3I56V

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i56V00
1VQ7V 1N8RW 1S72V 1VQ4V 1Q82W 1QVFU 1YHQV 1W2BU 3CCJV 3CC2V 1VQ9V 2QEXV 3CMEV 1VQMV 1VQOV 1M90W 1R73A 1YJNV 1Q81W 1Q86W 3CC7V 3I56V 1K73W 1VQNV 1VQKV 1K9MW 1YITV 1YIJV 3I55V 3OW2U 1YJ9V 1M1KW 1VQLV 1JJ2U 3CPWU 3CCQV 3CCSV 1KD1W 3G71V 3CCLV 1YJWV 2OTLV 4WFAV 3CD6V 3G4SV 3CCMV 1YI2V 3CXCU 3G6EV 1KQSU 3CCEV 4WCEV 1VQ5V 2QA4V 1K8AW 1VQ8V 3CC4V 1NJIW 1VQPV 1VQ6V 2OTJV 5DM6V 4WFBV 4WF9V 3CCRV 1QVGU 1KC8W 3CMAV 3CCUV 1Q7YW 2D3OW 3CCVV
chains in the Genus database with same CATH superfamily
4QIWF 3UKMA 2DOSA 1URFA 1Q81W 3L9DA 1KBHA 5H5NA 3NXSA 3OT7A 3TGUH 1XNQB 4PA4A 1I0HA 3D36A 5B1BB 3SPIA 5BMVA 1US6A 4UUJC 4TQFA 3THOA 5DN6G 4WBNB 2P7TC 3H1HH 3T1HO 2V1DA 3SR2C 4J10A 3CMEV 4FLTA 5GONA 3A2FA 4PDLA 4FIPC 5LP6C 3L73H 4X65O 5B3SB 5ITZB 3A0HZ 3T1HB 3BA8A 2XAJA 1JOYA 2QA4V 2ZE6A 4JI5O 4PA3A 2YS8A 3FB5C 4DRXA 1QLNA 3OMIB 4U3JB 2HEPA 4X65B 3AK1A 2IM9A 2EBOA 2A7WA 4G27B 5B1NA 2E76B 5D5PA 4JI5B 5LYJA 4ABMA 4MTFA 4P9OA 1PM9A 1FYJA 1VQ8V 5IDJA 4LF9B 1S5HC 4TOIA 1Q7YW 1Z5WA 3N2GA 1BQZA 3B2EE 2UUAO 1H8HG 1NTZH 4B7EA 2OIEA 4F6RA 1K9MW 1TUBA 1PNKA 4TUYA 1M9NA 4UVCA 1IBKO 5B1AB 3ETEA 1GM7A 1PPJH 2Q0AA 2VRZA 4JZGA 3JAKA 4A5UB 4UVBA 3CC2V 1V55B 1M90W 1IBKB 1WNSA 3IGAC 4ZOLA 4U7NA 4RAIA 3CCQV 3B8NA 3BY6A 3CP1A 2Y48A 4CH6A 1FJGO 4NYKA 3UO3A 4KL1A 4FFBB 1AI6A 2H8PC 2Q7HA 1NTKH 3E89A 2EILB 1FJGB 5J2TA 1AB3A 3OUFA 4J7ZA 2KG7B 3H01A 4NB5A 2OCCC 3JARA 4JTDB 2PY5A 2Z3YA 2ATKC 4NTXA 3CD6V 1Y66A 4R6ZA 1Q90D 4Z2WA 2OTJV 3ZN0A 4DR1O 1JCHA 1VQ4V 2ZT9B 2IU0A 2EINC 2NLJC 2EIJC 1R1BA 1BMFG 3OTFA 2Q8VA 1ROPA 2DWEC 4LFCB 1KKDA 1N4CA 4FLVA 2IU3A 4DR6O 4LF7O 4E2LA 5E1AC 2ITDC 3ZMVA 1W0JG 2ETNA 1XHZA 5HFMA 1F4MA 5CA0B 3CMAV 3MAQA 1N36B 4LF7B 2Z0AA 1M57B 1IVSA 2UXCO 1RFYA 4NTYA 4Q6GA 1E1RG 1YJWV 3C90A 4IIJB 1WAZA 2HHHO 4FLZA 4KXRA 4DV4O 2XNDG 3JD4A 4DR2O 3D3QA 4GKKB 4CBCA 2W6JG 5IJ0A 1NR7A 3RYHA 4DV4B 4DR2B 2ZNJA 3APOA 2ADPA 2DYRC 2YC0A 2O57A 3TJTA 4WCEV 3K0GA 1FD9A 3WFVA 5IJ9B 2UXBB 3G67A 1AR5A 1ZL8A 4O2BA 4CH5A 1JR9A 1OCZB 1UFIA 5LBQA 4UFZA 1N33B 4K3AA 4K8XA 5EIBD 2XAQA 1VQNV 3QF7A 4DV0O 4LBEC 3RYIB 3AG4C 1AI4A 1KD1W 2QWNB 1XOUA 1XQ8A 2VWJA 5JH7B 4X88A 2GBOA 2HLDG 1BS3A 3HR0A 4DV0B 4JTAB 1N8RW 1W59A 4DV7O 2AHZA 3IC7A 4MT8A 4MVQA 4JI4O 2YI9A 4D7SA 2QDOA 2ARHA 4K8ZA 3VOUA 4DV7B 5IT9N 1FXKC 3OE7G 4JI4B 3CEIA 3K5OA 2A79B 5FNVB 5EC1C 4LR3A 3FYIB 1HR0O 2HVJC 1G1XB 5LP6A 1Y6XA 1BHAA 1THZA 1ZWIC 2QM4A 3A0BZ 1TVKB 5JVDA 2XT9A 4JPRA 1HR0B 5BXZA 4N23A 5L3EA 5LOVA 1RPOA 2F93B 1H2GA 5E79Z 1K8AW 3ZIAG 2BCCH 2ADQB 2DJVA 4J9ZB 4LF8B 4MW8A 2L6LA 1SQBH 3F5TA 2Q5ZA 2GSMB 3ZRVA 2Y0PA 4O4LB 4PDMA 3ZBHA 1SQGA 4MSWC 1FAFA 1SETA 1IXBA 1XMOB 1K5QA 1PL4A 4DR5O 2X6AA 3T1CA 3GB7C 3FX7A 1NT2B 1BT8A 3CJHA 5H6RA 2Q73A 5LHHA 1PKXA 3IFXA 5BZBA 2LGQA 4YJ2A 1KECA 4WF9V 1VIBA 4DR5B 3CCUV 2X0LA 2EIMB 4LF4B 1QVFU 4HBNA 2QKCA 3CRRA 4QPJA 1N34O 3K5NA 2JGUA 5H6QA 3K04A 2F1MA 4UCOA 1LUWA 4GX5A 5L3GA 3WG7B 2ZDIC 3IAYA 1DK1A 1GN2A 3QO7A 1CP9A 4MS2A 1GKFA 1X59A 1N32O 4R7CA 3I55V 3FAVB 2ZINA 1AR4A 2IJJA 4IL6Z 1WA8B 3SPJA 3JAWB 4YJ3B 2ZE7A 3JD3A 2Y4TA 5BY1A 3BRCA 1R3KC 4GYCB 2DWDC 5B1OA 4PD4F 1HNWO 2BOCC 4B3TO 1KB9F 3MD0A 4LFAO 1IDSA 1Q86W 3RWRD 5LXTB 1M1KW 3RYCB 4B3TB 2EULA 5EC2C 1VMGA 1J5EO 4LFAB 1GM8A 1WP7A 2WSSG 2WAMA 3WB1A 1GN4A 1MSWD 4LF5O 4UCUA 2YEVB 1YCIA 3C3SA 3U10A 5EZYA 1J5EB 3P30A 1YJNV 2P4KA 4CH4A 1OHHG 2WLLB 5DECA 4LNUB 5H2FZ 1UJWB 1QLEC 1G4YB 1EFRG 4JYAB 1IBLO 1I5YA 1B04A 2QWOB 2R9IA 4TV9A 3SYQA 3X2QB 1KYOF 3SYAA 4BAYA 5LHGA 4X62O 4HNAA 1VQOV 5J2UA 1SA0B 3JCUZ 3ABLB 2DQ0A 1K4DC 2ZR3A 3G6BA 4EKWA 5JQGA 5B3SC 4AQYB 2FL4A 4UV9A 3W7XA 4XDJA 4X62B 2ZE5A 4EEQA 1GK9A 2VQFB 2XAFA 3PN1A 2ZNIA 1H2NA 1PP9H 2JGDA 2VWKA 1PNLA 4TWKA 4O4JA 3RBZA 2PI4A 4ASUG 3H1LH 5EYPB 2QWQB 2CTQA 3RVYA 4EFBA 4DR7B 2GUZA 3SPGA 3EXAA 4NTWA 5LHIA 2CK3G 1P4RA 3ZHVA 4CH3A 4HZ3A 5K1PA 4FLYA 4MVSA 3R66A 4MVOA 1JPXA 4OX9O 4KFMA 1JFFB 4I0XA 1RM1B 1YDXA 1TA8A 3OEHG 5B1AC 3RGBA 1CEZA 3K59A 1GM9A 4CS3A 2CDYA 4MVRA 3K5LA 1ZAUA 1V55C 1Z2GA 3QTCA 2Z5UA 4BW5A 1W0KG 5CBHA 2V4DA 1S3JA 4QE7A 4UCRA 2NNUA 1HW7A 4JYBA 1B3QA 1FXKA 5KX5A 2ODMA 2OTLV 1I94B 1S77D 2F4VB 4B7KA 4AHCA 4J41A 3B8MA 3K3WA 3MDSA 5KHKA 1TUEB 4DR3O 2Q67A 5DM6V 1QCEA 2EILC 2N04A 1JMKC 3ASNB 4FVMA 1YXBA 3O65A 3KKYA 3H1KH 1QBZA 4DR3B 2R9RB 4I50A 4IHJB 2LO1A 2WLNA 4G28B 1IURA 2X6BA 2AGAA 4DV3O 3L72H 1Y74A 3SJBC 1F7YA 4LH7A 1E1QG 1QLEB 1OCOC 2QR4A 4N21A 3TK1A 3ETDA 4DV3B 2F66C 3HPLC 2B1IA 1R73A 5IYCO 3A0RA 5A2QN 3CSXA 1YIJV 1PD3A 2RJZA 3JASB 3UT5B 3KG2A 1FXHA 2LFSA 1EM1A 2EIKB 2PTMA 1VQPV 4ZI7B 4O4HB 4GCZA 4UVAA 2VS0A 2ILMA 1OCRB 4X20B 4O2AB 1M57C 2OIGA 4XBFA 4X1KA 1K73W 1QQCA 3DXRB 2YIBA 1Y76A 1MABG 2ZDIA 3H1IH 1N0NA 2LW7A 5CBFA 3RT3C 3W7WA 1E79G 4I55A 1P49A 1IBMO 3ABMB 4DR4O 1NI8A 4PA9A 1L8DA 4I9WA 3B4SA 3N2KA 4F6EA 3SDLA 1IBMB 4I7ZB 4NKGB 3HKBA 4DR4B 2DE0X 1ZSPA 4JI0O 3L75H 2UUAB 2M6YA 4JF3A 4UXNA 2DYSC 2BTQB 3K06A 3FKSG 3W7UA 4JI8O 1D5NA 4FK5C 1OJHA 2IJHA 2EX3A 3JSNA 3K5MA 1VQ7V 1SC5B 1OCZC 5BR8O 4ICGA 4TV8A 2W0FC 3JD2A 2E74B 4JI8B 2WLIB 3SPHA 1K33A 1ZX3A 4ZHQA 3WB0A 4K35A 5KAIZ 3DTUB 4IYHA 3OAAG 3ZHQA 3CXCU 5BR8B 3E8GA 4JI2O 4OGQB 3EFFK 3O9OA 2F43G 2Q4PA 3BABA 4DK0A 2Q7EA 1OV9A 4G2KA 1RPRA 4DV5O 2OCHA 3CCJV 4JI2B 4JAVA 