3I56V

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i56V00
1K9MW 1KQSU 3CC7V 3CMAV 3G4SV 1VQ5V 3CCSV 1Q82W 2OTLV 1QVGU 1NJIW 3CXCU 4WFBV 1VQ6V 1VQOV 1N8RW 1QVFU 1VQKV 1R73A 1YJ9V 1VQPV 4WFAV 2D3OW 3CCRV 1Q86W 3OW2U 1VQ9V 3CCJV 3CCQV 1YHQV 2QA4V 1K73W 4WCEV 1S72V 3CC4V 1YIJV 5DM6V 3G71V 1YJNV 1VQNV 3CCEV 3CD6V 2OTJV 3I55V 3G6EV 1YI2V 1KD1W 3CPWU 1VQMV 1M90W 3CCUV 1Q7YW 1K8AW 4WF9V 3CCLV 1VQ7V 1VQLV 2QEXV 1W2BU 1Q81W 3CC2V 1M1KW 1KC8W 1YITV 3CCMV 1YJWV 1VQ4V 3CMEV 3CCVV 1VQ8V 3I56V 1JJ2U
chains in the Genus database with same CATH superfamily
1K7DA 2ZNJA 2GUZA 1Q82W 1IXMA 3AG7A 2JK5C 1I94B 4W4LA 3LSSA 3CWBH 3LDDA 1YIJV 4B3RO 5DECA 4PA6A 4WFHA 4JI2O 2UUCO 2WAMA 1Q6UA 2EILB 4AQYO 2YIAA 2R9RB 1RM1C 1CXZB 4W4KA 3CXHF 2W0XA 2E3CA 1KP2A 2WLLB 5L3EA 3Q4HA 4DUZO 5KAFZ 4PDRA 1H2MA 1H8HG 2CGNA 3B2EE 2FTKA 1YZBA 3SPHA 1LUWA 2GDSA 3JARA 3FB5C 1Z2GA 3SJQC 1IXBA 4O4JB 5CBFA 4HAMA 1UJWB 4UB8Z 5IYZB 5KX5B 1RPOA 2ZXWB 3P3PA 2UUBB 3TJTA 1NH2D 2GSMB 1G6UA 3UT5A 4BIUA 4Q6GA 3SPJA 1NVPD 1WLEA 4CH4A 3JAKA 2P67A 1AP5A 5J2TB 1NVPB 4TV9B 4JI6B 5JQGA 1WA8A 5KA5A 1B06A 3BFRA 3IFXA 1Y6XA 4UFZA 4YHHB 4QGPA 1SERA 4QPKA 4DV4B 3OT7A 3ZHUA 1HNZO 3B8MA 4MW8A 1I08A 3F5WC 3U10A 2EIKB 4IGGA 4ZKIA 3JASB 3VQYA 3K5LA 3G6EV 4X88A 3DSQA 1N36O 2FKXA 1ZSPA 3RW0A 4DR1O 2Q6AA 1QNMA 3JATA 5LYJB 4ZOLB 4JI1B 4MVMA 1HR0B 2EZPA 3I5DA 3A0RA 1W59A 1JA8A 2Z0AA 3T1HB 1QVFU 1SA0B 4RQEA 1NZ6A 3P30A 5CB4B 3QF7A 2DQ0A 2KB1A 4KHPB 3K79A 4CC5A 5IYBO 4O2AB 1XHXA 4TQFA 4DR2B 4Q20A 5B66Z 4X20A 1AROP 1E79G 4DV7B 1AI4A 1Y67A 4CH6A 5EBMC 2VQFO 5LMNB 4K8XA 5EIBC 5FNVA 2ZE5A 3GVMA 4G28B 4LF5B 2JS5A 1SESA 4X62O 2WLKA 1BQ0A 1KBHA 3A2FA 5IWAO 4YJ3B 3ZRXA 3CP1A 5LBQA 1FS0G 1TVKB 4R8CA 2BE3A 5GONB 4B3TB 3FB6C 3X2QC 4GCZA 5B1OA 4JI7O 2YICA 1H2NA 1AVMA 4DR6B 3ZHSA 3RYFB 2ZNIA 1Q7YW 5B1AC 3HKEB 3OMAB 2VS0A 2EJ7A 2NN4A 1XL4A 2PI5A 1K5SA 3EXAA 2ZKOA 1DTOA 4DR3O 4MTOA 5KAIZ 1Q86W 3OMNB 2E75B 3N2KB 3L70H 4UVBA 3AK3A 2ATKC 1NU1H 2VQEO 2JGUA 2WLLA 4K3AA 3E83A 4OPAA 3THOA 5B5EZ 3WFVA 4H13B 3FAVB 1SQQH 4FMTA 4X65B 1OCOC 4O4JA 1D2DA 2XAQA 5F2VO 2QR4A 5IYZA 5KX5A 1DF5A 2ITDC 1PL0A 4OPHA 4FLYA 1AJPA 4HNAB 4FLXA 4B3SB 5IYCO 4UCRA 3RGBA 1I5XA 1M56B 3W7UA 3D3QA 1FJGO 3C90A 4NYKA 4K8ZA 1BCCH 2BTQB 2EIJB 1G4YB 3GB7C 5J2TA 4IYIA 4TV9A 5CBGA 1F23A 4U3JB 1H2LA 3LDEA 3RN4A 5KHHA 1PNLA 1IBKO 1VARA 1Y74B 2JJ1G 5L3DA 4DR7B 2DWDC 1P4RA 1BHAA 2B1IA 2Q7HA 3JASA 4NTYA 2Q67A 3BA9A 3S3WA 3CJHB 3RBZA 4QE9A 3CHXA 5LYJA 1VF5B 4ZOLA 3M8AA 3ETDA 4X66B 1VP7A 2OYQA 1ROPA 3AG1B 2CGOA 1XNQO 1YVWA 4ABMA 1SA0A 1FXKC 5CB4A 3F5TA 3K03A 4UCTA 2D2CB 2RQ6A 1SZTA 4ICGA 4LF6B 2QWOB 4GKJB 3RYHB 4J7KA 3D36A 4O2AA 4QIWF 5LA6B 1GN2A 3CRMA 1MA1A 1VQ7V 4U7NA 1SRYA 1MZFA 5IT9N 2UUAB 3TETA 4DV3O 5LMUB 5IJ0B 2RN9A 3VQWA 2UXCO 1N33O 4LBEC 2Q7GA 5FLXN 2JRIA 2IM9A 1HP8A 4MTFA 2KQXA 2LFSA 3SPIA 4YJ3A 3KKYA 1BL8A 2ZDIA 2A3QA 2QWNB 4F6EA 4PA3A 2JVDA 2ZCEA 4CC6A 2LW7A 4PELA 3LSQA 3W7TA 1TVKA 4DRXB 2E5LO 4LF4B 5GONA 1KKCA 2EZOA 2Y48A 3ZMVA 4DW1A 3ZBHA 3TXQA 4DW0A 3GWOA 3RYFA 2PF4E 4ZI7B 2DYRB 1AR1B 5KHIA 3HKEA 4DV6O 4JI3O 2YUAA 3WB1A 2YSUB 2QM4A 5K1PA 1YEWA 2GBOA 3B77A 1V54B 1HW7A 4FM1A 4LF7B 1FPOA 3N2KA 4MW3A 1JFFB 4CS4A 5BR8B 1Q43A 2ODMA 3UCSC 1AI5A 3CCUV 3OEEG 5LOVB 4JPRA 5L3CA 3FAVA 1J5EB 1XUQA 3CCMV 3ZHRA 3AG2C 5JJEB 1VQ5V 2DYSC 4YXWG 2PGGA 1JQ0A 1IURA 3T4DA 2ZINA 5L3GA 4HNAA 4BW9A 3SR2C 1R3KC 4NB5A 1V9PA 1Q3EA 3KG2A 3APQA 3ABLB 2PZSA 1IBMB 3JYCA 4JI4O 2BTQA 3SYOA 2OCHA 1OCZC 4MTXA 2UXXA 2WLIB 1N34O 2E74B 5H6RA 4U3JA 3CX5F 1D5NA 4K0KO 4D6TH 4UB6Z 1QQCA 2AXTZ 3APOA 3AG4C 1Y74A 4LFCB 1IX9A 4TOIA 4RWUA 1WNSA 3QG5A 1LNQA 3ASNC 2WWWA 4DR4B 4JTCB 3CJHA 3E35A 5EC2C 1M57B 4RUEA 1FFTB 3J7AU 4PHZA 1PNKA 2NLJC 5H6QA 4RO2A 1S0VA 1I7FA 2AZ2A 3A0BZ 4B3MB 2XNDG 5B1BC 2UXDB 2ZQMA 5BZBA 1NBMG 1K3EA 1FXVA 1JVMA 2IJJA 3HKDB 3AG3B 1N0JA 5KUMA 