3I56V

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i56V00
2OTLV 1VQOV 1Q7YW 1VQ6V 4WFBV 1YI2V 3CCQV 1NJIW 1M1KW 3CC2V 3CD6V 3CCEV 3I56V 1VQPV 3G6EV 1Q81W 1K8AW 1QVGU 1KQSU 1VQ4V 3CXCU 3G4SV 1VQ7V 1K73W 3I55V 1W2BU 4WCEV 1VQKV 3CCMV 1VQMV 1YJ9V 1VQ5V 2QA4V 3CMEV 3CCSV 1JJ2U 1Q86W 1YJNV 3CCJV 1R73A 3CCUV 1KC8W 1VQLV 1YITV 2D3OW 3CC4V 4WFAV 1YHQV 1Q82W 1YJWV 1VQNV 3CCVV 1QVFU 2QEXV 1KD1W 3G71V 4WF9V 1M90W 2OTJV 3CCRV 1YIJV 3CCLV 3OW2U 1VQ8V 1K9MW 3CC7V 1VQ9V 5DM6V 3CMAV 1S72V 1N8RW 3CPWU
chains in the Genus database with same CATH superfamily
1XHXA 3RFRA 2OCCB 4TV9A 4Z2WA 1TUEB 5C8YA 1WN7A 2HJDA 5JJJB 2HHHO 4WBNA 1V55C 1HNXB 4EFEA 5EYPA 1Z5WA 2Y4TA 3UM7A 3EHBB 1M57B 4DR5O 3K0DA 1AROP 3ZMZA 4X66B 1Z2GA 1Q7YW 4DR7O 3P3NA 1AJPA 5H6RA 1PPJH 4CC6A 1F51A 4QE7A 4MTOA 5CB4B 5EZYB 5IYCO 3QNEA 3FFQA 5LBQA 2ETNA 3D36A 1OCOB 4NKGB 3DC6A 2Q7HA 3JCZA 2EIKC 4F6RB 3ETQA 5DM6V 4O2BA 2YSUB 3MHSC 1HNWO 3AG4B 4Z1MG 1JJOA 2KQXA 4FLWA 5LMNO 2D2CB 3PN1A 1XBLA 4NR1A 1OCRB 1AR4A 2ZIOA 1MMMA 1XL4A 3ZEDA 1OJHA 1N4CA 2P06A 4JI5B 2UUAO 1B06A 4IT5A 5CBGA 1Q5OA 2PY5A 1GRJA 4U3JA 5IYZB 4BIOA 1EM1A 1QU7A 3X2QB 1WB7A 3ML0A 4X1YB 3RVYA 4XDLA 4X65O 3OD4A 2F1MA 2QTOA 1VF6A 3RVZA 3E8BA 4JYYA 3B77A 3ASNB 4K8XA 3VQYA 3WB1A 4UCRA 2Q68A 3IFXA 3SJBC 4X64B 3G6EV 2WWWA 1VQKV 4PHZA 2CTRA 1AI6A 1YITV 3AK2A 4B3RB 4D7TA 4NB5A 1QR9A 1WAZA 1NZ6A 4GT1A 3UKMA 2NNUA 1DGSA 5CN0A 2EIKB 2QR4A 5H9CA 1IURA 2N04A 2P90A 1RSOA 2B1IA 1WNSA 1ZL8B 1DTOA 4DR6B 3LUTB 4B3MB 2YXYA 3JAWA 2P67A 3FB8C 2FB5A 1AJQA 3JARB 3BPZA 5IJ0A 4BWAA 1F7YA 3SPIA 3LDDA 3FYEB 3QO8A 5CA1A 2EINC 2XOKG 4FK5C 3UT5B 1HNZO 3RYCA 2KB1A 4YJ2A 2LP7A 1XUQA 1R6NA 2ADQB 1M56B 4JI8B 1KP2A 4RQEA 2MW2B 1NS1A 4EFBA 1Y66A 3N2KA 4WFBV 4LFAO 2K9PA 4I9WA 2FTKA 2ZD9A 1W2BU 5F2VO 5L3CA 1K92A 2HVJC 2HFEC 2F4VO 1N34B 4GYCB 5CMUA 5D5PA 1XQ8A 4CH6A 4F4LA 4LF6O 2YEVA 3K9AA 4DR1O 1YI2V 5EC2C 1U97A 2GDSA 1Y76A 2A3QA 3RW0A 4PI0A 1VQMV 1WLEA 1VIBA 3KG2A 2E3CA 1Q6IA 1RM1B 1NQTA 4DV0O 4PDMA 4DV6B 1BT8A 4L87A 5JH7B 4TSFG 2DE0X 2M6YA 1I94B 1V54C 2WLLA 2DYSC 3HKDA 5EC1C 4UV9A 5DECA 5CA0A 4UB6Z 3WB2A 5LYJA 1VQLV 2YICA 2GTSA 1RFYA 4PA6A 1QNMA 4LWSA 4JAVA 4TOIA 1AILA 4AQYB 4N23A 1BGYH 1GTOA 1SKVA 2WLIA 1NI8A 4JPRA 3LNMB 4YJ3B 4JTCB 2QM4A 3K08A 1FPOA 1EN6A 1Q81W 3ETGA 1XNRO 4JYBA 3B40A 3G4SV 3H9VA 4O4LA 3SYCA 5KMGA 1R73A 5LA6A 3GVMA 2OT5A 1QLEB 4TQDA 2JJ1G 1WP7A 4ZHQB 1TAEA 3BHPA 3CP1A 2F66C 2P22C 1IVSA 3OTFA 2CTQA 3ZRVA 3JALB 4D6TH 1FJGB 4ICGA 1Q6HA 3CJHA 1LUVA 3CS5A 2DYRC 2LFSA 3EVKA 1F23A 1ZWIC 3N2GB 2YDEA 3K9SA 3SGIA 4GLXA 1VP7A 2PI5A 4P30A 1XNQO 4JGSA 4FFKA 4LP8A 1M1KW 4J80A 4DV7B 3L9DA 2IU0A 1AVMA 4X20A 3ZIAG 4IYIA 1H2NA 4B3SO 3HKEB 1SZXA 5KX5A 4JI7B 3CWBH 3AG2C 2DYSB 4RAIA 3ABLC 1MZEA 4GCZA 2CUGA 2DJVA 1FXKA 1SQXH 1TGOA 1SZTA 1XILA 5DEDA 2RN9A 2JDIG 2QKAA 1TVKB 1YJNV 1SQPH 4NTYA 3ZS8C 1B04A 2CH7B 1IBLB 5B1AC 1YIJV 5J2UB 1VF7A 3ZJZA 5BR8B 5LHIA 4JV5O 1XL6A 1TUBB 1US6A 5LXTA 3UCSC 1FFTB 1OV9A 4JF3A 2DMXA 2XAHA 3J81N 1K73W 3C3TA 2HG5C 1YZBA 2XAQA 3HR0A 4TV9B 4JI0O 5C8YB 1GN4A 5JCOA 1Q82W 4QNHB 1PM9A 4MW8A 3Q4HA 4WBNB 4PD4F 2RJZA 3F7VC 1R3JC 1VF6C 4J7JA 5EYPB 3CCLV 2JEUA 4I4TA 3SR2C 3D3QA 1COWG 4LBEC 1WP8A 3CD6V 2KKWA 3JATA 1QCEA 5IWAO 3TXQA 2QSAA 3ZBHA 3CB2A 3ZN1A 1S0VA 3K04A 2ZM6B 1D2DA 2BTQA 5J2TA 2D3OW 1N36B 3KCXA 1MSWD 3T2MA 3G6BA 3CCRV 2ZINA 3E89A 4DV3O 4NXNB 4O4HA 1QLNA 3AG2B 3ABLB 2WA4A 4PV1B 1IBMB 4YIPA 3K0GA 1W0JG 4O2BB 3E22A 3JSLA 2IM9A 4FM2A 4DW0A 3ZMVA 4FM0A 2Q73A 5EBMC 3QO7A 2PZSA 2R9IA 3I5DA 4R6ZA 4L8JA 2ZE5A 2ZE7A 4LF4B 5TISZ 4J7KA 1QQCA 2UUCO 3M99B 4A5UB 4LH7A 1M93A 2CGOA 4H13B 4U3JB 2Y69C 3CCMV 4DR3B 4ZHQA 1K4CC 3OM3B 4FLVA 5AG2A 1VARA 3CE2A 4YHHB 1BHBA 3BCCH 3JD4A 4OPHA 1D5AA 4PA3A 4B3TO 1NTKH 4TT3G 4UVAA 3FYIB 1NTMH 2Q67A 3B8NA 2DWDC 3H1JH 1LUWA 3H1IH 1M57C 2ZT9B 2B1GA 2HP8A 4J41A 2R70A 3C90A 4MS2A 5A2QN 2UXBB 3CSXA 4DV5B 4X9QA 3W7WA 2R72A 5L3FA 3MAQA 1FKAO 3R66A 1BS3A 4I55B 1XREA 4LF9B 2CE4A 2HEPA 2ZDIA 2BSKA 4OXSA 1JMKC 1OCOC 5KHIA 1MNGA 5L3EA 4I0XA 4IIJA 1AR1B 3W7TA 3AK3A 4HBNA 1RSOB 3AG4C 2Z3YA 2FL4A 3RBZA 3IGAC 4JI3B 4JI4O 1KKCA 3VBBA 1DF4A 4X88A 1NJIW 1OCRC 1L0LH 4Z1VA 3T1HO 2A0LA 4RUFA 2VQEB 3I56V 3JAWB 1XMOO 2JVDA 3E8GA 3IAYA 4CS4A 4DV1O 5IJ0B 1SQGA 3BVOA 2VQFO 3BABA 5CA1B 2N05A 2Y69B 3RYIA 1YJWV 2UUBO 3RYCB 3TJTA 5CBHA 5L3BA 4YJ2B 2VWKA 3ABKB 3X2QC 1K4DC 1VQOV 1G8MA 2ADPA 3E2EA 4IHJA 3MD0A 3TETA 2LGQA 1R6KA 2HLDG 2JRIA 3CXHF 4O4IA 1QR8A 3N2KB 3CCSV 1R3KC 4UFZA 3H1HH 1FD9A 2R9RB 1PKXA 2ZCEA 4E4EA 4XDJA 3S3WA 3ASNC 1H2KA 2LO1A 3ZRWB 2N74A 3DC5A 4ABMA 3QTCA 2HHHB 3L74H 1PP9H 4JAUA 5KA5A 2XAGA 4I7ZB 1W59A 2YEVB 2WLKA 4DR5B 1AB3A 3BA9A 5BY1A 1JFFB 1Y76B 4LFCO 1MABG 3IC9A 4DR7B 2WLMA 1NH2B 3QG5A 1JCHA 2ZIMA 4PA4A 3K57A 1NH2D 3K79A 2JJ2G 4DUZO 1E1RG 1SA0A 2IJKA 4ZBMA 4MVOA 2QM8A 4GKJB 3CC4V 2KSDA 3K59A 1HNWB 1SESA 2WLLB 3HKDB 2QWQB 5CA0B 1PNKA 1DF5A 5LYJB 3W7SA 4UVCA 3L72H 2XHBA 4LWSB 1GAXA 4DK1A 2IJJA 1GM7A 2WLIB 4KL1A 1H8EG 2H8PC 1M56C 2UUAB 3JD3A 3FB7C 4H33A 2P4VA 2YI9A 3FD9A 3ZHRA 4KHPB 1BQ0A 1NT2B 4IYHA 3W7XA 3LDEA 1U96A 4BR6A 2DQ0A 1ZSPA 4JYAB 3WG7B 4O4LB 1AJNA 5KMGB 5LA6B 2UXCO 1OCCB 1P84F 1Q3EA 3DTUB 1F4NA 4UCVA 3SJQC 5JQGA 4O4JB 4ZI7A 1EN4A 4K35A 3A8TA 4X64O 1HDJA 4LFBO 2EZPA 2Q8VA 1M4UA 4X89A 4I55A 3K5LA 2W0XA 