3OFNG 4JGSA 1SZXA 1SQQH 3D3IA 4I4TB 4OPAA 1OCCC 2YXHA 3OR6C 2QWRB 5CB4B 1KU9A 2YI8A 4DV1O 4GT1A 4DV5B 2WLMA 4WBNA 4PDRA 1Q6IA 1OCOB 1Q5OA 2A9HA 4LCUC 2JIZG 2QM8A 1SESA 1XHXA 4DV1B 4WFHA 5ITZA 1NH2D 3CHXA 3ZX6A 3ASOB 4PA7A 4NR1A 4FLXA 3UM7A 3W7TA 4DR1B 2HG5C 4U3JA 1BHBA 4UCSA 1VQ5V 5C8YB 1F4NA 4KUMA 1D5AA 1P7BA 4JYYA 3CCRV 4KP4A 5KHHA 4LF6O 1KP2A 4DR6B 5IWAO 4L8JA 5IYDO 3G80A 4J80A 4DV6O 4RWUA 4W4KA 1SRYA 2ZM6O 1NVPD 2YXLA 4DV2O 3G4SV 1CPYA 5AG2A 4EB6B 2ZM6B 3ABTA 2UXCB 4FLUA 3ZS8C 1VF6C 2EIMC 3SJAC 4Z1VA 4DV2B 3LDCA 2PYJA 2HVKC 4D7TA 1AI5A 4FLWA 1YHQV 2HHHB 3E22B 4XDKA 1VP7A 1YVWA 3JAMN 4X66O 5LL6Y 2IH3C 1R6NA 4J9YB 3ICXA 1KUQA 4X66B 2IH1C 2DYSB 1R3LC 3JSLA 3WG7C 4LWSB 3OEEG 1M93A 3JALB 1AR1B 4JAAA 3JD1A 1NBMG 3HKEB 3E86A 1XILA 2AXTZ 2XASA 3UQ8A 4FFBA 5LGTA 3G71V 2UUBO 1IX9A 2UXNA 5J9PC 3H9VA 4LC1A 4FM0A 2YIAA 3AK3A 4QJFB 4JTCB 1HWYA 2KG7A 3HKDA 4O4IB 2UUBB 2P90A 4GZRB 4H44B 1MZEA 2PZSA 1RSOB 1K7DA 1GMGA 4U3FH 2BSKB 4IT5A 2K1EA 2ZE8A 1OCCB 4HYOA 1BE3H 2L35A 4AILC 2CTPA 2EJ7A 1UPGA 2JEUA 3CC4V 4FMTA 3K0DA 4WFGA 1I08A 5FL7G 1W2BU 1XL6A 5L3BA 1AJPA 2ZCEA 5IY5B 4J42A 4RO2A 3RN4A 2OYQA 4JAUA 1LNQA 5CA0A 2PF4E 2W6IG 1N0JA 3QG5A 2QM7A 3ZEDA 1AI7A 3C3TA 2AHYA 4DUZO 4R50A 2PI5A 1R3IC 5KHJA 1ENVA 3T1YO 3X2QC 4DO2A 4DW0A 1MMMA 4AI8A 1FPOA 4BR6A 2CTWA 2JDIG 3QO5A 4QPKA 2CH7B 3MHSC 3TXSA 2N74A 4IIJA 3DSQA 3ABLC 5LA6B 1SQXH 4DUZB 4TQDA 3T1YB 2ZQMA 3J81N 4JI7O 1L1FA 4J11A 1NS1A 3BEHA 4HAMA 1BSMA 1WB7A 3JATB 1HNZO 2JS5A 4JI7B 5D5QA 5EIBC 5CA1B 2Y69B 2NN4A 3ZHSA 2WWWA 3J7AU 1HNZB 1YF2A 3K08A 1YEWA 5IJ9A 4JI6O 4UB8Z 2WLJA 2D2CB 1XMQO 3EVKA 2QGNA 1Q8IA 4WFBV 1FFXB 2H3OA 1N34B 5IYBO 3P3NA 1Z5VA 1FS0G 1QNMA 5KMGB 4B3SO 3HKCB 4JI6B 3RYIA 3E8HA 2IJKA 1RM1C 1MA1A 4BIOA 5JH7A 4ZIBA 2E5LO 2ZIOA 1SQPH 3CS5A 3ZRWB 5IYZB 1ZUQA 5K1XA 1N32B 1NH2B 3KZIZ 5B66Z 2E5LB 3TXQA 1S72V 3STLC 1IXMA 2HKOA 4YXWG 1HNWB 4GKJO 1OZ0A 5FNVA 1QR9A 4B3MO 2Q6AA 3MHHC 4DYLA 1XNRO 1BL8A 2JK5C 1M4UA 2R9AA 4YHHO 4P2ZA 2B9ZA 2ZXWB 3ASNC 3I5DA 4X1IB 4MVZA 3R65A 2XAGA 4B3MB 3CCVV 4PDVA 1TVKA 1NKDA 1XNRB 3K9SA 1VEWA 2AZ2A 2YIDA 3RYFB 5KUMA 1Y67A 1EN4A 3OW2U 3ABKB 4LF5B 3VQXA 3OD4A 4O4LA 3N27A 1FFTB 1B6QA 2P6JA 1ORQC 2LQTA 2E3CA 2A06H 1IBLB 3Q4HB 1WLEA 3JD0A 1GRJA 4TT3G 3ZHUA 1GAXA 4WFAV 5IE9A 1XEQA 4MTXA 2EIKC 2ZKOA 2K9PA 1VF6A 2XTAA 1R6TA 4DUYO 5JJJB 1QVGU 1OCRC 1MNGA 4FM2A 5BMVB 4KHPO 5C93A 1DF4A 1M56B 3AG2B 1SKVA 1S76D 1XBLA 5GONB 4JI1O 3E8FA 4KHPB 2WA4A 3ML0A 4LFBO 1NJIW 2FKXA 4CC6A 1XREA 4NVPA 3ABMC 3OGCC 4JI1B 2JJ2G 4DRXB 1YTFD 3FAVA 1SZTA 4LFBB 1WA8A 4YJ3A 4GX0A 2FMLA 3QO8A 5LMUO 4YIOA 1QR8A 5LYJB 2CUGA 1JVMA 5CBGA 4F4LA 1F23A 4OX9B 3H1JH 1KP3A 5LXTA 1O9HA 3J80N 3DC6A 3RYCA 1H2SB 2MW2B 5LMNO 3N2GB 5GTHZ 1JA8A 1WPBA 1V54B 2UU9O 1AJQA 1MG1A 2OWOA 4F6RB 5LMNB 1TUBB 3CWBH 2YEVA 5H9CA 3BA9A 4MTGA 1GH6A 1Q43A 4TUYB 2OT5A 2E75B 2UU9B 2WLLA 4LNUA 2RN9A 1XL4A 2HJFC 1F51A 3JAKB 3K58A 3BAAA 4FFKA 4QGPA 1TGOA 1BCCH 4E4EA 5KA6A 4MW3A 4ZOLB 1K97A 2HP8A 4FJCC 1SA0A 2RQ6A 3LSQA 3CYOA 2C2AA 3E83A 1DTOA 1H2LA 2FB5A 2P5OA 4UCVA 4YY3O 4JV5O 3ASOC 3FB6C 2QTOA 3W7SA 1PL0A 5EBMC 5J2TB 1A32A 4CZZA 4PI2A 2Q9LA 3ABUA 4JV5B 4YY3B 4C7UA 1HDJA 3UCSC 4JYCA 2DN9A 3JARB 1TAEA 5A9GA 1L0NH 1JX9A 1YZBA 5EYPA 3CRAA 3AG3B 2QKAA 4CS4A 1D2DA 3AG1B 4ZBMA 1JJ2U 3P32A 2PUSA 1KQSU 4MVMA 1KKCA 3FYEB 4PHZA 5HFLA 1SS3A 1ZTEA 2H94A 1KC8W 2ZIMA 1JFFA 4GLXA 1Y4MA 5L3FA 1U96A 3L74H 2QEXV 5KAFZ 4X1YA 3UO2A 4MVUA 4LF9O 2A0LA 1GN3A 3OM3B 5JJEB 3CX5F 3M8AA 3CCMV 3ETGA 3NR7A 2BOBC 2WLKA 3JCZA 1VQ6V 1PV0A 2M7WA 5L3CA 1FXVA 2Y0IA 5LGUA 4JI0B 3M7MX 1GTOA 5IJ0B 5TISZ 3AG7A 3RYHB 4FPPA 4GX2A 1NQTA 3D8CA 2RNBA 3SPCA 1HNXO 1AVMA 3IJ4A 1Q6HA 3ZMZA 3CB2A 3OR7C 4YIPA 3BPZA 4RQEA 2LP7A 2XUMA 2LFRA 4UB6Z 1J95A 4IHJA 4LH6A 1HNXB 3AK2A 1Q3EA 3B09A 4JASA 1CXZB 1ZL8B 4P30A 4O2BB 3FB8C 2ZD9A 5JJNB 1P7GA 2B5UA 1SQVH 1AP6A 1AP5A 5JCOC 4CS2A 1SERA 3KCYA 1K92A 4J7KA 5KHIA 2QWPB 4I5SA 3JASA 1HP8A 3UT5A 3HKDB 2WLHA 1PNMA 5IY5C 2KB1A 4PV1B 4U7OA 4ZI7A 2KSDA 5F2VO 2CGOA 4O4HA 4BW9A 4FM1A 3S3XA 1RP3B 2GV9A 4X20A 1WB8A 2X6CA 4O2AA 4L87A 1YTFB 2EZPA 3ZN1A 4LFCO 4K0KO 1GN6A 5KA5A 1U97A 3DXRA 3FB7C 4RUFA 5LP6B 2F23A 2YSUB 3LSUA 4K0KB 2JJ1G 1N36O 3WB2A 1T5EA 3BCCH 3QNEA 4LF6B 1G8MA 2YXYA 5IWAB 4QNHB 2UXDO 5JVDB 4DV6B 5FPOA 1EN6A 3KCXA 5LOVB 1EBOA 1S5LZ 2FTKA 4XDLA 2KQXA 2Y69C 1H38A 2UXDB 2EZOA 5KHGA 4NXMO 3K9AA 1I5XA 4GKKO 2Q69A 2BTQA 4CC5A 1K4CC 3SJQC 2QTSA 5CMUA 2CAZC 4NXMB 2Q0OC 2G38A 1L0LH 1WPXA 2WA3A 1H2MA 3LUTB 4IGGA 4PA6A 3K57A 2GDSA 3CJHB 2RMKB 2CTRA 4UV8A 2D3OW 3ZHTA 2WLIA 4YJ2B 3S3WA 1QU7A 1S5JA 1R6KA 2HJDA 5L3DA 2UXBO 1NZ6A 1BQ0A 3SYPA 1SQFA 3B40A 4JZ2A 1N33O 3ZMUA 3L71H 3GVMA 1LR1A 3LNNA 3B77A 4I4TA 5CB4A 4H13B 4JI3O 3ZRSA 2KKWA 3T2MA 3CCSV 3CRMA 2YICA 3RFRA 3RVZA 3K79A 1I7FA 4JI3B 1V9PA 2ZXWC 4RQFA 3QVNA 2YIBD 2QKSA 2AZ0A 1BGYH 3ABKC 5C8YA 4W4LA 1VQLV 2OCCB 3BVOA 5CN0A 5KLVH 3E8BA 3F5WC 1NU1H 3TCUA 1GO3F 3LDDA 1XUQA 4X64O 1NTMH 4X9QA 5B5EZ 1Q82W 3AEIA 5CA3A 1VQMV 2EINB 2JS3A 2EIJB 4X64B 4EB6A 5EZYB 2V7QG 5LGNA 4LF8O 4P9PA 1H2KA 3IC9A 5GW7A 3G6EV 3E35A 2NR5A 2LW1A 2HR3A 3E22A 1XMOO 4QE9A 3D36C 2R72A 1COWG 4TV9B 2LGWA 2PGGA 2XAHA 1MZFA 2QJ1A 1M56C 1MSDA 1EZJA 3AG2C 1YITV 3CRCA 1M5IA 2P06A 1QHTA 3CPWU 4D6TH 4HNAB 4LF4O 5J2UB 3SYCA 4LWSA 2IJIA 5JQGB 