5CMUA 3OUFA 4HYOA 3RYHA 5LHGA 4GKKB 2E76B 3IGAC 3MHSC 2ITCC 3H1KH 4TT3G 5LA6A 2K1EA 3OUSA 3JCZA 2EINC 2F4VO 3CCEV 4MVZA 5C8YB 2YIBD 3CEIA 4GUNA 2P4KA 3KZIZ 3TXSA 1VEWA 1TUBB 3ZX6A 5IJ0A 4FLUA 2ARHA 4TUYB 4FLTA 1Y76B 2Q4PA 1EN4A 4PV1B 3T1YB 4PI2A 2QE7G 4NXNO 2ZM6B 4DRXA 2F95B 5KHKA 4UXNA 1PD3A 5B3SC 5KHJA 4O4LB 2Q8VA 4CS2A 2DMXA 4O4IB 3CRRA 4ZI7A 1HNWO 1VMGA 2Z5UA 3WB0A 5GW7A 5JCOA 2ETNA 4LFBO 2XASA 1JOYA 2X6CA 2X0LA 2Y0IA 4G2KA 4U7OA 2QDOA 5ITZB 2PUSA 2UXBB 3IC7A 4XDLA 1MNGA 2IJKA 2X7RB 3BVOA 5EYPB 4LP8A 2Z3YA 2QKAA 2VWKA 5B1AB 1JFFA 1AP6A 4XBFA 1GN4A 1XMOO 3B09A 3CCSV 2JJ2G 1QU7A 3T2MA 1JJOA 1LR1A 1MG1A 1GN6A 1OCCB 5LOVA 5D5PA 3OMIB 4KXRA 5H5NA 2UU9O 1KKDA 3VOUA 4MS2A 2RCVA 2QKSA 5EC1C 2QTSA 4FZ0A 1JJ2U 4FM0A 1K34A 3OR7C 5GTHZ 2A9HA 3E8HA 2A0LA 1VQ9V 1OCOB 3BEHA 3PN1A 1QHTA 1WP7A 3N27A 2W0FC 3P32A 4DR1B 5KLVH 4E2LA 2WLIA 2YEVB 3DC5A 1KQSU 3K3WA 3K5MA 1R6TA 4JYBA 4I50B 2OCCC 3DXRB 2NR5A 1KD1W 3CPWU 4WF9V 1F51A 2W6JG 2DE0X 5C93A 1R1BA 4EKWA 3CCVV 2X6AA 3G67A 3M7MX 4FLWA 5IE9A 4JAAA 4TQDA 1I94O 2Q0OC 4E4EA 4J9ZB 3SJAC 2QWQB 1W0KG 3E8GA 3ABKB 1U96A 1Q90D 2IBZH 2N04A 3HKCB 3HKDA 2HG5C 2AHYA 4DV0B 4H44B 1WPBA 1QLNA 3E22B 4JYCA 3W7WA 1AILA 4YIPA 5CBHA 4PJ0Z 3ZJZA 1FXKB 4WFAV 3CYOA 5JJJB 5C8YA 4FK5C 1VF6A 4J7ZA 1XBLA 2XTAA 1TUBA 2P90A 3RVYA 2YIBA 2V1DA 4TUYA 1Y76A 1R3IC 3OTOB 1U97A 1PL4A 2UUBO 3RYIB 5CA0B 1ZUQA 4BAYA 2RMKB 4DR3B 4IHJB 3JD4A 4O4LA 1XNRB 4O4IA 4PDMA 3N2GB 1GO3F 2ILMA 4JI6O 2IH1C 3ASOC 4UV9A 4YHHO 4PI0A 4DV1O 2ZE8A 1H2GA 2HKOA 4DV4O 1L1FA 3RT3C 1ENVA 1OZ0A 4RUFA 3JAWB 1S77D 4H0LB 5ITZA 5BXZA 3HPLC 3ZHQA 4F6RB 1XHZA 4B7EA 1GM8A 5EYPA 4MVSA 2QEXV 1N32B 1OCRC 3ML0A 5HFLA 1E1QG 1ZWIC 3M99B 4JI1O 1FJGB 1HR0O 3VQXA 2F93B 4ASUG 2WSSG 4JF3A 3T1HO 3ABMC 4CH5A 4PDLA 1GH6A 2QJ1A 3CCRV 4JYAB 1PPJH 2Y69C 4JGSA 3K9AA 2CTRA 3J81N 3OEHG 4KHPO 5JVDB 2ZR2A 1W0JG 1MSWD 1VQ8V 1JPXA 4DR2O 3MHHC 1AJQA 1XI1A 3HR0A 2KKWA 1MMMA 1NS1A 4DV7O 3FYIB 4UUJC 1K5QA 3SJCC 4YIOA 5LMNO 4R6ZA 1Y66A 4N23A 2YEVA 2EILC 3ZS8C 1N4CA 2OT5A 4LF5O 2JIZG 5B1NA 2A06H 4B08A 4I50A 1THZA 1VQLV 4IL6Z 1R3LC 1GRJA 1GN3A 1TGOA 1OCZB 1US6A 4DK1A 3DXRA 4JAUA 4NXMB 1CEZA 3SYQA 4B3TO 1V55B 2Q0AA 4LH7A 2JGDB 4G27B 3AG4B 4NKGB 2ZXWC 4UCVA 4DO2A 1VQMV 4DR6O 1DK1A 3CCLV 4DV2B 1TAEA 5IJ9B 5E79Z 4ZBMA 1I5YA 1GKFA 1ZAUA 1SS3A 1I0HA 1HNXB 3HKCA 2XT9A 2PYJA 3WG7C 5DM6V 5KUKA 3ZMUA 3IC9A 3JD2A 3ABUA 1E1RG 3AEIA 3E22A 3QO8A 5B1BB 2V4DA 3QVNA 1FXKA 3E89A 1FFXB 4RAIA 1F4NA 3C3TA 3K5OA 2JEUA 5EZYB 3H1LH 4X65O 3EFFK 2N05A 4GX2A 2Q7EA 4R7CA 4DUYB 2EINB 3RYIA 2EULA 5CA0A 1S5HC 2ZIOA 5D5QA 4B7KA 3MAQA 2YI8A 1DGSA 4B3SO 3L75H 1Q6IA 2XUMA 3CMEV 1IDSA 4LWSB 3K0DA 3STZC 4X64B 4IHJA 3CC7V 3HB3B 2B1GA 1WJZA 3CXCU 1RP3B 4I55B 4I9QA 1K92A 2MK3A 3ZRWB 3SGIA 1YXBA 3CS5A 4JASA 1T5EA 1P84F 3N2GA 3FD9A 4CS3A 2PYLA 4JI8O 4O2BB 3D36C 4UVAA 5HFMA 2CK3G 1PKXA 5JJNB 1P49A 2ZT9B 4LF8B 3K58A 4EFBA 1R3JC 3JAWA 3I56V 5B3SB 5L3BA 3TGUH 4LCUC 3JAMN 3E8BA 1Q5OA 4JTAB 1BSMA 4F6RA 1EFRG 3K08A 2Q69A 1B6QA 2ZDIC 4X66O 4DV5B 2YXLA 4LFAB 1G8MA 3L74H 5L3FA 3G4SV 3ZHVA 3A0HZ 2F66C 4X1KB 1K97A 4EFEA 1O9GA 1SQFA 1LUVA 2FB5A 5JVDA 5CA1B 1EZVH 2FMLA 4LF6O 4GKJO 4LF9B 1URFA 1XDCA 4X9QA 1M1KW 3BY6A 4GX1A 1YSCA 1Z5VA 4P9PA 4DR5B 1RM1B 3LDCA 2UUAO 4JI0B 1XMQB 5LMUO 5LGUA 2H94A 3OAAG 1R73A 5J9PC 5K1XA 2ADPA 2QWPB 5LXTB 1YHQV 2QGNA 1YCIA 3STLC 4FFBB 4BR6A 4KFMA 5H2FZ 1GMGA 1PP9H 4A5UB 4LF4O 4X89A 3RVZA 4D7TA 4CBCA 2JGDA 2YXYA 3ZHTA 3JALB 1BMFG 1Q8IA 2F4VB 4MVQA 2PTMA 1IBLB 3H1HH 1SZXA 3AK2A 5IJ9A 1AR5A 1XREA 1M56C 3OTFA 2LO1A 4PD4F 4DK0A 4JI5B 3P3NA 1YJWV 1VQ4V 3ZMZA 2EIJC 2IJIA 1NTZH 5BMVB 1QVGU 1WB7A 2F43G 4WBNB 4LF7O 1YF2A 4OX9B 3CRQA 2B9ZA 5A2QN 5BR8O 2JDIG 4GX5A 3SPGA 1NKDA 1M90W 4JV5B 3TK1A 3CSXA 4U3FH 1FFXA 1S5JA 1SQXH 3OGCC 2L6LA 5LP6C 4DXWA 1J5EO 4AHCA 5EZYA 2CE4A 3J80N 1S3JA 3CMAV 2HP8A 2OTLV 3WB2A 