1BZKA

Structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
RYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BAND 3 ANION TRANSPORT PROTEIN)
publication title Structural studies on the effects of the deletion in the red cell anion exchanger (band 3, AE1) associated with South East Asian ovalocytosis.
pubmed doi rcsb
molecule tags Transport protein
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.570 Mainly Alpha Orthogonal Bundle Helix Hairpins Helical hairpin bin 1bzkA00
1BZKA
chains in the Genus database with same CATH superfamily
2XAQA 4C7UA 2JJ2G 2Y4TA 4FMTA 1K34A 2Q4PA 3UO2A 4DR4O 1SQXH 3ZIAG 3UM7A 3HB3B 1FFTB 2G38A 4JAUA 1W2BU 1VF6C 1NT2B 2Q0OC 4KHPB 4I4TB 2A3QA 1URFA 3QO7A 5IJ0B 4YHHB 4I7ZB 3ZN0A 1H2LA 3FB5C 3IC7A 2LQTA 5JJNB 1Y66A 3E8FA 1MA1A 4MSWC 1GM9A 1KQSU 1FAFA 3K06A 4LF7O 4GKKB 4JV5O 4E2LA 3Q4HB 4X20B 1HWYA 3N2KB 2Q69A 1LNQA 4YJ2A 4DV7B 4JGSA 1H2KA 1VQLV 3DXRB 4MVMA 2R72A 4GKJO 2DMXA 4X62B 1VARA 1AR1B 3G67A 5JJEB 1FJGB 5JCOC 1VQPV 4B3TB 4LWSB 1R1BA 2YC0A 1QHTA 2CTQA 3OTFA 2RNBA 2HJDA 1PNMA 1IZ3A 4TV8A 4JAVA 5LHIA 2BSKB 4X1KB 3A0BZ 3KZIZ 4DR2O 3ASNC 1R3JC 3H1JH 2P4KA 5H5NA 4PD4F 3E2EA 4JTCB 3BFRA 2CDYA 3AK1A 1Q86W 5FLXN 1Q3EA 3ZHQA 2R9IA 2WLIB 2QR4A 4DK0A 4FLXA 4NXNB 3BVOA 4MTFA 2IW5A 4BAYA 4X65O 2QE7G 4H33A 4N23A 2PYJA 1ZAUA 4BIZA 4D7SA 2DWDC 2BE3A 3CRCA 3T2MA 5JVDB 4N21A 1SQGA 3LSQA 3RYCB 2JS3A 4DR3O 3KKYA 4LFAO 1YSCA 3D36A 5IDJA 2WSSG 1J5EB 4MVUA 4CH6A 4WFGA 4OPAA 1N33B 4DXWA 3GB7C 3U11A 3VQVA 1BMFG 3RYHA 4IHJA 2ZNIA 3OR7C 3OE7G 4MVZA 4DR7B 1P7BA 3SDLA 1MSDA 3C3SA 3E35A 4NTXA 5KHGA 3G71V 1QR9A 4JI4B 4F6RA 3CCSV 3ZRXA 1IVSA 4MTGA 4J42A 3CRQA 2Q73A 2ZE7A 2IM9A 3G4SV 1TAEA 4G27B 1FXHA 3FAVB 2LW1A 2E75B 5CN0A 2UUAO 4BW5A 2WLJA 1ZUQA 4PA7A 2QEXV 3JAKB 3THOA 1Y74B 2YI8A 2Q8VA 5EZYB 1XMQO 2ZT9B 4J10A 4JZ2A 4JI2B 1QR8A 1GH6A 4MVSA 4WF9V 2OTJV 2MK3A 5LXTA 3RT3C 3M7MX 4FK5C 2BTQA 3B09A 4R50A 4J7JA 1BHBA 4WBNA 3K04A 2VQEB 1XHZA 5JQGA 2CE4A 4FZ0A 1AI4A 5EZYA 3BY6A 2OT5A 1BQZA 4DW0A 1S3JA 2P90A 2YUAA 3OMAB 4I9QA 1JFFA 2ZE8A 2DYSB 2XASA 1QLNA 2WLLB 4JI3O 1PNLA 2CTRA 5C8YA 3MAQA 4GLXA 3F5TA 1R6TA 2QWQB 4UB8Z 3E8HA 3I5DA 4B3RB 3H1IH 1M56C 2VQFB 3ZS8C 5GW7A 1U96A 2LJ2A 4Z1MG 1N36B 1WB8A 2LFSA 2P7TC 4LF8B 4K0KO 1K4DC 3STZC 1WP8A 3AG1B 3TXSA 5IYCO 5IY5C 1NR7A 4DUYO 2BCCH 1SC5B 3O65A 4X64B 4TQDA 2M7WA 3E89A 3JD0A 3HKCB 1V9PA 1YVWA 3K9AA 5GONA 5LYJB 1VF7A 5L3BA 2LP7A 3U10A 2R70A 3OUSA 1EN4A 1JJ2U 5CA1A 1RPRA 1KD1W 4AQYO 5B3SC 1G1XB 3HKCA 3JASB 4CC5A 4DW1A 2KG7B 2W0XA 3ASOB 1YXBA 5JCOA 4CS3A 4QGPA 1Q5OA 2QM4A 2JRIA 1R3IC 2UXBB 3GWKC 1TVKA 2ZE6A 2UU9B 1LUWA 4TV9A 4DV0O 5KHJA 2LFRA 2UXCO 3B8NA 4OPHA 3VBBA 3HKDB 3E22A 4LNUA 4MVOA 5BY1A 1VQ5V 3JALB 2EINB 1S72V 2NNUA 1IBKB 1AR4A 1Z5VA 2B9ZA 3OEEG 3MHHC 5CA0B 2ZCEA 4F6EA 3HKBA 4B08A 3ZHVA 4J7KA 3HKDA 1NTKH 4KHPO 2DQ3A 3OGIB 1L8DA 2ZDIC 4YHHO 2QWOB 2EIKB 1NTMH 1U97A 1KBHA 4LP8A 2JDIG 2AGAA 4DV5B 4GKKO 4DRXA 1M4UA 3SJBC 4W4KA 4LFBB 3B40A 1HR0B 2D2CB 2PY5A 1UJWB 1K92A 1CPYA 1G4YB 2EZPA 3L75H 2N74A 3OTOB 1IDSA 2EX3A 3RW0A 4DV7O 5JH7B 3D3IA 1HNWB 2GUZA 3A0HZ 3ABKC 4X89A 4X62O 1EN5A 1H38A 1XMOB 4LF9B 1XILA 4IYHA 2GV9A 1FJGO 3AK3A 4B3TO 2KB1A 1I0HA 3WB0A 1CXZB 1E1QG 4RUFA 3OD4A 2IH3C 4J41A 3A0RA 1X4TA 1US6A 4FLZA 5E1AC 3T1YB 3QVNA 1S5JA 2PI5A 1P4RA 1UPGA 4TQFA 5J2UB 1Q82W 1QVGU 5L3CA 2YS8A 3WFVA 3H1LH 4LCUC 3UT5B 5B1AB 3JAWB 2Q0AA 3UKMA 4IL6Z 4UVAA 2E3CA 4TUYB 5DN6G 5KHIA 3E83A 4O2BB 4ASUG 4PHZA 1IXMA 1DTOA 3CSXA 5EK0A 4G28B 5BMVA 1O9HA 2ZIOA 2NLJC 4F4LA 1VQ6V 3JATB 1BQ0A 4O2AB 3J81N 4O2BA 1AI6A 1P49A 2YIDA 3J80N 4LH6A 1P84F 4KUMA 2AHZA 1J5EO 4O4HA 3RVZA 1N33O 4CH3A 3EFFK 4I50B 4NB5A 1FXKB 1YCIA 4UCSA 5A9GA 3DC5A 1B6QA 3HPLC 3D36C 5GTIZ 