3CCVV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccvV00
3G71V 3CCVV 3CCSV 3CCQV 1VQKV 1VQPV 3OW2U 3I55V 1VQ4V 1Q86W 1YJWV 3CD6V 4WCEV 5DM6V 3I56V 2D3OW 1NJIW 3G6EV 1YJNV 2QEXV 1M90W 3CPWU 2OTLV 1VQMV 3CC2V 3CC7V 1K73W 3CCRV 1VQOV 1YJ9V 3CC4V 2OTJV 1QVFU 1YIJV 1K9MW 1R73A 1YITV 1KD1W 1Q81W 3CXCU 1QVGU 1K8AW 3CCUV 3CCLV 1KC8W 1M1KW 1VQ8V 3G4SV 1VQLV 1JJ2U 1VQNV 3CMEV 1S72V 1Q82W 1YI2V 1N8RW 2QA4V 1KQSU 1VQ6V 1VQ7V 4WF9V 3CCEV 3CMAV 1YHQV 1VQ5V 4WFBV 1Q7YW 1W2BU 3CCJV 4WFAV 3CCMV 1VQ9V
chains in the Genus database with same CATH superfamily
2X6CA 3ABMB 1ZX3A 2CH7A 4LH6A 2D3OW 3IFXA 2WWWA 4FIPC 1FXHA 1JR9A 5IY5C 1EN5A 2ZE6A 2UUBB 2RJZA 3N2KA 2Q9LA 4FLWA 4X65O 5B1NA 5EYPA 3RGBA 5IJ9B 4LCUC 1WJZA 4ZHQA 5C8YB 4RQFA 4XDJA 3FB7C 5J2TA 3SR2C 4R50A 4DR3O 1TVKA 3D8CA 1AVMA 3RYIA 3RVZA 1EM1A 4PA3A 1P7BA 1SETA 2HP8A 2UXCO 3C90A 1OJHA 2BSKB 4MSWC 2YEVB 4BR6A 4GUNA 5LHHA 1BZKA 1GO3F 2F4VO 3AK1A 3RVYA 2BSKA 2PI4A 3ETEA 3ZMTA 5L3CA 2OCCB 2VWJA 5H6RA 2LFRA 1P4RA 1EBOA 1N0NA 1YITV 1PNMA 5LYJA 1L1FA 1BSMA 2XNDG 3ZMZA 4LF5O 2JGDB 2GUZB 3ASOC 2X7RB 4EEQA 2YS8A 1LUVA 2JIZG 5GONA 1DF4A 4X64B 5IYZB 1SESA 1AI7A 2IH3C 3CWBH 4CBCA 2Q7GA 4O2AB 3JAWA 4JASA 2QEXV 4DV7B 2QTOA 4Z1VA 3P32A 1GN3A 3LSSA 2O57A 1PM9A 4DR6O 3X2QC 1YTFB 1PNLA 1E79G 2R9RB 1L8DA 1TUBA 4PHZA 4RUEA 3TCUA 4LWSA 5LP6B 1EN4A 3CYOA 3OGIB 2EIJC 4RO2A 5JQGA 2A9HA 4FFBB 1L0NH 3E86A 1IZ3A 1LR1A 1AR1B 3D36C 2OT5A 1PV0A 3EVKA 1VF5B 2UXBO 1K34A 1M1KW 1A32A 4PA6A 3AG3B 5KUKA 1FPOA 1W2BU 3CCVV 5LA6B 4X65B 3GVMA 2NN4A 3MHSC 5BZBA 4B7EA 4OXSA 3GB7C 3CC7V 1WPBA 1UFIA 3CC4V 1Q43A 2ZE7A 1PP9H 2MW2B 3WG7B 2ZCEA 2B9ZA 3APQA 4JI1O 1TGOA 1SZTA 3APOA 4ZIBA 5LGUA 2XAFA 1K92A 3OTOB 1V54B 1N32O 1AI5A 1OCZB 2V4DA 4IL6Z 1IBLB 2JDIG 2VS0A 3F5WC 3E8HA 3P3NA 5H6QA 3U11A 2QKSA 1N34O 3RWRD 4EB6A 3A2FA 1ZL8A 2ZXWB 3RYFA 2RCVA 4CH3A 1XUQA 1MZEA 1AJNA 2ZINA 3T1CA 3RYHA 3CD6V 5CA3A 2EIJB 3AK2A 2A0LA 2JS5A 3SPGA 3G6EV 1JFFB 4X64O 5IWAO 3ZX6A 3JD2A 4CS3A 2Y69C 2KB1A 3MD0A 5EK0A 3B77A 4N23A 4JI0B 2PYLA 4J11A 2P6JA 3CCEV 3E8GA 1US6A 2M6YA 3JD0A 1M57B 3OFNG 2M7WA 3A0BZ 2GV9A 1F7YA 1SQGA 3K57A 2OYQA 4WFGA 4FLXA 3IAYA 2UUAB 2EJRA 5B1OA 2R9IA 3JD4A 4JTDB 4O4HA 4JI4B 3IC7A 4C7UA 4J10A 5KHHA 1XHZA 2AHYA 4LF6B 2KG7B 4MT8A 2B1GA 4NR1A 4JZGA 5LGTA 5KA5A 4X1KA 4DW1A 1NVPD 2YI9A 1SQXH 2Q5ZA 3T1HO 2F43G 2F93B 1BHAA 3DXRA 1NBMG 2QSAA 3FB6C 3ZS8C 1K5QA 5BXZA 1FYJA 3ZCCA 3WU2Z 3SJBC 1SQPH 2WLLB 3CHXA 1NTZH 1QVFU 1Q81W 1Y74B 2RMKB 4JZ2A 5IY5B 1XMOO 2YDEA 1YF2A 1R6TA 3AEIA 2ILMA 5EBMC 3D3IA 1Q6IA 1MMMA 4FJCC 4PDVA 1D5NA 3JATA 1SZXA 5CA1B 1HNWO 4TQFA 1P7GA 4TQDA 1S77D 4E4EA 1GKFA 2ETNA 4FM1A 1HR0B 5LXTB 4GZRB 1I94O 1H2SB 3QO8A 2Q0OC 4AHCA 2CK3G 4DV6B 2Q0AA 4LBEC 5EC2C 4LF8B 4PV1B 2ADPA 4B7KA 1VQ7V 1MSWD 1Q8IA 1MZFA 3CRMA 2IH1C 3STLC 4H44B 3AG4C 1FXKA 1WAZA 2W6IG 1WP8A 4DUYB 2OCHA 3T1YO 4FLZA 1TUBB 3ZHTA 1VQ4V 5J2UB 5LL6Y 5BMVB 1KQSU 2HKOA 3SYOA 2DQ0A 4CH4A 4FPPA 2WAMA 2W0FC 4JYYA 4KHPB 3OEEG 4QPJA 5CBHA 4CH5A 3T2MA 4DV2B 1B04A 1WNSA 4GX1A 1GTOA 4K8XA 1GM7A 3UO3A 4MW8A 3CMEV 3K5LA 1N8RW 1H2MA 3RYCA 1NR1A 4IGGA 1M5IA 3GWKC 4FFBA 1UJWB 1N36B 1IBMO 2CTPA 3RFRA 1SQFA 4F6RA 1VQKV 5GTIZ 2XUMA 2VWKA 1Z2GA 3E8FA 2HLDG 2A7WA 4NB5A 3ZRSA 4RQEA 2EX3A 2DN9A 4DR7O 4LF9B 4TSFG 3J80N 3LNNA 2KQXA 3L71H 1EN6A 3JALB 4MVUA 4CS2A 4PD4F 1JVMA 2P4KA 5FNVA 4ZI7A 4UUJC 4JI0O 5C8YA 4ZHQB 3FFQA 4D7SA 3SYCA 1H38A 2UXCB 2UXNA 1HNWB 1VQLV 4OPHA 3K5NA 1JCHA 1XILA 2ZIOA 3B09A 1BT8A 4UCVA 1FFTB 3H1JH 4WFAV 3HB3B 5JH7A 1ZAUA 3CP1A 2A79B 4X62B 4B3MO 4JI7B 4EFEA 2C2AA 1NH2D 3N2GB 1BS3A 3KG2A 3JALA 1R73A 2NLJC 2WLKA 3HKCB 1CXZB 5CMUA 1YCIA 3SDLA 1H2LA 2CDYA 2PZSA 1DK1A 5H2FZ 4O4IA 2ZT9B 1O9GA 1QCEA 4U7NA 1XL4A 2EIMC 3OUFA 1V55B 4WCEV 3M99B 3I56V 2AW9A 1Y76A 2Y4UA 5A2QN 3AG3C 2X0LA 3BA9A 1JMKC 4K8ZA 1ZTEA 2E75B 3EXAA 1EZJA 5GTHZ 3O9OA 4CS4A 3FX7A 1GN6A 2UXDO 3ZHUA 2RNBA 1XMQO 3T4ZA 3FAVA 4HZ3A 2FMLA 1FD9A 5LMUB 3CCSV 2CE4A 5LP6C 1BQ0A 1EZVH 3FB8C 3QO7A 4B3TB 2F1MA 1ZLZA 4CC6A 2BE3A 4DV3O 2UU9O 1OCCC 3DSQA 4O2BB 3E22A 5B66Z 4TOIA 4L87A 5E79Z 2ZKOA 2CTWA 1KP3A 1U97A 2YXYA 4NKGB 2E74B 2H3OA 1ROPA 3QO5A 4LF4B 4J7ZA 3ABLB 4MTFA 4JI8B 1RM1B 2ADQB 3P30A 1I5XA 5JQGB 4JV5B 2P4VA 2QWOB 1EFRG 3SJQC 1Q6UA 3ASOB 1BQZA 4F6EA 1T5EA 5KMGA 1IVSA 3CC2V 1Z5VA 1AI4A 2Q67A 2QM4A 3JARB 1AJPA 5L3FA 3N2GA 2DYRC 1WB8A 3UKMA 2NNUA 4B3TO 5KHGA 3OE7G 3OMIB 1KYOF 2UXDB 1NQTA 1N4CA 1FKAO 4B3SO 4LWSB 1FJGB 2OCCC 5KLVH 5HFLA 3MHHC 1U96A 4F6RB 1DF5A 4G28B 1HWYA 4X66O 2WLNA 4DR2O 2VQEO 3H1KH 2EIKC 2BTOA 1RPRA 4GX0A 2YSUB 2H94A 5DN6G 1Q5OA 5LHGA 5CN0A 4NXMO 1S3JA 2ATKC 3BRCA 5JJNB 2E5LO 3VQVA 1BCCH 1HW7A 1PKXA 2G38A 1IDSA 3BHPA 4X8AA 5EIBC 1YJ9V 3W7SA 5HFMA 1G4YB 3K58A 4X1KB 1COWG 2ODMA 3WB1A 4JYCA 2KG7A 3ZIAG 1VQMV 1GM9A 4IT5A 3G6BA 4DV5B 1K5SA 4MVQA 4K0KB 4GT1A 1JJ2U 1H8EG 3OM3B 3W7XA 3UT5A 1M56C 3THOA 3RYIB 2EINC 1SRYA 1VQ9V 2P7TC 2QWRB 1KKDA 2JS3A 4MVRA 3S3WA 1JQ0A 3TXSA 3KCXA 1R3IC 1W0JG 3FB5C 5CA1A 3WB0A 3IC9A 4PI0A 4YY3B 3ZHSA 2VQEB 2CAZC 4TV9A 3VOUA 3OT7A 4BWAA 5JCOA 1OCRC 3NR7A 2QKAA 4WFEA 4FLTA 1VEWA 3CCJV 1VMGA 4YJ3B 4BW5A 2BTQB 2L6LA 2JEUA 3HR0A 3LDDA 4DV3B 3VQXA 1PNKA 2UU9B 2QM8A 2ZM6O 1TVKB 4HNAA 1TAEA 2ZE8A 4XDKA 4DR4B 2EULA 4MVMA 4FVMA 2N74A 1G6UA 3K0GA 5FPOA 3ZHRA 2KKWA 3FYIB 4R6ZA 3I55V 