1MOFA

Coat protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
53
structure length
53
Chain Sequence
DLREVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECAFYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retrovirus envelope domain at 1.7 angstrom resolution.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
molecule keywords MOLONEY MURINE LEUKEMIA VIRUS P15
total genus 18
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mofA00
1MOFA 3MHSC 1SZTA 4E2LA 2X7RB 3B8NA 3GWOA 4N21A 5CMUA 1DLBA 2OT5A 1DF4A 1Y4MA 5KA5A 1QR8A 4FK5C 4JPRA 2EZOA 3M99B 1I5XA 3P30A 3MHHC 1ENVA 2EBOA 2EZPA 2MK3A 4JGSA 4N23A 5CN0A 5HFMA 3B77A 2P6JA 1QR9A 1MG1A 1EBOA 5HFLA 3B8MA 1DF5A 1F23A 3H01A 3WFVA 1K34A 4FIPC 1K33A 1QBZA 3CYOA 3K9AA 1QCEA 3CP1A 1I5YA 1Y66A 5KA6A 5H9CA 1JQ0A 4FJCC 4G2KA 1JPXA 4JF3A 2LP7A 2M7WA
chains in the Genus database with same CATH superfamily
2WA3A 2QKSA 2EINC 4O4HA 4J80A 4IL6Z 4JI0B 1Y67A 5B1OA 4GX2A 1F4MA 2R9RB 1AR4A 1AROP 1Y6XA 1SETA 1XEQA 2IJIA 3A0HZ 1OJHA 1WNSA 1YVWA 2BSKB 2KG7A 3LNNA 4GUNA 5IYCO 3CMAV 3CCVV 5IYZA 4JI2B 3ZMUA 3M99B 5LA6B 1SA0A 4WF9V 2YIBD 2UXCB 1SQFA 3T4DA 3Q4HA 2KSDA 1YJWV 1IXBA 1SQBH 3CYOA 5FPOA 1GRJA 4ZOLA 4H37A 1R6TA 3HR0A 2K9PA 5LL6Y 2FTKA 4XDJA 4PA7A 5EC2C 3P3NA 4CZZA 1SZXA 2JVDA 3CHXA 4O4IB 5GONA 2Y48A 1XNQO 2R9AA 1S72V 5BY1A 2YI9A 3FB5C 4J10A 1YTFD 3S3WA 2ZQMA 4NTWA 3HKCA 1XL6A 3NR7A 2Q73A 4Z1MG 1VIBA 1DGSA 4ZKIA 3L9DA 2NLJC 2Q8VA 3H9VA 2Q7EA 3CXHF 4O4IA 1S3JA 4AI8A 1OCRC 4GCZA 2WLMA 1JQ0A 5KHKA 4K0KO 3CD6V 3GWOA 2Y4UA 4IGGA 2WSSG 4NYKA 2EIMB 4NB5A 3ASNB 3J81N 4JI4B 5IY5C 1I94B 3K3WA 4UB8Z 2VQFO 4NKGB 2ITCC 1KMIZ 5LHHA 4MVMA 2EIJC 1N32O 5LA6A 2V1DA 2Z3YA 4JYAB 3J7AU 1BQ0A 1NQTA 2HR3A 1XMOB 4TV9B 4R8CA 4PDVA 3M8AA 4JI6B 3RYCB 1TA8A 1QLEB 2P7TC 3SJBC 2ZM6O 4CS4A 1N32B 3E8BA 3K57A 4NXNO 2F23A 1AR1B 4FM1A 3CCLV 4I5SA 3B09A 3JD0A 3CX5F 3AG4C 1XMQO 3E89A 2XAJA 4MVSA 4DK0A 3SJQC 5C8YB 1G8MA 1J5EO 2GSMB 2EZPA 3OTOO 1N36O 3BA9A 4X62B 1MZEA 1MG1A 5EBMC 2GDSA 2CTPA 3AK2A 1ZL8A 3KZIZ 3JAWA 3WG7C 2PGGA 1V55C 2QDOA 1EZVH 2EINB 3K04A 1MSDA 2ZDIA 4LFBO 1L8DA 5A2QN 1IZ3A 5KMGA 3OGIB 2B1GA 1S5JA 3BPZA 1FXKA 4J7JA 3LUTB 3VOUA 1JJOA 4BAYA 4O2AB 1XNRB 2JEXA 4TOIA 4X88A 1RSOB 3AEIA 3OMNB 4H13B 1RP3B 1EN6A 1SA0B 3UT5A 1Q7YW 2HVJC 4K3AA 3RVYA 5EBLC 4J9YB 1HR0O 1PNLA 1XREA 4PV1B 2UXNA 4JGSA 4KL1A 4DV7O 3I5DA 1KBHA 1WP7A 3QTCA 1N4CA 1TVKA 3CRCA 3JSNA 5B1BB 1XMOO 4LNUB 1OCZC 3SJCC 2VWKA 2DYRB 3X2QB 2DWDC 2ZXWB 5E79Z 1W59A 4D7SA 3TETA 3GB7C 2B1IA 2M6YA 2LW1A 1QLNA 3VQWA 4JV5B 1OZ0A 1H2KA 1IBMB 3G80A 4Q20A 1VQPV 4PI0A 2ADQB 1K4CC 2W6JG 2AGAA 1IBLB 1R3LC 1XOUA 3IFXA 5DM6V 4X1KA 2F4VB 1B04A 1NU1H 1Q86W 5CB4A 4FFKA 3H1JH 3K58A 3ASNC 4I55A 5KHGA 5LMUB 1I7FA 1IX9A 3AG2B 2YUAA 2ETNA 4FJCC 5DECA 5BMVA 4LF4O 4O2BB 2CTQA 1K7DA 4GZRB 1CP9A 4I7ZB 3JAKA 1XDCA 3IC9A 2Q68A 2Y69C 4NXMB 2DYRC 2IM9A 5K1XA 4PELA 2WA4A 5GW7A 4GYCB 4CS2A 5L3GA 2WLIA 2XTAA 5EZYB 3H1KH 4TUYB 4X64O 4DUZB 1TUBB 2WLJA 1U96A 1DF4A 2P5OA 4DV7B 4JI5O 3HB3B 1VQLV 3B77A 3G67A 2NNUA 3A0BZ 5IYBO 1WP8A 2QR4A 1O9HA 5CB4B 2HHHO 4KXRA 4KHPB 1QQCA 1GN6A 1NI8A 3OEEG 1PD3A 2WLNA 2DMXA 3B8NA 4K8XA 1ZL8B 3HKEA 5H5NA 3EFFK 3UO2A 1Y74B 1VQ7V 3ZHTA 3AG1B 4UUJC 2EX3A 3K0DA 2GBOA 3ETDA 2ARHA 3CCSV 2IBZH 5KA6A 3B4SA 3W7TA 1GN3A 1Z5VA 1XL4A 3BA8A 4B3RB 1W0JG 3BY6A 3FB7C 3HKCB 3OD4A 4OX9O 5JVDB 4P30A 2N74A 2XASA 5FL7G 2EZOA 5LXTA 3T1YO 4DV6B 5HFMA 3ICXA 4CS3A 5IWAB 1QU7A 2UU9B 2H94A 1GKFA 4QNHB 1FXKC 4W4KA 3F5WC 5L3FA 4OPHA 5BZBA 3LSQA 1K5QA 1RPRA 2Q9LA 2ZT9B 4LWSA 5L3DA 3RYCA 2AXTZ 4LF5O 1H2LA 1XILA 4NXMO 1D5AA 2ZE7A 4X1IA 5CBGA 2ZXWC 3ZJZA 3JAMN 1N36B 2ATKC 4CC6A 5CA1B 3U11A 2IH3C 1H8HG 1WB7A 1TAEA 1BL8A 3WU2Z 2FYUH 3UO3A 4X64B 4G27B 4DUZO 2B9ZA 1YEWA 1Q90D 5EYPA 1MNGA 3ABLC 2KKWA 4UV9A 2LP7A 3JAWB 2JRIA 5KHHA 1SZTA 4LWSB 5IDJA 5H2FZ 3AK3A 2VQEO 1XUQA 2JK5C 5IJ9B 2BCCH 2VS0A 2BSKA 3JAKB 2P06A 1VQ8V 3OEHG 3OT7A 3WB2A 3UT5B 2QWPB 3KCYA 1Q6UA 3SYCA 4JYYA 3JD4A 3TJTA 1RSOA 3TXSA 3L72H 4E2LA 3OUFA 4AQYO 1L0LH 2L6LA 1M90W 2NR5A 5JJNB 3SDLA 1WA8A 2JS5A 3ASOB 4MSWC 2Z5UA 5IJ9A 4LFAO 1BQZA 3FAVB 4NVPA 3CRMA 1K8AW 5BR8O 2DWEC 3RWRD 4IYIA 1NBMG 3LSSA 1SQGA 4QE7A 3D36C 4ZHQB 2JDIG 2UU9O 1HNXO 2QTSA 3W7WA 2EJRA 1OCCC 1BHAA 3TGUH 4TT3G 2CTWA 3JCZA 3K5MA 1XQ8A 4Q6GA 4JI7O 3QVNA 3D3QA 3N2KB 2G38A 2QTOA 3OM3B 4JI0O 4FM0A 3A8TA 1SESA 4O2AA 1SQXH 4UCVA 4ASUG 2FB5A 1N34B 4JYAO 3ETEA 2QWQB 5F2VO 4LF5B 5IE9A 1M5IA 3R66A 1NT2B 1WB8A 3H1IH 5EZYA 5JVDA 3JATB 4WFHA 4J11A 4JI2O 2F95B 2MK3A 5E1AC 2GHYA 2ZNIA 1LNQA 3AG3C 2EIJB 4LF6O 4IT5A 5IT9N 3CC7V 4QPJA 2F66C 2HFEC 1GO3F 3O65A 5KX5A 4X1YA 1E1RG 4I4TB 2ZD9A 2XHBA 4DV4B 1T5EA 3TK1A 2LO1A 2ZE5A 2OYQA 2OTLV 3HKEB 2UXBO 1YHQV 3LDDA 4X65O 3ABKC 1B3QA 1EFRG 4YIPA 5EIBC 3OFNG 3K08A 5CN0A 1YITV 2DQ0A 2YIDA 4LFBB 2Y0IA 4LH7A 5LGTA 3E86A 3ETQA 3OW2U 2N05A 3ZMZA 5J2TB 1Y74A 3H01A 1OCOB 3T2MA 1YJ9V 1AILA 1R3KC 2X6AA 4H0LB 4JF3A 4QPKA 4YHHB 1GMGA 4FLZA 4RQEA 2RN9A 2Q7HA 1YJNV 2A7WA 5KHIA 5EBWC 1X59A 4BIUA 3CS5A 1ZAUA 1Q6IA 5BR8B 3CCUV 4IHJB 3O9OA 1VF6A 3MDSA 4HAMA 1KUQA 2LJ2A 1GM8A 2CH7A 1VF6C 1BE3H 2ILMA 3IJ4A 1F7YA 1JFFA 2W0XA 1BMFG 4X9QA 3HPLC 4MS2A 3TXQA 4QJFB 5J2UB 2F93B 3EVKA 5D5PA 1I94O 4DV0B 1Q8IA 2WLKA 3L75H 4FLTA 1FFXB 1G4YB 1P4RA 1TGOA 1D5NA 2DJVA 3AG1C 3RBZA 4DXWA 1MMMA 