3CCVV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccvV00
3CCLV 1VQPV 2OTLV 1VQNV 1N8RW 1K9MW 1VQ4V 1YJWV 2D3OW 1VQ9V 1YHQV 3I55V 1QVGU 1K73W 1VQ8V 3CXCU 1VQLV 1YJ9V 1W2BU 1VQOV 3CC4V 3G71V 3CCVV 1S72V 1KD1W 3CCJV 1VQ5V 3CCRV 1YI2V 3CD6V 3CMAV 1K8AW 3CCMV 1Q82W 4WFAV 1Q81W 1KQSU 3CPWU 3CMEV 1YJNV 3CCEV 1JJ2U 1YIJV 1NJIW 1KC8W 1QVFU 1VQ7V 3CC7V 3G6EV 3OW2U 1M1KW 4WFBV 2OTJV 4WF9V 3CCQV 1M90W 3CC2V 3CCUV 1VQKV 1VQ6V 1VQMV 2QA4V 3CCSV 1Q86W 1Q7YW 1R73A 5DM6V 3G4SV 1YITV 3I56V 4WCEV 2QEXV
chains in the Genus database with same CATH superfamily
1AJQA 4FLTA 5HFLA 2YEVB 2WLJA 2Y69C 3QF7A 3HKCB 4KHPB 3SJBC 4JI6B 2B1GA 2YXHA 2D2CB 3E35A 4FZ0A 4JTDB 2W0FC 1ZAUA 2EINC 1HP8A 5C8YB 4FM0A 1OCCC 2LJ2A 1AVMA 2JS3A 3TCUA 3ZEDA 1ZL8B 3E22A 4JI5O 5JCOC 1XUQA 2QTSA 2YDEA 3CYOA 2PTMA 1U96A 2XAHA 5KAIZ 1XI1A 2JGDB 1NBMG 2UXXA 2XAQA 3C90A 4ICGA 3OGCC 3K0DA 1IZ3A 3N2KA 1HDJA 4DR4O 4LWSB 1HR0O 5KX5B 1F7YA 3E8GA 3K5LA 5J2UB 3DXRB 3VQXA 1GTOA 1TVKB 2QR4A 2YEVA 4NTXA 1CXZB 2UXBO 4IYIA 2UXCO 1PL0A 4KXRA 4FLUA 5IWAO 3EVKA 3T4ZA 1U97A 3JASB 3HKCA 2C2AA 1JJ2U 1NJIW 3UQ8A 4LF9O 1OCZC 2IJJA 3W7UA 5C8YA 3AG4C 2Q0AA 4JYCA 3CRAA 1ORQC 1NU1H 1ZL8A 3APOA 2R70A 1M57B 1LR1A 4DR1B 4OX9B 2YSUB 4DXWA 1H2SB 3LDCA 4YY3B 3L71H 2OT5A 2EBOA 2ZM6O 1NVPB 1S5HC 3VOUA 2UUBB 4LFCB 3N2GB 4LWSA 2V4DA 1OCOB 2P6JA 2H8PC 5KX5A 1THZA 1N34O 1MMMA 5J2UA 3DXRA 3JAMN 1DF5A 1JVMA 4PA7A 3JATB 2E76B 1BS3A 2OYQA 3RT3C 3JASA 1QR8A 1XL4A 2XASA 4J7ZA 1XMOB 1K9MW 1L0LH 4B3MO 3ZN0A 4B3TO 3B40A 2EULA 4HNAB 4DV4O 2JEUA 3SJAC 4DYLA 2CAZC 3BA9A 3OEEG 2WLHA 3AG2B 4HAMA 4DR5O 1PPJH 4FPPA 2QKSA 3ML0A 2FMLA 1GN2A 4X65B 3STZC 4U7OA 3CX5F 5LYJB 2VQFO 4O2BB 3ASOB 4JGSA 5BMVB 4JI3O 1XQ8A 1PKXA 2WWWA 2LO1A 4B3SO 3TXQA 5AG2A 4MTFA 1NTMH 3QNEA 3OD4A 4A5UB 1BZKA 3JATA 5LMNB 1AR4A 4L87A 4DUYB 2F93B 4RAIA 3W7TA 3M7MX 2HP8A 2XNDG 1O9HA 3P3PA 4YIOA 3BFRA 2PI5A 3ZHVA 4DW1A 2ZDIC 2EIJB 4X62B 4HNAA 1G8MA 1PD3A 2ILMA 5LGNA 4FLWA 4JI0B 4J80A 3FX7A 4LR3A 2K1EA 3CCUV 1PV0A 4TWKA 4Z1MG 3DC6A 2PYJA 1BSMA 3R66A 3K5NA 3SYQA 2HVJC 4QE9A 3L70H 3RYIB 1OJHA 3L75H 1XBLA 1B04A 4PDRA 4RO2A 3D3IA 2CUGA 5EBMC 1XNQO 5IYCO 2P4VA 2YXLA 2X6AA 3M8AA 1ZX3A 3DTUB 3VBBA 1VEWA 4X1YB 4O2BA 5BMVA 1Y74B 3RYCB 3SPHA 3KCXA 5EYPB 4UCUA 4TUYB 3A0RA 1L0NH 4UV8A 1Y4MA 1EN5A 4G28B 4LF8O 1FFTB 4RQEA 3C3SA 5LMUO 3OMAB 2AXTZ 4DV6B 4MVUA 3ZRVA 4CH5A 4O2AB 1WB7A 4X64B 2EZPA 1YIJV 4WFBV 2OWOA 2RQ6A 3JAWA 4I4TB 3JSLA 2DN9A 3SPIA 1B3QA 1QR9A 2ZCEA 1KUQA 1VF6C 1I5YA 3RYIA 5EK0A 4DV5O 1GM9A 4X66O 2GHYA 2DQ3A 3CCEV 1KC8W 1FKAO 2EIKB 1M90W 4GX5A 2MW2B 1N0NA 3P32A 3CRCA 4X1YA 1FFXB 3ICXA 1K33A 3FB6C 4D7TA 1Y74A 3A2FA 4UCTA 2P5OA 2BTQB 3ETGA 3G80A 2QWPB 3DSQA 4J9ZB 5B3SB 4PJ0Z 3EFFK 1N32O 3RVZA 1I0HA 4K0KO 4O2AA 1NS1A 1QHTA 3L74H 4LFBB 3CC2V 2P7TC 3G6BA 3LSSA 1S3JA 4U3FH 4DR3B 1VP7A 1YXBA 1BL8A 2DYRB 4JI7B 4BAYA 3P30A 1FJGO 4BW5A 3QG5A 1Q82W 4GZRB 1SQXH 1QNMA 4KFMA 2ZKOA 2QJ1A 4DR7B 2ZE7A 1MG1A 5DECA 3LNNA 1IBMO 1KP2A 4PI0A 2ZD9A 4C7UA 1VQ8V 1FFXA 3FB8C 4EFEA 4GUNA 4H0LB 2BTQA 2A9HA 2R9RB 3CSXA 2UU9B 1H2KA 3JSNA 1Q81W 1A32A 3GWKC 1UFIA 4O4LB 3ZS8C 1H2LA 3G4SV 1NH2D 2KG7A 1J5EO 1HNWB 4DK0A 1KB9F 3OEHG 4FM2A 4YJ2B 4WFFA 1WPXA 3IJ4A 2ZXWC 2LW1A 4LH6A 2NNUA 1VIBA 4JPRA 3MHSC 2ETNA 2YI8A 4X89A 3CJHA 2F1MA 3BPZA 2WAMA 2RNBA 3E2EA 2Q7HA 3G6EV 2UUCB 1WAZA 3I5DA 1H2NA 2IW5A 4CS2A 4WCEV 1I94O 3RYFB 2UXDB 2XAGA 3GB7C 2N04A 2D3OW 1MSWD 5BR8O 1AJPA 4HZ3A 5H2FZ 4NXNB 1YSCA 1LNQA 1US6A 2IH3C 1K7DA 3FFQA 1S76D 2FTKA 2EIKC 3CMEV 3APQA 2IBZH 4ZHQB 1TGOA 3B8NA 1SZXA 3BHPA 1M56C 1BCCH 2MK3A 1TUBB 4JI5B 1Q8IA 4YJ2A 2Y0IA 1AROP 1D2DA 3HB3B 3H9VA 3M99B 1XILA 3T1YO 1K8AW 1ZUQA 1L8DA 1EFRG 3ABUA 5L3EA 5LHGA 4DR4B 3UKMA 1XNRB 5EC1C 3HR0A 1WJZA 5ITZA 3K3WA 4JI4B 3W7SA 4PD4F 1JA8A 2QM8A 3ZHUA 2E5LO 2YIAA 3U11A 3CCJV 4U3JB 5LHIA 3ABLB 3ABTA 2A3QA 4G2KA 1PP9H 4GKKB 3CCSV 1ZTEA 1Z5VA 2QKAA 4JI8B 3QO5A 4JI2O 4DV1O 2JVDA 1YVWA 1V54B 1JQ0A 2IM9A 5B66Z 1TUBA 3OMNB 3LDDA 4CBCA 2QWOB 3RWRD 2AHZA 3Q4HB 3TJTA 3F5WC 2ZE5A 2EJ7A 3RN4A 3BY6A 4X1IB 2CE4A 2KSDA 3H01A 1GN3A 4UV9A 4JF3A 1RSOB 2RDCA 3CP1A 1WP7A 4TV8B 1XHZA 5CA0A 4I0XB 1N34B 3LDEA 3FYIB 2PZSA 2VQEO 1BGYH 4LFAB 1HNZO 5L3CA 1KYOF 2OCCB 4B3RO 3X2QC 3JALA 2HKOA 4U3JA 1XEQA 3T1HO 5EBLC 2Z3YA 5DM6V 1HNXO 2CGOA 4DUZO 5KAFZ 1LUWA 1EZJA 1MZFA 4X88A 4B3MB 3AG1B 4P9PA 4DV2O 3DGEA 3G67A 2CH7B 3Q4HA 2HFEC 4TQFA 5J2TB 1QVGU 3W7XA 2QSAA 4UB6Z 4X1IA 3J80N 1IBKO 3ZBHA 1EN4A 4N21A 2VRZA 5H6RA 4JZ2A 3ZHRA 2Z0AA 1ZLZA 5IYBO 4IHJA 1RSOA 3D36A 4JYAO 3OTOO 4TV8A 4JI3B 4KUMA 5CA1B 4I0XA 2L35A 2OCHA 3D3QA 4Z2WA 4GX2A 4H13B 1FXKA 2E3CA 4AQYO 1R3LC 4AI8A 4H33A 4MTXA 4E2LA 3ABLC 4DR2B 2Y4TA 3CMAV 4KL1A 5L3BA 1EM1A 1R3IC 2R9IA 3AEIA 1GMGA 1MNGA 1SRYA 5A2QN 3ABKB 4Z1VA 5B1AB 3PN1A 3WG7B 4AHCA 2JJ1G 1IBLO 3K03A 4TSFG 4UB8Z 3BRCA 2CH7A 3K59A 3VQYA 5J2TA 2QTOA 3TXSA 3IC7A 4FM1A 1XNQB 4UCOA 1H2GA 1GO3F 5GONB 1B06A 1OV9A 1XOUA 2EILC 2HHHO 4QPJA 3AK3A 5IY5B 4IGGA 3ZCCA 2ADQB 4P2ZA 4J9YB 2A0LA 1XREA 5CA1A 4PDVA 3K5MA 1YTFB 2EIMC 1H8EG 1KBHA 2Q6AA 1IVSA 5EIBD 3WB0A 1W0KG 3OUFA 2LGQA 1AILA 2WLNA 4W4LA 4LF8B 3MHHC 4FZ1A 1BHBA 1IURA 2OCCC 3AK2A 5B1BB 2OTJV 4LF4O 4BIOA 2JK5C 1VQKV 3SGIA 2Q9LA 1NH2B 1YITV 3VQVA 1TUEB 2FL4A 4DV0O 4RUFA 1G1XB 4LF7O 1JX9A 2QWNB 2GUZB 4LC1A 3T1CA 4DV5B 