1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Envelope glycoprotein
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
1MG1A 1I5YA 1QR8A 3B8NA 3MHSC 5KA5A 3M99B 2EBOA 2OT5A 2EZPA 2MK3A 1QR9A 1F23A 3GWOA 4JGSA 1DF4A 3CP1A 1Y4MA 2M7WA 4E2LA 1SZTA 1EBOA 1QCEA 2P6JA 1Y66A 3B77A 5HFMA 4JPRA 3H01A 1I5XA 1JQ0A 4N23A 1DLBA 3WFVA 4G2KA 5CN0A 5H9CA 3P30A 2X7RB 4FIPC 5KA6A 1K34A 4FK5C 3B8MA 1ENVA 5HFLA 1K33A 3K9AA 1QBZA 1JPXA 5CMUA 3MHHC 2EZOA 2LP7A 3CYOA 1MOFA 4JF3A 4FJCC 4N21A 1DF5A
chains in the Genus database with same CATH superfamily
4JI8O 5DN6G 4X1IB 1S72V 2VWJA 3CMAV 2XAHA 3JSNA 1H2LA 3K06A 3Q4HA 4G2KA 3ZMUA 4O4HA 4LF6B 3WB1A 2RCVA 1SERA 2DYRC 3ZHUA 1WP7A 3ABMC 1NTMH 2YIBD 2HKOA 3K3WA 3N2GB 4U7NA 1M56C 1HR0B 4LNUB 5IYDO 4MW3A 2AZ2A 4JYCA 3B8NA 1CPYA 1M9NA 1Y4MA 2IW5A 2Q7HA 4QJFB 2RQ6A 3P3PA 5CN0A 2ZIMA 5B1BC 3CHXA 1OCZC 1FAFA 1N36B 2YEVB 1FFTB 4UCVA 2EJ7A 2N74A 2XNDG 4X8AA 1AP6A 3AG1C 1YVWA 2BOCC 2UUAB 4MVRA 4XDLA 1WAZA 5LL6Y 4TQFA 5TISZ 1QR9A 1DTOA 4ICGA 1QU7A 4O2BA 3OTOO 4DR5O 1B04A 1ZL8B 1Y6XA 1HNZO 4B7KA 1N33B 1SESA 4PA9A 4AQYO 4TV8B 3F5TA 3PJSK 2B1GA 3K5MA 1VQ6V 4W4KA 2YIDA 1FPOA 3QO7A 3CE2A 4LF9O 2EZPA 3ZMVA 4BW5A 1GAXA 1FJGB 1JMKC 2CGOA 1TUBB 1IBKB 3VQWA 1Q86W 5JCOA 2DN9A 5B1OA 4JI6O 4KL1A 4OX9O 5LGUA 2F66C 2CTWA 3HKEA 3JASB 1R3LC 4LC1A 2JGUA 3ZEDA 4J9YB 1SQXH 1S0VA 2EINB 1S76D 4X1YA 1XMQO 1NS1A 2ILMA 4IIJA 2BTOA 1EN4A 1XL6A 3I5DA 2F4VB 4JI5B 4X64O 3QO8A 4FZ1A 1XQ8A 1XREA 2N05A 5EIBC 1I94B 4K8ZA 3M99B 4MT8A 5L3CA 1XUQA 2UXDO 3AK3A 4I55B 1F51A 3DC6A 5LP6C 3RYFB 3K08A 2E76B 3J81N 1AI4A 2RDCA 2AHYA 4U3JA 3K0DA 5KMGA 1L0NH 1NBMG 2OYQA 2LGQA 1KUQA 4TV9A 4N21A 4DR1O 3WU2Z 2EIKC 4KHPB 2EBOA 4JGSA 1F23A 1NTKH 5LHHA 1LUVA 1N0JA 3TCUA 4LFCO 2CUGA 3C3SA 3JAMN 3SYCA 4UB8Z 2XAJA 2MW2B 2DYSC 4LFAB 1HP8A 2Q69A 2GHYA 4B3MO 4O4IA 4JAUA 4H13B 1IXMA 1SQVH 2JK5C 2P22C 3K0GA 3K79A 2YI8A 2Y4UA 4JPRA 1GK9A 1HNXO 2UU9O 1NVPD 1SETA 2B9ZA 2L35A 4NYKA 4GYCB 1M57B 5KUKA 2WPDG 3RYIA 4PV1B 3ASOB 4GUNA 1P7BA 4YIPA 3RFRA 3HB3B 3CCUV 5FNVA 4UCSA 1OZ0A 2ADPA 2EIJC 5FPRA 2QEXV 3LSSA 3BY6A 1R6NA 1NH2D 2ZM6B 1S77D 3H9VA 4ASUG 3LSUA 5A9GA 4GX5A 4JAVA 3BA8A 3K5OA 4I50A 1W0KG 5JH7B 4JV5B 3EFFK 4DR3O 1AR1B 2Q67A 1KP2A 3E8HA 2R72A 4L87A 4DV3O 1EBOA 3D3IA 3G80A 4MTFA 4JTDB 4MVQA 3ZS8C 1KKCA 2GDSA 2JJ2G 3HKEB 4QIWF 3HKCB 3RVYA 1THZA 1K92A 3K04A 4EEQA 4K0KO 1GN3A 5IYZA 3MAQA 4JI1B 3IC7A 3E8FA 4YXWG 4O4LA 1FD9A 4B3TO 3KCYA 2BE3A 3JALB 2W0FC 4LH7A 4PA4A 5BY1A 5J2TB 3T1HB 2RN9A 1R3JC 2EULA 3A0BZ 4YY3B 4WCEV 3THOA 1KP3A 4UB6Z 4CZZA 5B5EZ 1IZ3A 2ZR2A 3BCCH 2PUSA 4QE7A 3JD2A 1BCCH 4JAAA 2JRIA 4MSWC 3RYHA 2FTKA 2QWRB 1QVFU 5IJ0A 3AK2A 5EC1C 4NR1A 5GTHZ 2WLLB 3ZHQA 1K5SA 3SYPA 1GM7A 3CJHB 3OT7A 2P7TC 2E74B 1ZLZA 3OAAG 3VBBA 3ML0A 2Q8VA 2BCCH 4JI3O 4TV9B 5H9CA 4X88A 4GCZA 3QTCA 4LP8A 5EZYA 4U3FH 3CRQA 2HHHO 2VQFO 1WLEA 3L73H 2Q73A 1VARA 5FLXN 1Y74A 1W0JG 4LF8B 3ZHVA 2YSUB 1H2GA 1YIJV 3E22A 5LHGA 4UUJC 1BHAA 4O4IB 1QLEB 3LNMB 1NKDA 3K9AA 4GZRB 3LDDA 2UXCO 2FL4A 1M90W 4CS2A 1V54B 1FFXA 3JYCA 3S3WA 1VQ8V 5KAFZ 2W6JG 4YHHO 2LGWA 2QWOB 4WFAV 2UUCO 1T5EA 1KBHA 3OEHG 1Y76B 1XMOB 1PV0A 2ITCC 3H1LH 1MMMA 2WA3A 4Z1MG 1JFFA 5CA0B 4L8JA 2R9IA 3H1JH 1FXVA 1N4CA 1VQ9V 1IBLB 2FKXA 2YIAA 2KSDA 1VQ4V 1G4YB 3O9OA 3QF7A 3FB6C 4DV6B 3P30A 1MA1A 5CB4B 1LNQA 4PI0A 4TUYA 4DYLA 5KLVH 4JI7O 2O57A 2KG7A 2QM4A 4MTGA 1K33A 2BTQB 1PL4A 4DR7O 1YHQV 4AHCA 2A0LA 4F4LA 3F7YC 4DV5B 5LMUO 3B4SA 2GUZB 1NT2B 4I9QA 3H01A 1Q6HA 1EZJA 3SYOA 1LUWA 3BFRA 1I7FA 4BIOA 3ETDA 4X1IA 1RP3B 1HNWO 3G6EV 1SKVA 1GRJA 3CCQV 2P67A 2X6AA 3C3TA 2ZXWB 4JI0B 5KA5A 4J7JA 4RUEA 1MNGA 1SZTA 5L3GA 4LNUA 2V7QG 2A79B 3ZHRA 5IJ0B 1K8AW 3L70H 2X7RB 5LMNB 1E1RG 1E1QG 5LGNA 3BPZA 2PYJA 1IVSA 2QM7A 4DR4B 2CGNA 2UXXA 3JCZA 3CXCU 3T1YO 4PJ0Z 5J2UA 3OUSA 5EZYB 4FLTA 2NR5A 2YEVA 3UCSC 2WA4A 3H1KH 1VQKV 3J80N 4XDJA 3JD3A 1Y74B 2EINC 3DC5A 2ZE5A 4GKJO 2ZDIA 1K73W 3FB8C 4KFMA 4MVMA 3LDEA 3D3QA 1VEWA 4WFBV 3SPCA 2QTSA 2YC0A 4FFKA 3STLC 4TV8A 3B77A 1P4RA 4KXRA 3APOA 2WLJA 3KG2A 4Z2WA 1JVMA 2ZCEA 3OTOB 4FLVA 1P84F 4DR5B 1N0NA 3M7MX 3FB7C 3FB5C 5IWAO 4AQYB 1JR9A 4MS2A 4ZI7B 4DUZB 2JEUA 1TUBA 3ZHTA 1J5EO 4IL6Z 1H2NA 3BVOA 1P7GA 1R1BA 4LF9B 3SJQC 3JASA 1KB9F 4X65O 1JJOA 5IY5B 3B8MA 2HG5C 2CTRA 4CH5A 1YXBA 4JZGA 1L8DA 3K59A 1QNMA 5KAIZ 4JASA 2H8PC 2QSAA 3HKDB 3MHSC 2DQ0A 4NXNB 4PA6A 3RBZA 1O9HA 5DECA 1Y66A 1V55B 4N23A 2K9PA 1DLBA 1Q90D 4J7ZA 2Q7GA 1KMIZ 2OWOA 3G4SV 2CK3G 1XMQB 1SF9A 2F93B 2RMKB 4LF7O 5BR8B 1BE3H 5IE9A 4IGGA 2Q6AA 1FXKA 4I55A 4WBNB 4LWSA 1IDSA 2XHBA 1N32O 4X66B 1WNSA 1K5QA 2K1EA 3CC4V 3IJ4A 2QM8A 2AW9A 2ZE7A 3WG7B 1NQTA 3OTFA 1GN4A 3OM3B 2ITDC 3KZIZ 1SS3A 3I56V 4JI2B 2OCHA 4DO2A 4FLUA 1Q7YW 1OHHG 1K7DA 5IJ9A 5EC2C 1COWG 4DR1B 3K58A 2JIZG 2QJ1A 5JCOC 4HBNA 4NXMO 2YS8A 5J2UB 4J80A 1SZXA 1YITV 4ABMA 2UUBB 2GV9A 3N27A 4Q20A 2JGDB 2ZE6A 3U11A 2L6LA 4RWUA 2WLMA 1PNKA 1I5YA 3GVMA 2DW4A 1N34O 2DMXA 1D5AA 1A32A 1NI8A 3G71V 1D5NA 2IJJA 1HNXB 4OPAA 2BOBC 1K34A 2HVJC 3L75H 3IAYA 1MZFA 2LQTA 4FLWA 3X2QC 4X1KB 1R3IC 1NJIW 2Z0AA 1D2DA 1YJWV 3QO5A 3K9SA 4IYIA 5JH7A 4DR6O 4J41A 4LFBO 5F2VO 2DQ3A 1QLNA 4NTXA 2KKWA 2OIEA 1NVPB 3DTUB 4B08A 2IU0A 5KUMA 3APQA 1XNRB 3HKCA 1Q5OA 3ABKB 1CXZB 1Z2GA 3G67A 1PNLA 4DR3B 3LUTB 5B1AB 1SQBH 4DV3B 