1BZKA

Structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
b'RYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BAND 3 ANION TRANSPORT PROTEIN)
publication title Structural studies on the effects of the deletion in the red cell anion exchanger (band 3, AE1) associated with South East Asian ovalocytosis.
pubmed doi rcsb
molecule tags Transport protein
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.570 Mainly Alpha Orthogonal Bundle Helix Hairpins Helical hairpin bin 1bzkA00
1BZKA
chains in the Genus database with same CATH superfamily
3K79A 4B3RO 3APOA 3LDCA 1V54B 3AK1A 4DXWA 1N32B 1Y74A 5D5PA 1DF4A 4CH5A 4CC5A 1BL8A 1RM1B 1AR4A 4QPKA 5JQGB 5BR8O 5KA6A 1TAEA 2A9HA 5IWAB 3U11A 1F51A 5EC2C 2H8PC 1H2NA 3NXSA 1QVFU 5KHKA 3EXAA 2P4KA 3DTUB 5EIBD 4X65O 1FXHA 4HAMA 1GM9A 2GTAA 5A2QN 1I5YA 1Y66A 4LF8O 4X1YA 5CA0A 2ZXWC 4I7ZB 1VIBA 1BMFG 2A7WA 2ILMA 1ZL8A 2QE7G 4X9QA 2DYSB 1IXMA 5EK0A 1RP3B 2XOKG 3CRCA 1OCCC 2QWPB 2OIEA 4F6EA 4XDJA 3AG4B 4X1IA 5KUMA 1F23A 3K08A 3TJTA 2JS5A 2AHZA 4DR1B 1IX9A 1PNKA 2ITCC 2P4VA 3CC2V 1BT8A 2YC0A 3JASB 1NVPD 1Q90D 5KAFZ 3MHHC 5KMGA 4LFAB 5BY1A 1AI6A 1VQMV 2Y4TA 4QIWF 1TVKB 3Q4HA 4JTCB 4ZOLB 3T1HO 5B3SC 2IU3A 4O4HA 4DK1A 1NKDA 2ZNJA 1K3EA 4JZ2A 5LGUA 5IJ0A 4FLTA 1SC5B 2CGOA 1JJ2U 2UUCO 1R1BA 3H1HH 1Q5OA 3SYPA 2QKCA 3JAWA 3NR7A 4LH6A 3G71V 4IYHA 4DR6O 2UXBO 4DRXB 3CXCU 1EZVH 3X2QB 4B3MB 1Y76A 1QHTA 5C8YA 3JALB 4PV1B 3C3SA 2LW1A 1UFIA 4TQFA 1M57B 5L3CA 1M9NA 5LYJA 1W2BU 3CP1A 4KUMA 3OGIB 2D2CB 2UUBB 3VBBA 3E8BA 4J80A 3T4ZA 5CB4A 1HNXO 2WA3A 2JEUA 5B66Z 3JAKA 4LF6B 2JDIG 3MDSA 1DGSA 4FJCC 1WN7A 1FYJA 3E83A 3CRQA 3N27A 4IHJB 3I5DA 2V1DA 5LHIA 4JAAA 4GKJB 2M7WA 1YSCA 1FJGB 3EHBB 1RSOB 1KQSU 1VQ5V 4ZKIA 5EZYB 2UXXA 1S77D 4LF7B 1N0JA 3OUFA 4KP4A 2BSKA 2RNBA 2CGNA 2LFSA 4OPHA 3D36A 2QJ1A 4JYBA 2IBZH 1JR9A 1TUBA 1KU9A 3OD4A 4R8CA 2LGQA 3ZMUA 1R3JC 2CTRA 2ZE6A 3LUTB 2YIBD 1FPOA 4I55B 4UVAA 1I5XA 1SQBH 5CA3A 1XNQO 4NTYA 1FFXA 4LF5O 1NS1A 5ITZA 4K8XA 2PTMA 3ZRVA 5DEDA 1AP5A 3OAAG 4ZHQB 4K0KB 1YVWA 3CCSV 2XAQA 3AG1B 3SJCC 2DWDC 1IURA 1IVSA 5EYPB 1AJNA 1QCEA 3HKBB 2H94A 1US6A 4DV6B 5D5QA 1SZTA 1XNRB 2A79B 3E86A 3QNEA 1BCCH 2B9ZA 3ZBHA 4FFKA 3UQ8A 1FFTB 1R73A 4H33A 3TK1A 1P7BA 2FL4A 2P67A 4ZIBA 5CA1B 4TV9B 3M8AA 3ASOC 4KL1A 1XMOO 4BWAA 4DYLA 1OCCB 1K5QA 2LFRA 1PNLA 4DUYB 4K35A 1NJIW 2ODMA 1Q8IA 1CPYA 2ZT9B 3JCUZ 4JI6B 2DYRC 4MSWC 3IFXA 4NXMB 3ICXA 1AVMA 1WPXA 1RPOA 5IJ9A 3TETA 2HR3A 4WFGA 3J81N 3FX7A 1OHHG 1Y6XA 2QM8A 1XMQO 4DV0O 4X62O 2ITDC 2EILB 2HEPA 3QF7A 1R6NA 1GTOA 1SQVH 1XILA 3CMEV 3S3XA 2Q0OC 2Q73A 5L3GA 3VQYA 2ZNIA 1RFYA 1T5EA 2ADPA 2H3OA 1LNQA 1KP2A 1S76D 2KG7A 5J2UA 1XL6A 4ZBMA 2GUZB 3OW2U 1OCOB 4H44B 3ABKB 2IJKA 1AJQA 1AP6A 1Y67A 4RAIA 2XAFA 4LF4B 2ZCEA 1KYOF 5KX5B 3E89A 3CCVV 3SYCA 3ABMB 3UM7A 3CRRA 3F5TA 4G28B 4X8AA 3OE7G 1M5IA 4B3TB 4DV4B 1VF6C 4IGGA 3DC6A 3RYHB 3LNNA 4JI3O 2YIDA 3ZMTA 4PI2A 1SS3A 3IAYA 2A06H 4UCRA 4UXNA 2EIMB 3SJAC 2GBOA 1PNMA 4FZ1A 3W7XA 5KHGA 4MVSA 2AZ0A 1VQ8V 2F4VB 5LP6C 1NR7A 3SJBC 1N33B 2HHHO 3N2GB 2JJ2G 2MW2B 3PN1A 4O4LA 3HKEA 1QLEC 1YCIA 3FB6C 4AQYO 3K58A 3CEIA 3LDEA 1GN2A 3JD0A 4PA9A 1D2DA 4N23A 3N2KA 4FFBB 1NT2B 4O2BA 1PM9A 3ABLB 4YJ2A 4FPPA 1N36B 2UXCB 4LNUB 2OCCB 1GN4A 3CXHF 4FIPC 2WLLB 1O9HA 3TCUA 4C7UA 4JI2B 1WA8B 1EFRG 2K1EA 3APQA 4BAYA 4U3FH 1FXVA 3AG2C 3UT5A 2CK3G 2LO1A 4J10A 1GAXA 1ROPA 4HNAA 3WU2Z 3WG7B 2OCHA 5JJEB 4TOIA 1XL4A 4R7CA 1H2GA 3ABTA 3BA9A 4X66O 4RQEA 4X89A 1DTOA 3OFNG 5KHJA 3UO2A 4MVOA 3I56V 4G2KA 4KFMA 4DR5B 4J9ZB 3T4DA 3K0DA 5LOVB 1BS3A 2CE4A 1JPXA 2QM4A 4I0XA 4DV2O 2K9PA 3BFRA 3OMIB 2X6CA 2QWQB 3CRAA 1GMGA 3GB7C 2YIBA 4BW9A 4ASUG 2IH1C 1DF5A 1GM7A 3GWKC 4JTDB 2IW5A 1HW7A 2EJ7A 4JV5B 4DK0A 2YIAA 1R6KA 