1BZKA

Structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
RYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the effects of the deletion in the red cell anion exchanger (band 3, AE1) associated with South East Asian ovalocytosis.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords PROTEIN (BAND 3 ANION TRANSPORT PROTEIN)
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.570 Mainly Alpha Orthogonal Bundle Helix Hairpins Helical hairpin bin 1bzkA00
1BZKA
chains in the Genus database with same CATH superfamily
3P32A 1PL0A 1QBZA 1YTFB 4I4TB 4TT3G 3SJCC 3W7UA 2WA3A 4FLZA 3P3PA 2HP8A 2ZNJA 2XTAA 1V55B 5A9GA 4O2BB 5LXTA 2ZM6B 3FYIB 1QU7A 5KHHA 2DQ3A 1YXBA 2EILB 3W7SA 2XAFA 1MZEA 1PKXA 2YIBD 3R66A 3ETEA 5LGNA 2GSMB 1DF4A 1NVPB 3ETGA 4IL6Z 1BSMA 4KHPO 2F4VO 5D5PA 3OR6C 2ZE7A 4JGSA 4JI2B 1GKFA 4NB5A 5EYPA 3CD6V 2LGWA 2X7RB 3ASNC 3QG5A 3SPCA 5IY5B 2YEVB 1FFTB 3AG7A 3OUSA 3ABKC 1OHHG 3UQ8A 2QTSA 1K9MW 1FYJA 2ZXWB 4H37A 5BR8O 4CC6A 4GKJB 3JD1A 4TV9B 2B5UA 5J2UB 5BXZA 1LUVA 5J2TA 1IBKB 3SJBC 5DEDA 4IT5A 1HNZO 4TV9A 4JTCB 1RPRA 1V54C 3J80N 1VQMV 4QE9A 2FL4A 2DWDC 3W7TA 1KMIZ 4X64B 3A0RA 4QPKA 1DGSA 3CRAA 3ABLC 1SC5B 4LFBO 1SZTA 3OTFA 5CBGA 1WPXA 1Y66A 1RM1B 3E22B 3F5TA 4RAIA 5LP6A 1VF7A 3CRCA 4FLUA 4CH3A 2HR3A 1ZL8B 3BRCA 3D36A 4UCUA 4DV5O 1CPYA 1HP8A 4X1YB 1HNXB 1VQ7V 1U96A 3SYPA 4HYOA 2Y69B 1Q8IA 3U10A 1XI1A 1ROPA 5IWAO 5JQGB 1U97A 4FZ1A 4FFKA 1EFRG 4DRXB 4JYCA 5CB4A 4JI3B 2XAJA 1B6QA 1JJ2U 1TUBA 4X9QA 3Q4HA 5GTHZ 1VQPV 1E1QG 4G28B 5LOVB 2Q0OC 5EK0A 1XOUA 4NYKA 1DF5A 3B8MA 4KXRA 2CGOA 1O9HA 2PY5A 1XMOO 1KU9A 3N2KA 3AEIA 4GYCB 3U11A 3CCMV 2EIJC 4U3FH 3CS5A 4CS4A 4DV2B 4PI0A 4NXMO 4XBFA 3MHHC 1THZA 4X20B 2UU9O 3FAVA 1S76D 1FXKC 4O2AB 4DV5B 3HKEA 1EBOA 3DGEA 3ASNB 2ZM6O 4X65B 1BS3A 1SQVH 1Y76B 1I94B 2A9HA 4TWKA 2EIMC 3OGCC 4P9PA 2JGDB 1VQ4V 4F4LA 2K9PA 4NKGB 1FKAO 2V4DA 4QIWF 4UCTA 4W4KA 3C90A 3C3TA 3BAAA 2QWOB 3JARB 2BCCH 3A0HZ 3W7XA 3K08A 1HNWO 2EZPA 3ABMC 4CH6A 2AGAA 1ZSPA 2R72A 2B1IA 3OMNB 4ZOLA 1SQQH 2NN4A 4TQFA 3CRQA 5HFLA 1FXKA 5LHIA 4BW9A 1S77D 2G38A 2QWRB 2QR4A 5K1XA 1G4YB 3K9AA 4HNAA 3D8CA 3CP1A 3LDCA 4X20A 4UFZA 1KQSU 1VF5B 1E1RG 3APOA 2LW7A 4RO2A 1YIJV 3OMAB 3E2EA 1W0KG 1YDXA 3RW0A 1G1XB 1K5SA 2UXXA 3M7MX 4WFBV 2QKCA 2QWPB 3OR7C 4EFEA 2GBOA 3H1KH 1M1KW 2AW9A 5IYCO 4JPRA 5C8YA 5B1OA 5LOVA 1MG1A 1K8AW 4PA7A 2IU3A 3K5LA 2JS5A 4UUJC 1NR1A 4NTWA 1PNMA 4NTYA 5CB4B 2JS3A 3ZRWA 4A5UB 3FB7C 3AG4B 3E83A 5BMVB 1M90W 3TJTA 3EXAA 3JD3A 4FM2A 3EVKA 4YXWG 3ML0A 1FFXB 3JAMN 3QNEA 1GN6A 2QWQB 4GLXA 2LP7A 2D3OW 2ILMA 4P9OA 4Z1VA 1PV0A 5J9PC 4GZRB 1S5HC 2A7WA 2N05A 3BABA 3A0BZ 3OUFA 3ABTA 2RCVA 3THOA 3CCSV 3UO3A 2KG7B 3LSUA 3CWBH 5L3FA 1IX9A 3ABUA 2XT9A 1UFIA 4PV1B 1F4NA 1TUEB 2QM4A 3WFVA 1H38A 2H8PC 2HKOA 1Q5OA 3K06A 4X65O 4DYLA 1H2GA 3ABMB 5A2QN 2CK3G 3KG2A 4WBNB 2Q5ZA 1MA1A 4LBEC 2JK5C 5DN6G 5EZYB 4B3MB 1K92A 2IH1C 3JAKA 4FM1A 2FTKA 3IC7A 3APQA 4DV3O 4TSFG 4B3RO 1IBLB 2YXLA 3GVMA 1N36O 4IYHA 1NU1H 2UUCO 2DQ0A 1R3IC 3E89A 3HB3B 3WU2Z 3JATA 4UB8Z 3DXRA 2BTQB 1UJWB 4DR1O 5AG2A 3K3WA 1R6KA 4DV1B 1B3QA 2YDEA 3IFXA 4JYYA 1YF2A 5KX5A 1GAXA 1H2KA 4UB6Z 1CP9A 3VBBA 1NVPD 1Y6XA 4R50A 4NXNO 1VQOV 1RSOB 2XOKG 5IYDO 3BEHA 3RFRA 1K3EA 4X66B 1NTKH 4Z1MG 2VRZA 3SR2C 4LNUB 3OTOB 1SKVA 4DR5O 2ZR2A 5LA6B 2CDYA 2B1GA 4J9ZB 3E8GA 1AILA 2WLIB 3UO2A 2F93B 3JASB 5CMUA 1AI5A 2NR5A 4PDLA 1H2LA 5FNVA 2LW1A 5B1AC 4LF5O 4LR3A 1RSOA 2F23A 1XEQA 1IDSA 5JVDA 1EZJA 3OGIB 3QVNA 4YHHO 4DV7O 1OCCC 1N34O 2XUMA 2XHBA 1BGYH 3CJHB 3CMAV 1WJZA 2Q67A 2YIDA 5LBQA 2YSUB 1W0JG 4J80A 1COWG 1XREA 4DUZO 3JALB 3QO8A 2P4VA 1RPOA 2RNBA 3K79A 5H9CA 5KMGA 3K5MA 1XNRO 2A06H 1WA8B 3FB8C 1CEZA 2RQ6A 4EFBA 5B1BB 5TISZ 4UVAA 2LJ2A 3OEEG 