1GM7A 3JD0A 1W59A 4BWAA 1N33O 1P84F 4XDJA 5DEDA 5GONA 1YDXA 4GX1A 1VF7A 1VQNV 2NN4A 5LP6B 2YS8A 2GTAA 1NT2B 3GVMA 4FFBA 4OPHA 4JTAB 2ZQMA 2H94A 1IXBA 1VQLV 2B9ZA 1VQOV 2LW7A 2Z5UA 4NB5A 1JCHA 1AR1B 4IL6Z 4PELA 1QBZA 2DE0X 1N32B 4NXMO 2XOKG 1R3JC 4JAUA 4MS2A 1VF5B 3OUSA 3CE2A 5BZBA 4MVRA 2V1DA 5IDJA 1W2BU 1EZVH 1GH6A 2IU3A 1V9PA 4IT5A 2X6BA 2VWJA 1FYJA 1OHHG 2GUZA 4YIPA 3SYPA 4GYCB 3AK1A 3OW2U 2V7QG 2IJHA 4DR6O 2BTOA 3A0HZ 3B2EE 2E75B 1SF9A 1F4MA 4ZIBA 1P49A 4QIWF 3H1KH 4NYKA 4KHPO 3WB2A 1N4CA 1AI5A 5LP6A 2IH1C 1N36B 1M93A 5IY5C 3H1HH 5L3FA 3JAKB 2KB1A 3OT7A 3RFRA 3JAWB 1JMKC 3DC5A 3RBZA 2Y48A 4MW3A 2M6YA 3BEHA 1J5EB 1VQ4V 3ETEA 1AP5A 2XT9A 5CBGA 3P3NA 3WFVA 1PM9A 1Y67A 5B1BC 1M57C 2UUAB 2UXNA 1K5SA 4RUEA 3FB5C 4RWUA 4H37A 5L3GA 2AGAA 3L9DA 2ZIMA 1H2MA 4MT8A 2YXYA 4AILC 1OCOC 1Q90D 2Q69A 2M7WA 5FNVA 3CC4V 2YICA 1S72V 3K9AA 1BT8A 1SA0B 1ZWIC 1S5LZ 2EJRA 4DV3B 1SERA 3CXHF 5B1OA 2AZ0A 4F6EA 3CHXA 3JAKA 3ZX6A 2QEXV 1NTZH 3JCUZ 1G4YB 1FS0G 1K4DC 4EB6B 1N8RW 2P90A 5D5PA 4I9WA 3N27A 1W0JG 5KUKA 3FAVB 4MVQA 4OX9O 4YXWG 4YY3O 4JYBA 4P30A 3AG2C 3KG2A 2A79B 1COWG 1VQ6V 1WB8A 5IYZB 2FB5A 2XUMA 2QGNA 4Q20A 3ZRWA 1WNSA 1Y66A 2IJKA 4XDLA 3K08A 4FVMA 2Q4PA 4MSWC 3ASOC 3CS5A 5TISZ 2F4VB 3CWBH 4J42A 5GTHZ 2ZIOA 3ABMB 4GKJO 1Q6HA 1GK9A 2O57A 1X4TA 1SA0A 3MDSA 2KG7B 1SQVH 2VWKA 3K5OA 2AHYA 2ZR3A 4UCVA 5KA6A 4DV7O 2ZNJA 5CBHA 2WA3A 1FD9A 3K79A 4EB6A 3CJHB 4W4KA 4DV1B 2EIJC 1WPBA 3WU2Z 1XL6A 3CCMV 1V55B 4OXSA 4UXNA 2JS5A 3FAVA 4GCZA 3UO2A 2DWEC 5CA3A 4HYOA 3NR7A 4FFKA 3K06A 4FLZA 4X65O 3JD1A 3ASNB 4JV5B 4JI1B 4R7CA 4PHZA 2W0XA 5IYZA 4LF5B 4LF6O 1FAFA 5C93A 1L1FA 3E8FA 3CD6V 3WB1A 3ZRSA 3O9OA 3SPJA 5LMNO 4DUYO 4PA6A 4UUJC 2LP7A 1JR9A 5JVDA 2Y0PA 1HNXB 2BOBC 5IJ0B 1JOYA 5GW7A 1RP3B 2YC0A 3W7WA 4FLVA 4JI0O 1QLEB 1CPYA 1YJNV 3IC9A 3S3WA 4I9QA 1HWYA 4NVPA 4ZOLA 4BIZA 1BHAA 4MVSA 5ITZB 5LHHA 2F95B 3IFXA 4J10A 4F4LA 3GWOA 4O4JA 3ZMZA 4WFEA 4MVMA 2Q8VA 3ZMVA 2PGGA 4NTYA 3BABA 5LGUA 1NR7A 1EBOA 3H1LH 3ZIAG 2YIBD 3UM7A 5EBWC 3ZRXA 1K3EA 3LUTB 4YHHO 4QJFB 1Q6IA 1S0VA 1VQ9V 3HKBA 1JFFA 5B3SC 4O4IA 4I55B 4LCUC 5IJ0A 4X64O 1PL4A 1CP9A 3QVNA 2X0LA 2B1IA 5DN6G 3CRMA 3D8CA 1GRJA 3CB2A 2DWDC 1VQPV 1ZSPA 1HR0B 1P4RA 1IDSA 2DYRC 2JGUA 1GN4A 5LXTB 5CA0B 4DRXB 5KLVH 1V55C 5L3DA 3BAAA 3L72H 2PY5A 3CEIA 3JALB 4J11A 4ZBMA 2UXBB 2UXCB 5IWAB 2VS0A 3CC7V 1B6QA 3T4DA 5B1NA 2EINB 2DYSB 4R6ZA 4LF9B 1NQTA 1MZEA 3OGIB 1AP6A 2Q7GA 2ITDC 3JCZA 2LFSA 1XMQO 3CCRV 3ZN1A 3OR6C 2Q73A 4MVOA 4K8XA 3K04A 4I55A 3QO8A 4DR3O 2WLKA 3R65A 2JDIG 5FPRA 3LSQA 4EEQA 5KHIA 4DW0A 4JI7O 4GT1A 1I7FA 2ZM6B 1ENVA 4IHJB 2Q67A 1P7BA 1M4UA 1Z5WA 3CCVV 1QLEC 3O65A 1CEZA 1K97A 5LXTA 4DR7O 4DRXA 2F66C 3B4SA 4PA9A 4I5SA 1FXKB 1SKVA 2JRIA 2RMKB 3A0BZ 1OCZB 5LA6B 1YEWA 1Y76B 3AG4B 5CN0A 1Q3EA 2HJDA 1Q43A 4LBEC 4UVAA 3RYHB 5F2VO 3TETA 4B3TB 2K9PA 4WBNB 5JCOA 4DV4B 1N0JA 4G27B 4N23A 4PDMA 5A9GA 4PA4A 1M1KW 1HNWO 2CTPA 1BQ0A 1Y6XA 4QGPA 1M5IA 2PYLA 5FPOA 3CCLV 4L8JA 4DR5B 1DLBA 4TT3G 3IGAC 2L6LA 2BOCC 3CXCU 1XHXA 1YJ9V 1KU9A 2A7WA 4MTOA 1SQGA 2VQFB 2ZT9B 4CH6A 2UUCO 2XAJA 3S3XA 2YI9A 4B3SB 1R3KC 4ZI7B 3ETQA 4NXNO 4DR6B 3F5TA 3KCYA 4MVZA 5LA6A 4R50A 4UFZA 1AI6A 1Y76A 2XHBA 2CGNA 4JAVA 1DF4A 4OPAA 2Q7EA 2QKCA 1DTOA 3UT5A 1KKCA 3HKDB 3RYHA 4IYHA 2DYSC 1SESA 4B08A 4WBNA 4R8CA 1MOFA 1K5QA 2N74A 4FJCC 2HVKC 5LBQA 3E89A 2QE7G 1K73W 5KHJA 2ADPA 2BSKB 5IYDO 1V54C 3E86A 1HW7A 1FXVA 1X59A 1WLEA 4CH3A 1MA1A 3J7AU 2W6JG 1SQFA 1XNRO 4O4HA 4PDLA 2XTAA 4FFBB 1AB3A 2PUSA 4JI4O 1YZBA 4ZI7A 4CC6A 3D36C 3HKEB 4WFHA 2OIEA 1D5AA 4FLXA 5LMUB 1FXKC 2QM4A 5GTIZ 1GM8A 2EX3A 1KKDA 4GKKO 3E83A 1JPXA 1R6KA 2HG5C 1J95A 3E8BA 4JI8O 1O9GA 3HKDA 1R73A 5JJJB 5EZYB 2GDSA 3OTFA 1TA8A 3AG1C 4CC5A 4FIPC 5BXZA 1KD1W 4CS4A 2FKXA 4UCSA 2PF4E 2BSKA 2LFRA 1QQCA 4UVCA 4X66B 3MAQA 5CMUA 2IJIA 2JGDA 2HLDG 4NTWA 4D7SA 2WLLB 4I50B 3B77A 4LFAO 1IX9A 3HKEA 1TVKA 2RN9A 1SC5B 5JWPA 4GKJB 5K1PA 2ZDIA 4K0KB 1QU7A 2WLIB 1SS3A 4DV7B 4PV1B 5IJ9B 5EZYA 2YIDA 1RFYA 1F23A 2CK3G 5LOVB 1FJGB 3ZMUA 2LQTA 4CS3A 2ZINA 5K1XA 3BA8A 4FLYA 3K0GA 3ABKC 3RGBA 1FPOA 2R9AA 5B1AC 2NR5A 4WF9V 4H44B 3WG7C 1GN6A 1H8HG 1IBMB 3T2MA 1YHQV 4FMTA 5FNVB 2CDYA 4JI6O 4LF6B 3N2GA 4Q6GA 4F6RB 5BY1A 3SR2C 2XAFA 2WLLA 2P06A 4I50A 2WSSG 2HR3A 2QM7A 2YIBA 1IXMA 3QTCA 5JH7B 4B7EA 4NKGB 4MTGA 5LL6Y 2FYUH 4UVBA 2Q5ZA 2WLIA 4DR2O 1MSDA 1D5NA 2JIZG 1R6NA 3BCCH 1RPOA 1FXHA 3CRQA 5IJ9A 3OE7G 3SYOA 1F4NA 1AR5A 4U7NA 2G38A 1UPGA 1VF6A 5LOVA 5KA5A 1Q5OA 3ZRWB 1E79G 3FYEB 1QCEA 3I56V 4XBFA 2WPDG 4ZKIA 3AG7A 4TV9B 1I94B 5IT9N 4PI2A 5BR8B 3SYAA 2DW4A 2Q68A 5D5QA 2E74B 4UCRA 3OR7C 1NTKH 2GBOA 4YJ3B 2Q0OC 5LYJA 4J41A 1Q6UA 5KUMA 4F6RA 3UCSC 4TQDA 1S5JA 3JARB 2W6IG 4YHHB 1Q86W 5FL7G 5KMGB 5FLXN 5LP6C 1K92A 1RM1B 1OZ0A 5EC2C 3U10A 5JH7A 3OMIB 2DJVA 3AG3B 1OCRB 2ZXWB 1BMFG 4K3AA 2RCVA 1GAXA 4WFAV 4DR1O 3T1YB 4JASA 2BE3A 2QWQB 4JZGA 3JD2A 2X6CA 2UUBO 4LFCO 2WA4A 3LSUA 2ZE6A 2ODMA 4HBNA 5CB4B 4TV9A 2E5LB 4LH7A 3LNMB 1H38A 1KQSU 5HFMA 4K8ZA 2EZOA 3ZMSA 1VQ7V 2N05A 4JTCB 5JVDB 1P7GA 4YJ3A 2YUAA 2IU0A 2GV9A 1XMOO 3RW0A 3FB7C 3B8MA 3HPLC 3JARA 1M56B 3RYCA 2ATKC 5KMGA 5EYPA 4TUYA 4PA3A 4CH4A 1R1BA 4JI2B 2CTWA 3KKYA 1GKFA 1KMIZ 1VMGA 1XMQB 5H5NA 4ZOLB 4BR6A 4I7ZB 3CPWU 2ZR2A 2WLMA 1DK1A 4X9QA 2AW9A 3FKSG 4QNHB 4O4JB 3OFNG 2OTLV 