1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Envelope glycoprotein
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
2P6JA 1EBOA 1F23A 4FJCC 5CN0A 3CYOA 2EZOA 1JPXA 1I5YA 4N23A 5H9CA 1Y4MA 1DF5A 3MHSC 5CMUA 4JGSA 4JF3A 1K33A 5HFMA 3B8NA 3K9AA 1Y66A 5KA5A 5HFLA 1ENVA 4N21A 1MOFA 2OT5A 3MHHC 3GWOA 1DLBA 4FIPC 4FK5C 1QCEA 2LP7A 1QR9A 1SZTA 2MK3A 3H01A 3M99B 4E2LA 1DF4A 3P30A 5KA6A 1MG1A 3CP1A 1K34A 3WFVA 2EBOA 4JPRA 2M7WA 2X7RB 4G2KA 1QR8A 3B77A 3B8MA 1JQ0A 1QBZA 2EZPA 1I5XA
chains in the Genus database with same CATH superfamily
4GX5A 3W7UA 1HR0B 4B3SO 1JA8A 4JI5B 3CCMV 4HZ3A 4NTWA 1JOYA 4UB8Z 1PL0A 2DN9A 4O2AA 2HP8A 1NVPB 1N32B 4BR6A 3H1IH 3FX7A 2ZDIA 4DV5O 2YXLA 3E22B 4L87A 2GTAA 5LGUA 2ITDC 3ETQA 5KHGA 4JI1B 1V55B 5L3DA 5K1XA 3U11A 4O4LB 2VWJA 4GUNA 4HAMA 4AQYO 5EIBD 1HNZO 4I50B 2DWEC 4X1YA 3K5LA 3BHPA 2XTAA 2R72A 4X65B 4UCUA 4LF5O 3HKCB 4MTFA 2N05A 4EB6A 2XAQA 3CD6V 1L0LH 3IAYA 1N4CA 3LDCA 1BHBA 4U7OA 4GX2A 5IJ0B 3K3WA 5JJNB 5H2FZ 4NR1A 1DGSA 2XUMA 2B9ZA 4DR6O 3WG7C 3LNNA 4P9OA 4UVAA 2W6JG 5EK0A 4LC1A 3ASOB 5LL6Y 3SPGA 1AI6A 2BCCH 4LFBO 2UXNA 4TOIA 2YSUB 5CB4A 1JR9A 1AR1B 5LHIA 2Z0AA 3JD2A 3W7XA 4I9QA 4CBCA 4O4JA 4JF3A 5BR8O 2P90A 1AI5A 4X20A 5J9PC 1S72V 1V54C 1MOFA 2VQEB 3LDEA 3OTFA 4BIOA 1GKFA 3CS5A 3AG3C 2KB1A 3ZHQA 5KA6A 3LUTB 2EINB 2E5LO 3CX5F 1R73A 3OGCC 4J10A 2QE7G 4OX9B 1KC8W 3DC6A 1YJNV 1Q82W 2WLLA 2EZOA 4RQEA 3ZN0A 4FLYA 3QO8A 2ZE6A 3X2QB 4YJ3B 3N27A 5JJEB 1FXKB 3VOUA 1TAEA 3MHHC 3K03A 4JZ2A 2R70A 1K8AW 2F93B 1YXBA 1XQ8A 3JAKA 4DR4O 4PV1B 1OCOC 1Y74A 5B1AC 1KUQA 3SJQC 2EJRA 4JYAO 4ICGA 5IYBO 2DQ3A 2R9RB 2HHHB 3TGUH 2ZIOA 3TJTA 1BCCH 1H2LA 1ENVA 5JCOC 5KUMA 1NR1A 4TQDA 2D3OW 1QCEA 2MK3A 2QWOB 1DK1A 2EIKB 5L3GA 3L73H 4L8JA 3RT3C 5KMGB 1XDCA 1JCHA 1X4TA 2ZNJA 3HKDB 4NXMO 4D7TA 2OTJV 3ETGA 5H6RA 4HNAA 4N21A 2UXDB 3I55V 4AHCA 1QLEC 3KZIZ 4NXNO 1SQFA 4JI3O 1M56C 3WFVA 2PUSA 1H2GA 4O2AB 2DW4A 3U10A 2EZPA 4FJCC 4DR5B 1XNQB 3IFXA 5DM6V 3OE7G 3E8BA 1AJNA 2HEPA 5JH7A 1Z5WA 1HNWB 1OZ0A 1GM9A 2Q73A 4MVQA 1JJOA 2O57A 1VF5B 2R9IA 3T1CA 4DW1A 1IBKB 1H8HG 4LF4O 3K59A 2QDOA 3A2FA 4X1YB 2CGNA 1SQGA 4EFBA 4OGQB 4DW0A 3FAVA 4FZ1A 1M57B 4X64B 3F7YC 1B3QA 1IBLO 2PI4A 2AGAA 3APQA 4O4IA 4KHPB 5IWAB 4UCSA 4EB6B 3CC2V 1S0VA 4K8XA 4YXWG 3ZHRA 5LGNA 3DXRA 1SKVA 3JCZA 2CE4A 1GTOA 4MW8A 3EXAA 4DV4B 3JD4A 3O9OA 4LH6A 1JMKC 4JTCB 4DV0B 1VQLV 3B8NA 3I56V 2DWDC 5CB4B 4LBEC 2Y0IA 2PYLA 3SJCC 5J2TA 3B09A 2B1GA 4UCVA 4O4JB 4DV6B 1Q86W 4X20B 4FM0A 1Q8IA 2DYSC 4RWUA 3JASA 2Z5UA 1PNMA 1GMGA 2Q0OC 4H44B 3G6EV 2WLLB 3DC5A 4R7CA 1R1BA 1N33O 1OCZB 4JASA 1PKXA 3CCLV 1MSDA 4QGPA 4DR3B 4I9WA 3HPLC 5KHJA 4NVPA 4RO2A 1AB3A 2UU9B 3CPWU 1EN6A 3JAKB 3R65A 3MD0A 1Y74B 1IBMB 1IZ3A 2D2CB 2WPDG 5B1OA 2GDSA 2JEUA 2AZ2A 4JI0B 1O9HA 3FD9A 2YIDA 3OM3B 2YUAA 3AG2C 1BHAA 4JI8B 4GT1A 3ICXA 1I0HA 4YY3O 1NI8A 4UCOA 1Q43A 3JALA 1J5EB 1P49A 4FZ0A 5IT9N 3ZIAG 4JI4O 2JJ1G 1KQSU 4UB6Z 2W6IG 3JD0A 4WFBV 4WF9V 3ZJZA 4MVRA 4HNAB 5JWPA 1WNSA 3K58A 4PA6A 3K08A 5E1AC 4CS2A 2GTSA 2PF4E 4B3SB 2BTOA 5L3FA 3ZHUA 1BZKA 2LW1A 4RAIA 4CH4A 2V1DA 1SZTA 2JGDA 1F4MA 1N0JA 2CUGA 4U3FH 4DV5B 5JH7B 1KYOF 3ETDA 1VQPV 4I4TA 1F4NA 1E79G 1WB7A 3CB2A 4DUYO 3A8TA 2QKCA 4AQYB 4DV1O 3SYAA 4BAYA 1HNZB 5KUKA 1S5JA 3E2EA 3RVYA 3OMAB 3FAVB 2IJHA 2Q8VA 1QLNA 4LF5B 1VF7A 5B3SB 4O4IB 1HW7A 4B3MO 1CPYA 4K35A 3BPZA 1Z2GA 3OUSA 3P3NA 2B5UA 2Q69A 2HFEC 3FYIB 2ZM6O 1U96A 2E74B 2YC0A 1DF5A 2E75B 2A7WA 3DXRB 4IIJA 4DO2A 1XNRO 4JAVA 1KMIZ 2WSSG 4FLUA 2IBZH 4LF7B 4DR6B 2CDYA 4DV3O 3CP1A 3VQWA 1AP5A 4FLZA 4LFBB 3RYIA 1R6KA 4DUZO 1NJIW 2QWNB 2AHZA 5J2TB 3CHXA 4FLWA 1YCIA 3OW2U 3UQ8A 1OCRC 2RN9A 2P5OA 2K1EA 3FB8C 3JD1A 4IT5A 4U7NA 5CMUA 5BR8B 3JASB 2QJ1A 2QM7A 1SQXH 3UM7A 2ETNA 3ZHSA 3JSLA 4RUEA 2YICA 5BMVA 4DR2O 5KAFZ 2QWQB 2CAZC 2DYRC 2E5LB 2ZNIA 2LW7A 5B1BB 3T1HO 3F7VC 1AILA 3ABLB 4CS4A 4ZHQA 3TK1A 4JTAB 1M93A 4DV4O 4UUJC 3D36C 4FFBA 2QKSA 1K73W 1E1QG 4QPKA 3OR7C 1IXMA 2UUAO 1KU9A 1OCCC 4DR4B 4JYAB 2WLKA 4Z1MG 4XDJA 1MABG 3L74H 4FM1A 4JYCA 2W0FC 2ZIMA 1MNGA 1RP3B 2F66C 1WP8A 2OCHA 5LP6C 4HBNA 3JALB 2JGUA 3LDDA 3N2GA 3L70H 1GM8A 1YF2A 3D8CA 1PP9H 4JZGA 1WB8A 4R8CA 2GUZA 2CTQA 4NXMB 1FXKA 2EIJC 3QVNA 2LO1A 1XL4A 3RN4A 1T5EA 4AI8A 1XL6A 4FMTA 1O9GA 3CXCU 4Q6GA 2XAHA 1SA0A 5LMUO 4E2LA 1B06A 4NXNB 4JI3B 3CC7V 4PDMA 1AVMA 2KSDA 1FAFA 1ROPA 4DYLA 4MTXA 5JVDA 4ASUG 2UUCO 2JGDB 1PNKA 1YHQV 4LH7A 1XHZA 5GW7A 1KD1W 3FKSG 4I4TB 4PA3A 1QHTA 2XHBA 3VQXA 3CCJV 3LSUA 2QWRB 3RWRD 5KX5A 3UT5A 4JYBA 1V9PA 2ZE8A 1I5XA 3BA8A 1WPBA 2WAMA 3ZMTA 4Z2WA 4B3RO 1EZVH 2LGQA 1K7DA 4F6EA 1VARA 1IBLB 4UFZA 1RPOA 2VS0A 3CWBH 4MVZA 2WA4A 2LP7A 3CCSV 1TVKA 1IURA 4IIJB 1G6UA 2W0XA 3JAWA 1M90W 2RMKB 2C2AA 5LHHA 2ARHA 4CH3A 3RYIB 1GN6A 4PA9A 4TUYA 2EIMB 4EFEA 3AG1C 2OT5A 3IC9A 4FIPC 4K0KO 2EULA 1U97A 2X6AA 2AW9A 1XMOO 2GV9A 5LYJA 5BMVB 4XDLA 1K5QA 4YJ2A 4WFEA 4BW9A 4DR1O 4PI0A 4ZHQB 4LF7O 1S3JA 1N33B 2KQXA 1VQ8V 1A32A 3ZN1A 2UXBO 2WA3A 1Q6UA 2FKXA 4Z1VA 4FFBB 5LMNO 4J41A 3UKMA 1RM1C 5LXTA 5KAIZ 3B40A 4JTDB 1JPXA 5DEDA 1K33A 5IJ9A 1EM1A 4R6ZA 2WLHA 1VEWA 3SJBC 1ORQC 4CZZA 3ABKC 3DGEA 2QA4V 4CC5A 1JQ0A 1Z5VA 1QBZA 2Q6AA 1YI2V 4YY3B 2VRZA 3N2GB 1NTMH 1K97A 1Y66A 3DTUB 5IE9A 1K4DC 2GUZB 4JI4B 4W4KA 3SR2C 4UV8A 2XNDG 4BWAA 1J95A 3N2KA 3E86A 