3I56V

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i56V00
1QVGU 3G71V 4WCEV 1Q86W 3CCVV 1K8AW 3G4SV 1JJ2U 1YJNV 1W2BU 3CPWU 1M1KW 1KD1W 2QEXV 3CD6V 3CC2V 3CCEV 1VQNV 3CCMV 1VQ4V 2D3OW 1YHQV 1VQPV 3G6EV 3CMEV 1VQMV 2OTLV 3CCJV 3I56V 3CCSV 1VQKV 1YJ9V 4WFBV 3CC7V 1VQ7V 1VQ8V 1YITV 1S72V 3CCRV 1K9MW 1VQ9V 5DM6V 3CMAV 1VQ6V 2OTJV 1K73W 1YJWV 1QVFU 3I55V 1M90W 3CCQV 3CCLV 1R73A 2QA4V 1VQOV 3CCUV 1NJIW 3CC4V 1KQSU 1YI2V 1VQ5V 1Q7YW 4WF9V 4WFAV 3OW2U 1YIJV 1Q82W 3CXCU 1VQLV 1Q81W 1N8RW 1KC8W
chains in the Genus database with same CATH superfamily
2X7RB 2HHHB 2EIMC 2P06A 4DR3O 1H2NA 2DWDC 5BY1A 3FKSG 3ZMVA 1WNSA 1WP7A 3I55V 3K06A 1VQ5V 2UUBO 1H2MA 1Y4MA 3STLC 1EZVH 4DV3O 3JALB 2V7QG 1MMMA 3K59A 1YJNV 1HNZO 1P7BA 2JGUA 3OD4A 4CS2A 4O4HA 4DUZO 5LMNB 5IJ9A 2ZE7A 4JI6O 1SZXA 1XMQO 1ZX3A 4MT8A 2JK5C 2R9IA 4MTGA 4JZ2A 2E3CA 5LHIA 1FKAO 3L9DA 3SR2C 2ZIOA 3BRCA 1KECA 4OPAA 4GYCB 4YJ2B 4WFEA 4TQDA 1K92A 5H6RA 3MAQA 4J10A 3WFVA 1GKFA 5KHIA 5GTIZ 3SPHA 1R3IC 3CXCU 4ZBMA 2JEXA 1M1KW 4UFZA 4CC6A 1AR4A 2RDCA 4JI4O 2YEVB 4GKKB 4DR2B 1RPRA 2WPDG 1KYOF 3UT5B 2JJ1G 2Q7GA 3E22B 3GWKC 2PI5A 4CH3A 1US6A 2QWPB 1VQLV 3WG7C 1IBLB 1R6TA 5LYJB 1TA8A 4LF6O 4DV0B 2OCCC 1K4CC 4O2AB 3B09A 4J7JA 1SS3A 4IHJA 1FFXA 1YSCA 1VQMV 4PDRA 1WA8B 1RSOB 3GVMA 4DR5O 1CP9A 5KLVH 2P4VA 2DOSA 2KSDA 4WBNA 1IXBA 1NBMG 2C2AA 4LF7B 2DJVA 4XDJA 3WG7B 1VIBA 3RYIA 1F4MA 2OCCB 4EB6B 3OEEG 2V4DA 4OX9O 2NNUA 4O4LA 1ROPA 3CCJV 3IGAC 3JASB 2F23A 3SJBC 1N34B 3UM7A 1UFIA 1E1QG 3CJHA 4DV4O 3TJTA 1CEZA 3E8HA 4JI8B 2BE3A 1VF5B 2OYQA 1JOYA 1NTKH 4DV2O 1M57C 4LF9B 5KHGA 2PYJA 1VQPV 3KZIZ 3H1HH 3FB8C 3CE2A 1BQZA 2ZCEA 5K1XA 1NH2D 1TGOA 1JFFA 1A32A 3AG3C 5KX5A 3CCLV 3W7SA 4JYBA 3C90A 1SQGA 4NTXA 5FL7G 4NKGB 2YIBA 2PY5A 3SYCA 4LWSB 1QHTA 1QR8A 4CC5A 1VEWA 3JATA 3BHPA 2ZKOA 1TVKB 1NT2B 1IZ3A 4I55A 1FPOA 1S5HC 2F43G 3CCQV 1DF4A 5LHGA 1R6NA 2F1MA 4NXNB 4TV8A 3LDEA 2WAMA 2LP7A 5JH7B 2QDOA 1Y76A 1BS3A 1NQTA 2UUCB 2N74A 4E2LA 2G38A 5IJ0A 2OTLV 2B1IA 4LFCB 4DV6B 5EBWC 3UO2A 4LF5B 1FXKC 4MS2A 4X64B 1T5EA 4JPRA 1GO3F 2F66C 1O9GA 2Y0PA 1K5SA 5IWAB 2QA4V 1KQSU 1P49A 4NXMB 2LJ2A 3L72H 3G80A 4X89A 4U3JB 3J80N 3HKEB 4FVMA 1YXBA 3ZHTA 3VBBA 3OTFA 1FS0G 4K35A 1FXKB 2JIZG 3ABTA 5HFLA 4D7TA 2GTSA 2WLLB 4DRXB 3ZRVA 1YVWA 2PTMA 2YS8A 1OCRC 4R7CA 1MSWD 2YICA 2EBOA 1HNXB 3BFRA 2P22C 5GONA 5JQGB 3B77A 1VQ6V 2DQ3A 3N2GA 3AG4B 3X2QC 3W7XA 4EFEA 4JYAB 2WA3A 4B7KA 1BZKA 2LFRA 1AB3A 3PJSK 2E75B 1OCRB 3ABKB 1ZAUA 3JD2A 1Q3EA 1Q7YW 2Q9LA 1D5NA 2DYRC 2FMLA 3SJCC 1L0NH 1IXMA 4J11A 4ZOLA 1JVMA 1BGYH 4BWAA 3X2QB 3ZMZA 1SQQH 3ZRXA 1Q90D 4XDLA 1YTFD 1KU9A 1N32O 3RYHA 3G67A 4PDLA 4J9ZB 2YIBD 4ASUG 1EN5A 1MOFA 3FB5C 4MTFA 1MG1A 2MW2B 4JI7O 1NVPB 3CRRA 3ZN0A 2X0LA 2IM9A 4B3RB 2UXDO 4JTAB 1Q5OA 2DW4A 4H0LB 1GTOA 4TV9B 4JI4B 4X1IA 3K04A 4ZI7A 1YI2V 4I4TA 1XQ8A 5BR8O 4LFAO 2UXBO 1SZTA 3T1HB 3E8GA 2YSUB 2GDSA 2H8PC 1G1XB 4LF6B 1WPBA 1HR0O 2NLJC 3S3XA 3CCRV 4K8XA 3FX7A 1GN3A 5LMUO 4YJ3B 1QVFU 3BVOA 1AI7A 4A5UB 3CS5A 2K1EA 4O4HB 1BCCH 4UCTA 4DR5B 3T1YO 1G6UA 5IJ9B 1SKVA 2YUAA 3OMNB 3CCMV 2HJDA 5CBHA 3I56V 2BTQA 3ABMC 3A2FA 1VQ7V 4DR1B 5KMGA 4LF8B 5E79Z 3JYCA 4UVCA 1XNRO 4MVOA 4FLYA 1NKDA 4OXSA 1PL0A 4UCVA 2OT5A 2PI4A 4LF4O 3G4SV 2GUZA 4DV5B 1KD1W 3SYPA 1XL6A 5J2UA 2FYUH 3B4SA 4PI2A 5E1AC 2EIJC 1QU7A 4BAYA 5C8YA 3ZHUA 4JTDB 5C93A 4DV2B 5LGNA 2R9RB 1IBKB 4D7SA 1N36B 1K73W 1AROP 1O9HA 4PDMA 3JD1A 5H5NA 2RMKB 4QE7A 1Y74A 1SESA 1WB7A 3OMIB 5CB4B 2CUGA 3DTUB 3SPCA 2EIJB 5EZYA 3OT7A 4UB6Z 4JZGA 4X62O 1Y6XA 4LH6A 4RQFA 1THZA 1TUBA 4IHJB 3BPZA 2YI8A 2R70A 4IYHA 4DYLA 2QJ1A 1ZUQA 1WPXA 3P3PA 1QQCA 3GWOA 3BY6A 4U7NA 3JAKA 3ZHVA 4MVQA 2AGAA 1FJGO 3FYEB 2HP8A 4JAUA 4GLXA 4H37A 4FZ0A 3H1LH 1COWG 2ITCC 1B3QA 4DV1B 1FXHA 4P9OA 4CS3A 3QG5A 3JCUZ 4QNHB 2UXCO 3RW0A 4KP4A 1XHXA 2XT9A 3CJHB 4LNUA 4XBFA 4B3MB 3HKCA 4IYIA 3C3TA 1D2DA 4F6EA 1HDJA 2ZXWB 2BCCH 1RPOA 2Q0AA 2PYLA 4FM2A 2UUAB 3SPIA 1S3JA 1K3EA 4X8AA 1J5EB 3A0RA 1OCCC 4B3TB 4IGGA 4X1YB 4JI2B 4CBCA 1JFFB 5CBFA 1E79G 4H44B 1BE3H 2XASA 1FXVA 5GW7A 4TSFG 4FLUA 5EC2C 4LBEC 1OCCB 2WA4A 3JATB 1IDSA 4FJCC 4PA3A 1WP8A 1FYJA 2W6JG 2AXTZ 4JI3O 4IIJA 1KKCA 2RNBA 1W59A 3MD0A 3ETQA 3WU2Z 4Z2WA 4J7KA 2QM7A 4DK1A 1PL4A 4TV8B 1XMOO 1V55C 1Y76B 4JI0O 2KQXA 4CZZA 5FLXN 3SJAC 2F95B 2WLMA 1NR7A 4X9QA 5JJEB 5IJ0B 2LO1A 5DEDA 3RYFB 2CTPA 1N32B 3VQYA 3L73H 4PELA 4F6RA 3WB1A 4EEQA 4JF3A 1ZL8A 5DECA 4PV1B 1P7GA 1R3KC 2XNDG 4J9YB 3E8BA 5LA6A 3VQXA 3F5WC 1KBHA 3LSUA 3ZRWA 2H3OA 2A3QA 3MDSA 4GCZA 1AR1B 2AHYA 4I0XA 1RFYA 3P3NA 3CRMA 3OM3B 3N27A 4DO2A 4QE9A 4D6TH 3CPWU 1Y66A 2Q68A 5BR8B 2EIMB 5JJNB 1JR9A 3MHSC 4YHHO 2VQFO 2DMXA 5GONB 2HLDG 3BA8A 2XTAA 2P5OA 2HKOA 1QLNA 1MZEA 2VQEO 3OR6C 3N2GB 3THOA 2GSMB 1PM9A 5J9PC 2YI9A 4GX0A 1QR9A 4CS4A 5IYZB 1FAFA 3K0DA 2D3OW 3JAWA 1B06A 4GUNA 3ZN1A 3HKBA 2QE7G 2QKSA 2IW5A 1XNQO 4X20B 1AI6A 4J7ZA 3P30A 3OR7C 3UKMA 1PP9H 2XOKG 1IBMB 1HW7A 5EBLC 3D36A 4DR7O 4KFMA 1TUEB 3L75H 2A0LA 2AZ2A 3UO3A 5B3SC 2BSKA 1YZBA 4CH5A 1K5QA 1OV9A 4R8CA 4MVRA 2IJKA 4N23A 1JA8A 3F7YC 2GTAA 4TQFA 1K34A 4C7UA 1PNKA 3QO7A 4WFAV 1SETA 3RYCB 3CXHF 1QVGU 1SA0A 3IC9A 5B3SB 1JJOA 1JX9A 2GV9A 4FFBA 3D3QA 2R72A 3ABLC 2XAHA 2YXHA 2ZT9B 4ZHQA 1CPYA 3AG2C 2N04A 4U7OA 3K5OA 3Q4HA 3RT3C 5LGTA 3BABA 1YF2A 3E83A 1DK1A 1HNWO 5LL6Y 