3L75H 4GT1A 1MMMA 3HKCB 2BE3A 1VQPV 4IIJB 2OT5A 3OTFA 4JYAB 4BIUA 1K4CC 3AG7A 4UCTA 3HKDB 2Y69C 2GHYA 4FMTA 4PA6A 2BOCC 3RVYA 2OTLV 2FKXA 3K59A 4MVRA 4FLVA 5B1NA 1YJ9V 2HFEC 3E8GA 3QO5A 1WP7A 1SQGA 3CJHB 4J11A 2DE0X 4DR1O 1YTFB 2ZDIC 3SPGA 4DR4O 3ZHRA 4U3JA 3K5MA 4YIPA 4CH3A 1FXKC 2E5LB 2PI5A 4J41A 1VMGA 3CE2A 2QWOB 4UV9A 3SYAA 3H9VA 1EN5A 4WBNB 4HZ3A 3B77A 3SPHA 1IBMO 2WA4A 4I9WA 1XDCA 3ZIAG 1KMIZ 3MAQA 2CDYA 4WFBV 2DOSA 2JVDA 4X1KB 5L3FA 2ZDIA 3LNMB 5BMVB 4NYKA 2X0LA 3CX5F 1JJOA 4DW0A 5LP6B 1J5EO 5IT9N 2JIZG 4B3MO 3KG2A 4OXSA 1M1KW 4GKKB 2CH7B 4IL6Z 4OX9B 4DRXA 4EFBA 2WPDG 2Q7GA 3RBZA 2M6YA 4B7EA 3JALA 3ZHVA 2AXTZ 5K1XA 2JJ1G 5JVDB 2R72A 1QLEB 3OGCC 5CBGA 4J7JA 1MNGA 1JMKC 1MOFA 4TUYB 3ZMSA 5JH7B 5B1OA 1I94O 3H1JH 1CXZB 4CH6A 3WB0A 3QO7A 3CD6V 3RFRA 3ZRSA 1VF7A 2XASA 1M56C 4QE9A 4QJFB 1IDSA 2C2AA 2JGDB 4IHJA 4GX1A 2UU9O 4Q20A 3K5OA 1WJZA 3AEIA 4LF7O 2EIJB 4RQFA 4CBCA 1COWG 2ZQMA 5L3EA 5EBWC 2ARHA 2KB1A 1JVMA 3DXRB 3ZHUA 3T2MA 4DR7B 1WAZA 3ZMZA 3K04A 5LMNB 3ZRWA 4P9OA 2Z0AA 5GONB 5B1AB 1PP9H 2L6LA 1S3JA 2RCVA 1KECA 2LGWA 5B1BB 5LHGA 3VOUA 1RPRA 4QE7A 3AG3B 1EBOA 3GVMA 5LMUO 1MSDA 1P49A 3THOA 3ZHQA 1UPGA 3L70H 2YXLA 4JI4O 1BGYH 3RYFB 4LFBB 4TV8B 3ML0A 3K3WA 5IYZA 4AHCA 3ABUA 2P6JA 3SYQA 5KUKA 1KD1W 2YDEA 1IBLB 2OTJV 2BTQA 4KXRA 4W4LA 2P90A 2HJFC 1HR0B 1CP9A 1K4DC 3GWOA 2ZE8A 4MTFA 3ZX6A 2HVKC 4WFFA 4RO2A 5J2TB 5E1AC 4YJ3B 2X6BA 2YS8A 4WFHA 3FAVA 1F4NA 3OMNB 4JI0O 2XHBA 1R3IC 3D3QA 1FS0G 4K3AA 1GO3F 3ZMVA 4Z1VA 5CA1A 3CCQV 4TV9A 3DGEA 3QG5A 4WCEV 3FYIB 3CPWU 4JI6O 1OCZC 3STZC 2YXYA 4NXMO 3JCZA 2NLJC 3HR0A 4YXWG 5CBFA 2CTWA 3ZS8C 1YTFD 3G80A 1HNZB 2MK3A 4I50A 2YUAA 3A2FA 2VS0A 1N34B 2Y48A 3CRMA 5H5NA 3D36C 4LC1A 1QR9A 2LJ2A 4B3SB 1B3QA 1Y74B 2Q7EA 4E4EA 4UB8Z 4DV5O 1BHAA 2ETNA 1V9PA 1AI7A 4EEQA 5LGTA 5BR8B 1P84F 1TUEB 2P5OA 4Z1MG 1D5NA 1H2MA 1MSWD 3H1KH 2EULA 5IDJA 4GCZA 3SPIA 2OIGA 4CZZA 3OTOB 1XREA 1ZX3A 4X1YB 4PD4F 4DV3O 3OR6C 1V55C 4LWSA 3RGBA 1CEZA 1YDXA 3WB1A 4MVQA 1K8AW 4LF8B 4UVCA 3ETDA 2E75B 1VEWA 3B8MA 3EFFK 1ZL8B 4F6RA 3FB7C 5FL7G 4B3TO 4JI7O 1VQ9V 3RT3C 3LSQA 4DV4O 2VWJA 3RYIA 2QKAA 5HFMA 2P7TC 2PI4A 1G8MA 1Q7YW 3CB2A 4JAUA 2GV9A 2UXDO 4NR1A 4UCOA 1HNWO 1OZ0A 4J7ZA 4LP8A 1JQ0A 1FD9A 1X4TA 3CCRV 5KAIZ 4X1IB 1S72V 4EB6A 3ZHSA 3ETGA 3JYCA 4YHHO 2ZXWB 1WB8A 5IY5C 2AW9A 3OEEG 2QWRB 4X20A 2P06A 3K03A 5KMGB 5EIBC 2RMKB 2V4DA 4X64O 4X88A 3Q4HB 4LFCO 4MTOA 3RVZA 1THZA 1G6UA 2VWKA 1NI8A 4ABMA 3BA8A 3K5LA 1N36O 4FFBA 2WLMA 1B04A 5LXTA 4JAVA 4JPRA 5IJ0B 1SA0B 2B1IA 4LNUA 3JAWB 3L72H 3JATA 2UUCB 1NR1A 3LSUA 1MG1A 2DN9A 1QU7A 5DECA 1IBKB 2A0LA 1QNMA 4DR6B 3A0RA 3E8FA 1K73W 2UXBB 2N04A 1Y76B 2UUAO 5C8YB 2PY5A 2Q8VA 1AROP 5B3SB 1GN6A 4OPAA 4L8JA 4DV1O 5FNVA 4BIZA 3K5NA 2WLKA 4O4JA 1NTZH 5CB4B 4DR5O 1E79G 4DV7O 4DR2B 4JGSA 2QTOA 2XUMA 3JAKB 2ZD9A 2FYUH 4KHPB 2VRZA 5DM6V 2QKSA 3VQXA 2AZ2A 2GTSA 4NXNB 3JSNA 1GN3A 1K5SA 1SQFA 1WP8A 1QVGU 5EC1C 3IJ4A 4UCUA 1SZXA 3WFVA 5C93A 1K97A 1R3LC 1PL4A 3JD1A 4DW1A 2QSAA 4I4TA 2YEVA 2ZKOA 2BSKB 4FVMA 4I5SA 4GLXA 2VQFB 3OT7A 3R65A 1TUBB 1L8DA 4XDKA 1URFA 3CCJV 4LF9O 1EN4A 5DN6G 1BQ0A 3AK2A 4MS2A 2WWWA 3CHXA 3D8CA 1XI1A 2ATKC 2EX3A 1FFXB 1F4MA 1P4RA 2BOBC 3JARA 1XNQB 4LF5B 5LA6A 4ZI7B 3CC7V 4I9QA 4RWUA 4DR3O 1OV9A 5FPRA 3TXQA 5F2VO 1U97A 4MW8A 2IM9A 1YI2V 2LW7A 3KCYA 1OCRC 4XBFA 2RDCA 1M4UA 1BE3H 1KKDA 4AI8A 4DUZO 4PJ0Z 2DMXA 4O2AA 1V54C 1XUQA 1Q81W 3IC9A 4FK5C 2W6IG 4JI8O 3E22A 1W59A 1AI4A 1WB7A 5FLXN 4PA3A 1RM1C 4JYCA 1XMOB 3RYCA 2VQEB 3A0BZ 2FTKA 1JA8A 2NR5A 4LH7A 4O4IA 1O9GA 1QQCA 4UUJC 2QM7A 1SERA 3VQWA 2G38A 5IJ9B 4JI5O 5BXZA 2WLIA 3K06A 1X59A 4GKKO 1XBLA 4JZGA 3W7SA 3KZIZ 4ICGA 3TXSA 1N32O 4JI1B 1ZTEA 1YJWV 1XMQB 5EBMC 1I0HA 1XQ8A 2EZOA 4DV0B 2ZR2A 3ASOB 