2PY5A 4JV5O 1TA8A 1MG1A 1HNZO 4PA4A 3U10A 3HKCA 2IJJA 4MVZA 3J81N 2GHYA 2GDSA 4U3JA 5KHKA 2V7QG 2UUAO 2AXTZ 1IBKB 1WLEA 3LSUA 4FLYA 3CX5F 4BIUA 3DGEA 3A0RA 4J9YB 4JI5O 3H01A 5D5PA 4QE9A 5ITZA 2RDCA 3BCCH 1P84F 3K79A 2CUGA 3C3TA 3ZBHA 3F7VC 3KKYA 4QGPA 1PD3A 3ZRWB 4PDRA 4MVSA 1YHQV 2EILB 1QNMA 4G27B 4QE7A 4ASUG 5F2VO 4WFFA 1XMOB 1XEQA 2ZR2A 4MW3A 1R3JC 4I0XB 5J2TB 1VF7A 1PPJH 3D36A 4X9QA 1R6KA 1H2GA 3BA8A 3AG1B 3W7UA 1YI2V 3QF7A 1QQCA 1H2KA 1O9HA 4J7KA 2PYJA 1ZWIC 2HHHB 2Y0PA 1OCZC 2V1DA 4D7TA 1V54C 3VQWA 5CB4B 3JD3A 4JI6B 1WP7A 2EINB 5EBWC 4I9QA 1M56B 4JGSA 3UM7A 1XBLA 2F23A 5LBQA 2LO1A 2YXLA 3K3WA 2GUZA 2WA3A 5KX5A 4GKKO 1QLNA 4RUFA 2HG5C 5L3BA 3RYHB 4DV4B 3CRAA 2IM9A 5CB4A 3MAQA 1I5YA 1Y67A 1XDCA 2XAGA 4FM0A 1S76D 4NTYA 4O4LA 2E76B 5E1AC 3ZN1A 4DV7O 4X88A 5EZYA 3H1LH 5LGNA 4YXWG 4DR2B 2LW7A 2JK5C 5LMNO 3TXQA 1Q6HA 4IYHA 4ZI7B 1KU9A 2HR3A 1OCOC 1MOFA 4IIJB 1DTOA 4JI3B 5IJ0B 1NJIW 4B08A 3UCSC 1N36O 1IBMB 4G2KA 4AILC 3BABA 1KECA 5EC1C 4MS2A 1RP3B 1YIJV 4P30A 3RYFB 3CJHA 2LGQA 1R3KC 2HJDA 1KKCA 4X20A 4I55A 1YXBA 1K4DC 3ETDA 1N34B 5IYBO 4O4JA 1B6QA 3F7YC 1AP6A 1B06A 2P67A 4NVPA 2WLJA 1FXKB 5TISZ 4UCRA 3RYCB 4JYAO 4TV8B 1Y74A 2Y0IA 3BEHA 2ZNJA 3JARA 1MNGA 4PELA 4TUYA 4P2ZA 2X6BA 2QR4A 1NKDA 1XNQO 3K08A 1M9NA 1XNRO 4O4JB 4EFBA 2XTAA 4BIOA 4GCZA 3SPCA 5LMUO 3P3PA 3FD9A 1MSDA 2OTLV 3L70H 3FYEB 5CBGA 5JVDA 5KHJA 2YICA 1AROP 1VQ8V 1GN4A 2HEPA 4QNHB 3AK3A 1E1RG 5EZYB 4DR1O 4H33A 4PA7A 1S5HC 4IIJA 3QVNA 4EKWA 3Q4HB 1E1QG 4NTXA 3H1HH 2EBOA 4JYAB 5LP6A 2A3QA 3TGUH 4OPAA 1M93A 5LXTA 2QWPB 4FK5C 2QE7G 1VARA 4LFCB 2ZE5A 3ZRVA 1VQ6V 4D6TH 4DR4O 5AG2A 4PA9A 3SJAC 3B8MA 2GBOA 1R6NA 4BW9A 1YZBA 4GKJB 4OX9B 3ZRXA 2ZQMA 2QWQB 4I4TA 4GX2A 1H2NA 1VQ5V 4DUYO 2F4VB 4I0XA 5ITZB 3CCQV 3KCYA 1YJWV 4YHHB 3M7MX 4I9WA 1Y6XA 1YJNV 4Z1MG 4AI8A 3N2KB 1L0LH 2DMXA 5JCOC 3CCUV 3RBZA 3AG1C 1VIBA 2CTRA 1Q90D 2Z0AA 5LOVB 3K0DA 3Q4HA 2ZD9A 4X1IA 5KUMA 4P9OA 4TV8A 3CXHF 5B3SB 1Y4MA 3RT3C 1PL0A 2YIBA 4K35A 1AP5A 1R1BA 3QNEA 5EBLC 2XOKG 2DWEC 2E3CA 2IBZH 4MTOA 2IJHA 2OTJV 4I55B 3STZC 4GYCB 1ENVA 2JRIA 4UCUA 3W7WA 2DQ3A 2JGUA 1HDJA 1B3QA 5KAIZ 4OGQB 2ZR3A 3L9DA 3L73H 3WFVA 1FJGO 1XREA 2B5UA 4KL1A 3DTUB 4XBFA 4YJ3A 4U3JB 4FZ0A 1QVGU 3SYPA 1K8AW 1W59A 4B3MB 2P06A 2EZPA 1X4TA 4YJ2B 3OTFA 1KUQA 4AQYB 1YEWA 3T1HB 4DRXA 5B3SC 2Q8VA 3JYCA 4DV1B 3H1IH 3B40A 2PF4E 4UVCA 3U0ZA 3ASNC 1SS3A 4DV6O 1K7DA 1HNXO 3O65A 2L35A 3B4SA 1XHXA 5CA0B 3SPJA 1WB7A 1BE3H 2DE0X 4JI7O 3TJTA 1RFYA 3SJCC 3ETGA 2ZM6B 2CGNA 2R72A 2VRZA 5J9PC 1G1XB 5LYJB 2ZXWC 4LFBB 1I7FA 2UXBB 4DV4O 4NYKA 4TV9B 3HKDA 4WBNB 3PN1A 1IXMA 4UV8A 1J5EB 3HKBA 1JJOA 2FKXA 5IE9A 5JJJB 2H8PC 1URFA 4Z2WA 2JEXA 3K5OA 4UB8Z 3JAKB 2ITDC 4P9PA 4UB6Z 4HYOA 2DOSA 3OEHG 2Q7EA 3TK1A 1DLBA 5A9GA 2QWNB 1F23A 2R70A 1S0VA 1JPXA 3OW2U 4RWUA 4ABMA 2EJ7A 3LUTB 4JF3A 1H8HG 2NR5A 3E89A 3ABKC 4XDLA 4JTCB 1SA0A 2OIGA 3JAKA 3E8BA 2VQFO 4LFBO 1KD1W 4JYBA 3CSXA 3CCLV 2AHZA 5KAFZ 1FS0G 3UQ8A 2IJKA 3SYAA 3ZMVA 3OUSA 5KHIA 4CZZA 3B8NA 4UVBA 3ZMSA 2LP7A 4DV5O 3CS5A 3VQYA 4KHPO 3JAMN 4UCOA 3TETA 5GW7A 4B3RB 1N0JA 4YJ2A 3X2QB 5JVDB 2R9AA 4H37A 2XASA 2LJ2A 4IHJB 5CBFA 1KMIZ 3EFFK 3OR7C 2UUCB 1BL8A 3LNMB 4LNUA 4J80A 4X66B 2OWOA 1UPGA 2N04A 4IHJA 4FZ1A 4DK0A 4H13B 4X20B 2DYRB 4TWKA 2Y69B 5B1AB 2HFEC 5IWAB 4GLXA 3QG5A 3M8AA 4NXMB 4HAMA 3E35A 1QLEC 5C93A 3ZN0A 3JASA 4LFAB 1XOUA 3L72H 1Q86W 1OCOB 2JJ2G 4H0LB 1RM1C 5BY1A 5KA6A 5FLXN 2PGGA 1GMGA 2FL4A 2P90A 1VQOV 3MDSA 2IU3A 3UT5B 2XAQA 3CB2A 5FNVB 3JSNA 3K04A 1SQVH 1CP9A 4LF4O 2IJIA 3VBBA 1AR4A 4O4LB 1XI1A 3ZHVA 3FAVB 1XNQB 3BAAA 1IBKO 3JASB 5JH7B 4JAVA 4KUMA 3I5DA 3WG7C 1Z5WA 2XAJA 3K59A 2Q73A 1DGSA 1CEZA 5EIBD 1ZUQA 3ICXA 4LF8O 1Q7YW 3K5MA 2Q68A 3S3XA 1NI8A 3ABMC 1YSCA 4DO2A 1NR7A 4DR5O 1GRJA 4DUZB 2QJ1A 3E2EA 4I5SA 1I08A 3ABTA 2VQFB 2Q4PA 4O4HB 4DV0O 4DV2O 3HKDB 4JI6O 2YIDA 1FAFA 3N27A 2RQ6A 4A5UB 3CEIA 3ZHQA 2P5OA 1SQQH 3CRQA 2Y48A 3L75H 1ZSPA 4DV1O 1NVPB 5B5EZ 5B1BB 1XNRB 4YIPA 3FKSG 3ASNB 3C3SA 2UXXA 2LW1A 2FYUH 2ARHA 1K97A 4QIWF 1BMFG 1GH6A 4LP8A 2AZ2A 4DRXB 5K1XA 2EILC 2E5LB 4TT3G 2GTAA 1RPOA 3IJ4A 4W4KA 3RW0A 3SPHA 4FFKA 4JPRA 5EYPB 4I50B 4WF9V 4LF9O 1BGYH 1XQ8A 2Z3YA 2ZDIC 3CCMV 4LNUB 4BIZA 1QR9A 2Q69A 1VF6C 3CE2A 2ITCC 4FLVA 2CH7B 3SGIA 4CH6A 4X1YB 4RAIA 2PI5A 3HPLC 2LGWA 3KZIZ 4JI8O 1RSOA 3CRCA 2DYSB 3E83A 2WLIB 4OX9O 3UO2A 2WLIA 1IXBA 1OHHG 2D2CB 1VQPV 2JJ1G 4LFAO 5IYCO 4ZBMA 4DR3B 5IJ0A 1MA1A 4J7JA 1QBZA 2BTQA 1SKVA 1K73W 3E22B 4F4LA 1BHBA 1SC5B 4HNAB 4UCSA 1F4MA 1IBLO 2A06H 2HVJC 3AG4B 2ZIMA 3WB2A 2WLMA 1W0KG 5LMNB 2GTSA 3ZEDA 4UFZA 2BOBC 4GKJO 3CJHB 4AQYO 3JD1A 3OTOO 1OCRB 1AI6A 1WA8A 1Q82W 2ZNIA 2FTKA 1N33O 2F95B 3JATB 1FXVA 1NZ6A 4JI5B 5L3GA 1FFXB 1QR8A 1J95A 4LR3A 2Y4TA 4I4TB 5L3EA 1N32B 1K3EA 2UUCO 2IU0A 4NXNO 5GONB 3IGAC 2WSSG 3PJSK 2FB5A 1NTMH 1TUEB 3W7TA 1S72V 4JI1B 4I50A 1K33A 2W6JG 3H9VA 4ZOLB 1HNZB 5D5QA 3LSQA 3L74H 3HKEA 1ORQC 4K0KO 3OMAB 1NH2B 2Z5UA 1NTKH 4KP4A 5LOVA 3CCRV 1NU1H 4WFHA 1K9MW 2WPDG 4GX5A 4O2AA 1QU7A 3OR6C 1OV9A 4CC5A 4YY3O 3SYQA 2WLHA 2QM7A 3HKEB 1QLEB 4U7OA 4N21A 1SERA 1CPYA 3DC5A 2EIKB 2YIBD 5JWPA 4EB6B 2XHBA 1M4UA 3RN4A 4TUYB 4E2LA 3A0HZ 5DECA 1V9PA 5BMVA 5J2UA 1JA8A 4ZKIA 4JI4O 1FXKC 5IDJA 1P49A 2XT9A 4Q20A 5DM6V 1M57C 3ZMUA 1JX9A 4DR5B 4R8CA 3AG2B 5K1PA 3G80A 1GN2A 