2XT9A 3CJHB 4R50A 1K3EA 4B3RO 2HR3A 2X6BA 1ROPA 1H8HG 1VQ6V 2Q69A 5FNVA 4EB6A 3P32A 4G27B 2LW7A 3STZC 3ABTA 1RM1C 3BEHA 5KAIZ 1YJ9V 4FMTA 4GX2A 4Q20A 4BIZA 2V4DA 4X20B 1IZ3A 5FPRA 5GTIZ 3OT7A 5KX5B 5KHGA 3CC7V 2PI4A 3RT3C 1HP8A 5EIBC 2RMKB 2IBZH 3B2EE 1FXKB 3SPJA 2Q5ZA 5H6QA 4UV8A 1TA8A 5D5QA 4J9YB 3B4SA 1K7DA 1GM8A 3IJ4A 1GN3A 2OIGA 3ZX6A 1P49A 2QWNB 2ZR3A 4NXMO 2DN9A 3FAVA 4GX1A 4JI8O 4MSWC 4JI6O 3F5WC 2LFRA 4MVUA 5IDJA 4UCOA 2EIJB 4K8ZA 4D7SA 4BIUA 1FXHA 5LGNA 1JVMA 4IGGA 3CX5F 1QLEC 3ZRWA 3CMEV 5KHJA 1KB9F 1IDSA 5LXTB 1XMQB 2ZNJA 2PTMA 1X59A 4LFAB 4MW3A 1XDCA 3HB3B 2AZ2A 4AI8A 4WFHA 3A0BZ 3SPGA 2F4VB 3JD1A 1R6TA 2AZ0A 1JFFA 3Q4HB 1EFRG 4I4TB 1H2GA 3ETDA 3TXSA 3K03A 4LF7B 1AI5A 1AR5A 5K1PA 2E5LB 3JATB 1G4YB 4LF6B 4PDRA 1N33O 4LF5O 1VMGA 5K1XA 2BTQB 5J2TB 2JGDA 1SRYA 1YCIA 2EJRA 2PUSA 1V9PA 4DV6O 4P2ZA 3AG1B 3SJCC 1YEWA 4O4HB 4UUJC 1YVWA 3FB5C 4DV0B 2L6LA 3BFRA 2UXDB 1I7FA 3OTOO 5EIBD 3OGCC 1I94O 4QPKA 2ZNIA 3FKSG 4I50A 4LCUC 1KD1W 2XNDG 4BW5A 3E22B 4BAYA 3FB6C 4DR4O 3SDLA 2ATKC 4LNUA 3HKCA 1LNQA 4MTXA 1WA8A 5E79Z 3U11A 2ITDC 1RPRA 3OR6C 4KFMA 5LGUA 2AGAA 1GN6A 1CEZA 4K0KO 4JASA 4GKKB 4GZRB 3OMAB 4O4JA 1SQFA 1G6UA 4NVPA 1MA1A 1KU9A 1CPYA 1JQ0A 1J5EB 4B7KA 4QPJA 1OCZB 2JS3A 4JTDB 3LNNA 4LC1A 4JI2O 2O57A 2E74B 2H94A 4XDKA 1FS0G 1GM9A 5LGTA 1IX9A 2L35A 3E86A 4UVBA 3AG3B 1N32B 2A7WA 4FLXA 2AHZA 3WU2Z 2E76B 2OIEA 5LP6A 3BRCA 2JGUA 4WFFA 1M5IA 4DV7O 1HR0O 4MVMA 1XNQB 4CH4A 3K06A 1BMFG 4WFAV 1NR7A 2BSKB 5B5EZ 3D36C 4DV4B 3AK1A 3CHXA 1Q8IA 4I0XB 4IIJB 4B3SB 5EK0A 2K1EA 1RP3B 4U3FH 1F4MA 1ZLZA 2EILB 1K5QA 3MHHC 4JAAA 3ZRSA 1MZFA 2P4KA 4MTFA 2EZOA 2YUAA 2YXLA 3K5NA 2QE7G 3DSQA 5KLVH 4H0LB 4DXWA 4LR3A 2MK3A 3A0HZ 3EFFK 4GX0A 2Q9LA 1R3LC 5B66Z 3OEEG 3ABMB 3RYIB 4FFBB 4R7CA 2YI8A 3F7YC 3ZRXA 2XASA 5B3SB 3JAKA 1I5YA 4JI1O 3JAMN 4O2AA 1DLBA 1JJ2U 4IHJB 4HNAA 1CXZB 1KP3A 4JV5B 2WA3A 3ASOC 1QVFU 2QDOA 2F95B 5HFMA 4O4IB 4FM1A 1IBKO 4CZZA 3ABUA 2QKCA 4MTGA 2DOSA 4TV8A 3TGUH 4JI0B 2X6CA 1JX9A 2P7TC 3SYAA 2YIBA 1GKFA 2NN4A 4OX9B 2GUZA 1JOYA 5B1NA 2XAFA 1I0HA 5IWAB 3UO2A 3ICXA 3N27A 3ZMUA 2EIMB 3JASA 4NXNO 1KQSU 1H38A 5LMUO 1VF5B 2QKSA 1IBMO 1S3JA 4FLYA 3T4DA 4DV3B 4DR2O 5FLXN 4H44B 1SA0B 1ZTEA 2C2AA 2ZR2A 2A79B 1GO3F 1URFA 4QIWF 1BHAA 2KG7A 1S5LZ 2YIAA 4PDVA 5LHHA 3LSSA 2IW5A 3ABKC 2UUCB 1THZA 3E83A 2DQ3A 5KA6A 2UU9O 3SYQA 4YY3O 3CPWU 3ASOB 4N21A 4FLTA 2Q0OC 1EZJA 4I5SA 4FJCC 4X62O 4KUMA 1VQ7V 1ZUQA 3AG7A 4RO2A 2Y48A 1QHTA 3DXRA 4DV2B 5JQGB 3M8AA 4BW9A 3STLC 1FFXA 4ZI7B 4I9QA 2XUMA 3LDCA 5EBWC 3F5TA 3L73H 4J42A 1S76D 2OTLV 4QGPA 2UXBO 3CC2V 4DV5O 1SQVH 1P4RA 5KUKA 3CXCU 4WCEV 3MDSA 3BY6A 2YIDA 5GONA 5FNVB 4FZ0A 4PA9A 4EB6B 5BMVA 1FAFA 3APOA 4WF9V 4DUYB 3TK1A 2BE3A 1S77D 4GX5A 4FLZA 5LOVA 2QWPB 3R65A 4JI3O 1YSCA 2WLNA 4IL6Z 3KCYA 2VQEO 3CRQA 3D8CA 1Y6XA 4JI4B 4LF8O 5L3GA 2UXXA 4FFBA 2F93B 2W6JG 5IY5B 3T1HB 3K5MA 1XMOB 1I08A 3CMAV 1H2MA 4FVMA 1B6QA 3CRCA 4DV1B 3T1YO 2HKOA 2WPDG 1P7GA 2Q7GA 3FAVB 1J95A 3E8HA 2PYLA 3CCJV 1G1XB 3U0ZA 3WG7C 4E2LA 4NTWA 1R3IC 5L3DA 1HNXO 2ZQMA 1KECA 1OCCC 2VS0A 5JVDB 5LL6Y 1BQZA 1E79G 1WPBA 1NVPB 4MT8A 5IE9A 1BSMA 1NVPD 1H2SB 4X66O 2YS8A 4U7OA 4EKWA 5IT9N 2E75B 1JPXA 2X6AA 3RYHA 3SPCA 1N0JA 1KC8W 1WJZA 2CTPA 3VOUA 3ZMSA 3P30A 2V1DA 2W6IG 5LHGA 2IH3C 2DW4A 3C3SA 4X1IA 2ZE6A 4KP4A 4X1KA 4DK0A 3APQA 4LFCB 4ASUG 5LP6C 2YXHA 1XI1A 3G80A 2QGNA 2JGDB 3IC7A 4B08A 2XTAA 2PYJA 3BAAA 4HYOA 3JYCA 4GUNA 2CTWA 1AI7A 4DUZB 4GKJO 4DRXA 1WPXA 5LMNB 4JI5O 4W4KA 4I50B 1FXKC 1W0KG 4HZ3A 2LW1A 2QJ1A 3RN4A 5IYDO 4FLUA 1T5EA 1WB8A 3GWOA 4LNUB 2Q4PA 4J11A 3HKCB 1YHQV 1WA8B 1GH6A 1UFIA 3ZHQA 4KHPO 4PDLA 3QO5A 1BE3H 3RWRD 2Z5UA 1A32A 3QVNA 2EIJC 4DYLA 4OPAA 4TQFA 3CCEV 4JYAO 1ZAUA 4ZIBA 3OUSA 3K58A 2A06H 3GWKC 4X65B 4FZ1A 3LSQA 3SYPA 1NU1H 1P7BA 2X7RB 4TUYA 3ZHSA 1GN2A 4CS3A 1V55B 5JJNB 1K33A 2UXCB 3K5OA 3CCVV 1R1BA 5C93A 5JCOC 1SS3A 3RYFA 3UQ8A 4NTXA 2AXTZ 1RPOA 4LFBB 1XHZA 2OCHA 5E1AC 3W7UA 2WLJA 4ZKIA 1K34A 4H37A 4TWKA 1AI4A 1Q6UA 2ODMA 2BTOA 2YC0A 5LP6B 5ITZA 3CYOA 2GTAA 4DR6O 4MVZA 4U7NA 2CGNA 4B3MO 3AG1C 2QWOB 3OE7G 2IU3A 3ZHTA 4ZOLA 1XOUA 3OGIB 2CK3G 3WFVA 4AILC 3OAAG 1SQQH 3H1KH 2UXNA 4FPPA 2P5OA 2EJ7A 3CRRA 1KMIZ 1HNZB 3TCUA 4CBCA 5KHKA 1VQ4V 4LH6A 3HKBA 1X4TA 5JVDA 4UCTA 4F6EA 2RCVA 2HJFC 4NXMB 1H2LA 3VQVA 1HWYA 4JI6B 2QEXV 1MOFA 2BOBC 1LR1A 1N34O 3JAKB 2OTJV 2QM7A 1XMQO 2BCCH 3CRMA 4O2AB 2GSMB 1OCZC 4HNAB 4OGQB 3CCQV 4NYKA 2ARHA 2XAJA 4CH5A 2Z0AA 2NR5A 4G28B 4TV8B 3S3XA 4PJ0Z 3AG3C 1Z5VA 3OUFA 4LF7O 4P9OA 4PELA 3L70H 4QJFB 4DR1B 5A9GA 2E5LO 2Q6AA 4QE9A 5CB4A 4MVQA 5CBFA 2ZE8A 4P9PA 3OFNG 5EZYA 1OHHG 3JCUZ 2R9AA 2GUZB 2YIBD 4YXWG 2OYQA 4KXRA 2LJ2A 4CS2A 2FKXA 2ZXWC 3KZIZ 4W4LA 1N33B 2ZDIC 3JASB 4LF5B 2QA4V 4F6RA 3OMIB 2JIZG 4FIPC 4G2KA 3CEIA 2WLHA 2UXDO 4J9ZB 4RUEA 1M90W 3ZMTA 2V7QG 5KUMA 2RDCA 2OWOA 3D3IA 5IYBO 2B9ZA 2EILC 4J7ZA 4CC5A 1SERA 3OMNB 4B7EA 3THOA 4JYCA 4AQYO 3OTOB 1VQPV 1B3QA 2M7WA 1L1FA 2W0FC 3M7MX 2VWJA 2KG7B 2EINB 3JD2A 5IYZA 1UPGA 3OR7C 4DR4B 3JSNA 3ABMC 2QWRB 4GKKO 1K5SA 1Y67A 1S72V 1XNRB 3PJSK 1PV0A 4X1YA 2BOCC 2AHYA 2DWEC 2IH1C 3B09A 1PD3A 3GB7C 5B3SC 3QF7A 4K0KB 4HAMA 4UCUA 1J5EO 1EBOA 3HPLC 3ZCCA 2Y4UA 1E1QG 1S5JA 1FJGO 5KAFZ 3DXRB 1JR9A 3J7AU 5BXZA 3E8FA 1FFXB 1Y4MA 4JI2B 3P3PA 4JZGA 5B1BC 1D5NA 4UCSA 2EBOA 