2QEXV 2Q6AA 3LNMB 5D5PA 4UVBA 2XUMA 1OCZC 1PV0A 3ABLB 4PDVA 4LCUC 3WB2A 1Y67A 5FNVA 2DN9A 1VF6A 3AG2B 1S77D 2FL4A 3A8TA 1NR1A 5EK0A 5KAFZ 4PJ0Z 3RBZA 3AK1A 1LUVA 1KC8W 1FJGB 2D2CB 1AR5A 2CK3G 1OCZB 4L87A 3K3WA 4O4JA 3ZX6A 3G6EV 4YY3O 4DR4B 2EINC 2M7WA 2UXCB 2Q7EA 4JI5O 4X66O 3A0HZ 4OPHA 1GRJA 4KHPB 1UJWB 2ZM6O 3RVYA 1DLBA 4B3SO 1WN7A 4X1KA 1M57B 1KP3A 1S5JA 4JV5O 5BMVA 3K58A 1IVSA 2M6YA 1S72V 1K9MW 1VQ9V 1RM1C 1Y74B 3QVNA 3AG3B 2RJZA 5L3GA 3K03A 5B1BC 2E76B 5EZYB 1WJZA 5CA3A 1OCOC 3ZJZA 2QTSA 3ZBHA 3K5LA 1ZTEA 1N33O 2ZINA 3M99B 4PA6A 3TETA 3EHBB 1TUBB 4UCSA 3OGIB 4LH7A 2X6BA 1MSDA 2LGWA 5LXTA 1LUWA 1I94O 1SERA 5TISZ 1JQ0A 5B1BB 4FLWA 2ZE5A 3OUSA 1OCOB 3EVKA 4TUYA 1H2SB 4DUYO 4Q20A 3CSXA 3H1IH 2OIGA 4X65O 1AVMA 4F4LA 2CH7B 1H8HG 4BIOA 1K33A 3APQA 3F5TA 3U11A 2OTJV 3BAAA 1KP2A 4HNAA 4NB5A 2DWEC 1S76D 4DR3B 2WSSG 4I7ZB 2ZQMA 3H1JH 4FZ1A 4LNUB 1ORQC 4DV7O 1BSMA 1Q86W 3LSSA 2CAZC 5LP6A 5A2QN 2UUBB 1KKDA 4NR1A 4FPPA 4N21A 4UVAA 3RWRD 4DV3B 1VQ8V 4DXWA 5KHJA 2DE0X 1HNZB 3DGEA 4Z1VA 2NN4A 3JD4A 3HKDB 4DUZB 1XREA 4K0KO 3CEIA 3NXSA 4X88A 4JI6B 3ML0A 1XMQB 2O57A 4E4EA 1XEQA 5IY5C 2E5LO 2AW9A 5BZBA 3CC7V 1JMKC 4MTOA 5DN6G 1R73A 1VQOV 4IIJB 2Q5ZA 3OW2U 2HVKC 2QM4A 1YIJV 2DYRB 1V54C 5JCOA 1XNQB 3SDLA 4LFBO 5IY5B 3P32A 1EN6A 1BT8A 3JD3A 2PF4E 3B2EE 3K08A 3KKYA 4PHZA 3CCSV 2N05A 4DR7B 4AQYO 4OGQB 2YIAA 5LOVA 5IDJA 1L8DA 1SQXH 2HHHO 4JYYA 4W4KA 4F6RB 2YEVA 1GMGA 2ADPA 2CTRA 1Q6UA 3MHHC 1E1RG 3UT5A 4JAVA 3E22A 5LA6B 3ZHSA 1IURA 3U0ZA 2Q69A 2UXXA 2A79B 4I0XB 2YDEA 4IT5A 5IE9A 2OCHA 2XAJA 1RSOA 3H01A 1Q82W 1M93A 2RQ6A 5LMNO 1AP5A 5JJJB 4KXRA 1L1FA 5K1PA 1GK9A 4EB6A 1HNWB 1HWYA 2ILMA 4HZ3A 3K57A 3HPLC 4FLZA 5HFMA 1XBLA 1NH2B 4GT1A 4OX9B 1K4DC 2DQ0A 3D36C 3M8AA 3JASA 1EZJA 1BMFG 3JAWB 5ITZA 1PNMA 1IX9A 3ASNC 4DV4B 5EBMC 4FLVA 3E2EA 3ETGA 3JCZA 3ABMB 4FLXA 4MVSA 2FTKA 2QSAA 2HVJC 4FK5C 4MVUA 4I9QA 4YY3B 3K5NA 1AI5A 1OJHA 2BSKB 2QR4A 3K79A 3OEHG 3K5MA 2EZOA 2Y69C 3B40A 4GKKO 1H8EG 1URFA 3AG1C 4DR2O 1ENVA 3OMAB 1DF5A 4JGSA 4NVPA 1LNQA 1XHZA 3STZC 1IBLO 2EIKC 4JAAA 4DV0O 5KA5A 4FM0A 2JEUA 2CTWA 4QPKA 1SA0B 2KKWA 1NJIW 3NR7A 3AK3A 4H13B 3H9VA 4FFBB 1FFXB 2ZDIA 3AG1B 5JVDA 4MVMA 1M9NA 4ZHQB 1VF6C 1AJPA 5JH7A 3Q4HB 1P84F 4WBNB 4DW0A 2EIKB 4BR6A 3ASOC 3O9OA 2KG7A 3RYIB 1N33B 1RP3B 3J81N 4RO2A 2F4VO 1EBOA 1GN6A 5CN0A 4O4LB 3BA9A 4DW1A 3CHXA 3QTCA 1GM7A 4H33A 1I94B 4PD4F 5FNVB 3K0GA 3E89A 4R50A 4YXWG 1N34O 2JVDA 5EYPA 2YXYA 3HKEA 4O4IA 4DUYB 4PA7A 3ASOB 1H38A 4X65B 3OFNG 1EM1A 2B1GA 1M90W 3U10A 5B1AC 4DR6O 2Q0OC 1L0LH 1S0VA 4B7EA 1NTZH 2IU3A 2WLLA 2Z3YA 1Z5VA 5JQGA 4GX2A 4WFHA 1K7DA 3GB7C 1G4YB 4TT3G 2HR3A 5KX5B 4UUJC 1YTFB 1MABG 2W0FC 5B1AB 4X1KB 1MZFA 4QIWF 4UB8Z 2Q67A 3CP1A 3JARA 1I7FA 4K3AA 4JI1O 1FD9A 4HBNA 4GKJO 2ZIMA 4I55B 3CC2V 2ATKC 5A9GA 1J95A 2Y48A 4K0KB 3L71H 4AHCA 5CBGA 2P67A 5KUMA 1U97A 5GTHZ 2E5LB 1BHBA 2FKXA 3DSQA 2ADQB 3IFXA 2UUCO 1OZ0A 3T1CA 1SQFA 2WWWA 3LDCA 3G71V 4LF5O 3CD6V 1M5IA 3PN1A 4X64O 1U96A 2VWJA 2EULA 5D5QA 5LXTB 4UCOA 4JI7B 2ZR3A 4NXMO 1VP7A 2BTOA 1DTOA 1V55B 2UXDB 3R65A 3K9AA 1S5LZ 5LP6C 3CYOA 3IAYA 4TV9A 4MTXA 3ZMSA 4P9PA 1K8AW 1BQ0A 5EIBD 1PPJH 4HNAB 4LFAB 2UXBB 2P7TC 1GN2A 4WFBV 5CMUA 1HNXO 2L35A 4ICGA 3TXSA 2HFEC 5LP6B 3SJQC 1HR0B 3TCUA 4YIOA 2Q4PA 4YJ3A 1NI8A 5LMUB 3L70H 4JYAO 1VQNV 4ZIBA 3L74H 2HG5C 2PUSA 4CH6A 1F23A 3A0BZ 3ZIAG 1ZSPA 3T1YB 1H2LA 3QNEA 4J80A 3O65A 5FPRA 2ZE8A 2AZ0A 3APOA 5J2TA 1GM9A 4FIPC 4AILC 3UQ8A 5JCOC 2X6AA 4AI8A 2H94A 1PD3A 4ZOLB 4LP8A 4JASA 5FPOA 1QLEC 1XNRB 3DXRA 1F4NA 1WB8A 4HAMA 2IU0A 4P2ZA 1F7YA 3RYHB 3E8FA 1PNLA 4LF4B 1YCIA 2KB1A 3OE7G 3OTOO 4B3RO 4K8ZA 1QLEB 2LGQA 5LOVB 1SRYA 2NR5A 5B1OA 1SF9A 3OUFA 4MW8A 2ETNA 1Q6IA 5CB4A 2PZSA 2A9HA 3E86A 4X1IB 4ZI7B 3RN4A 4I4TB 4QJFB 2UU9O 3M7MX 4DK0A 3T1HO 1N0NA 2EILC 2QWNB 1EFRG 3E35A 2IJHA 2JRIA 4I5SA 5H2FZ 2XHBA 4FM1A 5CA1A 1NVPD 2EX3A 3CX5F 2QKCA 5KHHA 4X62B 2Q7HA 4BW9A 1M56C 4MSWC 2ODMA 1R6KA 1Q6HA 1XUQA 4B08A 1D5AA 2XAFA 3D3IA 3SPJA 1GAXA 2JDIG 2EILB 4UXNA 2CE4A 2ZE6A 4BIZA 1I08A 1V9PA 2XAQA 4GX5A 4RQEA 5CA0A 4Q6GA 2BTQB 1QBZA 1W0JG 5L3CA 4DR1O 1M56B 2F4VB 4LF8O 5KMGB 4I50A 4RUFA 1SQVH 2P90A 5EC1C 3N2KA 3RVZA 1GH6A 5B5EZ 2B5UA 1WAZA 4UCUA 2LFSA 1KMIZ 5ITZB 2X6CA 2ZD9A 1MA1A 4DV5O 5IYCO 3ZMTA 2OWOA 2WLNA 2GUZB 5J2UB 4PA4A 4WCEV 1K97A 5C8YB 4DR6B 1IBKO 4WFFA 4JTCB 2JS3A 3SYQA 1KB9F 1N36O 2WLIA 1VQ4V 5BXZA 1BHAA 3JSLA 2EINB 3ZEDA 4MVZA 3QO8A 4X1YA 3IJ4A 2W6IG 3FAVA 4O2BA 2CDYA 2ZDIC 4YIPA 3BEHA 3SYOA 3D8CA 2ZNJA 5LGUA 4WF9V 1TAEA 2Q73A 2QM8A 2JJ2G 3T4DA 4JI1B 1NS1A 5EIBC 2IJJA 2Y4TA 4UV8A 4GKJB 2OIEA 1W0KG 1JPXA 3G6BA 3ZCCA 2LQTA 3VOUA 3FFQA 1RM1B 4JI3B 3W7UA 2CGNA 2HEPA 5JVDB 2B9ZA 4RAIA 5L3EA 4PI0A 3KCYA 1XMOB 4CH4A 3JAKB 2QWQB 4JI0B 1YDXA 3RFRA 2JGDA 4LC1A 1N0JA 2KG7B 3RYFA 2YC0A 2ITDC 4DV1O 3SYAA 2QGNA 3W7WA 3W7TA 2EZPA 1R3LC 5EYPB 1Q81W 1N8RW 4B3MO 3OGCC 3JD0A 3ETEA 3HKCB 2PGGA 4O4IB 1SC5B 4W4LA 1I0HA 1LR1A 1AP6A 2UUAO 1H2GA 2QWRB 3AG4C 2CGOA 5IYBO 3JALA 1XILA 5KA6A 1X59A 4KL1A 3OAAG 3T4ZA 3CRCA 1J5EO 4B3TO 1KUQA 3ABKC 1XI1A 2K9PA 4YHHB 2WLKA 2VQFB 4JI2O 5LHHA 3AK2A 4XDKA 3CCEV 2VQEB 1VF7A 1VMGA 2ZR2A 3JARB 1NTMH 5IYZA 3ZHQA 3QF7A 3SPGA 5H6QA 3CMAV 3WB0A 3ZS8C 2WLJA 3B8MA 3S3WA 5IYDO 1Z5WA 3CCUV 4J42A 4UCRA 4ZKIA 1AI4A 4YJ2A 1WLEA 4X20A 1AJNA 