1QVFU 4DR7O 1SF9A 4JYAB 2DN9A 3RYFA 4JYYA 5EBLC 3X2QB 1AILA 4PA6A 3NXSA 4L87A 1HNXB 1NU1H 1VQ7V 4JI4O 3CCMV 1XBLA 2XTAA 4PDVA 1HDJA 1PL0A 1M5IA 2F66C 1FD9A 2Z0AA 4EFBA 3EXAA 2LO1A 3W7UA 2PZSA 3JD2A 1SQVH 2QWRB 3ZHSA 3K58A 2WAMA 3IJ4A 2JVDA 4UCVA 1RFYA 4JI2O 2UUCB 1ROPA 3T1HB 2QDOA 1RM1B 3P3NA 4ZOLB 2OCHA 5LGNA 1PD3A 3R65A 4EFEA 5LOVA 1K8AW 2JK5C 4DO2A 2GTAA 3FX7A 5ITZB 5CBHA 4ICGA 2AZ0A 1KP2A 1E79G 2H8PC 1AVMA 3L74H 3AG2C 3FYIB 5KUKA 3HKEB 4CS4A 1FS0G 4RQFA 2F23A 1BL8A 4AI8A 4DV2B 4FLYA 4XDKA 4B3RO 1HP8A 2VQFO 1KECA 2F1MA 1YZBA 3P3PA 2ZDIA 4X1YB 3WU2Z 2Q7GA 5KHKA 1KUQA 3CWBH 1GM8A 5H2FZ 2EIMB 2P67A 2P6JA 3AG3B 4JI5B 1G8MA 1WN7A 2A7WA 3RWRD 3ZRVA 4L8JA 4X64O 1YJ9V 4DYLA 3BAAA 1VQMV 3ZRSA 1Q8IA 1N4CA 4X1YA 1FPOA 2P4VA 1MABG 4HZ3A 3L70H 1N32B 1JOYA 1QU7A 3FB6C 4I0XB 4LF4B 1HNZB 4NTYA 5EYPB 3ZBHA 3ZMTA 3L73H 4R6ZA 4P9OA 1XNQB 4I4TA 2BTOA 4DR5B 5IJ0A 4DR1O 1PL4A 1Y76B 4H44B 4U3JB 2ZM6B 3D8CA 4FVMA 2ITDC 3JARB 1MZEA 4HBNA 1THZA 2HFEC 3K57A 1BE3H 5EC1C 4YY3B 2UXBO 1SQFA 1OCCB 3Q4HA 4X20A 2ZD9A 2UU9O 3N2KA 3H01A 1JQ0A 1M90W 1NH2B 1AROP 2Y4UA 4ZIBA 4Z2WA 5B1NA 1Q43A 1I08A 1NI8A 3N2GB 5CMUA 3DXRA 4FLUA 1ZL8B 1IBKO 2GDSA 2XAFA 3W7TA 3SPCA 1GM7A 2HR3A 1GK9A 3OUFA 1AJNA 1AP5A 3ASOC 3KCYA 2EJ7A 2CH7B 4B3MB 1D5NA 4LWSA 3TXQA 3CMEV 3N2GA 1WJZA 2Y0IA 4JZGA 4RUEA 5L3EA 3B8MA 1GTOA 4DV5O 2BSKA 3BEHA 2P22C 4X1KA 1YIJV 4LFBO 1HR0O 1SQQH 1GN2A 2JEXA 1KB9F 2CH7A 1YTFB 1GN4A 4QJFB 2ZKOA 3OTOO 1KKDA 1X59A 2UXXA 3FD9A 2Z5UA 1XL4A 4O4JB 5L3GA 4JI6B 1HNWO 2JGUA 2WLIA 4OX9B 3BA9A 2R9AA 3OFNG 2EIKC 2B1GA 3OEHG 5AG2A 4LF9O 1E1RG 2XNDG 3G80A 2YICA 4P30A 1NKDA 3T1CA 1RSOB 4LBEC 4BWAA 4BIOA 1NVPD 4FLVA 5JVDA 3MD0A 4B7KA 2RJZA 3RYCA 3T1YO 1Q6HA 4BR6A 2H3OA 3N27A 3L71H 5D5PA 2FKXA 3CRRA 1TGOA 1RSOA 3LDCA 2IU3A 1BZKA 3CX5F 2CUGA 4FM0A 4X9QA 3EVKA 2F4VB 1NZ6A 2XAJA 1R6KA 3WB2A 2ETNA 3TJTA 5CBFA 2DQ0A 4UVBA 1D2DA 4WFBV 2IBZH 3I55V 3DTUB 3SPIA 1YHQV 1QLEC 2EULA 1A32A 4FZ1A 4X1IB 2Q67A 1V54B 5FPOA 2C2AA 4UVCA 3FAVA 3LNMB 1OCRB 4HNAB 2GSMB 2WLNA 1J95A 4ABMA 3G6BA 5B1AC 3JAKA 1B06A 3OT7A 2PUSA 3K5OA 1Y74A 3CC4V 2W0FC 4QPKA 5F2VO 1QNMA 1VIBA 3FKSG 3CCEV 3CCUV 4JYAO 2LW7A 3A2FA 4PDLA 1N8RW 1Y67A 3A8TA 4QE9A 1YF2A 4DV4B 1HNXO 5LGTA 3BCCH 5KMGB 3ZMSA 1F51A 5BR8B 3QTCA 2WLLA 4R8CA 2MW2B 3RYIB 2GHYA 4EEQA 2QM7A 1I94B 2QKSA 2KKWA 1EZJA 4LC1A 3SJAC 1FYJA 2Y69B 5KX5B 3CCVV 4PDRA 2O57A 3ABMB 4JI8B 4MW3A 4GX1A 2UUCO 2JGDB 2EIJB 3T1HO 3BABA 2QWNB 1GO3F 2EJRA 1EN6A 1SZXA 3E8BA 1XL6A 1YITV 2LGWA 4FFKA 3CCJV 4WFEA 2UXNA 4CH5A 1JX9A 3ZJZA 4JI0B 1R3KC 4ZI7B 5LYJA 2ILMA 2D3OW 4OXSA 1GN3A 1OCZC 4YIOA 4EKWA 2CAZC 5B1OA 5KLVH 3FB8C 1IBMO 4TT3G 4DV2O 1RM1C 2DWEC 2QTSA 3JASA 2CTPA 2KG7A 2CK3G 3K59A 2P5OA 1XREA 4FM2A 4NKGB 1V55B 2LGQA 3ETEA 2FTKA 4FFBB 3VOUA 1AI7A 2Y0PA 2VWJA 4RO2A 3OGCC 4JI5O 3WG7B 4E4EA 1VP7A 2YSUB 3JALA 4HYOA 3AG4B 1Y6XA 4MVQA 4IIJB 1NBMG 4MW8A 2QJ1A 1SERA 3ABUA 1EM1A 2XT9A 1N32O 2ZQMA 5CA0A 3P32A 3JYCA 4DUZB 4DV6B 1VQ8V 4LF4O 2DJVA 1WA8B 1HNZO 3BHPA 4FM1A 3JSLA 1S0VA 4DR5O 1WLEA 4J11A 1FXVA 1Z5WA 2ZM6O 4IIJA 1O9GA 1KC8W 3CHXA 3AG3C 4G2KA 4K3AA 3K0GA 3K5MA 3K5LA 2N04A 4YY3O 1MZFA 3D3QA 3C90A 4MVRA 4DR6B 2UXDB 5CA3A 4NVPA 2H94A 1MMMA 1PV0A 5JH7A 2EILB 2K1EA 3IAYA 2WWWA 3E8GA 1M57B 3K0DA 1ZLZA 3M8AA 2PYLA 1YDXA 3UO3A 4IT5A 4RWUA 1F23A 3B4SA 4J7ZA 5H9CA 4B3MO 1OCCC 1IBLB 4JI7B 5IYBO 3VQWA 2NN4A 3K03A 4FPPA 4AILC 5J9PC 3QF7A 1K33A 2OCCB 1YJWV 4LF6B 3M99B 4I9WA 4H13B 4NXNO 3ABLB 4UUJC 4DV3B 3CD6V 5J2UA 3OM3B 4J9ZB 2RDCA 2QGNA 3UT5A 3W7XA 1PKXA 2HG5C 3JAWA 1YJNV 4JI6O 4TUYA 1DF5A 3TCUA 4OX9O 2V7QG 2IJHA 1H8EG 2ZR3A 3GVMA 1OZ0A 4OGQB 1NH2D 3ZMVA 2QKCA 4JPRA 5C93A 4PV1B 2QKAA 1DGSA 4ZHQB 2XAGA 2QA4V 5IWAB 3CRAA 3JATA 4FJCC 4O2AA 1GKFA 1FKAO 