1BZKA

Structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
RYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROTEIN (BAND 3 ANION TRANSPORT PROTEIN)
publication title Structural studies on the effects of the deletion in the red cell anion exchanger (band 3, AE1) associated with South East Asian ovalocytosis.
pubmed doi rcsb
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.570 Mainly Alpha Orthogonal Bundle Helix Hairpins Helical hairpin bin 1bzkA00
1BZKA
chains in the Genus database with same CATH superfamily
1I08A 3E22A 4JAVA 2C2AA 5J2UA 2KB1A 4DV4B 2QKCA 3MHSC 5E79Z 5LGTA 3CHXA 4EFEA 1M9NA 4P9OA 4XDKA 1RPOA 2EULA 3HKDA 4J10A 3F5TA 2W6IG 1M5IA 1QLEC 3SDLA 4QJFB 3RYIB 4NTWA 1ORQC 1V9PA 4K0KO 1XNRO 1EM1A 3CSXA 1MZEA 3ZHTA 1SESA 2X6AA 5CA0A 4CZZA 4FLTA 1S76D 1UPGA 3NR7A 4O2BB 4DV2B 1HWYA 3L75H 4FMTA 4DR5O 1RP3B 2QM7A 5BR8B 1AJQA 1DF4A 1KU9A 1FJGB 4OXSA 5IYDO 4F6RB 3CP1A 4LP8A 1N4CA 2GBOA 3ZS8C 3T4DA 2EIMB 4B3SB 4LF5O 1F4NA 3CPWU 1SQBH 4O2AA 2ETNA 1GKFA 4UUJC 3T4ZA 5IYBO 4TT3G 2N05A 2QJ1A 4G27B 2JGDA 1OZ0A 5J9PC 3J80N 2X6BA 1SZTA 1Y74B 1MSWD 1MA1A 5LGNA 3QG5A 4JI4O 2OT5A 3H1JH 4LF8O 1ENVA 4MTXA 2P7TC 4RWUA 4LFAB 3UO3A 3N2GB 1Q6HA 5EBLC 1QQCA 2YEVB 3AG3B 3BRCA 3W7UA 2CGNA 2QKSA 1K7DA 4IYIA 5IYZB 2QEXV 5E1AC 4NXNB 1QHTA 4JTCB 5LXTB 4N21A 5TISZ 4AHCA 1TUBB 5CBFA 1OCZB 1B06A 1P7GA 3LNNA 4DUZO 3E2EA 2FYUH 4FZ0A 1L8DA 3DC6A 4PELA 4HYOA 2HHHO 3JD2A 4MTGA 3BFRA 2X6CA 3L9DA 1K5SA 4Z1MG 3F7VC 1VQLV 1KMIZ 5HFLA 1FYJA 1VQ7V 4B3TO 3ASNC 4I55A 2PYJA 1SQXH 1BE3H 4I0XA 4PDMA 4LR3A 3CJHB 5BMVB 5LA6B 3WB1A 1XMQB 1H38A 1N32O 4DR4O 3E86A 3MHHC 3CYOA 1UFIA 3ZRWA 3EFFK 1OCOB 2IBZH 1XL6A 1WPXA 3AG1C 2RCVA 3OGIB 2XAHA 1XNQB 1SS3A 1AVMA 1S5LZ 3B2EE 3B4SA 5LGUA 4K0KB 3OR7C 2B9ZA 1BMFG 1F23A 2YXYA 2ZD9A 4JTAB 1R3IC 5HFMA 3M99B 5JCOA 2CTWA 1XEQA 1J95A 5CB4B 4YIPA 3I55V 2Y48A 1VARA 2HG5C 4RUEA 1Y4MA 2ZM6O 2XTAA 5JQGA 1SZXA 2EIJC 3A0HZ 2PY5A 5JH7B 1HNZO 1CPYA 1NKDA 2ITCC 1HNWB 2UUAB 4DRXA 2ITDC 3P32A 2V4DA 1WB7A 2Q9LA 2YIBD 4LFBO 1RFYA 4FFBA 5KHJA 3HKCA 2IU0A 4WF9V 4I9QA 5AG2A 1SA0A 2RNBA 3JAMN 4U3JB 3SJQC 3B40A 2IJKA 3DC5A 3WFVA 2Y69C 1YCIA 2O57A 1TAEA 4LF8B 1JQ0A 2ZXWB 3OMAB 1YJNV 3FAVB 1QLNA 4K35A 4KFMA 3THOA 4JV5O 1WNSA 2W0FC 2WLLA 1VQ9V 3OAAG 1Y66A 1E1RG 3G6BA 3QO8A 1K5QA 3VQYA 1JA8A 2F93B 4DV7O 3RFRA 1JCHA 3CCEV 1HP8A 3BHPA 1X4TA 4JI6B 2YSUB 2XHBA 1TUEB 3IAYA 2KG7A 4KUMA 1IBKO 1PL0A 4J42A 3ZX6A 4LWSA 1XDCA 3JSLA 2QE7G 4CS2A 2AZ2A 4PA7A 4UB8Z 3HB3B 5L3GA 1JX9A 2AXTZ 4R50A 1M56C 4YJ2B 5LMUO 4E2LA 1N34B 3HKEB 1WP7A 1OHHG 4RAIA 4QE9A 4WFEA 5EYPB 3TXQA 1N32B 1OCCC 4DUYB 3T1YO 2JGUA 2BTQA 2VQFB 2VWJA 1XMOO 3CCJV 1F7YA 5GW7A 3CCQV 1AI7A 2OTJV 4DV6O 2Y0PA 5KLVH 5IDJA 1QLEB 1MOFA 2YIDA 3D36A 3X2QC 3CRRA 2JJ2G 1ZAUA 4MW3A 1NJIW 5ITZA 4IT5A 1D2DA 2Q0OC 4LNUA 5CBGA 3ZN1A 3ABUA 3OR6C 2HFEC 1XI1A 3ZRXA 1SERA 4GKJO 4B3RO 2Q7EA 3ZHQA 1HNZB 4J80A 2OYQA 2EZOA 3JATB 4DV3O 5LOVA 5H9CA 1IX9A 4OX9O 4JI8O 1DK1A 2AHZA 2ZR3A 3CCVV 2WLNA 3UCSC 4O4HB 4X62B 2MW2B 3AEIA 1FAFA 4ZI7B 4AQYO 2AGAA 5KMGB 4QNHB 2ZR2A 2WLHA 4TUYA 1M57C 4QIWF 2YC0A 2F4VB 2A3QA 2ZE7A 4GYCB 3G67A 4BW9A 3O65A 3C3TA 1Q43A 2VRZA 5IJ9B 1HR0O 1GRJA 3ASOB 2BTOA 2P6JA 3ZMZA 2XAQA 4I5SA 4FM2A 3N2KA 1X59A 4L8JA 1ZL8A 2F95B 5IJ0B 5GONA 3J7AU 1YF2A 3STZC 3ETEA 3I5DA 1K4DC 2LW7A 4UV8A 4DV1B 3VQXA 5KX5B 2HVJC 5B3SC 4X1IA 3K5MA 1US6A 4CH5A 3WG7C 4CS4A 1KKCA 2YUAA 3H1HH 5LHHA 4TWKA 3U11A 2FMLA 3RVZA 1R1BA 1NT2B 1Q86W 1AROP 4GX0A 1DF5A 2HVKC 4PV1B 2B1IA 4NKGB 1CEZA 3L70H 2AHYA 3LSSA 4KP4A 4DV6B 3CRMA 4BIZA 1GAXA 3RYFB 1RM1C 4RQEA 2E75B 3LSQA 1SQGA 2H3OA 3AG1B 2Y0IA 2W0XA 3ABLB 1ZLZA 2CTPA 2WLMA 2PZSA 3D3QA 2WWWA 1FXKC 3OE7G 5B1AC 2ADQB 3DXRB 3R65A 3JCUZ 2LJ2A 3S3XA 