1AJQA 3CRAA 5KHKA 4FFKA 3HB3B 3IC7A 1PKXA 3F7VC 1F51A 5L3FA 1G8MA 2QKAA 4G2KA 4NYKA 4GX1A 1V54B 1ZL8B 2EJRA 2Z5UA 3OTOB 2YIDA 2GHYA 1XOUA 1DGSA 3RYCA 3QO5A 1ZWIC 2QTOA 1I5YA 3ZRWB 3JSNA 5LYJA 2HJFC 3ETDA 4RWUA 4O2AA 3C3SA 2R9AA 4QGPA 2Q8VA 3LSQA 4R6ZA 1GN4A 1WA8A 2UU9B 1B6QA 4UV9A 1JJ2U 2GBOA 2P4KA 4EKWA 1QCEA 2A7WA 3HR0A 2L6LA 2AHZA 1AILA 4GZRB 1Z2GA 3AEIA 2RCVA 5F2VO 3VQWA 3DC6A 4TOIA 3FYIB 5LBQA 3KCXA 3CCVV 3ABUA 3ZRSA 3HKBB 4Z1MG 5J2TB 1BL8A 2VRZA 3ICXA 4J41A 1YJ9V 3SGIA 5H9CA 1IBMO 5L3BA 4IL6Z 5DM6V 3VQVA 1YEWA 3DXRB 4PA9A 4JYCA 4JI5B 4X66B 3CRQA 3DC5A 2RN9A 4G28B 3ASNB 1HP8A 1XL4A 3LNNA 1MNGA 2ZM6B 1B04A 3K9SA 4BIUA 1VQKV 4B3SB 1N4CA 4WFGA 4LWSA 1I5XA 2Y4UA 5L3DA 4JV5B 3FD9A 3CB2A 1TVKA 2LW1A 3TGUH 2JS5A 3LUTB 1FFTB 2Y69B 2IH1C 3RGBA 1GM8A 4NTYA 3CMEV 3FB7C 2BOCC 2DYSC 4LF7O 3AG7A 3EFFK 1OHHG 1YJWV 5CA1B 3LDDA 1X4TA 4RUEA 4HYOA 3CC4V 2Z0AA 1Q8IA 1VARA 3UCSC 4QPJA 2ZNIA 4ABMA 2F93B 4EFBA 2IBZH 2XAGA 5IT9N 2QWOB 2UXNA 4U3JA 2DYSB 5KAIZ 1XDCA 1R3JC 1Q43A 5CA0B 2EJ7A 2E74B 4JI8O 1P4RA 2BOBC 2CH7A 2ZXWC 1FXKA 2FB5A 4I50B 4LF9O 1NZ6A 2LW7A 1H2KA 4O4JB 3N2KB 4DR4O 2VWKA 5B1NA 4DRXA 1W2BU 4KHPO 4FMTA 4TWKA 5B66Z 1ZLZA 4DV7B 4I9WA 2A06H 2W0XA 4BW5A 2Y0IA 2VS0A 2WLIB 3ZHRA 1NU1H 3JAMN 5JWPA 2YXLA 3HKDA 5BMVB 3R66A 3CWBH 2MK3A 2IH3C 1SQBH 1M4UA 3TK1A 3FAVB 1YHQV 4O2BB 3TXQA 2CTQA 1JCHA 4U3FH 4NXNO 3FB6C 1QNMA 1EN4A 1UPGA 4NTWA 4FLTA 1CXZB 3EXAA 4KUMA 3BCCH 4L8JA 3J7AU 3B8NA 4LFCO 4DV6O 2ARHA 4LR3A 2IJIA 4MW3A 2V1DA 3ZMUA 2P6JA 4P30A 5KUKA 5AG2A 1R1BA 5IWAO 1SQPH 4G27B 1YITV 4LFBB 3H1KH 3T2MA 3KG2A 4TUYB 3I5DA 2JGDB 4AQYB 2WLHA
chains in the Genus database with same CATH topology
1SESA 1QBZA 1W0JG 2X7RB 3OMIB 5L3CA 1M56B 3DTUB 3SPCA 2EIJB 4RUFA 5IY5C 2EIMC 2P90A 5EC1C 3RVZA 5BZBA 3CC7V 2DWDC 3FKSG 2B5UA 3ZMVA 2LFSA 4MTOA 2X6CA 5DN6G 2ZD9A 3I55V 5IYCO 1R73A 3ZMTA 1VQOV 2WLNA 4RQFA 1THZA 3K06A 1VQ5V 4PA4A 3OW2U 2HVKC 1YIJV 1Y4MA 2DYRB 1V54C 3STLC 4WCEV 1K97A 2V7QG 1YJNV 1P7BA 4WFFA 4JTCB 1WPXA 5IY5B 3SYQA 3P32A 1VQ4V 2WLIA 3GWOA 3JD3A 3BY6A 3CCSV 3K08A 1BHAA 2EINB 4U7NA 4MVZA 3QO8A 4MVQA 2W6IG 5IDJA 2ZDIC 2JK5C 3FYEB 4MT8A 3BEHA 2R9IA 4JAUA 3SYOA 2YEVA 4H37A 4MTGA 1GMGA 1COWG 2ITCC 5LGUA 4WF9V 3MHHC 1FXHA 4P9OA 5LHIA 1E1RG 2QM8A 3T4DA 2JJ2G 4JAVA 4QNHB 2Q69A 3RW0A 4KP4A 2UXXA 2A79B 2IJJA 4UV8A 1KECA 4XBFA 1W0KG 1JPXA 3ZCCA 3VOUA 1RM1B 2ZXWB 3W7UA 4WFEA 1RPOA 1K92A 2XAJA 5H6RA 3WFVA 1GKFA 3SPIA 4RAIA 1S3JA 1K3EA 3H01A 5L3EA 1Q82W 4X8AA 3SPHA 1R3IC 3CXCU 4ZBMA 3A0RA 2JEXA 1OCCC 1M1KW 1L1FA 4LC1A 1GK9A 4CBCA 5CBFA 1E79G 2ITDC 1HWYA 4HZ3A 3HPLC 2YEVB 5HFMA 1RPRA 2WPDG 3SYAA 1NH2B 4GT1A 1K4DC 2DQ0A 3W7WA 2XASA 2JJ1G 1FXVA 5GW7A 3W7TA 1EZJA 2EZPA 1R3LC 1BMFG 4TSFG 2PI5A 5EC2C 1VQLV 4LBEC 1OCCB 3WG7C 1Q81W 1N8RW 1PNMA 3OGCC 3JD0A 3ETEA 4FJCC 3ASNC 4PA3A 2W6JG 2OCCC 1K4CC 5EBMC 3E2EA 3ETGA 3JCZA 1YSCA 3MD0A 1VQMV 1H2GA 3ABMB 4PDRA 3AG4C 4MVSA 5IYBO 2FTKA 5KA6A 2QM7A 2HVJC 3OAAG 3T4ZA 1CP9A 4FK5C 1V55C 4MVUA 3ABKC 1NBMG 2C2AA 2WLKA 1AI5A 4XDJA 4CZZA 3WG7B 2WLMA 1NR7A 5LHHA 3K79A 1F4MA 3OEHG 2EZOA 4XDKA 2OCCB 2Y69C 4PELA 1H8EG 3AG1C 3OEEG 3CCEV 1ENVA 4JF3A 3OMAB 1DF5A 2NNUA 2ZR2A 4JGSA 1ROPA 3CCJV 3IGAC 1LNQA 1R3KC 2XNDG 3SPGA 4J9YB 3E8BA 3STZC 3F5WC 5H6QA 3CMAV 3ZRWA 2EIKC 2WLJA 3UM7A 3B8MA 5KA5A 1E1QG 2JEUA 5IYDO 4QPKA 4GCZA 1AR1B 2AHYA 1NJIW 3CCUV 1CEZA 3E8HA 3OM3B 4ZKIA 1AI4A 2ZDIA 1JOYA 1WLEA 1AJNA 4DO2A 1AJQA 3AG1B 4MVMA 4QE9A 3CPWU 1M57C 1Y66A 2Q68A 2EIMB 1M9NA 1VQPV 1AJPA 3HB3B 3MHSC 3FB8C 3IC7A 2EIKB 1PKXA 2HLDG 3F7VC 1F51A 3ASOC 5L3FA 1NH2D 1G8MA 2HKOA 1QLNA 3AG3C 3CCLV 4G2KA 3W7SA 4RO2A 1EBOA 3OR6C 4JYBA 2GSMB 4GX1A 5J9PC 4GX0A 1V54B 5CN0A 5FL7G 1QR9A 2EJRA 2Z5UA 1GM7A 4H33A 2GHYA 3K0DA 3SYCA 3K0GA 1QR8A 3E89A 3QO5A 4R50A 4YXWG 1ZWIC 2QTOA 1I5YA 3ZRWB 2D3OW 2HJFC 3ETDA 3ZN1A 4PA7A 3ASOB 1H38A 2QE7G 2QKSA 3OFNG 2IW5A 1S5HC 2B1GA 2F43G 1M90W 3CCQV 1AI6A 5B1AC 3LSQA 4R6ZA 1DF4A 3P30A 3OR7C 5LHGA 3UKMA 1R6NA 2XOKG 1S0VA 1B6QA 2WLLA 2IU3A 5EBLC 3LDEA 2WAMA 3D36A 2LP7A 4UV9A 2Z3YA 1JJ2U 4KFMA 1TUEB 2A0LA 4EKWA 1QCEA 1NQTA 4GX2A 4WFHA 1K7DA 5B3SC 4E2LA 3GB7C 2OTLV 2B1IA 1G4YB 4TT3G 2HR3A 5EBWC 4UUJC 1FXKC 1YTFB 1K5QA 4MS2A 4R8CA 4MVRA 2IJKA 1MABG 4JPRA 1GO3F 2AHZA 4N23A 2W0FC 3F7YC 5B1AB 4QIWF 1K34A 1K5SA 2Q67A 3CP1A 2QA4V 3AEIA 1PNKA 1KQSU 3QO7A 4WFAV 1SETA 4X89A 1QVGU 5LBQA 3FYIB 3CCVV 3ABUA 3ZRSA 3CC2V 4Z1MG 2ATKC 5B3SB 1J95A 2Y48A 1BL8A 1JX9A 3VBBA 5CBGA 2P67A 1YJ9V 1FS0G 3ABLC 5KUMA 1FXKB 2JIZG 3ABTA 2XAHA 5H9CA 5L3BA 5HFLA 5DM6V 1BHBA 2WLLB 1CPYA 3ZRVA 3AG2C 4U7OA 1MSWD 1OCRC 3IFXA 4R7CA 1OZ0A 2EBOA 3T1CA 5LGTA 4PA9A 4JYCA 3E83A 3B77A 2WWWA 3LDCA 4G28B 3ASNB 3G71V 1VQ6V 3CD6V 2QEXV 1XL4A 2DQ3A 2Q6AA 3LNMB 4UVBA 1OCZC 4BIUA 3ABLB 1VQKV 3AG4B 3X2QC 3W7XA 4PDVA 2ZR3A 4LCUC 4WFGA 2LFRA 1I5XA 1DTOA 3AG2B 5L3DA 1S77D 1V55B 3PJSK 1OCRB 3ABKB 1NR1A 3R65A 3K9AA 3JD2A 5EK0A 1Q7YW 3CYOA 3RBZA 3LUTB 1KC8W 2DYRC 4MTXA 3ZMSA 1FFTB 2Y69B 4P9PA 1K8AW 1IXMA 2IH1C 2CK3G 1GM8A 1OCZB 4L87A 1JVMA 3K3WA 3X2QB 3G6EV 3CMEV 2P7TC 3ZMZA 2EINC 3ZRXA 2M7WA 3FB7C 4XDLA 2BOCC 2DYSC 5CMUA 4WFBV 3EFFK 1YTFD 1OHHG 1YJWV 3LDDA 4RUEA 4HYOA 4PDLA 2HFEC 3CC4V 4J9ZB 4ASUG 3SJQC 1UJWB 1MOFA 3FB5C 4MTFA 3TCUA 3RVYA 1DLBA 1MG1A 1NVPB 4QPJA 1M57B 1KP3A 3ZN0A 1VQNV 2X0LA 