3D3IA 2AW9A 4FLVA 1EM1A 4P30A 1D5AA 2DOSA 1ZX3A 1EN5A 2EIMC 2Q5ZA 3O65A 2HHHB 2P22C 1NTMH 4YY3B 3AG1C 3ZMSA 4LWSA 3QO7A 1W2BU 1J95A 1IBMO 4XDKA 1EZJA 1XL6A 1NTKH 2CTPA 4I55A 4FVMA 3ZRWA 4PA4A 4TSFG 1VF7A 1NJIW 5JWPA 4MT8A 4O2BA 1IVSA 2LW1A 2BCCH 1S5LZ 4MTGA 2GTAA 4B3RB 2AHZA 4MVRA 3OGIB 4LFCO 5EIBD 2MW2B 4JI2B 2UUCB 4GZRB 4JZGA 1CP9A 1BT8A 2EX3A 4AQYB 4PA7A 2UXNA 3ABTA 1QLEC 4ZHQB 4FIPC 4OGQB 3ASOB 4DR4O 2XHBA 1VQ6V 3H01A 3JD0A 2WLMA 2DQ3A 4DUZB 3FKSG 1YTFD 4UV8A 4H37A 3UKMA 5KA6A 5LHIA 2XAHA 1HWYA 4B3MO 3B40A 2B5UA 4Z2WA 1YTFB 3X2QB 2UXDO 1QR8A 1K8AW 4X1KA 4Z1MG 3FB8C 4EB6B 4JAVA 3DGEA 4ZIBA 2CH7B 2AZ0A 5CA1A 2LFRA 2BSKB 2DYRC 1VQKV 4I9WA 4GKKO 4MVUA 3CB2A 3TCUA 5EBWC 3UQ8A 3ABMB 1S72V 2Y4UA 2ZD9A 5JCOC 2IJHA 3VQVA 3SYPA 3OFNG 3H1JH 2GV9A 2WLHA 5LXTA 3F7YC 1HNZB 4PDVA 5BY1A 3T1YO 1M93A 5KHGA 4AILC 4FFBA 2YXHA 3ETGA 3FB7C 1WN7A 1N36B 2ZM6O 4IT5A 1M5IA 3OM3B 2W6IG 2R9AA 3JALA 1KECA 1NQTA 2WA3A 2LP7A 1KYOF 1P7GA 1XEQA 1NI8A 1Q6HA 2YIDA 3ABLC 4GT1A 3VBBA 3UM7A 1TA8A 4LNUB 1K4CC 3F7VC 2UXBO 5BMVA 4WBNA 1RFYA 4YJ2B 1NH2B 3ZN1A 5IYDO 5AG2A 3QO5A 2OWOA 2VQFB 3CCJV 1F4MA 3R66A 1NT2B 3WG7B 1L0NH 4BW5A 4X62B 4GYCB 4QPJA 5IWAB 1PNMA 3CC2V 1K33A 1M57C 4DV1B 4EEQA 1SF9A 2C2AA 5JH7B 3SDLA 3S3XA 4NTWA 4TWKA 4JI7B 2LQTA 4WCEV 1COWG 4HBNA 4JYYA 3BHPA 2RJZA 3AG3C 1B3QA 4X1IB 1S76D 1L8DA 2XOKG 4UCSA 4BIZA 2IH3C 4I7ZB 4K35A 2QWRB 1SKVA 2QSAA 1BGYH 4D7SA 1VF6C 4LR3A 3CC4V 3I55V 1DLBA 1JMKC 4ZHQA 4R50A 4FPPA 4I5SA 1GTOA 5IY5C 4N21A 4X1YB 4I0XB 2VQEB 4HZ3A 1Z5WA 2RNBA 2WLNA 3BCCH 3OD4A 4WFBV 2Q73A 4RQFA 3JD1A 1OJHA 3UO2A 2FYUH 4LH6A 1YDXA 2QA4V 3ZRVA 2F1MA 4TV8B 1GAXA 1R6NA 5DN6G 2XAGA 4EB6A 3UO3A 2CH7A 1XQ8A 3E86A 3RFRA 4JTDB 5LL6Y 1Q81W 4KUMA 3C3SA 2BSKA 1AI6A 4QNHB 4DV0O 2L35A 4BIOA 1RSOB 2LJ2A 1B04A 3WU2Z 2CTQA 1Y4MA 1ZL8B 1FD9A 4CZZA 2D3OW 3BA8A 2HJFC 5EK0A 4WFFA 1IBKB 2OIGA 1PV0A 3CRCA 2IU3A 3LNNA 1F7YA 1QR9A 3KCYA 3L9DA 1EBOA 3OTOO 1IZ3A 5E1AC 1O9HA 2RDCA 1OCCC 2YI9A 1MSDA 3BABA 3DTUB 1YJ9V 3AG2B 5FPRA 4FZ1A 4H33A 2DYSB 4UCOA 2IU0A 2FL4A 3G80A 1XNRO 2HFEC 3SYAA 3ZEDA 3ZIAG 1PM9A 5J2UB 1XNQB 2M6YA 2H8PC 3IJ4A 4FJCC 3AK1A 1VQPV 5CA3A 1SQPH 4CH3A 4LNUA 1K73W 4I4TB 3NXSA 3D8CA 4YJ2A 2P5OA 1MZEA 1N32O 1L0LH 1WPXA 3ASNB 4WFEA 1WAZA 3U0ZA 1WB8A 1UPGA 4DV3B 1BE3H 4J7JA 1QCEA 2CDYA 3MDSA 1UFIA 1VQOV 2UXCB 1N33B 3CRAA 4FLZA 3QTCA 4JYAO 1TUEB 4JI8B 3ZCCA 3L72H 4BWAA 4X8AA 5JH7A 2E5LB 1SQVH 4PA9A 1KC8W 2DWEC 1XOUA 3JCUZ 2GHYA 4FFKA 5LP6B 3K04A 2P7TC 1MOFA 3EVKA 2EIKC 3ABKC 2BOCC 4O4HB 3OW2U 2M7WA 4OXSA 3G71V 4KL1A 4X1IA 4DYLA 4DV6B 2QM7A 5KMGB 1FXHA 4JI3B 2EIMB 2V7QG 3ZN0A 1SC5B 2F23A 2IW5A 2ZIMA 4WFGA 3ETEA 2NNUA 3LSUA 5H9CA 1AJNA 3H1IH 4NXMO 2XAFA 2Q9LA 4X1YA 5IDJA 4I0XA 2DJVA 1GM9A 2Q68A 5EBLC 1BHBA 2VRZA 2HVJC 1AB3A 4IIJB 2R72A 5A9GA 4DV2O 3R65A 1JR9A 2PY5A 3U11A 4DR7O 1NR7A 3HKBB 1QLEB 1GM7A 1XILA 4MVOA 5CN0A 2OIEA 4J11A 4TV8A 3LNMB 1H2SB 3BAAA 3ZRSA 1BS3A 2XAJA 3RWRD 1HNXO 2ZE7A 3DC6A 2WA4A 1ZTEA 1OV9A 3JD3A 3E2EA 2CUGA 4GLXA 4J41A 1RSOA 3E8FA 2ADQB 2EJRA 2O57A 4JI4B 1ZL8A 1SQGA 1N34B 2HEPA 4K0KB 1N8RW 3SJBC 2QM8A 3H9VA 2R70A 3ICXA 4F4LA 2OTJV 1R6KA 2HVKC 4DUYO 1FAFA 5LGNA 1RPRA 2KG7B 1G1XB 1NR1A 4L8JA 4X64O 3RYCB 3FYEB 3CCQV 2GUZB 2LGWA 2YC0A 1JCHA 1MABG 4NTXA 5J2UA 1YI2V 2LGQA 3NR7A 2YS8A 3OR6C 5GTIZ 3W7SA 4C7UA 1KP3A 2Y0PA 1X59A 3BPZA 4LF8O 5LGTA 4AI8A 3FFQA 1HDJA 4I4TA 3BRCA 1M4UA 2R9IA 1VIBA 3L73H 4P2ZA 3K59A 2QKCA 2P6JA 4IYHA 4FM2A 3B8NA 1GK9A 3KCXA 1H2KA 2OCCB 3W7XA 3CD6V 3Q4HB 2K9PA 2CTWA 3CE2A 3JARB 4DV5O 4Z1VA 4LFAO 2WPDG 2A79B 1BQZA 1SETA 1A32A 5FPOA 1V55C 2KSDA 2ZE6A 4UVCA 4NXNB 4P9OA 2H3OA 3GWKC 2CAZC 3UT5B 1KMIZ 4LF9O 3K06A 5LP6A 1H38A 2PI4A 2N74A 3JAKB 1SQBH 3JSNA 1OHHG 1K9MW 1HNWB 5JQGB 4O4HA 4QJFB 1WA8B 2HR3A 5FL7G 4DR5O 4JI0O 3LUTB 1XMQO 3K5NA 3ETQA 3T4ZA 1KU9A 5KMGA 2BTOA 2BOBC 2P4VA 4LFBB 3JSLA 