1NR1A 1NKDA 1WP8A 4I4TA 1DGSA 1PNMA 2P4KA 2Y4UA 2R72A 1PNLA 2JJ2G 3B09A 3ZMTA 5CB4A 1WN7A 2VQEB 1HNZB 3MD0A 2QWRB 2DQ0A 1SQQH 1VQMV 4B3RB 3SDLA 3HKBB 4MW8A 3SYCA 3QO7A 4ABMA 5J9PC 1YTFD 1AI4A 3BVOA 1MABG 3T1HB 1AJNA 1JFFB 1LUVA 3I55V 2GSMB 4X1KB 2DOSA 4DUZB 1N36O 4KP4A 4O4IB 3A8TA 2NLJC 3UO3A 2H3OA 1E1RG 4X62O 1BQZA 2F43G 3U0ZA 4J7KA 4EKWA 1KP3A 2F23A 5JJNB 5H9CA 3STLC 4IIJB 3SJCC 1RM1C 4J7JA 4DV2B 5H6QA 1NVPD 3AG3C 1OCRC 1YJWV 4LP8A 1K34A 4EFBA 1R6TA 4JAAA 2KKWA 2QDOA 2UUAO 2HEPA 1JJOA 2JEXA 3JD3A 1IBKB 5JQGB 3EXAA 5KHKA 2ZNIA 1F51A 3ZHQA 4JYAB 3OTOB 3X2QB 4X20B 2A06H 1SQBH 5KHGA 3F7VC 4AQYB 4XDKA 4BW9A 1NZ6A 4QPKA 4DV6O 5B5EZ 2PI4A 4FK5C 4DV3O 4TOIA 4X1KA 3ABMC 3ZJZA 3SPGA 3JD4A 3ETDA 3ZHTA 3CRRA 1AI7A 2DMXA 2RJZA 5E79Z 2QA4V 1SZTA 4O4LA 1VARA 1YCIA 4IIJA 3RVYA 2P67A 2HJFC 1T5EA 1BE3H 3C3TA 3K57A 3FD9A 2AZ2A 1IBLB 5CBFA 3KZIZ 1VQ5V 2Y69B 2X7RB 1WA8B 4E4EA 5JQGA 2HHHB 3TK1A 3ASNC 3NXSA 4CZZA 5E1AC 1EN6A 1OCCB 3SPCA 4DK1A 4JYYA 4X20A 3F7YC 3VQWA 3RYFA 2BCCH 2F4VO 2OIGA 4X8AA 1M9NA 1SQPH 1K4CC 2LGWA 2CTQA 3SJQC 3L73H 4WFGA 4LFBO 3J81N 3H1JH 4OGQB 3THOA 4LF4B 1I5XA 4LNUB 2GTSA 4ZHQA 1UJWB 1S77D 1PNKA 5EIBC 4K35A 4DV0B 4LF7B 4GX0A 3OAAG 5LGTA 1G6UA 4GLXA 2KQXA 1SETA 2EILB 3CCQV 1TAEA 2B5UA 1Z2GA 1Q7YW 4JV5O 1N33B 1WA8A 4JI1O 4DO2A 4BIUA 4LF5O 4B7KA 1URFA 2ARHA 2CTRA 4D6TH 2EIMB 5KHHA 1RPRA 1KECA 3UT5B 3TGUH 3G71V 2ZE8A 2UU9O 1YI2V 1I08A 3PJSK 4NR1A 3K9SA 3EHBB 1QLNA 4ASUG 5JJEB 3K58A 3E22B 4NXMB 4QE7A 1E1QG 4RQFA 4P9OA 3ZHSA 4LNUA 3E8HA 1XDCA 3N2KB 3OM3B 3JYCA 2ITCC 4O4HB 3IAYA 1YF2A 1NI8A 3H1IH 1QVFU 5IE9A 2UXDO 2P22C 1ROPA
chains in the Genus database with same CATH topology
3ZRWA 1AJQA 5HFLA 2YEVB 1Y66A 2IJKA 4XDLA 2MK3A 3K08A 4MSWC 2WLJA 2Y69C 3ASOC 1AROP 1F23A 2CK3G 3HB3B 3M99B 2B1GA 1K8AW 3ZMUA 3E35A 4JTDB 2W0FC 3ABMB 1GK9A 2EINC 3K0GA 3ABKC 5B1AC 4WF9V 1EFRG 3ABUA 2AHYA 1OCCC 3WG7C 5L3EA 2ZR3A 5LHGA 5KA6A 3UKMA 1H8HG 5EC1C 3T2MA 3TCUA 5CBHA 1YHQV 4FMTA 3K3WA 3W7SA 3K79A 2QM8A 3CYOA 2EIJC 3CCJV 1XL6A 5LHIA 3CCMV 2XAHA 2XAFA 1V55B 2WLLA 3ABLB 4OXSA 3ABTA 1NBMG 2UXXA 2WSSG 2XAQA 4UXNA 2HR3A 3OGCC 3K0DA 4G2KA 4GCZA 2QM7A 1IXMA 2DWEC 5CA3A 3CCSV 4HYOA 3K06A 3JD1A 3ASNB 4MTGA 3E8GA 3QO5A 4R7CA 1GTOA 4UVBA 2WLIA 5C93A 1L1FA 3E8FA 1V54B 2YEVA 2JIZG 1R6NA 1JQ0A 3CD6V 1RPOA 1FXHA 1PL0A 3OMNB 3OE7G 3SYOA 1F4NA 3T4ZA 3LDDA 3ZRSA 4CBCA 2C2AA 1JJ2U 4U7NA 1NJIW 3SPJA 5KA5A 2AHZA 1OCZC 4PA6A 3ZRWB 1E79G 3F5WC 3FYEB 2IJJA 4UUJC 3W7UA 1QCEA 2LP7A 3I56V 3BY6A 4XBFA 2WPDG 4ZKIA 3H01A 3AG4C 2BOBC 4UV9A 4JYCA 1JOYA 3SYAA 2DW4A 2Q68A 4JF3A 1ORQC 3CP1A 5GW7A 3OR7C 3W7WA 3LDEA 3FYIB 1QLEB 5L3CA 1CPYA 1M57B 1YJNV 2OCCB 5KUMA 3X2QC 1HWYA 2HKOA 2YSUB 4BIZA 4DXWA 3LDCA 4MVSA 1BHAA 2W6IG 1Q86W 5EBLC 5FL7G 2Z3YA 5DM6V 2OT5A 2EBOA 5LHHA 1K92A 1RM1B 1NVPB 1S5HC 3VOUA 1EZJA 1OZ0A 3IFXA 5EC2C 4F4LA 1OCOB 3OMIB 3GWOA 3AG3B 3ZMZA 1OCRB 4X88A 2P6JA 2H8PC 4WFEA 4MVMA 1THZA 2ZXWB 1BMFG 3ZMVA 3AG1B 5LGUA 1NR7A 1EBOA 1DF5A 1JVMA 3ZIAG 3UM7A 4PA7A 4WFAV 5EBWC 4P9PA 3ZRXA 1K3EA 4JASA 3LUTB 4QJFB 3DGEA 3JD2A 2X6CA 1QR8A 1XL4A 2XASA 2HFEC 1S0VA 1K9MW 1VQ9V 1QVGU 3ZN0A 3W7XA 5B3SC 4N21A 5H6RA 2JEUA 4LCUC 5IYBO 1CP9A 3LNMB 1H38A 1KQSU 2X0LA 3D36A 5HFMA 2B1IA 2EZOA 3ZMSA 4KUMA 5DN6G 1VQ7V 3OEEG 2WLHA 4JTCB 3AG2B 2IU0A 4HAMA 4GX2A 4FPPA 1FXKA 2DWDC 2QKSA 3FB7C 3RW0A 3B8MA 3HPLC 3ML0A 1VQPV 1R3LC 1M56B 1P4RA 2DYRC 2ATKC 3STZC 4H33A 4MTXA 4U7OA 4PA3A 4E2LA 1V55C 3ABLC 5L3DA 3ASOB 1GKFA 3CMAV 4JGSA 5L3BA 1R3IC 1PKXA 2WWWA 3CPWU 4ZBMA 2R9IA 3AEIA 2ZR2A 3CC7V 1B6QA 3T4DA 5B1NA 1GMGA 2WLMA 4MTFA 3QNEA 1SRYA 2DYSB 2EINB 3ABKB 4R6ZA 5B1AB 4L87A 1NQTA 3FKSG 4QNHB 3WG7B 3OFNG 2OTLV 4RAIA 2JJ1G 1NR1A 1NKDA 3K03A 3W7TA 4TSFG 2XNDG 1PNMA 2ITDC 3JCZA 1PNLA 2QTOA 3IC7A 2LFSA 2PI5A 2JJ2G 2ZDIC 3CCRV 3ZN1A 1H2GA 3OR6C 3ZMTA 2EIJB 1GO3F 2EILC 4MVOA 1G8MA 1PD3A 4QPJA 5LGNA 5IY5B 3K04A 3ZCCA 2K1EA 3MD0A 3QO8A 2WLKA 3R65A 4J9YB 2JDIG 2DQ0A 2A0LA 4P2ZA 4TWKA 3CCUV 1VQMV 4Z1MG 4MW8A 4PDVA 3QO7A 3SYCA 3LSQA 5J9PC 1YTFD 1AI4A 1MABG 2EIMC 1H8EG 4GT1A 3SYQA 1AJNA 2HVJC 3I55V 1YTFB 4QE9A 2GSMB 2Q6AA 4KP4A 4PDRA 4RO2A 1ENVA 3D3IA 2Q67A 1W0KG 2NLJC 1P7BA 3OUFA 5EBMC 1E1RG 2WLNA 3CCVV 3MHHC 1QLEC 5IYCO 1CEZA 2F43G 1K97A 1BHBA 2OCCC 2X6AA 3DTUB 5B1BB 4PA9A 3VBBA 4EKWA 1KP3A 4I5SA 2OTJV 1FXKB 5H9CA 3STLC 2JK5C 1OCZB 1VQKV 1RM1C 1NH2B 3SPHA 1YITV 5H6QA 1NVPD 3AG3C 1OCRC 1YJWV 4LP8A 1TUEB 3A0RA 1K34A 4UV8A 4RUFA 1Y4MA 3AG4B 5CN0A 4G28B 1JX9A 4LBEC 1FFTB 4UVAA 4RQEA 3OMAB 4LC1A 4MVUA 2JEXA 3JD3A 3ZRVA 3TETA 3T1CA 1GM7A 1F51A 2EZPA 3JD0A 4G27B 4N23A 1YIJV 4PDMA 4PA4A 1M1KW 4WFBV 4XDJA 3X2QB 4GX1A 3CCLV 1VQNV 1DLBA 4TT3G 3SPIA 1QR9A 4JTAB 3F7VC 4XDKA 3IGAC 2ZQMA 2H94A 2BOCC 4QPKA 3CXCU 1VQLV 1YJ9V 2PI4A 1VQOV 4FK5C 1I5YA 2Z5UA 1JCHA 5EK0A 1AR1B 4MTOA 3ABMC 4PELA 1GM9A 3ZJZA 3SPGA 2GHYA 1QBZA 2DQ3A 3JD4A 3CCEV 3ETDA 1KC8W 2XAJA 2EIKB 1AI7A 2XOKG 4GX5A 1M90W 1R3KC 3P32A 2QA4V 1R3JC 1SZTA 4JAUA 4MS2A 1K33A 3FB6C 3OUSA 3RVYA 2P67A 5BZBA 2HJFC 4MVZA 4MVRA 4R50A 2V1DA 3ETGA 1AI6A 5IDJA 5CBFA 1W2BU 2IU3A 4JAVA 1VQ5V 1DF4A 4J9ZB 5B3SB 2Y69B 2X6BA 2X7RB 1DTOA 1OHHG 3EFFK 3RVZA 2DYSC 1SESA 3SYPA 3OW2U 2V7QG 3CC2V 4R8CA 2P7TC 1MOFA 2IJHA 3TK1A 3LSSA 3ASNC 3NXSA 1S3JA 1K5QA 4CZZA 5E1AC 1OCCB 4FJCC 3SPCA 2HVKC 5LBQA 