2XAGA 2HG5C 1F23A 3ZIAG 2UXNA 2DYSB 3QNEA 4JTAB 1R3JC 1S72V 1K9MW 2DW4A 1VQ9V 1GM9A 1RM1C 1P4RA 2BOBC 2ZXWC 4FIPC 1GTOA 3AG3B 2X6AA 1FXKA 3K04A 1YI2V 5L3GA 2H94A 1PD3A 3K03A 4LP8A 5B1BC 1SZTA 5B1NA 4JASA 1QLEC 5CA3A 1OCOC 1W2BU 3E8GA 3ZJZA 2YSUB 1F4NA 4HAMA 2IU0A 4P2ZA 2H8PC 3E8FA 4FMTA 4TWKA 3M99B 4PA6A 2NLJC 1PNLA 3TETA 3EHBB 4I9WA 3CCRV 2KB1A 2X6BA 1QVFU 3OE7G 1AI7A 4BW5A 1SERA 2WLIB 2K1EA 1JQ0A 5B1BB 3OUSA 1QLEB 1OCOB 4Q20A 2MK3A 2IH3C 3OMNB 1SRYA 3TK1A 3CCMV 1YHQV 5B1OA 4F4LA 5CBHA 3OUFA 3I56V 1H8HG 3ABMC 4MW8A 1VQ7V 1JCHA 2A9HA 1K33A 3E86A 4QJFB 2OTJV 1KP2A 3JYCA 3FB6C 4UVCA 2DWEC 4MVOA 1S76D 2EILC 1NKDA 4OXSA 1EFRG 1PL0A 3E35A 2IJHA 2WSSG 2ZQMA 4I5SA 4KUMA 3B8NA 1ORQC 2OT5A 1NVPD 2PI4A 1Q86W 3LSSA 3G4SV 2IJIA 4MW3A 1XL6A 2V1DA 3SYPA 3ZMUA 1KD1W 1M56C 2P6JA 4P30A 4MSWC 5E1AC 1KKDA 2EIJC 5KUKA 1R6KA 4FPPA 4N21A 4UVAA 2XAFA 4BAYA 4G27B 4JTDB 5C93A 4DXWA 1VQ8V 5LGNA 3D3IA 1YITV 2R9RB 3SPJA 3DGEA 1K73W 1AROP 4PDMA 3JD4A 2JDIG 2EILB 3JD1A 4UXNA 3T2MA 3KG2A 4BIZA 2XAQA 4GX5A 4QE7A 2WLHA 4RQEA 3NXSA 4X88A 3ML0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG U;  3G71 V;  4WCE V;  1Q86 W;  3CCV V;  1K8A W;  3G4S V;  1JJ2 U;  1YJN V;  1W2B U;  3CPW U;  1M1K W;  1KD1 W;  2QEX V;  3CD6 V;  3CC2 V;  3CCE V;  1VQN V;  3CCM V;  1VQ4 V;  2D3O W;  1YHQ V;  1VQP V;  3G6E V;  3CME V;  1VQM V;  2OTL V;  3CCJ V;  3I56 V;  3CCS V;  1VQK V;  1YJ9 V;  4WFB V;  3CC7 V;  1VQ7 V;  1VQ8 V;  1YIT V;  1S72 V;  3CCR V;  1K9M W;  1VQ9 V;  5DM6 V;  3CMA V;  1VQ6 V;  2OTJ V;  1K73 W;  1YJW V;  1QVF U;  3I55 V;  1M90 W;  3CCQ V;  3CCL V;  1R73 A;  2QA4 V;  1VQO V;  3CCU V;  1NJI W;  3CC4 V;  1KQS U;  1YI2 V;  1VQ5 V;  1Q7Y W;  4WF9 V;  4WFA V;  3OW2 U;  1YIJ V;  1Q82 W;  3CXC U;  1VQL V;  1Q81 W;  1N8R W;  1KC8 W; 
#chains in the Genus database with same CATH topology
 2X7R B;  2HHH B;  2EIM C;  2P06 A;  4DR3 O;  1H2N A;  2DWD C;  5BY1 A;  3FKS G;  3ZMV A;  1WNS A;  1WP7 A;  3I55 V;  3K06 A;  1VQ5 V;  2UUB O;  1H2M A;  1Y4M A;  3STL C;  1EZV H;  4DV3 O;  3JAL B;  2V7Q G;  1MMM A;  3K59 A;  1YJN V;  1HNZ O;  1P7B A;  2JGU A;  3OD4 A;  4CS2 A;  4O4H A;  4DUZ O;  5LMN B;  5IJ9 A;  2ZE7 A;  4JI6 O;  1SZX A;  1XMQ O;  1ZX3 A;  4MT8 A;  2JK5 C;  2R9I A;  4MTG A;  4JZ2 A;  2E3C A;  5LHI A;  1FKA O;  3L9D A;  3SR2 C;  2ZIO A;  3BRC A;  1KEC A;  4OPA A;  4GYC B;  4YJ2 B;  4WFE A;  4TQD A;  1K92 A;  5H6R A;  3MAQ A;  4J10 A;  3WFV A;  1GKF A;  5KHI A;  5GTI Z;  3SPH A;  1R3I C;  3CXC U;  4ZBM A;  2JEX A;  1M1K W;  4UFZ A;  4CC6 A;  1AR4 A;  2RDC A;  4JI4 O;  2YEV B;  4GKK B;  4DR2 B;  1RPR A;  2WPD G;  1KYO F;  3UT5 B;  2JJ1 G;  2Q7G A;  3E22 B;  3GWK C;  2PI5 A;  4CH3 A;  1US6 A;  2QWP B;  1VQL V;  3WG7 C;  1IBL B;  1R6T A;  5LYJ B;  1TA8 A;  4LF6 O;  4DV0 B;  2OCC C;  1K4C C;  4O2A B;  3B09 A;  4J7J A;  1SS3 A;  4IHJ A;  1FFX A;  1YSC A;  1VQM V;  4PDR A;  1WA8 B;  1RSO B;  3GVM A;  4DR5 O;  1CP9 A;  5KLV H;  2P4V A;  2DOS A;  2KSD A;  4WBN A;  1IXB A;  1NBM G;  2C2A A;  4LF7 B;  2DJV A;  4XDJ A;  3WG7 B;  1VIB A;  3RYI A;  1F4M A;  2OCC B;  4EB6 B;  3OEE G;  2V4D A;  4OX9 O;  2NNU A;  4O4L A;  1ROP A;  3CCJ V;  3IGA C;  3JAS B;  2F23 A;  3SJB C;  1N34 B;  3UM7 A;  1UFI A;  1E1Q G;  3CJH A;  4DV4 O;  3TJT A;  1CEZ A;  3E8H A;  4JI8 B;  2BE3 A;  1VF5 B;  2OYQ A;  1JOY A;  1NTK H;  4DV2 O;  1M57 C;  4LF9 B;  5KHG A;  2PYJ A;  1VQP V;  3KZI Z;  3H1H H;  3FB8 C;  3CE2 A;  1BQZ A;  2ZCE A;  5K1X A;  1NH2 D;  1TGO A;  1JFF A;  1A32 A;  3AG3 C;  5KX5 A;  3CCL V;  3W7S A;  4JYB A;  3C90 A;  1SQG A;  4NTX A;  5FL7 G;  4NKG B;  2YIB A;  2PY5 A;  3SYC A;  4LWS B;  1QHT A;  1QR8 A;  4CC5 A;  1VEW A;  3JAT A;  3BHP A;  2ZKO A;  1TVK B;  1NT2 B;  1IZ3 A;  4I55 A;  1FPO A;  1S5H C;  2F43 G;  3CCQ V;  1DF4 A;  5LHG A;  1R6N A;  2F1M A;  4NXN B;  4TV8 A;  3LDE A;  2WAM A;  2LP7 A;  5JH7 B;  2QDO A;  1Y76 A;  1BS3 A;  1NQT A;  2UUC B;  2N74 A;  4E2L A;  2G38 A;  5IJ0 A;  2OTL V;  2B1I A;  4LFC B;  4DV6 B;  5EBW C;  3UO2 A;  4LF5 B;  1FXK C;  4MS2 A;  4X64 B;  1T5E A;  4JPR A;  1GO3 F;  2F66 C;  1O9G A;  2Y0P A;  1K5S A;  5IWA B;  2QA4 V;  1KQS U;  1P49 A;  4NXM B;  2LJ2 A;  3L72 H;  3G80 A;  4X89 A;  4U3J B;  3J80 N;  3HKE B;  4FVM A;  1YXB A;  3ZHT A;  3VBB A;  3OTF A;  1FS0 G;  4K35 A;  1FXK B;  2JIZ G;  3ABT A;  5HFL A;  4D7T A;  2GTS A;  2WLL B;  4DRX B;  3ZRV A;  1YVW A;  2PTM A;  2YS8 A;  1OCR C;  4R7C A;  1MSW D;  2YIC A;  2EBO A;  1HNX B;  3BFR A;  2P22 C;  5GON A;  5JQG B;  3B77 A;  1VQ6 V;  2DQ3 A;  3N2G A;  3AG4 B;  3X2Q C;  3W7X A;  4EFE A;  4JYA B;  2WA3 A;  4B7K A;  1BZK A;  2LFR A;  1AB3 A;  3PJS K;  2E75 B;  1OCR B;  3ABK B;  1ZAU A;  3JD2 A;  1Q3E A;  1Q7Y W;  2Q9L A;  1D5N A;  2DYR C;  2FML A;  3SJC C;  1L0N H;  1IXM A;  4J11 A;  4ZOL A;  1JVM A;  1BGY H;  4BWA A;  3X2Q B;  3ZMZ A;  1SQQ H;  3ZRX A;  1Q90 D;  4XDL A;  1YTF D;  1KU9 A;  1N32 O;  3RYH A;  3G67 A;  4PDL A;  4J9Z B;  2YIB D;  4ASU G;  1EN5 A;  1MOF A;  3FB5 C;  4MTF A;  1MG1 A;  2MW2 B;  4JI7 O;  1NVP B;  3CRR A;  3ZN0 A;  2X0L A;  2IM9 A;  4B3R B;  2UXD O;  4JTA B;  1Q5O A;  2DW4 A;  4H0L B;  1GTO A;  4TV9 B;  4JI4 B;  4X1I A;  3K04 A;  4ZI7 A;  1YI2 V;  4I4T A;  1XQ8 A;  5BR8 O;  4LFA O;  