5B1BC 1I0HA 1VP7A 2K1EA 1KC8W 3OAAG 2PTMA 4DXWA 5DEDA 4J42A 4B3RO 1OCCB 1XL6A 1WN7A 5L3DA 4PI2A 1AB3A 4UCTA 1SF9A 3LDEA 3A8TA 3BVOA 2W0XA 2B1IA 2DJVA 3ABLC 4FLUA 3BY6A 3SPIA 4YHHO 2X6AA 3G4SV 1NS1A 1Y66A 2QGNA 4Q6GA 1I94B 3OGCC 1WPXA 5IYZA 2WLLA 4JI3O 1V55C 1J5EO 2EIMB 1Y76B 2QTSA 4KFMA 1HP8A 3ZJZA 2XAHA 4BAYA 1NT2B 2QKCA 3ML0A 2PUSA 1GAXA 1Q3EA 3K06A 4DYLA 1IX9A 2QDOA 4DR7B 4MTGA 2DW4A 2KSDA 3EHBB 5KX5B 2HHHO 4PJ0Z 4R7CA 1RSOB 4JI2B 4WFBV 2MK3A 3R66A 4DK1A 2AZ0A 4J9ZB 4LFCO 4LF7O 2N05A 1D2DA 3CPWU 4KXRA 1JOYA 2JVDA 1SA0B 1KP2A 2K9PA 2EZOA 4MTXA 4WBNA 4JTAB 3B2EE 3DC6A 1KBHA 3K9AA 2F66C 2YUAA 4X62O 5LHIA 5FPRA 1KB9F 4UV9A 4J41A 3G71V 3DXRB 1OZ0A 3JAWB 2AGAA 4JAAA 4ZOLA 5IJ9A 1IURA 4X1IB 2BOCC 2OIEA 4JAUA 4W4LA 5B1AC 2JGDA 3CXCU 3T4DA 2CTQA 4B3SB 4FM2A 2IW5A 4X1YA 4MVOA 1HR0O 2QA4V 3AG2C 1FFXA 3F5TA 3JCZA 3NXSA 3HKBB 3JCUZ 4DV0B 3CRRA 2YI8A 1JFFA 2Q7HA 3K9SA 4U3FH 4UXNA 4PDMA 2YXHA 1YTFD 4YIOA 2HVKC 5IT9N 4DUZO 2DYSC 3QTCA 2Q6AA 5H9CA 1ZL8B 1SQBH 1AJQA 3GWOA 4LF6O 2ZDIA 2YEVA 4ICGA 3LDCA 2HJFC 2YC0A 3D3QA 4LF5B 2P22C 3J7AU 1K4CC 3G67A 1VF6A 2YIAA 4LF7B 4UVAA 2LFSA 3ETQA 1LNQA 1QHTA 3ZRWA 4LH7A 2RN9A 1F51A 4DR6B 5FL7G 1VQNV 3BPZA 5KMGB 1X59A 5JJEB 4I7ZB 4NXNB 4O2BA 1WA8B 3ABKB 3AG7A 1S5LZ 5IYDO 4QJFB 1D5AA 1M90W 3T1YB 4L8JA 1N33B 3K03A 4PDLA 5BR8B 4K3AA 5CA0A 3OD4A 3ABUA 4DR1B 3CMAV 1LUWA 4HBNA 2WA4A 1MABG 4DW0A 2GSMB 1G8MA 1HNXB 1GK9A 1R3LC 4QPKA 4LC1A 2UUBO 3R65A 1YVWA 1THZA 1F4NA 2CGOA 1XMQB 5LA6A 4IYIA 3BFRA 1S5JA 3JSLA 4O4IB 1PL4A 4FMTA 4X89A 2BCCH 4GKKB 1AR5A 2LQTA 1AILA 4NTWA 3OMNB 4JI2O 1YDXA 5BR8O 1GM8A 2DWDC 5H5NA
chains in the Genus database with same CATH topology
3CP1A 2A79B 1K97A 2X6CA 3ABMB 4GCZA 3SPCA 4QIWF 1BMFG 4LP8A 2D3OW 3IFXA 2WWWA 4FIPC 1FXHA 2C2AA 2EILC 2OTLV 1NH2D 3FYEB 5CBGA 4TT3G 5IY5C 1RPOA 3KG2A 3RW0A 1R73A 1AROP 2NLJC 3SPHA 1VQ8V 2WLKA 4QNHB 4JPRA 1E1RG 5B1NA 5CMUA 4WF9V 4H33A 4LCUC 2Z3YA 2ZDIC 4PA7A 4RQFA 3CCMV 1S5HC 4XDJA 3FB7C 1QCEA 4EKWA 4R50A 4U7NA 1E1QG 1XL4A 4BIZA 1QR9A 2Q69A 2EIMC 3OUFA 1V55B 2ITCC 3M99B 3RVZA 4WCEV 3I56V 2EBOA 4PA3A 1P7BA 1SETA 4RAIA 2PI5A 3HPLC 3AG3C 2X0LA 4MSWC 2YEVB 5LHHA 1EZJA 1GO3F 4FK5C 2QE7G 3ZRVA 1VQ6V 2DYSB 3RVYA 4PA9A 3B8MA 3E83A 3T4ZA 4HZ3A 2WLIB 2PI4A 2WLIA 3ETEA 3CCSV 1OHHG 3ZMTA 5L3CA 1VQPV 2JJ1G 2OCCB 5IYCO 1R6NA 4ZBMA 5H6RA 2LFRA 1QBZA 1P4RA 3FB8C 3QO7A 1EBOA 3ZRXA 2ZQMA 1OCCC 1K73W 1YITV 4L87A 1PNMA 4F4LA 1L1FA 1BHBA 1KP3A 2XNDG 3ZMZA 1F4MA 1ROPA 3QO5A 4GX2A 3ASOC 3ABLB 4MTFA 2X7RB 1RM1B 1VQ5V 3AG4B 2HVJC 2JIZG 3P30A 1I5XA 1DF4A 3CCQV 1SESA 2WLMA 1W0KG 1AI7A 1EFRG 2IH3C 1YJWV 4CBCA 3SJQC 4I9WA 1YJNV 3ASOB 4JASA 2BOBC 2QEXV 4Z1MG 3CC2V 1AI4A 2QTOA 3JD1A 2Q67A 1OCRB 3P32A 1AJPA 1AI6A 3LSSA 5L3FA 3CCUV 3RBZA 2DYRC 1PNLA 3AG1C 1E79G 2NNUA 2R9RB 3UKMA 3X2QC 1YTFB 1Q82W 2FTKA 3OE7G 3OMIB 1NQTA 4RUEA 1FXVA 3TCUA 3CYOA 3K0DA 2EIJC 2ZD9A 4RO2A 2A9HA 5KUMA 4P9OA 2OCCC 5L3GA 1QR8A 5HFLA 1J95A 5B3SB 3MHHC 1Y4MA 3E86A 1PL0A 5L3EA 1K3EA 1DF5A 3QNEA 4G28B 5EBLC 2XOKG 1AR1B 2DWEC 3HB3B 2IU0A 4MTOA 1HWYA 2IJHA 2OT5A 2OTJV 3IGAC 2WLNA 2WSSG 3PJSK 1TUEB 1K34A 3STZC 1M1KW 2EIKC 1ENVA 3W7TA 1S72V 1RPRA 4PA6A 3AG3B 5KUKA 3W7WA 4GX0A 1K33A 2W6JG 2DQ3A 2YSUB 2H94A 1W2BU 2ZR3A 3CCVV 5DN6G 3LSQA 5LHGA 5CN0A 3WFVA 3MHSC 1ORQC 3OMAB 1S3JA 2Z5UA 1NH2B 2B5UA 5BZBA 2ATKC 3DTUB 4OXSA 4XBFA 3GB7C 4KP4A 3CC7V 3CCRV 3CC4V 1PKXA 4WFHA 1K9MW 1QVGU 3SYPA 1K8AW 3WG7B 2EZPA 2WPDG 4GX5A 3OR6C 1SZTA 4X8AA 1YJ9V 3SYQA 3W7SA 5HFMA 1G4YB 2WLHA 2QM7A 5LGUA 5B3SC 2XAFA 1K92A 1COWG 1V54B 4JYCA 1QLEB 4U7OA 1AI5A 3ZIAG 4N21A 1OCZB 1SERA 3JYCA 1VQMV 1CPYA 1GM9A 4UVCA 3ASNC 2JDIG 1K5SA 4MVQA 2EIKB 3F5WC 1K7DA 3E8HA 4GT1A 2QKSA 5H6QA 1JJ2U 1H8EG 3OM3B 3W7XA 4E2LA 2ZXWB 1M56C 3SPJA 2EINC 4ZKIA 1SRYA 1VQ9V 1FXKC 2P7TC 5IDJA 1AJNA 4MVRA 1KKDA 1JQ0A 3T1CA 1R3IC 4Q20A 1W0JG 3CD6V 3FB5C 3ETGA 5CA3A 2EIJB 5DM6V 2A0LA 1M57C 3SPGA 3G6EV 5J9PC 3ZMUA 1JX9A 2ZXWC 3AG2B 4R8CA 3JD2A 2Y69C 5B1BC 2KB1A 2K1EA 3MD0A 5EK0A 3OAAG 3VOUA 1KC8W 3B77A 4N23A 4DXWA 1OCRC 1OCCB 1XL6A 1IXMA 2P6JA 5L3DA 3CCEV 3E8GA 4WFEA 4UV8A 3JD0A 1M57B 3CCJV 3LDEA 3OFNG 4BW5A 2M7WA 2JEUA 2B1IA 3LDDA 3ABLC 2H8PC 1PNKA 2QM8A 4WFGA 2JEXA 2ITDC 3BY6A 3SPIA 4P9PA 2X6AA 2EJRA 4HYOA 5B1OA 3OEHG 2R9IA 3G4SV 4XDKA 3JD4A 1Y66A 4MVMA 3TK1A 1DLBA 4JTDB 3OGCC 3IC7A 1F23A 1WPXA 3K0GA 1S0VA 1JPXA 2AHYA 2WLLA 1V55C 2EIMB 3FYIB 4KFMA 3OW2U 4R6ZA 3ZJZA 3I55V 2XAHA 4BAYA 3ML0A 1MG1A 2B1GA 3LUTB 4MT8A 4PA4A 5LGTA 3K06A 4JF3A 5KA5A 1H8HG 2IJJA 3ABKC 3E89A 4MVZA 4XDLA 2GHYA 4JTCB 4MTGA 2DW4A 1NVPD 3E8BA 1KD1W 2V7QG 4JYBA 3CCLV 2AHZA 1FS0G 3EHBB 2IJKA 1WLEA 3SYAA 3ZMVA 3OUSA 4R7CA 4CZZA 2F43G 4WFBV 4BIUA 3B8NA 4UVBA 3ZMSA 1BHAA 2MK3A 2LP7A 3DGEA 1NBMG 3A0RA 4J9ZB 4J9YB 3H01A 3FB6C 1K5QA 3ZCCA 3CPWU 4QE9A 3TETA 5GW7A 1JOYA 2WLLB 1QVFU 3K79A 1Q81W 3F7VC 3X2QB 1KP2A 2EZOA 4MTXA 1PD3A 4JTAB 4H37A 3ZRWB 3K9AA 2XASA 4PDRA 5LHIA 5IY5B 4MVSA 1YHQV 2EILB 3AEIA 4G27B 4UV9A 4QE7A 4ASUG 5EBMC 3G71V 1OZ0A 3D3IA 5CBFA 3EFFK 4FJCC 4PDVA 3OR7C 4WFFA 2ZR2A 1S77D 1BL8A 4MW3A 1R3JC 3LNMB 1GKFA 2BOCC 4JAUA 5B1AC 3D36A 1R6KA 1H2GA 3QO8A 3CXCU 2DYRB 2CK3G 3AG1B 4TWKA 3T4DA 4LBEC 2Y69B 3W7UA 2IW5A 5EC2C 4MVOA 1YI2V 5B1AB 2QA4V 1VQ7V 2HFEC 1MSWD 3AG2C 1ZWIC 1OCZC 2V1DA 4HAMA 3E35A 1QLEC 3JCZA 