3CCVV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccvV00
1M90W 1VQ4V 1VQ6V 3I56V 3I55V 1VQ5V 1KD1W 1YHQV 3CC2V 3G71V 1QVGU 1YJWV 1NJIW 1R73A 1YIJV 1JJ2U 1QVFU 2D3OW 4WFBV 4WFAV 3CCUV 3CCVV 3CC7V 1VQ7V 1VQLV 1VQMV 1Q7YW 1N8RW 1VQ9V 1Q82W 3CD6V 5DM6V 1VQKV 1VQNV 3CCSV 4WF9V 3CMAV 1M1KW 3CCEV 1KQSU 3G6EV 1K8AW 3OW2U 3CC4V 3CCQV 2QA4V 3CCJV 4WCEV 1YJNV 1VQPV 1Q86W 1K73W 3CPWU 2OTJV 1K9MW 1KC8W 3CCMV 1W2BU 3G4SV 1S72V 3CCLV 3CMEV 1VQ8V 1YITV 3CXCU 1YJ9V 1VQOV 2OTLV 3CCRV 1YI2V 1Q81W 2QEXV
chains in the Genus database with same CATH superfamily
4X1YB 2WSSG 2MW2B 2XAGA 3AG4B 2P22C 4ZKIA 1HNZO 2E3CA 1G8MA 5K1XA 3B8NA 1WA8A 4BW5A 3PN1A 4J42A 2WLHA 3CRAA 4MVUA 2QKSA 1IX9A 1WB8A 4DR1B 1UPGA 5IWAO 3ETEA 1K92A 2ARHA 3LSSA 4GKJB 3CRQA 4LR3A 1LUWA 4B7EA 5B1AB 3KG2A 4J7KA 3G80A 4F6RB 2BOBC 4TWKA 5BZBA 1PV0A 3D3QA 3DC5A 4JZGA 3RVZA 2HKOA 2Y69C 1E1RG 2Q0OC 1YITV 2R70A 4X20B 1RM1C 1YJ9V 1N33O 1ZUQA 5L3DA 4TQFA 1DF5A 1W2BU 3FAVB 3QG5A 1WAZA 4TV8B 4YY3O 4DV3B 1KUQA 2A3QA 5EC1C 1SQGA 2WLMA 1FXKB 2P4VA 1MABG 2EIKB 3ZMZA 4LH7A 1M9NA 2LJ2A 5H6QA 4FIPC 3BA8A 3T1YO 1NVPB 4Z2WA 3SDLA 4JYAB 1M1KW 4DR7B 2EILB 1R3IC 3ZMVA 4FLWA 2UUCB 4BIOA 3ZRWA 2PF4E 2ITCC 1VQ8V 1GMGA 2YEVB 1QU7A 5EYPA 1JR9A 4PI0A 3RYFA 4LFAB 2XNDG 2JK5C 4DR3O 1VQ9V 2YUAA 2CTRA 1XQ8A 2K1EA 1H8EG 3T4DA 2WPDG 4JI5B 4LWSB 2QKAA 4OX9B 1MMMA 1XMQB 1OV9A 3IC9A 3HKCB 4UB6Z 1L0NH 4YHHO 1NJIW 3CJHB 3CYOA 3TETA 4MT8A 5C8YA 3UO2A 2P4KA 3C3SA 1KB9F 1BSMA 4KL1A 3E8GA 3E83A 1HNWB 4ZOLB 2BSKA 2GUZB 1H2SB 3ZBHA 1I0HA 4MW8A 1BCCH 1XHXA 4GUNA 1IVSA 2XASA 3L70H 3CSXA 2KG7B 2JGDA 3Q4HA 4JYCA 2W0FC 3OTOB 2EBOA 2KQXA 4ZHQB 2L6LA 1S77D 2AHZA 4O4IA 1Z5WA 5J2TA 2AW9A 3OUSA 1R3LC 3E22B 1VP7A 4JI4O 5LHIA 4JI3B 5A2QN 4Q6GA 1ZSPA 3T1HO 2HJDA 4G27B 3K9AA 2PI4A 4KUMA 2EZOA 1R73A 4B3SB 3PJSK 3ABMC 2CGNA 4J9YB 2QA4V 4IIJB 1K9MW 1FXVA 1P7GA 2M7WA 1QLNA 3HKDB 3OEHG 1DK1A 4I4TB 1D5NA 3E35A 4JYYA 3BABA 1D2DA 1FJGB 4TQDA 1M57C 4DRXA 1NBMG 2PGGA 4JGSA 1V55B 5FL7G 4WFAV 3JALA 2HR3A 3D3IA 5EC2C 3LUTB 4F4LA 4B3MB 4LNUA 2IBZH 4BR6A 4FLXA 3KKYA 2D2CB 4DR1O 1EN4A 1US6A 1BMFG 1XNQO 1AI5A 4GCZA 3T1CA 1ZWIC 1XREA 2QTSA 3I56V 2Y4TA 1E1QG 4DR6O 4JV5B 2XT9A 3LDEA 4YJ2A 4LF8B 1YCIA 5KUMA 1SZXA 3BAAA 5B3SB 1KKCA 4TUYB 4ZIBA 3ZRXA 3ABUA 3OE7G 2N05A 2ZM6B 4OGQB 3TXSA 3JAMN 1QBZA 4DV3O 3ZHTA 1VIBA 4DV6B 4LF9B 4UCUA 5LOVA 2QM4A 1XMOB 4LF4B 1XNRB 2WLLA 4DR5B 4MTOA 1XHZA 3W7TA 2ITDC 3SJBC 5J2UA 1FPOA 5LMNO 2L35A 3X2QC 1VQPV 1TUBA 4UVCA 4X1IA 3CMEV 2QTOA 4DV1B 1AI7A 1RSOA 4JI1B 2ZIOA 3G67A 4UVBA 4K8ZA 1QHTA 3ASOB 3F5WC 4Z1VA 1K5QA 5CN0A 3ZRSA 4D7TA 5B5EZ 2FL4A 1VQLV 1AP6A 2UUCO 3AG2B 1M4UA 3SPJA 1YJNV 5LP6C 1WA8B 2ADPA 3CCLV 4O4LB 4DUZB 1YI2V 2YXLA 2W6IG 1OHHG 1N32B 1BS3A 2AHYA 4O2AB 3ZCCA 1M56B 1JFFB 3L75H 4MSWC 1BGYH 1R6KA 1EFRG 3IGAC 2ILMA 4PHZA 4DV4B 4O4HA 3RYHB 2QDOA 2VQEB 2HEPA 2EX3A 2NN4A 4CBCA 4OX9O 2Q7HA 1MG1A 4WFGA 3SJCC 4I0XB 2QWRB 4B3RB 4LF6B 2RCVA 1HNXO 1Y66A 1DGSA 5TISZ 1Y6XA 1P84F 3E89A 4PI2A 5JJEB 3AK2A 4H37A 4LFCB 2MK3A 4PA4A 4UB8Z 1NQTA 4JAAA 4PA7A 3H9VA 5EBLC 2WAMA 1HNWO 2DW4A 2Z5UA 4X65O 2UXDO 1AI6A 1IXMA 4G28B 3FYEB 1PL0A 3RYIA 4F6EA 5IWAB 3E8FA 1J95A 2CTPA 1YZBA 5LA6B 1KBHA 1Y4MA 1YTFB 2IU3A 1EZVH 1Y76A 2BOCC 4JI3O 3OMAB 1FAFA 2JDIG 3G6BA 3ZRWB 5FLXN 1SZTA 3UCSC 5BY1A 2GSMB 3U10A 1ZTEA 2EZPA 3K08A 3RYFB 2PY5A 4K35A 5LL6Y 1NR7A 3L9DA 3A0RA 1QR9A 3OM3B 3K57A 5IT9N 3ZMTA 2ZD9A 4CS2A 2E5LO 4MTGA 4EB6B 5EZYA 5KHHA 4JI7O 2IW5A 3ETGA 3T1YB 5IE9A 4UVAA 1H2KA 3BVOA 1QNMA 1Y67A 5C8YB 1KP2A 2W6JG 3ETDA 3AG1B 2IH1C 4IHJA 4LF8O 4J11A 2LO1A 4KFMA 4O2BA 3JYCA 3ZMUA 3J7AU 3RT3C 5DM6V 3EFFK 3N2KA 1JPXA 1VF6A 3O9OA 2JGDB 3HPLC 2LFSA 3BA9A 3FYIB 2HVJC 1XEQA 5J2TB 1N36O 4JAUA 4LF9O 4K8XA 1XDCA 3UT5B 4J80A 3L73H 5DEDA 5K1PA 2Q69A 1XNRO 3CRRA 1KD1W 2F23A 1KMIZ 2A9HA 3HKEA 4YHHB 1EN6A 1KP3A 4DV1O 4MVZA 4CC5A 5KUKA 2PTMA 5CB4A 1WPBA 1K7DA 1Q8IA 2EIMC 1Q6HA 4OPAA 4WBNB 1TVKA 2GTAA 2LW1A 3RYCA 3FX7A 2HFEC 5FNVA 4OXSA 1JOYA 1THZA 3HKBA 3SPCA 1G4YB 2EIJC 4PD4F 4DRXB 2CGOA 4NVPA 3ETQA 2BTQA 1AJNA 1W59A 2A7WA 1B3QA 3EVKA 3JALB 3TGUH 2UUAO 4HNAB 1A32A 2F66C 3OUFA 4NYKA 2ZE7A 2OTLV 2DE0X 2DMXA 3K06A 1YXBA 4DV4O 3RWRD 2VQEO 3N27A 5JWPA 3ZMSA 3T1HB 4IT5A 3QO5A 4XBFA 1N0NA 3MDSA 1Z2GA 1BZKA 1OCOC 4PV1B 1VF7A 1MZFA 4C7UA 5LXTA 2YC0A 2YS8A 3RW0A 4RQFA 1MSWD 1ENVA 4LFCO 2DYSB 4D7SA 2ZNIA 5CBHA 1G1XB 2UU9O 4EEQA 5KMGA 3A8TA 3AG4C 3CS5A 3FKSG 4PJ0Z 1K3EA 2FYUH 1NTZH 3C90A 5J2UB 2YIBD 2OCCB 4X1KA 4N21A 3BFRA 4JI0O 1TUBB 3GWOA 4X1IB 5KHGA 3W7XA 1XNQB 1JCHA 3AK3A 1RSOB 5LP6A 1BQZA 2ZXWB 3WG7B 4NXNO 3BY6A 4CS3A 1AR1B 4DR6B 3RBZA 2OCHA 3K5LA 4R6ZA 5B1AC 4DR4O 4K3AA 3ZX6A 3OAAG 5IYBO 4I50B 3QF7A 5H6RA 3ZHQA 2GV9A 1SRYA 1S0VA 1UFIA 4AILC 3GVMA 2GTSA 1U96A 3THOA 2M6YA 3JAWA 1NT2B 2ZCEA 3CMAV 5CA0A 2XTAA 2LQTA 3CRCA 3K58A 1OCCB 5DECA 4O4HB 1H2LA 1FXKC 3JCUZ 5LMNB 1OCRB 3L72H 3SGIA 2EIKC 5JVDA 1J5EB 2PYJA 3EXAA 3AEIA 2F95B 1K4CC 3SPGA 4ABMA 2YI8A 4JI2O 3CRMA 1LR1A 2CH7A 2AZ2A 3CWBH 3A0BZ 2F1MA 1Q6IA 5B1BB 3OW2U 3CCQV 2ZQMA 1MOFA 2VQFO 2Q4PA 4N23A 1N34O 2JEXA 2YXYA 3JATB 1LNQA 4MVSA 3ABLC 3RVYA 3VQYA 3RFRA 2DYRB 4DR2B 3OMNB 1IZ3A 4FFBB 4MVRA 1Q3EA 4OPHA 2Q73A 3E8HA 4JZ2A 2RQ6A 5ITZA 1WP7A 4IL6Z 5LYJA 1SESA 3P3NA 1JVMA 1Q90D 2Q7GA 1QR8A 3ZIAG 1S5JA 4PA3A 1Y76B 2JJ1G 