5IJ9B 1N32O 1ORQC 1Q90D 3CRAA 5FPOA 3ZHUA 3CCUV 4XBFA 3UO3A 2ZXWB 2EIMC 1PNLA 4JI7O 3NR7A 3ZHVA 1MG1A 1NBMG 5GONB 3VQXA 4WFGA 3KKYA 1ZL8A 4YIOA 4DV4O 5BMVB 1HR0B 2WAMA 2P6JA 1BL8A 1JA8A 1Y74B 3OEHG 3DGEA 5LOVB 2PF4E 3JARA 1EZVH 1CP9A 4X8AA 1V54B 2LQTA 1IXBA 3UT5A 1FXVA 3ZN0A 1IBLO 1GK9A 5BR8O 2Q0AA 4J10A 2GBOA 3FX7A 2JS5A 4MVSA 3O9OA 2F23A 3L71H 1KBHA 4JTAB 1VQ9V 4JI1B 2ZKOA 1IXMA 4UXNA 5B1BB 2GHYA 1IBKB 3L75H 5GW7A 1OZ0A 2ZM6O 2DYRB 5DN6G 3RYHB 1UJWB 1NTZH 1N36O 4OX9O 1AP6A 5H5NA 2AW9A 2FMLA 4K3AA 5B1OA 2GV9A 3H01A 1S5HC 4X1IB 5KHHA 1NKDA 5HFLA 4EEQA 2PGGA 4X1KB 1N0NA 1AP5A 1SQBH 1Q86W 1Q43A 5CA3A 4MVRA 5JH7A 3SYOA 3NXSA 1K9MW 1N8RW 5LMUB 2Y0PA 1QBZA 2RQ6A 2Y0IA 3AEIA 2CAZC 4DR2B 4LF4O 1BCCH 1SETA 3I55V 4DRXB 2Q7EA 1K97A 3JD0A 5IY5C 2CDYA 1SF9A 4YJ3A 3BA8A 1O9GA 4DR3O 2H3OA 2IJIA 3O65A 2WSSG 3OW2U 4YHHO 1L0NH 1L8DA 4CH3A 1PNMA 5B1AB 2ITCC 3RGBA 5J9PC 3J80N 2B5UA 3U10A 1YF2A 2JEXA 2QTSA 5H2FZ 3K3WA 4DW1A 2UU9B 4B3TB 3A2FA 4YY3B 4C7UA 2OCCC 4DV2O 3JALA 5IJ9A 1YTFB 4X62B 4TUYB 1YTFD 2F43G 3N2GA 3T4ZA 3RYFB 2HVKC 4R8CA 1ZX3A 5EBLC 4LF9O 3WB0A 2EULA 1MSDA 1BZKA 5JJEB 1VEWA 1VQNV 4AHCA 2EX3A 1I5XA 3ETEA 1KUQA 3HKEA 1Y74A 4UB8Z 2A9HA 4DUYO 2JK5C 1DK1A 5ITZB 5GTHZ 1SC5B 1XEQA 1K8AW 1QVGU 1KYOF 1VQ5V 1YDXA 2NLJC 4WFEA 1EN5A 5BZBA 4RQFA 3VQWA 1M9NA 1O9HA 4RWUA 3G71V 4ZOLB 1KKDA 3B8MA 1VQ8V 3E35A 2LGWA 4JZ2A 4PA7A 2FYUH 1GMGA 5JWPA 3SJAC 1PL4A 1TVKA 1PL0A 4DO2A 3SPHA 2VQFB 2VRZA 2CH7A 2IJHA 4Q6GA 4LF8B 5J2UA 2RNBA 3T1CA 2UUBB 3EXAA 2G38A 1HW7A 4PI2A 2ILMA 1TUBA 3A0RA 3H1LH 2X0LA 1NR1A 1ENVA 3HKBB 3G67A 3LSUA 1YXBA 3T1YB 1FYJA 5FL7G
chains in the Genus database with same CATH topology
3ABLB 3AG1C 2OCCB 1TUEB 4QPJA 1OCZB 3OE7G 2IU3A 3K0GA 1W0JG 1V55C 4JTDB 4LC1A 2CK3G 3WFVA 3ZMVA 2H94A 3UM7A 3OAAG 4XDKA 3EHBB 5EBMC 3QO7A 2UXNA 4FPPA 1M57B 1FS0G 2R9IA 1GM9A 3K0DA 4R6ZA 1AROP 5LGTA 3ZMZA 3E86A 4UVBA 3AG3B 1Q7YW 3M99B 3TCUA 4CBCA 1AJPA 2AHZA 5H6RA 1VQ4V 1F51A 4QE7A 2Y69C 4MTOA 4WFFA 3CCMV 1K4CC 5IYCO 3OM3B 4MVMA 3QNEA 2HJFC 5LBQA 3D36A 1OCOB 3K06A 1BMFG 4WFAV 1HWYA 1BHBA 1NR7A 3JD4A 2QEXV 1MOFA 2BOBC 3JCZA 4PA3A 2OTJV 2EIKC 2QM7A 4TT3G 5DM6V 2GSMB 4UVAA 3FYIB 2YSUB 1OCZC 3MHSC 3AG4B 4Z1MG 5EK0A 3CCQV 2K1EA 1F4MA 2Q67A 2XAJA 3B8NA 2EILB 1K5QA 2DWDC 3MHHC 3ZRSA 1OCRB 4MTFA 1XL4A 4G28B 2EZOA 1M57C 2QE7G 2B1GA 3AG3C 3OUFA 4MS2A 4P9OA 4PELA 4QJFB 5CBGA 4DXWA 2Q6AA 1JQ0A 2MK3A 3EFFK 4GX0A 4QE9A 3W7WA 1R3LC 4MVQA 5L3FA 5CBFA 4P9PA 3OEEG 3ABMB 3OFNG 1OHHG 4R7CA 4YXWG 2ZDIA 3F7YC 3X2QB 3ML0A 2XASA 4OXSA 3ZRXA 2ZXWC 1OCOC 5B3SB 1I5YA 2ZDIC 2QA4V 3RVYA 5L3EA 3OMIB 1DLBA 1JJ2U 4XDLA 1AR1B 2JIZG 3W7TA 1KP3A 4FIPC 4G2KA 3ASOC 1QVFU 2QTOA 2WLHA 3RVZA 4J9ZB 3AG4C 2Z3YA 3E8BA 4RUEA 5HFMA 3ZMTA 1M90W 2V7QG 3RBZA 3IGAC 5KUMA 3ABUA 4CZZA 3D3IA 5IYBO 3B77A 3VBBA 2EILC 3ASNB 4MTGA 1SERA 3OMNB 1DF4A 4X88A 1NJIW 1OCRC 3ZMUA 2A0LA 2Q68A 4RUFA 3I56V 4JYCA 1VQPV 3IFXA 3G6EV 3E8GA 2X6CA 1JX9A 2M7WA 2WWWA 1L1FA 1QLNA 2P7TC 1VQKV 3SYAA 2W0FC 1AI6A 1GKFA 2EINB 3JD2A 1YITV 3OR7C 2Y69B 1YJWV 1JOYA 3ABMC 5B1NA 2XAFA 5CBHA 5L3BA 1QR9A 1K5SA 1S72V 3ABKB 3PJSK 4GT1A 1K4DC 2EIMB 3X2QC 2BOCC 1G8MA 2AHYA 3UKMA 2DWEC 2NNUA 1VQOV 2IH1C 3E2EA 5CN0A 1PD3A 3GB7C 5B3SC 2EIKB 3MD0A 4HAMA 5H9CA 3TETA 2P90A 1KQSU 1H38A 1R6KA 2HLDG 2B1IA 2QKSA 1DTOA 1QR8A 1EBOA 3HPLC 3CCSV 1S3JA 1R3KC 3ZCCA 3T4DA 1E1QG 3LUTB 2R9RB 1PKXA 4XDJA 3ASNC 2P67A 3FB8C 3ZRWB 2C2AA 1AJQA 2ZR2A 2A79B 1GO3F 4QIWF 3E8FA 3SPIA 3LDDA 1Y4MA 3FYEB 1BHAA 5B1BC 3QO8A 2EBOA 4JAUA 1ORQC 5KA5A 2EINC 2XOKG 2XAGA 4FK5C 4PDVA 5LHHA 2KB1A 2YEVB 2WLKA 3LSSA 2LP7A 3CCUV 1MABG 4XBFA 1R6NA 1M56B 2ZXWB 2IW5A 2WLMA 3ABKC 1THZA 2EIMC 3E83A 1NH2B 1PNLA 2DQ3A 5KA6A 1KP2A 4RQEA 1MG1A 1NBMG 1JCHA 4PA4A 3SYQA 3CPWU 1Y66A 4WFGA 1NH2D 3K79A 3ASOB 4WFBV 4N21A 1EZJA 2JJ2G 4I5SA 4I9WA 1E1RG 4FJCC 2FTKA 2ZD9A 2IJKA 2WAMA 4KUMA 1VQ7V 2P6JA 1W2BU 5L3CA 1BL8A 4ZBMA 1K92A 2HVJC 3OEHG 2HFEC 3DGEA 4RO2A 4MVOA 2Y48A 1CP9A 4X8AA 1V54B 5CMUA 2QM8A 3STLC 3CC4V 1SESA 2WLLB 3LDCA 5EBWC 4F4LA 1S76D 1FXVA 1PNKA 3ZN0A 1DF5A 2OTLV 2YEVA 3K9AA 3W7SA 1YI2V 5EC2C 4UVCA 1GK9A 3CC2V 5KUKA 1P4RA 3RW0A 2IJJA 1GM7A 3CXCU 4WCEV 2WLIB 1H8EG 2H8PC 1M56C 1VQMV 3BY6A 1WLEA 3JD3A 3FB7C 4H33A 3KG2A 4PA9A 3W7XA 4MVSA 3LDEA 1RM1B 4WF9V 1NQTA 2DQ0A 3TK1A 4JTAB 3WG7B 1VQ9V 1S77D 4PDMA 4GX5A 1AJNA 1OCCB 3DTUB 3SJQC 1F4NA 4L87A 3R65A 4TSFG 1IXMA 1YSCA 4UXNA 1V54C 2WLLA 2DYSC 2WLNA 5EC1C 4UV9A 5B1BB 2GHYA 2EZPA 1VQLV 4X89A 5GW7A 4PA6A 5L3GA 2UXXA 2W6JG 1OZ0A 4JAVA 2DYRB 5IY5B 4R50A 5DN6G 1UJWB 1K3EA 4N23A 1GTOA 2HR3A 2X6BA 3CMAV 2WLIA 1ROPA 1H8HG 4JPRA 1VQ6V 1B6QA 3LNMB 2Q69A 4JTCB 3K08A 5B1OA 3P32A 4G27B 2HKOA 2WPDG 3H01A 1Q81W 3ETGA 4JYBA 3G4SV 1S5HC 1J95A 1NKDA 3ABTA 3E8HA 3BEHA 5HFLA 3STZC 4FMTA 1RM1C 1YJ9V 4GX2A 1Q86W 4Q20A 3SYCA 3CCJV 1R73A 4BIZA 5CA3A 3WG7C 2OT5A 4E2LA 1QLEB 1R3IC 2JJ1G 4MVRA 5L3DA 2ZQMA 1KECA 1OCCC 1E79G 3SYOA 3NXSA 1K9MW 3CC7V 2PI4A 1N8RW 1NVPB 3CP1A 4MT8A 1QBZA 3AEIA 1NVPD 3ZRVA 1SETA 4U7OA 4EKWA 3I55V 1FXKB 1JPXA 2X6AA 3SPJA 1K97A 3SPCA 5H6QA 4UV8A 3JD0A 2DYRC 2LFSA 5IY5C 1KC8W 4J9YB 3VOUA 1F23A 1ZWIC 3ZMSA 3P30A 1K7DA 1GM8A 2V1DA 2W6IG 2IJIA 2WSSG 3OW2U 5LHGA 2IH3C 2ZR3A 2DW4A 4P30A 2PI5A 5FL7G 4GX1A 1PNMA 4JGSA 4KP4A 4MSWC 5B1AB 4LP8A 3F5WC 2LFRA 1M1KW 