3CCVV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccvV00
1YI2V 1M90W 1VQ4V 2OTLV 3CC4V 1VQ6V 2OTJV 3CCUV 1JJ2U 3CCLV 1VQNV 1K9MW 1KQSU 3CCJV 4WFAV 3CPWU 3CCQV 1Q81W 4WF9V 3CCMV 1Q86W 1VQPV 4WCEV 3CMAV 3G4SV 1KD1W 3CXCU 2D3OW 1S72V 1W2BU 1K8AW 3CCRV 3CCEV 3CC7V 3I56V 3G6EV 4WFBV 3OW2U 3CCVV 1K73W 3CC2V 1NJIW 1R73A 1YIJV 3CD6V 1VQ7V 2QA4V 1VQKV 1KC8W 1QVFU 5DM6V 1YJWV 1VQMV 1Q7YW 1YJ9V 3G71V 3I55V 2QEXV 3CCSV 1N8RW 1M1KW 1VQ9V 1Q82W 1VQOV 1YITV 1VQ5V 1VQ8V 1QVGU 1VQLV 3CMEV 1YHQV 1YJNV
chains in the Genus database with same CATH superfamily
1R6TA 1NTZH 3CE2A 1WB8A 2BSKA 4TV8B 1YVWA 3CPWU 4DRXA 3UQ8A 1X4TA 1HNXB 3FX7A 4BIZA 3DXRB 1QQCA 3WB1A 2FMLA 3PJSK 4B3RO 2LFSA 4U7NA 2EBOA 3FB7C 4DRXB 5EBWC 4FIPC 4R7CA 5K1PA 3RYIB 1KB9F 1WB7A 4WFAV 1ZUQA 4FFBA 2JGDB 1NH2D 5LYJB 1PNMA 2DWDC 1Y66A 1U96A 4LP8A 3C3TA 3M7MX 2HHHB 4FFBB 1VIBA 2P90A 2Y69C 2C2AA 2YSUB 5B5EZ 1XI1A 1K34A 1KP3A 4LF7O 4JASA 1PNKA 2W0XA 3ZMUA 3WB0A 1P7GA 3JCUZ 3QO5A 1M4UA 4K0KB 3ABKB 2VS0A 2B5UA 1R73A 2MW2B 3BAAA 4JF3A 4C7UA 2A3QA 4JYYA 1H8HG 3H9VA 2F43G 3OR6C 1RPOA 3FKSG 1XNQB 4GUNA 2QWPB 4NXMO 4DR6O 3LDDA 1R6NA 3MHSC 2ZDIA 1ZLZA 4O4LA 1XL4A 4YJ2A 3ETQA 1H2SB 2R72A 4GT1A 2X6BA 1BMFG 5GTHZ 3CC2V 1VP7A 4AQYO 3IC7A 3CWBH 4YJ2B 2DOSA 5D5PA 1GN6A 4W4KA 4I9QA 1R6KA 3BA8A 4FLYA 1OCOB 4PHZA 3JSLA 4JTCB 2ILMA 3B2EE 1Q5OA 4DUZB 3JALA 2CAZC 5KMGA 4KHPB 4FLVA 1I0HA 3G6BA 3ZJZA 5IWAB 4I50A 3JD3A 2YIBA 4X8AA 1L0NH 3ZHSA 3JALB 2X7RB 4DV3B 4I50B 1YI2V 5A2QN 1MNGA 1TVKA 2QWOB 5LP6A 4DR5B 2Q67A 4B3MB 1TVKB 2YIDA 5B1BB 3VBBA 4I55A 2EIKB 3H1IH 1YEWA 1X59A 1VQ8V 2B1IA 1VQ4V 1QR8A 2CTWA 4PDRA 2DYRB 1HNWB 3QF7A 3ABUA 5LMUB 1Z2GA 1IBLB 2WLKA 4I55B 4Z1MG 3ZX6A 3D3IA 3G4SV 1D2DA 2DE0X 2QWNB 1NH2B 1N34O 1O9GA 2ADQB 3K08A 3TK1A 1JMKC 1HR0B 2LW1A 2E5LO 1QNMA 4HBNA 1L8DA 2W0FC 2AZ0A 4UXNA 1U97A 1SQBH 2PZSA 1XHXA 1M56B 2YICA 3K5NA 3ABMC 1B3QA 3JAWA 2YI8A 4J9ZB 1GH6A 5IYBO 2QM8A 3T4DA 4MTFA 1BHBA 1NVPD 3AK1A 3QG5A 1Q3EA 5BXZA 3G67A 4FLTA 3JAWB 1JQ0A 1Y74A 2YDEA 2LP7A 1RPRA 2A0LA 4DV3O 3X2QB 3TXQA 2P22C 3AG2C 5TISZ 1IURA 5KHJA 1H2MA 4MVRA 1ZSPA 3M99B 3HPLC 1KD1W 1BL8A 5BMVB 2GBOA 1MOFA 3B8NA 5JH7A 4NR1A 2HR3A 1EZJA 3L70H 4WFEA 2DWEC 5K1XA 4UFZA 5B3SB 2F1MA 4B7KA 5JH7B 4I4TA 4UB8Z 5LMUO 2QE7G 4QIWF 3E2EA 2Q4PA 1AP5A 1M93A 1MA1A 1WA8B 1E1QG 3SYQA 2PTMA 5IY5B 3EFFK 1HR0O 1UFIA 2WLLA 5KA6A 1V55C 4J42A 1WPBA 3AG1C 4JYAB 2G38A 1IDSA 4CBCA 4NXNB 2HP8A 4LFBO 2WLLB 3K5OA 5E79Z 3THOA 2UXDB 2E3CA 4PDLA 3CCQV 3FYEB 1XEQA 4DK0A 5KHKA 4DV4O 5LGNA 2R9AA 3WG7B 2AGAA 2VQEB 1QR9A 3B40A 4YJ3A 4NTXA 3SYPA 5JWPA 5B1AC 3JYCA 3OAAG 1GN3A 1M57C 1W0KG 4DR1B 1LNQA 3CCMV 3BY6A 4CS3A 2Q0AA 1PD3A 1I5XA 2CE4A 1YIJV 4R8CA 5LHGA 2Q68A 4DV0B 2F4VB 2ATKC 3ABTA 5EC1C 3ZCCA 1HWYA 3SR2C 1HNZO 4NKGB 4LF6B 4DV1O 4ZIBA 1N4CA 1Q43A 1SESA 3AG3C 3MHHC 2EIJC 3P3PA 1XMQO 1SQVH 1AJPA 3ZRSA 1JR9A 4LWSB 1VQKV 2YXLA 1NVPB 3HKDB 4J80A 5ITZA 5CA3A 1AVMA 1M1KW 3SJBC 1QCEA 1US6A 3VOUA 3FB5C 4JI3B 2OTLV 3HB3B 5KHHA 5CB4A 2OIEA 1AJQA 4LFAB 4PD4F 1OHHG 5BR8O 2F95B 2OIGA 2EINB 3CEIA 4ZOLA 3CHXA 2Q6AA 4FFKA 4JV5O 2VQEO 5L3FA 2DQ0A 3F5WC 3I5DA 4DV2B 1PPJH 2EIMB 1KMIZ 4ZOLB 2UXBB 4DR1O 1DGSA 2F66C 1E79G 2RCVA 1J95A 4MVSA 3K59A 3TJTA 2EJ7A 5FNVB 4X89A 5LGUA 4J41A 2LO1A 2UUBO 3RT3C 3J80N 4EEQA 4DR2O 5IYDO 1K4DC 2Q7EA 2IJHA 3CCVV 3OW2U 5EC2C 1IBMB 1ZL8A 5JCOC 5BZBA 5H5NA 3JD1A 4B7EA 4TOIA 1ZWIC 3DGEA 1M90W 4EB6A 2XUMA 5DN6G 1BCCH 5FLXN 2RMKB 1WP8A 4IIJA 1K8AW 4GKKO 3HKBB 1EFRG 1R1BA 3G6EV 4EB6B 4JI6B 2JS5A 1YCIA 3ZHRA 2RDCA 4GX2A 4IIJB 3ZMVA 1CP9A 4JI1O 4LR3A 4F6EA 3K03A 1SKVA 3ZN0A 4LH6A 4PDMA 4OGQB 1XDCA 3K57A 4B3TO 4TT3G 3JSNA 5LOVA 4EFBA 4OX9B 4GKJB 3JASB 4FM2A 3L9DA 4GX1A 2JK5C 2OCHA 4LFCB 5LOVB 4JZ2A 3UT5B 3A0HZ 3WB2A 1AI7A 4MTGA 4DR7B 4UVBA 3RBZA 1TUEB 3ZIAG 4JI2B 2BTOA 3LSSA 5KUKA 1IVSA 4FZ0A 5JJNB 2QGNA 4HNAA 2CTPA 5LMNB 1EN5A 1RSOA 1SQFA 1FXHA 1N32B 1WPXA 5H9CA 4X88A 3CCLV 4HNAB 2P67A 1CXZB 3HKEA 3OD4A 3N27A 1FYJA 4WCEV 1PM9A 1Y6XA 1ORQC 4JTDB 5AG2A 2M6YA 4QGPA 1NJIW 3E89A 4P30A 3BCCH 4CH4A 4L8JA 1GK9A 2ZT9B 3W7TA 2JJ2G 1YHQV 3APQA 2GV9A 4K35A 4D7SA 4FJCC 4LNUB 1OCRC 1V9PA 2JGUA 1VF6C 1SERA 2AXTZ 3LNMB 1VQ7V 2CK3G 2RN9A 3OMNB 1ZX3A 2AZ2A 2UUCB 4GYCB 1S77D 2WA3A 3L74H 4FM0A 2LQTA 1KUQA 1KECA 1PP9H 3GVMA 1PL4A 1D5AA 1VF7A 3FFQA 1KYOF 3J81N 2WA4A 5LMNO 4JI5B 2GSMB 1NT2B 5BY1A 2LFRA 1THZA 2YIBD 3N2GA 1Q6IA 4PA9A 2GUZB 3T2MA 1DK1A 4CH3A 3MDSA 4H13B 1AROP 4NVPA 1JFFB 2YI9A 2ZE5A 4O4HA 5KHGA 1P4RA 1TUBB 1ZAUA 3N2GB 3RYHA 2QM7A 2IJJA 2BSKB 5F2VO 4O4HB 1WN7A 2L35A 4IYHA 1Z5WA 4FPPA 1Q82W 3UM7A 1WNSA 1I7FA 2VQFB 1GM8A 2XT9A 5B1NA 3ZMTA 2YS8A 1IBKB 3RFRA 1YXBA 1JPXA 3AG2B 2LJ2A 4JI4B 2FKXA 4UCSA 4N21A 4XBFA 4XDJA 4WBNA 3AG4C 2R70A 2N05A 1BSMA 3DSQA 1JJ2U 1VEWA 5DEDA 3WU2Z 5IT9N 2WLIA 1UPGA 1MABG 2UXXA 3F7YC 1S72V 1W2BU 2KG7A 3T4ZA 3P3NA 1OCCC 3S3WA 1SQXH 4DR4B 1TGOA 2WLIB 5H6RA 3QO8A 4JGSA 4X62O 2KG7B 4LF9B 3NR7A 3WFVA 1SRYA 4KP4A 4PA7A 5CBGA 1HNXO 2QTSA 2DW4A 1YDXA 2CUGA 4E4EA 3JAKA 3W7WA 1FXKC 1AP6A 4TWKA 4OPHA 3TGUH 1QLEC 4O4LB 4DR3B 2ZIMA 4KFMA 2DN9A 3JAKB 4MS2A 1VQOV 4I5SA 1EM1A 2KQXA 3SJCC 3RYFA 4GX0A 2ZIOA 2E76B 3E8BA 4O4IA 5B66Z 1I94B 1FXVA 4X66B 4DV6B 1RM1B 3JATA 4KUMA 3RYFB 2HHHO 1S76D 2ZE7A 2ZCEA 4F6RA 5KX5A 5KMGB 3JATB 4JYCA 5GW7A 4JAVA 4TUYA 