3M99B 4QJFB 2R9RB 1M93A 2V7QG 4GX2A 5FPRA 2ZR3A 4FLYA 4YIPA 2QWOB 3K5MA 1FFTB 1HNXB 1M5IA 2JS3A 3WU2Z 4UCRA 3TK1A 4FFKA 3K79A 1K33A 1ORQC 3C3TA 3JD0A 2Z3YA 4X65B 3AK1A 1FFXA 3TXQA 4NR1A 4WFEA 2UXDB 4JF3A 2XUMA 1ZX3A 4G2KA 5EZYB 2GHYA 4E2LA 1V9PA 3OGIB 3IFXA 5L3BA 1H38A 2DJVA 2PI5A 4FK5C 5KA5A 4TV9A 4UCVA 1NTKH 1P7BA 3H01A 3JD1A 3U11A 5E79Z 2V1DA 4FM1A 1YIJV 2DN9A 1NS1A 1K8AW 3A0HZ 3DC6A 4YJ3A 3IAYA 4DV7O 4KHPO 4LF5O 4I9WA 2IJIA 5CBGA 1IURA 3N2KB 5IJ0A 1AVMA 4QNHB 2ZT9B 3DTUB 4CZZA 1KYOF 4HBNA 3ABMB 2ATKC 1KKDA 1PD3A 2QWQB 4MW3A 2K9PA 3WFVA 3VQXA 4NKGB 2E5LB 4U3JA 1SQBH 2HJFC 2H3OA 1F4NA 4JI7B 3KCYA 5LMUO 4I55A 2Y0PA 4X64O 3ZRVA 1O9HA 3AG7A 5IYZA 2IJJA 1GK9A 1SQPH 2XOKG 1WN7A 3J81N 3ABTA 1TGOA 1R1BA 1AR5A 1YJWV 2UXCO 1VQ7V 3CD6V 1Y74B 2EINB 1ZL8B 3D8CA 3CCEV 4LP8A 5EIBD 4BWAA 3HKBB 3CCJV 1OZ0A 5KHIA 1Q86W 2ZKOA 3P30A 1RP3B 5IDJA 1QLEB 5JH7A 4LH6A 1N36B 1D5AA 5KX5B 1IBLO 1SQXH 4U7NA 3UO3A 4RAIA 5L3EA 3J80N 2B9ZA 1B04A 3BHPA 4MVQA 2V4DA 4I5SA 4P30A 3G6EV 4QE9A 5LHGA 5JQGA 1J5EO 4X1YA 1SETA 2CTQA 4AQYO 5L3FA 1OCZB 1X4TA 3D36C 4B3TO 3O65A 5JCOC 5IJ9A 4FLZA 4WFFA 5IY5C 1XI1A 3BRCA 4X89A 5GTHZ 3HB3B 2QR4A 1I7FA 4DW1A 3AG2C 1NR1A 4LF7B 2UUAB 2JGUA 2A06H 4DR2O 3JSNA 5H5NA 4X1KB 4FPPA 5H2FZ 2G38A 4MS2A 3K0DA 3ML0A 3QO7A 1R6NA 2Q9LA 3DXRA 3M8AA 5IYCO 1M56C 4X20A 5EK0A 4LC1A 3FAVA 4TV8A 4BAYA 2CAZC 2P6JA 2BCCH 3ASNC 3F7YC 4DV2O 2RDCA 4ZBMA 1VQ4V 1V54B 1ZAUA 1VQ5V 1FXKA 4CH5A 3L71H 4H0LB 1F4MA 4K0KO 2N04A 1WPXA 4KP4A 3BPZA 2E75B 2UU9B 2YSUB 4MTFA 2UUBO 5CA0B 1W0JG 3H1LH 1B6QA 1VMGA 2ZE5A 2HVKC 3OFNG 2YI9A 4JASA 5JVDB 3M7MX 4JI0B 1EBOA 2H94A 2DWDC 2CH7B 5GONA 4AHCA 4NXNB 2YEVA 4QGPA 1S72V 4DO2A 4DR4B 1VF5B 2OIGA 4NTYA 1GN4A 2IJHA 4LCUC 4WFBV 5EYPB 4U7OA 3LSQA 1PM9A 3SYAA 4X62O 3AG3C 2X7RB 2CUGA 4RUFA 3IJ4A 3P32A 3BCCH 3B8MA 3HKCA 4FMTA 4XDKA 4E4EA 4RQEA 2UXNA 1BL8A 3CJHA 2HLDG 3SPIA 3CC2V 3SYQA 4GYCB 1SERA 5CA1A 2JEUA 4R50A 4JI2B 4NTWA 3DSQA 3STZC 2B1IA 3R66A 4X9QA 4ZOLA 3E2EA 1GN3A 4PDLA 3S3WA 4EKWA 1AI4A 2KKWA 4RUEA 4P9PA 4GLXA 3B2EE 1FXHA 2CE4A 2VQFB 2F4VO 1N34B 2LFRA 5GTIZ 4UCSA 4HYOA 4JPRA 2BSKB 4ZHQA 4XDJA 1PP9H 2AZ0A 2LGWA 3OD4A 2VRZA 2QSAA 1O9GA 2PZSA 2WLIA 5IYDO 2X0LA 1SQFA 3Q4HB 1AB3A 3SYOA 2VS0A 4O4IB 3CCRV 2R9IA 2Y4UA 3JASA 1NI8A 1QCEA 1HWYA 3LSUA 4TV9B 4NB5A 1ROPA 1SQQH 1MZEA 2QWPB 1JJ2U 3LDDA 4DK0A 3ZHVA 3ZJZA 3HKDA 3ABKC 2Q0AA 2VWJA 3IC7A 3S3XA 4I7ZB 2BTOA 3BEHA 3ZHSA 5IJ0B 2NLJC 1TUEB 3UKMA 1MNGA 2ADQB 1AILA 1N8RW 2EIMB 4H13B 1N0JA 4TSFG 4PA6A 2LW7A 2X6CA 4LF7O 1Q43A 1CEZA 5A9GA 4LNUB 1H8HG 1NH2D 3MAQA 1DF4A 1Q81W 4I55B 2A79B 4TUYA 2FTKA 5IYZB 2C2AA 2Q68A 2RMKB 4ICGA 3SYCA 3FD9A 1SKVA 2Q8VA 4YJ2B 4J10A 2NNUA 1EN5A 1SC5B 2VWKA 4YIOA 1GM7A 5KHKA 4DV7B 4KHPB 4LF5B 1AJQA 3U0ZA 2GBOA 2RJZA 3JSLA 1WLEA 1ZLZA 4UUJC 3K59A 4PA9A 3NXSA 5LHHA 3K9SA 1GN2A 2DYSC 2OYQA 1OCOB 4DK1A 1NVPD 1KU9A 2EULA 2ZINA 4JTCB 3D36A 5LOVB 1KQSU 5JCOA 2WLLB 2PYLA 1H2GA 1FD9A 4MTXA 2XHBA 4L87A 4DUYB 3A2FA 4X88A 5E1AC 4GX0A 3JARA 4PDVA 5JQGB 5LMUB 1IXBA 1SS3A 4XDLA 3WB2A 3HR0A 2OCCC 1I94B 4X64B 1P4RA 2HG5C 4JI8B 1QVGU 3CHXA 2P90A 2Z0AA 4GT1A 1IBKO 1YEWA 4CH3A 4O4LA 1VQNV 2ZXWC 3WG7C 2UXCB 5BR8O 1P49A 5IJ9B 3CPWU 4JYBA 4UV8A 2YXHA 5L3GA 2ZE6A 4O2AA 4R8CA 3H1JH 1JFFA 2QEXV 3T2MA 4UCOA 4GX1A 2N74A 2IH3C 1CP9A 3RYHA 4PELA 4PDRA 5KAFZ 3SPHA 2AXTZ 1PNKA 2Y69B 3K0GA 4W4LA 3SR2C 4D6TH 1NH2B 1RM1B 2DOSA 1IBLB 2WLNA 3T4ZA 4I0XA 2OTJV 3DXRB 4QIWF 4TOIA 1BQ0A 3GWKC 2XAHA 1OCCC 4P2ZA 4H33A 1OCRC 2IJKA 3I55V 4AQYB 3CEIA 1GO3F 3CE2A 3JD2A 1HR0B 2GDSA 1NTMH 4IYHA 2Q6AA 1SA0A 1YVWA 4B3TB 4JAVA 2CTWA 1YF2A 5J9PC 1AP5A 4J41A 5D5QA 2IM9A 5B1BC 2IU0A 2EILC 4DYLA 2JJ2G 5B1OA 3ZHRA 4UCTA 2EJRA 5LA6A 1N4CA 1TA8A 1HW7A 4HAMA 1K5SA 2QKCA 1RPOA 2HP8A 4DV0O 3RYIB 2DYRC 2Q7EA 2Q5ZA 5GW7A 3APQA 3CCSV 5BXZA 3W7SA 2F43G 2P06A 3ABLB 4H44B 5GONB 3CXCU 4NXMO 3F7VC 2X6BA 3B40A 4J9ZB 3I5DA 1HP8A 4DV2B 1UJWB 3ZN1A 3CCUV 1NZ6A 2FKXA 3GB7C 3K5NA 2WA4A 1JMKC 1K4DC 3WB1A 4K0KB 2OIEA 3ZHUA 3KZIZ 4EB6A 5LBQA 1B06A 2JIZG 2ZDIC 3STLC 1R3JC 2UUBB 2ZIMA 1SF9A 4O4JA 4LBEC 4GX5A 2XAFA 1EM1A 4NTXA 3UM7A 1VQMV 5CA1B 1L1FA 1PKXA 2W0XA 5CBFA 5BMVA 3G4SV 3H1IH 1R3KC 2OT5A 5LGNA 2UXBO 1K34A 1PNLA 3JAKA 4IHJB 2QGNA 1RPRA 1BE3H 3MHSC 5CA3A 1IBMO 1JQ0A 2QM7A 4O2BB 3VBBA 3UT5A 1BHBA 2WLIB 4W4KA 4FZ0A 4X62B 3K04A 2HHHO 4MVOA 1CXZB 1VF6C 5CMUA 3JASB 1GM9A 2D3OW 3FB7C 1YSCA 2WA3A 2WWWA 1I08A 4WBNA 4DUYO 1V55C 3CC4V 1U97A 5B66Z 3VQWA 3QO8A 5JJNB 4JI6O 1NU1H 3HKEB 3B77A 1AJPA 1I94O 1M57B 3QNEA 5EBWC 4FM2A 4JI8O 1NKDA 5CB4B 1M90W 3UQ8A 1IDSA 2Q67A 2O57A 1TVKB 1MA1A 1GM8A 3RYCB 2F4VB 4HNAA 1FS0G 5FNVB 5B1NA 3OT7A 1XILA 2LGQA 2EINC 5B3SC 3LNNA 4GKJO 2BTQB 3ICXA 4DV5B 2AGAA 4ZI7A 3R65A 3LNMB 1XUQA 1CPYA 1QLEC 1H2NA 2KSDA 2JVDA 1K97A 1EZJA 1PPJH 2E74B 4UFZA 3N2GA 4UV9A 3E86A 1E79G 3SJQC 1JA8A 2KB1A 3H1KH 1HR0O 3E8BA 5LXTB 4GKKB 4B08A 3TCUA 3OTFA 1H2MA 3X2QB 2RNBA 1OCZC 3ASOC 4LFBB 2XAQA 4X66B 1GAXA 4GZRB 2JS5A 4BIUA 3ZEDA 5KMGB 3MHHC 2F93B 2E76B 3OEEG 1VQOV 1YTFD 1AR4A 1URFA 3H1HH 3CXHF 4FM0A 4UXNA 4B7KA 5IY5B 3OMIB 2P5OA 4F6RA 3JARB 5H9CA 1FYJA 4JYAO 1PL4A 5KAIZ 1JX9A 4DR7O 4Z1MG 1COWG 2YIAA 1W0KG 4I50A 5LP6B 3ZS8C 4FLVA 3CB2A 3K03A 4FJCC 5KLVH 3CCMV 4LFAO 5L3CA 3RGBA 5HFMA 1FKAO 4EFEA 1GTOA 1V54C 2ZE8A 4X8AA 4CC6A 1Q82W 