1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Envelope glycoprotein
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
2EZOA 1I5XA 5CN0A 3P30A 3B77A 1QR9A 1Y66A 1JPXA 2M7WA 1SZTA 3WFVA 4G2KA 4N21A 3GWOA 4FIPC 2MK3A 5H9CA 2P6JA 3CYOA 1K34A 3MHHC 5KA5A 4JPRA 1MOFA 1DF4A 1QBZA 4N23A 1QCEA 3CP1A 5HFMA 2EBOA 1DF5A 1MG1A 4FJCC 1DLBA 3B8MA 5HFLA 2X7RB 4E2LA 2EZPA 3MHSC 1F23A 3K9AA 3B8NA 1I5YA 3M99B 1ENVA 1K33A 2OT5A 4FK5C 4JF3A 1JQ0A 1QR8A 5CMUA 5KA6A 2LP7A 4JGSA 1Y4MA 1EBOA 3H01A
chains in the Genus database with same CATH superfamily
2N04A 5LMNB 2AHZA 1P49A 4B3MO 1V55B 2JK5C 4I5SA 4KL1A 3ZHSA 4DV6O 4FIPC 1X59A 1G6UA 2EJRA 5H2FZ 3JAWB 5LXTA 3G6EV 1EFRG 2QWNB 3E86A 3LDCA 5K1PA 3SJCC 2VQEB 3K5MA 4KHPO 1OCZC 2RCVA 2WLJA 2ZE6A 5BXZA 1QVFU 1AILA 4WFAV 1F4MA 4UCTA 2ZXWB 1HR0O 1RFYA 4DV5O 4UCSA 3ZHVA 4JI8O 1QBZA 4MW8A 4UCUA 4PDMA 1EZVH 1N32O 2UXNA 4PI0A 3A0HZ 2DYSC 1IVSA 3H01A 2JDIG 4GX5A 1H8EG 2K9PA 5IE9A 4JTDB 1KUQA 2QKAA 3TK1A 1YIJV 1SQBH 3MAQA 1LNQA 2DW4A 1YJ9V 1M93A 2NLJC 1Z5WA 4J7ZA 1XNRB 3ZBHA 1VQ9V 5KHHA 1YTFB 1GRJA 2Q73A 2WLKA 4PA7A 1Q90D 3OTOB 2EILC 3CRCA 4GUNA 2CDYA 2DWEC 1M4UA 1W0KG 2EULA 4JYAB 3B77A 3N2KA 1OCRC 2AHYA 2PI5A 1VQ7V 1HNXO 3RW0A 4Z2WA 1WP7A 3E83A 2PZSA 4X9QA 2CK3G 3SYPA 2OCCB 2HVKC 1I0HA 3N2KB 4LF9B 3JD0A 4J10A 1XQ8A 1VQ5V 2A3QA 3ZIAG 2R9RB 3JD2A 2IJJA 3L9DA 3UM7A 2JS3A 2YXYA 1FFTB 3BY6A 5KHJA 4JI5B 5KMGA 1OCZB 5AG2A 1KC8W 3W7XA 3H9VA 5EBLC 1WA8A 3CEIA 2UXBB 1Q6IA 1DGSA 1K4DC 4GKJO 3TXSA 2XTAA 1K5QA 3B8NA 2CH7A 4LF5B 1NTZH 5IY5C 1GO3F 4CBCA 1WA8B 2DYSB 3ZMVA 2KB1A 4X66O 3SJAC 4DR6O 5CB4A 4TSFG 4JI3B 2XNDG 1PP9H 3OR7C 2CH7B 5FNVA 1M90W 3H1IH 4DW1A 2IH1C 4OX9O 4JV5B 1S5LZ 2F1MA 5CB4B 3CMEV 1AVMA 2QSAA 4JAAA 3RBZA 4TV8A 2UXCO 5FNVB 4AQYO 1NVPB 3BA8A 3ZMUA 1Q82W 1NR7A 1SZXA 2HKOA 2LFRA 2PYLA 4N23A 3EHBB 1K8AW 3MHSC 1YCIA 3JD3A 4YIPA 2ZNIA 4TV8B 1XMQO 5LYJA 1Q7YW 1I5XA 1WN7A 4K0KB 3MDSA 5IYDO 4FM1A 1YJNV 1AI6A 4G27B 1P7GA 3CCRV 1F4NA 3N2GA 4FJCC 4ZBMA 2XASA 3BRCA 5LYJB 1MNGA 4JI4B 3ML0A 1K33A 2IW5A 3FYIB 4PA3A 4J7JA 5EK0A 4FFBA 4J41A 2F4VB 1M57C 4R50A 2GV9A 5CBGA 1QQCA 1SESA 3WFVA 2JVDA 3N2GB 2ILMA 5KA5A 3UO2A 2GUZA 2QWRB 3B8MA 1DK1A 2D2CB 2ATKC 4MVZA 4FFBB 5IY5B 4B3SO 2GBOA 1HNWO 3TJTA 1JCHA 1JVMA 2B1GA 3JYCA 2VWKA 4UCOA 2GUZB 4JZGA 3QG5A 2LW1A 4UV9A 4X89A 1Q5OA 5LP6C 1AP5A 5CA0A 4QPKA 2P67A 3ETGA 3K5LA 4FZ0A 1U97A 4LP8A 2M7WA 4P9OA 3E22A 2BE3A 4DR4O 3QTCA 3CRQA 5CA0B 4B3MB 2Q68A 3C3TA 1WB8A 2HR3A 2F66C 4DV6B 2YIBA 5E1AC 2RJZA 2XHBA 1ZL8A 1WLEA 3CJHA 3T1HB 3N27A 3E22B 3ASNB 3A0BZ 5IWAO 1GN4A 4JI1O 1XNRO 3EFFK 4N21A 1IURA 2Y69C 3ETEA 3ZMSA 1F7YA 3VQWA 4JYYA 3CJHB 5EYPA 1VQNV 5LOVA 4QNHB 2EZPA 4JYAO 2EINC 1HR0B 4B3RB 3OGCC 4JI8B 4YJ2B 2KQXA 2Z5UA 1B6QA 1M57B 4MVUA 3E89A 5H6RA 4GLXA 5EYPB 4O2AB 5LOVB 1GM7A 3B09A 1LUVA 4LF9O 5KAFZ 1ZAUA 2FTKA 2W6IG 5LP6A 2ITCC 1K4CC 1WPXA 1XMOB 5H5NA 3BFRA 4HNAA 4JI5O 1GM9A 1L1FA 4TQDA 1VIBA 3TGUH 2NNUA 2UU9O 1BSMA 5LP6B 2CTPA 4EEQA 5L3EA 3LSSA 3ETQA 1UJWB 2UXBO 4MT8A 1S72V 4HNAB 1WNSA 1Y76A 2P5OA 3BEHA 4EFBA 2ZM6B 2VWJA 1VQMV 3LSQA 3R65A 4LF5O 3WB1A 4DR5O 2RN9A 3AG3C 3RN4A 1TVKA 1BS3A 5L3GA 1R3LC 4DK0A 1Y76B 4CH5A 2QTOA 5F2VO 1VQLV 5EBMC 1AR4A 1EM1A 2DQ3A 2EIKC 4B7EA 1X4TA 2UXDO 2Y4UA 5L3DA 1YDXA 2QDOA 2Y69B 3SPJA 1NQTA 4PA6A 1TVKB 4F6EA 1D5NA 2ODMA 2Q4PA 3IFXA 2EINB 2ZE7A 3BABA 2R70A 4DK1A 2HJDA 2WLLA 1IBMO 2QGNA 3ICXA 1JPXA 4LF8O 3WB2A 1QHTA 2QM8A 4BW9A 2IH3C 4LNUA 5H9CA 4X8AA 3CMAV 4RO2A 5IYZA 3DC5A 4X1KA 4DR6B 4JI2O 2WLLB 1VF5B 5L3FA 4K0KO 1S3JA 4TT3G 1AR1B 4LNUB 4OX9B 2XAFA 3ZRSA 1AI5A 3E2EA 4JTAB 3BA9A 3ZEDA 4FZ1A 5IYZB 4X1KB 4JI4O 4CZZA 3CC4V 1YHQV 4D7TA 5L3CA 5BR8O 4O4LA 3SGIA 1PM9A 4XBFA 2F4VO 3H1KH 4NTYA 4PV1B 4CS2A 4WFGA 1KP2A 1E1QG 1K9MW 5C8YB 3GVMA 4O4LB 1XMQB 5GTIZ 4UUJC 4J9ZB 1H38A 2CGNA 3ZX6A 5ITZA 1RSOA 1Q6HA 2WPDG 3ZJZA 5J2UA 3ZMZA 4DUYB 3U10A 1IBLO 5LHHA 3AG3B 4H33A 4JF3A 1KECA 3ZHQA 1VF6C 2Q0AA 4DUZO 1S77D 2IJIA 1Q43A 1ZX3A 5A2QN 1H2KA 2EIMC 2EIKB 2P90A 5C93A 3RWRD 3UO3A 5ITZB 1RSOB 5J2UB 4ZKIA 4FLTA 4ZOLA 1XUQA 1P84F 1HW7A 4LH7A 4ZHQA 2ETNA 4X64O 1PKXA 1FFXA 1MA1A 3IC7A 1QLNA 1BMFG 3OEHG 5L3BA 1OJHA 2Y4TA 1S76D 4WCEV 4MSWC 4B3SB 3TETA 1W59A 1HNWB 4PELA 4ZOLB 2HP8A 4WFHA 3ZRWA 1BT8A 3OM3B 3FB6C 4ZHQB 3T1HO 1NTKH 2ZINA 3IC9A 2A06H 1FPOA 3L70H 1FFXB 3OEEG 3M99B 2NR5A 1R6KA 1SF9A 2N74A 1PD3A 3JALA 5IYCO 5JJJB 4JYBA 3AK2A 2E5LO 3ZRWB 3OT7A 2B5UA 5B1AC 5LXTB 4BIUA 1JX9A 4B3RO 1E1RG 3LDEA 2YICA 1HWYA 3RT3C 2HJFC 3QVNA 1N33O 3JALB 3VOUA 4DR4B 2RNBA 4CS4A 2RDCA 4IHJA 4I9QA 2W0XA 3D36C 2ADQB 2RQ6A 3FKSG 2Q7GA 2PUSA 4JYCA 3SR2C 1R3IC 5GONA 3H1LH 3HR0A 1VF6A 4LCUC 3KKYA 4OPAA 2QR4A 2BSKA 3SYQA 4DRXA 4DR7O 2Q7EA 5IWAB 4JI1B 4IHJB 4DV2O 3O65A 1JR9A 1G4YB 1XMOO 1YVWA 4K8ZA 1VARA 2QM4A 5GONB 5CN0A 1XBLA 2BSKB 3APQA 4DRXB 2EIMB 3L72H 3JSLA 1P4RA 4TOIA 3VQVA 1J5EO 4J7KA 1Q3EA 1DF5A 3E8FA 2GTSA 2OTLV 1N34B 3CCJV 4MTFA 2N05A 1MABG 2ZM6O 1NBMG 4LWSA 2Q0OC 4JI7B 1M1KW 1TUEB 4NVPA 2IU0A 3VQYA 2X0LA 3GWOA 2B9ZA 2XAQA 3OUSA 3X2QC 3CCUV 2JJ1G 1PV0A 4GKKB 4LWSB 4FM2A 4ICGA 1RPRA 2WAMA 2UU9B 4NYKA 4B08A 5LGUA 3D36A 2XAHA 1V54C 2A7WA 5B1AB 4F6RA 1QU7A 1EN4A 5JCOC 4WF9V 1KP3A 5KMGB 2VS0A 3FAVA 3UKMA 1GN2A 4BWAA 4GCZA 2HHHO 3ABKC 1NI8A 3IGAC 3C3SA 4UCVA 1ZWIC 4DR5B 4IIJA 