3KCYA 4JASA 1W2BU 2FB5A 3L71H 5KA5A 2QSAA 4TQDA 4DV3B 4IYIA 3TXQA 4GX2A 3T4ZA 2EINB 2OCHA 4FFBB 4EEQA 4X88A 4DK0A 1SS3A 4PHZA 2ZIOA 4O4LB 4KP4A 2H94A 4U3JA 1I5XA 2C2AA 1SQPH 1YZBA 2PYJA 4DR5B 5KHGA 3X2QC 4ZI7A 1DK1A 3GB7C 2HG5C 2CTRA 4K8XA 2P4KA 2Y4UA 1XMQO 2EJ7A 2QKAA 4FJCC 4FLXA 4K8ZA 4DR4B 3G4SV 3ETQA 5HFMA 5FL7G 5CA1B 1ZX3A 1JCHA 4JI1B 5L3BA 3CE2A 3CCUV 3HKBB 1K97A 1D5AA 2X6CA 4ZOLB 1SRYA 3E35A 1G8MA 3DC5A 5EC2C 2IJHA 4JI8B 4WFGA 2N04A 1GN4A 1I7FA 3HKCB 4X1KB 3K5NA 5KHIA 4G2KA 2ZR3A 1ENVA 2UXBO 5GONB 2V7QG 3JSNA 5FLXN 4JI0B 1IBLO 5H6RA 4FZ0A 1R73A 3L75H 5C8YB 1M56B 3CC2V 4MTFA 2WPDG 4DW0A 1PPJH 4P2ZA 1PM9A 2W0FC 4LWSA 2CTPA 3SYCA 4LH6A 5IE9A 1V9PA 1Y74B 3K5OA 1Y76A 2BSKB 1WAZA 1QCEA 3ZCCA 2PZSA 4JYAO 3HKEB 3AK2A 2VQFO 3AG4C 4B3SB 4LFBB 1OZ0A 4ICGA 1XMOB 2M7WA 4DV4O 5LYJB 3DSQA 3T1YB 4O4IA 5LYJA 4PELA 2BOCC 3LNNA 3CCQV 1WP8A 2ZE5A 2VS0A 4LWSB 3VOUA 1NTZH 4YJ3B 4PD4F 4UCOA 2BSKA 5ITZB 3OTOO 5K1PA 5GONA 3ABLB 5B1BC 1NQTA 5IWAB 4X66O 4GX1A 4X1KA 1BHAA 5B3SC 5KAIZ 2LFRA 3RVZA 5L3GA 3L74H 1OCRB 1XILA 1XMQB 3E8FA 1SA0A 3TGUH 1AB3A 3D3QA 3HKCA 3F7YC 1YJNV 1YITV 2P06A 3ZBHA 1AI7A 4BW5A 1BZKA 3UKMA 4MS2A 1OCOC 4KHPB 1E79G 3UCSC 1GK9A 2P6JA 4JI6O 1M5IA 1K33A 1RFYA 2UXDO 5KA6A 1FPOA 4IIJB 1AP5A 3P30A 4MT8A 4O4LA 4X8AA 2UUAO 5KHJA 2DW4A 2DJVA 1M56C 4FFBA 2Z0AA 4GUNA 3WG7C 4CZZA 1F23A 3RYIB 1S72V 1EM1A 3LNMB 2BTOA 2OCCB 2W0XA 5IJ0A 2CGNA 1VF6C 3OT7A 4YY3B 2ZNIA 3NR7A 5J2TB 4J9YB 2IBZH 1WA8A 1R1BA 5KMGB 4JV5B 4DV0O 1N4CA 4Q6GA 3OW2U 3RGBA 1Z5VA 3ZHRA 3JALA 5EC1C 4K3AA 4ABMA 3G6BA 1ZL8A 2VWJA 4QNHB 1M9NA 2YUAA 2BOBC 1QHTA 3E22A 1WN7A 4LCUC 3JCZA 3ZN1A 5JVDB 4ZIBA 2EX3A 3LUTB 3CYOA 2EINC 1LUWA 4UCSA 3E8HA 1FAFA 4DR4O 1VF6A 1QVGU 4D7TA 1SF9A 2FKXA 1KBHA 5CBHA 2ADPA 4P30A 2XAHA 1BCCH 5LA6A 3T1HO 1NTMH 4JI8O 3BY6A 3BHPA 3I5DA 1WPBA 3JASA 2OT5A 1LNQA 3EFFK 1URFA 3OM3B 2WLIA 4LF4B 2CE4A 3E86A 4DV0B 3LSQA 4UCRA 4O4HA 1VMGA 4BIZA 3JD0A 4UCVA 4FMTA 2WAMA 2WLLB 1BQZA 3DC6A 2IH3C 1A32A 3OAAG 4UV8A 2BTQA 4LF6O 2Z3YA 4CH5A 3JATB 3WG7B 1IBMO 5KX5B 4FLVA 3I56V 1FXVA 2OWOA 4MVUA 1IZ3A 1R3JC 3IAYA 3DXRB 4UXNA 4RQEA 1XHZA 2UU9B 5EZYA 3STZC 2PYLA 1F51A 3K04A 2UXDB 1BHBA 4JI0O 3CCEV 4F6RB 3JAKB 3RYHA 3WB2A 3I55V 4JI4B 5L3CA 1BE3H 4E2LA 5IJ0B 3L73H 4LF8O 1OCRC 1M57B 3RYIA 2OTJV 4J7JA 1NZ6A 4HBNA 4G27B 2CTQA 2UUBB 5D5QA 4ZHQA 2ZCEA 3BA8A 3GWOA 2P5OA 1Q6UA 2IW5A 3K9SA 3N27A 3M99B 1N32O 4J10A 5KLVH 4JTDB 2XNDG 1N0NA 2UUAB 3ZRWB 1NH2D 1FFXA 1B06A 5CA3A 5IJ9A 1HR0B 2NLJC 3LDEA 3AK1A 4JI2O 5BMVA 2W6IG 5KUKA 2X6AA 2CH7B 2Q7EA 2HJDA 4BR6A 5C93A 1BL8A 5CN0A 4CBCA 3M8AA 2ZKOA 4I50A 2WLMA 4H44B 4MTGA 3CCVV 4J11A 4YJ3A 2PTMA 2GHYA 4TUYA 1IXMA 3FD9A 1IBMB 4L8JA 3OFNG 2Q0AA 4LC1A 2HVJC 1BQ0A 2YIBA 1OV9A 4DK1A 3K0DA 4X62O 4IIJA 2EIKC 4JF3A 4O4IB 4ASUG 1QLEC 2DYSC 4DXWA 3JSLA 1QNMA 1TVKA 2O57A 4MSWC 2ETNA 3O9OA 3AG1C 5LP6C 4EB6A 1KKCA 2DYRB 2JJ2G 1L8DA 4IGGA 5EIBC 3CRMA 4HZ3A 1SA0B 3CX5F 3RYFB 4GCZA 3K57A 2GUZB 1AR4A 4CH4A 4DUYB 3KCXA 3MHSC 1WB7A 2R70A 1I0HA 1R3LC 2QJ1A 3JARA 1M93A 2LO1A 3RYFA 1S5JA 1BMFG 1NH2B 1SESA 3B2EE 3FYEB 4AI8A 4EB6B 2ADQB 3ZHUA 5JCOA 2YI8A 3HKBA 4C7UA 2PI5A 4LF9O 2LQTA 2E74B 4E4EA 1QVFU 1FD9A 4RQFA 1TVKB 1DTOA 2YIAA 2YICA 3ASOC 1I08A 1Q43A 2JGUA 4TOIA 3N2KB 1GM9A 1NBMG 2F66C 5B3SB 4HAMA 4DV4B 1KP2A 4LFCB 1Y74A 1Q7YW 1PD3A 4QPJA 3QF7A 2FMLA 3Q4HB 1JVMA 1TAEA 5LMUO 2YI9A 4BIOA 4FLWA 2WA4A 2KSDA 5JQGA 1X4TA 3PJSK 1AP6A 1TUBB 3KZIZ 3ZRXA 4DR2O 2PF4E 4NXMB 3RVYA 4MVSA 4K35A 1ZWIC 3QO5A 4LF9B 2WLHA 5CA1A 4FIPC 2QDOA 1N0JA 4JYBA 1ZLZA 4I55B 4UV9A 4X1YA 1S3JA 4JYAB 2MK3A 2A79B 2IJJA 4JI1O 1SETA 4Q20A 2HFEC 5EBLC 5F2VO 2DE0X 1Q6HA 3FB6C 4ZKIA 5LP6B 3ABKB 5L3DA 1ORQC 5IYZB 4NR1A 4FPPA 2ZDIA 1XHXA 4JI6B 4YJ2B 2UXNA 2ITCC 