3FFQA 2L35A 4QGPA 2B1GA 5IWAO 2EJRA 5JCOC 2Q4PA 5JQGA 1S0VA 3K9AA 4H0LB 2X6AA 3OUSA 2DYRB 5A9GA 2HP8A 3H1LH 3IGAC 2KG7B 5J2UB 3S3WA 3ZHTA 2YXHA 1N8RW 3T1CA 2XAGA 4J42A 4Z2WA 3G4SV 2HLDG 3AG4C 1YIJV 1Q43A 1SRYA 2HJDA 1VQ6V 1HWYA 1PPJH 2CTPA 1HDJA 5JCOA 3ZEDA 2FMLA 2DQ0A 2F43G 1L1FA 2PZSA 2Z3YA 3JSLA 1AILA 4TQDA 2JEXA 3OEHG 1IZ3A 2F23A 3SPCA 4MVZA 2IJJA 5JJJB 5GONA 4JI3B 2XTAA 1IXBA 3C90A 4UCVA 3BPZA 5CN0A 3SR2C 3R66A 1GKFA 1KB9F 1W0JG 4NKGB 5LBQA 1PL0A 4WFAV 3ZN1A 4JASA 4TV8A 4LFAO 1EM1A 1BQZA 3JASA 4EFEA 5J9PC 4JTAB 1XHXA 3QTCA 4IT5A 3X2QC 1AJPA 1IBLO 1HR0O 1M93A 3D3IA 2HHHB 4O4LB 4JF3A 4MTXA 1R3KC 2ZE5A 1M57C 3HKEB 1H2KA 1TVKA 3AK3A 4ZOLA 4B7KA 2E76B 3N2KB 3ZN0A 4O2BB 3F7VC 2W0FC 4UCSA 4YJ2B 4D6TH 2X7RB 3T1YB 1P7GA 2XT9A 1LUWA 4CH4A 4FM0A 4P30A 2WLNA 1S5JA 4B08A 4MTGA 1NBMG 4PA4A 1A32A 2JK5C 4W4KA 4HYOA 1Z2GA 3U0ZA 4HNAB 1SQPH 3E8HA 3JD3A 2E3CA 2YSUB 1N34O 2JGUA 3CSXA 4FLYA 3PJSK 5H9CA 2UUBO 3P3PA 3BAAA 4X66B 1WNSA 4B3SO 3G67A 4LF6O 2W0XA 3ETQA 1Q6UA 4J9YB 4F4LA 2ZM6B 5KA5A 3AG2B 1NTKH 4I0XB 1YXBA 4GKJO 1FJGO 1F7YA 1BZKA 4RUEA 1SF9A 3FKSG 1M90W 4DV2B 3HB3B 1RSOA 3SYOA 3WB2A 5EZYA 1VARA 3H1IH 1JCHA 3W7WA 4JYYA 1H8EG 1U96A 1FAFA 1VQKV 3OTOO 3AG1C 4R50A 3RN4A 4EKWA 4UB6Z 2EBOA 4MVMA 4PDVA 3BABA 3P32A 4UV8A 2CTQA 1ENVA 1QBZA 1ZAUA 2YICA 3SGIA 1KKCA 2NN4A 1EN6A 2Q9LA 1OJHA 1AR1B 1NH2B 3CCEV 2QWNB 1EZJA 5JWPA 1YZBA 3F7YC 3VQVA 2EINC 4I55A 4IYIA 4LBEC 1BSMA 1DLBA 3U10A 2DJVA 4K0KO 4ZHQA 1Q6HA 3CS5A 2ZIMA 2RJZA 5LGNA 3OR7C 3QO8A 4DV6O 2E74B 5EYPA 1K92A 1XNRO 1PKXA 2W6JG 3HKBA 4U3JB 4DR4B 2Y69B 3RWRD 3IC7A 4PHZA 2EILC 2IH3C 1Q3EA 3CCLV 4WFEA 4DUYO 4BIOA 4PDLA 1IBMB 4DO2A 4K8ZA 3QVNA 4YY3B 3W7TA 3EVKA 3B40A 2DW4A 2XAJA 2Q5ZA 4MW3A 1BHBA 4U7NA 4QNHB 1I08A 1SA0A 2IJIA 2Q7HA 1IBKO 2WAMA 1JFFB 3L73H 2PUSA 2Y0IA 1OCOC 1FXKB 4GUNA 3ABKC 1E1RG 1J5EB 5GTIZ 4CC6A 4B3RB 2Q0AA 2WSSG 1QLNA 4CS3A 1VQ7V 4R6ZA 3ABMC 3L71H 2R9IA 4GZRB 4DR2O 1YEWA 2IU0A 4GX2A 4KHPO 3CMAV 1I94B 3STLC 3C3TA 2F93B 1NZ6A 4NXNO 2GUZA 3A8TA 1MABG 5BZBA 3BEHA 3CWBH 4LF4O 1S5HC 1XEQA 2EIMC 5GTHZ 2KQXA 4X65B 5KX5A 1H8HG 5CA0B 3M99B 4NB5A 2A3QA 2UU9B 4PA7A 1XOUA 4BR6A 3DC5A 5AG2A 3B2EE 2VQFO 3P30A 4GX5A 1MZFA 3CYOA 3RYHA 3JD2A 3P3NA 3JAMN 3ZRWB 1B06A 2HVJC 4FLUA 1M56B 2QDOA 1KC8W 1E1QG 2PF4E 2PGGA 3ABLC 5IYDO 1VQ4V 3ASNC 2YI8A 3E35A 2OCCC 2P22C 2F4VO 5HFLA 2R70A 4LCUC 5LMUB 1N33O 1HP8A 3JD4A 4JI4B 1SESA 5CMUA 5IYZB 3N2GA 4UVBA 4ZI7A 5LL6Y 1R6TA 4RUFA 3WG7C 2BTQB 5JJNB 3E2EA 2F1MA 5KHHA 4E2LA 4O4HB 1XHZA 3G6BA 4TT3G 3T1HB 2UXCO 1AR5A 2OWOA 2QR4A 3FAVB 1NH2D 2HKOA 4JI2O 2XNDG 4FM1A 3KKYA 5LHHA 1JOYA 2WLLA 1WA8A 2EINB 5H6QA 4JI0B 1NQTA 2VQEO 2EIKC 2PYJA 3J7AU 1S5LZ 2IJHA 1J95A 2UXNA 2RN9A 2RQ6A 4MT8A 4PI0A 5LYJB 5H2FZ 4I50B 3HPLC 5KHIA 1AB3A 4JI1O 3ETEA 3F5WC 2WLHA 1H2SB 1KUQA 1YITV 1H2LA 4GX0A 5L3BA 3FB8C 3L9DA 1VP7A 2KSDA 2GSMB 1VQOV 1SQQH 5LOVA 3K57A 1ZSPA 1HNXB 3FB5C 2KKWA 2WLJA 2ZR3A 1H38A 5IYBO 1OCZB 3BVOA 4DV5B 3LDDA 2OYQA 3FYEB 3MD0A 2DWEC 2BTOA 2BCCH 3O65A 4JV5O 2Y4UA 2R9AA 1Q6IA 4PDMA 2AHYA 3CCMV 3ZRXA 1WLEA 4JYAO 5FPOA 3HKCA 4IIJA 1SETA 4H13B 2Q68A 4LWSB 1L0NH 1SKVA 4FLZA 3HKDA 2EZPA 4DV3B 1KP3A 1ZUQA 2B5UA 3DSQA 4F6RB 1VQNV 2O57A 4QPJA 1DK1A 3ZCCA 3RYIB 1GH6A 4JI7B 1GRJA 2N05A 4FLWA 2QGNA 2AGAA 4CS2A 4NVPA 4PDRA 4Q6GA 4FZ0A 3KCXA 5ITZB 4H37A 3CJHA 4PELA 3A0HZ 2UXDB 1HNWB 3OMAB 3LSSA 4EB6B 1B6QA 3L74H 4BW5A 2E5LO 3K0GA 1PV0A 1V55B 1W0KG 2R9RB 4D7SA 4YHHB 4X20B 2Q69A 4P2ZA 3FD9A 3UKMA 4WBNA 4YIOA 1Z5WA 5H6RA 4TSFG 4A5UB 4LR3A 2HG5C 1VF6A 1FKAO 4X64B 4UFZA 4LFCB 3TGUH 1K34A 1TGOA 3T1YO 3MHSC 5LXTB 2Q6AA 3ASNB 1Y4MA 4X1KA 5GW7A 5KLVH 3K9SA 2D3OW 3JATB 5BMVA 3SJQC 2Z5UA 4OX9O 2JRIA 5LP6A 3M7MX 5IY5B 1D5AA 2LQTA 2CH7A 1Z5VA 1AI5A 2Y0PA 