4RUFA 4LF5B 3CCJV 3R65A 2Y4TA 1F4NA 4IL6Z 5KX5B 3IJ4A 1BE3H 1YTFD 1Q6HA 4K0KO 2HJFC 2JRIA 3CD6V 4MSWC 1GO3F 5LP6B 1YJ9V 2EIJB 4LF9O 4MW8A 3PN1A 1XNQO 3W7UA 2XASA 1EN4A 1FPOA 3ZBHA 3IC9A 1L0LH 1COWG 1Y76A 3W7XA 3B09A 4YHHB 2UU9B 3FAVA 2IBZH 5EBLC 2OYQA 2YEVA 1Y76B 2GTAA 1KBHA 2QEXV 1D5NA 3FAVB 2WLMA 5C93A 2F23A 1PNLA 3D8CA 4R50A 4DUZO 4DV6O 3L75H 1SC5B 4KHPO 2FL4A 5IWAO 4O4JA 5JCOA 4JI7B 2B1GA 4Z2WA 4B08A 1XNRB 4X20A 1MZEA 5H6QA 3BRCA 3C90A 2JEUA 4DW1A 2CGOA 2X0LA 1BQZA 4GX5A 2KSDA 4X20B 3CX5F 1MG1A 2BOBC 5KUMA 1Y74B 1DLBA 4DR5O 2E74B 3E35A 3K06A 2OT5A 5LBQA 3LDEA 3EXAA 4B3MO 4QNHB 4LF4B 3OMIB 3ETGA 1W0JG 3BHPA 2AHYA 2Q9LA 2Y48A 3U11A 1UJWB 1VQLV 2IU3A 5EIBC 1K92A 4XDKA 4NYKA 1HNWO 1IBLO 2YC0A 3AK2A 3CSXA 1SZTA 4NTWA 4YXWG 5FPOA 1Q8IA 2YIAA 4I4TB 4DV5B 2ZE6A 5EYPA 1XMOB 3KCYA 3G71V 1MSDA 1F4MA 3T1HB 3CXHF 3B8MA 4CH6A 2V1DA 3ABKC 3CCUV 4FM1A 5EYPB 5JVDA 1NKDA 2NNUA 2B9ZA 2PI5A 3DTUB 4ICGA 3IAYA 2HJDA 2EILB 2ZR3A 5J2UA 1GN4A 4U7OA 3K04A 1YTFB 1EN6A 3T1CA 4AHCA 3D36C 4LF8B 3CCSV 4ZBMA 2HFEC 5LA6A 3BABA 1FJGB 4KL1A 1LUWA 3CP1A 1MZFA 2HLDG 1AJNA 3BA9A 2GDSA 4TSFG 4UCVA 4YJ3B 4BAYA 5LA6B 3SYAA 4K8ZA 2K9PA 1BT8A 1FFTB 1S5JA 5L3EA 1OCOC 4PA4A 1KC8W 2BOCC 2QWQB 3H1JH 4WFGA 4JI8B 3RN4A 4UCTA 5EK0A 4IHJA 2OCCB 2Y4UA 1P7BA 3OTOB 3B4SA 1SZXA 5LL6Y 3SPGA 1YSCA 4QE7A 2VWKA 4J7ZA 4H33A 1VF6A 4DV7B 2Q7GA 4DV5O 3LSQA 1PV0A 3OUSA 5IE9A 1XMOO 4DW0A 1S3JA 4YY3B 4LBEC 4JYAO 4GCZA 3RGBA 3QO7A 1OCRB 4RAIA 4NXNO 1N36B 4J11A 2H3OA 2WLNA 2UXDO 3MAQA 2MK3A 1K5QA 2JVDA 5LHHA 1VMGA 5B1BC 5ITZB 1V54B 2JJ1G 2EIKC 3ASOB 3SPIA 4UCUA 5CB4B 2DYRC 4DO2A 2JEXA 1KKCA 4H37A 2LGWA 1VQ6V 4FVMA 1SQPH 3UO2A 2ARHA 2HG5C 2ZNIA 3CXCU 2QKCA 1J5EB 2NLJC 1R3IC 5LGTA 1M56C 3JD2A 3R66A 1B06A 4DV0O 2F4VO 3STZC 1S5LZ 4O2AA 5KHIA 1QVGU 4LF6O 4J7KA 4X64B 1ZL8B 3CS5A 1JJOA 1E1RG 4JTAB 2GTSA 1I5YA 4FZ1A 3FD9A 4DV7O 4O2AB 5CA1A 4X65B 4B3SB 4G28B 3A8TA 4YY3O 3GWKC 2FYUH 1XL6A 1YJWV 1VQMV 1QBZA 4RUEA 1NI8A 1AI5A 3TCUA 2BTQA 1JVMA 4JI3O 3AG4B 1IXMA 2JDIG 3BFRA 2Y69B 3CRCA 4LFAO 5KLVH 4U3FH 2BTQB 1TAEA 5CA0A 3I56V 2ZM6B 4K8XA 2ZXWC 1PKXA 4EKWA 5B3SC 2PYLA 4ZHQA 2EULA 3JARA 2HVJC 1N0JA 1XREA 3CRAA 2DYSC 5GONA 4DV2O 4YIPA 1N8RW 2FTKA 4I0XA 4AI8A 1OCCB 5IY5C 2UXBO 2OWOA 4ZHQB 1F7YA 1JCHA 1VQNV 1W59A 2AW9A 1DF4A 3T1YB 3K58A 1SA0A 5CMUA 4ZKIA 1FXKA 1SQQH 4H0LB 1IBMO 3W7SA 4UUJC 1K73W 3KZIZ 3E86A 4FK5C 1SA0B 2CDYA 1NZ6A 1FXKB 2UXCB 3A2FA 4MVZA 2CH7A 1G8MA 1GKFA 3WG7C 1FFXA 1PL0A 5JJJB 1TA8A 1VQPV 2Z0AA 4PA3A 2EJRA 4PI0A 2ZR2A 1RFYA 2UUAB 1RSOB 2VWJA 1XUQA 1N33B 4JI6O 2XTAA 3D3QA 2ITDC 4HYOA 3HKEB 3HKCA 4JI0B 2RJZA 2GHYA 2PF4E 3KKYA 4DYLA 3P30A 5FPRA 2D3OW 3K0GA 2YUAA 2ETNA 1MMMA 4OX9O 4U3JA 5JQGA 4B3RB 4GKJO 4Q6GA 4BW5A 1SQGA 1Y4MA 3DC6A 4BWAA 5JJEB 3ASNC 2Z3YA 2P06A 2ZINA 4OXSA 3OMAB 4LFCO 3J7AU 4TV9A 2PUSA 1SS3A 3AEIA 3ZHVA 1R3LC 3LNNA 2ADPA 1S5HC 4TV9B 1G4YB 4DR7O 5HFLA 2QDOA 2PI4A 4JI2O 3SGIA 4RQEA 1CEZA 1IZ3A 4LCUC 1AILA 5FL7G 5KAFZ 1K33A 1XQ8A 3CJHA 3BEHA 1N32O 1WLEA 3OGCC 3ZHUA 4PI2A 4LF7B 1CPYA 2EINC 2WLJA 3BPZA 2XAHA 2Q0OC 2ITCC 5L3CA 1AR4A 3SPJA 4MVQA 5J2TA 3LSUA 3CMAV 3CRMA 2AHZA 2Z5UA 2EIMC 1A32A 2CGNA 4F4LA 4Q20A 4TV8A 3ABMB 1NBMG 2L6LA 3RVYA 1AR1B 4UVCA 3JCZA 3K3WA 4GLXA 1M5IA 2QKSA 3RYHB 4NXMB 5A9GA 4DR6B 3CB2A 2ZE8A 3ABLC 1P84F 3S3XA 1ZTEA 1ENVA 3H1LH 3E8HA 2R9IA 2XHBA 2EZPA 1Z5VA 1H8EG 3RYIA 4AQYB 2JGDA 5LYJA 2UUCO 4PJ0Z 1IXBA 3CC4V 4KXRA 3FB6C 4WBNB 4FMTA 5LXTA 1F23A 1ROPA 4BW9A 1BS3A 1XBLA 3U10A 4JI5O 1F51A 5LXTB 1QVFU 1GAXA 3APOA 4JPRA 2H94A 1XOUA 2FB5A 1V55B 3AG1B 4X1IA 3E8GA 1Q86W 1YZBA 4D6TH 1H2NA 1JX9A 2X6AA 4WFFA 3CC7V 5B1OA 1M9NA 2ZNJA 4X1IB 2D2CB 3ZMSA 3D36A 3UCSC 5H2FZ 2Q7HA 1RP3B 1AI4A 4X1YA 5D5QA 3CRQA 4MTOA 2VQFO 1KP2A 1BGYH 4UVAA 1XHZA 1K9MW 2XAFA 4TQFA 1AB3A 2YXHA 1IBKO 4R6ZA 2KB1A 5B1AB 4X1YB 2IU0A 5CN0A 1N34B 1M57B 4JI4O 3Q4HA 1R3KC 2E5LB 4O4IB 1H2GA 3AG7A 3GB7C 2PYJA 3K9SA 1L1FA 3Q4HB 1YJNV 4FLZA 3F7VC 3ZRWA 1KQSU 5HFMA 4ABMA 1XILA 1VARA 3LDCA 3O9OA 4F6RB 3CYOA 2ZKOA 4I9WA 5EBMC 4WFBV 2A79B 3ETEA 4TUYB 4DR4O 3ZRWB 4QE9A 2JIZG 3AG3B 3IFXA 2NR5A 4ASUG 5IJ0A 4RO2A 1K5SA 1LUVA 3B77A 3SJQC 1HDJA 5IDJA 5IJ0B 1WJZA 2EZOA 2X6CA 4G2KA 4QPJA 4MVMA 4DR3O 2W6JG 2IJKA 2Q5ZA 5DM6V 1H2LA 1NR7A 4BR6A 3VQYA 3JAMN 1OZ0A 1K97A 2KKWA 3BVOA 4JYBA 2ZQMA 3OEEG 3ZRVA 2YEVB 1OCZC 1I94O 2QSAA 4X66O 3K9AA 1K4CC 1WAZA 2UXNA 4IYIA 4QJFB 2QR4A 2V4DA 4D7TA 2V7QG 1GN2A 1B04A 2A9HA 3RVZA 3ZHTA 1NQTA 4LFBB 4O4JB 4LF5O 1QHTA 4PELA 4O2BA 4DV4B 4PA6A 5IYZA 1GMGA 4OPAA 4ZI7A 3A0RA 2XAGA 4O2BB 4JAUA 1R3JC 3JD0A 3RWRD 2DJVA 1K3EA 4L87A 3VQVA 2Q73A 5IYZB 5BMVA 4ZI7B 2YXYA 1BHAA 2XAQA 1I08A 2F93B 3O65A 2QWRB 1NU1H 2ZD9A 1NS1A 2CTRA 1SF9A 4YHHO 3QTCA 5E1AC 2UU9O 1QLNA 1FAFA 1GRJA 3TETA 1WA8A 2Y0IA 4UB6Z 1BQ0A 1VQ9V 2ZXWB 3ML0A 4GZRB 1HNZB 3UO3A 3EHBB 4DV1B 2DYSB 4E2LA 3LUTB 2XAJA 1K7DA 2XNDG 1XMQB 3K5MA 2Y0PA 1FKAO 3E22A 2PY5A 4RQFA 4JI7O 5JVDB 4Z1VA 1XNRO 2M7WA 1HW7A 2P5OA 4CZZA 2IH3C 1WP7A 3ZN1A 4DUYB 1N0NA 5J2UB 3E22B 4UV8A 1JA8A 4CC6A 2ZDIC 2HKOA 3H01A 3ZS8C 4UV9A 3UKMA 2WLHA 5BR8B 4LH7A 3P32A 4JZGA 3QVNA 5EZYA 4JV5B 2RQ6A 4QPKA 3N2KA 4LF4O 4CH5A 1Q7YW 3NXSA 1DTOA 1VQ5V 4P9PA 1RM1C 5EZYB 2OTJV 3N2KB 3L71H 3OR7C 1DF5A 4I7ZB 2NN4A 2DMXA 2JS3A 4IHJB 4PDVA 5L3DA 3A0BZ 3SJAC 3RW0A 2UUBB 3CCRV 2WWWA 