3NXSA 3ZN0A 5C93A 1V54C 2IH1C 3JD3A 4UXNA 4PDMA 1Q86W 3STLC 1OCOB 1YTFD 2JJ2G 3AG4C 1FXKA 2HVKC 1RM1C 2EINB 2W6IG 5EBWC 5KA6A 1M56B 4JGSA 1GMGA 2DYSC 2P90A 3UM7A 1VQOV 2Q6AA 5LBQA 5H9CA 2IU3A 1VQ4V 3K3WA 1QLNA 1AJQA 4RUFA 3GWOA 2HG5C 2XAQA 1KQSU 2HKOA 5L3BA 3SYOA 2ZDIA 3K04A 2YEVA 1CP9A 2DQ0A 3LDCA 2HJFC 2IJIA 4FPPA 3VBBA 2WAMA 1K4CC 2W0FC 1I5YA 3OEEG 2LFSA 4UVAA 4QPJA 1LNQA 3ZRWA 5CBHA 2XAGA 3T2MA 1S76D 5E1AC 1F51A 4GX1A 4JAVA 3ZN1A 1GTOA 4KUMA 1GM7A 4X88A 3WG7C 5FL7G 4MW8A 5LGNA 2XAJA 4YXWG 1VQNV 3CMEV 1N8RW 2JK5C 1CEZA 1NR1A 3ABKB 1Q7YW 1UJWB 2Q68A 2HR3A 1OCOC 1MOFA 3ABMC 1DTOA 1VQKV 1YSCA 4DO2A 5IYDO 4QJFB 1NJIW 1NR7A 1FFTB 4G2KA 1M90W 3E8FA 3E2EA 1KECA 5EC1C 4I5SA 2HLDG 3K03A 4MS2A 4PDLA 3ZRSA 4RQEA 1YIJV 4P30A 3ABTA 3ABUA 1R3KC 4TSFG 3CMAV 1MABG 1K4DC 2GSMB 1G8MA 3ETDA 4MVUA 5IYBO 1GK9A 1R3LC 4QPKA 4LC1A 1B6QA 3F7YC 2P67A 1JVMA 3R65A 1THZA 1FXKB 2WLJA 1F4NA 4UUJC 2Y48A 3BEHA 4FMTA 4X89A 3SYCA 1H38A 2UXNA 4PELA 1NVPB 5B1BB 1VQLV 4P2ZA 3FKSG 3ASNB 3OMNB 2X6BA 1JCHA 2UXXA 1GM8A 1NKDA 2DWDC 4WFAV 3K08A 1M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 V;  3CCV V;  3CCS V;  3CCQ V;  1VQK V;  1VQP V;  3OW2 U;  3I55 V;  1VQ4 V;  1Q86 W;  1YJW V;  3CD6 V;  4WCE V;  5DM6 V;  3I56 V;  2D3O W;  1NJI W;  3G6E V;  1YJN V;  2QEX V;  1M90 W;  3CPW U;  2OTL V;  1VQM V;  3CC2 V;  3CC7 V;  1K73 W;  3CCR V;  1VQO V;  1YJ9 V;  3CC4 V;  2OTJ V;  1QVF U;  1YIJ V;  1K9M W;  1R73 A;  1YIT V;  1KD1 W;  1Q81 W;  3CXC U;  1QVG U;  1K8A W;  3CCU V;  3CCL V;  1KC8 W;  1M1K W;  1VQ8 V;  3G4S V;  1VQL V;  1JJ2 U;  1VQN V;  3CME V;  1S72 V;  1Q82 W;  1YI2 V;  1N8R W;  2QA4 V;  1KQS U;  1VQ6 V;  1VQ7 V;  4WF9 V;  3CCE V;  3CMA V;  1YHQ V;  1VQ5 V;  4WFB V;  1Q7Y W;  1W2B U;  3CCJ V;  4WFA V;  3CCM V;  1VQ9 V; 
#chains in the Genus database with same CATH topology
 2X6C A;  3ABM B;  1ZX3 A;  2CH7 A;  4LH6 A;  2D3O W;  3IFX A;  2WWW A;  4FIP C;  1FXH A;  1JR9 A;  5IY5 C;  1EN5 A;  2ZE6 A;  2UUB B;  2RJZ A;  3N2K A;  2Q9L A;  4FLW A;  4X65 O;  5B1N A;  5EYP A;  3RGB A;  5IJ9 B;  4LCU C;  1WJZ A;  4ZHQ A;  5C8Y B;  4RQF A;  4XDJ A;  3FB7 C;  5J2T A;  3SR2 C;  4R50 A;  4DR3 O;  1TVK A;  3D8C A;  1AVM A;  3RYI A;  3RVZ A;  1EM1 A;  4PA3 A;  1P7B A;  1SET A;  2HP8 A;  2UXC O;  3C90 A;  1OJH A;  2BSK B;  4MSW C;  2YEV B;  4BR6 A;  4GUN A;  5LHH A;  1BZK A;  1GO3 F;  2F4V O;  3AK1 A;  3RVY A;  2BSK A;  2PI4 A;  3ETE A;  3ZMT A;  5L3C A;  2OCC B;  2VWJ A;  5H6R A;  2LFR A;  1P4R A;  1EBO A;  1N0N A;  1YIT V;  1PNM A;  5LYJ A;  1L1F A;  1BSM A;  2XND G;  3ZMZ A;  4LF5 O;  2JGD B;  2GUZ B;  3ASO C;  2X7R B;  4EEQ A;  2YS8 A;  1LUV A;  2JIZ G;  5GON A;  1DF4 A;  4X64 B;  5IYZ B;  1SES A;  1AI7 A;  2IH3 C;  3CWB H;  4CBC A;  2Q7G A;  4O2A B;  3JAW A;  4JAS A;  2QEX V;  4DV7 B;  2QTO A;  4Z1V A;  3P32 A;  1GN3 A;  3LSS A;  2O57 A;  1PM9 A;  4DR6 O;  3X2Q C;  1YTF B;  1PNL A;  1E79 G;  2R9R B;  1L8D A;  1TUB A;  4PHZ A;  4RUE A;  3TCU A;  4LWS A;  5LP6 B;  1EN4 A;  3CYO A;  3OGI B;  2EIJ C;  4RO2 A;  5JQG A;  2A9H A;  4FFB B;  1L0N H;  3E86 A;  1IZ3 A;  1LR1 A;  1AR1 B;  3D36 C;  2OT5 A;  1PV0 A;  3EVK A;  1VF5 B;  2UXB O;  1K34 A;  1M1K W;  1A32 A;  4PA6 A;  3AG3 B;  5KUK A;  1FPO A;  1W2B U;  3CCV V;  5LA6 B;  4X65 B;  3GVM A;  2NN4 A;  3MHS C;  5BZB A;  4B7E A;  4OXS A;  3GB7 C;  3CC7 V;  1WPB A;  1UFI A;  3CC4 V;  1Q43 A;  2ZE7 A;  1PP9 H;  2MW2 B;  3WG7 B;  2ZCE A;  2B9Z A;  3APQ A;  4JI1 O;  1TGO A;  1SZT A;  3APO A;  4ZIB A;  5LGU A;  2XAF A;  1K92 A;  3OTO B;  1V54 B;  1N32 O;  1AI5 A;  1OCZ B;  2V4D A;  4IL6 Z;  1IBL B;  2JDI G;  2VS0 A;  3F5W C;  3E8H A;  3P3N A;  5H6Q A;  3U11 A;  2QKS A;  1N34 O;  3RWR D;  4EB6 A;  3A2F A;  1ZL8 A;  2ZXW B;  3RYF A;  2RCV A;  4CH3 A;  1XUQ A;  1MZE A;  1AJN A;  2ZIN A;  3T1C A;  3RYH A;  3CD6 V;  5CA3 A;  2EIJ B;  3AK2 A;  2A0L A;  2JS5 A;  3SPG A;  3G6E V;  1JFF B;  4X64 O;  5IWA O;  3ZX6 A;  3JD2 A;  4CS3 A;  2Y69 C;  2KB1 A;  3MD0 A;  5EK0 A;  3B77 A;  4N23 A;  4JI0 B;  2PYL A;  4J11 A;  2P6J A;  3CCE V;  3E8G A;  1US6 A;  2M6Y A;  3JD0 A;  1M57 B;  3OFN G;  2M7W A;  3A0B Z;  2GV9 A;  1F7Y A;  1SQG A;  3K57 A;  2OYQ A;  4WFG A;  4FLX A;  3IAY A;  2UUA B;  2EJR A;  5B1O A;  2R9I A;  3JD4 A;  4JTD B;  4O4H A;  4JI4 B;  3IC7 A;  4C7U A;  4J10 A;  5KHH A;  1XHZ A;  2AHY A;  4LF6 B;  2KG7 B;  4MT8 A;  2B1G A;  4NR1 A;  4JZG A;  5LGT A;  5KA5 A;  4X1K A;  4DW1 A;  1NVP D;  2YI9 A;  1SQX H;  2Q5Z A;  3T1H O;  2F43 G;  2F93 B;  1BHA A;  3DXR A;  1NBM G;  2QSA A;  3FB6 C;  3ZS8 C;  1K5Q A;  5BXZ A;  1FYJ A;  3ZCC A;  3WU2 Z;  3SJB C;  1SQP H;  2WLL B;  3CHX A;  1NTZ H;  1QVF U;  1Q81 W;  1Y74 B;  2RMK B;  4JZ2 A;  5IY5 B;  1XMO O;  2YDE A;  1YF2 A;  1R6T A;  3AEI A;  2ILM A;  5EBM C;  3D3I A;  1Q6I A;  1MMM A;  4FJC C;  4PDV A;  1D5N A;  3JAT A;  1SZX A;  5CA1 B;  1HNW O;  4TQF A;  1P7G A;  4TQD A;  1S77 D;  4E4E A;  1GKF A;  2ETN A;  4FM1 A;  1HR0 B;  5LXT B;  4GZR B;  1I94 O;  1H2S B;  3QO8 A;  2Q0O C;  4AHC A;  2CK3 G;  4DV6 B;  2Q0A A;  4LBE C;  5EC2 C;  4LF8 B;  4PV1 B;  2ADP A;  4B7K A;  1VQ7 V;  1MSW D;  1Q8I A;  1MZF A;  3CRM A;  2IH1 C;  3STL C;  4H44 B;  3AG4 C;  1FXK A;  1WAZ A;  2W6I G;  1WP8 A;  4DUY B;  