5JVDA 4X62B 1ZLZA 4G27B 2UUAB 5IYCO 4TWKA 1YF2A 2EIJC 5FNVB 4TUYA 5JH7A 2PYLA 2ZE7A 4DV1B 4O4JB 4N21A 2DYSC 1G4YB 1K9MW 4WF9V 3BHPA 2DQ3A 4CS4A 4D7TA 2ZM6O 1NU1H 4DV7B 2YI9A 5B1AC 4U7OA 1K7DA 2EIKB 2JGDA 5B1BC 1PD3A 2F66C 4FM2A 3RW0A 2JS3A 3I55V 4NTWA 1MZEA 3AG3C 3B09A 1MA1A 1N4CA 3UCSC 2F95B 5CBHA 1VQLV 4J7KA 3ZJZA 1ORQC 1GK9A 2FB5A 1G1XB 2ZINA 1NVPB 1TA8A 4I4TB 1I7FA 2YEVB 4DR7O 1VF5B 4XDLA 1YHQV 1JX9A 3DXRA 2ADQB 5LMNO 2GDSA 2XAHA 4NTXA 1GM8A 4P9PA 1KBHA 5L3DA 3H01A 5IE9A 1LR1A 4GYCB 4HBNA 3BY6A 3SPJA 2CAZC 4LF9B 4MVUA 4OGQB 1K33A 5B5EZ 4LFBO 1LUVA 4FLXA 3RYFA 5EBLC 1Q86W 3JARB 5LA6B 3W7UA 2QEXV 1N0NA 2N74A 5E79Z 2LP7A 3J80N 2NNUA 3B8NA 4DR3B 5K1PA 2QA4V 5J2TA 4AQYB 3UO3A 5TISZ 4YJ3A 1SQXH 1WPBA 3O9OA 3G6EV 4O2AB 4DUZB 3E22B 4YY3O 4AILC 3UT5B 1YJNV 4JI8B 2CUGA 3OM3B 3RYCB 2Q67A 1QR8A 4O4IB 1HNZO 1L0LH 3BCCH 2ZIOA 1UJWB 2V7QG 1NTMH 2WLIB 1ZWIC 1JFFA 3CCUV 3B4SA 2QTSA 4L87A 3CC4V 1OCRB 4JI5B 3SDLA 1Q82W 1FXKA 3BRCA
chains in the Genus database with same CATH topology
1BZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZK A; 
#chains in the Genus database with same CATH topology
 3K79 A;  4B3R O;  3APO A;  3LDC A;  1V54 B;  3AK1 A;  4DXW A;  1N32 B;  1Y74 A;  5D5P A;  1DF4 A;  4CH5 A;  4CC5 A;  1BL8 A;  1RM1 B;  1AR4 A;  4QPK A;  5JQG B;  5BR8 O;  5KA6 A;  1TAE A;  2A9H A;  5IWA B;  3U11 A;  1F51 A;  5EC2 C;  2H8P C;  1H2N A;  3NXS A;  1QVF U;  5KHK A;  3EXA A;  2P4K A;  3DTU B;  5EIB D;  4X65 O;  1FXH A;  4HAM A;  1GM9 A;  2GTA A;  5A2Q N;  1I5Y A;  1Y66 A;  4LF8 O;  4X1Y A;  5CA0 A;  2ZXW C;  4I7Z B;  1VIB A;  1BMF G;  2A7W A;  2ILM A;  1ZL8 A;  2QE7 G;  4X9Q A;  2DYS B;  1IXM A;  5EK0 A;  1RP3 B;  2XOK G;  3CRC A;  1OCC C;  2QWP B;  2OIE A;  4F6E A;  4XDJ A;  3AG4 B;  4X1I A;  5KUM A;  1F23 A;  3K08 A;  3TJT A;  2JS5 A;  2AHZ A;  4DR1 B;  1IX9 A;  1PNK A;  2ITC C;  2P4V A;  3CC2 V;  1BT8 A;  2YC0 A;  3JAS B;  1NVP D;  1Q90 D;  5KAF Z;  3MHH C;  5KMG A;  4LFA B;  5BY1 A;  1AI6 A;  1VQM V;  2Y4T A;  4QIW F;  1TVK B;  3Q4H A;  4JTC B;  4ZOL B;  3T1H O;  5B3S C;  2IU3 A;  4O4H A;  4DK1 A;  1NKD A;  2ZNJ A;  1K3E A;  4JZ2 A;  5LGU A;  5IJ0 A;  4FLT A;  1SC5 B;  2CGO A;  1JJ2 U;  2UUC O;  1R1B A;  3H1H H;  1Q5O A;  3SYP A;  2QKC A;  3JAW A;  3NR7 A;  4LH6 A;  3G71 V;  4IYH A;  4DR6 O;  2UXB O;  4DRX B;  3CXC U;  1EZV H;  3X2Q B;  4B3M B;  1Y76 A;  1QHT A;  5C8Y A;  3JAL B;  4PV1 B;  3C3S A;  2LW1 A;  1UFI A;  4TQF A;  1M57 B;  5L3C A;  1M9N A;  5LYJ A;  1W2B U;  3CP1 A;  4KUM A;  3OGI B;  2D2C B;  2UUB B;  3VBB A;  3E8B A;  4J80 A;  3T4Z A;  5CB4 A;  1HNX O;  2WA3 A;  2JEU A;  5B66 Z;  3JAK A;  4LF6 B;  2JDI G;  3MDS A;  1DGS A;  4FJC C;  1WN7 A;  1FYJ A;  3E83 A;  3CRQ A;  3N27 A;  4IHJ B;  3I5D A;  2V1D A;  5LHI A;  4JAA A;  4GKJ B;  2M7W A;  1YSC A;  1FJG B;  3EHB B;  1RSO B;  1KQS U;  1VQ5 V;  4ZKI A;  5EZY B;  2UXX A;  1S77 D;  4LF7 B;  1N0J A;  3OUF A;  4KP4 A;  2BSK A;  2RNB A;  2CGN A;  2LFS A;  4OPH A;  3D36 A;  2QJ1 A;  4JYB A;  2IBZ H;  1JR9 A;  1TUB A;  1KU9 A;  3OD4 A;  4R8C A;  2LGQ A;  3ZMU A;  1R3J C;  2CTR A;  2ZE6 A;  3LUT B;  2YIB D;  1FPO A;  4I55 B;  4UVA A;  1I5X A;  1SQB H;  5CA3 A;  1XNQ O;  4NTY A;  1FFX A;  4LF5 O;  1NS1 A;  5ITZ A;  4K8X A;  2PTM A;  3ZRV A;  5DED A;  1AP5 A;  3OAA G;  4ZHQ B;  4K0K B;  1YVW A;  3CCS V;  2XAQ A;  3AG1 B;  3SJC C;  2DWD C;  1IUR A;  1IVS A;  5EYP B;  1AJN A;  1QCE A;  3HKB B;  2H94 A;  1US6 A;  4DV6 B;  5D5Q A;  1SZT A;  1XNR B;  2A79 B;  3E86 A;  3QNE A;  1BCC H;  2B9Z A;  3ZBH A;  4FFK A;  3UQ8 A;  1FFT B;  1R73 A;  4H33 A;  3TK1 A;  1P7B A;  2FL4 A;  2P67 A;  4ZIB A;  5CA1 B;  4TV9 B;  3M8A A;  3ASO C;  4KL1 A;  1XMO O;  