A;  3EVK A;  5LXT B;  3OTO O;  1MSW D;  1SZT A;  3HKC B;  1H2M A;  4P9P A;  4NXM O;  4BR6 A;  4N23 A;  2Q5Z A;  5B1B C;  4LBE C;  5EYP B;  3O9O A;  2WLJ A;  2IJJ A;  1YI2 V;  3E22 A;  5EBM C;  1WP7 A;  1I7F A;  2F95 B;  1BE3 H;  1K33 A;  1B06 A;  4GKJ B;  3OAA G;  2KQX A;  4MVZ A;  1HWY A;  1M1K W;  4AQY B;  3AK2 A;  1S5L Z;  2OTJ V;  2XAQ A;  3WG7 C;  1FAF A;  1JJO A;  5H6Q A;  4J10 A;  2OIG A;  5KUK A;  3T1H O;  3HKE B;  5D5Q A;  1VF6 A;  3FB7 C;  3VQY A;  2QKA A;  1YVW A;  1GAX A;  2DWE C;  3JAK A;  3JAT A;  4UV8 A;  1OV9 A;  3L74 H;  2QWP B;  5IJ0 A;  1I5Y A;  1VQK V;  1P4R A;  4FLT A;  2VQE O;  3SYA A;  5CA0 B;  4JZ2 A;  1Q82 W;  3CWB H;  3ZED A;  5CN0 A;  1F4N A;  4WFB V;  4X1I A;  1Y74 A;  2W0X A;  2MK3 A;  2JDI G;  1IBL O;  2ZE8 A;  1AR1 B;  2BSK A;  3ABT A;  1KEC A;  5B5E Z;  1KKD A;  3BAA A;  4UB8 Z;  4I5S A;  5BZB A;  3QO5 A;  1XNQ O;  1JA8 A;  3TGU H;  4PD4 F;  1W2B U;  1ROP A;  2W6J G;  4J7Z A;  4EEQ A;  5JCO A;  5KA5 A;  1YIT V;  2V1D A;  3APO A;  3RYI A;  2Y48 A;  1AI4 A;  3RYF B;  3TXQ A;  1K34 A;  4FFB B;  2LFR A;  2PTM A;  4EB6 B;  5KAF Z;  3W7W A;  5GW7 A;  3ZS8 C;  1J95 A;  2EIL B;  2OIE A;  3U11 A;  1YTF D;  1R1B A;  1WA8 A;  2ZDI A;  3M99 B;  3OR7 C;  4PA3 A;  1XQ8 A;  1MZE A;  2JIZ G;  3WFV A;  2RCV A;  3VOU A;  4JAU A;  3F5W C;  4L87 A;  3EXA A;  1HNW B;  4LWS B;  4FM2 A;  5BMV A;  1S5J A;  4LP8 A;  3R65 A;  1ARO P;  3CC4 V;  4UVB A;  1BS3 A;  3B8M A;  1TVK A;  4BW9 A;  1OCR B;  2Z3Y A;  5EBW C;  1FFX A;  2CAZ C;  5LA6 A;  1I5X A;  2AHY A;  1PL4 A;  3U10 A;  4WBN A;  2N05 A;  1EN5 A;  1DLB A;  2ZE6 A;  4LC1 A;  4CBC A;  3M7M X;  3CMA V;  2YID A;  1R3L C;  5IYC O;  2ZD9 A;  4X66 O;  4WFG A;  3JCZ A;  3ABL B;  4B3T O;  2EJ7 A;  4DUY B;  1ORQ C;  2KB1 A;  4D7S A;  3SPJ A;  1X4T A;  1ZUQ A;  3JAS A;  4PDV A;  1K4C C;  4LFC B;  5L3B A;  3FD9 A;  3LSU A;  1P49 A;  2DYS C;  2WSS G;  3E86 A;  4IT5 A;  2Z0A A;  3H1L H;  2P06 A;  4JYY A;  3CCU V;  4QNH B;  2A0L A;  3SDL A;  2K1E A;  1G1X B;  3J81 N;  5EC1 C;  1N34 O;  2OYQ A;  1QLE C;  3UCS C;  4WFA V;  2PYL A;  4NTX A;  1GMG A;  5CA3 A;  3MD0 A;  1DTO A;  3K0G A;  1L1F A;  1N36 B;  4B3R O;  4NXN O;  3FB5 C;  3JSN A;  2O57 A;  4DV0 O;  3BY6 A;  2LW1 A;  2WLM A;  5J2T A;  3JAM N;  2UU9 B;  4LF7 B;  1N32 O;  3SGI A;  4H44 B;  2BTQ A;  2G38 A;  3OMI B;  1JPX A;  1YJW V;  1Y6X A;  4U7N A;  1IZ3 A;  4HYO A;  1B6Q A;  4ZIB A;  3MHH C;  4ZOL B;  5LP6 B;  1VQ9 V;  3CHX A;  1FJG B;  4W4K A;  1GRJ A;  3HKB A;  3AG4 B;  4YY3 B;  3VBB A;  1N4C A;  3JAW A;  3CRQ A;  1THZ A;  