4MVUA 5IDJA 2ITCC 2EIJB 2IU0A 4ASUG 4BIUA 3ZIAG 5J9PC 2B5UA 1FXHA 5LGNA 1JVMA 2JEXA 1QLEC 3ZRWA 3CMEV 3K3WA 3IC7A 3AG2C 2DYSB 4RAIA 3ABLC 4HYOA 3JYCA 2OCCC 4GCZA 4MW3A 1YTFB 1AI7A 3HB3B 1FXKA 1WPXA 4WFHA 3SPGA 2F43G 1YTFD 1FXKC 3JD1A 1W0KG 1EFRG 1SZTA 4HZ3A 3T4ZA 1H2GA 2HVKC 2JDIG 3ETDA 4R8CA 3K03A 5IYDO 1AI5A 5EBLC 1YJNV 1G4YB 3GWOA 1YHQV 4PDRA 1VQNV 5B1AC 4PDLA 1YIJV 1I5XA 3QO5A 3ETEA 3ZJZA 5LHIA 2Z5UA 2EIJC 1XL6A 2A9HA 2JK5C 1SRYA 3CCEV 2EJRA 3OUSA 1FFTB 1K8AW 4JF3A 1QVGU 4P2ZA 2XAHA 1K73W 3AG1B 2HG5C 4UUJC 3LSQA 2XAQA 3SYPA 1VQ5V 1P7BA 3FB5C 2NLJC 4WFEA 2X7RB 5BZBA 3OGCC 4QPKA 1V55B 4RQFA 1K33A 3FKSG 1M9NA 1Q82W 4QNHB 3CCVV 4LCUC 4MW8A 1KD1W 3G71V 2XNDG 4BW5A 3B8MA 5C93A 1KKDA 3F7VC 3CCLV 1R3JC 1VQ8V 2JEUA 3E35A 4BAYA 3FB6C 4PA7A 1GMGA 1COWG 4LBEC 1PL0A 3CD6V 1RPOA 1QCEA 2ATKC 4DO2A 1LNQA 3SPHA 4MTXA 5E1AC 3W7UA 2IJHA 2ITDC 3ZN1A 1RPRA 3OR6C 1S0VA 2WLJA 4KFMA 5LGUA 4ZKIA 3K04A 3T1CA 1K34A 4H37A 1CEZA 4TWKA 1AI4A 4JASA 2D3OW 3A0RA 2X0LA 1MSWD 1NR1A 3T2MA 1ENVA 3CYOA 3OMAB 3CCRV 3E89A 4MVZA 4U7NA 1CPYA 3AG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL V;  1VQO V;  1Q7Y W;  1VQ6 V;  4WFB V;  1YI2 V;  3CCQ V;  1NJI W;  1M1K W;  3CC2 V;  3CD6 V;  3CCE V;  3I56 V;  1VQP V;  3G6E V;  1Q81 W;  1K8A W;  1QVG U;  1KQS U;  1VQ4 V;  3CXC U;  3G4S V;  1VQ7 V;  1K73 W;  3I55 V;  1W2B U;  4WCE V;  1VQK V;  3CCM V;  1VQM V;  1YJ9 V;  1VQ5 V;  2QA4 V;  3CME V;  3CCS V;  1JJ2 U;  1Q86 W;  1YJN V;  3CCJ V;  1R73 A;  3CCU V;  1KC8 W;  1VQL V;  1YIT V;  2D3O W;  3CC4 V;  4WFA V;  1YHQ V;  1Q82 W;  1YJW V;  1VQN V;  3CCV V;  1QVF U;  2QEX V;  1KD1 W;  3G71 V;  4WF9 V;  1M90 W;  2OTJ V;  3CCR V;  1YIJ V;  3CCL V;  3OW2 U;  1VQ8 V;  1K9M W;  3CC7 V;  1VQ9 V;  5DM6 V;  3CMA V;  1S72 V;  1N8R W;  3CPW U; 
#chains in the Genus database with same CATH topology
 1XHX A;  3RFR A;  2OCC B;  4TV9 A;  4Z2W A;  1TUE B;  5C8Y A;  1WN7 A;  2HJD A;  5JJJ B;  2HHH O;  4WBN A;  1V55 C;  1HNX B;  4EFE A;  5EYP A;  1Z5W A;  2Y4T A;  3UM7 A;  3EHB B;  1M57 B;  4DR5 O;  3K0D A;  1ARO P;  3ZMZ A;  4X66 B;  1Z2G A;  1Q7Y W;  4DR7 O;  3P3N A;  1AJP A;  5H6R A;  1PPJ H;  4CC6 A;  1F51 A;  4QE7 A;  4MTO A;  5CB4 B;  5EZY B;  5IYC O;  3QNE A;  3FFQ A;  5LBQ A;  2ETN A;  3D36 A;  1OCO B;  4NKG B;  3DC6 A;  2Q7H A;  3JCZ A;  2EIK C;  4F6R B;  3ETQ A;  5DM6 V;  4O2B A;  2YSU B;  3MHS C;  1HNW O;  3AG4 B;  4Z1M G;  1JJO A;  2KQX A;  4FLW A;  5LMN O;  2D2C B;  3PN1 A;  1XBL A;  4NR1 A;  1OCR B;  1AR4 A;  2ZIO A;  1MMM A;  1XL4 A;  3ZED A;  1OJH A;  1N4C A;  2P06 A;  4JI5 B;  2UUA O;  1B06 A;  4IT5 A;  5CBG A;  1Q5O A;  2PY5 A;  1GRJ A;  4U3J A;  5IYZ B;  4BIO A;  1EM1 A;  1QU7 A;  3X2Q B;  1WB7 A;  3ML0 A;  4X1Y B;  3RVY A;  4XDL A;  4X65 O;  3OD4 A;  2F1M A;  2QTO A;  1VF6 A;  3RVZ A;  3E8B A;  4JYY A;  3B77 A;  3ASN B;  4K8X A;  3VQY A;  3WB1 A;  4UCR A;  2Q68 A;  3IFX A;  3SJB C;  4X64 B;  3G6E V;  2WWW A;  1VQK V;  4PHZ A;  2CTR A;  1AI6 A;  1YIT V;  3AK2 A;  4B3R B;  4D7T A;  4NB5 A;  1QR9 A;  1WAZ A;  1NZ6 A;  4GT1 A;  3UKM A;  2NNU A;  1DGS A;  5CN0 A;  2EIK B;  2QR4 A;  5H9C A;  1IUR A;  2N04 A;  2P90 A;  1RSO A;  2B1I A;  1WNS A;  1ZL8 B;  1DTO A;  4DR6 B;  3LUT B;  4B3M B;  2YXY A;  3JAW A;  2P67 A;  3FB8 C;  2FB5 A;  1AJQ A;  3JAR B;  3BPZ A;  5IJ0 A;  4BWA A;  1F7Y A;  3SPI A;  3LDD A;  3FYE B;  3QO8 A;  5CA1 A;  2EIN C;  2XOK G;  4FK5 C;  3UT5 B;  1HNZ O;  3RYC A;  2KB1 A;  4YJ2 A;  2LP7 A;  1XUQ A;  1R6N A;  2ADQ B;  1M56 B;  4JI8 B;  1KP2 A;  4RQE A;  2MW2 B;  1NS1 A;  4EFB A;  1Y66 A;  3N2K A;  4WFB V;  4LFA O;  2K9P A;  4I9W A;  2FTK A;  2ZD9 A;  1W2B U;  5F2V O;  5L3C A;  1K92 A;  2HVJ C;  2HFE C;  2F4V O;  1N34 B;  4GYC B;  5CMU A;  5D5P A;  1XQ8 A;  4CH6 A;  4F4L A;  4LF6 O;  2YEV A;  3K9A A;  4DR1 O;  1YI2 V;  5EC2 C;  1U97 A;  2GDS A;  1Y76 A;  2A3Q A;  3RW0 A;  4PI0 A;  1VQM V;  1WLE A;  1VIB A;  3KG2 A;  2E3C A;  1Q6I A;  1RM1 B;  1NQT A;  4DV0 O;  4PDM A;  4DV6 B;  1BT8 A;  4L87 A;  5JH7 B;  4TSF G;  2DE0 X;  2M6Y A;  1I94 B;  1V54 C;  2WLL A;  2DYS C;  3HKD A;  5EC1 C;  4UV9 A;  5DEC A;  5CA0 A;  4UB6 Z;  3WB2 A;  5LYJ A;  1VQL V;  2YIC A;  2GTS A;  1RFY A;  4PA6 A;  1QNM A;  4LWS A;  4JAV A;  4TOI A;  1AIL A;  4AQY B;  4N23 A;  1BGY H;  1GTO A;  1SKV A;  2WLI A;  1NI8 A;  4JPR A;  3LNM B;  4YJ3 B;  4JTC B;  2QM4 A;  3K08 A;  1FPO A;  1EN6 A;  1Q81 W;  3ETG A;  1XNR O;  4JYB A;  3B40 A;  3G4S V;  3H9V A;  4O4L A;  3SYC A;  5KMG A;  1R73 A;  5LA6 A;  3GVM A;  2OT5 A;  1QLE B;  4TQD A;  2JJ1 G;  1WP7 A;  4ZHQ B;  1TAE A;  3BHP A;  3CP1 A;  2F66 C;  2P22 C;  1IVS A;  3OTF A;  2CTQ A;  3ZRV A;  3JAL B;  4D6T H;  1FJG B;  4ICG A;  1Q6H A;  3CJH A;  1LUV A;  3CS5 A;  2DYR C;  2LFS A;  3EVK A;  1F23 A;  1ZWI C;  3N2G B;  2YDE A;  3K9S A;  3SGI A;  4GLX A;  1VP7 A;  2PI5 A;  4P30 A;  1XNQ O;  4JGS A;  4FFK A;  4LP8 A;  1M1K W;  4J80 A;  4DV7 B;  3L9D A;  2IU0 A;  1AVM A;  4X20 A;  3ZIA G;  4IYI A;  1H2N A;  4B3S O;  3HKE B;  1SZX A;  5KX5 A;  4JI7 B;  3CWB H;  3AG2 C;  2DYS B;  4RAI A;  3ABL C;  1MZE A;  4GCZ A;  2CUG A;  2DJV A;  1FXK A;  1SQX H;  1TGO A;  1SZT A;  1XIL A;  5DED A;  2RN9 A;  2JDI G;  2QKA A;  1TVK B;  1YJN V;  1SQP H;  4NTY A;  