2UXB O;  1SZT A;  3T1H B;  3E8G A;  2YSU B;  2GDS A;  2H8P C;  1G1X B;  4LF6 B;  1WPB A;  1HR0 O;  2NLJ C;  3S3X A;  3CCR V;  4K8X A;  3FX7 A;  1GN3 A;  5LMU O;  4YJ3 B;  1QVF U;  3BVO A;  1AI7 A;  4A5U B;  3CS5 A;  2K1E A;  4O4H B;  1BCC H;  4UCT A;  4DR5 B;  3T1Y O;  1G6U A;  5IJ9 B;  1SKV A;  2YUA A;  3OMN B;  3CCM V;  2HJD A;  5CBH A;  3I56 V;  2BTQ A;  3ABM C;  3A2F A;  1VQ7 V;  4DR1 B;  5KMG A;  4LF8 B;  5E79 Z;  3JYC A;  4UVC A;  1XNR O;  4MVO A;  4FLY A;  1NKD A;  4OXS A;  1PL0 A;  4UCV A;  2OT5 A;  2PI4 A;  4LF4 O;  3G4S V;  2GUZ A;  4DV5 B;  1KD1 W;  3SYP A;  1XL6 A;  5J2U A;  2FYU H;  3B4S A;  4PI2 A;  5E1A C;  2EIJ C;  1QU7 A;  4BAY A;  5C8Y A;  3ZHU A;  4JTD B;  5C93 A;  4DV2 B;  5LGN A;  2R9R B;  1IBK B;  4D7S A;  1N36 B;  1K73 W;  1ARO P;  1O9H A;  4PDM A;  3JD1 A;  5H5N A;  2RMK B;  4QE7 A;  1Y74 A;  1SES A;  1WB7 A;  3OMI B;  5CB4 B;  2CUG A;  3DTU B;  3SPC A;  2EIJ B;  5EZY A;  3OT7 A;  4UB6 Z;  4JZG A;  4X62 O;  1Y6X A;  4LH6 A;  4RQF A;  1THZ A;  1TUB A;  4IHJ B;  3BPZ A;  2YI8 A;  2R70 A;  4IYH A;  4DYL A;  2QJ1 A;  1ZUQ A;  1WPX A;  3P3P A;  1QQC A;  3GWO A;  3BY6 A;  4U7N A;  3JAK A;  3ZHV A;  4MVQ A;  2AGA A;  1FJG O;  3FYE B;  2HP8 A;  4JAU A;  4GLX A;  4H37 A;  4FZ0 A;  3H1L H;  1COW G;  2ITC C;  1B3Q A;  4DV1 B;  1FXH A;  4P9O A;  4CS3 A;  3QG5 A;  3JCU Z;  4QNH B;  2UXC O;  3RW0 A;  4KP4 A;  1XHX A;  2XT9 A;  3CJH B;  4LNU A;  4XBF A;  4B3M B;  3HKC A;  4IYI A;  3C3T A;  1D2D A;  4F6E A;  1HDJ A;  2ZXW B;  2BCC H;  1RPO A;  2Q0A A;  2PYL A;  4FM2 A;  2UUA B;  3SPI A;  1S3J A;  1K3E A;  4X8A A;  1J5E B;  3A0R A;  1OCC C;  4B3T B;  4IGG A;  4X1Y B;  4JI2 B;  4CBC A;  1JFF B;  5CBF A;  1E79 G;  4H44 B;  1BE3 H;  2XAS A;  1FXV A;  5GW7 A;  4TSF G;  4FLU A;  5EC2 C;  4LBE C;  1OCC B;  2WA4 A;  3JAT B;  1IDS A;  4FJC C;  4PA3 A;  1WP8 A;  1FYJ A;  2W6J G;  2AXT Z;  4JI3 O;  4IIJ A;  1KKC A;  2RNB A;  1W59 A;  3MD0 A;  3ETQ A;  3WU2 Z;  4Z2W A;  4J7K A;  2QM7 A;  4DK1 A;  1PL4 A;  4TV8 B;  1XMO O;  1V55 C;  1Y76 B;  4JI0 O;  2KQX A;  4CZZ A;  5FLX N;  3SJA C;  2F95 B;  2WLM A;  1NR7 A;  4X9Q A;  5JJE B;  5IJ0 B;  2LO1 A;  5DED A;  3RYF B;  2CTP A;  1N32 B;  3VQY A;  3L73 H;  4PEL A;  4F6R A;  3WB1 A;  4EEQ A;  4JF3 A;  1ZL8 A;  5DEC A;  4PV1 B;  1P7G A;  1R3K C;  2XND G;  4J9Y B;  3E8B A;  5LA6 A;  3VQX A;  3F5W C;  1KBH A;  3LSU A;  3ZRW A;  2H3O A;  2A3Q A;  3MDS A;  4GCZ A;  1AR1 B;  2AHY A;  4I0X A;  1RFY A;  3P3N A;  3CRM A;  3OM3 B;  3N27 A;  4DO2 A;  4QE9 A;  4D6T H;  3CPW U;  1Y66 A;  2Q68 A;  5BR8 B;  2EIM B;  5JJN B;  1JR9 A;  3MHS C;  4YHH O;  2VQF O;  2DMX A;  5GON B;  2HLD G;  3BA8 A;  2XTA A;  2P5O A;  2HKO A;  1QLN A;  1MZE A;  2VQE O;  3OR6 C;  3N2G B;  3THO A;  2GSM B;  1PM9 A;  5J9P C;  2YI9 A;  4GX0 A;  1QR9 A;  4CS4 A;  5IYZ B;  1FAF A;  3K0D A;  2D3O W;  3JAW A;  1B06 A;  4GUN A;  3ZN1 A;  3HKB A;  2QE7 G;  2QKS A;  2IW5 A;  1XNQ O;  4X20 B;  1AI6 A;  4J7Z A;  3P30 A;  3OR7 C;  3UKM A;  1PP9 H;  2XOK G;  1IBM B;  1HW7 A;  5EBL C;  3D36 A;  4DR7 O;  4KFM A;  1TUE B;  3L75 H;  2A0L A;  2AZ2 A;  3UO3 A;  5B3S C;  2BSK A;  1YZB A;  4CH5 A;  1K5Q A;  1OV9 A;  4R8C A;  4MVR A;  2IJK A;  4N23 A;  1JA8 A;  3F7Y C;  2GTA A;  4TQF A;  1K34 A;  4C7U A;  1PNK A;  3QO7 A;  4WFA V;  1SET A;  3RYC B;  3CXH F;  1QVG U;  1SA0 A;  3IC9 A;  5B3S B;  1JJO A;  1JX9 A;  2GV9 A;  4FFB A;  3D3Q A;  2R72 A;  3ABL C;  2XAH A;  2YXH A;  2ZT9 B;  4ZHQ A;  1CPY A;  3AG2 C;  2N04 A;  4U7O A;  3K5O A;  3Q4H A;  3RT3 C;  5LGT A;  3BAB A;  1YF2 A;  3E83 A;  1DK1 A;  1HNW O;  5LL6 Y;  2QEX V;  2Q6A A;  3LNM B;  5D5P A;  4UVB A;  2XUM A;  1OCZ C;  1PV0 A;  3ABL B;  4PDV A;  4LCU C;  3WB2 A;  1Y67 A;  5FNV A;  2DN9 A;  1VF6 A;  3AG2 B;  1S77 D;  2FL4 A;  3A8T A;  1NR1 A;  5EK0 A;  5KAF Z;  4PJ0 Z;  3RBZ A;  3AK1 A;  1LUV A;  1KC8 W;  1FJG B;  2D2C B;  1AR5 A;  2CK3 G;  1OCZ B;  4L87 A;  3K3W A;  4O4J A;  3ZX6 A;  3G6E V;  4YY3 O;  4DR4 B;  2EIN C;  2M7W A;  2UXC B;  2Q7E A;  4JI5 O;  4X66 O;  3A0H Z;  4OPH A;  1GRJ A;  4KHP B;  1UJW B;  2ZM6 O;  3RVY A;  1DLB A;  4B3S O;  1WN7 A;  4X1K A;  1M57 B;  1KP3 A;  1S5J A;  4JV5 O;  5BMV A;  3K58 A;  1IVS A;  2M6Y A;  1S72 V;  1K9M W;  1VQ9 V;  1RM1 C;  1Y74 B;  3QVN A;  3AG3 B;  2RJZ A;  5L3G A;  3K03 A;  5B1B C;  2E76 B;  5EZY B;  1WJZ A;  5CA3 A;  1OCO C;  3ZJZ A;  2QTS A;  3ZBH A;  3K5L A;  1ZTE A;  1N33 O;  2ZIN A;  3M99 B;  4PA6 A;  3TET A;  3EHB B;  1TUB B;  4UCS A;  3OGI B;  4LH7 A;  2X6B A;  1MSD A;  2LGW A;  5LXT A;  1LUW A;  1I94 O;  1SER A;  5TIS Z;  1JQ0 A;  5B1B B;  4FLW A;  2ZE5 A;  3OUS A;  1OCO B;  3EVK A;  4TUY A;  1H2S B;  4DUY O;  4Q20 A;  3CSX A;  3H1I H;  2OIG A;  4X65 O;  1AVM A;  4F4L A;  2CH7 B;  1H8H G;  4BIO A;  1K33 A;  3APQ A;  3F5T A;  3U11 A;  2OTJ V;  3BAA A;  1KP2 A;  4HNA A;  4NB5 A;  2DWE C;  1S76 D;  4DR3 B;  2WSS G;  4I7Z B;  2ZQM A;  3H1J H;  4FZ1 A;  4LNU B;  1ORQ C;  4DV7 O;  1BSM A;  1Q86 W;  3LSS A;  2CAZ C;  5LP6 A;  5A2Q N;  2UUB B;  1KKD A;  4NR1 A;  4FPP A;  4N21 A;  4UVA A;  3RWR D;  4DV3 B;  1VQ8 V;  4DXW A;  5KHJ A;  2DE0 X;  1HNZ B;  3DGE A;  4Z1V A;  2NN4 A;  3JD4 A;  3HKD B;  4DUZ B;  1XRE A;  4K0K O;  3CEI A;  3NXS A;  4X88 