1GM9 A;  1SES A;  1SQP H;  4RQF A;  5B3S B;  3CCS V;  2E76 B;  1Y76 A;  3A2F A;  3I55 V;  1HNX O;  1MSD A;  2IJH A;  1H2N A;  1OJH A;  1V55 C;  3WB0 A;  4DR6 O;  1RP3 B;  1NR1 A;  3DSQ A;  4X89 A;  3VQW A;  1E79 G;  1K9M W;  3OTF A;  4OX9 B;  5LYJ B;  3B77 A;  3RVY A;  5HFL A;  2EIK C;  3BCC H;  4LF9 O;  4K35 A;  3N2K B;  1LUV A;  1RPR A;  5IJ9 A;  1XNR B;  1KMI Z;  1MZF A;  2QSA A;  4UCS A;  2QGN A;  3CJH B;  1OCZ C;  1NTK H;  2GSM B;  3L70 H;  3ZHT A;  1H2L A;  3CCQ V;  1YIJ V;  2ADQ B;  4LF5 O;  4UB6 Z;  2ZE7 A;  1Q8I A;  5BR8 O;  1COW G;  1BZK A;  5CBG A;  4DUZ B;  4X62 O;  1HW7 A;  2CE4 A;  4U3J B;  3OT7 A;  1IXM A;  3HB3 B;  3K3W A;  3OEH G;  4TV8 B;  4JI0 B;  2Q0O C;  3CCR V;  4IGG A;  2DYR B;  4O2A A;  3G4S V;  4X88 A;  4O2B A;  2DOS A;  4JI8 O;  1QBZ A;  2YUA A;  3RW0 A;  1DGS A;  4O4L A;  4MTG A;  1VQ4 V;  1VF5 B;  1WLE A;  1MAB G;  2P5O A;  2F66 C;  3DXR B;  2WLL A;  3CPW U;  1SQB H;  4LF8 O;  2GTA A;  3Q4H A;  4F6E A;  3RYH A;  3UM7 A;  3AG3 C;  4WCE V;  1FXV A;  3CEI A;  4JTC B;  3IFX A;  4GT1 A;  4I50 A;  4CS3 A;  5JWP A;  1R3I C;  3ETQ A;  2EIL C;  4OPH A;  3S3W A;  2XT9 A;  4K8Z A;  4DR1 O;  2DMX A;  4B08 A;  4NYK A;  1YEW A;  4O4J B;  5FL7 G;  4JI1 O;  1Q5O A;  4I4T B;  4UCT A;  3A8T A;  4CZZ A;  4ZKI A;  1V54 B;  1I08 A;  2JEX A;  1YHQ V;  1NVP D;  3UT5 B;  4KHP O;  4B3S B;  4DV1 B;  4LF4 B;  3G80 A;  5JH7 A;  1H2S B;  3ZJZ A;  2ZNJ A;  4J7J A;  2DW4 A;  4UCV A;  4RQE A;  2XAS A;  4XBF A;  2AXT Z;  3PN1 A;  2W0F C;  1SQG A;  2AZ0 A;  4GCZ A;  1CEZ A;  1PNK A;  3AG2 B;  1HDJ A;  4UVA A;  3FB8 C;  2A7W A;  2KG7 B;  2WWW A;  3SPG A;  4PA4 A;  4RWU A;  1ZX3 A;  3K03 A;  4MW3 A;  2UXX A;  4X8A A;  1KD1 W;  1FPO A;  3CCE V;  2WAM A;  2PUS A;  1GH6 A;  1SQV H;  2RDC A;  5ITZ B;  1TGO A;  4KFM A;  4I7Z B;  1NH2 D;  5JVD B;  4BWA A;  3J80 N;  2HJD A;  1I94 O;  2ZT9 B;  4HBN A;  4X64 O;  3DGE A;  5FLX N;  4B7K A;  5CBH A;  3HKD A;  4JYA O;  5EC2 C;  2CH7 A;  4JF3 A;  5J9P C;  4DV6 O;  1AI7 A;  2HVJ C;  3E83 A;  1UPG A;  4DV2 O;  3EHB B;  3ZMS A;  4BAY A;  3OTO B;  2ODM A;  3ABL C;  1B04 A;  1KU9 A;  4NXM B;  4LFA O;  4ICG A;  1N33 O;  2WLI A;  4I55 A;  5F2V O;  3CME V;  1SS3 A;  4UVC A;  4EKW A;  2EIN C;  3CRC A;  3TXS A;  2V4D A;  1RM1 B;  3K79 A;  3MDS A;  5AG2 A;  3ZRV A;  1XMO O;  2DQ3 A;  4BIU A;  4DRX B;  4Q20 A;  4R7C A;  1H38 A;  3JAL B;  5CB4 A;  2EZP A;  4B7E A;  2AW9 A;  4LH7 A;  4DV5 O;  3KKY A;  3T1H B;  5IY5 B;  1M90 W;  1WB8 A;  2JGD B;  2QWR B;  3P3N A;  1Y67 A;  1FFT B;  1YXB A;  3L9D A;  5LGU A;  