2NNUA 1JFFB 1U97A 2EJ7A 5J2TB 4WCEV 2WLIB 3GVMA 3IC9A 1P49A 2OCHA 5CN0A 4GKKB 5H6QA 2A7WA 4PI2A 4DV2O 4WBNA 2H94A 3JARB 1MSDA 3OD4A 4PA3A 4FLUA 5BR8O 4D7SA 2L35A 3RT3C 5JJEB 1FJGO 4XBFA 1K3EA 3CX5F 1K33A 1NS1A 1EBOA 2DWEC 2K9PA 4UCRA 2A79B 4MTOA 4H0LB 1NQTA 1Y76B 3Q4HA 3RYHB 4W4LA 1JMKC 3BA8A 3BVOA 1TGOA 3A8TA 2UXBO 3SR2C 4DK1A 4RUFA 3K06A 2X0LA 3UO2A 3LNMB 4H33A 1YHQV 4DV5B 2VQEB 2Y4UA 1G6UA 2RJZA 2ZDIA 2GHYA 1JJ2U 4LFAO 4EEQA 4J9ZB 4TQDA 5KAIZ 1VF5B 1ZSPA 4UXNA 2XT9A 2Q7HA 4B7EA 1QVFU 3OTOB 4NXNO 3SYAA 3UKMA 2WLJA 2QWRB 2ZCEA 4ZOLA 2ZIOA 3EVKA 1A32A 2YIBA 5K1XA 2WLKA 4DR7B 5B1NA 4UVBA 4FLVA 4RQFA 5FNVA 4JI3B 5KA6A 5B1BC 4PJ0Z 4U7NA 4MS2A 4O4JB 2DQ0A 1PNMA 3KKYA 1OCCB 2DOSA 4I4TB 3ZMSA 3H1LH 1NR1A 1K73W 1MNGA 4AI8A 1XMQO 3X2QB 2GUZB 3E8HA 3K03A 2DMXA 1K34A 3ZHVA 3CCLV 1S72V 3K5NA 2G38A 3AK2A 4X65B 4C7UA 1JPXA 2P06A 1XNQO 1YXBA 1RPRA 3JD1A 4CS3A 4CH4A 4H37A 1MMMA 2QTSA 3E22B 5J2UB 3B09A 4DO2A 2HJDA 4BW5A 3ZHUA 3CRAA 2AZ0A 4F4LA 3OW2U 1SRYA 1ROPA 1SKVA 1GN2A 1MABG 1O9HA 1AR5A 3SPHA 1HNWO 4LC1A 2UUAO 3HKDB 1L1FA 1YI2V 2F66C 4YJ3A 5H6RA 1SQPH 4FLWA 1QVGU 3D36C 1I5YA 4DW0A 4FLZA 2UXBB 3KG2A 2HR3A 3SPGA 5CA0B 4DR1B 2PYLA 1GN6A 1WJZA 2JJ1G 5H2FZ 2HP8A 4J11A 4R6ZA 4ICGA 4DR6B 3CC7V 2QSAA 3W7XA 4CH6A 3JASA 3CWBH 1YVWA 3P3NA 1NBMG 2YXLA 4BAYA 5BY1A 3CEIA 3OUFA 4CC5A 2N74A 4TQFA 2CH7A 1VQ4V 4FM1A 3ZHRA 4LF4B 1Q3EA 3ICXA 5EIBD 2XAFA 3RWRD 4X20A 2DE0X 2JK5C 3J81N 1BS3A 4MVQA 3WG7B 4O2AB 1XQ8A 3JALA 1NH2B 4TV8A 2EX3A 4JTDB 3KCYA 3AG7A 4NXMO 1S5HC 1Q81W 1ZUQA 1FXKA 2JGDB 4UCUA 2P67A 2RN9A 2QM4A 4JI6O 5LBQA 1WB8A 2UU9B 1V55C 1QCEA 1YEWA 3K5LA 2CUGA 5EZYA 3E8BA 2E5LO 4LF7B 1BHAA 1FPOA 5IY5B 2Z0AA 3S3WA 3AK1A 2PTMA 3ABKC 4PA6A 1N34O 4FVMA 1FS0G 3E83A 1G4YB 2X7RB 1UJWB 3RN4A 4DUYO 4ZBMA 1BGYH 4JAAA 2VQFO 3JAWA 4X9QA 3SPJA 1YZBA 4P30A 1K92A 3OM3B 3CD6V 4PA9A 1OCRB 1O9GA 5FPOA 4JYYA 2D3OW 1M90W 1IBLO 3OGCC 5IWAB 3F7YC 3M8AA 2RDCA 4I55B 4CH3A 4B7KA 4I0XB 4LFCB 1M1KW 2A0LA 2ADPA 4JF3A 4NR1A 1NVPB 3AG4C 4Z2WA 3B8MA 3D3IA 2ZNJA 3ZRWB 1K8AW 3E8FA 3K58A 1MZFA 1PM9A 3GB7C 3WU2Z 4X62O 3K59A 3NXSA 3LUTB 3K57A 4JYAB 1IBMO 4MVZA 1TVKA 4F6EA 1V54C 3ZMVA 3A0BZ 4UCVA 1WAZA 3CXHF 2JIZG 3CXCU 5BZBA 1K97A 4TV9A 2F4VO 5JQGB 2H8PC 4KXRA 5LP6C 2Y4TA 2R9IA 1XL4A 2UXDB 1PNLA 4ZHQA 2JEUA 1IXBA 4DRXB 3HKBA 3G6EV 4FFBB 2EINC 2ZIMA 3HKCB 2Q0AA 1SETA 2VS0A 4ZIBA 1KBHA 1SA0B 4DV1O 4HAMA 4NXMB 4DV0O 4QPKA 5C93A 2EIKC 2EILC 4MVRA 5JVDA 2FTKA 3FB7C 3IGAC 3APOA 1FFTB 4HNAA 2ZNIA 2E5LB 3CRCA 1EZJA 1SF9A 2GTAA 2XAGA 2WLLB 5KUMA 3ETDA 2Z3YA 2ZDIC 1XHZA 2OIEA 2FB5A 3TETA 2KQXA 1WA8A 4MVSA 4JASA 2D2CB 1VF6C 3ABMC 4FFKA 1NH2D 3UT5A 2YDEA 2KG7B 3K9SA 4JI0B 5KA5A 1IBLB 1R3KC 4LWSB 4JI5B 3KZIZ 3BA9A 1AI5A 1F51A 4JI1O 1QR9A 1Y6XA 2UUBB 2Q6AA 1AILA 2P4VA 1Q5OA 4JYBA 3CE2A 4OPAA 1AI4A 3L74H 2BTQB 1GK9A 3ETQA 4GKKO 1J5EB 3K04A 2XASA 5KHIA 4PD4F 1M4UA 1IBMB 1AP5A 1GM8A 3ETGA 4DR2B 5ITZB 2DYSC 4LNUB 3FB8C 1GH6A 1BT8A 4IL6Z 1EZVH 4N23A 1G1XB 4NVPA 3FYEB 2PGGA 3JD0A 2OTLV 4X88A 1N33B 4MVUA 3VQWA 3K3WA 3MDSA 3FFQA 1BZKA 5LYJA 3EXAA 4GUNA 5LOVB 5LMNB 1P4RA 3N27A 1VQ6V 5BXZA 2EIMC 4I9WA 5LHGA 4DV5O 2VQEO 1URFA 1N36B 1GM9A 1XBLA 1PP9H 2JDIG 4G2KA 2CGOA 4EFBA 4DV0B 4X8AA 4TUYB 1K4CC 3P3PA 4X89A 4IHJA 1U96A 4I50A 1R6NA 3OTOO 2OWOA 4K8ZA 3BCCH 3M7MX 4ASUG 1V55B 3L72H 3MAQA 3AG3C 4PHZA 4DXWA 3CC2V 3N2KB 3ASNB 1S0VA 1RSOA 1ZL8B 3ML0A 4DR7O 5GONB 4JGSA 2QKAA 3W7SA 1I94B 3E35A 1FXHA 4JI3O 3RYCA 5C8YA 1VQMV 3W7WA 4X1IB 1GN3A 2B5UA 1Q7YW 1JOYA 2LP7A 1L0NH 4GLXA 3QO5A 3B8NA 5KHKA 4PDVA 3ZMUA 2Q67A 4GZRB 4MW8A 2JS3A 3ZCCA 1NTZH 4BR6A 4I7ZB 2DWDC 2P22C 1EN4A 3WB0A 4O4LA 2IJHA 4IIJA 4JI1B 4X65O 5CA1A 3A0RA 5FL7G 5KHGA 3PJSK 2EIJB 1XREA 5LP6A 4X1KA 1Z2GA 4X1YA 3P30A 