1AP6A 4PA4A 2XUMA 1WB7A 4I55B 4MT8A 1KYOF 2HKOA 2IJKA 2ZIMA 5KAIZ 3CB2A 4X66B 5LMUB 2BOCC 1I5XA 5L3DA 3W7SA 1K5SA 1NQTA 1B3QA 4I50A 4B3SB 1MNGA 1FXKA 1DF4A 2FB5A 1SKVA 3CP1A 4U7OA 3ZRWB 3JSNA 4I55A 4RAIA 5H6QA 3C3TA 1ZWIC 3CYOA 3BPZA 3LDEA 2GTSA 2PF4E 1Q81W 3K5NA 4GX5A 3T4ZA 1BS3A 1JA8A 5LP6B 1F4MA 4KFMA 4O4IB 2AW9A 2XAHA 3JCUZ 5IJ9B 1SA0B 3ZRWA 3SPHA 2JEUA 2P06A 1WPBA 4UCUA 5B3SB 4W4LA 2AHYA 1FFXB 2VQEO 3CJHB 5J2TB 4PA3A 1ZX3A 4BIUA 2EZOA 4O4IA 3TETA 3B77A 1BT8A 5EIBC 4LF5B 3KG2A 4ZOLA 4AHCA 1KMIZ 5B66Z 2L6LA 4KXRA 4O4LB 2IU0A 3CC2V 4NTWA 3RVYA 5LMNB 1Q90D 2ADQB 1V54C 1IURA 3QNEA 4DV4O 1PM9A 5ITZA 1OJHA 1OCRC 3H1HH 1H2GA 1N36O 2X6BA 5BR8O 1TA8A 1N34B 5E79Z 4CZZA 1I94O 4LF8O 3ETGA 3HKEA 3SJQC 3UCSC 1XI1A 1B04A 4H37A 2E5LB 3AG7A 5IT9N 2FYUH 4WFAV 3L9DA 2DYSC 1K73W 2Y48A 4IYIA 3OMIB 1ENVA 4ZBMA 4JI8O 5EBWC 4XDJA 1L0NH 4LFCB 4Z1VA 1Q6UA 3GWOA 1LUVA 2JS5A 1NS1A 2IJIA 1R3LC 3OW2U 1SS3A 2HJFC 4FIPC 3JD3A 1S5LZ 4UCRA 3ABKB 5TISZ 4JI0O 4CS2A 4U3FH 4DV1B 3AG1C 1BCCH 4MTXA 5LGUA 1KKCA 4YJ2B 4I0XA 2YIAA 2Y69C 4UCTA 3ABMC 5EYPA 1IXBA 1PP9H 3AK2A 1KP3A 4GYCB 3LNNA 3ZEDA 4J80A 3CC7V 2EIJC 4PDMA 2CGNA 1Y76A 4U3JA 1GN6A 1BSMA 3H9VA 1I7FA 4JI1B 4TSFG 1D5AA 4TOIA 3JARA 1UFIA 1YI2V 2WLMA 5B5EZ 3ML0A 4TV8B 1T5EA 3RN4A 2YEVB 4JF3A 3B2EE 2OWOA 1XHXA 3CCQV 3DC6A 2PTMA 1K97A 2EBOA 3FYEB 5B1BB 4DK1A 1BHAA 4YIPA 1TUBB 2YDEA 3R66A 1ZL8A 4RQEA 2DE0X 5K1XA 5H6RA 5D5QA 4DV6O 1W59A 4DUZO 1EZVH 4QPJA 1K3EA 2YEVA 1AJPA 1AB3A 5KHHA 2EINC 1SESA 3KCXA 2IH1C 1OCOB 1V55C 2YIBD 2A06H 1TUBA 3F7VC 4GX2A 4MTOA 2OIEA 1Y4MA 4WFFA 3WG7C 2E76B 4ZKIA 3OR6C 4K8ZA 4H0LB 1NTZH 3AG4C 4P9PA 1QQCA 2XHBA 3CMAV 1XMOO 1WAZA 1NR1A 1EBOA 4D7TA 1WPXA 4DR6O 2UXDO 3ZHUA 3IC9A 5DM6V 4LR3A 3RYHB 3W7WA 4O4JA 2IJJA 4IHJB 4NR1A 2HHHB 1JPXA 3SJCC 2V1DA 2WLHA 4EB6B 2B5UA 4XDLA 3RFRA 4F6RB 1K7DA 1MOFA 4XBFA 2DOSA 1IBLO 4JI7O 2CTWA 3JAMN 5DEDA 2Z3YA 4GT1A 4LF6O 1NJIW 4WCEV 2Q7HA 4UFZA 5KA5A 4EB6A 1S5HC 3G6EV 4DV3O 1JMKC 2EILC 3SGIA 3UQ8A 1XDCA 1PPJH 2ADPA 1M57C 1AJQA 1S77D 2Q7EA 3L72H 1R6NA 2DYRB 2Q6AA 2QM8A 3RBZA 3SYAA 3JCZA 2ZXWB 3I56V 2QWPB 5LXTB 2HP8A 1L0LH 3S3XA 1TUEB 2BTQB 2Q5ZA 1XEQA 3AG2B 4WBNB 4UXNA 2RQ6A 1OV9A 2PI4A 5JQGB 2OCCC 3MHSC 4X1IA 3F7YC 4X88A 1W0KG 3E86A 5IWAO 1JFFB 3ABLC 2RN9A 4HNAA 4PELA 3SR2C 4K35A 3CCLV 3WB1A 2L35A 3APQA 5C8YB 4X66O 4TWKA 5LMUO 2UUBB 1AI5A 1CP9A 2ITCC 1SETA 1Z2GA 4B3SO 3CXCU 4A5UB 4QE7A 2WLKA 2FMLA 2KSDA 4BW9A 1GRJA 1K9MW 3AEIA 1XOUA 3SYOA 2ZINA 1FXKC 1XNRB 3CS5A 5KMGA 1SQPH 4NXMB 1VQNV 3ZCCA 5LL6Y 5KUMA 4JAAA 3X2QC 1VF6A 3RYIA 5GONB 1F7YA 4DR4B 1R73A 4IGGA 2ARHA 1H2SB 1MG1A 1WP7A 3OAAG 4WFHA 5CA1B 5KX5A 3STLC 5GTHZ 2VRZA 1VQOV 3SPJA 1MSWD 2JGDA 4J9YB 2E74B 4PA9A 4LF5O 2X0LA 3ETDA 2AZ2A 5LP6C 4D6TH 1F4NA 2B1IA 4LF7B 5LBQA 1K5QA 5LMNO 4JV5B 2YIBA 1TVKB 2GBOA 4DR1B 4TV9B 2VS0A 3F5WC 3ZMZA 3SYPA 3E22B 4LNUB 3LSSA 4ZI7A 4PJ0Z 3QO5A 4CC6A 3LSUA 1N34O 1M93A 3ZHRA 3ASNB 5FL7G 4GKJB 4NYKA 2ZNJA 2E5LO 5FPRA 3HKBB 2OYQA 2W6IG 5CB4B 5FNVB 4PI2A 4P2ZA 1NVPB 5L3FA 1XQ8A 4LFCO 1I5YA 2Q9LA 4KP4A 2FL4A 1W0JG 3K08A 4FFBA 1GAXA 1DLBA 4DRXB 5EC2C 5LA6B 2YXLA 5IYDO 1QCEA 1XNQO 3FFQA 3QO8A 5CB4A 1N0NA 2WA4A 3LUTB 5FNVA 4DR2B 1VMGA 4UV9A 1QBZA 4JTAB 4DV1O 3CE2A 3BRCA 1GMGA 2EIMC 5BXZA 1IX9A 3TGUH 1P7GA 2GUZB 5LA6A 1WA8A 3PJSK 3IFXA 4HAMA 1PNKA 2WA3A 1JVMA 4UV8A 2M6YA 4X65B 3K9SA 1VQ4V 4GCZA 5IYZB 4JI1O 3ABTA 2X6CA 4QNHB 1SRYA 1JCHA 2A79B 4YXWG 3SYCA 3RGBA 1VQ9V 2X6AA 4DR3B 4UCOA 3CRMA 1LR1A 1JJOA 2HLDG 2Q68A 4LFAB 2XOKG 1M1KW 2RMKB 2ATKC 5IYZA 1VQKV 1L1FA 3VQYA 1QLEB 4GZRB 2A9HA 3SPGA 1YEWA 3DGEA 4FLWA 3BA8A 5HFLA 1Q6IA 2V4DA 1HW7A 3IGAC 4Q20A 2KQXA 4X8AA 3ZX6A 3S3WA 3CCRV 2HVKC 1OHHG 5KA6A 4UB6Z 3OMNB 1SQBH 5BMVB 4YJ3B 1S76D 1EFRG 2WPDG 