2XHBA 4ZKIA 3JALA 2ITCC 1DF5A 4IYIA 1XI1A 3HKEA 3WU2Z 2UXXA 2FYUH 5GTIZ 3T4DA 3BHPA 1XMQB 5JWPA 4BWAA 1VQKV 2IW5A 2DYRB 2JGDB 2JEXA 4X8AA 2B1GA 4O4JB 2P4VA 4B3SB 3F7VC 4RUEA 4O4IA 1RSOA 2F95B 2GUZB 3GWKC 1SF9A 2BSKA 3M99B 1H8EG 4GX1A 3OUSA 4I9QA 5JCOA 1JJOA 3PJSK 1IZ3A 3OMAB 1V54C 3AG4B 1K34A 1AROP 1S0VA 2CE4A 4I0XB 2DW4A 4BIZA 1EZVH 2N05A 1FKAO 4Q20A 2YUAA 1Q6UA 2JRIA 4OPHA 3K03A 4GUNA 1K5SA 3ZJZA 4GKJB 1G6UA 2X7RB 1NVPB 1AJNA 1YSCA 2P22C 1NR1A 4YHHB 2UUCO 1O9GA 4PI0A 3HB3B 3VQWA 1XDCA 1FXKB 5KX5B 4NXNO 2CH7A 2JVDA 3ZRXA 5LA6A 2UUCB 1VF7A 4JYAO 1VQ9V 4WFFA 3EHBB 2DMXA 4NXNB 3CC7V 4DW1A 1WP8A 2HFEC 3CE2A 4J7JA 3ZHRA 3JATA 2CGNA 1YI2V 4I50B 5B1BC 3LSSA 4MTOA 2EJRA 5CA1A 3FD9A 3OGIB 1B06A 5DEDA 2VQEO 1Y74B 4AQYO 1VF5B 3VQYA 2IBZH 2QE7G 4B3RO 2WPDG 3VBBA 3FFQA 2VQFO 2PYLA 3AG3C 2RDCA 3AG1C 2VQEB 1R3JC 3BFRA 4B08A 4DUYB 2QSAA 4H0LB 4B3RB 3T4ZA 1FFXA 2W0XA 3SGIA 5KMGA 3HKCA 3LNMB 1DGSA 3P3PA 5FLXN 4FZ0A 4Z1MG 1KMIZ 4DR7O 2MK3A 1DLBA 3LDEA 2DQ3A 3OTOO 3DC5A 2Q7GA 3JAWA 4X89A 3STZC 3ETQA 1P84F 3ZRWA 4WFEA 5IYZA 1X4TA 4R8CA 2R70A 4X1KB 5EK0A 2XOKG 5KUKA 3ZMSA 3U11A 3OTOB 2Y4UA 2YDEA 2ZR2A 3U0ZA 1Y76B 2P67A 3OMNB 5LMUB 5EBLC 4I55B 1K3EA 3RW0A 4PELA 3ZMTA 3DGEA 4TSFG 3SJCC 4UCTA 3SYOA 3A8TA 1BZKA 4X1YB 3CCLV 4PJ0Z 2BE3A 2LJ2A 4H37A 3VQVA 3N2KB 4X1IA 5FPRA 1JQ0A 4LP8A 4EFEA 3CCEV 3HKBB 4FZ1A 5EBWC 2GTAA 2RCVA 2A3QA 4OXSA 3RYFA 1MOFA 1I94O 2F4VO 3ZCCA 1WN7A 2BTOA 3CRQA 3GWOA 3I56V 3F7YC 3CXHF 1EN5A 1YJ9V 1AILA 4TV8B 1WJZA 1VARA 3TETA 3L70H 2GTSA 4BIUA 4ZHQB 2AW9A 1LUVA 3APQA 4DXWA 4DK1A 3JYCA 2GHYA 3Q4HA 1XNQO 1ZLZA 2Q68A 4H33A 3E2EA
chains in the Genus database with same CATH topology
4QIWF 5FL7G 3UKMA 1W2BU 1XL6A 3P30A 1YJNV 1Q81W 2WLHA 1PNMA 5L3BA 1AJPA 1OHHG 3NXSA 5IY5C 2KB1A 5IY5B 2WLLB 4RO2A 4U7OA 4JAUA 4PA4A 1UJWB 1QLEC 1G4YB 1EFRG 1LNQA 3D36A 2W6IG 2QM7A 1I5YA 1AI7A 5B1BB 2X6CA 2R9IA 4L87A 3SPIA 2AHYA 3SYQA 4R50A 1YTFB 2PI5A 1R3IC 2EZPA 1ENVA 3ZN1A 4UUJC 3X2QC 4DO2A 5DN6G 3X2QB 3SYAA 4BAYA 2JDIG 5LHGA 2P7TC 3QO5A 4QPKA 3MHSC 5KA5A 2V1DA 3CMEV 1VQOV 3ABLC 3ABLB 4PDLA 3FB7C 2DQ0A 1K4DC 2ZR3A 4FIPC 4EKWA 4RUFA 5B3SC 2ZQMA 5B3SB 2YSUB 4UV9A 2JJ1G 1L1FA 3W7XA 4XDJA 3QNEA 1G8MA 2XAJA 3BEHA 1GK9A 4HAMA 4QNHB 2QA4V 1JOYA 4PA3A 3FB5C 1QLNA 3OMIB 2XAFA 2EBOA 1EBOA 2FTKA 4XDLA 2Y69C 1H38A 2Y69B 4G27B 2EZOA 5B1NA 3K9AA 1PNLA 4TWKA 2WWWA 1I5XA 3RBZA 4MTFA 2PI4A 4ASUG 2Q69A 1K4CC 3SJQC 4P9OA 3K08A 3RVYA 5CMUA 2WLJA 1VQ8V 5IDJA 1WPXA 3SPGA 3LUTB 5LHIA 1S5HC 4PA6A 2CK3G 4WFBV 1P4RA 1Q7YW 5IYBO 4HZ3A 4UV8A 2D3OW 2WLIA 1FS0G 4MVSA 1H8HG 4MVOA 1JPXA 4KFMA 1R6KA 3E8HA 1K9MW 2IJKA 1RM1C 5L3DA 1RM1B 3SYPA 1PNKA 1M9NA 3OEHG 4UVCA 5B1AC 3ZRWB 5B1AB 1CEZA 1GM9A 3ZMUA 3ETEA 1GM7A 1NH2B 3B77A 1S72V 4MVRA 4UVBA 3STLC 3CC2V 1V55C 4BW5A 5CBHA 1IXMA 2Z5UA 1V55B 1W0KG 1M90W 1S3JA 4QE7A 3IGAC 2NNUA 3ZRSA 2HKOA 4U7NA 4JYBA 1FXKA 4RAIA 3T2MA 3CCQV 3CCSV 4YXWG 3B8NA 2OTLV 1OZ0A 3BY6A 1QR9A 3CP1A 2Y48A 2Q6AA 1S77D 3MHHC 3B8MA 3RVZA 3K79A 3K3WA 1AI6A 1TUEB 1BL8A 2Q67A 2H8PC 2JK5C 5DM6V 2ZXWC 1QCEA 2EILC 2ZXWB 3ASNC 3E89A 2EILB 4P2ZA 4RQFA 3ASNB 3R65A 2XAGA 4MVZA 3CCVV 4PDVA 1NKDA 2QKSA 1QBZA 3OUFA 2R9RB 2WLNA 3H01A 4G28B 5KUMA 3ABKC 3OW2U 3ABKB 2X6BA 4WCEV 1VQLV 2OCCC 4JTDB 2OCCB 2Z3YA 2ATKC 3CD6V 5CN0A 1E1QG 1QLEB 1Y66A 4R6ZA 3E8BA 3F5WC 1OCOC 3TCUA 1GO3F 3LDDA 4N21A 3TK1A 2OTJV 3ETDA 3ZN0A 1FFTB 1B6QA 2P6JA 1JCHA 1VQ4V 1ORQC 1Q82W 2IU0A 3AEIA 2EINC 3HPLC 5CA3A 1VQMV 2EINB 2B1IA 2NLJC 1R73A 5IYCO 2EIJC 3A0RA 1WLEA 2EIJB 1BMFG 3JD0A 1YIJV 1PD3A 2V7QG 5LGNA 1ROPA 2DWEC 4P9PA 4TT3G 1KKDA 4WFAV 3KG2A 2IU3A 1FXHA 2LFSA 5GW7A 3G6EV 4MTXA 3E35A 2ITDC 5E1AC 4E2LA 2EIKC 3ZMVA 1W0JG 2EIKB 1VQPV 2HR3A 5HFMA 4QE9A 1F4MA 4GCZA 4UVAA 1QVGU 1OCRC 1COWG 3CMAV 1OCRB 1M57C 1M57B 2XAHA 4XBFA 5C93A 1M56C 1DF4A 1M56B 1K73W 1EZJA 3AG2C 1YITV 3AG2B 1E1RG 3CPWU 1YJWV 1S76D 3SYCA 1MABG 2ZDIA 3E8FA 2XNDG 3JD4A 2IJIA 5CBFA 3ML0A 3W7WA 1E79G 1NJIW 4ZKIA 2ITCC 4CBCA 3ABMC 3ABMB 1DF5A 2W6JG 3OGCC 2UXXA 2JJ2G 1YTFD 1NR7A 4PA9A 4I9WA 3T4DA 1SZTA 2DYRC 1VQKV 2IW5A 2DYRB 4GX0A 3QO8A 1QR8A 2JEXA 4X8AA 2B1GA 1JVMA 4UXNA 3F7VC 4JF3A 4RUEA 4F4LA 2DYSC 5CBGA 3K0GA 3K06A 3FKSG 1F23A 3W7UA 3WFVA 4FK5C 1KP3A 2IJHA 1VQ7V 1OCZC 1OCZB 3M99B 1H8EG 4GX1A 2W0FC 3JD2A 5LBQA 3OUSA 3PJSK 2XAQA 1VQNV 2WLIB 3SPHA 1K33A 3OMAB 4LBEC 1V54C 3AG4C 1AI4A 1V54B 3AG4B 1KD1W 1K34A 1AROP 1S0VA 1AJQA 1MG1A 3DTUB 3OAAG 3CXCU 4BIZA 2DW4A 3E8GA 2YEVA 4X88A 4Q20A 5H9CA 3EFFK 2HLDG 4MTGA 2F43G 3K03A 2OT5A 1K5SA 3ZJZA 4JTAB 4G2KA 1N8RW 1RPRA 2X7RB 1NVPB 2WLLA 3CCJV 2AHZA 1AJNA 3IC7A 4MT8A 4MVQA 1XL4A 1YSCA 4JAVA 2HJFC 3OFNG 1F51A 1NR1A 4JGSA 3D3IA 1OCCC 3OR6C 3VOUA 5KA6A 4GT1A 4MW3A 2WLMA 1FXKC 3HB3B 3OE7G 4PDRA 1FXKB 1K97A 1OCOB 3ZRXA 2A79B 4FJCC 5EC1C 2A9HA 3LSQA 4LCUC 2JIZG 2QM8A 3FYIB 3CYOA 2C2AA 2HVJC 1SESA 3E83A 1DTOA 1BHAA 4WFHA 1NH2D 4WFFA 1VQ9V 3EHBB 3ASOC 3FB6C 2QTOA 1THZA 3ASOB 1ZWIC 3CC7V 3W7SA 4PA7A 1PL0A 2HFEC 5EBMC 3UM7A 3W7TA 2HG5C 4JPRA 4N23A 5L3EA 1BHBA 1RPOA 4CZZA 1YI2V 3ABUA 3LSSA 4MTOA 5B1BC 1H2GA 2EJRA 1VQ5V 1K8AW 4JYCA 3ZIAG 1F4NA 4KUMA 1P7BA 3CCRV 4J9ZB 4MW8A 1JX9A 2QE7G 4KP4A 2WPDG 1KP2A 3VBBA 5IYDO 2GSMB 3ZRVA 4PDMA 4MSWC 3AG3C 1SRYA 1NVPD 3AG3B 3AG1C 1R3JC 1SETA 3AG1B 4ZBMA 1K5QA 1JJ2U 2X6AA 3T1CA 3GB7C 