3OM3 B;  2WPD G;  4ZI7 B;  1VQL V;  4MSW C;  1WN7 A;  4E4E A;  2QEX V;  1X59 A;  4IL6 Z;  2RMK B;  1IVS A;  1UJW B;  2VQF O;  1IBL B;  4I9W A;  3HR0 A;  1SF9 A;  1VQO V;  4ASU G;  4O4I A;  1BL8 A;  3CX5 F;  4JAA A;  5C8Y B;  2EX3 A;  2QWQ B;  1JCH A;  3UKM A;  3ZIA G;  5JJN B;  3ZCC A;  4CC5 A;  1XNQ B;  3BA9 A;  4NTW A;  1VQ5 V;  4DR2 O;  3ZMU A;  1OHH G;  3ZHV A;  1EBO A;  2Q4P A;  3P32 A;  4MTX A;  2Q67 A;  1LUW A;  5LBQ A;  1KC8 W;  3SYP A;  3JAR A;  1IX9 A;  4L8J A;  5KMG A;  1HP8 A;  1L8D A;  5A9G A;  1G6U A;  4JTD B;  2R70 A;  5KX5 B;  2EIJ C;  2YXH A;  1IXB A;  3RYC B;  1H8E G;  3K57 A;  5FNV A;  5DEC A;  3OD4 A;  2ZM6 O;  3QF7 A;  3AG7 A;  4R6Z A;  4PEL A;  5EZY B;  5LL6 Y;  2QKC A;  1VIB A;  2EIM B;  1MNG A;  4OGQ B;  1XOU A;  1NJI W;  2R72 A;  1M56 B;  1AI6 A;  3OMN B;  4ZBM A;  3IJ4 A;  2XAH A;  1VF7 A;  1VQP V;  3QVN A;  4O4H B;  3E22 B;  1FXK B;  1O9G A;  4JYB A;  1K97 A;  2F93 B;  4JZG A;  2EJR A;  4YJ2 A;  4DK0 A;  1FD9 A;  4G2K A;  4TOI A;  2E5L O;  3K9A A;  3HKE A;  1GN4 A;  2XOK G;  2JS3 A;  3B4S A;  3AK3 A;  4OPA A;  4XDK A;  4HAM A;  5L3F A;  5KA6 A;  1QQC A;  4TT3 G;  1OCO B;  1OCC C;  1FKA O;  1PPJ H;  4JI6 O;  4DYL A;  1GTO A;  4X66 B;  4FLW A;  2DJV A;  1E1R G;  2IU3 A;  3OUF A;  4B3T B;  3ZHR A;  1NBM G;  5H6R A;  1VQ6 V;  1S77 D;  1Y74 B;  1K3E A;  3K5O A;  2PYJ A;  2B9Z A;  3K58 A;  2BSK B;  4DV4 O;  1JX9 A;  2QM7 A;  2QDO A;  5LGT A;  4JV5 O;  4JI2 O;  3ZN1 A;  1EN6 A;  4X1Y B;  1V54 C;  3G71 V;  4DR3 O;  3SPI A;  4PDR A;  3WU2 Z;  2AZ2 A;  3E8H A;  1IUR A;  4HNA A;  1BHA A;  2EBO A;  4FFB A;  4K8X A;  4IYI A;  3RYI B;  4PI2 A;  4XDL A;  3X2Q B;  1N34 B;  1M57 B;  1IBK O;  2HLD G;  1W0J G;  2FYU H;  1BMF G;  4GX0 A;  1Q7Y W;  1RFY A;  3ZRW B;  4WFF A;  4B3R B;  1R6T A;  3AG1 C;  4MVM A;  4NXN B;  2Y4U A;  1L0N H;  1Z5V A;  4DV0 B;  1EZJ A;  3LSQ A;  1YSC A;  5J2U A;  1M93 A;  3HPL C;  1K5Q A;  2MW2 B;  1F23 A;  3GWK C;  1N32 B;  5KHK A;  4FZ0 A;  2IBZ H;  1R6N A;  4JAS A;  5IE9 A;  4MTF A;  5FPO A;  4P30 A;  1KKC A;  1HR0 O;  3A0B Z;  4LF6 O;  2R9A A;  2ITC C;  3CP1 A;  4GLX A;  1IDS A;  2OCH A;  2WLH A;  5HFM A;  4X20 A;  1LR1 A;  4D7T A;  4LR3 A;  4LFB O;  4MVR A;  1A32 A;  5IWA B;  3F7Y C;  5EBL C;  3NXS A;  4J11 A;  5KHI A;  5BMV B;  3C3S A;  2BCC H;  4JI4 O;  1WP8 A;  3CB2 A;  3U0Z A;  2AHZ A;  4QIW F;  4UCU A;  2BOC C;  4GX1 A;  1HNX B;  1TVK B;  1PD3 A;  4DK1 A;  1NTM H;  4TQF A;  1FFX B;  1SER A;  4PA7 A;  2PY5 A;  1AP6 A;  1Z5W A;  4DR6 B;  1Z2G A;  3CC2 V;  4WBN B;  4I9Q A;  2B1G A;  2UXB