1QBZA

The crystal structure of the siv gp41 ectodomain at 1.47 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
102
Chain Sequence
b'QSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGTPKWNNETWQEWERKVDFLEENITALLEEAQIQQEKNMYELQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIV GP41 ECTODOMAIN)
publication title The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Envelope glycoprotein
total genus 50
structure length 102
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qbzA00
1F23A 2M7WA 3MHHC 4JF3A 2EZOA 1QR9A 3M99B 3B8NA 5CN0A 4JPRA 2P6JA 3MHSC 5HFLA 1SZTA 1JPXA 4N23A 1ENVA 1I5XA 5KA6A 1K33A 3P30A 3B77A 3GWOA 1DF5A 2X7RB 4N21A 4FJCC 5CMUA 5H9CA 3CP1A 1I5YA 4E2LA 4JGSA 1K34A 1Y4MA 1MG1A 1QR8A 1Y66A 2MK3A 1QCEA 1DF4A 1MOFA 2LP7A 3K9AA 4FIPC 1EBOA 3WFVA 1QBZA 3H01A 2OT5A 2EZPA 2EBOA 4G2KA 3B8MA 4FK5C 5HFMA 5KA5A 3CYOA 1JQ0A 1DLBA
chains in the Genus database with same CATH superfamily
2KQXA 4JI0O 2RMKB 1Z2GA 4JAVA 1WB7A 3VQXA 4JI8B 3K57A 2EJRA 1FXKB 1NU1H 1L0LH 1S3JA 4TQDA 4RO2A 2HEPA 3CRCA 4TOIA 3OTFA 1YDXA 2ZR2A 2W0XA 3STZC 2N74A 4CS4A 2QKCA 5BMVB 5CA1A 3K5MA 2CTWA 3UKMA 4WBNA 1TUBB 1NH2D 3E8FA 2PY5A 4LFBB 4QIWF 1PV0A 3MDSA 4NTXA 2UUCB 4O4JB 5AG2A 4PI2A 1YXBA 1YTFD 4UVBA 1Y76A 3G80A 3D3IA 3FYEB 1SQXH 4DW1A 4DR5B 4MVQA 3L71H 2A06H 4PDMA 3JARA 2Q9LA 4O2BA 5LMNB 1NI8A 3F7YC 2PTMA 3ZCCA 1YVWA 1F4NA 4YXWG 1DGSA 1P7BA 1GAXA 1YJWV 1N32O 4X1IB 3OAAG 2CTQA 1ZX3A 1KMIZ 1GRJA 4TV9B 3SPHA 3JD1A 2XASA 4FK5C 4FLWA 3ABLC 1KB9F 4B3SO 3M8AA 3H01A 2ZT9B 3ZHQA 1SESA 1NQTA 1EN5A 3G6EV 1GKFA 1N4CA 2BTQB 3T2MA 1SQPH 1IURA 1XMQO 2IJJA 1WAZA 1AI6A 4MVOA 4J9YB 2W6IG 1XI1A 1NBMG 2D2CB 1PNLA 1HNWB 1HW7A 2EX3A 2ATKC 5IJ0A 4YIPA 3ZMSA 3T1YO 4H37A 5C93A 2PF4E 1R1BA 1BHBA 3ZS8C 5IE9A 1S0VA 3SPIA 2YEVB 2WLJA 1Q43A 4FLZA 2JEXA 2JEUA 4GX5A 1XEQA 1M5IA 4MVSA 2F4VO 4F4LA 4JASA 4KP4A 3Q4HB 1OCCB 3JSLA 3N2GB 1PKXA 4JI6B 1AVMA 3APOA 3LDCA 4ASUG 1M90W 4CS3A 2OWOA 2IM9A 1BZKA 4EB6A 1K34A 4FM1A 2IJKA 1FS0G 3HKCA 5K1PA 4A5UB 2UU9B 2WLLB 1MNGA 2YICA 4K0KO 2R70A 4J42A 2WLMA 1V55B 3J80N 3LDEA 1B3QA 3BY6A 4L87A 4ABMA 4LNUA 1MZFA 3HR0A 3OUFA 1JOYA 3FAVB 2DE0X 4MTOA 4JYCA 4IGGA 3K5NA 2EIKC 1BS3A 2CH7A 4OGQB 2EILB 3SYOA 4X1YA 3IC9A 1M4UA 1SQVH 5KAIZ 2QM4A 1F23A 2QE7G 5EK0A 4XBFA 3EHBB 4O4IA 3UO2A 3TGUH 4UCOA 1SZXA 2OIEA 3AG1C 2H3OA 1M93A 2B9ZA 4JI1O 1TGOA 1Y66A 1N36B 5LHGA 3WB2A 1AR4A 2CTPA 2FTKA 2Q7EA 1G6UA 2WLNA 2E5LB 1AP5A 4X20B 4AI8A 4HZ3A 1K5QA 1BE3H 3AG4B 3BA9A 3MAQA 4W4LA 3UQ8A 2P4VA 2Z0AA 5EBMC 3OFNG 4DR6B 5A9GA 3B8MA 3SPCA 2ZQMA 5EC2C 4IL6Z 4DR4B 3JAKA 1IBLB 3LNNA 3JAWB 1VQNV 2Y0IA 3ZN0A 1L0NH 2R9RB 4LF7B 1R6KA 1OCOB 2O57A 4PA6A 1ZLZA 1QLEC 3K0DA 1YCIA 1EFRG 1WP7A 1VQPV 3E8HA 4DV0B 1QQCA 5CB4B 4DR2B 2ARHA 1COWG 1OCRC 1FXHA 3A8TA 1PD3A 1XOUA 3RN4A 3RVZA 5IY5B 3GWKC 3PJSK 1URFA 4IHJA 2K9PA 4YJ3A 2DJVA 1QVFU 1YITV 3W7UA 4UUJC 1NR7A 3OTOB 3OE7G 4LFBO 4G28B 1K9MW 1H8HG 2UUCO 3ABKB 3SYAA 3ZMTA 4GX0A 3CXHF 4JF3A 3EVKA 4DR5O 2CDYA 4Q6GA 5KAFZ 2P67A 4FFBA 5KA6A 1S76D 3BA8A 5LMNO 3BCCH 1I0HA 1VQMV 2X6BA 3H1JH 3K3WA 3T1HB 5IYZA 1H2LA 1YSCA 3BEHA 3CHXA 5GTIZ 2AGAA 3CCMV 2YXLA 1US6A 1N34B 5TISZ 4MTXA 1SRYA 3CD6V 3O65A 4UCVA 2HLDG 2Q8VA 4JYYA 3E22A 3KZIZ 4X88A 1FD9A 2N04A 2YIDA 5IT9N 1BCCH 1HNWO 2XAQA 3E35A 1WB8A 3HPLC 1PL4A 2KKWA 4J9ZB 3OM3B 4U3FH 2QM8A 4I0XB 4GUNA 1GN2A 1XL6A 4XDLA 3EXAA 3ZMVA 1Q6UA 4UVAA 4Z1MG 4HAMA 1IVSA 3K0GA 1OHHG 2BOCC 2R9AA 1Q90D 2ZM6B 1JMKC 5B3SB 4CC5A 1MSWD 1X4TA 4JV5O 1MABG 4JI6O 4RWUA 3JD4A 3RYFA 2CE4A 1KC8W 1JPXA 2ZNIA 2UU9O 1P4RA 1Q82W 1FKAO 5IYCO 3LUTB 2VWJA 4MTFA 5JCOC 5LA6B 4DR3B 2EIJB 5B1BC 3AEIA 1M1KW 2EJ7A 4LH7A 1NTKH 1JR9A 2UXCB 2EINC 2XHBA 1FFXA 3K04A 3AG2B 3ZN1A 3K9AA 5KHHA 2IW5A 2QSAA 2QWRB 1VQ9V 2L6LA 1N32B 1JFFA 2AZ2A 4X66B 1H8EG 5CBFA 1O9GA 5F2VO 3W7SA 2C2AA 3X2QB 2E5LO 1XMQB 4K3AA 4CH6A 3KCXA 2Q0OC 4JZ2A 2DWEC 4F6RA 3UCSC 4FLXA 1B04A 4UV9A 2F95B 2LFSA 4ZI7A 4TT3G 4PJ0Z 1RM1C 4KXRA 2AXTZ 2XNDG 3I55V 2IBZH 5CMUA 2E3CA 4I50A 2JGDA 3ASNB 3ZIAG 2XTAA 4DR4O 2YIAA 5JVDA 3UM7A 1IBLO 4E4EA 1PL0A 3K06A 5B1AB 4LF7O 3CCVV 3A2FA 4YHHO 2WLIA 4JAUA 4X89A 4YY3O 3B4SA 4JPRA 4P2ZA 5EZYB 4J80A 4JI7O 4FMTA 3VOUA 1T5EA 4DV0O 4JI5O 3JATA 4DR2O 4K0KB 4AQYB 5H5NA 2MK3A 3KKYA 1QCEA 1EBOA 3RVYA 4J11A 5H6QA 2UUBB 1XMOB 3SJBC 3ABUA 5CBGA 2ZKOA 3OTOO 4PDVA 4MVRA 5JCOA 1VIBA 2CGNA 4KFMA 4LH6A 4H44B 2ADQB 4FJCC 4LBEC 1W0JG 2GSMB 1U97A 5B5EZ 2GUZB 4NTYA 3RFRA 5J2UB 3ZJZA 1MA1A 3UT5B 4Z2WA 2YS8A 4GCZA 1X59A 3P32A 2QTOA 3E8BA 1YZBA 2QKSA 2HKOA 2ILMA 2ZDIC 4D7SA 2Q6AA 5LHHA 4I55B 3HKEA 1GN6A 1N34O 3IFXA 2KG7A 5CBHA 2A7WA 2VS0A 3FKSG 2NNUA 4NB5A 4LF9B 2IU0A 2VQFB 1WA8A 1R3JC 1BT8A 3OMNB 2X6CA 2DYRC 1SETA 2HR3A 2QWQB 2JS3A 5KLVH 1K4DC 3B09A 5KHIA 1I94B 1LUVA 4O2AB 3DC5A 4GX1A 3JYCA 1SKVA 4WF9V 5CA3A 2UXBB 1F51A 2WPDG 5BR8O 3D8CA 3EFFK 4IIJA 3ZX6A 5L3EA 2QA4V 2YXHA 2ZXWB 4O4LB 1R3LC 1GN3A 2QJ1A 1WPBA 1BL8A 3O9OA 2ZM6O 1YJ9V 1U96A 3B77A 1NR1A 4Z1VA 3CB2A 3JSNA 2Q67A 3BVOA 1A32A 2NR5A 2DMXA 1QBZA 4WFGA 2UXDB 1UJWB 4X64O 4WCEV 4BW9A 1YI2V 1OCCC 2P90A 1DLBA 4GKKB 5CA1B 3M99B 1V9PA 2P5OA 5GTHZ 1L1FA 3QO5A 4WBNB 3SDLA 1PNKA 3CSXA 1SA0B 3HKDA 2HJFC 3K5LA 2DYSC 1JCHA 4DR3O 3D3QA 2ZE6A 1R6TA 3AG3B 4P9PA 4U3JA 4R7CA 4UVCA 3N2KA 3ETDA 2VRZA 2UXCO 4O2BB 4B7KA 5BMVA 4G27B 3DTUB 4DK0A 2QWPB 