3E89A 1F4MA 2QE7G 4QIWF 3F7YC 1K73W 1BL8A 2DYRB 5IYDO 1V54C 3P30A 4BAYA 1AI5A 3E86A 4X8AA 2IH1C 1M9NA 4BW5A 1FXVA 5IY5C 1K4CC 1WLEA 1Q82W 5L3FA 3SJQC 2KB1A 4KFMA 4WFGA 2W6JG 1MG1A 1KP2A 2Y48A 4MW3A 4PDLA 3RBZA 1I5XA 3BEHA 1UJWB 1VQ4V 3ETEA 1S77D 1PNKA 2ZD9A 1VQ8V 5CBGA 3FB8C 4WFHA 3WFVA 4GX0A 3OAAG 5B1BC 5LGTA 2A9HA 2R9RB 1M57C 2UXNA 1FXKC 1K5SA 1Q81W 1GM8A 1KKDA 4RUEA 1SETA 2EILB 3E83A 1JPXA 1R6KA 3FB5C 2HG5C 1J95A 3CCQV 4H37A 3E8BA 2B5UA 5L3GA 1Q7YW 1R73A 3G4SV 1NH2D 4DO2A 4BIUA 3OEHG 4MT8A 1OCOC 4WFFA 1WPXA 2EIMB 2Q69A 2ZXWC 1RPRA 1KECA 3AG1C 2M7WA 4FIPC 3CC4V 2NNUA 3G71V 1S72V 1KD1W 3K9AA 4JPRA 1ZWIC 1YI2V 3MHSC 2LFRA 4X89A 3PJSK 2EJRA 1SERA 2WAMA 3EHBB 1QLNA 3E2EA 4UVCA 4ASUG 5B1OA 5CMUA 3G6EV 2IJIA 2HLDG 2IW5A 4Q20A 2QEXV 4QE7A 1E1QG 4WCEV 1G4YB 1FS0G 1K4DC 2XAGA 4RQFA 3GB7C 2P90A 1N8RW 4P9OA 2D3OW 4I9WA 1MSWD 1AJPA 4HZ3A 1YSCA 1LNQA 2IH3C 2WLLB 1K7DA 3E8HA 1W0JG 3B77A 5KUKA 3OM3B 4MVQA 3JYCA 4YXWG 1S76D 2ITCC 2FTKA 2EIKC 3CMEV 4JYBA 4P30A 3AG2C 1QVFU 3KG2A 1ROPA 2ZDIA 2A79B 1COWG 1VQ6V 3B8NA 2WLIB 1M56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  1VQP V;  2OTL V;  1VQN V;  1N8R W;  1K9M W;  1VQ4 V;  1YJW V;  2D3O W;  1VQ9 V;  1YHQ V;  3I55 V;  1QVG U;  1K73 W;  1VQ8 V;  3CXC U;  1VQL V;  1YJ9 V;  1W2B U;  1VQO V;  3CC4 V;  3G71 V;  3CCV V;  1S72 V;  1KD1 W;  3CCJ V;  1VQ5 V;  3CCR V;  1YI2 V;  3CD6 V;  3CMA V;  1K8A W;  3CCM V;  1Q82 W;  4WFA V;  1Q81 W;  1KQS U;  3CPW U;  3CME V;  1YJN V;  3CCE V;  1JJ2 U;  1YIJ V;  1NJI W;  1KC8 W;  1QVF U;  1VQ7 V;  3CC7 V;  3G6E V;  3OW2 U;  1M1K W;  4WFB V;  2OTJ V;  4WF9 V;  3CCQ V;  1M90 W;  3CC2 V;  3CCU V;  1VQK V;  1VQ6 V;  1VQM V;  2QA4 V;  3CCS V;  1Q86 W;  1Q7Y W;  1R73 A;  5DM6 V;  3G4S V;  1YIT V;  3I56 V;  4WCE V;  2QEX V; 
#chains in the Genus database with same CATH topology
 1AJQ A;  4FLT A;  5HFL A;  2YEV B;  2WLJ A;  2Y69 C;  3QF7 A;  3HKC B;  4KHP B;  3SJB C;  4JI6 B;  2B1G A;  2YXH A;  2D2C B;  3E35 A;  4FZ0 A;  4JTD B;  2W0F C;  1ZAU A;  2EIN C;  1HP8 A;  5C8Y B;  4FM0 A;  1OCC C;  2LJ2 A;  1AVM A;  2JS3 A;  3TCU A;  3ZED A;  1ZL8 B;  3E22 A;  4JI5 O;  5JCO C;  1XUQ A;  2QTS A;  2YDE A;  3CYO A;  2PTM A;  1U96 A;  2XAH A;  5KAI Z;  1XI1 A;  2JGD B;  1NBM G;  2UXX A;  2XAQ A;  3C90 A;  4ICG A;  3OGC C;  3K0D A;  1IZ3 A;  3N2K A;  1HDJ A;  4DR4 O;  4LWS B;  1HR0 O;  5KX5 B;  1F7Y A;  3E8G A;  3K5L A;  5J2U B;  3DXR B;  3VQX A;  1GTO A;  1TVK B;  2QR4 A;  2YEV A;  4NTX A;  1CXZ B;  2UXB O;  4IYI A;  2UXC O;  1PL0 A;  4KXR A;  4FLU A;  5IWA O;  3EVK A;  3T4Z A;  1U97 A;  3JAS B;  3HKC A;  2C2A A;  1JJ2 U;  1NJI W;  3UQ8 A;  4LF9 O;  1OCZ C;  2IJJ A;  3W7U A;  5C8Y A;  3AG4 C;  2Q0A A;  4JYC A;  3CRA A;  1ORQ C;  1NU1 H;  1ZL8 A;  3APO A;  2R70 A;  1M57 B;  1LR1 A;  4DR1 B;  4OX9 B;  2YSU B;  4DXW A;  1H2S B;  3LDC A;  4YY3 B;  3L71 H;  2OT5 A;  2EBO A;  2ZM6 O;  1NVP B;  1S5H C;  3VOU A;  2UUB B;  4LFC B;  3N2G B;  4LWS A;  2V4D A;  1OCO B;  2P6J A;  2H8P C;  5KX5 A;  1THZ A;  1N34 O;  1MMM A;  5J2U A;  3DXR A;  3JAM N;  1DF5 A;  1JVM A;  4PA7 A;  3JAT B;  2E76 B;  1BS3 A;  2OYQ A;  3RT3 C;  3JAS A;  1QR8 A;  1XL4 A;  2XAS A;  4J7Z A;  1XMO B;  1K9M W;  1L0L H;  4B3M O;  3ZN0 A;  4B3T O;  3B40 A;  2EUL A;  4HNA B;  4DV4 O;  2JEU A;  3SJA C;  4DYL A;  2CAZ C;  3BA9 A;  3OEE G;  2WLH A;  3AG2 B;  4HAM A;  4DR5 O;  1PPJ H;  4FPP A;  2QKS A;  3ML0 A;  2FML A;  1GN2 A;  4X65 B;  3STZ C;  4U7O A;  3CX5 F;  5LYJ B;  2VQF O;  4O2B B;  3ASO B;  4JGS A;  5BMV B;  4JI3 O;  1XQ8 A;  1PKX A;  2WWW A;  2LO1 A;  4B3S O;  3TXQ A;  5AG2 A;  4MTF A;  1NTM H;  3QNE A;  3OD4 A;  4A5U B;  1BZK A;  3JAT A;  5LMN B;  1AR4 A;  4L87 A;  4DUY B;  2F93 B;  4RAI A;  3W7T A;  3M7M X;  2HP8 A;  2XND G;  1O9H A;  3P3P A;  4YIO A;  3BFR A;  2PI5 A;  3ZHV A;  4DW1 A;  2ZDI C;  2EIJ B;  4X62 B;  4HNA A;  1G8M A;  1PD3 A;  2ILM A;  5LGN A;  4FLW A;  4JI0 B;  4J80 A;  3FX7 A;  4LR3 A;  2K1E A;  3CCU V;  1PV0 A;  4TWK A;  4Z1M G;  3DC6 A;  2PYJ A;  1BSM A;  3R66 A;  3K5N A;  3SYQ A;  2HVJ C;  4QE9 A;  3L70 H;  3RYI B;  1OJH A;  3L75 H;  1XBL A;  1B04 A;  4PDR A;  4RO2 A;  3D3I A;  2CUG A;  5EBM C;  1XNQ O;  5IYC O;  2P4V A;  2YXL A;  2X6A A;  3M8A A;  1ZX3 A;  3DTU B;  3VBB A;  1VEW A;  4X1Y B;  4O2B A;  5BMV A;  1Y74 B;  3RYC B;  3SPH A;  3KCX A;  5EYP B;  4UCU A;  4TUY B;  3A0R A;  1L0N H;  4UV8 A;  1Y4M A;  1EN5 A;  4G28 B;  4LF8 O;  1FFT B;  4RQE A;  3C3S A;  5LMU O;  3OMA B;  2AXT Z;  4DV6 B;  4MVU A;  3ZRV A;  4CH5 A;  4O2A B;  1WB7 A;  4X64 B;  2EZP A;  1YIJ V;  4WFB V;  2OWO A;  2RQ6 A;  3JAW A;  4I4T B;  3JSL A;  2DN9 A;  3SPI A;  1B3Q A;  1QR9 A;  2ZCE A;  1KUQ A;  1VF6 C;  1I5Y A;  3RYI A;  5EK0 A;  4DV5 O;  1GM9 A;  4X66 O;  2GHY A;  2DQ3 A;  3CCE V;  1KC8 W;  1FKA O;  2EIK B;  1M90 W;  4GX5 A;  2MW2 B;  1N0N A;  3P32 A;  3CRC A;  4X1Y A;  1FFX B;  3ICX A;  1K33 A;  3FB6 C;  4D7T A;  1Y74 A;  3A2F A;  4UCT A;  2P5O A;  2BTQ B;  3ETG A;  3G80 A;  2QWP B;  3DSQ A;  4J9Z B;  5B3S B;  4PJ0 Z;  3EFF K;  1N32 O;  3RVZ A;  1I0H A;  4K0K O;  4O2A A;  1NS1 A;  1QHT A;  3L74 H;  4LFB B;  3CC2 V;  2P7T C;  3G6B A;  3LSS A;  1S3J A;  4U3F H;  4DR3 B;  1VP7 A;  1YXB A;  1BL8 A;  2DYR B;  4JI7 