O;  4JPR A;  3I56 V;  2FB5 A;  3P30 A;  2Q9L A;  1NI8 A;  3R66 A;  1NKD A;  5LOV A;  3MAQ A;  3G67 A;  1JFF A;  4CH5 A;  5IY5 C;  3W7T A;  1XEQ A;  4R50 A;  2DN9 A;  3QG5 A;  2OTL V;  4LF5 B;  3ABM C;  5BR8 B;  3EFF K;  4JI7 O;  2UXN A;  2NLJ C;  3JAS B;  2QTS A;  2Y0I A;  3T1Y O;  4X62 B;  3ABK C;  4YXW G;  2YIC A;  4N21 A;  4KP4 A;  4TUY A;  4JI5 O;  5CA1 B;  2ARH A;  1AJP A;  2FML A;  4JI8 B;  3M8A A;  3DC5 A;  2P67 A;  3BEH A;  2ZXW C;  3JD3 A;  1GM8 A;  1Q90 D;  4NR1 A;  5EK0 A;  1SA0 A;  2ZIO A;  3RVZ A;  2HR3 A;  1O9H A;  3STZ C;  2LQT A;  2BOB C;  3CXC U;  5B1N A;  4YIO A;  1QR8 A;  4QGP A;  2QJ1 A;  3BVO A;  4I0X A;  4LF8 B;  3O65 A;  4J7K A;  4QE9 A;  4E2L A;  1SQX H;  1PM9 A;  4JI3 O;  4FIP C;  2N04 A;  4OXS A;  2BTQ B;  5GON A;  1VAR A;  3ASN B;  5LHI A;  5E79 Z;  4PHZ A;  1YJ9 V;  2P90 A;  3IC7 A;  2ADP A;  3LDE A;  2YIB D;  1S76 D;  3OGC C;  4DR1 B;  3ASO B;  2GTS A;  1R3J C;  2HG5 C;  2Q69 A;  2LFS A;  1CXZ B;  3HKB B;  1DF4 A;  4F4L A;  3JAW B;  2XND G;  4JI1 B;  1YZB A;  5C93 A;  1M56 C;  3CS5 A;  3WB1 A;  3A0R A;  1K5S A;  1XL4 A;  2LGQ A;  2XAG A;  1Q86 W;  2W6I G;  4KHP B;  1Y76 B;  3P3P A;  4CH4 A;  1FXK C;  2QE7 G;  2A9H A;  2WLK A;  2ZCE A;  3TJT A;  1E1Q G;  3D3Q A;  2Q7E A;  2HKO A;  2Q68 A;  1XIL A;  3JD4 A;  3JYC A;  3RBZ A;  2A06 H;  2OT5 A;  3CJH A;  1QLN A;  1K92 A;  4DV7 O;  4GYC B;  5IJ9 B;  3H1K H;  4ZHQ A;  3CCJ V;  4J80 A;  1H2K A;  5JQG A;  1I94 B;  3NR7 A;  4UUJ C;  5B1B B;  4X64 B;  1QR9 A;  1XI1 A;  5GTI Z;  2HVK C;  3ETD A;  4FLZ A;  4JYA B;  4GKK O;  1OCO C;  1MA1 A;  3SJC C;  1TUB A;  4DV6 B;  1XHX A;  2E74 B;  4RUE A;  2IH1 C;  3JD1 A;  4MVU A;  3GVM A;  3OGI B;  3FAV A;  5JJE B;  1Q6I A;  1U97 A;  1F4M A;  4O2A B;  2YEV B;  3ZRX A;  4LFA B;  1K4D C;  1N33 B;  3W7U A;  4W4L A;  1JR9 A;  3WG7 B;  1XHZ A;  3G6B A;  2LJ2 A;  4O4L B;  4Z2W A;  2QWO B;  1P7G A;  2YSU B;  4H37 A;  3DXR A;  2UXD O;  5LMN O;  5H2F Z;  5B1O A;  1XMO B;  2YI8 A;  4PV1 B;  4DO2 A;  3T4D A;  3K08 A;  1UFI A;  3Q4H B;  4LNU A;  3H1J H;  1GM7 A;  4UFZ A;  3LNM B;  4DV5 B;  2GBO A;  3AK1 A;  3OUS A;  4I50 B;  4BIZ A;  1KQS U;  4DV3 O;  3N27 A;  3E89 A;  4O4J A;  3OW2 U;  1AJN A;  3OE7 G;  1M9N A;  3OR6 C;  4F6R A;  2DWD C;  1JQ0 A;  1JVM A;  2A3Q A;  2YXY A;  4JAV A;  4G28 B;  1YCI A;  3BHP A;  1PKX A;  1H2G A;  1KBH A;  5KHJ A;  4MVQ A;  4NVP A;  2VQF B;  3W7X A;  1N0N A;  1AR5 A;  4X1K B;  3RWR D;  3ICX A;  5JH7 B;  1OCR C;  3T4Z A;  3TCU A;  3LUT B;  5IYZ B;  1ZL8 A;  1RSO A;  1XMQ O;  1KYO F;  1S3J A;  2P4K