1OCOC 2EJRA 1VEWA 1XILA 3AG4B 3CMEV 1N0NA 3L73H 5B66Z 4EB6A 2R9RB 2CTQA 1VIBA 1N8RW 2GV9A 4JI7B 4ABMA 2LW1A 2ZINA 1KC8W 1YITV 2QTOA 1V54B 3F5WC 3CC4V 2WAMA 1FFXA 2Y69B 2HJFC 4FK5C 1Q6UA 3E89A 1R3LC 2W6JG 1VQPV 4DR1O 4OPHA 2OCCC 4P9PA 1D5NA 2F23A 2BOCC 4DR6O 4WBNB 2E3CA 1L0LH 1AP6A 4K8XA 2BSKA 2E76B 1YIJV 2WPDG 5L3EA 4YY3B 4KL1A 1E79G 1YJWV 2NN4A 4FJCC 3IC7A 1OJHA 4O4IA 1XHXA 4LF4O 4PI0A 1T5EA 4DR3B 4X66O 3JD4A 3Q4HB 1E1QG 3JAKA 3OT7A 3H1KH 1VF6A 1KUQA 5F2VO 5EK0A 3FX7A 2JEXA 2WA4A 1Q82W 2ZXWC 1WN7A 4H44B 5JJJB 3QO7A 5EC2C 1S77D 4BIUA 3OUSA 1B3QA 2LGWA 2P90A 1SQFA 3CCRV 1M56B 4UB6Z 3SPIA 1AR1B 1W59A 1YDXA 4R8CA 3WB2A 4ZKIA 2UU9O 2PF4E 1SC5B 3FYIB 4BWAA 1XOUA 3W7TA 2Q8VA 2BOBC 4LF7O 1HNXB 1R73A 2E74B 3RYIA 3CMAV 1DLBA 3OEEG 2WA3A 2DQ3A 4TSFG 2BCCH 3QNEA 5EC1C 5IT9N 2QWOB 4O2BA 4ZOLB 1VP7A 1KECA 1KQSU 1R3JC 4QPJA 3EHBB 3UM7A 1Q6IA 5FNVB 4F6RA 2EZPA 4B3MB 5IWAO 1H2NA 2LGQA 4YHHB 2DYRC 3JSNA 4X64O 3K0DA 2EBOA 4LF6B 2Q4PA 4LFCO 4PA4A 4YIOA 5FPRA 2IJIA 3E8GA 5B5EZ 2ZE8A 5L3BA 1HDJA 1NU1H 2UXCO 2DYSB 3ZRVA 3I56V 3R66A 3OEHG 4EKWA 1WPBA 1M57B 1Y74A 1MG1A 3AG2C 4JYAO 1H2GA 3TCUA 1H2SB 2MK3A 4NB5A 4WFGA 1R6KA 3N2GA 3O9OA 2N04A 3CCUV 1H8EG 2YEVA 1PL4A 5GTIZ 2IW5A 3L71H 3T1HB 1LUVA 4UCTA 5IYZA 2UXDO 2UXNA 5LXTA 2JVDA 1TUBA 4R7CA 2UUCO 4YJ3B 3K9AA 5B3SB 4WFAV 5CBHA 4X66B 2Z5UA 3BEHA 4JAUA 1AJPA 1IZ3A 3ZN0A 3SJCC 3ASOC 4TOIA 4PDLA 4LF9O 1WLEA 3G71V 3ZMTA 1NR7A 2CE4A 2F1MA 2QM8A 2ATKC 1EN6A 1DGSA 3JASB 4JI2B 5BMVA 3CJHA 5LA6A 3OMIB 3DSQA 2CH7B 2V7QG 3CS5A 3K0GA 1PPJH 2JRIA 1Z5VA 3C3SA 3LSUA 4JYCA 4X20B 1RM1B 4KHPB 1SQQH 5L3FA 3JALB 3VQVA 5CB4A 4TV8B 5KHHA 1G8MA 3H01A 2PI5A 1I7FA 1S5JA 3K08A 1KYOF 4A5UB 1FXKB 3VOUA 2IH3C 4HBNA 4JPRA 1KKDA 5B1AB 4PDRA 3T2MA 5JH7A 4MTFA 2XUMA 4JI0O 1ZTEA 4JI5O 1PD3A 2KSDA 5EZYB 4CC6A 4WFBV 2YXHA 4X64B 2DW4A 2UUBO 4D6TH 5DEDA 1CP9A 3CRQA 2KKWA 4HZ3A 1XNRB 2P4KA 3ABLC 1JR9A 4OGQB 4MT8A 2L6LA 1BCCH 4U3JA 3JAWB 1IVSA 2Q73A 4FLYA 1P84F 2UXCB 4J7JA 1OV9A 1J5EO 4U7OA 1NTKH 4DR5B 2PUSA 2M7WA 1KB9F 3HPLC 3LDCA 1AI6A 4DR2O 1LR1A 1B6QA 3FAVA 1IDSA 3IFXA 3U10A 2OCCB 3APQA 1NI8A 5EIBC 4LF5B 1N33O 2ZE5A 2BE3A 4CBCA 5A9GA 5D5PA 4UVCA 5IYCO 1QU7A 2UUCB 3VBBA 5LMNO 1FXVA 1F4MA 3RW0A 2ARHA 4LH7A 2QGNA 1GMGA 4GCZA 3SYCA 4JI4B 1N36O 4LF9B 3CCSV 2NLJC 1VQKV 3JYCA 2LFRA 1TVKB 1WP8A 2QWNB 1ZX3A 2NR5A 2RQ6A 2FL4A 2GTSA 4Q6GA 5GTHZ 4YJ2A 2DJVA 1GM7A 1KD1W 1THZA 5L3DA 3HKEA 4TV9B 5EYPA 2YS8A 5A2QN 4ZHQB 2DN9A 5B1BB 4UCOA 1YTFB 5JWPA 4DUZB 2VWKA 3HKBB 2ZT9B 1NTMH 2HHHB 4YXWG 3FD9A 1I5XA 1I94O 2ZQMA 3FB6C 3QTCA 3QF7A 2YICA 4LCUC 2CK3G 1AJNA 1ZWIC 1HW7A 3OTFA 3JD3A 1EN5A 3KCXA 4B3TB 2QWQB 2CTRA 2R70A 2R9AA 3ZBHA 3A2FA 1CXZB 3PN1A 5H5NA 5JVDB 2CDYA 3JATA 4DR4B 2IM9A 3GWKC 4E4EA 2B1GA 5DECA 4HNAB 2QDOA 3GWOA 3LDEA 4O4HA 2QWPB 2DYRB 3BAAA 3ZIAG 1DTOA 1GTOA 4QGPA 4ZI7A 5K1PA 4NYKA 3SPCA 3ZHSA 1VQ5V 3RVYA 3LDDA 5KMGA 1AB3A 1JVMA 3TJTA 1KP2A 1Z5WA 2ZM6B 1WA8B 3U0ZA 1VMGA 5FLXN 5LL6Y 5B1OA 2ZE6A 2HEPA 4RO2A 1PV0A 3ZJZA 2ZKOA 3UT5B 5IJ9A 3AG2B 2YIAA 4AILC 4JI7O 3HR0A 3SYOA 4LFBB 4IYHA 4XDLA 2YI8A 5IJ0A 1BQZA 2XOKG 4GT1A 4FLXA 2PI4A 1YSCA 5KAFZ 4FZ1A 1JJOA 3K5OA 5KX5A 4DK0A 1I0HA 1NVPD 1EFRG 3ABTA 4L87A 4YY3O 1BSMA 1COWG 1PKXA 2Q7GA 2IU3A 2XAJA 3STLC 4NTYA 4DR3O 4JV5B 1R6TA 4LBEC 4GX1A 1IURA 3BPZA 2FKXA 1KP3A 2JS5A 4J41A 2GSMB 2Q5ZA 1QR8A 4DV7B 5LYJB 4DYLA 1K9MW 4WFHA 3T1CA 3RYFA 1AR4A 4GX5A 3RGBA 5EBMC 3ABKB 3K79A 3G4SV 1YJ9V 1IBKB 3RBZA 4BIOA 2LFSA 1OCZC 2ILMA 2IJJA 1M93A 1H8HG 3DTUB 5LHIA 1LNQA 3OFNG 1HNXO 2F43G 4IHJB 1QNMA 5LMUB 2OIGA 4I50B 2RMKB 5D5QA 3DXRA 4MSWC 1JFFA 2WSSG 1VQOV 3T1YB 5J2TA 2WLIA 4J7ZA 1BQ0A 1XMOB 4FPPA 5CMUA 4D7TA 5IY5C 4DV4O 3D8CA 3IJ4A 1H2KA 4MVMA 1H2MA 3JARA 2QR4A 1RSOB 3ZEDA 