4JI5O 5EBMC 5EIBC 1S5LZ 2X6AA 3QVNA 4R7CA 2Y48A 3ASNB 4P9OA 3EHBB 3JAWB 1GH6A 1XMQO 4A5UB 2UXXA 1SQVH 1HDJA 1F51A 3W7WA 4BW9A 1WJZA 4TT3G 2PUSA 3JD4A 2YDEA 3CCVV 3RN4A 4RO2A 3OR6C 1HNZB 3VQVA 2QM8A 3JATA 1G6UA 1SA0B 1IBKB 5HFLA 5FPOA 5BR8B 4EFBA 4J7JA 4FFBA 1RFYA 3OTOO 2YIBA 5LGTA 2BE3A 2QE7G 3JD3A 3CX5F 2P7TC 4LWSA 1VARA 2WLJA 1K73W 3MD0A 4PDMA 4RWUA 1L0LH 5ITZB 4L8JA 5LYJB 4B3SO 2B5UA 1Q5OA 4U3FH 5F2VO 1N33B 2CK3G 3OGCC 3WB0A 1QQCA 4YY3B 2ZDIA 3AG3B 4QE7A 1Q7YW 1S5HC 1XBLA 1VQKV 2EJ7A 1GRJA 2GUZA 2ODMA 1FJGO 3F5TA 3K5OA 2ZR2A 4QPJA 1VQ6V 1X59A 2R72A 2KG7A 3AG1C 3G71V 1I5YA 4B3MO 4CH4A 1YDXA 4BIZA 3CC7V 4O4JB 1FFXB 3VOUA 4MVMA 3SJAC 1PNMA 3TJTA 4FLUA 4WF9V 4YXWG 1LUVA 2WLKA 4DV0B 1TAEA 3E22A 1AROP 2FB5A 4ASUG 5C93A 4DV5O 3FB8C 4Q20A 2YICA 4JV5O 2OWOA 5BMVB 4HZ3A 1WB7A 3LDCA 4CS4A 4AI8A 4NXMB 3KCXA 2YIDA 2LP7A 4IIJA 3JAKB 2ZM6O 5DN6G 1DLBA 3SYPA 4DR3B 4I4TA 5KA6A 4FLTA 1WNSA 2DWEC 5JJJB 1XOUA 4YJ3B 1VEWA 5LGUA 4DV6O 4J7ZA 4I9QA 4GKKO 2JRIA 1XMOO 4LF4O 3L74H 4DR5O 4LFBO 4WFHA 4X66O 3B09A 1DTOA 2ETNA 2DQ3A 3ABKB 1GN6A 3B4SA 3FFQA 3QTCA 2FMLA 5D5PA 4JI1O 3ZN0A 4U3JB 4JTDB 1S3JA 1JJOA 3W7UA 4CH6A 1S76D 1Y74A 2EIJB 1Q6UA 1ZL8A 1YHQV 2RN9A 1GKFA 1QVFU 5AG2A 2Y0IA 2UXBB 1MSDA 1KECA 1T5EA 1L8DA 3FB6C 4DUZO 3OR7C 1IBMB 1XL6A 2A0LA 1N32O 1KC8W 3NR7A 1OJHA 4IYIA 2P67A 1I5XA 2B1GA 3K3WA 4FZ1A 3DGEA 1Z5VA 5KX5A 2CDYA 2QJ1A 4KXRA 4FVMA 1F7YA 2NR5A 2QWNB 4ZI7B 4JI4B 4DXWA 2HHHB 1BT8A 3P3PA 4JTAB 5JH7B 2ZNJA 2H8PC 4IGGA 4QPKA 3CP1A 5KHJA 1F23A 2R9AA 3APOA 4WCEV 1XL4A 1R6TA 4B3RO 1WP8A 4LF6O 3FB5C 4DW0A 3JCZA 3N2GB 2XAJA 1BHAA 4JI6B 2DQ0A
chains in the Genus database with same CATH topology
1R3JC 1OCZB 2WSSG 4MTGA 2XAGA 4LBEC 3AG4B 4GX5A 2XAFA 4ZKIA 1G8MA 2IW5A 3ETGA 4WFFA 5IY5C 3UM7A 1VQMV 3B8NA 4X89A 4BW5A 1L1FA 1PKXA 4UVAA 3HB3B 2WLHA 5CBFA 4MVUA 2QKSA 3G4SV 3AG2C 1KP2A 2W6JG 3ETDA 3AG1B 2IH1C 1NR1A 1R3KC 3ETEA 1K92A 2OT5A 5LGNA 3LSSA 4FPPA 1K34A 1PNLA 4KFMA 4MS2A 1RPRA 3K0DA 3MHSC 5B1AB 3ML0A 3QO7A 1R6NA 5CA3A 3KG2A 3JYCA 3ZMUA 2BOBC 1JQ0A 3EFFK 4TWKA 1M56C 5DM6V 5BZBA 5IYCO 2QM7A 1JPXA 3RVZA 3VBBA 5EK0A 2HKOA 3HPLC 2Y69C 2LFSA 4LC1A 1E1RG 3FYIB 4BAYA 1YITV 1BHBA 1RM1C 2HVJC 1YJ9V 2P6JA 2WLIB 4JAUA 5L3DA 3ASNC 3F7YC 1DF5A 3K04A 1W2BU 4ZBMA 1VQ4V 4MVOA 2Q69A 1V54B 1VQ5V 1KD1W 1FXKA 5CMUA 1F4MA 1GM9A 2D3OW 3FB7C 1YSCA 2WWWA 5EC1C 2WLMA 1WPXA 4KP4A 2A9HA 1FXKB 1KP3A 1MABG 1V55C 2YSUB 3CC4V 4MVZA 2EIKB 3QO8A 4MTFA 3ZMZA 5KUKA 1K7DA 2EIMC 1W0JG 3B77A 1AJPA 1B6QA 1M57B 3QNEA 5EBWC 1M9NA 3OFNG 2HVKC 5H6QA 1NKDA 4FIPC 4JASA 1M90W 2Q67A 2HFEC 1NVPB 4OXSA 1JOYA 1THZA 3SPCA 1EBOA 1G4YB 1GM8A 2EIJC 2H94A 2DWDC 1FS0G 1AJNA 1M1KW 2EILB 5B1NA 2YEVA 1R3IC 3ZMVA 2EINC 3ZRWA 5B3SC 1S72V 2ITCC 4DO2A 1VQ8V 3OUFA 1GMGA 2OTLV 2YEVB 3R65A 3LNMB 2IJHA 2XNDG 3K06A 1CPYA 1QLEC 4LCUC 2JK5C 4WFBV 1VQ9V 3ZMSA 4U7OA 3QO5A 1K97A 4XBFA 1EZJA 3LSQA 2K1EA 1H8EG 3T4DA 3SYAA 4UV9A 3AG3C 2X7RB 4RUFA 1OCOC 2WPDG 3P32A 3E86A 1E79G 3SJQC 3B8MA 2KB1A 4FMTA 4XDKA 3RW0A 4RQEA 2UXNA 1BL8A 4RQFA 1MSWD 3E8BA 1ENVA 2HLDG 2DYSB 3SPIA 3TCUA 5CBHA 3CC2V 3SYQA 1SERA 1NJIW 3X2QB 2JEUA 1OCZC 3ASOC 4R50A 2XAQA 3CYOA 3AG4C 3TETA 4MT8A 3STZC 2B1IA 3FKSG 4BIUA 3E2EA 1K3EA 3MHHC 4PDLA 3E8GA 1AI4A 3E83A 4RUEA 4P9PA 4EKWA 2OCCB 3OEEG 1VQOV 4N21A 1YTFD 1FXHA 3GWOA 4UXNA 4MW8A 3W7XA 1JCHA 5IY5B 3OMIB 2LFRA 5H9CA 4HYOA 4JPRA 1JX9A 2XASA 4XDJA 2ZXWB 3WG7B 4Z1MG 3BY6A 1AR1B 1COWG 3RBZA 4JYCA 2W0FC 1W0KG 2EBOA 4R6ZA 5B1AC 1S77D 3OAAG 3K03A 2AHZA 2WLIA 5IYDO 4FJCC 2X0LA 5IYBO 3CCMV 3OUSA 1R3LC 3SYOA 5H6RA 5L3CA 3CCRV 2R9IA 1SRYA 1S0VA 5LHIA 1QCEA 1HWYA 5HFMA 4G27B 1ROPA 3K9AA 2PI4A 4KUMA 1GTOA 2EZOA 1R73A 3LDDA 1JJ2U 3PJSK 1V54C 3ABMC 4X8AA 1Q82W 3ZJZA 5EBMC 3CMAV 2X6AA 4R7CA 4J9YB 2Y48A 3ABKC 3ASNB 2QA4V 4P9OA 3EHBB 1OCCB 1K9MW 1FXVA 3IC7A 1FXKC 2UXXA 1OCRB 2M7WA 2EIKC 3BEHA 1QLNA 3OEHG 1F51A 3W7WA 3AEIA 3E35A 1K4CC 3SPGA 2NLJC 1TUEB 1M57C 1NBMG 3UKMA 4TT3G 4JGSA 1V55B 3JD4A 5FL7G 4WFAV 3CCVV 1N8RW 2HR3A 3D3IA 2EIMB 5EC2C 4TSFG 4RO2A 3LUTB 3OR6C 5B1BB 4F4LA 4PA6A 2QM8A 2X6CA 3OW2U 3CCQV 2ZQMA 1MOFA 5HFLA 1BMFG 1CEZA 1AI5A 4GCZA 4N23A 2JEXA 1NH2D 1H8HG 3T1CA 1LNQA 4MVSA 1DF4A 1Q81W 1ZWIC 3ABLC 3RVYA 2A79B 3I56V 1E1QG 2DYRB 3LDEA 5LGTA 2FTKA 2C2AA 5KUMA 2Q68A 2QE7G 3JD3A 3SYCA 3OMNB 2P7TC 4MVRA 5B3SB 3E8HA 2NNUA 3ZRXA 2WLJA 1K73W 3MD0A 3ABUA 3OE7G 4PDMA 1SESA 1JVMA 1GM7A 1QR8A 1AJQA 1QBZA 3ZIAG 4PA3A 2JJ1G 2B5UA 1WLEA 2CK3G 3M99B 3OGCC 4QJFB 2R9RB 2V7QG 4GX2A 4UUJC 2ZR3A 4PA9A 3NXSA 5LHHA 2ZDIA 2DYSC 3AG3B 1FFTB 2WLLA 1OCOB 4QE7A 4MTOA 1NVPD 1Q7YW 3W7TA 1S5HC 1VQKV 2ITDC 4JTCB 3D36A 3X2QC 1KQSU 1VQPV 2WLLB 1H2GA 4MTXA 4UVCA 4L87A 3CMEV 2QTOA 3TK1A 4X88A 3K79A 1AI7A 5E1AC 4GX0A 4PDVA 1K33A 4UVBA 1ORQC 4XDLA 3JD0A 2Z3YA 3ASOB 3F5WC 2ZR2A 4QPJA 2OCCC 1VQ6V 1K5QA 5CN0A 1P4RA 3AG1C 4WFEA 3ZRSA 2HG5C 3G71V 1I5YA 1QVGU 4JF3A 4BIZA 2P90A 1VQLV 4GT1A 3CC7V 4G2KA 3VOUA 4MVMA 1PNMA 1VQNV 2GHYA 4WF9V 4E2LA 2ZXWC 4YXWG 3WG7C 3AG2B 2WLKA 3SPJA 3IFXA 5L3BA 1H38A 4ASUG 1AROP 5C93A 1YJNV 3FB8C 4JYBA 4UV8A 3CPWU 4Q20A 3CCLV 5L3GA 2PI5A 4FK5C 5KA5A 4R8CA 1YI2V 2QEXV 2W6IG 1OHHG 3T2MA 1P7BA 3H01A 4HZ3A 3LDCA 3JD1A 4GX1A 2IH3C 1CP9A 2AHYA 2V1DA 4PELA 4PDRA 1M56B 3ZCCA 3SPHA 1YIJV 4MSWC 1R6KA 1K8AW 1EFRG 1PNKA 3IGAC 2Y69B 