A;  2NN4 A;  4IIJ B;  4DR2 B;  4DR4 O;  3UO3 A;  4A5U B;  5IYB O;  1SQF A;  3SYC A;  1KP2 A;  2UUB O;  3TET A;  1AJQ A;  3ZMZ A;  1AI5 A;  1JJ2 U;  1BHB A;  5KUM A;  3K5M A;  1QHT A;  2Y69 B;  3T1C A;  3SYO A;  3E8G A;  4FM0 A;  4FZ1 A;  4GX2 A;  1BQ0 A;  2ZM6 B;  3HKD B;  3S3X A;  2CH7 B;  2P6J A;  3GWO A;  4WF9 V;  2N74 A;  3CE2 A;  1TAE A;  3K04 A;  4IHJ A;  1QU7 A;  4KL1 A;  2VWK A;  3SPC A;  2R9I A;  1NT2 B;  2CK3 G;  2E75 B;  3SR2 C;  4RO2 A;  4DR5 O;  4LCU C;  4I55 B;  3GB7 C;  1IBM O;  1SZX A;  4B3M O;  4DRX A;  3N2G B;  3E8F A;  3JAL A;  2VWJ A;  1OZ0 A;  2HFE C;  3ABU A;  3B09 A;  3ZHS A;  2PF4 E;  1FXH A;  1F51 A;  2YI9 A;  2E5L B;  2D3O W;  5FPR A;  2IJK A;  2WA4 A;  2KKW A;  2GUZ B;  4YHH O;  4MTO A;  2WA3 A;  3ETE A;  3LDC A;  2VQE B;  3KCY A;  1VQ7 V;  5A2Q N;  1NTZ H;  1KUQ A;  3CCV V;  2DYS B;  4JI6 B;  5LP6 C;  1T5E A;  3VQX A;  3BRC A;  3AG4 C;  1I0H A;  1MMM A;  2PZS A;  1VQ8 V;  3JCU Z;  2HHH O;  2UUC O;  3E2E A;  1XUQ A;  3K59 A;  1Q81 W;  5B3S C;  3B2E E;  4U3F H;  1EM1 A;  4YJ3 B;  1AIL A;  4FPP A;  1Y66 A;  1NR7 A;  4DV4 B;  1GKF A;  1QLE B;  3CSX A;  4O4I B;  2KSD A;  3D36 C;  2RN9 A;  4MVO A;  4JI2 B;  4JV5 B;  4TV9 B;  4DR3 B;  2P22 C;  1G4Y B;  4UCO A;  4Z1M G;  1TUE B;  4CS2 A;  3QTC A;  2GHY A;  2H3O A;  4J9Z B;  4PDM A;  1IBK B;  5LXT A;  1YDX A;  4R8C A;  3HKC A;  3JAR B;  5KMG B;  1GO3 F;  4UV9 A;  2HJF C;  5DM6 V;  4AIL C;  2FTK A;  5EYP A;  5EZY A;  5FNV B;  3ZRS A;  1HNZ O;  5GTH Z;  2QM4 A;  2ZE5 A;  4QJF B;  3IC9 A;  1S72 V;  1VEW A;  3IAY A;  5D5P A;  5L3C A;  4CH6 A;  4K3A A;  1FYJ A;  5CBF A;  2WLN A;  1HR0 B;  2ETN A;  4LF6 B;  2DYR C;  2K9P A;  1ENV A;  4K0K O;  2DQ0 A;  3UQ8 A;  4JYC A;  4O4H A;  3STL C;  1FXK A;  1V55 B;  2X0L A;  4LFB B;  3IGA C;  2CTW A;  3TK1 A;  4MVS A;  4JI4 B;  4LH6 A;  2Q73 A;  2EIK B;  2C2A A;  5KAI Z;  3L72 H;  1K73 W;  4YJ2 B;  2ZQM A;  5KHG A;  4PA6 A;  3C90 A;  3QNE A;  2F4V O;  1SC5 B;  4DW0 A;  5LMU O;  5EIB D;  1JMK C;  3KZI Z;  4MS2 A;  2JJ2 G;  1OCZ B;  1XL6 A;  4DR7 O;  5CA0 A;  2V7Q G;  2Y0P A;  3JAK B;  2CGN A;  3JAT B;  4D6T H;  5IDJ A;  5IJ0 B;  3E8B A;  1R3K C;  4AHC A;  1YJN V;  2UXB B;  4Z1V A;  1W59 A;  1S5H C;  3LDD A;  1ZTE A;  4X1I B;  1Q6U A;  1J5E O;  4X65 O;  2LP7 A;  4JI7 B;  1QVF U;  2QM8 A;  3T1Y B;  1GN2 A;  2UUA O;  3RYF A;  4X1Y A;  2RNB A;  5LHG A;  2YXL A;  4FLY A;  4NKG B;  2A79 B;  1D5A A;  4JI5 B;  2YC0 A;  3PJS K;  4EB6 A;  3CCL V;  2Q8V A;  4KXR A;  4UXN A;  2Y4T A;  2UXC O;  3AG2 C;  4HNA B;  4J41 A;  3BAB A;  1JOY A;  