1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Envelope glycoprotein
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
3B77A 1F23A 1Y66A 3K9AA 1ENVA 1DLBA 3MHHC 1DF4A 3MHSC 3B8NA 5HFLA 1JPXA 3CP1A 1K33A 4JF3A 1QR8A 3GWOA 5HFMA 5KA6A 1MOFA 4JGSA 5H9CA 4FK5C 2MK3A 3M99B 4N21A 1QBZA 1Y4MA 3CYOA 2X7RB 2OT5A 1JQ0A 3H01A 1EBOA 3P30A 1QR9A 1QCEA 1DF5A 2EZOA 4JPRA 5CN0A 1I5XA 2LP7A 1SZTA 4E2LA 4G2KA 2EBOA 5KA5A 4N23A 5CMUA 2EZPA 1MG1A 4FJCC 3WFVA 1K34A 1I5YA 3B8MA 2M7WA 2P6JA 4FIPC
chains in the Genus database with same CATH superfamily
2X6AA 1ZSPA 4JI3B 4NXNO 4DV2B 3ZMSA 1Y4MA 1U97A 2OTJV 4LFCO 4FM1A 3JAMN 1NH2B 5IT9N 1H2SB 5KHJA 4NTXA 4DW0A 5IYZA 1TAEA 2CTWA 3AG3B 4O2BB 2YEVA 2VQEB 4BR6A 4Z1MG 4DV3B 2FL4A 1Q90D 3MHHC 1N34B 3AK2A 3CHXA 3ABKB 1W0JG 3FB8C 3VBBA 2WLIB 2Q67A 3EXAA 4J10A 2UUAO 1AP5A 4P30A 3WB2A 3ABMB 3ABUA 2QR4A 3J80N 1VP7A 2X6BA 1H2NA 2IW5A 1FKAO 2Y69C 2BOCC 4Q6GA 4TSFG 4DUYO 2LGWA 4DK1A 1SQFA 2CTQA 5CA0A 3L71H 2IH3C 1S77D 2JS5A 4PHZA 1UJWB 2D2CB 3JARB 3AG1C 3ZBHA 4YJ3B 3A2FA 1OZ0A 2BTQB 4DV6B 5KHKA 5EK0A 1K92A 1IURA 3RN4A 2HVKC 3JD3A 2VRZA 2Q0AA 1Y76B 4D6TH 2Q6AA 1DF4A 3EHBB 3CWBH 4TV8A 4DV5O 3SJBC 3WG7B 3HPLC 2DYSC 1E79G 2DYSB 2CTPA 3E8BA 4DYLA 2PYJA 1SETA 1NZ6A 2LQTA 3K9AA 3D3IA 3UKMA 2IU0A 5LA6A 2NLJC 5K1XA 4DV4O 2Y48A 1FJGO 4UCRA 3ETGA 4D7SA 3DSQA 3IGAC 3ZN0A 4CS2A 3SYCA 4CH6A 2KKWA 4GX1A 5CA0B 3BAAA 3MDSA 2OYQA 4FFBA 4I55B 3E8GA 1JVMA 4PELA 2DWDC 4K0KB 3DC5A 1R6NA 4UVAA 2Y4UA 3OFNG 4WBNB 3CCJV 1VQ4V 2Y69B 5JH7B 1BHAA 1R3LC 4XDLA 1H2KA 1WB8A 3CC7V 2DW4A 5F2VO 5LP6A 3B8NA 4B7KA 1VQLV 1V55B 3DTUB 4OX9O 2B9ZA 1EBOA 3K5NA 2ZXWB 4U3FH 1K7DA 3LUTB 1V55C 4O2AB 1SA0B 1OV9A 2N74A 3SJCC 3LDDA 3CC4V 4UCSA 1SESA 4JASA 2Q73A 1Y66A 4WFBV 4NTWA 4X1YB 2GUZB 3BY6A 1XI1A 4LF9O 3FYIB 1VIBA 2UUAB 3LDCA 5CBGA 2AGAA 4LF8B 1TUBA 3DXRB 3RVZA 1Q8IA 3X2QC 2EJ7A 4GKJO 4NKGB 3BRCA 3FKSG 1X59A 5CBFA 1Q81W 4KHPB 4TT3G 3RYFA 1ZLZA 2H94A 1P7GA 3RYCB 1T5EA 4JTDB 4I9WA 1HNZB 4YJ2A 1SERA 4TQFA 1XOUA 4LH6A 4U3JA 3JASB 4GYCB 2W0XA 1R1BA 4QE7A 4R7CA 1ZWIC 2G38A 1XEQA 3QG5A 3CRAA 4IYHA 1NVPB 4DV3O 4GX0A 3SPHA 3JCZA 4LWSB 4X89A 1SKVA 3SYAA 1XNRB 1LUWA 4PA4A 5L3FA 1JQ0A 4GX5A 1QU7A 5ITZB 1VQOV 1M56B 3ZHVA 5JJJB 2WPDG 3LSQA 3ZS8C 4LF4O 3MD0A 1K9MW 5EYPA 2ZD9A 1SQPH 2N04A 3HKCB 2ZKOA 3ZMZA 4PDVA 1F4NA 4UCVA 3RVYA 1RFYA 4NB5A 3JD1A 4DR6O 2WLLA 2WLIA 4MSWC 1IBKO 1NU1H 4UCOA 4YY3O 2UUBB 4HBNA 2P22C 2HJFC 5KHGA 3CE2A 3JCUZ 1NQTA 4PDRA 1EZJA 4JGSA 1FXKB 1NKDA 4WFFA 1Y67A 1W2BU 4CH5A 4X1KB 2XT9A 4U7OA 4WFHA 4X88A 1SQQH 3L73H 4E2LA 4JYYA 3OE7G 3CPWU 1VQ7V 1I94B 4FLXA 3STLC 1NJIW 1YF2A 3PJSK 5EIBC 5DEDA 3E83A 4CH4A 1YHQV 3JD2A 4O4IA 4PA9A 1I7FA 5LYJB 2WLJA 3ZN1A 3FX7A 2A79B 2EULA 3BVOA 4J9ZB 4LNUB 2GTSA 3VQYA 4K3AA 2EINB 1YTFB 4B3TB 5C8YA 4LFBO 4WBNA 4DR1B 5B1AB 2QKSA 1H38A 3CS5A 4DV1B 4JI7B 3ZJZA 1JPXA 4JF3A 1K5SA 2EIMB 1R3IC 4MW8A 4GKKB 4J7KA 4O4LB 3OR6C 3P30A 2JGUA 3GVMA 4E4EA 2E76B 3SJQC 4XBFA 1XMQB 4HNAA 3VQXA 5D5PA 2CAZC 1YITV 4EKWA 2R9RB 1YIJV 3ABLC 1CXZB 2F23A 3SJAC 4B3MB 2M6YA 1BL8A 3CMEV 5IY5B 3NR7A 2WSSG 1H2GA 5GONB 2JEUA 2JRIA 4U7NA 1UPGA 1IBLB 4DV0B 4B3SO 1SQGA 4LF5B 3ZMUA 2F66C 3HKDA 4LF7O 1WLEA 1R3KC 1KYOF 2NR5A 1RM1B 2PI4A 3T4ZA 2OWOA 5L3BA 5LL6Y 3G6EV 4TV8B 2L6LA 4J7JA 1Y76A 1G8MA 4DUYB 2ZIOA 2DJVA 3N2GB 4WFAV 4H37A 3WG7C 1E1QG 1YJ9V 1XBLA 5JCOA 1WPBA 3N27A 1FFXA 1XUQA 2DQ0A 1MSWD 1KECA 2RNBA 2QWOB 3CCUV 5B1AC 3W7TA 1NR7A 3J7AU 4EEQA 5H6RA 1S0VA 4JI4O 4GZRB 4LF9B 2ZNJA 3ZHQA 3E2EA 1JOYA 1CPYA 4PI0A 2R70A 2VS0A 3AG3C 3QF7A 1WN7A 2IJIA 2VQFB 3R66A 1SA0A 4EFEA 4DR6B 5A2QN 5KMGB 1YJNV 2IM9A 4AHCA 1BS3A 1K8AW 1LUVA 4JI2B 4TQDA 2OIEA 4J11A 1QHTA 2FMLA 4DXWA 1SC5B 2Q69A 4ZI7B 2AZ0A 1ZAUA 5JWPA 2M7WA 4FIPC 3ZHUA 2UXBB 1QQCA 4KP4A 4BIZA 3H1IH 4J80A 3OW2U 2LW7A 4X8AA 1OCRC 3AG4C 3K79A 5J2UA 5E1AC 3LNNA 4JAUA 2QA4V 4JYBA 1X4TA 3JSNA 3UT5A 5LOVB 4RQFA 1M93A 4KXRA 4BWAA 3CCVV 1OCOC 3NXSA 3DC6A 5KLVH 1L1FA 2DOSA 5BR8B 3APOA 1I0HA 4FK5C 2B1IA 1DGSA 1QBZA 1Z5WA 2OIGA 3QO7A 1Q6HA 3WB1A 4GT1A 4DRXA 4KUMA 2YXYA 1KUQA 3ETEA 4LFAO 3TGUH 2HFEC 4DV1O 5LGUA 3RYIB 5JCOC 4JI7O 4UVCA 1F23A 1JR9A 1U96A 2PY5A 3W7UA 3EFFK 4OXSA 1F51A 1KD1W 1BHBA 1BMFG 2O57A 2F4VB 3GB7C 3HR0A 3F5TA 1XNQO 2K1EA 2AXTZ 4FM2A 1P4RA 3OTOO 5GTIZ 3ZHTA 2KSDA 3T2MA 3HKDB 2GTAA 3OEEG 3ZEDA 4MTGA 1GO3F 2FYUH 5CBHA 1IVSA 1H2MA 4UCUA 2JK5C 4QIWF 1GH6A 5LHGA 1VQ6V 4QJFB 5LXTB 2WWWA 2EZPA 5FNVB 2X6CA 2BCCH 1FFTB 2ITDC 3OAAG 2A06H 1XHZA 5IWAB 2P6JA 5LHHA 3OD4A 3CJHB 2OTLV 2CK3G 2QE7G 4AI8A 2UXCO 4RUEA 3L75H 2C2AA 3SPJA 3BA9A 4W4KA 3VQVA 3H01A 3K59A 3K5MA 1EN4A 3CXHF 4MT8A 2KG7B 1XNQB 4GKKO 1VQKV 1RSOA 5CN0A 4PI2A 3I56V 2OCCB 3O65A 3THOA 2DYRB 4PA3A 3WU2Z 1AR5A 1JFFA 4ASUG 1Y74A 1CP9A 2HVJC 3BPZA 3OM3B 5KA6A 4UCTA 4I7ZB 1M5IA 1DK1A 2E74B 2OT5A 5B66Z 3B09A 2YUAA 1GN6A 5BMVA 2Q7EA 5IYDO 1FXKC 1Z5VA 3CJHA 4I50A 1TGOA 1OCCC 4WFEA 1AB3A 3MAQA 3K04A 3Q4HB 5B1NA 1PL0A 2N05A 1JMKC 1RPRA 3SPGA 2UXDO 2Y4TA 4MVMA 4YHHB 4DV2O 1FXKA 4C7UA 1PKXA 4MVRA 4R8CA 4LFCB 3UO2A 2ZM6B 1PNKA 2E3CA 2ETNA 1EN6A 3DGEA 4MVOA 1VF6A 1KKDA 2W0FC 2EIKC 3G4SV 1M90W 2B5UA 4DV6O 2XHBA 3PN1A 2ITCC 1N34O 4X65B 2IJJA 2AHZA 2Q4PA 2ADQB 2RQ6A 4RWUA 5EZYB 4DR4O 1K4CC 3K0GA 3ML0A 4UUJC 2FTKA 2JEXA 2KQXA 4GKJB 4O4IB 2CDYA 1N36B 