2MW2B 4CZZA 2Y69B 5J2TA 4TUYA 1R6NA 4LCUC 3GWOA 2A9HA 2JK5C 1TVKA 4MW3A 2Q73A 5H9CA 1PM9A 1M57C 3OMAB 3CC7V 1N33B 4LF6B 4UXNA 1AJNA 4X66O 2ZDIA 3CCSV 5LBQA 1SS3A 3THOA 2PYLA 4NVPA 1JQ0A 3IAYA 3DSQA 5FLXN 4HNAA 1VF7A 1FJGB 3U10A 1B06A 4DV4B 4YJ2A 4I4TA 5IJ0B 3DC6A 4X1IA 5KHKA 3H1KH 1F7YA 2QWNB 4TV9A 4DV6B 3GB7C 4UCUA 1RPRA 1M9NA 3RYCA 4TSFG 3K08A 4X8AA 3AG4C 1AI5A 4MSWC 2KB1A 3JD3A 1ZSPA 1MZEA 2D3OW 2RDCA 4X65B 2NLJC 2NN4A 3CMAV 1VQ7V 4TQFA 4JV5B 1JVMA 3JD0A 4EB6B 2YEVA 1TAEA 2V1DA 3SR2C 4EEQA 2LGQA 3S3XA 5EIBD 3OGCC 4XDKA 1HWYA 4RQEA 3RT3C 2YIBD 4AQYO 4XDJA 3B8NA 4JTAB 1MMMA 4LNUB 2UUBO 4R6ZA 1XMOO 5DN6G 3ML0A 5GW7A 3Q4HA 4N21A 1ZL8B 3QNEA 4LR3A 1M56B 2XUMA 1HNZB 3L9DA 4I5SA 1QR8A 4OPHA 2YUAA 2CH7B 2P06A 2JIZG 4FLUA 2KSDA 3OMIB 4QE7A 1Q6IA 2YSUB 3SJCC 1DTOA 1G4YB 2F43G 4O4IB 1UPGA 1KECA 3FAVA 4DV5B 4JI4B 5GONA 1P49A 3CP1A 3SJQC 2EIMC 3T4ZA 4KUMA 3WB0A 2LO1A 4FM2A 2FB5A 1VEWA 2RNBA 4I9QA 3TJTA 3ICXA 4FZ0A 3JCUZ 1SQFA 4LF9O 1GMGA 2VQFO 3ZHSA 4HYOA 2X7RB 2PGGA 1HNXB 1Q81W 1N0NA 4JGSA 1K7DA 4PI0A 4TV8A 1P84F 2H8PC 3I56V 1I94O 4MVZA 3VQYA 2UXBO 4FFKA 3JAKB 3CJHB 1E1RG 2FYUH 2FKXA 2GV9A 3CCJV 3CCQV 4E2LA 3T4DA 4YHHB 2P22C 4YY3B 4D7TA 3DXRA 4GT1A 2XAFA 3BHPA 5LL6Y 4JI7B 4JI5B 3WG7B 1SF9A 3SJAC 2UXDO 2ZR3A 1TA8A 4YJ3B 4DR1O 1NVPB 2Y4TA 4J10A 2GHYA 4GKKO 4IYIA 2XAHA 2Y4UA 4U7OA 4DO2A 4AHCA 4Q20A 5IWAB 1PP9H 3R65A 4ZBMA 3L73H 2EIKB 4FVMA 4LF4O 1IDSA 4WFBV 4FFBB 4GX2A 3TXQA 4PV1B 1G1XB 5FPOA 5LOVA 5JQGB 3UO3A 2ADPA 3K9SA 5IYZB 1WLEA 1CEZA 4NTWA 1SQQH 2X6AA 1J5EB 1KU9A 4DUZB 3KCYA 1N33O 1H2GA 3TXSA 4LF6O 2VQEB 2QM7A 3BRCA 3W7TA 3MHSC 5EYPA 1QNMA 3E22B 2B1IA 4DRXA 1AROP 2HVJC 4GLXA 3F7VC 2GBOA 4GYCB 1FJGO 4DV4O 4DK1A 3JASB 4ZHQA 1K92A 3NXSA 1LUWA 4DV6O 3S3WA 3ABMB 3J7AU 1GM9A 3APQA 4NR1A 3X2QC 2RJZA 1IXBA 2OCCC 4J41A 5BR8B 2Q7HA 4LWSA 2CUGA 4J7KA 4JTCB 1JJOA 1XILA 3IJ4A 2OTLV 1MG1A 2OCHA 2QR4A 3TCUA 3ZEDA 1RSOA 1F4MA 2JVDA 4P30A 4X65O 4NXMB 4JI3B 4FZ1A 3CRAA 3E86A 2Q0AA 4YIOA 4F6EA 3RYFB 5CN0A 3K79A 2R9IA 3OGIB 2A0LA 2P4KA 3OD4A 4I0XA 4X64B 1BHAA 4MVUA 1OCRB 2JRIA 3ASOC 5ITZA 1YHQV 1THZA 4DV3B 3ZRVA 3K03A 4G2KA 1N8RW 1W0KG 1HNZO 3HB3B 1VQ6V 5FNVA 1YF2A 3CC2V 1R3IC 5KMGB 4KHPB 1FFXB 3JALA 3A0BZ 2CAZC 5LYJA 3CX5F 3LSSA 3M7MX 5J9PC 4PDLA 5EBLC 5LGTA 5H6RA 4PA7A 4DV5O 4JI4O 3WB1A 1VP7A 1XREA 1JFFB 3CPWU 2F93B 2PUSA 2BCCH 5IYBO 5HFLA 1L8DA 3ZRWA 5LXTA 1I5XA 2IH1C 1NS1A 1NTMH 5CA0A 3E8GA 1Q5OA 4I9WA 5LP6B 2DQ3A 1MOFA 3N27A 4F6RB 5IJ9A 3H1HH 3RYHA 1HNXO 1LNQA 2QDOA 1K97A 4RUEA 2DWDC 3RYIA 3B2EE 1XNRB 4ZI7B 5KHJA 4DV1O 4EKWA 2Z3YA 2A79B 5KX5A 4RUFA 3K58A 4LF5O 2QGNA 1Q6HA 1OCZB 1ROPA 4I50B 4DV7B 2JGDB 2BSKB 5JVDB 4O4HA 4X1KB 4ZOLA 4MS2A 2PZSA 1AJPA 1VMGA 2WLIB 1VF6C 2W6JG 3T1CA 3CYOA 3MHHC 1GN4A 1KUQA 4DW0A 4UV8A 3W7XA 1GO3F 4UB6Z 3JATB 2ZXWC 3BABA 3ZMUA 3LNMB 4MVMA 1PNMA 1OZ0A 4DR7B 2XT9A 1K5SA 3ZBHA 4W4KA 1R3KC 3G6BA 4QNHB 2RQ6A 1FXKC 1GTOA 3SYCA 2X0LA 5LGUA 2UUAO 5IWAO 5EZYA 4WFFA 3RGBA 5EIBC 3H1IH 1EZVH 1FPOA 3OEHG 4I7ZB 4LC1A 5B1BB 2E76B 1XNQB 1PPJH 1GM8A 4K8ZA 3HKBA 1XHZA 2EINB 1WN7A 1RP3B 4DYLA 3OUSA 1VQ8V 5L3CA 1Y67A 1EZJA 1O9HA 1BQ0A 4MT8A 1Y74A 4WFHA 5KHGA 1SZTA 5E1AC 1QU7A 1J5EO 3HKEB 3FYIB 4DUZO 1KBHA 1MSDA 4OXSA 5DEDA 2W0FC 2VQEO 3L70H 1K73W 1XUQA 1P7GA 2GUZA 3FB7C 2CK3G 1WA8B 5BZBA 5C8YB 1V54B 3PN1A 1AR1B 3A0HZ 5KUMA 1D5NA 5BY1A 1Z5WA 4X62B 2HHHB 1VQ4V 4IIJB 3J81N 1RM1B 4FPPA 4B3MB 1HR0B 1Y6XA 1UFIA 4BIOA 3C3SA 2ETNA 4BW5A 5JH7A 1CPYA 3IGAC 1XQ8A 4NXMO 4JI3O 1FFTB 1VF6A 1ORQC 1BQZA 3RW0A 4LF8B 2Q4PA 4UFZA 3QF7A 3VQWA 2XAGA 4TWKA 2B1GA 3E2EA 4PA3A 4DR1B 1WJZA 2WA3A 2GTSA 2Q68A 2IJIA 2G38A 2IH3C 3DGEA 4IYHA 4DV3O 4QJFB 4PA9A 3HKDB 1VQOV 4MTGA 4H13B 1FXKA 3MD0A 1Y76B 3ZHUA 4U3JB 3N2KB 4LF4B 1V55C 5IDJA 2PI5A 4KHPO 2YIBA 3JARB 3GVMA 1M56C 4WFEA 1AILA 5J2TB 4TUYB 2N05A 3L72H 2FL4A 5JJNB 5E79Z 1TVKB 5LHIA 1TUBA 4H33A 1SA0A 2EILC 1I5YA 4O4JA 1YJNV 1B6QA 1SERA 4OPAA 5B1OA 3FX7A 5FPRA 3G71V 4HNAB 1S77D 3P3PA 4JI2O 4YJ2B 1N0JA 4I4TB 2PI4A 2UXNA 3ETGA 2LFRA 1DF5A 4LFAB 1XHXA 2DYRB 2GDSA 1XNRO 1FAFA 5D5QA 1GM7A 1W59A 3LSUA 1KP2A 2GTAA 1KKDA 3RYCB 2ZIMA 3SPGA 4DV7O 2BTQA 4J7JA 1Q3EA 1ZWIC 2YI8A 4K35A 4LFCB 1NKDA 4PD4F 2HFEC 3JD2A 1DK1A 2L35A 4JYAB 2Z5UA 4CH4A 4B3RB 2F23A 1I7FA 4PDRA 3HKCB 3LSQA 1IBMB 5DECA 5HFMA 4ZIBA 1YEWA 4DR7O 1IZ3A 1OCOC 1QVGU 5JJEB 2AZ0A 4FM0A 5A2QN 1XBLA 4B08A 1H38A 3LDDA 2OYQA 3R66A 3N2GA 3WG7C 2DYSB 4X1YB 1QLNA 3CRMA 4UCSA 2WLLA 4U7NA 5IY5C 2QEXV 1XNQO 4GKJB 3CWBH 2JDIG 5GONB 1SC5B 1ZL8A 5EC1C 2Q69A 4QPKA 3OW2U 3QG5A 3ABKC 4UCTA 3WU2Z 1ZAUA 2E74B 2ZE7A 3U0ZA 1M57B 1H2MA 1VQKV 2YC0A 3ABLB 2M7WA 2ZE5A 1JA8A 4RQFA 3D36C 4N23A 1FYJA 2ODMA 2BOBC 3CC4V 4PA4A 1H2KA 4NXNB 1ZTEA 2XOKG 4TV8B 5L3GA 1SQGA 4DV1B 2BE3A 4DV2B 2EZPA 4FLYA 1AR5A 4LF5B 3SGIA 4EFBA 4K8XA 4X62O 2HHHO 4BR6A 3CCLV 1SQBH 4B3TB 3BFRA 4B3MO 4X20A 1HR0O 4CH5A 4OX9B 3B40A 3ABMC 5L3BA 3DXRB 3L74H 5EBWC 1QHTA 2EBOA 2YXYA 4LF8O 1IX9A 1H2NA 4BWAA 4CH3A 3FB8C 3CJHA 2WLKA 3P30A 1OJHA 3JAWA 5B3SC 4IHJB 3TETA 4KL1A 1Y4MA 3JCZA 3CEIA 3CXCU 2LP7A 4JI8O 3JAMN 3CRQA 2OIGA 2UUAB 1NJIW 4JYBA 4J7ZA 1R73A 2DOSA 5CB4A 3BAAA 3FFQA 1HDJA 5LOVB 5DM6V 2A3QA 3IC7A 2LQTA 4AILC 1XDCA 2AHYA 2R72A 2ZNJA 2RCVA 2EIJC 3AG1B 1IBKB 2EIMB 3KG2A 1AI7A 1S5HC 3AG2C 5EYPB 4DRXB 1ENVA 4JAAA 5B1NA 5JQGA 1H2SB 4BIZA 4QPJA 2Q5ZA 1RPOA 