3BY6A 4MW3A 3WU2Z 3B77A 1SA0B 1GN2A 1XUQA 2YI9A 3F5TA 5EBMC 5GTIZ 1US6A 2PYJA 3EHBB 3JATA 3U0ZA 1CXZB 3HKEA 2P4VA 3RYFA 5J2UA 4WFHA 3VQYA 1IXBA 4MSWC 4X1KA 5AG2A 5HFLA 5JVDB 4IYIA 1Q3EA 2UUBO 5H6QA 1BE3H 2YDEA 3E8GA 2ZCEA 2ZXWB 1WLEA 1VQMV 4DUYB 3C90A 5KX5B 3UT5B 4DV1B 1N8RW 3EFFK 1CP9A 1H8EG 1OHHG 1N36O 4BIZA 4RQFA 2FL4A 4B3MB 4LWSA 4DK0A 3CCRV 4HYOA 3TXSA 3ZBHA 3OTOO 1TVKB 2F1MA 2ZM6B 2NN4A 4X66O 3BABA 1GK9A 3CE2A 3JAWB 4MTOA 1XNRB 4IHJA 1ZUQA 3ABMB 4XDKA 2FYUH 3CC4V 1KP2A 5JQGA 4QJFB 2IH1C 1HP8A 4DV3B 4TUYB 1Q90D 1QVFU 2E76B 2X7RB 4DUZB 5EYPA 2XASA 2YIBA 3MHSC 2OCCC 2YIBD 4TSFG 5LYJB 2PGGA 2FTKA 3STLC 4EKWA 5JCOA 2BTQA 1G8MA 3CCUV 4PELA 1P4RA 4DR2B 4YJ2B 1EN5A 1TUEB 2CGOA 2ZR3A 3KCXA 3T1HB 1M4UA 1UPGA 2EX3A 5A2QN 5IY5C 1I94O 4JV5B 3K0GA 1VQ5V 3OFNG 1SQBH 5LXTB 2KG7A 4IL6Z 2N74A 1DLBA 1PL4A 2FB5A 1W2BU 2ZKOA 3HR0A 2UUAB 5IJ9B 4J11A 3ASNC 1XMQO 3JCUZ 2R9AA 4C7UA 3WB2A 1HNXO 3RGBA 1YTFD 4ZKIA 2IM9A 3B4SA 2Y69C 1SQQH 3JARA 1VF6C 1VQ7V 1RPRA 2P4KA 5TISZ 4YIPA 3H01A 3BCCH 5B1NA 4WCEV 3SYOA 3ZCCA 1R3LC 2ADQB 3SPJA 3ABUA 2ZT9B 3VQVA 1S5HC 3N2KB 5LBQA 1D2DA 4PA7A 4LNUA 3PJSK 4WFGA 2WWWA 4KXRA 3RYCA 4X62O 3D3QA 4DR7O 5LMUB 1H2MA 2A0LA 3JATB 4BW5A 5C93A 3HKEB 3RYFB 1PV0A 5J2UB 2EILC 2F4VO 3AG4C 2YS8A 1RFYA 4X1KB 1YJ9V 3ETEA 3CXHF 1P7GA 2UUCB 3T4ZA 2UXCO 3WG7B 3CYOA 1FPOA 4LF9O 4H13B 1Y76A 3OR6C 4MVOA 1GN3A 3K79A 3THOA 1JJ2U 4JI2B 2V4DA 1YSCA 3JSNA 1K92A 4E4EA 1XEQA 1RSOA 3SPIA 1V54B 2HLDG 3FB5C 3AG3B 3WB1A 4B3RB 3P3PA 4LWSB 3QG5A 5IYCO 4P2ZA 4PJ0Z 2QEXV 4YHHO 4IHJB 4LP8A 3SYPA 1H2SB 5JQGB 2RNBA 4ZOLA 4IYHA 3OMNB 1YITV 5C8YA 3OEEG 4GLXA 2Z3YA 5EYPB 1XHXA 3CRCA 1OCOB 5B1AB 2OYQA 4K0KB 1PM9A 4K3AA 3APOA 3ZX6A 1M1KW 1KB9F 2ZQMA 5KHHA 1XMOB 5FL7G 2BTQB 3NR7A 4DXWA 4LFCO 3ASOC 2P22C 2IJJA 1GN4A 5IYDO 2JRIA 2HR3A 3G67A 5A9GA 1G1XB 1MZFA 4DR1B 3AK2A 1NT2B 2UXBB 4TV9A 1VP7A 4TT3G 1SC5B 2KG7B 1LR1A 1NQTA 5LMNB 1NS1A 2Q7HA 1WJZA 3A0BZ 4A5UB 4LF8O 5ITZA 3K06A 3G80A 1QLEB 4CC6A 1N34B 2Q0AA 2G38A 2EINC 1M56B 3SPHA 1YTFB 3JAMN 2AXTZ 3QNEA 2WLMA 1FJGO 3JARB 4F4LA 4X9QA 1MG1A 1K34A 3X2QC 4D6TH 4I5SA 2P67A 1FXKC 4NTXA 1WAZA 3OUFA 1F23A 1AR4A 1TUBA 4CS3A 3H1JH 3K5NA 4JV5O 5KA5A 3M7MX 3MDSA 1FD9A 2WLIA 2DQ0A 5KHIA 2OTLV 3CRQA 2CTWA 4ZI7A 3SDLA 1Q6IA 4X8AA 4LNUB 3RYCB 3K57A 2VWKA 2B1IA 4OPAA 2K9PA 4FFKA 3CRAA 2OIGA 1QVGU 4UV9A 4B08A 5H9CA 3L75H 1CEZA 1NBMG 2EIKC 2JS5A 1KECA 1HDJA 1W59A 1Q81W 1QQCA 1FFTB 1F51A 3E35A 1NH2D 2UUBB 4WBNA 1B04A 3PN1A 1XI1A 1D5NA 1AI7A 3A0RA 2HJDA 4X89A 3TXQA 2HVKC 1Y76B 1URFA 2H8PC 1NR7A 3SJAC 1WA8A 4OPHA 3P32A 1AI4A 4YIOA 2BSKA 3OD4A 1TGOA 3ZRXA 3G4SV 1RSOB 4JI7O 2DYSB 2RJZA 3ZRSA 3Q4HA 2DJVA 2Q7GA 1N36B 1PD3A 2ZDIC 4MTGA 5IDJA 1QNMA 4FLTA 4FPPA 4GYCB 5K1PA 4WFAV 3OTOB 5EIBC 1YDXA 1YIJV 4DV2O 2JK5C 1WPXA 3S3XA 4X66B 5DECA 1NTKH 2ODMA 3D36A 4PD4F 1MZEA 4ZOLB 1M57C 2YXYA 5C8YB 4TV8A 4JI2O 1XBLA 4QE7A 5BZBA 4KFMA 2F23A 4O4HA 3BA9A 4KP4A 2QKAA 1EBOA 4OXSA 4TQFA 4UVBA 2X6CA 4DRXA 2QTOA 1WN7A 3AG2B 5HFMA 1JFFA 4J7KA 4JAUA 3FB6C 3OEHG 3ZS8C 3M99B 4UCRA 5LP6A 3FFQA 2M6YA 3ZMZA 2F43G 3ZMUA 1FXHA 2JJ2G 2PY5A 3D3IA 2YEVA 1ZWIC 1K9MW 3FYEB 3L9DA 1ZL8A 4TV9B 1KKCA 1I94B 4R50A 4H37A 1VQKV 5ITZB 2NNUA 3T1YO 5KLVH 1TA8A 4NB5A 2DMXA 3IGAC 1XMQB 1SF9A 3ZRVA 3BEHA 1LUVA 5EZYA 1OJHA 1HNXB 5IYZA 3G71V 1OCZC 1ZX3A 4GKKB 1EN4A 1XOUA 2PTMA 4LFAO 2PZSA 4TWKA 1TUBB 2GHYA 2H3OA 4LF6O 1X59A 2CH7A 1DTOA 4P30A 1P84F 1VQ6V 3T2MA 2DOSA 4JI6O 2WLIB 4G2KA 1NZ6A 3B8MA 4ZI7B 3R66A 2P6JA 1BQZA 5KHKA 1LNQA 5L3BA 1N34O 4X62B 4DR7B 4KUMA 4X1IA 2V7QG 3H1KH 4W4LA 2JS3A 5GONA 2KKWA 4DK1A 2L35A 2F4VB 1DF4A 2PI5A 1NH2B 1R6TA 2BOCC 1VQ4V 1SS3A 3K0DA 1QR8A 3C3SA 4J9ZB 5GTHZ 1ZAUA 3GWKC 4WBNB 4QIWF 2UXCB 1BMFG 3CCVV 2CK3G 2VQFO 1F7YA 4KL1A 3RW0A 3STZC 5L3EA 2YI8A 4H33A 3S3WA 2LJ2A 4FM2A 1QU7A 4LF9B 1HWYA 1JVMA 1R3IC 1WA8B 3CCQV 3J81N 1OCRB 2BSKB 4MVMA 2P06A 5LA6A 2IU3A 3L71H 3Q4HB 1BS3A 4GZRB 2A06H 4X88A 2DYRB 3EVKA 4I55A 3ZMVA 3W7TA 4RUFA 2JVDA 2ATKC 4YHHB 3C3TA 1VMGA 1VQOV 1L1FA 3MAQA 2CTRA 4QE9A 1MSWD 4TV8B 2QR4A 1W0JG 4B3TO 5B3SC 4O4HB 5DN6G 2A9HA 2RCVA 1OCCB 4JAAA 5EBLC 1EFRG 4DRXB 2HG5C 1GH6A 4GX1A 1XILA 2MW2B 1Q5OA 1BGYH 2QM8A 2BOBC 1JFFB 4QNHB 3LSSA 2UXXA 2RDCA 2DE0X 2WLNA 1R6NA 3K5OA 1R3KC 4J80A 4J7JA 4LFCB 3SYQA 5LP6B 1KKDA 1OV9A 3CCEV 4N23A 5F2VO 4UVCA 2IW5A 3J7AU 2ILMA 2YEVB 3H9VA 3I5DA 2JEXA 1ZL8B 2EIJB 4I0XA 3SYCA 5H5NA 3BAAA 5FNVA 1MA1A 1G4YB 4LF8B 1JX9A 3ZRWA 4MS2A 1ZSPA 3AK1A 4F6RA 3LNMB 3CMAV 1LUWA 5B1BC 5EZYB 5D5PA 1THZA 5IYZB 4NKGB 4QPJA 1ZTEA 1FJGB 3ABLC 1BQ0A 4PDRA 2X0LA 4GKJB 3E8FA 1AR5A 2NR5A 4G28B 2CH7B 1HR0O 3OGIB 4JI5O 1GAXA 3TETA 3F5WC 2YXHA 1W0KG 4G27B 4EEQA 3ZHVA 4FLVA 1K4CC 5FPRA 2IJIA 5FLXN 3OAAG 1N32O 3RVZA 2LFRA 4X1IB 4GCZA 2M7WA 3IC7A 2HKOA 4PHZA 5GONB 1WP7A 4JI1O 1L8DA 1H2NA 2Y48A 2Q9LA 1Y4MA 1AJPA 3K5MA 2Y0PA 4GKKO 2QWPB 3IJ4A 5LHGA 3O65A 4X65O 1H2KA 4U3JA 3WB0A 1NKDA 2A79B 1IVSA 5BY1A 1FFXA 2N04A 1YEWA 3AG1B 3QO5A 1UJWB 5LA6B 2Q67A 3AEIA 3QO7A 4UXNA 3RBZA 4MVUA 3CRMA 2QM4A 4JI7B 3KKYA 4WFFA 1K5SA 1R3JC 3UCSC 4J42A 3VBBA 3ZMSA 2XOKG 4I55B 1Q6HA 2EBOA 4J7ZA 4CH6A 1Y67A 2Q68A 2X6BA 3TCUA 3L72H 3RYHA 1P7BA 4GX0A 4B7KA 2QGNA 2Q5ZA 2RQ6A 3OMIB 3E89A 4DV2B 1PPJH 2IU0A 5CA1A 2E3CA 3HKBA 1YZBA 4O2BA 5FPOA 5B66Z 2LGWA 2VQEO 