3P32A 3G4SV 1CPYA 3T4ZA 1KQSU 5H6RA 4MVMA 3FYEB 5LHHA 1PKXA 3IFXA 5BZBA 3ABTA 5HFLA 3LNMB 1KECA 4WF9V 2H94A 1KC8W 3CCUV 2EIMC 2X0LA 2EIMB 3LDCA 4Z1MG 2HVKC 1QVFU 1AI5A 1DLBA 1Y4MA 2MK3A 3LDEA 5L3FA 1YHQV 2QEXV 4XDKA 2DQ3A 4MVUA 2A0LA 4X89A 3STZC 2IH3C 1R6NA 3OM3B 3ZRWA 4QPJA 4WFEA 4R8CA 4J9YB 5H6QA 3K04A 3CCMV 3ETGA 5EK0A 2XOKG 2BOBC 5KUKA 3ZMSA 2WLKA 2IH1C 2DYSB 1R3LC 3JCZA 4GX5A 3WG7C 2ZR2A 5L3GA 1VQ6V 3WG7B 2ZDIC 2P67A 3OMNB 2M7WA 5L3CA 3OEEG 3QO7A 5EBLC 1CP9A 1FXVA 1K3EA 4MS2A 3RW0A 1GKFA 4PELA 5LGUA 3ZMTA 1AR1B 1GTOA 3JD1A 3DGEA 1NBMG 4TSFG 3E86A 2XASA 4R7CA 3I55V 3SYOA 4FPPA 4GX2A 5LGTA 2IJJA 1NQTA 3G71V 3CCLV 4H37A 3SPJA 3SPCA 3JD3A 1JQ0A 4LP8A 3CCEV 2UXNA 3ZMZA 5J9PC 1R3KC 3OR7C 4LC1A 5EBWC 2DWDC 4QJFB 4RQEA 5B1OA 4JTCB 1HWYA 4OXSA 2LP7A 2BOCC 1MOFA 2LFRA 1J95A 2P90A 3ZCCA 3MD0A 1K7DA 4JASA 1Q86W 1GMGA 3GWOA 3I56V 4P30A 3F7YC 1M1KW 3FB8C 1YJ9V 2K1EA 2ZD9A 1OCCB 2B5UA 4HYOA 3TETA 5EC2C 2JEUA 4BIUA 3CC4V 4FMTA 1SERA 1GM8A 1K92A 4DXWA 2WSSG 2WAMA 3JYCA 2GHYA 3K0DA 4WFGA 4I5SA 1MSWD 2Q68A 4H33A 3E2EA 2YEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 V;  1N8R W;  1S72 V;  1VQ4 V;  1Q82 W;  1QVF U;  1YHQ V;  1W2B U;  3CCJ V;  3CC2 V;  1VQ9 V;  2QEX V;  3CME V;  1VQM V;  1VQO V;  1M90 W;  1R73 A;  1YJN V;  1Q81 W;  1Q86 W;  3CC7 V;  3I56 V;  1K73 W;  1VQN V;  1VQK V;  1K9M W;  1YIT V;  1YIJ V;  3I55 V;  3OW2 U;  1YJ9 V;  1M1K W;  1VQL V;  1JJ2 U;  3CPW U;  3CCQ V;  3CCS V;  1KD1 W;  3G71 V;  3CCL V;  1YJW V;  2OTL V;  4WFA V;  3CD6 V;  3G4S V;  3CCM V;  1YI2 V;  3CXC U;  3G6E V;  1KQS U;  3CCE V;  4WCE V;  1VQ5 V;  2QA4 V;  1K8A W;  1VQ8 V;  3CC4 V;  1NJI W;  1VQP V;  1VQ6 V;  2OTJ V;  5DM6 V;  4WFB V;  4WF9 V;  3CCR V;  1QVG U;  1KC8 W;  3CMA V;  3CCU V;  1Q7Y W;  2D3O W;  3CCV V; 
#chains in the Genus database with same CATH topology
 4QIW F;  3UKM A;  2DOS A;  1URF A;  1Q81 W;  3L9D A;  1KBH A;  5H5N A;  3NXS A;  3OT7 A;  3TGU H;  1XNQ B;  4PA4 A;  1I0H A;  3D36 A;  5B1B B;  3SPI A;  5BMV A;  1US6 A;  4UUJ C;  4TQF A;  3THO A;  5DN6 G;  4WBN B;  2P7T C;  3H1H H;  3T1H O;  2V1D A;  3SR2 C;  4J10 A;  3CME V;  4FLT A;  5GON A;  3A2F A;  4PDL A;  4FIP C;  5LP6 C;  3L73 H;  4X65 O;  5B3S B;  5ITZ B;  3A0H Z;  3T1H B;  3BA8 A;  2XAJ A;  1JOY A;  2QA4 V;  2ZE6 A;  4JI5 O;  4PA3 A;  2YS8 A;  3FB5 C;  4DRX A;  1QLN A;  3OMI B;  4U3J B;  2HEP A;  4X65 B;  3AK1 A;  2IM9 A;  2EBO A;  2A7W A;  4G27 B;  5B1N A;  2E76 B;  5D5P A;  4JI5 B;  5LYJ A;  4ABM A;  4MTF A;  4P9O A;  1PM9 A;  1FYJ A;  1VQ8 V;  5IDJ A;  4LF9 B;  1S5H C;  4TOI A;  1Q7Y W;  1Z5W A;  3N2G A;  1BQZ A;  3B2E E;  2UUA O;  1H8H G;  1NTZ H;  4B7E A;  2OIE A;  4F6R A;  1K9M W;  1TUB A;  1PNK A;  4TUY A;  1M9N A;  4UVC A;  1IBK O;  5B1A B;  3ETE A;  1GM7 A;  1PPJ H;  2Q0A A;  2VRZ A;  4JZG A;  3JAK A;  4A5U B;  4UVB A;  3CC2 V;  1V55 B;  1M90 W;  1IBK B;  1WNS A;  3IGA C;  4ZOL A;  4U7N A;  4RAI A;  3CCQ V;  3B8N A;  3BY6 A;  3CP1 A;  2Y48 A;  4CH6 A;  1FJG O;  4NYK A;  3UO3 A;  4KL1 A;  4FFB B;  1AI6 A;  2H8P C;  2Q7H A;  1NTK H;  3E89 A;  2EIL B;  1FJG B;  5J2T A;  1AB3 A;  3OUF A;  4J7Z A;  2KG7 B;  3H01 A;  4NB5 A;  2OCC C;  3JAR A;  4JTD B;  2PY5 A;  2Z3Y A;  2ATK C;  4NTX A;  3CD6 V;  1Y66 A;  4R6Z A;  1Q90 D;  4Z2W A;  2OTJ V;  3ZN0 A;  4DR1 O;  1JCH A;  1VQ4 V;  2ZT9 B;  2IU0 A;  2EIN C;  2NLJ C;  2EIJ C;  1R1B A;  1BMF G;  3OTF A;  2Q8V A;  1ROP A;  2DWE C;  4LFC B;  1KKD A;  1N4C A;  4FLV A;  2IU3 A;  4DR6 O;  4LF7 O;  4E2L A;  5E1A C;  2ITD C;  3ZMV A;  1W0J G;  2ETN A;  1XHZ A;  5HFM A;  1F4M A;  5CA0 B;  3CMA V;  3MAQ A;  1N36 B;  4LF7 B;  2Z0A A;  1M57 B;  1IVS A;  2UXC O;  1RFY A;  4NTY A;  4Q6G A;  1E1R G;  1YJW V;  3C90 A;  4IIJ B;  1WAZ A;  2HHH O;  4FLZ A;  4KXR A;  4DV4 O;  2XND G;  3JD4 A;  4DR2 O;  3D3Q A;  4GKK B;  4CBC A;  2W6J G;  5IJ0 A;  1NR7 A;  3RYH A;  4DV4 B;  4DR2 B;  2ZNJ A;  3APO A;  2ADP A;  2DYR C;  2YC0 A;  2O57 A;  3TJT A;  4WCE V;  3K0G A;  1FD9 A;  3WFV A;  5IJ9 B;  2UXB B;  3G67 A;  1AR5 A;  1ZL8 A;  4O2B A;  4CH5 A;  1JR9 A;  1OCZ B;  1UFI A;  5LBQ A;  4UFZ A;  1N33 B;  4K3A A;  4K8X A;  5EIB D;  2XAQ A;  1VQN V;  3QF7 A;  4DV0 O;  4LBE C;  3RYI B;  3AG4 C;  1AI4 A;  1KD1 W;  2QWN B;  1XOU A;  1XQ8 A;  2VWJ A;  5JH7 B;  4X88 A;  2GBO A;  2HLD G;  1BS3 A;  3HR0 A;  4DV0 B;  4JTA B;  1N8R W;  1W59 A;  4DV7 O;  2AHZ A;  3IC7 A;  4MT8 A;  4MVQ A;  4JI4 O;  2YI9 A;  4D7S A;  2QDO A;  2ARH A;  4K8Z A;  3VOU A;  4DV7 B;  5IT9 N;  1FXK C;  3OE7 G;  4JI4 B;  3CEI A;  3K5O A;  2A79 B;  5FNV B;  5EC1 C;  4LR3 A;  3FYI B;  1HR0 O;  2HVJ C;  1G1X B;  5LP6 A;  1Y6X A;  1BHA A;  1THZ A;  1ZWI C;  2QM4 A;  3A0B Z;  1TVK B;  5JVD A;  2XT9 A;  4JPR A;  1HR0 B;  5BXZ A;  4N23 A;  5L3E A;  5LOV A;  1RPO A;  2F93 B;  1H2G A;  5E79 Z;  1K8A W;  3ZIA G;  2BCC H;  2ADQ B;  2DJV A;  4J9Z B;  4LF8 B;  4MW8 A;  2L6L A;  1SQB H;  3F5T A;  2Q5Z A;  2GSM B;  3ZRV A;  2Y0P A;  4O4L B;  4PDM A;  3ZBH A;  1SQG A;  4MSW C;  1FAF A;  1SET A;  1IXB A;  1XMO B;  1K5Q A;  1PL4 A;  4DR5 O;  2X6A A;  3T1C A;  3GB7 C;  3FX7 A;  1NT2 B;  1BT8 A;  3CJH A;  5H6R A;  2Q73 A;  5LHH A;  1PKX A;  3IFX A;  5BZB A;  2LGQ A;  4YJ2 A;  1KEC A;  4WF9 V;  1VIB A;  4DR5 B;  