2QEXV 3KKYA 4DO2A 1BT8A 4UVBA 4DR6B 5BY1A 1PNLA 4DUYO 3FB5C 1Q81W 2VQEB 2EIJB 4TV8A 3JAWB 1KB9F 2DWEC 3B8NA 3VQXA 1XBLA 1AJPA 1D2DA 1O9GA 4F6RA 2HVKC 5EIBD 1AR1B 2E3CA 5J2UA 1NT2B 1AR5A 3OMIB 1KYOF 3SPIA 1P84F 4DR2B 1GRJA 4OGQB 4MVRA 5FPRA 2EJRA 3PN1A 3E8BA 3FKSG 4QE7A 2IM9A 4YY3O 5LHGA 2WLJA 1L1FA 1V55C 2R9AA 2F4VB 3CRRA 3D36C 1F4MA 2R9RB 3O65A 3ZHVA 4N23A 2CAZC 1KC8W 4FM0A 2AHZA 2JRIA 1JA8A 4WFEA 2DMXA 1WP7A 2DOSA 1YSCA 4I0XB 3CJHA 1ZUQA 1M57C 2WLNA 4LF7B 3VQWA 5BZBA 5H2FZ 2X0LA 4H13B 3JD4A 2JDIG 1R6NA 3CMEV 2P90A 3EHBB 1VQNV 2JEUA 2E76B 3ZMUA 5IDJA 2Z5UA 4WBNA 4Z2WA 3ZJZA 5FPOA 4MTXA 3ZX6A 3JYCA 1SZXA 4LFCO 1P49A 2Q7GA 3JCUZ 1XL6A 2ZDIC 4WF9V 2HEPA 2LFSA 1V54B 1VQLV 1FS0G 3SDLA 4JAUA 2QA4V 3TK1A 4B3SO 1K4DC 2HHHB 2RN9A 2PI4A 4O4JA 1F7YA 3G6EV 4N21A 4LP8A 3OE7G 3RYCA 4X1IB 3K58A 3BFRA 2KB1A 4GKKB 1N34B 2Y0PA 2ZIMA 3DTUB 1YJWV 4J42A 4OXSA 5B1AB 2DYRC 1JPXA 4F6EA 3CSXA 5E1AC 1N8RW 2JIZG 1JFFA 4U7NA 4AQYO 4I9QA 2RDCA 4LF7O 3A8TA 5JJJB 4H0LB 1WNSA 1GN2A 3H01A 3H1HH 3ZMSA 3IJ4A 4B3TO 2Q73A 2YXHA 1Q6IA 4PJ0Z 4AILC 2OYQA 3ZEDA 5LMUB 4BWAA 4MVQA 3C3SA 3S3XA 5GTIZ 3CC4V 4DR6O 1KP3A 2QKSA 4I7ZB 4B3MO 4LFAB 3J81N 4JV5O 3BVOA 4LH7A 2EILC 2UUBO 1TA8A 4PA4A 5H5NA 4CC5A 4PI2A 1QQCA 4MW3A 3AG2B 5CA0B 2KG7A 2NNUA 4OX9O 2LGQA 4NVPA 2ARHA 4YHHB 3ZHSA 4DV7B 1HW7A 1Q90D 4CS2A 2V1DA 5BR8B 3CPWU 1N36B 2UUCB 3CXHF 1AROP 1DLBA 2M6YA 1IURA 5H6QA 5DM6V 4DW1A 3ICXA 1FXKB 2VWKA 3SPGA 2IJKA 3FX7A 2AHYA 1QR8A 2A0LA 1AJNA 1Y4MA 4J7ZA 1NR7A 3MD0A 3BA9A 3MDSA 1Q3EA 3CB2A 4CS3A 3MAQA 3D3IA 3TETA 3IC9A 3TXSA 2VQEO 1R3KC 1XQ8A 3AK3A 2HHHO 3ZRSA 4JI5B 4K0KB 2YC0A 2E5LB 2F1MA 4I50B 1MSWD 2UXCB 2GV9A 2P67A 3T1CA 1VP7A 4LF8B 1YCIA 3WB1A 1HNWB 5KAFZ 2JGDA 2PUSA 3CXCU 3SYQA 3CHXA 2YS8A 4JAAA 1TGOA 4KFMA 2H3OA 4KUMA 4LF6B 2ZQMA 5LGUA 2BE3A 3STLC 1YTFD 5JJEB 3TCUA 3FAVB 3LSSA 1XUQA 1IVSA 4HNAB 1VQ8V 1YEWA 2HJFC 2Q4PA 3B4SA 2Y69C 1W59A 2Q69A 3BCCH 1KD1W 1GM8A 3OD4A 4J41A 5CA0A 3ASOB 2ODMA 2XASA 4MVMA 3H1JH 1JMKC 3J7AU 1B04A 4JZ2A 3U0ZA 1SQGA 1P7BA 2RJZA 2Y0IA 2AZ2A 3NXSA 1AI6A 4OX9B 2QGNA 4DR3O 1KKDA 5DECA 1KUQA 1UPGA 1Z2GA 4PA6A 2AZ0A 4DRXA 3ZMTA 3RYHB 1K34A 4LF4O 1GN3A 2FYUH 3HR0A 1HDJA 2XAGA 1J5EB 2YXYA 2JEXA 4LFAO 2EZOA 2OIEA 5LHHA 1XL4A 3ZHTA 1VQ6V 1JFFB 4BAYA 4DV6O 3AG3B 4I0XA 2VQFB 2ZE8A 1I5YA 3HPLC 4B3TB 2EIMB 4B7KA 5JCOC 3LDDA 3SYAA 2IJIA 4ZI7B 1SERA 3ZIAG 1VIBA 4DR7O 3SYOA 2Q8VA 2QM8A 1N33O 1JQ0A 4GX0A 4X1IA 3RYCB 1LR1A 4U3JB 4H33A 1J95A 4L87A 3B40A 5JH7B 2EBOA 3AG1B 4NTXA 3N2GA 3OEHG 5B5EZ 3ZMVA 4IHJB 4MW8A 2WLLA 4EKWA 4JI3O 2F95B 3FFQA 2AXTZ 2D2CB 1NS1A 2F43G 2OTLV 3UT5B 3QTCA 3JAWA 3SPHA 1WLEA 1XDCA 2E5LO 4WFAV 4XDLA 4XDJA 4MVZA 1X59A 5IYZA 4J7KA 4DV6B 1KECA 4DV2O 1L0NH 2YEVA 1Y67A 2KKWA 3VQVA 3X2QB 3R65A 4PA9A 1HNXO 5EYPB 3H9VA 4D6TH 5LGTA 3G80A 4AQYB 3K0GA 4YIPA 1P4RA 1YI2V 1SQFA 2Q9LA 5FNVB 4GT1A 2CTWA 2IU0A 3F5WC 3SJQC 1AI4A 3UM7A 3CCRV 1FJGO 2UXCO 1OCOB 1RM1C 2PGGA 3ZN0A 3UT5A 4I5SA 2QE7G 2GTAA 1QR9A 4U7OA 3B09A 5KHKA 2Y4TA 4LNUA 2A3QA 4O2BA 5LXTB 1SQXH 2Q7HA 3ZRVA 2Q68A 5EBMC 3P3NA 4I9WA 4TV8B 4I4TA 3CEIA 1VARA 2WSSG 2JJ1G 2RMKB 5JH7A 4FK5C 3T2MA 5LMNB 2ITDC 4YJ2A 4OPHA 4W4LA 3G67A 1NI8A 4IHJA 3SJAC 1EN5A 3N2GB 3RWRD 4JTAB 1XNQO 1M4UA 1J5EO 5IT9N 3K03A 1D5NA 1MABG 1ZTEA 2XAQA 4RUEA 1SQBH 4OPAA 4I55A 3BPZA 3QO7A 2ZE6A 2P22C 1YHQV 4DR3B 5IY5C 2OIGA 1OJHA 4JI7O 2K1EA 1GH6A 4WFHA 4JAVA 1I94O 1OCZC 4B3RB 2R9IA 4AHCA 4QJFB 1NJIW 4KL1A 5L3EA 4NXNB 2X6BA 1CXZB 1H8HG 1Q86W 4ZBMA 4PDVA 4LF5B 1HNZB 1H2MA 1G6UA 3ZS8C 2CUGA 1Q82W 4WCEV 4DR1B 2QTOA 5ITZA 2W6JG 3HKDB 3T1YO 5EBWC 1PP9H 3RT3C 2ZT9B 1AVMA 2EIKB 2ZD9A 4XDKA 1XNQB 3K59A 4MTOA 3AG3C 2Y48A 4X62B 2MW2B 1VEWA 3ZHQA 2QWNB 1AJQA 5LMNO 1YJ9V 5JJNB 1GTOA 1XNRB 1T5EA 