1W0JG 3JCZA 1S3JA 2LO1A 1YTFD 2IH1C 3RYCB 5C8YB 4B3MO 2A9HA 1TA8A 2UXXA 2XNDG 1OCRC 4FIPC 4IGGA 4YHHO 3B77A 1Y76A 4U3FH 3RYHA 4GKJB 4LF6O 4B3RB 2V1DA 2P5OA 4GX2A 4Q20A 3BABA 3TXSA 2Q69A 1FKAO 4DV3B 2R72A 3SYPA 4WFFA 4OX9B 4JI8B 1BHBA 4O4LB 4FM0A 2LQTA 2QA4V 4IIJB 3FB5C 5CA1B 3FKSG 1FD9A 3G80A 1Q8IA 1PNKA 4P2ZA 5LP6B 4X1KB 2K1EA 4J9YB 3SYQA 2HKOA 1IXMA 4JZGA 4X1YB 5KUKA 4H13B 1VF7A 4AQYB 2A06H 2HLDG 4J7KA 4G28B 3CCMV 1VQ8V 3C90A 3SGIA 2ODMA 4EB6B 3T1HO 3SJAC 3H1IH 4DW1A 4B3SO 4JZ2A 2YI9A 3TK1A 1Q90D 2EINB 5IE9A 5JCOC 3ZRSA 4NTXA 1HR0B 4W4KA 1W2BU 4MVOA 2GDSA 1NZ6A 1D5AA 1H2LA 3BY6A 4K3AA 4UFZA 1FFXB 2EIKB 2EILB 2Q68A 1VQNV 2AW9A 3DGEA 3AK3A 3QVNA 4O4JA 5DM6V 4XDJA 4I4TA 2CAZC 4LH6A 5CA3A 3TGUH 4B08A 1W0KG 4UV9A 1B04A 5L3CA 3OMNB 4Z1VA 4JI2O 1LUWA 3UQ8A 1XUQA 1SQVH 3SJBC 5EBWC 2BSKB 5JJNB 2GUZA 4UVAA 1N0JA 3CB2A 4O4IB 3MD0A 4QE7A 1Y67A 4UCSA 1QBZA 2M6YA 1P7BA 1GO3F 3JAKB 1BL8A 4KHPO 3ABMB 1GN4A 5DN6G 3H9VA
chains in the Genus database with same CATH topology
1BZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZK A; 
#chains in the Genus database with same CATH topology
 1I08 A;  3E22 A;  4JAV A;  2C2A A;  5J2U A;  2KB1 A;  4DV4 B;  2QKC A;  3MHS C;  5E79 Z;  5LGT A;  3CHX A;  4EFE A;  1M9N A;  4P9O A;  4XDK A;  1RPO A;  2EUL A;  3HKD A;  4J10 A;  3F5T A;  2W6I G;  1M5I A;  1QLE C;  3SDL A;  4QJF B;  3RYI B;  4NTW A;  1ORQ C;  1V9P A;  4K0K O;  1XNR O;  1EM1 A;  3CSX A;  1MZE A;  3ZHT A;  1SES A;  2X6A A;  5CA0 A;  4CZZ A;  4FLT A;  1S76 D;  1UPG A;  3NR7 A;  4O2B B;  4DV2 B;  1HWY A;  3L75 H;  4FMT A;  4DR5 O;  1RP3 B;  2QM7 A;  5BR8 B;  1AJQ A;  1DF4 A;  1KU9 A;  1FJG B;  4OXS A;  5IYD O;  4F6R B;  3CP1 A;  4LP8 A;  1N4C A;  2GBO A;  3ZS8 C;  3T4D A;  2EIM B;  4B3S B;  4LF5 O;  1F4N A;  3CPW U;  1SQB H;  4O2A A;  2ETN A;  1GKF A;  4UUJ C;  3T4Z A;  5IYB O;  4TT3 G;  2N05 A;  2QJ1 A;  4G27 B;  2JGD A;  1OZ0 A;  5J9P C;  3J80 N;  2X6B A;  1SZT A;  1Y74 B;  1MSW D;  1MA1 A;  5LGN A;  3QG5 A;  4JI4 O;  2OT5 A;  3H1J H;  4LF8 O;  1ENV A;  4MTX A;  2P7T C;  4RWU A;  4LFA B;  3UO3 A;  3N2G B;  1Q6H A;  5EBL C;  1QQC A;  2YEV B;  3AG3 B;  3BRC A;  3W7U A;  2CGN A;  2QKS A;  1K7D A;  4IYI A;  5IYZ B;  2QEX V;  5E1A C;  4NXN B;  1QHT A;  4JTC B;  5LXT B;  4N21 A;  5TIS Z;  4AHC A;  1TUB B;  5CBF A;  1OCZ B;  1B06 A;  1P7G A;  3LNN A;  4DUZ O;  3E2E A;  2FYU H;  4FZ0 A;  1L8D A;  3DC6 A;  4PEL A;  4HYO A;  2HHH O;  3JD2 A;  4MTG A;  3BFR A;  2X6C A;  3L9D A;  1K5S A;  4Z1M G;  3F7V C;  1VQL V;  1KMI Z;  5HFL A;  1FYJ A;  1VQ7 V;  4B3T O;  3ASN C;  4I55 A;  2PYJ A;  1SQX H;  1BE3 H;  4I0X A;  4PDM A;  4LR3 A;  3CJH B;  5BMV B;  5LA6 B;  3WB1 A;  1XMQ B;  1H38 A;  1N32 O;  4DR4 O;  3E86 A;  3MHH C;  3CYO A;  1UFI A;  3ZRW A;  3EFF K;  1OCO B;  2IBZ H;  1XL6 A;  1WPX A;  3AG1 C;  2RCV A;  3OGI B;  2XAH A;  1XNQ B;  1SS3 A;  1AVM A;  1S5L Z;  3B2E E;  3B4S A;  5LGU A;  4K0K B;  3OR7 C;  2B9Z A;  1BMF G;  1F23 A;  2YXY A;  2ZD9 A;  4JTA B;  1R3I C;  5HFM A;  3M99 B;  5JCO A;  2CTW A;  1XEQ A;  1J95 A;  5CB4 B;  4YIP A;  3I55 V;  2Y48 A;  1VAR A;  2HG5 C;  4RUE A;  1Y4M A;  2ZM6 O;  2XTA A;  5JQG A;  1SZX A;  2EIJ C;  3A0H Z;  2PY5 A;  5JH7 B;  1HNZ O;  1CPY A;  1NKD A;  2ITC C;  1HNW B;  2UUA B;  4DRX A;  2ITD C;  3P32 A;  2V4D A;  1WB7 A;  2Q9L A;  2YIB D;  4LFB O;  1RFY A;  4FFB A;  5KHJ A;  3HKC A;  2IU0 A;  4WF9 V;  4I9Q A;  5AG2 A;  1SA0 A;  2RNB A;  3JAM N;  4U3J B;  3SJQ C;  3B40 A;  2IJK A;  3DC5 A;  3WFV A;  2Y69 C;  1YCI A;  2O57 A;  1TAE A;  4LF8 B;  1JQ0 A;  2ZXW B;  3OMA B;  1YJN V;  3FAV B;  1QLN A;  4K35 A;  4KFM A;  3THO A;  4JV5 O;  1WNS A;  2W0F C;  2WLL A;  1VQ9 V;  3OAA G;  1Y66 