1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Envelope glycoprotein
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
2M7WA 1QR9A 4JF3A 3P30A 1DF4A 1MG1A 1DLBA 4N21A 3K9AA 3H01A 4N23A 3B77A 2EZPA 5KA6A 1K34A 5KA5A 1F23A 3B8NA 1K33A 1I5YA 1DF5A 1JQ0A 4FK5C 3MHHC 3M99B 5CN0A 2OT5A 1MOFA 2EZOA 5H9CA 3CP1A 3GWOA 5CMUA 1Y4MA 2MK3A 1JPXA 5HFLA 3B8MA 2EBOA 1EBOA 4FIPC 1Y66A 2X7RB 4JGSA 1ENVA 3WFVA 2P6JA 1I5XA 4JPRA 2LP7A 1QR8A 4G2KA 1QCEA 5HFMA 1QBZA 3MHSC 4FJCC 1SZTA 4E2LA 3CYOA
chains in the Genus database with same CATH superfamily
2Q68A 4X89A 3AG4C 3ZCCA 4LF5B 1Q8IA 3ZRSA 2BE3A 4UFZA 3OFNG 4DV2O 3RFRA 4D7TA 3UCSC 4D7SA 3BY6A 4QJFB 4YHHO 3BA9A 2CH7A 5KUMA 2PYJA 4PHZA 4RWUA 1KUQA 4E2LA 2IH1C 3HKCB 3G4SV 4WFAV 2LFRA 5CA0A 3E8FA 3LDEA 2P90A 3BFRA 1Z5VA 3SPIA 2LO1A 5C8YB 2QKCA 3N2GA 4DW0A 3AG3C 3QF7A 1VQ4V 1ZWIC 2EX3A 4LNUB 3CRCA 2FMLA 3O9OA 4X88A 2JIZG 1V54B 3FB6C 2YEVB 2WLMA 1B04A 1BGYH 5DN6G 4W4KA 1P49A 1EFRG 4YXWG 4GLXA 1M9NA 4TV9B 2ADPA 3G71V 4J80A 2HHHB 1SKVA 2XAGA 1N4CA 2IJHA 2ZR2A 4IT5A 3STZC 1EZVH 3ZHVA 4B08A 1SETA 5KUKA 1M57B 3UQ8A 3ZEDA 1SZXA 3APOA 4UB6Z 4YY3B 1GH6A 3CC4V 4I50B 3L73H 4NXNB 4B3TB 3OTFA 1GN2A 4DV5B 4GZRB 1FXKB 1K5SA 2WLIB 1XMOB 1TVKA 2XNDG 4X9QA 3IJ4A 4MVUA 3K57A 1HR0O 1V55C 1QVFU 5KA6A 5B1OA 1OCOC 4JYYA 3OGIB 1SF9A 1LUVA 1XEQA 2RMKB 1K5QA 2QGNA 4O2BA 3IFXA 1Q6IA 4PDLA 3JD0A 1TUEB 3LDCA 1PD3A 5K1XA 4DK0A 1VQOV 3OUSA 2P5OA 3ZHQA 3RYFA 5CA1A 4PV1B 4LF4B 4JI0B 2BTQB 2LFSA 2QKSA 1KB9F 4DR1B 3SYPA 3C3SA 3AK3A 4RQFA 1KECA 1F4MA 5IT9N 1IX9A 5DM6V 1QLEB 2PGGA 1M1KW 1RSOB 2AGAA 4E4EA 1RPRA 3B2EE 1QU7A 5TISZ 3L74H 1IBKB 1L0NH 3BCCH 5JJJB 3MHSC 1IBLB 2LW7A 3CCRV 1WLEA 1HNWO 3K9SA 1K9MW 3RYFB 5LHGA 2XUMA 4WCEV 2VQFO 4LF6B 1BT8A 1JPXA 5LHHA 3K5OA 3THOA 3CCVV 5FPOA 1MA1A 4BW9A 4FZ0A 2KKWA 4G2KA 1F4NA 1NVPD 3QTCA 4DV2B 3P30A 2OIGA 2ZIOA 5EYPA 1MSWD 3IAYA 2R9IA 4DRXA 4JI2O 1R6NA 3JAWB 4QGPA 4X1KA 2EINC 1BQZA 5J2UB 3WG7B 3CCJV 3ETQA 2DWDC 4KXRA 1Y6XA 2X7RB 3QO7A 2F1MA 3LSQA 1EN5A 4ZIBA 4H44B 5BXZA 4X66B 4NTYA 2DMXA 4CBCA 2WLNA 1F51A 4DR7B 5EBLC 4O2BB 4DUZO 2EIJC 4UV9A 3RYHB 1XNQB 4YY3O 3FAVB 2XAFA 2CK3G 1JMKC 4PA9A 2V4DA 4B3TO 2EJRA 1YTFD 1FKAO 1SQXH 4GX5A 5EC1C 1IZ3A 4JI7B 2YC0A 2AHZA 4CC6A 3GB7C 3RYIA 4PA7A 1Q3EA 4GT1A 2MW2B 4WFFA 3B77A 3PJSK 3FYEB 5CA3A 4G28B 2QE7G 4IIJA 4W4LA 3ZN0A 1VQPV 5H9CA 1TUBA 2E76B 3JCUZ 2A79B 3K03A 3ZHTA 2QEXV 2EILC 5LMUO 2RN9A 1HNZB 2WAMA 2ODMA 4F6RB 1YIJV 2GDSA 3X2QB 2ZXWB 4I9QA 3FYIB 1XL6A 2JS5A 4UB8Z 3SPGA 1M56B 4X1IA 2IU3A 4UUJC 4MSWC 2QSAA 3TXQA 4CH4A 3MAQA 5IYCO 2H8PC 2Q73A 4JGSA 2IBZH 2EIKC 3SJQC 5JH7B 2PYLA 1AI6A 4WFGA 1S76D 3AG2C 5LGNA 4MVZA 3ZJZA 2VRZA 1AI7A 4DO2A 1EM1A 4JASA 1W2BU 3JD4A 2ZT9B 3D3IA 1FXKC 3ETDA 1UFIA 2HEPA 1PNMA 2MK3A 4KHPO 5EIBD 1XBLA 1OJHA 4NYKA 4ZHQA 2F66C 3LDDA 2L6LA 3Q4HA 4TSFG 2Y48A 4JAAA 1J5EO 1QR9A 4LF6O 4X1YB 3U10A 3RWRD 1WJZA 1HNWB 3N2KA 3GWKC 5CMUA 3JASB 1NR7A 2NNUA 1WA8B 4DR7O 5IYDO 1FXKA 2UU9B 2JGUA 5D5PA 2UU9O 2CTRA 5JCOC 4UCOA 5IWAB 1YSCA 5C8YA 4ZI7A 1ZAUA 2FB5A 1H2NA 3SGIA 3ABLB 4CH5A 1JX9A 3UO3A 4KUMA 3TETA 3Q4HB 4DR2B 1FAFA 1TUBB 1I94B 4U3JB 1E1RG 2P06A 3X2QC 1I7FA 5JWPA 3G6BA 1QNMA 4LWSA 2FKXA 1Q5OA 4ZOLA 3T1CA 1K92A 4TV9A 1E79G 1XILA 3K08A 3L72H 2FL4A 4X20A 4DUYB 3KZIZ 2F95B 4JI4O 4NVPA 3CC7V 3B4SA 3MD0A 4DR5B 1PM9A 2XOKG 1NKDA 4X1IB 3ZMZA 1N8RW 2ZM6B 3KG2A 4RO2A 1VF5B 2X6CA 1N34B 2AHYA 4NXMB 1O9HA 1IDSA 2OCCB 3WU2Z 4FFBA 4TUYB 1MNGA 2WPDG 1JCHA 3OD4A 4RAIA 1AR4A 2QWPB 4U7OA 4BIOA 2DYRB 1VQKV 5LP6A 2Y69B 2CH7B 2XASA 1SA0A 3DSQA 5LOVA 2WA3A 2NLJC 2LW1A 2UXXA 3FX7A 4J11A 3ZBHA 4X1YA 4FLVA 2W0FC 5CA0B 1VARA 5LMNB 4I4TA 3AEIA 3SYAA 3CC2V 4I55A 2VQFB 2Y69C 3ZRXA 4PA6A 5D5QA 3JSNA 5HFMA 4XDKA 1D2DA 1K3EA 3NR7A 1DLBA 3OMAB 1GK9A 2B9ZA 1HWYA 3E2EA 4JI1B 3T1HB 4R7CA 1BE3H 1KQSU 2K9PA 1AR5A 4CC5A 1R6TA 5LA6B 3RBZA 4ZI7B 4BWAA 1HW7A 4BIUA 1IBMO 2QWRB 1M90W 5DECA 1VQ8V 1VQ6V 2WLHA 2ZQMA 2BSKA 5LP6C 4XBFA 1EZJA 1GN3A 4X8AA 3D36C 1US6A 4I55B 2CGOA 5L3CA 4MVSA 4JI5O 1OZ0A 1S3JA 1YEWA 4DV4O 3JAMN 5K1PA 3EXAA 2WLIA 5JVDA 3CE2A 5FNVB 1KP2A 5BR8O 4MT8A 2ZCEA 3JAKA 1JQ0A 4KHPB 4O4JB 1AJQA 3QVNA 4JI7O 1SQQH 1EBOA 3OGCC 2DYSB 3HB3B 2YIBA 4OPAA 2E5LO 1QR8A 2XAHA 1GN6A 3JALA 1AJPA 2B5UA 5KHIA 4DV0O 2L35A 3OR7C 1XHZA 2QM4A 1E1QG 5IY5C 3DGEA 1S5JA 5HFLA 1VP7A 3RYCA 1NH2D 3KCYA 1MABG 1PNLA 1KYOF 2QWNB 3W7TA 4BIZA 1FFXA 1QLEC 1GTOA 3QG5A 1ORQC 2B1GA 3A2FA 1VQMV 3G67A 1L0LH 3H1KH 3STLC 5JQGA 4DXWA 4JZ2A 4QE7A 1Q7YW 1Q86W 1XQ8A 5LGTA 1D5NA 4J9ZB 1RSOA 4LFAO 1YJWV 5KAFZ 2Q67A 2YI9A 4J7JA 4RUFA 1FS0G 2Q0OC 1H38A 3BRCA 4MVQA 2JEUA 1R3IC 2ITCC 3RYCB 1NU1H 1B06A 4MTFA 4B3SO 4LH6A 4JZGA 1BL8A 3K0GA 1K7DA 3J81N 4JAVA 2DQ3A 1V54C 1QCEA 1SS3A 2DYRC 2Y0PA 4DV3B 2QWOB 3CWBH 4HNAA 5A9GA 2YIBD 2X6AA 2JEXA 1X4TA 1OCOB 3RVYA 2V7QG 3FFQA 1P7GA 2UXBB 4K3AA 3JARA 4P30A 4UCSA 4FPPA 1VF6C 1GMGA 3WFVA 5J2UA 3CCEV 5A2QN 2BTOA 1FD9A 1MZFA 4JYBA 2RNBA 4WFBV 1N32O 4JI0O 3HKBB 5L3EA 3K79A 1K4DC 4DR6B 3W7SA 4QE9A 3OW2U 2Q7HA 3W7XA 4FK5C 3ETEA 3D36A 2UUBO 5L3GA 4LWSB 2Q5ZA 2PTMA 3ZN1A 1XDCA 2VS0A 3L9DA 1QLNA 5KLVH 1WB8A 2W6JG 2Q4PA 4DUZB 3OEEG 2ZINA 5KX5B 1KKCA 3CRMA 3RYIB 2RQ6A 5FPRA 4FM2A 3WG7C 1JJ2U 4CS3A 2XAJA 1SQGA 2CTWA 1WP7A 4TUYA 4R50A 1Z2GA 3AG3B 4LNUA 3RT3C 1N36B 1AI5A 