3A0HZ 1RM1B 1MMMA 2OWOA 2AHYA 1S76D 2OIEA 1SETA 3E8HA 4OX9O 1GO3F 3FB7C 3ZHTA 4NYKA 3AG7A 3ABKB 2GBOA 1NTZH 1VQ9V 3CEIA 4B7EA 2HJFC 1VF6A 3SGIA 3CJHA 5EC1C 1V55C 3GWOA 1KP3A 2XAJA 5CBHA 3KCYA 4DV7B 2XAFA 5E79Z 1M9NA 2A3QA 3AK3A 2EIMC 1L0NH 4LR3A 4K8ZA 3OT7A 3DSQA 4I0XB 2HHHO 5JJJB 5FNVB 4MT8A 1VQNV 1BSMA 5CA0A 1YVWA 2ZINA 3ZRWB 4LCUC 3T1YB 1BL8A 5LOVA 3T4DA 4F6RB 1QR9A 3LSQA 1SQPH 4PDVA 4D7SA 3UO2A 2LFSA 5EBWC 2JIZG 1SZXA 2QTSA 3GVMA 4PI2A 1SERA 3BFRA 3CMEV 3JD3A 4ABMA 4LFAB 2IH3C 3ML0A 2UXDO 2Y4TA 4FK5C 4LF6B 2P7TC 3P30A 3G6BA 4JI6B 1AP6A 4BIUA 3J80N 3ABTA 3GB7C 1M5IA 4DR5O 2BE3A 1XNQO 5B5EZ 2ZR2A 3BVOA 2AZ0A 1AJQA 1NVPD 3K9AA 2YIAA 3E22A 1SRYA 1HNWO 4AILC 4PA4A 3CSXA 4O4LA 1IBKO 3K9SA 2GSMB 2WLJA 4Q20A 4XBFA 4GKJO 4I50A 4ZBMA 2JDIG 2VQFB 4X64O 4U3JB 4UCTA 4JGSA 1FFXB 4P9PA 2ADPA 4KHPO 5IWAO 3RFRA 3B2EE 3HKCA 2LQTA 3JYCA 1NU1H 1IDSA 5LGTA 1EZJA 5CBFA 2ITCC 2OCCB 5IJ0A 3W7WA 5L3CA 3M8AA 2QSAA 4JPRA 1D5AA 1PNLA 1Y6XA 3ZEDA 4J9YB 1SQVH 2CTPA 4DV0O 3RYHB 2ZXWC 1FXVA 3W7SA 1S77D 2ZE5A 1FKAO 4ZIBA 2Q7EA 2F95B 5CA1B 4DV6O 5IY5B 3HKBB 1XREA 4MVSA 4O2BB 1BT8A 1S5LZ 3NXSA 4I7ZB 4H0LB 2IJKA 1IX9A 4FVMA 4IGGA 3K04A 4B3TB 2ZE7A 2Y4UA 2NLJC 2L6LA 2H94A 2Q4PA 3ASNB 1H38A 2XAGA 1B6QA 1SESA 2HVJC 5D5QA 1YJWV 1COWG 2Y69B 3CJHB 3ABMC 4DR3O 4YJ3A 2FMLA 3SPCA 1E1RG 4NTYA 5CN0A 2UU9O 1I5YA 3HB3B 1GM7A 3KG2A 5EC2C 3E83A 1IBMO 3CRRA 4JYYA 3QTCA 4FLXA 2ZD9A 2EJ7A 4CH5A 1VIBA 3H1HH 4JI0O 5CA0B 1Q7YW 1I7FA 1KBHA 5CBGA 2XT9A 4JI8O 4PDLA 1GRJA 1K3EA 1UFIA 5CA3A 5LOVB 1N0NA 5BXZA 2EILB 1FYJA 3AG4B 3QF7A 1FS0G 3UO3A 1J5EO 3H1LH 3BRCA 1ZLZA 5KMGA 3HKDA 4LF4B 4DV7O 1I08A 1AROP
chains in the Genus database with same CATH topology
1MSWD 4GX5A 3W7UA 3OW2U 1OCRC 1S5HC 1W0JG 2K1EA 3FB8C 3JD1A 5LBQA 4U7NA 4PA7A 4HZ3A 5B3SC 5CMUA 3PJSK 4WFGA 3CCMV 2WWWA 1JOYA 2QM7A 5DN6G 2A9HA 1OCCB 5EBLC 3UM7A 1PL0A 2A0LA 1EFRG 4BW5A 1NVPB 2HG5C 5C93A 4RUEA 4GX1A 2EILC 2ZDIA 3AG4C 2QM8A 2BOBC 4QNHB 2DYRC 4L87A 1YJ9V 3LSSA 5LGUA 3ETEA 2ITDC 2UXXA 5B1BB 2WLNA 1R6NA 1V55B 1R3KC 5L3DA 3F7VC 3T4ZA 3WG7B 3CYOA 3SYQA 1KKDA 3ABLB 4HAMA 3CCEV 4N23A 3TK1A 4JTAB 4UVCA 2IW5A 4UUJC 2DWEC 2YEVB 2QKSA 2JEXA 3OR6C 4MVOA 3K79A 1JJ2U 1K73W 2EIJB 1E1QG 1YSCA 3OR7C 1IXMA 4QPKA 1K92A 3SYCA 1G4YB 1OCCC 1JX9A 3SPIA 1V54B 4MTFA 2WLKA 3ZRWA 4Z1MG 2XAQA 4MS2A 2HLDG 3FB5C 3AG3B 3CD6V 3LDCA 1BHBA 4U7OA 4XDJA 4GX2A 1MABG 3LNMB 3CMAV 3K3WA 5B1BC 4JYCA 2W0FC 1THZA 4QPJA 3WG7C 5IYCO 4P2ZA 4P9OA 3ABLC 2W6JG 4UVAA 5EK0A 3LDDA 3ASOB 4LC1A 2QEXV 4PDRA 3SPGA 4LP8A 1AI6A 2X0LA 3SYPA 1GM8A 3E8FA 2UXNA 2YSUB 4R8CA 4G28B 1AR1B 5LHIA 1FXKA 3JD2A 2EIJC 3W7XA 4QE9A 3OMNB 1YITV 1XL4A 3OEEG 4CBCA 2Z3YA 3TETA 4JF3A 1XL6A 2P90A 3F5WC 1AI5A 1W0KG 5J9PC 1S72V 4FMTA 4G27B 3CXCU 1MOFA 1OCOB 1V54C 2XAHA 3LDEA 5B1AB 1GKFA 1K4CC 2IJIA 3OAAG 3AG3C 4E2LA 2KB1A 3RVZA 3CC7V 4PDMA 2LFRA 5KA6A 3LUTB 2EINB 1M1KW 1ROPA 2ZQMA 2M7WA 1R73A 4GCZA 3IC7A 3OGCC 2HKOA 2QE7G 5FL7G 4MTXA 1KC8W 4ASUG 2Y48A 1YJNV 1PNKA 4DXWA 1YHQV 2WLLA 1Q82W 2EZOA 4RQEA 3ASOC 3ZN0A 5GW7A 1Y4MA 1AJPA 2IJJA 1KD1W 3QO8A 3X2QB 5IYDO 2HR3A 3FKSG 4PA3A 1FXKB 3VOUA 3MHHC 3K03A 5LHGA 3CCJV 1K8AW 4JYBA 4TT3G 1NKDA 2A79B 1NQTA 3AG1B 1OCOC 5B1AC 3SJQC 2EJRA 3K06A 1I5XA 3QO5A 1UJWB 5IYBO 1QLEB 2WAMA 2DQ3A 2R9RB 2Q67A 3ZMTA 3AEIA 3QO7A 4UXNA 3RBZA 4MVUA 1K7DA 2EINC 1M56B 1RPOA 4WFFA 1K5SA 1R3JC 1ENVA 5KUMA 3SPHA 1YTFB 1NR1A 3QNEA 2WLMA 4MVZA 2D3OW 1QCEA 2LP7A 2MK3A 3VBBA 3ZMSA 3CCSV 4F4LA 2XOKG 2EIKB 1MG1A 1K34A 2EBOA 3X2QC 5L3GA 4I5SA 2Q68A 2P67A 1FXKC 2X6BA 3TCUA 1M90W 1P7BA 3OUFA 1JCHA 4GX0A 1F23A 3OMIB 3E89A 2C2AA 5LHHA 2OTJV 2IU0A 3ETGA 4PA9A 5H6RA 2EIMB 5KA5A 2WLIA 3AG1C 4N21A 2DQ0A 2OT5A 2OTLV 3I55V 4FIPC 1RM1B 1QLEC 2AHYA 4X8AA 1S76D 1M56C 3WFVA 2X6AA 1SETA 2B1IA 1H2GA 3E8HA 2DW4A 1GO3F 3FB7C 2EZPA 4FJCC 4XDLA 1K5QA 3IFXA 5DM6V 1QVGU 3OE7G 3E8BA 3ABKB 4UV9A 5H9CA 1CEZA 1NBMG 2EIKC 1AJNA 1KECA 1VQ9V 2HJFC 1Q81W 4WFEA 1FFTB 1F51A 1OZ0A 3E35A 1GM9A 5EC1C 1NH2D 1V55C 3GWOA 4MVQA 1KP3A 2R9IA 2XAJA 3T1CA 1S3JA 5CBHA 1VQ8V 1H8HG 2XAFA 3ZN1A 1M9NA 1AI7A 2EIMC 3A0RA 4X89A 2HVKC 3UKMA 1RM1C 2H8PC 1NR7A 4JTDB 1M57B 1JPXA 3P32A 1AI4A 3F7YC 4MT8A 1VQNV 1K33A 2PI4A 3ZRXA 3G4SV 2DYSB 3ZRWB 4LCUC 4R6ZA 3ZRSA 3CC2V 1BL8A 2WLHA 1S0VA 1PD3A 2ZDIC 4MTGA 3T4DA 1QR9A 1ORQC 3LSQA 4CZZA 3ABKC 4PDVA 4YXWG 5IDJA 3DGEA 5LGNA 2LFSA 2QA4V 4FPPA 4WFAV 5EBWC 1JQ0A 3JCZA 2JIZG 1QBZA 2Q6AA 1YI2V 1GTOA 1YIJV 4MW8A 2JK5C 1SERA 1WPXA 3CMEV 3JD4A 3JD3A 4JTCB 1K97A 1VQLV 3B8NA 3I56V 1Y66A 2DWDC 2IH3C 3DTUB 4LBEC 3ML0A 1K4DC 3D36A 2B1GA 4FK5C 4UV8A 1M57C 2XNDG 4QE7A 2P7TC 5BZBA 3P30A 1Q86W 1J95A 4KFMA 3E86A 3BY6A 4MW3A 4BIUA 3B77A 4KP4A 2DYSC 3ABTA 3GB7C 2Z5UA 1PNMA 1EBOA 4OXSA 5EBMC 4UVBA 1GMGA 2X6CA 3EHBB 2ZR2A 2QTOA 1AJQA 1NVPD 3AG2B 4WFHA 5HFMA 3K9AA 4MSWC 1SRYA 5HFLA 3G6EV 4JAUA 3FB6C 3OEHG 2WLLB 4R7CA 4PA4A 5H6QA 3M99B 1OCZB 4JASA 3E8GA 3ZMZA 1PKXA 2F43G 2GSMB 2WLJA 4Q20A 4XBFA 2ZXWB 1FXHA 2JJ2G 4I9WA 3ZMUA 1WLEA 3CCLV 3D3IA 3HPLC 2YEVA 1VQMV 1ZWIC 4ZBMA 1K9MW 2JDIG 4RO2A 3FYEB 1N8RW 3CPWU 3EFFK 1CP9A 1H8EG 1OHHG 4H37A 4JGSA 3R65A 4P9PA 3MD0A 4R50A 1VQKV 2NNUA 2WPDG 5B1OA 3JYCA 4BIZA 2JEUA 4RQFA 3IGAC 3OM3B 5LGTA 1EZJA 3AG2C 1BHAA 5CBFA 2ITCC 2OCCB 4GT1A 3CCRV 4HYOA 3W7WA 5L3CA 3ZRVA 3BEHA 