2OCH A;  3T1Y O;  4FLZ A;  1TUB B;  3ZHT A;  1VQ4 V;  5J2U B;  5LL6 Y;  5BMV B;  1KQS U;  2HKO A;  3SYO A;  2DQ0 A;  4CH4 A;  4FPP A;  2WAM A;  2W0F C;  4JYY A;  4KHP B;  3OEE G;  4QPJ A;  5CBH A;  4CH5 A;  3T2M A;  4DV2 B;  1B04 A;  1WNS A;  4GX1 A;  1GTO A;  4K8X A;  1GM7 A;  3UO3 A;  4MW8 A;  3CME V;  3K5L A;  1N8R W;  1H2M A;  3RYC A;  1NR1 A;  4IGG A;  1M5I A;  3GWK C;  4FFB A;  1UJW B;  1N36 B;  1IBM O;  2CTP A;  3RFR A;  1SQF A;  4F6R A;  1VQK V;  5GTI Z;  2XUM A;  2VWK A;  1Z2G A;  3E8F A;  2HLD G;  2A7W A;  4NB5 A;  3ZRS A;  4RQE A;  2EX3 A;  2DN9 A;  4DR7 O;  4LF9 B;  4TSF G;  3J80 N;  3LNN A;  2KQX A;  3L71 H;  1EN6 A;  3JAL B;  4MVU A;  4CS2 A;  4PD4 F;  1JVM A;  2P4K A;  5FNV A;  4ZI7 A;  4UUJ C;  4JI0 O;  5C8Y A;  4ZHQ B;  3FFQ A;  4D7S A;  3SYC A;  1H38 A;  2UXC B;  2UXN A;  1HNW B;  1VQL V;  4OPH A;  3K5N A;  1JCH A;  1XIL A;  2ZIO A;  3B09 A;  1BT8 A;  4UCV A;  1FFT B;  3H1J H;  4WFA V;  3HB3 B;  5JH7 A;  1ZAU A;  3CP1 A;  2A79 B;  4X62 B;  4B3M O;  4JI7 B;  4EFE A;  2C2A A;  1NH2 D;  3N2G B;  1BS3 A;  3KG2 A;  3JAL A;  1R73 A;  2NLJ C;  2WLK A;  3HKC B;  1CXZ B;  5CMU A;  1YCI A;  3SDL A;  1H2L A;  2CDY A;  2PZS A;  1DK1 A;  5H2F Z;  4O4I A;  2ZT9 B;  1O9G A;  1QCE A;  4U7N A;  1XL4 A;  2EIM C;  3OUF A;  1V55 B;  4WCE V;  3M99 B;  3I56 V;  2AW9 A;  1Y76 A;  2Y4U A;  5A2Q N;  3AG3 C;  2X0L A;  3BA9 A;  1JMK C;  4K8Z A;  1ZTE A;  2E75 B;  3EXA A;  1EZJ A;  5GTH Z;  3O9O A;  4CS4 A;  3FX7 A;  1GN6 A;  2UXD O;  3ZHU A;  2RNB A;  1XMQ O;  3T4Z A;  3FAV A;  4HZ3 A;  2FML A;  1FD9 A;  5LMU B;  3CCS V;  2CE4 A;  5LP6 C;  1BQ0 A;  1EZV H;  3FB8 C;  3QO7 A;  4B3T B;  2F1M A;  1ZLZ A;  4CC6 A;  2BE3 A;  4DV3 O;  2UU9 O;  1OCC C;  3DSQ A;  4O2B B;  3E22 A;  5B66 Z;  4TOI A;  4L87 A;  5E79 Z;  2ZKO A;  2CTW A;  1KP3 A;  1U97 A;  2YXY A;  4NKG B;  2E74 B;  2H3O A;  1ROP A;  3QO5 A;  4LF4 B;  4J7Z A;  3ABL B;  4MTF A;  4JI8 B;  1RM1 B;  2ADQ B;  3P30 A;  1I5X A;  5JQG B;  4JV5 B;  2P4V A;  2QWO B;  1EFR G;  3SJQ C;  1Q6U A;  3ASO B;  1BQZ A;  4F6E A;  1T5E A;  5KMG A;  1IVS A;  3CC2 V;  1Z5V A;  1AI4 A;  2Q67 A;  2QM4 A;  3JAR B;  1AJP A;  5L3F A;  3N2G A;  2DYR C;  1WB8 A;  3UKM A;  2NNU A;  4B3T O;  5KHG A;  3OE7 G;  3OMI B;  1KYO F;  2UXD B;  1NQT A;  1N4C A;  1FKA O;  4B3S O;  4LWS B;  1FJG B;  2OCC C;  5KLV H;  5HFL A;  3MHH C;  1U96 A;  4F6R B;  1DF5 A;  4G28 B;  1HWY A;  4X66 O;  2WLN A;  4DR2 O;  2VQE O;  3H1K H;  2EIK C;  2BTO A;  1RPR A;  4GX0 A;  2YSU B;  2H94 A;  5DN6 G;  1Q5O A;  5LHG A;  5CN0 A;  4NXM O;  1S3J A;  2ATK C;  3BRC A;  5JJN B;  2E5L O;  3VQV A;  1BCC H;  1HW7 A;  1PKX A;  2G38 A;  1IDS A;  3BHP A;  4X8A A;  5EIB C;  1YJ9 V;  3W7S A;  5HFM A;  1G4Y B;  3K58 A;  4X1K B;  1COW G;  2ODM A;  3WB1 A;  4JYC A;  2KG7 A;  3ZIA G;  1VQM V;  1GM9 A;  4IT5 A;  3G6B A;  4DV5 B;  1K5S A;  4MVQ A;  4K0K B;  4GT1 A;  1JJ2 U;  1H8E G;  3OM3 B;  3W7X A;  3UT5 A;  1M56 C;  3THO A;  3RYI B;  2EIN C;  1SRY A;  1VQ9 V;  2P7T C;  2QWR B;  1KKD A;  2JS3 A;  4MVR A;  3S3W A;  1JQ0 A;  3TXS A;  3KCX A;  1R3I C;  1W0J G;  3FB5 C;  5CA1 A;  3WB0 A;  3IC9 A;  4PI0 A;  4YY3 B;  3ZHS A;  2VQE B;  2CAZ C;  4TV9 A;  3VOU A;  3OT7 A;  4BWA A;  5JCO A;  1OCR C;  3NR7 A;  2QKA A;  4WFE A;  4FLT A;  1VEW A;  3CCJ V;  1VMG A;  4YJ3 B;  4BW5 A;  2BTQ B;  2L6L A;  2JEU A;  3HR0 A;  3LDD A;  4DV3 B;  3VQX A;  1PNK A;  2UU9 B;  2QM8 A;  2ZM6 O;  1TVK B;  4HNA A;  1TAE A;  2ZE8 A;  4XDK A;  4DR4 B;  2EUL A;  4MVM A;  4FVM A;  2N74 A;  1G6U A;  3K0G A;  5FPO A;  3ZHR A;  2KKW A;  3FYI B;  4R6Z A;  3I55 V;  2PY5 A;  4JV5 O;  1TA8 A;  1MG1 A;  1HNZ O;  4PA4 A;  3U10 A;  3HKC A;  2IJJ A;  4MVZ A;  3J81 N;  2GHY A;  2GDS A;  4U3J A;  5KHK A;  2V7Q G;  2UUA O;  2AXT Z;  1IBK B;  1WLE A;  3LSU A;  4FLY A;  3CX5 F;  4BIU A;  3DGE A;  3A0R A;  4J9Y B;  4JI5 O;  3H01 A;  5D5P A;  4QE9 A;  5ITZ A;  2RDC A;  3BCC H;  1P84 F;  3K79 A;  2CUG A;  3C3T A;  3ZBH A;  3F7V C;  3KKY A;  4QGP A;  1PD3 A;  3ZRW B;  4PDR A;  4MVS A;  1YHQ V;  2EIL B;  1QNM A;  4G27 B;  4QE7 A;  4ASU G;  5F2V O;  4WFF A;  1XMO B;  1XEQ A;  2ZR2 A;  4MW3 A;  1R3J C;  4I0X B;  5J2T B;  1VF7 A;  1PPJ H;  3D36 A;  4X9Q A;  1R6K A;  1H2G A;  3BA8 A;  3AG1 B;  3W7U A;  1YI2 V;  3QF7 A;  1QQC A;  1H2K A;  1O9H A;  4J7K A;  2PYJ A;  1ZWI C;  2HHH B;  2Y0P A;  1OCZ C;  2V1D A;  4D7T A;  1V54 C;  3VQW A;  5CB4 B;  3JD3 A;  4JI6 B;  1WP7 A;  2EIN B;  5EBW C;  4I9Q A;  1M56 B;  4JGS A;  3UM7 A;  1XBL A;  2F23 A;  5LBQ A;  2LO1 A;  2YXL A;  3K3W A;  2GUZ A;  2WA3 A;  5KX5 A;  4GKK O;  1QLN A;  4RUF A;  2HG5 C;  5L3B A;  3RYH B;  4DV4 B;  3CRA A;  2IM9 A;  5CB4 A;  3MAQ A;  1I5Y A;  1Y67 A;  1XDC A;  2XAG A;  4FM0 A;  1S76 D;  4NTY A;  4O4L A;  2E76 B;  5E1A C;  3ZN1 A;  4DV7 O;  4X88 A;  5EZY A;  3H1L H;  5LGN A;  4YXW G;  4DR2 B;  2LW7 A;  2JK5 C;  5LMN O;  3TXQ A;  1Q6H A;  4IYH A;  4ZI7 B;  1KU9 A;  2HR3 A;  1OCO C;  1MOF A;  4IIJ B;  1DTO A;  4JI3 B;  5IJ0 B;  1NJI W;  4B08 A;  3UCS C;  1N36 O;  1IBM B;  4G2K A;  4AIL C;  3BAB A;  1KEC A;  5EC1 C;  4MS2 A;  1RP3 B;  1YIJ V;  4P30 A;  3RYF B;  3CJH A;  2LGQ A;  1R3K C;  2HJD A;  1KKC A;  4X20 A;  4I55 A;  1YXB A;  1K4D C;  3ETD A;  1N34 