1K92A 1M56C 4FLWA 4F6RB 1BHAA 1B04A 4JAVA 1VQPV 4P9PA 2VQFO 3FAVB 3T1CA 3O9OA 2EX3A 4D6TH 3F5WC 2ARHA 3SJQC 3GWKC 3L73H 4KUMA 3SPCA 3JCUZ 4IIJB 2UXDB 1FS0G 1N4CA 2XUMA 3DXRA 4PJ0Z 2EILB 4BIZA 4CC6A 4MW3A 2WLHA 4X62B 1EN5A 1US6A 1SZTA 1FD9A 2BCCH 5D5PA 1OCRB 3RVZA 2YS8A 3MHHC 1JOYA 1IBMB 4NB5A 3OE7G 4DR3O 4LF4O 4LF8B 1BQ0A 1XHXA 3DXRB 4E2LA 4PDRA 4D7SA 4GX2A 1Y74A 1YEWA 1S5JA 4JGSA 3JASA 2W0FC 1XDCA 1KB9F 4MTXA 4JI2B 3CCLV 2HLDG 3GB7C 5K1XA 2KSDA 4DUYO 2BTOA 1R3KC 4NKGB 2DN9A 3X2QB 2QKCA 1WB7A 2YI8A 3JASB 5JCOA 1KBHA 2OT5A 4PA9A 5BR8B 1MZFA 4J9YB 2CTQA 2YSUB 5DEDA 2QE7G 4DV1O 1N0NA 1ORQC 4RUFA 4JZ2A 1M9NA 1V54B 1IZ3A 4KP4A 1PNLA 1AP6A 1CXZB 1BGYH 4OGQB 2IBZH 1IX9A 2GSMB 2DE0X 2QKSA 4K3AA 3CXHF 5LHGA 1BE3H 5JQGA 3ABKB 4BAYA 5KA6A 3ABMC 4MVSA 3B40A 4QE7A 1M56B 5H6QA 2ZIOA 1MSDA 1VEWA 1YXBA 1I94B 4A5UB 1IBLB 2OWOA 1WP8A 1FYJA 4YHHO 4DUZB 5BMVA 4WBNA 3SYAA 4F4LA 1VQ8V 5JQGB 1K5SA 1QR8A 1TA8A 4TV9A 1FXKC 1XNQO 5FPRA 3C90A 4WBNB 4X64B 1FJGO 2WSSG 4I9WA 4OPHA 5EZYA 1H2GA 4DV3O 1QLEC 4O4HA 1NH2D 4TV9B 3CC2V 1DTOA 1HNZB 4IYIA 4CS3A 1G1XB 3QO8A 4JASA 3FD9A 4GYCB 1Z2GA 3S3XA 3LSUA 1KKCA 4NTXA 4G28B 2LQTA 4O4HB 1SA0A 3RGBA 1O9GA 2JRIA 3CPWU 3OGIB 5CBHA 2QTSA 1OCOC 2E5LB 2IJHA 3FX7A 1SQQH 1ZL8B 5EIBD 1VQ6V 4EFEA 4QJFB 2YXHA 4MS2A 3CCEV 3G4SV 1TAEA 1B3QA 1N33B 1SA0B 3CCVV 1I08A 4CC5A 1SQXH 3LNNA 1N34O 1ZTEA 1IBKB 2EBOA 3UT5A 4R7CA 1CPYA 3ZN0A 2JIZG 2LFSA 2H3OA 1H2LA 4JI7O 3CCMV 3KG2A 4DR7B 4HYOA 4WFEA 1L0NH 2AGAA 3ABMB 2R9AA 4O4JA 4UVCA 1R1BA 4DV2B 2XT9A 1W0JG 1LR1A 1OZ0A 4W4KA 2ZR3A 3K06A 4PDLA 4GKKO 1FXKA 4AHCA 2JJ2G 1XHZA 1UPGA 4B7KA 4O4JB 4U3FH 3T4DA 2CTWA 3K5NA 1J5EB 2DQ0A 3ZMTA 3D3IA 4RAIA 2CAZC 1SERA 1K7DA 1FXKB 2EIJC 1KKDA 5BZBA 2Q7HA 2V1DA 3H1HH 3FB5C 2UUAB 2DWDC 3CP1A 4FLZA 1QLEB 4LFCB 1SQPH 2Q69A 3K0GA 3HKBA 3P32A 1ZLZA 4JI6B 3ETDA 2DJVA 2V7QG 4NTWA 1NT2B 3A0RA 5FLXN 5D5QA 1H8HG 4LC1A 3L71H 3ZS8C 5LMUB 1RPOA 1M5IA 2M6YA 2X6BA 4FLXA 1AJQA 2QA4V 2AXTZ 1NH2B 1JMKC 2UUBB 3K9SA 1FAFA 5KLVH 3ABTA 3HKBB 1HP8A 5KX5A 1MMMA 3E8GA 3DC6A 1OCOB 3K04A 4YIOA 5IYBO 4LFBB 4X62O 1Q81W 1WAZA 4JI0B 2Q6AA 4K8XA 3B2EE 4BIOA 1Y4MA 3IJ4A 1THZA 2HG5C 1AI4A 2CGOA 2HHHB 1SQFA 4DV7B 2OTJV 5KX5B 4I7ZB 4R8CA 4X20A 2QWOB 5B5EZ 4EKWA 3G71V 2VQFB 3BCCH 5CBFA 3E8BA 2JEXA 3UCSC 5IJ9A 2D3OW 2BTQA 1VQKV 1V55C 3AK1A 5GTHZ 2FMLA 3BAAA 2LGWA 4X20B 2F93B 2Q5ZA 4LF6O 2FB5A 4J42A 2Y0IA 2RMKB 3F7YC 3AG7A 5JJNB 2CUGA 5IJ9B 3M7MX 2BTQB 2XOKG 3I55V 5CMUA 4DR3B 4LF4B 5FPOA 3QO5A 2GHYA 2WLMA 2XAJA 4Q6GA 2EIJB 4CH3A 3WU2Z 2PGGA 4FM0A 4G2KA 4O4IA 4YJ3A 3F5TA 3D8CA 3ZRXA 1K34A 2E76B 1OHHG 4JPRA 4XDKA 5JWPA 4QIWF 3HPLC 4RQEA 1KMIZ 3AG4C 4TUYA 1I94O 1R3JC 1Q8IA 3OUFA 3ZN1A 2IM9A 4O4IB 4YJ3B 4I4TA 2DOSA 1YTFD 5KUMA 1KU9A 3I56V 2R9IA 2MK3A 4DW0A 2E75B 2YDEA 1DF4A 4TUYB 4IT5A 1GKFA 4DV1B 2P4VA 3SPGA 1YSCA 1Y6XA 4I4TB 2LW7A 4BW5A 3CXCU 4Z1MG 1H2SB 1AJNA 1YITV 4RWUA 4B3TB 3J80N 1JA8A 2JGUA 2O57A 1NTMH 5GW7A 1SKVA 3J81N 4IGGA 1HNZO 3PJSK 1DLBA 2W6JG 2X6AA 2A79B 1I5YA 4YHHB 4DV4O 1B06A 3LNMB 1CEZA 5LA6A 5B3SC 4PI2A 3MD0A 3K58A 4DV0B 1GMGA 2JGDA 3TXQA 1SS3A 4U3JA 1XNQB 2V4DA 4H13B 2X6CA 3SYOA 2GDSA 3ABUA 1FJGB 3T1YB 3SJBC 4LH6A 4JAUA 1N36O 4DV3B 5LA6B 4DR1B 5IDJA 3T2MA 3CCQV 1IBKO 1AB3A 2HEPA 5KUKA 2JGDB 4NXNO 4U3JB 3W7TA 3OMAB 1GTOA 1H2NA 2A0LA 3K0DA 2YIAA 3AG4B 3J7AU 4FK5C 3CRMA 3QO7A 4UFZA 3A2FA 1D5AA 4X65B 3RFRA 1IXMA 4ASUG 2OYQA 1BL8A 3THOA 1NJIW 1TGOA 4UXNA 4CH4A 1NVPD 3STZC 1UFIA 1JQ0A 1S0VA 2HFEC 3W7UA 2UUAO 3SPIA 3JAKA 2Q67A 1N0JA 1AR5A 4LFCO 4NXMB 3G6BA 2G38A 4JI6O 3RYFA 3Q4HA 4ZIBA 4YY3B 3K5OA 5LMUO 3NXSA 4DO2A 1MZEA 5JVDA 1F23A 3DGEA 3K59A 2P4KA 5CA3A 2UUBO 1Q86W 1QNMA 2WLIA 3AG2C 3JAKB 1RM1C 3WG7C 2NN4A 2UUCO 2PTMA 3RYFB 3Q4HB 4LR3A 5B3SB 2PYJA 3OW2U 4DR2B 4LFBO 1L8DA 5JVDB 4JI0O 4L8JA 1PL0A 3CE2A 3RYCA 5KHIA 4W4LA 5LBQA 2WLIB 2DMXA 3HB3B 4DV7O 4MVOA 1XILA 2Q9LA 1XOUA 1EBOA 5IJ0A 3ABLC 5EC2C 1K97A 3K03A 1SQVH 2QWPB 3DSQA 5DM6V 4GT1A 4K35A 3AK3A 5J9PC 3RYCB 2YUAA 3L74H 3OR6C 3WB0A 2ZD9A 1VQOV 3JATA 3EXAA 3K57A 1AJPA 5IJ0B 1H2MA 4GX0A 3APOA 2EZOA 1XEQA 3ASOC 3G80A 5BY1A 4HZ3A 3E35A 1R73A 2YC0A 3JATB 4EB6A 4P2ZA 1P7BA 1PNKA 3HKEA 1PPJH 1SC5B 4KFMA 2QWQB 4U7OA 2HVJC 3PN1A 3JAMN 3I5DA 2ZR2A 3P3NA 2AZ2A 4EB6B 2JS5A 4PA4A 3HKEB 1PNMA 3QF7A 3F7VC 3RVYA 1Y74B 3K3WA 3EVKA 2QJ1A 2ADPA 3K79A 2Z0AA 4H37A 3JARA 4TQFA 4MVMA 1ZUQA 4UVAA 1PL4A 4LF6B 3ASNC 4DXWA 2YIBD 4FLVA 4WFFA 3AG2B 1GK9A 1RM1B 2CTRA 4LFAO 3M8AA 3WG7B 5CA1A 3CRAA 2ZE8A 1Y66A 1SQGA 4MVQA 5DECA 2AW9A 1WPBA 1HDJA 4PDVA 3ZHRA 1F51A 1QCEA 3JARB 1Q6UA 1U96A 5KAIZ 2ITDC 3CX5F 1BHBA 4QE9A 4B3TO 4NR1A 1XL6A 5CA1B 3OMNB 3NR7A 2PY5A 1AI7A 5LGTA 3U0ZA 3ABLB 3P30A 3CWBH 2F23A 4JTCB 5B1BC 1NS1A 5LMNO 1OCCC 4OXSA 1VQ4V 4Z1VA 1NKDA 4R6ZA 1EN6A 3LUTB 4DV0O 1J95A 5KHGA 3ASOB 1GAXA 2ZDIC 4X88A 1GN6A 5BMVB 2VQEO 2IJKA 1XL4A 3T1YO 4LF7B 1VP7A 5LGNA 4MTGA 5TISZ 4DR1O 2H8PC 3QNEA 2ZE5A 4GZRB 3ZRVA 3BVOA 1TUBA 1ZSPA 2L35A 3BPZA 3W7WA 1XREA 1YZBA 2LGQA 4FLYA 5EZYB 3JD1A 3KZIZ 3SPHA 4DV4B 2LO1A 2P22C 3P3PA 2P6JA 3BHPA 1K73W 4L87A 2ZCEA 4X1YA 2KKWA 2WA4A 1TUBB 1I7FA 2DYRC 3D3QA 5HFLA 3H1JH 4X65O 3OMIB 2YXLA 1FXHA 2WWWA 4H44B 1VF7A 1V9PA 4XDLA 3KCYA 2OIGA 4YJ2A 4FVMA 2H94A 3CSXA 5EIBC 4RUEA 4KHPB 2PI4A 4X1YB 1A32A 1N36B 3K08A 5B1OA 