3ZS8 C;  1B04 A;  2CH7 B;  1IBL B;  5B1A C;  1YIJ V;  5J2U B;  1VF7 A;  3ZJZ A;  5BR8 B;  5LHI A;  4JV5 O;  1XL6 A;  1TUB B;  1US6 A;  5LXT A;  3UCS C;  1FFT B;  1OV9 A;  4JF3 A;  2DMX A;  2XAH A;  3J81 N;  1K73 W;  3C3T A;  2HG5 C;  1YZB A;  2XAQ A;  3HR0 A;  4TV9 B;  4JI0 O;  5C8Y B;  1GN4 A;  5JCO A;  1Q82 W;  4QNH B;  1PM9 A;  4MW8 A;  3Q4H A;  4WBN B;  4PD4 F;  2RJZ A;  3F7V C;  1R3J C;  1VF6 C;  4J7J A;  5EYP B;  3CCL V;  2JEU A;  4I4T A;  3SR2 C;  3D3Q A;  1COW G;  4LBE C;  1WP8 A;  3CD6 V;  2KKW A;  3JAT A;  1QCE A;  5IWA O;  3TXQ A;  2QSA A;  3ZBH A;  3CB2 A;  3ZN1 A;  1S0V A;  3K04 A;  2ZM6 B;  1D2D A;  2BTQ A;  5J2T A;  2D3O W;  1N36 B;  3KCX A;  1MSW D;  3T2M A;  3G6B A;  3CCR V;  2ZIN A;  3E89 A;  4DV3 O;  4NXN B;  4O4H A;  1QLN A;  3AG2 B;  3ABL B;  2WA4 A;  4PV1 B;  1IBM B;  4YIP A;  3K0G A;  1W0J G;  4O2B B;  3E22 A;  3JSL A;  2IM9 A;  4FM2 A;  4DW0 A;  3ZMV A;  4FM0 A;  2Q73 A;  5EBM C;  3QO7 A;  2PZS A;  2R9I A;  3I5D A;  4R6Z A;  4L8J A;  2ZE5 A;  2ZE7 A;  4LF4 B;  5TIS Z;  4J7K A;  1QQC A;  2UUC O;  3M99 B;  4A5U B;  4LH7 A;  1M93 A;  2CGO A;  4H13 B;  4U3J B;  2Y69 C;  3CCM V;  4DR3 B;  4ZHQ A;  1K4C C;  3OM3 B;  4FLV A;  5AG2 A;  1VAR A;  3CE2 A;  4YHH B;  1BHB A;  3BCC H;  3JD4 A;  4OPH A;  1D5A A;  4PA3 A;  4B3T O;  1NTK H;  4TT3 G;  4UVA A;  3FYI B;  1NTM H;  2Q67 A;  3B8N A;  2DWD C;  3H1J H;  1LUW A;  3H1I H;  1M57 C;  2ZT9 B;  2B1G A;  2HP8 A;  4J41 A;  2R70 A;  3C90 A;  4MS2 A;  5A2Q N;  2UXB B;  3CSX A;  4DV5 B;  4X9Q A;  3W7W A;  2R72 A;  5L3F A;  3MAQ A;  1FKA O;  3R66 A;  1BS3 A;  4I55 B;  1XRE A;  4LF9 B;  2CE4 A;  2HEP A;  2ZDI A;  2BSK A;  4OXS A;  1JMK C;  1OCO C;  5KHI A;  1MNG A;  5L3E A;  4I0X A;  4IIJ A;  1AR1 B;  3W7T A;  3AK3 A;  4HBN A;  1RSO B;  3AG4 C;  2Z3Y A;  2FL4 A;  3RBZ A;  3IGA C;  4JI3 B;  4JI4 O;  1KKC A;  3VBB A;  1DF4 A;  4X88 A;  1NJI W;  1OCR C;  1L0L H;  4Z1V A;  3T1H O;  2A0L A;  4RUF A;  2VQE B;  3I56 V;  3JAW B;  1XMO O;  2JVD A;  3E8G A;  3IAY A;  4CS4 A;  4DV1 O;  5IJ0 B;  1SQG A;  3BVO A;  2VQF O;  3BAB A;  5CA1 B;  2N05 A;  2Y69 B;  3RYI A;  1YJW V;  2UUB O;  3RYC B;  3TJT A;  5CBH A;  5L3B A;  4YJ2 B;  2VWK A;  3ABK B;  3X2Q C;  1K4D C;  1VQO V;  1G8M A;  2ADP A;  3E2E A;  4IHJ A;  3MD0 A;  3TET A;  2LGQ A;  1R6K A;  2HLD G;  2JRI A;  3CXH F;  4O4I A;  1QR8 A;  3N2K B;  3CCS V;  1R3K C;  4UFZ A;  3H1H H;  1FD9 A;  2R9R B;  1PKX A;  2ZCE A;  4E4E A;  4XDJ A;  3S3W A;  3ASN C;  1H2K A;  2LO1 A;  3ZRW B;  2N74 A;  3DC5 A;  4ABM A;  3QTC A;  2HHH B;  3L74 H;  1PP9 H;  4JAU A;  5KA5 A;  2XAG A;  4I7Z B;  1W59 A;  2YEV B;  2WLK A;  4DR5 B;  1AB3 A;  3BA9 A;  5BY1 A;  1JFF B;  1Y76 B;  4LFC O;  1MAB G;  3IC9 A;  4DR7 B;  2WLM A;  1NH2 B;  3QG5 A;  1JCH A;  2ZIM A;  4PA4 A;  3K57 A;  1NH2 D;  3K79 A;  2JJ2 G;  4DUZ O;  1E1R G;  1SA0 A;  2IJK A;  4ZBM A;  4MVO A;  2QM8 A;  4GKJ B;  3CC4 V;  2KSD A;  3K59 A;  1HNW B;  1SES A;  2WLL B;  3HKD B;  2QWQ B;  5CA0 B;  1PNK A;  1DF5 A;  5LYJ B;  3W7S A;  4UVC A;  3L72 H;  2XHB A;  4LWS B;  1GAX A;  4DK1 A;  2IJJ A;  1GM7 A;  2WLI B;  4KL1 A;  1H8E G;  2H8P C;  1M56 C;  2UUA B;  3JD3 A;  3FB7 C;  4H33 A;  2P4V A;  2YI9 A;  3FD9 A;  3ZHR A;  4KHP B;  1BQ0 A;  1NT2 B;  4IYH A;  3W7X A;  3LDE A;  1U96 A;  4BR6 A;  2DQ0 A;  1ZSP A;  4JYA B;  3WG7 B;  4O4L B;  1AJN A;  5KMG B;  5LA6 B;  2UXC O;  1OCC B;  1P84 F;  1Q3E A;  3DTU B;  1F4N A;  4UCV A;  3SJQ C;  5JQG A;  4O4J B;  4ZI7 A;  1EN4 A;  4K35 A;  3A8T A;  4X64 O;  1HDJ A;  4LFB O;  2EZP A;  2Q8V A;  1M4U A;  4X89 A;  4I55 A;  3K5L A;  2W0X A;  2XT9 A;  3CJH B;  4R50 A;  1K3E A;  4B3R O;  2HR3 A;  2X6B A;  1ROP A;  1H8H G;  1VQ6 V;  2Q69 A;  5FNV A;  4EB6 A;  3P32 A;  4G27 B;  2LW7 A;  3STZ C;  3ABT A;  1RM1 C;  3BEH A;  5KAI Z;  1YJ9 V;  4FMT A;  4GX2 A;  4Q20 A;  4BIZ A;  2V4D A;  4X20 B;  1IZ3 A;  5FPR A;  5GTI Z;  3OT7 A;  5KX5 B;  5KHG A;  3CC7 V;  2PI4 A;  3RT3 C;  1HP8 A;  5EIB C;  2RMK B;  2IBZ H;  3B2E E;  1FXK B;  3SPJ A;  2Q5Z A;  5H6Q A;  4UV8 A;  1TA8 A;  5D5Q A;  4J9Y B;  3B4S A;  1K7D A;  1GM8 A;  3IJ4 A;  1GN3 A;  2OIG A;  3ZX6 A;  1P49 A;  2QWN B;  2ZR3 A;  4NXM O;  2DN9 A;  3FAV A;  4GX1 A;  4JI8 O;  4MSW C;  4JI6 O;  3F5W C;  2LFR A;  4MVU A;  5IDJ A;  4UCO A;  2EIJ B;  4K8Z A;  4D7S A;  4BIU A;  1FXH A;  5LGN A;  1JVM A;  4IGG A;  3CX5 F;  1QLE C;  3ZRW A;  3CME V;  5KHJ A;  1KB9 F;  1IDS A;  5LXT B;  1XMQ B;  2ZNJ A;  2PTM A;  1X59 A;  4LFA B;  4MW3 A;  1XDC A;  3HB3 B;  2AZ2 A;  4AI8 A;  4WFH A;  3A0B Z;  3SPG A;  2F4V B;  3JD1 A;  1R6T A;  2AZ0 A;  1JFF A;  3Q4H B;  1EFR G;  4I4T B;  1H2G A;  3ETD A;  3TXS A;  3K03 A;  4LF7 B;  1AI5 A;  1AR5 A;  5K1P A;  2E5L B;  3JAT B;  1G4Y B;  4LF6 B;  4PDR A;  1N33 O;  4LF5 O;  1VMG A;  5K1X A;  2BTQ B;  5J2T B;  2JGD A;  1SRY A;  1YCI A;  2EJR A;  2PUS A;  1V9P A;  4DV6 O;  4P2Z A;  3AG1 B;  3SJC C;  1YEW A;  4O4H B;  4UUJ C;  1YVW A;  3FB5 C;  4DV0 B;  2L6L A;  3BFR A;  2UXD B;  1I7F A;  3OTO O;  5EIB D;  3OGC C;  1I94 O;  4QPK A;  2ZNI A;  3FKS G;  4I50 A;  4LCU C;  1KD1 W;  2XND G;  4BW5 A;  3E22 B;  4BAY A;  3FB6 C;  4DR4 O;  3SDL A;  2ATK C;  4LNU A;  3HKC A;  1LNQ A;  4MTX A;  1WA8 A;  5E79 Z;  3U11 A;  2ITD