A;  1E1R G;  3G6B A;  3QO8 A;  1K5Q A;  3VQY A;  1JA8 A;  2F93 B;  4DV7 O;  3RFR A;  1JCH A;  3CCE V;  1HP8 A;  3BHP A;  1X4T A;  4JI6 B;  2YSU B;  2XHB A;  1TUE B;  3IAY A;  2KG7 A;  4KUM A;  1IBK O;  1PL0 A;  4J42 A;  3ZX6 A;  4LWS A;  1XDC A;  3JSL A;  2QE7 G;  4CS2 A;  2AZ2 A;  4PA7 A;  4UB8 Z;  3HB3 B;  5L3G A;  1JX9 A;  2AXT Z;  4R50 A;  1M56 C;  4YJ2 B;  5LMU O;  4E2L A;  1N34 B;  3HKE B;  1WP7 A;  1OHH G;  4RAI A;  4QE9 A;  4WFE A;  5EYP B;  3TXQ A;  1N32 B;  1OCC C;  4DUY B;  3T1Y O;  2JGU A;  2BTQ A;  2VQF B;  2VWJ A;  1XMO O;  3CCJ V;  1F7Y A;  5GW7 A;  3CCQ V;  1AI7 A;  2OTJ V;  4DV6 O;  2Y0P A;  5KLV H;  5IDJ A;  1QLE B;  1MOF A;  2YID A;  3D36 A;  3X2Q C;  3CRR A;  2JJ2 G;  1ZAU A;  4MW3 A;  1NJI W;  5ITZ A;  4IT5 A;  1D2D A;  2Q0O C;  4LNU A;  5CBG A;  3ZN1 A;  3ABU A;  3OR6 C;  2HFE C;  1XI1 A;  3ZRX A;  1SER A;  4GKJ O;  4B3R O;  2Q7E A;  3ZHQ A;  1HNZ B;  4J80 A;  2OYQ A;  2EZO A;  3JAT B;  4DV3 O;  5LOV A;  5H9C A;  1IX9 A;  4OX9 O;  4JI8 O;  1DK1 A;  2AHZ A;  2ZR3 A;  3CCV V;  2WLN A;  3UCS C;  4O4H B;  4X62 B;  2MW2 B;  3AEI A;  1FAF A;  4ZI7 B;  4AQY O;  2AGA A;  5KMG B;  4QNH B;  2ZR2 A;  2WLH A;  4TUY A;  1M57 C;  4QIW F;  2YC0 A;  2F4V B;  2A3Q A;  2ZE7 A;  4GYC B;  3G67 A;  4BW9 A;  3O65 A;  3C3T A;  1Q43 A;  2VRZ A;  5IJ9 B;  1HR0 O;  1GRJ A;  3ASO B;  2BTO A;  2P6J A;  3ZMZ A;  2XAQ A;  4I5S A;  4FM2 A;  3N2K A;  1X59 A;  4L8J A;  1ZL8 A;  2F95 B;  5IJ0 B;  5GON A;  3J7A U;  1YF2 A;  3STZ C;  3ETE A;  3I5D A;  1K4D C;  2LW7 A;  4UV8 A;  4DV1 B;  3VQX A;  5KX5 B;  2HVJ C;  5B3S C;  4X1I A;  3K5M A;  1US6 A;  4CH5 A;  3WG7 C;  4CS4 A;  1KKC A;  2YUA A;  3H1H H;  5LHH A;  4TWK A;  3U11 A;  2FML A;  3RVZ A;  1R1B A;  1NT2 B;  1Q86 W;  1ARO P;  4GX0 A;  1DF5 A;  2HVK C;  4PV1 B;  2B1I A;  4NKG B;  1CEZ A;  3L70 H;  2AHY A;  3LSS A;  4KP4 A;  4DV6 B;  3CRM A;  4BIZ A;  1GAX A;  3RYF B;  1RM1 C;  4RQE A;  2E75 B;  3LSQ A;  1SQG A;  2H3O A;  3AG1 B;  2Y0I A;  2W0X A;  3ABL B;  1ZLZ A;  2CTP A;  2WLM A;  2PZS A;  3D3Q A;  2WWW A;  1FXK C;  3OE7 G;  5B1A C;  2ADQ B;  3DXR B;  3R65 A;  3JCU Z;  2LJ2 A;  3S3X A;  2NNU A;  1JFF B;  1U97 A;  2EJ7 A;  5J2T B;  4WCE V;  2WLI B;  3GVM A;  3IC9 A;  1P49 A;  2OCH A;  5CN0 A;  4GKK B;  5H6Q A;  2A7W A;  4PI2 A;  4DV2 O;  4WBN A;  2H94 A;  3JAR B;  1MSD A;  3OD4 A;  4PA3 A;  4FLU A;  5BR8 O;  4D7S A;  2L35 A;  3RT3 C;  5JJE B;  1FJG O;  4XBF A;  1K3E A;  3CX5 F;  1K33 A;  1NS1 A;  1EBO A;  2DWE C;  2K9P A;  4UCR A;  2A79 B;  4MTO A;  4H0L B;  1NQT A;  1Y76 B;  3Q4H A;  3RYH B;  4W4L A;  1JMK C;  3BA8 A;  3BVO A;  1TGO A;  3A8T A;  2UXB O;  3SR2 C;  4DK1 A;  4RUF A;  3K06 A;  2X0L A;  3UO2 A;  3LNM B;  4H33 A;  1YHQ V;  4DV5 B;  2VQE B;  2Y4U A;  1G6U A;  2RJZ A;  2ZDI A;  2GHY A;  1JJ2 U;  4LFA O;  4EEQ A;  4J9Z B;  4TQD A;  5KAI Z;  1VF5 B;  1ZSP A;  4UXN A;  2XT9 A;  2Q7H A;  4B7E A;  1QVF U;  3OTO B;  4NXN O;  3SYA A;  3UKM A;  2WLJ A;  2QWR B;  2ZCE A;  4ZOL A;  2ZIO A;  3EVK A;  1A32 A;  2YIB A;  5K1X A;  2WLK A;  4DR7 B;  5B1N A;  4UVB A;  4FLV A;  4RQF A;  5FNV A;  4JI3 B;  5KA6 A;  5B1B C;  4PJ0 Z;  4U7N A;  4MS2 A;  4O4J B;  2DQ0 A;  1PNM A;  3KKY A;  1OCC B;  2DOS A;  4I4T B;  3ZMS A;  3H1L H;  1NR1 A;  1K73 W;  1MNG A;  4AI8 A;  1XMQ O;  3X2Q B;  2GUZ B;  3E8H A;  3K03 A;  2DMX A;  1K34 A;  3ZHV A;  3CCL V;  1S72 V;  3K5N A;  2G38 A;  3AK2 A;  4X65 B;  4C7U A;  1JPX A;  2P06 A;  1XNQ O;  1YXB A;  1RPR A;  3JD1 A;  4CS3 A;  4CH4 A;  4H37 A;  1MMM A;  2QTS A;  3E22 B;  5J2U B;  3B09 A;  4DO2 A;  2HJD A;  4BW5 A;  3ZHU A;  3CRA A;  2AZ0 A;  4F4L A;  3OW2 U;  1SRY A;  1ROP A;  1SKV A;  1GN2 A;  1MAB G;  1O9H A;  1AR5 A;  