2QTOA 3L71H 3EHBB 2VWJA 4UCUA 3A8TA 1N0NA 3T1CA 4NR1A 2ZR3A 3K57A 1FKAO 4QE7A 4XDJA 3MD0A 1XMOB 1AR4A 1JX9A 3JATB 4J10A 3IAYA 1X4TA 3K0GA 2EBOA 3O9OA 3G6BA 4IIJA 1WP8A 2UU9B 2A7WA 1M9NA 3FX7A 4NVPA 1IBLO 5LHHA 3HKBA 2YDEA 1DF4A 5DEDA 3B4SA 4JI5O 2X6BA 2G38A 5IY5B 1P7BA 2DW4A 1EN6A 2DN9A 3SPCA 2JS3A 3PJSK 1FYJA 2GTSA 2HLDG 4J80A 4X20B 4OX9O 1QBZA 4KP4A 5TISZ 1CPYA 1VQNV 4J42A 3SYCA 2AGAA 4MSWC 4JZ2A 3QNEA 2Y4TA 3K9SA 4JV5O 1BZKA 1K4DC 2JEXA 1H8EG 1KB9F 1YITV 4J9YB 5FNVB 1KUQA 1OCRB 2P06A 3OE7G 4LC1A 1ORQC 4GX0A 3ZMTA 1YJNV 2KG7A 1ZLZA 2HHHO 2Y69B 4YY3O 2HJDA 3RYCA 1V54C 4L87A 2WLJA 1AI7A
chains in the Genus database with same CATH topology
2WLIB 3E89A 1K7DA 5H6RA 1Q82W 4WFBV 1IXMA 1F4NA 4RAIA 3JD1A 4RQFA 2JEUA 2JK5C 3AG4C 3EFFK 3LSSA 3LDDA 2QA4V 4GX2A 3ZRVA 1YIJV 1R6NA 4R7CA 5DN6G 2XAGA 2EINB 4PA6A 4WFHA 1S5HC 1LNQA 3ASNC 3E86A 2WAMA 2EILB 4JTDB 1Q81W 4KUMA 2WWWA 2R9RB 1RM1C 1AI6A 4QNHB 3CMEV 4JTCB 3K0DA 3STZC 3CC7V 3E35A 5EC2C 3HB3B 1M57B 4RUEA 1Y4MA 2B1GA 3CXCU 1FFTB 1KP2A 2WLLB 1PNKA 5L3EA 2NLJC 5H6QA 1K92A 4CZZA 2MK3A 3ZRWB 2D3OW 4RO2A 1S0VA 4PDRA 1H8HG 4JASA 2FTKA 2HJFC 3SPHA 3FB5C 5EK0A 4WFFA 3SJQC 2XNDG 4UVAA 5B1BC 5CBFA 2CK3G 2IU3A 4HAMA 5HFMA 2ZQMA 5BZBA 1UJWB 1NBMG 1PKXA 1QR9A 1RPOA 2ZXWB 1EBOA 1K3EA 1NH2D 1FXVA 5E1AC 1R3JC 1JVMA 2IJJA 3I56V 3AG3B 5B3SB 5L3BA 2GSMB 5KUMA 4LCUC 1OCCC 5CMUA 3OUFA 4HYOA 3E8BA 5LHGA 3DTUB 1YJ9V 3AG2B 4BIUA 3IGAC 3MHSC 4JTAB 2ITCC 3SPJA 4H33A 4TT3G 1EFRG 2DYSB 3K08A 1NVPD 2K1EA 3OUSA 1WLEA 3JCZA 2EINC 2Q69A 3CCEV 4MVZA 2P67A 1B6QA 1NVPB 2IU0A 2ZDIC 2HFEC 3SYAA 3ZIAG 5KA5A 3IFXA 1G8MA 1SERA 4QPKA 5L3FA 3G4SV 2H8PC 4FJCC 1K97A 3B8MA 4MW8A 1VQPV 2QE7G 5CA3A 3F5WC 2EIKB 4ZKIA 1K73W 3NXSA 3G6EV 4X88A 3RW0A 2Q6AA 4UXNA 1WPXA 1PD3A 5B3SC 4MVMA 3ASNB 1M1KW 3BY6A 2EZPA 4GX1A 4WFEA 1YSCA 4P9PA 3A0RA 1RM1B 3LDCA 1QCEA 5LGUA 1VQOV 2H94A 3OAAG 1QVFU 1R73A 5J9PC 2Z5UA 1TUEB 1YHQV 4RQEA 3P30A 5GW7A 2XASA 1JOYA 3ZCCA 2DQ0A 2X6CA 2KB1A 2X0LA 4G2KA 4U7OA 3STLC 3K79A 3IC7A 4X8AA 4XDLA 5IYBO 4KFMA 4PA9A 1KC8W 2IJKA 2DWEC 2X7RB 4Q20A 1GMGA 4LP8A 2Z3YA 4X89A 5B1AB 3RVZA 2GHYA 4XBFA 1AROP 3K04A 4CBCA 1E79G 3CCSV 2JJ2G 1MOFA 2P7TC 3T2MA 1AI4A 2EIKC 1BMFG 1MG1A 3ABKC 2BOCC 1OCCB 5EBMC 3OW2U 2M7WA 4OXSA 4MVQA 3OMIB 3G71V 2QM7A 1KKDA 1FXHA 3VOUA 2EIMB 4G28B 2V7QG 4MS2A 3ZN0A 1SESA 1M56C 2WLKA 2QKSA 2IW5A 3ZRXA 4WFGA 3CP1A 3ETEA 1YJWV 1VQ4V 2NNUA 3ZMZA 5LBQA 2EIJC 5EC1C 2IJIA 1JJ2U 5H9CA 1AJNA 1FS0G 1K34A 3OR7C 1QVGU 2F43G 2A9HA 4R8CA 4MTXA 3E8HA 2XAFA 3FB6C 2A0LA 1VQ9V 3X2QC 4GCZA 2JDIG 5B1OA 5IDJA 1OCOB 3BEHA 4GX5A 3SPGA 1GM9A 2Q68A 5EBLC 1NKDA 1BHBA 2W0FC 3P32A 2HVJC 1M90W 4E2LA 1Q7YW 3TK1A 2WLIA 3OGCC 5B1AC 2YEVB 3R65A 3OMAB 4DXWA 1NR7A 1QLEB 1KQSU 1GM7A 1S3JA 3CMAV 3K3WA 4MVOA 1XL4A 5CN0A 2OTLV 2PI5A 3D3IA 3LNMB 4JYBA 1K5SA 3ZRSA 2OCCC 4P30A 1DTOA 2XAJA 4MTOA 1Q86W 3OMNB 2EIMC 3JD3A 3E2EA 1KD1W 3AG1C 4UVBA 3CPWU 3ZMSA 3E8FA 3QO7A 2EJRA 4WF9V 1F51A 2ATKC 2W6JG 1W2BU 1J95A 4XDKA 1EZJA 1XL6A 5C93A 2WLLA 4EKWA 3CCVV 3ZRWA 3E83A 2X6AA 3WFVA 4PA4A 4TSFG 1NJIW 1N8RW 4FMTA 4MT8A 1OCOC 2QM8A 2XAQA 4J9ZB 1W0KG 3E8GA 4MTGA 1DF5A 2AHZA 4F4LA 3ABKB 2ITDC 4MVRA 2OTJV 1PL0A 1R6KA 2HVKC 1AJPA 2HG5C 1CP9A 2AHYA 5LGNA 5IYCO 4PA7A 2UXNA 3ABTA 1RPRA 1QLEC 1QLNA 4FIPC 1M56B 1I5XA 3W7UA 3ASOB 4JYCA 3W7WA 1NR1A 1VQ6V 3H01A 3JD0A 5CBHA 2WLMA 3ZJZA 2DQ3A 2EIJB 1G4YB 3FKSG 1FXKB 4WFAV 3CYOA 3GB7C 4FK5C 1YTFD 3FYEB 4UV8A 3CCQV 5CBGA 4H37A 3UKMA 5KA6A 1F23A 5LHIA 3LDEA 1JCHA 2P90A 2XAHA 1HWYA 1MABG 3RVYA 1YI2V 2B5UA 1YTFB 1PNLA 2V1DA 3X2QB 1QR8A 1R3IC 1K8AW 2JJ1G 3OR6C 3W7SA 5L3DA 2DWDC 1KP3A 4Z1MG 3FB8C 4JAVA 3DGEA 1P4RA 1BHAA 4BAYA 5LGTA 2B1IA 2LFRA 2Q67A 2DYRC 1VQKV 2R9IA 4I9WA 4P2ZA 4MVUA 3RBZA 4QE9A 3TCUA 2P6JA 5EBWC 3ABMB 3B8NA 2ZD9A 1GK9A 1S72V 3JD4A 2OCCB 3W7XA 3CD6V 2IJHA 3ETDA 3SYPA 4PDMA 1GO3F 1ROPA 