4JPRA 1PNLA 4J9YB 3G71V 1OCZC 1GK9A 4MTOA 3ABMB 4XDKA 2ZXWC 1FXVA 3W7SA 3CC4V 3ZIAG 1KP2A 1S77D 4QJFB 2IH1C 2JJ1G 4TWKA 1KQSU 2W6IG 2GHYA 3JD0A 4P30A 1DTOA 4WFBV 5IY5B 4WF9V 3ZJZA 1QVFU 1VQ6V 3T2MA 4MVSA 4MVRA 2WLIB 2X7RB 4G2KA 3NXSA 3B8MA 4PA6A 2XASA 3K08A 5E1AC 2P6JA 2IJKA 3K04A 5L3FA 1LNQA 5L3BA 3MHSC 2NLJC 2OCCC 4KUMA 2H94A 3ASNB 2V7QG 4TSFG 1H38A 2XAGA 2FTKA 1B6QA 4RAIA 3STLC 4EKWA 1G8MA 1SESA 3CCUV 2HVJC 2V1DA 1SZTA 4PELA 1F4MA 1DF4A 1P4RA 1YJWV 1COWG 2Y69B 2PI5A 1NH2B 1VQ4V 2BOCC 1TUEB 3ABMC 3K0DA 1QR8A 4J9ZB 3ETDA 2ZR3A 1VQPV 1F4NA 4QIWF 3SPCA 1BMFG 1E1RG 1E79G 5CN0A 3CCVV 2CK3G 1I5YA 3HB3B 3RW0A 3SYAA 3STZC 5IY5C 4BAYA 5L3EA 3K0GA 1VQ5V 1GM7A 3OFNG 4H33A 3KG2A 5KUKA 1HWYA 1JVMA 3E83A 5EC2C 1R3IC 3E2EA 3RVYA 3OMAB 3CCQV 1DLBA 2IJHA 1OCRB 4MVMA 2ZD9A 1W2BU 1QLNA 2IU3A 1Q7YW 5B3SB 5CBGA 3ASNC 4PDLA 1K3EA 5CA3A 1CPYA 3OUSA 2B5UA 2Q69A 2HFEC 3FYIB 1YTFD 2EILB 4ZKIA 3AG4B 1DF5A 4X88A 2Y69C 1FS0G 2DYRB 4DO2A 3ZMVA 4JAVA 3W7TA 1RPRA 4RUFA 1VQ7V 2WSSG 2ATKC 3H01A 5B1NA 4WCEV 1VQOV 1L1FA 3CP1A 3SYOA 3ZCCA 1R6KA 1NJIW 1AROP 1R3LC 2AHZA 3SPJA 3ABUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6J A;  1EBO A;  1F23 A;  4FJC C;  5CN0 A;  3CYO A;  2EZO A;  1JPX A;  1I5Y A;  4N23 A;  5H9C A;  1Y4M A;  1DF5 A;  3MHS C;  5CMU A;  4JGS A;  4JF3 A;  1K33 A;  5HFM A;  3B8N A;  3K9A A;  1Y66 A;  5KA5 A;  5HFL A;  1ENV A;  4N21 A;  1MOF A;  2OT5 A;  3MHH C;  3GWO A;  1DLB A;  4FIP C;  4FK5 C;  1QCE A;  2LP7 A;  1QR9 A;  1SZT A;  2MK3 A;  3H01 A;  3M99 B;  4E2L A;  1DF4 A;  3P30 A;  5KA6 A;  1MG1 A;  3CP1 A;  1K34 A;  3WFV A;  2EBO A;  4JPR A;  2M7W A;  2X7R B;  4G2K A;  1QR8 A;  3B77 A;  3B8M A;  1JQ0 A;  1QBZ A;  2EZP A;  1I5X A; 
#chains in the Genus database with same CATH topology
 4GX5 A;  3W7U A;  1HR0 B;  4B3S O;  1JA8 A;  4JI5 B;  3CCM V;  4HZ3 A;  4NTW A;  1JOY A;  4UB8 Z;  1PL0 A;  2DN9 A;  4O2A A;  2HP8 A;  1NVP B;  1N32 B;  4BR6 A;  3H1I H;  3FX7 A;  2ZDI A;  4DV5 O;  2YXL A;  3E22 B;  4L87 A;  2GTA A;  5LGU A;  2ITD C;  3ETQ A;  5KHG A;  4JI1 B;  1V55 B;  5L3D A;  5K1X A;  3U11 A;  4O4L B;  2VWJ A;  4GUN A;  4HAM A;  4AQY O;  5EIB D;  1HNZ O;  4I50 B;  2DWE C;  4X1Y A;  3K5L A;  3BHP A;  2XTA A;  2R72 A;  4X65 B;  4UCU A;  4LF5 O;  3HKC B;  4MTF A;  2N05 A;  4EB6 A;  2XAQ A;  3CD6 V;  1L0L H;  3IAY A;  1N4C A;  3LDC A;  1BHB A;  4U7O A;  4GX2 A;  5IJ0 B;  3K3W A;  5JJN B;  5H2F Z;  4NR1 A;  1DGS A;  2XUM A;  2B9Z A;  4DR6 O;  3WG7 C;  3LNN A;  4P9O A;  4UVA A;  2W6J G;  5EK0 A;  4LC1 A;  3ASO B;  5LL6 Y;  3SPG A;  1AI6 A;  2BCC H;  4LFB O;  2UXN A;  4TOI A;  2YSU B;  5CB4 A;  1JR9 A;  1AR1 B;  5LHI A;  2Z0A A;  3JD2 A;  3W7X A;  4I9Q A;  4CBC A;  4O4J A;  4JF3 A;  5BR8 O;  2P90 A;  1AI5 A;  4X20 A;  5J9P C;  1S72 V;  1V54 C;  1MOF A;  2VQE B;  3LDE A;  3OTF A;  4BIO A;  1GKF A;  3CS5 A;  3AG3 C;  2KB1 A;  3ZHQ A;  5KA6 A;  3LUT B;  2EIN B;  2E5L O;  3CX5 F;  1R73 A;  3OGC C;  4J10 A;  2QE7 G;  4OX9 B;  1KC8 W;  3DC6 A;  1YJN V;  1Q82 W;  2WLL A;  2EZO A;  4RQE A;  3ZN0 A;  4FLY A;  3QO8 A;  2ZE6 A;  3X2Q B;  4YJ3 B;  3N27 A;  5JJE B;  1FXK B;  3VOU A;  1TAE A;  3MHH C;  3K03 A;  4JZ2 A;  2R70 A;  1K8A W;  2F93 B;  1YXB A;  1XQ8 A;  3JAK A;  4DR4 O;  4PV1 B;  1OCO C;  1Y74 A;  5B1A C;  1KUQ A;  3SJQ C;  2EJR A;  4JYA O;  4ICG A;  5IYB O;  2DQ3 A;  2R9R B;  2HHH B;  3TGU H;  2ZIO A;  3TJT A;  1BCC H;  1H2L A;  1ENV A;  5JCO C;  5KUM A;  1NR1 A;  4TQD A;  2D3O W;  1QCE A;  2MK3 A;  2QWO B;  1DK1 A;  2EIK B;  5L3G A;  3L73 H;  4L8J A;  3RT3 C;  5KMG B;  1XDC A;  1JCH A;  1X4T A;  2ZNJ A;  3HKD B;  4NXM O;  4D7T A;  2OTJ V;  3ETG A;  5H6R A;  4HNA A;  4N21 A;  2UXD B;  3I55 V;  4AHC A;  1QLE C;  3KZI Z;  4NXN O;  1SQF A;  4JI3 O;  1M56 C;  3WFV A;  2PUS A;  1H2G A;  4O2A B;  2DW4 A;  3U10 A;  2EZP A;  4FJC C;  4DR5 B;  1XNQ B;  3IFX A;  5DM6 V;  3OE7 G;  3E8B A;  1AJN A;  2HEP A;  5JH7 A;  1Z5W A;  1HNW B;  1OZ0 A;  1GM9 A;  2Q73 A;  4MVQ A;  1JJO A;  2O57 A;  1VF5 B;  2R9I A;  3T1C A;  4DW1 A;  1IBK B;  1H8H G;  4LF4 O;  3K59 A;  2QDO A;  3A2F A;  4X1Y B;  2CGN A;  1SQG A;  4EFB A;  4OGQ B;  4DW0 A;  3FAV A;  4FZ1 A;  1M57 B;  4X64 B;  3F7Y C;  1B3Q A;  1IBL O;  2PI4 A;  2AGA A;  3APQ A;  4O4I A;  4KHP B;  5IWA B;  4UCS A;  4EB6 B;  3CC2 V;  1S0V A;  4K8X A;  4YXW G;  3ZHR A;  5LGN A;  3DXR A;  1SKV A;  3JCZ A;  2CE4 A;  1GTO A;  4MW8 A;  3EXA A;  4DV4 B;  3JD4 A;  3O9O A;  4LH6 A;  1JMK C;  4JTC B;  4DV0 B;  1VQL V;  3B8N A;  3I56 V;  2DWD C;  5CB4 B;  4LBE C;  2Y0I A;  2PYL A;  3SJC C;  5J2T A;  3B09 A;  2B1G A;  4UCV A;  4O4J B;  4DV6 B;  1Q86 W;  4X20 B;  4FM0 A;  1Q8I A;  2DYS C;  4RWU A;  3JAS A;  2Z5U A;  1PNM A;  1GMG A;  2Q0O C;  4H44 B;  3G6E V;  2WLL B;  3DC5 A;  4R7C A;  1R1B A;  1N33 O;  1OCZ B;  4JAS A;  1PKX A;  3CCL V;  1MSD A;  4QGP A;  4DR3 B;  4I9W A;  3HPL C;  5KHJ A;  4NVP A;  4RO2 A;  1AB3 A;  2UU9 B;  3CPW U;  1EN6 A;  3JAK B;  3R65 A;  3MD0 A;  1Y74 B;  1IBM B;  1IZ3 A;  2D2C B;  2WPD G;  5B1O A;  2GDS A;  2JEU A;  2AZ2 A;  4JI0 B;  1O9H A;  3FD9 A;  2YID A;  3OM3 B;  2YUA A;  3AG2 C;  1BHA A;  4JI8 B;  4GT1 A;  3ICX A;  1I0H A;  4YY3 O;  1NI8 A;  4UCO A;  1Q43 A;  3JAL A;  1J5E B;  1P49 