B;  4BAY A;  3P30 A;  1FJG O;  4BW5 A;  3QG5 A;  1Q82 W;  4GZR B;  1SQX H;  1QNM A;  4KFM A;  2ZKO A;  2QJ1 A;  4DR7 B;  2ZE7 A;  1MG1 A;  5DEC A;  3LNN A;  1IBM O;  1KP2 A;  4PI0 A;  2ZD9 A;  4C7U A;  1VQ8 V;  1FFX A;  3FB8 C;  4EFE A;  4GUN A;  4H0L B;  2BTQ A;  2A9H A;  2R9R B;  3CSX A;  2UU9 B;  1H2K A;  3JSN A;  1Q81 W;  1A32 A;  3GWK C;  1UFI A;  4O4L B;  3ZS8 C;  1H2L A;  3G4S V;  1NH2 D;  2KG7 A;  1J5E O;  1HNW B;  4DK0 A;  1KB9 F;  3OEH G;  4FM2 A;  4YJ2 B;  4WFF A;  1WPX A;  3IJ4 A;  2ZXW C;  2LW1 A;  4LH6 A;  2NNU A;  1VIB A;  4JPR A;  3MHS C;  2ETN A;  2YI8 A;  4X89 A;  3CJH A;  2F1M A;  3BPZ A;  2WAM A;  2RNB A;  3E2E A;  2Q7H A;  3G6E V;  2UUC B;  1WAZ A;  3I5D A;  1H2N A;  2IW5 A;  4CS2 A;  4WCE V;  1I94 O;  3RYF B;  2UXD B;  2XAG A;  3GB7 C;  2N04 A;  2D3O W;  1MSW D;  5BR8 O;  1AJP A;  4HZ3 A;  5H2F Z;  4NXN B;  1YSC A;  1LNQ A;  1US6 A;  2IH3 C;  1K7D A;  3FFQ A;  1S76 D;  2FTK A;  2EIK C;  3CME V;  3APQ A;  2IBZ H;  4ZHQ B;  1TGO A;  3B8N A;  1SZX A;  3BHP A;  1M56 C;  1BCC H;  2MK3 A;  1TUB B;  4JI5 B;  1Q8I A;  4YJ2 A;  2Y0I A;  1ARO P;  1D2D A;  3HB3 B;  3H9V A;  3M99 B;  1XIL A;  3T1Y O;  1K8A W;  1ZUQ A;  1L8D A;  1EFR G;  3ABU A;  5L3E A;  5LHG A;  4DR4 B;  3UKM A;  1XNR B;  5EC1 C;  3HR0 A;  1WJZ A;  5ITZ A;  3K3W A;  4JI4 B;  3W7S A;  4PD4 F;  1JA8 A;  2QM8 A;  3ZHU A;  2E5L O;  2YIA A;  3U11 A;  3CCJ V;  4U3J B;  5LHI A;  3ABL B;  3ABT A;  2A3Q A;  4G2K A;  1PP9 H;  4GKK B;  3CCS V;  1ZTE A;  1Z5V A;  2QKA A;  4JI8 B;  3QO5 A;  4JI2 O;  4DV1 O;  2JVD A;  1YVW A;  1V54 B;  1JQ0 A;  2IM9 A;  5B66 Z;  1TUB A;  3OMN B;  3LDD A;  4CBC A;  2QWO B;  3RWR D;  2AHZ A;  3Q4H B;  3TJT A;  3F5W C;  2ZE5 A;  2EJ7 A;  3RN4 A;  3BY6 A;  4X1I B;  2CE4 A;  2KSD A;  3H01 A;  1GN3 A;  4UV9 A;  4JF3 A;  1RSO B;  2RDC A;  3CP1 A;  1WP7 A;  4TV8 B;  1XHZ A;  5CA0 A;  4I0X B;  1N34 B;  3LDE A;  3FYI B;  2PZS A;  2VQE O;  1BGY H;  4LFA B;  1HNZ O;  5L3C A;  1KYO F;  2OCC B;  4B3R O;  3X2Q C;  3JAL A;  2HKO A;  4U3J A;  1XEQ A;  3T1H O;  5EBL C;  2Z3Y A;  5DM6 V;  1HNX O;  2CGO A;  4DUZ O;  5KAF Z;  1LUW A;  1EZJ A;  1MZF A;  4X88 A;  4B3M B;  3AG1 B;  4P9P A;  4DV2 O;  3DGE A;  3G67 A;  2CH7 B;  3Q4H A;  2HFE C;  4TQF A;  5J2T B;  1QVG U;  3W7X A;  2QSA A;  4UB6 Z;  4X1I A;  3J80 N;  1IBK O;  3ZBH A;  1EN4 A;  4N21 A;  2VRZ A;  5H6R A;  4JZ2 A;  3ZHR A;  2Z0A A;  1ZLZ A;  5IYB O;  4IHJ A;  1RSO A;  3D36 A;  4JYA O;  3OTO O;  4TV8 A;  4JI3 B;  4KUM A;  5CA1 B;  4I0X A;  2L35 A;  2OCH A;  3D3Q A;  4Z2W A;  4GX2 A;  4H13 B;  1FXK A;  2E3C A;  4AQY O;  1R3L C;  4AI8 A;  4H33 A;  4MTX A;  4E2L A;  3ABL C;  4DR2 B;  2Y4T A;  3CMA V;  4KL1 A;  5L3B A;  1EM1 A;  1R3I C;  2R9I A;  3AEI A;  1GMG A;  1MNG A;  1SRY A;  5A2Q N;  3ABK B;  4Z1V A;  5B1A B;  3PN1 A;  3WG7 B;  4AHC A;  2JJ1 G;  1IBL O;  3K03 A;  4TSF G;  4UB8 Z;  3BRC A;  2CH7 A;  3K59 A;  3VQY A;  5J2T A;  2QTO A;  3TXS A;  3IC7 A;  4FM1 A;  1XNQ B;  4UCO A;  1H2G A;  1GO3 F;  5GON B;  1B06 A;  1OV9 A;  1XOU A;  2EIL C;  2HHH O;  4QPJ A;  3AK3 A;  5IY5 B;  4IGG A;  3ZCC A;  2ADQ B;  4P2Z A;  4J9Y B;  2A0L A;  1XRE A;  5CA1 A;  4PDV A;  3K5M A;  1YTF B;  2EIM C;  1H8E G;  1KBH A;  2Q6A A;  1IVS A;  5EIB D;  3WB0 A;  1W0K G;  3OUF A;  2LGQ A;  1AIL A;  2WLN A;  4W4L A;  4LF8 B;  3MHH C;  4FZ1 A;  1BHB A;  1IUR A;  2OCC C;  3AK2 A;  5B1B B;  2OTJ V;  4LF4 O;  4BIO A;  2JK5 C;  1VQK V;  3SGI A;  2Q9L A;  1NH2 B;  1YIT V;  3VQV A;  1TUE B;  2FL4 A;  4DV0 O;  4RUF A;  1G1X B;  4LF7 O;  1JX9 A;  2QWN B;  2GUZ B;  4LC1 A;  3T1C A;  4DV5 B;  1GM7 A;  3JD0 A;  1W59 A;  4BWA A;  1N33 O;  1P84 F;  4XDJ A;  5DED A;  5GON A;  1YDX A;  4GX1 A;  1VF7 A;  1VQN V;  2NN4 A;  5LP6 B;  2YS8 A;  2GTA A;  1NT2 B;  3GVM A;  4FFB A;  4OPH A;  4JTA B;  2ZQM A;  2H94 A;  1IXB A;  1VQL V;  2B9Z A;  1VQO V;  2LW7 A;  2Z5U A;  4NB5 A;  1JCH A;  1AR1 B;  4IL6 Z;  4PEL A;  1QBZ A;  2DE0 X;  1N32 B;  4NXM O;  2XOK G;  1R3J C;  4JAU A;  4MS2 A;  1VF5 B;  3OUS A;  3CE2 A;  5BZB A;  4MVR A;  2V1D A;  5IDJ A;  1W2B U;  1EZV H;  1GH6 A;  2IU3 A;  1V9P A;  4IT5 A;  2X6B A;  2VWJ A;  1FYJ A;  1OHH G;  2GUZ A;  4YIP A;  3SYP A;  4GYC B;  3AK1 A;  3OW2 U;  2V7Q G;  2IJH A;  4DR6 O;  2BTO A;  3A0H Z;  3B2E E;  2E75 B;  1SF9 A;  1F4M A;  4ZIB A;  1P49 A;  4QIW F;  3H1K H;  4NYK A;  4KHP O;  3WB2 A;  1N4C A;  1AI5 A;  5LP6 A;  2IH1 C;  1N36 B;  1M93 A;  5IY5 C;  3H1H H;  5L3F A;  3JAK B;  2KB1 A;  3OT7 A;  3RFR A;  3JAW B;  1JMK C;  3DC5 A;  3RBZ A;  2Y48 A;  4MW3 A;  2M6Y A;  3BEH A;  1J5E B;  1VQ4 V;  3ETE A;  1AP5 A;  2XT9 A;  5CBG A;  3P3N A;  3WFV A;  1PM9 A;  1Y67 A;  5B1B C;  1M57 C;  2UUA B;  2UXN A;  1K5S A;  4RUE A;  3FB5 C;  4RWU A;  4H37 A;  5L3G A;  2AGA A;  3L9D A;  2ZIM A;  1H2M A;  4MT8 A;  2YXY A;  4AIL C;  1OCO C;  1Q90 D;  2Q69 A;  2M7W A;  5FNV A;  3CC4 V;  2YIC A;  1S72 V;  3K9A A;  1BT8 A;  1SA0 B;  1ZWI C;  1S5L Z;  2EJR A;  4DV3 B;  1SER A;  3CXH F;  5B1O A;  2AZ0 A;  4F6E A;  3CHX A;  3JAK A;  3ZX6 A;  2QEX V;  1NTZ H;  3JCU Z;  1G4Y B;  1FS0 G;  1K4D C;  4EB6 B;  1N8R W;  2P90 A;  5D5P A;  4I9W A;  3N27 A;  1W0J G;  5KUK A;  3FAV B;  4MVQ A;  4OX9 O;  4YXW G;  4YY3 O;  4JYB A;  4P30 