3CCVV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccvV00
1R73A 1M1KW 1VQ7V 3CC4V 1YITV 1VQNV 1K9MW 1VQLV 2D3OW 1YJWV 1VQ4V 3I55V 2OTJV 3CCJV 4WF9V 1S72V 3CMAV 4WFAV 1VQMV 3G4SV 1VQOV 1YHQV 1YIJV 1QVFU 1JJ2U 3CC2V 3G71V 3CCVV 1N8RW 1W2BU 1VQ9V 1VQ8V 3CCSV 3CD6V 1VQ5V 1KQSU 1VQPV 2QEXV 2QA4V 3CCLV 1Q86W 3CCQV 1M90W 1VQ6V 1K73W 1KD1W 3CCUV 3CCMV 5DM6V 4WFBV 3CPWU 3CC7V 1YJ9V 1Q81W 1NJIW 3OW2U 1Q82W 1VQKV 3G6EV 1Q7YW 3CXCU 4WCEV 1K8AW 1KC8W 2OTLV 1YJNV 3CMEV 1YI2V 1QVGU 3I56V 3CCEV 3CCRV
chains in the Genus database with same CATH superfamily
3JATB 2HHHO 1QU7A 5TISZ 1FPOA 1K4CC 1HNZO 4PV1B 2WA3A 2IBZH 2P67A 4ZI7B 5CA1A 1M56C 1OCOC 3ZN0A 2AHYA 2YEVA 3D3QA 3E2EA 3NXSA 1Q82W 4J80A 1CPYA 1UJWB 3ML0A 3JD4A 3IFXA 1QLEB 2YICA 2DYSB 1N33B 2EIJC 4UCSA 2EINB 5GTHZ 1QR8A 3CCQV 1O9GA 4PA4A 1SF9A 3OGCC 5EIBD 5IWAB 1RSOB 1XMQO 4UFZA 3B77A 1VQNV 1Z5VA 1L1FA 4B3MB 2KB1A 4X20B 1H2LA 4XDLA 2EINC 1VQ8V 4E2LA 4UV8A 4JYAB 4H44B 4DUYO 3K0DA 5KMGA 2AW9A 3SPIA 1Y4MA 4GYCB 4JI3O 4FJCC 4RO2A 2R72A 1GRJA 2XASA 2PZSA 3RVZA 3SJQC 1NVPB 4O4HB 3QVNA 5B1BB 4D7SA 4OPAA 4RUFA 3UQ8A 1Y6XA 3THOA 2CTPA 2QWRB 2EX3A 3D36A 3X2QC 5DM6V 2F93B 5KHHA 1QLEC 3RN4A 1QR9A 4DR6O 3JAKB 4PA6A 1J95A 2QM8A 2WPDG 2GBOA 1SQVH 2OTJV 3RYCA 3B8MA 5J2TA 1Y74A 2H3OA 1M57B 4H33A 1NQTA 3K5MA 1BHAA 1X4TA 4NB5A 3L73H 4LF8B 5IE9A 2ADPA 5LGNA 4Q20A 5F2VO 5EK0A 1OHHG 1QQCA 3E8GA 2BSKB 1M57C 4J10A 5EZYB 2L6LA 1AJPA 2E3CA 2A0LA 4UCUA 2VWJA 1H8HG 1YXBA 4CC6A 3H01A 5CBGA 4O4LA 4CS2A 4AHCA 2JEXA 2VQEO 3GWKC 3FB7C 1YJNV 3U11A 1YCIA 1R73A 2R9AA 3OAAG 1NBMG 4IIJA 1MSDA 2LGWA 4B7EA 4X65B 1OV9A 3D3IA 2IU0A 2WWWA 4KUMA 3CRMA 1VQ6V 1WN7A 2XAHA 4DRXA 4I4TA 2JK5C 2UXNA 2F95B 1JJOA 2UU9B 3L71H 1K9MW 3SYPA 4MVRA 3K03A 1NTKH 3ABTA 5EBMC 4LH7A 4ZKIA 1K33A 3QTCA 2WLNA 2AZ2A 4QJFB 4X64B 5KHJA 2Q6AA 1OCOB 1HR0O 4GCZA 3E35A 4LFCB 3W7XA 2WAMA 2YC0A 5GTIZ 3ZN1A 4W4KA 3TJTA 1XL4A 3H1HH 4O4IB 3T1HO 1JMKC 1N36O 2KG7B 3AG2B 1H2MA 1AP6A 1IBLB 1HNWB 1P7GA 3STLC 1SQFA 3B2EE 1KB9F 3OEHG 3ABUA 3SYCA 4PHZA 1G1XB 5CA3A 1Q6IA 2FKXA 3CD6V 2ITCC 2F1MA 1B06A 4YIOA 5L3GA 4U3JA 3CWBH 4YY3B 2Y0IA 4BWAA 3LSSA 2X6BA 1VQ4V 1ZSPA 2ZQMA 4LF7B 3G4SV 2P7TC 5E1AC 1COWG 2W0FC 3AEIA 5KA6A 4ZHQB 1XMOB 4AQYB 1F7YA 2O57A 2RJZA 3O65A 3T4ZA 1V55C 3FB6C 3ZCCA 2F23A 1MMMA 1SQGA 4X62B 2IH3C 1Y66A 4G2KA 3JD3A 3ETDA 1VQ5V 2F66C 5BY1A 2EZPA 5KA5A 4GX2A 4UVAA 4ABMA 2EIKB 1GTOA 2F4VB 2ZE6A 4JI0O 1YI2V 3ASNB 3JSLA 1Q3EA 1K92A 1NS1A 5IYCO 4F6RA 3MHSC 1P49A 3OE7G 4CC5A 4MW3A 1VQ9V 3ABMB 4JZGA 4N21A 4DV1B 3AK2A 3IGAC 2PF4E 4U3JB 4D7TA 4Q6GA 4I0XB 4RQEA 2XAJA 2EIKC 1JA8A 1NI8A 1RPOA 2ZNJA 4AI8A 4TV8B 1QVFU 5IJ0B 1UFIA 4X8AA 4LF6O 2JGDA 1SRYA 3HKBA 4R7CA 1VF5B 3H9VA 1FS0G 5K1PA 1G4YB 4HBNA 4I9QA 2LJ2A 4XDJA 1M56B 1SESA 5JVDB 4IYIA 2DYRC 4FLZA 2QR4A 2YXYA 2DQ0A 3A0RA 4PDVA 1JFFB 1OCRC 1OCCC 4UVBA 4IL6Z 1TUBB 1ZUQA 4QE7A 2NR5A 4JPRA 4JI8B 5JCOC 4DV0B 2JGDB 4CS3A 4WFEA 2Q9LA 4DO2A 3BPZA 3DC5A 1R6KA 4FLTA 3LDEA 3Q4HB 4DV5B 4JI1O 5JJNB 1VQMV 1OCZB 1VMGA 2JJ1G 1SQPH 5FNVB 4ASUG 1PP9H 1N36B 4FM1A 2ZXWC 3J7AU 1TUBA 1YVWA 2VRZA 3L75H 4JYYA 3JAMN 3RGBA 2LGQA 3SYQA 1NR7A 2Q69A 2Q7HA 3DSQA 3RYCB 2ILMA 3IC9A 2Y4TA 3F7YC 1VF7A 4PI2A 2R70A 3UO2A 3ABLB 3JD0A 2RNBA 3TCUA 4CH5A 2KSDA 1Y76B 2R9RB 3MAQA 2QA4V 1HDJA 3CCUV 3SR2C 4X1YB 1GN3A 4LWSA 2Q68A 1BZKA 1S77D 4TQFA 3PN1A 3ZMTA 4BR6A 1VQOV 2VWKA 1YHQV 1EN6A 4FPPA 2ZR2A 1DTOA 3OT7A 4DK1A 1OCZC 2V1DA 2YDEA 2JEUA 4B3RO 4MT8A 3CXCU 1K8AW 2AZ0A 3ICXA 2AGAA 5L3CA 3Q4HA 3EVKA 2BE3A 1EM1A 2NNUA 4WF9V 1FXKB 2GSMB 5FNVA 2Q7EA 1ZAUA 2DJVA 4PDRA 2XUMA 4J11A 1R3KC 3ZHUA 3CCSV 3E86A 4XBFA 2QWNB 1DLBA 3SJAC 4E4EA 3ASOB 4EFBA 3CCMV 2Y48A 3B8NA 3CPWU 4O2BA 3SPJA 4DV3B 3OMIB 1GKFA 2UUCO 2VQFB 1CXZB 2UUCB 4NTWA 2QKSA 1FXVA 1S3JA 1I0HA 5EYPA 5CB4A 2CDYA 1RM1B 2PY5A 1WB7A 3JALA 4MVZA 2M6YA 4IT5A 2KG7A 2Q7GA 5LP6C 3OTOB 4YHHB 3UT5A 3HR0A 2CTRA 5IY5B 5BR8O 4P9PA 1R3LC 2QTOA 2UUAO 1H2SB 4X66B 3CCRV 1TVKA 4X89A 2OT5A 4PA7A 1IX9A 1YJWV 3T1HB 5HFLA 1R3JC 2K1EA 1XMQB 3JYCA 3O9OA 4HNAA 2GV9A 4DR1O 2ETNA 1G8MA 4DV5O 3ZHTA 4JF3A 4F4LA 4DR1B 5KUMA 4EFEA 1M1KW 3KKYA 1AJQA 1RFYA 4U7NA 4ZOLB 5J2UA 1PNLA 4DV2B 2A06H 5E79Z 1HP8A 2PGGA 4J9ZB 4UVCA 3FFQA 1US6A 1S76D 4GUNA 4HAMA 3CJHA 3RYIB 4CH4A 5JH7B 4DR5B 5H2FZ 1L0LH 5D5QA 4LFBB 3BY6A 5LGUA 1PL0A 5L3EA 3JAWA 4Z1VA 1KKCA 5C8YA 5LA6A 1MZEA 4J9YB 2PI4A 4JTCB 4BIZA 5FPOA 4MTFA 1KECA 4IGGA 3OM3B 4TV8A 1ROPA 4LF7O 4R6ZA 1XNQO 3D8CA 3FD9A 2DW4A 4ZIBA 4GZRB 4KP4A 4K0KO 1FFTB 3A2FA 1YIJV 1MZFA 5JWPA 4IHJB 4TQDA 1E79G 1XDCA 2XNDG 3HB3B 4B3TO 3OD4A 1B6QA 1THZA 4LF4O 1ENVA 4JYAO 1ZLZA 2DWDC 3AK3A 3FB8C 4K8ZA 4ICGA 2DWEC 3T1YB 1L0NH 3AG1C 1KUQA 1VP7A 4OPHA 1JVMA 2A7WA 3CSXA 4DV4O 3RYFA 3A8TA 5CN0A 1T5EA 2OWOA 2XOKG 4JYBA 4X65O 4DV4B 4J41A 4NXMO 2DOSA 3ZHQA 5KAFZ 1Q81W 5GONA 2FB5A 2P22C 4ZBMA 2WLIB 1QLNA 4GKKO 1HNZB 5LHGA 3SPGA 1XNRB 3OR7C 1K34A 1K5SA 4NKGB 5B3SB 3RYFB 4PJ0Z 1D5NA 1YEWA 3VQWA 4UUJC 1SETA 2QKCA 2EJRA 3TGUH 2VQFO 4DR4B 4ZI7A 5CA1B 3X2QB 2WLMA 3BVOA 5BR8B 4OGQB 1F51A 5H9CA 4CS4A 5CB4B 4W4LA 4KHPO 1JJ2U 1WAZA 2ZE5A 1YTFB 4IHJA 4H13B 4EB6A 2ZDIC 3IAYA 3U10A 1VQKV 1ZTEA 3BCCH 2YIBD 4GKJO 4TT3G 5IY5C 1GMGA 3ZMZA 3NR7A 1XREA 1WA8A 4WFAV 5LGTA 4FLWA 3H1KH 1GN6A 1MG1A 3RBZA 4DV7O 4GT1A 3K5NA 3RFRA 1JR9A 4LFBO 4NXNB 