4DR7B 1QLNA 1GO3F 1N33B 3A2FA 5E79Z 1HWYA 1NKDA 1MMMA 4DV1O 5IYBO 4DUZB 4D7SA 5B1NA 1YVWA 3CC7V 1IBKO 3VQYA 3T1HB 5CBFA 3GWKC 3L72H 2ATKC 3WB0A 4JZGA 4JI4O 4FLYA 1L0LH 3ETDA 1RP3B 1R6TA 3SPJA 1GM7A 1K5QA 1FJGB 4PA3A 1VQ9V 2JVDA 2P7TC 3H1LH 1US6A 1ZAUA 1VQKV 5B66Z 2CH7A 1JJOA 1H2SB 2GUZA 4FLTA 4B7EA 1IXBA 1EN6A 2GDSA 3L70H 2GTSA 5IJ9B 4QGPA 1P7GA 2OCCC 4RUFA 1OCZB 3T4DA 2ZINA 1MSDA 3S3WA 1OCCB 1H8EG 3B77A 3G71V 3CCJV 1PNKA 5JWPA 1MNGA 1FXHA 1H2NA 1VQ5V 1EZVH 3W7WA 3H1IH 3CCLV 4BIUA 4RWUA 4PDRA 4ZHQB 1JX9A 1K4CC 4GX5A 3ZMZA 2HLDG 4WFFA 2UXBB 4TUYB 2KQXA 4GKJO 1S5LZ 2WWWA 3IGAC 5LL6Y 2WLKA 1JOYA 4X64O 4JI7B 2ZXWC 3F7VC 4YIOA 1JR9A 3JD2A 1HR0O 3SGIA 1EN4A 1S0VA 2B9ZA 4UVCA 1PL4A 5GW7A 4JI5O 4K0KO 5KUMA 4PDMA 2N74A 1K73W 1WB8A 1MOFA 4GKKO 4O2AA 1N32B 4R8CA 1QLEB 2DYSB 2DN9A 3L9DA 2L35A 1MZFA 2E75B 3AG2C 2EULA 2QM7A 4FVMA 1Z5WA 4R6ZA 3RN4A 4MVOA 4B08A 1GMGA 2Q6AA 3HKDA 4X89A 4O4HB 3RBZA 1K7DA 2L6LA 4O4JB 4R7CA
chains in the Genus database with same CATH topology
1BZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZK A; 
#chains in the Genus database with same CATH topology
 3P32 A;  1PL0 A;  1QBZ A;  1YTF B;  4I4T B;  4TT3 G;  3SJC C;  3W7U A;  2WA3 A;  4FLZ A;  3P3P A;  2HP8 A;  2ZNJ A;  2XTA A;  1V55 B;  5A9G A;  4O2B B;  5LXT A;  2ZM6 B;  3FYI B;  1QU7 A;  5KHH A;  2DQ3 A;  1YXB A;  2EIL B;  3W7S A;  2XAF A;  1MZE A;  1PKX A;  2YIB D;  3R66 A;  3ETE A;  5LGN A;  2GSM B;  1DF4 A;  1NVP B;  3ETG A;  4IL6 Z;  1BSM A;  4KHP O;  2F4V O;  5D5P A;  3OR6 C;  2ZE7 A;  4JGS A;  4JI2 B;  1GKF A;  4NB5 A;  5EYP A;  3CD6 V;  2LGW A;  2X7R B;  3ASN C;  3QG5 A;  3SPC A;  5IY5 B;  2YEV B;  1FFT B;  3AG7 A;  3OUS A;  3ABK C;  1OHH G;  3UQ8 A;  2QTS A;  1K9M W;  1FYJ A;  2ZXW B;  4H37 A;  5BR8 O;  4CC6 A;  4GKJ B;  3JD1 A;  4TV9 B;  2B5U A;  5J2U B;  5BXZ A;  1LUV A;  5J2T A;  1IBK B;  3SJB C;  5DED A;  4IT5 A;  1HNZ O;  4TV9 A;  4JTC B;  1RPR A;  1V54 C;  3J80 N;  1VQM V;  4QE9 A;  2FL4 A;  2DWD C;  3W7T A;  1KMI Z;  4X64 B;  3A0R A;  4QPK A;  1DGS A;  3CRA A;  3ABL C;  1SC5 B;  4LFB O;  1SZT A;  3OTF A;  5CBG A;  1WPX A;  1Y66 A;  1RM1 B;  3E22 B;  3F5T A;  4RAI A;  5LP6 A;  1VF7 A;  3CRC A;  4FLU A;  4CH3 A;  2HR3 A;  1ZL8 B;  3BRC A;  3D36 A;  4UCU A;  4DV5 O;  1CPY A;  1HP8 A;  4X1Y B;  1HNX B;  1VQ7 V;  1U96 A;  3SYP A;  4HYO A;  2Y69 B;  1Q8I A;  3U10 A;  1XI1 A;  1ROP A;  5IWA O;  5JQG B;  1U97 A;  4FZ1 A;  4FFK A;  1EFR G;  4DRX B;  4JYC A;  5CB4 A;  4JI3 B;  2XAJ A;  1B6Q A;  1JJ2 U;  1TUB A;  4X9Q A;  3Q4H A;  5GTH Z;  1VQP V;  1E1Q G;  4G28 B;  5LOV B;  2Q0O C;  5EK0 A;  1XOU A;  4NYK A;  1DF5 A;  3B8M A;  4KXR A;  2CGO A;  1O9H A;  2PY5 A;  1XMO O;  1KU9 A;  3N2K A;  3AEI A;  4GYC B;  3U11 A;  3CCM V;  2EIJ C;  4U3F H;  3CS5 A;  4CS4 A;  4DV2 B;  4PI0 A;  4NXM O;  4XBF A;  3MHH C;  1THZ A;  4X20 B;  2UU9 O;  3FAV A;  1S76 D;  1FXK C;  4O2A B;  4DV5 B;  3HKE A;  1EBO A;  3DGE A;  3ASN B;  2ZM6 O;  4X65 B;  1BS3 A;  1SQV H;  1Y76 B;  1I94 B;  2A9H A;  4TWK A;  2EIM C;  3OGC C;  4P9P A;  2JGD B;  1VQ4 V;  4F4L A;  2K9P A;  4NKG B;  1FKA O;  2V4D A;  4QIW F;  4UCT A;  4W4K A;  3C90 A;  3C3T A;  3BAA A;  2QWO B;  3JAR B;  2BCC H;  3A0H Z;  3W7X A;  3K08 A;  1HNW O;  2EZP A;  3ABM C;  4CH6 A;  2AGA A;  1ZSP A;  2R72 A;  2B1I A;  3OMN B;  4ZOL A;  1SQQ H;  2NN4 A;  4TQF A;  3CRQ A;  5HFL A;  1FXK A;  5LHI A;  4BW9 A;  1S77 D;  2G38 A;  2QWR B;  2QR4 A;  5K1X A;  1G4Y B;  3K9A A;  4HNA A;  3D8C A;  3CP1 A;  3LDC A;  4X20 A;  4UFZ A;  1KQS U;  1VF5 B;  1E1R G;  3APO A;  2LW7 A;  4RO2 A;  1YIJ V;  3OMA B;  3E2E A;  1W0K G;  1YDX A;  3RW0 A;  1G1X B;  1K5S A;  2UXX A;  3M7M X;  4WFB V;  2QKC A;  2QWP