2YUAA 2NLJC 4F6EA 1NH2B 2GTSA 1GN2A 1QLEC 2A06H 2Y69C 3FX7A 3JALA 2PI5A 5J2TA 1KQSU 1S3JA 2JJ1G 2WAMA 1PM9A 3T1CA 1JOYA 1AI5A 1AILA 1R6TA 2MK3A 4PHZA 2M7WA 4QNHB 4JTAB 1FXKB 3KCXA 4DV7O 3ZN0A 4J42A 3E83A 4LWSB 2X6BA 1Z5VA 4DW1A 1RM1B 1IBMO 4F6RB 2WLLA 4FK5C 2UXNA 3QVNA 5CBGA 3GB7C 3CJHA 3RT3C 5IYCO 4FZ0A 2VWKA 2IJHA 1DF4A 4LF6O 4OXSA 3ZJZA 3ZRWB 3JD1A 4WFHA 4MVZA 1HR0O 2Q68A 1XHZA 5IJ9B 4DV0B 2QKCA 2VQEO 4DRXA 1XOUA 2LP7A 2QKAA 2HHHB 5GW7A 3MD0A 4PDMA 2N04A 5D5QA 1URFA 1GH6A 5K1XA 3CSXA 2C2AA 2W0XA 1N36O 5CA1B 3EVKA 2IJIA 1BGYH 1MABG 1K4CC 3K03A 3VQYA 4RUFA 1AP5A 5C93A 3AG3B 2ZNJA 3JATB 1X59A 2OTLV 4NKGB 1HWYA 2IJKA 2WLIA 1M93A 5LOVB 2ZXWC 1Y76A 3B09A 3QG5A 1IURA 4EB6B 1FXHA 3HR0A 3TK1A 1YTFD 2P90A 2OTJV 4RQFA 5CA0A 3OGCC 1N33O 1V9PA 1WPXA 1U96A 1VF6C 1J95A 3DSQA 1Q6IA 3IGAC 2PGGA 5B3SB 3DGEA 2QWNB 2G38A 1H38A 3TETA 4YIOA 4IHJB 1MG1A 3ZRXA 1VMGA 1AI6A 1FJGO 3ABUA 5CB4A 1XNQB 2DJVA 4UV9A 2LW7A 2BTQA 2EIMB 1IBKO 1XILA 4UCOA 2DYRB 1M5IA 3ABMB 1VQMV 5BMVB 5KHJA 2GUZA 1ENVA 2AXTZ 2PTMA 1NTZH 4JI7B 1US6A 5EK0A 2ADQB 3RW0A 4LF5O 2RJZA 4R8CA 4B7EA 2QA4V 4B3RB 3STZC 3ABTA 1OCCB 2X6CA 2CTQA 4DV4B 4I5SA 2F4VO 4JI5O 3W7XA 3KKYA 2YI9A 4JYBA 5J9PC 5HFLA 1QBZA 2A9HA 3BAAA 1F4NA 5KHHA 1I94O 1VF5B 3RGBA 1VQLV 1MZEA 1VF6A 4X62O 3SJBC 4FLZA 3BABA 3EXAA 4KP4A 2B1IA 4LH6A 4NTYA 4IYHA 4ZKIA 3U0ZA 4EKWA 3VQVA 3SGIA 1TUEB 3BHPA 3AG4C 4G27B 4NB5A 4I7ZB 3HKBA 3ASNB 2W6IG 3AK1A 5JVDB 1AR4A 4TWKA 4PA7A 4DUYB 3FAVA 5KX5A 4KHPO 4BR6A 1AJPA 1LR1A 5CA3A 3JD0A 2M6YA 3SPIA 1Q6UA 4DRXB 3CCVV 1RPOA 2YIBA 3B2EE 2A7WA 2WWWA 4B3SO 4BIZA 3UQ8A 4DV1O 2HJDA 2X0LA 3UKMA 4LCUC 4H33A 5L3EA 3I55V 4R7CA 4GKKO 4PI2A 3JARB 5DEDA 1B6QA 3ZRVA 2UXBB 4XDKA 3UT5A 4GX0A 4LF4B 2AZ0A 1O9GA 4ZI7A 1OCOB 1MSDA 2WLIB 3E35A 1K9MW 1SQFA 1AVMA 2XTAA 3UO2A 5IWAB 4UVCA 3OEEG 1I08A 3RYCB 1SQGA 4FM2A 4ZHQA 3K57A 5LP6B 3D36A 1OJHA 4YJ2B 5KHIA 3HKDA 4JV5O 5CBFA 3SYQA 3OMAB 4H44B 4UCRA 2ZINA 2GBOA 4I9WA 1YJNV 2P4KA 2ZDIC 4DK1A 2F95B 2VS0A 1WB8A 5BZBA 5GONB 4WBNA 3VOUA 1YZBA 2BSKB 4UV8A 1ZWIC 1JA8A 5EBWC 3EHBB 1Y67A 4DR2O 4LF7B 4TT3G 3SR2C 2XASA 2YDEA 3T1HO 1L1FA 1HDJA 3CPWU 4YY3O 2WLNA 4E4EA 5GTIZ 4JI8B 2YXYA 3C90A 3CCEV 3CCLV 1VQNV 1QHTA 1RPRA 2YXHA 2QDOA 2Q7EA 1QVGU 3HKBB 4HYOA 2P4VA 3A0RA 2EIJB 4YJ3B 1WP8A 2EILB 1WPBA 1OCRB 2Y0IA 2AHZA 3FAVB 4ZOLB 5KX5B 2JGDA 3W7WA 4MVOA 4P9PA 5B1AC 5K1PA 5KA6A 4AILC 2IU3A 5EIBD 1PP9H 4LR3A 4LF8O 4PA3A 3FFQA 2PF4E 2ZIOA 4GX1A 4LBEC 3CB2A 1GTOA 2YICA 2F1MA 2HJFC 3AG7A 3FYIB 2DOSA 3K5NA 1N34B 1BT8A 4X1KA 1FXKC 2V1DA 2KB1A 1RM1C 3E8GA 1I0HA 3MHHC 2R9RB 1HNZB 1H2MA 4CH4A 1MOFA 3UT5B 4UVBA 3L72H 1BMFG 4WFEA 3ZBHA 5A2QN 2ZKOA 1X4TA 1EFRG 1WJZA 2QE7G 2JVDA 3DXRB 3SPGA 3U10A 2XT9A 4LFBB 4ZHQB 2ATKC 1HW7A 3A8TA 1XL4A 4O2AB 4JI6B 1AJNA 2NN4A 1DF5A 1EN5A 1SC5B 1IBLO 4OX9B 4W4LA 4UVAA 1VP7A 3OR7C 1TGOA 3WB2A 1K4DC 2OCCB 1ZSPA 3CEIA 2VRZA 1YDXA 1B3QA 4QGPA 4I0XB 1FS0G 4PD4F 4Q6GA 4DV5O 3AG3C 4A5UB 1BHBA 1M57C 1TVKB 4R50A 5KHGA 3CCJV 4X64B 4F6RA 3ASOC 5IT9N 1P49A 3FD9A 2UXDB 1RSOB 2D2CB 1KKDA 1XHXA 5E79Z 1JX9A 4JI0O 3CRCA 5B3SC 4XBFA 1ZAUA 3ZMZA 4QPJA 3ZRWA 5LA6A 1KYOF 5C8YA 3OGIB 5LMNO 2EIMC 3AEIA 2PI4A 4KUMA 3ETQA 4DR4O 1GM8A 4LFCB 1Q8IA 2XAQA 3JAKB 5CA1A 3UO3A 2VQEB 1SQQH 1R3KC 5JWPA 3E8BA 4PDLA 4B3MB 3CWBH 3PN1A 1B06A 2NNUA 4JI4O 5EBLC 3RN4A 3JATA 1OCCC 2HEPA 2XAGA 1W59A 2KQXA 5LYJB 3CMEV 2DE0X 2UU9B 3L71H 2QGNA 1KECA 3GWKC 5LOVA 1QQCA 4EB6A 1Z5WA 5L3BA 1H8HG 2RNBA 5LHIA 4MVSA 2Q4PA 1EM1A 5HFMA 4DV2O 4JYAO 4IHJA 2V4DA 2EJRA 3ASNC 5CMUA 5EBMC 4DUZO 1GKFA 4NTWA 4H0LB 3CCSV 1KC8W 4FMTA 1EN6A 1GMGA 5BMVA 4ZIBA 4I4TB 4P9OA 2E5LO 2OT5A 1IXBA 1GN6A 1AB3A 1AI7A 3BA9A 1YTFB 5H2FZ 4TOIA 1M1KW 3T2MA 5ITZB 2OIGA 4HNAA 3JAWA 2ZT9B 3CC7V 4MW8A 4RO2A 4K0KB 4NXNO 1K97A 4CC6A 4FFBA 4RAIA 3D8CA 3ZMSA 3ABLB 5E1AC 1XDCA 1V54C 5EYPB 4UFZA 1W2BU 4X20A 4LF5B 4B3TB 4D6TH 4G28B 4J9ZB 1K3EA 4D7SA 4K8XA 4P30A 1WB7A 5BR8O 2Q9LA 3FYEB 4FIPC 3LDCA 1OCOC 3A2FA 2PZSA 2D3OW 2FMLA 3CRRA 4X66O 2IH1C 1BQZA 3ETEA 5H5NA 5JVDA 4X62B 4OPHA 3GWOA 1XEQA 2CH7A 3H1IH 5LA6B 5LGTA 4WFGA 4JI3B 1JJ2U 4JI2O 4IT5A 3TXSA 5C8YB 3RVZA 1ORQC 3Q4HB 4O4HB 2WSSG 2VQFB 1U97A 5LXTA 4HZ3A 2HP8A 1FKAO 1Q3EA 3CCRV 3AG2B 2B5UA 4JYYA 2UUBO 2QTOA 3SJCC 3P32A 1ROPA 5D5PA 4B3SB 4DV1B 4CH3A 3JARA 5IDJA 2ARHA 1AR5A 1PPJH 4J11A 2UUAO 4GLXA 1VQ5V 4R6ZA 2UXCB 1CEZA 1NU1H 1WA8A 1Q43A 3L74H 4GKKB 1QCEA 3HPLC 1PNMA 4YHHB 5FPOA 3F5WC 2Y0PA 5IYBO 3CD6V 2UUCB 3CRAA 3S3XA 3RYCA 1YSCA 1MSWD 3TGUH 2Q0OC 5LP6A 4O2BB 4JZ2A 4YJ2A 4UXNA 4TQDA 2JDIG 2DWEC 3CS5A 3BRCA 1XI1A 2EILC 4O4JA 4P2ZA 1OCRC 4MVUA 5KHKA 4DW0A 1M56B 1XNRO 3E86A 3F7VC 4RQEA 2ZD9A 4DR7B 2H3OA 5GONA 3LNNA 2E3CA 5H6RA 4Z1VA 2BSKA 4HNAB 2P6JA 3JAWB 5B1BB 5LMUB 1I5XA 1OCZB 1GO3F 4FFBB 3TJTA 2CE4A 2F43G 1ZX3A 1S5LZ 3AG1B 1PKXA 4X20B 2Z3YA 1VIBA 1FYJA 4X1YB 1RFYA 1HNWB 4DR2B 4TSFG 4CH6A 4IIJB 2XOKG 5AG2A 3W7TA 1EZVH 2PYLA 3R65A 3CXHF 1AJQA 1YCIA 4C7UA 2JEXA 3ZRSA 4PDVA 1VQOV 1UFIA 3SDLA 3ZMTA 4YJ3A 4K3AA 1Q82W 4GT1A 4BWAA 3X2QB 2R70A 3B40A 2ZE8A 2EZOA 4D7TA 3O65A 5IY5C 4ZOLA 1WN7A 4MTOA 3NXSA 3D36C 4U3JB 3M8AA 2CH7B 5DM6V 4UCUA 5KMGB 2GTAA 3T1YB 1E79G 5JJNB 3OD4A 4DV0O 2OCCC 3ZN1A 1G8MA 1V55C 4NVPA 5LXTB 4U7OA 4LFAO 1CP9A 3ZCCA 4GKJB 2Q5ZA 3JSLA 2HLDG 4DXWA 3OUFA 4JF3A 