A;  4FZ0 A;  5IT9 N;  3ZIA G;  4JI4 O;  2JJ1 G;  1KQS U;  4UB6 Z;  2W6I G;  3JD0 A;  4WFB V;  4WF9 V;  3ZJZ A;  4MVR A;  4HNA B;  5JWP A;  1WNS A;  3K58 A;  4PA6 A;  3K08 A;  5E1A C;  4CS2 A;  2GTS A;  2PF4 E;  4B3S B;  2BTO A;  5L3F A;  3ZHU A;  1BZK A;  2LW1 A;  4RAI A;  4CH4 A;  2V1D A;  1SZT A;  2JGD A;  1F4M A;  1N0J A;  2CUG A;  4U3F H;  4DV5 B;  5JH7 B;  1KYO F;  3ETD A;  1VQP V;  4I4T A;  1F4N A;  1E79 G;  1WB7 A;  3CB2 A;  4DUY O;  3A8T A;  2QKC A;  4AQY B;  4DV1 O;  3SYA A;  4BAY A;  1HNZ B;  5KUK A;  1S5J A;  3E2E A;  3RVY A;  3OMA B;  3FAV B;  2IJH A;  2Q8V A;  1QLN A;  4LF5 B;  1VF7 A;  5B3S B;  4O4I B;  1HW7 A;  4B3M O;  1CPY A;  4K35 A;  3BPZ A;  1Z2G A;  3OUS A;  3P3N A;  2B5U A;  2Q69 A;  2HFE C;  3FYI B;  2ZM6 O;  1U96 A;  2E74 B;  2YC0 A;  1DF5 A;  2E75 B;  2A7W A;  3DXR B;  4IIJ A;  4DO2 A;  1XNR O;  4JAV A;  1KMI Z;  2WSS G;  4FLU A;  2IBZ H;  4LF7 B;  4DR6 B;  2CDY A;  4DV3 O;  3CP1 A;  3VQW A;  1AP5 A;  4FLZ A;  4LFB B;  3RYI A;  1R6K A;  4DUZ O;  1NJI W;  2QWN B;  2AHZ A;  5J2T B;  3CHX A;  4FLW A;  1YCI A;  3OW2 U;  3UQ8 A;  1OCR C;  2RN9 A;  2P5O A;  2K1E A;  3FB8 C;  3JD1 A;  4IT5 A;  4U7N A;  5CMU A;  5BR8 B;  3JAS B;  2QJ1 A;  2QM7 A;  1SQX H;  3UM7 A;  2ETN A;  3ZHS A;  3JSL A;  4RUE A;  2YIC A;  5BMV A;  4DR2 O;  5KAF Z;  2QWQ B;  2CAZ C;  2DYR C;  2E5L B;  2ZNI A;  2LW7 A;  5B1B B;  3T1H O;  3F7V C;  1AIL A;  3ABL B;  4CS4 A;  4ZHQ A;  3TK1 A;  4JTA B;  1M93 A;  4DV4 O;  4UUJ C;  3D36 C;  4FFB A;  2QKS A;  1K73 W;  1E1Q G;  4QPK A;  3OR7 C;  1IXM A;  2UUA O;  1KU9 A;  1OCC C;  4DR4 B;  4JYA B;  2WLK A;  4Z1M G;  4XDJ A;  1MAB G;  3L74 H;  4FM1 A;  4JYC A;  2W0F C;  2ZIM A;  1MNG A;  1RP3 B;  2F66 C;  1WP8 A;  2OCH A;  5LP6 C;  4HBN A;  3JAL B;  2JGU A;  3LDD A;  3N2G A;  3L70 H;  1GM8 A;  1YF2 A;  3D8C A;  1PP9 H;  4JZG A;  1WB8 A;  4R8C A;  2GUZ A;  2CTQ A;  4NXM B;  1FXK A;  2EIJ C;  3QVN A;  2LO1 A;  1XL4 A;  3RN4 A;  1T5E A;  4AI8 A;  1XL6 A;  4FMT A;  1O9G A;  3CXC U;  4Q6G A;  2XAH A;  1SA0 A;  5LMU O;  4E2L A;  1B06 A;  4NXN B;  4JI3 B;  3CC7 V;  4PDM A;  1AVM A;  2KSD A;  1FAF A;  1ROP A;  4DYL A;  4MTX A;  5JVD A;  4ASU G;  2UUC O;  2JGD B;  1PNK A;  1YHQ V;  4LH7 A;  1XHZ A;  5GW7 A;  1KD1 W;  3FKS G;  4I4T B;  4PA3 A;  1QHT A;  2XHB A;  3VQX A;  3CCJ V;  3LSU A;  2QWR B;  3RWR D;  5KX5 A;  3UT5 A;  4JYB A;  1V9P A;  2ZE8 A;  1I5X A;  3BA8 A;  1WPB A;  2WAM A;  3ZMT A;  4Z2W A;  4B3R O;  1EZV H;  2LGQ A;  1K7D A;  4F6E A;  1VAR A;  1IBL B;  4UFZ A;  1RPO A;  2VS0 A;  3CWB H;  4MVZ A;  2WA4 A;  2LP7 A;  3CCS V;  1TVK A;  1IUR A;  4IIJ B;  1G6U A;  2W0X A;  3JAW A;  1M90 W;  2RMK B;  2C2A A;  5LHH A;  2ARH A;  4CH3 A;  3RYI B;  1GN6 A;  4PA9 A;  4TUY A;  2EIM B;  4EFE A;  3AG1 C;  2OT5 A;  3IC9 A;  4FIP C;  4K0K O;  2EUL A;  1U97 A;  2X6A A;  2AW9 A;  1XMO O;  2GV9 A;  5LYJ A;  5BMV B;  4XDL A;  1K5Q A;  4YJ2 A;  4WFE A;  4BW9 A;  4DR1 O;  4PI0 A;  4ZHQ B;  4LF7 O;  1S3J A;  1N33 B;  2KQX A;  1VQ8 V;  1A32 A;  3ZN1 A;  2UXB O;  2WA3 A;  1Q6U A;  2FKX A;  4Z1V A;  4FFB B;  5LMN O;  4J41 A;  3UKM A;  1RM1 C;  5LXT A;  5KAI Z;  3B40 A;  4JTD B;  1JPX A;  5DED A;  1K33 A;  5IJ9 A;  1EM1 A;  4R6Z A;  2WLH A;  1VEW A;  3SJB C;  1ORQ C;  4CZZ A;  3ABK C;  3DGE A;  2QA4 V;  4CC5 A;  1JQ0 A;  1Z5V A;  1QBZ A;  2Q6A A;  1YI2 V;  4YY3 B;  2VRZ A;  3N2G B;  1NTM H;  1K97 A;  1Y66 A;  3DTU B;  5IE9 A;  1K4D C;  2GUZ B;  4JI4 B;  4W4K A;  3SR2 C;  4UV8 A;  2XND G;  4BWA A;  1J95 A;  3N2K A;  3E86 A;  3BY6 A;  4MW3 A;  3WU2 Z;  3B77 A;  1SA0 B;  1GN2 A;  1XUQ A;  2YI9 A;  3F5T A;  5EBM C;  5GTI Z;  1US6 A;  2PYJ A;  3EHB B;  3JAT A;  3U0Z A;  1CXZ B;  3HKE A;  2P4V A;  3RYF A;  5J2U A;  4WFH A;  3VQY A;  1IXB A;  4MSW C;  4X1K A;  5AG2 A;  5HFL A;  5JVD B;  4IYI A;  1Q3E A;  2UUB O;  5H6Q A;  1BE3 H;  2YDE A;  3E8G A;  2ZCE A;  2ZXW B;  1WLE A;  1VQM V;  4DUY B;  3C90 A;  5KX5 B;  3UT5 B;  4DV1 B;  1N8R W;  3EFF K;  1CP9 A;  1H8E G;  1OHH G;  1N36 O;  4BIZ A;  4RQF A;  2FL4 A;  4B3M B;  4LWS A;  4DK0 A;  3CCR V;  4HYO A;  3TXS A;  3ZBH A;  3OTO O;  1TVK B;  2F1M A;  2ZM6 B;  2NN4 A;  4X66 O;  3BAB A;  1GK9 A;  3CE2 A;  3JAW B;  4MTO A;  1XNR B;  4IHJ A;  1ZUQ A;  3ABM B;  4XDK A;  2FYU H;  3CC4 V;  1KP2 A;  5JQG A;  4QJF B;  2IH1 C;  1HP8 A;  4DV3 B;  4TUY B;  1Q90 D;  1QVF U;  2E76 B;  2X7R B;  4DUZ B;  5EYP A;  2XAS A;  2YIB A;  3MHS C;  2OCC C;  2YIB D;  4TSF G;  5LYJ B;  2PGG A;  2FTK A;  3STL C;  4EKW A;  5JCO A;  2BTQ A;  1G8M A;  3CCU V;  4PEL A;  1P4R A;  4DR2 B;  4YJ2 B;  1EN5 A;  1TUE B;  2CGO A;  2ZR3 A;  3KCX A;  3T1H B;  1M4U A;  1UPG A;  2EX3 A;  5A2Q N;  5IY5 C;  1I94 O;  4JV5 B;  3K0G A;  1VQ5 V;  3OFN G;  1SQB H;  5LXT B;  2KG7 A;  4IL6 Z;  2N74 A;  1DLB A;  1PL4 A;  2FB5 A;  1W2B U;  2ZKO A;  3HR0 A;  2UUA B;  5IJ9 B;  4J11 A;  3ASN C;  1XMQ O;  3JCU Z;  2R9A A;  4C7U A;  3WB2 A;  1HNX O;  3RGB A;  1YTF D;  4ZKI A;  2IM9 A;  3B4S A;  2Y69 C;  1SQQ H;  3JAR A;  1VF6 C;  1VQ7 V;  1RPR A;  2P4K A;  5TIS Z;  4YIP A;  3H01 A;  3BCC H;  5B1N A;  4WCE V;  3SYO A;  3ZCC A;  1R3L C;  2ADQ B;  3SPJ A;  3ABU A;  2ZT9 B;  3VQV A;  1S5H C;  3N2K B;  5LBQ A;  1D2D A;  4PA7 A;  4LNU