2Z3YA 1OCRB 4DW0A 4DK0A 1OJHA 3ZHVA 2FMLA 3LSQA 2CUGA 1M9NA 3FYIB 3CHXA 4X1YA 3M99B 3RW0A 3SYAA 5LHIA 2RQ6A 5JH7A 2EIJB 3CC7V 1NKDA 4KFMA 4JZ2A 1WP8A 1VF6A 1URFA 1IXMA 2WLLA 4PI0A 1XL6A 5IYZB 2GHYA 2RN9A 1WNSA 3EHBB 3BA9A 4KL1A 1Q5OA 2LFSA 3HPLC 4EB6B 5EC1C 5JQGB 4B3SB 1WPBA 1Q8IA 2E76B 3QO8A 3QO5A 2Y69B 1FXKA 2E75B 4P9OA 2XHBA 2XTAA 1NTZH 4BIOA 1ZWIC 2WLLB 3N2GB 4I9WA 1X59A 2A79B 3LNMB 4YJ2A 2Q4PA 4DR3O 5EC2C 1BQZA 2H8PC 3DTUB 3BFRA 1FJGO 1SQQH 4B3RB 4CBCA 3SPCA 4RUEA 5KMGB 2X6AA 3OMAB 3UO3A 4J42A 4I55A 4P30A 4QE9A 3BHPA 4PA3A 2HJFC 3ZRVA 4LFAO 3FX7A 4X1IB 4JI5O 4R8CA 1M5IA 2FL4A 3SYOA 2YIAA 1WB8A 5CA0B 1E1RG 2YSUB 2C2AA 3CCVV 1TUEB 2P4KA 4L8JA 2OIGA 3LNNA 2Q8VA 2GUZA 3SGIA 1TGOA 3KZIZ 4FLXA 3HKCA 2FYUH 1RSOA 4LF6B 2QWQB 4ZHQA 1SKVA 3KG2A 1KP2A 4PD4F 3I56V 4DR4O 1W0KG 2Q67A 5LOVB 2X0LA 4AILC 4FLUA 4JAVA 4K3AA 2JJ2G 2Y69C 4H0LB 4DV6O 3N27A 3OTOO 2EIMC 5H6QA 1N32B 4YJ3A 3WB1A 2UXCO 4DRXB 2PYJA 1N0JA 4MVSA 4O4HA 4UCRA 1NVPD 3K06A 5C93A 3VBBA 5LYJA 2H94A 4DR7O 3DC6A 3K5OA 1PKXA 3BA8A 3E8HA 2CGNA 3L74H 3B40A 2JIZG 2CE4A 4F6RB 3ABLC 4YJ3B 4FFKA 1JFFA 1NU1H 2GTSA 2HHHB 1DGSA 3G6EV 2IJHA 4DV2O 5KHKA 3JASB 4FFBB 1QVGU 2EULA 4WBNB 4FVMA 4QPJA 3G67A 5FL7G 1JPXA 5IDJA 3C3TA 5FPRA 4LF9B 4WFFA 4UCOA 5H5NA 3BRCA 1S5JA 3PJSK 1XEQA 2QEXV 2IJJA 2WSSG 3A0BZ 4LR3A 1IBMB 3AG2C 4DR6B 1K97A 5IJ0A 4U3FH 1VARA 3JD1A 3AG3C 4HYOA 2QDOA 3CP1A 3SJCC 2OTLV 5LMUB 1Q7YW 3AG4C 4I4TB 2BTQB 2ZM6B 3I5DA 4WBNA 2YXLA 5LMUO 1JX9A 1NT2B 4X66O 1P7BA 1HNXB 1AP5A 3L72H 3K5LA 2PYLA 5ITZA 1AILA 2DE0X 2HP8A 4R50A 4MVOA 1EZJA 4LNUB 1MNGA 1Z2GA 1IZ3A 4WCEV 3JATA 1KC8W 1JQ0A 4LF4B 4NYKA 3OMNB 3TXSA 3CRRA 4Z2WA 4MW8A 4GX5A 4CH3A 1RPRA 3DXRB 1EFRG 3K04A 2UXBO 3R65A 4MVQA 3CRQA 4GKKB 2B9ZA 1BT8A 2YIBA 4MS2A 5J2UB 1U97A 1YTFD 1XBLA 4OXSA 1AI5A 3G6BA 2UXDO 5KUKA 1D5AA 2NN4A 1VQ7V 4G27B 1XNRO 4JI6O 5J9PC 1VF6C 2JS5A 1Q43A 1TVKB 3AG4B 1K7DA 3B09A 5B5EZ 1NH2D 2PTMA 2P4VA 2Z5UA 5B1AB 2QWPB 4OX9B 3FKSG 2A3QA 3W7SA 3K9AA 3ABMC 3K57A 3ZRWA 4UCVA 4J7KA 3RWRD 3QF7A 3EXAA 1SC5B 3CRAA 2ZT9B 2HVKC 4WFGA 5GW7A 1JCHA 4NVPA 1F4NA 1Q6UA 4P2ZA 2DMXA 2ITDC 1K5QA 3A0HZ 1UPGA 4DV6B 3ETQA 2EJ7A 5BXZA 1EZVH 4DYLA 1AR1B 2F4VO 4I50A 2D2CB 1DK1A 4NTYA 2UUBB 2BOCC 1K3EA 2ATKC 5DECA 1LR1A 1YF2A 3VQVA 1VQPV 1XHXA 4MTXA 4FM2A 1BE3H 5LA6B 2NLJC 4PDMA 1JOYA 2X7RB 3N2KB 4B7KA 2Q5ZA 5B1OA 1HWYA 5DN6G 1Q6HA 1EN4A 2IH1C 2EZOA 5JVDA 1BS3A 3LDCA 2UU9O 2WLIA 4LC1A 1FXKC 3JCZA 2DQ3A 1B04A 2JRIA 5LMNO 1J5EB 4O4JB 3H1LH 1IBKO 2G38A 5LMNB 1J5EO 4MTOA 3L9DA 4GX1A 1GN4A 2LW1A 3E8BA 3FYEB 2E5LO 4LWSB 3WU2Z 2ZXWB 3UKMA 4K0KB 1VIBA 1BGYH 3F5WC 3JAWB 1XNQB 4LF5B 1OCCB 4BIUA 3ZRSA 4O4JA 1P84F 3FAVA 4RQFA 2ZM6O 2HEPA 1S5LZ 1BHBA 1Y76A 3HKBB 4B3TB 3E22B 4LCUC 1XILA 2JGUA 4FIPC 4JI3B 3ZMVA 3P3PA 3HKEA 2P5OA 1N4CA 2W6JG 4H37A 4JI0B 2OCCB 5LHHA 4YXWG 3BABA 4DUYB 1XQ8A 1FFXB 1SA0A 4EEQA 1KU9A 3AK1A 3T2MA 1I94B 3OFNG 3J80N 5L3DA 2ZCEA 4L87A 1NJIW 3LUTB 4LFAB 5LYJB 2AXTZ 3W7UA 2W0XA 1XI1A 4F6EA 4NXMB 1Y74B 5CA0A 1O9HA 1SQBH 2OYQA 3M7MX 2K9PA 2WLHA 1YITV 1VQLV 4JI7B 1AROP 3ZMUA 3D36C 1AB3A 1ZX3A 3CC2V 1PNMA 3ZHRA 1BQ0A 1R6NA 2JVDA 2UXDB 1M90W 1CP9A 4U7OA 4WFBV 1DF5A 4JI5B 3SDLA 4D6TH 2QWOB 1BSMA 5B66Z 2YS8A 3GVMA 2BSKA 1CEZA 4RAIA 1B3QA 4I5SA 4JI2B 1YZBA 2ARHA 4JTDB 1GO3F 3T1CA 3P3NA 3ZJZA 1KBHA 1KP3A 4DR2O 2YI8A 3J81N 1IXBA 4B08A 2B5UA 1QNMA 2X6CA 1M93A 2YEVB 3K59A 1Q90D 4FZ1A 4MSWC 5LP6B 4X1KA 5AG2A 2EILB 5DEDA 3C90A 2MW2B 2XAQA 3JASA 4FFBA 4UXNA 5B1NA 5CBHA 1A32A 1IBLO 1HNWO 2VQEB 3CB2A 4YJ2B 3UCSC 2Y0PA 3UT5B 5EBWC 3ASOC 3ETEA 1R1BA 3F7VC 3LDDA 4QPKA 2HKOA 1WJZA 4DV1O 5KX5A 2GDSA 1PM9A 2EBOA 5KAIZ 2QM7A 1BL8A 2EILC 3SJBC 1QHTA 4EKWA 4JI4O 4LF9O 1AVMA 2CH7B 5HFMA 5KLVH 3GB7C 2N04A 1D2DA 4CH6A 4MVMA 3DXRA 1I08A 3H1JH 4LBEC 2QGNA 4QGPA 4LF8O 1FD9A 4I7ZB 4X88A 4DXWA 3N2KA 1IBKB 5C8YB 4Z1MG 3E89A 4BW9A 3BAAA 4UV9A 4IYHA 2Q0AA 3JALB 2CAZC 1LUVA 1HR0B 4J7ZA 1N32O 3HKDA 5LXTB 1N8RW 2L35A 2N05A 2CK3G 4QIWF 3UM7A 4LP8A 4LF5O 4JI8O 3CS5A 1W2BU 4JGSA 3WG7C 1BMFG 3FAVB 4PA9A 1KYOF 4FM0A 5IYZA 4JTAB 5EIBC 4G28B 4HNAB 1LUWA 2V7QG 2UXBB 3JARB 4DV3O 1QCEA 1FAFA 1SZXA 1M4UA 3E83A 1H2NA 3ZMSA 1R6TA 2DYSC 5IYDO 4TV9A 1AI6A 4TWKA 3B4SA 4TUYB 3CCLV 4UCTA 4N23A 2LQTA 4FLYA 2OCHA 3MDSA 1FFXA 3CMEV 2LO1A 2F43G 4FK5C 2ZIMA 3F5TA 1PNKA 3ETGA 4PELA 1YSCA 3ZX6A 1H2KA 4X62O 3WFVA 2ZIOA 4KHPB 1BCCH 4X1IA 5FLXN 4WFHA 3W7TA 1GM9A 1MSWD 2MK3A 2XAFA 4JYCA 4I50B 4X20A 4K35A 3TK1A 1GK9A 4JAUA 3S3XA 2B1IA 1XOUA 1N34B 4DR2B 2D3OW 5B3SC 4JASA 1W59A 2HG5C 3G71V 2AHZA 1NTMH 1IURA 2W6IG 4DUZO 4DV7B 2BOBC 1XHZA 3IJ4A 3FB5C 4DUZB 1H2GA 3HKEB 3JCUZ 1GM8A 1TA8A 4C7UA 3JARA 2YIDA 1AR4A 3ABKC 2WLKA 3SPHA 1GAXA 4JI4B 3JD2A 3JSNA 2IU3A 2QM4A 1V55B 2QKAA 5KHIA 2IJKA 4TSFG 5IYBO 1GN2A 2ZE8A 3K79A 3K9SA 4PDLA 5EBLC 3ZBHA 5ITZB 3ZRXA 3VOUA 1VEWA 4YHHO 1RP3B 5L3BA 4X64O 3OTFA 1V54B 4RWUA 3CMAV 2UUAB 2E5LB 4JAAA 5BMVA 4GX0A 1ZL8B 2PI5A 3K0GA 5IWAO 1NH2B 5KHGA 1K73W 1MABG 2VS0A 2QJ1A 1U96A 1MOFA 3CXHF 4O2AA 1AJNA 2ZR3A 5EZYA 5CBFA 2GTAA 1YDXA 3M8AA 4MVUA 3AG7A 4X9QA 1G6UA 2RMKB 3I55V 4KXRA 4O4LB 2ZE7A 5JCOA 1PPJH 3OEEG 3K3WA 2ZD9A 2CH7A 1I94O 4DV0O 2LFRA 3ZIAG 2BTQA 1KQSU 2HVJC 2UXXA 2ZINA 5A2QN 3CRCA 4GLXA 2DYRB 2FTKA 5JJEB 1SQXH 1LNQA 4DR5O 4O4IA 3OUFA 3DGEA 3IC7A 4YY3O 3CYOA 1K4DC 