2EJ7A 4LBEC 3OTOO 4P30A 2Q8VA 4NXNB 1O9HA 1MG1A 4O2AA 1NU1H 1NZ6A 4DV5B 3K9AA 2ZIMA 2C2AA 3AG1C 4QGPA 4NXMO 2WLNA 4X1IA 1N32B 4UB6Z 2BOCC 1S5HC 4J80A 2P7TC 3UQ8A 4Q20A 2E3CA 1QR9A 1ROPA 4YY3O 1YF2A 3FYEB 5J2TA 2KG7A 2FL4A 2OIEA 1IXBA 1JFFA 4FLUA 3UT5B 2ZDIA 5B1BB 3SYCA 1FKAO 1KQSU 4I0XA 4X1IB 1OCCB 1FXVA 1URFA 2JEUA 1QVGU 2LP7A 5J2TB 2KG7B 5HFMA 4MVRA 4DR2O 1JFFB 3CRRA 2YEVA 2GTAA 4AI8A 1BCCH 1OV9A 2LJ2A 3JCZA 4DYLA 4TWKA 3JD4A 1BQZA 3CCSV 4I0XB 1MOFA 2A9HA 4XDJA 1T5EA 4FFKA 1RP3B 3FFQA 1COWG 3ZHUA 4ABMA 1HNXB 2YEVB 1YI2V 2VRZA 2AZ0A 3CHXA 2CE4A 1KYOF 4ZI7A 2FKXA 1Y67A 4FMTA 4PHZA 1YJWV 2ZQMA 3L75H 2IU3A 3DTUB 2UUCB 1GM8A 3VBBA 2Z3YA 2DYRB 5LL6Y 5EC1C 1Z5VA 1N8RW 4I55A 1NR1A 4JI3O 2YIDA 1D2DA 4ZI7B 4QPJA 2F95B 3LDDA 2XAGA 3CC7V 1AROP 3G67A 5JH7A 3OD4A 5JJEB 3FB8C 3OTFA 4JV5O 4IL6Z 4HAMA 4C7UA 2OCHA 3CD6V 4I55B 2PF4E 1KD1W 3KCXA 1XI1A 3U11A 3STLC 2Y48A 4AILC 5EBWC 3AG1B 1GH6A 3HKDA 4GKJB 5JH7B 1W2BU 2P06A 1R6TA 4I50A 5A9GA 1JJ2U 1R6NA 1LUWA 2ZT9B 1CP9A 1MSWD 4X66B 5B1NA 2MW2B 4YXWG 4UB8Z 1G8MA 3T4ZA 3HKDB 2WA3A 4PD4F 1GN3A 1K3EA 3RYHA 4I50B 3SDLA 1BZKA 5B66Z 3ZHTA 4KXRA 1WJZA 3VQXA 3RYIA 4BR6A 1IDSA 1SETA 2ZXWC 2B1IA 2FYUH 3R66A 4UV8A 3A8TA 5C8YA 2UXXA 3IAYA 3RYHB 3W7SA 2UXCB 4AQYB 3OAAG 4HBNA 3RYIB 2K1EA 3TCUA 2L6LA 5IT9N 4UVBA 4J11A 3ZCCA 4RQFA 1E79G 3AEIA 3B4SA 3FB7C 3S3WA 5LHIA 1JJOA 3CS5A 4U7NA 5E79Z 5FL7G 3OFNG 3E8HA 4LFAB 3JSNA 4UCRA 1SRYA 2R72A 4H0LB 4O2BA 1VMGA 2Y0PA 2ZKOA 3HKCA 4IYHA 2ZNJA 1EZJA 4LF7O 4CH6A 1L0LH 2BOBC 5DN6G 4E4EA 3CB2A 3CYOA 4MTOA 4WFBV 4O2BB 2QEXV 2X7RB 3HKCB 2YI9A 4GX1A 3JAWA 4FPPA 1ENVA 2OCCC 2E74B 2F43G 2QM7A 5KHKA
chains in the Genus database with same CATH topology
1FXKC 3ABLC 5EC2C 1K97A 2AHZA 2DQ3A 3K03A 1V55B 2EIKC 2JK5C 4I5SA 5DM6V 4GT1A 5J9PC 2WSSG 4FIPC 4I9WA 3OR6C 1H2GA 2ZD9A 5L3DA 2EJRA 2Y69B 3SPJA 1VQOV 1NQTA 1QLEC 4PA6A 3G6EV 1NH2D 1EFRG 3E86A 3LDCA 1AJPA 3IFXA 2EINB 3CC2V 4GX0A 1DTOA 1OCZC 2WLJA 2WLLA 2EZOA 3QO8A 3ASOC 4JASA 4HZ3A 3E35A 1JPXA 1QVFU 4WFAV 1F4MA 2QM8A 2ZXWB 4G28B 1R73A 2IH3C 5H9CA 4X8AA 4P2ZA 1P7BA 1QBZA 3CMAV 4MW8A 5CBHA 3CPWU 4PDMA 1PNKA 1OCOC 4RO2A 2IJHA 2UXNA 4KFMA 4U7OA 2WLLB 1VQ6V 5L3FA 1S3JA 2HVJC 4QJFB 4MS2A 3CCEV 4TT3G 1AR1B 3G4SV 2DYSC 3H01A 2JDIG 2ZR2A 4GX5A 1H8EG 3CCVV 2XAFA 4JTDB 1AI5A 3ZRSA 3E2EA 4JTAB 4PA4A 3TK1A 1PNMA 1YIJV 1LNQA 2DW4A 3F7VC 4CZZA 1YJ9V 2NLJC 3CC4V 3RVYA 1YHQV 2EBOA 3K3WA 4R7CA 5L3CA 1CPYA 3ZN0A 2JIZG 2LFSA 1VQ9V 1YTFB 3K79A 4XBFA 2WLKA 4PA7A 4H37A 3CCMV 4MVMA 3KG2A 4HYOA 4UVAA 2EILC 4WFEA 3ASNC 4DXWA 3ABMB 4WFFA 3AG2B 1GK9A 4UVCA 1RM1B 2DWEC 3WG7B 1W0KG 1W0JG 1OZ0A 3B77A 4WFGA 1KP2A 1E1QG 1Y66A 2ZR3A 3K06A 1K9MW 1OCRC 2AHYA 4MVQA 2PI5A 4PDLA 1FXKA 1VQ7V 3RW0A 4PDVA 4UUJC 2JJ2G 1F51A 4J9ZB 1QCEA 1H38A 3E83A 2ITDC 1BHBA 4QE9A 2WPDG 3T4DA 1XL6A 3ZJZA 2DQ0A 3ZMTA 3ZMZA 2CK3G 3D3IA 3SYPA 4RAIA 5LHHA 3AG3B 4H33A 4JF3A 1KECA 2OCCB 2HVKC 3OMNB 1SERA 1K7DA 1AI7A 5LGTA 1S77D 2IJIA 1FXKB 3ABLB 3JD0A 3P30A 1VQ5V 2EIJC 2EIMC 2EIKB 2P90A 5C93A 1KKDA 5BZBA 3ZIAG 2R9RB 2V1DA 4JTCB 3FB5C 5B1BC 3JD2A 2DWDC 4ZKIA 2IJJA 3CP1A 1QLEB 2Q69A 3K0GA 3P32A 3UM7A 1FFTB 1OCCC 3BY6A 4OXSA 1VQ4V 3ETDA 2V7QG 1NKDA 3A0RA 4R6ZA 1H8HG 4LC1A 1PKXA 1OCZB 3LUTB 1KC8W 1RPOA 1J95A 3ASOB 2X6BA 3IC7A 3W7XA 1AJQA 1QLNA 1BMFG 3OEHG 2QA4V 5L3BA 1NH2B 5EBLC 2ZDIC 1S76D 4X88A 4WCEV 4MSWC 3TETA 2IJKA 1XL4A 3ABTA 4PELA 4WFHA 3ZRWA 3OM3B 3FB6C 1K4DC 5LGNA 3E8GA 1OCOB 4MTGA 3K04A 2H8PC 5IYBO 1K5QA 3QNEA 3OEEG 3ZRVA 3B8NA 3M99B 1Q81W 1R6KA 2Q6AA 1GO3F 4CBCA 5IY5C 3W7WA 1Y4MA 1PD3A 2DYSB 5IYCO 1THZA 2HG5C 3ZMVA 2KB1A 4JYBA 1AI4A 3ZRWB 2OTJV 2B5UA 3JD1A 3SPHA 4TSFG 5B1AC 2XNDG 2P6JA 4R8CA 1JX9A 4BIUA 1E1RG 3LDEA 3OR7C 1K73W 4L87A 1HWYA 2HJFC 2DYRC 1M90W 5HFLA 2IH1C 3VOUA 4EKWA 3OMIB 3G71V 1FXHA 5CBFA 3E8BA 2WWWA 2JEXA 3FKSG 2D3OW 4XDLA 1VQKV 1V55C 3CMEV 4JYCA 1R3IC 2H94A 4RUEA 3RBZA 2PI4A 4LCUC 1NVPB 3K08A 5B1OA 4LBEC 3SYQA 3ZMUA 1Q82W 4P30A 1NR7A 2HKOA 2LFRA 4N23A 3F7YC 3EHBB 1MG1A 1K8AW 3MHSC 3K9AA 3JD3A 1G4YB 3AG1C 2C2AA 2XOKG 3I55V 5CMUA 2WLNA 1Q7YW 3QO5A 2GHYA 1I5XA 2BOCC 1S5HC 2WLMA 2P7TC 2XAJA 5CN0A 4Q20A 5IYDO 1YJNV 1QR9A 1ROPA 1AI6A 2EIJB 2EIMB 3FYEB 4G27B 1P4RA 1VQLV 4G2KA 3ZRXA 1K34A 1OHHG 4JPRA 4XDKA 3CCRV 2ZDIA 5B1BB 3SYCA 1F4NA 1DF5A 3E8FA 4QIWF 3HPLC 4FJCC 2OTLV 1KQSU 4RQEA 4ZBMA 3CCJV 3AG4C 2XASA 1OCCB 1FXVA 4MTFA 3ML0A 2JEUA 1K33A 1MABG 2IW5A 1QVGU 3FYIB 2LP7A 1R3JC 5HFMA 3OUFA 1NBMG 4MVRA 3ZN1A 4PA3A 2YEVA 5EK0A 1M1KW 1M57C 1TUEB 1YTFD 4R50A 5KUMA 2IU0A 5CBGA 3JCZA 1SESA 4TWKA 3WFVA 2R9IA 3I56V 2X0LA 3GWOA 2MK3A 3JD4A 5KA5A 2XAQA 3CCSV 1DF4A 1MOFA 2A9HA 3OUSA 4XDJA 3X2QC 3CCUV 2JJ1G 1GKFA 3B8MA 1COWG 3SPGA 2ATKC 1YSCA 2YEVB 1YI2V 4MVZA 4BW5A 5IY5B 3CXCU 4Z1MG 1RPRA 1AJNA 2WAMA 1YITV 5LGUA 1JCHA 1JVMA 3D36A 2B1GA 3JYCA 5GW7A 4FMTA 1YJWV 2ZQMA 2XAHA 1V54C 2IU3A 3DTUB 5B1AB 4WF9V 1KP3A 4UV9A 3PJSK 1GM8A 4X89A 3VBBA 2Z3YA 2DYRB 1DLBA 2W6JG 2X6AA 5EC1C 3UKMA 1N8RW 4GCZA 4QPKA 2A79B 1I5YA 3ABKC 2P67A 1NR1A 3ETGA 3IGAC 1ZWIC 4QPJA 3LDDA 1K92A 2XAGA 3CC7V 1AROP 1M56C 4LP8A 1BHAA 3LNMB 1CEZA 2M7WA 4JAVA 5B3SC 4P9OA 3MD0A 4P9PA 3FB8C 1VQPV 1GMGA 4HAMA 3T1CA 3CD6V 2Q68A 3F5WC 2X6CA 3SJQC 3SYOA 1KD1W 2HR3A 4KUMA 3SPCA 3ABUA 5E1AC 3STLC 2Y48A 1FS0G 5EBWC 3AG1B 1WLEA 