3SPH A;  1HNW O;  4LC1 A;  2UUA O;  3HKD B;  1L1F A;  1YI2 V;  2F66 C;  4YJ3 A;  5H6R A;  1SQP H;  4FLW A;  1QVG U;  3D36 C;  1I5Y A;  4DW0 A;  4FLZ A;  2UXB B;  3KG2 A;  2HR3 A;  3SPG A;  5CA0 B;  4DR1 B;  2PYL A;  1GN6 A;  1WJZ A;  2JJ1 G;  5H2F Z;  2HP8 A;  4J11 A;  4R6Z A;  4ICG A;  4DR6 B;  3CC7 V;  2QSA A;  3W7X A;  4CH6 A;  3JAS A;  3CWB H;  1YVW A;  3P3N A;  1NBM G;  2YXL A;  4BAY A;  5BY1 A;  3CEI A;  3OUF A;  4CC5 A;  2N74 A;  4TQF A;  2CH7 A;  1VQ4 V;  4FM1 A;  3ZHR A;  4LF4 B;  1Q3E A;  3ICX A;  5EIB D;  2XAF A;  3RWR D;  4X20 A;  2DE0 X;  2JK5 C;  3J81 N;  1BS3 A;  4MVQ A;  3WG7 B;  4O2A B;  1XQ8 A;  3JAL A;  1NH2 B;  4TV8 A;  2EX3 A;  4JTD B;  3KCY A;  3AG7 A;  4NXM O;  1S5H C;  1Q81 W;  1ZUQ A;  1FXK A;  2JGD B;  4UCU A;  2P67 A;  2RN9 A;  2QM4 A;  4JI6 O;  5LBQ A;  1WB8 A;  2UU9 B;  1V55 C;  1QCE A;  1YEW A;  3K5L A;  2CUG A;  5EZY A;  3E8B A;  2E5L O;  4LF7 B;  1BHA A;  1FPO A;  5IY5 B;  2Z0A A;  3S3W A;  3AK1 A;  2PTM A;  3ABK C;  4PA6 A;  1N34 O;  4FVM A;  1FS0 G;  3E83 A;  1G4Y B;  2X7R B;  1UJW B;  3RN4 A;  4DUY O;  4ZBM A;  1BGY H;  4JAA A;  2VQF O;  3JAW A;  4X9Q A;  3SPJ A;  1YZB A;  4P30 A;  1K92 A;  3OM3 B;  3CD6 V;  4PA9 A;  1OCR B;  1O9G A;  5FPO A;  4JYY A;  2D3O W;  1M90 W;  1IBL O;  3OGC C;  5IWA B;  3F7Y C;  3M8A A;  2RDC A;  4I55 B;  4CH3 A;  4B7K A;  4I0X B;  4LFC B;  1M1K W;  2A0L A;  2ADP A;  4JF3 A;  4NR1 A;  1NVP B;  3AG4 C;  4Z2W A;  3B8M A;  3D3I A;  2ZNJ A;  3ZRW B;  1K8A W;  3E8F A;  3K58 A;  1MZF A;  1PM9 A;  3GB7 C;  3WU2 Z;  4X62 O;  3K59 A;  3NXS A;  3LUT B;  3K57 A;  4JYA B;  1IBM O;  4MVZ A;  1TVK A;  4F6E A;  1V54 C;  3ZMV A;  3A0B Z;  4UCV A;  1WAZ A;  3CXH F;  2JIZ G;  3CXC U;  5BZB A;  1K97 A;  4TV9 A;  2F4V O;  5JQG B;  2H8P C;  4KXR A;  5LP6 C;  2Y4T A;  2R9I A;  1XL4 A;  2UXD B;  1PNL A;  4ZHQ A;  2JEU A;  1IXB A;  4DRX B;  3HKB A;  3G6E V;  4FFB B;  2EIN C;  2ZIM A;  3HKC B;  2Q0A A;  1SET A;  2VS0 A;  4ZIB A;  1KBH A;  1SA0 B;  4DV1 O;  4HAM A;  4NXM B;  4DV0 O;  4QPK A;  5C93 A;  2EIK C;  2EIL C;  4MVR A;  5JVD A;  2FTK A;  3FB7 C;  3IGA C;  3APO A;  1FFT B;  4HNA A;  2ZNI A;  2E5L B;  3CRC A;  1EZJ A;  1SF9 A;  2GTA A;  2XAG A;  2WLL B;  5KUM A;  3ETD A;  2Z3Y A;  2ZDI C;  1XHZ A;  2OIE A;  2FB5 A;  3TET A;  2KQX A;  1WA8 A;  4MVS A;  4JAS A;  2D2C B;  1VF6 C;  3ABM C;  4FFK A;  1NH2 D;  3UT5 A;  2YDE A;  2KG7 B;  3K9S A;  4JI0 B;  5KA5 A;  1IBL B;  1R3K C;  4LWS B;  4JI5 B;  3KZI Z;  3BA9 A;  1AI5 A;  1F51 A;  4JI1 O;  1QR9 A;  1Y6X A;  2UUB B;  2Q6A A;  1AIL A;  2P4V A;  1Q5O A;  4JYB A;  3CE2 A;  4OPA A;  1AI4 A;  3L74 H;  2BTQ B;  1GK9 A;  3ETQ A;  4GKK O;  1J5E B;  3K04 A;  2XAS A;  5KHI A;  4PD4 F;  1M4U A;  1IBM B;  1AP5 A;  1GM8 A;  3ETG A;  4DR2 B;  5ITZ B;  2DYS C;  4LNU B;  3FB8 C;  1GH6 A;  1BT8 A;  4IL6 Z;  1EZV H;  4N23 A;  1G1X B;  4NVP A;  3FYE B;  2PGG A;  3JD0 A;  2OTL V;  4X88 A;  1N33 B;  4MVU A;  3VQW A;  3K3W A;  3MDS A;  3FFQ A;  1BZK A;  5LYJ A;  3EXA A;  4GUN A;  5LOV B;  5LMN B;  1P4R A;  3N27 A;  1VQ6 V;  5BXZ A;  2EIM C;  4I9W A;  5LHG A;  4DV5 O;  2VQE O;  1URF A;  1N36 B;  1GM9 A;  1XBL A;  1PP9 H;  2JDI G;  4G2K A;  2CGO A;  4EFB A;  4DV0 B;  4X8A A;  4TUY B;  1K4C C;  3P3P A;  4X89 A;  4IHJ A;  1U96 A;  4I50 A;  1R6N A;  3OTO O;  2OWO A;  4K8Z A;  3BCC H;  3M7M X;  4ASU G;  1V55 B;  3L72 H;  3MAQ A;  3AG3 C;  4PHZ A;  4DXW A;  3CC2 V;  3N2K B;  3ASN B;  1S0V A;  1RSO A;  1ZL8 B;  3ML0 A;  4DR7 O;  5GON B;  4JGS A;  2QKA A;  3W7S A;  1I94 B;  3E35 A;  1FXH A;  4JI3 O;  3RYC A;  5C8Y A;  1VQM V;  3W7W A;  4X1I B;  1GN3 A;  2B5U A;  1Q7Y W;  1JOY A;  2LP7 A;  1L0N H;  4GLX A;  3QO5 A;  3B8N A;  