A;  3PJS K;  4WFG A;  2WWW A;  4KXR A;  3RYC A;  4X62 O;  3D3Q A;  4DR7 O;  5LMU B;  1H2M A;  2A0L A;  3JAT B;  4BW5 A;  5C93 A;  3HKE B;  3RYF B;  1PV0 A;  5J2U B;  2EIL C;  2F4V O;  3AG4 C;  2YS8 A;  1RFY A;  4X1K B;  1YJ9 V;  3ETE A;  3CXH F;  1P7G A;  2UUC B;  3T4Z A;  2UXC O;  3WG7 B;  3CYO A;  1FPO A;  4LF9 O;  4H13 B;  1Y76 A;  3OR6 C;  4MVO A;  1GN3 A;  3K79 A;  3THO A;  1JJ2 U;  4JI2 B;  2V4D A;  1YSC A;  3JSN A;  1K92 A;  4E4E A;  1XEQ A;  1RSO A;  3SPI A;  1V54 B;  2HLD G;  3FB5 C;  3AG3 B;  3WB1 A;  4B3R B;  3P3P A;  4LWS B;  3QG5 A;  5IYC O;  4P2Z A;  4PJ0 Z;  2QEX V;  4YHH O;  4IHJ B;  4LP8 A;  3SYP A;  1H2S B;  5JQG B;  2RNB A;  4ZOL A;  4IYH A;  3OMN B;  1YIT V;  5C8Y A;  3OEE G;  4GLX A;  2Z3Y A;  5EYP B;  1XHX A;  3CRC A;  1OCO B;  5B1A B;  2OYQ A;  4K0K B;  1PM9 A;  4K3A A;  3APO A;  3ZX6 A;  1M1K W;  1KB9 F;  2ZQM A;  5KHH A;  1XMO B;  5FL7 G;  2BTQ B;  3NR7 A;  4DXW A;  4LFC O;  3ASO C;  2P22 C;  2IJJ A;  1GN4 A;  5IYD O;  2JRI A;  2HR3 A;  3G67 A;  5A9G A;  1G1X B;  1MZF A;  4DR1 B;  3AK2 A;  1NT2 B;  2UXB B;  4TV9 A;  1VP7 A;  4TT3 G;  1SC5 B;  2KG7 B;  1LR1 A;  1NQT A;  5LMN B;  1NS1 A;  2Q7H A;  1WJZ A;  3A0B Z;  4A5U B;  4LF8 O;  5ITZ A;  3K06 A;  3G80 A;  1QLE B;  4CC6 A;  1N34 B;  2Q0A A;  2G38 A;  2EIN C;  1M56 B;  3SPH A;  1YTF B;  3JAM N;  2AXT Z;  3QNE A;  2WLM A;  1FJG O;  3JAR B;  4F4L A;  4X9Q A;  1MG1 A;  1K34 A;  3X2Q C;  4D6T H;  4I5S A;  2P67 A;  1FXK C;  4NTX A;  1WAZ A;  3OUF A;  1F23 A;  1AR4 A;  1TUB A;  4CS3 A;  3H1J H;  3K5N A;  4JV5 O;  5KA5 A;  3M7M X;  3MDS A;  1FD9 A;  2WLI A;  2DQ0 A;  5KHI A;  2OTL V;  3CRQ A;  2CTW A;  4ZI7 A;  3SDL A;  1Q6I A;  4X8A A;  4LNU B;  3RYC B;  3K57 A;  2VWK A;  2B1I A;  4OPA A;  2K9P A;  4FFK A;  3CRA A;  2OIG A;  1QVG U;  4UV9 A;  4B08 A;  5H9C A;  3L75 H;  1CEZ A;  1NBM G;  2EIK C;  2JS5 A;  1KEC A;  1HDJ A;  1W59 A;  1Q81 W;  1QQC A;  1FFT B;  1F51 A;  3E35 A;  1NH2 D;  2UUB B;  4WBN A;  1B04 A;  3PN1 A;  1XI1 A;  1D5N A;  1AI7 A;  3A0R A;  2HJD A;  4X89 A;  3TXQ A;  2HVK C;  1Y76 B;  1URF A;  2H8P C;  1NR7 A;  3SJA C;  1WA8 A;  4OPH A;  3P32 A;  1AI4 A;  4YIO A;  2BSK A;  3OD4 A;  1TGO A;  3ZRX A;  3G4S V;  1RSO B;  4JI7 O;  2DYS B;  2RJZ A;  3ZRS A;  3Q4H A;  2DJV A;  2Q7G A;  1N36 B;  1PD3 A;  2ZDI C;  4MTG A;  5IDJ A;  1QNM A;  4FLT A;  4FPP A;  4GYC B;  5K1P A;  4WFA V;  3OTO B;  5EIB C;  1YDX A;  1YIJ V;  4DV2 O;  2JK5 C;  1WPX A;  3S3X A;  4X66 B;  5DEC A;  1NTK H;  2ODM A;  3D36 A;  4PD4 F;  1MZE A;  4ZOL B;  1M57 C;  2YXY A;  5C8Y B;  4TV8 A;  4JI2 O;  1XBL A;  4QE7 A;  5BZB A;  4KFM A;  2F23 A;  4O4H A;  3BA9 A;  4KP4 A;  2QKA A;  1EBO A;  4OXS A;  4TQF A;  4UVB A;  2X6C A;  4DRX A;  2QTO A;  1WN7 A;  3AG2 B;  5HFM A;  1JFF A;  4J7K A;  4JAU A;  3FB6 C;  3OEH G;  3ZS8 C;  3M99 B;  4UCR A;  5LP6 A;  3FFQ A;  2M6Y A;  3ZMZ A;  2F43 G;  3ZMU A;  1FXH A;  2JJ2 G;  2PY5 A;  3D3I A;  2YEV A;  1ZWI C;  1K9M W;  3FYE B;  3L9D A;  1ZL8 A;  4TV9 B;  1KKC A;  1I94 B;  4R50 A;  4H37 A;  1VQK V;  5ITZ B;  2NNU A;  3T1Y O;  5KLV H;  1TA8 A;  4NB5 A;  2DMX A;  3IGA C;  1XMQ B;  1SF9 A;  3ZRV A;  3BEH A;  1LUV A;  5EZY A;  1OJH A;  1HNX B;  5IYZ A;  3G71 V;  1OCZ C;  1ZX3 A;  4GKK B;  1EN4 A;  1XOU A;  2PTM A;  4LFA O;  2PZS A;  4TWK A;  1TUB B;  2GHY A;  2H3O A;  4LF6 O;  1X59 A;  2CH7 A;  1DTO A;  4P30 A;  1P84 F;  1VQ6 V;  3T2M A;  2DOS A;  4JI6 O;  2WLI B;  4G2K A;  1NZ6 A;  3B8M A;  4ZI7 B;  3R66 A;  2P6J A;  1BQZ A;  5KHK A;  1LNQ A;  5L3B A;  1N34 O;  4X62 B;  4DR7 B;  4KUM A;  4X1I A;  2V7Q G;  3H1K H;  4W4L A;  2JS3 A;  5GON A;  2KKW A;  4DK1 A;  2L35 A;  2F4V B;  1DF4 A;  2PI5 A;  1NH2 B;  1R6T A;  2BOC C;  1VQ4 V;  1SS3 A;  3K0D A;  1QR8 A;  3C3S A;  4J9Z B;  5GTH Z;  1ZAU A;  3GWK C;  4WBN B;  4QIW F;  2UXC B;  1BMF G;  3CCV V;  2CK3 G;  2VQF O;  1F7Y A;  4KL1 A;  3RW0 A;  3STZ C;  5L3E A;  2YI8 A;  4H33 A;  3S3W A;  2LJ2 A;  4FM2 A;  1QU7 A;  4LF9 B;  1HWY A;  1JVM A;  1R3I C;  1WA8 B;  3CCQ V;  3J81 N;  1OCR B;  2BSK B;  4MVM A;  2P06 A;  5LA6 A;  2IU3 A;  3L71 H;  3Q4H B;  1BS3 A;  4GZR B;  2A06 H;  4X88 A;  2DYR B;  3EVK A;  4I55 A;  3ZMV A;  3W7T A;  4RUF A;  2JVD A;  2ATK C;  4YHH B;  3C3T A;  1VMG A;  1VQO V;  1L1F A;  3MAQ A;  2CTR A;  4QE9 A;  1MSW D;  4TV8 B;  2QR4 A;  1W0J G;  4B3T O;  5B3S C;  4O4H B;  5DN6 G;  2A9H A;  2RCV A;  1OCC B;  4JAA A;  5EBL C;  1EFR G;  4DRX B;  2HG5 C;  1GH6 A;  4GX1 A;  1XIL A;  2MW2 B;  1Q5O A;  1BGY H;  2QM8 A;  2BOB C;  1JFF B;  4QNH B;  3LSS A;  2UXX A;  2RDC A;  2DE0 X;  2WLN A;  1R6N A;  3K5O A;  1R3K C;  4J80 A;  4J7J A;  4LFC B;  3SYQ A;  5LP6 B;  1KKD A;  1OV9 A;  3CCE V;  4N23 A;  5F2V O;  4UVC A;  2IW5 A;  3J7A U;  2ILM A;  2YEV B;  3H9V A;  3I5D A;  2JEX A;  1ZL8 B;  2EIJ B;  4I0X A;  3SYC A;  5H5N A;  3BAA A;  5FNV A;  1MA1 A;  1G4Y B;  4LF8 B;  1JX9 A;  3ZRW A;  4MS2 A;  1ZSP A;  3AK1 A;  4F6R A;  3LNM B;  3CMA V;  1LUW A;  5B1B C;  5EZY B;  5D5P A;  1THZ A;  5IYZ B;  4NKG B;  4QPJ A;  1ZTE A;  1FJG B;  3ABL C;  1BQ0 A;  4PDR A;  2X0L A;  4GKJ B;  3E8F A;  1AR5 A;  2NR5 A;  4G28 B;  2CH7 B;  1HR0 O;  3OGI B;  4JI5 O;  1GAX A;  3TET A;  3F5W C;  2YXH A;  1W0K G;  