2LP7A 3K0GA 5DN6G 1NH2B 1DLBA 1RM1B 2WLNA 4I9WA 3SYPA 3T4ZA 2IJIA 5CBGA 2OTJV 4CBCA 4QIWF 5KA6A 5LGUA 2DWEC 1MG1A 2XAHA 4QNHB 4WFGA 1OCCC 3DTUB 4P2ZA 4H33A 4CZZA 1Y66A 1OCRC 2IJKA 3ABMB 2ATKC 3I55V 1KKDA 1PD3A 4WFHA 1GO3F 3E89A 3JD2A 4MW3A 4H37A 1DTOA 3WFVA 2DQ3A 2MK3A 3ABKB 4PA4A 1NQTA 2Q6AA 4PA7A 2HJFC 1F4NA 4JAVA 5EBLC 2WAMA 2DW4A 5J9PC 3ZN0A 5B1BC 2IU0A 2Z5UA 4JTDB 1S3JA 3ZRVA 2EILC 2JJ2G 1AI6A 1IXMA 4G28B 5B1OA 3FYEB 3W7UA 1PL0A 2IJJA 1S76D 1GK9A 2EJRA 2XOKG 2EIJB 4HAMA 1YHQV 1K5SA 3E8FA 3ABTA 1GKFA 1YJWV 1RPOA 1QVFU 1J95A 1VQ7V 3CD6V 2DYRC 2EINB 1KECA 5GW7A 3CCSV 3FB6C 3CCEV 4LP8A 3OR7C 1Y4MA 1YTFB 2IU3A 3CCJV 1XL6A 1OZ0A 2A0LA 2F43G 3ABLB 3W7SA 1Q86W 1KC8W 2BOCC 2P67A 3P30A 1I5XA 3OMAB 3CXCU 2B1GA 3K3WA 3F7VC 3DGEA 2JDIG 3ZRWB 5IDJA 1QLEB 1SZTA 2X6BA 4J9ZB 4DXWA 2GSMB 1UJWB 3ZN1A 4U7NA 4JTAB 2EZPA 3K08A 3CCUV 3GB7C 4RAIA 5L3EA 1NR7A 4MVQA 2H8PC 1K4DC 4I5SA 4QPKA 4P30A 3A0RA 3CP1A 3G6EV 1F23A 4QE9A 1QR9A 5LHGA 4WCEV 1XL4A 3OM3B 3FB5C 1SETA 3JCZA 3ZMTA 5LBQA 2ZD9A 2JIZG 2ZDIC 2XAJA 1BHAA 5L3FA 3STLC 2DQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 W;  1VQ4 V;  1VQ6 V;  3I56 V;  3I55 V;  1VQ5 V;  1KD1 W;  1YHQ V;  3CC2 V;  3G71 V;  1QVG U;  1YJW V;  1NJI W;  1R73 A;  1YIJ V;  1JJ2 U;  1QVF U;  2D3O W;  4WFB V;  4WFA V;  3CCU V;  3CCV V;  3CC7 V;  1VQ7 V;  1VQL V;  1VQM V;  1Q7Y W;  1N8R W;  1VQ9 V;  1Q82 W;  3CD6 V;  5DM6 V;  1VQK V;  1VQN V;  3CCS V;  4WF9 V;  3CMA V;  1M1K W;  3CCE V;  1KQS U;  3G6E V;  1K8A W;  3OW2 U;  3CC4 V;  3CCQ V;  2QA4 V;  3CCJ V;  4WCE V;  1YJN V;  1VQP V;  1Q86 W;  1K73 W;  3CPW U;  2OTJ V;  1K9M W;  1KC8 W;  3CCM V;  1W2B U;  3G4S V;  1S72 V;  3CCL V;  3CME V;  1VQ8 V;  1YIT V;  3CXC U;  1YJ9 V;  1VQO V;  2OTL V;  3CCR V;  1YI2 V;  1Q81 W;  2QEX V; 
#chains in the Genus database with same CATH topology
 4X1Y B;  2WSS G;  2MW2 B;  2XAG A;  3AG4 B;  2P22 C;  4ZKI A;  1HNZ O;  2E3C A;  1G8M A;  5K1X A;  3B8N A;  1WA8 A;  4BW5 A;  3PN1 A;  4J42 A;  2WLH A;  3CRA A;  4MVU A;  2QKS A;  1IX9 A;  1WB8 A;  4DR1 B;  1UPG A;  5IWA O;  3ETE A;  1K92 A;  2ARH A;  3LSS A;  4GKJ B;  3CRQ A;  4LR3 A;  1LUW A;  4B7E A;  5B1A B;  3KG2 A;  4J7K A;  3G80 A;  4F6R B;  2BOB C;  4TWK A;  5BZB A;  1PV0 A;  3D3Q A;  3DC5 A;  4JZG A;  3RVZ A;  2HKO A;  2Y69 C;  1E1R G;  2Q0O C;  1YIT V;  2R70 A;  4X20 B;  1RM1 C;  1YJ9 V;  1N33 O;  1ZUQ A;  5L3D A;  4TQF A;  1DF5 A;  1W2B U;  3FAV B;  3QG5 A;  1WAZ A;  4TV8 B;  4YY3 O;  4DV3 B;  1KUQ A;  2A3Q A;  5EC1 C;  1SQG A;  2WLM A;  1FXK B;  2P4V A;  1MAB G;  2EIK B;  3ZMZ A;  4LH7 A;  1M9N A;  2LJ2 A;  5H6Q A;  4FIP C;  3BA8 A;  3T1Y O;  1NVP B;  4Z2W A;  3SDL A;  4JYA B;  1M1K W;  4DR7 B;  2EIL B;  1R3I C;  3ZMV A;  4FLW A;  2UUC B;  4BIO A;  3ZRW A;  2PF4 E;  2ITC C;  1VQ8 V;  1GMG A;  2YEV B;  1QU7 A;  5EYP A;  1JR9 A;  4PI0 A;  3RYF A;  4LFA B;  2XND G;  2JK5 C;  4DR3 O;  1VQ9 V;  2YUA A;  2CTR A;  1XQ8 A;  2K1E A;  1H8E G;  3T4D A;  2WPD G;  4JI5 B;  4LWS B;  2QKA A;  4OX9 B;  1MMM A;  1XMQ B;  1OV9 A;  3IC9 A;  3HKC B;  4UB6 Z;  1L0N H;  4YHH O;  1NJI W;  3CJH B;  3CYO A;  3TET A;  4MT8 A;  5C8Y A;  3UO2 A;  2P4K A;  3C3S A;  1KB9 F;  1BSM A;  4KL1 A;  3E8G A;  3E83 A;  1HNW B;  4ZOL B;  2BSK A;  2GUZ B;  1H2S B;  3ZBH A;  1I0H A;  4MW8 A;  1BCC H;  1XHX A;  4GUN A;  1IVS A;  2XAS A;  3L70 H;  3CSX A;  2KG7 B;  2JGD A;  3Q4H A;  4JYC A;  2W0F C;  3OTO B;  2EBO A;  2KQX A;  4ZHQ B;  2L6L A;  1S77 D;  2AHZ A;  4O4I A;  1Z5W A;  5J2T A;  2AW9 A;  3OUS A;  1R3L C;  3E22 B;  1VP7 A;  4JI4 O;  5LHI A;  4JI3 B;  5A2Q N;  4Q6G A;  1ZSP A;  3T1H O;  2HJD A;  4G27 B;  3K9A A;  2PI4 A;  4KUM A;  2EZO A;  1R73 A;  4B3S B;  3PJS K;  3ABM C;  2CGN A;  4J9Y B;  2QA4 V;  4IIJ B;  1K9M W;  1FXV A;  1P7G A;  2M7W A;  1QLN A;  3HKD B;  3OEH G;  1DK1 A;  4I4T B;  1D5N A;  3E35 A;  4JYY A;  3BAB A;  1D2D A;  1FJG B;  4TQD A;  1M57 C;  4DRX A;  1NBM G;  2PGG A;  4JGS A;  1V55 B;  5FL7 G;  4WFA V;  3JAL A;  2HR3 A;  3D3I A;  5EC2 C;  3LUT B;  4F4L A;  4B3M B;  4LNU A;  2IBZ H;  4BR6 A;  4FLX A;  3KKY A;  2D2C B;  4DR1 O;  1EN4 A;  1US6 A;  1BMF G;  1XNQ O;  1AI5 A;  4GCZ A;  3T1C A;  1ZWI C;  1XRE A;  2QTS A;  3I56 V;  2Y4T A;  1E1Q G;  4DR6 O;  4JV5 B;  2XT9 A;  3LDE A;  4YJ2 A;  4LF8 B;  1YCI A;  5KUM A;  1SZX A;  3BAA A;  5B3S B;  1KKC A;  4TUY B;  4ZIB A;  3ZRX A;  3ABU A;  3OE7 G;  2N05 A;  2ZM6 B;  4OGQ B;  3TXS A;  3JAM N;  1QBZ A;  4DV3 O;  3ZHT A;  1VIB A;  4DV6 B;  4LF9 B;  4UCU A;  5LOV A;  2QM4 A;  1XMO B;  4LF4 B;  1XNR B;  2WLL A;  4DR5 B;  4MTO A;  1XHZ A;  3W7T A;  2ITD C;  3SJB C;  5J2U A;  1FPO A;  5LMN O;  2L35 A;  3X2Q C;  1VQP V;  1TUB A;  4UVC A;  4X1I A;  3CME V;  2QTO A;  4DV1 B;  1AI7 A;  1RSO A;  4JI1 B;  2ZIO A;  3G67 A;  4UVB A;  4K8Z A;  1QHT A;  3ASO B;  3F5W C;  4Z1V A;  1K5Q A;  5CN0 A;  3ZRS A;  4D7T A;  5B5E Z;  2FL4 A;  1VQL V;  1AP6 A;  2UUC O;  3AG2 B;  1M4U A;  3SPJ A;  1YJN V;  5LP6 C;  1WA8 B;  2ADP A;  3CCL V;  4O4L B;  4DUZ B;  1YI2 V;  2YXL A;  2W6I G;  1OHH G;  1N32 B;  1BS3 A;  2AHY A;  4O2A B;  3ZCC A;  1M56 B;  1JFF B;  3L75 H;  4MSW C;  1BGY H;  1R6K A;  1EFR G;  3IGA C;  2ILM A;  4PHZ A;  4DV4 B;  4O4H A;  3RYH B;  2QDO A;  2VQE B;  