1JX9A 1AJQA 1K4CC 3D36A 1GK9A 3ZHRA 4ZHQB 2QTSA 1NZ6A 4X9QA 4R8CA 4LFAO 4CC6A 4CBCA 2H94A 1AP6A 2EULA 5LP6C 4LP8A 2RN9A 3ZMZA 5H2FZ 4DUYB 3SYQA 3OEEG 4LWSB 1K33A 4FLVA 1RSOB 2VWKA 1CP9A 4WFAV 3JASA 2WAMA 3P3NA 3F5WC 4LFCO 3C90A 4B7EA 4JYAO 3AK3A 1OCZC 3NR7A 2P7TC 5IYDO 5LGNA 3A0RA 1QLEB 4B3RO 5LMUB 3QO8A 1CXZB 3ZHVA 1Q8IA 3ASNC 3SPJA 2Y48A 1IBMO 2UXXA 4P9OA 1XL4A 2IU3A 5B1AC 1NVPD 4BIUA 5B66Z 4JI0B 2OTJV 4FLTA 5ITZB 3OR6C 2AW9A 1EN6A 1D5AA 2XAJA 5FNVB 2F1MA 1JJ2U 2F66C 1GH6A 3RBZA 1IXMA 2BTOA 3SYPA 2YI9A 3JALB 3FB6C 1BMFG 3H1LH 5LYJB 1TUEB 1J95A 4JZGA 4GKJO 1WPXA 4ICGA 4H0LB 3U11A 4D6TH 1KP3A 1VF5B 2HVKC 5LA6A 3ETEA 1WNSA 5KA5A 1EM1A 1KQSU 3ZHTA 3ZRWB 5LXTB 2JS5A 5CA0B 5KMGA 3FB5C 3I5DA 2WLHA 2QKAA 3CCUV 5IJ9B 2JGUA 5L3FA 2LW1A 2Q7GA 3C3TA 3VQVA 3RYHB 4JI2B 2AHZA 2E75B 1YIJV 2HJDA 3RYIB 4NXNO 1BGYH 3K5OA 5K1XA 1N36O 2P6JA 4NKGB 5KX5B 4B3SB 4DV2O 2M6YA 3CE2A 1BSMA 4QE9A 3ETQA 5LP6A 1NT2B 2OCCB 2IJHA 3WFVA 4B3TO 1ZUQA 4O4HB 4ZOLB 1K8AW 3ZRXA 4DXWA 1Q86W 4EFEA 1V54C 1S5JA 3H9VA 4OX9O 3T1YB 2LGWA 1G8MA 4DR6O 3AK1A 3AK2A 3ZRSA 2B5UA 3CCEV 2ZIOA 2V4DA 4IT5A 2F4VB 4UB8Z 2BSKA 2DQ0A 5JWPA 2K1EA 4X1KA 4PHZA 2YDEA 1KKCA 3FD9A 3ASOB 2LJ2A 2EZOA 3CRRA 5BXZA 3STLC 5L3DA 1E79G 2WSSG 3VBBA 3QO7A 4R50A 1W2BU 2JJ1G 3CMEV 4QGPA 5D5PA 2Y0PA 4UCRA 4FIPC 2V7QG 4NYKA 3HKBB 1LR1A 3W7WA 2DN9A 3AG7A 2LW7A 2OT5A 1KD1W 2ITCC 1OV9A 3L75H 3CCRV 4GZRB 1K3EA 4MW8A 2DW4A 2WA4A 1Y74B 1VARA 1NTZH 2ZD9A 4PELA 2CGOA 1NH2B 3AG3C 1IBKO 5KUKA 1E1QG 3QVNA 3G4SV 1YTFB 1Q7YW 1AB3A 2KG7B 3E89A 4HBNA 1DF4A 3TK1A 5J2UA 2Y69C 1S5LZ 2PYJA 1FXVA 3UT5A 2HP8A 3T1HO 4JI1B 3QTCA 1EN4A 2ZINA 1Z5VA 1D2DA 2ZCEA 3RWRD 5FL7G 2CTRA 4I55A 4ZKIA 1RFYA 1HP8A 3OT7A 2QWOB 4DUYO 4BAYA 4L8JA 2FMLA 3BPZA 1WP8A 3CS5A 3OR7C 5JH7B 1S72V 3G67A 2ITDC 2HG5C 3F5TA 1QR9A 4JTDB 5C8YA 4CS2A 1AI4A 1I08A 2WWWA 3E83A 3ABTA 5JJJB 4RAIA 4O2AA 3K59A 1VQLV 2ZE8A 1KYOF 5LMUO 2JJ2G 4C7UA 4O4LA 1VQ5V
chains in the Genus database with same CATH topology
2QM7A 4TT3G 3W7TA 3MHSC 4JAVA 2JDIG 2B1IA 2EJRA 1RM1C 1FXKB 2XNDG 1AROP 3I55V 5EC1C 2HVJC 2Q69A 5CMUA 1S3JA 4QPKA 3F7VC 3OW2U 4RO2A 3ABKC 3ASNB 3ZIAG 3UM7A 1K92A 1PL0A 3K06A 3NXSA 2ZR2A 1M57B 5B1AB 3STZC 3CCVV 1VQKV 2WLIA 4JAUA 4X89A 3ABMB 3ABLB 1GM9A 2M7WA 3X2QC 4JPRA 4P2ZA 4RQFA 2OCCC 4N23A 3UKMA 2BOBC 3E8FA 1NH2D 4QIWF 4FMTA 3CC4V 3VOUA 4PA4A 1YTFD 4JTCB 4UVBA 3D3IA 2OTLV 1MG1A 2MK3A 2XOKG 3FYEB 1QCEA 3TCUA 1F4MA 4P30A 5L3GA 1EBOA 3RVYA 4MVQA 5H6QA 4PDMA 2EZPA 3ABUA 3E86A 5CBGA 3F7YC 3ZCCA 3CCLV 5CN0A 1F4NA 3K79A 2R9IA 4MVRA 2A0LA 4PDVA 4YXWG 1P7BA 4KFMA 1YJWV 3OAAG 1BHAA 4FJCC 4LBEC 4MVUA 3SPHA 1W0JG 2GSMB 1OCRB 3JD1A 2XASA 4FK5C 3ABMC 3ABLC 5L3BA 3ASOC 1YHQV 1THZA 3H01A 5EBWC 1SESA 3ZJZA 1NQTA 3ZRVA 3K03A 1GKFA 3G6EV 3T2MA 2EBOA 4G2KA 1N8RW 1W0KG 3HB3B 2IJJA 4GCZA 1VQ6V 1AI6A 3P32A 2QTOA 3E8BA 4J9YB 4MVOA 2QKSA 2W6IG 3FB8C 2HKOA 1NBMG 1PNLA 2WLKA 2ZDIC 3CC2V 2Q6AA 1R3IC 2ATKC 3P30A 5LHHA 5B3SC 3ZMSA 3TETA 4H37A 5C93A 3IFXA 1BHBA 3LSSA 1Y4MA 3JCZA 5CBHA 1S0VA 3CXCU 2LP7A 3SPIA 2YEVB 3FKSG 2NNUA 2WLJA 4PDLA 5EBLC 5J9PC 2IU0A 5LGTA 5H6RA 1NJIW 4PA7A 4JYBA 1R73A 1R3JC 2JEXA 2JEUA 4GX5A 3OMNB 2X6CA 4MVSA 3CPWU 2DYRC 4F4LA 1SETA 2HR3A 4JASA 5IYBO 5HFLA 4KP4A 1K4DC 3ZRWA 1I5XA 2IH1C 5DM6V 1OCCB 3E8GA 4GX1A 1PKXA 3IC7A 3JYCA 3LDCA 4ASUG 4I9WA 1M90W 2DQ3A 4WF9V 5CA3A 1K34A 2AHYA 1F51A 1MOFA 2WPDG 3EFFK 2IJKA 5L3EA 1FS0G 2EIJC 3AG1B 2QA4V 1LNQA 2ZXWB 1K97A 2EIMB 2WLLB 2DWDC 4RUEA 1R3LC 3KG2A 1AI7A 1S5HC 2WLMA 1V55B 3LDEA 1BL8A 3BY6A 3AG2C 4EKWA 1YJ9V 4L87A 2Z3YA 1ENVA 2A79B 5B1NA 3OUFA 4RUFA 1JOYA 3B77A 1NR1A 1OCZB 1ROPA 4MTOA 4JYCA 4QPJA 4BIZA 1RPOA 1JX9A 1AJQA 2Q67A 1K4CC 3D36A 1GK9A 2EIKC 1QBZA 4WFGA 1UJWB 2EILB 4MS2A 4R8CA 1AJPA 3SYOA 2WLIB 2W6JG 4WCEV 3T1CA 1YI2V 1OCCC 2P90A 3CYOA 4CBCA 1DLBA 1F23A 2QE7G 3MHHC 2H94A 3M99B 5EK0A 4XBFA 4LP8A 3QO5A 3EHBB 1L1FA 3ZMZA 4UV8A 3W7XA 3SYQA 3OEEG 1GO3F 1PNKA 1K33A 3AG1C 2HJFC 2DYSC 2ZXWC 1JCHA 3ZMUA 3LNMB 1CP9A 1Y66A 4MVMA 1PNMA 1OZ0A 3AG3B 5LHGA 4P9PA 4WFAV 4R7CA 4UVCA 2WAMA 1K5SA 3F5WC 3ETDA 1R3KC 2FTKA 4G27B 2WLNA 1OCZC 3DTUB 1GTOA 1FXKC 4QNHB 2P7TC 3SYCA 5IYDO 2X0LA 5LGNA 3A0RA 1QLEB 5LGUA 4CZZA 2Y69B 3QO8A 4HZ3A 3ASNC 3SPJA 1K5QA 1R6NA 2Y48A 3AG4B 4LCUC 3GWOA 2A9HA 2JK5C 2UXXA 4WFFA 4P9OA 4MW3A 5H9CA 1XL4A 2IU3A 5B1AC 3OEHG 1M57C 3OMAB 4LC1A 5B1BB 4BIUA 3CC7V 1NVPD 2OTJV 4UXNA 1AJNA 3OR6C 2ZDIA 3CCSV 5LBQA 1GM8A 5EBMC 3OFNG 2EINB 3OUSA 3B8MA 1VQ8V 2XAJA 1JQ0A 5L3CA 1JJ2U 1EZJA 3SPCA 2ZQMA 4MT8A 3RBZA 5EC2C 4WFHA 1SZTA 1IXMA 5E1AC 3SYPA 3FYIB 1VQNV 3ZN0A 2R9RB 3FB6C 4OXSA 1BMFG 1R6KA 1TUEB 1OCOB 2W0FC 1J95A 4PA6A 1K73W 3GB7C 1WPXA 1RPRA 1QLEC 3FB7C 3K0DA 1M9NA 4TSFG 1EFRG 2CK3G 1KP3A 3K08A 2HVKC 4X8AA 5BZBA 3AG4C 1AI5A 1VQPV 3ETEA 3E8HA 2KB1A 3JD3A 4MSWC 5KA5A 1KQSU 2D3OW 1COWG 1OCRC 3ZRWB 1FXHA 1PD3A 2NLJC 3CMAV 1V54B 1AR1B 3RVZA 5KUMA 5IY5B 3PJSK 1VQ7V 3FB5C 1JVMA 3JD0A 1QVFU 1YITV 3W7UA 2WLHA 3CCUV 4UUJC 1NR7A 5L3FA 1VQ4V 3OE7G 2YEVA 1RM1B 2AHZA 2V1DA 4FPPA 4G28B 1YIJV 1K9MW 3OGCC 1H8HG 4XDKA 1HWYA 4BW5A 4RQEA 3ABKB 1CPYA 3SYAA 3IGAC 3ZMTA 4GX0A 4XDJA 4JF3A 3B8NA 2P6JA 4JTAB 1FFTB 4R6ZA 2P67A 5DN6G 5KA6A 3ML0A 5GW7A 1S76D 4N21A 1ORQC 3QNEA 1M56B 3RW0A 1VQMV 4QE9A 2X6BA 2OCCB 4I5SA 1QR8A 2IJHA 3K3WA 3WFVA 1K8AW 2JIZG 3ZRXA 4DXWA 2XAGA 4TWKA 