1HR0B 4JI2B 4JI1O 1OCZC 4DR1O 3H1IH 3IC7A 2ZM6O 1R6KA 4DV5O 4PI2A 2ATKC 5IJ0B 2CUGA 3L71H 1J5EB 4JI8O 5LYJB 1FXVA 3B8NA 2JS3A 1SA0B 3MHHC 4K8ZA 3QO5A 4JI6O 3CP1A 4K0KO 2IH3C 2PZSA 4K0KB 5JJNB 4U3JA 3JYCA 2Z0AA 1GM7A 1FFTB 3K3WA 3ICXA 4J7KA 4JPRA 2M6YA 2UUCO 4RQEA 2ZKOA 5JH7A 5FL7G 2UXCB 4JV5B 3LUTB 2YUAA 2WLLA 4O4LB 4CS4A 2DJVA 3BABA 4GKJB 4A5UB 3SJAC 3N27A 3NXSA 3DTUB 4LR3A 1BZKA 4LF9B 3ZMVA 1N0NA 1U96A 1SQVH 1YDXA 4XDLA 3AG2B 3O65A 4ZHQB 2WLKA 4IIJB 1ZSPA 1DF4A 1VQLV 4MVRA 1I5YA 1AR1B 3AG7A 2DQ0A 4LFBB 1BHAA 1KP3A 4B3MO 2EULA 4GX0A 2AW9A 3C90A 3N2KB 3LNNA 4F6RA 2CGNA 2DYSC 5BZBA 1AJNA 4LCUC 4LF7B 4MTXA 1OCZB 4IHJA 3H1JH 5KMGB 1XNRO 3CCQV 5KHJA 5GONB 3M99B 3HKDA 1MOFA 5FNVA 1BQ0A 1FPOA 3SYCA 1NI8A 4JI3B 1NQTA 1BSMA 4MVOA 1YJNV 2ADQB 5JCOA 4IGGA 4PDRA 1ENVA 1I0HA 4Q20A 4WF9V 3IC9A 2UUAO 2UXNA 5IYZB 3ETGA 4ASUG 1FXHA 3SYQA 3CYOA 2JVDA 1P4RA 4B7KA 2HR3A 4B3RO 1M57C 1S5LZ 5IJ0A 1AVMA 5IYBO 3BVOA 4B3RB 2YXYA 2HP8A 1RPOA 2AXTZ 3U11A 4QNHB 2HJFC 4HZ3A 1GO3F 5KHHA 2GV9A 3H01A 4PI0A 1W0JG 1HP8A 1YF2A 1EN4A 5H2FZ 3R65A 4MVMA 1Z5WA 5CBFA 1Y67A 2XAQA 2GBOA 3E8BA 3AK1A 4JI6B 2G38A 4FLYA 1SERA 5FLXN 1TA8A 2ITDC 4OX9O 1YVWA 3E8HA 4OGQB 2DWEC 1XNQO 1UJWB 1KC8W 2C2AA 2P22C 5LOVB 1IBLO 3C3TA 3E35A 4UVAA 1JVMA 4L8JA 4PELA 1FJGO 1G8MA 2F93B 3CCSV 2KB1A 2F43G 2OT5A 4HNAB 4X65B 3TXSA 2XHBA 5B5EZ 3UT5A 2ZE5A 4JTDB 2RDCA 1MSDA 2X6BA 4HBNA 4AQYO 2OWOA 1XNRB 3DC6A 3U0ZA 3ML0A 2R9RB 2OIEA 2QDOA 1MMMA 3CEIA 1FFXB 2QTSA 3VQVA 4FFBB 1WPXA 1Y74B 2RCVA 4EB6A 3E83A 4LFBO 4TV8B 3S3XA 4JI8B 1IURA 4TQFA 3UM7A 4O4IA 3H9VA 1BMFG 4H37A 2Y0IA 2Q6AA 4EKWA 4X66O 3TCUA 3JSLA 5EZYB 4DR4O 2ZDIC 3T1HO 3ASNC 1DF5A 1VF7A 3ZRWB 3CCMV 4I4TB 3OTOO 3APQA 4BW5A 1NJIW 2JJ2G 1JR9A 1VQ7V 4NXNO 4FZ1A 1H8EG 4PA4A 5B3SC 1W0KG 4PD4F 2OCCC 4D6TH 4JI4B 2UUBB 1XHXA 1NH2B 3K0DA 5J2TB 1YI2V 1DTOA 3ZHSA 1GRJA 3CJHA 1VMGA 1VIBA 4CH6A 2A3QA 4EFEA 3M8AA 5L3FA 5LA6A 4O2AB 5EIBC 2P7TC 4JI5B 3ZRVA 1ZTEA 1EN6A 3HKBA 2IM9A 1OV9A 3J7AU 5IY5B 5LL6Y 4U7NA 1MZEA 2N05A 2UXBO 2Z3YA 1HDJA 2HKOA 1P7BA 3ZRWA 1PV0A 3SJCC 3I56V 1CPYA 2QM8A 4LP8A 3OTOB 1R3JC 1AB3A 1SQBH 3BAAA 2WSSG 5H5NA 4J7ZA 3UT5B 4DV7B 5EBMC 4UCUA 4NKGB 4U3FH 4R6ZA 2LJ2A 4B3SB 5GTHZ 5KX5A 1XMOO 4JV5O 3S3WA 2WWWA 2Q8VA 2OYQA 2X0LA 3ASOB 1ROPA 3WB1A 2QJ1A 3ZX6A 2BOBC 2F4VO 4DUYO 4FLWA 4DR5O 3B09A 5BY1A 1LUWA 2ZXWC 2P6JA 2EIMB 2ILMA 3VQXA 1SRYA 5LYJA 2V1DA 4FJCC 3K5NA 3TGUH 2QKAA 3AG1C 2R9AA 1H2LA 2NR5A 2P4VA 4AQYB 4JTCB 4X62B 2IJIA 3FB5C 4AI8A 2AZ0A 2Q9LA 4RUEA 3CCLV 2D3OW 4K8XA 4TQDA 4Q6GA 4GKKB 1QHTA 2HJDA 4L87A 4AHCA 4CZZA 1AP6A 4I5SA 5E79Z 3ASOC 3R66A 1VQNV 4JF3A 4O4LA 3OE7G 1K73W 4DR4B 2JRIA 1JJOA 5EK0A 1G1XB 3BA8A 4Z2WA 3CMEV 5E1AC 2UUAB 2YXLA 4DRXB 1WB7A 1DK1A 1AP5A 4WBNB 4JI3O 3T2MA 1TGOA 1QQCA 4GCZA 2ZIMA 4J42A 2YXHA 1Q43A 2ZE6A 3W7UA 3I55V 3JATB 1KBHA 1M56C 3CX5F 5L3DA 4N23A 3HPLC 3K5MA 1D5AA 4LF8B 1YZBA 4UVBA 1GN4A 4LH7A 4LF7O 4DK1A 2WA4A 4X65O 4UVCA 4OXSA 4DV6O 2Q7GA 4AILC 1RFYA 4X64O 4PDMA 2ARHA 4B3MB 1YCIA 4N21A 1OHHG 4KP4A 4ZKIA 1RM1B 1S77D 1KU9A 1COWG 2FYUH 3HR0A 3K06A 3UKMA 2YIDA 1SESA 2EBOA 5DEDA 1YTFB 3F7VC 4B7EA 2CAZC 3E22A 3ZHUA 1XL4A 4FVMA 1NTMH 2PY5A 2R70A 5LBQA 3J80N 2VQEB 1Y76B 5ITZB 3CRQA 4JAUA 1ZL8A 4J41A 1WN7A 3HKEA 3A0RA 3T1YB 2A0LA 2LP7A 1Q82W 2R72A 1O9GA 4CH3A 5CB4A 3D3QA 4LF5O 3GVMA 2EIKB 3K9AA 2HVJC 1B3QA 2P67A 2F4VB 1N36O 2W0XA 4GUNA 1NZ6A 3M7MX 4O4HA 2CTPA 3DXRB 1JFFB 3JALB 1PKXA 3CD6V 4HAMA 2VWKA 4Z1VA 4J9YB 2CE4A 2LQTA 4YJ3B 3SPJA 2BCCH 1W59A 2CDYA 3RVZA 4O4IB 5ITZA 3G80A 2M7WA 5H6RA 4GYCB 4PDVA 3SYOA 4JYAB 4I0XA 4GKJO 4FLZA 5H6QA 3SDLA 1L8DA 2UXDB 5CBGA 5KMGA 3HKDB 2UXCO 4UCVA 2DN9A 1V55B 4EFBA 1I5XA 2GTAA 4FLTA 3SR2C 1BS3A 4IL6Z 2O57A 1X59A 2A06H 5B1NA 2GHYA 3K59A 2HVKC 2NN4A 1L1FA 4FLUA 1R1BA 2IW5A 2ETNA 3JD3A 3GWOA 3PN1A 3CS5A 1H2KA 5KHKA 2Z5UA 5J9PC 1K4CC 1LNQA 3A8TA 4DV1O 3DC5A 5B1AC 1HNXB 1M5IA 2PI4A 1G6UA 3E86A 2ZNJA 2EJ7A 1VQ5V 4EB6B 4NR1A 2KQXA 5BMVA 1OCCB 4KL1A 2D2CB 4MTGA 2DW4A 3FD9A 1K8AW 5C93A 1Q81W 4DV3O 2A9HA 3SJBC 3FAVA 5JJEB 3VQYA 3ABTA 4QIWF 1TAEA 4LF4O 2GTSA 3OMNB 1BCCH 2XTAA 4YJ2B 1CXZB 1PNKA 3F5TA 1WPBA 1F7YA 3T4ZA 1NTZH 4H33A 4LFCB 5LXTB 5F2VO 2OTLV 3E8GA 1G4YB 4R8CA 3IGAC 3JD2A 3K5LA 2Q0AA 3I5DA 5EBWC 2JJ1G 4DR6O 1P84F 4DW1A 1Y66A 3JD1A 3ABUA 5L3BA 3DXRA 1NR1A 1WP8A 1S0VA 3P32A 1SQPH 2F23A 2ZR3A 4UV8A 1I94O 2Y4TA 3UO2A 3T1YO 1THZA 4TOIA 1OCCC 4MW3A 5LP6B 2VQEO 1XI1A 2EIMC 5CN0A 2PI5A 1Q6HA 3A0BZ 3OR6C 4I0XB 5IJ9B 1S72V 2GSMB 2N74A 3B8MA 3CB2A 3CMAV 2JK5C 4JYCA 3CXCU 2IU0A 3AG4B 4NXMO 2PF4E 4LC1A 3RN4A 3TK1A 4P9OA 1SC5B 2BOCC 1I08A 2YDEA 4GX2A 2EZPA 1DGSA 2LGQA 4I50A 2IJJA 1S5HC 3WB2A 5KHGA 3L75H 1B6QA 4YIPA 2HLDG 4GKKO 1NBMG 1Y74A 3FB8C 3CCUV 3ZIAG 2E75B 3KKYA 2PUSA 3JCZA 4LFAB 4QPJA 1GM8A 4X62O 2E3CA 4DR3B 2OCHA 1R3KC 1H8HG 1UPGA 1JA8A 4KFMA 2ZNIA 3EVKA 3FKSG 5EZYA 4ICGA 4IYIA 4WFEA 5BMVB 4DV4B 1AI4A 4DR3O 1RP3B 1FJGB 4FIPC 4BR6A 1PL4A 2ZE8A 4LF8O 1KD1W 2E74B 3JASA 1Q6UA 3K04A 3CRRA 1QVGU 1NT2B 3QO8A 3CXHF 1WAZA 5EYPB 4FLXA 5CA1B 3OM3B 5JQGB 3JAKB 1J95A 2YEVA 1VQ9V 4DV0B 2BTQA 2AZ2A 2Q69A 1PP9H 3VBBA 1H2GA 3OEHG 4I7ZB 2E5LB 3BPZA 3E22B 1N0JA 3KCXA 4TV8A 3ABKB 1IVSA 4YHHB 4WBNA 2W6IG 5BR8B 2ZE7A 1ZL8B 3JATA 2LGWA 4X20B 5IJ9A 4K35A 3ABLC 4P2ZA 4MTOA 2P4KA 1YJ9V 