B;  5IYB O;  4O4J A;  1B6Q A;  3F7Y C;  1AP6 A;  1B06 A;  2P67 A;  4NVP A;  2WLJ A;  1FXK B;  5TIS Z;  4UCR A;  3RYC B;  4JYA O;  4TV8 B;  1Y74 A;  2Y0I A;  3BEH A;  2ZNJ A;  3JAR A;  1MNG A;  4PEL A;  4TUY A;  4P2Z A;  2X6B A;  2QR4 A;  1NKD A;  1XNQ O;  3K08 A;  1M9N A;  1XNR O;  4O4J B;  4EFB A;  2XTA A;  4BIO A;  4GCZ A;  3SPC A;  5LMU O;  3P3P A;  3FD9 A;  1MSD A;  2OTL V;  3L70 H;  3FYE B;  5CBG A;  5JVD A;  5KHJ A;  2YIC A;  1ARO P;  1VQ8 V;  1GN4 A;  2HEP A;  4QNH B;  3AK3 A;  1E1R G;  5EZY B;  4DR1 O;  4H33 A;  4PA7 A;  1S5H C;  4IIJ A;  3QVN A;  4EKW A;  3Q4H B;  1E1Q G;  4NTX A;  3H1H H;  2EBO A;  4JYA B;  5LP6 A;  2A3Q A;  3TGU H;  4OPA A;  1M93 A;  5LXT A;  2QWP B;  4FK5 C;  2QE7 G;  1VAR A;  4LFC B;  2ZE5 A;  3ZRV A;  1VQ6 V;  4D6T H;  4DR4 O;  5AG2 A;  4PA9 A;  3SJA C;  3B8M A;  2GBO A;  1R6N A;  4BW9 A;  1YZB A;  4GKJ B;  4OX9 B;  3ZRX A;  2ZQM A;  2QWQ B;  4I4T A;  4GX2 A;  1H2N A;  1VQ5 V;  4DUY O;  2F4V B;  4I0X A;  5ITZ B;  3CCQ V;  3KCY A;  1YJW V;  4YHH B;  3M7M X;  4I9W A;  1Y6X A;  1YJN V;  4Z1M G;  4AI8 A;  3N2K B;  1L0L H;  2DMX A;  5JCO C;  3CCU V;  3RBZ A;  3AG1 C;  1VIB A;  2CTR A;  1Q90 D;  2Z0A A;  5LOV B;  3K0D A;  3Q4H A;  2ZD9 A;  4X1I A;  5KUM A;  4P9O A;  4TV8 A;  3CXH F;  5B3S B;  1Y4M A;  3RT3 C;  1PL0 A;  2YIB A;  4K35 A;  1AP5 A;  1R1B A;  3QNE A;  5EBL C;  2XOK G;  2DWE C;  2E3C A;  2IBZ H;  4MTO A;  2IJH A;  2OTJ V;  4I55 B;  3STZ C;  4GYC B;  1ENV A;  2JRI A;  4UCU A;  3W7W A;  2DQ3 A;  2JGU A;  1HDJ A;  1B3Q A;  5KAI Z;  4OGQ B;  2ZR3 A;  3L9D A;  3L73 H;  3WFV A;  1FJG O;  1XRE A;  2B5U A;  4KL1 A;  3DTU B;  4XBF A;  4YJ3 A;  4U3J B;  4FZ0 A;  1QVG U;  3SYP A;  1K8A W;  1W59 A;  4B3M B;  2P06 A;  2EZP A;  1X4T A;  4YJ2 B;  3OTF A;  1KUQ A;  4AQY B;  1YEW A;  3T1H B;  4DRX A;  5B3S C;  2Q8V A;  3JYC A;  4DV1 B;  3H1I H;  3B40 A;  2PF4 E;  4UVC A;  3U0Z A;  3ASN C;  1SS3 A;  4DV6 O;  1K7D A;  1HNX O;  3O65 A;  2L35 A;  3B4S A;  1XHX A;  5CA0 B;  3SPJ A;  1WB7 A;  1BE3 H;  2DE0 X;  4JI7 O;  3TJT A;  1RFY A;  3SJC C;  3ETG A;  2ZM6 B;  2CGN A;  2R72 A;  2VRZ A;  5J9P C;  1G1X B;  5LYJ B;  2ZXW C;  4LFB B;  1I7F A;  2UXB B;  4DV4 O;  4NYK A;  4TV9 B;  3HKD A;  4WBN B;  3PN1 A;  1IXM A;  4UV8 A;  1J5E B;  3HKB A;  1JJO A;  2FKX A;  5IE9 A;  5JJJ B;  2H8P C;  1URF A;  4Z2W A;  2JEX A;  3K5O A;  4UB8 Z;  3JAK B;  2ITD C;  4P9P A;  4UB6 Z;  4HYO A;  2DOS A;  3OEH G;  2Q7E A;  3TK1 A;  1DLB A;  5A9G A;  2QWN B;  1F23 A;  2R70 A;  1S0V A;  1JPX A;  3OW2 U;  4RWU A;  4ABM A;  2EJ7 A;  3LUT B;  4JF3 A;  1H8H G;  2NR5 A;  3E89 A;  3ABK C;  4XDL A;  4JTC B;  1SA0 A;  2OIG A;  3JAK A;  3E8B A;  2VQF O;  4LFB O;  1KD1 W;  4JYB A;  3CSX A;  3CCL V;  2AHZ A;  5KAF Z;  1FS0 G;  3UQ8 A;  2IJK A;  3SYA A;  3ZMV A;  3OUS A;  5KHI A;  4CZZ A;  3B8N A;  4UVB A;  3ZMS A;  2LP7 A;  4DV5 O;  3CS5 A;  3VQY A;  4KHP O;  3JAM N;  4UCO A;  3TET A;  5GW7 A;  4B3R B;  1N0J A;  4YJ2 A;  3X2Q B;  5JVD B;  2R9A A;  4H37 A;  2XAS A;  2LJ2 A;  4IHJ B;  5CBF A;  1KMI Z;  3EFF K;  3OR7 C;  2UUC B;  1BL8 A;  3LNM B;  4LNU A;  4J80 A;  4X66 B;  2OWO A;  1UPG A;  2N04 A;  4IHJ A;  4FZ1 A;  4DK0 A;  4H13 B;  4X20 B;  2DYR B;  4TWK A;  2Y69 B;  5B1A B;  2HFE C;  5IWA B;  4GLX A;  3QG5 A;  3M8A A;  4NXM B;  4HAM A;  3E35 A;  1QLE C;  5C93 A;  3ZN0 A;  3JAS A;  4LFA B;  1XOU A;  3L72 H;  1Q86 W;  1OCO B;  2JJ2 G;  4H0L B;  1RM1 C;  5BY1 A;  5KA6 A;  5FLX N;  2PGG A;  1GMG A;  2FL4 A;  2P90 A;  1VQO V;  3MDS A;  2IU3 A;  3UT5 B;  2XAQ A;  3CB2 A;  5FNV B;  3JSN A;  3K04 A;  1SQV H;  1CP9 A;  4LF4 O;  2IJI A;  3VBB A;  1AR4 A;  4O4L B;  1XI1 A;  3ZHV A;  3FAV B;  1XNQ B;  3BAA A;  1IBK O;  3JAS B;  5JH7 B;  4JAV A;  4KUM A;  3I5D A;  3WG7 C;  1Z5W A;  2XAJ A;  3K59 A;  2Q73 A;  1DGS A;  1CEZ A;  5EIB D;  1ZUQ A;  3ICX A;  4LF8 O;  1Q7Y W;  3K5M A;  2Q68 A;  3S3X A;  1NI8 A;  3ABM C;  1YSC A;  4DO2 A;  1NR7 A;  4DR5 O;  1GRJ A;  4DUZ B;  2QJ1 A;  3E2E A;  4I5S A;  1I08 A;  3ABT A;  2VQF B;  2Q4P A;  4O4H B;  4DV0 O;  4DV2 O;  3HKD B;  4JI6 O;  2YID A;  1FAF A;  3N27 A;  2RQ6 A;  4A5U B;  3CEI A;  3ZHQ A;  2P5O A;  1SQQ H;  3CRQ A;  2Y48 A;  3L75 H;  1ZSP A;  4DV1 O;  1NVP B;  5B5E Z;  5B1B B;  1XNR B;  4YIP A;  3FKS G;  3ASN B;  3C3S A;  2UXX A;  2LW1 A;  2FYU H;  2ARH A;  1K97 A;  4QIW F;  1BMF G;  1GH6 A;  4LP8 A;  2AZ2 A;  4DRX B;  5K1X A;  2EIL C;  2E5L B;  4TT3 G;  2GTA A;  1RPO A;  3IJ4 A;  4W4K A;  3RW0 A;  3SPH A;  4FFK A;  4JPR A;  5EYP B;  4I50 B;  4WF9 V;  4LF9 O;  1BGY H;  1XQ8 A;  2Z3Y A;  2ZDI C;  3CCM V;  4LNU B;  4BIZ A;  1QR9 A;  2Q69 A;  1VF6 C;  3CE2 A;  2ITC C;  4FLV A;  2CH7 B;  3SGI A;  4CH6 A;  4X1Y B;  4RAI A;  2PI5 A;  3HPL C;  2LGW A;  3KZI Z;  4JI8 O;  1RSO A;  3CRC A;  2DYS B;  3E83 A;  2WLI B;  4OX9 O;  3UO2 A;  2WLI A;  1IXB A;  1OHH G;  2D2C B;  1VQP V;  2JJ1 G;  4LFA O;  5IYC O;  4ZBM A;  4DR3 B;  5IJ0 A;  1MA1 A;  4J7J A;  1QBZ A;  2BTQ A;  1SKV A;  1K73 W;  3E22 B;  4F4L A;  1BHB A;  1SC5 B;  4HNA B;  4UCS A;  1F4M A;  1IBL O;  2A06 H;  2HVJ C;  3AG4 B;  2ZIM A;  3WB2 A;  2WLM A;  1W0K G;  5LMN B;  2GTS A;  3ZED A;  4UFZ A;  2BOB C;  4GKJ O;  3CJH B;  4AQY O;  3JD1 A;  3OTO O;  1OCR B;  1AI6 A;  