1XBLA 2YIAA 3BEHA 2CK3G 4GKJB 2E75B 3JALB 2CGOA 4JI6O 1QVFU 4L87A 4LC1A 3FFQA 2UUAB 4PHZA 1QCEA 3LNMB 3ZHVA 1JJ2U 1N33B 5JQGA 4DK1A 1VQOV 1JVMA 2E5LO 5ITZA 5B1AB 4YJ2A 4LF7O 1ORQC 4CH4A 2RDCA 1NKDA 3T1HB 1ZUQA 4LR3A 1MSWD 1WN7A 3SYOA 3U10A 5KX5B 2UXXA 1FYJA 2UXCO 3ZRXA 4X66O 3RYIB 2UUBB 5KUKA 2GTSA 4HZ3A 1L0NH 3MHSC 1FJGB 2CTRA 3T1HO 1KYOF 1K73W 3VQYA 2PZSA 2GTAA 4DR7B 2GV9A 2XAGA 4YY3O 3ZRWA 5FNVB 1Y66A 1FXKB 3JALA 1H2GA 4DRXB 2UUCB 2O57A 4P2ZA 2EIMC 1BCCH 2OCHA 2IW5A 3D36A 4IIJB 4U7OA 4DR3O 4DV0O 4LBEC 4KHPO 4MTGA 1OCRB 3CRRA 3OGCC 1AR5A 1K34A 4LF9O 4FLXA 3ABTA 5JCOC 3STZC 1Y76B 3JSLA 1R1BA 2EILB 3BVOA 4DUYB 3G4SV 4C7UA 4DR2B 1SS3A 1JR9A 3G6BA 3K79A 1VEWA 3RT3C 4LNUA 3D3IA 4IYHA 1KP3A 1IBMO 2YXHA 1JMKC 4R50A 1NR7A 2HLDG 4B3TB 4DV3O 1PKXA 1N0JA 4DUYO 4DR2O 3DTUB 4JZ2A 1Q82W 4B3SO 1E79G 3MD0A 1PM9A 3N2GB 4ICGA 4X1KB 1AJQA 2PUSA 4BR6A 2ZE6A 3VQVA 2Q4PA 3AG2C 4UCUA 3SPIA 3CC2V 2N04A 1K33A 4I50B 1SERA 2C2AA 4ZOLB 2QEXV 1YSCA 3N2KA 4WFGA 3L74H 3CMEV 3DGEA 4GT1A 1AVMA 1SQVH 4NXNB 4I50A 4YY3B 2QKCA 4GKJO 4WFBV 1WAZA 3N27A 1H38A 4CH6A 3OTOB 2F1MA 2W6IG 4FFBA 4DV1O 3DSQA 4GX5A 4TQDA 5JH7B 2KG7B 4W4LA 3ZHSA 1FXHA 5KAFZ 1THZA 1ROPA 2HEPA 4O2BA 4LF6B 1DLBA 1DTOA 2HJDA 2PTMA 5C93A 1JOYA 2YI8A 2X0LA 1X4TA 1IBKB 3WB0A 3ZRVA 4BW5A 2A0LA 3CSXA 2P22C 3ZRWB 1OCCB 2Q5ZA 3BFRA 1FFTB 5B1AC 1KD1W 1PP9H 2YC0A 4H33A 1EN5A 5JH7A 4NTYA 5LBQA 4FLYA 4MVRA 3T4ZA 4RQFA 1HNXB 2V7QG 3HKDA 1QBZA 1PNKA 2HJFC 3CCEV 5LP6C 4ABMA 3U0ZA 3OMIB 5KA5A 1Q5OA 5FNVA 3BCCH 4X1IB 1S0VA 2L35A 2F43G 4TUYA 3CC4V 3E2EA 4YJ3A 4LF8O 1J5EB 5JQGB 2YSUB 1AP6A 2JGDA 2VQEB 3K9AA 2Q0OC 4P9PA 1AB3A 1BSMA 5D5QA 3G6EV 1XHZA 4YJ3B 3FB6C 1MA1A 1YCIA 2CUGA 2UXBB 1NTKH 4AQYB 2ZIMA 1HNWO 4CBCA 4DV3B 4DV4O 2PYJA 3ZN1A 3RGBA 4B3MB 4UVAA 4ZBMA 1NVPB 1GN2A 4FZ1A 4X20A 4TV8B 2E3CA 2WAMA 2NN4A 1WA8B 2EILC 1YDXA 3BAAA 1OCOC 1I08A 4O4LB 2CGNA 1YIJV 3JARA 4BIOA 1URFA 5CBHA 3C3TA 4IIJA 4U7NA 2LW7A 4LF7B 3E8FA 3CCMV 4PD4F 1BT8A 2CDYA 3ABKB 1P84F 4K8ZA 4K0KB 3SYPA 2P90A 4A5UB 4DR3B 2ZINA 3C3SA 2WLLA 1N8RW 3OR7C 2ZCEA 5J2UA 3SR2C 4K35A 4LH6A 1N0NA 2PY5A 4DR4B 5BXZA 1GTOA 1PNMA 1AI5A 5FLXN 1G6UA 2E74B 4EKWA 1JCHA 3I56V 2RJZA 4JZGA 1MZFA 3X2QC 4MTFA 4KFMA 1YF2A 5LMNB 1I5XA 3CRQA 3B40A 4ZIBA 5JJJB 3W7SA 2W0FC 2ZE8A 1FS0G 1KKDA 4FLUA 1M93A 2Q0AA 1NTMH 3K03A 3N2GA 3BABA 1XHXA 2A3QA 4D6TH 2MW2B 4UVBA 4Z1VA 1ZLZA 3VBBA 2DW4A 4I55B 1SF9A 1QR8A 1OHHG 3EHBB 4R7CA 2ADPA 3FYIB 1I0HA 5B66Z 1IXMA 5J2TA 1U97A 4J42A 1KU9A 1F23A 2LFRA 3K06A 1EN4A 3SPGA 4DV6O 1P7GA 2IJKA 2QSAA 4MVZA 2R72A 3RYFA 4MW3A 1R73A 1GH6A 5KUMA 1VARA 5GTHZ 1K9MW 1W0KG 1FFXA 4HYOA 4OGQB 1QVGU 3DXRA 3K0GA 3WB1A 3RYFB 4CH5A 3A0RA 3WG7B 1K3EA 1Q6HA 4JI5B 4FFBB 2JJ1G 4ZHQA 3ZRSA 4F6RA 1NTZH 1FJGO 1R3IC 3CB2A 1M56C 2YS8A 4DR7O 3K9SA 3OE7G 5J9PC 4N21A 1WPBA 1R3JC 4MT8A 4I0XB 1JA8A 1PPJH 1VQNV 2ODMA 1V55B 2AZ0A 1TUBA 4YXWG 4U3FH 4DW0A 3ZMSA 1QLEC 2IU3A 3SYQA 2E76B 2H3OA 3G71V 4XBFA 4I0XA 1FKAO 1OCZB 5KMGB 3PJSK 3RYHB 2OIEA 2PYLA 4CH3A 1QR9A 1GK9A 5EC1C 3UQ8A 2LGWA 3T1YB 2GUZA 1M57C 4LP8A 1DF5A 1NVPD 3E83A 3GWKC 2HVKC 2YXYA 5LYJA 5IY5B 5H6RA 3J80N 5EYPB 3ABMC 1US6A 3CJHA 3AG7A 4O4HB 4NR1A 4YJ2B 2DYSB 1RPOA 1PL0A 2VRZA 1PV0A 5ITZB 2YIBA 4WFFA 4JPRA 2WLHA 1Z5WA 1FAFA 3IAYA 4B3SB 2AZ2A 2DOSA 4LF8B 2XUMA 2UUAO 4DV2B 4Z2WA 1R6KA 1QHTA 4BWAA 3HKBA 4RO2A 1NS1A 5LP6A 1JPXA 1UJWB 3CEIA 1IURA 3W7XA 1Z2GA 5IJ0A 1NR1A 1HWYA 1N34O 2JS3A 3QNEA 4UCTA 5EK0A 3IC7A 2P4VA 3HKBB 1FD9A 4JTAB 1FXVA 1V54C 1H2MA 3CRAA 4ZI7B 4PI2A 2A79B 4B7KA 2Q67A 1BHBA 2F4VO 4I4TA 4B3MO 2IH1C 4X1YB 4DV1B 5B5EZ 4TSFG 1K4DC 1QNMA 3MHHC 4AHCA 2YXLA 4EFEA 1XNRO 3B8MA 4O4JB 3OR6C 1VQ9V 3ASOC 1XMQB 2CH7B 2JGDB 3T1CA 1AJNA 4R6ZA 5CBFA 2BE3A 3ETGA 3ZHQA 3TCUA 1HNWB 2JEUA 2XOKG 5AG2A 5B1NA 2D3OW 3ZCCA 1Q81W 2HP8A 5CA3A 5GTIZ 4PA4A 4FZ0A 1M1KW 1HNZB 5LOVB 3OTFA 1W2BU 4LF9B 2WLIB 4J41A 2QE7G 1S5LZ 2DQ3A 4JAUA 4DR6B 4KP4A 3UCSC 4UB6Z 3FAVA 2B5UA 4JI4O 5FPRA 1WPXA 4PDMA 5H6QA 4TV8A 5LXTB 1HNZO 4DV2O 3OAAG 1SC5B 5LOVA 4DV5B 2RMKB 3AG3B 1UFIA 1V54B 4UCSA 1IBLO 3ML0A 4DYLA 3SPHA 1B6QA 4EB6A 3ZEDA 1CXZB 2YEVA 4BW9A 3R65A 2EBOA 3FYEB 5B1BC 3THOA 3M7MX 3L70H 4RAIA 1SQPH 3DC6A 4PDRA 5LP6B 4PJ0Z 1CPYA 4EB6B 4B08A 3VQXA 4FM2A 1SRYA 4I9WA 1FPOA 4OPAA 1GM7A 3CXCU 2ZDIC 4DR1B 4X62O 1RM1B 2E5LB 1G1XB 1K92A 2RNBA 4BIZA 2X6CA 3E35A 3AK1A 4PA6A 3KG2A 2XT9A 4QE9A 2CE4A 3FX7A 4DW1A 3MAQA 1MABG 2WLLB 4WCEV 1P49A 2JJ2G 2XAHA 3UKMA 2BOCC 1VF5B 1S5HC 4CC5A 3CP1A 1LUWA 3JARB 1TUEB 2DN9A 3SPJA 4PA9A 1TVKB 4DR4O 4F4LA 1F51A 4PDLA 5CA0B 2UUCO 1EZJA 2HKOA 5L3EA 3JCUZ 1CEZA 2IU0A 4MVQA 3L73H 3RYHA 3E22A 2PF4E 4O4LA 5EIBD 1L1FA 4F6RB 1YXBA 2JIZG 4JV5O 2Z0AA 1SKVA 2M7WA 4UV8A 3SJAC 4GKKO 1R6NA 2EIKB 3ZMVA 4UCRA 4FK5C 3CPWU 1GAXA 2EIKC 4J7ZA 4MVOA 1KKCA 4JI3O 5CA1A 5IWAO 5IYZB 2VQFB 3E22B 1V9PA 4UVCA 3SYAA 2OWOA 1NZ6A 4LFCO 2RCVA 2LQTA 5CA0A 2D2CB 3PN1A 3QO7A 4B3TO 3LDEA 1LUVA 2YEVB 2A9HA 4XDLA 5KAIZ 1XI1A 1M4UA 1H2NA 5DEDA 4JI3B 1PL4A 3RVZA 4JI7B 4QGPA 3SGIA 3APOA 4LF4B 1HR0B 1E1QG 3ZHUA 1IVSA 3EXAA 3CCRV 3RYIA 1VQKV 4RUEA 2UXDB 1B06A 1EM1A 3JYCA 2EJ7A 2QM8A 4X8AA 4G28B 3HKDB 3RN4A 3K5NA 5K1PA 2QGNA 3FKSG 1VQ4V 4YIOA 3FB8C 4RWUA 1ENVA 3ZBHA 5L3CA 5LHGA 3ZIAG 2Y4TA 4P9OA 4EEQA 5DN6G 4UCOA 5KHJA 3WFVA 2OTJV 3ZX6A 1BZKA 3OUSA 3QG5A 3DC5A 4G2KA 3P32A 1VQ5V 1VMGA 