2CTQA 2QWQB 5GONA 3H1HH 1XREA 1ZUQA 1XOUA 3K58A 3CRAA 1RM1C 3JARB 4LFCO 2HG5C 4CS2A 3W7WA 2B1IA 1OCRB 3N2GB 1GM9A 3E89A 3SPCA 3ZHRA 2QR4A 4O4HB 4Z1MG 1IBMB 3ZS8C 2YIAA 4DV7O 3RGBA 2GUZA 3AG1B 1AILA 3LNMB 3JAWA 5KA5A 4YJ3A 5LHIA 4FMTA 1K33A 3ASNB 3VQWA 4DYLA 1HNXO 2FTKA 1ZLZA 4F6EA 1Y4MA 1NVPB 2KG7A 2N04A 1V9PA 3FB7C 3CPWU 5EC2C 2JGDA 4F4LA 2HFEC 3G6EV 2UUCB 4IYHA 3ZMSA 1VF6A 3P3NA 5LMNO 2A7WA 3F7YC 1MG1A 4TT3G 3OUFA 5B66Z 4BAYA 1F23A 4H0LB 4LBEC 1XMQB 1KKDA 1GKFA 2YSUB 3RW0A 1R3LC 1N32B 1XUQA 1M93A 1TVKB 1U97A 2Y4UA 2DOSA 5AG2A 5CB4B 3CHXA 3OAAG 5IDJA 2XT9A 2GUZB 1M4UA 2WLJA 4FM0A 1LR1A 2H94A 3ZMTA 5CBHA 2UXDO 1IXBA 3P3PA 1JFFA 5B1BB 4LF9O 2BSKB 2JGDB 1CEZA 1PL0A 4JTAB 4NB5A 2Q7EA 1ZX3A 4GX1A 1N34O 2EILB 3ABMC 3BEHA 2VWJA 4UXNA 3MDSA 5B1BC 4DV1B 4FFKA 4P9PA 1YITV 2YS8A 4NTXA 2YICA 1Q90D 2QA4V 5JVDB 1CP9A 1OCRC 3H1LH 4UCTA 4QPKA 4J10A 3BHPA 1YHQV 2RJZA 4O4JA 4ZBMA 1R73A 1PPJH 1JOYA 1VEWA 4XDJA 5IE9A 2EIJB 2HHHO 1SZTA 4DR2O 3L70H 1BHBA 2QM7A 4PA3A 1IBKO 1WNSA 3ABKC 3QNEA 1Y76A 3TJTA 4ZOLB 5IWAO 3ZMUA 1URFA 1H2SB 4TWKA 4G27B 3A0HZ 5GW7A 2ZDIA 3HKEB 5B1AB 4UCRA 3D8CA 2KG7B 1K97A 2EINB 3CSXA 3F5WC 4MW8A 1YXBA 4HYOA 1N33B 3EHBB 3LSUA 2OTJV 2JDIG 1AROP 4OX9B 4DV6B 1GAXA 2WLLB 5IYZA 3SPHA 2IJKA 2H3OA 4C7UA 1XMQO 1WA8A 5B3SB 4YJ2A 4NTWA 4H13B 5J2TA 5GTIZ 1NTKH 3CJHB 5LXTA 4WFHA 4O2AA 3ABMB 1K34A 4X1KB 1NS1A 3VOUA 2EZOA 4PJ0Z 3WB0A 4I9WA 4FM1A 2KSDA 3OMIB 1SQFA 4OPHA 4JYAO 1FYJA 5KAIZ 1N33O 1T5EA 1A32A 4YIOA 2QTOA 2DE0X 3RYHA 3AK2A 5LGUA 3LSSA 4IHJB 4MS2A 3HKCA 4EEQA 2K1EA 3OT7A 1KMIZ 3B40A 1H2MA 1IXMA 4X64B 2YI8A 2ZD9A 4ABMA 5LMUB 3EFFK 1HNZO 1QBZA 3T4DA
chains in the Genus database with same CATH topology
2X6CA 2Q68A 4X89A 3AG4C 3E86A 3H01A 3ZCCA 1VQ5V 2AHYA 1W0JG 2OCCB 1OCCB 3R65A 3ZRSA 4MVMA 4MTGA 2DW4A 3OFNG 5CBFA 2XAQA 1K8AW 5C93A 1Q81W 3E8BA 2WPDG 1JCHA 2A9HA 3BY6A 4QJFB 4RAIA 5KUMA 3ABTA 4U7OA 1SERA 4QIWF 2DYRB 1VQKV 3OMNB 2Y69B 2ITDC 4E2LA 2XASA 1PNKA 2IH1C 3G4SV 3T4ZA 2LFRA 4WFAV 3E8HA 4H33A 2NLJC 2DWEC 1UJWB 2OTLV 1KC8W 2C2AA 3E8GA 2UXXA 3E8FA 1G4YB 3LDEA 4R8CA 2P90A 3IGAC 3JD2A 2W0FC 3SPIA 3E35A 5EBWC 4UVAA 1JVMA 2JJ1G 1Y66A 3AEIA 3JD1A 3SYAA 3ABUA 3CC2V 5L3BA 3AG3C 1NR1A 2Y69C 3ZRXA 4PA6A 3P32A 5HFMA 1S0VA 4XDKA 1VQ4V 1ZWIC 4UV8A 2ZR3A 4PELA 1K3EA 1THZA 1DLBA 1OCCC 4MW3A 3OMAB 1G8MA 4X88A 2JIZG 1GK9A 1V54B 3FB6C 2YEVB 3CCSV 2KB1A 2WLMA 1HWYA 2EIMC 2F43G 2OT5A 5CN0A 2PI5A 3E2EA 5DN6G 3OR6C 4R7CA 1KQSU 1EFRG 4YXWG 4JTDB 1S72V 2X6BA 1M9NA 2GSMB 3B8MA 3CMAV 2JK5C 3ML0A 4JYCA 3RBZA 2R9RB 3G71V 3CXCU 2IU0A 4BIUA 3AG4B 1M90W 1VQ8V 4LC1A 1VQ6V 3TK1A 2XAGA 2IJHA 2ZR2A 4P9OA 3STZC 2WLHA 2ZQMA 2BOCC 4GX2A 1SETA 1WPXA 2EZPA 4XBFA 5KUKA 1M57B 1S5HC 2IJJA 1EZJA 1B6QA 3CC4V 2HLDG 4X8AA 1NBMG 3E83A 3FB8C 3CCUV 3ZIAG 5L3CA 3UM7A 4MVSA 3JCZA 1FXKB 1K5SA 2WLIB 4QPJA 1BMFG 4H37A 1OZ0A 1S3JA 2XNDG 1GM8A 2Q6AA 4MVUA 4EKWA 1R3KC 1H8HG 2WLIA 3TCUA 1KP2A 1V55C 4KFMA 1QVFU 5KA6A 5B1OA 2ZDIC 4MT8A 1OCOC 3ASNC 1DF5A 1JQ0A 3FKSG 3ZRWB 3CCMV 1AJQA 4WFEA 4BW5A 1NJIW 1EBOA 2JJ2G 1AI4A 3OGCC 4FIPC 1VQ7V 2DYSB 3HB3B 1H8EG 1KD1W 1K5QA 4PA4A 5B3SC 1QR8A 2XAHA 1W0KG 1AJPA 3IFXA 2B5UA 2OCCC 4PDLA 1NH2B 3K04A 3JD0A 1TUEB 3K0DA 1YI2V 1QVGU 1DTOA 3LDCA 3QO8A 3OR7C 1PD3A 5L3FA 2P7TC 3OM3B 1E1QG 1VQOV 3OUSA 5IY5C 3DGEA 1J95A 2YEVA 5HFLA 3ZRVA 1VQ9V 1NH2D 1MABG 2Q69A 5IY5B 3VBBA 1PNLA 1H2GA 4U7NA 3OEHG 2LFSA 2QKSA 2Z3YA 3SYPA 2HKOA 3W7TA 1P7BA 3ZRWA 4RQFA 1KECA 1F4MA 4BIZA 3I56V 1QLEC 1CPYA 2QM8A 4LP8A 5DM6V 1GTOA 1QLEB 3ABKB 1R3JC 2W6IG 1ORQC 1M1KW 2B1GA 1VQMV 2WSSG 3STLC 1RPRA 4DXWA 4QE7A 1Q7YW 1Q86W 3ABLC 5EBMC 5LGTA 4P2ZA 4MTOA 4R6ZA 4J9ZB 1YJWV 1YJ9V 3MHSC 2Q67A 2WWWA 3CCRV 2X0LA 4RUFA 1FS0G 3ASOB 1H38A 1ROPA 1WLEA 2BOBC 1K9MW 4MVQA 1RM1C 2JEUA 1R3IC 2ITCC 5LHGA 2HG5C 4WCEV 3W7WA 2B1IA 1OCRB 4MTFA 1JPXA 1GM9A 5LHHA 3CCVV 3E89A 3SPCA 2ZXWC 2P6JA 1BL8A 2EIMB 1K7DA 3K0GA 4JAVA 2DQ3A 1V54C 4Z1MG 4G2KA 1QCEA 1SRYA 2DYRC 2V1DA 1F4NA 4FJCC 1NVPD 3AG1C 3AG1B 3P30A 3LNMB 5KA5A 1MSWD 5LHIA 4FMTA 2R9IA 2X6AA 2JEXA 4JTCB 1K33A 1OCOB 3ASNB 2IJIA 1R6NA 2FTKA 3FB5C 3RVYA 2V7QG 2EINC 1Y4MA 3WG7B 4RUEA 3CCJV 3CCLV 2D3OW 4P30A 1NVPB 3FB7C 3CPWU 2DWDC 5EC2C 4F4LA 2HFEC 4FPPA 2X7RB 3QO7A 3G6EV 1GMGA 3LSQA 3WFVA 3CCEV 3ZMSA 4JYBA 4L87A 4CZZA 4I5SA 4WFBV 3ASOC 1VQNV 5L3EA 3K79A 2WLNA 4CBCA 1F51A 3F7YC 3OE7G 1K4DC 4JF3A 5EBLC 1MG1A 1K73W 3W7SA 4QE9A 4TT3G 3OUFA 3OW2U 5EK0A 4BAYA 1F23A 4LBEC 3W7XA 4FK5C 3ETEA 3D36A 1KKDA 1GKFA 2EIJC 2YSUB 3RW0A 5L3GA 5E1AC 1R3LC 4UV9A 3CMEV 2XAFA 2CK3G 3ZN1A 4PA9A 3T2MA 2EJRA 4GCZA 1YTFD 5IDJA 3OAAG 1QLNA 4GX5A 2W6JG 5EC1C 2WLJA 3W7UA 3I55V 2AHZA 3GB7C 1M56C 2H94A 5L3DA 4N23A 3HPLC 4PA7A 4GT1A 3ZMTA 4WFFA 5CBHA 3OEEG 3B77A 3PJSK 4UVBA 3FYEB 5CA3A 4G28B 2QE7G 1VQPV 3ZN0A 5B1BB 3WG7C 5H9CA 1CEZA 1JJ2U 1PL0A 2A79B 4JTAB 3K03A 2XAJA 4UVCA 4OXSA 4GX1A 2QEXV 2EILC 2EILB 3ABMC 4R50A 3AG3B 1AI5A 3BEHA 1OCZC 2WAMA 3IC7A 4UXNA 4PDMA 5B1BC 1YIJV 1R6KA 4P9PA 1YITV 3X2QB 2ATKC 4N21A 2ZXWB 1OHHG 4KP4A 3FYIB 4ZKIA 2QA4V 1FXVA 3B8NA 1RM1B 1XL6A 3MHHC 1S77D 3SPGA 1M56B 1CP9A 1COWG 3QO5A 1OCRC 3CP1A 3K06A 2IU3A 3UKMA 4QPKA 1SESA 2IH3C 2EBOA 4UUJC 1YHQV 4MSWC 1YTFB 5IYCO 4ZBMA 2H8PC 3JYCA 4JGSA 1GM7A 1R73A 3F7VC 1FFTB 2EIKC 3K3WA 1JOYA 3SJQC 4XDJA 4JPRA 