C;  1RPR A;  3OR6 C;  4KFM A;  5LGU A;  2AGA A;  1GN6 A;  1CEZ A;  4K0K O;  4JAS A;  4GKK B;  4GZR B;  3OMA B;  4O4J A;  1SQF A;  1G6U A;  4NVP A;  1MA1 A;  1KU9 A;  1CPY A;  1JQ0 A;  1J5E B;  4B7K A;  4QPJ A;  1OCZ B;  2JS3 A;  4JTD B;  3LNN A;  4LC1 A;  4JI2 O;  2O57 A;  2E74 B;  2H94 A;  4XDK A;  1FS0 G;  1GM9 A;  5LGT A;  1IX9 A;  2L35 A;  3E86 A;  4UVB A;  3AG3 B;  1N32 B;  2A7W A;  4FLX A;  2AHZ A;  3WU2 Z;  2E76 B;  2OIE A;  5LP6 A;  3BRC A;  2JGU A;  4WFF A;  1M5I A;  4DV7 O;  1HR0 O;  4MVM A;  1XNQ B;  4CH4 A;  3K06 A;  1BMF G;  4WFA V;  1NR7 A;  2BSK B;  5B5E Z;  3D36 C;  4DV4 B;  3AK1 A;  3CHX A;  1Q8I A;  4I0X B;  4IIJ B;  4B3S B;  5EK0 A;  2K1E A;  1RP3 B;  4U3F H;  1F4M A;  1ZLZ A;  2EIL B;  1K5Q A;  3MHH C;  4JAA A;  3ZRS A;  1MZF A;  2P4K A;  4MTF A;  2EZO A;  2YUA A;  2YXL A;  3K5N A;  2QE7 G;  3DSQ A;  5KLV H;  4H0L B;  4DXW A;  4LR3 A;  2MK3 A;  3A0H Z;  3EFF K;  4GX0 A;  2Q9L A;  1R3L C;  5B66 Z;  3OEE G;  3ABM B;  3RYI B;  4FFB B;  4R7C A;  2YI8 A;  3F7Y C;  3ZRX A;  2XAS A;  5B3S B;  3JAK A;  1I5Y A;  4JI1 O;  3JAM N;  4O2A A;  1DLB A;  1JJ2 U;  4IHJ B;  4HNA A;  1CXZ B;  1KP3 A;  4JV5 B;  2WA3 A;  3ASO C;  1QVF U;  2QDO A;  2F95 B;  5HFM A;  4O4I B;  4FM1 A;  1IBK O;  4CZZ A;  3ABU A;  2QKC A;  4MTG A;  2DOS A;  4TV8 A;  3TGU H;  4JI0 B;  2X6C A;  1JX9 A;  2P7T C;  3SYA A;  2YIB A;  1GKF A;  2NN4 A;  4OX9 B;  2GUZ A;  1JOY A;  5B1N A;  2XAF A;  1I0H A;  5IWA B;  3UO2 A;  3ICX A;  3N27 A;  3ZMU A;  2EIM B;  3JAS A;  4NXN O;  1KQS U;  1H38 A;  5LMU O;  1VF5 B;  2QKS A;  1IBM O;  1S3J A;  4FLY A;  3T4D A;  4DV3 B;  4DR2 O;  5FLX N;  4H44 B;  1SA0 B;  1ZTE A;  2C2A A;  2ZR2 A;  2A79 B;  1GO3 F;  1URF A;  4QIW F;  1BHA A;  2KG7 A;  1S5L Z;  2YIA A;  4PDV A;  5LHH A;  3LSS A;  2IW5 A;  3ABK C;  2UUC B;  1THZ A;  3E83 A;  2DQ3 A;  5KA6 A;  2UU9 O;  3SYQ A;  4YY3 O;  3CPW U;  3ASO B;  4N21 A;  4FLT A;  2Q0O C;  1EZJ A;  4I5S A;  4FJC C;  4X62 O;  4KUM A;  1VQ7 V;  1ZUQ A;  3AG7 A;  4RO2 A;  2Y48 A;  1QHT A;  3DXR A;  4DV2 B;  5JQG B;  3M8A A;  4BW9 A;  3STL C;  1FFX A;  4ZI7 B;  4I9Q A;  2XUM A;  3LDC A;  5EBW C;  3F5T A;  3L73 H;  4J42 A;  1S76 D;  2OTL V;  4QGP A;  2UXB O;  3CC2 V;  4DV5 O;  1SQV H;  1P4R A;  5KUK A;  3CXC U;  4WCE V;  3MDS A;  3BY6 A;  2YID A;  5GON A;  5FNV B;  4FZ0 A;  4PA9 A;  4EB6 B;  5BMV A;  1FAF A;  3APO A;  4WF9 V;  4DUY B;  3TK1 A;  2BE3 A;  1S77 D;  4GX5 A;  4FLZ A;  5LOV A;  2QWP B;  3R65 A;  4JI3 O;  1YSC A;  2WLN A;  4IL6 Z;  3KCY A;  2VQE O;  3CRQ A;  3D8C A;  1Y6X A;  4JI4 B;  4LF8 O;  5L3G A;  2UXX A;  4FFB A;  2F93 B;  2W6J G;  5IY5 B;  3T1H B;  3K5M A;  1XMO B;  1I08 A;  3CMA V;  1H2M A;  4FVM A;  1B6Q A;  3CRC A;  4DV1 B;  3T1Y O;  2HKO A;  2WPD G;  1P7G A;  2Q7G A;  3FAV B;  1J95 A;  3E8H A;  2PYL A;  3CCJ V;  1G1X B;  3U0Z A;  3WG7 C;  4E2L A;  4NTW A;  1R3I C;  5L3D A;  1HNX O;  2ZQM A;  1KEC A;  1OCC C;  2VS0 A;  5JVD B;  5LL6 Y;  1BQZ A;  1E79 G;  1WPB A;  1NVP B;  4MT8 A;  5IE9 A;  1BSM A;  1NVP D;  1H2S B;  4X66 O;  2YS8 A;  4U7O A;  4EKW A;  5IT9 N;  2E75 B;  1JPX A;  2X6A A;  3RYH A;  3SPC A;  1N0J A;  1KC8 W;  1WJZ A;  2CTP A;  3VOU A;  3ZMS A;  3P30 A;  2V1D A;  2W6I G;  5LHG A;  2IH3 C;  2DW4 A;  3C3S A;  4X1I A;  2ZE6 A;  4KP4 A;  4X1K A;  4DK0 A;  3APQ A;  4LFC B;  4ASU G;  5LP6 C;  2YXH A;  1XI1 A;  3G80 A;  2QGN A;  2JGD B;  3IC7 A;  4B08 A;  2XTA A;  2PYJ A;  3BAA A;  4HYO A;  3JYC A;  4GUN A;  2CTW A;  1AI7 A;  4DUZ B;  4GKJ O;  4DRX A;  1WPX A;  5LMN B;  4JI5 O;  4W4K A;  4I50 B;  1FXK C;  1W0K G;  4HZ3 A;  2LW1 A;  2QJ1 A;  3RN4 A;  5IYD O;  4FLU A;  1T5E A;  1WB8 A;  3GWO A;  4LNU B;  2Q4P A;  4J11 A;  3HKC B;  1YHQ V;  1WA8 B;  1GH6 A;  1UFI A;  3ZHQ A;  4KHP O;  4PDL A;  3QO5 A;  1BE3 H;  3RWR D;  2Z5U A;  1A32 A;  3QVN A;  2EIJ C;  4DYL A;  4OPA A;  4TQF A;  3CCE V;  4JYA O;  1ZAU A;  4ZIB A;  3OUS A;  3K58 A;  2A06 H;  3GWK C;  4X65 B;  4FZ1 A;  3LSQ A;  3SYP A;  1NU1 H;  1P7B A;  2X7R B;  4TUY A;  3ZHS A;  1GN2 A;  4CS3 A;  1V55 B;  5JJN B;  1K33 A;  2UXC B;  3K5O A;  3CCV V;  1R1B A;  5C93 A;  5JCO C;  1SS3 A;  3RYF A;  3UQ8 A;  4NTX A;  2AXT Z;  1RPO A;  4LFB B;  1XHZ A;  2OCH A;  5E1A C;  3W7U A;  2WLJ A;  4ZKI A;  1K34 A;  4H37 A;  4TWK A;  1AI4 A;  1Q6U A;  2ODM A;  2BTO A;  2YC0 A;  5LP6 B;  5ITZ A;  3CYO A;  2GTA A;  4DR6 O;  4MVZ A;  4U7N A;  2CGN A;  4B3M O;  3AG1 C;  2QWO B;  3OE7 G;  2IU3 A;  3ZHT A;  4ZOL A;  1XOU A;  3OGI B;  2CK3 G;  3WFV A;  4AIL C;  3OAA G;  1SQQ H;  3H1K H;  2UXN A;  4FPP A;  2P5O A;  2EJ7 A;  3CRR A;  1KMI Z;  1HNZ B;  3TCU A;  4CBC A;  5KHK A;  1VQ4 V;  4LH6 A;  3HKB A;  1X4T A;  5JVD A;  4UCT A;  4F6E A;  2RCV A;  2HJF C;  4NXM B;  1H2L A;  3VQV A;  1HWY A;  4JI6 B;  2QEX V;  1MOF A;  2BOB C;  1LR1 A;  1N34 O;  3JAK B;  2OTJ V;  2QM7 A;  1XMQ O;  2BCC H;  3CRM A;  4O2A B;  2GSM B;  1OCZ C;  4HNA B;  4OGQ B;  3CCQ V;  4NYK A;  2ARH A;  2XAJ A;  4CH5 A;  2Z0A A;  2NR5 A;  4G28 B;  4TV8 B;  3S3X A;  4PJ0 Z;  3AG3 C;  1Z5V A;  3OUF A;  4LF7 O;  4P9O A;  4PEL A;  3L70 H;  4QJF B;  4DR1 B;  5A9G A;  2E5L O;  2Q6A A;  4QE9 A;  5CB4 A;  4MVQ A;  5CBF A;  2ZE8 A;  4P9P A;  3OFN G;  5EZY A;  1OHH G;  3JCU Z;  2R9A A;  