2QWQB 2WLHA 3CRMA 1TAEA 1H2KA 3CP1A 3OMIB 3J7AU 4PDRA 1NR1A 3TXQA 2Y69B 3ETGA 1YI2V 1WA8B 3ZHSA 4DK0A 3WG7C 3T4ZA 2CDYA 5B1NA 1IX9A 3H1HH 3NR7A 4CBCA 2H94A 3DXRA 4FLYA 4MTXA 1TA8A 2ZM6O 1JCHA 1J5EB 3RYIB 3OR6C 2LJ2A 4O2AA 2QR4A 1BS3A 5FNVB 2ODMA 4AI8A 1BQ0A 4CS4A 1N8RW 3QNEA 1JPXA 4X65B 4O4JB 3P3NA 1XNQO 1GM9A 2LFSA 2EIKB 1ZTEA 2A3QA 3IC9A 5CBHA 1NZ6A 2Z5UA 4I50B 1DGSA 2P5OA 1UJWB 4I0XA 4J7KA 3N2KA 3BEHA 2IBZH 1VQ7V 2Y4TA 3ICXA 5JQGA 1AROP 1TVKA 2CAZC 3JCUZ 2DYSB 3FKSG 5L3DA 4JI1O 4UCTA 2IM9A 4B3RO 3JD4A 1RSOA 2CTPA 5H6QA 5IYZB 1BZKA 4HAMA 4DV4O 1N32B 1SA0A 3UM7A 3WFVA 4O4LB 3ZX6A 4CC5A 5LBQA 3SPHA 5JJJB 3CCMV 1SRYA 3T4DA 2YXLA 2ZNIA 5JJEB 3W7UA 3CYOA 4BIUA 4FJCC 2EX3A 1SQPH 3RYHB 3ABKC 3N2GA 3JAKA 5B66Z 2LW1A 4DUYO 3CX5F 1BSMA 1M4UA 2HR3A 4NXMB 4X9QA 2XAFA 1F7YA 3K5LA 1S5JA 1PD3A 4J10A 4FLXA 4BAYA 5LYJA 4WF9V 1YEWA 3ABLC 2P06A 1R6KA 1UPGA 2Y48A 2AGAA 1R73A 4PELA 1H2SB 4JI4B 2QKSA 3E89A 4OGQB 4FPPA 4H37A 1VQPV 3W7SA 3E22B 2ZQMA 2FYUH 2QWPB 4JTCB 4FM0A 2PY5A 1VF7A 2LO1A 3OFNG 1QR8A 2R9AA 1ZL8A 2UXBO 3L9DA 5L3FA 5BXZA 3MDSA 4GX2A 2HFEC 4E2LA 4LF4O 1Q81W 3OE7G 3CC2V 1S5HC 2JS5A 2HVKC 1FFXB 1XMOO 4DV2B 4DR6B 4I4TA 4JYAB 1XBLA 4K35A 3IFXA 4BW9A 1DK1A 3SJAC 2XUMA 1F4MA 3AG4B 1H8EG 5ITZA 2E75B 4FM1A 3SYAA 1JFFB 1NR7A 3A0HZ 1KD1W 4DV6O 2E5LB 1JQ0A 1ZUQA 3G6BA 3AG2C 2LFRA 1BL8A 4CS3A 1OV9A 2WLKA 1YJ9V 1L0LH 5EYPA 3E2EA 4X89A 3R66A 3RWRD 3OMNB 3N2KB 4QPKA 4FVMA 2Q0AA 5JQGB 4QE9A 4TUYB 3WB0A 2F23A 2GSMB 2JS3A 2KG7B 1YF2A 3LSQA 3ZIAG 1G1XB 5FL7G 3SPJA 2FB5A 2ZR3A 1G6UA 3OW2U 1PL0A 2IH3C 4DV7B 3VQXA 1IBMB 4EFEA 1KU9A 2DWDC 4ZBMA 1SA0B 4EFBA 3RYFA 4WFFA 2ETNA
chains in the Genus database with same CATH topology
2ZXWB 5DN6G 4KP4A 1S72V 2B1IA 4ZKIA 5KA5A 4EKWA 3CMAV 2XAHA 3GWOA 4RUEA 1SZTA 1TUEB 5L3GA 3AG4C 3K06A 4G2KA 2V7QG 2A79B 3ZMUA 4G27B 3ASNB 1SERA 2W6IG 2DYRC 5LGTA 1K8AW 2X7RB 1E1RG 3ABMC 4WFGA 1JJ2U 1E1QG 5LGNA 2HKOA 3K3WA 4TWKA 4PA7A 4U7NA 3RVZA 1ORQC 2QM7A 1M56C 5IYDO 4MW3A 2UXXA 1AJPA 2WSSG 3JCZA 3CXCU 5CA3A 3OUSA 3JD0A 4JYCA 3B8NA 1CPYA 4HZ3A 1M9NA 2YEVA 3SPIA 1Y4MA 2IW5A 3CCRV 3AG2B 4QJFB 3CCVV 1VQKV 1RPOA 2B5UA 4XDJA 5CN0A 3JD3A 5B1BC 2QTOA 2EINC 2WWWA 1OCZC 1ROPA 3P32A 4BIZA 2ZDIA 1K73W 2X0LA 2YEVB 3FB8C 1FFTB 4KFMA 4MVMA 3LDEA 3UKMA 4LCUC 4H33A 2XNDG 4X8AA 5IDJA 3AG1C 5L3EA 3I55V 4WFBV 1VQ5V 2BOCC 4R7CA 4R6ZA 3SPCA 1CEZA 4MVRA 4XDLA 1QR9A 1DTOA 1B6QA 1QCEA 3HPLC 3STLC 3B77A 3ZRVA 1P4RA 1PNMA 4XDKA 3F5WC 5IYBO 3CD6V 4GX0A 2WLJA 1OCOB 3KG2A 1JVMA 2WLIB 1SESA 4PA9A 1YSCA 1MSWD 3E35A 3FB7C 3FB5C 1K9MW 3PJSK 2B1GA 1VQ6V 4MS2A 3QO7A 4UXNA 4UVCA 3OEEG 2JEUA 2JDIG 2DWEC 2EZPA 3ZMVA 4BW5A 2EILC 3D36A 4P2ZA 1OCRC 4MVUA 3SJQC 5IY5B 1Q86W 3B8MA 1M56B 2HG5C 5B1OA 5CBFA 3E86A 3SYQA 3OMAB 5LGUA 3F7VC 4RQEA 4JASA 2ZD9A 2H8PC 1R3LC 4LC1A 3MHSC 2DQ0A 4I9WA 4PA6A 3RBZA 1YJNV 4J9YB 5H6RA 2ZDIC 2P6JA 1Y66A 5B1BB 1S0VA 1I5XA 1V55B 2EINB 1OCZB 1DLBA 4N23A 1S76D 1GO3F 5BZBA 3VOUA 3G4SV 2F43G 2CK3G 3AG1B 4UV8A 1PKXA 1ZWIC 1XL6A 2Z3YA 5EBWC 3EHBB 4TT3G 2Q6AA 1FXKA 2XASA 3QO8A 4TSFG 2XOKG 1L1FA 3M99B 4MT8A 3CPWU 3W7TA 1K5QA 2K1EA 2WLNA 3CC4V 3R65A 5L3CA 1AJQA 1F51A 3CCEV 3K08A 3CCLV 2QM8A 2JEXA 1AI4A 3ZRSA 2AHYA 3WG7B 1NQTA 4PDVA 3K0DA 1VQOV 3ZMTA 3OM3B 1VQNV 2ITDC 1RPRA 1Q82W 1NBMG 4GT1A 3X2QB 2EZOA 5IY5C 3I56V 1QVGU 4MTOA 4DO2A 3NXSA 4N21A 4HYOA 1Q7YW 3A0RA 5DM6V 2EIKC 2EIJB 1OHHG 1K7DA 2EILB 2EBOA 4JGSA 1F23A 5EC2C 1COWG 1E79G 1OCRB 5LHHA 2JIZG 2AHZA 3TCUA 3W7WA 2OCCC 4MVOA 3ZN1A 4P9PA 5B1AC 1G8MA 1V55C 3SYCA 1YITV 4U7OA 5KA6A 2XAJA 1CP9A 3ZCCA 2IU3A 2DYSC 2HLDG 4Q20A 2Q69A 4DXWA 2GHYA 4PA3A 3OUFA 4JF3A 2WLMA 4JAUA 1PNKA 1IXMA 4GX1A 2WLHA 1I5YA 4LBEC 2JK5C 2DW4A 3K0GA 3K79A 3CP1A 1GTOA 3OMIB 2HJFC 4JPRA 1GK9A 3FYIB 4PDRA 1NR1A 3G71V 1NVPD 2Y69B 2IJJA 3ETGA 1FXKC 1SETA 1YI2V 2BOBC 1K34A 2V1DA 2KB1A 1RM1C 3WG7C 3E8GA 2HVJC 3T4ZA 1M57B 3MHHC 2R9RB 5KUKA 5B1NA 2WPDG 4CBCA 1MOFA 2H94A 4UVBA 3X2QC 3ASOB 1BMFG 1R3IC 1NJIW 1P7BA 4WFEA 3CCUV 3HB3B 4MTXA 1YJWV 1EFRG 1OZ0A 3QO5A 1JCHA 2EIJC 2QEXV 3LSSA 3BY6A 1R6NA 3OR6C 1NH2D 2QE7G 3SPGA 2DQ3A 1S77D 1QLNA 4ASUG 4GX5A 1NVPB 2ATKC 4JAVA 3DTUB 1N8RW 3QNEA 1JPXA 1W0KG 1XL4A 1GM9A 3EFFK 5KUMA 2LFSA 2EIKB 2IU0A 1AJNA 1DF5A 3ABKB 1AR1B 2Q67A 1KP2A 4UVAA 1PNLA 3E8HA 5CBHA 3OR7C 2Z5UA 4L87A 1UJWB 1EBOA 1K4DC 2OCCB 3D3IA 4MTFA 3BEHA 3LUTB 4JTDB 4MVQA 5B1AB 1VQ7V 4QIWF 2JJ2G 3RVYA 2NLJC 1THZA 1AROP 1NH2B 1K92A 3K04A 2DYSB 3FKSG 5L3DA 1QLEC 2Y69C 2PI5A 1FS0G 3AG3C 1KQSU 3IC7A 1S3JA 3E8FA 4YXWG 2JJ1G 1BHBA 1M57C 2WAMA 4R50A 3T1CA 3CCJV 3JD4A 1JOYA 1AI5A 2MK3A 3ASOC 2W0FC 4PA4A 5H6QA 2M7WA 4HAMA 4QNHB 3UM7A 1R3JC 3WFVA 4JTAB 1FXKB 3ZN0A 5LBQA 3E83A 4WCEV 1KP3A 2X6BA 4CZZA 1RM1B 3SPHA 3CCMV 1SRYA 2ZR2A 3T4DA 2WLLA 4FK5C 2UXNA 5CBGA 1KKDA 4QE7A 3GB7C 3JD2A 1JX9A 4MSWC 3W7UA 5IYCO 3CYOA 5B3SC 2FTKA 4XBFA 3ZMZA 4BIUA 1QVFU 4FJCC 4QPJA 5EC1C 3ZRWA 2WLLB 2IJHA 1K5SA 3SYPA 1GM7A 1DF4A 2P7TC 3ABKC 3OAAG 3VBBA 4OXSA 3ML0A 5H9CA 2EIMC 3AEIA 3ZJZA 4X88A 3ZRWB 4GCZA 3JD1A 4WFHA 2PI4A 4MVZA 4LP8A 4KUMA 2Q68A 2HR3A 1GM8A 1WLEA 2XAFA 2LP7A 2XAQA 5GW7A 1PD3A 3MD0A 4PDMA 1W0JG 1R3KC 4BAYA 3E8BA 2YSUB 4PDLA 1H2GA 4WF9V 1YIJV 2C2AA 3ABLC 2NNUA 1R6KA 5EBLC 2Y48A 5LHGA 4UUJC 1R73A 4PELA 1BHAA 2IJIA 1OCCC 2QKSA 2XAGA 3E89A 1MABG 