5KHK A;  4PDV A;  3ZMU A;  2Q67 A;  4GZR B;  4MW8 A;  2JS3 A;  3ZCC A;  1NTZ H;  4BR6 A;  4I7Z B;  2DWD C;  2P22 C;  1EN4 A;  3WB0 A;  4O4L A;  2IJH A;  4IIJ A;  4JI1 B;  4X65 O;  5CA1 A;  3A0R A;  5FL7 G;  5KHG A;  3PJS K;  2EIJ B;  1XRE A;  5LP6 A;  4X1K A;  1Z2G A;  4X1Y A;  3P30 A;  1OCO C;  2EJR A;  1VEW A;  1XIL A;  3AG4 B;  3CME V;  1N0N A;  3L73 H;  5B66 Z;  4EB6 A;  2R9R B;  2CTQ A;  1VIB A;  1N8R W;  2GV9 A;  4JI7 B;  4ABM A;  2LW1 A;  2ZIN A;  1KC8 W;  1YIT V;  2QTO A;  1V54 B;  3F5W C;  3CC4 V;  2WAM A;  1FFX A;  2Y69 B;  2HJF C;  4FK5 C;  1Q6U A;  3E89 A;  1R3L C;  2W6J G;  1VQP V;  4DR1 O;  4OPH A;  2OCC C;  4P9P A;  1D5N A;  2F23 A;  2BOC C;  4DR6 O;  4WBN B;  2E3C A;  1L0L H;  1AP6 A;  4K8X A;  2BSK A;  2E76 B;  1YIJ V;  2WPD G;  5L3E A;  4YY3 B;  4KL1 A;  1E79 G;  1YJW V;  2NN4 A;  4FJC C;  3IC7 A;  1OJH A;  4O4I A;  1XHX A;  4LF4 O;  4PI0 A;  1T5E A;  4DR3 B;  4X66 O;  3JD4 A;  3Q4H B;  1E1Q G;  3JAK A;  3OT7 A;  3H1K H;  1VF6 A;  1KUQ A;  5F2V O;  5EK0 A;  3FX7 A;  2JEX A;  2WA4 A;  1Q82 W;  2ZXW C;  1WN7 A;  4H44 B;  5JJJ B;  3QO7 A;  5EC2 C;  1S77 D;  4BIU A;  3OUS A;  1B3Q A;  2LGW A;  2P90 A;  1SQF A;  3CCR V;  1M56 B;  4UB6 Z;  3SPI A;  1AR1 B;  1W59 A;  1YDX A;  4R8C A;  3WB2 A;  4ZKI A;  2UU9 O;  2PF4 E;  1SC5 B;  3FYI B;  4BWA A;  1XOU A;  3W7T A;  2Q8V A;  2BOB C;  4LF7 O;  1HNX B;  1R73 A;  2E74 B;  3RYI A;  3CMA V;  1DLB A;  3OEE G;  2WA3 A;  2DQ3 A;  4TSF G;  2BCC H;  3QNE A;  5EC1 C;  5IT9 N;  2QWO B;  4O2B A;  4ZOL B;  1VP7 A;  1KEC A;  1KQS U;  1R3J C;  4QPJ A;  3EHB B;  3UM7 A;  1Q6I A;  5FNV B;  4F6R A;  2EZP A;  4B3M B;  5IWA O;  1H2N A;  2LGQ A;  4YHH B;  2DYR C;  3JSN A;  4X64 O;  3K0D A;  2EBO A;  4LF6 B;  2Q4P A;  4LFC O;  4PA4 A;  4YIO A;  5FPR A;  2IJI A;  3E8G A;  5B5E Z;  2ZE8 A;  5L3B A;  1HDJ A;  1NU1 H;  2UXC O;  2DYS B;  3ZRV A;  3I56 V;  3R66 A;  3OEH G;  4EKW A;  1WPB A;  1M57 B;  1Y74 A;  1MG1 A;  3AG2 C;  4JYA O;  1H2G A;  3TCU A;  1H2S B;  2MK3 A;  4NB5 A;  4WFG A;  1R6K A;  3N2G A;  3O9O A;  2N04 A;  3CCU V;  1H8E G;  2YEV A;  1PL4 A;  5GTI Z;  2IW5 A;  3L71 H;  3T1H B;  1LUV A;  4UCT A;  5IYZ A;  2UXD O;  2UXN A;  5LXT A;  2JVD A;  1TUB A;  4R7C A;  2UUC O;  4YJ3 B;  3K9A A;  5B3S B;  4WFA V;  5CBH A;  4X66 B;  2Z5U A;  3BEH A;  4JAU A;  1AJP A;  1IZ3 A;  3ZN0 A;  3SJC C;  3ASO C;  4TOI A;  4PDL A;  4LF9 O;  1WLE A;  3G71 V;  3ZMT A;  1NR7 A;  2CE4 A;  2F1M A;  2QM8 A;  2ATK C;  1EN6 A;  1DGS A;  3JAS B;  4JI2 B;  5BMV A;  3CJH A;  5LA6 A;  3OMI B;  3DSQ A;  2CH7 B;  2V7Q G;  3CS5 A;  3K0G A;  1PPJ H;  2JRI A;  1Z5V A;  3C3S A;  3LSU A;  4JYC A;  4X20 B;  1RM1 B;  4KHP B;  1SQQ H;  5L3F A;  3JAL B;  3VQV A;  5CB4 A;  4TV8 B;  5KHH A;  1G8M A;  3H01 A;  2PI5 A;  1I7F A;  1S5J A;  3K08 A;  1KYO F;  4A5U B;  1FXK B;  3VOU A;  2IH3 C;  4HBN A;  4JPR A;  1KKD A;  5B1A B;  4PDR A;  3T2M A;  5JH7 A;  4MTF A;  2XUM A;  4JI0 O;  1ZTE A;  4JI5 O;  1PD3 A;  2KSD A;  5EZY B;  4CC6 A;  4WFB V;  2YXH A;  4X64 B;  2DW4 A;  2UUB O;  4D6T H;  5DED A;  1CP9 A;  3CRQ A;  2KKW A;  4HZ3 A;  1XNR B;  2P4K A;  3ABL C;  1JR9 A;  4OGQ B;  4MT8 A;  2L6L A;  1BCC H;  4U3J A;  3JAW B;  1IVS A;  2Q73 A;  4FLY A;  1P84 F;  2UXC B;  4J7J A;  1OV9 A;  1J5E O;  4U7O A;  1NTK H;  4DR5 B;  2PUS A;  2M7W A;  1KB9 F;  3HPL C;  3LDC A;  1AI6 A;  4DR2 O;  1LR1 A;  1B6Q A;  3FAV A;  1IDS A;  3IFX A;  3U10 A;  2OCC B;  3APQ A;  1NI8 A;  5EIB C;  4LF5 B;  1N33 O;  2ZE5 A;  2BE3 A;  4CBC A;  5A9G A;  5D5P A;  4UVC A;  5IYC O;  1QU7 A;  2UUC B;  3VBB A;  5LMN O;  1FXV A;  1F4M A;  3RW0 A;  2ARH A;  4LH7 A;  2QGN A;  1GMG A;  4GCZ A;  3SYC A;  4JI4 B;  1N36 O;  4LF9 B;  3CCS