4JAUA 2EILB 4BIZA 1W2BU 4MW3A 5IDJA 3ASNB 3T2MA 3CCQV 5KUKA 2WLHA 1SZTA 3W7TA 3EFFK 1GTOA 3OMAB 1OCRB 4N21A 1JJ2U 1R6NA 3RVZA 3MHHC 1JOYA 1CP9A 1MSWD 2A0LA 3K0DA 2Y69C 3ETEA 3OE7G 5B1NA 3ZMSA 4YXWG 1G8MA 3T4ZA 1VQNV 4E2LA 4PDRA 4QNHB 2EZPA 3AG4B 2EINC 4GX2A 1K3EA 4FK5C 3OGCC 3QO7A 4JGSA 2W0FC 4MTXA 2Z5UA 1B6QA 3CCLV 1M57B 1IXMA 2HLDG 3E89A 4MVUA 5H6RA 4ASUG 3GB7C 1SETA 2ZXWC 2B1IA 4UV8A 1BL8A 1GM7A 1R3KC 3X2QB 1NJIW 2UXXA 3W7SA 4UXNA 3OAAG 2FTKA 1NVPD 3STZC 2OT5A 4PA9A 1JQ0A 2W6IG 1S0VA 2K1EA 2ITCC 3TCUA 1K4CC 4UVBA 2HFEC 3W7UA 4J9YB 2YSUB 2QE7G 3ZCCA 1WPXA 4RQFA 3SPIA 1E79G 3AEIA 2Q67A 3FB7C 5LHIA 1ORQC 4RUFA 4U7NA 5FL7G 1M9NA 1GM9A 1L1FA 1V54B 3OFNG 3E8HA 4KP4A 1PNLA 2NNUA 1SRYA 3NXSA 4DO2A 2GSMB 1F23A 2QKSA 3DGEA 5LHGA 3ABKB 5L3EA 4BAYA 3LSSA 5CA3A 5KA6A 1UJWB 1Q86W 3ABMC 4MVSA 2WLIA 1EZJA 3AG2C 4MT8A 1RM1C 3WG7C 1S72V 4QE7A 1M56B 5H6QA 2BOBC 5B3SB 3BEHA 5DN6G 3OW2U 3CYOA 4MTOA 1VQMV 3LSQA 3R65A 4WFBV 3SYAA 1PL0A 4F4LA 1VQ8V 2QEXV 5LBQA 2X7RB 2WLIB 4GX1A 4FPPA 1ENVA 3AG3C 3HB3B 2OCCC 2F43G 4MVOA 1K5SA 1QR8A 5L3GA 1R3LC 2QM7A 2QTOA 1EBOA 5EBMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZO A;  1I5X A;  5CN0 A;  3P30 A;  3B77 A;  1QR9 A;  1Y66 A;  1JPX A;  2M7W A;  1SZT A;  3WFV A;  4G2K A;  4N21 A;  3GWO A;  4FIP C;  2MK3 A;  5H9C A;  2P6J A;  3CYO A;  1K34 A;  3MHH C;  5KA5 A;  4JPR A;  1MOF A;  1DF4 A;  1QBZ A;  4N23 A;  1QCE A;  3CP1 A;  5HFM A;  2EBO A;  1DF5 A;  1MG1 A;  4FJC C;  1DLB A;  3B8M A;  5HFL A;  2X7R B;  4E2L A;  2EZP A;  3MHS C;  1F23 A;  3K9A A;  3B8N A;  1I5Y A;  3M99 B;  1ENV A;  1K33 A;  2OT5 A;  4FK5 C;  4JF3 A;  1JQ0 A;  1QR8 A;  5CMU A;  5KA6 A;  2LP7 A;  4JGS A;  1Y4M A;  1EBO A;  3H01 A; 
#chains in the Genus database with same CATH topology
 2N04 A;  5LMN B;  2AHZ A;  1P49 A;  4B3M O;  1V55 B;  2JK5 C;  4I5S A;  4KL1 A;  3ZHS A;  4DV6 O;  4FIP C;  1X59 A;  1G6U A;  2EJR A;  5H2F Z;  3JAW B;  5LXT A;  3G6E V;  1EFR G;  2QWN B;  3E86 A;  3LDC A;  5K1P A;  3SJC C;  2VQE B;  3K5M A;  4KHP O;  1OCZ C;  2RCV A;  2WLJ A;  2ZE6 A;  5BXZ A;  1QVF U;  1AIL A;  4WFA V;  1F4M A;  4UCT A;  2ZXW B;  1HR0 O;  1RFY A;  4DV5 O;  4UCS A;  3ZHV A;  4JI8 O;  1QBZ A;  4MW8 A;  4UCU A;  4PDM A;  1EZV H;  1N32 O;  2UXN A;  4PI0 A;  3A0H Z;  2DYS C;  1IVS A;  3H01 A;  2JDI G;  4GX5 A;  1H8E G;  2K9P A;  5IE9 A;  4JTD B;  1KUQ A;  2QKA A;  3TK1 A;  1YIJ V;  1SQB H;  3MAQ A;  1LNQ A;  2DW4 A;  1YJ9 V;  1M93 A;  2NLJ C;  1Z5W A;  4J7Z A;  1XNR B;  3ZBH A;  1VQ9 V;  5KHH A;  1YTF B;  1GRJ A;  2Q73 A;  2WLK A;  4PA7 A;  1Q90 D;  3OTO B;  2EIL C;  3CRC A;  4GUN A;  2CDY A;  2DWE C;  1M4U A;  1W0K G;  2EUL A;  4JYA B;  3B77 A;  3N2K A;  1OCR C;  2AHY A;  2PI5 A;  1VQ7 V;  1HNX O;  3RW0 A;  4Z2W A;  1WP7 A;  3E83 A;  2PZS A;  4X9Q A;  2CK3 G;  3SYP A;  2OCC B;  2HVK C;  1I0H A;  3N2K B;  4LF9 B;  3JD0 A;  4J10 A;  1XQ8 A;  1VQ5 V;  2A3Q A;  3ZIA G;  2R9R B;  3JD2 A;  2IJJ A;  3L9D A;  3UM7 A;  2JS3 A;  2YXY A;  1FFT B;  3BY6 A;  5KHJ A;  4JI5 B;  5KMG A;  1OCZ B;  5AG2 A;  1KC8 W;  3W7X A;  3H9V A;  5EBL C;  1WA8 A;  3CEI A;  2UXB B;  1Q6I A;  1DGS A;  1K4D C;  4GKJ O;  3TXS A;  2XTA A;  1K5Q A;  3B8N A;  2CH7 A;  4LF5 B;  1NTZ H;  5IY5 C;  1GO3 F;  4CBC A;  1WA8 B;  2DYS B;  3ZMV A;  2KB1 A;  4X66 O;  3SJA C;  4DR6 O;  5CB4 A;  4TSF G;  4JI3 B;  2XND G;  1PP9 H;  3OR7 C;  2CH7 B;  5FNV A;  1M90 W;  3H1I H;  4DW1 A;  2IH1 C;  4OX9 O;  4JV5 B;  1S5L Z;  2F1M A;  5CB4 B;  3CME V;  1AVM A;  2QSA A;  4JAA A;  3RBZ A;  4TV8 A;  2UXC O;  5FNV B;  4AQY O;  1NVP B;  3BA8 A;  3ZMU A;  1Q82 W;  1NR7 A;  1SZX A;  2HKO A;  2LFR A;  2PYL A;  4N23 A;  3EHB B;  1K8A W;  3MHS C;  1YCI A;  3JD3 A;  4YIP A;  2ZNI A;  4TV8 B;  1XMQ O;  5LYJ A;  1Q7Y W;  1I5X A;  1WN7 A;  4K0K B;  3MDS A;  5IYD O;  4FM1 A;  1YJN V;  1AI6 A;  4G27 B;  1P7G A;  3CCR V;  1F4N A;  3N2G A;  4FJC C;  4ZBM A;  2XAS A;  3BRC A;  5LYJ B;  1MNG A;  4JI4 B;  3ML0 A;  1K33 A;  2IW5 A;  3FYI B;  4PA3 A;  4J7J A;  5EK0 A;  4FFB A;  4J41 A;  2F4V B;  1M57 C;  4R50 A;  2GV9 A;  5CBG A;  1QQC A;  1SES A;  3WFV A;  2JVD A;  3N2G B;  2ILM A;  5KA5 A;  3UO2 A;  2GUZ A;  2QWR B;  3B8M A;  1DK1 A;  2D2C B;  2ATK C;  4MVZ A;  4FFB B;  5IY5 B;  4B3S O;  2GBO A;  1HNW O;  3TJT A;  1JCH A;  1JVM A;  2B1G A;  3JYC A;  2VWK A;  4UCO A;  2GUZ B;  4JZG A;  3QG5 A;  2LW1 A;  4UV9 A;  4X89 A;  1Q5O A;  5LP6 C;  1AP5 A;  5CA0 A;  4QPK A;  2P67 A;  3ETG A;  3K5L A;  4FZ0 A;  1U97 A;  4LP8 A;  2M7W A;  4P9O A;  3E22 A;  2BE3 A;  4DR4 O;  3QTC A;  3CRQ A;  5CA0 B;  4B3M B;  2Q68 A;  3C3T A;  1WB8 A;  2HR3 A;  2F66 C;  4DV6 B;  2YIB A;  5E1A C;  2RJZ A;  2XHB A;  1ZL8 A;  1WLE A;  3CJH A;  3T1H B;  3N27 A;  3E22 B;  3ASN B;  3A0B Z;  5IWA O;  1GN4 A;  4JI1 O;  1XNR O;  3EFF K;  4N21 A;  1IUR A;  2Y69 C;  3ETE A;  3ZMS A;  1F7Y A;  3VQW A;  4JYY A;  3CJH B;  5EYP A;  1VQN V;  5LOV A;  4QNH B;  2EZP A;  4JYA O;  2EIN C;  1HR0 B;  4B3R B;  3OGC C;  4JI8 B;  4YJ2 B;  2KQX A;  2Z5U A;  1B6Q A;  1M57 B;  4MVU A;  3E89 A;  5H6R A;  4GLX A;  5EYP B;  4O2A B;  5LOV B;  1GM7 A;  3B09 A;  1LUV A;  4LF9 O;  5KAF Z;  1ZAU A;  2FTK A;  2W6I G;  5LP6 A;  2ITC C;  1K4C C;  1WPX A;  1XMO B;  5H5N