A;  4JI6 B;  3ML0 A;  1XMQ B;  2O57 A;  4E4E A;  1XEQ A;  5IY5 C;  2E5L O;  2AW9 A;  5BZB A;  3CC7 V;  1JMK C;  4MTO A;  5DN6 G;  1R73 A;  1VQO V;  4IIJ B;  2Q5Z A;  3OW2 U;  2HVK C;  2QM4 A;  1YIJ V;  2DYR B;  1V54 C;  5JCO A;  1XNQ B;  3SDL A;  4LFB O;  5IY5 B;  3P32 A;  1EN6 A;  1BT8 A;  3JD3 A;  2PF4 E;  3B2E E;  3K08 A;  3KKY A;  4PHZ A;  3CCS V;  2N05 A;  4DR7 B;  4AQY O;  4OGQ B;  2YIA A;  5LOV A;  5IDJ A;  1L8D A;  1SQX H;  2HHH O;  4JYY A;  4W4K A;  4F6R B;  2YEV A;  1GMG A;  2ADP A;  2CTR A;  1Q6U A;  3MHH C;  1E1R G;  3UT5 A;  4JAV A;  3E22 A;  5LA6 B;  3ZHS A;  1IUR A;  3U0Z A;  2Q69 A;  2UXX A;  2A79 B;  4I0X B;  2YDE A;  4IT5 A;  5IE9 A;  2OCH A;  2XAJ A;  1RSO A;  3H01 A;  1Q82 W;  1M93 A;  2RQ6 A;  5LMN O;  1AP5 A;  5JJJ B;  4KXR A;  1L1F A;  5K1P A;  1GK9 A;  4EB6 A;  1HNW B;  1HWY A;  2ILM A;  4HZ3 A;  3K57 A;  3HPL C;  4FLZ A;  5HFM A;  1XBL A;  1NH2 B;  4GT1 A;  4OX9 B;  1K4D C;  2DQ0 A;  3D36 C;  3M8A A;  3JAS A;  1EZJ A;  1BMF G;  3JAW B;  5ITZ A;  1PNM A;  1IX9 A;  3ASN C;  4DV4 B;  5EBM C;  4FLV A;  3E2E A;  3ETG A;  3JCZ A;  3ABM B;  4FLX A;  4MVS A;  2FTK A;  2QSA A;  2HVJ C;  4FK5 C;  4MVU A;  4I9Q A;  4YY3 B;  3K5N A;  1AI5 A;  1OJH A;  2BSK B;  2QR4 A;  3K79 A;  3OEH G;  3K5M A;  2EZO A;  2Y69 C;  3B40 A;  4GKK O;  1H8E G;  1URF A;  3AG1 C;  4DR2 O;  1ENV A;  3OMA B;  1DF5 A;  4JGS A;  4NVP A;  1LNQ A;  1XHZ A;  3STZ C;  1IBL O;  2EIK C;  4JAA A;  4DV0 O;  5KA5 A;  4FM0 A;  2JEU A;  2CTW A;  4QPK A;  1SA0 B;  2KKW A;  1NJI W;  3NR7 A;  3AK3 A;  4H13 B;  3H9V A;  4FFB B;  1FFX B;  2ZDI A;  3AG1 B;  5JVD A;  4MVM A;  1M9N A;  4ZHQ B;  1VF6 C;  1AJP A;  5JH7 A;  3Q4H B;  1P84 F;  4WBN B;  4DW0 A;  2EIK B;  4BR6 A;  3ASO C;  3O9O A;  2KG7 A;  3RYI B;  1N33 B;  1RP3 B;  3J81 N;  4RO2 A;  2F4V O;  1EBO A;  1GN6 A;  5CN0 A;  4O4L B;  3BA9 A;  4DW1 A;  3CHX A;  3QTC A;  1GM7 A;  4H33 A;  1I94 B;  4PD4 F;  5FNV B;  3K0G A;  3E89 A;  4R50 A;  4YXW G;  1N34 O;  2JVD A;  5EYP A;  2YXY A;  3HKE A;  4O4I A;  4DUY B;  4PA7 A;  3ASO B;  1H38 A;  4X65 B;  3OFN G;  1EM1 A;  2B1G A;  1M90 W;  3U10 A;  5B1A C;  4DR6 O;  2Q0O C;  1L0L H;  1S0V A;  4B7E A;  1NTZ H;  2IU3 A;  2WLL A;  2Z3Y A;  1Z5V A;  5JQG A;  4GX2 A;  4WFH A;  1K7D A;  3GB7 C;  1G4Y B;  4TT3 G;  2HR3 A;  5KX5 B;  4UUJ C;  1YTF B;  1MAB G;  2W0F C;  5B1A B;  4X1K B;  1MZF A;  4QIW F;  4UB8 Z;  2Q67 A;  3CP1 A;  3JAR A;  1I7F A;  4K3A A;  4JI1 O;  1FD9 A;  4HBN A;  4GKJ O;  2ZIM A;  4I55 B;  3CC2 V;  2ATK C;  5A9G A;  1J95 A;  2Y48 A;  4K0K B;  3L71 H;  4AHC A;  5CBG A;  2P67 A;  5KUM A;  1U97 A;  5GTH Z;  2E5L B;  1BHB A;  2FKX A;  3DSQ A;  2ADQ B;  3IFX A;  2UUC O;  1OZ0 A;  3T1C A;  1SQF A;  2WWW A;  3LDC A;  3G71 V;  4LF5 O;  3CD6 V;  1M5I A;  3PN1 A;  4X64 O;  1U96 A;  2VWJ A;  2EUL A;  5D5Q A;  5LXT B;  4UCO A;  4JI7 B;  2ZR3 A;  4NXM O;  1VP7 A;  2BTO A;  1DTO A;  1V55 B;  2UXD B;  3R65 A;  3K9A A;  1S5L Z;  5LP6 C;  3CYO A;  3IAY A;  4TV9 A;  4MTX A;  3ZMS A;  4P9P A;  1K8A W;  1BQ0 A;  5EIB D;  1PPJ H;  4HNA B;  4LFA B;  2UXB B;  2P7T C;  1GN2 A;  4WFB V;  5CMU A;  1HNX O;  2L35 A;  4ICG A;  3TXS A;  2HFE C;  5LP6 B;  3SJQ C;  1HR0 B;  3TCU A;  4YIO A;  2Q4P A;  4YJ3 A;  1NI8 A;  5LMU B;  3L70 H;  4JYA O;  1VQN V;  4ZIB A;  3L74 H;  2HG5 C;  2PUS A;  4CH6 A;  1F23 A;  3A0B Z;  3ZIA G;  1ZSP A;  3T1Y B;  1H2L A;  3QNE A;  4J80 A;  3O65 A;  5FPR A;  2ZE8 A;  2AZ0 A;  3APO A;  5J2T A;  1GM9 A;  4FIP C;  4AIL C;  3UQ8 A;  5JCO C;  2X6A A;  4AI8 A;  2H94 A;  1PD3 A;  4ZOL B;  4LP8 A;  4JAS A;  5FPO A;  1QLE C;  1XNR B;  3DXR A;  1F4N A;  1WB8 A;  4HAM A;  2IU0 A;  4P2Z A;  1F7Y A;  3RYH B;  3E8F A;  1PNL A;  4LF4 B;  1YCI A;  2KB1 A;  3OE7 G;  3OTO O;  4B3R O;  4K8Z A;  1QLE B;  2LGQ A;  5LOV B;  1SRY A;  2NR5 A;  5B1O A;  1SF9 A;  3OUF A;  4MW8 A;  2ETN A;  1Q6I A;  5CB4 A;  2PZS A;  2A9H A;  3E86 A;  4X1I B;  4ZI7 B;  3RN4 A;  4I4T B;  4QJF B;  2UU9 O;  3M7M X;  4DK0 A;  3T1H O;  1N0N A;  2EIL C;  2QWN B;  1EFR G;  3E35 A;  2IJH A;  2JRI A;  4I5S A;  5H2F Z;  2XHB A;  4FM1 A;  5CA1 A;  1NVP D;  2EX3 A;  3CX5 F;  2QKC A;  5KHH A;  4X62 B;  2Q7H A;  4BW9 A;  1M56 C;  4MSW C;  2ODM A;  1R6K A;  1Q6H A;  1XUQ A;  4B08 A;  1D5A A;  2XAF A;  3D3I A;  3SPJ A;  1GAX A;  2JDI G;  2EIL B;  4UXN A;  2CE4 A;  2ZE6 A;  4BIZ A;  1I08 A;  1V9P A;  2XAQ A;  4GX5 A;  4RQE A;  5CA0 A;  4Q6G A;  2BTQ B;  1QBZ A;  1W0J G;  5L3C A;  4DR1 O;  1M56 B;  2F4V B;  4LF8 O;  5KMG B;  4I50 A;  4RUF A;  1SQV H;  2P90 A;  5EC1 C;  3N2K A;  3RVZ A;  1GH6 A;  5B5E Z;  2B5U A;  1WAZ A;  4UCU A;  2LFS A;  1KMI Z;  5ITZ B;  2X6C A;  2ZD9 A;  1MA1 A;  4DV5 O;  5IYC O;  3ZMT A;  2OWO A;  2WLN A;  2GUZ B;  5J2U B;  4PA4 A;  4WCE V;  1K97 A;  5C8Y B;  4DR6 B;  1IBK O;  4WFF A;  4JTC B;  2JS3 A;  3SYQ A;  1KB9 F;  1N36 O;  2WLI A;  1VQ4 V;  5BXZ A;  1BHA A;  3JSL A;  2EIN B;  3ZED A;  4MVZ A;  3QO8 A;  4X1Y A;  3IJ4 A;  2W6I G;  3FAV A;  4O2B A;  2CDY A;  2ZDI C;  4YIP A;  3BEH A;  3SYO A;  3D8C A;  2ZNJ A;  5LGU A;  4WF9 V;  1TAE A;  2Q73 A;  2QM8 A;  2JJ2 G;  3T4D A;  4JI1 B;  1NS1 A;  5EIB C;  2IJJ A;  2Y4T A;  4UV8 A;  4GKJ B;  2OIE A;  1W0K G;  1JPX A;  3G6B A;  3ZCC A;  2LQT A;  