B;  3OR7 C;  4EFE A;  2GBO A;  3H1K H;  1M1K W;  2AW9 A;  5IYC O;  4JPR A;  5C8Y A;  5B1O A;  5LOV A;  1MG1 A;  1K8A W;  4PA7 A;  2IU3 A;  3K5L A;  2JS5 A;  4UUJ C;  1NR1 A;  4NTW A;  1PNM A;  4NTY A;  5CB4 B;  2JS3 A;  3ZRW A;  4A5U B;  3FB7 C;  3AG4 B;  3E83 A;  5BMV B;  1M90 W;  3TJT A;  3EXA A;  3JD3 A;  4FM2 A;  3EVK A;  4YXW G;  3ML0 A;  1FFX B;  3JAM N;  3QNE A;  1GN6 A;  2QWQ B;  4GLX A;  2LP7 A;  2D3O W;  2ILM A;  4P9O A;  4Z1V A;  1PV0 A;  5J9P C;  4GZR B;  1S5H C;  2A7W A;  2N05 A;  3BAB A;  3A0B Z;  3OUF A;  3ABT A;  2RCV A;  3THO A;  3CCS V;  3UO3 A;  2KG7 B;  3LSU A;  3CWB H;  5L3F A;  1IX9 A;  3ABU A;  2XT9 A;  1UFI A;  4PV1 B;  1F4N A;  1TUE B;  2QM4 A;  3WFV A;  1H38 A;  2H8P C;  2HKO A;  1Q5O A;  3K06 A;  4X65 O;  4DYL A;  1H2G A;  3ABM B;  5A2Q N;  2CK3 G;  3KG2 A;  4WBN B;  2Q5Z A;  1MA1 A;  4LBE C;  2JK5 C;  5DN6 G;  5EZY B;  4B3M B;  1K92 A;  2IH1 C;  3JAK A;  4FM1 A;  2FTK A;  3IC7 A;  3APQ A;  4DV3 O;  4TSF G;  4B3R O;  1IBL B;  2YXL A;  3GVM A;  1N36 O;  4IYH A;  1NU1 H;  2UUC O;  2DQ0 A;  1R3I C;  3E89 A;  3HB3 B;  3WU2 Z;  3JAT A;  4UB8 Z;  3DXR A;  2BTQ B;  1UJW B;  4DR1 O;  5AG2 A;  3K3W A;  1R6K A;  4DV1 B;  1B3Q A;  2YDE A;  3IFX A;  4JYY A;  1YF2 A;  5KX5 A;  1GAX A;  1H2K A;  4UB6 Z;  1CP9 A;  3VBB A;  1NVP D;  1Y6X A;  4R50 A;  4NXN O;  1VQO V;  1RSO B;  2XOK G;  5IYD O;  3BEH A;  3RFR A;  1K3E A;  4X66 B;  1NTK H;  4Z1M G;  2VRZ A;  3SR2 C;  4LNU B;  3OTO B;  1SKV A;  4DR5 O;  2ZR2 A;  5LA6 B;  2CDY A;  2B1G A;  4J9Z B;  3E8G A;  1AIL A;  2WLI B;  3UO2 A;  2F93 B;  3JAS B;  5CMU A;  1AI5 A;  2NR5 A;  4PDL A;  1H2L A;  5FNV A;  2LW1 A;  5B1A C;  4LF5 O;  4LR3 A;  1RSO A;  2F23 A;  1XEQ A;  1IDS A;  5JVD A;  1EZJ A;  3OGI B;  3QVN A;  4YHH O;  4DV7 O;  1OCC C;  1N34 O;  2XUM A;  2XHB A;  1BGY H;  3CJH B;  3CMA V;  1WJZ A;  2Q67 A;  2YID A;  5LBQ A;  2YSU B;  1W0J G;  4J80 A;  1COW G;  1XRE A;  4DUZ O;  3JAL B;  3QO8 A;  2P4V A;  1RPO A;  2RNB A;  3K79 A;  5H9C A;  5KMG A;  3K5M A;  1XNR O;  2A06 H;  1WA8 B;  3FB8 C;  1CEZ A;  2RQ6 A;  4EFB A;  5B1B B;  5TIS Z;  4UVA A;  2LJ2 A;  3OEE G;  3KCY A;  4JAS A;  1W2B U;  2FB5 A;  3L71 H;  5KA5 A;  2QSA A;  4TQD A;  4DV3 B;  4IYI A;  3TXQ A;  4GX2 A;  3T4Z A;  2EIN B;  2OCH A;  4FFB B;  4EEQ A;  4X88 A;  4DK0 A;  1SS3 A;  4PHZ A;  2ZIO A;  4O4L B;  4KP4 A;  2H94 A;  4U3J A;  1I5X A;  2C2A A;  1SQP H;  1YZB A;  2PYJ A;  4DR5 B;  5KHG A;  3X2Q C;  4ZI7 A;  1DK1 A;  3GB7 C;  2HG5 C;  2CTR A;  4K8X A;  2P4K A;  2Y4U A;  1XMQ O;  2EJ7 A;  2QKA A;  4FJC C;  4FLX A;  4K8Z A;  4DR4 B;  3G4S V;  3ETQ A;  5HFM A;  5FL7 G;  5CA1 B;  1ZX3 A;  1JCH A;  4JI1 B;  5L3B A;  3CE2 A;  3CCU V;  3HKB B;  1K97 A;  1D5A A;  2X6C A;  4ZOL B;  1SRY A;  3E35 A;  1G8M A;  3DC5 A;  5EC2 C;  2IJH A;  4JI8 B;  4WFG A;  2N04 A;  1GN4 A;  1I7F A;  3HKC B;  4X1K B;  3K5N A;  5KHI A;  4G2K A;  2ZR3 A;  1ENV A;  2UXB O;  5GON B;  2V7Q G;  3JSN A;  5FLX N;  4JI0 B;  1IBL O;  5H6R A;  4FZ0 A;  1R73 A;  3L75 H;  5C8Y B;  1M56 B;  3CC2 V;  4MTF A;  2WPD G;  4DW0 A;  1PPJ H;  4P2Z A;  1PM9 A;  2W0F C;  4LWS A;  2CTP A;  3SYC A;  4LH6 A;  5IE9 A;  1V9P A;  1Y74 B;  3K5O A;  1Y76 A;  2BSK B;  1WAZ A;  1QCE A;  3ZCC A;  2PZS A;  4JYA O;  3HKE B;  3AK2 A;  2VQF O;  3AG4 C;  4B3S B;  4LFB B;  1OZ0 A;  4ICG A;  1XMO B;  2M7W A;  4DV4 O;  5LYJ B;  3DSQ A;  3T1Y B;  4O4I A;  5LYJ A;  4PEL A;  2BOC C;  3LNN A;  3CCQ V;  1WP8 A;  2ZE5 A;  2VS0 A;  4LWS B;  3VOU A;  1NTZ H;  4YJ3 B;  4PD4 F;  4UCO A;  2BSK A;  5ITZ B;  3OTO O;  5K1P A;  5GON A;  3ABL B;  5B1B C;  1NQT A;  5IWA B;  4X66 O;  4GX1 A;  4X1K A;  1BHA A;  5B3S C;  5KAI Z;  2LFR A;  3RVZ A;  5L3G