A;  3AG2 C;  3KG2 A;  2A79 B;  1COW G;  1VQ6 V;  1WB8 A;  5IYZ B;  2FB5 A;  2XUM A;  2QGN A;  4Q20 A;  3ZRW A;  1WNS A;  1Y66 A;  2IJK A;  4XDL A;  3K08 A;  4FVM A;  2Q4P A;  4MSW C;  3ASO C;  3CS5 A;  5TIS Z;  2F4V B;  3CWB H;  4J42 A;  5GTH Z;  2ZIO A;  3ABM B;  4GKJ O;  1Q6H A;  1GK9 A;  2O57 A;  1X4T A;  1SA0 A;  3MDS A;  2KG7 B;  1SQV H;  2VWK A;  3K5O A;  2AHY A;  2ZR3 A;  4UCV A;  5KA6 A;  4DV7 O;  2ZNJ A;  5CBH A;  2WA3 A;  1FD9 A;  3K79 A;  4EB6 A;  3CJH B;  4W4K A;  4DV1 B;  2EIJ C;  1WPB A;  3WU2 Z;  1XL6 A;  3CCM V;  1V55 B;  4OXS A;  4UXN A;  2JS5 A;  3FAV A;  4GCZ A;  3UO2 A;  2DWE C;  5CA3 A;  4HYO A;  3NR7 A;  4FFK A;  3K06 A;  4FLZ A;  4X65 O;  3JD1 A;  3ASN B;  4JV5 B;  4JI1 B;  4R7C A;  4PHZ A;  2W0X A;  5IYZ A;  4LF5 B;  4LF6 O;  1FAF A;  5C93 A;  1L1F A;  3E8F A;  3CD6 V;  3WB1 A;  3ZRS A;  3O9O A;  3SPJ A;  5LMN O;  4DUY O;  4PA6 A;  4UUJ C;  2LP7 A;  1JR9 A;  5JVD A;  2Y0P A;  1HNX B;  2BOB C;  5IJ0 B;  1JOY A;  5GW7 A;  1RP3 B;  2YC0 A;  3W7W A;  4FLV A;  4JI0 O;  1QLE B;  1CPY A;  1YJN V;  3IC9 A;  3S3W A;  4I9Q A;  1HWY A;  4NVP A;  4ZOL A;  4BIZ A;  1BHA A;  4MVS A;  5ITZ B;  5LHH A;  2F95 B;  3IFX A;  4J10 A;  4F4L A;  3GWO A;  4O4J A;  3ZMZ A;  4WFE A;  4MVM A;  2Q8V A;  3ZMV A;  2PGG A;  4NTY A;  3BAB A;  5LGU A;  1NR7 A;  1EBO A;  3H1L H;  3ZIA G;  2YIB D;  3UM7 A;  5EBW C;  3ZRX A;  1K3E A;  3LUT B;  4YHH O;  4QJF B;  1Q6I A;  1S0V A;  1VQ9 V;  3HKB A;  1JFF A;  5B3S C;  4O4I A;  4I55 B;  4LCU C;  5IJ0 A;  4X64 O;  1PL4 A;  1CP9 A;  3QVN A;  2X0L A;  2B1I A;  5DN6 G;  3CRM A;  3D8C A;  1GRJ A;  3CB2 A;  2DWD C;  1VQP V;  1ZSP A;  1HR0 B;  1P4R A;  1IDS A;  2DYR C;  2JGU A;  1GN4 A;  5LXT B;  5CA0 B;  4DRX B;  5KLV H;  1V55 C;  5L3D A;  3BAA A;  3L72 H;  2PY5 A;  3CEI A;  3JAL B;  4J11 A;  4ZBM A;  2UXB B;  2UXC B;  5IWA B;  2VS0 A;  3CC7 V;  1B6Q A;  3T4D A;  5B1N A;  2EIN B;  2DYS B;  4R6Z A;  4LF9 B;  1NQT A;  1MZE A;  3OGI B;  1AP6 A;  2Q7G A;  2ITD C;  3JCZ A;  2LFS A;  1XMQ O;  3CCR V;  3ZN1 A;  3OR6 C;  2Q73 A;  4MVO A;  4K8X A;  3K04 A;  4I55 A;  3QO8 A;  4DR3 O;  2WLK A;  3R65 A;  2JDI G;  5FPR A;  3LSQ A;  4EEQ A;  5KHI A;  4DW0 A;  4JI7 O;  4GT1 A;  1I7F A;  2ZM6 B;  1ENV A;  4IHJ B;  2Q67 A;  1P7B A;  1M4U A;  1Z5W A;  3CCV V;  1QLE C;  3O65 A;  1CEZ A;  1K97 A;  5LXT A;  4DR7 O;  4DRX A;  2F66 C;  3B4S A;  4PA9 A;  4I5S A;  1FXK B;  1SKV A;  2JRI A;  2RMK B;  3A0B Z;  1OCZ B;  5LA6 B;  1YEW A;  1Y76 B;  3AG4 B;  5CN0 A;  1Q3E A;  2HJD A;  1Q43 A;  4LBE C;  4UVA A;  3RYH B;  5F2V O;  3TET A;  4B3T B;  2K9P A;  4WBN B;  5JCO A;  4DV4 B;  1N0J A;  4G27 B;  4N23 A;  4PDM A;  5A9G A;  4PA4 A;  1M1K W;  1HNW O;  2CTP A;  1BQ0 A;  1Y6X A;  4QGP A;  1M5I A;  2PYL A;  5FPO A;  3CCL V;  4L8J A;  4DR5 B;  1DLB A;  4TT3 G;  3IGA C;  2L6L A;  2BOC C;  3CXC U;  1XHX A;  1YJ9 V;  1KU9 A;  2A7W A;  4MTO A;  1SQG A;  2VQF B;  2ZT9 B;  4CH6 A;  2UUC O;  2XAJ A;  3S3X A;  2YI9 A;  4B3S B;  1R3K C;  4ZI7 B;  3ETQ A;  4NXN O;  4DR6 B;  3F5T A;  3KCY A;  4MVZ A;  5LA6 A;  4R50 A;  4UFZ A;  1AI6 A;  1Y76 A;  2XHB A;  2CGN A;  4JAV A;  1DF4 A;  4OPA A;  2Q7E A;  2QKC A;  1DTO A;  3UT5 A;  1KKC A;  3HKD B;  3RYH A;  4IYH A;  2DYS C;  1SES A;  4B08 A;  4WBN A;  4R8C A;  1MOF A;  1K5Q A;  2N74 A;  4FJC C;  2HVK C;  5LBQ A;  3E89 A;  2QE7 G;  1K73 W;  5KHJ A;  2ADP A;  2BSK B;  5IYD O;  1V54 C;  3E86 A;  1HW7 A;  1FXV A;  1X59 A;  1WLE A;  4CH3 A;  1MA1 A;  3J7A U;  2W6J G;  1SQF A;  1XNR O;  4O4H A;  4PDL A;  2XTA A;  4FFB B;  1AB3 A;  2PUS A;  4JI4 O;  1YZB A;  4ZI7 A;  4CC6 A;  3D36 C;  3HKE B;  4WFH A;  2OIE A;  1D5A A;  4FLX A;  5LMU B;  1FXK C;  2QM4 A;  5GTI Z;  1GM8 A;  2EX3 A;  1KKD A;  4GKK O;  3E83 A;  1JPX A;  1R6K A;  2HG5 C;  1J95 A;  3E8B A;  4JI8 O;  1O9G A;  3HKD A;  1R73 A;  5JJJ B;  5EZY B;  2GDS A;  3OTF A;  1TA8 A;  3AG1 C;  4CC5 A;  4FIP C;  5BXZ A;  1KD1 W;  4CS4 A;  2FKX A;  4UCS A;  2PF4 E;  2BSK A;  2LFR A;  1QQC A;  4UVC A;  4X66 B;  3MAQ A;  5CMU A;  2IJI A;  2JGD A;  2HLD G;  4NTW A;  4D7S A;  2WLL B;  4I50 B;  3B77 A;  4LFA O;  1IX9 A;  3HKE A;  1TVK A;  2RN9 A;  1SC5 B;  5JWP A;  4GKJ B;  5K1P A;  2ZDI A;  4K0K B;  1QU7 A;  2WLI B;  1SS3 A;  4DV7 B;  4PV1 B;  5IJ9 B;  5EZY A;  2YID A;  1RFY A;  1F23 A;  2CK3 G;  5LOV B;  1FJG B;  3ZMU A;  2LQT A;  4CS3 A;  2ZIN A;  5K1X A;  3BA8 A;  4FLY A;  3K0G A;  3ABK C;  3RGB A;  1FPO A;  2R9A A;  5B1A C;  2NR5 A;  4WF9 V;  4H44 B;  3WG7 C;  1GN6 A;  1H8H G;  1IBM B;  3T2M A;  1YHQ V;  4FMT A;  5FNV B;  2CDY A;  4JI6 O;  4LF6 B;  3N2G A;  4Q6G A;  4F6R B;  5BY1 A;  3SR2 C;  2XAF A;  2WLL A;  2P06 A;  4I50 A;  2WSS G;  2HR3 A;  2QM7 A;  2YIB A;  1IXM A;  3QTC A;  5JH7 B;  4B7E A;  4NKG B;  4MTG A;  5LL6 Y;  2FYU H;  4UVB A;  2Q5Z A;  2WLI A;  4DR2 O;  1MSD A;  1D5N A;  2JIZ G;  1R6N A;  3BCC H;  1RPO A;  1FXH A;  3CRQ A;  5IJ9 A;  3OE7 G;  3SYO A;  1F4N A;  1AR5 A;  4U7N A;  2G38 A;  1UPG A;  1VF6 A;  5LOV A;  5KA5 A;  1Q5O A;  3ZRW B;  1E79 G;  3FYE B;  1QCE A;  3I56 V;  4XBF A;  2WPD G;  4ZKI A;  3AG7 A;  4TV9 B;  1I94 B;  5IT9 N;  4PI2 A;  5BR8 B;  3SYA A;  2DW4 A;  2Q68 A;  5D5Q A;  2E74 B;  4UCR A;  3OR7 C;  1NTK H;  2GBO A;  4YJ3 B;  