4UFZA 3C90A 3LDCA 3Q4HB 3BHPA 1AP5A 5LGNA 2OIGA 3E8HA 2LFSA 3JD3A 4PA3A 2XAQA 4DRXA 4EFBA 4GKKB 2Y69B 2RQ6A 2FL4A 3ABMB 1ZTEA 5L3BA 4LFAB 2H8PC 2ZR2A 2K1EA 1KP2A 5LMUO 5LYJB 2PI4A 2OT5A 4AILC 4JYCA 3NXSA 2BTQA 4FLVA 5BMVB 1VF7A 4FPPA 1EBOA 4OXSA 2LGQA 1Q43A 4FLWA 3SPCA 2ZKOA 2AHZA 2FMLA 4GLXA 4TQFA 2KB1A 2R9IA 2DE0X 2CAZC 1HW7A 4E4EA 4UXNA 4WBNB 3AG4B 5IYDO 1M9NA 4XDKA 3H1LH 4JASA 3ZHRA 3QF7A 1YZBA 1WJZA 2QM4A 5GONB 4DR6O 3P3PA 2UXDO 5B3SB 3ABUA 3IGAC 3JASA 5JWPA 2ZM6B 3H1HH 1RM1C 2ZR3A 4J7KA 4DR1O 4WBNA 1KC8W 4JAAA 4HNAA 4FVMA 2BTOA 2QA4V 1HP8A 5JJEB 1H8EG 4HNAB 2VWJA 1N33O 4MTOA 4B7EA 3S3XA 4YHHO 2QJ1A 4JAVA 1JFFB 2QWNB 2WPDG 3W7UA 3P30A 4N23A 3LSUA 4MW8A 2QWOB 3F5TA 4TWKA 1YTFB 4LCUC 3QO5A 1UPGA 3BRCA 3K59A 1OV9A 2Q69A 4X89A 4WFAV 3RFRA 5LHIA 4X65B 1NH2D 1KB9F 4JTDB 2AHYA 1MOFA 2X7RB 1O9GA 5CMUA 3UM7A 4D7TA 4RUFA 3KCXA 1WLEA 1COWG 3KKYA 3CCQV 1GN4A 1KQSU 1S76D 1BS3A 2HG5C 2Q7GA 2R70A 2P6JA 2XAFA 4O4JA 3K5OA 4JTCB 4NTXA 1J95A 2Q6AA 2YDEA 4JI8O 4JI1O 1AI7A 4WFEA 2BTQB 3ZS8C 2QWRB 4MVUA 3JD2A 2ZIOA 1K97A 3FD9A 3CCJV 4DR5O 1ZX3A 3I55V 4ZI7A 4KUMA 5C8YA 3RW0A 2GUZB 4U3JB 4LFCB 1VQMV 1SQQH 2WWWA 2IJHA 4JI1B 4JYBA 1M57B 4B3RO 3GVMA 4H44B 4TV9A 4OX9B 1BGYH 3K5LA 2X6BA 3APQA 4FMTA 4L8JA 2ZNJA 3JASB 1AI4A 1Q3EA 4DO2A 3E8GA 4GX1A 5H9CA 4F6EA 4J9ZB 1K5SA 3F7YC 1H2SB 3QO8A 2ITDC 2A06H 4GX0A 1Y4MA 1YI2V 3CJHB 4MTXA 2OCCB 2P67A 5HFLA 1AJPA 1M56B 1S77D 3B2EE 1ZSPA 1Y76A 1KECA 2IJJA 2QKAA 1VP7A 3CE2A 4DV5O 1AI6A 3ZN0A 3D8CA 3L71H 4QIWF 3JATA 1IDSA 2PI5A 4U3JA 4X66B 2UUBO 3A2FA 4I9QA 1HDJA 4IHJA 5LMNO 5LGUA 3ABLB 2YICA 5A9GA 2EULA 1I5YA 2QM7A 1JX9A 4JI8B 4HBNA 1GM9A 4FIPC 2HHHB 3OMAB 4DR5B 1A32A 2FKXA 3F7VC 1VQ6V 1RFYA 5IJ0B 1NH2B 1XNQB 4X20B 3ZMTA 1F4NA 1P7BA 5KLVH 2DYSC 2XNDG 2BOBC 2KQXA 3STLC 1LR1A 5B3SC 2Y0PA 5JCOA 3CWBH 1ZWIC 3JD1A 1DK1A 1IBKO 2JGUA 1D2DA 2P4KA 3DXRB 2AW9A 2OCCC 5TISZ 2V4DA 1NJIW
chains in the Genus database with same CATH topology
1SZTA 3OMIB 5IDJA 2QKSA 2EINC 5KA5A 2JK5C 1S0VA 1MABG 2WLLB 4WCEV 2JJ2G 2XAHA 2F43G 5B1OA 3UKMA 3CC4V 4GX2A 1VQ8V 3E2EA 2BOCC 2YSUB 1F4MA 1S5HC 3OEHG 2R9RB 1AROP 3K9AA 3CP1A 1SETA 4P9PA 2IJIA 3SYCA 3JD4A 5IYCO 3CMAV 4E2LA 3OUFA 3CCVV 3G6EV 3ZMUA 1M90W 1TUEB 3SPJA 3M99B 4PA9A 3FB6C 4WF9V 4F4LA 1F51A 4PDLA 1EZJA 2HKOA 5L3EA 1CEZA 3ASOB 4MSWC 2Z5UA 2IU0A 3T4DA 4MVQA 1YJWV 4CBCA 3CYOA 1K8AW 2DWEC 3ZN1A 1NBMG 3LSSA 1L1FA 2JIZG 4QE7A 4UVAA 4H37A 2JDIG 4ZBMA 2M7WA 4UV8A 1NVPB 1R6NA 2EIKB 3W7WA 2EJRA 3ZMVA 2FTKA 1OCCC 1BHAA 2WAMA 4XDJA 4FK5C 4TT3G 4PA7A 2EILC 3JCZA 5EC2C 3CPWU 4CZZA 1OCOC 2QTOA 2EIKC 3OM3B 4MVOA 2Y48A 1SESA 4UVCA 3SYAA 1YIJV 4ASUG 3ETEA 5CBHA 1S72V 4U7NA 3FB5C 3QO7A 3E8FA 3CCMV 1YTFD 3ABKB 3LDEA 2YEVB 2A9HA 2ZQMA 3SYPA 4XDLA 4WFHA 2P90A 1XL6A 3RVZA 2WLLA 2MK3A 5E1AC 4Z1MG 2GHYA 1N8RW 3OR7C 1LNQA 3AG3C 1E1QG 2EIJB 4ZKIA 3CCRV 3CC7V 2NLJC 4QPJA 1VQKV 4RUEA 2HFEC 1GO3F 1S3JA 1GTOA 1OCRC 4GCZA 1PNMA 1AI5A 2WLMA 3JYCA 1JQ0A 2QM8A 1E1RG 4EKWA 2ZD9A 4X8AA 4G28B 1JCHA 3I56V 3TK1A 2OTLV 3CD6V 3GWOA 1YHQV 3LDDA 3X2QC 3FKSG 4MTFA 1VQ4V 2WSSG 4KFMA 3ABKC 3FB8C 2EIMB 1EFRG 1I5XA 1ENVA 3OFNG 3K08A 5CN0A 5L3CA 5LHGA 3ASNB 1YITV 2DQ0A 3ZIAG 5LGTA 3E86A 5IY5C 3OW2U 3K3WA 4P9OA 3ZMZA 3W7SA 2W0FC 5DN6G 3H01A 1OCOB 2ITCC 3WFVA 1FS0G 1KKDA 3T2MA 5LHHA 2OTJV 4MVMA 1YJ9V 2EIJC 3OUSA 4G2KA 1R3KC 2V1DA 2X6AA 2Z3YA 3K03A 3P32A 4JF3A 4QPKA 1VQ5V 1GMGA 3LDCA 4UVBA 1NQTA 3VBBA 4RQEA 2DW4A 1YJNV 1QR8A 5LGNA 1OHHG 2HR3A 3EHBB 4R7CA 3FYIB 5EBWC 3E8HA 4R8CA 2LFSA 4PDVA 3JD3A 4PA3A 1IXMA 4BIUA 2XAQA 1QLEB 2P7TC 1F23A 2LFRA 2Y69B 3E8BA 3ABMB 3CCUV 3K06A 5L3BA 3SPGA 1AR1B 2H8PC 2ZR2A 3CCLV 4I5SA 2IJKA 2K1EA 4HAMA 4MVZA 1KP2A 3JD0A 4MW3A 3AG4C 1R73A 5KUMA 1GM8A 1K9MW 1W0KG 2PI4A 3E89A 2OT5A 2XAJA 4JYCA 3NXSA 4HYOA 4MVSA 3SJQC 1G8MA 1BMFG 2GSMB 2EZPA 3HPLC 4MS2A 1QVGU 3K0GA 4FPPA 4QJFB 3A0RA 1MG1A 3WG7B 1EBOA 5EBMC 1K3EA 4OXSA 2JJ1G 3ZRSA 3SPCA 3WG7C 2WLKA 1V55C 2AHZA 1R3IC 2R9IA 1G4YB 1M56C 1P4RA 2EINB 2KB1A 3K04A 3OE7G 5J9PC 2ZDIA 3AG1C 3RBZA 4N21A 4UXNA 4DXWA 3BEHA 3AG4B 5IYDO 1R3JC 2B1GA 4MT8A 1M9NA 4XDKA 4JASA 2CK3G 1FXKA 4BAYA 3LUTB 3VOUA 1VQNV 2JEXA 4X88A 1V55B 1QVFU 3AEIA 3OMNB 4L87A 4LC1A 4YXWG 3ZMSA 5B3SB 1QLEC 2IU3A 3ABUA 3SYQA 1QCEA 3IGAC 3LNMB 1Q7YW 2HVJC 1JJ2U 3RVYA 5EBLC 4J9YB 1PNLA 3G71V 1RM1C 2ZR3A 4XBFA 1VQOV 1JVMA 5B1AB 1OCZB 1KC8W 1ORQC 2UXNA 3PJSK 4JGSA 1NKDA 1QR9A 1GK9A 5EC1C 1MSWD 3SYOA 1M57C 4LP8A 1DF5A 2UXXA 5B1BB 1NVPD 3ZRXA 3E83A 2QA4V 2HVKC 5IY5B 5KUKA 5H6RA 4HZ3A 3ABMC 1H8EG 1OCZC 4MTOA 2DYSB 2DYRB 3MHSC 3X2QB 1RPOA 1PL0A 2DWDC 2ZXWB 4JAVA 2WPDG 4WFFA 3W7UA 4JPRA 1K73W 3P30A 2WLHA 4N23A 3TETA 3GB7C 2B1IA 1QLNA 4MW8A 1OZ0A 4Q20A 4TWKA 2XAGA 1VQPV 1YTFB 4LCUC 1K4CC 3QO5A 2W6JG 1R3LC 3ZRWA 3IFXA 5DM6V 1Y66A 1FXKB 1R6KA 2Q69A 4WFAV 4X89A 5LHIA 1Q86W 1H2GA 4RO2A 1NH2D 1JPXA 1UJWB 4JTDB 2AHYA 4P2ZA 2EIMC 1MOFA 3W7XA 2IW5A 2X7RB 3ASNC 3D36A 5CMUA 3UM7A 1NR1A 1HWYA 4RUFA 4U7OA 4LBEC 1WLEA 3QNEA 1COWG 3CCQV 1KQSU 1S76D 5EK0A 3IC7A 2HG5C 2P6JA 4MTGA 1OCRB 2XAFA 4JTAB 3OGCC 1FXVA 1V54C 1K34A 4JTCB 2A79B 1J95A 3AG2B 3ABTA 2Q67A 3STZC 1BHBA 4FJCC 2Q6AA 2EILB 2IH1C 3G4SV 1K7DA 1AI7A 4WFEA 1CP9A 4MVUA 4TSFG 1K4DC 3JD2A 3K79A 1K97A 3MHHC 3D3IA 3CCJV 2Q68A 2Y69C 2DYRC 3I55V 4PELA 5GW7A 4KUMA 3B8MA 1KP3A 3OR6C 3RW0A 5L3GA 1VQ9V 3ASOC 