2GUZ B;  2YIB D;  4YXW G;  2OYQ A;  4KXR A;  2LJ2 A;  4CS2 A;  2FKX A;  2ZXW C;  3KZI Z;  4W4L A;  1N33 B;  2ZDI C;  3JAS B;  4LF5 B;  2QA4 V;  4F6R A;  3OMI B;  2JIZ G;  4FIP C;  4G2K A;  3CEI A;  2WLH A;  2UXD O;  4J9Z B;  4RUE A;  1M90 W;  3ZMT A;  2V7Q G;  5KUM A;  2RDC A;  2OWO A;  3D3I A;  5IYB O;  2B9Z A;  2EIL C;  4J7Z A;  4CC5 A;  1SER A;  3OMN B;  4B7E A;  3THO A;  4JYC A;  4AQY O;  3OTO B;  1VQP V;  1B3Q A;  2M7W A;  1L1F A;  2W0F C;  3M7M X;  2VWJ A;  2KG7 B;  2EIN B;  3JD2 A;  5IYZ A;  1UPG A;  3OR7 C;  4DR4 B;  3JSN A;  3ABM C;  2QWR B;  4GKK O;  1K5S A;  1Y67 A;  1S72 V;  1XNR B;  3PJS K;  1PV0 A;  4X1Y A;  2BOC C;  2AHY A;  2DWE C;  2IH1 C;  3B09 A;  1PD3 A;  3GB7 C;  5B3S C;  3QF7 A;  4K0K B;  4HAM A;  4UCU A;  1J5E O;  1EBO A;  3HPL C;  3ZCC A;  2Y4U A;  1E1Q G;  1S5J A;  1FJG O;  5KAF Z;  3DXR B;  1JR9 A;  3J7A U;  5BXZ A;  3E8F A;  1FFX B;  1Y4M A;  4JI2 B;  3P3P A;  4JZG A;  5B1B C;  1D5N A;  4UCS A;  2EBO A;  5IJ9 B;  1N32 O;  1ORQ C;  1Q90 D;  3CRA A;  5FPO A;  3ZHU A;  3CCU V;  4XBF A;  3UO3 A;  2ZXW B;  2EIM C;  1PNL A;  4JI7 O;  3NR7 A;  3ZHV A;  1MG1 A;  1NBM G;  5GON B;  3VQX A;  4WFG A;  3KKY A;  1ZL8 A;  4YIO A;  4DV4 O;  5BMV B;  1HR0 B;  2WAM A;  2P6J A;  1BL8 A;  1JA8 A;  1Y74 B;  3OEH G;  3DGE A;  5LOV B;  2PF4 E;  3JAR A;  1EZV H;  1CP9 A;  4X8A A;  1V54 B;  2LQT A;  1IXB A;  3UT5 A;  1FXV A;  3ZN0 A;  1IBL O;  1GK9 A;  5BR8 O;  2Q0A A;  4J10 A;  2GBO A;  3FX7 A;  2JS5 A;  4MVS A;  3O9O A;  2F23 A;  3L71 H;  1KBH A;  4JTA B;  1VQ9 V;  4JI1 B;  2ZKO A;  1IXM A;  4UXN A;  5B1B B;  2GHY A;  1IBK B;  3L75 H;  5GW7 A;  1OZ0 A;  2ZM6 O;  2DYR B;  5DN6 G;  3RYH B;  1UJW B;  1NTZ H;  1N36 O;  4OX9 O;  1AP6 A;  5H5N A;  2AW9 A;  2FML A;  4K3A A;  5B1O A;  2GV9 A;  3H01 A;  1S5H C;  4X1I B;  5KHH A;  1NKD A;  5HFL A;  4EEQ A;  2PGG A;  4X1K B;  1N0N A;  1AP5 A;  1SQB H;  1Q86 W;  1Q43 A;  5CA3 A;  4MVR A;  5JH7 A;  3SYO A;  3NXS A;  1K9M W;  1N8R W;  5LMU B;  2Y0P A;  1QBZ A;  2RQ6 A;  2Y0I A;  3AEI A;  2CAZ C;  4DR2 B;  4LF4 O;  1BCC H;  1SET A;  3I55 V;  4DRX B;  2Q7E A;  1K97 A;  3JD0 A;  5IY5 C;  2CDY A;  1SF9 A;  4YJ3 A;  3BA8 A;  1O9G A;  4DR3 O;  2H3O A;  2IJI A;  3O65 A;  2WSS G;  3OW2 U;  4YHH O;  1L0N H;  1L8D A;  4CH3 A;  1PNM A;  5B1A B;  2ITC C;  3RGB A;  5J9P C;  3J80 N;  2B5U A;  3U10 A;  1YF2 A;  2JEX A;  2QTS A;  5H2F Z;  3K3W A;  4DW1 A;  2UU9 B;  4B3T B;  3A2F A;  4YY3 B;  4C7U A;  2OCC C;  4DV2 O;  3JAL A;  5IJ9 A;  1YTF B;  4X62 B;  4TUY B;  1YTF D;  2F43 G;  3N2G A;  3T4Z A;  3RYF B;  2HVK C;  4R8C A;  1ZX3 A;  5EBL C;  4LF9 O;  3WB0 A;  2EUL A;  1MSD A;  1BZK A;  5JJE B;  1VEW A;  1VQN V;  4AHC A;  2EX3 A;  1I5X A;  3ETE A;  1KUQ A;  3HKE A;  1Y74 A;  4UB8 Z;  2A9H A;  4DUY O;  2JK5 C;  1DK1 A;  5ITZ B;  5GTH Z;  1SC5 B;  1XEQ A;  1K8A W;  1QVG U;  1KYO F;  1VQ5 V;  1YDX A;  2NLJ C;  4WFE A;  1EN5 A;  5BZB A;  4RQF A;  3VQW A;  1M9N A;  1O9H A;  4RWU A;  3G71 V;  4ZOL B;  1KKD A;  3B8M A;  1VQ8 V;  3E35 A;  2LGW A;  4JZ2 A;  4PA7 A;  2FYU H;  1GMG A;  5JWP A;  3SJA C;  1PL4 A;  1TVK A;  1PL0 A;  4DO2 A;  3SPH A;  2VQF B;  2VRZ A;  2CH7 A;  2IJH A;  4Q6G A;  4LF8 B;  5J2U A;  2RNB A;  3T1C A;  2UUB B;  3EXA A;  2G38 A;  1HW7 A;  4PI2 A;  2ILM A;  1TUB A;  3A0R A;  3H1L H;  2X0L A;  1NR1 A;  1ENV A;  3HKB B;  3G67 A;  3LSU A;  1YXB A;  3T1Y B;  1FYJ A;  5FL7 G; 
#chains in the Genus database with same CATH homology
 3ABL B;  3AG1 C;  2OCC B;  1TUE B;  4QPJ A;  1OCZ B;  3OE7 G;  2IU3 A;  3K0G A;  1W0J G;  1V55 C;  4JTD B;  4LC1 A;  2CK3 G;  3WFV A;  3ZMV A;  2H94 A;  3UM7 A;  3OAA G;  4XDK A;  3EHB B;  5EBM C;  3QO7 A;  2UXN A;  4FPP A;  1M57 B;  1FS0 G;  2R9I A;  1GM9 A;  3K0D A;  4R6Z A;  1ARO P;  5LGT A;  3ZMZ A;  3E86 A;  4UVB A;  3AG3 B;  1Q7Y W;  3M99 B;  3TCU A;  4CBC A;  1AJP A;  2AHZ A;  5H6R A;  1VQ4 V;  1F51 A;  4QE7 A;  2Y69 C;  4MTO A;  4WFF A;  3CCM V;  1K4C C;  5IYC O;  3OM3 B;  4MVM A;  3QNE A;  2HJF C;  5LBQ A;  3D36 A;  1OCO B;  3K06 A;  1BMF G;  4WFA V;  1HWY A;  1BHB A;  1NR7 A;  3JD4 A;  2QEX V;  1MOF A;  2BOB C;  3JCZ A;  4PA3 A;  2OTJ V;  2EIK C;  2QM7 A;  4TT3 G;  5DM6 V;  2GSM B;  4UVA A;  3FYI B;  2YSU B;  1OCZ C;  3MHS C;  3AG4 B;  4Z1M G;  5EK0 A;  3CCQ V;  2K1E A;  1F4M A;  2Q67 A;  2XAJ A;  3B8N A;  2EIL B;  1K5Q A;  2DWD C;  3MHH C;  3ZRS A;  1OCR B;  4MTF A;  1XL4 A;  4G28 B;  2EZO A;  1M57 C;  2QE7 G;  2B1G A;  3AG3 C;  3OUF A;  4MS2 A;  4P9O A;  4PEL A;  4QJF B;  5CBG A;  4DXW A;  2Q6A A;  1JQ0 A;  2MK3 A;  3EFF K;  4GX0 A;  4QE9 A;  3W7W A;  1R3L C;  4MVQ A;  5L3F A;  5CBF A;  4P9P A;  3OEE G;  3ABM B;  3OFN G;  1OHH G;  4R7C A;  4YXW G;  2ZDI A;  3F7Y C;  3X2Q B;  3ML0 A;  2XAS A;  4OXS A;  3ZRX A;  2ZXW C;  1OCO C;  5B3S B;  1I5Y A;  2ZDI C;  2QA4 V;  3RVY A;  5L3E A;  3OMI B;  1DLB A;  1JJ2 U;  4XDL A;  1AR1 B;  2JIZ G;  3W7T A;  1KP3 A;  4FIP C;  4G2K A;  3ASO C;  1QVF U;  2QTO A;  2WLH A;  3RVZ A;  4J9Z B;  3AG4 C;  2Z3Y A;  3E8B A;  4RUE A;  5HFM A;  3ZMT A;  1M90 W;  2V7Q G;  3RBZ A;  3IGA C;  5KUM A;  3ABU A;  4CZZ A;  3D3I A;  5IYB O;  3B77 A;  3VBB A;  2EIL C;  3ASN B;  4MTG A;  1SER A;  3OMN B;  1DF4 A;  4X88 A;  1NJI W;  1OCR C;  