A;  3BFR A;  4HNA A;  4JI5 O;  1GM9 A;  1L1F A;  4TQD A;  1VIB A;  3TGU H;  2NNU A;  2UU9 O;  1BSM A;  5LP6 B;  2CTP A;  4EEQ A;  5L3E A;  3LSS A;  3ETQ A;  1UJW B;  2UXB O;  4MT8 A;  1S72 V;  4HNA B;  1WNS A;  1Y76 A;  2P5O A;  3BEH A;  4EFB A;  2ZM6 B;  2VWJ A;  1VQM V;  3LSQ A;  3R65 A;  4LF5 O;  3WB1 A;  4DR5 O;  2RN9 A;  3AG3 C;  3RN4 A;  1TVK A;  1BS3 A;  5L3G A;  1R3L C;  4DK0 A;  1Y76 B;  4CH5 A;  2QTO A;  5F2V O;  1VQL V;  5EBM C;  1AR4 A;  1EM1 A;  2DQ3 A;  2EIK C;  4B7E A;  1X4T A;  2UXD O;  2Y4U A;  5L3D A;  1YDX A;  2QDO A;  2Y69 B;  3SPJ A;  1NQT A;  4PA6 A;  1TVK B;  4F6E A;  1D5N A;  2ODM A;  2Q4P A;  3IFX A;  2EIN B;  2ZE7 A;  3BAB A;  2R70 A;  4DK1 A;  2HJD A;  2WLL A;  1IBM O;  2QGN A;  3ICX A;  1JPX A;  4LF8 O;  3WB2 A;  1QHT A;  2QM8 A;  4BW9 A;  2IH3 C;  4LNU A;  5H9C A;  4X8A A;  3CMA V;  4RO2 A;  5IYZ A;  3DC5 A;  4X1K A;  4DR6 B;  4JI2 O;  2WLL B;  1VF5 B;  5L3F A;  4K0K O;  1S3J A;  4TT3 G;  1AR1 B;  4LNU B;  4OX9 B;  2XAF A;  3ZRS A;  1AI5 A;  3E2E A;  4JTA B;  3BA9 A;  3ZED A;  4FZ1 A;  5IYZ B;  4X1K B;  4JI4 O;  4CZZ A;  3CC4 V;  1YHQ V;  4D7T A;  5L3C A;  5BR8 O;  4O4L A;  3SGI A;  1PM9 A;  4XBF A;  2F4V O;  3H1K H;  4NTY A;  4PV1 B;  4CS2 A;  4WFG A;  1KP2 A;  1E1Q G;  1K9M W;  5C8Y B;  3GVM A;  4O4L B;  1XMQ B;  5GTI Z;  4UUJ C;  4J9Z B;  1H38 A;  2CGN A;  3ZX6 A;  5ITZ A;  1RSO A;  1Q6H A;  2WPD G;  3ZJZ A;  5J2U A;  3ZMZ A;  4DUY B;  3U10 A;  1IBL O;  5LHH A;  3AG3 B;  4H33 A;  4JF3 A;  1KEC A;  3ZHQ A;  1VF6 C;  2Q0A A;  4DUZ O;  1S77 D;  2IJI A;  1Q43 A;  1ZX3 A;  5A2Q N;  1H2K A;  2EIM C;  2EIK B;  2P90 A;  5C93 A;  3RWR D;  3UO3 A;  5ITZ B;  1RSO B;  5J2U B;  4ZKI A;  4FLT A;  4ZOL A;  1XUQ A;  1P84 F;  1HW7 A;  4LH7 A;  4ZHQ A;  2ETN A;  4X64 O;  1PKX A;  1FFX A;  1MA1 A;  3IC7 A;  1QLN A;  1BMF G;  3OEH G;  5L3B A;  1OJH A;  2Y4T A;  1S76 D;  4WCE V;  4MSW C;  4B3S B;  3TET A;  1W59 A;  1HNW B;  4PEL A;  4ZOL B;  2HP8 A;  4WFH A;  3ZRW A;  1BT8 A;  3OM3 B;  3FB6 C;  4ZHQ B;  3T1H O;  1NTK H;  2ZIN A;  3IC9 A;  2A06 H;  1FPO A;  3L70 H;  1FFX B;  3OEE G;  3M99 B;  2NR5 A;  1R6K A;  1SF9 A;  2N74 A;  1PD3 A;  3JAL A;  5IYC O;  5JJJ B;  4JYB A;  3AK2 A;  2E5L O;  3ZRW B;  3OT7 A;  2B5U A;  5B1A C;  5LXT B;  4BIU A;  1JX9 A;  4B3R O;  1E1R G;  3LDE A;  2YIC A;  1HWY A;  3RT3 C;  2HJF C;  3QVN A;  1N33 O;  3JAL B;  3VOU A;  4DR4 B;  2RNB A;  4CS4 A;  2RDC A;  4IHJ A;  4I9Q A;  2W0X A;  3D36 C;  2ADQ B;  2RQ6 A;  3FKS G;  2Q7G A;  2PUS A;  4JYC A;  3SR2 C;  1R3I C;  5GON A;  3H1L H;  3HR0 A;  1VF6 A;  4LCU C;  3KKY A;  4OPA A;  2QR4 A;  2BSK A;  3SYQ A;  4DRX A;  4DR7 O;  2Q7E A;  5IWA B;  4JI1 B;  4IHJ B;  4DV2 O;  3O65 A;  1JR9 A;  1G4Y B;  1XMO O;  1YVW A;  4K8Z A;  1VAR A;  2QM4 A;  5GON B;  5CN0 A;  1XBL A;  2BSK B;  3APQ A;  4DRX B;  2EIM B;  3L72 H;  3JSL A;  1P4R A;  4TOI A;  3VQV A;  1J5E O;  4J7K A;  1Q3E A;  1DF5 A;  3E8F A;  2GTS A;  2OTL V;  1N34 B;  3CCJ V;  4MTF A;  2N05 A;  1MAB G;  2ZM6 O;  1NBM G;  4LWS A;  2Q0O C;  4JI7 B;  1M1K W;  1TUE B;  4NVP A;  2IU0 A;  3VQY A;  2X0L A;  3GWO A;  2B9Z A;  2XAQ A;  3OUS A;  3X2Q C;  3CCU V;  2JJ1 G;  1PV0 A;  4GKK B;  4LWS B;  4FM2 A;  4ICG A;  1RPR A;  2WAM A;  2UU9 B;  4NYK A;  4B08 A;  5LGU A;  3D36 A;  2XAH A;  1V54 C;  2A7W A;  5B1A B;  4F6R A;  1QU7 A;  1EN4 A;  5JCO C;  4WF9 V;  1KP3 A;  5KMG B;  2VS0 A;  3FAV A;  3UKM A;  1GN2 A;  4BWA A;  4GCZ A;  2HHH O;  3ABK C;  1NI8 A;  3IGA C;  3C3S A;  4UCV A;  1ZWI C;  4DR5 B;  4IIJ A;  1K92 A;  1M56 C;  4FLW A;  4F6R B;  1BHA A;  1B04 A;  4JAV A;  1VQP V;  4P9P A;  2VQF O;  3FAV B;  3T1C A;  3O9O A;  2EX3 A;  4D6T H;  3F5W C;  2ARH A;  3SJQ C;  3GWK C;  3L73 H;  4KUM A;  3SPC A;  3JCU Z;  4IIJ B;  2UXD B;  1FS0 G;  1N4C A;  2XUM A;  3DXR A;  4PJ0 Z;  2EIL B;  4BIZ A;  4CC6 A;  4MW3 A;  2WLH A;  4X62 B;  1EN5 A;  1US6 A;  1SZT A;  1FD9 A;  2BCC H;  5D5P A;  1OCR B;  3RVZ A;  2YS8 A;  3MHH C;  1JOY A;  1IBM B;  4NB5 A;  3OE7 G;  4DR3 O;  4LF4 O;  4LF8 B;  1BQ0 A;  1XHX A;  3DXR B;  4E2L A;  4PDR A;  4D7S A;  4GX2 A;  1Y74 A;  1YEW A;  1S5J A;  4JGS A;  3JAS A;  2W0F C;  1XDC A;  1KB9 F;  4MTX A;  4JI2 B;  3CCL V;  2HLD G;  3GB7 C;  5K1X A;  2KSD A;  4DUY O;  2BTO A;  1R3K C;  4NKG B;  2DN9 A;  3X2Q B;  2QKC A;  1WB7 A;  2YI8 A;  3JAS B;  5JCO A;  1KBH A;  2OT5 A;  4PA9 A;  5BR8 B;  1MZF A;  4J9Y B;  2CTQ A;  2YSU B;  5DED A;  2QE7 G;  4DV1 O;  1N0N A;  1ORQ C;  4RUF A;  4JZ2 A;  1M9N A;  1V54 B;  1IZ3 A;  4KP4 A;  1PNL A;  1AP6 A;  1CXZ B;  1BGY H;  4OGQ B;  2IBZ H;  1IX9 A;  2GSM B;  2DE0 X;  2QKS A;  4K3A A;  3CXH F;  5LHG A;  1BE3 H;  5JQG A;  3ABK B;  4BAY A;  5KA6 A;  3ABM C;  4MVS A;  3B40 A;  4QE7 A;  1M56 B;  5H6Q A;  2ZIO A;  1MSD A;  1VEW A;  1YXB A;  1I94 B;  4A5U B;  1IBL B;  2OWO A;  1WP8 A;  1FYJ A;  4YHH O;  4DUZ B;  5BMV A;  4WBN A;  3SYA A;  4F4L A;  1VQ8 V;  5JQG B;  1K5S A;  1QR8 A;  1TA8 A;  4TV9 A;  1FXK C;  1XNQ O;  5FPR A;  3C90 A;  4WBN B;  4X64 B;  1FJG O;  2WSS G;  4I9W A;  4OPH A;  5EZY A;  1H2G A;  4DV3 O;  1QLE C;  4O4H A;  1NH2 D;  4TV9 B;  3CC2 V;  1DTO A;  1HNZ B;  4IYI A;  4CS3 A;  1G1X B;  3QO8 A;  4JAS A;  3FD9 A;  4GYC B;  1Z2G A;  3S3X