4R50A 1NR7A 2HLDG 1PKXA 1VQMV 2WLIA 2WWWA 2IJHA 3T1CA 3DTUB 4JYBA 1M57B 1AJNA 4R6ZA 5CBFA 1Q82W 2X6BA 2WLJA 3ETGA 1E79G 4FMTA 1DF4A 3MD0A 3TCUA 2JEUA 2XOKG 3HB3B 1AJQA 5B1NA 1VQLV 3B77A 2D3OW 3ZCCA 1Q81W 5CA3A 2NNUA 3AG2C 4PA4A 3SPIA 1AI4A 1M1KW 3CC2V 4DO2A 5IYBO 3E8GA 4GX1A 1K33A 1W2BU 1SERA 2WLIB 2C2AA 5H9CA 3OEEG 1PD3A 2WLNA 4J9ZB 1K5SA 2QE7G 1YSCA 3B8NA 2QEXV 2DQ3A 3F7YC 4JAUA 4KP4A 4WFGA 3QO8A 3CMEV 3EFFK 2ITDC 3DGEA 4GT1A 4GX0A 1Y4MA 2B5UA 1YI2V 1WPXA 4PDMA 5H6QA 1VQ7V 4MTXA 4WFBV 3OAAG 2OCCB 3AG1B 1H38A 4UUJC 2P67A 5HFLA 2W6IG 3AG3B 3K0DA 3ETDA 1AJPA 1M56B 1S77D 3CCSV 1V54B 4GX5A 1KECA 2IJJA 5KA6A 3ML0A 3W7TA 3SPHA 1XL4A 1FXHA 1THZA 1AI6A 1B6QA 1W0JG 3ZN0A 3BY6A 3FB7C 1ROPA 4QIWF 4P30A 1DLBA 1DTOA 2YEVA 2PI5A 2XASA 5FL7G 2EZOA 3R65A 5C93A 2EBOA 5HFMA 1JOYA 3FYEB 5B1BC 2H94A 1GKFA 4QNHB 1FXKC 2X0LA 3F5WC 4RAIA 5LGUA 4PDRA 3ABLB 5L3FA 5BZBA 3LSQA 1K5QA 1RPRA 3ZRVA 5L3DA 4BW5A 1CPYA 1I5YA 2A0LA 2QM7A 3ZRWB 1JX9A 1OCCB 1FFTB 5B1AC 1KD1W 1GM9A 4FIPC 3OMAB 3F7VC 1SRYA 1VQ6V 1NH2B 4I9WA 4H33A 3ZMTA 1GM7A 5CBGA 1F4NA 3CXCU 2ZDIC 1P7BA 2ZXWC 3ZJZA 2DYSC 2XNDG 1RM1B 2BOBC 3STLC 5LBQA 2ATKC 4MVRA 3T4ZA 5B3SC 1K92A 4RQFA 2V7QG 2IH3C 1H8HG 4BIZA 1ZWIC 2X6CA 1BL8A 3JD1A 3E35A 4G27B 1QBZA 4PA6A 3KG2A 2OCCC 1PNKA 2HJFC 3CCEV 3ABLC 4UV9A 4QE9A 1NJIW 2LP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOF A;  3MHS C;  1SZT A;  4E2L A;  2X7R B;  3B8N A;  3GWO A;  4N21 A;  5CMU A;  1DLB A;  2OT5 A;  1DF4 A;  1Y4M A;  5KA5 A;  1QR8 A;  4FK5 C;  4JPR A;  2EZO A;  3M99 B;  1I5X A;  3P30 A;  3MHH C;  1ENV A;  2EBO A;  2EZP A;  2MK3 A;  4JGS A;  4N23 A;  5CN0 A;  5HFM A;  3B77 A;  2P6J A;  1QR9 A;  1MG1 A;  1EBO A;  5HFL A;  3B8M A;  1DF5 A;  1F23 A;  3H01 A;  3WFV A;  1K34 A;  4FIP C;  1K33 A;  1QBZ A;  3CYO A;  3K9A A;  1QCE A;  3CP1 A;  1I5Y A;  1Y66 A;  5KA6 A;  5H9C A;  1JQ0 A;  4FJC C;  4G2K A;  1JPX A;  4JF3 A;  2LP7 A;  2M7W A; 
#chains in the Genus database with same CATH topology
 2WA3 A;  2QKS A;  2EIN C;  4O4H A;  4J80 A;  4IL6 Z;  4JI0 B;  1Y67 A;  5B1O A;  4GX2 A;  1F4M A;  2R9R B;  1AR4 A;  1ARO P;  1Y6X A;  1SET A;  1XEQ A;  2IJI A;  3A0H Z;  1OJH A;  1WNS A;  1YVW A;  2BSK B;  2KG7 A;  3LNN A;  4GUN A;  5IYC O;  3CMA V;  3CCV V;  5IYZ A;  4JI2 B;  3ZMU A;  3M99 B;  5LA6 B;  1SA0 A;  4WF9 V;  2YIB D;  2UXC B;  1SQF A;  3T4D A;  3Q4H A;  2KSD A;  1YJW V;  1IXB A;  1SQB H;  3CYO A;  5FPO A;  1GRJ A;  4ZOL A;  4H37 A;  1R6T A;  3HR0 A;  2K9P A;  5LL6 Y;  2FTK A;  4XDJ A;  4PA7 A;  5EC2 C;  3P3N A;  4CZZ A;  1SZX A;  2JVD A;  3CHX A;  4O4I B;  5GON A;  2Y48 A;  1XNQ O;  2R9A A;  1S72 V;  5BY1 A;  2YI9 A;  3FB5 C;  4J10 A;  1YTF D;  3S3W A;  2ZQM A;  4NTW A;  3HKC A;  1XL6 A;  3NR7 A;  2Q73 A;  4Z1M G;  1VIB A;  1DGS A;  4ZKI A;  3L9D A;  2NLJ C;  2Q8V A;  3H9V A;  2Q7E A;  3CXH F;  4O4I A;  1S3J A;  4AI8 A;  1OCR C;  4GCZ A;  2WLM A;  1JQ0 A;  5KHK A;  4K0K O;  3CD6 V;  3GWO A;  2Y4U A;  4IGG A;  2WSS G;  4NYK A;  2EIM B;  4NB5 A;  3ASN B;  3J81 N;  4JI4 B;  5IY5 C;  1I94 B;  3K3W A;  4UB8 Z;  2VQF O;  4NKG B;  2ITC C;  1KMI Z;  5LHH A;  4MVM A;  2EIJ C;  1N32 O;  5LA6 A;  2V1D A;  2Z3Y A;  4JYA B;  3J7A U;  1BQ0 A;  1NQT A;  2HR3 A;  1XMO B;  4TV9 B;  4R8C A;  4PDV A;  3M8A A;  4JI6 B;  3RYC B;  1TA8 A;  1QLE B;  2P7T C;  3SJB C;  2ZM6 O;  4CS4 A;  1N32 B;  3E8B A;  3K57 A;  4NXN O;  2F23 A;  1AR1 B;  4FM1 A;  3CCL V;  4I5S A;  3B09 A;  3JD0 A;  3CX5 F;  3AG4 C;  1XMQ O;  3E89 A;  2XAJ A;  4MVS A;  4DK0 A;  3SJQ C;  5C8Y B;  1G8M A;  1J5E O;  2GSM B;  2EZP A;  3OTO O;  1N36 O;  3BA9 A;  4X62 B;  1MZE A;  1MG1 A;  5EBM C;  2GDS A;  2CTP A;  3AK2 A;  1ZL8 A;  3KZI Z;  3JAW A;  3WG7 C;  2PGG A;  1V55 C;  2QDO A;  1EZV H;  2EIN B;  3K04 A;  1MSD A;  2ZDI A;  4LFB O;  1L8D A;  5A2Q N;  1IZ3 A;  5KMG A;  3OGI B;  2B1G A;  1S5J A;  3BPZ A;  1FXK A;  4J7J A;  3LUT B;  3VOU A;  1JJO A;  4BAY A;  4O2A B;  1XNR B;  2JEX A;  4TOI A;  4X88 A;  1RSO B;  3AEI A;  3OMN B;  4H13 B;  1RP3 B;  1EN6 A;  1SA0 B;  3UT5 A;  1Q7Y W;  2HVJ C;  4K3A A;  3RVY A;  5EBL C;  4J9Y B;  1HR0 O;  1PNL A;  1XRE A;  4PV1 B;  2UXN A;  4JGS A;  4KL1 A;  4DV7 O;  3I5D A;  1KBH A;  1WP7 A;  3QTC A;  1N4C A;  1TVK A;  3CRC A;  3JSN A;  5B1B B;  1XMO O;  4LNU B;  1OCZ C;  3SJC C;  2VWK A;  2DYR B;  3X2Q B;  2DWD C;  2ZXW B;  5E79 Z;  1W59 A;  4D7S A;  3TET A;  3GB7 C;  2B1I A;  2M6Y A;  2LW1 A;  1QLN A;  3VQW A;  4JV5 B;  1OZ0 A;  1H2K A;  1IBM B;  3G80 A;  4Q20 A;  1VQP V;  4PI0 A;  2ADQ B;  1K4C C;  2W6J G;  2AGA A;  1IBL B;  1R3L C;  1XOU A;  3IFX A;  5DM6 V;  4X1K A;  2F4V B;  1B04 A;  1NU1 H;  1Q86 W;  5CB4 A;  4FFK A;  3H1J H;  3K58 A;  3ASN C;  4I55 A;  5KHG A;  5LMU B;  1I7F A;  1IX9 A;  3AG2 B;  2YUA A;  2ETN A;  4FJC C;  5DEC A;  5BMV A;  4LF4 O;  4O2B B;  2CTQ A;  1K7D A;  4GZR B;  1CP9 A;  4I7Z B;  3JAK A;  1XDC A;  3IC9 A;  2Q68 A;  2Y69 C;  4NXM B;  2DYR C;  2IM9 A;  5K1X A;  4PEL A;  2WA4 A;  5GW7 A;  4GYC B;  4CS2 A;  5L3G A;  2WLI A;  2XTA A;  5EZY B;  3H1K H;  4TUY B;  4X64 O;  4DUZ B;  1TUB B;  2WLJ A;  1U96 A;  1DF4 A;  2P5O A;  4DV7 B;  4JI5 O;  3HB3 B;  1VQL V;  3B77 A;  3G67 A;  2NNU A;  3A0B Z;  5IYB O;  1WP8 A;  2QR4 A;  1O9H A;  5CB4 B;  2HHH O;  4KXR A;  4KHP B;  