3E83A 4DR2B 1OV9A 4CS2A 3HR0A 1KKDA 1T5EA 2N74A 4YIOA 5KAIZ 3T1HO 2HVKC 1Q90D 3SPCA 5IYCO 4DK1A 5LHIA 3FYIB 3ASNB 4XDLA 2P6JA 3AK3A 4W4LA 4LWSA 3RYCA 4MVUA 3HKDA 1S0VA 5LP6C 2WSSG 4P2ZA 4GKKB 2IW5A 4N23A 2Q8VA 1HP8A 3RYCB 4FLUA 2O57A 4LF8O 2P7TC 3OE7G 5L3BA 1Y67A 3DC5A 4DUYO 3SDLA 3SPHA 1FJGO 4JI1B 3FB8C 2XOKG 1AR5A 1LR1A 1FD9A 3CRRA 4B3TB 2LGQA 3STLC 5J9PC 3CCEV 2QTOA 4BIUA 3TXSA 3OM3B 2IH1C 4G27B 2R9RB 5FNVA 3SYCA 4JI8O 3OT7A 1G6UA 3G80A 4NTYA 3OTOO 4MT8A 5CBFA 2N04A 3K0DA 2RNBA 3U0ZA 3M8AA 4WF9V 1GTOA 2A7WA 4RWUA 1QU7A 4J10A 3ABLB 4PV1B 3SYOA 3X2QC 4MVOA 4FLXA 2VRZA 3OFNG 1YF2A 3OGIB 1N36O 3HKBA 2WAMA 5CA1B 5CBHA 1OJHA 3H1HH 2E75B 2BE3A 5DECA 3H1KH 3K5LA 3VQXA 4BIOA 2QKAA 4HAMA 3L73H 4A5UB 4X1KA 3ZRXA 4UCRA 2IJIA 5IJ9A 2QM4A 3QNEA 1SETA 5KA5A 5CA0B 1IX9A 4X1KB 4CC5A 3JASA 3F5TA 5GTIZ 3JARB 5IJ9B 5GONB 1EBOA 4I0XB 2W6IG 4MTXA 3UT5A 1J5EO 2QJ1A 4J7JA 4X9QA 1GM9A 3ZEDA 2EX3A 4HZ3A 2A06H 1URFA 4DXWA 5C8YA 4J9YB 1MSWD 2EILC 3VQWA 3CMEV 1BZKA 4X64O 1QLEB 1B6QA 1P49A 2ODMA 2Q69A 3EVKA 5EIBD 5C8YB 2LW7A 4P9OA 4X65O 1G1XB 2CH7B 4B3SO 2H8PC 1FFXB 3IGAC 4TQDA 2CTQA 2PGGA 1FS0G 1NTKH 4FLWA 3K79A 3HKCB 4WFHA 1JOYA 3OEHG 2OCCC 2ZM6O 3OTFA 5L3GA 2IM9A 3JD4A 4IGGA 2K1EA 1EZVH 3ETDA 3KG2A 4LNUA 4U3JB 1YITV 5JQGB 1GM7A 2WPDG 3GWOA 3E8FA 3L72H 4IT5A 3ZHQA 3ICXA 3MD0A 3T1YO 1NR1A 2DQ3A 2QA4V 4JAAA 3I55V 2UXCO 1V54C 4MW3A 3OUFA 3ASOC 3KCXA 4NB5A 4EFEA 1Q81W 4H44B 3CJHB 1VF5B 1O9HA 2UUAO 4UCOA 1N33O 2BCCH 3C3SA 2GUZA 3ZMZA 1H38A 1H2KA 1KU9A 1OCZB 2P4KA 2P4VA 1Q6UA 5J2TB 1JFFA 4X62B 3DXRA 1NTMH 1TUBA 1AI6A 4JI0O 4CS4A 4K3AA 4AILC 4LC1A 2HEPA
chains in the Genus database with same CATH topology
1K5SA 3CP1A 3K03A 2HLDG 3ZN0A 1AJNA 3CPWU 3B77A 4PDMA 4TSFG 4BIZA 3SJQC 5IDJA 4TT3G 4BAYA 3SYAA 3PJSK 2LFSA 2EZOA 4U7NA 2X6CA 1FFTB 4G2KA 2EBOA 4MVMA 4QPJA 5L3EA 1OCOC 4PA4A 3FB7C 4GX1A 1KC8W 2BOCC 2W6JG 2IJKA 5DM6V 2JK5C 4WFGA 1NR7A 5EBWC 5EK0A 2OCCB 4FIPC 1P7BA 1OZ0A 4R7CA 3SPGA 1K97A 1YSCA 4QE7A 4JYBA 2ZQMA 3OEEG 3ZRVA 1AI7A 4WFAV 1NH2D 1PNMA 1OCZC 2YEVB 4MTGA 3K9AA 4UVBA 3RBZA 1TUEB 3ZIAG 1K4CC 2UXNA 4H33A 2DWDC 1Y66A 4LP8A 3LSSA 3LSQA 3OUSA 5KUKA 4QJFB 1S3JA 4LBEC 2P90A 2V7QG 4GCZA 2Y69C 3QO7A 2C2AA 2YSUB 1OCRB 4RAIA 1K34A 2A9HA 1KP3A 1FXHA 1WPXA 5H9CA 2WLNA 3RVZA 1NQTA 4X88A 4JASA 2MK3A 4PELA 3CCLV 1K5QA 5LHHA 1PNKA 3ZMUA 2P67A 5B1BC 4WCEV 1V54B 4PA6A 2JJ1G 2EIKC 1ORQC 3ASOB 4JTDB 3SPIA 1GMGA 3QO5A 3ABKB 3A0RA 2XAGA 2B5UA 4JAUA 1NJIW 1R73A 4JF3A 1R3JC 3E89A 3JD0A 4P30A 2DYRC 4DO2A 1K3EA 1H8HG 4L87A 2F43G 1GK9A 3OR6C 2JEXA 1RPOA 3FKSG 3W7TA 2JJ2G 4H37A 3LDDA 1R6NA 1YHQV 3MHSC 1VQ6V 2ZDIA 1BHAA 2XAQA 2HG5C 1XL4A 2ZD9A 3CXCU 4FJCC 1OCRC 4GT1A 2X6BA 1BMFG 1SERA 2NLJC 3LNMB 3CC2V 5E1AC 1R3IC 5LGTA 1VQ7V 1M56C 2CK3G 3JD2A 3IC7A 1QLNA 3OMNB 3TETA 1VQ9V 2ZXWB 3ML0A 3STZC 1R6KA 1S77D 1QVGU 1OCOB 3EHBB 2DYSB 4JTCB 1E1RG 4E2LA 3LUTB 4JTAB 1KECA 2XAJA 1K7DA 2XNDG 1I5YA 3ZJZA 4G28B 3JD3A 4RQFA 4X8AA 2GSMB 2M7WA 1XL6A 1YJWV 1VQMV 1QBZA 4RUEA 1AI5A 2X7RB 3TCUA 4CZZA 2IH3C 2LFRA 1THZA 1JVMA 3ZN1A 1YI2V 4UV8A 4PA9A 3T2MA 3AG4B 1IXMA 2JDIG 2ZDIC 2HKOA 3H01A 2Y69B 1AROP 4UV9A 3UKMA 2WLHA 1P4RA 3I56V 3P32A 2ZXWC 2Q67A 2QM7A 1PKXA 4EKWA 5B3SC 2IJJA 4QPKA 2HVJC 5B1BB 1Q7YW 3NXSA 2DYSC 3VBBA 1N8RW 2FTKA 2EIKB 4FPPA 1Q82W 1DTOA 3UM7A 1VQ8V 1OCCB 4P9PA 5IY5C 1RM1C 1VQ5V 2B1IA 1GM8A 1VQ4V 2OTJV 1QR8A 5B1NA 3ZMTA 1JCHA 4PDRA 3OR7C 1VQNV 2DYRB 1DF5A 1DF4A 3ABUA 2WLKA 4Z1MG 3G4SV 3D3IA 4PDVA 5CMUA 5L3DA 1JPXA 1FXKA 3RW0A 4ZKIA 2WWWA 3AG2B 3E83A 3CCRV 1NH2B 3K08A 3W7SA 4UUJC 1K73W 4N21A 3TK1A 4XBFA 4XDJA 3E86A 1KKDA 3AG4C 4FK5C 1FXKB 2HVKC 3SPCA 5IYCO 2W0FC 4MVZA 4UXNA 5LHIA 3FYIB 1G8MA 1GKFA 3ASNB 4XDLA 2P6JA 3WG7C 1M56B 1PL0A 1JJ2U 4MVUA 3ABMC 4PA3A 1VQPV 1S0VA 2EJRA 2WLIA 2ZR2A 4J9ZB 1MABG 2UXXA 3F7YC 2QM8A 5IYBO 1S72V 1W2BU 3T4DA 2WSSG 4P2ZA 2IW5A 4MTFA 4N23A 1NVPD 1BHBA 3T4ZA 1OCCC 2ITDC 2WLIB 1JQ0A 4HYOA 5H6RA 2P7TC 3QO8A 4JGSA 3OE7G 5L3BA 2LP7A 1RPRA 2A0LA 3SPHA 3X2QB 2GHYA 3AG2C 3WFVA 1SRYA 3FB8C 4KP4A 3P30A 4PA7A 2XOKG 5CBGA 4MVRA 3M99B 3HPLC 2DW4A 3STLC 1KD1W 1BL8A 5J9PC 3K0GA 2D3OW 3CCEV 2QTOA 4BIUA 1FXKC 3W7WA 3OM3B 4TWKA 2IH1C 4G27B 4BW5A 1QLEC 1Y4MA 1MOFA 2R9RB 3B8NA 3ASNC 2Z3YA 2HR3A 4KFMA 1EZJA 3SYCA 4OXSA 3OMAB 4MS2A 4WFEA 2DWEC 1VQOV 4I5SA 4MT8A 5CBFA 5B3SB 3K0DA 3AEIA 4GX0A 1R3LC 2QE7G 4QIWF 4WF9V 3E8BA 3E2EA 1S5HC 1GTOA 1G4YB 1E1QG 1FXVA 5HFLA 3SYQA 5IY5B 1RM1B 2PI4A 3EFFK 3ABLB 4KUMA 3SYOA 3X2QC 4MVOA 4RQEA 1CEZA 1S76D 2WLLA 4LCUC 5FL7G 5KA6A 1V55C 1K33A 3AG1C 3OFNG 4CBCA 3BEHA 1WLEA 3OGCC 4JYCA 5GW7A 2WAMA 5CBHA 1CPYA 2EINC 2WLJA 2WLLB 4JAVA 2XAHA 4RUFA 4PDLA 3CCJV 2ITCC 5L3CA 3FYEB 3R65A 3CCQV 1F4NA 3SPJA 4MVQA 3CMAV 2AHZA 2Z5UA 5LGNA 1YTFD 2EIMC 2HJFC 4HAMA 3WG7B 4F4LA 3CD6V 3ZRXA 4Q20A 3ABMB 1QR9A 1GO3F 1NBMG 4MSWC 3RVYA 1YJ9V 2IJIA 2EIJB 1AR1B 4UVCA 3SYPA 3JCZA 3K3WA 3QNEA 5B1AC 1SETA 4MW8A 5KA5A 3JYCA 2QKSA 3OAAG 3W7UA 1M57C 1W0KG 2XASA 3ABLC 1LNQA 3CCMV 1ENVA 1COWG 3BY6A 1EBOA 2W6IG 3W7XA 1PD3A 3E8HA 2R9IA 4MTXA 1I5XA 2EZPA 1GM9A 1H8EG 1YIJV 4HZ3A 4R8CA 5LHGA 2Q68A 5EBLC 2YEVA 2ATKC 3ABTA 5EC1C 3ZCCA 4DXWA 1HWYA 4J9YB 1MSWD 2EILC 3CMEV 2QEXV 1QLEB 3CC4V 1B6QA 2WLMA 3FB6C 5C93A 1PNLA 2Q69A 4FMTA 4R50A 1F23A 1SESA 3AG3C 3MHHC 2EIJC 4P9OA 1ROPA 1AJPA 