1WA8 A;  1Q82 W;  2ZNI A;  2FTK A;  1N33 O;  2F95 B;  3JAT B;  1FXV A;  1NZ6 A;  4JI5 B;  5L3G A;  1FFX B;  1QR8 A;  1J95 A;  4LR3 A;  2Y4T A;  4I4T B;  5L3E A;  1N32 B;  1K3E A;  2UUC O;  2IU0 A;  4NXN O;  5GON B;  3IGA C;  2WSS G;  3PJS K;  2FB5 A;  1NTM H;  1TUE B;  3W7T A;  1S72 V;  4JI1 B;  4I50 A;  1K33 A;  2W6J G;  3H9V A;  4ZOL B;  1HNZ B;  5D5Q A;  3LSQ A;  3L74 H;  3HKE A;  1ORQ C;  4K0K O;  3OMA B;  1NH2 B;  2Z5U A;  1NTK H;  4KP4 A;  5LOV A;  3CCR V;  1NU1 H;  4WFH A;  1K9M W;  2WPD G;  4GX5 A;  4O2A A;  1QU7 A;  3OR6 C;  1OV9 A;  4CC5 A;  4YY3 O;  3SYQ A;  2WLH A;  2QM7 A;  3HKE B;  1QLE B;  4U7O A;  4N21 A;  1SER A;  1CPY A;  3DC5 A;  2EIK B;  2YIB D;  5JWP A;  4EB6 B;  2XHB A;  1M4U A;  3RN4 A;  4TUY B;  4E2L A;  3A0H Z;  5DEC A;  1V9P A;  5BMV A;  5J2U A;  1JA8 A;  4ZKI A;  4JI4 O;  1FXK C;  5IDJ A;  1P49 A;  2XT9 A;  4Q20 A;  5DM6 V;  1M57 C;  3ZMU A;  1JX9 A;  4DR5 B;  4R8C A;  3AG2 B;  5K1P A;  3G80 A;  1GN2 A;  5B1B C;  1I0H A;  1VP7 A;  2K1E A;  1KC8 W;  3OAA G;  2PTM A;  4DXW A;  5DED A;  4J42 A;  4B3R O;  1OCC B;  1XL6 A;  1WN7 A;  5L3D A;  4PI2 A;  1AB3 A;  4UCT A;  1SF9 A;  3LDE A;  3A8T A;  3BVO A;  2W0X A;  2B1I A;  2DJV A;  3ABL C;  4FLU A;  3BY6 A;  3SPI A;  4YHH O;  2X6A A;  3G4S V;  1NS1 A;  1Y66 A;  2QGN A;  4Q6G A;  1I94 B;  3OGC C;  1WPX A;  5IYZ A;  2WLL A;  4JI3 O;  1V55 C;  1J5E O;  2EIM B;  1Y76 B;  2QTS A;  4KFM A;  1HP8 A;  3ZJZ A;  2XAH A;  4BAY A;  1NT2 B;  2QKC A;  3ML0 A;  2PUS A;  1GAX A;  1Q3E A;  3K06 A;  4DYL A;  1IX9 A;  2QDO A;  4DR7 B;  4MTG A;  2DW4 A;  2KSD A;  3EHB B;  5KX5 B;  2HHH O;  4PJ0 Z;  4R7C A;  1RSO B;  4JI2 B;  4WFB V;  2MK3 A;  3R66 A;  4DK1 A;  2AZ0 A;  4J9Z B;  4LFC O;  4LF7 O;  2N05 A;  1D2D A;  3CPW U;  4KXR A;  1JOY A;  2JVD A;  1SA0 B;  1KP2 A;  2K9P A;  2EZO A;  4MTX A;  4WBN A;  4JTA B;  3B2E E;  3DC6 A;  1KBH A;  3K9A A;  2F66 C;  2YUA A;  4X62 O;  5LHI A;  5FPR A;  1KB9 F;  4UV9 A;  4J41 A;  3G71 V;  3DXR B;  1OZ0 A;  3JAW B;  2AGA A;  4JAA A;  4ZOL A;  5IJ9 A;  1IUR A;  4X1I B;  2BOC C;  2OIE A;  4JAU A;  4W4L A;  5B1A C;  2JGD A;  3CXC U;  3T4D A;  2CTQ A;  4B3S B;  4FM2 A;  2IW5 A;  4X1Y A;  4MVO A;  1HR0 O;  2QA4 V;  3AG2 C;  1FFX A;  3F5T A;  3JCZ A;  3NXS A;  3HKB B;  3JCU Z;  4DV0 B;  3CRR A;  2YI8 A;  1JFF A;  2Q7H A;  3K9S A;  4U3F H;  4UXN A;  4PDM A;  2YXH A;  1YTF D;  4YIO A;  2HVK C;  5IT9 N;  4DUZ O;  2DYS C;  3QTC A;  2Q6A A;  5H9C A;  1ZL8 B;  1SQB H;  1AJQ A;  3GWO A;  4LF6 O;  2ZDI A;  2YEV A;  4ICG A;  3LDC A;  2HJF C;  2YC0 A;  3D3Q A;  4LF5 B;  2P22 C;  3J7A U;  1K4C C;  3G67 A;  1VF6 A;  2YIA A;  4LF7 B;  4UVA A;  2LFS A;  3ETQ A;  1LNQ A;  1QHT A;  3ZRW A;  4LH7 A;  2RN9 A;  1F51 A;  4DR6 B;  5FL7 G;  1VQN V;  3BPZ A;  5KMG B;  1X59 A;  5JJE B;  4I7Z B;  4NXN B;  4O2B A;  1WA8 B;  3ABK B;  3AG7 A;  1S5L Z;  5IYD O;  4QJF B;  1D5A A;  1M90 W;  3T1Y B;  4L8J A;  1N33 B;  3K03 A;  4PDL A;  5BR8 B;  4K3A A;  5CA0 A;  3OD4 A;  3ABU A;  4DR1 B;  3CMA V;  1LUW A;  4HBN A;  2WA4 A;  1MAB G;  4DW0 A;  2GSM B;  1G8M A;  1HNX B;  1GK9 A;  1R3L C;  4QPK A;  4LC1 A;  2UUB O;  3R65 A;  1YVW A;  1THZ A;  1F4N A;  2CGO A;  1XMQ B;  5LA6 A;  4IYI A;  3BFR A;  1S5J A;  3JSL A;  4O4I B;  1PL4 A;  4FMT A;  4X89 A;  2BCC H;  4GKK B;  1AR5 A;  2LQT A;  1AIL A;  4NTW A;  3OMN B;  4JI2 O;  1YDX A;  5BR8 O;  1GM8 A;  2DWD C;  5H5N A; 
#chains in the Genus database with same CATH homology
 3CP1 A;  2A79 B;  1K97 A;  2X6C A;  3ABM B;  4GCZ A;  3SPC A;  4QIW F;  1BMF G;  4LP8 A;  2D3O W;  3IFX A;  2WWW A;  4FIP C;  1FXH A;  2C2A A;  2EIL C;  2OTL V;  1NH2 D;  3FYE B;  5CBG A;  4TT3 G;  5IY5 C;  1RPO A;  3KG2 A;  3RW0 A;  1R73 A;  1ARO P;  2NLJ C;  3SPH A;  1VQ8 V;  2WLK A;  4QNH B;  4JPR A;  1E1R G;  5B1N A;  5CMU A;  4WF9 V;  4H33 A;  4LCU C;  2Z3Y A;  2ZDI C;  4PA7 A;  4RQF A;  3CCM V;  1S5H C;  4XDJ A;  3FB7 C;  1QCE A;  4EKW A;  4R50 A;  4U7N A;  1E1Q G;  1XL4 A;  4BIZ A;  1QR9 A;  2Q69 A;  2EIM C;  3OUF A;  1V55 B;  2ITC C;  3M99 B;  3RVZ A;  4WCE V;  3I56 V;  2EBO A;  4PA3 A;  1P7B A;  1SET A;  4RAI A;  2PI5 A;  3HPL C;  3AG3 C;  2X0L A;  4MSW C;  2YEV B;  5LHH A;  1EZJ A;  1GO3 F;  4FK5 C;  2QE7 G;  3ZRV A;  1VQ6 V;  2DYS B;  3RVY A;  4PA9 A;  3B8M A;  3E83 A;  3T4Z A;  4HZ3 A;  2WLI B;  2PI4 A;  2WLI A;  3ETE A;  3CCS V;  1OHH G;  3ZMT A;  5L3C A;  1VQP V;  2JJ1 G;  2OCC B;  5IYC O;  1R6N A;  4ZBM A;  5H6R A;  2LFR A;  1QBZ A;  1P4R A;  3FB8 C;  3QO7 A;  1EBO A;  3ZRX A;  2ZQM A;  1OCC C;  1K73 W;  1YIT V;  4L87 A;  1PNM A;  4F4L A;  1L1F A;  1BHB A;  1KP3 A;  2XND G;  3ZMZ A;  1F4M A;  1ROP A;  3QO5 A;  4GX2 A;  3ASO C;  3ABL B;  4MTF A;  2X7R B;  1RM1 B;  1VQ5 V;  3AG4 B;  2HVJ C;  2JIZ G;  3P30 A;  1I5X A;  1DF4 A;  3CCQ V;  1SES A;  2WLM A;  1W0K G;  1AI7 A;  1EFR G;  2IH3 C;  1YJW V;  4CBC A;  3SJQ C;  4I9W A;  1YJN V;  3ASO B;  4JAS A;  2BOB C;  2QEX V;  4Z1M G;  3CC2 V;  1AI4 A;  2QTO A;  3JD1 A;  2Q67 A;  1OCR B;  3P32 A;  1AJP A;  1AI6 A;  3LSS A;  5L3F A;  3CCU V;  3RBZ A;  2DYR C;  1PNL A;  3AG1 C;  1E79 G;  2NNU A;  2R9R B;  3UKM A;  3X2Q C;  1YTF B;  1Q82 W;  2FTK A;  3OE7 G;  3OMI B;  1NQT A;  4RUE A;  1FXV A;  3TCU A;  3CYO A;  