1Q86W 1YSCA 3BEHA 1V54C 2B1GA 3CCMV 3OMIB 3E2EA 4QE7A 4PA3A 2YSUB 4MTXA 1DTOA 2Q68A 1SRYA 1G4YB 3CD6V 2F43G 2IJIA 1G8MA 2IH3C 3DGEA 2HLDG 4QJFB 4PA9A 3ZRSA 4X88A 1KECA 1VQOV 4MTGA 2B5UA 1FXKA 3CCEV 3CP1A 3SJQC 2EIMC 3MD0A 3T4ZA 4KUMA 2XAQA 3E35A 2DQ0A 2K1EA 1V55C 5IDJA 2PI5A 3HPLC 3ASOB 2EZOA 1M56C 4WFEA 4J9ZB 3OM3B 3STLC 5L3DA 2QM8A 1E79G 1GMGA 2WSSG 3VBBA 3QO7A 4R50A 4HYOA 5LHIA 2X7RB 1W2BU 4H33A 1XL6A 2JJ1G 4XDLA 3ZMVA 2EILC 3CMEV 1I5YA 4UVAA 4Z1MG 1Q81W 4HAMA 1YJNV 3K0GA 4JGSA 4FIPC 1OHHG 1B6QA 2BOCC 2V7QG 1K7DA 3W7WA 2H8PC 5B3SB 3I56V 1SERA 1MSWD 4MVZA 2OT5A 1KD1W 2ITCC 5B1OA 1MABG 3G71V 3CCRV 1S77D 3JD4A 1K3EA 4MW8A 1KC8W 2DW4A 2ZD9A 4PELA 1E1RG 2PI4A 1JPXA 2UXNA 4U7NA 1NH2B 3AG3C 1P4RA 3ETGA 1Q82W 2LFRA 1DF5A 2DYRB 3CCJV 5KUKA 3CCQV 1E1QG 1GM7A 4E2LA 3G4SV 1Q7YW 3T4DA 1YTFB 3E89A 5IYCO 1KP2A 1DF4A 3TK1A 1KKDA 4GT1A 3LUTB 4MTFA 2Y69C 3SPGA 2XAFA 1FXVA 3WG7B 1ZWIC 2EIJB 5B1BC 3AEIA 2ZR3A 1M1KW 1NKDA 5FL7G 2EINC 1NVPB 4ZKIA 3K04A 2HFEC 2GHYA 3AG2B 3JD2A 2XAHA 2Z5UA 3ZN1A 3K9AA 4U7OA 4DO2A 4Q20A 4PDRA 3R65A 4BAYA 2IW5A 3LSQA 3OR7C 4ZBMA 1VQ9V 5HFMA 1S72V 2ITDC 2HG5C 2EIKB 1QR9A 1OCOC 1QVGU 4JTDB 4WFBV 1H8EG 4GX2A 1AI4A 5CBFA 2WWWA 3E83A 3W7SA 3ABTA 3LDDA 1H38A 2C2AA 4RAIA 3X2QB 1VQLV 3WG7C 1WLEA 2JJ2G 1CEZA 2DWEC 4UV9A 2DYSB 2X6AA 1QLNA 1VQ5V 2LFSA 2WLLA 1H2GA 5IY5C 2QEXV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  2M7W A;  3MHH C;  4JF3 A;  2EZO A;  1QR9 A;  3M99 B;  3B8N A;  5CN0 A;  4JPR A;  2P6J A;  3MHS C;  5HFL A;  1SZT A;  1JPX A;  4N23 A;  1ENV A;  1I5X A;  5KA6 A;  1K33 A;  3P30 A;  3B77 A;  3GWO A;  1DF5 A;  2X7R B;  4N21 A;  4FJC C;  5CMU A;  5H9C A;  3CP1 A;  1I5Y A;  4E2L A;  4JGS A;  1K34 A;  1Y4M A;  1MG1 A;  1QR8 A;  1Y66 A;  2MK3 A;  1QCE A;  1DF4 A;  1MOF A;  2LP7 A;  3K9A A;  4FIP C;  1EBO A;  3WFV A;  1QBZ A;  3H01 A;  2OT5 A;  2EZP A;  2EBO A;  4G2K A;  3B8M A;  4FK5 C;  5HFM A;  5KA5 A;  3CYO A;  1JQ0 A;  1DLB A; 
#chains in the Genus database with same CATH topology
 2KQX A;  4JI0 O;  2RMK B;  1Z2G A;  4JAV A;  1WB7 A;  3VQX A;  4JI8 B;  3K57 A;  2EJR A;  1FXK B;  1NU1 H;  1L0L H;  1S3J A;  4TQD A;  4RO2 A;  2HEP A;  3CRC A;  4TOI A;  3OTF A;  1YDX A;  2ZR2 A;  2W0X A;  3STZ C;  2N74 A;  4CS4 A;  2QKC A;  5BMV B;  5CA1 A;  3K5M A;  2CTW A;  3UKM A;  4WBN A;  1TUB B;  1NH2 D;  3E8F A;  2PY5 A;  4LFB B;  4QIW F;  1PV0 A;  3MDS A;  4NTX A;  2UUC B;  4O4J B;  5AG2 A;  4PI2 A;  1YXB A;  1YTF D;  4UVB A;  1Y76 A;  3G80 A;  3D3I A;  3FYE B;  1SQX H;  4DW1 A;  4DR5 B;  4MVQ A;  3L71 H;  2A06 H;  4PDM A;  3JAR A;  2Q9L A;  4O2B A;  5LMN B;  1NI8 A;  3F7Y C;  2PTM A;  3ZCC A;  1YVW A;  1F4N A;  4YXW G;  1DGS A;  1P7B A;  1GAX A;  1YJW V;  1N32 O;  4X1I B;  3OAA G;  2CTQ A;  1ZX3 A;  1KMI Z;  1GRJ A;  4TV9 B;  3SPH A;  3JD1 A;  2XAS A;  4FK5 C;  4FLW A;  3ABL C;  1KB9 F;  4B3S O;  3M8A A;  3H01 A;  2ZT9 B;  3ZHQ A;  1SES A;  1NQT A;  1EN5 A;  3G6E V;  1GKF A;  1N4C A;  2BTQ B;  3T2M A;  1SQP H;  1IUR A;  1XMQ O;  2IJJ A;  1WAZ A;  1AI6 A;  4MVO A;  4J9Y B;  2W6I G;  1XI1 A;  1NBM G;  2D2C B;  1PNL A;  1HNW B;  1HW7 A;  2EX3 A;  2ATK C;  5IJ0 A;  4YIP A;  3ZMS A;  3T1Y O;  4H37 A;  5C93 A;  2PF4 E;  1R1B A;  1BHB A;  3ZS8 C;  5IE9 A;  1S0V A;  3SPI A;  2YEV B;  2WLJ A;  1Q43 A;  4FLZ A;  2JEX A;  2JEU A;  4GX5 A;  1XEQ A;  1M5I A;  4MVS A;  2F4V O;  4F4L A;  4JAS A;  4KP4 A;  3Q4H B;  1OCC B;  3JSL A;  3N2G B;  1PKX A;  4JI6 B;  1AVM A;  3APO A;  3LDC A;  4ASU G;  1M90 W;  4CS3 A;  2OWO A;  2IM9 A;  1BZK A;  4EB6 A;  1K34 A;  4FM1 A;  2IJK A;  1FS0 G;  3HKC A;  5K1P A;  4A5U B;  2UU9 B;  2WLL B;  1MNG A;  2YIC A;  4K0K O;  2R70 A;  4J42 A;  2WLM A;  1V55 B;  3J80 N;  3LDE A;  1B3Q A;  3BY6 A;  4L87 A;  4ABM A;  4LNU A;  1MZF A;  3HR0 A;  3OUF A;  1JOY A;  3FAV B;  2DE0 X;  4MTO A;  4JYC A;  4IGG A;  3K5N A;  2EIK C;  1BS3 A;  2CH7 A;  4OGQ B;  2EIL B;  3SYO A;  4X1Y A;  3IC9 A;  1M4U A;  1SQV H;  5KAI Z;  2QM4 A;  1F23 A;  2QE7 G;  5EK0 A;  4XBF A;  3EHB B;  4O4I A;  3UO2 A;  3TGU H;  4UCO A;  1SZX A;  2OIE A;  3AG1 C;  2H3O A;  1M93 A;  2B9Z A;  4JI1 O;  1TGO A;  1Y66 A;  1N36 B;  5LHG A;  3WB2 A;  1AR4 A;  2CTP A;  2FTK A;  2Q7E A;  1G6U A;  2WLN A;  2E5L B;  1AP5 A;  4X20 B;  4AI8 A;  4HZ3 A;  1K5Q A;  1BE3 H;  3AG4 B;  3BA9 A;  3MAQ A;  4W4L A;  3UQ8 A;  2P4V A;  2Z0A A;  5EBM C;  3OFN G;  4DR6 B;  5A9G A;  3B8M A;  3SPC A;  2ZQM A;  5EC2 C;  4IL6 Z;  4DR4 B;  3JAK A;  1IBL B;  3LNN A;  3JAW B;  1VQN V;  2Y0I A;  3ZN0 A;  1L0N H;  2R9R B;  4LF7 B;  1R6K A;  1OCO B;  2O57 A;  4PA6 A;  1ZLZ A;  1QLE C;  3K0D A;  1YCI A;  1EFR G;  1WP7 A;  1VQP V;  3E8H A;  4DV0 B;  1QQC A;  5CB4 B;  4DR2 B;  2ARH A;  1COW G;  1OCR C;  1FXH A;  3A8T A;  1PD3 A;  1XOU A;  3RN4 A;  3RVZ A;  5IY5 B;  3GWK C;  3PJS K;  1URF A;  4IHJ A;  2K9P A;  4YJ3 A;  2DJV A;  1QVF U;  1YIT V;  3W7U A;  4UUJ C;  1NR7 A;  3OTO B;  3OE7 G;  4LFB O;  4G28 B;  1K9M W;  1H8H G;  2UUC O;  3ABK B;  3SYA A;  3ZMT A;  4GX0 A;  3CXH F;  4JF3 A;  3EVK A;  4DR5 O;  2CDY A;  4Q6G A;  5KAF Z;  2P67 A;  4FFB A;  5KA6 A;  1S76 D;  3BA8 A;  5LMN O;  3BCC H;  1I0H A;  1VQM V;  2X6B A;  3H1J H;  3K3W A;  3T1H B;  5IYZ A;  1H2L A;  1YSC A;  3BEH A;  3CHX A;  5GTI Z;  2AGA A;  3CCM V;  