1K4CC 3K03A 1QLEB 3LNMB 4RUFA 3CMEV 4FPPA 4H37A 1VQPV 5C93A 1KECA 1NKDA 3AG3B 3W7SA 3K9AA 2ZQMA 3LDDA 2OTLV 5L3BA 1M90W 4JTCB 1H8HG 1V54B 3JYCA 1VQ8V 5LHIA 4MVSA 3OFNG 1QR8A 1HWYA 2W6JG 2IJKA 2WLIA 2ZXWC 5L3FA 4GX2A 4E2LA 2HFEC 4WFAV 1FXHA 5HFMA 3TK1A 1Q81W 2P90A 3OE7G 1YTFD 3CC2V 4RQFA 1S5HC 2OTJV 3OGCC 2HVKC 1WPXA 1J95A 3IGAC 3OEHG 2EJRA 3ASNC 2ITCC 5B3SB 3DGEA 5CMUA 5EBMC 4Z1MG 1GKFA 1H38A 3TETA 3IFXA 3CCSV 2R9IA 4FMTA 1GMGA 1KC8W 1MG1A 3ZRXA 1AI6A 1FXVA 4P9OA 1F4MA 3ABUA 3AG4B 1VQ9V 1H8EG 2OT5A 4UV9A 3SYAA 1NR7A 1KD1W 2EIMB 1JQ0A 1AI7A 2DYRB 1VQ4V 1G4YB 3AG2C 3ABMB 3FB6C 2LFRA 1BL8A 1VQMV 1YTFB 3P30A 2WLKA 1YJ9V 1LNQA 1M1KW 3T2MA 1ENVA 4MTGA 3E2EA 1K33A 4X89A 1YHQV 5EK0A 4MW8A 3OMNB 4RO2A 3CC7V 4QPKA 1K97A 2A0LA 4F4LA 4RAIA 3RW0A 4QE9A 3ZMSA 3ABLB 3F7YC 4R8CA 5E1AC 2GSMB 2QA4V 1V54C 3LSQA 1W2BU 3ZIAG 3STZC 3ABTA 1OCCB 3H01A 2X6CA 5FL7G 3SPJA 4G28B 1EZJA 4J9ZB 1K3EA 3SYOA 4P30A 2ZR3A 3OW2U 4I5SA 3ETDA 3W7XA 3FYEB 1PL0A 4FIPC 3LDCA 3G6EV 2IH3C 4JYBA 1OCOC 5J9PC 5HFLA 1QBZA 2DWDC 2A9HA 2D3OW 1F4NA 4ZBMA 1VQLV 2IH1C 3CCQV 2P67A 4WFFA 2X6AA 3ETEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  1I5Y A;  1QR8 A;  3B8N A;  3MHS C;  5KA5 A;  3M99 B;  2EBO A;  2OT5 A;  2EZP A;  2MK3 A;  1QR9 A;  1F23 A;  3GWO A;  4JGS A;  1DF4 A;  3CP1 A;  1Y4M A;  2M7W A;  4E2L A;  1SZT A;  1EBO A;  1QCE A;  2P6J A;  1Y66 A;  3B77 A;  5HFM A;  4JPR A;  3H01 A;  1I5X A;  1JQ0 A;  4N23 A;  1DLB A;  3WFV A;  4G2K A;  5CN0 A;  5H9C A;  3P30 A;  2X7R B;  4FIP C;  5KA6 A;  1K34 A;  4FK5 C;  3B8M A;  1ENV A;  5HFL A;  1K33 A;  3K9A A;  1QBZ A;  1JPX A;  5CMU A;  3MHH C;  2EZO A;  2LP7 A;  3CYO A;  1MOF A;  4JF3 A;  4FJC C;  4N21 A;  1DF5 A; 
#chains in the Genus database with same CATH topology
 4JI8 O;  5DN6 G;  4X1I B;  1S72 V;  2VWJ A;  3CMA V;  2XAH A;  3JSN A;  1H2L A;  3K06 A;  3Q4H A;  4G2K A;  3ZMU A;  4O4H A;  4LF6 B;  3WB1 A;  2RCV A;  1SER A;  2DYR C;  3ZHU A;  1WP7 A;  3ABM C;  1NTM H;  2YIB D;  2HKO A;  3K3W A;  3N2G B;  4U7N A;  1M56 C;  1HR0 B;  4LNU B;  5IYD O;  4MW3 A;  2AZ2 A;  4JYC A;  3B8N A;  1CPY A;  1M9N A;  1Y4M A;  2IW5 A;  2Q7H A;  4QJF B;  2RQ6 A;  3P3P A;  5CN0 A;  2ZIM A;  5B1B C;  3CHX A;  1OCZ C;  1FAF A;  1N36 B;  2YEV B;  1FFT B;  4UCV A;  2EJ7 A;  2N74 A;  2XND G;  4X8A A;  1AP6 A;  3AG1 C;  1YVW A;  2BOC C;  2UUA B;  4MVR A;  4XDL A;  1WAZ A;  5LL6 Y;  4TQF A;  5TIS Z;  1QR9 A;  1DTO A;  4ICG A;  1QU7 A;  4O2B A;  3OTO O;  4DR5 O;  1B04 A;  1ZL8 B;  1Y6X A;  1HNZ O;  4B7K A;  1N33 B;  1SES A;  4PA9 A;  4AQY O;  4TV8 B;  3F5T A;  3PJS K;  2B1G A;  3K5M A;  1VQ6 V;  4W4K A;  2YID A;  1FPO A;  3QO7 A;  3CE2 A;  4LF9 O;  2EZP A;  3ZMV A;  4BW5 A;  1GAX A;  1FJG B;  1JMK C;  2CGO A;  1TUB B;  1IBK B;  3VQW A;  1Q86 W;  5JCO A;  2DN9 A;  5B1O A;  4JI6 O;  4KL1 A;  4OX9 O;  5LGU A;  2F66 C;  2CTW A;  3HKE A;  3JAS B;  1R3L C;  4LC1 A;  2JGU A;  3ZED A;  4J9Y B;  1SQX H;  1S0V A;  2EIN B;  1S76 D;  4X1Y A;  1XMQ O;  1NS1 A;  2ILM A;  4IIJ A;  2BTO A;  1EN4 A;  1XL6 A;  3I5D A;  2F4V B;  4JI5 B;  4X64 O;  3QO8 A;  4FZ1 A;  1XQ8 A;  1XRE A;  2N05 A;  5EIB C;  1I94 B;  4K8Z A;  3M99 B;  4MT8 A;  5L3C A;  1XUQ A;  2UXD O;  3AK3 A;  4I55 B;  1F51 A;  3DC6 A;  5LP6 C;  3RYF B;  3K08 A;  2E76 B;  3J81 N;  1AI4 A;  2RDC A;  2AHY A;  4U3J A;  3K0D A;  5KMG A;  1L0N H;  1NBM G;  2OYQ A;  2LGQ A;  1KUQ A;  4TV9 A;  4N21 A;  4DR1 O;  3WU2 Z;  2EIK C;  4KHP B;  2EBO A;  4JGS A;  1F23 A;  1NTK H;  5LHH A;  1LUV A;  1N0J A;  3TCU A;  4LFC O;  2CUG A;  3C3S A;  3JAM N;  3SYC A;  4UB8 Z;  2XAJ A;  2MW2 B;  2DYS C;  4LFA B;  1HP8 A;  2Q69 A;  2GHY A;  4B3M O;  4O4I A;  4JAU A;  4H13 B;  1IXM A;  1SQV H;  2JK5 C;  2P22 C;  3K0G A;  3K79 A;  2YI8 A;  2Y4U A;  4JPR A;  1GK9 A;  1HNX O;  2UU9 O;  1NVP D;  1SET A;  2B9Z A;  2L35 A;  4NYK A;  4GYC B;  1M57 B;  5KUK A;  2WPD G;  3RYI A;  4PV1 B;  3ASO B;  4GUN A;  1P7B A;  4YIP A;  3RFR A;  3HB3 B;  3CCU V;  5FNV A;  4UCS A;  1OZ0 A;  2ADP A;  2EIJ C;  5FPR A;  2QEX V;  3LSS A;  3BY6 A;  1R6N A;  1NH2 D;  2ZM6 B;  1S77 D;  3H9V A;  4ASU G;  3LSU A;  5A9G A;  4GX5 A;  4JAV A;  3BA8 A;  3K5O A;  4I50 A;  1W0K G;  5JH7 B;  4JV5 B;  3EFF K;  4DR3 O;  1AR1 B;  2Q67 A;  1KP2 A;  3E8H A;  2R72 A;  4L87 A;  4DV3 O;  1EBO A;  3D3I A;  3G80 A;  4MTF A;  4JTD B;  4MVQ A;  3ZS8 C;  1KKC A;  2GDS A;  2JJ2 G;  3HKE B;  4QIW F;  3HKC B;  3RVY A;  1THZ A;  1K92 A;  3K04 A;  4EEQ A;  4K0K O;  1GN3 A;  5IYZ A;  3MAQ A;  4JI1 B;  3IC7 A;  3E8F A;  4YXW G;  4O4L A;  1FD9 A;  4B3T O;  3KCY A;  2BE3 A;  3JAL B;  2W0F C;  4LH7 A;  4PA4 A;  5BY1 A;  5J2T B;  3T1H B;  2RN9 A;  1R3J C;  2EUL A;  3A0B Z;  4YY3 B;  4WCE V;  3THO A;  1KP3 A;  4UB6 Z;  4CZZ A;  5B5E Z;  1IZ3 A;  2ZR2 A;  3BCC H;  2PUS A;  4QE7 A;  3JD2 A;  1BCC H;  4JAA A;  2JRI A;  4MSW C;  3RYH A;  2FTK A;  2QWR B;  1QVF U;  5IJ0 A;  3AK2 A;  5EC1 C;  4NR1 A;  5GTH Z;  2WLL B;  3ZHQ A;  1K5S A;  3SYP A;  1GM7 A;  3CJH B;  3OT7 A;  2P7T C;  2E74 B;  1ZLZ A;  3OAA G;  3VBB A;  3ML0 A;  2Q8V A;  2BCC H;  4JI3 O;  4TV9 B;  5H9C A;  4X88 A;  4GCZ A;  3QTC A;  4LP8 A;  5EZY A;  4U3F H;  3CRQ A;  2HHH O;  2VQF O;  1WLE A;  3L73 H;  2Q73 A;  1VAR