1R3IC 2CGOA 2Q73A 3EFFK 2B1GA 4JI6B 4UB6Z 3APQA 2R9IA 2Q0OC 3APOA 3R66A 4A5UB 1N0NA 2N74A 5B1BC 2HFEC 4AQYO 2V4DA 5IT9N 5KX5B 1S5HC 1V9PA 1S72V 3N2GA 5LOVA 1E1QG 2LP7A 5BMVB 1XUQA 3AG1B 3WB0A 3GWOA 1MA1A 1WLEA 2QSAA 3CEIA 4TUYA 2KQXA 1ORQC 1SERA 4O2BB 3OR6C 2P06A 1IDSA 2YI9A 3CE2A 4YIPA 5LP6A 4JV5B 2DN9A 5JJJB 4JI2O 5H6RA 3JAKA 2ZKOA 5L3FA 4FMTA 3RVYA 5J2TB 1IVSA 1OZ0A 1I5YA 3STZC 1NZ6A 3OUSA 2UXCB 3MHHC 2WLJA 2Y4UA 2YXHA 3HKDB 1EBOA 5JQGA 3ZRWB 4DR3B 5D5PA 1SZTA 3P32A 1SA0B 3VQXA 4DR7B 2CTWA 3T4DA 3CC4V 5K1XA 2XAGA 2EIMB 2OIEA 1Y67A 1L8DA 4DW1A 3C3SA 1W0JG 4BW5A 4JI7O 1FYJA 1KMIZ 3K58A 2QE7G 1PV0A 4NR1A 1HW7A 3S3WA 2JS3A 5GONB 1IBMO 4UB8Z 4QNHB 3QNEA 5A9GA 3ASNC 1N33O 3K08A 4ZOLA 5CMUA 4I0XA 4IIJB 4LH6A 1WP7A 3ABKB 1P4RA 3RYHB 2WA4A 3ZHSA 5LXTA 1HNXO 4B3MO 1Q86W 3G80A 2GUZB 2OCCC 2JDIG 2LW7A 2ODMA 1H38A 4TOIA 1PL4A 3HKCB 2PUSA 3QG5A 3RT3C 1GM7A 5B1AC 1RM1C 1QBZA 2RCVA 4B3SO 1I5XA 3ZEDA 5IJ9B 4XDKA 5BZBA 4LFCO 4CZZA 3LSUA 1AI4A 4JI1B 3BEHA 2YUAA 3AG3B 1AI7A 2IW5A 2IM9A 1GH6A 3KCYA 3TXQA 3ZS8C 4GKJB 3CX5F 4NTXA 4I55B 5LL6Y 2XT9A 3T1YO 2P6JA 4X1KB 4TV9B 1FXHA 1ZL8A 2CTQA 2QTSA 3VQYA 1NR1A 3WB2A 1F4MA 1FKAO 4HZ3A 1PD3A 5IJ9A 3E22A 3W7WA 4O2AB 4NXNO 4K8XA 2P90A 3CJHB 3RYIA 2HJDA 3H1IH 4J7JA 3E8FA 2BTOA 3OW2U 4LNUA 1V54C 3MD0A 3KCXA 2KKWA 3WG7B 3QO7A 1WPXA 4OX9O 1KKDA 3TETA 2RDCA 1S0VA 3RYHA 5LBQA 1AR5A 2Z0AA 1I7FA 2ADQB 1Z5WA 1KD1W 4MTGA 1XMOO 4JV5O 1SS3A 1YJ9V 1DF4A 1F23A 2HR3A 4BAYA 1N34O 3P30A 1WA8B 3CCJV 1TAEA 4FLVA 2ZNIA 3L70H 4FZ0A 2E74B 3U0ZA 3OGIB 2HLDG 1H8EG 2BCCH 1FJGB 2M7WA 2IJIA 5EYPB 2ZDIA 1EN5A 2A9HA 2UUBO 3CCEV
chains in the Genus database with same CATH topology
1W0KG 2Q67A 2X0LA 2CK3G 4QIWF 3UM7A 4JAVA 1K4CC 4LP8A 2JJ2G 3ABLB 2Y69C 3JD0A 3TCUA 2EIMC 1W2BU 2P67A 2R9RB 4JGSA 3WG7C 5H6QA 1BMFG 1M56C 2QA4V 1OCOC 4PA9A 3ZN0A 2AHYA 3CCUV 2YEVA 3E2EA 4JTAB 3NXSA 4G28B 1Q82W 4MVSA 1CPYA 1NVPD 2V7QG 2Q68A 1UJWB 3ML0A 3K06A 5C93A 3VBBA 1S77D 1QCEA 3JD4A 3IFXA 3ZMTA 1QLEB 1VQOV 2DYSB 3E83A 2H94A 1YHQV 3ZMSA 4FPPA 2DYSC 5IYDO 2EIJC 1AI6A 1PKXA 2EINB 4TWKA 3E8HA 2JIZG 1QR8A 2ZR2A 3CCLV 3CCQV 1DTOA 4PA4A 3ABLC 3OGCC 1OCZC 4N23A 2V1DA 2JEUA 3G6EV 4MT8A 3CXCU 1K8AW 2IJHA 3CMEV 1QVGU 2F43G 4FK5C 3B77A 5L3CA 1VQNV 1PNKA 2NNUA 4WF9V 1FXKB 1L1FA 3ETGA 2GSMB 4PELA 4QPJA 5FL7G 1JPXA 5IDJA 1YSCA 4PDRA 2KB1A 4XDLA 4WFFA 3WFVA 1R3KC 2EINC 4E2LA 4UV8A 3CCSV 1VQ8V 3PJSK 3E86A 3K0DA 4WFHA 4XBFA 3W7TA 2QEXV 2IJJA 2WSSG 1DLBA 1GM9A 3SPIA 1Y4MA 1MSWD 3AG2C 2MK3A 3ASOB 2XAFA 3CCMV 4JYCA 2Y48A 3B8NA 3CPWU 4FJCC 1K97A 4RO2A 2XASA 3RVZA 3SPJA 3TK1A 3JD1A 3AG3C 4HYOA 3CP1A 2OTLV 3OMIB 1GK9A 1GKFA 4JAUA 3SJQC 1NVPB 1Q7YW 3AG4C 2B1IA 2D3OW 5B1BB 5B3SC 2QKSA 1FXVA 4JASA 1JX9A 1S3JA 4RUFA 1P7BA 2HG5C 3G71V 2AHZA 1N8RW 2W6IG 1RM1B 4MVZA 2BOBC 4R50A 3D36A 3X2QC 4MVOA 3FB5C 5DM6V 1EZJA 1H2GA 1QLEC 5IY5B 4P9PA 1R3LC 1GM8A 4WCEV 2QTOA 1QR9A 1KC8W 3CCEV 1JQ0A 3OMNB 4PA6A 3CCRV 1J95A 4X89A 2OT5A 4PA7A 2QM8A 2WPDG 1YJWV 3ABKC 2OTJV 2WLKA 3B8MA 4MW8A 4GX5A 3SPHA 1M57B 4H33A 1NQTA 1RPRA 1EFRG 5HFLA 3K04A 3JD2A 3R65A 2IU3A 1BHAA 1R3JC 4MVQA 2K1EA 1V55B 3JYCA 4MS2A 2IJKA 4TSFG 5IYBO 1YTFD 4OXSA 5LGNA 3K79A 1AI5A 4PDLA 5EBLC 3ZRXA 1G8MA 4Q20A 5KUKA 3VOUA 4JF3A 4F4LA 5EK0A 5KUMA 1OHHG 5L3BA 1M1KW 1VQ7V 1V54B 4U7NA 1AJQA 4G27B 3CMAV 3E8GA 1PNLA 1M57C 5J9PC 4GX0A 1AJPA 4UVCA 4J9ZB 2A0LA 2PI5A 3K0GA 3AG4B 1K7DA 1H8HG 1NH2B 1S76D 1NH2D 4HAMA 1K73W 1MABG 3H01A 1MOFA 5CBGA 2Z5UA 1AJNA 2ZR3A 5CBFA 2JEXA 3BY6A 5B1AB 3FB7C 5LGUA 1YJNV 1PL0A 5L3EA 1R73A 3OAAG 3FKSG 4MVUA 3W7SA 3K9AA 1NBMG 3I55V 3ABMC 3ZRWA 3OEEG 3K3WA 2ZD9A 4J9YB 2PI4A 2LFRA 4JTCB 2HVKC 3ZIAG 3D3IA 4WFGA 2WWWA 4KUMA 2IU0A 5GW7A 1KQSU 4BIZA 1VQ6V 1JCHA 2HVJC 4MTFA 2UXXA 1KECA 1F4NA 3OM3B 2XAHA 4P2ZA 2ITDC 1K5QA 1ROPA 2DYRB 2FTKA 4R6ZA 1LNQA 2DW4A 2JK5C 2UXNA 4KP4A 3OUFA 3DGEA 1K9MW 3IC7A 1FFTB 1AR1B 3SYPA 4MVRA 3K03A 3CYOA 1K4DC 3ABTA 5EBMC 4ZKIA 2BOCC 1YIJV 1K33A 1R3IC 1K3EA 2ATKC 3EFFK 2WLNA 2B1GA 1E79G 1VQPV 2XNDG 2R9IA 3HB3B 4MTXA 1B6QA 2NLJC 4PDMA 4QJFB 1THZA 1ENVA 1JOYA 2X7RB 5B1BC 2Q6AA 2DWDC 2HFEC 1OCOB 5B1OA 1HWYA 5DN6G 4GCZA 3E35A 3FB8C 1S5HC 2IH1C 2DWEC 2EZOA 3W7XA 1S72V 2WAMA 3AG1C 1E1QG 2LP7A 3ZN1A 3AG1B 3LDCA 3GWOA 2WLIA 1WLEA 1JVMA 4LC1A 1FXKC 1XL4A 3JCZA 1ORQC 2DQ3A 5CN0A 2XOKG 4JYBA 1SERA 1Q81W 3OR6C 4ZBMA 2WLIB 1QLNA 4MTOA 3AG2B 4GX1A 5LHGA 3E8BA 3FYEB 3SPGA 3STLC 3OR7C 3OEHG 1K34A 5H6RA 1K5SA 2ZXWB 3ABUA 5L3FA 3SYCA 3UKMA 4FMTA 3RVYA 1OZ0A 5CA3A 5B3SB 1I5YA 3STZC 3F5WC 3OUSA 3CD6V 3MHHC 2ITCC 2WLJA 1OCCB 4BIUA 4UUJC 1EBOA 1SETA 3ZRSA 5L3GA 2EJRA 3ZRWB 4RQFA 1BHBA 1SZTA 3P32A 3X2QB 3LSSA 4LCUC 2X6BA 1VQ4V 2WLMA 4FIPC 3T4DA 2ZQMA 3ZMVA 3CC4V 2XAGA 2EIMB 2W6JG 4H37A 1F51A 5H9CA 2OCCB 5LHHA 4YXWG 2P7TC 3G4SV 5E1AC 1JJ2U 1COWG 1W0JG 2W0FC 3AEIA 4BW5A 5KA6A 1YTFB 2QE7G 3T2MA 2ZDIC 3OFNG 5L3DA 4L87A 1NJIW 3LUTB 3W7UA 1VQKV 3T4ZA 1V55C 3FB6C 3ZCCA 4QNHB 3QNEA 3ASNC 4TT3G 2WLHA 1YITV 3K08A 5IY5C 1VQLV 2IH3C 1Y66A 1GMGA 3ZMZA 5CMUA 4G2KA 4WFAV 5LGTA 1AROP 3JD3A 3ETDA 3ZMUA 1MG1A 3RBZA 1PNMA 3CC2V 4GT1A 1R6NA 3ABKB 1VQ5V 1P4RA 2EZPA 5KA5A 1Q86W 1M90W 1CP9A 4U7OA 2OCCC 4GX2A 2JDIG 2Z3YA 4WFBV 1H38A 1OCRB 1DF5A 4UVAA 2EIKB 1GTOA 1YI2V 3ASNB 3LSQA 1GM7A 5B1AC 1RM1C 1QBZA 1K92A 1M9NA 1I5XA 3FYIB 5IYCO 