3ZMU A;  2A0L A;  2Q68 A;  4RUF A;  3I56 V;  4JYC A;  1VQP V;  3IFX A;  3G6E V;  3E8G A;  2X6C A;  1JX9 A;  2M7W A;  2WWW A;  1L1F A;  1QLN A;  2P7T C;  1VQK V;  3SYA A;  2W0F C;  1AI6 A;  1GKF A;  2EIN B;  3JD2 A;  1YIT V;  3OR7 C;  2Y69 B;  1YJW V;  1JOY A;  3ABM C;  5B1N A;  2XAF A;  5CBH A;  5L3B A;  1QR9 A;  1K5S A;  1S72 V;  3ABK B;  3PJS K;  4GT1 A;  1K4D C;  2EIM B;  3X2Q C;  2BOC C;  1G8M A;  2AHY A;  3UKM A;  2DWE C;  2NNU A;  1VQO V;  2IH1 C;  3E2E A;  5CN0 A;  1PD3 A;  3GB7 C;  5B3S C;  2EIK B;  3MD0 A;  4HAM A;  5H9C A;  3TET A;  2P90 A;  1KQS U;  1H38 A;  1R6K A;  2HLD G;  2B1I A;  2QKS A;  1DTO A;  1QR8 A;  1EBO A;  3HPL C;  3CCS V;  1S3J A;  1R3K C;  3ZCC A;  3T4D A;  1E1Q G;  3LUT B;  2R9R B;  1PKX A;  4XDJ A;  3ASN C;  2P67 A;  3FB8 C;  3ZRW B;  2C2A A;  1AJQ A;  2ZR2 A;  2A79 B;  1GO3 F;  4QIW F;  3E8F A;  3SPI A;  3LDD A;  1Y4M A;  3FYE B;  1BHA A;  5B1B C;  3QO8 A;  2EBO A;  4JAU A;  1ORQ C;  5KA5 A;  2EIN C;  2XOK G;  2XAG A;  4FK5 C;  4PDV A;  5LHH A;  2KB1 A;  2YEV B;  2WLK A;  3LSS A;  2LP7 A;  3CCU V;  1MAB G;  4XBF A;  1R6N A;  1M56 B;  2ZXW B;  2IW5 A;  2WLM A;  3ABK C;  1THZ A;  2EIM C;  3E83 A;  1NH2 B;  1PNL A;  2DQ3 A;  5KA6 A;  1KP2 A;  4RQE A;  1MG1 A;  1NBM G;  1JCH A;  4PA4 A;  3SYQ A;  3CPW U;  1Y66 A;  4WFG A;  1NH2 D;  3K79 A;  3ASO B;  4WFB V;  4N21 A;  1EZJ A;  2JJ2 G;  4I5S A;  4I9W A;  1E1R G;  4FJC C;  2FTK A;  2ZD9 A;  2IJK A;  2WAM A;  4KUM A;  1VQ7 V;  2P6J A;  1W2B U;  5L3C A;  1BL8 A;  4ZBM A;  1K92 A;  2HVJ C;  3OEH G;  2HFE C;  3DGE A;  4RO2 A;  4MVO A;  2Y48 A;  1CP9 A;  4X8A A;  1V54 B;  5CMU A;  2QM8 A;  3STL C;  3CC4 V;  1SES A;  2WLL B;  3LDC A;  5EBW C;  4F4L A;  1S76 D;  1FXV A;  1PNK A;  3ZN0 A;  1DF5 A;  2OTL V;  2YEV A;  3K9A A;  3W7S A;  1YI2 V;  5EC2 C;  4UVC A;  1GK9 A;  3CC2 V;  5KUK A;  1P4R A;  3RW0 A;  2IJJ A;  1GM7 A;  3CXC U;  4WCE V;  2WLI B;  1H8E G;  2H8P C;  1M56 C;  1VQM V;  3BY6 A;  1WLE A;  3JD3 A;  3FB7 C;  4H33 A;  3KG2 A;  4PA9 A;  3W7X A;  4MVS A;  3LDE A;  1RM1 B;  4WF9 V;  1NQT A;  2DQ0 A;  3TK1 A;  4JTA B;  3WG7 B;  1VQ9 V;  1S77 D;  4PDM A;  4GX5 A;  1AJN A;  1OCC B;  3DTU B;  3SJQ C;  1F4N A;  4L87 A;  3R65 A;  4TSF G;  1IXM A;  1YSC A;  4UXN A;  1V54 C;  2WLL A;  2DYS C;  2WLN A;  5EC1 C;  4UV9 A;  5B1B B;  2GHY A;  2EZP A;  1VQL V;  4X89 A;  5GW7 A;  4PA6 A;  5L3G A;  2UXX A;  2W6J G;  1OZ0 A;  4JAV A;  2DYR B;  5IY5 B;  4R50 A;  5DN6 G;  1UJW B;  1K3E A;  4N23 A;  1GTO A;  2HR3 A;  2X6B A;  3CMA V;  2WLI A;  1ROP A;  1H8H G;  4JPR A;  1VQ6 V;  1B6Q A;  3LNM B;  2Q69 A;  4JTC B;  3K08 A;  5B1O A;  3P32 A;  4G27 B;  2HKO A;  2WPD G;  3H01 A;  1Q81 W;  3ETG A;  4JYB A;  3G4S V;  1S5H C;  1J95 A;  1NKD A;  3ABT A;  3E8H A;  3BEH A;  5HFL A;  3STZ C;  4FMT A;  1RM1 C;  1YJ9 V;  4GX2 A;  1Q86 W;  4Q20 A;  3SYC A;  3CCJ V;  1R73 A;  4BIZ A;  5CA3 A;  3WG7 C;  2OT5 A;  4E2L A;  1QLE B;  1R3I C;  2JJ1 G;  4MVR A;  5L3D A;  2ZQM A;  1KEC A;  1OCC C;  1E79 G;  3SYO A;  3NXS A;  1K9M W;  3CC7 V;  2PI4 A;  1N8R W;  1NVP B;  3CP1 A;  4MT8 A;  1QBZ A;  3AEI A;  1NVP D;  3ZRV A;  1SET A;  4U7O A;  4EKW A;  3I55 V;  1FXK B;  1JPX A;  2X6A A;  3SPJ A;  1K97 A;  3SPC A;  5H6Q A;  4UV8 A;  3JD0 A;  2DYR C;  2LFS A;  5IY5 C;  1KC8 W;  4J9Y B;  3VOU A;  1F23 A;  1ZWI C;  3ZMS A;  3P30 A;  1K7D A;  1GM8 A;  2V1D A;  2W6I G;  2IJI A;  2WSS G;  3OW2 U;  5LHG A;  2IH3 C;  2ZR3 A;  2DW4 A;  4P30 A;  2PI5 A;  5FL7 G;  4GX1 A;  1PNM A;  4JGS A;  4KP4 A;  4MSW C;  5B1A B;  4LP8 A;  3F5W C;  2LFR A;  1M1K W;  4MVU A;  5IDJ A;  2ITC C;  2EIJ B;  2IU0 A;  4ASU G;  4BIU A;  3ZIA G;  5J9P C;  2B5U A;  1FXH A;  5LGN A;  1JVM A;  2JEX A;  1QLE C;  3ZRW A;  3CME V;  3K3W A;  3IC7 A;  3AG2 C;  2DYS B;  4RAI A;  3ABL C;  4HYO A;  3JYC A;  2OCC C;  4GCZ A;  4MW3 A;  1YTF B;  1AI7 A;  3HB3 B;  1FXK A;  1WPX A;  4WFH A;  3SPG A;  2F43 G;  1YTF D;  1FXK C;  3JD1 A;  1W0K G;  1EFR G;  1SZT A;  4HZ3 A;  3T4Z A;  1H2G A;  2HVK C;  2JDI G;  3ETD A;  4R8C A;  3K03 A;  5IYD O;  1AI5 A;  5EBL C;  1YJN V;  1G4Y B;  3GWO A;  1YHQ V;  4PDR A;  1VQN V;  5B1A C;  4PDL A;  1YIJ V;  1I5X A;  3QO5 A;  3ETE A;  3ZJZ A;  5LHI A;  2Z5U A;  2EIJ C;  1XL6 A;  2A9H A;  2JK5 C;  1SRY A;  3CCE V;  2EJR A;  3OUS A;  1FFT B;  1K8A W;  4JF3 A;  1QVG U;  4P2Z A;  2XAH A;  1K73 W;  3AG1 B;  2HG5 C;  4UUJ C;  3LSQ A;  2XAQ A;  3SYP A;  1VQ5 V;  1P7B A;  3FB5 C;  2NLJ C;  4WFE A;  2X7R B;  5BZB A;  3OGC C;  4QPK A;  1V55 B;  4RQF A;  1K33 A;  3FKS G;  1M9N A;  1Q82 W;  4QNH B;  3CCV V;  4LCU C;  4MW8 A;  1KD1 W;  3G71 V;  2XND G;  4BW5 A;  3B8M A;  5C93 A;  1KKD A;  3F7V C;  3CCL V;  1R3J C;  1VQ8 V;  2JEU A;  3E35 A;  4BAY A;  3FB6 C;  4PA7 A;  1GMG A;  1COW G;  4LBE C;  1PL0 A;  3CD6 V;  1RPO A;  1QCE A;  2ATK C;  4DO2 A;  1LNQ A;  3SPH A;  4MTX A;  5E1A C;  3W7U A;  2IJH A;  2ITD C;  3ZN1 A;  1RPR A;  3OR6 C;  1S0V A;  2WLJ A;  4KFM A;  5LGU A;  4ZKI A;  3K04 A;  3T1C A;  1K34 A;  4H37 A;  1CEZ A;  4TWK A;  1AI4 A;  4JAS A;  2D3O W;  3A0R A;  2X0L A;  1MSW D;  1NR1 A;  3T2M A;  1ENV A;  3CYO A;  3OMA B;  3CCR V;  3E89 A;  4MVZ A;  4U7N A;  1CPY A;  3AG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...