A;  5FLX N;  1Y74 A;  1W0J G;  4LF8 B;  3ZHV A;  2YSU B;  1H2G A;  1YIJ V;  3E22 A;  5LHG A;  4UUJ C;  1BHA A;  4O4I B;  1QLE B;  3LNM B;  1NKD A;  3K9A A;  4GZR B;  3LDD A;  2UXC O;  2FL4 A;  1M90 W;  4CS2 A;  1V54 B;  1FFX A;  3JYC A;  3S3W A;  1VQ8 V;  5KAF Z;  2W6J G;  4YHH O;  2LGW A;  2QWO B;  4WFA V;  2UUC O;  1T5E A;  1KBH A;  3OEH G;  1Y76 B;  1XMO B;  1PV0 A;  2ITC C;  3H1L H;  1MMM A;  2WA3 A;  4Z1M G;  1JFF A;  5CA0 B;  4L8J A;  2R9I A;  3H1J H;  1FXV A;  1N4C A;  1VQ9 V;  1IBL B;  2FKX A;  2YIA A;  2KSD A;  1VQ4 V;  1G4Y B;  3O9O A;  3QF7 A;  3FB6 C;  4DV6 B;  3P30 A;  1MA1 A;  5CB4 B;  1LNQ A;  4PI0 A;  4TUY A;  4DYL A;  5KLV H;  4JI7 O;  2O57 A;  2KG7 A;  2QM4 A;  4MTG A;  1K33 A;  2BTQ B;  1PL4 A;  4DR7 O;  1YHQ V;  4AHC A;  2A0L A;  4F4L A;  3F7Y C;  4DV5 B;  5LMU O;  3B4S A;  2GUZ B;  1NT2 B;  4I9Q A;  3H01 A;  1Q6H A;  1EZJ A;  3SYO A;  1LUW A;  3BFR A;  1I7F A;  4BIO A;  3ETD A;  4X1I A;  1RP3 B;  1HNW O;  3G6E V;  1SKV A;  1GRJ A;  3CCQ V;  2P67 A;  2X6A A;  3C3T A;  2ZXW B;  4JI0 B;  5KA5 A;  4J7J A;  4RUE A;  1MNG A;  1SZT A;  5L3G A;  4LNU A;  2V7Q G;  2A79 B;  3ZHR A;  5IJ0 B;  1K8A W;  3L70 H;  2X7R B;  5LMN B;  1E1R G;  1E1Q G;  5LGN A;  3BPZ A;  2PYJ A;  1IVS A;  2QM7 A;  4DR4 B;  2CGN A;  2UXX A;  3JCZ A;  3CXC U;  3T1Y O;  4PJ0 Z;  5J2U A;  3OUS A;  5EZY B;  4FLT A;  2NR5 A;  2YEV A;  3UCS C;  2WA4 A;  3H1K H;  1VQK V;  3J80 N;  4XDJ A;  3JD3 A;  1Y74 B;  2EIN C;  3DC5 A;  2ZE5 A;  4GKJ O;  2ZDI A;  1K73 W;  3FB8 C;  4KFM A;  4MVM A;  3LDE A;  3D3Q A;  1VEW A;  4WFB V;  3SPC A;  2QTS A;  2YC0 A;  4FFK A;  3STL C;  4TV8 A;  3B77 A;  1P4R A;  4KXR A;  3APO A;  2WLJ A;  3KG2 A;  4Z2W A;  1JVM A;  2ZCE A;  3OTO B;  4FLV A;  1P84 F;  4DR5 B;  1N0N A;  3M7M X;  3FB7 C;  3FB5 C;  5IWA O;  4AQY B;  1JR9 A;  4MS2 A;  4ZI7 B;  4DUZ B;  2JEU A;  1TUB A;  3ZHT A;  1J5E O;  4IL6 Z;  1H2N A;  3BVO A;  1P7G A;  1R1B A;  4LF9 B;  3SJQ C;  3JAS A;  1KB9 F;  4X65 O;  1JJO A;  5IY5 B;  3B8M A;  2HG5 C;  2CTR A;  4CH5 A;  1YXB A;  4JZG A;  1L8D A;  3K59 A;  1QNM A;  5KAI Z;  4JAS A;  2H8P C;  2QSA A;  3HKD B;  3MHS C;  2DQ0 A;  4NXN B;  4PA6 A;  3RBZ A;  1O9H A;  5DEC A;  1Y66 A;  1V55 B;  4N23 A;  2K9P A;  1DLB A;  1Q90 D;  4J7Z A;  2Q7G A;  1KMI Z;  2OWO A;  3G4S V;  2CK3 G;  1XMQ B;  1SF9 A;  2F93 B;  2RMK B;  4LF7 O;  5BR8 B;  1BE3 H;  5IE9 A;  4IGG A;  2Q6A A;  1FXK A;  4I55 A;  4WBN B;  4LWS A;  1IDS A;  2XHB A;  1N32 O;  4X66 B;  1WNS A;  1K5Q A;  2K1E A;  3CC4 V;  3IJ4 A;  2QM8 A;  2AW9 A;  2ZE7 A;  3WG7 B;  1NQT A;  3OTF A;  1GN4 A;  3OM3 B;  2ITD C;  3KZI Z;  1SS3 A;  3I56 V;  4JI2 B;  2OCH A;  4DO2 A;  4FLU A;  1Q7Y W;  1OHH G;  1K7D A;  5IJ9 A;  5EC2 C;  1COW G;  4DR1 B;  3K58 A;  2JIZ G;  2QJ1 A;  5JCO C;  4HBN A;  4NXM O;  2YS8 A;  5J2U B;  4J80 A;  1SZX A;  1YIT V;  4ABM A;  2UUB B;  2GV9 A;  3N27 A;  4Q20 A;  2JGD B;  2ZE6 A;  3U11 A;  2L6L A;  4RWU A;  2WLM A;  1PNK A;  1I5Y A;  3GVM A;  2DW4 A;  1N34 O;  2DMX A;  1D5A A;  1A32 A;  1NI8 A;  3G71 V;  1D5N A;  2IJJ A;  1HNX B;  4OPA A;  2BOB C;  1K34 A;  2HVJ C;  3L75 H;  3IAY A;  1MZF A;  2LQT A;  4FLW A;  3X2Q C;  4X1K B;  1R3I C;  1NJI W;  2Z0A A;  1D2D A;  1YJW V;  3QO5 A;  3K9S A;  4IYI A;  5JH7 A;  4DR6 O;  4J41 A;  4LFB O;  5F2V O;  2DQ3 A;  1QLN A;  4NTX A;  2KKW A;  2OIE A;  1NVP B;  3DTU B;  4B08 A;  2IU0 A;  5KUM A;  3APQ A;  1XNR B;  3HKC A;  1Q5O A;  3ABK B;  1CXZ B;  1Z2G A;  3G67 A;  1PNL A;  4DR3 B;  3LUT B;  5B1A B;  1SQB H;  4DV3 B;  2YUA A;  2NLJ C;  4F6E A;  1NH2 B;  2GTS A;  1GN2 A;  1QLE C;  2A06 H;  2Y69 C;  3FX7 A;  3JAL A;  2PI5 A;  5J2T A;  1KQS U;  1S3J A;  2JJ1 G;  2WAM A;  1PM9 A;  3T1C A;  1JOY A;  1AI5 A;  1AIL A;  1R6T A;  2MK3 A;  4PHZ A;  2M7W A;  4QNH B;  4JTA B;  1FXK B;  3KCX A;  4DV7 O;  3ZN0 A;  4J42 A;  3E83 A;  4LWS B;  2X6B A;  1Z5V A;  4DW1 A;  1RM1 B;  1IBM O;  4F6R B;  2WLL A;  4FK5 C;  2UXN A;  3QVN A;  5CBG A;  3GB7 C;  3CJH A;  3RT3 C;  5IYC O;  4FZ0 A;  2VWK A;  2IJH A;  1DF4 A;  4LF6 O;  4OXS A;  3ZJZ A;  3ZRW B;  3JD1 A;  4WFH A;  4MVZ A;  1HR0 O;  2Q68 A;  1XHZ A;  5IJ9 B;  4DV0 B;  2QKC A;  2VQE O;  4DRX A;  1XOU A;  2LP7 A;  2QKA A;  2HHH B;  5GW7 A;  3MD0 A;  4PDM A;  2N04 A;  5D5Q A;  1URF A;  1GH6 A;  5K1X A;  3CSX A;  2C2A A;  2W0X A;  1N36 O;  5CA1 B;  3EVK A;  2IJI A;  1BGY H;  1MAB G;  1K4C C;  3K03 A;  3VQY A;  4RUF A;  1AP5 A;  5C93 A;  3AG3 B;  2ZNJ A;  3JAT B;  1X59 A;  2OTL V;  4NKG B;  1HWY A;  2IJK A;  2WLI A;  1M93 A;  5LOV B;  2ZXW C;  1Y76 A;  3B09 A;  3QG5 A;  1IUR A;  4EB6 B;  1FXH A;  3HR0 A;  3TK1 A;  1YTF D;  2P90 A;  2OTJ V;  4RQF A;  5CA0 A;  3OGC C;  1N33 O;  1V9P A;  1WPX A;  1U96 A;  1VF6 C;  1J95 A;  3DSQ A;  1Q6I A;  3IGA C;  2PGG A;  5B3S B;  3DGE A;  2QWN B;  2G38 A;  1H38 A;  3TET A;  4YIO A;  4IHJ B;  1MG1 A;  3ZRX A;  1VMG A;  1AI6 A;  1FJG O;  3ABU A;  5CB4 A;  1XNQ B;  2DJV A;  4UV9 A;  2LW7 A;  2BTQ A;  2EIM B;  1IBK O;  1XIL A;  4UCO A;  2DYR B;  1M5I A;  3ABM B;  1VQM V;  5BMV B;  5KHJ A;  2GUZ A;  1ENV A;  2AXT Z;  2PTM A;  1NTZ H;  4JI7 B;  1US6 A;  5EK0 A;  2ADQ B;  3RW0 A;  4LF5 O;  2RJZ A;  4R8C A;  4B7E A;  2QA4 V;  4B3R B;  3STZ C;  3ABT