2H8PC 3ZRSA 1VQKV 3IGAC 1NVPB 2B1GA 1F51A 1QVFU 5H6QA 4JPRA 5CA3A 1M1KW 1FS0G 2H94A 2JEUA 1QCEA 3VOUA 3FB5C 2X0LA 2OTLV 1V55B 3HB3B 4GX5A 3AG1B 1AJQA 1MG1A 3E8GA 2BOBC 1Q86W 3K79A 5KUMA 4WFHA 1DLBA 1OHHG 1JOYA 3OEHG 1JX9A 2X6AA 4WFFA 2OCCC 3E35A 3K06A 2OT5A 3CC7V 2EINB 5LBQA 3LDEA 5B1OA 1M9NA 2Q6AA 5L3GA 4QNHB 3ZMSA 3D36A 3OMIB 3JD4A 2DQ0A 3F5WC 3ETGA 5L3FA 2K1EA 1W0JG 2AHYA 2Y48A 3ETDA 3KG2A 1AI4A 2EIMB 1YITV 1UJWB 1GM7A 2WPDG 3GWOA 1VQLV 4MTOA 2IU3A 1K92A 1KP2A 3E8FA 4UVAA 1E79G 4XDKA 1J95A 4MVSA 1K9MW 2XAFA 3MD0A 4X89A 1SZTA 5LGUA 1NR1A 4R6ZA 2KB1A 5B1AB 2IU0A 4YXWG 5CN0A 5IYDO 1K4DC 1M57B 2IJHA 3CCVV 3OW2U 5EC2C 1R3KC 2DQ3A 2QA4V 1H2GA 3G71V 3I55V 5BZBA 1F4MA 3GB7C 1V54C 3JD1A 4MW3A 1L1FA 3OUFA 1ZWIC 3B8MA 3ASOC 1YJNV 3DGEA 1M90W 2V1DA 3ABKC 3CCUV 3F7VC 5DN6G 3ZRWA 1KQSU 5HFMA 1Q81W 1NKDA 2NNUA 2PI5A 3LDCA 3DTUB 1K8AW 2EILB 3CYOA 4I9WA 1EFRG 2ZR3A 5EBMC 3G6EV 4WFBV 2A79B 3ETEA 4U7OA 3K04A 3ZRWB 3ZMZA 1H38A 1YTFB 3T1CA 1OCZB 4QE9A 3CCSV 4GX2A 2JIZG 3AG3B 3IFXA 3ZMVA 4ZBMA 4ASUG 2HFEC 1AI6A 1CP9A 4LC1A 4RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 V;  1M90 W;  1VQ4 V;  2OTL V;  3CC4 V;  1VQ6 V;  2OTJ V;  3CCU V;  1JJ2 U;  3CCL V;  1VQN V;  1K9M W;  1KQS U;  3CCJ V;  4WFA V;  3CPW U;  3CCQ V;  1Q81 W;  4WF9 V;  3CCM V;  1Q86 W;  1VQP V;  4WCE V;  3CMA V;  3G4S V;  1KD1 W;  3CXC U;  2D3O W;  1S72 V;  1W2B U;  1K8A W;  3CCR V;  3CCE V;  3CC7 V;  3I56 V;  3G6E V;  4WFB V;  3OW2 U;  3CCV V;  1K73 W;  3CC2 V;  1NJI W;  1R73 A;  1YIJ V;  3CD6 V;  1VQ7 V;  2QA4 V;  1VQK V;  1KC8 W;  1QVF U;  5DM6 V;  1YJW V;  1VQM V;  1Q7Y W;  1YJ9 V;  3G71 V;  3I55 V;  2QEX V;  3CCS V;  1N8R W;  1M1K W;  1VQ9 V;  1Q82 W;  1VQO V;  1YIT V;  1VQ5 V;  1VQ8 V;  1QVG U;  1VQL V;  3CME V;  1YHQ V;  1YJN V; 
#chains in the Genus database with same CATH topology
 1R6T A;  1NTZ H;  3CE2 A;  1WB8 A;  2BSK A;  4TV8 B;  1YVW A;  3CPW U;  4DRX A;  3UQ8 A;  1X4T A;  1HNX B;  3FX7 A;  4BIZ A;  3DXR B;  1QQC A;  3WB1 A;  2FML A;  3PJS K;  4B3R O;  2LFS A;  4U7N A;  2EBO A;  3FB7 C;  4DRX B;  5EBW C;  4FIP C;  4R7C A;  5K1P A;  3RYI B;  1KB9 F;  1WB7 A;  4WFA V;  1ZUQ A;  4FFB A;  2JGD B;  1NH2 D;  5LYJ B;  1PNM A;  2DWD C;  1Y66 A;  1U96 A;  4LP8 A;  3C3T A;  3M7M X;  2HHH B;  4FFB B;  1VIB A;  2P90 A;  2Y69 C;  2C2A A;  2YSU B;  5B5E Z;  1XI1 A;  1K34 A;  1KP3 A;  4LF7 O;  4JAS A;  1PNK A;  2W0X A;  3ZMU A;  3WB0 A;  1P7G A;  3JCU Z;  3QO5 A;  1M4U A;  4K0K B;  3ABK B;  2VS0 A;  2B5U A;  1R73 A;  2MW2 B;  3BAA A;  4JF3 A;  4C7U A;  2A3Q A;  4JYY A;  1H8H G;  3H9V A;  2F43 G;  3OR6 C;  1RPO A;  3FKS G;  1XNQ B;  4GUN A;  2QWP B;  4NXM O;  4DR6 O;  3LDD A;  1R6N A;  3MHS C;  2ZDI A;  1ZLZ A;  4O4L A;  1XL4 A;  4YJ2 A;  3ETQ A;  1H2S B;  2R72 A;  4GT1 A;  2X6B A;  1BMF G;  5GTH Z;  3CC2 V;  1VP7 A;  4AQY O;  3IC7 A;  3CWB H;  4YJ2 B;  2DOS A;  5D5P A;  1GN6 A;  4W4K A;  4I9Q A;  1R6K A;  3BA8 A;  4FLY A;  1OCO B;  4PHZ A;  3JSL A;  4JTC B;  2ILM A;  3B2E E;  1Q5O A;  4DUZ B;  3JAL A;  2CAZ C;  5KMG A;  4KHP B;  4FLV A;  1I0H A;  3G6B A;  3ZJZ A;  5IWA B;  4I50 A;  3JD3 A;  2YIB A;  4X8A A;  1L0N H;  3ZHS A;  3JAL B;  2X7R B;  4DV3 B;  4I50 B;  1YI2 V;  5A2Q N;  1MNG A;  1TVK A;  2QWO B;  5LP6 A;  4DR5 B;  2Q67 A;  4B3M B;  1TVK B;  2YID A;  5B1B B;  3VBB A;  4I55 A;  2EIK B;  3H1I H;  1YEW A;  1X59 A;  1VQ8 V;  2B1I A;  1VQ4 V;  1QR8 A;  2CTW A;  4PDR A;  2DYR B;  1HNW B;  3QF7 A;  3ABU A;  5LMU B;  1Z2G A;  1IBL B;  2WLK A;  4I55 B;  4Z1M G;  3ZX6 A;  3D3I A;  3G4S V;  1D2D A;  2DE0 X;  2QWN B;  1NH2 B;  1N34 O;  1O9G A;  2ADQ B;  3K08 A;  3TK1 A;  1JMK C;  1HR0 B;  2LW1 A;  2E5L O;  1QNM A;  4HBN A;  1L8D A;  2W0F C;  2AZ0 A;  4UXN A;  1U97 A;  1SQB H;  2PZS A;  1XHX A;  1M56 B;  2YIC A;  3K5N A;  3ABM C;  1B3Q A;  3JAW A;  2YI8 A;  4J9Z B;  1GH6 A;  5IYB O;  2QM8 A;  3T4D A;  4MTF A;  1BHB A;  1NVP D;  3AK1 A;  3QG5 A;  1Q3E A;  5BXZ A;  3G67 A;  4FLT A;  3JAW B;  1JQ0 A;  1Y74 A;  2YDE A;  2LP7 A;  1RPR A;  2A0L A;  4DV3 O;  3X2Q B;  3TXQ A;  2P22 C;  3AG2 C;  5TIS Z;  1IUR A;  5KHJ A;  1H2M A;  4MVR A;  1ZSP A;  3M99 B;  3HPL C;  1KD1 W;  1BL8 A;  5BMV B;  2GBO A;  1MOF A;  3B8N A;  5JH7 A;  4NR1 A;  2HR3 A;  1EZJ A;  3L70 H;  4WFE A;  2DWE C;  5K1X A;  4UFZ A;  5B3S B;  2F1M A;  4B7K A;  5JH7 B;  4I4T A;  4UB8 Z;  5LMU O;  2QE7 G;  4QIW F;  3E2E A;  2Q4P A;  1AP5 A;  1M93 A;  1MA1 A;  1WA8 B;  1E1Q G;  3SYQ A;  2PTM A;  5IY5 B;  3EFF K;  1HR0 O;  1UFI A;  2WLL A;  5KA6 A;  1V55 C;  4J42 A;  1WPB A;  3AG1 C;  4JYA B;  2G38 A;  1IDS A;  4CBC A;  4NXN B;  2HP8 A;  4LFB O;  2WLL B;  3K5O A;  5E79 Z;  3THO A;  2UXD B;  2E3C A;  4PDL A;  3CCQ V;  3FYE B;  1XEQ A;  4DK0 A;  5KHK A;  4DV4 O;  5LGN A;  2R9A A;  3WG7 B;  2AGA A;  2VQE B;  1QR9 A;  3B40 A;  4YJ3 A;  4NTX A;  3SYP A;  5JWP A;  5B1A C;  3JYC A;  3OAA G;  1GN3 A;  1M57 C;  1W0K G;  4DR1 B;  1LNQ A;  3CCM V;  3BY6 A;  4CS3 A;  2Q0A A;  1PD3 A;  1I5X A;  2CE4 A;  1YIJ V;  4R8C A;  5LHG A;  2Q68 A;  4DV0 B;  2F4V B;  2ATK C;  3ABT A;  5EC1 C;  3ZCC A;  1HWY A;  3SR2 C;  1HNZ O;  4NKG B;  4LF6 B;  4DV1 O;  4ZIB A;  1N4C A;  1Q43 A;  1SES A;  3AG3 C;  3MHH C;  2EIJ C;  3P3P A;  1XMQ O;  1SQV H;  