2OIGA 5IE9A 3ZMUA 2ODMA 2UUAB 3DSQA 2YI9A 5B1BC 1N0JA 4GX0A 2F43G 3MDSA 2N05A 3CXHF 2ZE5A 3O9OA 2K9PA 3CEIA 1AR5A 4O4HB 3U0ZA 1WNSA 5JWPA 1XMQB 3CPWU 2JIZG 4YJ3A 2YXYA 5DECA 4GUNA 2QSAA 4PI0A 1OCOC 1VEWA 2CGOA 3P30A 2HHHO 5K1PA 1M56B 2NR5A 4CBCA 5KAFZ 3APOA 3RYFB 2R9RB 5JJJB 3K3WA 5HFMA 3SYQA 3QG5A 2BOBC 1XUQA 3JD1A 2A0LA 3H1KH 1K4CC 3ZHTA 4ZHQA 1BGYH 1ZSPA 3EHBB 1SZTA 5IY5B 1JR9A 4JI3B 2F4VO 1RPOA 2F95B 4I5SA 3LDDA 4MS2A 3VQXA 2QTOA 2YXHA 5CBGA 1YTFD 1H2MA 3T4DA 2HEPA 1G6UA 4K0KB 4JYCA 1COWG 3JD4A 4R7CA 5A2QN 4JASA 1DK1A 1CEZA 2F93B 1ORQC 4DUYB 4JTDB 3ETQA 5LP6A 5LOVB 4JYBA 1OCZB 1H2NA 1M9NA 4KL1A 5IJ9A 1SA0A 5LHHA 3HR0A 1RP3B 1VF5B 1Q7YW 4B7EA 3K79A 2DW4A 2OTLV 5EBMC 1FFXA 4CH4A 4FLTA 3CJHA 2DYRC 5J2TA 2UUBO 5LHGA 1H8HG 1ZTEA 2ZXWC 4AQYB 2ZR2A 4LH7A 2PGGA 3FB7C 4QIWF 3PN1A 4Q6GA 4U7NA 2HVJC 2JJ1G 3NR7A 3ZN1A 3ICXA 1KU9A 4O4LA 2W6JG 3J7AU 5BZBA 1IBMB 3TK1A 1XNRO 4DV0B 5EIBD 2VWKA 2AXTZ 2UXCB 4K8XA 2RCVA 2X7RB 4NXMO
chains in the Genus database with same CATH topology
1BZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZK A; 
#chains in the Genus database with same CATH topology
 2XAQ A;  4C7U A;  2JJ2 G;  2Y4T A;  4FMT A;  1K34 A;  2Q4P A;  3UO2 A;  4DR4 O;  1SQX H;  3ZIA G;  3UM7 A;  3HB3 B;  1FFT B;  2G38 A;  4JAU A;  1W2B U;  1VF6 C;  1NT2 B;  2Q0O C;  4KHP B;  4I4T B;  2A3Q A;  1URF A;  3QO7 A;  5IJ0 B;  4YHH B;  4I7Z B;  3ZN0 A;  1H2L A;  3FB5 C;  3IC7 A;  2LQT A;  5JJN B;  1Y66 A;  3E8F A;  1MA1 A;  4MSW C;  1GM9 A;  1KQS U;  1FAF A;  3K06 A;  4LF7 O;  4GKK B;  4JV5 O;  4E2L A;  3Q4H B;  4X20 B;  1HWY A;  3N2K B;  2Q69 A;  1LNQ A;  4YJ2 A;  4DV7 B;  4JGS A;  1H2K A;  1VQL V;  3DXR B;  4MVM A;  2R72 A;  4GKJ O;  2DMX A;  4X62 B;  1VAR A;  1AR1 B;  3G67 A;  5JJE B;  1FJG B;  5JCO C;  1VQP V;  4B3T B;  4LWS B;  1R1B A;  2YC0 A;  1QHT A;  2CTQ A;  3OTF A;  2RNB A;  2HJD A;  1PNM A;  1IZ3 A;  4TV8 A;  4JAV A;  5LHI A;  2BSK B;  4X1K B;  3A0B Z;  3KZI Z;  4DR2 O;  3ASN C;  1R3J C;  3H1J H;  2P4K A;  5H5N A;  4PD4 F;  3E2E A;  4JTC B;  3BFR A;  2CDY A;  3AK1 A;  1Q86 W;  5FLX N;  1Q3E A;  3ZHQ A;  2R9I A;  2WLI B;  2QR4 A;  4DK0 A;  4FLX A;  4NXN B;  3BVO A;  4MTF A;  2IW5 A;  4BAY A;  4X65 O;  2QE7 G;  4H33 A;  4N23 A;  2PYJ A;  1ZAU A;  4BIZ A;  4D7S A;  2DWD C;  2BE3 A;  3CRC A;  3T2M A;  5JVD B;  4N21 A;  1SQG A;  3LSQ A;  3RYC B;  2JS3 A;  4DR3 O;  3KKY A;  4LFA O;  1YSC A;  3D36 A;  5IDJ A;  2WSS G;  1J5E B;  4MVU A;  4CH6 A;  4WFG A;  4OPA A;  1N33 B;  4DXW A;  3GB7 C;  3U11 A;  3VQV A;  1BMF G;  3RYH A;  4IHJ A;  2ZNI A;  3OR7 C;  3OE7 G;  4MVZ A;  4DR7 B;  1P7B A;  3SDL A;  1MSD A;  3C3S A;  3E35 A;  4NTX A;  5KHG A;  3G71 V;  1QR9 A;  4JI4 B;  4F6R A;  3CCS V;  3ZRX A;  1IVS A;  4MTG A;  4J42 A;  3CRQ A;  2Q73 A;  2ZE7 A;  2IM9 A;  3G4S V;  1TAE A;  4G27 B;  1FXH A;  3FAV B;  2LW1 A;  2E75 B;  5CN0 A;  2UUA O;  4BW5 A;  2WLJ A;  1ZUQ A;  4PA7 A;  2QEX V;  3JAK B;  3THO A;  1Y74 B;  2YI8 A;  2Q8V A;  5EZY B;  1XMQ O;  2ZT9 B;  4J10 A;  4JZ2 A;  4JI2 B;  1QR8 A;  1GH6 A;  4MVS A;  4WF9 V;  2OTJ V;  2MK3 A;  5LXT A;  3RT3 C;  3M7M X;  4FK5 C;  2BTQ A;  3B09 A;  4R50 A;  4J7J A;  1BHB A;  4WBN A;  3K04 A;  2VQE B;  1XHZ A;  5JQG A;  2CE4 A;  4FZ0 A;  1AI4 A;  5EZY A;  3BY6 A;  2OT5 A;  1BQZ A;  4DW0 A;  1S3J A;  2P90 A;  2YUA A;  3OMA B;  4I9Q A;  1JFF A;  2ZE8 A;  2DYS B;  2XAS A;  1QLN A;  2WLL B;  4JI3 O;  1PNL A;  2CTR A;  5C8Y A;  3MAQ A;  4GLX A;  3F5T A;  1R6T A;  2QWQ B;  4UB8 Z;  3E8H A;  3I5D A;  4B3R B;  3H1I H;  1M56 C;  2VQF B;  3ZS8 C;  5GW7 A;  1U96 A;  2LJ2 A;  4Z1M G;  1N36 B;  1WB8 A;  2LFS A;  2P7T C;  4LF8 B;  4K0K O;  1K4D C;  3STZ C;  1WP8 A;  3AG1 B;  