2Q0O C;  5LYJ A;  4J41 A;  1Q6U A;  5KUM A;  4F6R A;  3UCS C;  4TQD A;  1S5J A;  3JAR B;  2W6I G;  4YHH B;  1Q86 W;  5FL7 G;  5KMG B;  5FLX N;  5LP6 C;  1K92 A;  1RM1 B;  1OZ0 A;  5EC2 C;  3U10 A;  5JH7 A;  3OMI B;  2DJV A;  3AG3 B;  1OCR B;  2ZXW B;  1BMF G;  4K3A A;  2RCV A;  1GAX A;  4WFA V;  4DR1 O;  3T1Y B;  4JAS A;  2BE3 A;  2QWQ B;  4JZG A;  3JD2 A;  2X6C A;  2UUB O;  4LFC O;  2WA4 A;  3LSU A;  2ZE6 A;  2ODM A;  4HBN A;  5CB4 B;  4TV9 A;  2E5L B;  4LH7 A;  3LNM B;  1H38 A;  1KQS U;  5HFM A;  4K8Z A;  2EZO A;  3ZMS A;  1VQ7 V;  2N05 A;  4JTC B;  5JVD B;  1P7G A;  4YJ3 A;  2YUA A;  2IU0 A;  2GV9 A;  1XMO O;  3RW0 A;  3FB7 C;  3B8M A;  3HPL C;  3JAR A;  1M56 B;  3RYC A;  2ATK C;  5KMG A;  5EYP A;  4TUY A;  4PA3 A;  4CH4 A;  1R1B A;  4JI2 B;  2CTW A;  3KKY A;  1GKF A;  1KMI Z;  1VMG A;  1XMQ B;  5H5N A;  4ZOL B;  4BR6 A;  4I7Z B;  3CPW U;  2ZR2 A;  2WLM A;  1DK1 A;  4X9Q A;  2AW9 A;  3FKS G;  4QNH B;  4O4J B;  3OFN G;  2OTL V;  1NR1 A;  1NKD A;  1WP8 A;  4I4T A;  1DGS A;  1PNM A;  2P4K A;  2Y4U A;  2R72 A;  1PNL A;  2JJ2 G;  3B09 A;  3ZMT A;  5CB4 A;  1WN7 A;  2VQE B;  1HNZ B;  3MD0 A;  2QWR B;  2DQ0 A;  1SQQ H;  1VQM V;  4B3R B;  3SDL A;  3HKB B;  4MW8 A;  3SYC A;  3QO7 A;  4ABM A;  5J9P C;  1YTF D;  1AI4 A;  3BVO A;  1MAB G;  3T1H B;  1AJN A;  1JFF B;  1LUV A;  3I55 V;  2GSM B;  4X1K B;  2DOS A;  4DUZ B;  1N36 O;  4KP4 A;  4O4I B;  3A8T A;  2NLJ C;  3UO3 A;  2H3O A;  1E1R G;  4X62 O;  1BQZ A;  2F43 G;  3U0Z A;  4J7K A;  4EKW A;  1KP3 A;  2F23 A;  5JJN B;  5H9C A;  3STL C;  4IIJ B;  3SJC C;  1RM1 C;  4J7J A;  4DV2 B;  5H6Q A;  1NVP D;  3AG3 C;  1OCR C;  1YJW V;  4LP8 A;  1K34 A;  4EFB A;  1R6T A;  4JAA A;  2KKW A;  2QDO A;  2UUA O;  2HEP A;  1JJO A;  2JEX A;  3JD3 A;  1IBK B;  5JQG B;  3EXA A;  5KHK A;  2ZNI A;  1F51 A;  3ZHQ A;  4JYA B;  3OTO B;  3X2Q B;  4X20 B;  2A06 H;  1SQB H;  5KHG A;  3F7V C;  4AQY B;  4XDK A;  4BW9 A;  1NZ6 A;  4QPK A;  4DV6 O;  5B5E Z;  2PI4 A;  4FK5 C;  4DV3 O;  4TOI A;  4X1K A;  3ABM C;  3ZJZ A;  3SPG A;  3JD4 A;  3ETD A;  3ZHT A;  3CRR A;  1AI7 A;  2DMX A;  2RJZ A;  5E79 Z;  2QA4 V;  1SZT A;  4O4L A;  1VAR A;  1YCI A;  4IIJ A;  3RVY A;  2P67 A;  2HJF C;  1T5E A;  1BE3 H;  3C3T A;  3K57 A;  3FD9 A;  2AZ2 A;  1IBL B;  5CBF A;  3KZI Z;  1VQ5 V;  2Y69 B;  2X7R B;  1WA8 B;  4E4E A;  5JQG A;  2HHH B;  3TK1 A;  3ASN C;  3NXS A;  4CZZ A;  5E1A C;  1EN6 A;  1OCC B;  3SPC A;  4DK1 A;  4JYY A;  4X20 A;  3F7Y C;  3VQW A;  3RYF A;  2BCC H;  2F4V O;  2OIG A;  4X8A A;  1M9N A;  1SQP H;  1K4C C;  2LGW A;  2CTQ A;  3SJQ C;  3L73 H;  4WFG A;  4LFB O;  3J81 N;  3H1J H;  4OGQ B;  3THO A;  4LF4 B;  1I5X A;  4LNU B;  2GTS A;  4ZHQ A;  1UJW B;  1S77 D;  1PNK A;  5EIB C;  4K35 A;  4DV0 B;  4LF7 B;  4GX0 A;  3OAA G;  5LGT A;  1G6U A;  4GLX A;  2KQX A;  1SET A;  2EIL B;  3CCQ V;  1TAE A;  2B5U A;  1Z2G A;  1Q7Y W;  4JV5 O;  1N33 B;  1WA8 A;  4JI1 O;  4DO2 A;  4BIU A;  4LF5 O;  4B7K A;  1URF A;  2ARH A;  2CTR A;  4D6T H;  2EIM B;  5KHH A;  1RPR A;  1KEC A;  3UT5 B;  3TGU H;  3G71 V;  2ZE8 A;  2UU9 O;  1YI2 V;  1I08 A;  3PJS K;  4NR1 A;  3K9S A;  3EHB B;  1QLN A;  4ASU G;  5JJE B;  3K58 A;  3E22 B;  4NXM B;  4QE7 A;  1E1Q G;  4RQF A;  4P9O A;  3ZHS A;  4LNU A;  3E8H A;  1XDC A;  3N2K B;  3OM3 B;  3JYC A;  2ITC C;  4O4H B;  3IAY A;  1YF2 A;  1NI8 A;  3H1I H;  1QVF U;  5IE9 A;  2UXD O;  2P22 C;  1ROP A; 
#chains in the Genus database with same CATH homology
 3ZRW A;  1AJQ A;  5HFL A;  2YEV B;  1Y66 A;  2IJK A;  4XDL A;  2MK3 A;  3K08 A;  4MSW C;  2WLJ A;  2Y69 C;  3ASO C;  1ARO P;  1F23 A;  2CK3 G;  3HB3 B;  3M99 B;  2B1G A;  1K8A W;  3ZMU A;  3E35 A;  4JTD B;  2W0F C;  3ABM B;  1GK9 A;  2EIN C;  3K0G A;  3ABK C;  5B1A C;  4WF9 V;  1EFR G;  3ABU A;  2AHY A;  1OCC C;  3WG7 C;  5L3E A;  2ZR3 A;  5LHG A;  5KA6 A;  3UKM A;  1H8H G;  5EC1 C;  3T2M A;  3TCU A;  5CBH A;  1YHQ V;  4FMT A;  3K3W A;  3W7S A;  3K79 A;  2QM8 A;  3CYO A;  2EIJ C;  3CCJ V;  1XL6 A;  5LHI A;  3CCM V;  2XAH A;  2XAF A;  1V55 B;  2WLL A;  3ABL B;  4OXS A;  3ABT A;  1NBM G;  2UXX A;  2WSS G;  2XAQ A;  4UXN A;  2HR3 A;  3OGC C;  3K0D A;  4G2K A;  4GCZ A;  2QM7 A;  1IXM A;  2DWE C;  5CA3 A;  3CCS V;  4HYO A;  3K06 A;  3JD1 A;  3ASN B;  4MTG A;  3E8G A;  3QO5 A;  4R7C A;  1GTO A;  4UVB A;  2WLI A;  5C93 A;  1L1F A;  3E8F A;  1V54 B;  2YEV A;  2JIZ G;  1R6N A;  1JQ0 A;  3CD6 V;  1RPO A;  1FXH A;  1PL0 A;  3OMN B;  3OE7 G;  3SYO A;  1F4N A;  3T4Z A;  3LDD A;  3ZRS A;  4CBC A;  2C2A A;  1JJ2 U;  4U7N A;  1NJI W;  3SPJ A;  5KA5 A;  2AHZ A;  1OCZ C;  4PA6 A;  3ZRW B;  1E79 G;  3F5W C;  3FYE B;  2IJJ A;  4UUJ C;  3W7U A;  1QCE A;  2LP7 A;  3I56 V;  3BY6 A;  4XBF A;  2WPD G;  4ZKI A;  3H01 A;  3AG4 C;  2BOB C;  4UV9 A;  4JYC A;  1JOY A;  3SYA A;  2DW4 A;  2Q68 A;  4JF3 A;  1ORQ C;  3CP1 A;  5GW7 A;  3OR7 C;  3W7W A;  3LDE A;  3FYI B;  1QLE B;  5L3C A;  1CPY A;  1M57 B;  1YJN V;  2OCC B;  5KUM A;  3X2Q C;  1HWY A;  2HKO A;  2YSU B;  4BIZ A;  4DXW A;  3LDC A;  4MVS A;  1BHA A;  2W6I G;  1Q86 W;  5EBL C;  5FL7 G;  2Z3Y A;  5DM6 V;  2OT5 A;  2EBO A;  5LHH A;  1K92 A;  1RM1 B;  1NVP B;  1S5H C;  3VOU A;  1EZJ A;  1OZ0 A;  3IFX A;  5EC2 C;  4F4L A;  1OCO B;  3OMI B;  3GWO