A;  3LSU A;  1KKC A;  4NTX A;  4G28 B;  2LQT A;  4O4H B;  1SA0 A;  3RGB A;  1O9G A;  2JRI A;  3CPW U;  3OGI B;  5CBH A;  2QTS A;  1OCO C;  2E5L B;  2IJH A;  3FX7 A;  1SQQ H;  1ZL8 B;  5EIB D;  1VQ6 V;  4EFE A;  4QJF B;  2YXH A;  4MS2 A;  3CCE V;  3G4S V;  1TAE A;  1B3Q A;  1N33 B;  1SA0 B;  3CCV V;  1I08 A;  4CC5 A;  1SQX H;  3LNN A;  1N34 O;  1ZTE A;  1IBK B;  2EBO A;  3UT5 A;  4R7C A;  1CPY A;  3ZN0 A;  2JIZ G;  2LFS A;  2H3O A;  1H2L A;  4JI7 O;  3CCM V;  3KG2 A;  4DR7 B;  4HYO A;  4WFE A;  1L0N H;  2AGA A;  3ABM B;  2R9A A;  4O4J A;  4UVC A;  1R1B A;  4DV2 B;  2XT9 A;  1W0J G;  1LR1 A;  1OZ0 A;  4W4K A;  2ZR3 A;  3K06 A;  4PDL A;  4GKK O;  1FXK A;  4AHC A;  2JJ2 G;  1XHZ A;  1UPG A;  4B7K A;  4O4J B;  4U3F H;  3T4D A;  2CTW A;  3K5N A;  1J5E B;  2DQ0 A;  3ZMT A;  3D3I A;  4RAI A;  2CAZ C;  1SER A;  1K7D A;  1FXK B;  2EIJ C;  1KKD A;  5BZB A;  2Q7H A;  2V1D A;  3H1H H;  3FB5 C;  2UUA B;  2DWD C;  3CP1 A;  4FLZ A;  1QLE B;  4LFC B;  1SQP H;  2Q69 A;  3K0G A;  3HKB A;  3P32 A;  1ZLZ A;  4JI6 B;  3ETD A;  2DJV A;  2V7Q G;  4NTW A;  1NT2 B;  3A0R A;  5FLX N;  5D5Q A;  1H8H G;  4LC1 A;  3L71 H;  3ZS8 C;  5LMU B;  1RPO A;  1M5I A;  2M6Y A;  2X6B A;  4FLX A;  1AJQ A;  2QA4 V;  2AXT Z;  1NH2 B;  1JMK C;  2UUB B;  3K9S A;  1FAF A;  5KLV H;  3ABT A;  3HKB B;  1HP8 A;  5KX5 A;  1MMM A;  3E8G A;  3DC6 A;  1OCO B;  3K04 A;  4YIO A;  5IYB O;  4LFB B;  4X62 O;  1Q81 W;  1WAZ A;  4JI0 B;  2Q6A A;  4K8X A;  3B2E E;  4BIO A;  1Y4M A;  3IJ4 A;  1THZ A;  2HG5 C;  1AI4 A;  2CGO A;  2HHH B;  1SQF A;  4DV7 B;  2OTJ V;  5KX5 B;  4I7Z B;  4R8C A;  4X20 A;  2QWO B;  5B5E Z;  4EKW A;  3G71 V;  2VQF B;  3BCC H;  5CBF A;  3E8B A;  2JEX A;  3UCS C;  5IJ9 A;  2D3O W;  2BTQ A;  1VQK V;  1V55 C;  3AK1 A;  5GTH Z;  2FML A;  3BAA A;  2LGW A;  4X20 B;  2F93 B;  2Q5Z A;  4LF6 O;  2FB5 A;  4J42 A;  2Y0I A;  2RMK B;  3F7Y C;  3AG7 A;  5JJN B;  2CUG A;  5IJ9 B;  3M7M X;  2BTQ B;  2XOK G;  3I55 V;  5CMU A;  4DR3 B;  4LF4 B;  5FPO A;  3QO5 A;  2GHY A;  2WLM A;  2XAJ A;  4Q6G A;  2EIJ B;  4CH3 A;  3WU2 Z;  2PGG A;  4FM0 A;  4G2K A;  4O4I A;  4YJ3 A;  3F5T A;  3D8C A;  3ZRX A;  1K34 A;  2E76 B;  1OHH G;  4JPR A;  4XDK A;  5JWP A;  4QIW F;  3HPL C;  4RQE A;  1KMI Z;  3AG4 C;  4TUY A;  1I94 O;  1R3J C;  1Q8I A;  3OUF A;  3ZN1 A;  2IM9 A;  4O4I B;  4YJ3 B;  4I4T A;  2DOS A;  1YTF D;  5KUM A;  1KU9 A;  3I56 V;  2R9I A;  2MK3 A;  4DW0 A;  2E75 B;  2YDE A;  1DF4 A;  4TUY B;  4IT5 A;  1GKF A;  4DV1 B;  2P4V A;  3SPG A;  1YSC A;  1Y6X A;  4I4T B;  2LW7 A;  4BW5 A;  3CXC U;  4Z1M G;  1H2S B;  1AJN A;  1YIT V;  4RWU A;  4B3T B;  3J80 N;  1JA8 A;  2JGU A;  2O57 A;  1NTM H;  5GW7 A;  1SKV A;  3J81 N;  4IGG A;  1HNZ O;  3PJS K;  1DLB A;  2W6J G;  2X6A A;  2A79 B;  1I5Y A;  4YHH B;  4DV4 O;  1B06 A;  3LNM B;  1CEZ A;  5LA6 A;  5B3S C;  4PI2 A;  3MD0 A;  3K58 A;  4DV0 B;  1GMG A;  2JGD A;  3TXQ A;  1SS3 A;  4U3J A;  1XNQ B;  2V4D A;  4H13 B;  2X6C A;  3SYO A;  2GDS A;  3ABU A;  1FJG B;  3T1Y B;  3SJB C;  4LH6 A;  4JAU A;  1N36 O;  4DV3 B;  5LA6 B;  4DR1 B;  5IDJ A;  3T2M A;  3CCQ V;  1IBK O;  1AB3 A;  2HEP A;  5KUK A;  2JGD B;  4NXN O;  4U3J B;  3W7T A;  3OMA B;  1GTO A;  1H2N A;  2A0L A;  3K0D A;  2YIA A;  3AG4 B;  3J7A U;  4FK5 C;  3CRM A;  3QO7 A;  4UFZ A;  3A2F A;  1D5A A;  4X65 B;  3RFR A;  1IXM A;  4ASU G;  2OYQ A;  1BL8 A;  3THO A;  1NJI W;  1TGO A;  4UXN A;  4CH4 A;  1NVP D;  3STZ C;  1UFI A;  1JQ0 A;  1S0V A;  2HFE C;  3W7U A;  2UUA O;  3SPI A;  3JAK A;  2Q67 A;  1N0J A;  1AR5 A;  4LFC O;  4NXM B;  3G6B A;  2G38 A;  4JI6 O;  3RYF A;  3Q4H A;  4ZIB A;  4YY3 B;  3K5O A;  5LMU O;  3NXS A;  4DO2 A;  1MZE A;  5JVD A;  1F23 A;  3DGE A;  3K59 A;  2P4K A;  5CA3 A;  2UUB O;  1Q86 W;  1QNM A;  2WLI A;  3AG2 C;  3JAK B;  1RM1 C;  3WG7 C;  2NN4 A;  2UUC O;  2PTM A;  3RYF B;  3Q4H B;  4LR3 A;  5B3S B;  2PYJ A;  3OW2 U;  4DR2 B;  4LFB O;  1L8D A;  5JVD B;  4JI0 O;  4L8J A;  1PL0 A;  3CE2 A;  3RYC A;  5KHI A;  4W4L A;  5LBQ A;  2WLI B;  2DMX A;  3HB3 B;  4DV7 O;  4MVO A;  1XIL A;  2Q9L A;  1XOU A;  1EBO A;  5IJ0 A;  3ABL C;  5EC2 C;  1K97 A;  3K03 A;  1SQV H;  2QWP B;  3DSQ A;  5DM6 V;  4GT1 A;  4K35 A;  3AK3 A;  5J9P C;  3RYC B;  2YUA A;  3L74 H;  3OR6 C;  3WB0 A;  2ZD9 A;  1VQO V;  3JAT A;  3EXA A;  3K57 A;  1AJP A;  5IJ0 B;  1H2M A;  4GX0 A;  3APO A;  2EZO A;  1XEQ A;  3ASO C;  3G80 A;  5BY1 A;  4HZ3 A;  3E35 A;  1R73 A;  2YC0 A;  3JAT B;  4EB6 A;  4P2Z A;  1P7B A;  1PNK A;  3HKE A;  1PPJ H;  1SC5 B;  4KFM A;  2QWQ B;  4U7O A;  2HVJ C;  3PN1 A;  3JAM N;  3I5D A;  2ZR2 A;  3P3N A;  2AZ2 A;  4EB6 B;  2JS5 A;  4PA4 A;  3HKE B;  1PNM A;  3QF7 A;  3F7V C;  3RVY A;  1Y74 B;  3K3W A;  3EVK A;  2QJ1 A;  2ADP A;  3K79 A;  2Z0A A;  4H37 A;  3JAR A;  4TQF A;  4MVM A;  1ZUQ A;  4UVA A;  1PL4 A;  4LF6 B;  3ASN C;  4DXW A;  2YIB D;  4FLV A;  4WFF A;  3AG2 B;  1GK9 A;  1RM1 B;  2CTR A;  4LFA O;  3M8A A;  3WG7 B;  5CA1 A;  3CRA A;  2ZE8 A;  1Y66 A;  1SQG A;  4MVQ A;  5DEC A;  2AW9 A;  1WPB A;  1HDJ A;  4PDV A;  3ZHR A;  1F51 A;  1QCE A;  3JAR B;  1Q6U A;  1U96 A;  5KAI Z;  2ITD C;  3CX5 F;  1BHB A;  4QE9 A;  4B3T O;  4NR1 A;  1XL6 A;  5CA1 B;  3OMN B;  3NR7 A;  2PY5 A;  1AI7 A;  