4RAIA 1CEZA 3MHSC 4XDKA 5BZBA 4I5SA 4CZZA 3OE7G 4MW3A 1VQ9V 3ABMB 3M99B 4N21A 1AI4A 4JTDB 3RW0A 3IGAC 3SYAA 5LHIA 1GO3F 3BEHA 2EIJB 3T1CA 3AG3B 1AI7A 2IW5A 3ZJZA 4RQEA 2XAJA 3CC7V 1KP3A 2EIKC 1NKDA 4KFMA 2P6JA 1FXHA 1RPOA 2B5UA 1NR1A 1IXMA 1F4MA 2WLLA 2X6CA 1XL6A 2YEVB 2GHYA 4HZ3A 1PD3A 1QVFU 4MSWC 3EHBB 3W7WA 2LFSA 3HPLC 2EILB 2P90A 5EC1C 2XAQA 4X8AA 5B1NA 4UXNA 5CBHA 3E8FA 3QO8A 1SRYA 3QO5A 2Y69B 1FXKA 4R7CA 3OW2U 1FS0G 1G4YB 5EBWC 1V54C 3MD0A 3ASOC 4P9OA 3ETEA 3WG7B 3F7VC 3QO7A 4XDJA 1M56B 3LDDA 1ZWIC 4QPKA 1SESA 2WLLB 1WPXA 2HKOA 2DYRC 4I9WA 1KKDA 2A79B 2DQ0A 3LNMB 3TETA 3A0RA 4PDVA 1OCRC 1OCCC 4UVBA 1S0VA 2EBOA 5EC2C 2QM7A 2H8PC 1BL8A 3DTUB 2EILC 5LBQA 4QE7A 4JPRA 4EKWA 4CBCA 3SPCA 4RUEA 4MTGA 1KD1W 2X6AA 3OMAB 1YJ9V 4P30A 4QE9A 5HFMA 1DF4A 1F23A 2HJFC 2HR3A 4PA3A 4WFEA 4BAYA 3ZRVA 4DO2A 3GB7C 1R6KA 3P30A 4R8CA 3LDEA 4MVMA 3CCJV 3SYOA 1VQMV 1OCZB 4LBEC 2JJ1G 4ASUG 4DXWA 1E1RG 2YSUB 2C2AA 4X88A 3CCVV 1TUEB 2ZXWC 4Z1MG 3E89A 4UV9A 3SYQA 1NR7A 2Q69A 2HLDG 1H8EG 2M7WA 2IJIA 2ZDIA 3KG2A 1KP2A 2A9HA 3I56V 3F7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R73 A;  1M1K W;  1VQ7 V;  3CC4 V;  1YIT V;  1VQN V;  1K9M W;  1VQL V;  2D3O W;  1YJW V;  1VQ4 V;  3I55 V;  2OTJ V;  3CCJ V;  4WF9 V;  1S72 V;  3CMA V;  4WFA V;  1VQM V;  3G4S V;  1VQO V;  1YHQ V;  1YIJ V;  1QVF U;  1JJ2 U;  3CC2 V;  3G71 V;  3CCV V;  1N8R W;  1W2B U;  1VQ9 V;  1VQ8 V;  3CCS V;  3CD6 V;  1VQ5 V;  1KQS U;  1VQP V;  2QEX V;  2QA4 V;  3CCL V;  1Q86 W;  3CCQ V;  1M90 W;  1VQ6 V;  1K73 W;  1KD1 W;  3CCU V;  3CCM V;  5DM6 V;  4WFB V;  3CPW U;  3CC7 V;  1YJ9 V;  1Q81 W;  1NJI W;  3OW2 U;  1Q82 W;  1VQK V;  3G6E V;  1Q7Y W;  3CXC U;  4WCE V;  1K8A W;  1KC8 W;  2OTL V;  1YJN V;  3CME V;  1YI2 V;  1QVG U;  3I56 V;  3CCE V;  3CCR V; 
#chains in the Genus database with same CATH topology
 3JAT B;  2HHH O;  1QU7 A;  5TIS Z;  1FPO A;  1K4C C;  1HNZ O;  4PV1 B;  2WA3 A;  2IBZ H;  2P67 A;  4ZI7 B;  5CA1 A;  1M56 C;  1OCO C;  3ZN0 A;  2AHY A;  2YEV A;  3D3Q A;  3E2E A;  3NXS A;  1Q82 W;  4J80 A;  1CPY A;  1UJW B;  3ML0 A;  3JD4 A;  3IFX A;  1QLE B;  2YIC A;  2DYS B;  1N33 B;  2EIJ C;  4UCS A;  2EIN B;  5GTH Z;  1QR8 A;  3CCQ V;  1O9G A;  4PA4 A;  1SF9 A;  3OGC C;  5EIB D;  5IWA B;  1RSO B;  1XMQ O;  4UFZ A;  3B77 A;  1VQN V;  1Z5V A;  1L1F A;  4B3M B;  2KB1 A;  4X20 B;  1H2L A;  4XDL A;  2EIN C;  1VQ8 V;  4E2L A;  4UV8 A;  4JYA B;  4H44 B;  4DUY O;  3K0D A;  5KMG A;  2AW9 A;  3SPI A;  1Y4M A;  4GYC B;  4JI3 O;  4FJC C;  4RO2 A;  2R72 A;  1GRJ A;  2XAS A;  2PZS A;  3RVZ A;  3SJQ C;  1NVP B;  4O4H B;  3QVN A;  5B1B B;  4D7S A;  4OPA A;  4RUF A;  3UQ8 A;  1Y6X A;  3THO A;  2CTP A;  2QWR B;  2EX3 A;  3D36 A;  3X2Q C;  5DM6 V;  2F93 B;  5KHH A;  1QLE C;  3RN4 A;  1QR9 A;  4DR6 O;  3JAK B;  4PA6 A;  1J95 A;  2QM8 A;  2WPD G;  2GBO A;  1SQV H;  2OTJ V;  3RYC A;  3B8M A;  5J2T A;  1Y74 A;  2H3O A;  1M57 B;  4H33 A;  1NQT A;  3K5M A;  1BHA A;  1X4T A;  4NB5 A;  3L73 H;  4LF8 B;  5IE9 A;  2ADP A;  5LGN A;  4Q20 A;  5F2V O;  5EK0 A;  1OHH G;  1QQC A;  3E8G A;  2BSK B;  1M57 C;  4J10 A;  5EZY B;  2L6L A;  1AJP A;  2E3C A;  2A0L A;  4UCU A;  2VWJ A;  1H8H G;  1YXB A;  4CC6 A;  3H01 A;  5CBG A;  4O4L A;  4CS2 A;  4AHC A;  2JEX A;  2VQE O;  3GWK C;  3FB7 C;  1YJN V;  3U11 A;  1YCI A;  1R73 A;  2R9A A;  3OAA G;  1NBM G;  4IIJ A;  1MSD A;  2LGW A;  4B7E A;  4X65 B;  1OV9 A;  3D3I A;  2IU0 A;  2WWW A;  4KUM A;  3CRM A;  1VQ6 V;  1WN7 A;  2XAH A;  4DRX A;  4I4T A;  2JK5 C;  2UXN A;  2F95 B;  1JJO A;  2UU9 B;  3L71 H;  1K9M W;  3SYP A;  4MVR A;  3K03 A;  1NTK H;  3ABT A;  5EBM C;  4LH7 A;  4ZKI A;  1K33 A;  3QTC A;  2WLN A;  2AZ2 A;  4QJF B;  4X64 B;  5KHJ A;  2Q6A A;  1OCO B;  1HR0 O;  4GCZ A;  3E35 A;  4LFC B;  3W7X A;  2WAM A;  2YC0 A;  5GTI Z;  3ZN1 A;  4W4K A;  3TJT A;  1XL4 A;  3H1H H;  4O4I B;  3T1H O;  1JMK C;  1N36 O;  2KG7 B;  3AG2 B;  1H2M A;  1AP6 A;  1IBL B;  1HNW B;  1P7G A;  3STL C;  1SQF A;  3B2E E;  1KB9 F;  3OEH G;  3ABU A;  3SYC A;  4PHZ A;  1G1X B;  5CA3 A;  1Q6I A;  2FKX A;  3CD6 V;  2ITC C;  2F1M A;  1B06 A;  4YIO A;  5L3G A;  4U3J A;  3CWB H;  4YY3 B;  2Y0I A;  4BWA A;  3LSS A;  2X6B A;  1VQ4 V;  1ZSP A;  2ZQM A;  4LF7 B;  3G4S V;  2P7T C;  5E1A C;  1COW G;  2W0F C;  3AEI A;  5KA6 A;  4ZHQ B;  1XMO B;  4AQY B;  1F7Y A;  2O57 A;  2RJZ A;  3O65 A;  3T4Z A;  1V55 C;  3FB6 C;  3ZCC A;  2F23 A;  1MMM A;  1SQG A;  4X62 B;  2IH3 C;  1Y66 A;  4G2K A;  3JD3 A;  3ETD A;  1VQ5 V;  2F66 C;  5BY1 A;  2EZP A;  5KA5 A;  4GX2 A;  4UVA A;  4ABM A;  2EIK B;  1GTO A;  2F4V B;  2ZE6 A;  4JI0 O;  1YI2 V;  3ASN B;  3JSL A;  1Q3E A;  1K92 A;  1NS1 A;  5IYC O;  4F6R A;  3MHS C;  1P49 A;  3OE7 G;  4CC5 A;  4MW3 A;  1VQ9 V;  3ABM B;  4JZG A;  4N21 A;  4DV1 B;  3AK2 A;  3IGA C;  2PF4 E;  4U3J B;  4D7T A;  4Q6G A;  4I0X B;  4RQE A;  2XAJ A;  2EIK C;  1JA8 A;  1NI8 A;  1RPO A;  2ZNJ A;  4AI8 A;  4TV8 B;  1QVF U;  5IJ0 B;  1UFI A;  4X8A A;  4LF6 O;  2JGD A;  1SRY A;  3HKB A;  4R7C A;  1VF5 B;  3H9V A;  1FS0 G;  5K1P A;  1G4Y B;  4HBN A;  4I9Q A;  2LJ2 A;  4XDJ A;  1M56 B;  1SES A;  5JVD B;  4IYI A;  2DYR C;  4FLZ A;  2QR4 A;  2YXY A;  2DQ0 A;  3A0R A;  4PDV A;  1JFF B;  1OCR C;  1OCC C;  4UVB A;  