2YXL A;  1US6 A;  1N34 B;  5TIS Z;  4MTX A;  1SRY A;  3CD6 V;  3O65 A;  4UCV A;  2HLD G;  2Q8V A;  4JYY A;  3E22 A;  3KZI Z;  4X88 A;  1FD9 A;  2N04 A;  2YID A;  5IT9 N;  1BCC H;  1HNW O;  2XAQ A;  3E35 A;  1WB8 A;  3HPL C;  1PL4 A;  2KKW A;  4J9Z B;  3OM3 B;  4U3F H;  2QM8 A;  4I0X B;  4GUN A;  1GN2 A;  1XL6 A;  4XDL A;  3EXA A;  3ZMV A;  1Q6U A;  4UVA A;  4Z1M G;  4HAM A;  1IVS A;  3K0G A;  1OHH G;  2BOC C;  2R9A A;  1Q90 D;  2ZM6 B;  1JMK C;  5B3S B;  4CC5 A;  1MSW D;  1X4T A;  4JV5 O;  1MAB G;  4JI6 O;  4RWU A;  3JD4 A;  3RYF A;  2CE4 A;  1KC8 W;  1JPX A;  2ZNI A;  2UU9 O;  1P4R A;  1Q82 W;  1FKA O;  5IYC O;  3LUT B;  2VWJ A;  4MTF A;  5JCO C;  5LA6 B;  4DR3 B;  2EIJ B;  5B1B C;  3AEI A;  1M1K W;  2EJ7 A;  4LH7 A;  1NTK H;  1JR9 A;  2UXC B;  2EIN C;  2XHB A;  1FFX A;  3K04 A;  3AG2 B;  3ZN1 A;  3K9A A;  5KHH A;  2IW5 A;  2QSA A;  2QWR B;  1VQ9 V;  2L6L A;  1N32 B;  1JFF A;  2AZ2 A;  4X66 B;  1H8E G;  5CBF A;  1O9G A;  5F2V O;  3W7S A;  2C2A A;  3X2Q B;  2E5L O;  1XMQ B;  4K3A A;  4CH6 A;  3KCX A;  2Q0O C;  4JZ2 A;  2DWE C;  4F6R A;  3UCS C;  4FLX A;  1B04 A;  4UV9 A;  2F95 B;  2LFS A;  4ZI7 A;  4TT3 G;  4PJ0 Z;  1RM1 C;  4KXR A;  2AXT Z;  2XND G;  3I55 V;  2IBZ H;  5CMU A;  2E3C A;  4I50 A;  2JGD A;  3ASN B;  3ZIA G;  2XTA A;  4DR4 O;  2YIA A;  5JVD A;  3UM7 A;  1IBL O;  4E4E A;  1PL0 A;  3K06 A;  5B1A B;  4LF7 O;  3CCV V;  3A2F A;  4YHH O;  2WLI A;  4JAU A;  4X89 A;  4YY3 O;  3B4S A;  4JPR A;  4P2Z A;  5EZY B;  4J80 A;  4JI7 O;  4FMT A;  3VOU A;  1T5E A;  4DV0 O;  4JI5 O;  3JAT A;  4DR2 O;  4K0K B;  4AQY B;  5H5N A;  2MK3 A;  3KKY A;  1QCE A;  1EBO A;  3RVY A;  4J11 A;  5H6Q A;  2UUB B;  1XMO B;  3SJB C;  3ABU A;  5CBG A;  2ZKO A;  3OTO O;  4PDV A;  4MVR A;  5JCO A;  1VIB A;  2CGN A;  4KFM A;  4LH6 A;  4H44 B;  2ADQ B;  4FJC C;  4LBE C;  1W0J G;  2GSM B;  1U97 A;  5B5E Z;  2GUZ B;  4NTY A;  3RFR A;  5J2U B;  3ZJZ A;  1MA1 A;  3UT5 B;  4Z2W A;  2YS8 A;  4GCZ A;  1X59 A;  3P32 A;  2QTO A;  3E8B A;  1YZB A;  2QKS A;  2HKO A;  2ILM A;  2ZDI C;  4D7S A;  2Q6A A;  5LHH A;  4I55 B;  3HKE A;  1GN6 A;  1N34 O;  3IFX A;  2KG7 A;  5CBH A;  2A7W A;  2VS0 A;  3FKS G;  2NNU A;  4NB5 A;  4LF9 B;  2IU0 A;  2VQF B;  1WA8 A;  1R3J C;  1BT8 A;  3OMN B;  2X6C A;  2DYR C;  1SET A;  2HR3 A;  2QWQ B;  2JS3 A;  5KLV H;  1K4D C;  3B09 A;  5KHI A;  1I94 B;  1LUV A;  4O2A B;  3DC5 A;  4GX1 A;  3JYC A;  1SKV A;  4WF9 V;  5CA3 A;  2UXB B;  1F51 A;  2WPD G;  5BR8 O;  3D8C A;  3EFF K;  4IIJ A;  3ZX6 A;  5L3E A;  2QA4 V;  2YXH A;  2ZXW B;  4O4L B;  1R3L C;  1GN3 A;  2QJ1 A;  1WPB A;  1BL8 A;  3O9O A;  2ZM6 O;  1YJ9 V;  1U96 A;  3B77 A;  1NR1 A;  4Z1V A;  3CB2 A;  3JSN A;  2Q67 A;  3BVO A;  1A32 A;  2NR5 A;  2DMX A;  1QBZ A;  4WFG A;  2UXD B;  1UJW B;  4X64 O;  4WCE V;  4BW9 A;  1YI2 V;  1OCC C;  2P90 A;  1DLB A;  4GKK B;  5CA1 B;  3M99 B;  1V9P A;  2P5O A;  5GTH Z;  1L1F A;  3QO5 A;  4WBN B;  3SDL A;  1PNK A;  3CSX A;  1SA0 B;  3HKD A;  2HJF C;  3K5L A;  2DYS C;  1JCH A;  4DR3 O;  3D3Q A;  2ZE6 A;  1R6T A;  3AG3 B;  4P9P A;  4U3J A;  4R7C A;  4UVC A;  3N2K A;  3ETD A;  2VRZ A;  2UXC O;  4O2B B;  4B7K A;  5BMV A;  4G27 B;  3DTU B;  4DK0 A;  2QWP B;  2MW2 B;  4CZZ A;  2Y69 B;  5J2T A;  4TUY A;  1R6N A;  4LCU C;  3GWO A;  2A9H A;  2JK5 C;  1TVK A;  4MW3 A;  2Q73 A;  5H9C A;  1PM9 A;  1M57 C;  3OMA B;  3CC7 V;  1N33 B;  4LF6 B;  4UXN A;  1AJN A;  4X66 O;  2ZDI A;  3CCS V;  5LBQ A;  1SS3 A;  3THO A;  2PYL A;  4NVP A;  1JQ0 A;  3IAY A;  3DSQ A;  5FLX N;  4HNA A;  1VF7 A;  1FJG B;  3U10 A;  1B06 A;  4DV4 B;  4YJ2 A;  4I4T A;  5IJ0 B;  3DC6 A;  4X1I A;  5KHK A;  3H1K H;  1F7Y A;  2QWN B;  4TV9 A;  4DV6 B;  3GB7 C;  4UCU A;  1RPR A;  1M9N A;  3RYC A;  4TSF G;  3K08 A;  4X8A A;  3AG4 C;  1AI5 A;  4MSW C;  2KB1 A;  3JD3 A;  1ZSP A;  1MZE A;  2D3O W;  2RDC A;  4X65 B;  2NLJ C;  2NN4 A;  3CMA V;  1VQ7 V;  4TQF A;  4JV5 B;  1JVM A;  3JD0 A;  4EB6 B;  2YEV A;  1TAE A;  2V1D A;  3SR2 C;  4EEQ A;  2LGQ A;  3S3X A;  5EIB D;  3OGC C;  4XDK A;  1HWY A;  4RQE A;  3RT3 C;  2YIB D;  4AQY O;  4XDJ A;  3B8N A;  4JTA B;  1MMM A;  4LNU B;  2UUB O;  4R6Z A;  1XMO O;  5DN6 G;  3ML0 A;  5GW7 A;  3Q4H A;  4N21 A;  1ZL8 B;  3QNE A;  4LR3 A;  1M56 B;  2XUM A;  1HNZ B;  3L9D A;  4I5S A;  1QR8 A;  4OPH A;  2YUA A;  2CH7 B;  2P06 A;  2JIZ G;  4FLU A;  2KSD A;  3OMI B;  4QE7 A;  1Q6I A;  2YSU B;  3SJC C;  1DTO A;  1G4Y B;  2F43 G;  4O4I B;  1UPG A;  1KEC A;  3FAV A;  4DV5 B;  4JI4 B;  5GON A;  1P49 A;  3CP1 A;  3SJQ C;  2EIM C;  3T4Z A;  4KUM A;  3WB0 A;  2LO1 A;  4FM2 A;  2FB5 A;  1VEW A;  2RNB A;  4I9Q A;  3TJT A;  3ICX A;  4FZ0 A;  3JCU Z;  1SQF A;  4LF9 O;  1GMG A;  2VQF O;  3ZHS A;  4HYO A;  2X7R B;  2PGG A;  1HNX B;  1Q81 W;  1N0N A;  4JGS A;  1K7D A;  4PI0 A;  4TV8 A;  1P84 F;  2H8P C;  3I56 V;  1I94 O;  4MVZ A;  3VQY A;  2UXB O;  4FFK A;  3JAK B;  3CJH B;  1E1R G;  2FYU H;  2FKX A;  2GV9 A;  3CCJ V;  3CCQ V;  4E2L A;  3T4D A;  4YHH B;  2P22 C;  4YY3 B;  4D7T A;  3DXR A;  4GT1 A;  2XAF A;  3BHP A;  5LL6 Y;  4JI7 B;  4JI5 B;  3WG7 B;  1SF9 A;  3SJA C;  2UXD O;  2ZR3 A;  1TA8 A;  4YJ3 B;  4DR1 O;  1NVP B;  2Y4T A;  4J10 A;  2GHY A;  4GKK O;  4IYI A;  2XAH A;  2Y4U A;  4U7O A;  4DO2 A;  4AHC A;  4Q20 A;  5IWA B;  