A;  1OCC B;  2X6C A;  2CTQ A;  4DV4 B;  4I5S A;  2F4V O;  4JI5 O;  3W7X A;  3KKY A;  2YI9 A;  4JYB A;  5J9P C;  5HFL A;  1QBZ A;  2A9H A;  3BAA A;  1F4N A;  5KHH A;  1I94 O;  1VF5 B;  3RGB A;  1VQL V;  1MZE A;  1VF6 A;  4X62 O;  3SJB C;  4FLZ A;  3BAB A;  3EXA A;  4KP4 A;  2B1I A;  4LH6 A;  4NTY A;  4IYH A;  4ZKI A;  3U0Z A;  4EKW A;  3VQV A;  3SGI A;  1TUE B;  3BHP A;  3AG4 C;  4G27 B;  4NB5 A;  4I7Z B;  3HKB A;  3ASN B;  2W6I G;  3AK1 A;  5JVD B;  1AR4 A;  4TWK A;  4PA7 A;  4DUY B;  3FAV A;  5KX5 A;  4KHP O;  4BR6 A;  1AJP A;  1LR1 A;  5CA3 A;  3JD0 A;  2M6Y A;  3SPI A;  1Q6U A;  4DRX B;  3CCV V;  1RPO A;  2YIB A;  3B2E E;  2A7W A;  2WWW A;  4B3S O;  4BIZ A;  3UQ8 A;  4DV1 O;  2HJD A;  2X0L A;  3UKM A;  4LCU C;  4H33 A;  5L3E A;  3I55 V;  4R7C A;  4GKK O;  4PI2 A;  3JAR B;  5DED A;  1B6Q A;  3ZRV A;  2UXB B;  4XDK A;  3UT5 A;  4GX0 A;  4LF4 B;  2AZ0 A;  1O9G A;  4ZI7 A;  1OCO B;  1MSD A;  2WLI B;  3E35 A;  1K9M W;  1SQF A;  1AVM A;  2XTA A;  3UO2 A;  5IWA B;  4UVC A;  3OEE G;  1I08 A;  3RYC B;  1SQG A;  4FM2 A;  4ZHQ A;  3K57 A;  5LP6 B;  3D36 A;  1OJH A;  4YJ2 B;  5KHI A;  3HKD A;  4JV5 O;  5CBF A;  3SYQ A;  3OMA B;  4H44 B;  4UCR A;  2ZIN A;  2GBO A;  4I9W A;  1YJN V;  2P4K A;  2ZDI C;  4DK1 A;  2F95 B;  2VS0 A;  1WB8 A;  5BZB A;  5GON B;  4WBN A;  3VOU A;  1YZB A;  2BSK B;  4UV8 A;  1ZWI C;  1JA8 A;  5EBW C;  3EHB B;  1Y67 A;  4DR2 O;  4LF7 B;  4TT3 G;  3SR2 C;  2XAS A;  2YDE A;  3T1H O;  1L1F A;  1HDJ A;  3CPW U;  4YY3 O;  2WLN A;  4E4E A;  5GTI Z;  4JI8 B;  2YXY A;  3C90 A;  3CCE V;  3CCL V;  1VQN V;  1QHT A;  1RPR A;  2YXH A;  2QDO A;  2Q7E A;  1QVG U;  3HKB B;  4HYO A;  2P4V A;  3A0R A;  2EIJ B;  4YJ3 B;  1WP8 A;  2EIL B;  1WPB A;  1OCR B;  2Y0I A;  2AHZ A;  3FAV B;  4ZOL B;  5KX5 B;  2JGD A;  3W7W A;  4MVO A;  4P9P A;  5B1A C;  5K1P A;  5KA6 A;  4AIL C;  2IU3 A;  5EIB D;  1PP9 H;  4LR3 A;  4LF8 O;  4PA3 A;  3FFQ A;  2PF4 E;  2ZIO A;  4GX1 A;  4LBE C;  3CB2 A;  1GTO A;  2YIC A;  2F1M A;  2HJF C;  3AG7 A;  3FYI B;  2DOS A;  3K5N A;  1N34 B;  1BT8 A;  4X1K A;  1FXK C;  2V1D A;  2KB1 A;  1RM1 C;  3E8G A;  1I0H A;  3MHH C;  2R9R B;  1HNZ B;  1H2M A;  4CH4 A;  1MOF A;  3UT5 B;  4UVB A;  3L72 H;  1BMF G;  4WFE A;  3ZBH A;  5A2Q N;  2ZKO A;  1X4T A;  1EFR G;  1WJZ A;  2QE7 G;  2JVD A;  3DXR B;  3SPG A;  3U10 A;  2XT9 A;  4LFB B;  4ZHQ B;  2ATK C;  1HW7 A;  3A8T A;  1XL4 A;  4O2A B;  4JI6 B;  1AJN A;  2NN4 A;  1DF5 A;  1EN5 A;  1SC5 B;  1IBL O;  4OX9 B;  4W4L A;  4UVA A;  1VP7 A;  3OR7 C;  1TGO A;  3WB2 A;  1K4D C;  2OCC B;  1ZSP A;  3CEI A;  2VRZ A;  1YDX A;  1B3Q A;  4QGP A;  4I0X B;  1FS0 G;  4PD4 F;  4Q6G A;  4DV5 O;  3AG3 C;  4A5U B;  1BHB A;  1M57 C;  1TVK B;  4R50 A;  5KHG A;  3CCJ V;  4X64 B;  4F6R A;  3ASO C;  5IT9 N;  1P49 A;  3FD9 A;  2UXD B;  1RSO B;  2D2C B;  1KKD A;  1XHX A;  5E79 Z;  1JX9 A;  4JI0 O;  3CRC A;  5B3S C;  4XBF A;  1ZAU A;  3ZMZ A;  4QPJ A;  3ZRW A;  5LA6 A;  1KYO F;  5C8Y A;  3OGI B;  5LMN O;  2EIM C;  3AEI A;  2PI4 A;  4KUM A;  3ETQ A;  4DR4 O;  1GM8 A;  4LFC B;  1Q8I A;  2XAQ A;  3JAK B;  5CA1 A;  3UO3 A;  2VQE B;  1SQQ H;  1R3K C;  5JWP A;  3E8B A;  4PDL A;  4B3M B;  3CWB H;  3PN1 A;  1B06 A;  2NNU A;  4JI4 O;  5EBL C;  3RN4 A;  3JAT A;  1OCC C;  2HEP A;  2XAG A;  1W59 A;  2KQX A;  5LYJ B;  3CME V;  2DE0 X;  2UU9 B;  3L71 H;  2QGN A;  1KEC A;  3GWK C;  5LOV A;  1QQC A;  4EB6 A;  1Z5W A;  5L3B A;  1H8H G;  2RNB A;  5LHI A;  4MVS A;  2Q4P A;  1EM1 A;  5HFM A;  4DV2 O;  4JYA O;  4IHJ A;  2V4D A;  2EJR A;  3ASN C;  5CMU A;  5EBM C;  4DUZ O;  1GKF A;  4NTW A;  4H0L B;  3CCS V;  1KC8 W;  4FMT A;  1EN6 A;  1GMG A;  5BMV A;  4ZIB A;  4I4T B;  4P9O A;  2E5L O;  2OT5 A;  1IXB A;  1GN6 A;  1AB3 A;  1AI7 A;  3BA9 A;  1YTF B;  5H2F Z;  4TOI A;  1M1K W;  3T2M A;  5ITZ B;  2OIG A;  4HNA A;  3JAW A;  2ZT9 B;  3CC7 V;  4MW8 A;  4RO2 A;  4K0K B;  4NXN O;  1K97 A;  4CC6 A;  4FFB A;  4RAI A;  3D8C A;  3ZMS A;  3ABL B;  5E1A C;  1XDC A;  1V54 C;  5EYP B;  4UFZ A;  1W2B U;  4X20 A;  4LF5 B;  4B3T B;  4D6T H;  4G28 B;  4J9Z B;  1K3E A;  4D7S A;  4K8X A;  4P30 A;  1WB7 A;  5BR8 O;  2Q9L A;  3FYE B;  4FIP C;  3LDC A;  1OCO C;  3A2F A;  2PZS A;  2D3O W;  2FML A;  3CRR A;  4X66 O;  2IH1 C;  1BQZ A;  3ETE A;  5H5N A;  5JVD A;  4X62 B;  4OPH A;  3GWO A;  1XEQ A;  2CH7 A;  3H1I H;  5LA6 B;  5LGT A;  4WFG A;  4JI3 B;  1JJ2 U;  4JI2 O;  4IT5 A;  3TXS A;  5C8Y B;  3RVZ A;  1ORQ C;  3Q4H B;  4O4H B;  2WSS G;  2VQF B;  1U97 A;  5LXT A;  4HZ3 A;  2HP8 A;  1FKA O;  1Q3E A;  3CCR V;  3AG2 B;  2B5U A;  4JYY A;  2UUB O;  2QTO A;  3SJC C;  3P32 A;  1ROP A;  5D5P A;  4B3S B;  4DV1 B;  4CH3 A;  3JAR A;  5IDJ A;  2ARH A;  1AR5 A;  1PPJ H;  4J11 A;  2UUA O;  4GLX A;  1VQ5 V;  4R6Z A;  2UXC B;  1CEZ A;  1NU1 H;  1WA8 A;  1Q43 A;  3L74 H;  4GKK B;  1QCE A;  3HPL C;  1PNM A;  4YHH B;  5FPO A;  3F5W C;  2Y0P A;  5IYB O;  3CD6 V;  2UUC B;  3CRA A;  3S3X A;  3RYC A;  1YSC A;  1MSW D;  3TGU H;  2Q0O C;  5LP6 A;  4O2B B;  4JZ2 A;  4YJ2 A;  4UXN A;  4TQD A;  2JDI G;  2DWE C;  3CS5 A;  3BRC A;  1XI1 A;  2EIL C;  4O4J A;  4P2Z A;  1OCR C;  4MVU A;  5KHK A;  4DW0 A;  1M56 B;  1XNR O;  3E86 A;  3F7V C;  4RQE A;  2ZD9 A;  4DR7 B;  