A;  3L74 H;  1OCR B;  1XIL A;  1XMQ B;  3E8F A;  1SA0 A;  3TGU H;  1AB3 A;  3D3Q A;  3HKC A;  3F7Y C;  1YJN V;  1YIT V;  2P06 A;  3ZBH A;  1AI7 A;  4BW5 A;  1BZK A;  3UKM A;  4MS2 A;  1OCO C;  4KHP B;  1E79 G;  3UCS C;  1GK9 A;  2P6J A;  4JI6 O;  1M5I A;  1K33 A;  1RFY A;  2UXD O;  5KA6 A;  1FPO A;  4IIJ B;  1AP5 A;  3P30 A;  4MT8 A;  4O4L A;  4X8A A;  2UUA O;  5KHJ A;  2DW4 A;  2DJV A;  1M56 C;  4FFB A;  2Z0A A;  4GUN A;  3WG7 C;  4CZZ A;  1F23 A;  3RYI B;  1S72 V;  1EM1 A;  3LNM B;  2BTO A;  2OCC B;  2W0X A;  5IJ0 A;  2CGN A;  1VF6 C;  3OT7 A;  4YY3 B;  2ZNI A;  3NR7 A;  5J2T B;  4J9Y B;  2IBZ H;  1WA8 A;  1R1B A;  5KMG B;  4JV5 B;  4DV0 O;  1N4C A;  4Q6G A;  3OW2 U;  3RGB A;  1Z5V A;  3ZHR A;  3JAL A;  5EC1 C;  4K3A A;  4ABM A;  3G6B A;  1ZL8 A;  2VWJ A;  4QNH B;  1M9N A;  2YUA A;  2BOB C;  1QHT A;  3E22 A;  1WN7 A;  4LCU C;  3JCZ A;  3ZN1 A;  5JVD B;  4ZIB A;  2EX3 A;  3LUT B;  3CYO A;  2EIN C;  1LUW A;  4UCS A;  3E8H A;  1FAF A;  4DR4 O;  1VF6 A;  1QVG U;  4D7T A;  1SF9 A;  2FKX A;  1KBH A;  5CBH A;  2ADP A;  4P30 A;  2XAH A;  1BCC H;  5LA6 A;  3T1H O;  1NTM H;  4JI8 O;  3BY6 A;  3BHP A;  3I5D A;  1WPB A;  3JAS A;  2OT5 A;  1LNQ A;  3EFF K;  1URF A;  3OM3 B;  2WLI A;  4LF4 B;  2CE4 A;  3E86 A;  4DV0 B;  3LSQ A;  4UCR A;  4O4H A;  1VMG A;  4BIZ A;  3JD0 A;  4UCV A;  4FMT A;  2WAM A;  2WLL B;  1BQZ A;  3DC6 A;  2IH3 C;  1A32 A;  3OAA G;  4UV8 A;  2BTQ A;  4LF6 O;  2Z3Y A;  4CH5 A;  3JAT B;  3WG7 B;  1IBM O;  5KX5 B;  4FLV A;  3I56 V;  1FXV A;  2OWO A;  4MVU A;  1IZ3 A;  1R3J C;  3IAY A;  3DXR B;  4UXN A;  4RQE A;  1XHZ A;  2UU9 B;  5EZY A;  3STZ C;  2PYL A;  1F51 A;  3K04 A;  2UXD B;  1BHB A;  4JI0 O;  3CCE V;  4F6R B;  3JAK B;  3RYH A;  3WB2 A;  3I55 V;  4JI4 B;  5L3C A;  1BE3 H;  4E2L A;  5IJ0 B;  3L73 H;  4LF8 O;  1OCR C;  1M57 B;  3RYI A;  2OTJ V;  4J7J A;  1NZ6 A;  4HBN A;  4G27 B;  2CTQ A;  2UUB B;  5D5Q A;  4ZHQ A;  2ZCE A;  3BA8 A;  3GWO A;  2P5O A;  1Q6U A;  2IW5 A;  3K9S A;  3N27 A;  3M99 B;  1N32 O;  4J10 A;  5KLV H;  4JTD B;  2XND G;  1N0N A;  2UUA B;  3ZRW B;  1NH2 D;  1FFX A;  1B06 A;  5CA3 A;  5IJ9 A;  1HR0 B;  2NLJ C;  3LDE A;  3AK1 A;  4JI2 O;  5BMV A;  2W6I G;  5KUK A;  2X6A A;  2CH7 B;  2Q7E A;  2HJD A;  4BR6 A;  5C93 A;  1BL8 A;  5CN0 A;  4CBC A;  3M8A A;  2ZKO A;  4I50 A;  2WLM A;  4H44 B;  4MTG A;  3CCV V;  4J11 A;  4YJ3 A;  2PTM A;  2GHY A;  4TUY A;  1IXM A;  3FD9 A;  1IBM B;  4L8J A;  3OFN G;  2Q0A A;  4LC1 A;  2HVJ C;  1BQ0 A;  2YIB A;  1OV9 A;  4DK1 A;  3K0D A;  4X62 O;  4IIJ A;  2EIK C;  4JF3 A;  4O4I B;  4ASU G;  1QLE C;  2DYS C;  4DXW A;  3JSL A;  1QNM A;  1TVK A;  2O57 A;  4MSW C;  2ETN A;  3O9O A;  3AG1 C;  5LP6 C;  4EB6 A;  1KKC A;  2DYR B;  2JJ2 G;  1L8D A;  4IGG A;  5EIB C;  3CRM A;  4HZ3 A;  1SA0 B;  3CX5 F;  3RYF B;  4GCZ A;  3K57 A;  2GUZ B;  1AR4 A;  4CH4 A;  4DUY B;  3KCX A;  3MHS C;  1WB7 A;  2R70 A;  1I0H A;  1R3L C;  2QJ1 A;  3JAR A;  1M93 A;  2LO1 A;  3RYF A;  1S5J A;  1BMF G;  1NH2 B;  1SES A;  3B2E E;  3FYE B;  4AI8 A;  4EB6 B;  2ADQ B;  3ZHU A;  5JCO A;  2YI8 A;  3HKB A;  4C7U A;  2PI5 A;  4LF9 O;  2LQT A;  2E74 B;  4E4E A;  1QVF U;  1FD9 A;  4RQF A;  1TVK B;  1DTO A;  2YIA A;  2YIC A;  3ASO C;  1I08 A;  1Q43 A;  2JGU A;  4TOI A;  3N2K B;  1GM9 A;  1NBM G;  2F66 C;  5B3S B;  4HAM A;  4DV4 B;  1KP2 A;  4LFC B;  1Y74 A;  1Q7Y W;  1PD3 A;  4QPJ A;  3QF7 A;  2FML A;  3Q4H B;  1JVM A;  1TAE A;  5LMU O;  2YI9 A;  4BIO A;  4FLW A;  2WA4 A;  2KSD A;  5JQG A;  1X4T A;  3PJS K;  1AP6 A;  1TUB B;  3KZI Z;  3ZRX A;  4DR2 O;  2PF4 E;  4NXM B;  3RVY A;  4MVS A;  4K35 A;  1ZWI C;  3QO5 A;  4LF9 B;  2WLH A;  5CA1 A;  4FIP C;  2QDO A;  1N0J A;  4JYB A;  