3VOU A;  3FFQ A;  1RM1 B;  4JI3 B;  3W7U A;  2CGN A;  2HEP A;  5JVD B;  2B9Z A;  4RAI A;  5L3E A;  4PI0 A;  3KCY A;  1XMO B;  4CH4 A;  3JAK B;  2QWQ B;  4JI0 B;  1YDX A;  3RFR A;  2JGD A;  4LC1 A;  1N0J A;  2KG7 B;  3RYF A;  2YC0 A;  2ITD C;  4DV1 O;  3SYA A;  2QGN A;  3W7W A;  3W7T A;  2EZP A;  1R3L C;  5EYP B;  1Q81 W;  1N8R W;  4B3M O;  3OGC C;  3JD0 A;  3ETE A;  3HKC B;  2PGG A;  4O4I B;  1SC5 B;  4W4L A;  1I0H A;  1LR1 A;  1AP6 A;  2UUA O;  1H2G A;  2QWR B;  3AG4 C;  2CGO A;  5IYB O;  3JAL A;  1XIL A;  5KA6 A;  1X59 A;  4KL1 A;  3OAA G;  3T4Z A;  3CRC A;  1J5E O;  4B3T O;  1KUQ A;  3ABK C;  1XI1 A;  2K9P A;  4YHH B;  2WLK A;  2VQF B;  4JI2 O;  5LHH A;  3AK2 A;  4XDK A;  3CCE V;  2VQE B;  1VF7 A;  1VMG A;  2ZR2 A;  3JAR B;  1NTM H;  5IYZ A;  3ZHQ A;  3QF7 A;  3SPG A;  5H6Q A;  3CMA V;  3WB0 A;  3ZS8 C;  2WLJ A;  3B8M A;  3S3W A;  5IYD O;  1Z5W A;  3CCU V;  4J42 A;  4UCR A;  4ZKI A;  1AI4 A;  4YJ2 A;  1WLE A;  4X20 A;  1AJN A;  1AJQ A;  3CRA A;  5KHK A;  4FFK A;  3HB3 B;  3IC7 A;  1PKX A;  3F7V C;  1F51 A;  5L3F A;  1G8M A;  2QKA A;  4G2K A;  4NYK A;  4GX1 A;  1V54 B;  1ZL8 B;  2EJR A;  2Z5U A;  3OTO B;  2YID A;  2GHY A;  1XOU A;  1DGS A;  3RYC A;  3QO5 A;  1ZWI C;  2QTO A;  1I5Y A;  3ZRW B;  3JSN A;  5LYJ A;  2HJF C;  3ETD A;  4RWU A;  4O2A A;  3C3S A;  2R9A A;  4QGP A;  2Q8V A;  3LSQ A;  4R6Z A;  1GN4 A;  1WA8 A;  2UU9 B;  1B6Q A;  4UV9 A;  1JJ2 U;  2GBO A;  2P4K A;  4EKW A;  1QCE A;  2A7W A;  3HR0 A;  2L6L A;  2AHZ A;  1AIL A;  4GZR B;  1Z2G A;  3AEI A;  2RCV A;  5F2V O;  3VQW A;  3DC6 A;  4TOI A;  3FYI B;  5LBQ A;  3KCX A;  3CCV V;  3ABU A;  3ZRS A;  3HKB B;  4Z1M G;  5J2T B;  1BL8 A;  2VRZ A;  3ICX A;  4J41 A;  1YJ9 V;  3SGI A;  5H9C A;  1IBM O;  5L3B A;  4IL6 Z;  5DM6 V;  3VQV A;  1YEW A;  3DXR B;  4PA9 A;  4JYC A;  4JI5 B;  4X66 B;  3CRQ A;  3DC5 A;  2RN9 A;  4G28 B;  3ASN B;  1HP8 A;  1XL4 A;  3LNN A;  1MNG A;  2ZM6 B;  1B04 A;  3K9S A;  4BIU A;  1VQK V;  4B3S B;  1N4C A;  4WFG A;  4LWS A;  1I5X A;  2Y4U A;  5L3D A;  4JV5 B;  3FD9 A;  3CB2 A;  1TVK A;  2LW1 A;  3TGU H;  2JS5 A;  3LUT B;  1FFT B;  2Y69 B;  2IH1 C;  3RGB A;  1GM8 A;  4NTY A;  3CME V;  3FB7 C;  2BOC C;  2DYS C;  4LF7 O;  3AG7 A;  3EFF K;  1OHH G;  1YJW V;  5CA1 B;  3LDD A;  1X4T A;  4RUE A;  4HYO A;  3CC4 V;  2Z0A A;  1Q8I A;  1VAR A;  3UCS C;  4QPJ A;  2ZNI A;  4ABM A;  2F93 B;  4EFB A;  2IBZ H;  2XAG A;  5IT9 N;  2QWO B;  2UXN A;  4U3J A;  2DYS B;  5KAI Z;  1XDC A;  1R3J C;  1Q43 A;  5CA0 B;  2EJ7 A;  2E74 B;  4JI8 O;  1P4R A;  2BOB C;  2CH7 A;  2ZXW C;  1FXK A;  2FB5 A;  4I50 B;  4LF9 O;  1NZ6 A;  2LW7 A;  1H2K A;  4O4J B;  3N2K B;  4DR4 O;  2VWK A;  5B1N A;  4DRX A;  1W2B U;  4KHP O;  4FMT A;  4TWK A;  5B66 Z;  1ZLZ A;  4DV7 B;  4I9W A;  2A06 H;  2W0X A;  4BW5 A;  2Y0I A;  2VS0 A;  2WLI B;  3ZHR A;  1NU1 H;  3JAM N;  5JWP A;  2YXL A;  3HKD A;  5BMV B;  3R66 A;  3CWB H;  2MK3 A;  2IH3 C;  1SQB H;  1M4U A;  3TK1 A;  3FAV B;  1YHQ V;  4O2B B;  3TXQ A;  2CTQ A;  1JCH A;  4U3F H;  4NXN O;  3FB6 C;  1QNM A;  1EN4 A;  1UPG A;  4NTW A;  4FLT A;  1CXZ B;  3EXA A;  4KUM A;  3BCC H;  4L8J A;  3J7A U;  3B8N A;  4LFC O;  4DV6 O;  2ARH A;  4LR3 A;  2IJI A;  4MW3 A;  2V1D A;  3ZMU A;  2P6J A;  4P30 A;  5KUK A;  5AG2 A;  1R1B A;  5IWA O;  1SQP H;  4G27 B;  1YIT V;  4LFB B;  3H1K H;  3T2M A;  3KG2 A;  4TUY B;  3I5D A;  2JGD B;  4AQY B;  2WLH A; 
#chains in the Genus database with same CATH homology
 1SES A;  1QBZ A;  1W0J G;  2X7R B;  3OMI B;  5L3C A;  1M56 B;  3DTU B;  3SPC A;  2EIJ B;  4RUF A;  5IY5 C;  2EIM C;  2P90 A;  5EC1 C;  3RVZ A;  5BZB A;  3CC7 V;  2DWD C;  3FKS G;  2B5U A;  3ZMV A;  2LFS A;  4MTO A;  2X6C A;  5DN6 G;  2ZD9 A;  3I55 V;  5IYC O;  1R73 A;  3ZMT A;  1VQO V;  2WLN A;  4RQF A;  1THZ A;  3K06 A;  1VQ5 V;  4PA4 A;  3OW2 U;  2HVK C;  1YIJ V;  1Y4M A;  2DYR B;  1V54 C;  3STL C;  4WCE V;  1K97 A;  2V7Q G;  1YJN V;  1P7B A;  4WFF A;  4JTC B;  1WPX A;  5IY5 B;  3SYQ A;  3P32 A;  1VQ4 V;  2WLI A;  3GWO A;  3JD3 A;  3BY6 A;  3CCS V;  3K08 A;  1BHA A;  2EIN B;  4U7N A;  4MVZ A;  3QO8 A;  4MVQ A;  2W6I G;  5IDJ A;  2ZDI C;  2JK5 C;  3FYE B;  4MT8 A;  3BEH A;  2R9I A;  4JAU A;  3SYO A;  2YEV A;  4H37 A;  4MTG A;  1GMG A;  1COW G;  2ITC C;  5LGU A;  4WF9 V;  3MHH C;  1FXH A;  4P9O A;  5LHI A;  1E1R G;  2QM8 A;  3T4D A;  2JJ2 G;  4JAV A;  4QNH B;  2Q69 A;  3RW0 A;  4KP4 A;  2UXX A;  2A79 B;  2IJJ A;  4UV8 A;  1KEC A;  4XBF A;  1W0K G;  1JPX A;  3ZCC A;  3VOU A;  1RM1 B;  2ZXW B;  3W7U A;  4WFE A;  1RPO A;  1K92 A;  2XAJ A;  5H6R A;  3WFV A;  1GKF A;  3SPI A;  4RAI A;  1S3J A;  1K3E A;  3H01 A;  5L3E A;  1Q82 W;  4X8A A;  3SPH A;  1R3I C;  3CXC U;  4ZBM A;  3A0R A;  2JEX A;  1OCC C;  1M1K W;  1L1F A;  4LC1 A;  1GK9 A;  4CBC A;  5CBF A;  1E79 G;  2ITD C;  1HWY A;  4HZ3 A;  3HPL C;  2YEV B;  5HFM A;  1RPR A;  2WPD G;  3SYA A;  1NH2 B;  4GT1 A;  1K4D C;  2DQ0 A;  3W7W A;  2XAS A;  2JJ1 G;  1FXV A;  5GW7 A;  3W7T A;  1EZJ A;  2EZP A;  1R3L C;  1BMF G;  4TSF G;  2PI5 A;  5EC2 C;  1VQL V;  4LBE C;  1OCC B;  3WG7 C;  1Q81 W;  1N8R W;  1PNM A;  3OGC C;  3JD0 A;  3ETE A;  4FJC C;  3ASN C;  4PA3 A;  2W6J G;  2OCC C;  1K4C C;  5EBM C;  3E2E A;  3ETG A;  3JCZ A;  