4LC1A 3W7WA 1HR0B 4PDLA 1AILA 4K35A 3SYOA 2UXDB 1US6A 4P9PA 1XREA 4DR5B 1F4MA 4P2ZA 1MOFA 1HNZO 4QPJA 5KAIZ 2H8PC 3E22B 1DF5A 5JJEB 1PNLA 3AG1B 1K3EA 3ZIAG 2WLMA 1QVFU 2ZE5A 3K5LA 2WLNA 2QKAA 2P06A 4DV4B 4MTOA 2QM8A 3FAVB 5IJ9A 1Q6IA 1NI8A 4GUNA 1QR8A 4JI1B 1KQSU 1B6QA 1YEWA 2WAMA 4FFKA 4IT5A 4IIJB 3U11A 1Y74B 4LF4B 3I55V 4JI0B 1N36O 4F6RA 3D3QA 1XQ8A 1AJQA 5KUMA 2XTAA 2QSAA 1GN4A 3UM7A 2CGOA 1YXBA 1L0LH 4BW5A 1PNMA 5H6QA 1XILA 3H9VA 1XHXA 2Z0AA 4DR2O 3S3WA 4YIOA 2ZDIC 2ZQMA 1NBMG 4FLWA 4X62O 1OCZB 3SPIA 4PA6A 2P5OA 1IXMA 4IYIA 3P3NA 4FZ1A 4OX9B 1D2DA 1I08A 2K9PA 3ZCCA 2UXXA 4G28B 2AZ2A 1OCZC 4O4HA 1NTMH 3W7SA 3CCMV 1I5XA 1FJGB 1I5YA 1Q43A 3QTCA 2ZINA 3RBZA 1IX9A 1FFXB 4IIJA 1AI7A 3ASOC 1K4DC 2ODMA 4UVBA 4LF6O 4DR7O 4X1IB 1PV0A 1FXVA 3K08A 4LF8O 3I5DA 4WCEV 1VF6C 4PD4F 4FFBB 4I55A 1HNXB 1AI4A 4XDKA 2XNDG 2F1MA 1Q86W 1SRYA 4L8JA 1YTFD 2Q8VA 2VQFO 2Q7HA 3LDEA 1JX9A 3SYQA 4ZBMA 2CH7B 5LP6C 4X66O 3RGBA 4F4LA 4H13B 4NR1A 3A8TA 4AILC 1G6UA 1VQNV 4B08A 3K06A 3G67A 3U10A 2P4VA 3H1LH 1IZ3A 5FL7G 5IY5C 5CB4A 3FB6C 4Z2WA 2YICA 5KHIA 4DR7B 4LF6B 1HP8A 4DR4B 4W4LA 1TA8A 3J81N 2ARHA 3K0DA 4WF9V 4MVZA 2ZR3A 2LP7A 1HR0O 5LHIA 5B3SB 4LCUC 3N2KA 1SQVH 5TISZ 2EILB 3CD6V 4DO2A 3E8FA 4JI3O 4NXNB 3SGIA 4H33A 2BE3A 1BQZA 5BR8O 1EM1A 1QLEB 4X64O 1VQ9V 4OGQB 2BTOA 4O4HB 1P84F 2Y0PA 3ZMVA 4YHHO 2IJHA 1GMGA 4JYCA 4UXNA 1AR4A 2VQEO 3D36A 3T1CA 3ETQA 4FLZA 5L3GA 4WFGA 2ZE6A 1DLBA 1W0KG 1M57C 4JI4B 2UXNA 3ABMC 2W6JG 3HB3B 3KCXA 5LBQA 5CA1A 2GV9A 3B40A 2UU9B 2CTRA 3CCEV 3JASA 4DW1A 1BQ0A 2CUGA 3F7YC 1I94O 5J9PC 1IXBA 1VQ8V 1J5EB 1VQMV 1RSOB 1S76D 2XAQA 3CX5F 4IGGA 3LSSA 1SS3A 3CCRV 2YXHA 5GTHZ 3TXQA 1YZBA 2VWKA 2LW1A 2HEPA 3E89A 4ZOLA 2GDSA 3OMNB 2PYLA 5IJ9B 1K34A 2BSKA 2JGDA 2UXBO 3FB7C 4X1YA 1K33A 4MW3A 2HHHB 5H9CA 2E5LB 1QVGU 5EC2C 1W59A 2UU9O 2QDOA 3ZRXA 1RP3B 5DECA 4JI1O 1WAZA 3ZRVA 5LGTA 2FB5A 3G71V 4XDJA 1BE3H 3O9OA 4IL6Z 4I0XA 5LMUO 3D36C 5J2UB 4O4JA 4CZZA 1B3QA 3B4SA 1ENVA 1AI6A 4TOIA 5IJ0B 3M8AA 5D5QA 4RQEA 3L9DA 4UFZA 3CRQA 1Y6XA 4YJ2B 2GSMB 1HWYA 2YS8A 1COWG 5KX5B 4DUZO 3K9SA 5EZYA 3APQA 3S3XA 2ZR2A 1QLEC 2EZOA 1GM8A 4J41A 3IJ4A 2EBOA 2YIDA 5B1OA 4JI8B 1EFRG 4H44B 1JA8A 5C8YB 1S5HC 4PV1B 5KMGA 4HZ3A 2PI5A 1Q3EA 4I0XB 2HHHO 1KB9F 3GWOA 1ZL8B 1H8EG 2QM4A 3SPCA 5CB4B 5EBMC 4RUFA 5EBWC 1GN2A 2H3OA 2WA4A 3OTOB 5EIBD 3ZX6A 1B06A 3Q4HA 2P4KA 3ZRWA 2XAFA 1QNMA 4O2AA 1THZA 3E8HA 2GHYA 3HKEB 4JTCB 2QM7A 4NXMO 4ZOLB 1WA8B 4B7EA 3SYPA 2DQ3A 1JFFB 4TWKA 1AVMA 2OCCC 5CA3A 3CRCA 3ASNB 3BABA 4PDMA 1MMMA 3N2GA 4JV5B 3B8MA 1B04A 3BFRA 3E35A 4J42A 4TUYA 4F6EA 4LF7B 2UXCB 4Q20A 3U0ZA 4PA7A 4QE9A 4EFBA 4X64B 3TJTA 5KAFZ 1ZUQA 2R9IA 1O9HA 3IAYA 4FMTA 3ASOB 1PM9A 2QJ1A 3H1KH 1KC8W 1SF9A 3HKBA 1K97A 1WNSA 4YJ3A 1N33O 3JARA 1FYJA 1OCCB 3AG2C 2DN9A 5LXTA 1MNGA 2JJ1G 1R73A 2AHYA 1NTZH 3IFXA 4ZHQA 5CMUA 5H2FZ 2IU3A 2RCVA 4MTFA 4O4LA 4NVPA 1K73W 3D8CA 4RAIA 3KKYA 4JYAO 1WP8A 1ORQC 2IH1C 3ETDA 2F93B 2XAGA 2YI9A 2Y0IA 4ICGA 3L72H 4LNUA 4I9QA 4LFAB 3RYIA 2P67A 1E1RG 3T4DA 4JI5O 1M9NA 1KU9A 3JALB 1JJ2U 1XL4A 3FAVA 3OGCC 3HKEA 2QWRB 1HW7A 3E86A 2RDCA 3ZRWB 4L87A 3RYHA 1GM7A 2GUZA 4FVMA 2CH7A 1K5QA 5IYZB 5KHHA 1VEWA 4LP8A 1MZEA 3E22A 1L0NH 3UT5B 5LOVA 1SQBH 3CRRA 3CP1A 3T1YO 1J95A 2A9HA 2QWNB 2YIBA 1LNQA 2EIJC 4J7ZA 2LGQA 1FD9A 4KFMA 3ABLB 1V54B 2RN9A 3CCLV 3TETA 1P49A 3JD4A 1F7YA 1FAFA 4X1IA 1KMIZ 2PUSA 4DV0O 5EC1C 3JATB 2XASA 1GTOA 4ZI7A 2YIAA 2WLLB 4BAYA 2QWPB 1O9GA 3CCQV 1H2LA 3LNMB 2MW2B 3F7VC 3JAKA 1YVWA 3CRMA 3M99B 2CGNA 4A5UB 2ILMA 4UV8A 4JI6O 4RO2A 3RT3C 3VOUA 3B2EE 2F4VO 1BGYH 1NT2B 4N23A 4JAAA 1WB7A 2KB1A 1N8RW 5LMUB 1Q5OA 1Q7YW 4UB8Z 4H0LB 5HFLA 4LWSA 3QO8A 5JQGB 4NXMB 5A9GA 2LFSA 2BSKB 4K0KO 2JIZG 5LA6B 3AK1A 4B3TO 4LBEC 4JV5O 2Z5UA 1M57B 2WLKA 3AG7A 1R3JC 3P3PA 2IBZH 2OCHA 1V9PA 2DMXA 2ZNIA 2A0LA 1LR1A 3RYFB 5LGNA 4R6ZA 2F43G 2AW9A 2XUMA 2Q7GA 4TV9B 3FYEB 2ZM6O 5FPRA 5IYBO 5B3SC 1VQPV 1TUEB 4JI2O 3ZHSA 2PGGA 3EVKA 2EILC 1ROPA 1RPOA 3BA8A 3A0RA 1BT8A 2B1GA 5GONA 4MVQA 5CA1B 5IYCO 4B3MO 5B1BB 2Q5ZA 2Q68A 4YIPA 1HDJA 3H1HH 1AJNA 2V4DA 1KBHA 1N0NA 4BIUA 2HJDA 1IBLO 5FNVA 2EIJB 2RMKB 5BXZA 1BCCH 4DV7B 5IE9A 1GRJA 3F5WC 4QPKA 3K03A 4LH7A 5J2TA 4FLUA 1KKCA 2V7QG 2NNUA 2RJZA 3RWRD 3HKBB 3KCYA 2LJ2A 5IDJA 4EB6A 3OT7A 1IBKB 1L8DA 1ZL8A 1RM1C 1D5AA 4CC5A 1AI5A 1QCEA 3G80A 1HNWO 3A0BZ 1YI2V 5JH7A 1ZX3A 1H8HG 3UQ8A 2VWJA 1M1KW 1MSDA 1JJOA 1FXHA 2A7WA 4HAMA 4CC6A 5C93A 2JS3A 1TUBB 3DXRA 4MTXA 2YXLA 2UUCB 3CXCU 3A0HZ 1BZKA 5KX5A 4FM0A 4I4TB 4NTYA 2HG5C 2X0LA 4EB6B 3R65A 1XL6A 4X65O 5LYJA 1WA8A 5IJ0A 4P9OA 5FLXN 2YC0A 5B1BC 5J2TB 1N0JA 2ZCEA 4DV7O 4O4JB 1YDXA 1N4CA 3QNEA 1EN5A 2IJKA 2PF4E 1GK9A 1N32B 1JCHA 3C3SA 1S5LZ 3K57A 4O2BA 5DN6G 1PD3A 2ADPA 4GCZA 4I50B 4X1KA 5BY1A 4DR2B 5L3CA 5BMVB 3CCSV 4DUZB 3TK1A 3SR2C 5LP6B 5JVDB 5L3DA 3ZMTA 3UO3A 3AG2B 4I4TA 4LFBB 3BHPA 4MVSA 2R72A 5LMNO 5EBLC 3AK3A 4FZ0A 5B5EZ 4TV9A 4BIOA 4BW9A 3TCUA 4ABMA 1OHHG 3ABKC 5K1PA 2XOKG 4LR3A 4JI6B 2KG7A 4QNHB 4B3RB 2E75B 2QWQB 4QGPA 4FLVA 2A3QA 3OTFA 3M7MX 5JJNB 3FB5C 3JAWB 2D3OW 1TVKA 4ZHQB 1N32O 1WP7A 5EYPB 2BTQA 2XAJA 4IHJB 1R6KA 2QEXV 3HKCA 4FLYA 1Q82W 1NVPD 2WA3A 1AP6A 5FPOA 3OUFA 4DV5B 3OMIB 1OJHA 3RW0A 4CH3A 5ITZA 2X7RB 2QTOA 4ZKIA 2YDEA 1GKFA 3CC2V 1NTKH 1HNXO 3K3WA 2PZSA 4B3SB 