1ZLZ A;  4I55 B;  4UV9 A;  4X1Y A;  1S3J A;  4JYA B;  2MK3 A;  2A79 B;  2IJJ A;  4JI1 O;  1SET A;  4Q20 A;  2HFE C;  5EBL C;  5F2V O;  2DE0 X;  1Q6H A;  3FB6 C;  4ZKI A;  5LP6 B;  3ABK B;  5L3D A;  1ORQ C;  5IYZ B;  4NR1 A;  4FPP A;  2ZDI A;  1XHX A;  4JI6 B;  4YJ2 B;  2UXN A;  2ITC C;  2QEX V;  3KKY A;  4DO2 A;  1BT8 A;  4UVB A;  4DR6 B;  5BY1 A;  1PNL A;  4DUY O;  3FB5 C;  1Q81 W;  2VQE B;  2EIJ B;  4TV8 A;  3JAW B;  1KB9 F;  2DWE C;  3B8N A;  3VQX A;  1XBL A;  1AJP A;  1D2D A;  1O9G A;  4F6R A;  2HVK C;  5EIB D;  1AR1 B;  2E3C A;  5J2U A;  1NT2 B;  1AR5 A;  3OMI B;  1KYO F;  3SPI A;  1P84 F;  4DR2 B;  1GRJ A;  4OGQ B;  4MVR A;  5FPR A;  2EJR A;  3PN1 A;  3E8B A;  3FKS G;  4QE7 A;  2IM9 A;  4YY3 O;  5LHG A;  2WLJ A;  1L1F A;  1V55 C;  2R9A A;  2F4V B;  3CRR A;  3D36 C;  1F4M A;  2R9R B;  3O65 A;  3ZHV A;  4N23 A;  2CAZ C;  1KC8 W;  4FM0 A;  2AHZ A;  2JRI A;  1JA8 A;  4WFE A;  2DMX A;  1WP7 A;  2DOS A;  1YSC A;  4I0X B;  3CJH A;  1ZUQ A;  1M57 C;  2WLN A;  4LF7 B;  3VQW A;  5BZB A;  5H2F Z;  2X0L A;  4H13 B;  3JD4 A;  2JDI G;  1R6N A;  3CME V;  2P90 A;  3EHB B;  1VQN V;  2JEU A;  2E76 B;  3ZMU A;  5IDJ A;  2Z5U A;  4WBN A;  4Z2W A;  3ZJZ A;  5FPO A;  4MTX A;  3ZX6 A;  3JYC A;  1SZX A;  4LFC O;  1P49 A;  2Q7G A;  3JCU Z;  1XL6 A;  2ZDI C;  4WF9 V;  2HEP A;  2LFS A;  1V54 B;  1VQL V;  1FS0 G;  3SDL A;  4JAU A;  2QA4 V;  3TK1 A;  4B3S O;  1K4D C;  2HHH B;  2RN9 A;  2PI4 A;  4O4J A;  1F7Y A;  3G6E V;  4N21 A;  4LP8 A;  3OE7 G;  3RYC A;  4X1I B;  3K58 A;  3BFR A;  2KB1 A;  4GKK B;  1N34 B;  2Y0P A;  2ZIM A;  3DTU B;  1YJW V;  4J42 A;  4OXS A;  5B1A B;  2DYR C;  1JPX A;  4F6E A;  3CSX A;  5E1A C;  1N8R W;  2JIZ G;  1JFF A;  4U7N A;  4AQY O;  4I9Q A;  2RDC A;  4LF7 O;  3A8T A;  5JJJ B;  4H0L B;  1WNS A;  1GN2 A;  3H01 A;  3H1H H;  3ZMS A;  3IJ4 A;  4B3T O;  2Q73 A;  2YXH A;  1Q6I A;  4PJ0 Z;  4AIL C;  2OYQ A;  3ZED A;  5LMU B;  4BWA A;  4MVQ A;  3C3S A;  3S3X A;  5GTI Z;  3CC4 V;  4DR6 O;  1KP3 A;  2QKS A;  4I7Z B;  4B3M O;  4LFA B;  3J81 N;  4JV5 O;  3BVO A;  4LH7 A;  2EIL C;  2UUB O;  1TA8 A;  4PA4 A;  5H5N A;  4CC5 A;  4PI2 A;  1QQC A;  4MW3 A;  3AG2 B;  5CA0 B;  2KG7 A;  2NNU A;  4OX9 O;  2LGQ A;  4NVP A;  2ARH A;  4YHH B;  3ZHS A;  4DV7 B;  1HW7 A;  1Q90 D;  4CS2 A;  2V1D A;  5BR8 B;  3CPW U;  1N36 B;  2UUC B;  3CXH F;  1ARO P;  1DLB A;  2M6Y A;  1IUR A;  5H6Q A;  5DM6 V;  4DW1 A;  3ICX A;  1FXK B;  2VWK A;  3SPG A;  2IJK A;  3FX7 A;  2AHY A;  1QR8 A;  2A0L A;  1AJN A;  1Y4M A;  4J7Z A;  1NR7 A;  3MD0 A;  3BA9 A;  3MDS A;  1Q3E A;  3CB2 A;  4CS3 A;  3MAQ A;  3D3I A;  3TET A;  3IC9 A;  3TXS A;  2VQE O;  1R3K C;  1XQ8 A;  3AK3 A;  2HHH O;  3ZRS A;  4JI5 B;  4K0K B;  2YC0 A;  2E5L B;  2F1M A;  4I50 B;  1MSW D;  2UXC B;  2GV9 A;  2P67 A;  3T1C A;  1VP7 A;  4LF8 B;  1YCI A;  3WB1 A;  1HNW B;  5KAF Z;  2JGD A;  2PUS A;  3CXC U;  3SYQ A;  3CHX A;  2YS8 A;  4JAA A;  1TGO A;  4KFM A;  2H3O A;  4KUM A;  4LF6 B;  2ZQM A;  5LGU A;  2BE3 A;  3STL C;  1YTF D;  5JJE B;  3TCU A;  3FAV B;  3LSS A;  1XUQ A;  1IVS A;  4HNA B;  1VQ8 V;  1YEW A;  2HJF C;  2Q4P A;  3B4S A;  2Y69 C;  1W59 A;  2Q69 A;  3BCC H;  1KD1 W;  1GM8 A;  3OD4 A;  4J41 A;  5CA0 A;  3ASO B;  2ODM A;  2XAS A;  4MVM A;  3H1J H;  1JMK C;  3J7A U;  1B04 A;  4JZ2 A;  3U0Z A;  1SQG A;  1P7B A;  2RJZ A;  2Y0I A;  2AZ2 A;  3NXS A;  1AI6 A;  4OX9 B;  2QGN A;  4DR3 O;  1KKD A;  5DEC A;  1KUQ A;  1UPG A;  1Z2G A;  4PA6 A;  2AZ0 A;  4DRX A;  3ZMT A;  3RYH B;  1K34 A;  4LF4 O;  1GN3 A;  2FYU H;  3HR0 A;  1HDJ A;  2XAG A;  1J5E B;  2YXY A;  2JEX A;  4LFA O;  2EZO A;  2OIE A;  5LHH A;  1XL4 A;  3ZHT A;  1VQ6 V;  1JFF B;  4BAY A;  4DV6 O;  3AG3 B;  4I0X