1YSC A;  3MD0 A;  1VQM V;  1H2G A;  3ABM B;  4PDR A;  3AG4 C;  4MVS A;  5IYB O;  2FTK A;  5KA6 A;  2QM7 A;  2HVJ C;  3OAA G;  3T4Z A;  1CP9 A;  4FK5 C;  1V55 C;  4MVU A;  3ABK C;  1NBM G;  2C2A A;  2WLK A;  1AI5 A;  4XDJ A;  4CZZ A;  3WG7 B;  2WLM A;  1NR7 A;  5LHH A;  3K79 A;  1F4M A;  3OEH G;  2EZO A;  4XDK A;  2OCC B;  2Y69 C;  4PEL A;  1H8E G;  3AG1 C;  3OEE G;  3CCE V;  1ENV A;  4JF3 A;  3OMA B;  1DF5 A;  2NNU A;  2ZR2 A;  4JGS A;  1ROP A;  3CCJ V;  3IGA C;  1LNQ A;  1R3K C;  2XND G;  3SPG A;  4J9Y B;  3E8B A;  3STZ C;  3F5W C;  5H6Q A;  3CMA V;  3ZRW A;  2EIK C;  2WLJ A;  3UM7 A;  3B8M A;  5KA5 A;  1E1Q G;  2JEU A;  5IYD O;  4QPK A;  4GCZ A;  1AR1 B;  2AHY A;  1NJI W;  3CCU V;  1CEZ A;  3E8H A;  3OM3 B;  4ZKI A;  1AI4 A;  2ZDI A;  1JOY A;  1WLE A;  1AJN A;  4DO2 A;  1AJQ A;  3AG1 B;  4MVM A;  4QE9 A;  3CPW U;  1M57 C;  1Y66 A;  2Q68 A;  2EIM B;  1M9N A;  1VQP V;  1AJP A;  3HB3 B;  3MHS C;  3FB8 C;  3IC7 A;  2EIK B;  1PKX A;  2HLD G;  3F7V C;  1F51 A;  3ASO C;  5L3F A;  1NH2 D;  1G8M A;  2HKO A;  1QLN A;  3AG3 C;  3CCL V;  4G2K A;  3W7S A;  4RO2 A;  1EBO A;  3OR6 C;  4JYB A;  2GSM B;  4GX1 A;  5J9P C;  4GX0 A;  1V54 B;  5CN0 A;  5FL7 G;  1QR9 A;  2EJR A;  2Z5U A;  1GM7 A;  4H33 A;  2GHY A;  3K0D A;  3SYC A;  3K0G A;  1QR8 A;  3E89 A;  3QO5 A;  4R50 A;  4YXW G;  1ZWI C;  2QTO A;  1I5Y A;  3ZRW B;  2D3O W;  2HJF C;  3ETD A;  3ZN1 A;  4PA7 A;  3ASO B;  1H38 A;  2QE7 G;  2QKS A;  3OFN G;  2IW5 A;  1S5H C;  2B1G A;  2F43 G;  1M90 W;  3CCQ V;  1AI6 A;  5B1A C;  3LSQ A;  4R6Z A;  1DF4 A;  3P30 A;  3OR7 C;  5LHG A;  3UKM A;  1R6N A;  2XOK G;  1S0V A;  1B6Q A;  2WLL A;  2IU3 A;  5EBL C;  3LDE A;  2WAM A;  3D36 A;  2LP7 A;  4UV9 A;  2Z3Y A;  1JJ2 U;  4KFM A;  1TUE B;  2A0L A;  4EKW A;  1QCE A;  1NQT A;  4GX2 A;  4WFH A;  1K7D A;  5B3S C;  4E2L A;  3GB7 C;  2OTL V;  2B1I A;  1G4Y B;  4TT3 G;  2HR3 A;  5EBW C;  4UUJ C;  1FXK C;  1YTF B;  1K5Q A;  4MS2 A;  4R8C A;  4MVR A;  2IJK A;  1MAB G;  4JPR A;  1GO3 F;  2AHZ A;  4N23 A;  2W0F C;  3F7Y C;  5B1A B;  4QIW F;  1K34 A;  1K5S A;  2Q67 A;  3CP1 A;  2QA4 V;  3AEI A;  1PNK A;  1KQS U;  3QO7 A;  4WFA V;  1SET A;  4X89 A;  1QVG U;  5LBQ A;  3FYI B;  3CCV V;  3ABU A;  3ZRS A;  3CC2 V;  4Z1M G;  2ATK C;  5B3S B;  1J95 A;  2Y48 A;  1BL8 A;  1JX9 A;  3VBB A;  5CBG A;  2P67 A;  1YJ9 V;  1FS0 G;  3ABL C;  5KUM A;  1FXK B;  2JIZ G;  3ABT A;  2XAH A;  5H9C A;  5L3B A;  5HFL A;  5DM6 V;  1BHB A;  2WLL B;  1CPY A;  3ZRV A;  3AG2 C;  4U7O A;  1MSW D;  1OCR C;  3IFX A;  4R7C A;  1OZ0 A;  2EBO A;  3T1C A;  5LGT A;  4PA9 A;  4JYC A;  3E83 A;  3B77 A;  2WWW A;  3LDC A;  4G28 B;  3ASN B;  3G71 V;  1VQ6 V;  3CD6 V;  2QEX V;  1XL4 A;  2DQ3 A;  2Q6A A;  3LNM B;  4UVB A;  1OCZ C;  4BIU A;  3ABL B;  1VQK V;  3AG4 B;  3X2Q C;  3W7X A;  4PDV A;  2ZR3 A;  4LCU C;  4WFG A;  2LFR A;  1I5X A;  1DTO A;  3AG2 B;  5L3D A;  1S77 D;  1V55 B;  3PJS K;  1OCR B;  3ABK B;  1NR1 A;  3R65 A;  3K9A A;  3JD2 A;  5EK0 A;  1Q7Y W;  3CYO A;  3RBZ A;  3LUT B;  1KC8 W;  2DYR C;  4MTX A;  3ZMS A;  1FFT B;  2Y69 B;  4P9P A;  1K8A W;  1IXM A;  2IH1 C;  2CK3 G;  1GM8 A;  1OCZ B;  4L87 A;  1JVM A;  3K3W A;  3X2Q B;  3G6E V;  3CME V;  2P7T C;  3ZMZ A;  2EIN C;  3ZRX A;  2M7W A;  3FB7 C;  4XDL A;  2BOC C;  2DYS C;  5CMU A;  4WFB V;  3EFF K;  1YTF D;  1OHH G;  1YJW V;  3LDD A;  4RUE A;  4HYO A;  4PDL A;  2HFE C;  3CC4 V;  4J9Z B;  4ASU G;  3SJQ C;  1UJW B;  1MOF A;  3FB5 C;  4MTF A;  3TCU A;  3RVY A;  1DLB A;  1MG1 A;  1NVP B;  4QPJ A;  1M57 B;  1KP3 A;  3ZN0 A;  1VQN V;  2X0L A;  2XAG A;  2HG5 C;  1F23 A;  3ZIA G;  2UXN A;  2DYS B;  3QNE A;  4JTA B;  1R3J C;  1S72 V;  1K9M W;  2DW4 A;  1VQ9 V;  1GM9 A;  1RM1 C;  1P4R A;  2BOB C;  2ZXW C;  4FIP C;  1GTO A;  3AG3 B;  2X6A A;  1FXK A;  3K04 A;  1YI2 V;  5L3G A;  2H94 A;  1PD3 A;  3K03 A;  4LP8 A;  5B1B C;  1SZT A;  5B1N A;  4JAS A;  1QLE C;  5CA3 A;  1OCO C;  1W2B U;  3E8G A;  3ZJZ A;  2YSU B;  1F4N A;  4HAM A;  2IU0 A;  4P2Z A;  2H8P C;  3E8F A;  4FMT A;  4TWK A;  3M99 B;  4PA6 A;  2NLJ C;  1PNL A;  3TET A;  3EHB B;  4I9W A;  3CCR V;  2KB1 A;  2X6B A;  1QVF U;  3OE7 G;  1AI7 A;  4BW5 A;  1SER A;  2WLI B;  2K1E A;  1JQ0 A;  5B1B B;  3OUS A;  1QLE B;  1OCO B;  4Q20 A;  2MK3 A;  2IH3 C;  3OMN B;  1SRY A;  3TK1 A;  3CCM V;  1YHQ V;  5B1O A;  4F4L A;  5CBH A;  3OUF A;  3I56 V;  1H8H G;  3ABM C;  4MW8 A;  1VQ7 V;  1JCH A;  2A9H A;  1K33 A;  3E86 A;  4QJF B;  2OTJ V;  1KP2 A;  3JYC A;  3FB6 C;  4UVC A;  2DWE C;  4MVO A;  1S76 D;  2EIL C;  1NKD A;  4OXS A;  1EFR G;  1PL0 A;  3E35 A;  2IJH A;  2WSS G;  2ZQM A;  4I5S A;  4KUM A;  3B8N A;  1ORQ C;  2OT5 A;  1NVP D;  2PI4 A;  1Q86 W;  3LSS A;  3G4S V;  2IJI A;  4MW3 A;  1XL6 A;  2V1D A;  3SYP A;  3ZMU A;  1KD1 W;  1M56 C;  2P6J A;  4P30 A;  4MSW C;  5E1A C;  1KKD A;  2EIJ C;  5KUK A;  1R6K A;  4FPP A;  4N21 A;  4UVA A;  2XAF A;  4BAY A;  4G27 B;  4JTD B;  5C93 A;  4DXW A;  1VQ8 V;  5LGN A;  3D3I A;  1YIT V;  2R9R B;  3SPJ A;  3DGE A;  1K73 W;  1ARO P;  4PDM A;  3JD4 A;  2JDI G;  2EIL B;  3JD1 A;  4UXN A;  3T2M A;  3KG2 A;  4BIZ A;  2XAQ A;  4GX5 A;  4QE7 A;  2WLH A;  4RQE A;  3NXS A;  4X88 A;  3ML0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...