1AI6A 4RQEA 1XL4A 4WFGA 1S76D 2EIJB 3AG2C 1SZTA 4MVZA 3ZJZA 5LGNA 1BHBA 5FL7G 1AI7A 4DO2A 2QM7A 3LUTB 5LBQA 4JASA 4PA3A 3ABKC 1W2BU 2WLLA 3JD4A 3QNEA 3D3IA 1FXKC 4JAUA 3ETDA 3ZMUA 1PNMA 2MK3A 4TWKA 4G27B 3A0RA 5GW7A 2ZDIA 3NXSA 3DTUB 2A0LA 5B1AB 3ZMVA 2LP7A 1Q82W 3LDDA 1K97A 2EINB 4XDLA 3AG2B 4TSFG 2Y48A 2WLKA 1QR9A 3F5WC 1DF4A 4MW8A 4MVRA 1VQLV 2EIKB 3K9AA 2HVJC 4HYOA 1I5YA 2P67A 3EHBB 1AR1B 2OTJV 2DQ0A 2JDIG 1AROP 1BHAA 1KP3A 5CMUA 2WLLB 4GX0A 3SPHA 2IJKA 1PKXA 3CD6V 4HAMA 5B3SB 1NR7A 2NNUA 4J9YB 2DYSC 3SPJA 1AJNA 4LCUC 5BZBA 3RVZA 4MTXA 1OCZB 5IYDO 1FXKA 2M7WA 5H6RA 4WFHA 3ABMB 4PDVA 1K34A 3SYOA 3CCQV 3VOUA 3M99B 5H6QA 1MOFA 1YSCA 2EZOA 4I9WA 3SYCA 3OMIB 5CBGA 3ABLB 1NQTA 1JX9A 4MVOA 1YJNV 4KUMA 3TETA 4PDRA 1V55B 1ENVA 4Q20A 4WF9V 1I5XA 2UXNA 3ETGA 4ASUG 1E1RG 1FXHA 5B1NA 3SYQA 3CYOA 2GHYA 3X2QC 2QTOA 1P4RA 2HVKC 1L1FA 2HR3A 3T1CA 5LGUA 1K92A 3LSSA 1E79G 1M57C 3K08A 4MS2A 2IW5A 3JD3A 3GWOA 5IYBO 1RPOA 3CC7V 2K1EA 2Z5UA 3MD0A 5J9PC 2XOKG 1K4CC 1NKDA 4QNHB 3ZMZA 1N8RW 1LNQA 2HJFC 1IXMA 4HZ3A 5B1AC 3KG2A 1GO3F 2ZD9A 4RO2A 3EFFK 1QBZA 3T4DA 2PI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7W A;  1QR9 A;  4JF3 A;  3P30 A;  1DF4 A;  1MG1 A;  1DLB A;  4N21 A;  3K9A A;  3H01 A;  4N23 A;  3B77 A;  2EZP A;  5KA6 A;  1K34 A;  5KA5 A;  1F23 A;  3B8N A;  1K33 A;  1I5Y A;  1DF5 A;  1JQ0 A;  4FK5 C;  3MHH C;  3M99 B;  5CN0 A;  2OT5 A;  1MOF A;  2EZO A;  5H9C A;  3CP1 A;  3GWO A;  5CMU A;  1Y4M A;  2MK3 A;  1JPX A;  5HFL A;  3B8M A;  2EBO A;  1EBO A;  4FIP C;  1Y66 A;  2X7R B;  4JGS A;  1ENV A;  3WFV A;  2P6J A;  1I5X A;  4JPR A;  2LP7 A;  1QR8 A;  4G2K A;  1QCE A;  5HFM A;  1QBZ A;  3MHS C;  4FJC C;  1SZT A;  4E2L A;  3CYO A; 
#chains in the Genus database with same CATH topology
 2Q68 A;  4X89 A;  3AG4 C;  3ZCC A;  4LF5 B;  1Q8I A;  3ZRS A;  2BE3 A;  4UFZ A;  3OFN G;  4DV2 O;  3RFR A;  4D7T A;  3UCS C;  4D7S A;  3BY6 A;  4QJF B;  4YHH O;  3BA9 A;  2CH7 A;  5KUM A;  2PYJ A;  4PHZ A;  4RWU A;  1KUQ A;  4E2L A;  2IH1 C;  3HKC B;  3G4S V;  4WFA V;  2LFR A;  5CA0 A;  3E8F A;  3LDE A;  2P90 A;  3BFR A;  1Z5V A;  3SPI A;  2LO1 A;  5C8Y B;  2QKC A;  3N2G A;  4DW0 A;  3AG3 C;  3QF7 A;  1VQ4 V;  1ZWI C;  2EX3 A;  4LNU B;  3CRC A;  2FML A;  3O9O A;  4X88 A;  2JIZ G;  1V54 B;  3FB6 C;  2YEV B;  2WLM A;  1B04 A;  1BGY H;  5DN6 G;  4W4K A;  1P49 A;  1EFR G;  4YXW G;  4GLX A;  1M9N A;  4TV9 B;  2ADP A;  3G71 V;  4J80 A;  2HHH B;  1SKV A;  2XAG A;  1N4C A;  2IJH A;  2ZR2 A;  4IT5 A;  3STZ C;  1EZV H;  3ZHV A;  4B08 A;  1SET A;  5KUK A;  1M57 B;  3UQ8 A;  3ZED A;  1SZX A;  3APO A;  4UB6 Z;  4YY3 B;  1GH6 A;  3CC4 V;  4I50 B;  3L73 H;  4NXN B;  4B3T B;  3OTF A;  1GN2 A;  4DV5 B;  4GZR B;  1FXK B;  1K5S A;  2WLI B;  1XMO B;  1TVK A;  2XND G;  4X9Q A;  3IJ4 A;  4MVU A;  3K57 A;  1HR0 O;  1V55 C;  1QVF U;  5KA6 A;  5B1O A;  1OCO C;  4JYY A;  3OGI B;  1SF9 A;  1LUV A;  1XEQ A;  2RMK B;  1K5Q A;  2QGN A;  4O2B A;  3IFX A;  1Q6I A;  4PDL A;  3JD0 A;  1TUE B;  3LDC A;  1PD3 A;  5K1X A;  4DK0 A;  1VQO V;  3OUS A;  2P5O A;  3ZHQ A;  3RYF A;  5CA1 A;  4PV1 B;  4LF4 B;  4JI0 B;  2BTQ B;  2LFS A;  2QKS A;  1KB9 F;  4DR1 B;  3SYP A;  3C3S A;  3AK3 A;  4RQF A;  1KEC A;  1F4M A;  5IT9 N;  1IX9 A;  5DM6 V;  1QLE B;  2PGG A;  1M1K W;  1RSO B;  2AGA A;  4E4E A;  1RPR A;  3B2E E;  1QU7 A;  5TIS Z;  3L74 H;  1IBK B;  1L0N H;  3BCC H;  5JJJ B;  3MHS C;  1IBL B;  2LW7 A;  3CCR V;  1WLE A;  1HNW O;  3K9S A;  1K9M W;  3RYF B;  5LHG A;  2XUM A;  4WCE V;  2VQF O;  4LF6 B;  1BT8 A;  1JPX A;  5LHH A;  3K5O A;  3THO A;  3CCV V;  5FPO A;  1MA1 A;  4BW9 A;  4FZ0 A;  2KKW A;  4G2K A;  1F4N A;  1NVP D;  3QTC A;  4DV2 B;  3P30 A;  2OIG A;  2ZIO A;  5EYP A;  1MSW D;  3IAY A;  2R9I A;  4DRX A;  4JI2 O;  1R6N A;  3JAW B;  4QGP A;  4X1K A;  2EIN C;  1BQZ A;  5J2U B;  3WG7 B;  3CCJ V;  3ETQ A;  2DWD C;  4KXR A;  1Y6X A;  2X7R B;  3QO7 A;  2F1M A;  3LSQ A;  1EN5 A;  4ZIB A;  4H44 B;  5BXZ A;  4X66 B;  4NTY A;  2DMX A;  4CBC A;  2WLN A;  1F51 A;  4DR7 B;  5EBL C;  4O2B B;  4DUZ O;  2EIJ C;  4UV9 A;  3RYH B;  1XNQ B;  4YY3 O;  3FAV B;  2XAF A;  2CK3 G;  1JMK C;  4PA9 A;  2V4D A;  4B3T O;  2EJR A;  1YTF D;  1FKA O;  1SQX H;  4GX5 A;  5EC1 C;  1IZ3 A;  4JI7 B;  2YC0 A;  2AHZ A;  4CC6 A;  3GB7 C;  3RYI A;  4PA7 A;  1Q3E A;  4GT1 A;  2MW2 B;  4WFF A;  3B77 A;  3PJS K;  3FYE B;  5CA3 A;  4G28 B;  2QE7 G;  4IIJ A;  4W4L A;  3ZN0 A;  1VQP V;  5H9C A;  1TUB A;  2E76 B;  3JCU Z;  2A79 B;  3K03 A;  3ZHT A;  2QEX V;  2EIL C;  5LMU O;  2RN9 A;  1HNZ B;  2WAM A;  2ODM A;  4F6R B;  1YIJ V;  2GDS A;  3X2Q B;  2ZXW B;  4I9Q A;  3FYI B;  1XL6 A;  2JS5 A;  4UB8 Z;  3SPG A;  1M56 B;  4X1I A;  2IU3 A;  4UUJ C;  4MSW C;  2QSA A;  3TXQ A;  4CH4 A;  3MAQ A;  5IYC O;  2H8P C;  2Q73 A;  4JGS A;  2IBZ H;  2EIK C;  3SJQ C;  5JH7 B;  2PYL A;  1AI6 A;  4WFG A;  1S76 D;  3AG2 C;  5LGN A;  4MVZ A;  3ZJZ A;  2VRZ A;  1AI7 A;  4DO2 A;  1EM1 A;  4JAS A;  1W2B U;  3JD4 A;  2ZT9 B;  3D3I A;  1FXK C;  3ETD A;  1UFI A;  2HEP A;  1PNM A;  2MK3 A;  4KHP O;  5EIB D;  1XBL A;  1OJH A;  4NYK A;  4ZHQ A;  2F66 C;  3LDD A;  2L6L A;  3Q4H A;  4TSF G;  2Y48 A;  4JAA A;  1J5E O;  1QR9 A;  4LF6 O;  4X1Y B;  3U10 A;  3RWR