3TXS A;  5IYC O;  5IY5 C;  1NR7 A;  4DUY O;  2BCC H;  1SC5 B;  3O65 A;  4X64 B;  4TQD A;  2M7W A;  3E89 A;  3JD0 A;  3HKC B;  1V9P A;  1YVW A;  3K9A A;  5GON A;  5LYJ B;  1VF7 A;  5L3B A;  2LP7 A;  3U10 A;  2R70 A;  3OUS A;  1EN4 A;  1JJ2 U;  5CA1 A;  1RPR A;  1KD1 W;  4AQY O;  5B3S C;  1G1X B;  3HKC A;  3JAS B;  4CC5 A;  4DW1 A;  2KG7 B;  2W0X A;  3ASO B;  1YXB A;  5JCO A;  4CS3 A;  4QGP A;  1Q5O A;  2QM4 A;  2JRI A;  1R3I C;  2UXB B;  3GWK C;  1TVK A;  2ZE6 A;  2UU9 B;  1LUW A;  4TV9 A;  4DV0 O;  5KHJ A;  2LFR A;  2UXC O;  3B8N A;  4OPH A;  3VBB A;  3HKD B;  3E22 A;  4LNU A;  4MVO A;  5BY1 A;  1VQ5 V;  3JAL B;  2EIN B;  1S72 V;  2NNU A;  1IBK B;  1AR4 A;  1Z5V A;  2B9Z A;  3OEE G;  3MHH C;  5CA0 B;  2ZCE A;  4F6E A;  3HKB A;  4B08 A;  3ZHV A;  4J7K A;  3HKD A;  1NTK H;  4KHP O;  2DQ3 A;  3OGI B;  1L8D A;  2ZDI C;  4YHH O;  2QWO B;  2EIK B;  1NTM H;  1U97 A;  1KBH A;  4LP8 A;  2JDI G;  2AGA A;  4DV5 B;  4GKK O;  4DRX A;  1M4U A;  3SJB C;  4W4K A;  4LFB B;  3B40 A;  1HR0 B;  2D2C B;  2PY5 A;  1UJW B;  1K92 A;  1CPY A;  1G4Y B;  2EZP A;  3L75 H;  2N74 A;  3OTO B;  1IDS A;  2EX3 A;  3RW0 A;  4DV7 O;  5JH7 B;  3D3I A;  1HNW B;  2GUZ A;  3A0H Z;  3ABK C;  4X89 A;  4X62 O;  1EN5 A;  1H38 A;  1XMO B;  4LF9 B;  1XIL A;  4IYH A;  2GV9 A;  1FJG O;  3AK3 A;  4B3T O;  2KB1 A;  1I0H A;  3WB0 A;  1CXZ B;  1E1Q G;  4RUF A;  3OD4 A;  2IH3 C;  4J41 A;  3A0R A;  1X4T A;  1US6 A;  4FLZ A;  5E1A C;  3T1Y B;  3QVN A;  1S5J A;  2PI5 A;  1P4R A;  1UPG A;  4TQF A;  5J2U B;  1Q82 W;  1QVG U;  5L3C A;  2YS8 A;  3WFV A;  3H1L H;  4LCU C;  3UT5 B;  5B1A B;  3JAW B;  2Q0A A;  3UKM A;  4IL6 Z;  4UVA A;  2E3C A;  4TUY B;  5DN6 G;  5KHI A;  3E83 A;  4O2B B;  4ASU G;  4PHZ A;  1IXM A;  1DTO A;  3CSX A;  5EK0 A;  4G28 B;  5BMV A;  1O9H A;  2ZIO A;  2NLJ C;  4F4L A;  1VQ6 V;  3JAT B;  1BQ0 A;  4O2A B;  3J81 N;  4O2B A;  1AI6 A;  1P49 A;  2YID A;  3J80 N;  4LH6 A;  1P84 F;  4KUM A;  2AHZ A;  1J5E O;  4O4H A;  3RVZ A;  1N33 O;  4CH3 A;  3EFF K;  4I50 B;  4NB5 A;  1FXK B;  1YCI A;  4UCS A;  5A9G A;  3DC5 A;  1B6Q A;  3HPL C;  3D36 C;  5GTI Z;  1QVF U;  4DR7 O;  1SF9 A;  4JYA B;  2DN9 A;  3RYF A;  4JYY A;  5EBL C;  3X2Q B;  1AIL A;  4PA6 A;  3NXS A;  4L87 A;  1HNX B;  1NU1 H;  1VQ7 V;  4JI4 O;  3CCM V;  1XBL A;  2XTA A;  4PDV A;  1HDJ A;  1PL0 A;  1M5I A;  2F66 C;  1FD9 A;  2Z0A A;  4EFB A;  3EXA A;  2LO1 A;  3W7U A;  2PZS A;  3JD2 A;  1SQV H;  2QWR B;  3ZHS A;  3K58 A;  2WAM A;  3IJ4 A;  2JVD A;  4UCV A;  1RFY A;  4JI2 O;  2UUC B;  1ROP A;  3T1H B;  2QDO A;  1RM1 B;  3P3N A;  4ZOL B;  2OCH A;  5LGN A;  1PD3 A;  3R65 A;  4EFE A;  5LOV A;  1K8A W;  2JK5 C;  4DO2 A;  2GTA A;  3FX7 A;  5ITZ B;  5CBH A;  4ICG A;  2AZ0 A;  1KP2 A;  1E79 G;  2H8P C;  1AVM A;  3L74 H;  3AG2 C;  3FYI B;  5KUK A;  3HKE B;  4CS4 A;  1FS0 G;  4RQF A;  2F23 A;  1BL8 A;  4AI8 A;  4DV2 B;  4FLY A;  4XDK A;  4B3R O;  1HP8 A;  2VQF O;  1KEC A;  2F1M A;  1YZB A;  3P3P A;  2ZDI A;  4X1Y B;  3WU2 Z;  2Q7G A;  5KHK A;  1KUQ A;  3CWB H;  1GM8 A;  5H2F Z;  2EIM B;  2P67 A;  2P6J A;  3AG3 B;  4JI5 B;  1G8M A;  1WN7 A;  2A7W A;  3RWR D;  3ZRV A;  4L8J A;  4X64 O;  1YJ9 V;  4DYL A;  3BAA A;  1VQM V;  3ZRS A;  1Q8I A;  1N4C A;  4X1Y A;  1FPO A;  2P4V A;  1MAB G;  4HZ3 A;  3L70 H;  1N32 B;  1JOY A;  1QU7 A;  3FB6 C;  4I0X B;  4LF4 B;  1HNZ B;  4NTY A;  5EYP B;  3ZBH A;  3ZMT A;  3L73 H;  4R6Z A;  4P9O A;  1XNQ B;  4I4T A;  2BTO A;  4DR5 B;  5IJ0 A;  4DR1 O;  1PL4 A;  1Y76 B;  4H44 B;  4U3J B;  2ZM6 B;  3D8C A;  4FVM A;  2ITD C;  3JAR B;  1MZE A;  4HBN A;  1THZ A;  2HFE C;  3K57 A;  1BE3 H;  5EC1 C;  4YY3 B;  2UXB O;  1SQF A;  1OCC B;  3Q4H A;  4X20 A;  2ZD9 A;  2UU9 O;  