3CCU V;  2X0L A;  2EIM B;  4LF4 B;  1QVF U;  4HBN A;  2QKC A;  3CRR A;  4QPJ A;  1N34 O;  3K5N A;  2JGU A;  5H6Q A;  3K04 A;  2F1M A;  4UCO A;  1LUW A;  4GX5 A;  5L3G A;  3WG7 B;  2ZDI C;  3IAY A;  1DK1 A;  1GN2 A;  3QO7 A;  1CP9 A;  4MS2 A;  1GKF A;  1X59 A;  1N32 O;  4R7C A;  3I55 V;  3FAV B;  2ZIN A;  1AR4 A;  2IJJ A;  4IL6 Z;  1WA8 B;  3SPJ A;  3JAW B;  4YJ3 B;  2ZE7 A;  3JD3 A;  2Y4T A;  5BY1 A;  3BRC A;  1R3K C;  4GYC B;  2DWD C;  5B1O A;  4PD4 F;  1HNW O;  2BOC C;  4B3T O;  1KB9 F;  3MD0 A;  4LFA O;  1IDS A;  1Q86 W;  3RWR D;  5LXT B;  1M1K W;  3RYC B;  4B3T B;  2EUL A;  5EC2 C;  1VMG A;  1J5E O;  4LFA B;  1GM8 A;  1WP7 A;  2WSS G;  2WAM A;  3WB1 A;  1GN4 A;  1MSW D;  4LF5 O;  4UCU A;  2YEV B;  1YCI A;  3C3S A;  3U10 A;  5EZY A;  1J5E B;  3P30 A;  1YJN V;  2P4K A;  4CH4 A;  1OHH G;  2WLL B;  5DEC A;  4LNU B;  5H2F Z;  1UJW B;  1QLE C;  1G4Y B;  1EFR G;  4JYA B;  1IBL O;  1I5Y A;  1B04 A;  2QWO B;  2R9I A;  4TV9 A;  3SYQ A;  3X2Q B;  1KYO F;  3SYA A;  4BAY A;  5LHG A;  4X62 O;  4HNA A;  1VQO V;  5J2U A;  1SA0 B;  3JCU Z;  3ABL B;  2DQ0 A;  1K4D C;  2ZR3 A;  3G6B A;  4EKW A;  5JQG A;  5B3S C;  4AQY B;  2FL4 A;  4UV9 A;  3W7X A;  4XDJ A;  4X62 B;  2ZE5 A;  4EEQ A;  1GK9 A;  2VQF B;  2XAF A;  3PN1 A;  2ZNI A;  1H2N A;  1PP9 H;  2JGD A;  2VWK A;  1PNL A;  4TWK A;  4O4J A;  3RBZ A;  2PI4 A;  4ASU G;  3H1L H;  5EYP B;  2QWQ B;  2CTQ A;  3RVY A;  4EFB A;  4DR7 B;  2GUZ A;  3SPG A;  3EXA A;  4NTW A;  5LHI A;  2CK3 G;  1P4R A;  3ZHV A;  4CH3 A;  4HZ3 A;  5K1P A;  4FLY A;  4MVS A;  3R66 A;  4MVO A;  1JPX A;  4OX9 O;  4KFM A;  1JFF B;  4I0X A;  1RM1 B;  1YDX A;  1TA8 A;  3OEH G;  5B1A C;  3RGB A;  1CEZ A;  3K59 A;  1GM9 A;  4CS3 A;  2CDY A;  4MVR A;  3K5L A;  1ZAU A;  1V55 C;  1Z2G A;  3QTC A;  2Z5U A;  4BW5 A;  1W0K G;  5CBH A;  2V4D A;  1S3J A;  4QE7 A;  4UCR A;  2NNU A;  1HW7 A;  4JYB A;  1B3Q A;  1FXK A;  5KX5 A;  2ODM A;  2OTL V;  1I94 B;  1S77 D;  2F4V B;  4B7K A;  4AHC A;  4J41 A;  3B8M A;  3K3W A;  3MDS A;  5KHK A;  1TUE B;  4DR3 O;  2Q67 A;  5DM6 V;  1QCE A;  2EIL C;  2N04 A;  1JMK C;  3ASN B;  4FVM A;  1YXB A;  3O65 A;  3KKY A;  3H1K H;  1QBZ A;  4DR3 B;  2R9R B;  4I50 A;  4IHJ B;  2LO1 A;  2WLN A;  4G28 B;  1IUR A;  2X6B A;  2AGA A;  4DV3 O;  3L72 H;  1Y74 A;  3SJB C;  1F7Y A;  4LH7 A;  1E1Q G;  1QLE B;  1OCO C;  2QR4 A;  4N21 A;  3TK1 A;  3ETD A;  4DV3 B;  2F66 C;  3HPL C;  2B1I A;  1R73 A;  5IYC O;  3A0R A;  5A2Q N;  3CSX A;  1YIJ V;  1PD3 A;  2RJZ A;  3JAS B;  3UT5 B;  3KG2 A;  1FXH A;  2LFS A;  1EM1 A;  2EIK B;  2PTM A;  1VQP V;  4ZI7 B;  4O4H B;  4GCZ A;  4UVA A;  2VS0 A;  2ILM A;  1OCR B;  4X20 B;  4O2A B;  1M57 C;  2OIG A;  4XBF A;  4X1K A;  1K73 W;  1QQC A;  3DXR B;  2YIB A;  1Y76 A;  1MAB G;  2ZDI A;  3H1I H;  1N0N A;  2LW7 A;  5CBF A;  3RT3 C;  3W7W A;  1E79 G;  4I55 A;  1P49 A;  1IBM O;  3ABM B;  4DR4 O;  1NI8 A;  4PA9 A;  1L8D A;  4I9W A;  3B4S A;  3N2K A;  4F6E A;  3SDL A;  1IBM B;  4I7Z B;  4NKG B;  3HKB A;  4DR4 B;  2DE0 X;  1ZSP A;  4JI0 O;  3L75 H;  2UUA B;  2M6Y A;  4JF3 A;  4UXN A;  2DYS C;  2BTQ B;  3K06 A;  3FKS G;  3W7U A;  4JI8 O;  1D5N A;  4FK5 C;  1OJH A;  2IJH A;  2EX3 A;  3JSN A;  3K5M A;  1VQ7 V;  1SC5 B;  1OCZ C;  5BR8 O;  4ICG A;  4TV8 A;  2W0F C;  3JD2 A;  2E74 B;  4JI8 B;  2WLI B;  3SPH A;  1K33 A;  1ZX3 A;  4ZHQ A;  3WB0 A;  4K35 A;  5KAI Z;  3DTU B;  4IYH A;  3OAA G;  3ZHQ A;  3CXC U;  5BR8 B;  3E8G A;  4JI2 O;  4OGQ B;  3EFF K;  3O9O A;  2F43 G;  2Q4P A;  3BAB A;  4DK0 A;  2Q7E A;  1OV9 A;  4G2K A;  1RPR A;  4DV5 O;  2OCH A;  3CCJ V;  4JI2 B;  4JAV A;  3OFN G;  4JGS A;  1SZX A;  1SQQ H;  3D3I A;  4I4T B;  4OPA A;  1OCC C;  2YXH A;  3OR6 C;  2QWR B;  5CB4 B;  1KU9 A;  2YI8 A;  4DV1 O;  4GT1 A;  4DV5 B;  2WLM A;  4WBN A;  4PDR A;  1Q6I A;  1OCO B;  1Q5O A;  2A9H A;  4LCU C;  2JIZ G;  2QM8 A;  1SES A;  1XHX A;  4DV1 B;  4WFH A;  5ITZ A;  1NH2 D;  3CHX A;  3ZX6 A;  3ASO B;  4PA7 A;  4NR1 A;  4FLX A;  3UM7 A;  3W7T A;  4DR1 B;  2HG5 C;  4U3J A;  1BHB A;  4UCS A;  1VQ5 V;  5C8Y B;  1F4N A;  4KUM A;  1D5A A;  1P7B A;  4JYY A;  3CCR V;  4KP4 A;  5KHH A;  4LF6 O;  1KP2 A;  4DR6 B;  5IWA O;  4L8J A;  5IYD O;  3G80 A;  4J80 A;  4DV6 O;  4RWU A;  4W4K A;  1SRY A;  2ZM6 O;  1NVP D;  2YXL A;  4DV2 O;  3G4S V;  1CPY A;  5AG2 A;  4EB6 B;  2ZM6 B;  3ABT A;  2UXC B;  4FLU A;  3ZS8 C;  1VF6 C;  2EIM C;  3SJA C;  4Z1V A;  4DV2 B;  3LDC A;  2PYJ A;  2HVK C;  4D7T A;  1AI5 A;  4FLW A;  1YHQ V;  2HHH B;  3E22 B;  4XDK A;  1VP7 A;  1YVW A;  3JAM N;  4X66 O;  5LL6 Y;  2IH3 C;  1R6N A;  4J9Y B;  3ICX A;  1KUQ A;  4X66 B;  2IH1 C;  2DYS B;  1R3L C;  3JSL A;  3WG7 C;  4LWS B;  3OEE G;  1M93 A;  3JAL B;  1AR1 B;  4JAA A;  3JD1 A;  1NBM G;  3HKE B;  3E86 A;  1XIL A;  2AXT Z;  2XAS A;  3UQ8 A;  4FFB A;  5LGT A;  3G71 V;  2UUB O;  1IX9 A;  2UXN A;  5J9P C;  3H9V A;  4LC1 A;  4FM0 A;  2YIA A;  3AK3 A;  4QJF B;  4JTC B;  1HWY A;  2KG7 A;  3HKD A;  4O4I B;  2UUB B;  2P90 A;  4GZR B;  4H44 B;  1MZE A;  2PZS A;  1RSO B;  1K7D A;  1GMG A;  4U3F H;  2BSK B;  4IT5 A;  2K1E A;  2ZE8 A;  1OCC B;  4HYO A;  1BE3 H;  2L35 A;  4AIL C;  2CTP A;  2EJ7 A;  1UPG A;  2JEU A;  3CC4 V;  4FMT A;  3K0D A;  4WFG A;  1I08 A;  5FL7 G;  1W2B