4G27 B;  4EEQ A;  3ZHV A;  4FLV A;  1K4C C;  5FPR A;  2IJI A;  5FLX N;  3OAA G;  1N32 O;  3RVZ A;  2LFR A;  4X1I B;  4GCZ A;  2M7W A;  3IC7 A;  2HKO A;  4PHZ A;  5GON B;  1WP7 A;  4JI1 O;  1L8D A;  1H2N A;  2Y48 A;  2Q9L A;  1Y4M A;  1AJP A;  3K5M A;  2Y0P A;  4GKK O;  2QWP B;  3IJ4 A;  5LHG A;  3O65 A;  4X65 O;  1H2K A;  4U3J A;  3WB0 A;  1NKD A;  2A79 B;  1IVS A;  5BY1 A;  1FFX A;  2N04 A;  1YEW A;  3AG1 B;  3QO5 A;  1UJW B;  5LA6 B;  2Q67 A;  3AEI A;  3QO7 A;  4UXN A;  3RBZ A;  4MVU A;  3CRM A;  2QM4 A;  4JI7 B;  3KKY A;  4WFF A;  1K5S A;  1R3J C;  3UCS C;  4J42 A;  3VBB A;  3ZMS A;  2XOK G;  4I55 B;  1Q6H A;  2EBO A;  4J7Z A;  4CH6 A;  1Y67 A;  2Q68 A;  2X6B A;  3TCU A;  3L72 H;  3RYH A;  1P7B A;  4GX0 A;  4B7K A;  2QGN A;  2Q5Z A;  2RQ6 A;  3OMI B;  3E89 A;  4DV2 B;  1PPJ H;  2IU0 A;  5CA1 A;  2E3C A;  3HKB A;  1YZB A;  4O2B A;  5FPO A;  5B66 Z;  2LGW A;  2VQE O;  3A0H Z;  1RM1 B;  1MMM A;  2OWO A;  2AHY A;  1S76 D;  2OIE A;  1SET A;  3E8H A;  4OX9 O;  1GO3 F;  3FB7 C;  3ZHT A;  4NYK A;  3AG7 A;  3ABK B;  2GBO A;  1NTZ H;  1VQ9 V;  3CEI A;  4B7E A;  2HJF C;  1VF6 A;  3SGI A;  3CJH A;  5EC1 C;  1V55 C;  3GWO A;  1KP3 A;  2XAJ A;  5CBH A;  3KCY A;  4DV7 B;  2XAF A;  5E79 Z;  1M9N A;  2A3Q A;  3AK3 A;  2EIM C;  1L0N H;  4LR3 A;  4K8Z A;  3OT7 A;  3DSQ A;  4I0X B;  2HHH O;  5JJJ B;  5FNV B;  4MT8 A;  1VQN V;  1BSM A;  5CA0 A;  1YVW A;  2ZIN A;  3ZRW B;  4LCU C;  3T1Y B;  1BL8 A;  5LOV A;  3T4D A;  4F6R B;  1QR9 A;  3LSQ A;  1SQP H;  4PDV A;  4D7S A;  3UO2 A;  2LFS A;  5EBW C;  2JIZ G;  1SZX A;  2QTS A;  3GVM A;  4PI2 A;  1SER A;  3BFR A;  3CME V;  3JD3 A;  4ABM A;  4LFA B;  2IH3 C;  3ML0 A;  2UXD O;  2Y4T A;  4FK5 C;  4LF6 B;  2P7T C;  3P30 A;  3G6B A;  4JI6 B;  1AP6 A;  4BIU A;  3J80 N;  3ABT A;  3GB7 C;  1M5I A;  4DR5 O;  2BE3 A;  1XNQ O;  5B5E Z;  2ZR2 A;  3BVO A;  2AZ0 A;  1AJQ A;  1NVP D;  3K9A A;  2YIA A;  3E22 A;  1SRY A;  1HNW O;  4AIL C;  4PA4 A;  3CSX A;  4O4L A;  1IBK O;  3K9S A;  2GSM B;  2WLJ A;  4Q20 A;  4XBF A;  4GKJ O;  4I50 A;  4ZBM A;  2JDI G;  2VQF B;  4X64 O;  4U3J B;  4UCT A;  4JGS A;  1FFX B;  4P9P A;  2ADP A;  4KHP O;  5IWA O;  3RFR A;  3B2E E;  3HKC A;  2LQT A;  3JYC A;  1NU1 H;  1IDS A;  5LGT A;  1EZJ A;  5CBF A;  2ITC C;  2OCC B;  5IJ0 A;  3W7W A;  5L3C A;  3M8A A;  2QSA A;  4JPR A;  1D5A A;  1PNL A;  1Y6X A;  3ZED A;  4J9Y B;  1SQV H;  2CTP A;  4DV0 O;  3RYH B;  2ZXW C;  1FXV A;  3W7S A;  1S77 D;  2ZE5 A;  1FKA O;  4ZIB A;  2Q7E A;  2F95 B;  5CA1 B;  4DV6 O;  5IY5 B;  3HKB B;  1XRE A;  4MVS A;  4O2B B;  1BT8 A;  1S5L Z;  3NXS A;  4I7Z B;  4H0L B;  2IJK A;  1IX9 A;  4FVM A;  4IGG A;  3K04 A;  4B3T B;  2ZE7 A;  2Y4U A;  2NLJ C;  2L6L A;  2H94 A;  2Q4P A;  3ASN B;  1H38 A;  2XAG A;  1B6Q A;  1SES A;  2HVJ C;  5D5Q A;  1YJW V;  1COW G;  2Y69 B;  3CJH B;  3ABM C;  4DR3 O;  4YJ3 A;  2FML A;  3SPC A;  1E1R G;  4NTY A;  5CN0 A;  2UU9 O;  1I5Y A;  3HB3 B;  1GM7 A;  3KG2 A;  5EC2 C;  3E83 A;  1IBM O;  3CRR A;  4JYY A;  3QTC A;  4FLX A;  2ZD9 A;  2EJ7 A;  4CH5 A;  1VIB A;  3H1H H;  4JI0 O;  5CA0 B;  1Q7Y W;  1I7F A;  1KBH A;  5CBG A;  2XT9 A;  4JI8 O;  4PDL A;  1GRJ A;  1K3E A;  1UFI A;  5CA3 A;  5LOV B;  1N0N A;  5BXZ A;  2EIL B;  1FYJ A;  3AG4 B;  3QF7 A;  1FS0 G;  3UO3 A;  1J5E O;  3H1L H;  3BRC A;  1ZLZ A;  5KMG A;  3HKD A;  4LF4 B;  4DV7 O;  1I08 A;  1ARO P; 
#chains in the Genus database with same CATH homology
 1MSW D;  4GX5 A;  3W7U A;  3OW2 U;  1OCR C;  1S5H C;  1W0J G;  2K1E A;  3FB8 C;  3JD1 A;  5LBQ A;  4U7N A;  4PA7 A;  4HZ3 A;  5B3S C;  5CMU A;  3PJS K;  4WFG A;  3CCM V;  2WWW A;  1JOY A;  2QM7 A;  5DN6 G;  2A9H A;  1OCC B;  5EBL C;  3UM7 A;  1PL0 A;  2A0L A;  1EFR G;  4BW5 A;  1NVP B;  2HG5 C;  5C93 A;  4RUE A;  4GX1 A;  2EIL C;  2ZDI A;  3AG4 C;  2QM8 A;  2BOB C;  4QNH B;  2DYR C;  4L87 A;  1YJ9 V;  3LSS A;  5LGU A;  3ETE A;  2ITD C;  2UXX A;  5B1B B;  2WLN A;  1R6N A;  1V55 B;  1R3K C;  5L3D A;  3F7V C;  3T4Z A;  3WG7 B;  3CYO A;  3SYQ A;  1KKD A;  3ABL B;  4HAM A;  3CCE V;  4N23 A;  3TK1 A;  4JTA B;  4UVC A;  2IW5 A;  4UUJ C;  2DWE C;  2YEV B;  2QKS A;  2JEX A;  3OR6 C;  4MVO A;  3K79 A;  1JJ2 U;  1K73 W;  2EIJ B;  1E1Q G;  1YSC A;  3OR7 C;  1IXM A;  4QPK A;  1K92 A;  3SYC A;  1G4Y B;  1OCC C;  1JX9 A;  3SPI A;  1V54 B;  4MTF A;  2WLK A;  3ZRW A;  4Z1M G;  2XAQ A;  4MS2 A;  2HLD G;  3FB5 C;  3AG3 B;  3CD6 V;  3LDC A;  1BHB A;  4U7O A;  4XDJ A;  4GX2 A;  1MAB G;  3LNM B;  3CMA V;  3K3W A;  5B1B C;  4JYC A;  2W0F C;  1THZ A;  4QPJ A;  3WG7 C;  5IYC O;  4P2Z A;  4P9O A;  3ABL C;  2W6J G;  4UVA A;  5EK0 A;  3LDD A;  3ASO B;  4LC1 A;  2QEX V;  4PDR A;  3SPG A;  4LP8 A;  1AI6 A;  2X0L A;  3SYP A;  1GM8 A;  3E8F A;  2UXN A;  2YSU B;  4R8C A;  4G28 B;  1AR1 B;  5LHI A;  1FXK A;  3JD2 A;  2EIJ C;  3W7X A;  4QE9 A;  3OMN B;  1YIT V;  1XL4 A;  3OEE G;  4CBC A;  2Z3Y A;  3TET A;  4JF3 A;  1XL6 A;  2P90 A;  3F5W C;  1AI5 A;  1W0K G;  5J9P C;  1S72 V;  4FMT A;  4G27 B;  3CXC U;  1MOF A;  1OCO B;  1V54 C;  2XAH A;  3LDE A;  5B1A B;  1GKF A;  1K4C C;  2IJI A;  3OAA G;  3AG3 C;  4E2L A;  2KB1 A;  3RVZ A;  3CC7 V;  4PDM A;  2LFR A;  5KA6 A;  3LUT B;  2EIN B;  1M1K W;  1ROP A;  2ZQM A;  2M7W A;  