5LGT A;  3U0Z A;  3ABL B;  3P30 A;  3CWB H;  2F23 A;  4JTC B;  5B1B C;  1NS1 A;  5LMN O;  1OCC C;  4OXS A;  1VQ4 V;  4Z1V A;  1NKD A;  4R6Z A;  1EN6 A;  3LUT B;  4DV0 O;  1J95 A;  5KHG A;  3ASO B;  1GAX A;  2ZDI C;  4X88 A;  1GN6 A;  5BMV B;  2VQE O;  2IJK A;  1XL4 A;  3T1Y O;  4LF7 B;  1VP7 A;  5LGN A;  4MTG A;  5TIS Z;  4DR1 O;  2H8P C;  3QNE A;  2ZE5 A;  4GZR B;  3ZRV A;  3BVO A;  1TUB A;  1ZSP A;  2L35 A;  3BPZ A;  3W7W A;  1XRE A;  1YZB A;  2LGQ A;  4FLY A;  5EZY B;  3JD1 A;  3KZI Z;  3SPH A;  4DV4 B;  2LO1 A;  2P22 C;  3P3P A;  2P6J A;  3BHP A;  1K73 W;  4L87 A;  2ZCE A;  4X1Y A;  2KKW A;  2WA4 A;  1TUB B;  1I7F A;  2DYR C;  3D3Q A;  5HFL A;  3H1J H;  4X65 O;  3OMI B;  2YXL A;  1FXH A;  2WWW A;  4H44 B;  1VF7 A;  1V9P A;  4XDL A;  3KCY A;  2OIG A;  4YJ2 A;  4FVM A;  2H94 A;  3CSX A;  5EIB C;  4RUE A;  4KHP B;  2PI4 A;  4X1Y B;  1A32 A;  1N36 B;  3K08 A;  5B1O A;  2EJ7 A;  4LBE C;  3OTO O;  4P30 A;  2Q8V A;  4NXN B;  1O9H A;  1MG1 A;  4O2A A;  1NU1 H;  1NZ6 A;  4DV5 B;  3K9A A;  2ZIM A;  2C2A A;  3AG1 C;  4QGP A;  4NXM O;  2WLN A;  4X1I A;  1N32 B;  4UB6 Z;  2BOC C;  1S5H C;  4J80 A;  2P7T C;  3UQ8 A;  4Q20 A;  2E3C A;  1QR9 A;  1ROP A;  4YY3 O;  1YF2 A;  3FYE B;  5J2T A;  2KG7 A;  2FL4 A;  2OIE A;  1IXB A;  1JFF A;  4FLU A;  3UT5 B;  2ZDI A;  5B1B B;  3SYC A;  1FKA O;  1KQS U;  4I0X A;  4X1I B;  1OCC B;  1FXV A;  1URF A;  2JEU A;  1QVG U;  2LP7 A;  5J2T B;  2KG7 B;  5HFM A;  4MVR A;  4DR2 O;  1JFF B;  3CRR A;  2YEV A;  2GTA A;  4AI8 A;  1BCC H;  1OV9 A;  2LJ2 A;  3JCZ A;  4DYL A;  4TWK A;  3JD4 A;  1BQZ A;  3CCS V;  4I0X B;  1MOF A;  2A9H A;  4XDJ A;  1T5E A;  4FFK A;  1RP3 B;  3FFQ A;  1COW G;  3ZHU A;  4ABM A;  1HNX B;  2YEV B;  1YI2 V;  2VRZ A;  2AZ0 A;  3CHX A;  2CE4 A;  1KYO F;  4ZI7 A;  2FKX A;  1Y67 A;  4FMT A;  4PHZ A;  1YJW V;  2ZQM A;  3L75 H;  2IU3 A;  3DTU B;  2UUC B;  1GM8 A;  3VBB A;  2Z3Y A;  2DYR B;  5LL6 Y;  5EC1 C;  1Z5V A;  1N8R W;  4I55 A;  1NR1 A;  4JI3 O;  2YID A;  1D2D A;  4ZI7 B;  4QPJ A;  2F95 B;  3LDD A;  2XAG A;  3CC7 V;  1ARO P;  3G67 A;  5JH7 A;  3OD4 A;  5JJE B;  3FB8 C;  3OTF A;  4JV5 O;  4IL6 Z;  4HAM A;  4C7U A;  2OCH A;  3CD6 V;  4I55 B;  2PF4 E;  1KD1 W;  3KCX A;  1XI1 A;  3U11 A;  3STL C;  2Y48 A;  4AIL C;  5EBW C;  3AG1 B;  1GH6 A;  3HKD A;  4GKJ B;  5JH7 B;  1W2B U;  2P06 A;  1R6T A;  4I50 A;  5A9G A;  1JJ2 U;  1R6N A;  1LUW A;  2ZT9 B;  1CP9 A;  1MSW D;  4X66 B;  5B1N A;  2MW2 B;  4YXW G;  4UB8 Z;  1G8M A;  3T4Z A;  3HKD B;  2WA3 A;  4PD4 F;  1GN3 A;  1K3E A;  3RYH A;  4I50 B;  3SDL A;  1BZK A;  5B66 Z;  3ZHT A;  4KXR A;  1WJZ A;  3VQX A;  3RYI A;  4BR6 A;  1IDS A;  1SET A;  2ZXW C;  2B1I A;  2FYU H;  3R66 A;  4UV8 A;  3A8T A;  5C8Y A;  2UXX A;  3IAY A;  3RYH B;  3W7S A;  2UXC B;  4AQY B;  3OAA G;  4HBN A;  3RYI B;  2K1E A;  3TCU A;  2L6L A;  5IT9 N;  4UVB A;  4J11 A;  3ZCC A;  4RQF A;  1E79 G;  3AEI A;  3B4S A;  3FB7 C;  3S3W A;  5LHI A;  1JJO A;  3CS5 A;  4U7N A;  5E79 Z;  5FL7 G;  3OFN G;  3E8H A;  4LFA B;  3JSN A;  4UCR A;  1SRY A;  2R72 A;  4H0L B;  4O2B A;  1VMG A;  2Y0P A;  2ZKO A;  3HKC A;  4IYH A;  2ZNJ A;  1EZJ A;  4LF7 O;  4CH6 A;  1L0L H;  2BOB C;  5DN6 G;  4E4E A;  3CB2 A;  3CYO A;  4MTO A;  4WFB V;  4O2B B;  2QEX V;  2X7R B;  3HKC B;  2YI9 A;  4GX1 A;  3JAW A;  4FPP A;  1ENV A;  2OCC C;  2E74 B;  2F43 G;  2QM7 A;  5KHK A; 
#chains in the Genus database with same CATH homology
 1FXK C;  3ABL C;  5EC2 C;  1K97 A;  2AHZ A;  2DQ3 A;  3K03 A;  1V55 B;  2EIK C;  2JK5 C;  4I5S A;  5DM6 V;  4GT1 A;  5J9P C;  2WSS G;  4FIP C;  4I9W A;  3OR6 C;  1H2G A;  2ZD9 A;  5L3D A;  2EJR A;  2Y69 B;  3SPJ A;  1VQO V;  1NQT A;  1QLE C;  4PA6 A;  3G6E V;  1NH2 D;  1EFR G;  3E86 A;  3LDC A;  1AJP A;  3IFX A;  2EIN B;  3CC2 V;  4GX0 A;  1DTO A;  1OCZ C;  2WLJ A;  2WLL A;  2EZO A;  3QO8 A;  3ASO C;  4JAS A;  4HZ3 A;  3E35 A;  1JPX A;  1QVF U;  4WFA V;  1F4M A;  2QM8 A;  2ZXW B;  4G28 B;  1R73 A;  2IH3 C;  5H9C A;  4X8A A;  4P2Z A;  1P7B A;  1QBZ A;  3CMA V;  4MW8 A;  5CBH A;  3CPW U;  4PDM A;  1PNK A;  1OCO C;  4RO2 A;  2IJH A;  2UXN A;  4KFM A;  4U7O A;  2WLL B;  1VQ6 V;  5L3F A;  1S3J A;  2HVJ C;  4QJF B;  4MS2 A;  3CCE V;  4TT3 G;  1AR1 B;  3G4S V;  2DYS C;  3H01 A;  2JDI G;  2ZR2 A;  4GX5 A;  1H8E G;  3CCV V;  2XAF A;  4JTD B;  1AI5 A;  3ZRS A;  3E2E A;  4JTA B;  4PA4 A;  3TK1 A;  1PNM A;  1YIJ V;  1LNQ A;  2DW4 A;  3F7V C;  4CZZ A;  1YJ9 V;  2NLJ C;  3CC4 V;  3RVY A;  1YHQ V;  2EBO A;  3K3W A;  4R7C A;  5L3C A;  1CPY A;  3ZN0 A;  2JIZ G;  2LFS A;  1VQ9 V;  1YTF B;  3K79 A;  4XBF A;  2WLK A;  4PA7 A;  4H37 A;  3CCM V;  4MVM A;  3KG2 A;  4HYO A;  4UVA A;  2EIL C;  4WFE A;  3ASN C;  4DXW A;  3ABM B;  4WFF A;  3AG2 B;  1GK9 A;  4UVC A;  1RM1 B;  2DWE C;  3WG7 B;  1W0K G;  1W0J G;  1OZ0 A;  3B77 A;  4WFG A;  1KP2 A;  1E1Q G;  1Y66 A;  2ZR3 A;  3K06 A;  1K9M W;  1OCR C;  2AHY A;  4MVQ A;  2PI5 A;  4PDL A;  1FXK A;  1VQ7 V;  3RW0 A;  4PDV A;  4UUJ C;  2JJ2 G;  1F51 A;  4J9Z B;  1QCE A;  1H38 A;  3E83 A;  2ITD C;  1BHB A;  4QE9 A;  2WPD G;  3T4D A;  1XL6 A;  3ZJZ A;  2DQ0 A;  3ZMT A;  3ZMZ A;  2CK3 G;  3D3I A;  3SYP A;  4RAI A;  5LHH A;  3AG3 B;  4H33 A;  4JF3 A;  1KEC A;  2OCC B;  