1CEZA 1M4UA 3GWKC 3JYCA 3OUSA 2EJRA 2ZDIA 2P7TC 4YXWG 3CEIA 2JGDB 4DR1O 2P90A 2Q9LA 4U3JB 4MS2A 4X62B 4X66B 1G4YB 4X9QA 2Z3YA 4IHJA 1G1XB 3C90A 3FFQA 1NH2D 1V54C 2Q0OC 3JAWA 3IC7A 3X2QB 1MG1A 1XMQO 4K8ZA 4GLXA 4F6RB 3MHSC 3RFRA 2YIBD 2WLHA 3G6BA 2MK3A 4N21A 2L35A 1P7BA 2YEVB 3STZC 1S5JA 3ZHRA 1QLNA 4G2KA 1VF5B 1PP9H 4JI8O 2HLDG 5KUKA 3WFVA 3WB0A 5IWAO 1VQ5V 4DR3O 2ZXWC 3AG4B 1FPOA 4Z1VA 3RYHB 2JJ2G 1NS1A 1YSCA 4DR5O 2W6IG 3AEIA 1URFA 1HNWB 3IC9A 1QR9A 2ZT9B 3QO5A 3JALA 3ZRSA 3VQWA 1GAXA 3CSXA 4YY3B 3CMAV 4HNAB 2UUBO 4FJCC 3OGIB 4GX2A 3JAKB 1TVKB 2UUCO 1MA1A 5DM6V 4JI5B 5GW7A 2HP8A 5H5NA 3JATA 3N2KB 1WPXA 4OPHA 2HR3A 1XMOB 4JZGA 4FPPA 1IBMB 3H1JH 1Z2GA 3C3TA 2EIMC 2DYRC 3OMAB 2V1DA 1J5EO 1MZFA 4JI0O 2EIKB 1SZXA 2ZIMA 4KHPO 3K5OA 1OCOB 1MABG 3B77A 3P32A 5JVDA 4I5SA 5HFMA 3T1YB 3L74H 2CE4A 3JSLA 1GN3A 4CS3A 2NN4A 1NR1A 1AR1B 5AG2A 1A32A 1SZTA 1VMGA 4FLTA 1UFIA 1VF7A 2DWEC 1XDCA 2QGNA 1S72V 2FKXA 1M56C 1N33B 2DE0X 3QVNA 2LO1A 3ABTA 2E5LO 3ASNC 3KZIZ 1XNRO 1SQXH 1XMOO 1R6TA 1AJPA 3JD0A 1IBMO 4K8XA 1FS0G 3T1HB 1YCIA 1VARA 1ZTEA 2HKOA 3SDLA 2XAHA 1Q6UA 5KA5A 4UB6Z 2QKCA 4AQYB 2GBOA 4JAVA 1AROP 4DK0A 5L3EA 4JYAB 4OPAA 4PJ0Z 3LSUA 2LFRA 2YSUB 4D7TA 4JZ2A 2JDIG 3OR7C 2ZE8A 4J9YB 3KG2A 1KP3A 4X20A 2PTMA 3L70H 4LF5O 3BCCH 4JPRA 4CBCA 2QTSA 1IDSA 2BOBC 4X20B 5BZBA 4MVUA 5JQGA 5LMNB 3CB2A 3FD9A 3CYOA 1D5NA 3T1HO 2ZE7A 3TXSA 1GM9A 3OEHG 3UCSC 2R9AA 4B3RO 4ZIBA 4G27B 2EINC 4AQYO 4CS4A 5E79Z 2YI8A 1DTOA 4JTAB 1PPJH 4TUYB 1OCRB 1PL4A 1WJZA 1KP2A 1S3JA 3RYCA 2F95B 4KL1A 3BEHA 3K58A 2ATKC 3W7XA 1YJWV 2JVDA 1BSMA 4UV9A 4R50A 1EZVH 4NYKA 4DRXB 4DR3B 3ICXA 2EX3A 4HYOA
chains in the Genus database with same CATH topology
2X6AA 1RM1B 2PI4A 3T4ZA 5L3BA 3LDEA 1JX9A 3SYQA 4ZBMA 3G6EV 2A0LA 3ZMSA 1Y4MA 4F4LA 5LGNA 2OTJV 1G8MA 4R6ZA 2F43G 4WFAV 1NH2B 4H37A 3WG7C 1E1QG 1YJ9V 3FYEB 1VQNV 5IYBO 1VQPV 3AG3B 5B3SC 2DQ0A 3K06A 1TUEB 2YEVA 1MSWD 4Z1MG 1KECA 5FL7G 2EILC 3CCUV 1ROPA 5B1AC 1RPOA 5IY5C 3W7TA 3FB6C 1NR7A 3MHHC 3A0RA 3ABKB 5H6RA 2B1GA 1S0VA 4MVQA 5IYCO 3FB8C 1W0JG 5B1BB 2Q68A 3E2EA 1JOYA 1CPYA 3VBBA 2WLIB 2Q67A 1AJNA 3K0DA 4WF9V 4MVZA 4P30A 4BIUA 3ABMB 2EIJB 2ZR3A 2LP7A 3ABUA 5LHIA 3AG3C 4LCUC 5B3SB 2IJIA 3F5WC 4QPKA 3K03A 2EILB 2X6BA 3CD6V 2V7QG 4DO2A 3E8FA 2IW5A 2NNUA 4H33A 2Y69C 5IDJA 2BOCC 1YJNV 4TSFG 1QLEB 1VQ9V 1RM1C 3ZMVA 1AI5A 1QCEA 1GMGA 2IJHA 1K8AW 1YI2V 4JYCA 4UXNA 1H8HG 3D36A 3T1CA 2IH3C 4DXWA 1M1KW 1S77D 2Q69A 1FXHA 4HAMA 5C93A 2M7WA 5L3GA 4FIPC 4WFGA 1UJWB 1DLBA 4MTXA 1W0KG 1M57C 4KP4A 4BIZA 3AG1C 3CXCU 2UXNA 3ABMC 2W6JG 3HB3B 5LBQA 3OW2U 4X8AA 2HG5C 2X0LA 1OZ0A 1OCRC 3AG4C 3R65A 1XL6A 3K79A 5E1AC 3CCEV 4JAUA 4P9OA 2QA4V 4JYBA 5EK0A 5B1BC 1K92A 3F7YC 4RQFA 5J9PC 1VQ8V 2HVKC 3QNEA 2IJKA 3JD3A 3CCVV 1OCOC 1VQMV 1GK9A 3NXSA 1JCHA 1S76D 2Q6AA 2XAQA 1DF4A 3LSSA 5DN6G 3EHBB 1L1FA 1PD3A 3CCRV 4GCZA 4FK5C 2B1IA 1QBZA 3WG7B 3HPLC 2DYSC 5L3CA 3QO7A 3E89A 1E79G 3CCSV 3TK1A 2DYSB 3E8BA 4GT1A 4KUMA 5L3DA 3ZMTA 3AG2B 3OMNB 3ETEA 1SETA 4MVSA 1K34A 2HFEC 5LGUA 4UVCA 1F23A 3FB7C 3K9AA 5EBLC 3D3IA 3UKMA 2IU0A 3W7UA 1K33A 3TCUA 4MW3A 3EFFK 2NLJC 4OXSA 1OHHG 1F51A 5H9CA 1KD1W 3ABKC 1QVGU 2XOKG 2Y48A 5EC2C 1BHBA 4QNHB 3ZRXA 3ZRVA 5LGTA 1BMFG 3ETGA 3G71V 3GB7C 4XDJA 3FB5C 2K1EA 3IGAC 1P4RA 2D3OW 3ZN0A 3SYCA 3T2MA 4GX1A 3OEEG 4CZZA 2XAJA 1R6KA 2QEXV 1ENVA 3E8GA 1AI6A 1Q82W 1NVPD 4MTGA 4RQEA 1JVMA 3OUFA 1GO3F 3OMIB 2GSMB 1HWYA 4PELA 2DWDC 3RW0A 5CBHA 2X7RB 2QTOA 1COWG 1R6NA 4ZKIA 4UVAA 1GKFA 3CC2V 3OFNG 2JK5C 2ZR2A 1QLEC 2EZOA 3K3WA 1CEZA 4QIWF 1GM8A 5LHGA 3CCJV 1VQ6V 4QJFB 2Y69B 1VQ4V 2EBOA 1BHAA 2WWWA 1R3LC 2EZPA 2X6CA 3JYCA 4XDLA 1FFTB 3OUSA 2ITDC 5B1OA 2EJRA 2ZDIA 3CC7V 1EFRG 2DW4A 3OAAG 2P7TC 4YXWG 2P6JA 5LHHA 1S5HC 2OTLV 2CK3G 2QE7G 4RUEA 2P90A 3B8NA 4HZ3A 4MS2A 1G4YB 2PI5A 1VQLV 2C2AA 3SPJA 3GWOA 2Z3YA 1H8EG 3SPCA 1V55B 3DTUB 3H01A 1EBOA 1NH2D 2ZXWB 1V54C 1K7DA 3LUTB 4MT8A 5EBMC 1V55C 4RUFA 5EBWC 1VQKV 5CN0A 3I56V 3IC7A 2OCCB 3X2QB 1MG1A 3LDDA 3CC4V 2DYRB 4PA3A 1SESA 3ZRWA 2XAFA 4JASA 1Y66A 1THZA 4WFBV 3MHSC 4ASUG 1CP9A 2GHYA 2HVJC 2WLHA 3BY6A 3E8HA 3OM3B 5KA6A 2MK3A 4N21A 3FYIB 4JTCB 2QM7A 2OT5A 3LDCA 5CBGA 1P7BA 5IYDO 2YEVB 1FXKC 3RVZA 3SYPA 3STZC 1QLNA 2DQ3A 4G2KA 4TWKA 1OCCC 2OCCC 3X2QC 2HLDG 5CA3A 5KUKA 3ASNB 4PDMA 4WFEA 3WFVA 3FKSG 3B8MA 5CBFA 3K04A 1Q81W 4TT3G 3E35A 5B1NA 1VQ5V 2ZXWC 1PL0A 3AG4B 4Q20A 2H94A 1RPRA 4PA7A 4QE9A 3SPGA 2JJ2G 4MVMA 1YSCA 2W6IG 4JTDB 4I9WA 3AEIA 1FXKA 1SERA 1QR9A 1PKXA 3QO5A 4MVRA 3ZRSA 4R8CA 2R9IA 4FMTA 3ASOB 1KC8W 3CMAV 4FJCC 4GX2A 1PNKA 4QE7A 4R7CA 1ZWIC 1K97A 3DGEA 4MVOA 5DM6V 1KKDA 5GW7A 2W0FC 2EIKC 1NVPB 3G4SV 1M90W 4GX0A 2B5UA 3SPHA 1OCCB 3JCZA 3AG2C 4X89A 1WPXA 3SYAA 2HR3A 2ITCC 2IJJA 2AHZA 4FPPA 4PA4A 5L3FA 1JQ0A 4GX5A 1K4CC 1VQOV 2JJ1G 1M56B 3K0GA 2WPDG 3LSQA 3ML0A 4UUJC 1R73A 2EIMC 2FTKA 2JEXA 2DYRC 2AHYA 3OMAB 3IFXA 2V1DA 5CMUA 2IU3A 2EIKB 3MD0A 4LC1A 3W7WA 4MTFA 1K9MW 2ZD9A 1K73W 4PDLA 1OCOB 3ZMZA 3SYOA 1MABG 3B77A 3P32A 4PDVA 4P9PA 1F4NA 4RAIA 2IH1C 1ORQC 4I5SA 3ETDA 3RVYA 5HFMA 1F4MA 4P2ZA 1MOFA 2XAGA 3JD1A 2WLLA 4QPJA 2WLIA 4MSWC 2H8PC 1DF5A 1PNLA 1AR1B 1NR1A 1SZTA 3AG1B 1K3EA 3ZIAG 2WLMA 1QVFU 2DWEC 2P67A 1S72V 2WLNA 1E1RG 3T4DA 1M56C 2HJFC 1M9NA 3ABTA 3ASNC 2QM8A 4MTOA 1JJ2U 1XL4A 1NQTA 