1US6 A;  2YDE A;  3AG3 B;  1Q43 A;  2LGW A;  3FYI B;  4FK5 C;  2OWO A;  3ZRW A;  3FKS G;  2NR5 A;  4FLX A;  3I5D A;  1AR4 A;  2AGA A;  1TA8 A;  3QO8 A;  1KP3 A;  1WA8 B;  4CH3 A;  1W0K G;  1BSM A;  4FLU A;  5J2U B;  4J42 A;  4JI3 B;  4FLV A;  4LWS A;  3K9S A;  2VS0 A;  3SJB C;  2Y69 C;  3ZHQ A;  1QCE A;  2F1M A;  2ATK C;  2M6Y A;  4MW8 A;  1ZSP A;  3J7A U;  4GKJ O;  1DF5 A;  5DN6 G;  1BCC H;  2F43 G;  1K8A W;  3SJA C;  4PI0 A;  5LHH A;  4AQY O;  2OCC B;  1R6K A;  4X20 B;  2ZIM A;  3WB2 A;  2M7W A;  1R73 A;  1G8M A;  4XDJ A;  4P9O A;  2VRZ A;  1RM1 C;  5LA6 B;  4CS4 A;  2E3C A;  2P7T C;  3ETG A;  2QKS A;  3CC7 V;  1NU1 H;  3ML0 A; 
#chains in the Genus database with same CATH homology
 2OTJ V;  2WLI A;  2XAQ A;  4UUJ C;  5B1B B;  3CME V;  3WG7 C;  4UVC A;  1QR9 A;  1VQM V;  3ZMV A;  4EKW A;  2HVK C;  3ETD A;  2EIN C;  1OCO C;  5H6Q A;  1SRY A;  5KUK A;  4RUE A;  1RM1 B;  3K79 A;  2IH1 C;  3JD1 A;  3FB7 C;  4MVU A;  3CYO A;  3ZRV A;  1EFR G;  2DQ3 A;  4BIU A;  4Q20 A;  4R7C A;  2ZR2 A;  2DWE C;  2QTO A;  1H38 A;  1F4M A;  1YTF B;  2YEV B;  4UV8 A;  3ZRX A;  2H94 A;  1K4D C;  2IJI A;  5IYD O;  1I5Y A;  2EZP A;  3W7U A;  1VQK V;  1P4R A;  3LSS A;  1VQN V;  3SYA A;  2NNU A;  3WG7 B;  1Q82 W;  3FB6 C;  2EIN B;  5CN0 A;  1F4N A;  4WFB V;  5IY5 B;  1M90 W;  2YSU B;  4H37 A;  2MK3 A;  2JDI G;  1AR1 B;  5B1O A;  3ABT A;  1KEC A;  1FFT B;  2PI4 A;  1KKD A;  4DO2 A;  5LGU A;  3OM3 B;  4I5S A;  5BZB A;  3QO5 A;  4MT8 A;  3T4D A;  2WPD G;  3AEI A;  3K08 A;  1VQL V;  1W2B U;  1ROP A;  1GM7 A;  4MSW C;  2W6J G;  3LNM B;  5KA5 A;  1YIT V;  2QEX V;  3OUS A;  2V1D A;  4DXW A;  1UJW B;  2Y48 A;  1NQT A;  1AI4 A;  4I9W A;  4BIZ A;  1KQS U;  4WFE A;  1K34 A;  2LFR A;  1VQO V;  4ASU G;  1BL8 A;  3E89 A;  3ZIA G;  1JCH A;  3UKM A;  3OW2 U;  3ZCC A;  1AJN A;  3OE7 G;  1M9N A;  3OR6 C;  2DWD C;  1JQ0 A;  3W7W A;  1JVM A;  5GW7 A;  4JAV A;  1J95 A;  4G28 B;  1VQ5 V;  2EIL B;  1PKX A;  1H2G A;  3QO7 A;  1YTF D;  4MVQ A;  3CCM V;  3ZMU A;  1OHH G;  4QPK A;  1EBO A;  2ZDI A;  3M99 B;  3P32 A;  3OR7 C;  2Q67 A;  4MTX A;  3W7X A;  2EIM C;  4PA3 A;  5LBQ A;  1KC8 W;  3SYP A;  5L3E A;  2JIZ G;  3WFV A;  1CPY A;  4BW5 A;  1OCR C;  4G27 B;  3T4Z A;  3VOU A;  3TCU A;  3LUT B;  4JAU A;  3F5W C;  4JTD B;  2EIJ C;  3D36 A;  1H8E G;  1S3J A;  4L87 A;  3SPH A;  5H9C A;  5IYB O;  4R6Z A;  3SYC A;  4PEL A;  1KP2 A;  4LP8 A;  1K7D A;  3R65 A;  1ARO P;  1AJQ A;  3ZMZ A;  3TET A;  3CC4 V;  1AI5 A;  4GX5 A;  2EIM B;  4UVB A;  1JJ2 U;  1BHB A;  5KUM A;  1NJI W;  2Y69 B;  