2HEP A;  2EX3 A;  2NN4 A;  4CBC A;  4OX9 O;  2Q7H A;  1MG1 A;  4WFG A;  3SJC C;  4I0X B;  2QWR B;  4B3R B;  4LF6 B;  2RCV A;  1HNX O;  1Y66 A;  1DGS A;  5TIS Z;  1Y6X A;  1P84 F;  3E89 A;  4PI2 A;  5JJE B;  3AK2 A;  4H37 A;  4LFC B;  2MK3 A;  4PA4 A;  4UB8 Z;  1NQT A;  4JAA A;  4PA7 A;  3H9V A;  5EBL C;  2WAM A;  1HNW O;  2DW4 A;  2Z5U A;  4X65 O;  2UXD O;  1AI6 A;  1IXM A;  4G28 B;  3FYE B;  1PL0 A;  3RYI A;  4F6E A;  5IWA B;  3E8F A;  1J95 A;  2CTP A;  1YZB A;  5LA6 B;  1KBH A;  1Y4M A;  1YTF B;  2IU3 A;  1EZV H;  1Y76 A;  2BOC C;  4JI3 O;  3OMA B;  1FAF A;  2JDI G;  3G6B A;  3ZRW B;  5FLX N;  1SZT A;  3UCS C;  5BY1 A;  2GSM B;  3U10 A;  1ZTE A;  2EZP A;  3K08 A;  3RYF B;  2PY5 A;  4K35 A;  5LL6 Y;  1NR7 A;  3L9D A;  3A0R A;  1QR9 A;  3OM3 B;  3K57 A;  5IT9 N;  3ZMT A;  2ZD9 A;  4CS2 A;  2E5L O;  4MTG A;  4EB6 B;  5EZY A;  5KHH A;  4JI7 O;  2IW5 A;  3ETG A;  3T1Y B;  5IE9 A;  4UVA A;  1H2K A;  3BVO A;  1QNM A;  1Y67 A;  5C8Y B;  1KP2 A;  2W6J G;  3ETD A;  3AG1 B;  2IH1 C;  4IHJ A;  4LF8 O;  4J11 A;  2LO1 A;  4KFM A;  4O2B A;  3JYC A;  3ZMU A;  3J7A U;  3RT3 C;  5DM6 V;  3EFF K;  3N2K A;  1JPX A;  1VF6 A;  3O9O A;  2JGD B;  3HPL C;  2LFS A;  3BA9 A;  3FYI B;  2HVJ C;  1XEQ A;  5J2T B;  1N36 O;  4JAU A;  4LF9 O;  4K8X A;  1XDC A;  3UT5 B;  4J80 A;  3L73 H;  5DED A;  5K1P A;  2Q69 A;  1XNR O;  3CRR A;  1KD1 W;  2F23 A;  1KMI Z;  2A9H A;  3HKE A;  4YHH B;  1EN6 A;  1KP3 A;  4DV1 O;  4MVZ A;  4CC5 A;  5KUK A;  2PTM A;  5CB4 A;  1WPB A;  1K7D A;  1Q8I A;  2EIM C;  1Q6H A;  4OPA A;  4WBN B;  1TVK A;  2GTA A;  2LW1 A;  3RYC A;  3FX7 A;  2HFE C;  5FNV A;  4OXS A;  1JOY A;  1THZ A;  3HKB A;  3SPC A;  1G4Y B;  2EIJ C;  4PD4 F;  4DRX B;  2CGO A;  4NVP A;  3ETQ A;  2BTQ A;  1AJN A;  1W59 A;  2A7W A;  1B3Q A;  3EVK A;  3JAL B;  3TGU H;  2UUA O;  4HNA B;  1A32 A;  2F66 C;  3OUF A;  4NYK A;  2ZE7 A;  2OTL V;  2DE0 X;  2DMX A;  3K06 A;  1YXB A;  4DV4 O;  3RWR D;  2VQE O;  3N27 A;  5JWP A;  3ZMS A;  3T1H B;  4IT5 A;  3QO5 A;  4XBF A;  1N0N A;  3MDS A;  1Z2G A;  1BZK A;  1OCO C;  4PV1 B;  1VF7 A;  1MZF A;  4C7U A;  5LXT A;  2YC0 A;  2YS8 A;  3RW0 A;  4RQF A;  1MSW D;  1ENV A;  4LFC O;  2DYS B;  4D7S A;  2ZNI A;  5CBH A;  1G1X B;  2UU9 O;  4EEQ A;  5KMG A;  3A8T A;  3AG4 C;  3CS5 A;  3FKS G;  4PJ0 Z;  1K3E A;  2FYU H;  1NTZ H;  3C90 A;  5J2U B;  2YIB D;  2OCC B;  4X1K A;  4N21 A;  3BFR A;  4JI0 O;  1TUB B;  3GWO A;  4X1I B;  5KHG A;  3W7X A;  1XNQ B;  1JCH A;  3AK3 A;  1RSO B;  5LP6 A;  1BQZ A;  2ZXW B;  3WG7 B;  4NXN O;  3BY6 A;  4CS3 A;  1AR1 B;  4DR6 B;  3RBZ A;  2OCH A;  3K5L A;  4R6Z A;  5B1A C;  4DR4 O;  4K3A A;  3ZX6 A;  3OAA G;  5IYB O;  4I50 B;  3QF7 A;  5H6R A;  3ZHQ A;  2GV9 A;  1SRY A;  1S0V A;  1UFI A;  4AIL C;  3GVM A;  2GTS A;  1U96 A;  3THO A;  2M6Y A;  3JAW A;  1NT2 B;  2ZCE A;  3CMA V;  5CA0 A;  2XTA A;  2LQT A;  3CRC A;  3K58 A;  1OCC B;  5DEC A;  4O4H B;  1H2L A;  1FXK C;  3JCU Z;  5LMN B;  1OCR B;  3L72 H;  3SGI A;  2EIK C;  5JVD A;  1J5E B;  2PYJ A;  3EXA A;  3AEI A;  2F95 B;  1K4C C;  3SPG A;  4ABM A;  2YI8 A;  4JI2 O;  3CRM A;  1LR1 A;  2CH7 A;  2AZ2 A;  3CWB H;  3A0B Z;  2F1M A;  1Q6I A;  5B1B B;  3OW2 U;  3CCQ V;  2ZQM A;  1MOF A;  2VQF O;  2Q4P A;  4N23 A;  1N34 O;  2JEX A;  2YXY A;  3JAT B;  1LNQ A;  4MVS A;  3ABL C;  3RVY A;  3VQY A;  3RFR A;  2DYR B;  4DR2 B;  3OMN B;  1IZ3 A;  4FFB B;  4MVR A;  1Q3E A;  4OPH A;  2Q73 A;  3E8H A;  4JZ2 A;  2RQ6 A;  5ITZ A;  1WP7 A;  4IL6 Z;  5LYJ A;  1SES A;  3P3N A;  1JVM A;  1Q90 D;  2Q7G A;  1QR8 A;  3ZIA G;  1S5J A;  4PA3 A;  1Y76 B;  2JJ1 G;  3M99 B;  4QJF B;  2R9R B;  1M93 A;  2V7Q G;  4GX2 A;  5FPR A;  2ZR3 A;  4FLY A;  4YIP A;  2QWO B;  3K5M A;  1FFT B;  1HNX B;  1M5I A;  2JS3 A;  3WU2 Z;  4UCR A;  3TK1 A;  4FFK A;  3K79 A;  1K33 A;  1ORQ C;  3C3T A;  3JD0 A;  2Z3Y A;  4X65 B;  3AK1 A;  1FFX A;  3TXQ A;  4NR1 A;  4WFE A;  2UXD B;  4JF3 A;  2XUM A;  1ZX3 A;  4G2K A;  5EZY B;  2GHY A;  4E2L A;  1V9P A;  3OGI B;  3IFX A;  5L3B A;  1H38 A;  2DJV A;  2PI5 A;  4FK5 C;  5KA5 A;  4TV9 A;  4UCV A;  1NTK H;  1P7B A;  3H01 A;  3JD1 A;  3U11 A;  5E79 Z;  2V1D A;  4FM1 A;  1YIJ V;  2DN9 A;  1NS1 A;  1K8A W;  3A0H Z;  3DC6 A;  4YJ3 A;  3IAY A;  4DV7 O;  4KHP O;  4LF5 O;  4I9W A;  2IJI A;  5CBG A;  1IUR A;  3N2K B;  5IJ0 A;  1AVM A;  4QNH B;  2ZT9 B;  3DTU B;  4CZZ A;  1KYO F;  4HBN A;  3ABM B;  2ATK C;  1KKD A;  1PD3 A;  2QWQ B;  4MW3 A;  2K9P A;  3WFV A;  3VQX A;  4NKG B;  2E5L B;  4U3J A;  1SQB H;  2HJF C;  2H3O A;  1F4N A;  4JI7 B;  3KCY A;  5LMU O;  4I55 A;  2Y0P A;  4X64 O;  3ZRV A;  1O9H A;  3AG7 A;  5IYZ A;  2IJJ A;  1GK9 A;  1SQP H;  2XOK G;  1WN7 A;  3J81 N;  3ABT A;  1TGO A;  1R1B A;  1AR5 A;  1YJW V;  2UXC O;  1VQ7 V;  3CD6 V;  1Y74 B;  2EIN B;  1ZL8 B;  3D8C A;  3CCE V;  4LP8 A;  5EIB D;  4BWA A;  3HKB B;  3CCJ V;  1OZ0 A;  5KHI A;  1Q86 W;  2ZKO A;  3P30 A;  1RP3 B;  5IDJ A;  1QLE B;  5JH7 A;  4LH6 A;  1N36 B;  1D5A A;  5KX5 B;  1IBL O;  1SQX H;  4U7N A;  3UO3 A;  4RAI A;  5L3E A;  3J80 N;  2B9Z A;  1B04 A;  3BHP A;  4MVQ A;  2V4D A;  4I5S A;  4P30 A;  3G6E V;  4QE9 A;  5LHG A;  5JQG A;  1J5E O;  4X1Y A;  1SET A;  2CTQ A;  4AQY O;  5L3F A;  1OCZ B;  1X4T A;  3D36 C;  4B3T