U;  1XL6 A;  5L3B A;  1AJP A;  2ZCE A;  5IY5 B;  4J42 A;  4RO2 A;  3RN4 A;  2OYQ A;  4JAU A;  1LNQ A;  5CA0 A;  2PF4 E;  2W6I G;  1N0J A;  3QG5 A;  2QM7 A;  3ZED A;  1AI7 A;  3C3T A;  2AHY A;  4DUZ O;  4R50 A;  2PI5 A;  1R3I C;  5KHJ A;  1ENV A;  3T1Y O;  3X2Q C;  4DO2 A;  4DW0 A;  1MMM A;  4AI8 A;  1FPO A;  4BR6 A;  2CTW A;  2JDI G;  3QO5 A;  4QPK A;  2CH7 B;  3MHS C;  3TXS A;  2N74 A;  4IIJ A;  3DSQ A;  3ABL C;  5LA6 B;  1SQX H;  4DUZ B;  4TQD A;  3T1Y B;  2ZQM A;  3J81 N;  4JI7 O;  1L1F A;  4J11 A;  1NS1 A;  3BEH A;  4HAM A;  1BSM A;  1WB7 A;  3JAT B;  1HNZ O;  2JS5 A;  4JI7 B;  5D5Q A;  5EIB C;  5CA1 B;  2Y69 B;  2NN4 A;  3ZHS A;  2WWW A;  3J7A U;  1HNZ B;  1YF2 A;  3K08 A;  1YEW A;  5IJ9 A;  4JI6 O;  4UB8 Z;  2WLJ A;  2D2C B;  1XMQ O;  3EVK A;  2QGN A;  1Q8I A;  4WFB V;  1FFX B;  2H3O A;  1N34 B;  5IYB O;  3P3N A;  1Z5V A;  1FS0 G;  1QNM A;  5KMG B;  4B3S O;  3HKC B;  4JI6 B;  3RYI A;  3E8H A;  2IJK A;  1RM1 C;  1MA1 A;  4BIO A;  5JH7 A;  4ZIB A;  2E5L O;  2ZIO A;  1SQP H;  3CS5 A;  3ZRW B;  5IYZ B;  1ZUQ A;  5K1X A;  1N32 B;  1NH2 B;  3KZI Z;  5B66 Z;  2E5L B;  3TXQ A;  1S72 V;  3STL C;  1IXM A;  2HKO A;  4YXW G;  1HNW B;  4GKJ O;  1OZ0 A;  5FNV A;  1QR9 A;  4B3M O;  2Q6A A;  3MHH C;  4DYL A;  1XNR O;  1BL8 A;  2JK5 C;  1M4U A;  2R9A A;  4YHH O;  4P2Z A;  2B9Z A;  2ZXW B;  3ASN C;  3I5D A;  4X1I B;  4MVZ A;  3R65 A;  2XAG A;  4B3M B;  3CCV V;  4PDV A;  1TVK A;  1NKD A;  1XNR B;  3K9S A;  1VEW A;  2AZ2 A;  2YID A;  3RYF B;  5KUM A;  1Y67 A;  1EN4 A;  3OW2 U;  3ABK B;  4LF5 B;  3VQX A;  3OD4 A;  4O4L A;  3N27 A;  1FFT B;  1B6Q A;  2P6J A;  1ORQ C;  2LQT A;  2E3C A;  2A06 H;  1IBL B;  3Q4H B;  1WLE A;  3JD0 A;  1GRJ A;  4TT3 G;  3ZHU A;  1GAX A;  4WFA V;  5IE9 A;  1XEQ A;  4MTX A;  2EIK C;  2ZKO A;  2K9P A;  1VF6 A;  2XTA A;  1R6T A;  4DUY O;  5JJJ B;  1QVG U;  1OCR C;  1MNG A;  4FM2 A;  5BMV B;  4KHP O;  5C93 A;  1DF4 A;  1M56 B;  3AG2 B;  1SKV A;  1S76 D;  1XBL A;  5GON B;  4JI1 O;  3E8F A;  4KHP B;  2WA4 A;  3ML0 A;  4LFB O;  1NJI W;  2FKX A;  4CC6 A;  1XRE A;  4NVP A;  3ABM C;  3OGC C;  4JI1 B;  2JJ2 G;  4DRX B;  1YTF D;  3FAV A;  1SZT A;  4LFB B;  1WA8 A;  4YJ3 A;  4GX0 A;  2FML A;  3QO8 A;  5LMU O;  4YIO A;  1QR8 A;  5LYJ B;  2CUG A;  1JVM A;  5CBG A;  4F4L A;  1F23 A;  4OX9 B;  3H1J H;  1KP3 A;  5LXT A;  1O9H A;  3J80 N;  3DC6 A;  3RYC A;  1H2S B;  2MW2 B;  5LMN O;  3N2G B;  5GTH Z;  1JA8 A;  1WPB A;  1V54 B;  2UU9 O;  1AJQ A;  1MG1 A;  2OWO A;  4F6R B;  5LMN B;  1TUB B;  3CWB H;  2YEV A;  5H9C A;  3BA9 A;  4MTG A;  1GH6 A;  1Q43 A;  4TUY B;  2OT5 A;  2E75 B;  2UU9 B;  2WLL A;  4LNU A;  2RN9 A;  1XL4 A;  2HJF C;  1F51 A;  3JAK B;  3K58 A;  3BAA A;  4FFK A;  4QGP A;  1TGO A;  1BCC H;  4E4E A;  5KA6 A;  4MW3 A;  4ZOL B;  1K97 A;  2HP8 A;  4FJC C;  1SA0 A;  2RQ6 A;  3LSQ A;  3CYO A;  2C2A A;  3E83 A;  1DTO A;  1H2L A;  2FB5 A;  2P5O A;  4UCV A;  4YY3 O;  4JV5 O;  3ASO C;  3FB6 C;  2QTO A;  3W7S A;  1PL0 A;  5EBM C;  5J2T B;  1A32 A;  4CZZ A;  4PI2 A;  2Q9L A;  3ABU A;  4JV5 B;  4YY3 B;  4C7U A;  1HDJ A;  3UCS C;  4JYC A;  2DN9 A;  3JAR B;  1TAE A;  5A9G A;  1L0N H;  1JX9 A;  1YZB A;  5EYP A;  3CRA A;  3AG3 B;  2QKA A;  4CS4 A;  1D2D A;  3AG1 B;  4ZBM A;  1JJ2 U;  3P32 A;  2PUS A;  1KQS U;  4MVM A;  1KKC A;  3FYE B;  4PHZ A;  5HFL A;  1SS3 A;  1ZTE A;  2H94 A;  1KC8 W;  2ZIM A;  1JFF A;  4GLX A;  1Y4M A;  5L3F A;  1U96 A;  3L74 H;  2QEX V;  5KAF Z;  4X1Y A;  3UO2 A;  4MVU A;  4LF9 O;  2A0L A;  1GN3 A;  3OM3 B;  5JJE B;  3CX5 F;  3M8A A;  3CCM V;  3ETG A;  3NR7 A;  2BOB C;  2WLK A;  3JCZ A;  1VQ6 V;  1PV0 A;  2M7W A;  5L3C A;  1FXV A;  2Y0I A;  5LGU A;  4JI0 B;  3M7M X;  1GTO A;  5IJ0 B;  5TIS Z;  3AG7 A;  3RYH B;  4FPP A;  4GX2 A;  1NQT A;  3D8C A;  2RNB A;  3SPC A;  1HNX O;  1AVM A;  3IJ4 A;  1Q6H A;  3ZMZ A;  3CB2 A;  3OR7 C;  4YIP A;  3BPZ A;  4RQE A;  2LP7 A;  2XUM A;  2LFR A;  4UB6 Z;  1J95 A;  4IHJ A;  4LH6 A;  1HNX B;  3AK2 A;  1Q3E A;  3B09 A;  4JAS A;  1CXZ B;  1ZL8 B;  4P30 A;  4O2B B;  3FB8 C;  2ZD9 A;  5JJN B;  1P7G A;  2B5U A;  1SQV H;  1AP6 A;  1AP5 A;  5JCO C;  4CS2 A;  1SER A;  3KCY A;  1K92 A;  4J7K A;  5KHI A;  2QWP B;  4I5S A;  3JAS A;  1HP8 A;  3UT5 A;  3HKD B;  2WLH A;  1PNM A;  5IY5 C;  2KB1 A;  4PV1 B;  4U7O A;  4ZI7 A;  2KSD A;  5F2V O;  2CGO A;  4O4H A;  4BW9 A;  4FM1 A;  3S3X A;  1RP3 B;  2GV9 A;  4X20 A;  1WB8 A;  2X6C A;  4O2A A;  4L87 A;  1YTF B;  2EZP A;  3ZN1 A;  4LFC O;  4K0K O;  1GN6 A;  5KA5 A;  1U97 A;  3DXR A;  3FB7 C;  4RUF A;  5LP6 B;  2F23 A;  2YSU B;  3LSU A;  4K0K B;  2JJ1 G;  1N36 O;  3WB2 A;  1T5E A;  3BCC H;  3QNE A;  4LF6 B;  1G8M A;  2YXY A;  5IWA B;  4QNH B;  2UXD O;  5JVD B;  4DV6 B;  5FPO A;  1EN6 A;  3KCX A;  5LOV B;  1EBO A;  1S5L Z;  2FTK A;  4XDL A;  2KQX A;  2Y69 C;  1H38 A;  2UXD B;  2EZO A;  5KHG A;  4NXM O;  3K9A A;  1I5X A;  4GKK O;  2Q69 A;  2BTQ A;  4CC5 A;  1K4C C;  3SJQ C;  2QTS A;  5CMU A;  2CAZ C;  4NXM B;  2Q0O C;  2G38 A;  1L0L H;  1WPX A;  2WA3 A;  1H2M A;  3LUT B;  4IGG A;  4PA6 A;  3K57 A;  2GDS A;  3CJH B;  2RMK B;  2CTR A;  4UV8 A;  2D3O W;  3ZHT A;  2WLI A;  4YJ2 B;  3S3W A;  1QU7 A;  1S5J A;  1R6K A;  2HJD A;  5L3D A;  2UXB O;  1NZ6 A;  1BQ0 A;  