D;  1WJZ A;  1HNW B;  3N2K A;  3GWK C;  5CMU A;  3JAS B;  1NR7 A;  2NNU A;  1WA8 B;  4DR7 O;  5IYD O;  1FXK A;  2UU9 B;  2JGU A;  5D5P A;  2UU9 O;  2CTR A;  5JCO C;  4UCO A;  5IWA B;  1YSC A;  5C8Y A;  4ZI7 A;  1ZAU A;  2FB5 A;  1H2N A;  3SGI A;  3ABL B;  4CH5 A;  1JX9 A;  3UO3 A;  4KUM A;  3TET A;  3Q4H B;  4DR2 B;  1FAF A;  1TUB B;  1I94 B;  4U3J B;  1E1R G;  2P06 A;  3X2Q C;  1I7F A;  5JWP A;  3G6B A;  1QNM A;  4LWS A;  2FKX A;  1Q5O A;  4ZOL A;  3T1C A;  1K92 A;  4TV9 A;  1E79 G;  1XIL A;  3K08 A;  3L72 H;  2FL4 A;  4X20 A;  4DUY B;  3KZI Z;  2F95 B;  4JI4 O;  4NVP A;  3CC7 V;  3B4S A;  3MD0 A;  4DR5 B;  1PM9 A;  2XOK G;  1NKD A;  4X1I B;  3ZMZ A;  1N8R W;  2ZM6 B;  3KG2 A;  4RO2 A;  1VF5 B;  2X6C A;  1N34 B;  2AHY A;  4NXM B;  1O9H A;  1IDS A;  2OCC B;  3WU2 Z;  4FFB A;  4TUY B;  1MNG A;  2WPD G;  1JCH A;  3OD4 A;  4RAI A;  1AR4 A;  2QWP B;  4U7O A;  4BIO A;  2DYR B;  1VQK V;  5LP6 A;  2Y69 B;  2CH7 B;  2XAS A;  1SA0 A;  3DSQ A;  5LOV A;  2WA3 A;  2NLJ C;  2LW1 A;  2UXX A;  3FX7 A;  4J11 A;  3ZBH A;  4X1Y A;  4FLV A;  2W0F C;  5CA0 B;  1VAR A;  5LMN B;  4I4T A;  3AEI A;  3SYA A;  3CC2 V;  4I55 A;  2VQF B;  2Y69 C;  3ZRX A;  4PA6 A;  5D5Q A;  3JSN A;  5HFM A;  4XDK A;  1D2D A;  1K3E A;  3NR7 A;  1DLB A;  3OMA B;  1GK9 A;  2B9Z A;  1HWY A;  3E2E A;  4JI1 B;  3T1H B;  4R7C A;  1BE3 H;  1KQS U;  2K9P A;  1AR5 A;  4CC5 A;  1R6T A;  5LA6 B;  3RBZ A;  4ZI7 B;  4BWA A;  1HW7 A;  4BIU A;  1IBM O;  2QWR B;  1M90 W;  5DEC A;  1VQ8 V;  1VQ6 V;  2WLH A;  2ZQM A;  2BSK A;  5LP6 C;  4XBF A;  1EZJ A;  1GN3 A;  4X8A A;  3D36 C;  1US6 A;  4I55 B;  2CGO A;  5L3C A;  4MVS A;  4JI5 O;  1OZ0 A;  1S3J A;  1YEW A;  4DV4 O;  3JAM N;  5K1P A;  3EXA A;  2WLI A;  5JVD A;  3CE2 A;  5FNV B;  1KP2 A;  5BR8 O;  4MT8 A;  2ZCE A;  3JAK A;  1JQ0 A;  4KHP B;  4O4J B;  1AJQ A;  3QVN A;  4JI7 O;  1SQQ H;  1EBO A;  3OGC C;  2DYS B;  3HB3 B;  2YIB A;  4OPA A;  2E5L O;  1QR8 A;  2XAH A;  1GN6 A;  3JAL A;  1AJP A;  2B5U A;  5KHI A;  4DV0 O;  2L35 A;  3OR7 C;  1XHZ A;  2QM4 A;  1E1Q G;  5IY5 C;  3DGE A;  1S5J A;  5HFL A;  1VP7 A;  3RYC A;  1NH2 D;  3KCY A;  1MAB G;  1PNL A;  1KYO F;  2QWN B;  3W7T A;  4BIZ A;  1FFX A;  1QLE C;  1GTO A;  3QG5 A;  1ORQ C;  2B1G A;  3A2F A;  1VQM V;  3G67 A;  1L0L H;  3H1K H;  3STL C;  5JQG A;  4DXW A;  4JZ2 A;  4QE7 A;  1Q7Y W;  1Q86 W;  1XQ8 A;  5LGT A;  1D5N A;  4J9Z B;  1RSO A;  4LFA O;  1YJW V;  5KAF Z;  2Q67 A;  2YI9 A;  4J7J A;  4RUF A;  1FS0 G;  2Q0O C;  1H38 A;  3BRC A;  4MVQ A;  2JEU A;  1R3I C;  2ITC C;  3RYC B;  1NU1 H;  1B06 A;  4MTF A;  4B3S O;  4LH6 A;  4JZG A;  1BL8 A;  3K0G A;  1K7D A;  3J81 N;  4JAV A;  2DQ3 A;  1V54 C;  1QCE A;  1SS3 A;  2DYR C;  2Y0P A;  4DV3 B;  2QWO B;  3CWB H;  4HNA A;  5A9G A;  2YIB D;  2X6A A;  2JEX A;  1X4T A;  1OCO B;  3RVY A;  2V7Q G;  3FFQ A;  1P7G A;  2UXB B;  4K3A A;  3JAR A;  4P30 A;  4UCS A;  4FPP A;  1VF6 C;  1GMG A;  3WFV A;  5J2U A;  3CCE V;  5A2Q N;  2BTO A;  1FD9 A;  1MZF A;  4JYB A;  2RNB A;  4WFB V;  1N32 O;  4JI0 O;  3HKB B;  5L3E A;  3K79 A;  1K4D C;  4DR6 B;  3W7S A;  4QE9 A;  3OW2 U;  2Q7H A;  3W7X A;  4FK5 C;  3ETE A;  3D36 A;  2UUB O;  5L3G A;  4LWS B;  2Q5Z A;  2PTM A;  3ZN1 A;  1XDC A;  2VS0 A;  3L9D A;  1QLN A;  5KLV H;  1WB8 A;  2W6J G;  2Q4P A;  4DUZ B;  3OEE G;  2ZIN A;  5KX5 B;  1KKC A;  3CRM A;  3RYI B;  2RQ6 A;  5FPR A;  4FM2 A;  3WG7 C;  1JJ2 U;  4CS3 A;  2XAJ A;  1SQG A;  2CTW A;  1WP7 A;  4TUY A;  4R50 A;  1Z2G A;  3AG3 B;  4LNU A;  3RT3 C;  1N36 B;  1AI5 A;  1HR0 B;  4JI2 B;  4JI1 O;  1OCZ C;  4DR1 O;  3H1I H;  3IC7 A;  2ZM6 O;  1R6K A;  4DV5 O;  4PI2 A;  2ATK C;  5IJ0 B;  2CUG A;  3L71 H;  1J5E B;  4JI8 O;  5LYJ B;  1FXV A;  3B8N A;  2JS3 A;  1SA0 B;  3MHH C;  4K8Z A;  3QO5 A;  4JI6 O;  3CP1 A;  4K0K O;  2IH3 C;  2PZS A;  4K0K B;  5JJN B;  4U3J A;  3JYC A;  2Z0A A;  1GM7 A;  1FFT B;  3K3W A;  3ICX A;  4J7K A;  4JPR A;  2M6Y A;  2UUC O;  4RQE A;  2ZKO A;  5JH7 A;  5FL7 G;  2UXC B;  4JV5 B;  3LUT B;  2YUA A;  2WLL A;  4O4L B;  4CS4 A;  2DJV A;  3BAB A;  4GKJ B;  4A5U B;  3SJA C;  3N27 A;  3NXS A;  3DTU B;  4LR3 A;  1BZK A;  4LF9 B;  3ZMV A;  1N0N A;  1U96 A;  1SQV H;  1YDX A;  4XDL A;  3AG2 B;  3O65 A;  4ZHQ B;  2WLK A;  4IIJ B;  1ZSP A;  1DF4 A;  1VQL V;  4MVR A;  1I5Y A;  1AR1 B;  3AG7 A;  2DQ0 A;  4LFB B;  1BHA A;  1KP3 A;  4B3M O;  2EUL A;  4GX0 A;  2AW9 A;  3C90 A;  3N2K B;  3LNN A;  4F6R A;  2CGN A;  2DYS C;  5BZB A;  1AJN A;  4LCU C;  4LF7 B;  4MTX A;  1OCZ B;  4IHJ A;  3H1J H;  5KMG B;  1XNR O;  3CCQ V;  5KHJ A;  5GON B;  3M99 B;  3HKD A;  1MOF A;  5FNV A;  1BQ0 A;  1FPO A;  3SYC A;  1NI8 A;  4JI3 B;  1NQT A;  1BSM A;  4MVO A;  1YJN V;  2ADQ B;  5JCO A;  4IGG A;  4PDR A;  1ENV A;  1I0H A;  4Q20 A;  4WF9 V;  3IC9 A;  2UUA O;  2UXN A;  5IYZ B;  3ETG A;  4ASU G;  1FXH A;  3SYQ A;  3CYO A;  2JVD A;  1P4R A;  4B7K A;  2HR3 A;  4B3R O;  1M57 C;  1S5L Z;  5IJ0 A;  1AVM A;  5IYB O;  3BVO A;  4B3R B;  2YXY A;  2HP8 A;  1RPO A;  2AXT Z;  3U11 A;  4QNH B;  2HJF C;  4HZ3 A;  1GO3 F;  5KHH A;  2GV9 A;  3H01 A;  4PI0 A;  1W0J G;  1HP8 A;  1YF2 A;  1EN4 A;  5H2F Z;  3R65 A;  4MVM A;  1Z5W A;  5CBF A;  1Y67 A;  2XAQ A;  2GBO A;  3E8B A;  3AK1 A;  4JI6 