4PDRA 1EZJA 1QR8A 4JGSA 1AJPA 3JD0A 1FXKB 3OGCC 1KQSU 1NKDA 1FS0G 4WFFA 1B6QA 1W2BU 3E86A 3ZRWB 2WAMA 4L87A 1GM7A 4U7OA 4WFHA 2HKOA 4X88A 1K5QA 3I55V 4E2LA 2XAHA 5KA5A 1AJQA 3OE7G 3CPWU 4LP8A 1VQ7V 3STLC 5KUMA 1NJIW 4JAVA 3PJSK 1AROP 5L3EA 3CP1A 1J95A 2A9HA 3UM7A 1LNQA 2EIJC 2LFRA 2YSUB 3E83A 2JDIG 3OR7C 3JD2A 1YHQV 4PA9A 4KFMA 3ABLB 1V54B 4J9YB 4BW5A 2WLJA 1PNMA 5H6QA 3ZN1A 3CCLV 3KG2A 3TETA 1KP3A 2A79B 3JD4A 4J9ZB 2ZDIC 2EINB 2ZQMA 1NBMG 1YTFB 5EC1C 2XASA 1GTOA 4JPRA 2QKSA 2WLLB 5B1AB 4CBCA 2BOBC 1OCZB 4BAYA 1H38A 3SPIA 4PA6A 5BZBA 3CCQV 4MVUA 3LNMB 3ZJZA 1IXMA 1JPXA 3F7VC 4JF3A 1K5SA 2EIMB 3M99B 3ZCCA 1R3IC 2UXXA 3CYOA 4G28B 4MW8A 1OCZC 3OR6C 1GM9A 3P30A 4UV8A 4RO2A 3SJQC 3OEHG 4XBFA 3VOUA 3W7SA 3CCMV 1I5XA 4G27B 2EINC 4N23A 1I5YA 1DTOA 2KB1A 4JTAB 3RBZA 1N8RW 1YITV 4EKWA 2R9RB 1YIJV 3ABLC 1OCRB 1Q7YW 5HFLA 1AI7A 1KP2A 1S3JA 3QO8A 3ASOC 1K4DC 4UVBA 3BEHA 2LFSA 1FXVA 2ATKC 3K08A 3W7XA 1BL8A 1YJWV 3CMEV 5IY5B 2WSSG 4WCEV 1H2GA 4UV9A 4R50A 2JEUA 4U7NA 2JIZG 4LBEC 2Z5UA 1AI4A 4XDKA 1M57B 2XNDG 3ZMUA 1Q86W 1SRYA 1WLEA 2WLKA 1R3JC 1YTFD 1R3KC 4HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  1F23 A;  1Y66 A;  3K9A A;  1ENV A;  1DLB A;  3MHH C;  1DF4 A;  3MHS C;  3B8N A;  5HFL A;  1JPX A;  3CP1 A;  1K33 A;  4JF3 A;  1QR8 A;  3GWO A;  5HFM A;  5KA6 A;  1MOF A;  4JGS A;  5H9C A;  4FK5 C;  2MK3 A;  3M99 B;  4N21 A;  1QBZ A;  1Y4M A;  3CYO A;  2X7R B;  2OT5 A;  1JQ0 A;  3H01 A;  1EBO A;  3P30 A;  1QR9 A;  1QCE A;  1DF5 A;  2EZO A;  4JPR A;  5CN0 A;  1I5X A;  2LP7 A;  1SZT A;  4E2L A;  4G2K A;  2EBO A;  5KA5 A;  4N23 A;  5CMU A;  2EZP A;  1MG1 A;  4FJC C;  3WFV A;  1K34 A;  1I5Y A;  3B8M A;  2M7W A;  2P6J A;  4FIP C; 
#chains in the Genus database with same CATH topology
 2X6A A;  1ZSP A;  4JI3 B;  4NXN O;  4DV2 B;  3ZMS A;  1Y4M A;  1U97 A;  2OTJ V;  4LFC O;  4FM1 A;  3JAM N;  1NH2 B;  5IT9 N;  1H2S B;  5KHJ A;  4NTX A;  4DW0 A;  5IYZ A;  1TAE A;  2CTW A;  3AG3 B;  4O2B B;  2YEV A;  2VQE B;  4BR6 A;  4Z1M G;  4DV3 B;  2FL4 A;  1Q90 D;  3MHH C;  1N34 B;  3AK2 A;  3CHX A;  3ABK B;  1W0J G;  3FB8 C;  3VBB A;  2WLI B;  2Q67 A;  3EXA A;  4J10 A;  2UUA O;  1AP5 A;  4P30 A;  3WB2 A;  3ABM B;  3ABU A;  2QR4 A;  3J80 N;  1VP7 A;  2X6B A;  1H2N A;  2IW5 A;  1FKA O;  2Y69 C;  2BOC C;  4Q6G A;  4TSF G;  4DUY O;  2LGW A;  4DK1 A;  1SQF A;  2CTQ A;  5CA0 A;  3L71 H;  2IH3 C;  1S77 D;  2JS5 A;  4PHZ A;  1UJW B;  2D2C B;  3JAR B;  3AG1 C;  3ZBH A;  4YJ3 B;  3A2F A;  1OZ0 A;  2BTQ B;  4DV6 B;  5KHK A;  5EK0 A;  1K92 A;  1IUR A;  3RN4 A;  2HVK C;  3JD3 A;  2VRZ A;  2Q0A A;  1Y76 B;  4D6T H;  2Q6A A;  1DF4 A;  3EHB B;  3CWB H;  4TV8 A;  4DV5 O;  3SJB C;  3WG7 B;  3HPL C;  2DYS C;  1E79 G;  2DYS B;  2CTP A;  3E8B A;  4DYL A;  2PYJ A;  1SET A;  1NZ6 A;  2LQT A;  3K9A A;  3D3I A;  3UKM A;  2IU0 A;  5LA6 A;  2NLJ C;  5K1X A;  4DV4 O;  2Y48 A;  1FJG O;  4UCR A;  3ETG A;  4D7S A;  3DSQ A;  3IGA C;  3ZN0 A;  4CS2 A;  3SYC A;  4CH6 A;  2KKW A;  4GX1 A;  5CA0 B;  3BAA A;  3MDS A;  2OYQ A;  4FFB A;  4I55 B;  3E8G A;  1JVM A;  4PEL A;  2DWD C;  4K0K B;  3DC5 A;  1R6N A;  4UVA A;  2Y4U A;  3OFN G;  4WBN B;  3CCJ V;  1VQ4 V;  2Y69 B;  5JH7 B;  1BHA A;  1R3L C;  4XDL A;  1H2K A;  1WB8 A;  3CC7 V;  2DW4 A;  5F2V O;  5LP6 A;  3B8N A;  4B7K A;  1VQL V;  1V55 B;  3DTU B;  4OX9 O;  2B9Z A;  1EBO A;  3K5N A;  2ZXW B;  4U3F H;  1K7D A;  3LUT B;  1V55 C;  4O2A B;  1SA0 B;  1OV9 A;  2N74 A;  3SJC C;  3LDD A;  3CC4 V;  4UCS A;  1SES A;  4JAS A;  2Q73 A;  1Y66 A;  4WFB V;  4NTW A;  4X1Y B;  2GUZ B;  3BY6 A;  1XI1 A;  4LF9 O;  3FYI B;  1VIB A;  2UUA B;  3LDC A;  5CBG A;  2AGA A;  4LF8 B;  1TUB A;  3DXR B;  3RVZ A;  1Q8I A;  3X2Q C;  2EJ7 A;  4GKJ O;  4NKG B;  3BRC A;  3FKS G;  1X59 A;  5CBF A;  1Q81 W;  4KHP B;  4TT3 G;  3RYF A;  1ZLZ A;  2H94 A;  1P7G A;  3RYC B;  1T5E A;  4JTD B;  4I9W A;  1HNZ B;  4YJ2 A;  1SER A;  4TQF A;  1XOU A;  4LH6 A;  4U3J A;  3JAS B;  4GYC B;  2W0X A;  1R1B A;  4QE7 A;  4R7C A;  1ZWI C;  2G38 A;  1XEQ A;  3QG5 A;  3CRA A;  4IYH A;  1NVP B;  4DV3 O;  4GX0 A;  3SPH A;  3JCZ A;  4LWS B;  4X89 A;  1SKV A;  3SYA A;  1XNR B;  1LUW A;  4PA4 A;  5L3F A;  1JQ0 A;  4GX5 A;  1QU7 A;  5ITZ B;  1VQO V;  1M56 B;  3ZHV A;  5JJJ B;  2WPD G;  3LSQ A;  3ZS8 C;  4LF4 O;  3MD0 A;  1K9M W;  5EYP A;  2ZD9 A;  1SQP H;  2N04 A;  3HKC B;  2ZKO A;  3ZMZ A;  4PDV A;  1F4N A;  4UCV A;  3RVY A;  1RFY A;  4NB5 A;  3JD1 A;  4DR6 O;  2WLL A;  2WLI A;  4MSW C;  1IBK O;  1NU1 H;  4UCO A;  4YY3 O;  2UUB B;  4HBN A;  2P22 C;  2HJF C;  5KHG A;  3CE2 A;  3JCU Z;  1NQT A;  4PDR A;  1EZJ A;  4JGS A;  1FXK B;  1NKD A;  4WFF A;  1Y67 A;  1W2B U;  4CH5 A;  4X1K B;  2XT9 A;  4U7O A;  4WFH A;  4X88 A;  1SQQ H;  3L73 H;  4E2L A;  4JYY A;  3OE7 G;  3CPW U;  1VQ7 V;  1I94 B;  4FLX A;  3STL C;  1NJI W;  1YF2 A;  3PJS K;  5EIB C;  5DED A;  3E83 A;  4CH4 A;  1YHQ V;  3JD2 A;  4O4I A;  4PA9 A;  1I7F A;  5LYJ B;  2WLJ A;  3ZN1 A;  3FX7 A;  2A79 B;  2EUL A;  3BVO A;  4J9Z B;  4LNU B;  2GTS A;  3VQY A;  4K3A A;  2EIN B;  1YTF B;  4B3T B;  5C8Y A;  4LFB O;  4WBN A;  4DR1 B;  5B1A B;  2QKS A;  1H38 A;  3CS5 A;  4DV1 B;  4JI7 B;  3ZJZ A;  1JPX A;  4JF3 A;  1K5S A;  2EIM B;  1R3I