1PP9 H;  3R65 A;  4ZBM A;  3L73 H;  2EIK B;  4FVM A;  4LF4 O;  1IDS A;  4WFB V;  4FFB B;  4GX2 A;  3TXQ A;  4PV1 B;  1G1X B;  5FPO A;  5LOV A;  5JQG B;  3UO3 A;  2ADP A;  3K9S A;  5IYZ B;  1WLE A;  1CEZ A;  4NTW A;  1SQQ H;  2X6A A;  1J5E B;  1KU9 A;  4DUZ B;  3KCY A;  1N33 O;  1H2G A;  3TXS A;  4LF6 O;  2VQE B;  2QM7 A;  3BRC A;  3W7T A;  3MHS C;  5EYP A;  1QNM A;  3E22 B;  2B1I A;  4DRX A;  1ARO P;  2HVJ C;  4GLX A;  3F7V C;  2GBO A;  4GYC B;  1FJG O;  4DV4 O;  4DK1 A;  3JAS B;  4ZHQ A;  1K92 A;  3NXS A;  1LUW A;  4DV6 O;  3S3W A;  3ABM B;  3J7A U;  1GM9 A;  3APQ A;  4NR1 A;  3X2Q C;  2RJZ A;  1IXB A;  2OCC C;  4J41 A;  5BR8 B;  2Q7H A;  4LWS A;  2CUG A;  4J7K A;  4JTC B;  1JJO A;  1XIL A;  3IJ4 A;  2OTL V;  1MG1 A;  2OCH A;  2QR4 A;  3TCU A;  3ZED A;  1RSO A;  1F4M A;  2JVD A;  4P30 A;  4X65 O;  4NXM B;  4JI3 B;  4FZ1 A;  3CRA A;  3E86 A;  2Q0A A;  4YIO A;  4F6E A;  3RYF B;  5CN0 A;  3K79 A;  2R9I A;  3OGI B;  2A0L A;  2P4K A;  3OD4 A;  4I0X A;  4X64 B;  1BHA A;  4MVU A;  1OCR B;  2JRI A;  3ASO C;  5ITZ A;  1YHQ V;  1THZ A;  4DV3 B;  3ZRV A;  3K03 A;  4G2K A;  1N8R W;  1W0K G;  1HNZ O;  3HB3 B;  1VQ6 V;  5FNV A;  1YF2 A;  3CC2 V;  1R3I C;  5KMG B;  4KHP B;  1FFX B;  3JAL A;  3A0B Z;  2CAZ C;  5LYJ A;  3CX5 F;  3LSS A;  3M7M X;  5J9P C;  4PDL A;  5EBL C;  5LGT A;  5H6R A;  4PA7 A;  4DV5 O;  4JI4 O;  3WB1 A;  1VP7 A;  1XRE A;  1JFF B;  3CPW U;  2F93 B;  2PUS A;  2BCC H;  5IYB O;  5HFL A;  1L8D A;  3ZRW A;  5LXT A;  1I5X A;  2IH1 C;  1NS1 A;  1NTM H;  5CA0 A;  3E8G A;  1Q5O A;  4I9W A;  5LP6 B;  2DQ3 A;  1MOF A;  3N27 A;  4F6R B;  5IJ9 A;  3H1H H;  3RYH A;  1HNX O;  1LNQ A;  2QDO A;  1K97 A;  4RUE A;  2DWD C;  3RYI A;  3B2E E;  1XNR B;  4ZI7 B;  5KHJ A;  4DV1 O;  4EKW A;  2Z3Y A;  2A79 B;  5KX5 A;  4RUF A;  3K58 A;  4LF5 O;  2QGN A;  1Q6H A;  1OCZ B;  1ROP A;  4I50 B;  4DV7 B;  2JGD B;  2BSK B;  5JVD B;  4O4H A;  4X1K B;  4ZOL A;  4MS2 A;  2PZS A;  1AJP A;  1VMG A;  2WLI B;  1VF6 C;  2W6J G;  3T1C A;  3CYO A;  3MHH C;  1GN4 A;  1KUQ A;  4DW0 A;  4UV8 A;  3W7X A;  1GO3 F;  4UB6 Z;  3JAT B;  2ZXW C;  3BAB A;  3ZMU A;  3LNM B;  4MVM A;  1PNM A;  1OZ0 A;  4DR7 B;  2XT9 A;  1K5S A;  3ZBH A;  4W4K A;  1R3K C;  3G6B A;  4QNH B;  2RQ6 A;  1FXK C;  1GTO A;  3SYC A;  2X0L A;  5LGU A;  2UUA O;  5IWA O;  5EZY A;  4WFF A;  3RGB A;  5EIB C;  3H1I H;  1EZV H;  1FPO A;  3OEH G;  4I7Z B;  4LC1 A;  5B1B B;  2E76 B;  1XNQ B;  1PPJ H;  1GM8 A;  4K8Z A;  3HKB A;  1XHZ A;  2EIN B;  1WN7 A;  1RP3 B;  4DYL A;  3OUS A;  1VQ8 V;  5L3C A;  1Y67 A;  1EZJ A;  1O9H A;  1BQ0 A;  4MT8 A;  1Y74 A;  4WFH A;  5KHG A;  1SZT A;  5E1A C;  1QU7 A;  1J5E O;  3HKE B;  3FYI B;  4DUZ O;  1KBH A;  1MSD A;  4OXS A;  5DED A;  2W0F C;  2VQE O;  3L70 H;  1K73 W;  1XUQ A;  1P7G A;  2GUZ A;  3FB7 C;  2CK3 G;  1WA8 B;  5BZB A;  5C8Y B;  1V54 B;  3PN1 A;  1AR1 B;  3A0H Z;  5KUM A;  1D5N A;  5BY1 A;  1Z5W A;  4X62 B;  2HHH B;  1VQ4 V;  4IIJ B;  3J81 N;  1RM1 B;  4FPP A;  4B3M B;  1HR0 B;  1Y6X A;  1UFI A;  4BIO A;  3C3S A;  2ETN A;  4BW5 A;  5JH7 A;  1CPY A;  3IGA C;  1XQ8 A;  4NXM O;  4JI3 O;  1FFT B;  1VF6 A;  1ORQ C;  1BQZ A;  3RW0 A;  4LF8 B;  2Q4P A;  4UFZ A;  3QF7 A;  3VQW A;  2XAG A;  4TWK A;  2B1G A;  3E2E A;  4PA3 A;  4DR1 B;  1WJZ A;  2WA3 A;  2GTS A;  2Q68 A;  2IJI A;  2G38 A;  2IH3 C;  3DGE A;  4IYH A;  4DV3 O;  4QJF B;  4PA9 A;  3HKD B;  1VQO V;  4MTG A;  4H13 B;  1FXK A;  3MD0 A;  1Y76 B;  3ZHU A;  4U3J B;  3N2K B;  4LF4 B;  1V55 C;  5IDJ A;  2PI5 A;  4KHP O;  2YIB A;  3JAR B;  3GVM A;  1M56 C;  4WFE A;  1AIL A;  5J2T B;  4TUY B;  2N05 A;  3L72 H;  2FL4 A;  5JJN B;  5E79 Z;  1TVK B;  5LHI A;  1TUB A;  4H33 A;  1SA0 A;  2EIL C;  1I5Y A;  4O4J A;  1YJN V;  1B6Q A;  1SER A;  4OPA A;  5B1O A;  3FX7 A;  5FPR A;  3G71 V;  4HNA B;  1S77 D;  3P3P A;  4JI2 O;  4YJ2 B;  1N0J A;  4I4T B;  2PI4 A;  2UXN A;  3ETG A;  2LFR A;  1DF5 A;  4LFA B;  1XHX A;  2DYR B;  2GDS A;  1XNR O;  1FAF A;  5D5Q A;  1GM7 A;  1W59 A;  3LSU A;  1KP2 A;  2GTA A;  1KKD A;  3RYC B;  2ZIM A;  3SPG A;  4DV7 O;  2BTQ A;  4J7J A;  1Q3E A;  1ZWI C;  2YI8 A;  4K35 A;  4LFC B;  1NKD A;  4PD4 F;  2HFE C;  3JD2 A;  1DK1 A;  2L35 A;  4JYA B;  2Z5U A;  4CH4 A;  4B3R B;  2F23 A;  1I7F A;  4PDR A;  3HKC B;  3LSQ A;  1IBM B;  5DEC A;  5HFM A;  4ZIB A;  1YEW A;  4DR7 O;  1IZ3 A;  1OCO C;  1QVG U;  5JJE B;  2AZ0 A;  4FM0 A;  5A2Q N;  1XBL A;  4B08 A;  1H38 A;  3LDD A;  2OYQ A;  3R66 A;  3N2G A;  3WG7 C;  2DYS B;  4X1Y B;  1QLN A;  3CRM A;  4UCS A;  2WLL A;  4U7N A;  5IY5 C;  2QEX V;  1XNQ O;  4GKJ B;  3CWB H;  2JDI G;  5GON B;  1SC5 B;  1ZL8 A;  5EC1 C;  2Q69 A;  4QPK A;  3OW2 U;  3QG5 A;  3ABK C;  4UCT A;  3WU2 Z;  1ZAU A;  2E74 B;  2ZE7 A;  3U0Z A;  1M57 B;  1H2M A;  1VQK V;  2YC0 A;  3ABL B;  2M7W A;  2ZE5 A;  1JA8 A;  4RQF A;  3D36 C;  4N23 A;  1FYJ A;  2ODM A;  2BOB C;  3CC4 V;  4PA4 A;  1H2K A;  4NXN B;  1ZTE A;  2XOK G;  4TV8 B;  5L3G A;  1SQG A;  4DV1 B;  2BE3 A;  4DV2 B;  2EZP A;  4FLY A;  1AR5 A;  4LF5 B;  3SGI A;  4EFB A;  4K8X A;  4X62 O;  2HHH O;  4BR6 A;  3CCL V;  1SQB H;  4B3T B;  3BFR A;  4B3M O;  4X20 A;  1HR0 O;  4CH5 A;  4OX9 B;  3B40 A;  3ABM C;  5L3B A;  3DXR B;  3L74 H;  5EBW C;  1QHT A;  2EBO A;  2YXY A;  4LF8 O;  1IX9 A;  1H2N A;  4BWA A;  4CH3 A;  3FB8 C;  3CJH A;  2WLK A;  3P30 A;  1OJH A;  3JAW A;  5B3S C;  4IHJ B;  3TET A;  4KL1 A;  1Y4M A;  3JCZ A;  3CEI A;  3CXC U;  2LP7 A;  4JI8 O;  3JAM N;  3CRQ A;  2OIG A;  2UUA B;  1NJI W;  4JYB A;  4J7Z A;  1R73 A;  2DOS A;  5CB4 A;  3BAA A;  3FFQ A;  1HDJ A;  5LOV B;  5DM6 V;  2A3Q A;  3IC7 A;  2LQT A;  4AIL C;  1XDC A;  2AHY A;  2R72 A;  2ZNJ A;  2RCV A;  2EIJ C;  3AG1 B;  1IBK B;  2EIM B;  3KG2 A;  1AI7 A;  1S5H C;  3AG2 C;  5EYP B;  4DRX B;  1ENV A;  4JAA A;  5B1N A;  5JQG A;  1H2S B;  4BIZ A;  4QPJ A;  2Q5Z A;  1RPO A;  1JX9 A;  1AJQ A;  1K4C C;  3D36 A;  1GK9 A;  3ZHR A;  4ZHQ B;  2QTS A;  1NZ6 A;  4X9Q A;  4R8C A;  4LFA O;  4CC6 A;  4CBC A;  2H94 A;  1AP6 A;  2EUL A;  5LP6 C;  4LP8 A;  2RN9 A;  3ZMZ A;  5H2F Z;  4DUY B;  3SYQ A;  3OEE G;  4LWS B;  1K33 A;  4FLV A;  1RSO B;  2VWK A;  1CP9 A;  4WFA V;  3JAS A;  2WAM A;  3P3N A;  3F5W C;  4LFC O;  3C90 A;  4B7E A;  4JYA O;  3AK3 A;  1OCZ C;  3NR7 A;  2P7T C;  5IYD O;  5LGN A;  3A0R A;  1QLE B;  4B3R O;  5LMU B;  3QO8 A;  1CXZ B;  3ZHV A;  1Q8I A;  3ASN C;  3SPJ A;  2Y48 A;  1IBM O;  2UXX A;  4P9O A;  1XL4 A;  2IU3 A;  5B1A C;  1NVP D;  4BIU A;  5B66 Z;  4JI0 B;  2OTJ V;  4FLT A;  5ITZ B;  3OR6 C;  2AW9 A;  1EN6 A;  1D5A A;  2XAJ A;  5FNV B;  2F1M A;  1JJ2 U;  2F66 C;  1GH6 A;  3RBZ A;  1IXM A;  2BTO A;  3SYP A;  2YI9 A;  3JAL B;  3FB6 C;  1BMF G;  3H1L H;  5LYJ B;  1TUE B;  1J95 A;  4JZG A;  4GKJ O;  1WPX A;  4ICG A;  4H0L B;  3U11 A;  4D6T H;  1KP3 A;  1VF5 B;  2HVK C;  5LA6 A;  3ETE A;  1WNS A;  5KA5 A;  1EM1 A;  1KQS U;  3ZHT A;  3ZRW B;  5LXT B;  2JS5 A;  5CA0 B;  5KMG A;  3FB5 C;  3I5D A;  2WLH A;  2QKA A;  3CCU V;  5IJ9 B;  2JGU A;  5L3F A;  2LW1 A;  2Q7G A;  3C3T A;  3VQV A;  3RYH B;  4JI2 B;  2AHZ A;  2E75 B;  1YIJ V;  2HJD A;  3RYI B;  4NXN O;  1BGY H;  3K5O A;  5K1X A;  1N36 O;  2P6J A;  4NKG B;  5KX5 B;  4B3S B;  4DV2 O;  2M6Y A;  3CE2 A;  1BSM A;  4QE9 A;  3ETQ A;  5LP6 A;  1NT2 B;  2OCC B;  2IJH A;  3WFV A;  4B3T O;  1ZUQ A;  4O4H B;  4ZOL B;  1K8A W;  3ZRX A;  4DXW A;  1Q86 W;  4EFE A;  1V54 C;  1S5J A;  3H9V A;  4OX9 O;  3T1Y B;  2LGW A;  1G8M A;  4DR6 O;  3AK1 A;  3AK2 A;  3ZRS A;  2B5U A;  3CCE V;  2ZIO A;  2V4D A;  4IT5 A;  2F4V B;  4UB8 Z;  2BSK A;  2DQ0 A;  5JWP A;  2K1E A;  4X1K A;  4PHZ A;  2YDE A;  1KKC A;  3FD9 A;  3ASO B;  2LJ2 A;  2EZO A;  3CRR A;  5BXZ A;  3STL C;  5L3D A;  1E79 G;  2WSS G;  3VBB A;  3QO7 A;  4R50 A;  1W2B U;  2JJ1 G;  3CME V;  4QGP A;  5D5P A;  2Y0P A;  4UCR A;  4FIP C;  2V7Q G;  4NYK A;  3HKB B;  1LR1 A;  3W7W A;  2DN9 A;  3AG7 A;  2LW7 A;  2OT5 A;  1KD1 W;  2ITC C;  1OV9 A;  3L75 H;  3CCR V;  4GZR B;  1K3E A;  4MW8 A;  2DW4 A;  2WA4 A;  1Y74 B;  1VAR A;  1NTZ H;  2ZD9 A;  4PEL A;  2CGO A;  1NH2 B;  3AG3 C;  1IBK O;  5KUK A;  1E1Q G;  3QVN A;  3G4S V;  1YTF B;  1Q7Y W;  1AB3 A;  2KG7 B;  3E89 A;  4HBN A;  1DF4 A;  3TK1 A;  5J2U A;  2Y69 C;  1S5L Z;  2PYJ A;  1FXV A;  3UT5 A;  2HP8 A;  3T1H O;  4JI1 B;  3QTC A;  1EN4 A;  2ZIN A;  1Z5V A;  1D2D A;  2ZCE A;  3RWR D;  5FL7 G;  2CTR A;  4I55 A;  4ZKI A;  1RFY A;  1HP8 A;  3OT7 A;  2QWO B;  4DUY O;  4BAY A;  4L8J A;  2FML A;  3BPZ A;  1WP8 A;  3CS5 A;  3OR7 C;  5JH7 B;  1S72 V;  3G67 A;  2ITD C;  2HG5 C;  3F5T A;  1QR9 A;  4JTD B;  5C8Y A;  4CS2 A;  1AI4 A;  1I08 A;  2WWW A;  3E83 A;  3ABT A;  5JJJ B;  4RAI A;  4O2A A;  3K59 A;  1VQL V;  2ZE8 A;  1KYO F;  5LMU O;  2JJ2 G;  4C7U A;  4O4L A;  1VQ5 V; 
#chains in the Genus database with same CATH homology
 2QM7 A;  4TT3 G;  3W7T A;  3MHS C;  4JAV A;  2JDI G;  2B1I A;  2EJR A;  1RM1 C;  1FXK B;  2XND G;  1ARO P;  3I55 V;  5EC1 C;  2HVJ C;  2Q69 A;  5CMU A;  1S3J A;  4QPK A;  3F7V C;  3OW2 U;  4RO2 A;  3ABK C;  3ASN B;  3ZIA G;  3UM7 A;  1K92 A;  1PL0 A;  3K06 A;  3NXS A;  2ZR2 A;  1M57 B;  5B1A B;  3STZ C;  3CCV V;  1VQK V;  2WLI A;  4JAU A;  4X89 A;  3ABM B;  3ABL B;  1GM9 A;  2M7W A;  3X2Q C;  4JPR A;  4P2Z A;  4RQF A;  2OCC C;  4N23 A;  3UKM A;  2BOB C;  3E8F A;  1NH2 D;  4QIW F;  4FMT A;  3CC4 V;  3VOU A;  4PA4 A;  1YTF D;  4JTC B;  4UVB A;  3D3I A;  2OTL V;  1MG1 A;  2MK3 A;  2XOK G;  3FYE B;  1QCE A;  3TCU A;  1F4M A;  4P30 A;  5L3G A;  1EBO A;  3RVY A;  4MVQ A;  5H6Q A;  4PDM A;  2EZP A;  3ABU A;  3E86 A;  5CBG A;  3F7Y C;  3ZCC A;  3CCL V;  5CN0 A;  1F4N A;  3K79 A;  2R9I A;  4MVR A;  2A0L A;  4PDV A;  4YXW G;  1P7B A;  4KFM A;  1YJW V;  3OAA G;  1BHA A;  4FJC C;  4LBE C;  4MVU A;  3SPH A;  1W0J G;  2GSM B;  1OCR B;  3JD1 A;  2XAS A;  4FK5 C;  3ABM C;  3ABL C;  5L3B A;  3ASO C;  1YHQ V;  1THZ A;  3H01 A;  5EBW C;  1SES A;  3ZJZ A;  1NQT A;  3ZRV A;  3K03 A;  1GKF A;  3G6E V;  3T2M A;  2EBO A;  4G2K A;  1N8R W;  1W0K G;  3HB3 B;  2IJJ A;  4GCZ A;  1VQ6 V;  1AI6 A;  3P32 A;  2QTO A;  3E8B A;  4J9Y B;  4MVO A;  2QKS A;  2W6I G;  3FB8 C;  2HKO A;  1NBM G;  1PNL A;  2WLK A;  2ZDI C;  3CC2 V;  2Q6A A;  1R3I C;  2ATK C;  3P30 A;  5LHH A;  5B3S C;  3ZMS A;  3TET A;  4H37 A;  5C93 A;  3IFX A;  1BHB A;  3LSS A;  1Y4M A;  3JCZ A;  5CBH A;  1S0V A;  3CXC U;  2LP7 A;  3SPI A;  2YEV B;  3FKS G;  2NNU A;  2WLJ A;  4PDL A;  5EBL C;  5J9P C;  2IU0 A;  5LGT A;  5H6R A;  1NJI W;  4PA7 A;  4JYB A;  1R73 A;  1R3J C;  2JEX A;  2JEU A;  4GX5 A;  3OMN B;  