1QQC A;  1GN6 A;  1NI8 A;  3OEE G;  1PD3 A;  2WLN A;  2DMX A;  3B8N A;  4K8X A;  1ZL8 B;  3HKE A;  5H5N A;  3EFF K;  3UO2 A;  1Y74 B;  1VQ7 V;  3ZHT A;  3AG1 B;  4UUJ C;  2EX3 A;  3K0D A;  2GBO A;  3ETD A;  2ARH A;  3CCS V;  2IBZ H;  5KA6 A;  3B4S A;  3W7T A;  1GN3 A;  1Z5V A;  1XL4 A;  3BA8 A;  4B3R B;  1W0J G;  3BY6 A;  3FB7 C;  3HKC B;  3OD4 A;  4OX9 O;  5JVD B;  4P30 A;  2N74 A;  2XAS A;  5FL7 G;  2EZO A;  5LXT A;  3T1Y O;  4DV6 B;  5HFM A;  3ICX A;  4CS3 A;  5IWA B;  1QU7 A;  2UU9 B;  2H94 A;  1GKF A;  4QNH B;  1FXK C;  4W4K A;  3F5W C;  5L3F A;  4OPH A;  5BZB A;  3LSQ A;  1K5Q A;  1RPR A;  2Q9L A;  2ZT9 B;  4LWS A;  5L3D A;  3RYC A;  2AXT Z;  4LF5 O;  1H2L A;  1XIL A;  4NXM O;  1D5A A;  2ZE7 A;  4X1I A;  5CBG A;  2ZXW C;  3ZJZ A;  3JAM N;  1N36 B;  2ATK C;  4CC6 A;  5CA1 B;  3U11 A;  2IH3 C;  1H8H G;  1WB7 A;  1TAE A;  1BL8 A;  3WU2 Z;  2FYU H;  3UO3 A;  4X64 B;  4G27 B;  4DUZ O;  2B9Z A;  1YEW A;  1Q90 D;  5EYP A;  1MNG A;  3ABL C;  2KKW A;  4UV9 A;  2LP7 A;  3JAW B;  2JRI A;  5KHH A;  1SZT A;  4LWS B;  5IDJ A;  5H2F Z;  3AK3 A;  2VQE O;  1XUQ A;  2JK5 C;  5IJ9 B;  2BCC H;  2VS0 A;  2BSK A;  3JAK B;  2P06 A;  1VQ8 V;  3OEH G;  3OT7 A;  3WB2 A;  3UT5 B;  2QWP B;  3KCY A;  1Q6U A;  3SYC A;  4JYY A;  3JD4 A;  3TJT A;  1RSO A;  3TXS A;  3L72 H;  4E2L A;  3OUF A;  4AQY O;  1L0L H;  2L6L A;  1M90 W;  2NR5 A;  5JJN B;  3SDL A;  1WA8 A;  2JS5 A;  3ASO B;  4MSW C;  2Z5U A;  5IJ9 A;  4LFA O;  1BQZ A;  3FAV B;  4NVP A;  3CRM A;  1K8A W;  5BR8 O;  2DWE C;  3RWR D;  4IYI A;  1NBM G;  3LSS A;  1SQG A;  4QE7 A;  3D36 C;  4ZHQ B;  2JDI G;  2UU9 O;  1HNX O;  2QTS A;  3W7W A;  2EJR A;  1OCC C;  1BHA A;  3TGU H;  4TT3 G;  2CTW A;  3JCZ A;  3K5M A;  1XQ8 A;  4Q6G A;  4JI7 O;  3QVN A;  3D3Q A;  3N2K B;  2G38 A;  2QTO A;  3OM3 B;  4JI0 O;  4FM0 A;  3A8T A;  1SES A;  4O2A A;  1SQX H;  4UCV A;  4ASU G;  2FB5 A;  1N34 B;  4JYA O;  3ETE A;  2QWQ B;  5F2V O;  4LF5 B;  5IE9 A;  1M5I A;  3R66 A;  1NT2 B;  1WB8 A;  3H1I H;  5EZY A;  5JVD A;  3JAT B;  4WFH A;  4J11 A;  4JI2 O;  2F95 B;  2MK3 A;  5E1A C;  2GHY A;  2ZNI A;  1LNQ A;  3AG3 C;  2EIJ B;  4LF6 O;  4IT5 A;  5IT9 N;  3CC7 V;  4QPJ A;  2F66 C;  2HFE C;  1GO3 F;  3O65 A;  5KX5 A;  4X1Y A;  1E1R G;  4I4T B;  2ZD9 A;  2XHB A;  4DV4 B;  1T5E A;  3TK1 A;  2LO1 A;  2ZE5 A;  2OYQ A;  2OTL V;  3HKE B;  2UXB O;  1YHQ V;  3LDD A;  4X65 O;  3ABK C;  1B3Q A;  1EFR G;  4YIP A;  5EIB C;  3OFN G;  3K08 A;  5CN0 A;  1YIT V;  2DQ0 A;  2YID A;  4LFB B;  2Y0I A;  4LH7 A;  5LGT A;  3E86 A;  3ETQ A;  3OW2 U;  2N05 A;  3ZMZ A;  5J2T B;  1Y74 A;  3H01 A;  1OCO B;  3T2M A;  1YJ9 V;  1AIL A;  1R3K C;  2X6A A;  4H0L B;  4JF3 A;  4QPK A;  4YHH B;  1GMG A;  4FLZ A;  4RQE A;  2RN9 A;  2Q7H A;  1YJN V;  2A7W A;  5KHI A;  5EBW C;  1X59 A;  4BIU A;  3CS5 A;  1ZAU A;  1Q6I A;  5BR8 B;  3CCU V;  4IHJ B;  3O9O A;  1VF6 A;  3MDS A;  4HAM A;  1KUQ A;  2LJ2 A;  1GM8 A;  2CH7 A;  1VF6 C;  1BE3 H;  2ILM A;  3IJ4 A;  1F7Y A;  1JFF A;  2W0X A;  1BMF G;  4X9Q A;  3HPL C;  4MS2 A;  3TXQ A;  4QJF B;  5J2U B;  2F93 B;  3EVK A;  5D5P A;  1I94 O;  4DV0 B;  1Q8I A;  2WLK A;  3L75 H;  4FLT A;  1FFX B;  1G4Y B;  1P4R A;  1TGO A;  1D5N A;  2DJV A;  3AG1 C;  3RBZ A;  4DXW A;  1MMM A;  1XBL A;  2YIA A;  3BEH A;  2CK3 G;  4GKJ B;  2E75 B;  3JAL B;  2CGO A;  4JI6 O;  1QVF U;  4L87 A;  4LC1 A;  3FFQ A;  2UUA B;  4PHZ A;  1QCE A;  3LNM B;  3ZHV A;  1JJ2 U;  1N33 B;  5JQG A;  4DK1 A;  1VQO V;  1JVM A;  2E5L O;  5ITZ A;  5B1A B;  4YJ2 A;  4LF7 O;  1ORQ C;  4CH4 A;  2RDC A;  1NKD A;  3T1H B;  1ZUQ A;  4LR3 A;  1MSW D;  1WN7 A;  3SYO A;  3U10 A;  5KX5 B;  2UXX A;  1FYJ A;  2UXC O;  3ZRX A;  4X66 O;  3RYI B;  2UUB B;  5KUK A;  2GTS A;  4HZ3 A;  1L0N H;  3MHS C;  1FJG B;  2CTR A;  3T1H O;  1KYO F;  1K73 W;  3VQY A;  2PZS A;  2GTA A;  4DR7 B;  2GV9 A;  2XAG A;  4YY3 O;  3ZRW A;  5FNV B;  1Y66 A;  1FXK B;  3JAL A;  1H2G A;  4DRX B;  2UUC B;  2O57 A;  4P2Z A;  2EIM C;  1BCC H;  2OCH A;  2IW5 A;  3D36 A;  4IIJ B;  4U7O A;  4DR3 O;  4DV0 O;  4LBE C;  4KHP O;  4MTG A;  1OCR B;  3CRR A;  3OGC C;  1AR5 A;  1K34 A;  4LF9 O;  4FLX A;  3ABT A;  5JCO C;  3STZ C;  1Y76 B;  3JSL A;  1R1B A;  2EIL B;  3BVO A;  4DUY B;  3G4S V;  4C7U A;  4DR2 B;  1SS3 A;  1JR9 A;  3G6B A;  3K79 A;  1VEW A;  3RT3 C;  4LNU A;  3D3I A;  4IYH A;  1KP3 A;  1IBM O;  2YXH A;  1JMK C;  4R50 A;  1NR7 A;  2HLD G;  4B3T B;  4DV3 O;  1PKX A;  1N0J A;  4DUY O;  4DR2 O;  3DTU B;  4JZ2 A;  1Q82 W;  4B3S O;  1E79 G;  3MD0 A;  1PM9 A;  3N2G B;  4ICG A;  4X1K B;  1AJQ A;  2PUS A;  4BR6 A;  2ZE6 A;  3VQV A;  2Q4P A;  3AG2 C;  4UCU A;  3SPI A;  3CC2 V;  2N04 A;  1K33 A;  4I50 B;  1SER A;  2C2A A;  4ZOL B;  2QEX V;  1YSC A;  3N2K A;  4WFG A;  3L74 H;  3CME V;  3DGE A;  4GT1 A;  1AVM A;  1SQV H;  4NXN B;  4I50 A;  4YY3 B;  2QKC A;  4GKJ O;  4WFB V;  1WAZ A;  3N27 A;  1H38 A;  4CH6 A;  3OTO B;  2F1M A;  2W6I G;  4FFB A;  4DV1 O;  3DSQ A;  4GX5 A;  4TQD A;  5JH7 B;  2KG7 B;  4W4L A;  3ZHS A;  1FXH A;  5KAF Z;  1THZ A;  1ROP A;  2HEP A;  4O2B A;  4LF6 B;  1DLB A;  1DTO A;  2HJD A;  2PTM A;  5C93 A;  1JOY A;  2YI8 A;  2X0L A;  1X4T A;  1IBK B;  3WB0 A;  3ZRV A;  4BW5 A;  2A0L A;  3CSX A;  2P22 C;  3ZRW B;  1OCC B;  2Q5Z A;  3BFR A;  1FFT