1AJP A;  3ZRS A;  1JR9 A;  4LWS B;  1VQK V;  2YXL A;  1NVP B;  3HKD B;  4J80 A;  5ITZ A;  5CA3 A;  1AVM A;  1M1K W;  3SJB C;  1QCE A;  1US6 A;  3VOU A;  3FB5 C;  4JI3 B;  2OTL V;  3HB3 B;  5KHH A;  5CB4 A;  2OIE A;  1AJQ A;  4LFA B;  4PD4 F;  1OHH G;  5BR8 O;  2F95 B;  2OIG A;  2EIN B;  3CEI A;  4ZOL A;  3CHX A;  2Q6A A;  4FFK A;  4JV5 O;  2VQE O;  5L3F A;  2DQ0 A;  3F5W C;  3I5D A;  4DV2 B;  1PPJ H;  2EIM B;  1KMI Z;  4ZOL B;  2UXB B;  4DR1 O;  1DGS A;  2F66 C;  1E79 G;  2RCV A;  1J95 A;  4MVS A;  3K59 A;  3TJT A;  2EJ7 A;  5FNV B;  4X89 A;  5LGU A;  4J41 A;  2LO1 A;  2UUB O;  3RT3 C;  3J80 N;  4EEQ A;  4DR2 O;  5IYD O;  1K4D C;  2Q7E A;  2IJH A;  3CCV V;  3OW2 U;  5EC2 C;  1IBM B;  1ZL8 A;  5JCO C;  5BZB A;  5H5N A;  3JD1 A;  4B7E A;  4TOI A;  1ZWI C;  3DGE A;  1M90 W;  4EB6 A;  2XUM A;  5DN6 G;  1BCC H;  5FLX N;  2RMK B;  1WP8 A;  4IIJ A;  1K8A W;  4GKK O;  3HKB B;  1EFR G;  1R1B A;  3G6E V;  4EB6 B;  4JI6 B;  2JS5 A;  1YCI A;  3ZHR A;  2RDC A;  4GX2 A;  4IIJ B;  3ZMV A;  1CP9 A;  4JI1 O;  4LR3 A;  4F6E A;  3K03 A;  1SKV A;  3ZN0 A;  4LH6 A;  4PDM A;  4OGQ B;  1XDC A;  3K57 A;  4B3T O;  4TT3 G;  3JSN A;  5LOV A;  4EFB A;  4OX9 B;  4GKJ B;  3JAS B;  4FM2 A;  3L9D A;  4GX1 A;  2JK5 C;  2OCH A;  4LFC B;  5LOV B;  4JZ2 A;  3UT5 B;  3A0H Z;  3WB2 A;  1AI7 A;  4MTG A;  4DR7 B;  4UVB A;  3RBZ A;  1TUE B;  3ZIA G;  4JI2 B;  2BTO A;  3LSS A;  5KUK A;  1IVS A;  4FZ0 A;  5JJN B;  2QGN A;  4HNA A;  2CTP A;  5LMN B;  1EN5 A;  1RSO A;  1SQF A;  1FXH A;  1N32 B;  1WPX A;  5H9C A;  4X88 A;  3CCL V;  4HNA B;  2P67 A;  1CXZ B;  3HKE A;  3OD4 A;  3N27 A;  1FYJ A;  4WCE V;  1PM9 A;  1Y6X A;  1ORQ C;  4JTD B;  5AG2 A;  2M6Y A;  4QGP A;  1NJI W;  3E89 A;  4P30 A;  3BCC H;  4CH4 A;  4L8J A;  1GK9 A;  2ZT9 B;  3W7T A;  2JJ2 G;  1YHQ V;  3APQ A;  2GV9 A;  4K35 A;  4D7S A;  4FJC C;  4LNU B;  1OCR C;  1V9P A;  2JGU A;  1VF6 C;  1SER A;  2AXT Z;  3LNM B;  1VQ7 V;  2CK3 G;  2RN9 A;  3OMN B;  1ZX3 A;  2AZ2 A;  2UUC B;  4GYC B;  1S77 D;  2WA3 A;  3L74 H;  4FM0 A;  2LQT A;  1KUQ A;  1KEC A;  1PP9 H;  3GVM A;  1PL4 A;  1D5A A;  1VF7 A;  3FFQ A;  1KYO F;  3J81 N;  2WA4 A;  5LMN O;  4JI5 B;  2GSM B;  1NT2 B;  5BY1 A;  2LFR A;  1THZ A;  2YIB D;  3N2G A;  1Q6I A;  4PA9 A;  2GUZ B;  3T2M A;  1DK1 A;  4CH3 A;  3MDS A;  4H13 B;  1ARO P;  4NVP A;  1JFF B;  2YI9 A;  2ZE5 A;  4O4H A;  5KHG A;  1P4R A;  1TUB B;  1ZAU A;  3N2G B;  3RYH A;  2QM7 A;  2IJJ A;  2BSK B;  5F2V O;  4O4H B;  1WN7 A;  2L35 A;  4IYH A;  1Z5W A;  4FPP A;  1Q82 W;  3UM7 A;  1WNS A;  1I7F A;  2VQF B;  1GM8 A;  2XT9 A;  5B1N A;  3ZMT A;  2YS8 A;  1IBK B;  3RFR A;  1YXB A;  1JPX A;  3AG2 B;  2LJ2 A;  4JI4 B;  2FKX A;  4UCS A;  4N21 A;  4XBF A;  4XDJ A;  4WBN A;  3AG4 C;  2R70 A;  2N05 A;  1BSM A;  3DSQ A;  1JJ2 U;  1VEW A;  5DED A;  3WU2 Z;  5IT9 N;  2WLI A;  1UPG A;  1MAB G;  2UXX A;  3F7Y C;  1S72 V;  1W2B U;  2KG7 A;  3T4Z A;  3P3N A;  1OCC C;  3S3W A;  1SQX H;  4DR4 B;  1TGO A;  2WLI B;  5H6R A;  3QO8 A;  4JGS A;  4X62 O;  2KG7 B;  4LF9 B;  3NR7 A;  3WFV A;  1SRY A;  4KP4 A;  4PA7 A;  5CBG A;  1HNX O;  2QTS A;  2DW4 A;  1YDX A;  2CUG A;  4E4E A;  3JAK A;  3W7W A;  1FXK C;  1AP6 A;  4TWK A;  4OPH A;  3TGU H;  1QLE C;  4O4L B;  4DR3 B;  2ZIM A;  4KFM A;  2DN9 A;  3JAK B;  4MS2 A;  1VQO V;  4I5S A;  1EM1 A;  2KQX A;  3SJC C;  3RYF A;  4GX0 A;  2ZIO A;  2E76 B;  3E8B A;  4O4I A;  5B66 Z;  1I94 B;  1FXV A;  4X66 B;  4DV6 B;  1RM1 B;  3JAT A;  4KUM A;  3RYF B;  2HHH O;  1S76 D;  2ZE7 A;  2ZCE A;  4F6R A;  5KX5 A;  5KMG B;  3JAT B;  4JYC A;  5GW7 A;  4JAV A;  4TUY A;  4RUF A;  4LF5 B;  3CCJ V;  3R65 A;  2Y4T A;  1F4N A;  4IL6 Z;  5KX5 B;  3IJ4 A;  1BE3 H;  1YTF D;  1Q6H A;  4K0K O;  2HJF C;  2JRI A;  3CD6 V;  4MSW C;  1GO3 F;  5LP6 B;  1YJ9 V;  2EIJ B;  4LF9 O;  4MW8 A;  3PN1 A;  1XNQ O;  3W7U A;  2XAS A;  1EN4 A;  1FPO A;  3ZBH A;  3IC9 A;  1L0L H;  1COW G;  1Y76 A;  3W7X A;  3B09 A;  4YHH B;  2UU9 B;  3FAV A;  2IBZ H;  5EBL C;  2OYQ A;  2YEV A;  1Y76 B;  2GTA A;  1KBH A;  2QEX V;  1D5N A;  3FAV B;  2WLM A;  5C93 A;  2F23 A;  1PNL A;  3D8C A;  4R50 A;  4DUZ O;  4DV6 O;  3L75 H;  1SC5 B;  4KHP O;  2FL4 A;  5IWA O;  4O4J A;  5JCO A;  4JI7 B;  2B1G A;  4Z2W A;  4B08 A;  1XNR B;  4X20 A;  1MZE A;  5H6Q A;  3BRC A;  3C90 A;  2JEU A;  4DW1 A;  2CGO A;  2X0L A;  1BQZ A;  4GX5 A;  2KSD A;  4X20 B;  3CX5 F;  1MG1 A;  2BOB C;  5KUM A;  1Y74 B;  1DLB A;  4DR5 O;  2E74 B;  3E35 A;  3K06 A;  2OT5 A;  5LBQ A;  3LDE A;  3EXA A;  4B3M O;  4QNH B;  4LF4 B;  3OMI B;  3ETG A;  1W0J G;  3BHP A;  2AHY A;  2Q9L A;  2Y48 A;  3U11 A;  1UJW B;  1VQL V;  2IU3 A;  5EIB C;  1K92 A;  4XDK A;  4NYK A;  1HNW O;  1IBL O;  2YC0 A;  3AK2 A;  3CSX A;  1SZT A;  4NTW A;  4YXW G;  5FPO A;  1Q8I A;  2YIA A;  4I4T B;  4DV5 B;  2ZE6 A;  5EYP A;  1XMO B;  3KCY A;  3G71 V;  1MSD A;  1F4M A;  3T1H B;  3CXH F;  3B8M A;  4CH6 A;  2V1D A;  3ABK C;  3CCU V;  4FM1 A;  5EYP B;  5JVD A;  1NKD A;  2NNU A;  2B9Z A;  2PI5 A;  3DTU B;  4ICG A;  3IAY A;  2HJD A;  2EIL B;  2ZR3 A;  5J2U A;  1GN4 A;  4U7O A;  3K04 A;  1YTF B;  1EN6 A;  3T1C A;  4AHC A;  3D36 C;  4LF8 B;  3CCS V;  4ZBM A;  2HFE C;  5LA6 A;  3BAB A;  1FJG B;  4KL1 A;  1LUW A;  3CP1 A;  1MZF