2X6C A;  4MVS A;  3CPW U;  2DYR C;  4F4L A;  1SET A;  2HR3 A;  4JAS A;  5IYB O;  5HFL A;  4KP4 A;  1K4D C;  3ZRW A;  1I5X A;  2IH1 C;  5DM6 V;  1OCC B;  3E8G A;  4GX1 A;  1PKX A;  3IC7 A;  3JYC A;  3LDC A;  4ASU G;  4I9W A;  1M90 W;  2DQ3 A;  4WF9 V;  5CA3 A;  1K34 A;  2AHY A;  1F51 A;  1MOF A;  2WPD G;  3EFF K;  2IJK A;  5L3E A;  1FS0 G;  2EIJ C;  3AG1 B;  2QA4 V;  1LNQ A;  2ZXW B;  1K97 A;  2EIM B;  2WLL B;  2DWD C;  4RUE A;  1R3L C;  3KG2 A;  1AI7 A;  1S5H C;  2WLM A;  1V55 B;  3LDE A;  1BL8 A;  3BY6 A;  3AG2 C;  4EKW A;  1YJ9 V;  4L87 A;  2Z3Y A;  1ENV A;  2A79 B;  5B1N A;  3OUF A;  4RUF A;  1JOY A;  3B77 A;  1NR1 A;  1OCZ B;  1ROP A;  4MTO A;  4JYC A;  4QPJ A;  4BIZ A;  1RPO A;  1JX9 A;  1AJQ A;  2Q67 A;  1K4C C;  3D36 A;  1GK9 A;  2EIK C;  1QBZ A;  4WFG A;  1UJW B;  2EIL B;  4MS2 A;  4R8C A;  1AJP A;  3SYO A;  2WLI B;  2W6J G;  4WCE V;  3T1C A;  1YI2 V;  1OCC C;  2P90 A;  3CYO A;  4CBC A;  1DLB A;  1F23 A;  2QE7 G;  3MHH C;  2H94 A;  3M99 B;  5EK0 A;  4XBF A;  4LP8 A;  3QO5 A;  3EHB B;  1L1F A;  3ZMZ A;  4UV8 A;  3W7X A;  3SYQ A;  3OEE G;  1GO3 F;  1PNK A;  1K33 A;  3AG1 C;  2HJF C;  2DYS C;  2ZXW C;  1JCH A;  3ZMU A;  3LNM B;  1CP9 A;  1Y66 A;  4MVM A;  1PNM A;  1OZ0 A;  3AG3 B;  5LHG A;  4P9P A;  4WFA V;  4R7C A;  4UVC A;  2WAM A;  1K5S A;  3F5W C;  3ETD A;  1R3K C;  2FTK A;  4G27 B;  2WLN A;  1OCZ C;  3DTU B;  1GTO A;  1FXK C;  4QNH B;  2P7T C;  3SYC A;  5IYD O;  2X0L A;  5LGN A;  3A0R A;  1QLE B;  5LGU A;  4CZZ A;  2Y69 B;  3QO8 A;  4HZ3 A;  3ASN C;  3SPJ A;  1K5Q A;  1R6N A;  2Y48 A;  3AG4 B;  4LCU C;  3GWO A;  2A9H A;  2JK5 C;  2UXX A;  4WFF A;  4P9O A;  4MW3 A;  5H9C A;  1XL4 A;  2IU3 A;  5B1A C;  3OEH G;  1M57 C;  3OMA B;  4LC1 A;  5B1B B;  4BIU A;  3CC7 V;  1NVP D;  2OTJ V;  4UXN A;  1AJN A;  3OR6 C;  2ZDI A;  3CCS V;  5LBQ A;  1GM8 A;  5EBM C;  3OFN G;  2EIN B;  3OUS A;  3B8M A;  1VQ8 V;  2XAJ A;  1JQ0 A;  5L3C A;  1JJ2 U;  1EZJ A;  3SPC A;  2ZQM A;  4MT8 A;  3RBZ A;  5EC2 C;  4WFH A;  1SZT A;  1IXM A;  5E1A C;  3SYP A;  3FYI B;  1VQN V;  3ZN0 A;  2R9R B;  3FB6 C;  4OXS A;  1BMF G;  1R6K A;  1TUE B;  1OCO B;  2W0F C;  1J95 A;  4PA6 A;  1K73 W;  3GB7 C;  1WPX A;  1RPR A;  1QLE C;  3FB7 C;  3K0D A;  1M9N A;  4TSF G;  1EFR G;  2CK3 G;  1KP3 A;  3K08 A;  2HVK C;  4X8A A;  5BZB A;  3AG4 C;  1AI5 A;  1VQP V;  3ETE A;  3E8H A;  2KB1 A;  3JD3 A;  4MSW C;  5KA5 A;  1KQS U;  2D3O W;  1COW G;  1OCR C;  3ZRW B;  1FXH A;  1PD3 A;  2NLJ C;  3CMA V;  1V54 B;  1AR1 B;  3RVZ A;  5KUM A;  5IY5 B;  3PJS K;  1VQ7 V;  3FB5 C;  1JVM A;  3JD0 A;  1QVF U;  1YIT V;  3W7U A;  2WLH A;  3CCU V;  4UUJ C;  1NR7 A;  5L3F A;  1VQ4 V;  3OE7 G;  2YEV A;  1RM1 B;  2AHZ A;  2V1D A;  4FPP A;  4G28 B;  1YIJ V;  1K9M W;  3OGC C;  1H8H G;  4XDK A;  1HWY A;  4BW5 A;  4RQE A;  3ABK B;  1CPY A;  3SYA A;  3IGA C;  3ZMT A;  4GX0 A;  4XDJ A;  4JF3 A;  3B8N A;  2P6J A;  4JTA B;  1FFT B;  4R6Z A;  2P67 A;  5DN6 G;  5KA6 A;  3ML0 A;  5GW7 A;  1S76 D;  4N21 A;  1ORQ C;  3QNE A;  1M56 B;  3RW0 A;  1VQM V;  4QE9 A;  2X6B A;  2OCC B;  4I5S A;  1QR8 A;  2IJH A;  3K3W A;  3WFV A;  1K8A W;  2JIZ G;  3ZRX A;  4DXW A;  2XAG A;  4TWK A;  1Q86 W;  1YSC A;  3BEH A;  1V54 C;  2B1G A;  3CCM V;  3OMI B;  3E2E A;  4QE7 A;  4PA3 A;  2YSU B;  4MTX A;  1DTO A;  2Q68 A;  1SRY A;  1G4Y B;  3CD6 V;  2F43 G;  2IJI A;  1G8M A;  2IH3 C;  3DGE A;  2HLD G;  4QJF B;  4PA9 A;  3ZRS A;  4X88 A;  1KEC A;  1VQO V;  4MTG A;  2B5U A;  1FXK A;  3CCE V;  3CP1 A;  3SJQ C;  2EIM C;  3MD0 A;  3T4Z A;  4KUM A;  2XAQ A;  3E35 A;  2DQ0 A;  2K1E A;  1V55 C;  5IDJ A;  2PI5 A;  3HPL C;  3ASO B;  2EZO A;  1M56 C;  4WFE A;  4J9Z B;  3OM3 B;  3STL C;  5L3D A;  2QM8 A;  1E79 G;  1GMG A;  2WSS G;  3VBB A;  3QO7 A;  4R50 A;  4HYO A;  5LHI A;  2X7R B;  1W2B U;  4H33 A;  1XL6 A;  2JJ1 G;  4XDL A;  3ZMV A;  2EIL C;  3CME V;  1I5Y A;  4UVA A;  4Z1M G;  1Q81 W;  4HAM A;  1YJN V;  3K0G A;  4JGS A;  4FIP C;  1OHH G;  1B6Q A;  2BOC C;  2V7Q G;  1K7D A;  3W7W A;  2H8P C;  5B3S B;  3I56 V;  1SER A;  1MSW D;  4MVZ A;  2OT5 A;  1KD1 W;  2ITC C;  5B1O A;  1MAB G;  3G71 V;  3CCR V;  1S77 D;  3JD4 A;  1K3E A;  4MW8 A;  1KC8 W;  2DW4 A;  2ZD9 A;  4PEL A;  1E1R G;  2PI4 A;  1JPX A;  2UXN A;  4U7N A;  1NH2 B;  3AG3 C;  1P4R A;  3ETG A;  1Q82 W;  2LFR A;  1DF5 A;  2DYR B;  3CCJ V;  5KUK A;  3CCQ V;  1E1Q G;  1GM7 A;  4E2L A;  3G4S V;  1Q7Y W;  3T4D A;  1YTF B;  3E89 A;  5IYC O;  1KP2 A;  1DF4 A;  3TK1 A;  1KKD A;  4GT1 A;  3LUT B;  4MTF A;  2Y69 C;  3SPG A;  2XAF A;  1FXV A;  3WG7 B;  1ZWI C;  2EIJ B;  5B1B C;  3AEI A;  2ZR3 A;  1M1K W;  1NKD A;  5FL7 G;  2EIN C;  1NVP B;  4ZKI A;  3K04 A;  2HFE C;  2GHY A;  3AG2 B;  3JD2 A;  2XAH A;  2Z5U A;  3ZN1 A;  3K9A A;  4U7O A;  4DO2 A;  4Q20 A;  4PDR A;  3R65 A;  4BAY A;  2IW5 A;  3LSQ A;  3OR7 C;  4ZBM A;  1VQ9 V;  5HFM A;  1S72 V;  2ITD C;  2HG5 C;  2EIK B;  1QR9 A;  1OCO C;  1QVG U;  4JTD B;  4WFB V;  1H8E G;  4GX2 A;  1AI4 A;  5CBF A;  2WWW A;  3E83 A;  3W7S A;  3ABT A;  3LDD A;  1H38 A;  2C2A A;  4RAI A;  3X2Q B;  1VQL V;  3WG7 C;  1WLE A;  2JJ2 G;  1CEZ A;  2DWE C;  4UV9 A;  2DYS B;  2X6A A;  1QLN A;  1VQ5 V;  2LFS A;  2WLL A;  1H2G A;  5IY5 C;  2QEX V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...