4BWA A;  4DYL A;  1OCC B;  1K5Q A;  2LFR A;  1PNL A;  4DUY B;  4K35 A;  1NJI W;  2ODM A;  1Q8I A;  1CPY A;  2ZT9 B;  3JCU Z;  4JI6 B;  2DYR C;  4MSW C;  3IFX A;  4NXM B;  3ICX A;  1AVM A;  1WPX A;  1RPO A;  5IJ9 A;  3TET A;  2HR3 A;  4WFG A;  3J81 N;  3FX7 A;  1OHH G;  1Y6X A;  2QM8 A;  1XMQ O;  4DV0 O;  4X62 O;  2ITD C;  2EIL B;  2HEP A;  3QF7 A;  1R6N A;  1GTO A;  1SQV H;  1XIL A;  3CME V;  3S3X A;  2Q0O C;  2Q73 A;  5L3G A;  3VQY A;  2ZNI A;  1RFY A;  1T5E A;  2ADP A;  2H3O A;  1LNQ A;  1KP2 A;  1S76 D;  2KG7 A;  5J2U A;  1XL6 A;  4ZBM A;  2GUZ B;  3OW2 U;  1OCO B;  4H44 B;  3ABK B;  2IJK A;  1AJQ A;  1AP6 A;  1Y67 A;  4RAI A;  2XAF A;  4LF4 B;  2ZCE A;  1KYO F;  5KX5 B;  3E89 A;  3CCV V;  3SYC A;  3ABM B;  3UM7 A;  3CRR A;  3F5T A;  4G28 B;  4X8A A;  3OE7 G;  1M5I A;  4B3T B;  4DV4 B;  1VF6 C;  4IGG A;  3DC6 A;  3RYH B;  3LNN A;  4JI3 O;  2YID A;  3ZMT A;  4PI2 A;  1SS3 A;  3IAY A;  2A06 H;  4UCR A;  4UXN A;  2EIM B;  3SJA C;  2GBO A;  1PNM A;  4FZ1 A;  3W7X A;  5KHG A;  4MVS A;  2AZ0 A;  1VQ8 V;  2F4V B;  5LP6 C;  1NR7 A;  3SJB C;  1N33 B;  2HHH O;  3N2G B;  2JJ2 G;  2MW2 B;  3PN1 A;  4O4L A;  3HKE A;  1QLE C;  1YCI A;  3FB6 C;  4AQY O;  3K58 A;  3CEI A;  3LDE A;  1GN2 A;  3JD0 A;  4PA9 A;  1D2D A;  4N23 A;  3N2K A;  4FFB B;  1NT2 B;  4O2B A;  1PM9 A;  3ABL B;  4YJ2 A;  4FPP A;  1N36 B;  2UXC B;  4LNU B;  2OCC B;  1GN4 A;  3CXH F;  4FIP C;  2WLL B;  1O9H A;  3TCU A;  4C7U A;  4JI2 B;  1WA8 B;  1EFR G;  2K1E A;  3APQ A;  4BAY A;  4U3F H;  1FXV A;  3AG2 C;  3UT5 A;  2CK3 G;  2LO1 A;  4J10 A;  1GAX A;  1ROP A;  4HNA A;  3WU2 Z;  3WG7 B;  2OCH A;  5JJE B;  4TOI A;  1XL4 A;  4R7C A;  1H2G A;  3ABT A;  3BA9 A;  4X66 O;  4RQE A;  4X89 A;  1DTO A;  3OFN G;  5KHJ A;  3UO2 A;  4MVO A;  3I56 V;  4G2K A;  4KFM A;  4DR5 B;  4J9Z B;  3T4D A;  3K0D A;  5LOV B;  1BS3 A;  2CE4 A;  1JPX A;  2QM4 A;  4I0X A;  4DV2 O;  2K9P A;  3BFR A;  3OMI B;  2X6C A;  2QWQ B;  3CRA A;  1GMG A;  3GB7 C;  2YIB A;  4BW9 A;  4ASU G;  2IH1 C;  1DF5 A;  1GM7 A;  3GWK C;  4JTD B;  2IW5 A;  1HW7 A;  2EJ7 A;  4JV5 B;  4DK0 A;  2YIA A;  1R6K A;  3L75 H;  4GT1 A;  1MMM A;  3HKC B;  2BE3 A;  1VQP V;  4IIJ B;  2OT5 A;  3OTF A;  4JYA B;  4BIU A;  1K4C C;  3AG7 A;  4UCT A;  3HKD B;  2Y69 C;  2GHY A;  4FMT A;  4PA6 A;  2BOC C;  3RVY A;  2OTL V;  2FKX A;  3K59 A;  4MVR A;  4FLV A;  5B1N A;  1YJ9 V;  2HFE C;  3E8G A;  3QO5 A;  1WP7 A;  1SQG A;  3CJH B;  4J11 A;  2DE0 X;  4DR1 O;  1YTF B;  2ZDI C;  3SPG A;  4DR4 O;  3ZHR A;  4U3J A;  3K5M A;  4YIP A;  4CH3 A;  1FXK C;  2E5L B;  2PI5 A;  4J41 A;  1VMG A;  3CE2 A;  2QWO B;  4UV9 A;  3SYA A;  3H9V A;  1EN5 A;  4WBN B;  4HZ3 A;  3B77 A;  3SPH A;  1IBM O;  2WA4 A;  4I9W A;  1XDC A;  3ZIA G;  1KMI Z;  3MAQ A;  2CDY A;  4WFB V;  2DOS A;  2JVD A;  4X1K B;  5L3F A;  2ZDI A;  3LNM B;  5BMV B;  4NYK A;  2X0L A;  3CX5 F;  1JJO A;  4DW0 A;  5LP6 B;  1J5E O;  5IT9 N;  2JIZ G;  4B3M O;  3KG2 A;  4OXS A;  1M1K W;  4GKK B;  2CH7 B;  4IL6 Z;  4OX9 B;  4DRX A;  4EFB A;  2WPD G;  2Q7G A;  3RBZ A;  2M6Y A;  4B7E A;  3JAL A;  3ZHV A;  2AXT Z;  5K1X A;  2JJ1 G;  5JVD B;  2R72 A;  1QLE B;  3OGC C;  5CBG A;  4J7J A;  1MNG A;  1JMK C;  1MOF A;  4TUY B;  3ZMS A;  5JH7 B;  5B1O A;  1I94 O;  3H1J H;  1CXZ B;  4CH6 A;  3WB0 A;  3QO7 A;  3CD6 V;  3RFR A;  3ZRS A;  1VF7 A;  2XAS A;  1M56 C;  4QE9 A;  4QJF B;  1IDS A;  2C2A A;  2JGD B;  4IHJ A;  4GX1 A;  2UU9 O;  4Q20 A;  3K5O A;  1WJZ A;  3AEI A;  4LF7 O;  2EIJ B;  4RQF A;  4CBC A;  1COW G;  2ZQM A;  5L3E A;  5EBW C;  2ARH A;  2KB1 A;  1JVM A;  3DXR B;  3ZHU A;  3T2M A;  4DR7 B;  1WAZ A;  3ZMZ A;  3K04 A;  5LMN B;  3ZRW A;  4P9O A;  2Z0A A;  5GON B;  5B1A B;  1PP9 