2HVK C;  3OMN B;  1SER A;  1K7D A;  1AI7 A;  5LGT A;  1S77 D;  2IJI A;  1FXK B;  3ABL B;  3JD0 A;  3P30 A;  1VQ5 V;  2EIJ C;  2EIM C;  2EIK B;  2P90 A;  5C93 A;  1KKD A;  5BZB A;  3ZIA G;  2R9R B;  2V1D A;  4JTC B;  3FB5 C;  5B1B C;  3JD2 A;  2DWD C;  4ZKI A;  2IJJ A;  3CP1 A;  1QLE B;  2Q69 A;  3K0G A;  3P32 A;  3UM7 A;  1FFT B;  1OCC C;  3BY6 A;  4OXS A;  1VQ4 V;  3ETD A;  2V7Q G;  1NKD A;  3A0R A;  4R6Z A;  1H8H G;  4LC1 A;  1PKX A;  1OCZ B;  3LUT B;  1KC8 W;  1RPO A;  1J95 A;  3ASO B;  2X6B A;  3IC7 A;  3W7X A;  1AJQ A;  1QLN A;  1BMF G;  3OEH G;  2QA4 V;  5L3B A;  1NH2 B;  5EBL C;  2ZDI C;  1S76 D;  4X88 A;  4WCE V;  4MSW C;  3TET A;  2IJK A;  1XL4 A;  3ABT A;  4PEL A;  4WFH A;  3ZRW A;  3OM3 B;  3FB6 C;  1K4D C;  5LGN A;  3E8G A;  1OCO B;  4MTG A;  3K04 A;  2H8P C;  5IYB O;  1K5Q A;  3QNE A;  3OEE G;  3ZRV A;  3B8N A;  3M99 B;  1Q81 W;  1R6K A;  2Q6A A;  1GO3 F;  4CBC A;  5IY5 C;  3W7W A;  1Y4M A;  1PD3 A;  2DYS B;  5IYC O;  1THZ A;  2HG5 C;  3ZMV A;  2KB1 A;  4JYB A;  1AI4 A;  3ZRW B;  2OTJ V;  2B5U A;  3JD1 A;  3SPH A;  4TSF G;  5B1A C;  2XND G;  2P6J A;  4R8C A;  1JX9 A;  4BIU A;  1E1R G;  3LDE A;  3OR7 C;  1K73 W;  4L87 A;  1HWY A;  2HJF C;  2DYR C;  1M90 W;  5HFL A;  2IH1 C;  3VOU A;  4EKW A;  3OMI B;  3G71 V;  1FXH A;  5CBF A;  3E8B A;  2WWW A;  2JEX A;  3FKS G;  2D3O W;  4XDL A;  1VQK V;  1V55 C;  3CME V;  4JYC A;  1R3I C;  2H94 A;  4RUE A;  3RBZ A;  2PI4 A;  4LCU C;  1NVP B;  3K08 A;  5B1O A;  4LBE C;  3SYQ A;  3ZMU A;  1Q82 W;  4P30 A;  1NR7 A;  2HKO A;  2LFR A;  4N23 A;  3F7Y C;  3EHB B;  1MG1 A;  1K8A W;  3MHS C;  3K9A A;  3JD3 A;  1G4Y B;  3AG1 C;  2C2A A;  2XOK G;  3I55 V;  5CMU A;  2WLN A;  1Q7Y W;  3QO5 A;  2GHY A;  1I5X A;  2BOC C;  1S5H C;  2WLM A;  2P7T C;  2XAJ A;  5CN0 A;  4Q20 A;  5IYD O;  1YJN V;  1QR9 A;  1ROP A;  1AI6 A;  2EIJ B;  2EIM B;  3FYE B;  4G27 B;  1P4R A;  1VQL V;  4G2K A;  3ZRX A;  1K34 A;  1OHH G;  4JPR A;  4XDK A;  3CCR V;  2ZDI A;  5B1B B;  3SYC A;  1F4N A;  1DF5 A;  3E8F A;  4QIW F;  3HPL C;  4FJC C;  2OTL V;  1KQS U;  4RQE A;  4ZBM A;  3CCJ V;  3AG4 C;  2XAS A;  1OCC B;  1FXV A;  4MTF A;  3ML0 A;  2JEU A;  1K33 A;  1MAB G;  2IW5 A;  1QVG U;  3FYI B;  2LP7 A;  1R3J C;  5HFM A;  3OUF A;  1NBM G;  4MVR A;  3ZN1 A;  4PA3 A;  2YEV A;  5EK0 A;  1M1K W;  1M57 C;  1TUE B;  1YTF D;  4R50 A;  5KUM A;  2IU0 A;  5CBG A;  3JCZ A;  1SES A;  4TWK A;  3WFV A;  2R9I A;  3I56 V;  2X0L A;  3GWO A;  2MK3 A;  3JD4 A;  5KA5 A;  2XAQ A;  3CCS V;  1DF4 A;  1MOF A;  2A9H A;  3OUS A;  4XDJ A;  3X2Q C;  3CCU V;  2JJ1 G;  1GKF A;  3B8M A;  1COW G;  3SPG A;  2ATK C;  1YSC A;  2YEV B;  1YI2 V;  4MVZ A;  4BW5 A;  5IY5 B;  3CXC U;  4Z1M G;  1RPR A;  1AJN A;  2WAM A;  1YIT V;  5LGU A;  1JCH A;  1JVM A;  3D36 A;  2B1G A;  3JYC A;  5GW7 A;  4FMT A;  1YJW V;  2ZQM A;  2XAH A;  1V54 C;  2IU3 A;  3DTU B;  5B1A B;  4WF9 V;  1KP3 A;  4UV9 A;  3PJS K;  1GM8 A;  4X89 A;  3VBB A;  2Z3Y A;  2DYR B;  1DLB A;  2W6J G;  2X6A A;  5EC1 C;  3UKM A;  1N8R W;  4GCZ A;  4QPK A;  2A79 B;  1I5Y A;  3ABK C;  2P67 A;  1NR1 A;  3ETG A;  3IGA C;  1ZWI C;  4QPJ A;  3LDD A;  1K92 A;  2XAG A;  3CC7 V;  1ARO P;  1M56 C;  4LP8 A;  1BHA A;  3LNM B;  1CEZ A;  2M7W A;  4JAV A;  5B3S C;  4P9O A;  3MD0 A;  4P9P A;  3FB8 C;  1VQP V;  1GMG A;  4HAM A;  3T1C A;  3CD6 V;  2Q68 A;  3F5W C;  2X6C A;  3SJQ C;  3SYO A;  1KD1 W;  2HR3 A;  4KUM A;  3SPC A;  3ABU A;  5E1A C;  3STL C;  2Y48 A;  1FS0 G;  5EBW C;  3AG1 B;  1WLE A;  4JAU A;  2EIL B;  4BIZ A;  1W2B U;  4MW3 A;  5IDJ A;  3ASN B;  3T2M A;  3CCQ V;  5KUK A;  2WLH A;  1SZT A;  3W7T A;  3EFF K;  1GTO A;  3OMA B;  1OCR B;  4N21 A;  1JJ2 U;  1R6N A;  3RVZ A;  3MHH C;  1JOY A;  1CP9 A;  1MSW D;  2A0L A;  3K0D A;  2Y69 C;  3ETE A;  3OE7 G;  5B1N A;  3ZMS A;  4YXW G;  1G8M A;  3T4Z A;  1VQN V;  4E2L A;  4PDR A;  4QNH B;  2EZP A;  3AG4 B;  2EIN C;  4GX2 A;  1K3E A;  4FK5 C;  3OGC C;  3QO7 A;  4JGS A;  2W0F C;  4MTX A;  2Z5U A;  1B6Q A;  3CCL V;  1M57 B;  1IXM A;  2HLD G;  3E89 A;  4MVU A;  5H6R A;  4ASU G;  3GB7 C;  1SET A;  2ZXW C;  2B1I A;  4UV8 A;  1BL8 A;  1GM7 A;  1R3K C;  3X2Q B;  1NJI W;  2UXX A;  3W7S A;  4UXN A;  3OAA G;  2FTK A;  1NVP D;  3STZ C;  2OT5 A;  4PA9 A;  1JQ0 A;  2W6I G;  1S0V A;  2K1E A;  2ITC C;  3TCU A;  1K4C C;  4UVB A;  2HFE C;  3W7U A;  4J9Y B;  2YSU B;  2QE7 G;  3ZCC A;  1WPX A;  4RQF A;  3SPI A;  1E79 G;  3AEI A;  2Q67 A;  3FB7 C;  5LHI A;  1ORQ C;  4RUF A;  4U7N A;  5FL7 G;  1M9N A;  1GM9 A;  1L1F A;  1V54 B;  3OFN G;  3E8H A;  4KP4 A;  1PNL A;  2NNU A;  1SRY A;  3NXS A;  4DO2 A;  2GSM B;  1F23 A;  2QKS A;  3DGE A;  5LHG A;  3ABK B;  5L3E A;  4BAY A;  3LSS A;  5CA3 A;  5KA6 A;  1UJW B;  1Q86 W;  3ABM C;  4MVS A;  2WLI A;  1EZJ A;  3AG2 C;  4MT8 A;  1RM1 C;  3WG7 C;  1S72 V;  4QE7 A;  1M56 B;  5H6Q A;  2BOB C;  5B3S B;  3BEH A;  5DN6 G;  3OW2 U;  3CYO A;  4MTO A;  1VQM V;  3LSQ A;  3R65 A;  4WFB V;  3SYA A;  1PL0 A;  4F4L A;  1VQ8 V;  2QEX V;  5LBQ A;  2X7R B;  2WLI B;  4GX1 A;  4FPP A;  1ENV A;  3AG3 C;  3HB3 B;  2OCC C;  2F43 G;  4MVO A;  1K5S A;  1QR8 A;  5L3G A;  1R3L C;  2QM7 A;  2QTO A;  1EBO A;  5EBM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...