B;  2G38 A;  4FLY A;  1SER A;  5FLX N;  1TA8 A;  2ITD C;  4OX9 O;  1YVW A;  3E8H A;  4OGQ B;  2DWE C;  1XNQ O;  1UJW B;  1KC8 W;  2C2A A;  2P22 C;  5LOV B;  1IBL O;  3C3T A;  3E35 A;  4UVA A;  1JVM A;  4L8J A;  4PEL A;  1FJG O;  1G8M A;  2F93 B;  3CCS V;  2KB1 A;  2F43 G;  2OT5 A;  4HNA B;  4X65 B;  3TXS A;  2XHB A;  5B5E Z;  3UT5 A;  2ZE5 A;  4JTD B;  2RDC A;  1MSD A;  2X6B A;  4HBN A;  4AQY O;  2OWO A;  1XNR B;  3DC6 A;  3U0Z A;  3ML0 A;  2R9R B;  2OIE A;  2QDO A;  1MMM A;  3CEI A;  1FFX B;  2QTS A;  3VQV A;  4FFB B;  1WPX A;  1Y74 B;  2RCV A;  4EB6 A;  3E83 A;  4LFB O;  4TV8 B;  3S3X A;  4JI8 B;  1IUR A;  4TQF A;  3UM7 A;  4O4I A;  3H9V A;  1BMF G;  4H37 A;  2Y0I A;  2Q6A A;  4EKW A;  4X66 O;  3TCU A;  3JSL A;  5EZY B;  4DR4 O;  2ZDI C;  3T1H O;  3ASN C;  1DF5 A;  1VF7 A;  3ZRW B;  3CCM V;  4I4T B;  3OTO O;  3APQ A;  4BW5 A;  1NJI W;  2JJ2 G;  1JR9 A;  1VQ7 V;  4NXN O;  4FZ1 A;  1H8E G;  4PA4 A;  5B3S C;  1W0K G;  4PD4 F;  2OCC C;  4D6T H;  4JI4 B;  2UUB B;  1XHX A;  1NH2 B;  3K0D A;  5J2T B;  1YI2 V;  1DTO A;  3ZHS A;  1GRJ A;  3CJH A;  1VMG A;  1VIB A;  4CH6 A;  2A3Q A;  4EFE A;  3M8A A;  5L3F A;  5LA6 A;  4O2A B;  5EIB C;  2P7T C;  4JI5 B;  3ZRV A;  1ZTE A;  1EN6 A;  3HKB A;  2IM9 A;  1OV9 A;  3J7A U;  5IY5 B;  5LL6 Y;  4U7N A;  1MZE A;  2N05 A;  2UXB O;  2Z3Y A;  1HDJ A;  2HKO A;  1P7B A;  3ZRW A;  1PV0 A;  3SJC C;  3I56 V;  1CPY A;  2QM8 A;  4LP8 A;  3OTO B;  1R3J C;  1AB3 A;  1SQB H;  3BAA A;  2WSS G;  5H5N A;  4J7Z A;  3UT5 B;  4DV7 B;  5EBM C;  4UCU A;  4NKG B;  4U3F H;  4R6Z A;  2LJ2 A;  4B3S B;  5GTH Z;  5KX5 A;  1XMO O;  4JV5 O;  3S3W A;  2WWW A;  2Q8V A;  2OYQ A;  2X0L A;  3ASO B;  1ROP A;  3WB1 A;  2QJ1 A;  3ZX6 A;  2BOB C;  2F4V O;  4DUY O;  4FLW A;  4DR5 O;  3B09 A;  5BY1 A;  1LUW A;  2ZXW C;  2P6J A;  2EIM B;  2ILM A;  3VQX A;  1SRY A;  5LYJ A;  2V1D A;  4FJC C;  3K5N A;  3TGU H;  2QKA A;  3AG1 C;  2R9A A;  1H2L A;  2NR5 A;  2P4V A;  4AQY B;  4JTC B;  4X62 B;  2IJI A;  3FB5 C;  4AI8 A;  2AZ0 A;  2Q9L A;  4RUE A;  3CCL V;  2D3O W;  4K8X A;  4TQD A;  4Q6G A;  4GKK B;  1QHT A;  2HJD A;  4L87 A;  4AHC A;  4CZZ A;  1AP6 A;  4I5S A;  5E79 Z;  3ASO C;  3R66 A;  1VQN V;  4JF3 A;  4O4L A;  3OE7 G;  1K73 W;  4DR4 B;  2JRI A;  1JJO A;  5EK0 A;  1G1X B;  3BA8 A;  4Z2W A;  3CME V;  5E1A C;  2UUA B;  2YXL A;  4DRX B;  1WB7 A;  1DK1 A;  1AP5 A;  4WBN B;  4JI3 O;  3T2M A;  1TGO A;  1QQC A;  4GCZ A;  2ZIM A;  4J42 A;  2YXH A;  1Q43 A;  2ZE6 A;  3W7U A;  3I55 V;  3JAT B;  1KBH A;  1M56 C;  3CX5 F;  5L3D A;  4N23 A;  3HPL C;  3K5M A;  1D5A A;  4LF8 B;  1YZB A;  4UVB A;  1GN4 A;  4LH7 A;  4LF7 O;  4DK1 A;  2WA4 A;  4X65 O;  4UVC A;  4OXS A;  4DV6 O;  2Q7G A;  4AIL C;  1RFY A;  4X64 O;  4PDM A;  2ARH A;  4B3M B;  1YCI A;  4N21 A;  1OHH G;  4KP4 A;  4ZKI A;  1RM1 B;  1S77 D;  1KU9 A;  1COW G;  2FYU H;  3HR0 A;  3K06 A;  3UKM A;  2YID A;  1SES A;  2EBO A;  5DED A;  1YTF B;  3F7V C;  4B7E A;  2CAZ C;  3E22 A;  3ZHU A;  1XL4 A;  4FVM A;  1NTM H;  2PY5 A;  2R70 A;  5LBQ A;  3J80 N;  2VQE B;  1Y76 B;  5ITZ B;  3CRQ A;  4JAU A;  1ZL8 A;  4J41 A;  1WN7 A;  3HKE A;  3A0R A;  3T1Y B;  2A0L A;  2LP7 A;  1Q82 W;  2R72 A;  1O9G A;  4CH3 A;  5CB4 A;  3D3Q A;  4LF5 O;  3GVM A;  2EIK B;  3K9A A;  2HVJ C;  1B3Q A;  2P67 A;  2F4V B;  1N36 O;  2W0X A;  4GUN A;  1NZ6 A;  3M7M X;  4O4H A;  2CTP A;  3DXR B;  1JFF B;  3JAL B;  1PKX A;  3CD6 V;  4HAM A;  2VWK A;  4Z1V A;  4J9Y B;  2CE4 A;  2LQT A;  4YJ3 B;  3SPJ A;  2BCC H;  1W59 A;  2CDY A;  3RVZ A;  4O4I B;  5ITZ A;  3G80 A;  2M7W A;  5H6R A;  4GYC B;  4PDV A;  3SYO A;  4JYA B;  4I0X A;  4GKJ O;  4FLZ A;  5H6Q A;  3SDL A;  1L8D A;  2UXD B;  5CBG A;  5KMG A;  3HKD B;  2UXC O;  4UCV A;  2DN9 A;  1V55 B;  4EFB A;  1I5X A;  2GTA A;  4FLT A;  3SR2 C;  1BS3 A;  4IL6 Z;  2O57 A;  1X59 A;  2A06 H;  5B1N A;  2GHY A;  3K59 A;  2HVK C;  2NN4 A;  1L1F A;  4FLU A;  1R1B A;  2IW5 A;  2ETN A;  3JD3 A;  3GWO A;  3PN1 A;  3CS5 A;  1H2K A;  5KHK A;  2Z5U A;  5J9P C;  1K4C C;  1LNQ A;  3A8T A;  4DV1 O;  3DC5 A;  5B1A C;  1HNX B;  1M5I A;  2PI4 A;  1G6U A;  3E86 A;  2ZNJ A;  2EJ7 A;  1VQ5 V;  4EB6 B;  4NR1 A;  2KQX A;  5BMV A;  1OCC B;  4KL1 A;  2D2C B;  4MTG A;  2DW4 A;  3FD9 A;  1K8A W;  5C93 A;  1Q81 W;  4DV3 O;  2A9H A;  3SJB C;  3FAV A;  5JJE B;  3VQY A;  3ABT A;  4QIW F;  1TAE A;  4LF4 O;  2GTS A;  3OMN B;  1BCC H;  2XTA A;  4YJ2 B;  1CXZ B;  1PNK A;  3F5T A;  1WPB A;  1F7Y A;  3T4Z A;  1NTZ H;  4H33 A;  4LFC B;  5LXT B;  5F2V O;  2OTL V;  3E8G A;  1G4Y B;  4R8C A;  3IGA C;  3JD2 A;  3K5L A;  2Q0A A;  3I5D A;  5EBW C;  2JJ1 G;  4DR6 O;  1P84 F;  4DW1 A;  1Y66 A;  3JD1 A;  3ABU A;  5L3B A;  3DXR A;  1NR1 A;  1WP8 A;  1S0V A;  3P32 A;  1SQP H;  2F23 A;  2ZR3 A;  4UV8 A;  1I94 O;  2Y4T A;  3UO2 A;  3T1Y O;  1THZ A;  4TOI A;  1OCC C;  4MW3 A;  5LP6 B;  2VQE O;  1XI1 A;  2EIM C;  5CN0 A;  2PI5 A;  1Q6H A;  3A0B Z;  3OR6 C;  4I0X B;  5IJ9 B;  1S72 V;  2GSM B;  2N74 A;  3B8M A;  3CB2 A;  3CMA V;  2JK5 C;  4JYC A;  3CXC U;  2IU0 A;  3AG4 B;  4NXM O;  2PF4 E;  4LC1 A;  3RN4 A;  3TK1 A;  4P9O A;  1SC5 B;  2BOC C;  1I08 A;  2YDE A;  4GX2 A;  2EZP A;  1DGS A;  2LGQ A;  4I50 A;  2IJJ A;  1S5H C;  3WB2 A;  