3OFNG 2IH1C 3AG1B 3ASOC 2WLHA 4UV9A 2WPDG 2A79B 1SETA 1H2GA 1FXKC 2HKOA 3F7YC 1V55C 1L1FA 4PDVA 4UVCA 3K03A 1ENVA 1OZ0A 4RUFA 1S77D 4P9OA 1SZTA 3HPLC 3ETGA 3FB7C 3D36A 4QIWF 1GM8A 3K06A 4MVSA 1H38A 1VQ7V 4U7NA 2QEXV 1OCRC 3ML0A 3OM3B 1SRYA 2PI4A 5HFLA 1E1QG 2W6IG 1ZWIC 1KECA 3M99B 1OHHG 1NQTA 1K9MW 2LP7A 4QJFB 3TETA 4ASUG 2HR3A 5FL7G 2WSSG 4JF3A 3LUTB 3ABMC 3T4ZA 4LBEC 4PDLA 3CCRV 2BOBC 2Y69C 4JGSA 2QTOA 3K9AA 4MTFA 3ABLC 2LFSA 4GT1A 3SPIA 3EHBB 1BL8A 3VBBA 3OEHG 2ZDIA 3UM7A 4PA3A 1K4CC 3F7VC 3T1CA 2ZR2A 1W0JG 4PELA 2ZR3A 3LSQA 3W7TA 4QE7A 1MSWD 1VQ8V 1JPXA 4XDJA 3MHHC 1AJQA 3MD0A 1JX9A 1NH2B 3ZN1A 2EZOA 5IYDO 2Y48A 3ZMVA 3FYIB 4UUJC 3QO5A 1K5QA 3K0GA 3GWOA 2EBOA 3CCJV 1F4MA 2DYRB 1AR1B 1M9NA 1Y66A 4N23A 4R6ZA 2YEVA 2EILC 5LHHA 3WG7B 4BW5A 2OT5A 4QPJA 1DF4A 2YSUB 2JIZG 1PNMA 5B1NA 3CC2V 2X6BA 1K33A 1M57C 5IY5B 1THZA 1VQLV 3B77A 1R3LC 1V54B 1P7BA 2C2AA 2DW4A 1OCZB 3SPCA 3PJSK 4JAUA 1CEZA 2HLDG 3SYQA 4MW3A 4TWKA 1QBZA 4KP4A 1V55B 1CPYA 4WCEV 1COWG 4G27B 3AG4B 1VQNV 3SYCA 4MSWC 2ZXWC 3QNEA 4DO2A 1AI5A 1VQMV 3CCUV 3OEEG 4JPRA 3CCLV 3AG3C 1K4DC 5L3CA 1S76D 2JEXA 1H8EG 2XOKG 1YITV 4J9YB 3CCMV 4BIZA 2IH3C 1OCRB 3AG2C 3OE7G 4ZBMA 1I5YA 4LC1A 1ORQC 1VQ5V 1GKFA 2DYSC 4YXWG 1JQ0A 3T4DA 5L3GA 4GX0A 1R3KC 3WG7C 3CC4V 3ZMTA 5DM6V 1YJNV 5KUKA 3ZMUA 3I55V 1DLBA 3JD2A 4R50A 4FPPA 4I5SA 3ABUA 2Y69B 1E1RG 1GTOA 3KG2A 3AEIA 5IY5C 3ABLB 4N21A 3QO8A 5B1BB 4HZ3A 3JYCA 2WLNA 1V54C 4L87A 3SYOA 2WLJA 1OCZC 1FXKA 1AI7A 2UXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M W;  1KQS U;  3CC7 V;  3CMA V;  3G4S V;  1VQ5 V;  3CCS V;  1Q82 W;  2OTL V;  1QVG U;  1NJI W;  3CXC U;  4WFB V;  1VQ6 V;  1VQO V;  1N8R W;  1QVF U;  1VQK V;  1R73 A;  1YJ9 V;  1VQP V;  4WFA V;  2D3O W;  3CCR V;  1Q86 W;  3OW2 U;  1VQ9 V;  3CCJ V;  3CCQ V;  1YHQ V;  2QA4 V;  1K73 W;  4WCE V;  1S72 V;  3CC4 V;  1YIJ V;  5DM6 V;  3G71 V;  1YJN V;  1VQN V;  3CCE V;  3CD6 V;  2OTJ V;  3I55 V;  3G6E V;  1YI2 V;  1KD1 W;  3CPW U;  1VQM V;  1M90 W;  3CCU V;  1Q7Y W;  1K8A W;  4WF9 V;  3CCL V;  1VQ7 V;  1VQL V;  2QEX V;  1W2B U;  1Q81 W;  3CC2 V;  1M1K W;  1KC8 W;  1YIT V;  3CCM V;  1YJW V;  1VQ4 V;  3CME V;  3CCV V;  1VQ8 V;  3I56 V;  1JJ2 U; 
#chains in the Genus database with same CATH topology
 1K7D A;  2ZNJ A;  2GUZ A;  1Q82 W;  1IXM A;  3AG7 A;  2JK5 C;  1I94 B;  4W4L A;  3LSS A;  3CWB H;  3LDD A;  1YIJ V;  4B3R O;  5DEC A;  4PA6 A;  4WFH A;  4JI2 O;  2UUC O;  2WAM A;  1Q6U A;  2EIL B;  4AQY O;  2YIA A;  2R9R B;  1RM1 C;  1CXZ B;  4W4K A;  3CXH F;  2W0X A;  2E3C A;  1KP2 A;  2WLL B;  5L3E A;  3Q4H A;  4DUZ O;  5KAF Z;  4PDR A;  1H2M A;  1H8H G;  2CGN A;  3B2E E;  2FTK A;  1YZB A;  3SPH A;  1LUW A;  2GDS A;  3JAR A;  3FB5 C;  1Z2G A;  3SJQ C;  1IXB A;  4O4J B;  5CBF A;  4HAM A;  1UJW B;  4UB8 Z;  5IYZ B;  5KX5 B;  1RPO A;  2ZXW B;  3P3P A;  2UUB B;  3TJT A;  1NH2 D;  2GSM B;  1G6U A;  3UT5 A;  4BIU A;  4Q6G A;  3SPJ A;  1NVP D;  1WLE A;  4CH4 A;  3JAK A;  2P67 A;  1AP5 A;  5J2T B;  1NVP B;  4TV9 B;  4JI6 B;  5JQG A;  1WA8 A;  5KA5 A;  1B06 A;  3BFR A;  3IFX A;  1Y6X A;  4UFZ A;  4YHH B;  4QGP A;  1SER A;  4QPK A;  4DV4 B;  3OT7 A;  3ZHU A;  1HNZ O;  3B8M A;  4MW8 A;  1I08 A;  3F5W C;  3U10 A;  2EIK B;  4IGG A;  4ZKI A;  3JAS B;  3VQY A;  3K5L A;  3G6E V;  4X88 A;  3DSQ A;  1N36 O;  2FKX A;  1ZSP A;  3RW0 A;  4DR1 O;  2Q6A A;  1QNM A;  3JAT A;  5LYJ B;  4ZOL B;  4JI1 B;  4MVM A;  1HR0 B;  2EZP A;  3I5D A;  3A0R A;  1W59 A;  1JA8 A;  2Z0A A;  3T1H B;  1QVF U;  1SA0 B;  4RQE A;  1NZ6 A;  3P30 A;  5CB4 B;  3QF7 A;  2DQ0 A;  2KB1 A;  4KHP B;  3K79 A;  4CC5 A;  5IYB O;  4O2A B;  1XHX A;  4TQF A;  4DR2 B;  4Q20 A;  5B66 Z;  4X20 A;  1ARO P;  1E79 G;  4DV7 B;  1AI4 A;  1Y67 A;  4CH6 A;  5EBM C;  2VQF O;  5LMN B;  4K8X A;  5EIB C;  5FNV A;  2ZE5 A;  3GVM A;  4G28 B;  