3K0D A;  2EIJ C;  2ZD9 A;  4RO2 A;  2A9H A;  5KUM A;  4P9O A;  2OCC C;  5L3G A;  1QR8 A;  5HFL A;  1J95 A;  5B3S B;  3MHH C;  1Y4M A;  3E86 A;  1PL0 A;  5L3E A;  1K3E A;  1DF5 A;  3QNE A;  4G28 B;  5EBL C;  2XOK G;  1AR1 B;  2DWE C;  3HB3 B;  2IU0 A;  4MTO A;  1HWY A;  2IJH A;  2OT5 A;  2OTJ V;  3IGA C;  2WLN A;  2WSS G;  3PJS K;  1TUE B;  1K34 A;  3STZ C;  1M1K W;  2EIK C;  1ENV A;  3W7T A;  1S72 V;  1RPR A;  4PA6 A;  3AG3 B;  5KUK A;  3W7W A;  4GX0 A;  1K33 A;  2W6J G;  2DQ3 A;  2YSU B;  2H94 A;  1W2B U;  2ZR3 A;  3CCV V;  5DN6 G;  3LSQ A;  5LHG A;  5CN0 A;  3WFV A;  3MHS C;  1ORQ C;  3OMA B;  1S3J A;  2Z5U A;  1NH2 B;  2B5U A;  5BZB A;  2ATK C;  3DTU B;  4OXS A;  4XBF A;  3GB7 C;  4KP4 A;  3CC7 V;  3CCR V;  3CC4 V;  1PKX A;  4WFH A;  1K9M W;  1QVG U;  3SYP A;  1K8A W;  3WG7 B;  2EZP A;  2WPD G;  4GX5 A;  3OR6 C;  1SZT A;  4X8A A;  1YJ9 V;  3SYQ A;  3W7S A;  5HFM A;  1G4Y B;  2WLH A;  2QM7 A;  5LGU A;  5B3S C;  2XAF A;  1K92 A;  1COW G;  1V54 B;  4JYC A;  1QLE B;  4U7O A;  1AI5 A;  3ZIA G;  4N21 A;  1OCZ B;  1SER A;  3JYC A;  1VQM V;  1CPY A;  1GM9 A;  4UVC A;  3ASN C;  2JDI G;  1K5S A;  4MVQ A;  2EIK B;  3F5W C;  1K7D A;  3E8H A;  4GT1 A;  2QKS A;  5H6Q A;  1JJ2 U;  1H8E G;  3OM3 B;  3W7X A;  4E2L A;  2ZXW B;  1M56 C;  3SPJ A;  2EIN C;  4ZKI A;  1SRY A;  1VQ9 V;  1FXK C;  2P7T C;  5IDJ A;  1AJN A;  4MVR A;  1KKD A;  1JQ0 A;  3T1C A;  1R3I C;  4Q20 A;  1W0J G;  3CD6 V;  3FB5 C;  3ETG A;  5CA3 A;  2EIJ B;  5DM6 V;  2A0L A;  1M57 C;  3SPG A;  3G6E V;  5J9P C;  3ZMU A;  1JX9 A;  2ZXW C;  3AG2 B;  4R8C A;  3JD2 A;  2Y69 C;  5B1B C;  2KB1 A;  2K1E A;  3MD0 A;  5EK0 A;  3OAA G;  3VOU A;  1KC8 W;  3B77 A;  4N23 A;  4DXW A;  1OCR C;  1OCC B;  1XL6 A;  1IXM A;  2P6J A;  5L3D A;  3CCE V;  3E8G A;  4WFE A;  4UV8 A;  3JD0 A;  1M57 B;  3CCJ V;  3LDE A;  3OFN G;  4BW5 A;  2M7W A;  2JEU A;  2B1I A;  3LDD A;  3ABL C;  2H8P C;  1PNK A;  2QM8 A;  4WFG A;  2JEX A;  2ITD C;  3BY6 A;  3SPI A;  4P9P A;  2X6A A;  2EJR A;  4HYO A;  5B1O A;  3OEH G;  2R9I A;  3G4S V;  4XDK A;  3JD4 A;  1Y66 A;  4MVM A;  3TK1 A;  1DLB A;  4JTD B;  3OGC C;  3IC7 A;  1F23 A;  1WPX A;  3K0G A;  1S0V A;  1JPX A;  2AHY A;  2WLL A;  1V55 C;  2EIM B;  3FYI B;  4KFM A;  3OW2 U;  4R6Z A;  3ZJZ A;  3I55 V;  2XAH A;  4BAY A;  3ML0 A;  1MG1 A;  2B1G A;  3LUT B;  4MT8 A;  4PA4 A;  5LGT A;  3K06 A;  4JF3 A;  5KA5 A;  1H8H G;  2IJJ A;  3ABK C;  3E89 A;  4MVZ A;  4XDL A;  2GHY A;  4JTC B;  4MTG A;  2DW4 A;  1NVP D;  3E8B A;  1KD1 W;  2V7Q G;  4JYB A;  3CCL V;  2AHZ A;  1FS0 G;  3EHB B;  2IJK A;  1WLE A;  3SYA A;  3ZMV A;  3OUS A;  4R7C A;  4CZZ A;  2F43 G;  4WFB V;  4BIU A;  3B8N A;  4UVB A;  3ZMS A;  1BHA A;  2MK3 A;  2LP7 A;  3DGE A;  1NBM G;  3A0R A;  4J9Z B;  4J9Y B;  3H01 A;  3FB6 C;  1K5Q A;  3ZCC A;  3CPW U;  4QE9 A;  3TET A;  5GW7 A;  1JOY A;  2WLL B;  1QVF U;  3K79 A;  1Q81 W;  3F7V C;  3X2Q B;  1KP2 A;  2EZO A;  4MTX A;  1PD3 A;  4JTA B;  4H37 A;  3ZRW B;  3K9A A;  2XAS A;  4PDR A;  5LHI A;  5IY5 B;  4MVS A;  1YHQ V;  2EIL B;  3AEI A;  4G27 B;  4UV9 A;  4QE7 A;  4ASU G;  5EBM C;  3G71 V;  1OZ0 A;  3D3I A;  5CBF A;  3EFF K;  4FJC C;  4PDV A;  3OR7 C;  4WFF A;  2ZR2 A;  1S77 D;  1BL8 A;  4MW3 A;  1R3J C;  3LNM B;  1GKF A;  2BOC C;  4JAU A;  5B1A C;  3D36 A;  1R6K A;  1H2G A;  3QO8 A;  3CXC U;  2DYR B;  2CK3 G;  3AG1 B;  4TWK A;  3T4D A;  4LBE C;  2Y69 B;  3W7U A;  2IW5 A;  5EC2 C;  4MVO A;  1YI2 V;  5B1A B;  2QA4 V;  1VQ7 V;  2HFE C;  1MSW D;  3AG2 C;  1ZWI C;  1OCZ C;  2V1D A;  4HAM A;  3E35 A;  1QLE C;  3JCZ A;  3NXS A;  3ZN0 A;  5C93 A;  1V54 C;  2IH1 C;  3JD3 A;  4UXN A;  4PDM A;  1Q86 W;  3STL C;  1OCO B;  1YTF D;  2JJ2 G;  3AG4 C;  1FXK A;  2HVK C;  1RM1 C;  2EIN B;  2W6I G;  5EBW C;  5KA6 A;  1M56 B;  4JGS A;  1GMG A;  2DYS C;  2P90 A;  3UM7 A;  1VQO V;  2Q6A A;  5LBQ A;  5H9C A;  2IU3 A;  1VQ4 V;  3K3W A;  1QLN A;  1AJQ A;  4RUF A;  3GWO A;  2HG5 C;  2XAQ A;  1KQS U;  2HKO A;  5L3B A;  3SYO A;  2ZDI A;  3K04 A;  2YEV A;  1CP9 A;  2DQ0 A;  3LDC A;  2HJF C;  2IJI A;  4FPP A;  3VBB A;  2WAM A;  1K4C C;  2W0F C;  1I5Y A;  3OEE G;  2LFS A;  4UVA A;  4QPJ A;  1LNQ A;  3ZRW A;  5CBH A;  2XAG A;  3T2M A;  1S76 D;  5E1A C;  1F51 A;  4GX1 A;  4JAV A;  3ZN1 A;  1GTO A;  4KUM A;  1GM7 A;  4X88 A;  3WG7 C;  5FL7 G;  4MW8 A;  5LGN A;  2XAJ A;  4YXW G;  1VQN V;  3CME V;  1N8R W;  2JK5 C;  1CEZ A;  1NR1 A;  3ABK B;  1Q7Y W;  1UJW B;  2Q68 A;  2HR3 A;  1OCO C;  1MOF A;  3ABM C;  1DTO A;  1VQK V;  1YSC A;  4DO2 A;  5IYD O;  4QJF B;  1NJI W;  1NR7 A;  1FFT B;  4G2K A;  1M90 W;  3E8F A;  3E2E A;  1KEC A;  5EC1 C;  4I5S A;  2HLD G;  3K03 A;  4MS2 A;  4PDL A;  3ZRS A;  4RQE A;  1YIJ V;  4P30 A;  3ABT A;  3ABU A;  1R3K C;  4TSF G;  3CMA V;  1MAB G;  1K4D C;  2GSM B;  1G8M A;  3ETD A;  4MVU A;  5IYB O;  1GK9 A;  1R3L C;  4QPK A;  4LC1 A;  1B6Q A;  3F7Y C;  2P67 A;  1JVM A;  3R65 A;  1THZ A;  1FXK B;  2WLJ A;  1F4N A;  4UUJ C;  2Y48 A;  3BEH A;  4FMT A;  4X89 A;  3SYC A;  1H38 A;  2UXN A;  4PEL A;  1NVP B;  5B1B B;  1VQL V;  4P2Z A;  3FKS G;  3ASN B;  3OMN B;  2X6B A;  1JCH A;  2UXX A;  1GM8 A;  1NKD A;  2DWD C;  4WFA V;  3K08 A;  1M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...