4IL6 Z;  1TUB B;  1ZUQ A;  4QE7 A;  2NR5 A;  4JPR A;  4JI8 B;  5JCO C;  4DV0 B;  2JGD B;  4CS3 A;  4WFE A;  2Q9L A;  4DO2 A;  3BPZ A;  3DC5 A;  1R6K A;  4FLT A;  3LDE A;  3Q4H B;  4DV5 B;  4JI1 O;  5JJN B;  1VQM V;  1OCZ B;  1VMG A;  2JJ1 G;  1SQP H;  5FNV B;  4ASU G;  1PP9 H;  1N36 B;  4FM1 A;  2ZXW C;  3J7A U;  1TUB A;  1YVW A;  2VRZ A;  3L75 H;  4JYY A;  3JAM N;  3RGB A;  2LGQ A;  3SYQ A;  1NR7 A;  2Q69 A;  2Q7H A;  3DSQ A;  3RYC B;  2ILM A;  3IC9 A;  2Y4T A;  3F7Y C;  1VF7 A;  4PI2 A;  2R70 A;  3UO2 A;  3ABL B;  3JD0 A;  2RNB A;  3TCU A;  4CH5 A;  2KSD A;  1Y76 B;  2R9R B;  3MAQ A;  2QA4 V;  1HDJ A;  3CCU V;  3SR2 C;  4X1Y B;  1GN3 A;  4LWS A;  2Q68 A;  1BZK A;  1S77 D;  4TQF A;  3PN1 A;  3ZMT A;  4BR6 A;  1VQO V;  2VWK A;  1YHQ V;  1EN6 A;  4FPP A;  2ZR2 A;  1DTO A;  3OT7 A;  4DK1 A;  1OCZ C;  2V1D A;  2YDE A;  2JEU A;  4B3R O;  4MT8 A;  3CXC U;  1K8A W;  2AZ0 A;  3ICX A;  2AGA A;  5L3C A;  3Q4H A;  3EVK A;  2BE3 A;  1EM1 A;  2NNU A;  4WF9 V;  1FXK B;  2GSM B;  5FNV A;  2Q7E A;  1ZAU A;  2DJV A;  4PDR A;  2XUM A;  4J11 A;  1R3K C;  3ZHU A;  3CCS V;  3E86 A;  4XBF A;  2QWN B;  1DLB A;  3SJA C;  4E4E A;  3ASO B;  4EFB A;  3CCM V;  2Y48 A;  3B8N A;  3CPW U;  4O2B A;  3SPJ A;  4DV3 B;  3OMI B;  1GKF A;  2UUC O;  2VQF B;  1CXZ B;  2UUC B;  4NTW A;  2QKS A;  1FXV A;  1S3J A;  1I0H A;  5EYP A;  5CB4 A;  2CDY A;  1RM1 B;  2PY5 A;  1WB7 A;  3JAL A;  4MVZ A;  2M6Y A;  4IT5 A;  2KG7 A;  2Q7G A;  5LP6 C;  3OTO B;  4YHH B;  3UT5 A;  3HR0 A;  2CTR A;  5IY5 B;  5BR8 O;  4P9P A;  1R3L C;  2QTO A;  2UUA O;  1H2S B;  4X66 B;  3CCR V;  1TVK A;  4X89 A;  2OT5 A;  4PA7 A;  1IX9 A;  1YJW V;  3T1H B;  5HFL A;  1R3J C;  2K1E A;  1XMQ B;  3JYC A;  3O9O A;  4HNA A;  2GV9 A;  4DR1 O;  2ETN A;  1G8M A;  4DV5 O;  3ZHT A;  4JF3 A;  4F4L A;  4DR1 B;  5KUM A;  4EFE A;  1M1K W;  3KKY A;  1AJQ A;  1RFY A;  4U7N A;  4ZOL B;  5J2U A;  1PNL A;  4DV2 B;  2A06 H;  5E79 Z;  1HP8 A;  2PGG A;  4J9Z B;  4UVC A;  3FFQ A;  1US6 A;  1S76 D;  4GUN A;  4HAM A;  3CJH A;  3RYI B;  4CH4 A;  5JH7 B;  4DR5 B;  5H2F Z;  1L0L H;  5D5Q A;  4LFB B;  3BY6 A;  5LGU A;  1PL0 A;  5L3E A;  3JAW A;  4Z1V A;  1KKC A;  5C8Y A;  5LA6 A;  1MZE A;  4J9Y B;  2PI4 A;  4JTC B;  4BIZ A;  5FPO A;  4MTF A;  1KEC A;  4IGG A;  3OM3 B;  4TV8 A;  1ROP A;  4LF7 O;  4R6Z A;  1XNQ O;  3D8C A;  3FD9 A;  2DW4 A;  4ZIB A;  4GZR B;  4KP4 A;  4K0K O;  1FFT B;  3A2F A;  1YIJ V;  1MZF A;  5JWP A;  4IHJ B;  4TQD A;  1E79 G;  1XDC A;  2XND G;  3HB3 B;  4B3T O;  3OD4 A;  1B6Q A;  1THZ A;  4LF4 O;  1ENV A;  4JYA O;  1ZLZ A;  2DWD C;  3AK3 A;  3FB8 C;  4K8Z A;  4ICG A;  2DWE C;  3T1Y B;  1L0N H;  3AG1 C;  1KUQ A;  1VP7 A;  4OPH A;  1JVM A;  2A7W A;  3CSX A;  4DV4 O;  3RYF A;  3A8T A;  5CN0 A;  1T5E A;  2OWO A;  2XOK G;  4JYB A;  4X65 O;  4DV4 B;  4J41 A;  4NXM O;  2DOS A;  3ZHQ A;  5KAF Z;  1Q81 W;  5GON A;  2FB5 A;  2P22 C;  4ZBM A;  2WLI B;  1QLN A;  4GKK O;  1HNZ B;  5LHG A;  3SPG A;  1XNR B;  3OR7 C;  1K34 A;  1K5S A;  4NKG B;  5B3S B;  3RYF B;  4PJ0 Z;  1D5N A;  1YEW A;  3VQW A;  4UUJ C;  1SET A;  2QKC A;  2EJR A;  3TGU H;  2VQF O;  4DR4 B;  4ZI7 A;  5CA1 B;  3X2Q B;  2WLM A;  3BVO A;  5BR8 B;  4OGQ B;  1F51 A;  5H9C A;  4CS4 A;  5CB4 B;  4W4L A;  4KHP O;  1JJ2 U;  1WAZ A;  2ZE5 A;  1YTF B;  4IHJ A;  4H13 B;  4EB6 A;  2ZDI C;  3IAY A;  3U10 A;  1VQK V;  1ZTE A;  3BCC H;  2YIB D;  4GKJ O;  4TT3 G;  5IY5 C;  1GMG A;  3ZMZ A;  3NR7 A;  1XRE A;  1WA8 A;  4WFA V;  5LGT A;  4FLW A;  3H1K H;  1GN6 A;  1MG1 A;  3RBZ A;  4DV7 O;  4GT1 A;  3K5N A;  3RFR A;  1JR9 A;  4LFB O;  4NXN B;  2Z3Y A;  1OCR B;  4DW0 A;  4DK0 A;  1OJH A;  3ZHV A;  2FML A;  3LSQ A;  2CUG A;  1M9N A;  3FYI B;  3CHX A;  4X1Y A;  3M99 B;  3RW0 A;  3SYA A;  5LHI A;  2RQ6 A;  5JH7 A;  2EIJ B;  3CC7 V;  1NKD A;  4KFM A;  4JZ2 A;  1WP8 A;  1VF6 A;  1URF A;  1IXM A;  2WLL A;  4PI0 A;  1XL6 A;  5IYZ B;  2GHY A;  2RN9 A;  1WNS A;  3EHB B;  3BA9 A;  4KL1 A;  1Q5O A;  2LFS A;  3HPL C;  4EB6 B;  5EC1 C;  5JQG B;  4B3S B;  1WPB A;  1Q8I A;  2E76 B;  3QO8 A;  3QO5 A;  2Y69 B;  1FXK A;  2E75 B;  4P9O A;  2XHB A;  2XTA A;  1NTZ H;  4BIO A;  1ZWI C;  2WLL B;  3N2G B;  4I9W A;  1X59 A;  2A79 B;  3LNM B;  4YJ2 A;  2Q4P A;  4DR3 O;  5EC2 C;  1BQZ A;  2H8P C;  3DTU B;  3BFR A;  1FJG O;  1SQQ H;  4B3R B;  4CBC A;  3SPC A;  4RUE A;  5KMG B;  2X6A A;  3OMA B;  3UO3 A;  4J42 A;  4I55 A;  4P30 A;  4QE9 A;  3BHP A;  4PA3 A;  2HJF C;  3ZRV A;  4LFA O;  3FX7 A;  4X1I B;  4JI5 O;  4R8C A;  1M5I A;  2FL4 A;  3SYO A;  2YIA A;  1WB8 A;  5CA0 B;  1E1R G;  2YSU B;  2C2A A;  3CCV V;  1TUE B;  2P4K A;  4L8J A;  2OIG A;  3LNN A;  2Q8V A;  2GUZ A;  3SGI A;  1TGO A;  3KZI Z;  4FLX A;  3HKC A;  2FYU H;  1RSO A;  4LF6 B;  2QWQ B;  4ZHQ A;  1SKV A;  3KG2 A;  1KP2 A;  4PD4 F;  3I56 V;  4DR4 O;  1W0K G;  2Q67 A;  5LOV B;  2X0L A;  4AIL C;  4FLU A;  4JAV A;  4K3A A;  2JJ2 G;  2Y69 C;  4H0L B;  4DV6 O;  3N27 A;  3OTO O;  2EIM C;  5H6Q A;  1N32 B;  4YJ3 A;  3WB1 A;  2UXC O;  4DRX B;  2PYJ A;  1N0J A;  4MVS A;  4O4H A;  4UCR A;  1NVP D;  3K06 A;  5C93 A;  3VBB A;  5LYJ A;  2H94 A;  4DR7 O;  3DC6 A;  3K5O A;  1PKX A;  3BA8 A;  3E8H A;  2CGN A;  3L74 H;  3B40 A;  2JIZ G;  2CE4 A;  4F6R B;  3ABL