5KHG A;  3L75 H;  1B6Q A;  4YIP A;  2HLD G;  4GKK O;  1NBM G;  1Y74 A;  3FB8 C;  3CCU V;  3ZIA G;  2E75 B;  3KKY A;  2PUS A;  3JCZ A;  4LFA B;  4QPJ A;  1GM8 A;  4X62 O;  2E3C A;  4DR3 B;  2OCH A;  1R3K C;  1H8H G;  1UPG A;  1JA8 A;  4KFM A;  2ZNI A;  3EVK A;  3FKS G;  5EZY A;  4ICG A;  4IYI A;  4WFE A;  5BMV B;  4DV4 B;  1AI4 A;  4DR3 O;  1RP3 B;  1FJG B;  4FIP C;  4BR6 A;  1PL4 A;  2ZE8 A;  4LF8 O;  1KD1 W;  2E74 B;  3JAS A;  1Q6U A;  3K04 A;  3CRR A;  1QVG U;  1NT2 B;  3QO8 A;  3CXH F;  1WAZ A;  5EYP B;  4FLX A;  5CA1 B;  3OM3 B;  5JQG B;  3JAK B;  1J95 A;  2YEV A;  1VQ9 V;  4DV0 B;  2BTQ A;  2AZ2 A;  2Q69 A;  1PP9 H;  3VBB A;  1H2G A;  3OEH G;  4I7Z B;  2E5L B;  3BPZ A;  3E22 B;  1N0J A;  3KCX A;  4TV8 A;  3ABK B;  1IVS A;  4YHH B;  4WBN A;  2W6I G;  5BR8 B;  2ZE7 A;  1ZL8 B;  3JAT A;  2LGW A;  4X20 B;  5IJ9 A;  4K35 A;  3ABL C;  4P2Z A;  4MTO A;  2P4K A;  1YJ9 V;  2CTQ A;  2QWQ B;  5GON A;  3H1H H;  1XRE A;  1ZUQ A;  1XOU A;  3K58 A;  3CRA A;  1RM1 C;  3JAR B;  4LFC O;  2HG5 C;  4CS2 A;  3W7W A;  2B1I A;  1OCR B;  3N2G B;  1GM9 A;  3E89 A;  3SPC A;  3ZHR A;  2QR4 A;  4O4H B;  4Z1M G;  1IBM B;  3ZS8 C;  2YIA A;  4DV7 O;  3RGB A;  2GUZ A;  3AG1 B;  1AIL A;  3LNM B;  3JAW A;  5KA5 A;  4YJ3 A;  5LHI A;  4FMT A;  1K33 A;  3ASN B;  3VQW A;  4DYL A;  1HNX O;  2FTK A;  1ZLZ A;  4F6E A;  1Y4M A;  1NVP B;  2KG7 A;  2N04 A;  1V9P A;  3FB7 C;  3CPW U;  5EC2 C;  2JGD A;  4F4L A;  2HFE C;  3G6E V;  2UUC B;  4IYH A;  3ZMS A;  1VF6 A;  3P3N A;  5LMN O;  2A7W A;  3F7Y C;  1MG1 A;  4TT3 G;  3OUF A;  5B66 Z;  4BAY A;  1F23 A;  4H0L B;  4LBE C;  1XMQ B;  1KKD A;  1GKF A;  2YSU B;  3RW0 A;  1R3L C;  1N32 B;  1XUQ A;  1M93 A;  1TVK B;  1U97 A;  2Y4U A;  2DOS A;  5AG2 A;  5CB4 B;  3CHX A;  3OAA G;  5IDJ A;  2XT9 A;  2GUZ B;  1M4U A;  2WLJ A;  4FM0 A;  1LR1 A;  2H94 A;  3ZMT A;  5CBH A;  2UXD O;  1IXB A;  3P3P A;  1JFF A;  5B1B B;  4LF9 O;  2BSK B;  2JGD B;  1CEZ A;  1PL0 A;  4JTA B;  4NB5 A;  2Q7E A;  1ZX3 A;  4GX1 A;  1N34 O;  2EIL B;  3ABM C;  3BEH A;  2VWJ A;  4UXN A;  3MDS A;  5B1B C;  4DV1 B;  4FFK A;  4P9P A;  1YIT V;  2YS8 A;  4NTX A;  2YIC A;  1Q90 D;  2QA4 V;  5JVD B;  1CP9 A;  1OCR C;  3H1L H;  4UCT A;  4QPK A;  4J10 A;  3BHP A;  1YHQ V;  2RJZ A;  4O4J A;  4ZBM A;  1R73 A;  1PPJ H;  1JOY A;  1VEW A;  4XDJ A;  5IE9 A;  2EIJ B;  2HHH O;  1SZT A;  4DR2 O;  3L70 H;  1BHB A;  2QM7 A;  4PA3 A;  1IBK O;  1WNS A;  3ABK C;  3QNE A;  1Y76 A;  3TJT A;  4ZOL B;  5IWA O;  3ZMU A;  1URF A;  1H2S B;  4TWK A;  4G27 B;  3A0H Z;  5GW7 A;  2ZDI A;  3HKE B;  5B1A B;  4UCR A;  3D8C A;  2KG7 B;  1K97 A;  2EIN B;  3CSX A;  3F5W C;  4MW8 A;  1YXB A;  4HYO A;  1N33 B;  3EHB B;  3LSU A;  2OTJ V;  2JDI G;  1ARO P;  4OX9 B;  4DV6 B;  1GAX A;  2WLL B;  5IYZ A;  3SPH A;  2IJK A;  2H3O A;  4C7U A;  1XMQ O;  1WA8 A;  5B3S B;  4YJ2 A;  4NTW A;  4H13 B;  5J2T A;  5GTI Z;  1NTK H;  3CJH B;  5LXT A;  4WFH A;  4O2A A;  3ABM B;  1K34 A;  4X1K B;  1NS1 A;  3VOU A;  2EZO A;  4PJ0 Z;  3WB0 A;  4I9W A;  4FM1 A;  2KSD A;  3OMI B;  1SQF A;  4OPH A;  4JYA O;  1FYJ A;  5KAI Z;  1N33 O;  1T5E A;  1A32 A;  4YIO A;  2QTO A;  2DE0 X;  3RYH A;  3AK2 A;  5LGU A;  3LSS A;  4IHJ B;  4MS2 A;  3HKC A;  4EEQ A;  2K1E A;  3OT7 A;  1KMI Z;  3B40 A;  1H2M A;  1IXM A;  4X64 B;  2YI8 A;  2ZD9 A;  4ABM A;  5LMU B;  3EFF K;  1HNZ O;  1QBZ A;  3T4D A; 
#chains in the Genus database with same CATH homology
 2X6C A;  2Q68 A;  4X89 A;  3AG4 C;  3E86 A;  3H01 A;  3ZCC A;  1VQ5 V;  2AHY A;  1W0J G;  2OCC B;  1OCC B;  3R65 A;  3ZRS A;  4MVM A;  4MTG A;  2DW4 A;  3OFN G;  5CBF A;  2XAQ A;  1K8A W;  5C93 A;  1Q81 W;  3E8B A;  2WPD G;  1JCH A;  2A9H A;  3BY6 A;  4QJF B;  4RAI A;  5KUM A;  3ABT A;  4U7O A;  1SER A;  4QIW F;  2DYR B;  1VQK V;  3OMN B;  2Y69 B;  2ITD C;  4E2L A;  2XAS A;  1PNK A;  2IH1 C;  3G4S V;  3T4Z A;  2LFR A;  4WFA V;  3E8H A;  4H33 A;  2NLJ C;  2DWE C;  1UJW B;  2OTL V;  1KC8 W;  2C2A A;  3E8G A;  2UXX A;  3E8F A;  1G4Y B;  3LDE A;  4R8C A;  2P90 A;  3IGA C;  3JD2 A;  2W0F C;  3SPI A;  3E35 A;  5EBW C;  4UVA A;  1JVM A;  2JJ1 G;  1Y66 A;  3AEI A;  3JD1 A;  3SYA A;  3ABU A;  3CC2 V;  5L3B A;  3AG3 C;  1NR1 A;  2Y69 C;  3ZRX A;  4PA6 A;  3P32 A;  5HFM A;  1S0V A;  4XDK A;  1VQ4 V;  1ZWI C;  4UV8 A;  2ZR3 A;  4PEL A;  1K3E A;  1THZ A;  1DLB A;  1OCC C;  4MW3 A;  3OMA B;  1G8M A;  4X88 A;  2JIZ G;  1GK9 A;  1V54 B;  3FB6 C;  2YEV B;  3CCS V;  2KB1 A;  2WLM A;  1HWY A;  2EIM C;  2F43 G;  2OT5 A;  5CN0 A;  2PI5 A;  3E2E A;  5DN6 G;  3OR6 C;  4R7C A;  1KQS U;  1EFR G;  4YXW G;  4JTD B;  1S72 V;  2X6B A;  1M9N A;  2GSM B;  3B8M A;  3CMA V;  2JK5 C;  3ML0 A;  4JYC A;  3RBZ A;  2R9R B;  3G71 V;  3CXC U;  2IU0 A;  4BIU A;  3AG4 B;  1M90 W;  1VQ8 V;  4LC1 A;  1VQ6 V;  3TK1 A;  2XAG A;  2IJH A;  2ZR2 A;  4P9O A;  3STZ C;  2WLH A;  2ZQM A;  2BOC C;  4GX2 A;  1SET A;  1WPX A;  2EZP A;  4XBF A;  5KUK A;  1M57 B;  1S5H C;  2IJJ A;  1EZJ A;  1B6Q A;  3CC4 V;  2HLD G;  4X8A A;  1NBM G;  3E83 A;  3FB8 C;  3CCU V;  3ZIA G;  5L3C A;  3UM7 A;  4MVS A;  3JCZ A;  1FXK B;  1K5S A;  2WLI B;  4QPJ A;  1BMF G;  4H37 A;  1OZ0 A;  1S3J A;  2XND G;  1GM8 A;  2Q6A A;  4MVU A;  4EKW A;  1R3K C;  1H8H