A;  2HLD G;  1AJN A;  3BA9 A;  2GDS A;  4TSF G;  4UCV A;  4YJ3 B;  4BAY A;  5LA6 B;  3SYA A;  4K8Z A;  2K9P A;  1BT8 A;  1FFT B;  1S5J A;  5L3E A;  1OCO C;  4PA4 A;  1KC8 W;  2BOC C;  2QWQ B;  3H1J H;  4WFG A;  4JI8 B;  3RN4 A;  4UCT A;  5EK0 A;  4IHJ A;  2OCC B;  2Y4U A;  1P7B A;  3OTO B;  3B4S A;  1SZX A;  5LL6 Y;  3SPG A;  1YSC A;  4QE7 A;  2VWK A;  4J7Z A;  4H33 A;  1VF6 A;  4DV7 B;  2Q7G A;  4DV5 O;  3LSQ A;  1PV0 A;  3OUS A;  5IE9 A;  1XMO O;  4DW0 A;  1S3J A;  4YY3 B;  4LBE C;  4JYA O;  4GCZ A;  3RGB A;  3QO7 A;  1OCR B;  4RAI A;  4NXN O;  1N36 B;  4J11 A;  2H3O A;  2WLN A;  2UXD O;  3MAQ A;  2MK3 A;  1K5Q A;  2JVD A;  5LHH A;  1VMG A;  5B1B C;  5ITZ B;  1V54 B;  2JJ1 G;  2EIK C;  3ASO B;  3SPI A;  4UCU A;  5CB4 B;  2DYR C;  4DO2 A;  2JEX A;  1KKC A;  4H37 A;  2LGW A;  1VQ6 V;  4FVM A;  1SQP H;  3UO2 A;  2ARH A;  2HG5 C;  2ZNI A;  3CXC U;  2QKC A;  1J5E B;  2NLJ C;  1R3I C;  5LGT A;  1M56 C;  3JD2 A;  3R66 A;  1B06 A;  4DV0 O;  2F4V O;  3STZ C;  1S5L Z;  4O2A A;  5KHI A;  1QVG U;  4LF6 O;  4J7K A;  4X64 B;  1ZL8 B;  3CS5 A;  1JJO A;  1E1R G;  4JTA B;  2GTS A;  1I5Y A;  4FZ1 A;  3FD9 A;  4DV7 O;  4O2A B;  5CA1 A;  4X65 B;  4B3S B;  4G28 B;  3A8T A;  4YY3 O;  3GWK C;  2FYU H;  1XL6 A;  1YJW V;  1VQM V;  1QBZ A;  4RUE A;  1NI8 A;  1AI5 A;  3TCU A;  2BTQ A;  1JVM A;  4JI3 O;  3AG4 B;  1IXM A;  2JDI G;  3BFR A;  2Y69 B;  3CRC A;  4LFA O;  5KLV H;  4U3F H;  2BTQ B;  1TAE A;  5CA0 A;  3I56 V;  2ZM6 B;  4K8X A;  2ZXW C;  1PKX A;  4EKW A;  5B3S C;  2PYL A;  4ZHQ A;  2EUL A;  3JAR A;  2HVJ C;  1N0J A;  1XRE A;  3CRA A;  2DYS C;  5GON A;  4DV2 O;  4YIP A;  1N8R W;  2FTK A;  4I0X A;  4AI8 A;  1OCC B;  5IY5 C;  2UXB O;  2OWO A;  4ZHQ B;  1F7Y A;  1JCH A;  1VQN V;  1W59 A;  2AW9 A;  1DF4 A;  3T1Y B;  3K58 A;  1SA0 A;  5CMU A;  4ZKI A;  1FXK A;  1SQQ H;  4H0L B;  1IBM O;  3W7S A;  4UUJ C;  1K73 W;  3KZI Z;  3E86 A;  4FK5 C;  1SA0 B;  2CDY A;  1NZ6 A;  1FXK B;  2UXC B;  3A2F A;  4MVZ A;  2CH7 A;  1G8M A;  1GKF A;  3WG7 C;  1FFX A;  1PL0 A;  5JJJ B;  1TA8 A;  1VQP V;  2Z0A A;  4PA3 A;  2EJR A;  4PI0 A;  2ZR2 A;  1RFY A;  2UUA B;  1RSO B;  2VWJ A;  1XUQ A;  1N33 B;  4JI6 O;  2XTA A;  3D3Q A;  2ITD C;  4HYO A;  3HKE B;  3HKC A;  4JI0 B;  2RJZ A;  2GHY A;  2PF4 E;  3KKY A;  4DYL A;  3P30 A;  5FPR A;  2D3O W;  3K0G A;  2YUA A;  2ETN A;  1MMM A;  4OX9 O;  4U3J A;  5JQG A;  4B3R B;  4GKJ O;  4Q6G A;  4BW5 A;  1SQG A;  1Y4M A;  3DC6 A;  4BWA A;  5JJE B;  3ASN C;  2Z3Y A;  2P06 A;  2ZIN A;  4OXS A;  3OMA B;  4LFC O;  3J7A U;  4TV9 A;  2PUS A;  1SS3 A;  3AEI A;  3ZHV A;  1R3L C;  3LNN A;  2ADP A;  1S5H C;  4TV9 B;  1G4Y B;  4DR7 O;  5HFL A;  2QDO A;  2PI4 A;  4JI2 O;  3SGI A;  4RQE A;  1CEZ A;  1IZ3 A;  4LCU C;  1AIL A;  5FL7 G;  5KAF Z;  1K33 A;  1XQ8 A;  3CJH A;  3BEH A;  1N32 O;  1WLE A;  3OGC C;  3ZHU A;  4PI2 A;  4LF7 B;  1CPY A;  2EIN C;  2WLJ A;  3BPZ A;  2XAH A;  2Q0O C;  2ITC C;  5L3C A;  1AR4 A;  3SPJ A;  4MVQ A;  5J2T A;  3LSU A;  3CMA V;  3CRM A;  2AHZ A;  2Z5U A;  2EIM C;  1A32 A;  2CGN A;  4F4L A;  4Q20 A;  4TV8 A;  3ABM B;  1NBM G;  2L6L A;  3RVY A;  1AR1 B;  4UVC A;  3JCZ A;  3K3W A;  4GLX A;  1M5I A;  2QKS A;  3RYH B;  4NXM B;  5A9G A;  4DR6 B;  3CB2 A;  2ZE8 A;  3ABL C;  1P84 F;  3S3X A;  1ZTE A;  1ENV A;  3H1L H;  3E8H A;  2R9I A;  2XHB A;  2EZP A;  1Z5V A;  1H8E G;  3RYI A;  4AQY B;  2JGD A;  5LYJ A;  2UUC O;  4PJ0 Z;  1IXB A;  3CC4 V;  4KXR A;  3FB6 C;  4WBN B;  4FMT A;  5LXT A;  1F23 A;  1ROP A;  4BW9 A;  1BS3 A;  1XBL A;  3U10 A;  4JI5 O;  1F51 A;  5LXT B;  1QVF U;  1GAX A;  3APO A;  4JPR A;  2H94 A;  1XOU A;  2FB5 A;  1V55 B;  3AG1 B;  4X1I A;  3E8G A;  1Q86 W;  1YZB A;  4D6T H;  1H2N A;  1JX9 A;  2X6A A;  4WFF A;  3CC7 V;  5B1O A;  1M9N A;  2ZNJ A;  4X1I B;  2D2C B;  3ZMS A;  3D36 A;  3UCS C;  5H2F Z;  2Q7H A;  1RP3 B;  1AI4 A;  4X1Y A;  5D5Q A;  3CRQ A;  4MTO A;  2VQF O;  1KP2 A;  1BGY H;  4UVA A;  1XHZ A;  1K9M W;  2XAF A;  4TQF A;  1AB3 A;  2YXH A;  1IBK O;  4R6Z A;  2KB1 A;  5B1A B;  4X1Y B;  2IU0 A;  5CN0 A;  1N34 B;  1M57 B;  4JI4 O;  3Q4H A;  1R3K C;  2E5L B;  4O4I B;  1H2G A;  3AG7 A;  3GB7 C;  2PYJ A;  3K9S A;  1L1F A;  3Q4H B;  1YJN V;  4FLZ A;  3F7V C;  3ZRW A;  1KQS U;  5HFM A;  4ABM A;  1XIL A;  1VAR A;  3LDC A;  3O9O A;  4F6R B;  3CYO A;  2ZKO A;  4I9W A;  5EBM C;  4WFB V;  2A79 B;  3ETE A;  4TUY B;  4DR4 O;  3ZRW B;  4QE9 A;  2JIZ G;  3AG3 B;  3IFX A;  2NR5 A;  4ASU G;  5IJ0 A;  4RO2 A;  1K5S A;  1LUV A;  3B77 A;  3SJQ C;  1HDJ A;  5IDJ A;  5IJ0 B;  1WJZ A;  2EZO A;  2X6C A;  4G2K A;  4QPJ A;  4MVM A;  4DR3 O;  2W6J G;  2IJK A;  2Q5Z A;  5DM6 V;  1H2L A;  1NR7 A;  4BR6 A;  3VQY A;  3JAM N;  1OZ0 A;  1K97 A;  2KKW A;  3BVO A;  4JYB A;  2ZQM A;  3OEE G;  3ZRV A;  2YEV B;  1OCZ C;  1I94 O;  2QSA A;  4X66 O;  3K9A A;  1K4C C;  1WAZ A;  2UXN A;  4IYI A;  4QJF B;  2QR4 A;  2V4D A;  4D7T A;  2V7Q G;  1GN2 A;  1B04 A;  2A9H A;  3RVZ A;  3ZHT A;  1NQT A;  4LFB B;  4O4J B;  4LF5 O;  1QHT A;  4PEL A;  4O2B A;  4DV4 B;  4PA6 A;  5IYZ A;  1GMG A;  4OPA A;  4ZI7 A;  3A0R A;  2XAG A;  4O2B B;  4JAU A;  1R3J C;  3JD0 A;  3RWR D;  2DJV A;  1K3E A;  4L87 A;  3VQV A;  2Q73 A;  5IYZ B;  5BMV A;  4ZI7 B;  2YXY A;  1BHA A;  