B;  5B1A C;  1KD1 W;  1PP9 H;  2YC0 A;  4H33 A;  1EN5 A;  5JH7 A;  4NTY A;  5LBQ A;  4FLY A;  4MVR A;  3T4Z A;  4RQF A;  1HNX B;  2V7Q G;  3HKD A;  1QBZ A;  1PNK A;  2HJF C;  3CCE V;  5LP6 C;  4ABM A;  3U0Z A;  3OMI B;  5KA5 A;  1Q5O A;  5FNV A;  3BCC H;  4X1I B;  1S0V A;  2L35 A;  2F43 G;  4TUY A;  3CC4 V;  3E2E A;  4YJ3 A;  4LF8 O;  1J5E B;  5JQG B;  2YSU B;  1AP6 A;  2JGD A;  2VQE B;  3K9A A;  2Q0O C;  4P9P A;  1AB3 A;  1BSM A;  5D5Q A;  3G6E V;  1XHZ A;  4YJ3 B;  3FB6 C;  1MA1 A;  1YCI A;  2CUG A;  2UXB B;  1NTK H;  4AQY B;  2ZIM A;  1HNW O;  4CBC A;  4DV3 B;  4DV4 O;  2PYJ A;  3ZN1 A;  3RGB A;  4B3M B;  4UVA A;  4ZBM A;  1NVP B;  1GN2 A;  4FZ1 A;  4X20 A;  4TV8 B;  2E3C A;  2WAM A;  2NN4 A;  1WA8 B;  2EIL C;  1YDX A;  3BAA A;  1OCO C;  1I08 A;  4O4L B;  2CGN A;  1YIJ V;  3JAR A;  4BIO A;  1URF A;  5CBH A;  3C3T A;  4IIJ A;  4U7N A;  2LW7 A;  4LF7 B;  3E8F A;  3CCM V;  4PD4 F;  1BT8 A;  2CDY A;  3ABK B;  1P84 F;  4K8Z A;  4K0K B;  3SYP A;  2P90 A;  4A5U B;  4DR3 B;  2ZIN A;  3C3S A;  2WLL A;  1N8R W;  3OR7 C;  2ZCE A;  5J2U A;  3SR2 C;  4K35 A;  4LH6 A;  1N0N A;  2PY5 A;  4DR4 B;  5BXZ A;  1GTO A;  1PNM A;  1AI5 A;  5FLX N;  1G6U A;  2E74 B;  4EKW A;  1JCH A;  3I56 V;  2RJZ A;  4JZG A;  1MZF A;  3X2Q C;  4MTF A;  4KFM A;  1YF2 A;  5LMN B;  1I5X A;  3CRQ A;  3B40 A;  4ZIB A;  5JJJ B;  3W7S A;  2W0F C;  2ZE8 A;  1FS0 G;  1KKD A;  4FLU A;  1M93 A;  2Q0A A;  1NTM H;  3K03 A;  3N2G A;  3BAB A;  1XHX A;  2A3Q A;  4D6T H;  2MW2 B;  4UVB A;  4Z1V A;  1ZLZ A;  3VBB A;  2DW4 A;  4I55 B;  1SF9 A;  1QR8 A;  1OHH G;  3EHB B;  4R7C A;  2ADP A;  3FYI B;  1I0H A;  5B66 Z;  1IXM A;  5J2T A;  1U97 A;  4J42 A;  1KU9 A;  1F23 A;  2LFR A;  3K06 A;  1EN4 A;  3SPG A;  4DV6 O;  1P7G A;  2IJK A;  2QSA A;  4MVZ A;  2R72 A;  3RYF A;  4MW3 A;  1R73 A;  1GH6 A;  5KUM A;  1VAR A;  5GTH Z;  1K9M W;  1W0K G;  1FFX A;  4HYO A;  4OGQ B;  1QVG U;  3DXR A;  3K0G A;  3WB1 A;  3RYF B;  4CH5 A;  3A0R A;  3WG7 B;  1K3E A;  1Q6H A;  4JI5 B;  4FFB B;  2JJ1 G;  4ZHQ A;  3ZRS A;  4F6R A;  1NTZ H;  1FJG O;  1R3I C;  3CB2 A;  1M56 C;  2YS8 A;  4DR7 O;  3K9S A;  3OE7 G;  5J9P C;  4N21 A;  1WPB A;  1R3J C;  4MT8 A;  4I0X B;  1JA8 A;  1PPJ H;  1VQN V;  2ODM A;  1V55 B;  2AZ0 A;  1TUB A;  4YXW G;  4U3F H;  4DW0 A;  3ZMS A;  1QLE C;  2IU3 A;  3SYQ A;  2E76 B;  2H3O A;  3G71 V;  4XBF A;  4I0X A;  1FKA O;  1OCZ B;  5KMG B;  3PJS K;  3RYH B;  2OIE A;  2PYL A;  4CH3 A;  1QR9 A;  1GK9 A;  5EC1 C;  3UQ8 A;  2LGW A;  3T1Y B;  2GUZ A;  1M57 C;  4LP8 A;  1DF5 A;  1NVP D;  3E83 A;  3GWK C;  2HVK C;  2YXY A;  5LYJ A;  5IY5 B;  5H6R A;  3J80 N;  5EYP B;  3ABM C;  1US6 A;  3CJH A;  3AG7 A;  4O4H B;  4NR1 A;  4YJ2 B;  2DYS B;  1RPO A;  1PL0 A;  2VRZ A;  1PV0 A;  5ITZ B;  2YIB A;  4WFF A;  4JPR A;  2WLH A;  1Z5W A;  1FAF A;  3IAY A;  4B3S B;  2AZ2 A;  2DOS A;  4LF8 B;  2XUM A;  2UUA O;  4DV2 B;  4Z2W A;  1R6K A;  1QHT A;  4BWA A;  3HKB A;  4RO2 A;  1NS1 A;  5LP6 A;  1JPX A;  1UJW B;  3CEI A;  1IUR A;  3W7X A;  1Z2G A;  5IJ0 A;  1NR1 A;  1HWY A;  1N34 O;  2JS3 A;  3QNE A;  4UCT A;  5EK0 A;  3IC7 A;  2P4V A;  3HKB B;  1FD9 A;  4JTA B;  1FXV A;  1V54 C;  1H2M A;  3CRA A;  4ZI7 B;  4PI2 A;  2A79 B;  4B7K A;  2Q67 A;  1BHB A;  2F4V O;  4I4T A;  4B3M O;  2IH1 C;  4X1Y B;  4DV1 B;  5B5E Z;  4TSF G;  1K4D C;  1QNM A;  3MHH C;  4AHC A;  2YXL A;  4EFE A;  1XNR O;  3B8M A;  4O4J B;  3OR6 C;  1VQ9 V;  3ASO C;  1XMQ B;  2CH7 B;  2JGD B;  3T1C A;  1AJN A;  4R6Z A;  5CBF A;  2BE3 A;  3ETG A;  3ZHQ A;  3TCU A;  1HNW B;  2JEU A;  2XOK G;  5AG2 A;  5B1N A;  2D3O W;  3ZCC A;  1Q81 W;  2HP8 A;  5CA3 A;  5GTI Z;  4PA4 A;  4FZ0 A;  1M1K W;  1HNZ B;  5LOV B;  3OTF A;  1W2B U;  4LF9 B;  2WLI B;  4J41 A;  2QE7 G;  1S5L Z;  2DQ3 A;  4JAU A;  4DR6 B;  4KP4 A;  3UCS C;  4UB6 Z;  3FAV A;  2B5U A;  4JI4 O;  5FPR A;  1WPX A;  4PDM A;  5H6Q A;  4TV8 A;  5LXT B;  1HNZ O;  4DV2 O;  3OAA G;  1SC5 B;  5LOV A;  4DV5 B;  2RMK B;  3AG3 B;  1UFI A;  1V54 B;  4UCS A;  1IBL O;  3ML0 A;  4DYL A;  3SPH A;  1B6Q A;  4EB6 A;  3ZED A;  1CXZ B;  2YEV A;  4BW9 A;  3R65 A;  2EBO A;  3FYE B;  5B1B C;  3THO A;  3M7M X;  3L70 H;  4RAI A;  1SQP H;  3DC6 A;  4PDR A;  5LP6 B;  4PJ0 Z;  1CPY A;  4EB6 B;  4B08 A;  3VQX A;  4FM2 A;  1SRY A;  4I9W A;  1FPO A;  4OPA A;  1GM7 A;  3CXC U;  2ZDI C;  4DR1 B;  4X62 O;  1RM1 B;  2E5L B;  1G1X B;  1K92 A;  2RNB A;  4BIZ A;  2X6C A;  3E35 A;  3AK1 A;  4PA6 A;  3KG2 A;  2XT9 A;  4QE9 A;  2CE4 A;  3FX7 A;  4DW1 A;  3MAQ A;  1MAB G;  2WLL B;  4WCE V;  1P49 A;  2JJ2 G;  2XAH A;  3UKM A;  2BOC C;  1VF5 B;  1S5H C;  4CC5 A;  3CP1 A;  1LUW A;  3JAR B;  1TUE B;  2DN9 A;  3SPJ A;  4PA9 A;  1TVK B;  4DR4 O;  4F4L A;  1F51 A;  4PDL A;  5CA0 B;  2UUC O;  1EZJ A;  2HKO A;  5L3E A;  3JCU Z;  1CEZ A;  2IU0 A;  4MVQ A;  3L73 H;  3RYH A;  3E22 A;  2PF4 E;  4O4L A;  5EIB D;  1L1F A;  4F6R B;  1YXB A;  2JIZ G;  4JV5 O;  2Z0A A;  1SKV A;  2M7W A;  4UV8 A;  3SJA C;  4GKK O;  1R6N A;  2EIK B;  3ZMV A;  4UCR A;  4FK5 C;  3CPW U;  1GAX A;  2EIK C;  4J7Z A;  4MVO A;  1KKC A;  4JI3 O;  5CA1 A;  5IWA O;  5IYZ B;  2VQF B;  3E22 B;  1V9P A;  4UVC A;  3SYA A;  2OWO A;  1NZ6 A;  4LFC O;  2RCV A;  2LQT A;  5CA0 A;  2D2C B;  3PN1 A;  3QO7 A;  4B3T O;  3LDE A;  