3SYP A;  1SQF A;  3B40 A;  4JZ2 A;  1N33 O;  3ZMU A;  3L71 H;  3GVM A;  1LR1 A;  3LNN A;  3B77 A;  4I4T A;  5CB4 A;  4H13 B;  4JI3 O;  3ZRS A;  2KKW A;  3T2M A;  3CCS V;  3CRM A;  2YIC A;  3RFR A;  3RVZ A;  3K79 A;  1I7F A;  4JI3 B;  1V9P A;  2ZXW C;  4RQF A;  3QVN A;  2YIB D;  2QKS A;  2AZ0 A;  1BGY H;  3ABK C;  5C8Y A;  4W4L A;  1VQL V;  2OCC B;  3BVO A;  5CN0 A;  5KLV H;  3E8B A;  3F5W C;  1NU1 H;  3TCU A;  1GO3 F;  3LDD A;  1XUQ A;  4X64 O;  1NTM H;  4X9Q A;  5B5E Z;  1Q82 W;  3AEI A;  5CA3 A;  1VQM V;  2EIN B;  2JS3 A;  2EIJ B;  4X64 B;  4EB6 A;  5EZY B;  2V7Q G;  5LGN A;  4LF8 O;  4P9P A;  1H2K A;  3IC9 A;  5GW7 A;  3G6E V;  3E35 A;  2NR5 A;  2LW1 A;  2HR3 A;  3E22 A;  1XMO O;  4QE9 A;  3D36 C;  2R72 A;  1COW G;  4TV9 B;  2LGW A;  2PGG A;  2XAH A;  1MZF A;  2QJ1 A;  1M56 C;  1MSD A;  1EZJ A;  3AG2 C;  1YIT V;  3CRC A;  1M5I A;  2P06 A;  1QHT A;  3CPW U;  4D6T H;  4HNA B;  4LF4 O;  5J2U B;  3SYC A;  4LWS A;  2IJI A;  5JQG B;  2XHB A;  4ZKI A;  3JAL A;  2ITC C;  1DF5 A;  4IYI A;  1XI1 A;  3HKE A;  3WU2 Z;  2UXX A;  2FYU H;  5GTI Z;  3T4D A;  3BHP A;  1XMQ B;  5JWP A;  4BWA A;  1VQK V;  2IW5 A;  2DYR B;  2JGD B;  2JEX A;  4X8A A;  2B1G A;  4O4J B;  2P4V A;  4B3S B;  3F7V C;  4RUE A;  4O4I A;  1RSO A;  2F95 B;  2GUZ B;  3GWK C;  1SF9 A;  2BSK A;  3M99 B;  1H8E G;  4GX1 A;  3OUS A;  4I9Q A;  5JCO A;  1JJO A;  3PJS K;  1IZ3 A;  3OMA B;  1V54 C;  3AG4 B;  1K34 A;  1ARO P;  1S0V A;  2CE4 A;  4I0X B;  2DW4 A;  4BIZ A;  1EZV H;  2N05 A;  1FKA O;  4Q20 A;  2YUA A;  1Q6U A;  2JRI A;  4OPH A;  3K03 A;  4GUN A;  1K5S A;  3ZJZ A;  4GKJ B;  1G6U A;  2X7R B;  1NVP B;  1AJN A;  1YSC A;  2P22 C;  1NR1 A;  4YHH B;  2UUC O;  1O9G A;  4PI0 A;  3HB3 B;  3VQW A;  1XDC A;  1FXK B;  5KX5 B;  4NXN O;  2CH7 A;  2JVD A;  3ZRX A;  5LA6 A;  2UUC B;  1VF7 A;  4JYA O;  1VQ9 V;  4WFF A;  3EHB B;  2DMX A;  4NXN B;  3CC7 V;  4DW1 A;  1WP8 A;  2HFE C;  3CE2 A;  4J7J A;  3ZHR A;  3JAT A;  2CGN A;  1YI2 V;  4I50 B;  5B1B C;  3LSS A;  4MTO A;  2EJR A;  5CA1 A;  3FD9 A;  3OGI B;  1B06 A;  5DED A;  2VQE O;  1Y74 B;  4AQY O;  1VF5 B;  3VQY A;  2IBZ H;  2QE7 G;  4B3R O;  2WPD G;  3VBB A;  3FFQ A;  2VQF O;  2PYL A;  3AG3 C;  2RDC A;  3AG1 C;  2VQE B;  1R3J C;  3BFR A;  4B08 A;  4DUY B;  2QSA A;  4H0L B;  4B3R B;  3T4Z A;  1FFX A;  2W0X A;  3SGI A;  5KMG A;  3HKC A;  3LNM B;  1DGS A;  3P3P A;  5FLX N;  4FZ0 A;  4Z1M G;  1KMI Z;  4DR7 O;  2MK3 A;  1DLB A;  3LDE A;  2DQ3 A;  3OTO O;  3DC5 A;  2Q7G A;  3JAW A;  4X89 A;  3STZ C;  3ETQ A;  1P84 F;  3ZRW A;  4WFE A;  5IYZ A;  1X4T A;  4R8C A;  2R70 A;  4X1K B;  5EK0 A;  2XOK G;  5KUK A;  3ZMS A;  3U11 A;  3OTO B;  2Y4U A;  2YDE A;  2ZR2 A;  3U0Z A;  1Y76 B;  2P67 A;  3OMN B;  5LMU B;  5EBL C;  4I55 B;  1K3E A;  3RW0 A;  4PEL A;  3ZMT A;  3DGE A;  4TSF G;  3SJC C;  4UCT A;  3SYO A;  3A8T A;  1BZK A;  4X1Y B;  3CCL V;  4PJ0 Z;  2BE3 A;  2LJ2 A;  4H37 A;  3VQV A;  3N2K B;  4X1I A;  5FPR A;  1JQ0 A;  4LP8 A;  4EFE A;  3CCE V;  3HKB B;  4FZ1 A;  5EBW C;  2GTA A;  2RCV A;  2A3Q A;  4OXS A;  3RYF A;  1MOF A;  1I94 O;  2F4V O;  3ZCC A;  1WN7 A;  2BTO A;  3CRQ A;  3GWO A;  3I56 V;  3F7Y C;  3CXH F;  1EN5 A;  1YJ9 V;  1AIL A;  4TV8 B;  1WJZ A;  1VAR A;  3TET A;  3L70 H;  2GTS A;  4BIU A;  4ZHQ B;  2AW9 A;  1LUV A;  3APQ A;  4DXW A;  4DK1 A;  3JYC A;  2GHY A;  3Q4H A;  1XNQ O;  1ZLZ A;  2Q68 A;  4H33 A;  3E2E A; 
#chains in the Genus database with same CATH homology
 4QIW F;  5FL7 G;  3UKM A;  1W2B U;  1XL6 A;  3P30 A;  1YJN V;  1Q81 W;  2WLH A;  1PNM A;  5L3B A;  1AJP A;  1OHH G;  3NXS A;  5IY5 C;  2KB1 A;  5IY5 B;  2WLL B;  4RO2 A;  4U7O A;  4JAU A;  4PA4 A;  1UJW B;  1QLE C;  1G4Y B;  1EFR G;  1LNQ A;  3D36 A;  2W6I G;  2QM7 A;  1I5Y A;  1AI7 A;  5B1B B;  2X6C A;  2R9I A;  4L87 A;  3SPI A;  2AHY A;  3SYQ A;  4R50 A;  1YTF B;  2PI5 A;  1R3I C;  2EZP A;  1ENV A;  3ZN1 A;  4UUJ C;  3X2Q C;  4DO2 A;  5DN6 G;  3X2Q B;  3SYA A;  4BAY A;  2JDI G;  5LHG A;  2P7T C;  3QO5 A;  4QPK A;  3MHS C;  5KA5 A;  2V1D A;  3CME V;  1VQO V;  3ABL C;  3ABL B;  4PDL A;  3FB7 C;  2DQ0 A;  1K4D C;  2ZR3 A;  4FIP C;  4EKW A;  4RUF A;  5B3S C;  2ZQM A;  5B3S B;  2YSU B;  4UV9 A;  2JJ1 G;  1L1F A;  3W7X A;  4XDJ A;  3QNE A;  1G8M A;  2XAJ A;  3BEH A;  1GK9 A;  4HAM A;  4QNH B;  2QA4 V;  1JOY A;  4PA3 A;  3FB5 C;  1QLN A;  3OMI B;  2XAF A;  2EBO A;  1EBO A;  2FTK A;  4XDL A;  2Y69 C;  1H38 A;  2Y69 B;  4G27 B;  2EZO A;  5B1N A;  3K9A A;  1PNL A;  4TWK A;  2WWW A;  1I5X A;  3RBZ A;  4MTF A;  2PI4 A;  4ASU G;  2Q69 A;  1K4C C;  3SJQ C;  4P9O A;  3K08 A;  3RVY A;  5CMU A;  2WLJ A;  1VQ8 V;  5IDJ A;  1WPX A;  3SPG A;  3LUT B;  5LHI A;  1S5H C;  4PA6 A;  2CK3 G;  4WFB V;  1P4R A;  1Q7Y W;  5IYB O;  4HZ3 A;  4UV8 A;  2D3O W;  2WLI A;  1FS0 G;  4MVS A;  1H8H G;  4MVO A;  1JPX A;  4KFM A;  1R6K A;  3E8H A;  1K9M W;  2IJK A;  1RM1 C;  5L3D A;  1RM1 B;  3SYP A;  1PNK A;  1M9N A;  3OEH G;  4UVC A;  5B1A C;  3ZRW B;  5B1A B;  1CEZ A;  1GM9 A;  3ZMU A;  3ETE A;  1GM7 A;  1NH2 B;  3B77 A;  1S72 V;  4MVR A;  4UVB A;  3STL C;  3CC2 V;  1V55 C;  4BW5 A;  5CBH A;  1IXM A;  2Z5U A;  1V55 B;  1W0K G;  1M90 W;  1S3J A;  4QE7 A;  3IGA C;  2NNU A;  3ZRS A;  2HKO A;  4U7N A;  