2H3O A;  5GON A;  3LNN A;  2E3C A;  5H6R A;  4Z1V A;  2BSK A;  4HNA B;  2P6J A;  3JAW B;  5B1B B;  5LMU B;  1I5X A;  1OCZ B;  1GO3 F;  4FFB B;  3TJT A;  2CE4 A;  2F43 G;  1ZX3 A;  1S5L Z;  3AG1 B;  1PKX A;  4X20 B;  2Z3Y A;  1VIB A;  1FYJ A;  4X1Y B;  1RFY A;  1HNW B;  4DR2 B;  4TSF G;  4CH6 A;  4IIJ B;  2XOK G;  5AG2 A;  3W7T A;  1EZV H;  2PYL A;  3R65 A;  3CXH F;  1AJQ A;  1YCI A;  4C7U A;  2JEX A;  3ZRS A;  4PDV A;  1VQO V;  1UFI A;  3SDL A;  3ZMT A;  4YJ3 A;  4K3A A;  1Q82 W;  4GT1 A;  4BWA A;  3X2Q B;  2R70 A;  3B40 A;  2ZE8 A;  2EZO A;  4D7T A;  3O65 A;  5IY5 C;  4ZOL A;  1WN7 A;  4MTO A;  3NXS A;  3D36 C;  4U3J B;  3M8A A;  2CH7 B;  5DM6 V;  4UCU A;  5KMG B;  2GTA A;  3T1Y B;  1E79 G;  5JJN B;  3OD4 A;  4DV0 O;  2OCC C;  3ZN1 A;  1G8M A;  1V55 C;  4NVP A;  5LXT B;  4U7O A;  4LFA O;  1CP9 A;  3ZCC A;  4GKJ B;  2Q5Z A;  3JSL A;  2HLD G;  4DXW A;  3OUF A;  4JF3 A;  2QWQ B;  2WLH A;  3CRM A;  1TAE A;  1H2K A;  3CP1 A;  3OMI B;  3J7A U;  4PDR A;  1NR1 A;  3TXQ A;  2Y69 B;  3ETG A;  1YI2 V;  1WA8 B;  3ZHS A;  4DK0 A;  3WG7 C;  3T4Z A;  2CDY A;  5B1N A;  1IX9 A;  3H1H H;  3NR7 A;  4CBC A;  2H94 A;  3DXR A;  4FLY A;  4MTX A;  1TA8 A;  2ZM6 O;  1JCH A;  1J5E B;  3RYI B;  3OR6 C;  2LJ2 A;  4O2A A;  2QR4 A;  1BS3 A;  5FNV B;  2ODM A;  4AI8 A;  1BQ0 A;  4CS4 A;  1N8R W;  3QNE A;  1JPX A;  4X65 B;  4O4J B;  3P3N A;  1XNQ O;  1GM9 A;  2LFS A;  2EIK B;  1ZTE A;  2A3Q A;  3IC9 A;  5CBH A;  1NZ6 A;  2Z5U A;  4I50 B;  1DGS A;  2P5O A;  1UJW B;  4I0X A;  4J7K A;  3N2K A;  3BEH A;  2IBZ H;  1VQ7 V;  2Y4T A;  3ICX A;  5JQG A;  1ARO P;  1TVK A;  2CAZ C;  3JCU Z;  2DYS B;  3FKS G;  5L3D A;  4JI1 O;  4UCT A;  2IM9 A;  4B3R O;  3JD4 A;  1RSO A;  2CTP A;  5H6Q A;  5IYZ B;  1BZK A;  4HAM A;  4DV4 O;  1N32 B;  1SA0 A;  3UM7 A;  3WFV A;  4O4L B;  3ZX6 A;  4CC5 A;  5LBQ A;  3SPH A;  5JJJ B;  3CCM V;  1SRY A;  3T4D A;  2YXL A;  2ZNI A;  5JJE B;  3W7U A;  3CYO A;  4BIU A;  4FJC C;  2EX3 A;  1SQP H;  3RYH B;  3ABK C;  3N2G A;  3JAK A;  5B66 Z;  2LW1 A;  4DUY O;  3CX5 F;  1BSM A;  1M4U A;  2HR3 A;  4NXM B;  4X9Q A;  2XAF A;  1F7Y A;  3K5L A;  1S5J A;  1PD3 A;  4J10 A;  4FLX A;  4BAY A;  5LYJ A;  4WF9 V;  1YEW A;  3ABL C;  2P06 A;  1R6K A;  1UPG A;  2Y48 A;  2AGA A;  1R73 A;  4PEL A;  1H2S B;  4JI4 B;  2QKS A;  3E89 A;  4OGQ B;  4FPP A;  4H37 A;  1VQP V;  3W7S A;  3E22 B;  2ZQM A;  2FYU H;  2QWP B;  4JTC B;  4FM0 A;  2PY5 A;  1VF7 A;  2LO1 A;  3OFN G;  1QR8 A;  2R9A A;  1ZL8 A;  2UXB O;  3L9D A;  5L3F A;  5BXZ A;  3MDS A;  4GX2 A;  2HFE C;  4E2L A;  4LF4 O;  1Q81 W;  3OE7 G;  3CC2 V;  1S5H C;  2JS5 A;  2HVK C;  1FFX B;  1XMO O;  4DV2 B;  4DR6 B;  4I4T A;  4JYA B;  1XBL A;  4K35 A;  3IFX A;  4BW9 A;  1DK1 A;  3SJA C;  2XUM A;  1F4M A;  3AG4 B;  1H8E G;  5ITZ A;  2E75 B;  4FM1 A;  3SYA A;  1JFF B;  1NR7 A;  3A0H Z;  1KD1 W;  4DV6 O;  2E5L B;  1JQ0 A;  1ZUQ A;  3G6B A;  3AG2 C;  2LFR A;  1BL8 A;  4CS3 A;  1OV9 A;  2WLK A;  1YJ9 V;  1L0L H;  5EYP A;  3E2E A;  4X89 A;  3R66 A;  3RWR D;  3OMN B;  3N2K B;  4QPK A;  4FVM A;  2Q0A A;  5JQG B;  4QE9 A;  4TUY B;  3WB0 A;  2F23 A;  2GSM B;  2JS3 A;  2KG7 B;  1YF2 A;  3LSQ A;  3ZIA G;  1G1X B;  5FL7 G;  3SPJ A;  2FB5 A;  2ZR3 A;  1G6U A;  3OW2 U;  1PL0 A;  2IH3 C;  4DV7 B;  3VQX A;  1IBM B;  4EFE A;  1KU9 A;  2DWD C;  4ZBM A;  1SA0 B;  4EFB A;  3RYF A;  4WFF A;  2ETN A; 
#chains in the Genus database with same CATH homology
 2ZXW B;  5DN6 G;  4KP4 A;  1S72 V;  2B1I A;  4ZKI A;  5KA5 A;  4EKW A;  3CMA V;  2XAH A;  3GWO A;  4RUE A;  1SZT A;  1TUE B;  5L3G A;  3AG4 C;  3K06 A;  4G2K A;  2V7Q G;  2A79 B;  3ZMU A;  4G27 B;  3ASN B;  1SER A;  2W6I G;  2DYR C;  5LGT A;  1K8A W;  2X7R B;  1E1R G;  3ABM C;  4WFG A;  1JJ2 U;  1E1Q G;  5LGN A;  2HKO A;  3K3W A;  4TWK A;  4PA7 A;  4U7N A;  3RVZ A;  1ORQ C;  2QM7 A;  1M56 C;  5IYD O;  4MW3 A;  2UXX A;  1AJP A;  2WSS G;  3JCZ A;  3CXC U;  5CA3 A;  3OUS A;  3JD0 A;  4JYC A;  3B8N A;  1CPY A;  4HZ3 A;  1M9N A;  2YEV A;  3SPI A;  1Y4M A;  2IW5 A;  3CCR V;  3AG2 B;  4QJF B;  3CCV V;  1VQK V;  1RPO A;  2B5U A;  4XDJ A;  5CN0 A;  3JD3 A;  5B1B C;  2QTO A;  2EIN C;  2WWW A;  1OCZ C;  1ROP A;  3P32 A;  4BIZ A;  2ZDI A;  1K73 W;  2X0L A;  2YEV B;  3FB8 C;  1FFT B;  4KFM A;  4MVM A;  3LDE A;  3UKM A;  4LCU C;  4H33 A;  2XND G;  4X8A A;  5IDJ A;  3AG1 C;  5L3E A;  3I55 V;  4WFB V;  1VQ5 V;  2BOC C;  4R7C A;  4R6Z A;  3SPC A;  1CEZ A;  4MVR A;  4XDL A;  1QR9 A;  1DTO A;  1B6Q A;  1QCE A;  3HPL C;  3STL C;  3B77 A;  3ZRV A;  1P4R A;  1PNM A;  4XDK A;  3F5W C;  5IYB O;  3CD6 V;  4GX0 A;  2WLJ A;  1OCO B;  3KG2 A;  1JVM A;  2WLI B;  1SES A;  4PA9 A;  1YSC A;  1MSW D;  3E35 A;  3FB7 C;  3FB5 C;  1K9M W;  3PJS K;  2B1G A;  1VQ6 V;  4MS2 A;  3QO7 A;  4UXN A;  4UVC A;  3OEE G;  2JEU A;  2JDI G;  2DWE C;  2EZP A;  3ZMV A;  4BW5 A;  2EIL C;  3D36 A;  4P2Z A;  1OCR C;  4MVU A;  3SJQ C;  5IY5 B;  1Q86 W;  3B8M A;  1M56 B;  2HG5 C;  5B1O A;  5CBF A;  3E86 A;  3SYQ A;  3OMA B;  5LGU A;  3F7V C;  4RQE A;  4JAS A;  2ZD9 A;  2H8P C;  1R3L C;  4LC1 A;  3MHS C;  2DQ0 A;  4I9W A;  4PA6 A;  3RBZ A;  1YJN V;  4J9Y B;  5H6R A;  2ZDI C;  2P6J A;  1Y66 A;  5B1B B;  1S0V A;  1I5X A;  1V55 B;  2EIN B;  