O;  3O65 A;  5JCO C;  5IJ9 A;  4FLZ A;  4WFF A;  5IY5 C;  1XI1 A;  3BRC A;  4X89 A;  5GTH Z;  3HB3 B;  2QR4 A;  1I7F A;  4DW1 A;  3AG2 C;  1NR1 A;  4LF7 B;  2UUA B;  2JGU A;  2A06 H;  4DR2 O;  3JSN A;  5H5N A;  4X1K B;  4FPP A;  5H2F Z;  2G38 A;  4MS2 A;  3K0D A;  3ML0 A;  3QO7 A;  1R6N A;  2Q9L A;  3DXR A;  3M8A A;  5IYC O;  1M56 C;  4X20 A;  5EK0 A;  4LC1 A;  3FAV A;  4TV8 A;  4BAY A;  2CAZ C;  2P6J A;  2BCC H;  3ASN C;  3F7Y C;  4DV2 O;  2RDC A;  4ZBM A;  1VQ4 V;  1V54 B;  1ZAU A;  1VQ5 V;  1FXK A;  4CH5 A;  3L71 H;  4H0L B;  1F4M A;  4K0K O;  2N04 A;  1WPX A;  4KP4 A;  3BPZ A;  2E75 B;  2UU9 B;  2YSU B;  4MTF A;  2UUB O;  5CA0 B;  1W0J G;  3H1L H;  1B6Q A;  1VMG A;  2ZE5 A;  2HVK C;  3OFN G;  2YI9 A;  4JAS A;  5JVD B;  3M7M X;  4JI0 B;  1EBO A;  2H94 A;  2DWD C;  2CH7 B;  5GON A;  4AHC A;  4NXN B;  2YEV A;  4QGP A;  1S72 V;  4DO2 A;  4DR4 B;  1VF5 B;  2OIG A;  4NTY A;  1GN4 A;  2IJH A;  4LCU C;  4WFB V;  5EYP B;  4U7O A;  3LSQ A;  1PM9 A;  3SYA A;  4X62 O;  3AG3 C;  2X7R B;  2CUG A;  4RUF A;  3IJ4 A;  3P32 A;  3BCC H;  3B8M A;  3HKC A;  4FMT A;  4XDK A;  4E4E A;  4RQE A;  2UXN A;  1BL8 A;  3CJH A;  2HLD G;  3SPI A;  3CC2 V;  3SYQ A;  4GYC B;  1SER A;  5CA1 A;  2JEU A;  4R50 A;  4JI2 B;  4NTW A;  3DSQ A;  3STZ C;  2B1I A;  3R66 A;  4X9Q A;  4ZOL A;  3E2E A;  1GN3 A;  4PDL A;  3S3W A;  4EKW A;  1AI4 A;  2KKW A;  4RUE A;  4P9P A;  4GLX A;  3B2E E;  1FXH A;  2CE4 A;  2VQF B;  2F4V O;  1N34 B;  2LFR A;  5GTI Z;  4UCS A;  4HYO A;  4JPR A;  2BSK B;  4ZHQ A;  4XDJ A;  1PP9 H;  2AZ0 A;  2LGW A;  3OD4 A;  2VRZ A;  2QSA A;  1O9G A;  2PZS A;  2WLI A;  5IYD O;  2X0L A;  1SQF A;  3Q4H B;  1AB3 A;  3SYO A;  2VS0 A;  4O4I B;  3CCR V;  2R9I A;  2Y4U A;  3JAS A;  1NI8 A;  1QCE A;  1HWY A;  3LSU A;  4TV9 B;  4NB5 A;  1ROP A;  1SQQ H;  1MZE A;  2QWP B;  1JJ2 U;  3LDD A;  4DK0 A;  3ZHV A;  3ZJZ A;  3HKD A;  3ABK C;  2Q0A A;  2VWJ A;  3IC7 A;  3S3X A;  4I7Z B;  2BTO A;  3BEH A;  3ZHS A;  5IJ0 B;  2NLJ C;  1TUE B;  3UKM A;  1MNG A;  2ADQ B;  1AIL A;  1N8R W;  2EIM B;  4H13 B;  1N0J A;  4TSF G;  4PA6 A;  2LW7 A;  2X6C A;  4LF7 O;  1Q43 A;  1CEZ A;  5A9G A;  4LNU B;  1H8H G;  1NH2 D;  3MAQ A;  1DF4 A;  1Q81 W;  4I55 B;  2A79 B;  4TUY A;  2FTK A;  5IYZ B;  2C2A A;  2Q68 A;  2RMK B;  4ICG A;  3SYC A;  3FD9 A;  1SKV A;  2Q8V A;  4YJ2 B;  4J10 A;  2NNU A;  1EN5 A;  1SC5 B;  2VWK A;  4YIO A;  1GM7 A;  5KHK A;  4DV7 B;  4KHP B;  4LF5 B;  1AJQ A;  3U0Z A;  2GBO A;  2RJZ A;  3JSL A;  1WLE A;  1ZLZ A;  4UUJ C;  3K59 A;  4PA9 A;  3NXS A;  5LHH A;  3K9S A;  1GN2 A;  2DYS C;  2OYQ A;  1OCO B;  4DK1 A;  1NVP D;  1KU9 A;  2EUL A;  2ZIN A;  4JTC B;  3D36 A;  5LOV B;  1KQS U;  5JCO A;  2WLL B;  2PYL A;  1H2G A;  1FD9 A;  4MTX A;  2XHB A;  4L87 A;  4DUY B;  3A2F A;  4X88 A;  5E1A C;  4GX0 A;  3JAR A;  4PDV A;  5JQG B;  5LMU B;  1IXB A;  1SS3 A;  4XDL A;  3WB2 A;  3HR0 A;  2OCC C;  1I94 B;  4X64 B;  1P4R A;  2HG5 C;  4JI8 B;  1QVG U;  3CHX A;  2P90 A;  2Z0A A;  4GT1 A;  1IBK O;  1YEW A;  4CH3 A;  4O4L A;  1VQN V;  2ZXW C;  3WG7 C;  2UXC B;  5BR8 O;  1P49 A;  5IJ9 B;  3CPW U;  4JYB A;  4UV8 A;  2YXH A;  5L3G A;  2ZE6 A;  4O2A A;  4R8C A;  3H1J H;  1JFF A;  2QEX V;  3T2M A;  4UCO A;  4GX1 A;  2N74 A;  2IH3 C;  1CP9 A;  3RYH A;  4PEL A;  4PDR A;  5KAF Z;  3SPH A;  2AXT Z;  1PNK A;  2Y69 B;  3K0G A;  4W4L A;  3SR2 C;  4D6T H;  1NH2 B;  1RM1 B;  2DOS A;  1IBL B;  2WLN A;  3T4Z A;  4I0X A;  2OTJ V;  3DXR B;  4QIW F;  4TOI A;  1BQ0 A;  3GWK C;  2XAH A;  1OCC C;  4P2Z A;  4H33 A;  1OCR C;  2IJK A;  3I55 V;  4AQY B;  3CEI A;  1GO3 F;  3CE2 A;  3JD2 A;  1HR0 B;  2GDS A;  1NTM H;  4IYH A;  2Q6A A;  1SA0 A;  1YVW A;  4B3T B;  4JAV A;  2CTW A;  1YF2 A;  5J9P C;  1AP5 A;  4J41 A;  5D5Q A;  2IM9 A;  5B1B C;  2IU0 A;  2EIL C;  4DYL A;  2JJ2 G;  5B1O A;  3ZHR A;  4UCT A;  2EJR A;  5LA6 A;  1N4C A;  1TA8 A;  1HW7 A;  4HAM A;  1K5S A;  2QKC A;  1RPO A;  2HP8 A;  4DV0 O;  3RYI B;  2DYR C;  2Q7E A;  2Q5Z A;  5GW7 A;  3APQ A;  3CCS V;  5BXZ A;  3W7S A;  2F43 G;  2P06 A;  3ABL B;  4H44 B;  5GON B;  3CXC U;  4NXM O;  3F7V C;  2X6B A;  3B40 A;  4J9Z B;  3I5D A;  1HP8 A;  4DV2 B;  1UJW B;  3ZN1 A;  3CCU V;  1NZ6 A;  2FKX A;  3GB7 C;  3K5N A;  2WA4 A;  1JMK C;  1K4D C;  3WB1 A;  4K0K B;  2OIE A;  3ZHU A;  3KZI Z;  4EB6 A;  5LBQ A;  1B06 A;  2JIZ G;  2ZDI C;  3STL C;  1R3J C;  2UUB B;  2ZIM A;  1SF9 A;  4O4J A;  4LBE C;  4GX5 A;  2XAF A;  1EM1 A;  4NTX A;  3UM7 A;  1VQM V;  5CA1 B;  1L1F A;  1PKX A;  2W0X A;  5CBF A;  5BMV A;  3G4S V;  3H1I H;  1R3K C;  2OT5 A;  5LGN A;  2UXB O;  1K34 A;  1PNL A;  3JAK A;  4IHJ B;  2QGN A;  1RPR A;  1BE3 H;  3MHS C;  5CA3 A;  1IBM O;  1JQ0 A;  2QM7 A;  4O2B B;  3VBB A;  3UT5 A;  1BHB A;  2WLI B;  4W4K A;  4FZ0 A;  4X62 B;  3K04 A;  2HHH O;  4MVO A;  1CXZ B;  1VF6 C;  5CMU A;  3JAS B;  1GM9 A;  2D3O W;  3FB7 C;  1YSC A;  2WA3 A;  2WWW A;  1I08 A;  4WBN A;  4DUY O;  1V55 C;  3CC4 V;  1U97 A;  5B66 Z;  3VQW A;  3QO8 A;  5JJN B;  4JI6 O;  1NU1 H;  3HKE B;  3B77 A;  1AJP A;  1I94 O;  1M57 B;  3QNE A;  5EBW C;  4FM2 A;  4JI8 O;  1NKD A;  5CB4 B;  1M90 W;  3UQ8 A;  1IDS A;  2Q67 A;  2O57 A;  1TVK B;  1MA1 A;  1GM8 A;  3RYC B;  2F4V B;  4HNA A;  1FS0 G;  5FNV B;  