1LUV A;  2YEV B;  2A9H A;  4XDL A;  5KAI Z;  1XI1 A;  1M4U A;  1H2N A;  5DED A;  4JI3 B;  1PL4 A;  3RVZ A;  4JI7 B;  4QGP A;  3SGI A;  3APO A;  4LF4 B;  1HR0 B;  1E1Q G;  3ZHU A;  1IVS A;  3EXA A;  3CCR V;  3RYI A;  1VQK V;  4RUE A;  2UXD B;  1B06 A;  1EM1 A;  3JYC A;  2EJ7 A;  2QM8 A;  4X8A A;  4G28 B;  3HKD B;  3RN4 A;  3K5N A;  5K1P A;  2QGN A;  3FKS G;  1VQ4 V;  4YIO A;  3FB8 C;  4RWU A;  1ENV A;  3ZBH A;  5L3C A;  5LHG A;  3ZIA G;  2Y4T A;  4P9O A;  4EEQ A;  5DN6 G;  4UCO A;  5KHJ A;  3WFV A;  2OTJ V;  3ZX6 A;  1BZK A;  3OUS A;  3QG5 A;  3DC5 A;  4G2K A;  3P32 A;  1VQ5 V;  1VMG A;  4UFZ A;  3C90 A;  3LDC A;  3Q4H B;  3BHP A;  1AP5 A;  5LGN A;  2OIG A;  3E8H A;  2LFS A;  3JD3 A;  4PA3 A;  2XAQ A;  4DRX A;  4EFB A;  4GKK B;  2Y69 B;  2RQ6 A;  2FL4 A;  3ABM B;  1ZTE A;  5L3B A;  4LFA B;  2H8P C;  2ZR2 A;  2K1E A;  1KP2 A;  5LMU O;  5LYJ B;  2PI4 A;  2OT5 A;  4AIL C;  4JYC A;  3NXS A;  2BTQ A;  4FLV A;  5BMV B;  1VF7 A;  4FPP A;  1EBO A;  4OXS A;  2LGQ A;  1Q43 A;  4FLW A;  3SPC A;  2ZKO A;  2AHZ A;  2FML A;  4GLX A;  4TQF A;  2KB1 A;  2R9I A;  2DE0 X;  2CAZ C;  1HW7 A;  4E4E A;  4UXN A;  4WBN B;  3AG4 B;  5IYD O;  1M9N A;  4XDK A;  3H1L H;  4JAS A;  3ZHR A;  3QF7 A;  1YZB A;  1WJZ A;  2QM4 A;  5GON B;  4DR6 O;  3P3P A;  2UXD O;  5B3S B;  3ABU A;  3IGA C;  3JAS A;  5JWP A;  2ZM6 B;  3H1H H;  1RM1 C;  2ZR3 A;  4J7K A;  4DR1 O;  4WBN A;  1KC8 W;  4JAA A;  4HNA A;  4FVM A;  2BTO A;  2QA4 V;  1HP8 A;  5JJE B;  1H8E G;  4HNA B;  2VWJ A;  1N33 O;  4MTO A;  4B7E A;  3S3X A;  4YHH O;  2QJ1 A;  4JAV A;  1JFF B;  2QWN B;  2WPD G;  3W7U A;  3P30 A;  4N23 A;  3LSU A;  4MW8 A;  2QWO B;  3F5T A;  4TWK A;  1YTF B;  4LCU C;  3QO5 A;  1UPG A;  3BRC A;  3K59 A;  1OV9 A;  2Q69 A;  4X89 A;  4WFA V;  3RFR A;  5LHI A;  4X65 B;  1NH2 D;  1KB9 F;  4JTD B;  2AHY A;  1MOF A;  2X7R B;  1O9G A;  5CMU A;  3UM7 A;  4D7T A;  4RUF A;  3KCX A;  1WLE A;  1COW G;  3KKY A;  3CCQ V;  1GN4 A;  1KQS U;  1S76 D;  1BS3 A;  2HG5 C;  2Q7G A;  2R70 A;  2P6J A;  2XAF A;  4O4J A;  3K5O A;  4JTC B;  4NTX A;  1J95 A;  2Q6A A;  2YDE A;  4JI8 O;  4JI1 O;  1AI7 A;  4WFE A;  2BTQ B;  3ZS8 C;  2QWR B;  4MVU A;  3JD2 A;  2ZIO A;  1K97 A;  3FD9 A;  3CCJ V;  4DR5 O;  1ZX3 A;  3I55 V;  4ZI7 A;  4KUM A;  5C8Y A;  3RW0 A;  2GUZ B;  4U3J B;  4LFC B;  1VQM V;  1SQQ H;  2WWW A;  2IJH A;  4JI1 B;  4JYB A;  1M57 B;  4B3R O;  3GVM A;  4H44 B;  4TV9 A;  4OX9 B;  1BGY H;  3K5L A;  2X6B A;  3APQ A;  4FMT A;  4L8J A;  2ZNJ A;  3JAS B;  1AI4 A;  1Q3E A;  4DO2 A;  3E8G A;  4GX1 A;  5H9C A;  4F6E A;  4J9Z B;  1K5S A;  3F7Y C;  1H2S B;  3QO8 A;  2ITD C;  2A06 H;  4GX0 A;  1Y4M A;  1YI2 V;  3CJH B;  4MTX A;  2OCC B;  2P67 A;  5HFL A;  1AJP A;  1M56 B;  1S77 D;  3B2E E;  1ZSP A;  1Y76 A;  1KEC A;  2IJJ A;  2QKA A;  1VP7 A;  3CE2 A;  4DV5 O;  1AI6 A;  3ZN0 A;  3D8C A;  3L71 H;  4QIW F;  3JAT A;  1IDS A;  2PI5 A;  4U3J A;  4X66 B;  2UUB O;  3A2F A;  4I9Q A;  1HDJ A;  4IHJ A;  5LMN O;  5LGU A;  3ABL B;  2YIC A;  5A9G A;  2EUL A;  1I5Y A;  2QM7 A;  1JX9 A;  4JI8 B;  4HBN A;  1GM9 A;  4FIP C;  2HHH B;  3OMA B;  4DR5 B;  1A32 A;  2FKX A;  3F7V C;  1VQ6 V;  1RFY A;  5IJ0 B;  1NH2 B;  1XNQ B;  4X20 B;  3ZMT A;  1F4N A;  1P7B A;  5KLV H;  2DYS C;  2XND G;  2BOB C;  2KQX A;  3STL C;  1LR1 A;  5B3S C;  2Y0P A;  5JCO A;  3CWB H;  1ZWI C;  3JD1 A;  1DK1 A;  1IBK O;  2JGU A;  1D2D A;  2P4K A;  3DXR B;  2AW9 A;  2OCC C;  5TIS Z;  2V4D A;  1NJI W; 
#chains in the Genus database with same CATH homology
 1SZT A;  3OMI B;  5IDJ A;  2QKS A;  2EIN C;  5KA5 A;  2JK5 C;  1S0V A;  1MAB G;  2WLL B;  4WCE V;  2JJ2 G;  2XAH A;  2F43 G;  5B1O A;  3UKM A;  3CC4 V;  4GX2 A;  1VQ8 V;  3E2E A;  2BOC C;  2YSU B;  1F4M A;  1S5H C;  3OEH G;  2R9R B;  1ARO P;  3K9A A;  3CP1 A;  1SET A;  4P9P A;  2IJI A;  3SYC A;  3JD4 A;  5IYC O;  3CMA V;  4E2L A;  3OUF A;  3CCV V;  3G6E V;  3ZMU A;  1M90 W;  1TUE B;  3SPJ A;  3M99 B;  4PA9 A;  3FB6 C;  4WF9 V;  4F4L A;  1F51 A;  4PDL A;  1EZJ A;  2HKO A;  5L3E A;  1CEZ A;  3ASO B;  4MSW C;  2Z5U A;  2IU0 A;  3T4D A;  4MVQ A;  1YJW V;  4CBC A;  3CYO A;  1K8A W;  2DWE C;  3ZN1 A;  1NBM G;  3LSS A;  1L1F A;  2JIZ G;  4QE7 A;  4UVA A;  4H37 A;  2JDI G;  4ZBM A;  2M7W A;  4UV8 A;  1NVP B;  1R6N A;  2EIK B;  3W7W A;  2EJR A;  3ZMV A;  2FTK A;  1OCC C;  1BHA A;  2WAM A;  4XDJ A;  4FK5 C;  4TT3 G;  4PA7 A;  2EIL C;  3JCZ A;  5EC2 C;  3CPW U;  4CZZ A;  1OCO C;  2QTO A;  2EIK C;  3OM3 B;  4MVO A;  2Y48 A;  1SES A;  4UVC A;  3SYA A;  1YIJ V;  4ASU G;  3ETE A;  5CBH A;  1S72 V;  4U7N A;  3FB5 C;  3QO7 A;  3E8F A;  3CCM V;  1YTF D;  3ABK B;  3LDE A;  2YEV B;  2A9H A;  2ZQM A;  3SYP A;  4XDL A;  4WFH A;  2P90 A;  1XL6 A;  3RVZ A;  2WLL A;  2MK3 A;  5E1A C;  4Z1M G;  2GHY A;  1N8R W;  3OR7 C;  1LNQ A;  3AG3 C;  1E1Q G;  2EIJ B;  4ZKI A;  3CCR V;  3CC7 V;  2NLJ C;  4QPJ A;  1VQK V;  4RUE A;  2HFE C;  1GO3 F;  1S3J A;  1GTO A;  1OCR C;  4GCZ A;  1PNM A;  1AI5 A;  2WLM A;  3JYC A;  1JQ0 A;  2QM8 A;  1E1R G;  4EKW A;  2ZD9 A;  4X8A A;  4G28 B;  1JCH A;  3I56 V;  3TK1 A;  2OTL V;  3CD6 V;  3GWO A;  1YHQ V;  3LDD A;  3X2Q C;  3FKS G;  4MTF A;  1VQ4 V;  2WSS G;  4KFM A;  3ABK C;  3FB8 C;  2EIM B;  1EFR G;  1I5X A;  1ENV A;  3OFN G;  3K08 A;  