2XAQ A;  1I08 A;  2F93 B;  3O65 A;  2QWR B;  1NU1 H;  2ZD9 A;  1NS1 A;  2CTR A;  1SF9 A;  4YHH O;  3QTC A;  5E1A C;  2UU9 O;  1QLN A;  1FAF A;  1GRJ A;  3TET A;  1WA8 A;  2Y0I A;  4UB6 Z;  1BQ0 A;  1VQ9 V;  2ZXW B;  3ML0 A;  4GZR B;  1HNZ B;  3UO3 A;  3EHB B;  4DV1 B;  2DYS B;  4E2L A;  3LUT B;  2XAJ A;  1K7D A;  2XND G;  1XMQ B;  3K5M A;  2Y0P A;  1FKA O;  3E22 A;  2PY5 A;  4RQF A;  4JI7 O;  5JVD B;  4Z1V A;  1XNR O;  2M7W A;  1HW7 A;  2P5O A;  4CZZ A;  2IH3 C;  1WP7 A;  3ZN1 A;  4DUY B;  1N0N A;  5J2U B;  3E22 B;  4UV8 A;  1JA8 A;  4CC6 A;  2ZDI C;  2HKO A;  3H01 A;  3ZS8 C;  4UV9 A;  3UKM A;  2WLH A;  5BR8 B;  4LH7 A;  3P32 A;  4JZG A;  3QVN A;  5EZY A;  4JV5 B;  2RQ6 A;  4QPK A;  3N2K A;  4LF4 O;  4CH5 A;  1Q7Y W;  3NXS A;  1DTO A;  1VQ5 V;  4P9P A;  1RM1 C;  5EZY B;  2OTJ V;  3N2K B;  3L71 H;  3OR7 C;  1DF5 A;  4I7Z B;  2NN4 A;  2DMX A;  2JS3 A;  4IHJ B;  4PDV A;  5L3D A;  3A0B Z;  3SJA C;  3RW0 A;  2UUB B;  3CCR V;  2WWW A;  3E83 A;  4DR2 B;  1OV9 A;  4CS2 A;  3HR0 A;  1KKD A;  1T5E A;  2N74 A;  4YIO A;  5KAI Z;  3T1H O;  2HVK C;  1Q90 D;  3SPC A;  5IYC O;  4DK1 A;  5LHI A;  3FYI B;  3ASN B;  4XDL A;  2P6J A;  3AK3 A;  4W4L A;  4LWS A;  3RYC A;  4MVU A;  3HKD A;  1S0V A;  5LP6 C;  2WSS G;  4P2Z A;  4GKK B;  2IW5 A;  4N23 A;  2Q8V A;  1HP8 A;  3RYC B;  4FLU A;  2O57 A;  4LF8 O;  2P7T C;  3OE7 G;  5L3B A;  1Y67 A;  3DC5 A;  4DUY O;  3SDL A;  3SPH A;  1FJG O;  4JI1 B;  3FB8 C;  2XOK G;  1AR5 A;  1LR1 A;  1FD9 A;  3CRR A;  4B3T B;  2LGQ A;  3STL C;  5J9P C;  3CCE V;  2QTO A;  4BIU A;  3TXS A;  3OM3 B;  2IH1 C;  4G27 B;  2R9R B;  5FNV A;  3SYC A;  4JI8 O;  3OT7 A;  1G6U A;  3G80 A;  4NTY A;  3OTO O;  4MT8 A;  5CBF A;  2N04 A;  3K0D A;  2RNB A;  3U0Z A;  3M8A A;  4WF9 V;  1GTO A;  2A7W A;  4RWU A;  1QU7 A;  4J10 A;  3ABL B;  4PV1 B;  3SYO A;  3X2Q C;  4MVO A;  4FLX A;  2VRZ A;  3OFN G;  1YF2 A;  3OGI B;  1N36 O;  3HKB A;  2WAM A;  5CA1 B;  5CBH A;  1OJH A;  3H1H H;  2E75 B;  2BE3 A;  5DEC A;  3H1K H;  3K5L A;  3VQX A;  4BIO A;  2QKA A;  4HAM A;  3L73 H;  4A5U B;  4X1K A;  3ZRX A;  4UCR A;  2IJI A;  5IJ9 A;  2QM4 A;  3QNE A;  1SET A;  5KA5 A;  5CA0 B;  1IX9 A;  4X1K B;  4CC5 A;  3JAS A;  3F5T A;  5GTI Z;  3JAR B;  5IJ9 B;  5GON B;  1EBO A;  4I0X B;  2W6I G;  4MTX A;  3UT5 A;  1J5E O;  2QJ1 A;  4J7J A;  4X9Q A;  1GM9 A;  3ZED A;  2EX3 A;  4HZ3 A;  2A06 H;  1URF A;  4DXW A;  5C8Y A;  4J9Y B;  1MSW D;  2EIL C;  3VQW A;  3CME V;  1BZK A;  4X64 O;  1QLE B;  1B6Q A;  1P49 A;  2ODM A;  2Q69 A;  3EVK A;  5EIB D;  5C8Y B;  2LW7 A;  4P9O A;  4X65 O;  1G1X B;  2CH7 B;  4B3S O;  2H8P C;  1FFX B;  3IGA C;  4TQD A;  2CTQ A;  2PGG A;  1FS0 G;  1NTK H;  4FLW A;  3K79 A;  3HKC B;  4WFH A;  1JOY A;  3OEH G;  2OCC C;  2ZM6 O;  3OTF A;  5L3G A;  2IM9 A;  3JD4 A;  4IGG A;  2K1E A;  1EZV H;  3ETD A;  3KG2 A;  4LNU A;  4U3J B;  1YIT V;  5JQG B;  1GM7 A;  2WPD G;  3GWO A;  3E8F A;  3L72 H;  4IT5 A;  3ZHQ A;  3ICX A;  3MD0 A;  3T1Y O;  1NR1 A;  2DQ3 A;  2QA4 V;  4JAA A;  3I55 V;  2UXC O;  1V54 C;  4MW3 A;  3OUF A;  3ASO C;  3KCX A;  4NB5 A;  4EFE A;  1Q81 W;  4H44 B;  3CJH B;  1VF5 B;  1O9H A;  2UUA O;  4UCO A;  1N33 O;  2BCC H;  3C3S A;  2GUZ A;  3ZMZ A;  1H38 A;  1H2K A;  1KU9 A;  1OCZ B;  2P4K A;  2P4V A;  1Q6U A;  5J2T B;  1JFF A;  4X62 B;  3DXR A;  1NTM H;  1TUB A;  1AI6 A;  4JI0 O;  4CS4 A;  4K3A A;  4AIL C;  4LC1 A;  2HEP A; 
#chains in the Genus database with same CATH homology
 1K5S A;  3CP1 A;  3K03 A;  2HLD G;  3ZN0 A;  1AJN A;  3CPW U;  3B77 A;  4PDM A;  4TSF G;  4BIZ A;  3SJQ C;  5IDJ A;  4TT3 G;  4BAY A;  3SYA A;  3PJS K;  2LFS A;  2EZO A;  4U7N A;  2X6C A;  1FFT B;  4G2K A;  2EBO A;  4MVM A;  4QPJ A;  5L3E A;  1OCO C;  4PA4 A;  3FB7 C;  4GX1 A;  1KC8 W;  2BOC C;  2W6J G;  2IJK A;  5DM6 V;  2JK5 C;  4WFG A;  1NR7 A;  5EBW C;  5EK0 A;  2OCC B;  4FIP C;  1P7B A;  1OZ0 A;  4R7C A;  3SPG A;  1K97 A;  1YSC A;  4QE7 A;  4JYB A;  2ZQM A;  3OEE G;  3ZRV A;  1AI7 A;  4WFA V;  1NH2 D;  1PNM A;  1OCZ C;  2YEV B;  4MTG A;  3K9A A;  4UVB A;  3RBZ A;  1TUE B;  3ZIA G;  1K4C C;  2UXN A;  4H33 A;  2DWD C;  1Y66 A;  4LP8 A;  3LSS A;  3LSQ A;  3OUS A;  5KUK A;  4QJF B;  1S3J A;  4LBE C;  2P90 A;  2V7Q G;  4GCZ A;  2Y69 C;  3QO7 A;  2C2A A;  2YSU B;  1OCR B;  4RAI A;  1K34 A;  2A9H A;  1KP3 A;  1FXH A;  1WPX A;  5H9C A;  2WLN A;  3RVZ A;  1NQT A;  4X88 A;  4JAS A;  2MK3 A;  4PEL A;  3CCL V;  1K5Q A;  5LHH A;  1PNK A;  3ZMU A;  2P67 A;  5B1B C;  4WCE V;  1V54 B;  4PA6 A;  2JJ1 G;  2EIK C;  1ORQ C;  3ASO B;  4JTD B;  3SPI A;  1GMG A;  3QO5 A;  3ABK B;  3A0R A;  2XAG A;  2B5U A;  4JAU A;  1NJI W;  1R73 A;  4JF3 A;  1R3J C;  3E89 A;  3JD0 A;  4P30 A;  2DYR C;  4DO2 A;  1K3E A;  1H8H G;  4L87 A;  2F43 G;  1GK9 A;  3OR6 C;  2JEX A;  1RPO A;  3FKS G;  3W7T A;  2JJ2 G;  4H37 A;  3LDD A;  1R6N A;  1YHQ V;  3MHS C;  1VQ6 V;  2ZDI A;  1BHA A;  2XAQ A;  2HG5 C;  1XL4 A;  2ZD9 A;  3CXC U;  4FJC C;  1OCR C;  4GT1 A;  2X6B A;  1BMF G;  1SER A;  2NLJ C;  3LNM B;  3CC2 V;  5E1A C;  1R3I C;  5LGT A;  1VQ7 V;  1M56 C;  2CK3 G;  3JD2 A;  3IC7 A;  1QLN A;  3OMN B;  3TET A;  1VQ9 V;  2ZXW B;  3ML0 A;  3STZ C;  1R6K A;  1S77 D;  1QVG U;  1OCO B;  3EHB B;  2DYS B;  4JTC B;  