C;  4MW8 A;  4GKK B;  4J7K A;  4O4L B;  3OR6 C;  3P30 A;  2JGU A;  3GVM A;  4E4E A;  2E76 B;  3SJQ C;  4XBF A;  1XMQ B;  4HNA A;  3VQX A;  5D5P A;  2CAZ C;  1YIT V;  4EKW A;  2R9R B;  1YIJ V;  3ABL C;  1CXZ B;  2F23 A;  3SJA C;  4B3M B;  2M6Y A;  1BL8 A;  3CME V;  5IY5 B;  3NR7 A;  2WSS G;  1H2G A;  5GON B;  2JEU A;  2JRI A;  4U7N A;  1UPG A;  1IBL B;  4DV0 B;  4B3S O;  1SQG A;  4LF5 B;  3ZMU A;  2F66 C;  3HKD A;  4LF7 O;  1WLE A;  1R3K C;  1KYO F;  2NR5 A;  1RM1 B;  2PI4 A;  3T4Z A;  2OWO A;  5L3B A;  5LL6 Y;  3G6E V;  4TV8 B;  2L6L A;  4J7J A;  1Y76 A;  1G8M A;  4DUY B;  2ZIO A;  2DJV A;  3N2G B;  4WFA V;  4H37 A;  3WG7 C;  1E1Q G;  1YJ9 V;  1XBL A;  5JCO A;  1WPB A;  3N27 A;  1FFX A;  1XUQ A;  2DQ0 A;  1MSW D;  1KEC A;  2RNB A;  2QWO B;  3CCU V;  5B1A C;  3W7T A;  1NR7 A;  3J7A U;  4EEQ A;  5H6R A;  1S0V A;  4JI4 O;  4GZR B;  4LF9 B;  2ZNJ A;  3ZHQ A;  3E2E A;  1JOY A;  1CPY A;  4PI0 A;  2R70 A;  2VS0 A;  3AG3 C;  3QF7 A;  1WN7 A;  2IJI A;  2VQF B;  3R66 A;  1SA0 A;  4EFE A;  4DR6 B;  5A2Q N;  5KMG B;  1YJN V;  2IM9 A;  4AHC A;  1BS3 A;  1K8A W;  1LUV A;  4JI2 B;  4TQD A;  2OIE A;  4J11 A;  1QHT A;  2FML A;  4DXW A;  1SC5 B;  2Q69 A;  4ZI7 B;  2AZ0 A;  1ZAU A;  5JWP A;  2M7W A;  4FIP C;  3ZHU A;  2UXB B;  1QQC A;  4KP4 A;  4BIZ A;  3H1I H;  4J80 A;  3OW2 U;  2LW7 A;  4X8A A;  1OCR C;  3AG4 C;  3K79 A;  5J2U A;  5E1A C;  3LNN A;  4JAU A;  2QA4 V;  4JYB A;  1X4T A;  3JSN A;  3UT5 A;  5LOV B;  4RQF A;  1M93 A;  4KXR A;  4BWA A;  3CCV V;  1OCO C;  3NXS A;  3DC6 A;  5KLV H;  1L1F A;  2DOS A;  5BR8 B;  3APO A;  1I0H A;  4FK5 C;  2B1I A;  1DGS A;  1QBZ A;  1Z5W A;  2OIG A;  3QO7 A;  1Q6H A;  3WB1 A;  4GT1 A;  4DRX A;  4KUM A;  2YXY A;  1KUQ A;  3ETE A;  4LFA O;  3TGU H;  2HFE C;  4DV1 O;  5LGU A;  3RYI B;  5JCO C;  4JI7 O;  4UVC A;  1F23 A;  1JR9 A;  1U96 A;  2PY5 A;  3W7U A;  3EFF K;  4OXS A;  1F51 A;  1KD1 W;  1BHB A;  1BMF G;  2O57 A;  2F4V B;  3GB7 C;  3HR0 A;  3F5T A;  1XNQ O;  2K1E A;  2AXT Z;  4FM2 A;  1P4R A;  3OTO O;  5GTI Z;  3ZHT A;  2KSD A;  3T2M A;  3HKD B;  2GTA A;  3OEE G;  3ZED A;  4MTG A;  1GO3 F;  2FYU H;  5CBH A;  1IVS A;  1H2M A;  4UCU A;  2JK5 C;  4QIW F;  1GH6 A;  5LHG A;  1VQ6 V;  4QJF B;  5LXT B;  2WWW A;  2EZP A;  5FNV B;  2X6C A;  2BCC H;  1FFT B;  2ITD C;  3OAA G;  2A06 H;  1XHZ A;  5IWA B;  2P6J A;  5LHH A;  3OD4 A;  3CJH B;  2OTL V;  2CK3 G;  2QE7 G;  4AI8 A;  2UXC O;  4RUE A;  3L75 H;  2C2A A;  3SPJ A;  3BA9 A;  4W4K A;  3VQV A;  3H01 A;  3K59 A;  3K5M A;  1EN4 A;  3CXH F;  4MT8 A;  2KG7 B;  1XNQ B;  4GKK O;  1VQK V;  1RSO A;  5CN0 A;  4PI2 A;  3I56 V;  2OCC B;  3O65 A;  3THO A;  2DYR B;  4PA3 A;  3WU2 Z;  1AR5 A;  1JFF A;  4ASU G;  1Y74 A;  1CP9 A;  2HVJ C;  3BPZ A;  3OM3 B;  5KA6 A;  4UCT A;  4I7Z B;  1M5I A;  1DK1 A;  2E74 B;  2OT5 A;  5B66 Z;  3B09 A;  2YUA A;  1GN6 A;  5BMV A;  2Q7E A;  5IYD O;  1FXK C;  1Z5V A;  3CJH A;  4I50 A;  1TGO A;  1OCC C;  4WFE A;  1AB3 A;  3MAQ A;  3K04 A;  3Q4H B;  5B1N A;  1PL0 A;  2N05 A;  1JMK C;  1RPR A;  3SPG A;  2UXD O;  2Y4T A;  4MVM A;  4YHH B;  4DV2 O;  1FXK A;  4C7U A;  1PKX A;  4MVR A;  4R8C A;  4LFC B;  3UO2 A;  2ZM6 B;  1PNK A;  2E3C A;  2ETN A;  1EN6 A;  3DGE A;  4MVO A;  1VF6 A;  1KKD A;  2W0F C;  2EIK C;  3G4S V;  1M90 W;  2B5U A;  4DV6 O;  2XHB A;  3PN1 A;  2ITC C;  1N34 O;  4X65 B;  2IJJ A;  2AHZ A;  2Q4P A;  2ADQ B;  2RQ6 A;  4RWU A;  5EZY B;  4DR4 O;  1K4C C;  3K0G A;  3ML0 A;  4UUJ C;  2FTK A;  2JEX A;  2KQX A;  4GKJ B;  4O4I B;  2CDY A;  1N36 B;  4LC1 A;  3W7W A;  1HR0 B;  4PDL A;  1AIL A;  4K35 A;  3SYO A;  2UXD B;  1US6 A;  4P9P A;  1XRE A;  4DR5 B;  1F4M A;  4P2Z A;  1MOF A;  1HNZ O;  4QPJ A;  5KAI Z;  2H8P C;  3E22 B;  1DF5 A;  5JJE B;  1PNL A;  3AG1 B;  1K3E A;  3ZIA G;  2WLM A;  1QVF U;  2ZE5 A;  3K5L A;  2WLN A;  2QKA A;  2P06 A;  4DV4 B;  4MTO A;  2QM8 A;  3FAV B;  5IJ9 A;  1Q6I A;  1NI8 A;  4GUN A;  1QR8 A;  4JI1 B;  1KQS U;  1B6Q A;  1YEW A;  2WAM A;  4FFK A;  4IT5 A;  4IIJ B;  3U11 A;  1Y74 B;  4LF4 B;  3I55 V;  4JI0 B;  1N36 O;  4F6R A;  3D3Q A;  1XQ8 A;  1AJQ A;  5KUM A;  2XTA A;  2QSA A;  1GN4 A;  3UM7 A;  2CGO A;  1YXB A;  1L0L H;  4BW5 A;  1PNM A;  5H6Q A;  1XIL A;  3H9V A;  1XHX A;  2Z0A A;  4DR2 O;  3S3W A;  4YIO A;  2ZDI C;  2ZQM A;  1NBM G;  4FLW A;  4X62 O;  1OCZ B;  3SPI A;  4PA6 A;  2P5O A;  1IXM A;  4IYI A;  3P3N A;  4FZ1 A;  4OX9 B;  1D2D A;  1I08 A;  2K9P A;  3ZCC A;  2UXX A;  4G28 B;  2AZ2 A;  1OCZ C;  4O4H A;  1NTM H;  3W7S A;  3CCM V;  1I5X A;  1FJG B;  1I5Y A;  1Q43 A;  3QTC A;  2ZIN A;  3RBZ A;  1IX9 A;  1FFX B;  4IIJ A;  1AI7 A;  3ASO C;  1K4D C;  2ODM A;  4UVB A;  4LF6 O;  4DR7 O;  4X1I B;  1PV0 A;  1FXV A;  3K08 A;  4LF8 O;  3I5D A;  4WCE V;  1VF6 C;  4PD4 F;  4FFB B;  4I55 A;  1HNX B;  1AI4 A;  4XDK A;  2XND G;  2F1M A;  1Q86 W;  1SRY A;  4L8J A;  1YTF D;  2Q8V A;  2VQF O;  2Q7H A;  3LDE A;  1JX9 A;  3SYQ A;  4ZBM A;  2CH7 B;  5LP6 C;  4X66 O;  3RGB A;  4F4L A;  4H13 B;  4NR1 A;  3A8T A;  4AIL C;  1G6U A;  1VQN V;  4B08 A;  3K06 A;  3G67 A;  3U10 A;  2P4V A;  3H1L H;  1IZ3 A;  5FL7 G;  5IY5 C;  5CB4 A;  3FB6 C;  4Z2W A;  2YIC A;  5KHI A;  4DR7 B;  4LF6 B;  1HP8 A;  4DR4 B;  4W4L A;  1TA8 A;  3J81 