H;  2L6L A;  1S3J A;  2RCV A;  1KEC A;  2LGW A;  5B1B B;  5LHG A;  3VOU A;  1RPR A;  4QE7 A;  3AG3 B;  1EBO A;  3GVM A;  5LMU O;  1MSD A;  1P49 A;  3THO A;  3ZHQ A;  1UPG A;  3L70 H;  2YXL A;  4JI4 O;  1BGY H;  3RYF B;  4LFB B;  4TV8 B;  3ML0 A;  3K3W A;  5IYZ A;  4AHC A;  3ABU A;  2P6J A;  3SYQ A;  5KUK A;  1KD1 W;  2YDE A;  1IBL B;  2OTJ V;  2BTQ A;  4KXR A;  4W4L A;  2P90 A;  2HJF C;  1HR0 B;  1CP9 A;  1K4D C;  3GWO A;  2ZE8 A;  4MTF A;  3ZX6 A;  2HVK C;  4WFF A;  4RO2 A;  5J2T B;  5E1A C;  4YJ3 B;  2X6B A;  2YS8 A;  4WFH A;  3FAV A;  1F4N A;  3OMN B;  4JI0 O;  2XHB A;  1R3I C;  3D3Q A;  1FS0 G;  4K3A A;  1GO3 F;  3ZMV A;  4Z1V A;  5CA1 A;  3CCQ V;  4TV9 A;  3DGE A;  3QG5 A;  4WCE V;  3FYI B;  3CPW U;  4JI6 O;  1OCZ C;  3STZ C;  2YXY A;  4NXM O;  3JCZ A;  2NLJ C;  3HR0 A;  4YXW G;  5CBF A;  2CTW A;  3ZS8 C;  1YTF D;  3G80 A;  1HNZ B;  2MK3 A;  4I50 A;  2YUA A;  3A2F A;  2VS0 A;  1N34 B;  2Y48 A;  3CRM A;  5H5N A;  3D36 C;  4LC1 A;  1QR9 A;  2LJ2 A;  4B3S B;  1B3Q A;  1Y74 B;  2Q7E A;  4E4E A;  4UB8 Z;  4DV5 O;  1BHA A;  2ETN A;  1V9P A;  1AI7 A;  4EEQ A;  5LGT A;  5BR8 B;  1P84 F;  1TUE B;  2P5O A;  4Z1M G;  1D5N A;  1H2M A;  1MSW D;  3H1K H;  2EUL A;  5IDJ A;  4GCZ A;  3SPI A;  2OIG A;  4CZZ A;  3OTO B;  1XRE A;  1ZX3 A;  4X1Y B;  4PD4 F;  4DV3 O;  3OR6 C;  1V55 C;  4LWS A;  3RGB A;  1CEZ A;  1YDX A;  3WB1 A;  4MVQ A;  1K8A W;  4LF8 B;  4UVC A;  3ETD A;  2E75 B;  1VEW A;  3B8M A;  3EFF K;  1ZL8 B;  4F6R A;  3FB7 C;  5FL7 G;  4B3T O;  4JI7 O;  1VQ9 V;  3RT3 C;  3LSQ A;  4DV4 O;  2VWJ A;  3RYI A;  2QKA A;  5HFM A;  2P7T C;  2PI4 A;  1G8M A;  1Q7Y W;  3CB2 A;  4JAU A;  2GV9 A;  2UXD O;  4NR1 A;  4UCO A;  1HNW O;  1OZ0 A;  4J7Z A;  4LP8 A;  1JQ0 A;  1FD9 A;  1X4T A;  3CCR V;  5KAI Z;  4X1I B;  1S72 V;  4EB6 A;  3ZHS A;  3ETG A;  3JYC A;  4YHH O;  2ZXW B;  1WB8 A;  5IY5 C;  2AW9 A;  3OEE G;  2QWR B;  4X20 A;  2P06 A;  3K03 A;  5KMG B;  5EIB C;  2RMK B;  2V4D A;  4X64 O;  4X88 A;  3Q4H B;  4LFC O;  4MTO A;  3RVZ A;  1THZ A;  1G6U A;  2VWK A;  1NI8 A;  4ABM A;  3BA8 A;  3K5L A;  1N36 O;  4FFB A;  2WLM A;  1B04 A;  5LXT A;  4JAV A;  4JPR A;  5IJ0 B;  1SA0 B;  2B1I A;  4LNU A;  3JAW B;  3L72 H;  3JAT A;  2UUC B;  1NR1 A;  3LSU A;  1MG1 A;  2DN9 A;  1QU7 A;  5DEC A;  1IBK B;  2A0L A;  1QNM A;  4DR6 B;  3A0R A;  3E8F A;  1K73 W;  2UXB B;  2N04 A;  1Y76 B;  2UUA O;  5C8Y B;  2PY5 A;  2Q8V A;  1ARO P;  5B3S B;  1GN6 A;  4OPA A;  4L8J A;  4DV1 O;  5FNV A;  4BIZ A;  3K5N A;  2WLK A;  4O4J A;  1NTZ H;  5CB4 B;  4DR5 O;  1E79 G;  4DV7 O;  4DR2 B;  4JGS A;  2QTO A;  2XUM A;  3JAK B;  2ZD9 A;  2FYU H;  4KHP B;  2VRZ A;  5DM6 V;  2QKS A;  3VQX A;  2AZ2 A;  2GTS A;  4NXN B;  3JSN A;  1GN3 A;  1K5S A;  1SQF A;  1WP8 A;  1QVG U;  5EC1 C;  3IJ4 A;  4UCU A;  1SZX A;  3WFV A;  5C93 A;  1K97 A;  1R3L C;  1PL4 A;  3JD1 A;  4DW1 A;  2QSA A;  4I4T A;  2YEV A;  2ZKO A;  2BSK B;  4FVM A;  4I5S A;  4GLX A;  2VQF B;  3OT7 A;  3R65 A;  1TUB B;  1L8D A;  4XDK A;  1URF A;  3CCJ V;  4LF9 O;  1EN4 A;  5DN6 G;  1BQ0 A;  3AK2 A;  4MS2 A;  2WWW A;  3CHX A;  3D8C A;  1XI1 A;  2ATK C;  2EX3 A;  1FFX B;  1F4M A;  1P4R A;  2BOB C;  3JAR A;  1XNQ B;  4LF5 B;  5LA6 A;  4ZI7 B;  3CC7 V;  4I9Q A;  4RWU A;  4DR3 O;  1OV9 A;  5FPR A;  3TXQ A;  5F2V O;  1U97 A;  4MW8 A;  2IM9 A;  1YI2 V;  2LW7 A;  3KCY A;  1OCR C;  4XBF A;  2RDC A;  1M4U A;  1BE3 H;  1KKD A;  4AI8 A;  4DUZ O;  4PJ0 Z;  2DMX A;  4O2A A;  1V54 C;  1XUQ A;  1Q81 W;  3IC9 A;  4FK5 C;  2W6I G;  4JI8 O;  3E22 A;  1W59 A;  1AI4 A;  1WB7 A;  5FLX N;  4PA3 A;  1RM1 C;  4JYC A;  1XMO B;  3RYC A;  2VQE B;  3A0B Z;  2FTK A;  1JA8 A;  2NR5 A;  4LH7 A;  4O4I A;  1O9G A;  1QQC A;  4UUJ C;  2QM7 A;  1SER A;  3VQW A;  2G38 A;  5IJ9 B;  4JI5 O;  5BXZ A;  2WLI A;  3K06 A;  1X59 A;  4GKK O;  1XBL A;  4JZG A;  3W7S A;  3KZI Z;  4ICG A;  3TXS A;  1N32 O;  4JI1 B;  1ZTE A;  1YJW V;  1XMQ B;  5EBM C;  1I0H A;  1XQ8 A;  2EZO A;  4DV0 B;  2ZR2 A;  3ASO B;  3FFQ A;  2L35 A;  4QGP A;  2B1G A;  5IWA O;  2EJR A;  5JCO C;  2Q4P A;  5JQG A;  1S0V A;  3K9A A;  4H0L B;  2X6A A;  3OUS A;  2DYR B;  5A9G A;  2HP8 A;  3H1L H;  3IGA C;  2KG7 B;  5J2U B;  3S3W A;  3ZHT A;  2YXH A;  1N8R W;  3T1C A;  2XAG A;  4J42 A;  4Z2W A;  3G4S V;  2HLD G;  3AG4 C;  1YIJ V;  1Q43 A;  1SRY A;  2HJD A;  1VQ6 V;  1HWY A;  1PPJ H;  2CTP A;  1HDJ A;  5JCO A;  3ZED A;  2FML A;  2DQ0 A;  2F43 G;  1L1F A;  2PZS A;  2Z3Y A;  3JSL A;  1AIL A;  4TQD A;  2JEX A;  3OEH G;  1IZ3 A;  2F23 A;  3SPC A;  4MVZ A;  2IJJ A;  5JJJ B;  5GON A;  4JI3 B;  2XTA A;  1IXB A;  3C90 A;  4UCV A;  3BPZ A;  5CN0 A;  3SR2 C;  3R66 A;  1GKF A;  1KB9 F;  1W0J G;  4NKG B;  5LBQ A;  1PL0 A;  4WFA V;  3ZN1 A;  4JAS A;  4TV8 A;  4LFA O;  1EM1 A;  1BQZ A;  3JAS A;  4EFE A;  5J9P C;  4JTA B;  1XHX A;  3QTC A;  4IT5 A;  3X2Q C;  1AJP A;  1IBL O;  1HR0 O;  1M93 A;  3D3I A;  2HHH B;  4O4L B;  4JF3 A;  4MTX A;  1R3K C;  2ZE5 A;  1M57 C;  3HKE B;  1H2K A;  1TVK A;  3AK3 A;  4ZOL A;  4B7K A;  2E76 B;  3N2K B;  3ZN0 A;  4O2B B;  3F7V C;  2W0F C;  4UCS A;  4YJ2 B;  4D6T H;  2X7R B;  3T1Y B;  1P7G A;  2XT9 A;  1LUW A;  4CH4 A;  4FM0 A;  4P30 A;  2WLN A;  1S5J A;  4B08 A;  4MTG A;  1NBM G;  4PA4 A;  1A32 A;  2JK5 C;  4W4K A;  4HYO A;  1Z2G A;  3U0Z A;  4HNA B;  1SQP H;  3E8H A;  3JD3 A;  2E3C A;  2YSU B;  1N34 O;  2JGU A;  3CSX A;  4FLY A;  3PJS K;  5H9C A;  2UUB O;  3P3P A;  3BAA A;  4X66 B;  1WNS A;  4B3S O;  3G67 A;  4LF6 O;  2W0X A;  3ETQ A;  1Q6U A;  4J9Y B;  4F4L A;  2ZM6 B;  5KA5 A;  3AG2 B;  1NTK H;  4I0X B;  1YXB A;  4GKJ O;  1FJG O;  1F7Y A;  1BZK A;  4RUE A;  1SF9 A;  3FKS G;  1M90 W;  4DV2 B;  3HB3 B;  1RSO A;  3SYO A;  3WB2 A;  5EZY A;  1VAR A;  3H1I H;  1JCH A;  3W7W A;  4JYY A;  1H8E G;  1U96 A;  1FAF A;  1VQK V;  3OTO O;  3AG1 C;  4R50 A;  3RN4 A;  4EKW A;  4UB6 Z;  2EBO A;  4MVM A;  4PDV A;  3BAB A;  3P32 A;  4UV8 A;  2CTQ A;  1ENV A;  1QBZ A;  1ZAU A;  2YIC A;  3SGI A;  1KKC A;  2NN4 A;  1EN6 A;  2Q9L A;  1OJH A;  1AR1 B;  1NH2 B;  3CCE V;  2QWN B;  1EZJ A;  5JWP A;  1YZB A;  3F7Y C;  3VQV A;  2EIN C;  4I55 A;  4IYI A;  4LBE C;  1BSM A;  1DLB A;  3U10 A;  2DJV A;  4K0K O;  4ZHQ A;  1Q6H A;  3CS5 A;  2ZIM A;  2RJZ A;  5LGN A;  3OR7 C;  3QO8 A;  4DV6 O;  2E74 B;  5EYP A;  1K92 A;  1XNR O;  1PKX A;  2W6J G;  3HKB A;  4U3J B;  4DR4 B;  2Y69 B;  3RWR D;  3IC7 A;  4PHZ A;  2EIL C;  2IH3 C;  1Q3E A;  3CCL V;  4WFE A;  4DUY O;  4BIO A;  4PDL A;  1IBM B;  4DO2 A;  4K8Z A;  3QVN A;  4YY3 B;  3W7T A;  3EVK A;  3B40 A;  2DW4 A;  2XAJ A;  2Q5Z A;  4MW3 A;  1BHB A;  4U7N A;  4QNH B;  1I08 A;  1SA0 A;  2IJI A;  2Q7H A;  1IBK O;  2WAM A;  1JFF B;  3L73 H;  2PUS A;  2Y0I A;  1OCO C;  1FXK B;  4GUN A;  3ABK C;  1E1R G;  1J5E B;  5GTI Z;  4CC6 A;  4B3R B;  2Q0A A;  2WSS G;  1QLN A;  4CS3 A;  1VQ7 V;  4R6Z A;  3ABM C;  3L71 H;  2R9I A;  4GZR B;  4DR2 O;  1YEW A;  2IU0 A;  4GX2 A;  4KHP O;  3CMA V;  1I94 B;  3STL C;  3C3T A;  2F93 B;  1NZ6 A;  4NXN O;  2GUZ A;  3A8T A;  1MAB G;  5BZB A;  3BEH A;  3CWB H;  4LF4 O;  1S5H C;  1XEQ A;  2EIM C;  5GTH Z;  2KQX A;  4X65 B;  5KX5 A;  1H8H G;  5CA0 B;  3M99 B;  4NB5 A;  2A3Q A;  2UU9 B;  4PA7 A;  1XOU A;  4BR6 A;  3DC5 A;  5AG2 A;  3B2E E;  2VQF O;  3P30 A;  4GX5 A;  1MZF A;  3CYO A;  3RYH A;  3JD2 A;  3P3N A;  3JAM N;  3ZRW B;  1B06 A;  2HVJ C;  4FLU A;  1M56 B;  2QDO A;  1KC8 W;  1E1Q G;  2PF4 E;  2PGG A;  3ABL C;  