5CN0 A;  5L3C A;  5LHG A;  3ASN B;  1YIT V;  2DQ0 A;  3ZIA G;  5LGT A;  3E86 A;  5IY5 C;  3OW2 U;  3K3W A;  4P9O A;  3ZMZ A;  3W7S A;  2W0F C;  5DN6 G;  3H01 A;  1OCO B;  2ITC C;  3WFV A;  1FS0 G;  1KKD A;  3T2M A;  5LHH A;  2OTJ V;  4MVM A;  1YJ9 V;  2EIJ C;  3OUS A;  4G2K A;  1R3K C;  2V1D A;  2X6A A;  2Z3Y A;  3K03 A;  3P32 A;  4JF3 A;  4QPK A;  1VQ5 V;  1GMG A;  3LDC A;  4UVB A;  1NQT A;  3VBB A;  4RQE A;  2DW4 A;  1YJN V;  1QR8 A;  5LGN A;  1OHH G;  2HR3 A;  3EHB B;  4R7C A;  3FYI B;  5EBW C;  3E8H A;  4R8C A;  2LFS A;  4PDV A;  3JD3 A;  4PA3 A;  1IXM A;  4BIU A;  2XAQ A;  1QLE B;  2P7T C;  1F23 A;  2LFR A;  2Y69 B;  3E8B A;  3ABM B;  3CCU V;  3K06 A;  5L3B A;  3SPG A;  1AR1 B;  2H8P C;  2ZR2 A;  3CCL V;  4I5S A;  2IJK A;  2K1E A;  4HAM A;  4MVZ A;  1KP2 A;  3JD0 A;  4MW3 A;  3AG4 C;  1R73 A;  5KUM A;  1GM8 A;  1K9M W;  1W0K G;  2PI4 A;  3E89 A;  2OT5 A;  2XAJ A;  4JYC A;  3NXS A;  4HYO A;  4MVS A;  3SJQ C;  1G8M A;  1BMF G;  2GSM B;  2EZP A;  3HPL C;  4MS2 A;  1QVG U;  3K0G A;  4FPP A;  4QJF B;  3A0R A;  1MG1 A;  3WG7 B;  1EBO A;  5EBM C;  1K3E A;  4OXS A;  2JJ1 G;  3ZRS A;  3SPC A;  3WG7 C;  2WLK A;  1V55 C;  2AHZ A;  1R3I C;  2R9I A;  1G4Y B;  1M56 C;  1P4R A;  2EIN B;  2KB1 A;  3K04 A;  3OE7 G;  5J9P C;  2ZDI A;  3AG1 C;  3RBZ A;  4N21 A;  4UXN A;  4DXW A;  3BEH A;  3AG4 B;  5IYD O;  1R3J C;  2B1G A;  4MT8 A;  1M9N A;  4XDK A;  4JAS A;  2CK3 G;  1FXK A;  4BAY A;  3LUT B;  3VOU A;  1VQN V;  2JEX A;  4X88 A;  1V55 B;  1QVF U;  3AEI A;  3OMN B;  4L87 A;  4LC1 A;  4YXW G;  3ZMS A;  5B3S B;  1QLE C;  2IU3 A;  3ABU A;  3SYQ A;  1QCE A;  3IGA C;  3LNM B;  1Q7Y W;  2HVJ C;  1JJ2 U;  3RVY A;  5EBL C;  4J9Y B;  1PNL A;  3G71 V;  1RM1 C;  2ZR3 A;  4XBF A;  1VQO V;  1JVM A;  5B1A B;  1OCZ B;  1KC8 W;  1ORQ C;  2UXN A;  3PJS K;  4JGS A;  1NKD A;  1QR9 A;  1GK9 A;  5EC1 C;  1MSW D;  3SYO A;  1M57 C;  4LP8 A;  1DF5 A;  2UXX A;  5B1B B;  1NVP D;  3ZRX A;  3E83 A;  2QA4 V;  2HVK C;  5IY5 B;  5KUK A;  5H6R A;  4HZ3 A;  3ABM C;  1H8E G;  1OCZ C;  4MTO A;  2DYS B;  2DYR B;  3MHS C;  3X2Q B;  1RPO A;  1PL0 A;  2DWD C;  2ZXW B;  4JAV A;  2WPD G;  4WFF A;  3W7U A;  4JPR A;  1K73 W;  3P30 A;  2WLH A;  4N23 A;  3TET A;  3GB7 C;  2B1I A;  1QLN A;  4MW8 A;  1OZ0 A;  4Q20 A;  4TWK A;  2XAG A;  1VQP V;  1YTF B;  4LCU C;  1K4C C;  3QO5 A;  2W6J G;  1R3L C;  3ZRW A;  3IFX A;  5DM6 V;  1Y66 A;  1FXK B;  1R6K A;  2Q69 A;  4WFA V;  4X89 A;  5LHI A;  1Q86 W;  1H2G A;  4RO2 A;  1NH2 D;  1JPX A;  1UJW B;  4JTD B;  2AHY A;  4P2Z A;  2EIM C;  1MOF A;  3W7X A;  2IW5 A;  2X7R B;  3ASN C;  3D36 A;  5CMU A;  3UM7 A;  1NR1 A;  1HWY A;  4RUF A;  4U7O A;  4LBE C;  1WLE A;  3QNE A;  1COW G;  3CCQ V;  1KQS U;  1S76 D;  5EK0 A;  3IC7 A;  2HG5 C;  2P6J A;  4MTG A;  1OCR B;  2XAF A;  4JTA B;  3OGC C;  1FXV A;  1V54 C;  1K34 A;  4JTC B;  2A79 B;  1J95 A;  3AG2 B;  3ABT A;  2Q67 A;  3STZ C;  1BHB A;  4FJC C;  2Q6A A;  2EIL B;  2IH1 C;  3G4S V;  1K7D A;  1AI7 A;  4WFE A;  1CP9 A;  4MVU A;  4TSF G;  1K4D C;  3JD2 A;  3K79 A;  1K97 A;  3MHH C;  3D3I A;  3CCJ V;  2Q68 A;  2Y69 C;  2DYR C;  3I55 V;  4PEL A;  5GW7 A;  4KUM A;  3B8M A;  1KP3 A;  3OR6 C;  3RW0 A;  5L3G A;  1VQ9 V;  3ASO C;  4R50 A;  1NR7 A;  2HLD G;  1PKX A;  1VQM V;  2WLI A;  2WWW A;  2IJH A;  3T1C A;  3DTU B;  4JYB A;  1M57 B;  1AJN A;  4R6Z A;  5CBF A;  1Q82 W;  2X6B A;  2WLJ A;  3ETG A;  1E79 G;  4FMT A;  1DF4 A;  3MD0 A;  3TCU A;  2JEU A;  2XOK G;  3HB3 B;  1AJQ A;  5B1N A;  1VQL V;  3B77 A;  2D3O W;  3ZCC A;  1Q81 W;  5CA3 A;  2NNU A;  3AG2 C;  4PA4 A;  3SPI A;  1AI4 A;  1M1K W;  3CC2 V;  4DO2 A;  5IYB O;  3E8G A;  4GX1 A;  1K33 A;  1W2B U;  1SER A;  2WLI B;  2C2A A;  5H9C A;  3OEE G;  1PD3 A;  2WLN A;  4J9Z B;  1K5S A;  2QE7 G;  1YSC A;  3B8N A;  2QEX V;  2DQ3 A;  3F7Y C;  4JAU A;  4KP4 A;  4WFG A;  3QO8 A;  3CME V;  3EFF K;  2ITD C;  3DGE A;  4GT1 A;  4GX0 A;  1Y4M A;  2B5U A;  1YI2 V;  1WPX A;  4PDM A;  5H6Q A;  1VQ7 V;  4MTX A;  4WFB V;  3OAA G;  2OCC B;  3AG1 B;  1H38 A;  4UUJ C;  2P67 A;  5HFL A;  2W6I G;  3AG3 B;  3K0D A;  3ETD A;  1AJP A;  1M56 B;  1S77 D;  3CCS V;  1V54 B;  4GX5 A;  1KEC A;  2IJJ A;  5KA6 A;  3ML0 A;  3W7T A;  3SPH A;  1XL4 A;  1FXH A;  1THZ A;  1AI6 A;  1B6Q A;  1W0J G;  3ZN0 A;  3BY6 A;  3FB7 C;  1ROP A;  4QIW F;  4P30 A;  1DLB A;  1DTO A;  2YEV A;  2PI5 A;  2XAS A;  5FL7 G;  2EZO A;  3R65 A;  5C93 A;  2EBO A;  5HFM A;  1JOY A;  3FYE B;  5B1B C;  2H94 A;  1GKF A;  4QNH B;  1FXK C;  2X0L A;  3F5W C;  4RAI A;  5LGU A;  4PDR A;  3ABL B;  5L3F A;  5BZB A;  3LSQ A;  1K5Q A;  1RPR A;  3ZRV A;  5L3D A;  4BW5 A;  1CPY A;  1I5Y A;  2A0L A;  2QM7 A;  3ZRW B;  1JX9 A;  1OCC B;  1FFT B;  5B1A C;  1KD1 W;  1GM9 A;  4FIP C;  3OMA B;  3F7V C;  1SRY A;  1VQ6 V;  1NH2 B;  4I9W A;  4H33 A;  3ZMT A;  1GM7 A;  5CBG A;  1F4N A;  3CXC U;  2ZDI C;  1P7B A;  2ZXW C;  3ZJZ A;  2DYS C;  2XND G;  1RM1 B;  2BOB C;  3STL C;  5LBQ A;  2ATK C;  4MVR A;  3T4Z A;  5B3S C;  1K92 A;  4RQF A;  2V7Q G;  2IH3 C;  1H8H G;  4BIZ A;  1ZWI C;  2X6C A;  1BL8 A;  3JD1 A;  3E35 A;  4G27 B;  1QBZ A;  4PA6 A;  3KG2 A;  2OCC C;  1PNK A;  2HJF C;  3CCE V;  3ABL C;  4UV9 A;  4QE9 A;  1NJI W;  2LP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...