N;  2ARH A;  3K0D A;  4WF9 V;  4MVZ A;  2ZR3 A;  2LP7 A;  1HR0 O;  5LHI A;  5B3S B;  4LCU C;  3N2K A;  1SQV H;  5TIS Z;  2EIL B;  3CD6 V;  4DO2 A;  3E8F A;  4JI3 O;  4NXN B;  3SGI A;  4H33 A;  2BE3 A;  1BQZ A;  5BR8 O;  1EM1 A;  1QLE B;  4X64 O;  1VQ9 V;  4OGQ B;  2BTO A;  4O4H B;  1P84 F;  2Y0P A;  3ZMV A;  4YHH O;  2IJH A;  1GMG A;  4JYC A;  4UXN A;  1AR4 A;  2VQE O;  3D36 A;  3T1C A;  3ETQ A;  4FLZ A;  5L3G A;  4WFG A;  2ZE6 A;  1DLB A;  1W0K G;  1M57 C;  4JI4 B;  2UXN A;  3ABM C;  2W6J G;  3HB3 B;  3KCX A;  5LBQ A;  5CA1 A;  2GV9 A;  3B40 A;  2UU9 B;  2CTR A;  3CCE V;  3JAS A;  4DW1 A;  1BQ0 A;  2CUG A;  3F7Y C;  1I94 O;  5J9P C;  1IXB A;  1VQ8 V;  1J5E B;  1VQM V;  1RSO B;  1S76 D;  2XAQ A;  3CX5 F;  4IGG A;  3LSS A;  1SS3 A;  3CCR V;  2YXH A;  5GTH Z;  3TXQ A;  1YZB A;  2VWK A;  2LW1 A;  2HEP A;  3E89 A;  4ZOL A;  2GDS A;  3OMN B;  2PYL A;  5IJ9 B;  1K34 A;  2BSK A;  2JGD A;  2UXB O;  3FB7 C;  4X1Y A;  1K33 A;  4MW3 A;  2HHH B;  5H9C A;  2E5L B;  1QVG U;  5EC2 C;  1W59 A;  2UU9 O;  2QDO A;  3ZRX A;  1RP3 B;  5DEC A;  4JI1 O;  1WAZ A;  3ZRV A;  5LGT A;  2FB5 A;  3G71 V;  4XDJ A;  1BE3 H;  3O9O A;  4IL6 Z;  4I0X A;  5LMU O;  3D36 C;  5J2U B;  4O4J A;  4CZZ A;  1B3Q A;  3B4S A;  1ENV A;  1AI6 A;  4TOI A;  5IJ0 B;  3M8A A;  5D5Q A;  4RQE A;  3L9D A;  4UFZ A;  3CRQ A;  1Y6X A;  4YJ2 B;  2GSM B;  1HWY A;  2YS8 A;  1COW G;  5KX5 B;  4DUZ O;  3K9S A;  5EZY A;  3APQ A;  3S3X A;  2ZR2 A;  1QLE C;  2EZO A;  1GM8 A;  4J41 A;  3IJ4 A;  2EBO A;  2YID A;  5B1O A;  4JI8 B;  1EFR G;  4H44 B;  1JA8 A;  5C8Y B;  1S5H C;  4PV1 B;  5KMG A;  4HZ3 A;  2PI5 A;  1Q3E A;  4I0X B;  2HHH O;  1KB9 F;  3GWO A;  1ZL8 B;  1H8E G;  2QM4 A;  3SPC A;  5CB4 B;  5EBM C;  4RUF A;  5EBW C;  1GN2 A;  2H3O A;  2WA4 A;  3OTO B;  5EIB D;  3ZX6 A;  1B06 A;  3Q4H A;  2P4K A;  3ZRW A;  2XAF A;  1QNM A;  4O2A A;  1THZ A;  3E8H A;  2GHY A;  3HKE B;  4JTC B;  2QM7 A;  4NXM O;  4ZOL B;  1WA8 B;  4B7E A;  3SYP A;  2DQ3 A;  1JFF B;  4TWK A;  1AVM A;  2OCC C;  5CA3 A;  3CRC A;  3ASN B;  3BAB A;  4PDM A;  1MMM A;  3N2G A;  4JV5 B;  3B8M A;  1B04 A;  3BFR A;  3E35 A;  4J42 A;  4TUY A;  4F6E A;  4LF7 B;  2UXC B;  4Q20 A;  3U0Z A;  4PA7 A;  4QE9 A;  4EFB A;  4X64 B;  3TJT A;  5KAF Z;  1ZUQ A;  2R9I A;  1O9H A;  3IAY A;  4FMT A;  3ASO B;  1PM9 A;  2QJ1 A;  3H1K H;  1KC8 W;  1SF9 A;  3HKB A;  1K97 A;  1WNS A;  4YJ3 A;  1N33 O;  3JAR A;  1FYJ A;  1OCC B;  3AG2 C;  2DN9 A;  5LXT A;  1MNG A;  2JJ1 G;  1R73 A;  2AHY A;  1NTZ H;  3IFX A;  4ZHQ A;  5CMU A;  5H2F Z;  2IU3 A;  2RCV A;  4MTF A;  4O4L A;  4NVP A;  1K73 W;  3D8C A;  4RAI A;  3KKY A;  4JYA O;  1WP8 A;  1ORQ C;  2IH1 C;  3ETD A;  2F93 B;  2XAG A;  2YI9 A;  2Y0I A;  4ICG A;  3L72 H;  4LNU A;  4I9Q A;  4LFA B;  3RYI A;  2P67 A;  1E1R G;  3T4D A;  4JI5 O;  1M9N A;  1KU9 A;  3JAL B;  1JJ2 U;  1XL4 A;  3FAV A;  3OGC C;  3HKE A;  2QWR B;  1HW7 A;  3E86 A;  2RDC A;  3ZRW B;  4L87 A;  3RYH A;  1GM7 A;  2GUZ A;  4FVM A;  2CH7 A;  1K5Q A;  5IYZ B;  5KHH A;  1VEW A;  4LP8 A;  1MZE A;  3E22 A;  1L0N H;  3UT5 B;  5LOV A;  1SQB H;  3CRR A;  3CP1 A;  3T1Y O;  1J95 A;  2A9H A;  2QWN B;  2YIB A;  1LNQ A;  2EIJ C;  4J7Z A;  2LGQ A;  1FD9 A;  4KFM A;  3ABL B;  1V54 B;  2RN9 A;  3CCL V;  3TET A;  1P49 A;  3JD4 A;  1F7Y A;  1FAF A;  4X1I A;  1KMI Z;  2PUS A;  4DV0 O;  5EC1 C;  3JAT B;  2XAS A;  1GTO A;  4ZI7 A;  2YIA A;  2WLL B;  4BAY A;  2QWP B;  1O9G A;  3CCQ V;  1H2L A;  3LNM B;  2MW2 B;  3F7V C;  3JAK A;  1YVW A;  3CRM A;  3M99 B;  2CGN A;  4A5U B;  2ILM A;  4UV8 A;  4JI6 O;  4RO2 A;  3RT3 C;  3VOU A;  3B2E E;  2F4V O;  1BGY H;  1NT2 B;  4N23 A;  4JAA A;  1WB7 A;  2KB1 A;  1N8R W;  5LMU B;  1Q5O A;  1Q7Y W;  4UB8 Z;  4H0L B;  5HFL A;  4LWS A;  3QO8 A;  5JQG B;  4NXM B;  5A9G A;  2LFS A;  2BSK B;  4K0K O;  2JIZ G;  5LA6 B;  3AK1 A;  4B3T O;  4LBE C;  4JV5 O;  2Z5U A;  1M57 B;  2WLK A;  3AG7 A;  1R3J C;  3P3P A;  2IBZ H;  2OCH A;  1V9P A;  2DMX A;  2ZNI A;  2A0L A;  1LR1 A;  3RYF B;  5LGN A;  4R6Z A;  2F43 G;  2AW9 A;  2XUM A;  2Q7G A;  4TV9 B;  3FYE B;  2ZM6 O;  5FPR A;  5IYB O;  5B3S C;  1VQP V;  1TUE B;  4JI2 O;  3ZHS A;  2PGG A;  3EVK A;  2EIL C;  1ROP A;  1RPO A;  3BA8 A;  3A0R A;  1BT8 A;  2B1G A;  5GON A;  4MVQ A;  5CA1 B;  5IYC O;  4B3M O;  5B1B B;  2Q5Z A;  2Q68 A;  4YIP A;  1HDJ A;  3H1H H;  1AJN A;  2V4D A;  1KBH A;  1N0N A;  4BIU A;  2HJD A;  1IBL O;  5FNV A;  2EIJ B;  2RMK B;  5BXZ A;  1BCC H;  4DV7 B;  5IE9 A;  1GRJ A;  3F5W C;  4QPK A;  3K03 A;  4LH7 A;  5J2T A;  4FLU A;  1KKC A;  2V7Q G;  2NNU A;  2RJZ A;  3RWR D;  3HKB B;  3KCY A;  2LJ2 A;  5IDJ A;  4EB6 A;  3OT7 A;  1IBK B;  1L8D A;  1ZL8 A;  1RM1 C;  1D5A A;  4CC5 A;  1AI5 A;  1QCE A;  3G80 A;  1HNW O;  3A0B Z;  1YI2 V;  5JH7 A;  1ZX3 A;  1H8H G;  3UQ8 A;  2VWJ A;  1M1K W;  1MSD A;  1JJO A;  1FXH A;  2A7W A;  4HAM A;  4CC6 A;  5C93 A;  2JS3 A;  1TUB B;  3DXR A;  4MTX A;  2YXL A;  2UUC B;  3CXC U;  3A0H Z;  1BZK A;  5KX5 A;  4FM0 A;  4I4T B;  4NTY A;  2HG5 C;  2X0L A;  4EB6 B;  3R65 A;  1XL6 A;  4X65 O;  5LYJ A;  1WA8 A;  5IJ0 A;  4P9O A;  5FLX N;  2YC0 A;  5B1B C;  5J2T B;  1N0J A;  2ZCE A;  4DV7 O;  4O4J B;  1YDX A;  1N4C A;  3QNE A;  1EN5 A;  2IJK A;  