5IYD O;  1VQ4 V;  3ASN C;  2YI8 A;  3E35 A;  2OCC C;  2P22 C;  2F4V O;  5HFL A;  2R70 A;  4LCU C;  5LMU B;  1N33 O;  1HP8 A;  3JD4 A;  4JI4 B;  1SES A;  5CMU A;  5IYZ B;  3N2G A;  4UVB A;  4ZI7 A;  5LL6 Y;  1R6T A;  4RUF A;  3WG7 C;  2BTQ B;  5JJN B;  3E2E A;  2F1M A;  5KHH A;  4E2L A;  4O4H B;  1XHZ A;  3G6B A;  4TT3 G;  3T1H B;  2UXC O;  1AR5 A;  2OWO A;  2QR4 A;  3FAV B;  1NH2 D;  2HKO A;  4JI2 O;  2XND G;  4FM1 A;  3KKY A;  5LHH A;  1JOY A;  2WLL A;  1WA8 A;  2EIN B;  5H6Q A;  4JI0 B;  1NQT A;  2VQE O;  2EIK C;  2PYJ A;  3J7A U;  1S5L Z;  2IJH A;  1J95 A;  2UXN A;  2RN9 A;  2RQ6 A;  4MT8 A;  4PI0 A;  5LYJ B;  5H2F Z;  4I50 B;  3HPL C;  5KHI A;  1AB3 A;  4JI1 O;  3ETE A;  3F5W C;  2WLH A;  1H2S B;  1KUQ A;  1YIT V;  1H2L A;  4GX0 A;  5L3B A;  3FB8 C;  3L9D A;  1VP7 A;  2KSD A;  2GSM B;  1VQO V;  1SQQ H;  5LOV A;  3K57 A;  1ZSP A;  1HNX B;  3FB5 C;  2KKW A;  2WLJ A;  2ZR3 A;  1H38 A;  5IYB O;  1OCZ B;  3BVO A;  4DV5 B;  3LDD A;  2OYQ A;  3FYE B;  3MD0 A;  2DWE C;  2BTO A;  2BCC H;  3O65 A;  4JV5 O;  2Y4U A;  2R9A A;  1Q6I A;  4PDM A;  2AHY A;  3CCM V;  3ZRX A;  1WLE A;  4JYA O;  5FPO A;  3HKC A;  4IIJ A;  1SET A;  4H13 B;  2Q68 A;  4LWS B;  1L0N H;  1SKV A;  4FLZ A;  3HKD A;  2EZP A;  4DV3 B;  1KP3 A;  1ZUQ A;  2B5U A;  3DSQ A;  4F6R B;  1VQN V;  2O57 A;  4QPJ A;  1DK1 A;  3ZCC A;  3RYI B;  1GH6 A;  4JI7 B;  1GRJ A;  2N05 A;  4FLW A;  2QGN A;  2AGA A;  4CS2 A;  4NVP A;  4PDR A;  4Q6G A;  4FZ0 A;  3KCX A;  5ITZ B;  4H37 A;  3CJH A;  4PEL A;  3A0H Z;  2UXD B;  1HNW B;  3OMA B;  3LSS A;  4EB6 B;  1B6Q A;  3L74 H;  4BW5 A;  2E5L O;  3K0G A;  1PV0 A;  1V55 B;  1W0K G;  2R9R B;  4D7S A;  4YHH B;  4X20 B;  2Q69 A;  4P2Z A;  3FD9 A;  3UKM A;  4WBN A;  4YIO A;  1Z5W A;  5H6R A;  4TSF G;  4A5U B;  4LR3 A;  2HG5 C;  1VF6 A;  1FKA O;  4X64 B;  4UFZ A;  4LFC B;  3TGU H;  1K34 A;  1TGO A;  3T1Y O;  3MHS C;  5LXT B;  2Q6A A;  3ASN B;  1Y4M A;  4X1K A;  5GW7 A;  5KLV H;  3K9S A;  2D3O W;  3JAT B;  5BMV A;  3SJQ C;  2Z5U A;  4OX9 O;  2JRI A;  5LP6 A;  3M7M X;  5IY5 B;  1D5A A;  2LQT A;  2CH7 A;  1Z5V A;  1AI5 A;  2Y0P A;  5JVD A;  4X62 B;  1ZLZ A;  4G27 B;  2UUA B;  5IYC O;  4TWK A;  1YF2 A;  2EIJ C;  5FNV B;  4TUY A;  5JH7 A;  2PYL A;  2ZE7 A;  4DV1 B;  4O4J B;  4N21 A;  2DYS C;  1G4Y B;  1K9M W;  4WF9 V;  3BHP A;  2DQ3 A;  4CS4 A;  4D7T A;  2ZM6 O;  1NU1 H;  4DV7 B;  2YI9 A;  5B1A C;  4U7O A;  1K7D A;  2EIK B;  2JGD A;  5B1B C;  1PD3 A;  2F66 C;  4FM2 A;  3RW0 A;  2JS3 A;  3I55 V;  4NTW A;  1MZE A;  3AG3 C;  3B09 A;  1MA1 A;  1N4C A;  3UCS C;  2F95 B;  5CBH A;  1VQL V;  4J7K A;  3ZJZ A;  1ORQ C;  1GK9 A;  2FB5 A;  1G1X B;  2ZIN A;  1NVP B;  1TA8 A;  4I4T B;  1I7F A;  2YEV B;  4DR7 O;  1VF5 B;  4XDL A;  1YHQ V;  1JX9 A;  3DXR A;  2ADQ B;  5LMN O;  2GDS A;  2XAH A;  4NTX A;  1GM8 A;  4P9P A;  1KBH A;  5L3D A;  3H01 A;  5IE9 A;  1LR1 A;  4GYC B;  4HBN A;  3BY6 A;  3SPJ A;  2CAZ C;  4LF9 B;  4MVU A;  4OGQ B;  1K33 A;  5B5E Z;  4LFB O;  1LUV A;  4FLX A;  3RYF A;  5EBL C;  1Q86 W;  3JAR B;  5LA6 B;  3W7U A;  2QEX V;  1N0N A;  2N74 A;  5E79 Z;  2LP7 A;  3J80 N;  2NNU A;  3B8N A;  4DR3 B;  5K1P A;  2QA4 V;  5J2T A;  4AQY B;  3UO3 A;  5TIS Z;  4YJ3 A;  1SQX H;  1WPB A;  3O9O A;  3G6E V;  4O2A B;  4DUZ B;  3E22 B;  4YY3 O;  4AIL C;  3UT5 B;  1YJN V;  4JI8 B;  2CUG A;  3OM3 B;  3RYC B;  2Q67 A;  1QR8 A;  4O4I B;  1HNZ O;  1L0L H;  3BCC H;  2ZIO A;  1UJW B;  2V7Q G;  1NTM H;  2WLI B;  1ZWI C;  1JFF A;  3CCU V;  3B4S A;  2QTS A;  4L87 A;  3CC4 V;  1OCR B;  4JI5 B;  3SDL A;  1Q82 W;  1FXK A;  3BRC A; 
#chains in the Genus database with same CATH homology
 1BZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...