C;  4YJ3 B;  4FFK A;  1JFF A;  1NU1 H;  2GTS A;  2HHH B;  1DGS A;  3G6E V;  2IJH A;  4DV2 O;  5KHK A;  3JAS B;  4FFB B;  1QVG U;  2EUL A;  4WBN B;  4FVM A;  4QPJ A;  3G67 A;  5FL7 G;  1JPX A;  5IDJ A;  3C3T A;  5FPR A;  4LF9 B;  4WFF A;  4UCO A;  5H5N A;  3BRC A;  1S5J A;  3PJS K;  1XEQ A;  2QEX V;  2IJJ A;  2WSS G;  3A0B Z;  4LR3 A;  1IBM B;  3AG2 C;  4DR6 B;  1K97 A;  5IJ0 A;  4U3F H;  1VAR A;  3JD1 A;  3AG3 C;  4HYO A;  2QDO A;  3CP1 A;  3SJC C;  2OTL V;  5LMU B;  1Q7Y W;  3AG4 C;  4I4T B;  2BTQ B;  2ZM6 B;  3I5D A;  4WBN A;  2YXL A;  5LMU O;  1JX9 A;  1NT2 B;  4X66 O;  1P7B A;  1HNX B;  1AP5 A;  3L72 H;  3K5L A;  2PYL A;  5ITZ A;  1AIL A;  2DE0 X;  2HP8 A;  4R50 A;  4MVO A;  1EZJ A;  4LNU B;  1MNG A;  1Z2G A;  1IZ3 A;  4WCE V;  3JAT A;  1KC8 W;  1JQ0 A;  4LF4 B;  4NYK A;  3OMN B;  3TXS A;  3CRR A;  4Z2W A;  4MW8 A;  4GX5 A;  4CH3 A;  1RPR A;  3DXR B;  1EFR G;  3K04 A;  2UXB O;  3R65 A;  4MVQ A;  3CRQ A;  4GKK B;  2B9Z A;  1BT8 A;  2YIB A;  4MS2 A;  5J2U B;  1U97 A;  1YTF D;  1XBL A;  4OXS A;  1AI5 A;  3G6B A;  2UXD O;  5KUK A;  1D5A A;  2NN4 A;  1VQ7 V;  4G27 B;  1XNR O;  4JI6 O;  5J9P C;  1VF6 C;  2JS5 A;  1Q43 A;  1TVK B;  3AG4 B;  1K7D A;  3B09 A;  5B5E Z;  1NH2 D;  2PTM A;  2P4V A;  2Z5U A;  5B1A B;  2QWP B;  4OX9 B;  3FKS G;  2A3Q A;  3W7S A;  3K9A A;  3ABM C;  3K57 A;  3ZRW A;  4UCV A;  4J7K A;  3RWR D;  3QF7 A;  3EXA A;  1SC5 B;  3CRA A;  2ZT9 B;  2HVK C;  4WFG A;  5GW7 A;  1JCH A;  4NVP A;  1F4N A;  1Q6U A;  4P2Z A;  2DMX A;  2ITD C;  1K5Q A;  3A0H Z;  1UPG A;  4DV6 B;  3ETQ A;  2EJ7 A;  5BXZ A;  1EZV H;  4DYL A;  1AR1 B;  2F4V O;  4I50 A;  2D2C B;  1DK1 A;  4NTY A;  2UUB B;  2BOC C;  1K3E A;  2ATK C;  5DEC A;  1LR1 A;  1YF2 A;  3VQV A;  1VQP V;  1XHX A;  4MTX A;  4FM2 A;  1BE3 H;  5LA6 B;  2NLJ C;  4PDM A;  1JOY A;  2X7R B;  3N2K B;  4B7K A;  2Q5Z A;  5B1O A;  1HWY A;  5DN6 G;  1Q6H A;  1EN4 A;  2IH1 C;  2EZO A;  5JVD A;  1BS3 A;  3LDC A;  2UU9 O;  2WLI A;  4LC1 A;  1FXK C;  3JCZ A;  2DQ3 A;  1B04 A;  2JRI A;  5LMN O;  1J5E B;  4O4J B;  3H1L H;  1IBK O;  2G38 A;  5LMN B;  1J5E O;  4MTO A;  3L9D A;  4GX1 A;  1GN4 A;  2LW1 A;  3E8B A;  3FYE B;  2E5L O;  4LWS B;  3WU2 Z;  2ZXW B;  3UKM A;  4K0K B;  1VIB A;  1BGY H;  3F5W C;  3JAW B;  1XNQ B;  4LF5 B;  1OCC B;  4BIU A;  3ZRS A;  4O4J A;  1P84 F;  3FAV A;  4RQF A;  2ZM6 O;  2HEP A;  1S5L Z;  1BHB A;  1Y76 A;  3HKB B;  4B3T B;  3E22 B;  4LCU C;  1XIL A;  2JGU A;  4FIP C;  4JI3 B;  3ZMV A;  3P3P A;  3HKE A;  2P5O A;  1N4C A;  2W6J G;  4H37 A;  4JI0 B;  2OCC B;  5LHH A;  4YXW G;  3BAB A;  4DUY B;  1XQ8 A;  1FFX B;  1SA0 A;  4EEQ A;  1KU9 A;  3AK1 A;  3T2M A;  1I94 B;  3OFN G;  3J80 N;  5L3D A;  2ZCE A;  4L87 A;  1NJI W;  3LUT B;  4LFA B;  5LYJ B;  2AXT Z;  3W7U A;  2W0X A;  1XI1 A;  4F6E A;  4NXM B;  1Y74 B;  5CA0 A;  1O9H A;  1SQB H;  2OYQ A;  3M7M X;  2K9P A;  2WLH A;  1YIT V;  1VQL V;  4JI7 B;  1ARO P;  3ZMU A;  3D36 C;  1AB3 A;  1ZX3 A;  3CC2 V;  1PNM A;  3ZHR A;  1BQ0 A;  1R6N A;  2JVD A;  2UXD B;  1M90 W;  1CP9 A;  4U7O A;  4WFB V;  1DF5 A;  4JI5 B;  3SDL A;  4D6T H;  2QWO B;  1BSM A;  5B66 Z;  2YS8 A;  3GVM A;  2BSK A;  1CEZ A;  4RAI A;  1B3Q A;  4I5S A;  4JI2 B;  1YZB A;  2ARH A;  4JTD B;  1GO3 F;  3T1C A;  3P3N A;  3ZJZ A;  1KBH A;  1KP3 A;  4DR2 O;  2YI8 A;  3J81 N;  1IXB A;  4B08 A;  2B5U A;  1QNM A;  2X6C A;  1M93 A;  2YEV B;  3K59 A;  1Q90 D;  4FZ1 A;  4MSW C;  5LP6 B;  4X1K A;  5AG2 A;  2EIL B;  5DED A;  3C90 A;  2MW2 B;  2XAQ A;  3JAS A;  4FFB A;  4UXN A;  5B1N A;  5CBH A;  1A32 A;  1IBL O;  1HNW O;  2VQE B;  3CB2 A;  4YJ2 B;  3UCS C;  2Y0P A;  3UT5 B;  5EBW C;  3ASO C;  3ETE A;  1R1B A;  3F7V C;  3LDD A;  4QPK A;  2HKO A;  1WJZ A;  4DV1 O;  5KX5 A;  2GDS A;  1PM9 A;  2EBO A;  5KAI Z;  2QM7 A;  1BL8 A;  2EIL C;  3SJB C;  1QHT A;  4EKW A;  4JI4 O;  4LF9 O;  1AVM A;  2CH7 B;  5HFM A;  5KLV H;  3GB7 C;  2N04 A;  1D2D A;  4CH6 A;  4MVM A;  3DXR A;  1I08 A;  3H1J H;  4LBE C;  2QGN A;  4QGP A;  4LF8 O;  1FD9 A;  4I7Z B;  4X88 A;  4DXW A;  3N2K A;  1IBK B;  5C8Y B;  4Z1M G;  3E89 A;  4BW9 A;  3BAA A;  4UV9 A;  4IYH A;  2Q0A A;  3JAL B;  2CAZ C;  1LUV A;  1HR0 B;  4J7Z A;  1N32 O;  3HKD A;  5LXT B;  1N8R W;  2L35 A;  2N05 A;  2CK3 G;  4QIW F;  3UM7 A;  4LP8 A;  4LF5 O;  4JI8 O;  3CS5 A;  1W2B U;  4JGS A;  3WG7 C;  1BMF G;  3FAV B;  4PA9 A;  1KYO F;  4FM0 A;  5IYZ A;  4JTA B;  5EIB C;  4G28 B;  4HNA B;  1LUW A;  2V7Q G;  2UXB B;  3JAR B;  4DV3 O;  1QCE A;  1FAF A;  1SZX A;  1M4U A;  3E83 A;  1H2N A;  3ZMS A;  1R6T A;  2DYS C;  5IYD O;  4TV9 A;  1AI6 A;  4TWK A;  3B4S A;  4TUY B;  3CCL V;  4UCT A;  4N23 A;  2LQT A;  4FLY A;  2OCH A;  3MDS A;  1FFX A;  3CME V;  2LO1 A;  2F43 G;  4FK5 C;  2ZIM A;  3F5T A;  1PNK A;  3ETG A;  4PEL A;  1YSC A;  3ZX6 A;  1H2K A;  4X62 O;  3WFV A;  2ZIO A;  4KHP B;  1BCC H;  4X1I A;  5FLX N;  4WFH A;  3W7T A;  1GM9 A;  1MSW D;  2MK3 A;  2XAF A;  4JYC A;  4I50 B;  4X20 A;  4K35 A;  3TK1 A;  1GK9 A;  4JAU A;  3S3X A;  2B1I A;  1XOU A;  1N34 B;  4DR2 B;  2D3O W;  5B3S C;  4JAS A;  1W59 A;  2HG5 C;  3G71 V;  2AHZ A;  1NTM H;  1IUR A;  2W6I G;  4DUZ O;  4DV7 B;  2BOB C;  1XHZ A;  3IJ4 A;  3FB5 C;  4DUZ B;  1H2G A;  3HKE B;  3JCU Z;  1GM8 A;  