4LF5 B;  2JS5 A;  1SES A;  4X62 O;  2WLK A;  1BQ0 A;  1KBH A;  3A2F A;  5IWA O;  4YJ3 B;  3ZRX A;  3CP1 A;  5LBQ A;  1FS0 G;  1TVK B;  4R8C A;  2BE3 A;  5GON B;  4B3T B;  3FB6 C;  3X2Q C;  4GCZ A;  5B1O A;  4JI7 O;  2YIC A;  1H2N A;  1AVM A;  4DR6 B;  3ZHS A;  3RYF B;  2ZNI A;  1Q7Y W;  5B1A C;  3HKE B;  3OMA B;  2VS0 A;  2EJ7 A;  2NN4 A;  1XL4 A;  2PI5 A;  1K5S A;  3EXA A;  2ZKO A;  1DTO A;  4DR3 O;  4MTO A;  5KAI Z;  1Q86 W;  3OMN B;  2E75 B;  3N2K B;  3L70 H;  4UVB A;  3AK3 A;  2ATK C;  1NU1 H;  2VQE O;  2JGU A;  2WLL A;  4K3A A;  3E83 A;  4OPA A;  3THO A;  5B5E Z;  3WFV A;  4H13 B;  3FAV B;  1SQQ H;  4FMT A;  4X65 B;  1OCO C;  4O4J A;  1D2D A;  2XAQ A;  5F2V O;  2QR4 A;  5IYZ A;  5KX5 A;  1DF5 A;  2ITD C;  1PL0 A;  4OPH A;  4FLY A;  1AJP A;  4HNA B;  4FLX A;  4B3S B;  5IYC O;  4UCR A;  3RGB A;  1I5X A;  1M56 B;  3W7U A;  3D3Q A;  1FJG O;  3C90 A;  4NYK A;  4K8Z A;  1BCC H;  2BTQ B;  2EIJ B;  1G4Y B;  3GB7 C;  5J2T A;  4IYI A;  4TV9 A;  5CBG A;  1F23 A;  4U3J B;  1H2L A;  3LDE A;  3RN4 A;  5KHH A;  1PNL A;  1IBK O;  1VAR A;  1Y74 B;  2JJ1 G;  5L3D A;  4DR7 B;  2DWD C;  1P4R A;  1BHA A;  2B1I A;  2Q7H A;  3JAS A;  4NTY A;  2Q67 A;  3BA9 A;  3S3W A;  3CJH B;  3RBZ A;  4QE9 A;  3CHX A;  5LYJ A;  1VF5 B;  4ZOL A;  3M8A A;  3ETD A;  4X66 B;  1VP7 A;  2OYQ A;  1ROP A;  3AG1 B;  2CGO A;  1XNQ O;  1YVW A;  4ABM A;  1SA0 A;  1FXK C;  5CB4 A;  3F5T A;  3K03 A;  4UCT A;  2D2C B;  2RQ6 A;  1SZT A;  4ICG A;  4LF6 B;  2QWO B;  4GKJ B;  3RYH B;  4J7K A;  3D36 A;  4O2A A;  4QIW F;  5LA6 B;  1GN2 A;  3CRM A;  1MA1 A;  1VQ7 V;  4U7N A;  1SRY A;  1MZF A;  5IT9 N;  2UUA B;  3TET A;  4DV3 O;  5LMU B;  5IJ0 B;  2RN9 A;  3VQW A;  2UXC O;  1N33 O;  4LBE C;  2Q7G A;  5FLX N;  2JRI A;  2IM9 A;  1HP8 A;  4MTF A;  2KQX A;  2LFS A;  3SPI A;  4YJ3 A;  3KKY A;  1BL8 A;  2ZDI A;  2A3Q A;  2QWN B;  4F6E A;  4PA3 A;  2JVD A;  2ZCE A;  4CC6 A;  2LW7 A;  4PEL A;  3LSQ A;  3W7T A;  1TVK A;  4DRX B;  2E5L O;  4LF4 B;  5GON A;  1KKC A;  2EZO A;  2Y48 A;  3ZMV A;  4DW1 A;  3ZBH A;  3TXQ A;  4DW0 A;  3GWO A;  3RYF A;  2PF4 E;  4ZI7 B;  2DYR B;  1AR1 B;  5KHI A;  3HKE A;  4DV6 O;  4JI3 O;  2YUA A;  3WB1 A;  2YSU B;  2QM4 A;  5K1P A;  1YEW A;  2GBO A;  3B77 A;  1V54 B;  1HW7 A;  4FM1 A;  4LF7 B;  1FPO A;  3N2K A;  4MW3 A;  1JFF B;  4CS4 A;  5BR8 B;  1Q43 A;  2ODM A;  3UCS C;  1AI5 A;  3CCU V;  3OEE G;  5LOV B;  4JPR A;  5L3C A;  3FAV A;  1J5E B;  1XUQ A;  3CCM V;  3ZHR A;  3AG2 C;  5JJE B;  1VQ5 V;  2DYS C;  4YXW G;  2PGG A;  1JQ0 A;  1IUR A;  3T4D A;  2ZIN A;  5L3G A;  4HNA A;  4BW9 A;  3SR2 C;  1R3K C;  4NB5 A;  1V9P A;  1Q3E A;  3KG2 A;  3APQ A;  3ABL B;  2PZS A;  1IBM B;  3JYC A;  4JI4 O;  2BTQ A;  3SYO A;  2OCH A;  1OCZ C;  4MTX A;  2UXX A;  2WLI B;  1N34 O;  2E74 B;  5H6R A;  4U3J A;  3CX5 F;  1D5N A;  4K0K O;  4D6T H;  4UB6 Z;  1QQC A;  2AXT Z;  3APO A;  3AG4 C;  1Y74 A;  4LFC B;  1IX9 A;  4TOI A;  4RWU A;  1WNS A;  3QG5 A;  1LNQ A;  3ASN C;  2WWW A;  4DR4 B;  4JTC B;  3CJH A;  3E35 A;  5EC2 C;  1M57 B;  4RUE A;  1FFT B;  3J7A U;  4PHZ A;  1PNK A;  2NLJ C;  5H6Q A;  4RO2 A;  1S0V A;  1I7F A;  2AZ2 A;  3A0B Z;  4B3M B;  2XND G;  5B1B C;  2UXD B;  2ZQM A;  5BZB A;  1NBM G;  1K3E A;  1FXV A;  1JVM A;  2IJJ A;  3HKD B;  3AG3 B;  1N0J A;  5KUM A;  5CMU A;  3OUF A;  4HYO A;  3RYH A;  5LHG A;  4GKK B;  2E76 B;  3IGA C;  3MHS C;  2ITC C;  3H1K H;  4TT3 G;  5LA6 A;  2K1E A;  3OUS A;  3JCZ A;  2EIN C;  2F4V O;  3CCE V;  4MVZ A;  5C8Y B;  2YIB D;  3CEI A;  4GUN A;  2P4K A;  3KZI Z;  3TXS A;  1VEW A;  1TUB B;  3ZX6 A;  5IJ0 A;  4FLU A;  2ARH A;  4TUY B;  4FLT A;  1Y76 B;  2Q4P A;  1EN4 A;  4PV1 B;  3T1Y B;  4PI2 A;  2QE7 G;  4NXN O;  2ZM6 B;  4DRX A;  2F95 B;  5KHK A;  4UXN A;  1PD3 A;  5B3S C;  5KHJ A;  4O4L B;  2Q8V A;  4CS2 A;  2DMX A;  