1E1R G;  4E2L A;  3LUT B;  4JTA B;  1KEC A;  2XAJ A;  1K7D A;  2XND G;  1I5Y A;  3ZJZ A;  4G28 B;  3JD3 A;  4RQF A;  4X8A A;  2GSM B;  2M7W A;  1XL6 A;  1YJW V;  1VQM V;  1QBZ A;  4RUE A;  1AI5 A;  2X7R B;  3TCU A;  4CZZ A;  2IH3 C;  2LFR A;  1THZ A;  1JVM A;  3ZN1 A;  1YI2 V;  4UV8 A;  4PA9 A;  3T2M A;  3AG4 B;  1IXM A;  2JDI G;  2ZDI C;  2HKO A;  3H01 A;  2Y69 B;  1ARO P;  4UV9 A;  3UKM A;  2WLH A;  1P4R A;  3I56 V;  3P32 A;  2ZXW C;  2Q67 A;  2QM7 A;  1PKX A;  4EKW A;  5B3S C;  2IJJ A;  4QPK A;  2HVJ C;  5B1B B;  1Q7Y W;  3NXS A;  2DYS C;  3VBB A;  1N8R W;  2FTK A;  2EIK B;  4FPP A;  1Q82 W;  1DTO A;  3UM7 A;  1VQ8 V;  1OCC B;  4P9P A;  5IY5 C;  1RM1 C;  1VQ5 V;  2B1I A;  1GM8 A;  1VQ4 V;  2OTJ V;  1QR8 A;  5B1N A;  3ZMT A;  1JCH A;  4PDR A;  3OR7 C;  1VQN V;  2DYR B;  1DF5 A;  1DF4 A;  3ABU A;  2WLK A;  4Z1M G;  3G4S V;  3D3I A;  4PDV A;  5CMU A;  5L3D A;  1JPX A;  1FXK A;  3RW0 A;  4ZKI A;  2WWW A;  3AG2 B;  3E83 A;  3CCR V;  1NH2 B;  3K08 A;  3W7S A;  4UUJ C;  1K73 W;  4N21 A;  3TK1 A;  4XBF A;  4XDJ A;  3E86 A;  1KKD A;  3AG4 C;  4FK5 C;  1FXK B;  2HVK C;  3SPC A;  5IYC O;  2W0F C;  4MVZ A;  4UXN A;  5LHI A;  3FYI B;  1G8M A;  1GKF A;  3ASN B;  4XDL A;  2P6J A;  3WG7 C;  1M56 B;  1PL0 A;  1JJ2 U;  4MVU A;  3ABM C;  4PA3 A;  1VQP V;  1S0V A;  2EJR A;  2WLI A;  2ZR2 A;  4J9Z B;  1MAB G;  2UXX A;  3F7Y C;  2QM8 A;  5IYB O;  1S72 V;  1W2B U;  3T4D A;  2WSS G;  4P2Z A;  2IW5 A;  4MTF A;  4N23 A;  1NVP D;  1BHB A;  3T4Z A;  1OCC C;  2ITD C;  2WLI B;  1JQ0 A;  4HYO A;  5H6R A;  2P7T C;  3QO8 A;  4JGS A;  3OE7 G;  5L3B A;  2LP7 A;  1RPR A;  2A0L A;  3SPH A;  3X2Q B;  2GHY A;  3AG2 C;  3WFV A;  1SRY A;  3FB8 C;  4KP4 A;  3P30 A;  4PA7 A;  2XOK G;  5CBG A;  4MVR A;  3M99 B;  3HPL C;  2DW4 A;  3STL C;  1KD1 W;  1BL8 A;  5J9P C;  3K0G A;  2D3O W;  3CCE V;  2QTO A;  4BIU A;  1FXK C;  3W7W A;  3OM3 B;  4TWK A;  2IH1 C;  4G27 B;  4BW5 A;  1QLE C;  1Y4M A;  1MOF A;  2R9R B;  3B8N A;  3ASN C;  2Z3Y A;  2HR3 A;  4KFM A;  1EZJ A;  3SYC A;  4OXS A;  3OMA B;  4MS2 A;  4WFE A;  2DWE C;  1VQO V;  4I5S A;  4MT8 A;  5CBF A;  5B3S B;  3K0D A;  3AEI A;  4GX0 A;  1R3L C;  2QE7 G;  4QIW F;  4WF9 V;  3E8B A;  3E2E A;  1S5H C;  1GTO A;  1G4Y B;  1E1Q G;  1FXV A;  5HFL A;  3SYQ A;  5IY5 B;  1RM1 B;  2PI4 A;  3EFF K;  3ABL B;  4KUM A;  3SYO A;  3X2Q C;  4MVO A;  4RQE A;  1CEZ A;  1S76 D;  2WLL A;  4LCU C;  5FL7 G;  5KA6 A;  1V55 C;  1K33 A;  3AG1 C;  3OFN G;  4CBC A;  3BEH A;  1WLE A;  3OGC C;  4JYC A;  5GW7 A;  2WAM A;  5CBH A;  1CPY A;  2EIN C;  2WLJ A;  2WLL B;  4JAV A;  2XAH A;  4RUF A;  4PDL A;  3CCJ V;  2ITC C;  5L3C A;  3FYE B;  3R65 A;  3CCQ V;  1F4N A;  3SPJ A;  4MVQ A;  3CMA V;  2AHZ A;  2Z5U A;  5LGN A;  1YTF D;  2EIM C;  2HJF C;  4HAM A;  3WG7 B;  4F4L A;  3CD6 V;  3ZRX A;  4Q20 A;  3ABM B;  1QR9 A;  1GO3 F;  1NBM G;  4MSW C;  3RVY A;  1YJ9 V;  2IJI A;  2EIJ B;  1AR1 B;  4UVC A;  3SYP A;  3JCZ A;  3K3W A;  3QNE A;  5B1A C;  1SET A;  4MW8 A;  5KA5 A;  3JYC A;  2QKS A;  3OAA G;  3W7U A;  1M57 C;  1W0K G;  2XAS A;  3ABL C;  1LNQ A;  3CCM V;  1ENV A;  1COW G;  3BY6 A;  1EBO A;  2W6I G;  3W7X A;  1PD3 A;  3E8H A;  2R9I A;  4MTX A;  1I5X A;  2EZP A;  1GM9 A;  1H8E G;  1YIJ V;  4HZ3 A;  4R8C A;  5LHG A;  2Q68 A;  5EBL C;  2YEV A;  2ATK C;  3ABT A;  5EC1 C;  3ZCC A;  4DXW A;  1HWY A;  4J9Y B;  1MSW D;  2EIL C;  3CME V;  2QEX V;  1QLE B;  3CC4 V;  1B6Q A;  2WLM A;  3FB6 C;  5C93 A;  1PNL A;  2Q69 A;  4FMT A;  4R50 A;  1F23 A;  1SES A;  3AG3 C;  3MHH C;  2EIJ C;  4P9O A;  1ROP A;  1AJP A;  2H8P C;  3ZRS A;  1VQK V;  3IGA C;  1NVP B;  2B1G A;  1F51 A;  1QVF U;  5H6Q A;  4JPR A;  5CA3 A;  1M1K W;  1FS0 G;  2H94 A;  2JEU A;  1QCE A;  3VOU A;  3FB5 C;  2X0L A;  2OTL V;  1V55 B;  3HB3 B;  4GX5 A;  3AG1 B;  1AJQ A;  1MG1 A;  3E8G A;  2BOB C;  1Q86 W;  3K79 A;  5KUM A;  4WFH A;  1DLB A;  1OHH G;  1JOY A;  3OEH G;  1JX9 A;  2X6A A;  4WFF A;  2OCC C;  3E35 A;  3K06 A;  2OT5 A;  3CC7 V;  2EIN B;  5LBQ A;  3LDE A;  5B1O A;  1M9N A;  2Q6A A;  5L3G A;  4QNH B;  3ZMS A;  3D36 A;  3OMI B;  3JD4 A;  2DQ0 A;  3F5W C;  3ETG A;  5L3F A;  2K1E A;  1W0J G;  2AHY A;  2Y48 A;  3ETD A;  3KG2 A;  1AI4 A;  2EIM B;  1YIT V;  1UJW B;  1GM7 A;  2WPD G;  3GWO A;  1VQL V;  4MTO A;  2IU3 A;  1K92 A;  1KP2 A;  3E8F A;  4UVA A;  1E79 G;  4XDK A;  1J95 A;  4MVS A;  1K9M W;  2XAF A;  3MD0 A;  4X89 A;  1SZT A;  5LGU A;  1NR1 A;  4R6Z A;  2KB1 A;  5B1A B;  2IU0 A;  4YXW G;  5CN0 A;  5IYD O;  1K4D C;  1M57 B;  2IJH A;  3CCV V;  3OW2 U;  5EC2 C;  1R3K C;  2DQ3 A;  2QA4 V;  1H2G A;  3G71 V;  3I55 V;  5BZB A;  1F4M A;  3GB7 C;  1V54 C;  3JD1 A;  4MW3 A;  1L1F A;  3OUF A;  1ZWI C;  3B8M A;  3ASO C;  1YJN V;  3DGE A;  1M90 W;  2V1D A;  3ABK C;  3CCU V;  3F7V C;  5DN6 G;  3ZRW A;  1KQS U;  5HFM A;  1Q81 W;  1NKD A;  2NNU A;  2PI5 A;  3LDC A;  3DTU B;  1K8A W;  2EIL B;  3CYO A;  4I9W A;  1EFR G;  2ZR3 A;  5EBM C;  3G6E V;  4WFB V;  2A79 B;  3ETE A;  4U7O A;  3K04 A;  3ZRW B;  3ZMZ A;  1H38 A;  1YTF B;  3T1C A;  1OCZ B;  4QE9 A;  3CCS V;  4GX2 A;  2JIZ G;  3AG3 B;  3IFX A;  3ZMV A;  4ZBM A;  4ASU G;  2HFE C;  1AI6 A;  1CP9 A;  4LC1 A;  4RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...