1TA8 A;  4C7U A;  3JAR A;  2YID A;  1AR4 A;  3ABK C;  2WLK A;  3SPH A;  1GAX A;  4JI4 B;  3JD2 A;  3JSN A;  2IU3 A;  2QM4 A;  1V55 B;  2QKA A;  5KHI A;  2IJK A;  4TSF G;  5IYB O;  1GN2 A;  2ZE8 A;  3K79 A;  3K9S A;  4PDL A;  5EBL C;  3ZBH A;  5ITZ B;  3ZRX A;  3VOU A;  1VEW A;  4YHH O;  1RP3 B;  5L3B A;  4X64 O;  3OTF A;  1V54 B;  4RWU A;  3CMA V;  2UUA B;  2E5L B;  4JAA A;  5BMV A;  4GX0 A;  1ZL8 B;  2PI5 A;  3K0G A;  5IWA O;  1NH2 B;  5KHG A;  1K73 W;  1MAB G;  2VS0 A;  2QJ1 A;  1U96 A;  1MOF A;  3CXH F;  4O2A A;  1AJN A;  2ZR3 A;  5EZY A;  5CBF A;  2GTA A;  1YDX A;  3M8A A;  4MVU A;  3AG7 A;  4X9Q A;  1G6U A;  2RMK B;  3I55 V;  4KXR A;  4O4L B;  2ZE7 A;  5JCO A;  1PPJ H;  3OEE G;  3K3W A;  2ZD9 A;  2CH7 A;  1I94 O;  4DV0 O;  2LFR A;  3ZIA G;  2BTQ A;  1KQS U;  2HVJ C;  2UXX A;  2ZIN A;  5A2Q N;  3CRC A;  4GLX A;  2DYR B;  2FTK A;  5JJE B;  1SQX H;  1LNQ A;  4DR5 O;  4O4I A;  3OUF A;  3DGE A;  3IC7 A;  4YY3 O;  3CYO A;  1K4D C;  1R3I C;  2CGO A;  2Q73 A;  3EFF K;  2B1G A;  4JI6 B;  4UB6 Z;  3APQ A;  2R9I A;  2Q0O C;  3APO A;  3R66 A;  4A5U B;  1N0N A;  2N74 A;  5B1B C;  2HFE C;  4AQY O;  2V4D A;  5IT9 N;  5KX5 B;  1S5H C;  1V9P A;  1S72 V;  3N2G A;  5LOV A;  1E1Q G;  2LP7 A;  5BMV B;  1XUQ A;  3AG1 B;  3WB0 A;  3GWO A;  1MA1 A;  1WLE A;  2QSA A;  3CEI A;  4TUY A;  2KQX A;  1ORQ C;  1SER A;  4O2B B;  3OR6 C;  2P06 A;  1IDS A;  2YI9 A;  3CE2 A;  4YIP A;  5LP6 A;  4JV5 B;  2DN9 A;  5JJJ B;  4JI2 O;  5H6R A;  3JAK A;  2ZKO A;  5L3F A;  4FMT A;  3RVY A;  5J2T B;  1IVS A;  1OZ0 A;  1I5Y A;  3STZ C;  1NZ6 A;  3OUS A;  2UXC B;  3MHH C;  2WLJ A;  2Y4U A;  2YXH A;  3HKD B;  1EBO A;  5JQG A;  3ZRW B;  4DR3 B;  5D5P A;  1SZT A;  3P32 A;  1SA0 B;  3VQX A;  4DR7 B;  2CTW A;  3T4D A;  3CC4 V;  5K1X A;  2XAG A;  2EIM B;  2OIE A;  1Y67 A;  1L8D A;  4DW1 A;  3C3S A;  1W0J G;  4BW5 A;  4JI7 O;  1FYJ A;  1KMI Z;  3K58 A;  2QE7 G;  1PV0 A;  4NR1 A;  1HW7 A;  3S3W A;  2JS3 A;  5GON B;  1IBM O;  4UB8 Z;  4QNH B;  3QNE A;  5A9G A;  3ASN C;  1N33 O;  3K08 A;  4ZOL A;  5CMU A;  4I0X A;  4IIJ B;  4LH6 A;  1WP7 A;  3ABK B;  1P4R A;  3RYH B;  2WA4 A;  3ZHS A;  5LXT A;  1HNX O;  4B3M O;  1Q86 W;  3G80 A;  2GUZ B;  2OCC C;  2JDI G;  2LW7 A;  2ODM A;  1H38 A;  4TOI A;  1PL4 A;  3HKC B;  2PUS A;  3QG5 A;  3RT3 C;  1GM7 A;  5B1A C;  1RM1 C;  1QBZ A;  2RCV A;  4B3S O;  1I5X A;  3ZED A;  5IJ9 B;  4XDK A;  5BZB A;  4LFC O;  4CZZ A;  3LSU A;  1AI4 A;  4JI1 B;  3BEH A;  2YUA A;  3AG3 B;  1AI7 A;  2IW5 A;  2IM9 A;  1GH6 A;  3KCY A;  3TXQ A;  3ZS8 C;  4GKJ B;  3CX5 F;  4NTX A;  4I55 B;  5LL6 Y;  2XT9 A;  3T1Y O;  2P6J A;  4X1K B;  4TV9 B;  1FXH A;  1ZL8 A;  2CTQ A;  2QTS A;  3VQY A;  1NR1 A;  3WB2 A;  1F4M A;  1FKA O;  4HZ3 A;  1PD3 A;  5IJ9 A;  3E22 A;  3W7W A;  4O2A B;  4NXN O;  4K8X A;  2P90 A;  3CJH B;  3RYI A;  2HJD A;  3H1I H;  4J7J A;  3E8F A;  2BTO A;  3OW2 U;  4LNU A;  1V54 C;  3MD0 A;  3KCX A;  2KKW A;  3WG7 B;  3QO7 A;  1WPX A;  4OX9 O;  1KKD A;  3TET A;  2RDC A;  1S0V A;  3RYH A;  5LBQ A;  1AR5 A;  2Z0A A;  1I7F A;  2ADQ B;  1Z5W A;  1KD1 W;  4MTG A;  1XMO O;  4JV5 O;  1SS3 A;  1YJ9 V;  1DF4 A;  1F23 A;  2HR3 A;  4BAY A;  1N34 O;  3P30 A;  1WA8 B;  3CCJ V;  1TAE A;  4FLV A;  2ZNI A;  3L70 H;  4FZ0 A;  2E74 B;  3U0Z A;  3OGI B;  2HLD G;  1H8E G;  2BCC H;  1FJG B;  2M7W A;  2IJI A;  5EYP B;  2ZDI A;  1EN5 A;  2A9H A;  2UUB O;  3CCE V; 
#chains in the Genus database with same CATH homology
 1W0K G;  2Q67 A;  2X0L A;  2CK3 G;  4QIW F;  3UM7 A;  4JAV A;  1K4C C;  4LP8 A;  2JJ2 G;  3ABL B;  2Y69 C;  3JD0 A;  3TCU A;  2EIM C;  1W2B U;  2P67 A;  2R9R B;  4JGS A;  3WG7 C;  5H6Q A;  1BMF G;  1M56 C;  2QA4 V;  1OCO C;  4PA9 A;  3ZN0 A;  2AHY A;  3CCU V;  2YEV A;  3E2E A;  4JTA B;  3NXS A;  4G28 B;  1Q82 W;  4MVS A;  1CPY A;  1NVP D;  2V7Q G;  2Q68 A;  1UJW B;  3ML0 A;  3K06 A;  5C93 A;  3VBB A;  1S77 D;  1QCE A;  3JD4 A;  3IFX A;  3ZMT A;  1QLE B;  1VQO V;  2DYS B;  3E83 A;  2H94 A;  1YHQ V;  3ZMS A;  4FPP A;  2DYS C;  5IYD O;  2EIJ C;  1AI6 A;  1PKX A;  2EIN B;  4TWK A;  3E8H A;  2JIZ G;  1QR8 A;  2ZR2 A;  3CCL V;  3CCQ V;  1DTO A;  4PA4 A;  3ABL C;  3OGC C;  1OCZ C;  4N23 A;  2V1D A;  2JEU A;  3G6E V;  4MT8 A;  3CXC U;  1K8A W;  2IJH A;  3CME V;  1QVG U;  2F43 G;  4FK5 C;  3B77 A;  5L3C A;  1VQN V;  1PNK A;  2NNU A;  4WF9 V;  1FXK B;  1L1F A;  3ETG A;  2GSM B;  4PEL A;  4QPJ A;  5FL7 G;  1JPX A;  5IDJ A;  1YSC A;  4PDR A;  2KB1 A;  4XDL A;  4WFF A;  3WFV A;  1R3K C;  2EIN C;  4E2L A;  4UV8 A;  3CCS V;  1VQ8 V;  3PJS K;  3E86 A;  3K0D A;  4WFH A;  4XBF A;  3W7T A;  2QEX V;  2IJJ A;  2WSS G;  1DLB A;  1GM9 A;  3SPI A;  1Y4M A;  1MSW D;  3AG2 C;  2MK3 A;  3ASO B;  2XAF A;  3CCM V;  4JYC A;  2Y48 A;  3B8N A;  3CPW U;  4FJC C;  1K97 A;  4RO2 A;  2XAS A;  3RVZ A;  3SPJ A;  3TK1 A;  3JD1 A;  3AG3 C;  4HYO A;  3CP1 A;  2OTL V;  3OMI B;  1GK9 A;  1GKF A;  4JAU A;  3SJQ C;  1NVP B;  1Q7Y W;  3AG4 C;  2B1I A;  2D3O W;  5B1B B;  5B3S C;  2QKS A;  1FXV A;  4JAS A;  1JX9 A;  1S3J A;  4RUF A;  1P7B A;  2HG5 C;  3G71 V;  2AHZ A;  1N8R W;  2W6I G;  1RM1 B;  4MVZ A;  2BOB C;  4R50 A;  3D36 A;  3X2Q C;  4MVO A;  3FB5 C;  5DM6 V;  1EZJ A;  1H2G A;  1QLE C;  5IY5 B;  4P9P A;  