4O4I B;  3CRR A;  4ZI7 A;  1HNW O;  1VMG A;  2Z5U A;  3WB0 A;  5GW7 A;  5JCO A;  2ETN A;  4LFB O;  2XAS A;  1JOY A;  2X6C A;  2X0L A;  2Y0I A;  4G2K A;  4U7O A;  2QDO A;  5ITZ B;  2PUS A;  2UXB B;  3IC7 A;  4XDL A;  1MNG A;  2IJK A;  2X7R B;  3BVO A;  5EYP B;  4LP8 A;  2Z3Y A;  2QKA A;  2VWK A;  5B1A B;  1JFF A;  1AP6 A;  4XBF A;  1GN4 A;  1XMO O;  3B09 A;  3CCS V;  2JJ2 G;  1QU7 A;  3T2M A;  1JJO A;  1LR1 A;  1MG1 A;  1GN6 A;  1OCC B;  5LOV A;  5D5P A;  3OMI B;  4KXR A;  5H5N A;  2UU9 O;  1KKD A;  3VOU A;  4MS2 A;  2RCV A;  2QKS A;  5EC1 C;  2QTS A;  4FZ0 A;  1JJ2 U;  4FM0 A;  1K34 A;  3OR7 C;  5GTH Z;  2A9H A;  3E8H A;  2A0L A;  1VQ9 V;  1OCO B;  3BEH A;  3PN1 A;  1QHT A;  1WP7 A;  3N27 A;  2W0F C;  3P32 A;  4DR1 B;  5KLV H;  4E2L A;  2WLI A;  2YEV B;  3DC5 A;  1KQS U;  3K3W A;  3K5M A;  1R6T A;  4JYB A;  4I50 B;  2OCC C;  3DXR B;  2NR5 A;  1KD1 W;  3CPW U;  4WF9 V;  1F51 A;  2W6J G;  2DE0 X;  5C93 A;  1R1B A;  4EKW A;  3CCV V;  2X6A A;  3G67 A;  3M7M X;  4FLW A;  5IE9 A;  4JAA A;  4TQD A;  1I94 O;  2Q0O C;  4E4E A;  4J9Z B;  3SJA C;  2QWQ B;  1W0K G;  3E8G A;  3ABK B;  1U96 A;  1Q90 D;  2IBZ H;  2N04 A;  3HKC B;  3HKD A;  2HG5 C;  2AHY A;  4DV0 B;  4H44 B;  1WPB A;  1QLN A;  3E22 B;  4JYC A;  3W7W A;  1AIL A;  4YIP A;  5CBH A;  4PJ0 Z;  3ZJZ A;  1FXK B;  4WFA V;  3CYO A;  5JJJ B;  5C8Y A;  4FK5 C;  1VF6 A;  4J7Z A;  1XBL A;  2XTA A;  1TUB A;  2P90 A;  3RVY A;  2YIB A;  2V1D A;  4TUY A;  1Y76 A;  1R3I C;  3OTO B;  1U97 A;  1PL4 A;  2UUB O;  3RYI B;  5CA0 B;  1ZUQ A;  4BAY A;  2RMK B;  4DR3 B;  4IHJ B;  3JD4 A;  4O4L A;  1XNR B;  4O4I A;  4PDM A;  3N2G B;  1GO3 F;  2ILM A;  4JI6 O;  2IH1 C;  3ASO C;  4UV9 A;  4YHH O;  4PI0 A;  4DV1 O;  2ZE8 A;  1H2G A;  2HKO A;  4DV4 O;  1L1F A;  3RT3 C;  1ENV A;  1OZ0 A;  4RUF A;  3JAW B;  1S77 D;  4H0L B;  5ITZ A;  5BXZ A;  3HPL C;  3ZHQ A;  4F6R B;  1XHZ A;  4B7E A;  1GM8 A;  5EYP A;  4MVS A;  2QEX V;  1N32 B;  1OCR C;  3ML0 A;  5HFL A;  1E1Q G;  1ZWI C;  3M99 B;  4JI1 O;  1FJG B;  1HR0 O;  3VQX A;  2F93 B;  4ASU G;  2WSS G;  4JF3 A;  3T1H O;  3ABM C;  4CH5 A;  4PDL A;  1GH6 A;  2QJ1 A;  3CCR V;  4JYA B;  1PPJ H;  2Y69 C;  4JGS A;  3K9A A;  2CTR A;  3J81 N;  3OEH G;  4KHP O;  5JVD B;  2ZR2 A;  1W0J G;  1MSW D;  1VQ8 V;  1JPX A;  4DR2 O;  3MHH C;  1AJQ A;  1XI1 A;  3HR0 A;  2KKW A;  1MMM A;  1NS1 A;  4DV7 O;  3FYI B;  4UUJ C;  1K5Q A;  3SJC C;  4YIO A;  5LMN O;  4R6Z A;  1Y66 A;  4N23 A;  2YEV A;  2EIL C;  3ZS8 C;  1N4C A;  2OT5 A;  4LF5 O;  2JIZ G;  5B1N A;  2A06 H;  4B08 A;  4I50 A;  1THZ A;  1VQL V;  4IL6 Z;  1R3L C;  1GRJ A;  1GN3 A;  1TGO A;  1OCZ B;  1US6 A;  4DK1 A;  3DXR A;  4JAU A;  4NXM B;  1CEZ A;  3SYQ A;  4B3T O;  1V55 B;  2Q0A A;  4LH7 A;  2JGD B;  4G27 B;  3AG4 B;  4NKG B;  2ZXW C;  4UCV A;  4DO2 A;  1VQM V;  4DR6 O;  1DK1 A;  3CCL V;  4DV2 B;  1TAE A;  5IJ9 B;  5E79 Z;  4ZBM A;  1I5Y A;  1GKF A;  1ZAU A;  1SS3 A;  1I0H A;  1HNX B;  3HKC A;  2XT9 A;  2PYJ A;  3WG7 C;  5DM6 V;  5KUK A;  3ZMU A;  3IC9 A;  3JD2 A;  3ABU A;  1E1R G;  3AEI A;  3E22 A;  3QO8 A;  5B1B B;  2V4D A;  3QVN A;  1FXK A;  3E89 A;  1FFX B;  4RAI A;  1F4N A;  3C3T A;  3K5O A;  2JEU A;  5EZY B;  3H1L H;  4X65 O;  3EFF K;  2N05 A;  4GX2 A;  2Q7E A;  4R7C A;  4DUY B;  2EIN B;  3RYI A;  2EUL A;  5CA0 A;  1S5H C;  2ZIO A;  5D5Q A;  4B7K A;  3MAQ A;  2YI8 A;  1DGS A;  4B3S O;  3L75 H;  1Q6I A;  2XUM A;  3CME V;  1IDS A;  4LWS B;  3K0D A;  3STZ C;  4X64 B;  4IHJ A;  3CC7 V;  3HB3 B;  2B1G A;  1WJZ A;  3CXC U;  1RP3 B;  4I55 B;  4I9Q A;  1K92 A;  2MK3 A;  3ZRW B;  3SGI A;  1YXB A;  3CS5 A;  4JAS A;  1T5E A;  1P84 F;  3N2G A;  3FD9 A;  4CS3 A;  2PYL A;  4JI8 O;  4O2B B;  3D36 C;  4UVA A;  5HFM A;  2CK3 G;  1PKX A;  5JJN B;  1P49 A;  2ZT9 B;  4LF8 B;  3K58 A;  4EFB A;  1R3J C;  3JAW A;  