1OCZ B;  1DLB A;  4N23 A;  1S76 D;  1GO3 F;  5BZB A;  3VOU A;  3G4S V;  2F43 G;  2CK3 G;  3AG1 B;  4UV8 A;  1PKX A;  1ZWI C;  1XL6 A;  2Z3Y A;  5EBW C;  3EHB B;  4TT3 G;  2Q6A A;  1FXK A;  2XAS A;  3QO8 A;  4TSF G;  2XOK G;  1L1F A;  3M99 B;  4MT8 A;  3CPW U;  3W7T A;  1K5Q A;  2K1E A;  2WLN A;  3CC4 V;  3R65 A;  5L3C A;  1AJQ A;  1F51 A;  3CCE V;  3K08 A;  3CCL V;  2QM8 A;  2JEX A;  1AI4 A;  3ZRS A;  2AHY A;  3WG7 B;  1NQT A;  4PDV A;  3K0D A;  1VQO V;  3ZMT A;  3OM3 B;  1VQN V;  2ITD C;  1RPR A;  1Q82 W;  1NBM G;  4GT1 A;  3X2Q B;  2EZO A;  5IY5 C;  3I56 V;  1QVG U;  4MTO A;  4DO2 A;  3NXS A;  4N21 A;  4HYO A;  1Q7Y W;  3A0R A;  5DM6 V;  2EIK C;  2EIJ B;  1OHH G;  1K7D A;  2EIL B;  2EBO A;  4JGS A;  1F23 A;  5EC2 C;  1COW G;  1E79 G;  1OCR B;  5LHH A;  2JIZ G;  2AHZ A;  3TCU A;  3W7W A;  2OCC C;  4MVO A;  3ZN1 A;  4P9P A;  5B1A C;  1G8M A;  1V55 C;  3SYC A;  1YIT V;  4U7O A;  5KA6 A;  2XAJ A;  1CP9 A;  3ZCC A;  2IU3 A;  2DYS C;  2HLD G;  4Q20 A;  2Q69 A;  4DXW A;  2GHY A;  4PA3 A;  3OUF A;  4JF3 A;  2WLM A;  4JAU A;  1PNK A;  1IXM A;  4GX1 A;  2WLH A;  1I5Y A;  4LBE C;  2JK5 C;  2DW4 A;  3K0G A;  3K79 A;  3CP1 A;  1GTO A;  3OMI B;  2HJF C;  4JPR A;  1GK9 A;  3FYI B;  4PDR A;  1NR1 A;  3G71 V;  1NVP D;  2Y69 B;  2IJJ A;  3ETG A;  1FXK C;  1SET A;  1YI2 V;  2BOB C;  1K34 A;  2V1D A;  2KB1 A;  1RM1 C;  3WG7 C;  3E8G A;  2HVJ C;  3T4Z A;  1M57 B;  3MHH C;  2R9R B;  5KUK A;  5B1N A;  2WPD G;  4CBC A;  1MOF A;  2H94 A;  4UVB A;  3X2Q C;  3ASO B;  1BMF G;  1R3I C;  1NJI W;  1P7B A;  4WFE A;  3CCU V;  3HB3 B;  4MTX A;  1YJW V;  1EFR G;  1OZ0 A;  3QO5 A;  1JCH A;  2EIJ C;  2QEX V;  3LSS A;  3BY6 A;  1R6N A;  3OR6 C;  1NH2 D;  2QE7 G;  3SPG A;  2DQ3 A;  1S77 D;  1QLN A;  4ASU G;  4GX5 A;  1NVP B;  2ATK C;  4JAV A;  3DTU B;  1N8R W;  3QNE A;  1JPX A;  1W0K G;  1XL4 A;  1GM9 A;  3EFF K;  5KUM A;  2LFS A;  2EIK B;  2IU0 A;  1AJN A;  1DF5 A;  3ABK B;  1AR1 B;  2Q67 A;  1KP2 A;  4UVA A;  1PNL A;  3E8H A;  5CBH A;  3OR7 C;  2Z5U A;  4L87 A;  1UJW B;  1EBO A;  1K4D C;  2OCC B;  3D3I A;  4MTF A;  3BEH A;  3LUT B;  4JTD B;  4MVQ A;  5B1A B;  1VQ7 V;  4QIW F;  2JJ2 G;  3RVY A;  2NLJ C;  1THZ A;  1ARO P;  1NH2 B;  1K92 A;  3K04 A;  2DYS B;  3FKS G;  5L3D A;  1QLE C;  2Y69 C;  2PI5 A;  1FS0 G;  3AG3 C;  1KQS U;  3IC7 A;  1S3J A;  3E8F A;  4YXW G;  2JJ1 G;  1BHB A;  1M57 C;  2WAM A;  4R50 A;  3T1C A;  3CCJ V;  3JD4 A;  1JOY A;  1AI5 A;  2MK3 A;  3ASO C;  2W0F C;  4PA4 A;  5H6Q A;  2M7W A;  4HAM A;  4QNH B;  3UM7 A;  1R3J C;  3WFV A;  4JTA B;  1FXK B;  3ZN0 A;  5LBQ A;  3E83 A;  4WCE V;  1KP3 A;  2X6B A;  4CZZ A;  1RM1 B;  3SPH A;  3CCM V;  1SRY A;  2ZR2 A;  3T4D A;  2WLL A;  4FK5 C;  2UXN A;  5CBG A;  1KKD A;  4QE7 A;  3GB7 C;  3JD2 A;  1JX9 A;  4MSW C;  3W7U A;  5IYC O;  3CYO A;  5B3S C;  2FTK A;  4XBF A;  3ZMZ A;  4BIU A;  1QVF U;  4FJC C;  4QPJ A;  5EC1 C;  3ZRW A;  2WLL B;  2IJH A;  1K5S A;  3SYP A;  1GM7 A;  1DF4 A;  2P7T C;  3ABK C;  3OAA G;  3VBB A;  4OXS A;  3ML0 A;  5H9C A;  2EIM C;  3AEI A;  3ZJZ A;  4X88 A;  3ZRW B;  4GCZ A;  3JD1 A;  4WFH A;  2PI4 A;  4MVZ A;  4LP8 A;  4KUM A;  2Q68 A;  2HR3 A;  1GM8 A;  1WLE A;  2XAF A;  2LP7 A;  2XAQ A;  5GW7 A;  1PD3 A;  3MD0 A;  4PDM A;  1W0J G;  1R3K C;  4BAY A;  3E8B A;  2YSU B;  4PDL A;  1H2G A;  4WF9 V;  1YIJ V;  2C2A A;  3ABL C;  2NNU A;  1R6K A;  5EBL C;  2Y48 A;  5LHG A;  4UUJ C;  1R73 A;  4PEL A;  1BHA A;  2IJI A;  1OCC C;  2QKS A;  2XAG A;  3E89 A;  1MAB G;  1K4C C;  3K03 A;  1QLE B;  3LNM B;  4RUF A;  3CME V;  4FPP A;  4H37 A;  1VQP V;  5C93 A;  1KEC A;  1NKD A;  3AG3 B;  3W7S A;  3K9A A;  2ZQM A;  3LDD A;  2OTL V;  5L3B A;  1M90 W;  4JTC B;  1H8H G;  1V54 B;  3JYC A;  1VQ8 V;  5LHI A;  4MVS A;  3OFN G;  1QR8 A;  1HWY A;  2W6J G;  2IJK A;  2WLI A;  2ZXW C;  5L3F A;  4GX2 A;  4E2L A;  2HFE C;  4WFA V;  1FXH A;  5HFM A;  3TK1 A;  1Q81 W;  2P90 A;  3OE7 G;  1YTF D;  3CC2 V;  4RQF A;  1S5H C;  2OTJ V;  3OGC C;  2HVK C;  1WPX A;  1J95 A;  3IGA C;  3OEH G;  2EJR A;  3ASN C;  2ITC C;  5B3S B;  3DGE A;  5CMU A;  5EBM C;  4Z1M G;  1GKF A;  1H38 A;  3TET A;  3IFX A;  3CCS V;  2R9I A;  4FMT A;  1GMG A;  1KC8 W;  1MG1 A;  3ZRX A;  1AI6 A;  1FXV A;  4P9O A;  1F4M A;  3ABU A;  3AG4 B;  1VQ9 V;  1H8E G;  2OT5 A;  4UV9 A;  3SYA A;  1NR7 A;  1KD1 W;  2EIM B;  1JQ0 A;  1AI7 A;  2DYR B;  1VQ4 V;  1G4Y B;  3AG2 C;  3ABM B;  3FB6 C;  2LFR A;  1BL8 A;  1VQM V;  1YTF B;  3P30 A;  2WLK A;  1YJ9 V;  1LNQ A;  1M1K W;  3T2M A;  1ENV A;  4MTG A;  3E2E A;  1K33 A;  4X89 A;  1YHQ V;  5EK0 A;  4MW8 A;  3OMN B;  4RO2 A;  3CC7 V;  4QPK A;  1K97 A;  2A0L A;  4F4L A;  4RAI A;  3RW0 A;  4QE9 A;  3ZMS A;  3ABL B;  3F7Y C;  4R8C A;  5E1A C;  2GSM B;  2QA4 V;  1V54 C;  3LSQ A;  1W2B U;  3ZIA G;  3STZ C;  3ABT A;  1OCC B;  3H01 A;  2X6C A;  5FL7 G;  3SPJ A;  4G28 B;  1EZJ A;  4J9Z B;  1K3E A;  3SYO A;  4P30 A;  2ZR3 A;  3OW2 U;  4I5S A;  3ETD A;  3W7X A;  3FYE B;  1PL0 A;  4FIP C;  3LDC A;  3G6E V;  2IH3 C;  4JYB A;  1OCO C;  5J9P C;  5HFL A;  1QBZ A;  2DWD C;  2A9H A;  2D3O W;  1F4N A;  4ZBM A;  1VQL V;  2IH1 C;  3CCQ V;  2P67 A;  4WFF A;  2X6A A;  3ETE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...