3N2K A;  3H01 A;  1JQ0 A;  1M90 W;  1NH2 B;  1ARO P;  2Y4U A;  4ZIB A;  4Z2W A;  5B1N A;  1Q43 A;  1I08 A;  1NI8 A;  3N2G B;  5CMU A;  3DXR A;  4FLU A;  1ZL8 B;  1IBK O;  2GDS A;  2XAF A;  3W7T A;  3SPC A;  1GM7 A;  2HR3 A;  1GK9 A;  3OUF A;  1AJN A;  1AP5 A;  3ASO C;  3KCY A;  2EJ7 A;  2CH7 B;  4B3M B;  1D5N A;  4LWS A;  3TXQ A;  3CME V;  3N2G A;  1WJZ A;  2Y0I A;  4JZG A;  4RUE A;  5L3E A;  3B8M A;  1GTO A;  4DV5 O;  2BSK A;  3BEH A;  2P22 C;  4X1K A;  1YIJ V;  4LFB O;  1HR0 O;  1SQQ H;  1GN2 A;  2JEX A;  1KB9 F;  2CH7 A;  1YTF B;  1GN4 A;  4QJF B;  2ZKO A;  3OTO O;  1KKD A;  1X59 A;  2UXX A;  3FD9 A;  2Z5U A;  1XL4 A;  4O4J B;  5L3G A;  4JI6 B;  1HNW O;  2JGU A;  2WLI A;  4OX9 B;  3BA9 A;  2R9A A;  3OFN G;  2EIK C;  2B1G A;  3OEH G;  5AG2 A;  4LF9 O;  1E1R G;  2XND G;  3G80 A;  2YIC A;  4P30 A;  1NKD A;  3T1C A;  1RSO B;  4LBE C;  4BWA A;  4BIO A;  1NVP D;  4FLV A;  5JVD A;  3MD0 A;  4B7K A;  2RJZ A;  3RYC A;  3T1Y O;  1Q6H A;  4BR6 A;  2H3O A;  3N27 A;  3L71 H;  5D5P A;  2FKX A;  3CRR A;  1TGO A;  1RSO A;  3LDC A;  2IU3 A;  1BZK A;  3CX5 F;  2CUG A;  4FM0 A;  4X9Q A;  3EVK A;  2F4V B;  1NZ6 A;  2XAJ A;  1R6K A;  3WB2 A;  2ETN A;  3TJT A;  5CBF A;  2DQ0 A;  4UVB A;  1D2D A;  4WFB V;  2IBZ H;  3I55 V;  3DTU B;  3SPI A;  1YHQ V;  1QLE C;  2EUL A;  1A32 A;  4FZ1 A;  4X1I B;  2Q67 A;  1V54 B;  5FPO A;  2C2A A;  4UVC A;  3FAV A;  3LNM B;  1OCR B;  4HNA B;  2GSM B;  2WLN A;  1J95 A;  4ABM A;  3G6B A;  5B1A C;  3JAK A;  1B06 A;  3OT7 A;  2PUS A;  3K5O A;  1Y74 A;  3CC4 V;  2W0F C;  4QPK A;  5F2V O;  1QNM A;  1VIB A;  3FKS G;  3CCE V;  3CCU V;  4JYA O;  2LW7 A;  3A2F A;  4PDL A;  1N8R W;  1Y67 A;  3A8T A;  4QE9 A;  1YF2 A;  4DV4 B;  1HNX O;  5LGT A;  3BCC H;  5KMG B;  3ZMS A;  1F51 A;  5BR8 B;  3QTC A;  2WLL A;  4R8C A;  2MW2 B;  3RYI B;  2GHY A;  4EEQ A;  2QM7 A;  1I94 B;  2QKS A;  2KKW A;  1EZJ A;  4LC1 A;  3SJA C;  1FYJ A;  2Y69 B;  5KX5 B;  3CCV V;  4PDR A;  2O57 A;  3ABM B;  4JI8 B;  4MW3 A;  4GX1 A;  2UUC O;  2JGD B;  2EIJ B;  3T1H O;  3BAB A;  2QWN B;  1GO3 F;  2EJR A;  1EN6 A;  1SZX A;  3E8B A;  1XL6 A;  1YIT V;  2LGW A;  4FFK A;  3CCJ V;  4WFE A;  2UXN A;  4CH5 A;  1JX9 A;  3ZJZ A;  4JI0 B;  1R3K C;  4ZI7 B;  5LYJ A;  2ILM A;  2D3O W;  4OXS A;  1GN3 A;  1OCZ C;  4YIO A;  4EKW A;  2CAZ C;  5B1O A;  5KLV H;  3FB8 C;  1IBM O;  4TT3 G;  4DV2 O;  1RM1 C;  2DWE C;  2QTS A;  3JAS A;  2CTP A;  2KG7 A;  2CK3 G;  3K59 A;  2P5O A;  1XRE A;  4FM2 A;  4NKG B;  1V55 B;  2LGQ A;  3ETE A;  2FTK A;  4FFB B;  3VOU A;  1AI7 A;  2Y0P A;  2VWJ A;  4RO2 A;  3OGC C;  4JI5 O;  3WG7 B;  4E4E A;  1VP7 A;  2YSU B;  3JAL A;  4HYO A;  3AG4 B;  1Y6X A;  4MVQ A;  4IIJ B;  1NBM G;  4MW8 A;  2QJ1 A;  1SER A;  3ABU A;  1EM1 A;  2XT9 A;  1N32 O;  2ZQM A;  5CA0 A;  3P32 A;  3JYC A;  4DUZ B;  4DV6 B;  1VQ8 V;  4LF4 O;  2DJV A;  1WA8 B;  1HNZ O;  3BHP A;  4FM1 A;  3JSL A;  1S0V A;  4DR5 O;  1WLE A;  4J11 A;  1FXV A;  1Z5W A;  2ZM6 O;  4IIJ A;  1O9G A;  1KC8 W;  3CHX A;  3AG3 C;  4G2K A;  4K3A A;  3K0G A;  3K5M A;  3K5L A;  2N04 A;  4YY3 O;  1MZF A;  3D3Q A;  3C90 A;  4MVR A;  4DR6 B;  2UXD B;  5CA3 A;  4NVP A;  2H94 A;  1MMM A;  1PV0 A;  5JH7 A;  2EIL B;  2K1E A;  3IAY A;  2WWW A;  3E8G A;  1M57 B;  3K0D A;  1ZLZ A;  3M8A A;  2PYL A;  1YDX A;  3UO3 A;  4IT5 A;  4RWU A;  1F23 A;  3B4S A;  4J7Z A;  5H9C A;  4B3M O;  1OCC C;  1IBL B;  4JI7 B;  5IYB O;  3VQW A;  2NN4 A;  3K03 A;  4FPP A;  4AIL C;  5J9P C;  3QF7 A;  1K33 A;  2OCC B;  1YJW V;  4LF6 B;  3M99 B;  4I9W A;  4H13 B;  4NXN O;  3ABL B;  4UUJ C;  4DV3 B;  3CD6 V;  5J2U A;  3OM3 B;  4J9Z B;  2RDC A;  2QGN A;  3UT5 A;  3W7X A;  1PKX A;  2HG5 C;  3JAW A;  1YJN V;  4JI6 