5B1N A;  3OT7 A;  1XIL A;  2LGQ A;  2EIN C;  5B3S C;  3LNN A;  4GKJ O;  2BTQ B;  3ICX A;  4DV5 B;  2AGA A;  4ZI7 A;  3R65 A;  3LNM B;  1XUQ A;  1CPY A;  1QLE C;  1H2N A;  2KSD A;  2JVD A;  1K97 A;  1EZJ A;  1PPJ H;  2E74 B;  4UFZ A;  3N2G A;  4UV9 A;  3E86 A;  1E79 G;  3SJQ C;  1JA8 A;  2KB1 A;  3H1K H;  1HR0 O;  3E8B A;  5LXT B;  4GKK B;  4B08 A;  3TCU A;  3OTF A;  1H2M A;  3X2Q B;  2RNB A;  1OCZ C;  3ASO C;  4LFB B;  2XAQ A;  4X66 B;  1GAX A;  4GZR B;  2JS5 A;  4BIU A;  3ZED A;  5KMG B;  3MHH C;  2F93 B;  2E76 B;  3OEE G;  1VQO V;  1YTF D;  1AR4 A;  1URF A;  3H1H H;  3CXH F;  4FM0 A;  4UXN A;  4B7K A;  5IY5 B;  3OMI B;  2P5O A;  4F6R A;  3JAR B;  5H9C A;  1FYJ A;  4JYA O;  1PL4 A;  5KAI Z;  1JX9 A;  4DR7 O;  4Z1M G;  1COW G;  2YIA A;  1W0K G;  4I50 A;  5LP6 B;  3ZS8 C;  4FLV A;  3CB2 A;  3K03 A;  4FJC C;  5KLV H;  3CCM V;  4LFA O;  5L3C A;  3RGB A;  5HFM A;  1FKA O;  4EFE A;  1GTO A;  1V54 C;  2ZE8 A;  4X8A A;  4CC6 A;  1Q82 W;  4JI5 O;  5EBM C;  5EIB C;  1S5L Z;  2X6A A;  3QVN A;  4R7C A;  2Y48 A;  3ASN B;  4P9O A;  3EHB B;  3JAW B;  1GH6 A;  1XMQ O;  4A5U B;  2UXX A;  1SQV H;  1HDJ A;  1F51 A;  3W7W A;  4BW9 A;  1WJZ A;  4TT3 G;  2PUS A;  3JD4 A;  2YDE A;  3CCV V;  3RN4 A;  4RO2 A;  3OR6 C;  1HNZ B;  3VQV A;  2QM8 A;  3JAT A;  1G6U A;  1SA0 B;  1IBK B;  5HFL A;  5FPO A;  5BR8 B;  4EFB A;  4J7J A;  4FFB A;  1RFY A;  3OTO O;  2YIB A;  5LGT A;  2BE3 A;  2QE7 G;  3JD3 A;  3CX5 F;  2P7T C;  4LWS A;  1VAR A;  2WLJ A;  1K73 W;  3MD0 A;  4PDM A;  4RWU A;  1L0L H;  5ITZ B;  4L8J A;  5LYJ B;  4B3S O;  2B5U A;  1Q5O A;  4U3F H;  5F2V O;  1N33 B;  2CK3 G;  3OGC C;  3WB0 A;  1QQC A;  4YY3 B;  2ZDI A;  3AG3 B;  4QE7 A;  1Q7Y W;  1S5H C;  1XBL A;  1VQK V;  2EJ7 A;  1GRJ A;  2GUZ A;  2ODM A;  1FJG O;  3F5T A;  3K5O A;  2ZR2 A;  4QPJ A;  1VQ6 V;  1X59 A;  2R72 A;  2KG7 A;  3AG1 C;  3G71 V;  1I5Y A;  4B3M O;  4CH4 A;  1YDX A;  4BIZ A;  3CC7 V;  4O4J B;  1FFX B;  3VOU A;  4MVM A;  3SJA C;  1PNM A;  3TJT A;  4FLU A;  4WF9 V;  4YXW G;  1LUV A;  2WLK A;  4DV0 B;  1TAE A;  3E22 A;  1ARO P;  2FB5 A;  4ASU G;  5C93 A;  4DV5 O;  3FB8 C;  4Q20 A;  2YIC A;  4JV5 O;  2OWO A;  5BMV B;  4HZ3 A;  1WB7 A;  3LDC A;  4CS4 A;  4AI8 A;  4NXM B;  3KCX A;  2YID A;  2LP7 A;  4IIJ A;  3JAK B;  2ZM6 O;  5DN6 G;  1DLB A;  3SYP A;  4DR3 B;  4I4T A;  5KA6 A;  4FLT A;  1WNS A;  2DWE C;  5JJJ B;  1XOU A;  4YJ3 B;  1VEW A;  5LGU A;  4DV6 O;  4J7Z A;  4I9Q A;  4GKK O;  2JRI A;  1XMO O;  4LF4 O;  3L74 H;  4DR5 O;  4LFB O;  4WFH A;  4X66 O;  3B09 A;  1DTO A;  2ETN A;  2DQ3 A;  3ABK B;  1GN6 A;  3B4S A;  3FFQ A;  3QTC A;  2FML A;  5D5P A;  4JI1 O;  3ZN0 A;  4U3J B;  4JTD B;  1S3J A;  1JJO A;  3W7U A;  4CH6 A;  1S76 D;  1Y74 A;  2EIJ B;  1Q6U A;  1ZL8 A;  1YHQ V;  2RN9 A;  1GKF A;  1QVF U;  5AG2 A;  2Y0I A;  2UXB B;  1MSD A;  1KEC A;  1T5E A;  1L8D A;  3FB6 C;  4DUZ O;  3OR7 C;  1IBM B;  1XL6 A;  2A0L A;  1N32 O;  1KC8 W;  3NR7 A;  1OJH A;  4IYI A;  2P67 A;  1I5X A;  2B1G A;  3K3W A;  4FZ1 A;  3DGE A;  1Z5V A;  5KX5 A;  2CDY A;  2QJ1 A;  4KXR A;  4FVM A;  1F7Y A;  2NR5 A;  2QWN B;  4ZI7 B;  4JI4 B;  4DXW A;  2HHH B;  1BT8 A;  3P3P A;  4JTA B;  5JH7 B;  2ZNJ A;  2H8P C;  4IGG A;  4QPK A;  3CP1 A;  5KHJ A;  1F23 A;  2R9A A;  3APO A;  4WCE V;  1XL4 A;  1R6T A;  4B3R O;  1WP8 A;  4LF6 O;  3FB5 C;  4DW0 A;  3JCZ A;  3N2G B;  2XAJ A;  1BHA A;  4JI6 B;  2DQ0 A; 
#chains in the Genus database with same CATH homology
 1R3J C;  1OCZ B;  2WSS G;  4MTG A;  2XAG A;  4LBE C;  3AG4 B;  4GX5 A;  2XAF A;  4ZKI A;  1G8M A;  2IW5 A;  3ETG A;  4WFF A;  5IY5 C;  3UM7 A;  1VQM V;  3B8N A;  4X89 A;  4BW5 A;  1L1F A;  1PKX A;  4UVA A;  3HB3 B;  2WLH A;  5CBF A;  4MVU A;  2QKS A;  3G4S V;  3AG2 C;  1KP2 A;  2W6J G;  3ETD A;  3AG1 B;  2IH1 C;  1NR1 A;  1R3K C;  3ETE A;  1K92 A;  2OT5 A;  5LGN A;  3LSS A;  4FPP A;  1K34 A;  1PNL A;  4KFM A;  4MS2 A;  1RPR A;  3K0D A;  3MHS C;  5B1A B;  3ML0 A;  3QO7 A;  1R6N A;  5CA3 A;  3KG2 A;  3JYC A;  3ZMU A;  2BOB C;  1JQ0 A;  3EFF K;  4TWK A;  1M56 C;  5DM6 V;  5BZB A;  5IYC O;  2QM7 A;  1JPX A;  3RVZ A;  3VBB A;  5EK0 A;  2HKO A;  3HPL C;  2Y69 C;  2LFS A;  4LC1 A;  1E1R G;  3FYI B;  4BAY A;  1YIT V;  1BHB A;  1RM1 C;  2HVJ C;  1YJ9 V;  2P6J A;  2WLI B;  4JAU A;  5L3D A;  3ASN C;  3F7Y C;  1DF5 A;  3K04 A;  1W2B U;  4ZBM A;  1VQ4 V;  4MVO A;  2Q69 A;  1V54 B;  1VQ5 V;  1KD1 W;  1FXK A;  5CMU A;  1F4M A;  1GM9 A;  2D3O W;  3FB7 C;  1YSC A;  2WWW A;  5EC1 C;  2WLM A;  1WPX A;  4KP4 A;  2A9H A;  1FXK B;  1KP3 A;  1MAB G;  1V55 C;  2YSU B;  3CC4 V;  4MVZ A;  2EIK B;  3QO8 A;  4MTF A;  3ZMZ A;  5KUK A;  1K7D A;  2EIM C;  1W0J G;  3B77 A;  1AJP A;  1B6Q A;  1M57 B;  3QNE A;  5EBW C;  1M9N A;  3OFN G;  2HVK C;  5H6Q A;  1NKD A;  4FIP C;  4JAS A;  1M90 W;  2Q67 A;  2HFE C;  1NVP B;  4OXS A;  1JOY A;  1THZ A;  3SPC A;  1EBO A;  1G4Y B;  1GM8 A;  2EIJ C;  2H94 A;  2DWD C;  1FS0 G;  1AJN A;  1M1K W;  2EIL B;  5B1N A;  2YEV A;  1R3I C;  3ZMV A;  2EIN C;  3ZRW A;  5B3S C;  1S72 V;  2ITC C;  4DO2 A;  1VQ8 V;  3OUF A;  1GMG A;  2OTL V;  2YEV B;  3R65 A;  3LNM B;  2IJH A;  2XND G;  3K06 A;  1CPY A;  1QLE C;  4LCU C;  2JK5 C;  4WFB V;  1VQ9 V;  3ZMS A;  4U7O A;  3QO5 A;  