V;  2NLJ C;  1VQK V;  3JYC A;  2LFR A;  1TVK B;  1WP8 A;  2QWN B;  1ZX3 A;  2NR5 A;  2RQ6 A;  2FL4 A;  2GTS A;  4Q6G A;  5GTH Z;  4YJ2 A;  2DJV A;  1GM7 A;  1KD1 W;  1THZ A;  5L3D A;  3HKE A;  4TV9 B;  5EYP A;  2YS8 A;  5A2Q N;  4ZHQ B;  2DN9 A;  5B1B B;  4UCO A;  1YTF B;  5JWP A;  4DUZ B;  2VWK A;  3HKB B;  2ZT9 B;  1NTM H;  2HHH B;  4YXW G;  3FD9 A;  1I5X A;  1I94 O;  2ZQM A;  3FB6 C;  3QTC A;  3QF7 A;  2YIC A;  4LCU C;  2CK3 G;  1AJN A;  1ZWI C;  1HW7 A;  3OTF A;  3JD3 A;  1EN5 A;  3KCX A;  4B3T B;  2QWQ B;  2CTR A;  2R70 A;  2R9A A;  3ZBH A;  3A2F A;  1CXZ B;  3PN1 A;  5H5N A;  5JVD B;  2CDY A;  3JAT A;  4DR4 B;  2IM9 A;  3GWK C;  4E4E A;  2B1G A;  5DEC A;  4HNA B;  2QDO A;  3GWO A;  3LDE A;  4O4H A;  2QWP B;  2DYR B;  3BAA A;  3ZIA G;  1DTO A;  1GTO A;  4QGP A;  4ZI7 A;  5K1P A;  4NYK A;  3SPC A;  3ZHS A;  1VQ5 V;  3RVY A;  3LDD A;  5KMG A;  1AB3 A;  1JVM A;  3TJT A;  1KP2 A;  1Z5W A;  2ZM6 B;  1WA8 B;  3U0Z A;  1VMG A;  5FLX N;  5LL6 Y;  5B1O A;  2ZE6 A;  2HEP A;  4RO2 A;  1PV0 A;  3ZJZ A;  2ZKO A;  3UT5 B;  5IJ9 A;  3AG2 B;  2YIA A;  4AIL C;  4JI7 O;  3HR0 A;  3SYO A;  4LFB B;  4IYH A;  4XDL A;  2YI8 A;  5IJ0 A;  1BQZ A;  2XOK G;  4GT1 A;  4FLX A;  2PI4 A;  1YSC A;  5KAF Z;  4FZ1 A;  1JJO A;  3K5O A;  5KX5 A;  4DK0 A;  1I0H A;  1NVP D;  1EFR G;  3ABT A;  4L87 A;  4YY3 O;  1BSM A;  1COW G;  1PKX A;  2Q7G A;  2IU3 A;  2XAJ A;  3STL C;  4NTY A;  4DR3 O;  4JV5 B;  1R6T A;  4LBE C;  4GX1 A;  1IUR A;  3BPZ A;  2FKX A;  1KP3 A;  2JS5 A;  4J41 A;  2GSM B;  2Q5Z A;  1QR8 A;  4DV7 B;  5LYJ B;  4DYL A;  1K9M W;  4WFH A;  3T1C A;  3RYF A;  1AR4 A;  4GX5 A;  3RGB A;  5EBM C;  3ABK B;  3K79 A;  3G4S V;  1YJ9 V;  1IBK B;  3RBZ A;  4BIO A;  2LFS A;  1OCZ C;  2ILM A;  2IJJ A;  1M93 A;  1H8H G;  3DTU B;  5LHI A;  1LNQ A;  3OFN G;  1HNX O;  2F43 G;  4IHJ B;  1QNM A;  5LMU B;  2OIG A;  4I50 B;  2RMK B;  5D5Q A;  3DXR A;  4MSW C;  1JFF A;  2WSS G;  1VQO V;  3T1Y B;  5J2T A;  2WLI A;  4J7Z A;  1BQ0 A;  1XMO B;  4FPP A;  5CMU A;  4D7T A;  5IY5 C;  4DV4 O;  3D8C A;  3IJ4 A;  1H2K A;  4MVM A;  1H2M A;  3JAR A;  2QR4 A;  1RSO B;  3ZED A;  1W0J G;  3JCZ A;  1S3J A;  2LO1 A;  1YTF D;  2IH1 C;  3RYC B;  5C8Y B;  4B3M O;  2A9H A;  1TA8 A;  2UXX A;  2XND G;  1OCR C;  4FIP C;  4IGG A;  4YHH O;  3B77 A;  1Y76 A;  4U3F H;  3RYH A;  4GKJ B;  4LF6 O;  4B3R B;  2V1D A;  2P5O A;  4GX2 A;  4Q20 A;  3BAB A;  3TXS A;  2Q69 A;  1FKA O;  4DV3 B;  2R72 A;  3SYP A;  4WFF A;  4OX9 B;  4JI8 B;  1BHB A;  4O4L B;  4FM0 A;  2LQT A;  2QA4 V;  4IIJ B;  3FB5 C;  5CA1 B;  3FKS G;  1FD9 A;  3G80 A;  1Q8I A;  1PNK A;  4P2Z A;  5LP6 B;  4X1K B;  2K1E A;  4J9Y B;  3SYQ A;  2HKO A;  1IXM A;  4JZG A;  4X1Y B;  5KUK A;  4H13 B;  1VF7 A;  4AQY B;  2A06 H;  2HLD G;  4J7K A;  4G28 B;  3CCM V;  1VQ8 V;  3C90 A;  3SGI A;  2ODM A;  4EB6 B;  3T1H O;  3SJA C;  3H1I H;  4DW1 A;  4B3S O;  4JZ2 A;  2YI9 A;  3TK1 A;  1Q90 D;  2EIN B;  5IE9 A;  5JCO C;  3ZRS A;  4NTX A;  1HR0 B;  4W4K A;  1W2B U;  4MVO A;  2GDS A;  1NZ6 A;  1D5A A;  1H2L A;  3BY6 A;  4K3A A;  4UFZ A;  1FFX B;  2EIK B;  2EIL B;  2Q68 A;  1VQN V;  2AW9 A;  3DGE A;  3AK3 A;  3QVN A;  4O4J A;  5DM6 V;  4XDJ A;  4I4T A;  2CAZ C;  4LH6 A;  5CA3 A;  3TGU H;  4B08 A;  1W0K G;  4UV9 A;  1B04 A;  5L3C A;  3OMN B;  4Z1V A;  4JI2 O;  1LUW A;  3UQ8 A;  1XUQ A;  1SQV H;  3SJB C;  5EBW C;  2BSK B;  5JJN B;  2GUZ A;  4UVA A;  1N0J A;  3CB2 A;  4O4I B;  3MD0 A;  4QE7 A;  1Y67 A;  4UCS A;  1QBZ A;  2M6Y A;  1P7B A;  1GO3 F;  3JAK B;  1BL8 A;  4KHP O;  3ABM B;  1GN4 A;  5DN6 G;  3H9V A; 
#chains in the Genus database with same CATH homology
 1BZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...