2PF4 E;  1GK9 A;  1N32 B;  1JCH A;  3C3S A;  1S5L Z;  3K57 A;  4O2B A;  5DN6 G;  1PD3 A;  2ADP A;  4GCZ A;  4I50 B;  4X1K A;  5BY1 A;  4DR2 B;  5L3C A;  5BMV B;  3CCS V;  4DUZ B;  3TK1 A;  3SR2 C;  5LP6 B;  5JVD B;  5L3D A;  3ZMT A;  3UO3 A;  3AG2 B;  4I4T A;  4LFB B;  3BHP A;  4MVS A;  2R72 A;  5LMN O;  5EBL C;  3AK3 A;  4FZ0 A;  5B5E Z;  4TV9 A;  4BIO A;  4BW9 A;  3TCU A;  4ABM A;  1OHH G;  3ABK C;  5K1P A;  2XOK G;  4LR3 A;  4JI6 B;  2KG7 A;  4QNH B;  4B3R B;  2E75 B;  2QWQ B;  4QGP A;  4FLV A;  2A3Q A;  3OTF A;  3M7M X;  5JJN B;  3FB5 C;  3JAW B;  2D3O W;  1TVK A;  4ZHQ B;  1N32 O;  1WP7 A;  5EYP B;  2BTQ A;  2XAJ A;  4IHJ B;  1R6K A;  2QEX V;  3HKC A;  4FLY A;  1Q82 W;  1NVP D;  2WA3 A;  1AP6 A;  5FPO A;  3OUF A;  4DV5 B;  3OMI B;  1OJH A;  3RW0 A;  4CH3 A;  5ITZ A;  2X7R B;  2QTO A;  4ZKI A;  2YDE A;  1GKF A;  3CC2 V;  1NTK H;  1HNX O;  3K3W A;  2PZS A;  4B3S B;  1CEZ A;  1M4U A;  3GWK C;  3JYC A;  3OUS A;  2EJR A;  2ZDI A;  2P7T C;  4YXW G;  3CEI A;  2JGD B;  4DR1 O;  2P90 A;  2Q9L A;  4U3J B;  4MS2 A;  4X62 B;  4X66 B;  1G4Y B;  4X9Q A;  2Z3Y A;  4IHJ A;  1G1X B;  3C90 A;  3FFQ A;  1NH2 D;  1V54 C;  2Q0O C;  3JAW A;  3IC7 A;  3X2Q B;  1MG1 A;  1XMQ O;  4K8Z A;  4GLX A;  4F6R B;  3MHS C;  3RFR A;  2YIB D;  2WLH A;  3G6B A;  2MK3 A;  4N21 A;  2L35 A;  1P7B A;  2YEV B;  3STZ C;  1S5J A;  3ZHR A;  1QLN A;  4G2K A;  1VF5 B;  1PP9 H;  4JI8 O;  2HLD G;  5KUK A;  3WFV A;  3WB0 A;  5IWA O;  1VQ5 V;  4DR3 O;  2ZXW C;  3AG4 B;  1FPO A;  4Z1V A;  3RYH B;  2JJ2 G;  1NS1 A;  1YSC A;  4DR5 O;  2W6I G;  3AEI A;  1URF A;  1HNW B;  3IC9 A;  1QR9 A;  2ZT9 B;  3QO5 A;  3JAL A;  3ZRS A;  3VQW A;  1GAX A;  3CSX A;  4YY3 B;  3CMA V;  4HNA B;  2UUB O;  4FJC C;  3OGI B;  4GX2 A;  3JAK B;  1TVK B;  2UUC O;  1MA1 A;  5DM6 V;  4JI5 B;  5GW7 A;  2HP8 A;  5H5N A;  3JAT A;  3N2K B;  1WPX A;  4OPH A;  2HR3 A;  1XMO B;  4JZG A;  4FPP A;  1IBM B;  3H1J H;  1Z2G A;  3C3T A;  2EIM C;  2DYR C;  3OMA B;  2V1D A;  1J5E O;  1MZF A;  4JI0 O;  2EIK B;  1SZX A;  2ZIM A;  4KHP O;  3K5O A;  1OCO B;  1MAB G;  3B77 A;  3P32 A;  5JVD A;  4I5S A;  5HFM A;  3T1Y B;  3L74 H;  2CE4 A;  3JSL A;  1GN3 A;  4CS3 A;  2NN4 A;  1NR1 A;  1AR1 B;  5AG2 A;  1A32 A;  1SZT A;  1VMG A;  4FLT A;  1UFI A;  1VF7 A;  2DWE C;  1XDC A;  2QGN A;  1S72 V;  2FKX A;  1M56 C;  1N33 B;  2DE0 X;  3QVN A;  2LO1 A;  3ABT A;  2E5L O;  3ASN C;  3KZI Z;  1XNR O;  1SQX H;  1XMO O;  1R6T A;  1AJP A;  3JD0 A;  1IBM O;  4K8X A;  1FS0 G;  3T1H B;  1YCI A;  1VAR A;  1ZTE A;  2HKO A;  3SDL A;  2XAH A;  1Q6U A;  5KA5 A;  4UB6 Z;  2QKC A;  4AQY B;  2GBO A;  4JAV A;  1ARO P;  4DK0 A;  5L3E A;  4JYA B;  4OPA A;  4PJ0 Z;  3LSU A;  2LFR A;  2YSU B;  4D7T A;  4JZ2 A;  2JDI G;  3OR7 C;  2ZE8 A;  4J9Y B;  3KG2 A;  1KP3 A;  4X20 A;  2PTM A;  3L70 H;  4LF5 O;  3BCC H;  4JPR A;  4CBC A;  2QTS A;  1IDS A;  2BOB C;  4X20 B;  5BZB A;  4MVU A;  5JQG A;  5LMN B;  3CB2 A;  3FD9 A;  3CYO A;  1D5N A;  3T1H O;  2ZE7 A;  3TXS A;  1GM9 A;  3OEH G;  3UCS C;  2R9A A;  4B3R O;  4ZIB A;  4G27 B;  2EIN C;  4AQY O;  4CS4 A;  5E79 Z;  2YI8 A;  1DTO A;  4JTA B;  1PPJ H;  4TUY B;  1OCR B;  1PL4 A;  1WJZ A;  1KP2 A;  1S3J A;  3RYC A;  2F95 B;  4KL1 A;  3BEH A;  3K58 A;  2ATK C;  3W7X A;  1YJW V;  2JVD A;  1BSM A;  4UV9 A;  4R50 A;  1EZV H;  4NYK A;  4DRX B;  4DR3 B;  3ICX A;  2EX3 A;  4HYO A; 
#chains in the Genus database with same CATH homology
 2X6A A;  1RM1 B;  2PI4 A;  3T4Z A;  5L3B A;  3LDE A;  1JX9 A;  3SYQ A;  4ZBM A;  3G6E V;  2A0L A;  3ZMS A;  1Y4M A;  4F4L A;  5LGN A;  2OTJ V;  1G8M A;  4R6Z A;  2F43 G;  4WFA V;  1NH2 B;  4H37 A;  3WG7 C;  1E1Q G;  1YJ9 V;  3FYE B;  1VQN V;  5IYB O;  1VQP V;  3AG3 B;  5B3S C;  2DQ0 A;  3K06 A;  1TUE B;  2YEV A;  1MSW D;  4Z1M G;  1KEC A;  5FL7 G;  2EIL C;  3CCU V;  1ROP A;  5B1A C;  1RPO A;  5IY5 C;  3W7T A;  3FB6 C;  1NR7 A;  3MHH C;  3A0R A;  3ABK B;  5H6R A;  2B1G A;  1S0V A;  4MVQ A;  5IYC O;  3FB8 C;  1W0J G;  5B1B B;  2Q68 A;  3E2E A;  1JOY A;  1CPY A;  3VBB A;  2WLI B;  2Q67 A;  1AJN A;  3K0D A;  4WF9 V;  4MVZ A;  4P30 A;  4BIU A;  3ABM B;  2EIJ B;  2ZR3 A;  2LP7 A;  3ABU A;  5LHI A;  3AG3 C;  4LCU C;  5B3S B;  2IJI A;  3F5W C;  4QPK A;  3K03 A;  2EIL B;  2X6B A;  3CD6 V;  2V7Q G;  4DO2 A;  3E8F A;  2IW5 A;  2NNU A;  4H33 A;  2Y69 C;  5IDJ A;  2BOC C;  1YJN V;  4TSF G;  1QLE B;  1VQ9 V;  1RM1 C;  3ZMV A;  1AI5 A;  1QCE A;  1GMG A;  2IJH A;  1K8A W;  1YI2 V;  4JYC A;  4UXN A;  1H8H G;  3D36 A;  3T1C A;  2IH3 C;  4DXW A;  1M1K W;  1S77 D;  2Q69 A;  1FXH A;  4HAM A;  5C93 A;  2M7W A;  5L3G A;  4FIP C;  4WFG A;  1UJW B;  1DLB A;  4MTX A;  1W0K G;  1M57 C;  4KP4 A;  4BIZ A;  3AG1 C;  3CXC U;  2UXN A;  3ABM C;  2W6J G;  3HB3 B;  5LBQ A;  3OW2 U;  4X8A A;  2HG5 C;  2X0L A;  1OZ0 A;  1OCR C;  3AG4 C;  3R65 A;  1XL6 A;  3K79 A;  5E1A C;  3CCE V;  4JAU A;  4P9O A;  2QA4 V;  4JYB A;  5EK0 A;  5B1B C;  1K92 A;  3F7Y C;  4RQF A;  5J9P C;  1VQ8 V;  2HVK C;  3QNE A;  2IJK A;  3JD3 A;  3CCV V;  1OCO C;  1VQM V;  1GK9 A;  3NXS A;  1JCH A;  1S76 D;  2Q6A A;  2XAQ A;  1DF4 A;  3LSS A;  5DN6 G;  3EHB B;  1L1F A;  1PD3 A;  3CCR V;  4GCZ A;  4FK5 C;  2B1I A;  1QBZ A;  3WG7 B;  3HPL C;  2DYS