1R73 A;  4GCZ A;  3IC7 A;  3OGC C;  2HKO A;  2QE7 G;  5FL7 G;  4MTX A;  1KC8 W;  4ASU G;  2Y48 A;  1YJN V;  1PNK A;  4DXW A;  1YHQ V;  2WLL A;  1Q82 W;  2EZO A;  4RQE A;  3ASO C;  3ZN0 A;  5GW7 A;  1Y4M A;  1AJP A;  2IJJ A;  1KD1 W;  3QO8 A;  3X2Q B;  5IYD O;  2HR3 A;  3FKS G;  4PA3 A;  1FXK B;  3VOU A;  3MHH C;  3K03 A;  5LHG A;  3CCJ V;  1K8A W;  4JYB A;  4TT3 G;  1NKD A;  2A79 B;  1NQT A;  3AG1 B;  1OCO C;  5B1A C;  3SJQ C;  2EJR A;  3K06 A;  1I5X A;  3QO5 A;  1UJW B;  5IYB O;  1QLE B;  2WAM A;  2DQ3 A;  2R9R B;  2Q67 A;  3ZMT A;  3AEI A;  3QO7 A;  4UXN A;  3RBZ A;  4MVU A;  1K7D A;  2EIN C;  1M56 B;  1RPO A;  4WFF A;  1K5S A;  1R3J C;  1ENV A;  5KUM A;  3SPH A;  1YTF B;  1NR1 A;  3QNE A;  2WLM A;  4MVZ A;  2D3O W;  1QCE A;  2LP7 A;  2MK3 A;  3VBB A;  3ZMS A;  3CCS V;  4F4L A;  2XOK G;  2EIK B;  1MG1 A;  1K34 A;  2EBO A;  3X2Q C;  5L3G A;  4I5S A;  2Q68 A;  2P67 A;  1FXK C;  2X6B A;  3TCU A;  1M90 W;  1P7B A;  3OUF A;  1JCH A;  4GX0 A;  1F23 A;  3OMI B;  3E89 A;  2C2A A;  5LHH A;  2OTJ V;  2IU0 A;  3ETG A;  4PA9 A;  5H6R A;  2EIM B;  5KA5 A;  2WLI A;  3AG1 C;  4N21 A;  2DQ0 A;  2OT5 A;  2OTL V;  3I55 V;  4FIP C;  1RM1 B;  1QLE C;  2AHY A;  4X8A A;  1S76 D;  1M56 C;  3WFV A;  2X6A A;  1SET A;  2B1I A;  1H2G A;  3E8H A;  2DW4 A;  1GO3 F;  3FB7 C;  2EZP A;  4FJC C;  4XDL A;  1K5Q A;  3IFX A;  5DM6 V;  1QVG U;  3OE7 G;  3E8B A;  3ABK B;  4UV9 A;  5H9C A;  1CEZ A;  1NBM G;  2EIK C;  1AJN A;  1KEC A;  1VQ9 V;  2HJF C;  1Q81 W;  4WFE A;  1FFT B;  1F51 A;  1OZ0 A;  3E35 A;  1GM9 A;  5EC1 C;  1NH2 D;  1V55 C;  3GWO A;  4MVQ A;  1KP3 A;  2R9I A;  2XAJ A;  3T1C A;  1S3J A;  5CBH A;  1VQ8 V;  1H8H G;  2XAF A;  3ZN1 A;  1M9N A;  1AI7 A;  2EIM C;  3A0R A;  4X89 A;  2HVK C;  3UKM A;  1RM1 C;  2H8P C;  1NR7 A;  4JTD B;  1M57 B;  1JPX A;  3P32 A;  1AI4 A;  3F7Y C;  4MT8 A;  1VQN V;  1K33 A;  2PI4 A;  3ZRX A;  3G4S V;  2DYS B;  3ZRW B;  4LCU C;  4R6Z A;  3ZRS A;  3CC2 V;  1BL8 A;  2WLH A;  1S0V A;  1PD3 A;  2ZDI C;  4MTG A;  3T4D A;  1QR9 A;  1ORQ C;  3LSQ A;  4CZZ A;  3ABK C;  4PDV A;  4YXW G;  5IDJ A;  3DGE A;  5LGN A;  2LFS A;  2QA4 V;  4FPP A;  4WFA V;  5EBW C;  1JQ0 A;  3JCZ A;  2JIZ G;  1QBZ A;  2Q6A A;  1YI2 V;  1GTO A;  1YIJ V;  4MW8 A;  2JK5 C;  1SER A;  1WPX A;  3CME V;  3JD4 A;  3JD3 A;  4JTC B;  1K97 A;  1VQL V;  3B8N A;  3I56 V;  1Y66 A;  2DWD C;  2IH3 C;  3DTU B;  4LBE C;  3ML0 A;  1K4D C;  3D36 A;  2B1G A;  4FK5 C;  4UV8 A;  1M57 C;  2XND G;  4QE7 A;  2P7T C;  5BZB A;  3P30 A;  1Q86 W;  1J95 A;  4KFM A;  3E86 A;  3BY6 A;  4MW3 A;  4BIU A;  3B77 A;  4KP4 A;  2DYS C;  3ABT A;  3GB7 C;  2Z5U A;  1PNM A;  1EBO A;  4OXS A;  5EBM C;  4UVB A;  1GMG A;  2X6C A;  3EHB B;  2ZR2 A;  2QTO A;  1AJQ A;  1NVP D;  3AG2 B;  4WFH A;  5HFM A;  3K9A A;  4MSW C;  1SRY A;  5HFL A;  3G6E V;  4JAU A;  3FB6 C;  3OEH G;  2WLL B;  4R7C A;  4PA4 A;  5H6Q A;  3M99 B;  1OCZ B;  4JAS A;  3E8G A;  3ZMZ A;  1PKX A;  2F43 G;  2GSM B;  2WLJ A;  4Q20 A;  4XBF A;  2ZXW B;  1FXH A;  2JJ2 G;  4I9W A;  3ZMU A;  1WLE A;  3CCL V;  3D3I A;  3HPL C;  2YEV A;  1VQM V;  1ZWI C;  4ZBM A;  1K9M W;  2JDI G;  4RO2 A;  3FYE B;  1N8R W;  3CPW U;  3EFF K;  1CP9 A;  1H8E G;  1OHH G;  4H37 A;  4JGS A;  3R65 A;  4P9P A;  3MD0 A;  4R50 A;  1VQK V;  2NNU A;  2WPD G;  5B1O A;  3JYC A;  4BIZ A;  2JEU A;  4RQF A;  3IGA C;  3OM3 B;  5LGT A;  1EZJ A;  3AG2 C;  1BHA A;  5CBF A;  2ITC C;  2OCC B;  4GT1 A;  3CCR V;  4HYO A;  3W7W A;  5L3C A;  3ZRV A;  3BEH A;  4JPR A;  1PNL A;  4J9Y B;  3G71 V;  1OCZ C;  1GK9 A;  4MTO A;  3ABM B;  4XDK A;  2ZXW C;  1FXV A;  3W7S A;  3CC4 V;  3ZIA G;  1KP2 A;  1S77 D;  4QJF B;  2IH1 C;  2JJ1 G;  4TWK A;  1KQS U;  2W6I G;  2GHY A;  3JD0 A;  4P30 A;  1DTO A;  4WFB V;  5IY5 B;  4WF9 V;  3ZJZ A;  1QVF U;  1VQ6 V;  3T2M A;  4MVS A;  4MVR A;  2WLI B;  2X7R B;  4G2K A;  3NXS A;  3B8M A;  4PA6 A;  2XAS A;  3K08 A;  5E1A C;  2P6J A;  2IJK A;  3K04 A;  5L3F A;  1LNQ A;  5L3B A;  3MHS C;  2NLJ C;  2OCC C;  4KUM A;  2H94 A;  3ASN B;  2V7Q G;  4TSF G;  1H38 A;  2XAG A;  2FTK A;  1B6Q A;  4RAI A;  3STL C;  4EKW A;  1G8M A;  1SES A;  3CCU V;  2HVJ C;  2V1D A;  1SZT A;  4PEL A;  1F4M A;  1DF4 A;  1P4R A;  1YJW V;  1COW G;  2Y69 B;  2PI5 A;  1NH2 B;  1VQ4 V;  2BOC C;  1TUE B;  3ABM C;  3K0D A;  1QR8 A;  4J9Z B;  3ETD A;  2ZR3 A;  1VQP V;  1F4N A;  4QIW F;  3SPC A;  1BMF G;  1E1R G;  1E79 G;  5CN0 A;  3CCV V;  2CK3 G;  1I5Y A;  3HB3 B;  3RW0 A;  3SYA A;  3STZ C;  5IY5 C;  4BAY A;  5L3E A;  3K0G A;  1VQ5 V;  1GM7 A;  3OFN G;  4H33 A;  3KG2 A;  5KUK A;  1HWY A;  1JVM A;  3E83 A;  5EC2 C;  1R3I C;  3E2E A;  3RVY A;  3OMA B;  3CCQ V;  1DLB A;  2IJH A;  1OCR B;  4MVM A;  2ZD9 A;  1W2B U;  1QLN A;  2IU3 A;  1Q7Y W;  5B3S B;  5CBG A;  3ASN C;  4PDL A;  1K3E A;  5CA3 A;  1CPY A;  3OUS A;  2B5U A;  2Q69 A;  2HFE C;  3FYI B;  1YTF D;  2EIL B;  4ZKI A;  3AG4 B;  1DF5 A;  4X88 A;  2Y69 C;  1FS0 G;  2DYR B;  4DO2 A;  3ZMV A;  4JAV A;  3W7T A;  1RPR A;  4RUF A;  1VQ7 V;  2WSS G;  2ATK C;  3H01 A;  5B1N A;  4WCE V;  1VQO V;  1L1F A;  3CP1 A;  3SYO A;  3ZCC A;  1R6K A;  1NJI W;  1ARO P;  1R3L C;  2AHZ A;  3SPJ A;  3ABU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...