O;  4TUY A;  1DF5 A;  3TCU A;  4OX9 O;  2V7Q G;  2IJH A;  1H8E G;  2ZR3 A;  3GVM A;  1OZ0 A;  4OGQ B;  1NH2 D;  3ZMV A;  2QKC A;  4JPR A;  5C93 A;  4PV1 B;  2QKA A;  1DGS A;  4ZHQ B;  2XAG A;  2QA4 V;  5IWA B;  3CRA A;  3JAT A;  4FJC C;  4O2A A;  1GKF A;  1FKA O;  1AP6 A;  4PA4 A;  2XUM A;  1WB7 A;  4I55 B;  4MT8 A;  1KYO F;  2HKO A;  2IJK A;  2ZIM A;  5KAI Z;  3CB2 A;  4X66 B;  5LMU B;  2BOC C;  1I5X A;  5L3D A;  3W7S A;  1K5S A;  1NQT A;  1B3Q A;  4I50 A;  4B3S B;  1MNG A;  1FXK A;  1DF4 A;  2FB5 A;  1SKV A;  3CP1 A;  4U7O A;  3ZRW B;  3JSN A;  4I55 A;  4RAI A;  5H6Q A;  3C3T A;  1ZWI C;  3CYO A;  3BPZ A;  3LDE A;  2GTS A;  2PF4 E;  1Q81 W;  3K5N A;  4GX5 A;  3T4Z A;  1BS3 A;  1JA8 A;  5LP6 B;  1F4M A;  4KFM A;  4O4I B;  2AW9 A;  2XAH A;  3JCU Z;  5IJ9 B;  1SA0 B;  3ZRW A;  3SPH A;  2JEU A;  2P06 A;  1WPB A;  4UCU A;  5B3S B;  4W4L A;  2AHY A;  1FFX B;  2VQE O;  3CJH B;  5J2T B;  4PA3 A;  1ZX3 A;  4BIU A;  2EZO A;  4O4I A;  3TET A;  3B77 A;  1BT8 A;  5EIB C;  4LF5 B;  3KG2 A;  4ZOL A;  4AHC A;  1KMI Z;  5B66 Z;  2L6L A;  4KXR A;  4O4L B;  2IU0 A;  3CC2 V;  4NTW A;  3RVY A;  5LMN B;  1Q90 D;  2ADQ B;  1V54 C;  1IUR A;  3QNE A;  4DV4 O;  1PM9 A;  5ITZ A;  1OJH A;  1OCR C;  3H1H H;  1H2G A;  1N36 O;  2X6B A;  5BR8 O;  1TA8 A;  1N34 B;  5E79 Z;  4CZZ A;  1I94 O;  4LF8 O;  3ETG A;  3HKE A;  3SJQ C;  3UCS C;  1XI1 A;  1B04 A;  4H37 A;  2E5L B;  3AG7 A;  5IT9 N;  2FYU H;  4WFA V;  3L9D A;  2DYS C;  1K73 W;  2Y48 A;  4IYI A;  3OMI B;  1ENV A;  4ZBM A;  4JI8 O;  5EBW C;  4XDJ A;  1L0N H;  4LFC B;  4Z1V A;  1Q6U A;  3GWO A;  1LUV A;  2JS5 A;  1NS1 A;  2IJI A;  1R3L C;  3OW2 U;  1SS3 A;  2HJF C;  4FIP C;  3JD3 A;  1S5L Z;  4UCR A;  3ABK B;  5TIS Z;  4JI0 O;  4CS2 A;  4U3F H;  4DV1 B;  3AG1 C;  1BCC H;  4MTX A;  5LGU A;  1KKC A;  4YJ2 B;  4I0X A;  2YIA A;  2Y69 C;  4UCT A;  3ABM C;  5EYP A;  1IXB A;  1PP9 H;  3AK2 A;  1KP3 A;  4GYC B;  3LNN A;  3ZED A;  4J80 A;  3CC7 V;  2EIJ C;  4PDM A;  2CGN A;  1Y76 A;  4U3J A;  1GN6 A;  1BSM A;  3H9V A;  1I7F A;  4JI1 B;  4TSF G;  1D5A A;  4TOI A;  3JAR A;  1UFI A;  1YI2 V;  2WLM A;  5B5E Z;  3ML0 A;  4TV8 B;  1T5E A;  3RN4 A;  2YEV B;  4JF3 A;  3B2E E;  2OWO A;  1XHX A;  3CCQ V;  3DC6 A;  2PTM A;  1K97 A;  2EBO A;  3FYE B;  5B1B B;  4DK1 A;  1BHA A;  4YIP A;  1TUB B;  2YDE A;  3R66 A;  1ZL8 A;  4RQE A;  2DE0 X;  5K1X A;  5H6R A;  5D5Q A;  4DV6 O;  1W59 A;  4DUZ O;  1EZV H;  4QPJ A;  1K3E A;  2YEV A;  1AJP A;  1AB3 A;  5KHH A;  2EIN C;  1SES A;  3KCX A;  2IH1 C;  1OCO B;  1V55 C;  2YIB D;  2A06 H;  1TUB A;  3F7V C;  4GX2 A;  4MTO A;  2OIE A;  1Y4M A;  4WFF A;  3WG7 C;  2E76 B;  4ZKI A;  3OR6 C;  4K8Z A;  4H0L B;  1NTZ H;  3AG4 C;  4P9P A;  1QQC A;  2XHB A;  3CMA V;  1XMO O;  1WAZ A;  1NR1 A;  1EBO A;  4D7T A;  1WPX A;  4DR6 O;  2UXD O;  3ZHU A;  3IC9 A;  5DM6 V;  4LR3 A;  3RYH B;  3W7W A;  4O4J A;  2IJJ A;  4IHJ B;  4NR1 A;  2HHH B;  1JPX A;  3SJC C;  2V1D A;  2WLH A;  4EB6 B;  2B5U A;  4XDL A;  3RFR A;  4F6R B;  1K7D A;  1MOF A;  4XBF A;  2DOS A;  1IBL O;  4JI7 O;  2CTW A;  3JAM N;  5DED A;  2Z3Y A;  4GT1 A;  4LF6 O;  1NJI W;  4WCE V;  2Q7H A;  4UFZ A;  5KA5 A;  4EB6 A;  1S5H C;  3G6E V;  4DV3 O;  1JMK C;  2EIL C;  3SGI A;  3UQ8 A;  1XDC A;  1PPJ H;  2ADP A;  1M57 C;  1AJQ A;  1S77 D;  2Q7E A;  3L72 H;  1R6N A;  2DYR B;  2Q6A A;  2QM8 A;  3RBZ A;  3SYA A;  3JCZ A;  2ZXW B;  3I56 V;  2QWP B;  5LXT B;  2HP8 A;  1L0L H;  3S3X A;  1TUE B;  2BTQ B;  2Q5Z A;  1XEQ A;  3AG2 B;  4WBN B;  4UXN A;  2RQ6 A;  1OV9 A;  2PI4 A;  5JQG B;  2OCC C;  3MHS C;  4X1I A;  3F7Y C;  4X88 A;  1W0K G;  3E86 A;  5IWA O;  1JFF B;  3ABL C;  2RN9 A;  4HNA A;  4PEL A;  3SR2 C;  4K35 A;  