G;  2WLI A;  3TCU A;  1KP2 A;  1V55 C;  4KFM A;  1QVF U;  5KA6 A;  5B1O A;  2ZDI C;  4MT8 A;  1OCO C;  3ASN C;  1DF5 A;  1JQ0 A;  3FKS G;  3ZRW B;  3CCM V;  1AJQ A;  4WFE A;  4BW5 A;  1NJI W;  1EBO A;  2JJ2 G;  1AI4 A;  3OGC C;  4FIP C;  1VQ7 V;  2DYS B;  3HB3 B;  1H8E G;  1KD1 W;  1K5Q A;  4PA4 A;  5B3S C;  1QR8 A;  2XAH A;  1W0K G;  1AJP A;  3IFX A;  2B5U A;  2OCC C;  4PDL A;  1NH2 B;  3K04 A;  3JD0 A;  1TUE B;  3K0D A;  1YI2 V;  1QVG U;  1DTO A;  3LDC A;  3QO8 A;  3OR7 C;  1PD3 A;  5L3F A;  2P7T C;  3OM3 B;  1E1Q G;  1VQO V;  3OUS A;  5IY5 C;  3DGE A;  1J95 A;  2YEV A;  5HFL A;  3ZRV A;  1VQ9 V;  1NH2 D;  1MAB G;  2Q69 A;  5IY5 B;  3VBB A;  1PNL A;  1H2G A;  4U7N A;  3OEH G;  2LFS A;  2QKS A;  2Z3Y A;  3SYP A;  2HKO A;  3W7T A;  1P7B A;  3ZRW A;  4RQF A;  1KEC A;  1F4M A;  4BIZ A;  3I56 V;  1QLE C;  1CPY A;  2QM8 A;  4LP8 A;  5DM6 V;  1GTO A;  1QLE B;  3ABK B;  1R3J C;  2W6I G;  1ORQ C;  1M1K W;  2B1G A;  1VQM V;  2WSS G;  3STL C;  1RPR A;  4DXW A;  4QE7 A;  1Q7Y W;  1Q86 W;  3ABL C;  5EBM C;  5LGT A;  4P2Z A;  4MTO A;  4R6Z A;  4J9Z B;  1YJW V;  1YJ9 V;  3MHS C;  2Q67 A;  2WWW A;  3CCR V;  2X0L A;  4RUF A;  1FS0 G;  3ASO B;  1H38 A;  1ROP A;  1WLE A;  2BOB C;  1K9M W;  4MVQ A;  1RM1 C;  2JEU A;  1R3I C;  2ITC C;  5LHG A;  2HG5 C;  4WCE V;  3W7W A;  2B1I A;  1OCR B;  4MTF A;  1JPX A;  1GM9 A;  5LHH A;  3CCV V;  3E89 A;  3SPC A;  2ZXW C;  2P6J A;  1BL8 A;  2EIM B;  1K7D A;  3K0G A;  4JAV A;  2DQ3 A;  1V54 C;  4Z1M G;  4G2K A;  1QCE A;  1SRY A;  2DYR C;  2V1D A;  1F4N A;  4FJC C;  1NVP D;  3AG1 C;  3AG1 B;  3P30 A;  3LNM B;  5KA5 A;  1MSW D;  5LHI A;  4FMT A;  2R9I A;  2X6A A;  2JEX A;  4JTC B;  1K33 A;  1OCO B;  3ASN B;  2IJI A;  1R6N A;  2FTK A;  3FB5 C;  3RVY A;  2V7Q G;  2EIN C;  1Y4M A;  3WG7 B;  4RUE A;  3CCJ V;  3CCL V;  2D3O W;  4P30 A;  1NVP B;  3FB7 C;  3CPW U;  2DWD C;  5EC2 C;  4F4L A;  2HFE C;  4FPP A;  2X7R B;  3QO7 A;  3G6E V;  1GMG A;  3LSQ A;  3WFV A;  3CCE V;  3ZMS A;  4JYB A;  4L87 A;  4CZZ A;  4I5S A;  4WFB V;  3ASO C;  1VQN V;  5L3E A;  3K79 A;  2WLN A;  4CBC A;  1F51 A;  3F7Y C;  3OE7 G;  1K4D C;  4JF3 A;  5EBL C;  1MG1 A;  1K73 W;  3W7S A;  4QE9 A;  4TT3 G;  3OUF A;  3OW2 U;  5EK0 A;  4BAY A;  1F23 A;  4LBE C;  3W7X A;  4FK5 C;  3ETE A;  3D36 A;  1KKD A;  1GKF A;  2EIJ C;  2YSU B;  3RW0 A;  5L3G A;  5E1A C;  1R3L C;  4UV9 A;  3CME V;  2XAF A;  2CK3 G;  3ZN1 A;  4PA9 A;  3T2M A;  2EJR A;  4GCZ A;  1YTF D;  5IDJ A;  3OAA G;  1QLN A;  4GX5 A;  2W6J G;  5EC1 C;  2WLJ A;  3W7U A;  3I55 V;  2AHZ A;  3GB7 C;  1M56 C;  2H94 A;  5L3D A;  4N23 A;  3HPL C;  4PA7 A;  4GT1 A;  3ZMT A;  4WFF A;  5CBH A;  3OEE G;  3B77 A;  3PJS K;  4UVB A;  3FYE B;  5CA3 A;  4G28 B;  2QE7 G;  1VQP V;  3ZN0 A;  5B1B B;  3WG7 C;  5H9C A;  1CEZ A;  1JJ2 U;  1PL0 A;  2A79 B;  4JTA B;  3K03 A;  2XAJ A;  4UVC A;  4OXS A;  4GX1 A;  2QEX V;  2EIL C;  2EIL B;  3ABM C;  4R50 A;  3AG3 B;  1AI5 A;  3BEH A;  1OCZ C;  2WAM A;  3IC7 A;  4UXN A;  4PDM A;  5B1B C;  1YIJ V;  1R6K A;  4P9P A;  1YIT V;  3X2Q B;  2ATK C;  4N21 A;  2ZXW B;  1OHH G;  4KP4 A;  3FYI B;  4ZKI A;  2QA4 V;  1FXV A;  3B8N A;  1RM1 B;  1XL6 A;  3MHH C;  1S77 D;  3SPG A;  1M56 B;  1CP9 A;  1COW G;  3QO5 A;  1OCR C;  3CP1 A;  3K06 A;  2IU3 A;  3UKM A;  4QPK A;  1SES A;  2IH3 C;  2EBO A;  4UUJ C;  1YHQ V;  4MSW C;  1YTF B;  5IYC O;  4ZBM A;  2H8P C;  3JYC A;  4JGS A;  1GM7 A;  1R73 A;  3F7V C;  1FFT B;  2EIK C;  3K3W A;  1JOY A;  3SJQ C;  4XDJ A;  4JPR A;  1AI6 A;  4RQE A;  1XL4 A;  4WFG A;  1S76 D;  2EIJ B;  3AG2 C;  1SZT A;  4MVZ A;  3ZJZ A;  5LGN A;  1BHB A;  5FL7 G;  1AI7 A;  4DO2 A;  2QM7 A;  3LUT B;  5LBQ A;  4JAS A;  4PA3 A;  3ABK C;  1W2B U;  2WLL A;  3JD4 A;  3QNE A;  3D3I A;  1FXK C;  4JAU A;  3ETD A;  3ZMU A;  1PNM A;  2MK3 A;  4TWK A;  4G27 B;  3A0R A;  5GW7 A;  2ZDI A;  3NXS A;  3DTU B;  2A0L A;  5B1A B;  3ZMV A;  2LP7 A;  1Q82 W;  3LDD A;  1K97 A;  2EIN B;  4XDL A;  3AG2 B;  4TSF G;  2Y48 A;  2WLK A;  1QR9 A;  3F5W C;  1DF4 A;  4MW8 A;  4MVR A;  1VQL V;  2EIK B;  3K9A A;  2HVJ C;  4HYO A;  1I5Y A;  2P67 A;  3EHB B;  1AR1 B;  2OTJ V;  2DQ0 A;  2JDI G;  1ARO P;  1BHA A;  1KP3 A;  5CMU A;  2WLL B;  4GX0 A;  3SPH A;  2IJK A;  1PKX A;  3CD6 V;  4HAM A;  5B3S B;  1NR7 A;  2NNU A;  4J9Y B;  2DYS C;  3SPJ A;  1AJN A;  4LCU C;  5BZB A;  3RVZ A;  4MTX A;  1OCZ B;  5IYD O;  1FXK A;  2M7W A;  5H6R A;  4WFH A;  3ABM B;  4PDV A;  1K34 A;  3SYO A;  3CCQ V;  3VOU A;  3M99 B;  5H6Q A;  1MOF A;  1YSC A;  2EZO A;  4I9W A;  3SYC A;  3OMI B;  5CBG A;  3ABL B;  1NQT A;  1JX9 A;  4MVO A;  1YJN V;  4KUM A;  3TET A;  4PDR A;  1V55 B;  1ENV A;  4Q20 A;  4WF9 V;  1I5X A;  2UXN A;  3ETG A;  4ASU G;  1E1R G;  1FXH A;  5B1N A;  3SYQ A;  3CYO A;  2GHY A;  3X2Q C;  2QTO A;  1P4R A;  2HVK C;  1L1F A;  2HR3 A;  3T1C A;  5LGU A;  1K92 A;  3LSS A;  1E79 G;  1M57 C;  3K08 A;  4MS2 A;  2IW5 A;  3JD3 A;  3GWO A;  5IYB O;  1RPO A;  3CC7 V;  2K1E A;  2Z5U A;  3MD0 A;  5J9P C;  2XOK G;  1K4C C;  1NKD A;  4QNH B;  3ZMZ A;  1N8R W;  1LNQ A;  2HJF C;  1IXM A;  4HZ3 A;  5B1A C;  3KG2 A;  1GO3 F;  2ZD9 A;  4RO2 A;  3EFF K;  1QBZ A;  3T4D A;  2PI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...