C;  5L3C A;  3QO7 A;  3E89 A;  1E79 G;  3CCS V;  3TK1 A;  2DYS B;  3E8B A;  4GT1 A;  4KUM A;  5L3D A;  3ZMT A;  3AG2 B;  3OMN B;  3ETE A;  1SET A;  4MVS A;  1K34 A;  2HFE C;  5LGU A;  4UVC A;  1F23 A;  3FB7 C;  3K9A A;  5EBL C;  3D3I A;  3UKM A;  2IU0 A;  3W7U A;  1K33 A;  3TCU A;  4MW3 A;  3EFF K;  2NLJ C;  4OXS A;  1OHH G;  1F51 A;  5H9C A;  1KD1 W;  3ABK C;  1QVG U;  2XOK G;  2Y48 A;  5EC2 C;  1BHB A;  4QNH B;  3ZRX A;  3ZRV A;  5LGT A;  1BMF G;  3ETG A;  3G71 V;  3GB7 C;  4XDJ A;  3FB5 C;  2K1E A;  3IGA C;  1P4R A;  2D3O W;  3ZN0 A;  3SYC A;  3T2M A;  4GX1 A;  3OEE G;  4CZZ A;  2XAJ A;  1R6K A;  2QEX V;  1ENV A;  3E8G A;  1AI6 A;  1Q82 W;  1NVP D;  4MTG A;  4RQE A;  1JVM A;  3OUF A;  1GO3 F;  3OMI B;  2GSM B;  1HWY A;  4PEL A;  2DWD C;  3RW0 A;  5CBH A;  2X7R B;  2QTO A;  1COW G;  1R6N A;  4ZKI A;  4UVA A;  1GKF A;  3CC2 V;  3OFN G;  2JK5 C;  2ZR2 A;  1QLE C;  2EZO A;  3K3W A;  1CEZ A;  4QIW F;  1GM8 A;  5LHG A;  3CCJ V;  1VQ6 V;  4QJF B;  2Y69 B;  1VQ4 V;  2EBO A;  1BHA A;  2WWW A;  1R3L C;  2EZP A;  2X6C A;  3JYC A;  4XDL A;  1FFT B;  3OUS A;  2ITD C;  5B1O A;  2EJR A;  2ZDI A;  3CC7 V;  1EFR G;  2DW4 A;  3OAA G;  2P7T C;  4YXW G;  2P6J A;  5LHH A;  1S5H C;  2OTL V;  2CK3 G;  2QE7 G;  4RUE A;  2P90 A;  3B8N A;  4HZ3 A;  4MS2 A;  1G4Y B;  2PI5 A;  1VQL V;  2C2A A;  3SPJ A;  3GWO A;  2Z3Y A;  1H8E G;  3SPC A;  1V55 B;  3DTU B;  3H01 A;  1EBO A;  1NH2 D;  2ZXW B;  1V54 C;  1K7D A;  3LUT B;  4MT8 A;  5EBM C;  1V55 C;  4RUF A;  5EBW C;  1VQK V;  5CN0 A;  3I56 V;  3IC7 A;  2OCC B;  3X2Q B;  1MG1 A;  3LDD A;  3CC4 V;  2DYR B;  4PA3 A;  1SES A;  3ZRW A;  2XAF A;  4JAS A;  1Y66 A;  1THZ A;  4WFB V;  3MHS C;  4ASU G;  1CP9 A;  2GHY A;  2HVJ C;  2WLH A;  3BY6 A;  3E8H A;  3OM3 B;  5KA6 A;  2MK3 A;  4N21 A;  3FYI B;  4JTC B;  2QM7 A;  2OT5 A;  3LDC A;  5CBG A;  1P7B A;  5IYD O;  2YEV B;  1FXK C;  3RVZ A;  3SYP A;  3STZ C;  1QLN A;  2DQ3 A;  4G2K A;  4TWK A;  1OCC C;  2OCC C;  3X2Q C;  2HLD G;  5CA3 A;  5KUK A;  3ASN B;  4PDM A;  4WFE A;  3WFV A;  3FKS G;  3B8M A;  5CBF A;  3K04 A;  1Q81 W;  4TT3 G;  3E35 A;  5B1N A;  1VQ5 V;  2ZXW C;  1PL0 A;  3AG4 B;  4Q20 A;  2H94 A;  1RPR A;  4PA7 A;  4QE9 A;  3SPG A;  2JJ2 G;  4MVM A;  1YSC A;  2W6I G;  4JTD B;  4I9W A;  3AEI A;  1FXK A;  1SER A;  1QR9 A;  1PKX A;  3QO5 A;  4MVR A;  3ZRS A;  4R8C A;  2R9I A;  4FMT A;  3ASO B;  1KC8 W;  3CMA V;  4FJC C;  4GX2 A;  1PNK A;  4QE7 A;  4R7C A;  1ZWI C;  1K97 A;  3DGE A;  4MVO A;  5DM6 V;  1KKD A;  5GW7 A;  2W0F C;  2EIK C;  1NVP B;  3G4S V;  1M90 W;  4GX0 A;  2B5U A;  3SPH A;  1OCC B;  3JCZ A;  3AG2 C;  4X89 A;  1WPX A;  3SYA A;  2HR3 A;  2ITC C;  2IJJ A;  2AHZ A;  4FPP A;  4PA4 A;  5L3F A;  1JQ0 A;  4GX5 A;  1K4C C;  1VQO V;  2JJ1 G;  1M56 B;  3K0G A;  2WPD G;  3LSQ A;  3ML0 A;  4UUJ C;  1R73 A;  2EIM C;  2FTK A;  2JEX A;  2DYR C;  2AHY A;  3OMA B;  3IFX A;  2V1D A;  5CMU A;  2IU3 A;  2EIK B;  3MD0 A;  4LC1 A;  3W7W A;  4MTF A;  1K9M W;  2ZD9 A;  1K73 W;  4PDL A;  1OCO B;  3ZMZ A;  3SYO A;  1MAB G;  3B77 A;  3P32 A;  4PDV A;  4P9P A;  1F4N A;  4RAI A;  2IH1 C;  1ORQ C;  4I5S A;  3ETD A;  3RVY A;  5HFM A;  1F4M A;  4P2Z A;  1MOF A;  2XAG A;  3JD1 A;  2WLL A;  4QPJ A;  2WLI A;  4MSW C;  2H8P C;  1DF5 A;  1PNL A;  1AR1 B;  1NR1 A;  1SZT A;  3AG1 B;  1K3E A;  3ZIA G;  2WLM A;  1QVF U;  2DWE C;  2P67 A;  1S72 V;  2WLN A;  1E1R G;  3T4D A;  1M56 C;  2HJF C;  1M9N A;  3ABT A;  3ASN C;  2QM8 A;  4MTO A;  1JJ2 U;  1XL4 A;  1NQT A;  4PDR A;  1EZJ A;  1QR8 A;  4JGS A;  1AJP A;  3JD0 A;  1FXK B;  3OGC C;  1KQS U;  1NKD A;  1FS0 G;  4WFF A;  1B6Q A;  1W2B U;  3E86 A;  3ZRW B;  2WAM A;  4L87 A;  1GM7 A;  4U7O A;  4WFH A;  2HKO A;  4X88 A;  1K5Q A;  3I55 V;  4E2L A;  2XAH A;  5KA5 A;  1AJQ A;  3OE7 G;  3CPW U;  4LP8 A;  1VQ7 V;  3STL C;  5KUM A;  1NJI W;  4JAV A;  3PJS K;  1ARO P;  5L3E A;  3CP1 A;  1J95 A;  2A9H A;  3UM7 A;  1LNQ A;  2EIJ C;  2LFR A;  2YSU B;  3E83 A;  2JDI G;  3OR7 C;  3JD2 A;  1YHQ V;  4PA9 A;  4KFM A;  3ABL B;  1V54 B;  4J9Y B;  4BW5 A;  2WLJ A;  1PNM A;  5H6Q A;  3ZN1 A;  3CCL V;  3KG2 A;  3TET A;  1KP3 A;  2A79 B;  3JD4 A;  4J9Z B;  2ZDI C;  2EIN B;  2ZQM A;  1NBM G;  1YTF B;  5EC1 C;  2XAS A;  1GTO A;  4JPR A;  2QKS A;  2WLL B;  5B1A B;  4CBC A;  2BOB C;  1OCZ B;  4BAY A;  1H38 A;  3SPI A;  4PA6 A;  5BZB A;  3CCQ V;  4MVU A;  3LNM B;  3ZJZ A;  1IXM A;  1JPX A;  3F7V C;  4JF3 A;  1K5S A;  2EIM B;  3M99 B;  3ZCC A;  1R3I C;  2UXX A;  3CYO A;  4G28 B;  4MW8 A;  1OCZ C;  3OR6 C;  1GM9 A;  3P30 A;  4UV8 A;  4RO2 A;  3SJQ C;  3OEH G;  4XBF A;  3VOU A;  3W7S A;  3CCM V;  1I5X A;  4G27 B;  2EIN C;  4N23 A;  1I5Y A;  1DTO A;  2KB1 A;  4JTA B;  3RBZ A;  1N8R W;  1YIT V;  4EKW A;  2R9R B;  1YIJ V;  3ABL C;  1OCR B;  1Q7Y W;  5HFL A;  1AI7 A;  1KP2 A;  1S3J A;  3QO8 A;  3ASO C;  1K4D C;  4UVB A;  3BEH A;  2LFS A;  1FXV A;  2ATK C;  3K08 A;  3W7X A;  1BL8 A;  1YJW V;  3CME V;  5IY5 B;  2WSS G;  4WCE V;  1H2G A;  4UV9 A;  4R50 A;  2JEU A;  4U7N A;  2JIZ G;  4LBE C;  2Z5U A;  1AI4 A;  4XDK A;  1M57 B;  2XND G;  3ZMU A;  1Q86 W;  1SRY A;  1WLE A;  2WLK A;  1R3J C;  1YTF D;  1R3K C;  4HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...