4JYB A;  1FXK A;  4RAI A;  3T2M A;  3CCQ V;  3CCS V;  4YXW G;  3B8N A;  2OTL V;  1OZ0 A;  3BY6 A;  1QR9 A;  3CP1 A;  2Y48 A;  2Q6A A;  1S77 D;  3MHH C;  3B8M A;  3RVZ A;  3K79 A;  3K3W A;  1AI6 A;  1TUE B;  1BL8 A;  2Q67 A;  2H8P C;  2JK5 C;  5DM6 V;  2ZXW C;  1QCE A;  2EIL C;  2ZXW B;  3ASN C;  3E89 A;  2EIL B;  4P2Z A;  4RQF A;  3ASN B;  3R65 A;  2XAG A;  4MVZ A;  3CCV V;  4PDV A;  1NKD A;  2QKS A;  1QBZ A;  3OUF A;  2R9R B;  2WLN A;  3H01 A;  4G28 B;  5KUM A;  3ABK C;  3OW2 U;  3ABK B;  2X6B A;  4WCE V;  1VQL V;  2OCC C;  4JTD B;  2OCC B;  2Z3Y A;  2ATK C;  3CD6 V;  5CN0 A;  1E1Q G;  1QLE B;  1Y66 A;  4R6Z A;  3E8B A;  3F5W C;  1OCO C;  3TCU A;  1GO3 F;  3LDD A;  4N21 A;  3TK1 A;  2OTJ V;  3ETD A;  3ZN0 A;  1FFT B;  1B6Q A;  2P6J A;  1JCH A;  1VQ4 V;  1ORQ C;  1Q82 W;  2IU0 A;  3AEI A;  2EIN C;  3HPL C;  5CA3 A;  1VQM V;  2EIN B;  2B1I A;  2NLJ C;  1R73 A;  5IYC O;  2EIJ C;  3A0R A;  1WLE A;  2EIJ B;  1BMF G;  3JD0 A;  1YIJ V;  1PD3 A;  2V7Q G;  5LGN A;  1ROP A;  2DWE C;  4P9P A;  4TT3 G;  1KKD A;  4WFA V;  3KG2 A;  2IU3 A;  1FXH A;  2LFS A;  5GW7 A;  3G6E V;  4MTX A;  3E35 A;  2ITD C;  5E1A C;  4E2L A;  2EIK C;  3ZMV A;  1W0J G;  2EIK B;  1VQP V;  2HR3 A;  5HFM A;  4QE9 A;  1F4M A;  4GCZ A;  4UVA A;  1QVG U;  1OCR C;  1COW G;  3CMA V;  1OCR B;  1M57 C;  1M57 B;  2XAH A;  4XBF A;  5C93 A;  1M56 C;  1DF4 A;  1M56 B;  1K73 W;  1EZJ A;  3AG2 C;  1YIT V;  3AG2 B;  1E1R G;  3CPW U;  1YJW V;  1S76 D;  3SYC A;  1MAB G;  2ZDI A;  3E8F A;  2XND G;  3JD4 A;  2IJI A;  5CBF A;  3ML0 A;  3W7W A;  1E79 G;  1NJI W;  4ZKI A;  2ITC C;  4CBC A;  3ABM C;  3ABM B;  1DF5 A;  2W6J G;  3OGC C;  2UXX A;  2JJ2 G;  1YTF D;  1NR7 A;  4PA9 A;  4I9W A;  3T4D A;  1SZT A;  2DYR C;  1VQK V;  2IW5 A;  2DYR B;  4GX0 A;  3QO8 A;  1QR8 A;  2JEX A;  4X8A A;  2B1G A;  1JVM A;  4UXN A;  3F7V C;  4JF3 A;  4RUE A;  4F4L A;  2DYS C;  5CBG A;  3K0G A;  3K06 A;  3FKS G;  1F23 A;  3W7U A;  3WFV A;  4FK5 C;  1KP3 A;  2IJH A;  1VQ7 V;  1OCZ C;  1OCZ B;  3M99 B;  1H8E G;  4GX1 A;  2W0F C;  3JD2 A;  5LBQ A;  3OUS A;  3PJS K;  2XAQ A;  1VQN V;  2WLI B;  3SPH A;  1K33 A;  3OMA B;  4LBE C;  1V54 C;  3AG4 C;  1AI4 A;  1V54 B;  3AG4 B;  1KD1 W;  1K34 A;  1ARO P;  1S0V A;  1AJQ A;  1MG1 A;  3DTU B;  3OAA G;  3CXC U;  4BIZ A;  2DW4 A;  3E8G A;  2YEV A;  4X88 A;  4Q20 A;  5H9C A;  3EFF K;  2HLD G;  4MTG A;  2F43 G;  3K03 A;  2OT5 A;  1K5S A;  3ZJZ A;  4JTA B;  4G2K A;  1N8R W;  1RPR A;  2X7R B;  1NVP B;  2WLL A;  3CCJ V;  2AHZ A;  1AJN A;  3IC7 A;  4MT8 A;  4MVQ A;  1XL4 A;  1YSC A;  4JAV A;  2HJF C;  3OFN G;  1F51 A;  1NR1 A;  4JGS A;  3D3I A;  1OCC C;  3OR6 C;  3VOU A;  5KA6 A;  4GT1 A;  4MW3 A;  2WLM A;  1FXK C;  3HB3 B;  3OE7 G;  4PDR A;  1FXK B;  1K97 A;  1OCO B;  3ZRX A;  2A79 B;  4FJC C;  5EC1 C;  2A9H A;  3LSQ A;  4LCU C;  2JIZ G;  2QM8 A;  3FYI B;  3CYO A;  2C2A A;  2HVJ C;  1SES A;  3E83 A;  1DTO A;  1BHA A;  4WFH A;  1NH2 D;  4WFF A;  1VQ9 V;  3EHB B;  3ASO C;  3FB6 C;  2QTO A;  1THZ A;  3ASO B;  1ZWI C;  3CC7 V;  3W7S A;  4PA7 A;  1PL0 A;  2HFE C;  5EBM C;  3UM7 A;  3W7T A;  2HG5 C;  4JPR A;  4N23 A;  5L3E A;  1BHB A;  1RPO A;  4CZZ A;  1YI2 V;  3ABU A;  3LSS A;  4MTO A;  5B1B C;  1H2G A;  2EJR A;  1VQ5 V;  1K8A W;  4JYC A;  3ZIA G;  1F4N A;  4KUM A;  1P7B A;  3CCR V;  4J9Z B;  4MW8 A;  1JX9 A;  2QE7 G;  4KP4 A;  2WPD G;  1KP2 A;  3VBB A;  5IYD O;  2GSM B;  3ZRV A;  4PDM A;  4MSW C;  3AG3 C;  1SRY A;  1NVP D;  3AG3 B;  3AG1 C;  1R3J C;  1SET A;  3AG1 B;  4ZBM A;  1K5Q A;  1JJ2 U;  2X6A A;  3T1C A;  3GB7 C;  3P32 A;  3G4S V;  1CPY A;  3T4Z A;  1KQS U;  5H6R A;  4MVM A;  3FYE B;  5LHH A;  1PKX A;  3IFX A;  5BZB A;  3ABT A;  5HFL A;  3LNM B;  1KEC A;  4WF9 V;  2H94 A;  1KC8 W;  3CCU V;  2EIM C;  2X0L A;  2EIM B;  3LDC A;  4Z1M G;  2HVK C;  1QVF U;  1AI5 A;  1DLB A;  1Y4M A;  2MK3 A;  3LDE A;  5L3F A;  1YHQ V;  2QEX V;  4XDK A;  2DQ3 A;  4MVU A;  2A0L A;  4X89 A;  3STZ C;  2IH3 C;  1R6N A;  3OM3 B;  3ZRW A;  4QPJ A;  4WFE A;  4R8C A;  4J9Y B;  5H6Q A;  3K04 A;  3CCM V;  3ETG A;  5EK0 A;  2XOK G;  2BOB C;  5KUK A;  3ZMS A;  2WLK A;  2IH1 C;  2DYS B;  1R3L C;  3JCZ A;  4GX5 A;  3WG7 C;  2ZR2 A;  5L3G A;  1VQ6 V;  3WG7 B;  2ZDI C;  2P67 A;  3OMN B;  2M7W A;  5L3C A;  3OEE G;  3QO7 A;  5EBL C;  1CP9 A;  1FXV A;  1K3E A;  4MS2 A;  3RW0 A;  1GKF A;  4PEL A;  5LGU A;  3ZMT A;  1AR1 B;  1GTO A;  3JD1 A;  3DGE A;  1NBM G;  4TSF G;  3E86 A;  2XAS A;  4R7C A;  3I55 V;  3SYO A;  4FPP A;  4GX2 A;  5LGT A;  2IJJ A;  1NQT A;  3G71 V;  3CCL V;  4H37 A;  3SPJ A;  3SPC A;  3JD3 A;  1JQ0 A;  4LP8 A;  3CCE V;  2UXN A;  3ZMZ A;  5J9P C;  1R3K C;  3OR7 C;  4LC1 A;  5EBW C;  2DWD C;  4QJF B;  4RQE A;  5B1O A;  4JTC B;  1HWY A;  4OXS A;  2LP7 A;  2BOC C;  1MOF A;  2LFR A;  1J95 A;  2P90 A;  3ZCC A;  3MD0 A;  1K7D A;  4JAS A;  1Q86 W;  1GMG A;  3GWO A;  3I56 V;  4P30 A;  3F7Y C;  1M1K W;  3FB8 C;  1YJ9 V;  2K1E A;  2ZD9 A;  1OCC B;  2B5U A;  4HYO A;  3TET A;  5EC2 C;  2JEU A;  4BIU A;  3CC4 V;  4FMT A;  1SER A;  1GM8 A;  1K92 A;  4DXW A;  2WSS G;  2WAM A;  3JYC A;  2GHY A;  3K0D A;  4WFG A;  4I5S A;  1MSW D;  2Q68 A;  4H33 A;  3E2E A;  2YEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...