1R3L C;  1GM8 A;  4WCE V;  2QTO A;  1QR9 A;  1KC8 W;  3CCE V;  1JQ0 A;  3OMN B;  4PA6 A;  3CCR V;  1J95 A;  4X89 A;  2OT5 A;  4PA7 A;  2QM8 A;  2WPD G;  1YJW V;  3ABK C;  2OTJ V;  2WLK A;  3B8M A;  4MW8 A;  4GX5 A;  3SPH A;  1M57 B;  4H33 A;  1NQT A;  1RPR A;  1EFR G;  5HFL A;  3K04 A;  3JD2 A;  3R65 A;  2IU3 A;  1BHA A;  1R3J C;  4MVQ A;  2K1E A;  1V55 B;  3JYC A;  4MS2 A;  2IJK A;  4TSF G;  5IYB O;  1YTF D;  4OXS A;  5LGN A;  3K79 A;  1AI5 A;  4PDL A;  5EBL C;  3ZRX A;  1G8M A;  4Q20 A;  5KUK A;  3VOU A;  4JF3 A;  4F4L A;  5EK0 A;  5KUM A;  1OHH G;  5L3B A;  1M1K W;  1VQ7 V;  1V54 B;  4U7N A;  1AJQ A;  4G27 B;  3CMA V;  3E8G A;  1PNL A;  1M57 C;  5J9P C;  4GX0 A;  1AJP A;  4UVC A;  4J9Z B;  2A0L A;  2PI5 A;  3K0G A;  3AG4 B;  1K7D A;  1H8H G;  1NH2 B;  1S76 D;  1NH2 D;  4HAM A;  1K73 W;  1MAB G;  3H01 A;  1MOF A;  5CBG A;  2Z5U A;  1AJN A;  2ZR3 A;  5CBF A;  2JEX A;  3BY6 A;  5B1A B;  3FB7 C;  5LGU A;  1YJN V;  1PL0 A;  5L3E A;  1R73 A;  3OAA G;  3FKS G;  4MVU A;  3W7S A;  3K9A A;  1NBM G;  3I55 V;  3ABM C;  3ZRW A;  3OEE G;  3K3W A;  2ZD9 A;  4J9Y B;  2PI4 A;  2LFR A;  4JTC B;  2HVK C;  3ZIA G;  3D3I A;  4WFG A;  2WWW A;  4KUM A;  2IU0 A;  5GW7 A;  1KQS U;  4BIZ A;  1VQ6 V;  1JCH A;  2HVJ C;  4MTF A;  2UXX A;  1KEC A;  1F4N A;  3OM3 B;  2XAH A;  4P2Z A;  2ITD C;  1K5Q A;  1ROP A;  2DYR B;  2FTK A;  4R6Z A;  1LNQ A;  2DW4 A;  2JK5 C;  2UXN A;  4KP4 A;  3OUF A;  3DGE A;  1K9M W;  3IC7 A;  1FFT B;  1AR1 B;  3SYP A;  4MVR A;  3K03 A;  3CYO A;  1K4D C;  3ABT A;  5EBM C;  4ZKI A;  2BOC C;  1YIJ V;  1K33 A;  1R3I C;  1K3E A;  2ATK C;  3EFF K;  2WLN A;  2B1G A;  1E79 G;  1VQP V;  2XND G;  2R9I A;  3HB3 B;  4MTX A;  1B6Q A;  2NLJ C;  4PDM A;  4QJF B;  1THZ A;  1ENV A;  1JOY A;  2X7R B;  5B1B C;  2Q6A A;  2DWD C;  2HFE C;  1OCO B;  5B1O A;  1HWY A;  5DN6 G;  4GCZ A;  3E35 A;  3FB8 C;  1S5H C;  2IH1 C;  2DWE C;  2EZO A;  3W7X A;  1S72 V;  2WAM A;  3AG1 C;  1E1Q G;  2LP7 A;  3ZN1 A;  3AG1 B;  3LDC A;  3GWO A;  2WLI A;  1WLE A;  1JVM A;  4LC1 A;  1FXK C;  1XL4 A;  3JCZ A;  1ORQ C;  2DQ3 A;  5CN0 A;  2XOK G;  4JYB A;  1SER A;  1Q81 W;  3OR6 C;  4ZBM A;  2WLI B;  1QLN A;  4MTO A;  3AG2 B;  4GX1 A;  5LHG A;  3E8B A;  3FYE B;  3SPG A;  3STL C;  3OR7 C;  3OEH G;  1K34 A;  5H6R A;  1K5S A;  2ZXW B;  3ABU A;  5L3F A;  3SYC A;  3UKM A;  4FMT A;  3RVY A;  1OZ0 A;  5CA3 A;  5B3S B;  1I5Y A;  3STZ C;  3F5W C;  3OUS A;  3CD6 V;  3MHH C;  2ITC C;  2WLJ A;  1OCC B;  4BIU A;  4UUJ C;  1EBO A;  1SET A;  3ZRS A;  5L3G A;  2EJR A;  3ZRW B;  4RQF A;  1BHB A;  1SZT A;  3P32 A;  3X2Q B;  3LSS A;  4LCU C;  2X6B A;  1VQ4 V;  2WLM A;  4FIP C;  3T4D A;  2ZQM A;  3ZMV A;  3CC4 V;  2XAG A;  2EIM B;  2W6J G;  4H37 A;  1F51 A;  5H9C A;  2OCC B;  5LHH A;  4YXW G;  2P7T C;  3G4S V;  5E1A C;  1JJ2 U;  1COW G;  1W0J G;  2W0F C;  3AEI A;  4BW5 A;  5KA6 A;  1YTF B;  2QE7 G;  3T2M A;  2ZDI C;  3OFN G;  5L3D A;  4L87 A;  1NJI W;  3LUT B;  3W7U A;  1VQK V;  3T4Z A;  1V55 C;  3FB6 C;  3ZCC A;  4QNH B;  3QNE A;  3ASN C;  4TT3 G;  2WLH A;  1YIT V;  3K08 A;  5IY5 C;  1VQL V;  2IH3 C;  1Y66 A;  1GMG A;  3ZMZ A;  5CMU A;  4G2K A;  4WFA V;  5LGT A;  1ARO P;  3JD3 A;  3ETD A;  3ZMU A;  1MG1 A;  3RBZ A;  1PNM A;  3CC2 V;  4GT1 A;  1R6N A;  3ABK B;  1VQ5 V;  1P4R A;  2EZP A;  5KA5 A;  1Q86 W;  1M90 W;  1CP9 A;  4U7O A;  2OCC C;  4GX2 A;  2JDI G;  2Z3Y A;  4WFB V;  1H38 A;  1OCR B;  1DF5 A;  4UVA A;  2EIK B;  1GTO A;  1YI2 V;  3ASN B;  3LSQ A;  1GM7 A;  5B1A C;  1RM1 C;  1QBZ A;  1K92 A;  1M9N A;  1I5X A;  3FYI B;  5IYC O;  4RAI A;  1CEZ A;  3MHS C;  4XDK A;  5BZB A;  4I5S A;  4CZZ A;  3OE7 G;  4MW3 A;  1VQ9 V;  3ABM B;  3M99 B;  4N21 A;  1AI4 A;  4JTD B;  3RW0 A;  3IGA C;  3SYA A;  5LHI A;  1GO3 F;  3BEH A;  2EIJ B;  3T1C A;  3AG3 B;  1AI7 A;  2IW5 A;  3ZJZ A;  4RQE A;  2XAJ A;  3CC7 V;  1KP3 A;  2EIK C;  1NKD A;  4KFM A;  2P6J A;  1FXH A;  1RPO A;  2B5U A;  1NR1 A;  1IXM A;  1F4M A;  2WLL A;  2X6C A;  1XL6 A;  2YEV B;  2GHY A;  4HZ3 A;  1PD3 A;  1QVF U;  4MSW C;  3EHB B;  3W7W A;  2LFS A;  3HPL C;  2EIL B;  2P90 A;  5EC1 C;  2XAQ A;  4X8A A;  5B1N A;  4UXN A;  5CBH A;  3E8F A;  3QO8 A;  1SRY A;  3QO5 A;  2Y69 B;  1FXK A;  4R7C A;  3OW2 U;  1FS0 G;  1G4Y B;  5EBW C;  1V54 C;  3MD0 A;  3ASO C;  4P9O A;  3ETE A;  3WG7 B;  3F7V C;  3QO7 A;  4XDJ A;  1M56 B;  3LDD A;  1ZWI C;  4QPK A;  1SES A;  2WLL B;  1WPX A;  2HKO A;  2DYR C;  4I9W A;  1KKD A;  2A79 B;  2DQ0 A;  3LNM B;  3TET A;  3A0R A;  4PDV A;  1OCR C;  1OCC C;  4UVB A;  1S0V A;  2EBO A;  5EC2 C;  2QM7 A;  2H8P C;  1BL8 A;  3DTU B;  2EIL C;  5LBQ A;  4QE7 A;  4JPR A;  4EKW A;  4CBC A;  3SPC A;  4RUE A;  4MTG A;  1KD1 W;  2X6A A;  3OMA B;  1YJ9 V;  4P30 A;  4QE9 A;  5HFM A;  1DF4 A;  1F23 A;  2HJF C;  2HR3 A;  4PA3 A;  4WFE A;  4BAY A;  3ZRV A;  4DO2 A;  3GB7 C;  1R6K A;  3P30 A;  4R8C A;  3LDE A;  4MVM A;  3CCJ V;  3SYO A;  1VQM V;  1OCZ B;  4LBE C;  2JJ1 G;  4ASU G;  4DXW A;  1E1R G;  2YSU B;  2C2A A;  4X88 A;  3CCV V;  1TUE B;  2ZXW C;  4Z1M G;  3E89 A;  4UV9 A;  3SYQ A;  1NR7 A;  2Q69 A;  2HLD G;  1H8E G;  2M7W A;  2IJI A;  2ZDI A;  3KG2 A;  1KP2 A;  2A9H A;  3I56 V;  3F7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...