A;  3AG3 B;  3ZMZ A;  1OCR B;  4X88 A;  2P6J A;  2H8P C;  4WFE A;  4MVM A;  1THZ A;  2ZXW B;  1BMF G;  3ZMV A;  3AG1 B;  5LGU A;  1NR7 A;  1EBO A;  1DF5 A;  1JVM A;  3ZIA G;  3UM7 A;  4PA7 A;  4WFA V;  5EBW C;  4P9P A;  3ZRX A;  1K3E A;  4JAS A;  3LUT B;  4QJF B;  3DGE A;  3JD2 A;  2X6C A;  1QR8 A;  1XL4 A;  2XAS A;  2HFE C;  1S0V A;  1K9M W;  1VQ9 V;  1QVG U;  3ZN0 A;  3W7X A;  5B3S C;  4N21 A;  5H6R A;  2JEU A;  4LCU C;  5IYB O;  1CP9 A;  3LNM B;  1H38 A;  1KQS U;  2X0L A;  3D36 A;  5HFM A;  2B1I A;  2EZO A;  3ZMS A;  4KUM A;  5DN6 G;  1VQ7 V;  3OEE G;  2WLH A;  4JTC B;  3AG2 B;  2IU0 A;  4HAM A;  4GX2 A;  4FPP A;  1FXK A;  2DWD C;  2QKS A;  3FB7 C;  3RW0 A;  3B8M A;  3HPL C;  3ML0 A;  1VQP V;  1R3L C;  1M56 B;  1P4R A;  2DYR C;  2ATK C;  3STZ C;  4H33 A;  4MTX A;  4U7O A;  4PA3 A;  4E2L A;  1V55 C;  3ABL C;  5L3D A;  3ASO B;  1GKF A;  3CMA V;  4JGS A;  5L3B A;  1R3I C;  1PKX A;  2WWW A;  3CPW U;  4ZBM A;  2R9I A;  3AEI A;  2ZR2 A;  3CC7 V;  1B6Q A;  3T4D A;  5B1N A;  1GMG A;  2WLM A;  4MTF A;  3QNE A;  1SRY A;  2DYS B;  2EIN B;  3ABK B;  4R6Z A;  5B1A B;  4L87 A;  1NQT A;  3FKS G;  4QNH B;  3WG7 B;  3OFN G;  2OTL V;  4RAI A;  2JJ1 G;  1NR1 A;  1NKD A;  3K03 A;  3W7T A;  4TSF G;  2XND G;  1PNM A;  2ITD C;  3JCZ A;  1PNL A;  2QTO A;  3IC7 A;  2LFS A;  2PI5 A;  2JJ2 G;  2ZDI C;  3CCR V;  3ZN1 A;  1H2G A;  3OR6 C;  3ZMT A;  2EIJ B;  1GO3 F;  2EIL C;  4MVO A;  1G8M A;  1PD3 A;  4QPJ A;  5LGN A;  5IY5 B;  3K04 A;  3ZCC A;  2K1E A;  3MD0 A;  3QO8 A;  2WLK A;  3R65 A;  4J9Y B;  2JDI G;  2DQ0 A;  2A0L A;  4P2Z A;  4TWK A;  3CCU V;  1VQM V;  4Z1M G;  4MW8 A;  4PDV A;  3QO7 A;  3SYC A;  3LSQ A;  5J9P C;  1YTF D;  1AI4 A;  1MAB G;  2EIM C;  1H8E G;  4GT1 A;  3SYQ A;  1AJN A;  2HVJ C;  3I55 V;  1YTF B;  4QE9 A;  2GSM B;  2Q6A A;  4KP4 A;  4PDR A;  4RO2 A;  1ENV A;  3D3I A;  2Q67 A;  1W0K G;  2NLJ C;  1P7B A;  3OUF A;  5EBM C;  1E1R G;  2WLN A;  3CCV V;  3MHH C;  1QLE C;  5IYC O;  1CEZ A;  2F43 G;  1K97 A;  1BHB A;  2OCC C;  2X6A A;  3DTU B;  5B1B B;  4PA9 A;  3VBB A;  4EKW A;  1KP3 A;  4I5S A;  2OTJ V;  1FXK B;  5H9C A;  3STL C;  2JK5 C;  1OCZ B;  1VQK V;  1RM1 C;  1NH2 B;  3SPH A;  1YIT V;  5H6Q A;  1NVP D;  3AG3 C;  1OCR C;  1YJW V;  4LP8 A;  1TUE B;  3A0R A;  1K34 A;  4UV8 A;  4RUF A;  1Y4M A;  3AG4 B;  5CN0 A;  4G28 B;  1JX9 A;  4LBE C;  1FFT B;  4UVA A;  4RQE A;  3OMA B;  4LC1 A;  4MVU A;  2JEX A;  3JD3 A;  3ZRV A;  3TET A;  3T1C A;  1GM7 A;  1F51 A;  2EZP A;  3JD0 A;  4G27 B;  4N23 A;  1YIJ V;  4PDM A;  4PA4 A;  1M1K W;  4WFB V;  4XDJ A;  3X2Q B;  4GX1 A;  3CCL V;  1VQN V;  1DLB A;  4TT3 G;  3SPI A;  1QR9 A;  4JTA B;  3F7V C;  4XDK A;  3IGA C;  2ZQM A;  2H94 A;  2BOC C;  4QPK A;  3CXC U;  1VQL V;  1YJ9 V;  2PI4 A;  1VQO V;  4FK5 C;  1I5Y A;  2Z5U A;  1JCH A;  5EK0 A;  1AR1 B;  4MTO A;  3ABM C;  4PEL A;  1GM9 A;  3ZJZ A;  3SPG A;  2GHY A;  1QBZ A;  2DQ3 A;  3JD4 A;  3CCE V;  3ETD A;  1KC8 W;  2XAJ A;  2EIK B;  1AI7 A;  2XOK G;  4GX5 A;  1M90 W;  1R3K C;  3P32 A;  2QA4 V;  1R3J C;  1SZT A;  4JAU A;  4MS2 A;  1K33 A;  3FB6 C;  3OUS A;  3RVY A;  2P67 A;  5BZB A;  2HJF C;  4MVZ A;  4MVR A;  4R50 A;  2V1D A;  3ETG A;  1AI6 A;  5IDJ A;  5CBF A;  1W2B U;  2IU3 A;  4JAV A;  1VQ5 V;  1DF4 A;  4J9Z B;  5B3S B;  2Y69 B;  2X6B A;  2X7R B;  1DTO A;  1OHH G;  3EFF K;  3RVZ A;  2DYS C;  1SES A;  3SYP A;  3OW2 U;  2V7Q G;  3CC2 V;  4R8C A;  2P7T C;  1MOF A;  2IJH A;  3TK1 A;  3LSS A;  3ASN C;  3NXS A;  1S3J A;  1K5Q A;  4CZZ A;  5E1A C;  1OCC B;  4FJC C;  3SPC A;  2HVK C;  5LBQ A;  3E89 A;  1F4M A;  2QE7 G;  4QIW F;  3F7Y C;  1K73 W;  1BL8 A;  2DYR B;  5IYD O;  1V54 C;  3P30 A;  4BAY A;  1AI5 A;  3E86 A;  4X8A A;  2IH1 C;  1M9N A;  4BW5 A;  1FXV A;  5IY5 C;  1K4C C;  1WLE A;  1Q82 W;  5L3F A;  3SJQ C;  2KB1 A;  4KFM A;  4WFG A;  2W6J G;  1MG1 A;  1KP2 A;  2Y48 A;  4MW3 A;  4PDL A;  3RBZ A;  1I5X A;  3BEH A;  1UJW B;  1VQ4 V;  3ETE A;  1S77 D;  1PNK A;  2ZD9 A;  1VQ8 V;  5CBG A;  3FB8 C;  4WFH A;  3WFV A;  4GX0 A;  3OAA G;  5B1B C;  5LGT A;  2A9H A;  2R9R B;  1M57 C;  2UXN A;  1FXK C;  1K5S A;  1Q81 W;  1GM8 A;  1KKD A;  4RUE A;  1SET A;  2EIL B;  3E83 A;  1JPX A;  1R6K A;  3FB5 C;  2HG5 C;  1J95 A;  3CCQ V;  4H37 A;  3E8B A;  2B5U A;  5L3G A;  1Q7Y W;  1R73 A;  3G4S V;  1NH2 D;  4DO2 A;  4BIU A;  3OEH G;  4MT8 A;  1OCO C;  4WFF A;  1WPX A;  2EIM B;  2Q69 A;  2ZXW C;  1RPR A;  1KEC A;  3AG1 C;  2M7W A;  4FIP C;  3CC4 V;  2NNU A;  3G71 V;  1S72 V;  1KD1 W;  3K9A A;  4JPR A;  1ZWI C;  1YI2 V;  3MHS C;  2LFR A;  4X89 A;  3PJS K;  2EJR A;  1SER A;  2WAM A;  3EHB B;  1QLN A;  3E2E A;  4UVC A;  4ASU G;  5B1O A;  5CMU A;  3G6E V;  2IJI A;  2HLD G;  2IW5 A;  4Q20 A;  2QEX V;  4QE7 A;  1E1Q G;  4WCE V;  1G4Y B;  1FS0 G;  1K4D C;  2XAG A;  4RQF A;  3GB7 C;  2P90 A;  1N8R W;  4P9O A;  2D3O W;  4I9W A;  1MSW D;  1AJP A;  4HZ3 A;  1YSC A;  1LNQ A;  2IH3 C;  2WLL B;  1K7D A;  3E8H A;  1W0J G;  3B77 A;  5KUK A;  3OM3 B;  4MVQ A;  3JYC A;  4YXW G;  1S76 D;  2ITC C;  2FTK A;  2EIK C;  3CME V;  4JYB A;  4P30 A;  3AG2 C;  1QVF U;  3KG2 A;  1ROP A;  2ZDI A;  2A79 B;  1COW G;  1VQ6 V;  3B8N A;  2WLI B;  1M56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...