1K97 A;  4XBF A;  1EZJ A;  3LSQ A;  2K1E A;  1H8E G;  3T4D A;  3SYA A;  4UV9 A;  3AG3 C;  2X7R B;  4RUF A;  1OCO C;  2WPD G;  3P32 A;  3E86 A;  1E79 G;  3SJQ C;  3B8M A;  2KB1 A;  4FMT A;  4XDK A;  3RW0 A;  4RQE A;  2UXN A;  1BL8 A;  4RQF A;  1MSW D;  3E8B A;  1ENV A;  2HLD G;  2DYS B;  3SPI A;  3TCU A;  5CBH A;  3CC2 V;  3SYQ A;  1SER A;  1NJI W;  3X2Q B;  2JEU A;  1OCZ C;  3ASO C;  4R50 A;  2XAQ A;  3CYO A;  3AG4 C;  3TET A;  4MT8 A;  3STZ C;  2B1I A;  3FKS G;  4BIU A;  3E2E A;  1K3E A;  3MHH C;  4PDL A;  3E8G A;  1AI4 A;  3E83 A;  4RUE A;  4P9P A;  4EKW A;  2OCC B;  3OEE G;  1VQO V;  4N21 A;  1YTF D;  1FXH A;  3GWO A;  4UXN A;  4MW8 A;  3W7X A;  1JCH A;  5IY5 B;  3OMI B;  2LFR A;  5H9C A;  4HYO A;  4JPR A;  1JX9 A;  2XAS A;  4XDJ A;  2ZXW B;  3WG7 B;  4Z1M G;  3BY6 A;  1AR1 B;  1COW G;  3RBZ A;  4JYC A;  2W0F C;  1W0K G;  2EBO A;  4R6Z A;  5B1A C;  1S77 D;  3OAA G;  3K03 A;  2AHZ A;  2WLI A;  5IYD O;  4FJC C;  2X0L A;  5IYB O;  3CCM V;  3OUS A;  1R3L C;  3SYO A;  5H6R A;  5L3C A;  3CCR V;  2R9I A;  1SRY A;  1S0V A;  5LHI A;  1QCE A;  1HWY A;  5HFM A;  4G27 B;  1ROP A;  3K9A A;  2PI4 A;  4KUM A;  1GTO A;  2EZO A;  1R73 A;  3LDD A;  1JJ2 U;  3PJS K;  1V54 C;  3ABM C;  4X8A A;  1Q82 W;  3ZJZ A;  5EBM C;  3CMA V;  2X6A A;  4R7C A;  4J9Y B;  2Y48 A;  3ABK C;  3ASN B;  2QA4 V;  4P9O A;  3EHB B;  1OCC B;  1K9M W;  1FXV A;  3IC7 A;  1FXK C;  2UXX A;  1OCR B;  2M7W A;  2EIK C;  3BEH A;  1QLN A;  3OEH G;  1F51 A;  3W7W A;  3AEI A;  3E35 A;  1K4C C;  3SPG A;  2NLJ C;  1TUE B;  1M57 C;  1NBM G;  3UKM A;  4TT3 G;  4JGS A;  1V55 B;  3JD4 A;  5FL7 G;  4WFA V;  3CCV V;  1N8R W;  2HR3 A;  3D3I A;  2EIM B;  5EC2 C;  4TSF G;  4RO2 A;  3LUT B;  3OR6 C;  5B1B B;  4F4L A;  4PA6 A;  2QM8 A;  2X6C A;  3OW2 U;  3CCQ V;  2ZQM A;  1MOF A;  5HFL A;  1BMF G;  1CEZ A;  1AI5 A;  4GCZ A;  4N23 A;  2JEX A;  1NH2 D;  1H8H G;  3T1C A;  1LNQ A;  4MVS A;  1DF4 A;  1Q81 W;  1ZWI C;  3ABL C;  3RVY A;  2A79 B;  3I56 V;  1E1Q G;  2DYR B;  3LDE A;  5LGT A;  2FTK A;  2C2A A;  5KUM A;  2Q68 A;  2QE7 G;  3JD3 A;  3SYC A;  3OMN B;  2P7T C;  4MVR A;  5B3S B;  3E8H A;  2NNU A;  3ZRX A;  2WLJ A;  1K73 W;  3MD0 A;  3ABU A;  3OE7 G;  4PDM A;  1SES A;  1JVM A;  1GM7 A;  1QR8 A;  1AJQ A;  1QBZ A;  3ZIA G;  4PA3 A;  2JJ1 G;  2B5U A;  1WLE A;  2CK3 G;  3M99 B;  3OGC C;  4QJF B;  2R9R B;  2V7Q G;  4GX2 A;  4UUJ C;  2ZR3 A;  4PA9 A;  3NXS A;  5LHH A;  2ZDI A;  2DYS C;  3AG3 B;  1FFT B;  2WLL A;  1OCO B;  4QE7 A;  4MTO A;  1NVP D;  1Q7Y W;  3W7T A;  1S5H C;  1VQK V;  2ITD C;  4JTC B;  3D36 A;  3X2Q C;  1KQS U;  1VQP V;  2WLL B;  1H2G A;  4MTX A;  4UVC A;  4L87 A;  3CME V;  2QTO A;  3TK1 A;  4X88 A;  3K79 A;  1AI7 A;  5E1A C;  4GX0 A;  4PDV A;  1K33 A;  4UVB A;  1ORQ C;  4XDL A;  3JD0 A;  2Z3Y A;  3ASO B;  3F5W C;  2ZR2 A;  4QPJ A;  2OCC C;  1VQ6 V;  1K5Q A;  5CN0 A;  1P4R A;  3AG1 C;  4WFE A;  3ZRS A;  2HG5 C;  3G71 V;  1I5Y A;  1QVG U;  4JF3 A;  4BIZ A;  2P90 A;  1VQL V;  4GT1 A;  3CC7 V;  4G2K A;  3VOU A;  4MVM A;  1PNM A;  1VQN V;  2GHY A;  4WF9 V;  4E2L A;  2ZXW C;  4YXW G;  3WG7 C;  3AG2 B;  2WLK A;  3SPJ A;  3IFX A;  5L3B A;  1H38 A;  4ASU G;  1ARO P;  5C93 A;  1YJN V;  3FB8 C;  4JYB A;  4UV8 A;  3CPW U;  4Q20 A;  3CCL V;  5L3G A;  2PI5 A;  4FK5 C;  5KA5 A;  4R8C A;  1YI2 V;  2QEX V;  2W6I G;  1OHH G;  3T2M A;  1P7B A;  3H01 A;  4HZ3 A;  3LDC A;  3JD1 A;  4GX1 A;  2IH3 C;  1CP9 A;  2AHY A;  2V1D A;  4PEL A;  4PDR A;  1M56 B;  3ZCC A;  3SPH A;  1YIJ V;  4MSW C;  1R6K A;  1K8A W;  1EFR G;  1PNK A;  3IGA C;  2Y69 B;  2LP7 A;  3K0G A;  5DN6 G;  1NH2 B;  1DLB A;  1RM1 B;  2WLN A;  4I9W A;  3SYP A;  3T4Z A;  2IJI A;  5CBG A;  2OTJ V;  4CBC A;  4QIW F;  5KA6 A;  5LGU A;  2DWE C;  1MG1 A;  2XAH A;  4QNH B;  4WFG A;  1OCC C;  3DTU B;  4P2Z A;  4H33 A;  4CZZ A;  1Y66 A;  1OCR C;  2IJK A;  3ABM B;  2ATK C;  3I55 V;  1KKD A;  1PD3 A;  4WFH A;  1GO3 F;  3E89 A;  3JD2 A;  4MW3 A;  4H37 A;  1DTO A;  3WFV A;  2DQ3 A;  2MK3 A;  3ABK B;  4PA4 A;  1NQT A;  2Q6A A;  4PA7 A;  2HJF C;  1F4N A;  4JAV A;  5EBL C;  2WAM A;  2DW4 A;  5J9P C;  3ZN0 A;  5B1B C;  2IU0 A;  2Z5U A;  4JTD B;  1S3J A;  3ZRV A;  2EIL C;  2JJ2 G;  1AI6 A;  1IXM A;  4G28 B;  5B1O A;  3FYE B;  3W7U A;  1PL0 A;  2IJJ A;  1S76 D;  1GK9 A;  2EJR A;  2XOK G;  2EIJ B;  4HAM A;  1YHQ V;  1K5S A;  3E8F A;  3ABT A;  1GKF A;  1YJW V;  1RPO A;  1QVF U;  1J95 A;  1VQ7 V;  3CD6 V;  2DYR C;  2EIN B;  1KEC A;  5GW7 A;  3CCS V;  3FB6 C;  3CCE V;  4LP8 A;  3OR7 C;  1Y4M A;  1YTF B;  2IU3 A;  3CCJ V;  1XL6 A;  1OZ0 A;  2A0L A;  2F43 G;  3ABL B;  3W7S A;  1Q86 W;  1KC8 W;  2BOC C;  2P67 A;  3P30 A;  1I5X A;  3OMA B;  3CXC U;  2B1G A;  3K3W A;  3F7V C;  3DGE A;  2JDI G;  3ZRW B;  5IDJ A;  1QLE B;  1SZT A;  2X6B A;  4J9Z B;  4DXW A;  2GSM B;  1UJW B;  3ZN1 A;  4U7N A;  4JTA B;  2EZP A;  3K08 A;  3CCU V;  3GB7 C;  4RAI A;  5L3E A;  1NR7 A;  4MVQ A;  2H8P C;  1K4D C;  4I5S A;  4QPK A;  4P30 A;  3A0R A;  3CP1 A;  3G6E V;  1F23 A;  4QE9 A;  1QR9 A;  5LHG A;  4WCE V;  1XL4 A;  3OM3 B;  3FB5 C;  1SET A;  3JCZ A;  3ZMT A;  5LBQ A;  2ZD9 A;  2JIZ G;  2ZDI C;  2XAJ A;  1BHA A;  5L3F A;  3STL C;  2DQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...