3B8M A;  5E1A C;  1M56 B;  5B1A B;  3T1C A;  3SJQ C;  3SYO A;  3F7V C;  5L3G A;  1OCR B;  2Z3Y A;  3E8G A;  5EBW C;  1AI6 A;  3OMN B;  2EIJ B;  4ZBM A;  4GX2 A;  3OEE G;  2XAH A;  1VQP V;  2JJ1 G;  1I5X A;  2AHY A;  2P6J A;  3GWO A;  2Q6A A;  4WF9 V;  1FXK B;  3H01 A;  5CMU A;  3K04 A;  1DLB A;  2X6A A;  4LC1 A;  4JYB A;  3SPC A;  4CBC A;  3B8N A;  1K97 A;  2EJR A;  3CMA V;  2R9I A;  2CK3 G;  5IYC O;  1R3L C;  2ZD9 A;  4G2K A;  4WFG A;  4RO2 A;  3K9A A;  2B5U A;  3JCZ A;  3ABL B;  4LCU C;  3GB7 C;  2XOK G;  1ORQ C;  2KB1 A;  3SPJ A;  2EZO A;  4PDV A;  1K4C C;  4XDK A;  4HAM A;  5L3F A;  5L3B A;  3E8F A;  5KA6 A;  2YEV A;  2JEU A;  4TT3 G;  3D3I A;  2DYS C;  1OCO B;  1OZ0 A;  2HFE C;  1OCC C;  3ABU A;  3DTU B;  1FXH A;  1GTO A;  1E1R G;  2WSS G;  1F51 A;  3E86 A;  2IU3 A;  2D3O W;  3OUF A;  3CCU V;  4QNH B;  2X7R B;  2IJK A;  1NBM G;  2A0L A;  5H6R A;  2WLL B;  2K1E A;  4MTO A;  1VQ6 V;  1S77 D;  3ETE A;  3X2Q C;  3LDC A;  1M57 C;  1K3E A;  5EC1 C;  1VQ7 V;  1QLE C;  3FYE B;  4WFA V;  2Z5U A;  4H33 A;  1GK9 A;  1GMG A;  5CA3 A;  2PI5 A;  4PA9 A;  3CCV V;  1JX9 A;  2QM7 A;  2DYS B;  3MD0 A;  1WPX A;  1OCC B;  1DTO A;  3K0G A;  1L1F A;  5LGT A;  3ZN1 A;  3FB5 C;  1V54 C;  3G71 V;  1P7B A;  3BY6 A;  3SPI A;  4PDR A;  2WLM A;  3E8H A;  3AG4 C;  3SYQ A;  3ZN0 A;  1BHA A;  1VQ8 V;  3E35 A;  3E2E A;  2IU0 A;  2EBO A;  4QE7 A;  2ZDI C;  1Q81 W;  1H8H G;  5B3S C;  3OMI B;  4XDL A;  3X2Q B;  1M57 B;  2HLD G;  4FPP A;  4JGS A;  1Y66 A;  1NR7 A;  1W0J G;  1BMF G;  1JPX A;  1YJW V;  1GKF A;  1QLE B;  4U7N A;  4GX0 A;  4HYO A;  1B6Q A;  1Q7Y W;  3MHH C;  3ZRW B;  2XAF A;  4WFF A;  4MVO A;  3AG1 C;  4MVM A;  1EZJ A;  5L3D A;  3LSQ A;  1YSC A;  1VQ9 V;  1G4Y B;  3HPL C;  1K5Q A;  4WFH A;  4Z1M G;  1F23 A;  3AG4 B;  3VBB A;  4FJC C;  1PNL A;  1QVG U;  1THZ A;  1GM9 A;  1SES A;  1TUE B;  1R6N A;  3K0D A;  2GHY A;  4J9Z B;  4RQF A;  4PDM A;  5B3S B;  4JAS A;  4TSF G;  2OCC C;  4MTF A;  4R8C A;  3CCS V;  4P30 A;  2X6C A;  1GO3 F;  2ITC C;  2R9R B;  3CP1 A;  4JTA B;  4P2Z A;  3I55 V;  4UV9 A;  3W7S A;  1PNM A;  2HJF C;  2IJH A;  1V55 C;  2XAJ A;  3T2M A;  5DM6 V;  2FTK A;  3AG1 B;  3ZRS A;  2WLH A;  5HFM A;  1NR1 A;  4MVR A;  4QJF B;  4X89 A;  1E79 G;  3F7Y C;  1S72 V;  1N8R W;  5EBL C;  1K9M W;  3NXS A;  3B77 A;  5L3C A;  3RVY A;  5HFL A;  2EIK C;  5CBF A;  2WLN A;  2AHZ A;  4QIW F;  1RPR A;  2DYR C;  2BOC C;  1ENV A;  4GX1 A;  1PD3 A;  2DQ0 A;  4JYC A;  3STL C;  1FXK A;  1OCZ C;  2GSM B;  4PA7 A;  1SER A;  1V55 B;  2X0L A;  3CCQ V;  1YIJ V;  3G6E