3CCL V;  3WB1 A;  2L35 A;  3APQ A;  5C8Y B;  4X66 O;  4TWK A;  5LMU O;  2UUB B;  1AI5 A;  1CP9 A;  2ITC C;  1SET A;  1Z2G A;  4B3S O;  3CXC U;  4A5U B;  4QE7 A;  2WLK A;  2FML A;  2KSD A;  4BW9 A;  1GRJ A;  1K9M W;  3AEI A;  1XOU A;  3SYO A;  2ZIN A;  1FXK C;  1XNR B;  3CS5 A;  5KMG A;  1SQP H;  4NXM B;  1VQN V;  3ZCC A;  5LL6 Y;  5KUM A;  4JAA A;  3X2Q C;  1VF6 A;  3RYI A;  5GON B;  1F7Y A;  4DR4 B;  1R73 A;  4IGG A;  2ARH A;  1H2S B;  1MG1 A;  1WP7 A;  3OAA G;  4WFH A;  5CA1 B;  5KX5 A;  3STL C;  5GTH Z;  2VRZ A;  1VQO V;  3SPJ A;  1MSW D;  2JGD A;  4J9Y B;  2E74 B;  4PA9 A;  4LF5 O;  2X0L A;  3ETD A;  2AZ2 A;  5LP6 C;  4D6T H;  1F4N A;  2B1I A;  4LF7 B;  5LBQ A;  1K5Q A;  5LMN O;  4JV5 B;  2YIB A;  1TVK B;  2GBO A;  4DR1 B;  4TV9 B;  2VS0 A;  3F5W C;  3ZMZ A;  3SYP A;  3E22 B;  4LNU B;  3LSS A;  4ZI7 A;  4PJ0 Z;  3QO5 A;  4CC6 A;  3LSU A;  1N34 O;  1M93 A;  3ZHR A;  3ASN B;  5FL7 G;  4GKJ B;  4NYK A;  2ZNJ A;  2E5L O;  5FPR A;  3HKB B;  2OYQ A;  2W6I G;  5CB4 B;  5FNV B;  4PI2 A;  4P2Z A;  1NVP B;  5L3F A;  1XQ8 A;  4LFC O;  1I5Y A;  2Q9L A;  4KP4 A;  2FL4 A;  1W0J G;  3K08 A;  4FFB A;  1GAX A;  1DLB A;  4DRX B;  5EC2 C;  5LA6 B;  2YXL A;  5IYD O;  1QCE A;  1XNQ O;  3FFQ A;  3QO8 A;  5CB4 A;  1N0N A;  2WA4 A;  3LUT B;  5FNV A;  4DR2 B;  1VMG A;  4UV9 A;  1QBZ A;  4JTA B;  4DV1 O;  3CE2 A;  3BRC A;  1GMG A;  2EIM C;  5BXZ A;  1IX9 A;  3TGU H;  1P7G A;  2GUZ B;  5LA6 A;  1WA8 A;  3PJS K;  3IFX A;  4HAM A;  1PNK A;  2WA3 A;  1JVM A;  4UV8 A;  2M6Y A;  4X65 B;  3K9S A;  1VQ4 V;  4GCZ A;  5IYZ B;  4JI1 O;  3ABT A;  2X6C A;  4QNH B;  1SRY A;  1JCH A;  2A79 B;  4YXW G;  3SYC A;  3RGB A;  1VQ9 V;  2X6A A;  4DR3 B;  4UCO A;  3CRM A;  1LR1 A;  1JJO A;  2HLD G;  2Q68 A;  4LFA B;  2XOK G;  1M1K W;  2RMK B;  2ATK C;  5IYZ A;  1VQK V;  1L1F A;  3VQY A;  1QLE B;  4GZR B;  2A9H A;  3SPG A;  1YEW A;  3DGE A;  4FLW A;  3BA8 A;  5HFL A;  1Q6I A;  2V4D A;  1HW7 A;  3IGA C;  4Q20 A;  2KQX A;  4X8A A;  3ZX6 A;  3S3W A;  3CCR V;  2HVK C;  1OHH G;  5KA6 A;  4UB6 Z;  3OMN B;  1SQB H;  5BMV B;  4YJ3 B;  1S76 D;  1EFR G;  2WPD G;  2OIG A;  5IE9 A;  3ZMU A;  2ODM A;  2UUA B;  3DSQ A;  2YI9 A;  5B1B C;  1N0J A;  4GX0 A;  2F43 G;  3MDS A;  2N05 A;  3CXH F;  2ZE5 A;  3O9O A;  2K9P A;  3CEI A;  1AR5 A;  4O4H B;  3U0Z A;  1WNS A;  5JWP A;  1XMQ B;  3CPW U;  2JIZ G;  4YJ3 A;  2YXY A;  5DEC A;  4GUN A;  2QSA A;  4PI0 A;  1OCO C;  1VEW A;  2CGO A;  3P30 A;  2HHH O;  5K1P A;  1M56 B;  2NR5 A;  4CBC A;  5KAF Z;  3APO A;  3RYF B;  2R9R B;  5JJJ B;  3K3W A;  5HFM A;  3SYQ A;  3QG5 A;  2BOB C;  1XUQ A;  3JD1 A;  2A0L A;  3H1K H;  1K4C C;  3ZHT A;  4ZHQ A;  1BGY H;  1ZSP A;  3EHB B;  1SZT A;  5IY5 B;  1JR9 A;  4JI3 B;  2F4V O;  1RPO A;  2F95 B;  4I5S A;  3LDD A;  4MS2 A;  3VQX A;  2QTO A;  2YXH A;  5CBG A;  1YTF D;  1H2M A;  3T4D A;  2HEP A;  1G6U A;  4K0K B;  4JYC A;  1COW G;  3JD4 A;  4R7C A;  5A2Q N;  4JAS A;  1DK1 A;  1CEZ A;  2F93 B;  1ORQ C;  4DUY B;  4JTD B;  3ETQ A;  5LP6 A;  5LOV B;  4JYB A;  1OCZ B;  1H2N A;  1M9N A;  4KL1 A;  5IJ9 A;  1SA0 A;  5LHH A;  3HR0 A;  1RP3 B;  1VF5 B;  1Q7Y W;  4B7E A;  3K79 A;  2DW4 A;  2OTL V;  5EBM C;  1FFX A;  4CH4 A;  4FLT A;  3CJH A;  2DYR C;  5J2T A;  2UUB O;  5LHG A;  1H8H G;  1ZTE A;  2ZXW C;  4AQY B;  2ZR2 A;  4LH7 A;  2PGG A;  3FB7 C;  4QIW F;  3PN1 A;  4Q6G A;  4U7N A;  2HVJ C;  2JJ1 G;  3NR7 A;  3ZN1 A;  3ICX A;  1KU9 A;  4O4L A;  2W6J G;  3J7A U;  5BZB A;  1IBM B;  3TK1 A;  1XNR O;  4DV0 B;  5EIB D;  2VWK A;  2AXT Z;  2UXC B;  4K8X A;  2RCV A;  2X7R B;  4NXM O; 
#chains in the Genus database with same CATH homology
 1BZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...