A;  2VQF B;  2ZE8 A;  1I5Y A;  3HPL C;  4B3T B;  2EIM B;  4B7K A;  5JCO C;  3LDD A;  3SYA A;  2IJI A;  4ZI7 B;  1SER A;  3ZIA G;  1VIB A;  4DR7 O;  3SYO A;  2Q8V A;  2QM8 A;  1N33 O;  1JQ0 A;  4GX0 A;  4X1I A;  3RYC B;  1LR1 A;  4U3J B;  4H33 A;  1J95 A;  4L87 A;  3B40 A;  5JH7 B;  2EBO A;  3AG1 B;  4NTX A;  3N2G A;  3OEH G;  5B5E Z;  3ZMV A;  4IHJ B;  4MW8 A;  2WLL A;  4EKW A;  4JI3 O;  2F95 B;  3FFQ A;  2AXT Z;  2D2C B;  1NS1 A;  2F43 G;  2OTL V;  3UT5 B;  3QTC A;  3JAW A;  3SPH A;  1WLE A;  1XDC A;  2E5L O;  4WFA V;  4XDL A;  4XDJ A;  4MVZ A;  1X59 A;  5IYZ A;  4J7K A;  4DV6 B;  1KEC A;  4DV2 O;  1L0N H;  2YEV A;  1Y67 A;  2KKW A;  3VQV A;  3X2Q B;  3R65 A;  4PA9 A;  1HNX O;  5EYP B;  3H9V A;  4D6T H;  5LGT A;  3G80 A;  4AQY B;  3K0G A;  4YIP A;  1P4R A;  1YI2 V;  1SQF A;  2Q9L A;  5FNV B;  4GT1 A;  2CTW A;  2IU0 A;  3F5W C;  3SJQ C;  1AI4 A;  3UM7 A;  3CCR V;  1FJG O;  2UXC O;  1OCO B;  1RM1 C;  2PGG A;  3ZN0 A;  3UT5 A;  4I5S A;  2QE7 G;  2GTA A;  1QR9 A;  4U7O A;  3B09 A;  5KHK A;  2Y4T A;  4LNU A;  2A3Q A;  4O2B A;  5LXT B;  1SQX H;  2Q7H A;  3ZRV A;  2Q68 A;  5EBM C;  3P3N A;  4I9W A;  4TV8 B;  4I4T A;  3CEI A;  1VAR A;  2WSS G;  2JJ1 G;  2RMK B;  5JH7 A;  4FK5 C;  3T2M A;  5LMN B;  2ITD C;  4YJ2 A;  4OPH A;  4W4L A;  3G67 A;  1NI8 A;  4IHJ A;  3SJA C;  1EN5 A;  3N2G B;  3RWR D;  4JTA B;  1XNQ O;  1M4U A;  1J5E O;  5IT9 N;  3K03 A;  1D5N A;  1MAB G;  1ZTE A;  2XAQ A;  4RUE A;  1SQB H;  4OPA A;  4I55 A;  3BPZ A;  3QO7 A;  2ZE6 A;  2P22 C;  1YHQ V;  4DR3 B;  5IY5 C;  2OIG A;  1OJH A;  4JI7 O;  2K1E A;  1GH6 A;  4WFH A;  4JAV A;  1I94 O;  1OCZ C;  4B3R B;  2R9I A;  4AHC A;  4QJF B;  1NJI W;  4KL1 A;  5L3E A;  4NXN B;  2X6B A;  1CXZ B;  1H8H G;  1Q86 W;  4ZBM A;  4PDV A;  4LF5 B;  1HNZ B;  1H2M A;  1G6U A;  3ZS8 C;  2CUG A;  1Q82 W;  4WCE V;  4DR1 B;  2QTO A;  5ITZ A;  2W6J G;  3HKD B;  3T1Y O;  5EBW C;  1PP9 H;  3RT3 C;  2ZT9 B;  1AVM A;  2EIK B;  2ZD9 A;  4XDK A;  1XNQ B;  3K59 A;  4MTO A;  3AG3 C;  2Y48 A;  4X62 B;  2MW2 B;  1VEW A;  3ZHQ A;  2QWN B;  1AJQ A;  5LMN O;  1YJ9 V;  5JJN B;  1GTO A;  1XNR B;  1T5E A;  4DR7 B;  1QLN A;  1GO3 F;  1N33 B;  3A2F A;  5E79 Z;  1HWY A;  1NKD A;  1MMM A;  4DV1 O;  5IYB O;  4DUZ B;  4D7S A;  5B1N A;  1YVW A;  3CC7 V;  1IBK O;  3VQY A;  3T1H B;  5CBF A;  3GWK C;  3L72 H;  2ATK C;  3WB0 A;  4JZG A;  4JI4 O;  4FLY A;  1L0L H;  3ETD A;  1RP3 B;  1R6T A;  3SPJ A;  1GM7 A;  1K5Q A;  1FJG B;  4PA3 A;  1VQ9 V;  2JVD A;  2P7T C;  3H1L H;  1US6 A;  1ZAU A;  1VQK V;  5B66 Z;  2CH7 A;  1JJO A;  1H2S B;  2GUZ A;  4FLT A;  4B7E A;  1IXB A;  1EN6 A;  2GDS A;  3L70 H;  2GTS A;  5IJ9 B;  4QGP A;  1P7G A;  2OCC C;  4RUF A;  1OCZ B;  3T4D A;  2ZIN A;  1MSD A;  3S3W A;  1OCC B;  1H8E G;  3B77 A;  3G71 V;  3CCJ V;  1PNK A;  5JWP A;  1MNG A;  1FXH A;  1H2N A;  1VQ5 V;  1EZV H;  3W7W A;  3H1I H;  3CCL V;  4BIU A;  4RWU A;  4PDR A;  4ZHQ B;  1JX9 A;  1K4C C;  4GX5 A;  3ZMZ A;  2HLD G;  4WFF A;  2UXB B;  4TUY B;  2KQX A;  4GKJ O;  1S5L Z;  2WWW A;  3IGA C;  5LL6 Y;  2WLK A;  1JOY A;  4X64 O;  4JI7 B;  2ZXW C;  3F7V C;  4YIO A;  1JR9 A;  3JD2 A;  1HR0 O;  3SGI A;  1EN4 A;  1S0V A;  2B9Z A;  4UVC A;  1PL4 A;  5GW7 A;  4JI5 O;  4K0K O;  5KUM A;  4PDM A;  2N74 A;  1K73 W;  1WB8 A;  1MOF A;  4GKK O;  4O2A A;  1N32 B;  4R8C A;  1QLE B;  2DYS B;  2DN9 A;  3L9D A;  2L35 A;  1MZF A;  2E75 B;  3AG2 C;  2EUL A;  2QM7 A;  4FVM A;  1Z5W A;  4R6Z A;  3RN4 A;  4MVO A;  4B08 A;  1GMG A;  2Q6A A;  3HKD A;  4X89 A;  4O4H B;  3RBZ A;  1K7D A;  2L6L A;  4O4J B;  4R7C A; 
#chains in the Genus database with same CATH homology
 1BZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...