V;  1CP9 A;  3IGA C;  5LGN A;  3CC2 V;  1COW G;  2WLI B;  2B1G A;  4FMT A;  3TK1 A;  3K06 A;  4JPR A;  4MVS A;  3I56 V;  5CBG A;  3P30 A;  2EIK B;  2C2A A;  1IXM A;  3HB3 B;  1K73 W;  3K3W A;  2ZQM A;  3OEH G;  3JD0 A;  4PA6 A;  1NKD A;  3QNE A;  3CCR V;  2DYR B;  4RUF A;  5IY5 C;  1S0V A;  3G4S V;  4X88 A;  3W7T A;  4MS2 A;  2JJ2 G;  3CD6 V;  4R50 A;  2JK5 C;  1OCZ B;  1XL6 A;  1NVP B;  1QBZ A;  2V7Q G;  3RW0 A;  2OTL V;  3ABM C;  5IDJ A;  3E8B A;  1R3K C;  3EFF K;  4MTG A;  2UXN A;  1VQ4 V;  2NLJ C;  1YJN V;  3KG2 A;  3JD2 A;  4KUM A;  1WLE A;  2QA4 V;  3ABK C;  1MAB G;  1S5H C;  4YXW G;  3LDD A;  4N21 A;  4KP4 A;  4RAI A;  2WLL A;  3CPW U;  1PL0 A;  1AJP A;  1RPO A;  2P67 A;  3BEH A;  3UM7 A;  2ZXW C;  2LP7 A;  3OFN G;  3AG3 C;  1FS0 G;  3ABM B;  3ASN C;  3JD3 A;  4WCE V;  1GM8 A;  1FXV A;  4QPJ A;  5EK0 A;  4JTC B;  1LNQ A;  3RVZ A;  2HR3 A;  3IFX A;  2QM8 A;  1MG1 A;  4GT1 A;  1NH2 B;  1QVF U;  3STZ C;  3MHS C;  3ZMT A;  2BOB C;  5LHG A;  3CXC U;  3ABK B;  1R3I C;  5B1N A;  2EIL C;  1QR8 A;  2A79 B;  3PJS K;  3CCL V;  3ASO C;  2ZR3 A;  4QE9 A;  1SET A;  2B1I A;  4UXN A;  4E2L A;  3AG2 C;  4FIP C;  2IW5 A;  1ZWI C;  4TWK A;  1JOY A;  5FL7 G;  2ZXW B;  4OXS A;  3AG3 B;  3ASN B;  4CZZ A;  5LHI A;  2H8P C;  4ZKI A;  1V54 B;  3FYI B;  4FK5 C;  2JEX A;  3ZRW A;  3FKS G;  1YHQ V;  1NVP D;  1YJ9 V;  2ITD C;  3QO8 A;  3OMA B;  4HZ3 A;  2P90 A;  3IC7 A;  1KP3 A;  4PDL A;  2IH3 C;  3LDE A;  3ZJZ A;  1W0K G;  1S76 D;  2DW4 A;  3OGC C;  4J9Y B;  4RQE A;  1Y4M A;  2XAS A;  3ASO B;  4XBF A;  1R3J C;  2W0F C;  2HG5 C;  2Q69 A;  4GCZ A;  2LFS A;  1CEZ A;  2X6B A;  1PNK A;  3AG2 B;  1DF4 A;  4F4L A;  2XND G;  2Y69 C;  4UVA A;  5B1A C;  1M56 C;  1QCE A;  5C93 A;  3FB8 C;  1MOF A;  2ATK C;  3SPG A;  2WWW A;  4U7O A;  4PA4 A;  3K03 A;  4MW3 A;  3A0R A;  2UXX A;  4MW8 A;  4X8A A;  1K5S A;  1XL4 A;  2XAG A;  1Q86 W;  1KD1 W;  2W6I G;  1MSW D;  3CCE V;  2WAM A;  1SZT A;  1DF5 A;  5DN6 G;  4P9P A;  4KFM A;  2F43 G;  1K8A W;  1FXK C;  1NH2 D;  5LHH A;  4N23 A;  5B1B C;  4LBE C;  2QE7 G;  2A9H A;  2OCC B;  2WLK A;  1R6K A;  1E1Q G;  3DGE A;  2WLJ A;  2M7W A;  5CBH A;  1R73 A;  1G8M A;  2HKO A;  2Q68 A;  3JD4 A;  4XDJ A;  5EC2 C;  4JF3 A;  5J9P C;  4P9O A;  2IJJ A;  3JYC A;  5EBM C;  1YI2 V;  1AI7 A;  2HVJ C;  3E83 A;  3RBZ A;  1RM1 C;  2OT5 A;  2P7T C;  3ETG A;  2QKS A;  3EHB B;  3CC7 V;  1K33 A;  3ZMS A;  3ML0 A;  4BAY A;  3ABL C;  1QLN A;  1K92 A;  3OAA G;  4MVZ A;  3CCJ V;  1HWY A;  1M1K W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...