3I56 V;  5B3S B;  5L3B A;  3TGU H;  4LCU C;  3JAM N;  3E8B A;  1Q5O A;  4JTA B;  1BSM A;  4F6R A;  1EFR G;  3K08 A;  2Q69 A;  1B6Q A;  2ZDI C;  4X66 O;  4DV5 B;  2YXL A;  4LFA B;  1G8M A;  3L74 H;  5L3F A;  3G4S V;  3ZHV A;  3A0H Z;  2F66 C;  4X1K B;  1K97 A;  4EFE A;  1O9G A;  1SQF A;  1LUV A;  2FB5 A;  5JVD A;  5CA1 B;  1EZV H;  2FML A;  4LF6 O;  4GKJ O;  4LF9 B;  1URF A;  1XDC A;  4X9Q A;  1M1K W;  3BY6 A;  4GX1 A;  1YSC A;  1Z5V A;  4P9P A;  4DR5 B;  1RM1 B;  3LDC A;  2UUA O;  4JI0 B;  1XMQ B;  5LMU O;  5LGU A;  2H94 A;  3OAA G;  1R73 A;  5J9P C;  5K1X A;  2ADP A;  2QWP B;  5LXT B;  1YHQ V;  2QGN A;  1YCI A;  3STL C;  4FFB B;  4BR6 A;  4KFM A;  5H2F Z;  1GMG A;  1PP9 H;  4A5U B;  4LF4 O;  4X89 A;  3RVZ A;  4D7T A;  4CBC A;  2JGD A;  2YXY A;  3ZHT A;  3JAL B;  1BMF G;  1Q8I A;  2F4V B;  4MVQ A;  2PTM A;  1IBL B;  3H1H H;  1SZX A;  3AK2 A;  5IJ9 A;  1AR5 A;  1XRE A;  1M56 C;  3OTF A;  2LO1 A;  4PD4 F;  4DK0 A;  4JI5 B;  3P3N A;  1YJW V;  1VQ4 V;  3ZMZ A;  2EIJ C;  2IJI A;  1NTZ H;  5BMV B;  1QVG U;  1WB7 A;  2F43 G;  4WBN B;  4LF7 O;  1YF2 A;  4OX9 B;  3CRQ A;  2B9Z A;  5A2Q N;  5BR8 O;  2JDI G;  4GX5 A;  3SPG A;  1NKD A;  1M90 W;  4JV5 B;  3TK1 A;  3CSX A;  4U3F H;  1FFX A;  1S5J A;  1SQX H;  3OGC C;  2L6L A;  5LP6 C;  4DXW A;  1J5E O;  4AHC A;  5EZY A;  2CE4 A;  3J80 N;  1S3J A;  3CMA V;  2HP8 A;  2OTL V;  3WB2 A;  3D3I A;  2AW9 A;  4FLV A;  1EM1 A;  4P30 A;  1D5A A;  2DOS A;  1ZX3 A;  1EN5 A;  2EIM C;  2Q5Z A;  3O65 A;  2HHH B;  2P22 C;  1NTM H;  4YY3 B;  3AG1 C;  3ZMS A;  4LWS A;  3QO7 A;  1W2B U;  1J95 A;  1IBM O;  4XDK A;  1EZJ A;  1XL6 A;  1NTK H;  2CTP A;  4I55 A;  4FVM A;  3ZRW A;  4PA4 A;  4TSF G;  1VF7 A;  1NJI W;  5JWP A;  4MT8 A;  4O2B A;  1IVS A;  2LW1 A;  2BCC H;  1S5L Z;  4MTG A;  2GTA A;  4B3R B;  2AHZ A;  4MVR A;  3OGI B;  4LFC O;  5EIB D;  2MW2 B;  4JI2 B;  2UUC B;  4GZR B;  4JZG A;  1CP9 A;  1BT8 A;  2EX3 A;  4AQY B;  4PA7 A;  2UXN A;  3ABT A;  1QLE C;  4ZHQ B;  4FIP C;  4OGQ B;  3ASO B;  4DR4 O;  2XHB A;  1VQ6 V;  3H01 A;  3JD0 A;  2WLM A;  2DQ3 A;  4DUZ B;  3FKS G;  1YTF D;  4UV8 A;  4H37 A;  3UKM A;  5KA6 A;  5LHI A;  2XAH A;  1HWY A;  4B3M O;  3B40 A;  2B5U A;  4Z2W A;  1YTF B;  3X2Q B;  2UXD O;  1QR8 A;  1K8A W;  4X1K A;  4Z1M G;  3FB8 C;  4EB6 B;  4JAV A;  3DGE A;  4ZIB A;  2CH7 B;  2AZ0 A;  5CA1 A;  2LFR A;  2BSK B;  2DYR C;  1VQK V;  4I9W A;  4GKK O;  4MVU A;  3CB2 A;  3TCU A;  5EBW C;  3UQ8 A;  3ABM B;  1S72 V;  2Y4U A;  2ZD9 A;  5JCO C;  2IJH A;  3VQV A;  3SYP A;  3OFN G;  3H1J H;  2GV9 A;  2WLH A;  5LXT A;  3F7Y C;  1HNZ B;  4PDV A;  5BY1 A;  3T1Y O;  1M93 A;  5KHG A;  4AIL C;  4FFB A;  2YXH A;  3ETG A;  3FB7 C;  1WN7 A;  1N36 B;  2ZM6 O;  4IT5 A;  1M5I A;  3OM3 B;  2W6I G;  2R9A A;  3JAL A;  1KEC A;  1NQT A;  2WA3 A;  2LP7 A;  1KYO F;  1P7G A;  1XEQ A;  1NI8 A;  1Q6H A;  2YID A;  3ABL C;  4GT1 A;  3VBB A;  3UM7 A;  1TA8 A;  4LNU B;  1K4C C;  3F7V C;  2UXB O;  5BMV A;  4WBN A;  1RFY A;  4YJ2 B;  1NH2 B;  3ZN1 A;  5IYD O;  5AG2 A;  3QO5 A;  2OWO A;  2VQF B;  3CCJ V;  1F4M A;  3R66 A;  1NT2 B;  3WG7 B;  1L0N H;  4BW5 A;  4X62 B;  4GYC B;  4QPJ A;  5IWA B;  1PNM A;  3CC2 V;  1K33 A;  1M57 C;  4DV1 B;  4EEQ A;  1SF9 A;  2C2A A;  5JH7 B;  3SDL A;  3S3X A;  4NTW A;  4TWK A;  4JI7 B;  2LQT A;  4WCE V;  1COW G;  4HBN A;  4JYY A;  3BHP A;  2RJZ A;  3AG3 C;  1B3Q A;  4X1I B;  1S76 D;  1L8D A;  2XOK G;  4UCS A;  4BIZ A;  2IH3 C;  4I7Z B;  4K35 A;  2QWR B;  1SKV A;  2QSA A;  1BGY H;  4D7S A;  1VF6 C;  4LR3 A;  3CC4 V;  3I55 V;  1DLB A;  1JMK C;  4ZHQ A;  4R50 A;  4FPP A;  4I5S A;  1GTO A;  5IY5 C;  4N21 A;  4X1Y B;  4I0X B;  2VQE B;  4HZ3 A;  1Z5W A;  2RNB A;  2WLN A;  3BCC H;  3OD4 A;  4WFB V;  2Q73 A;  4RQF A;  3JD1 A;  1OJH A;  3UO2 A;  2FYU H;  4LH6 A;  1YDX A;  2QA4 V;  3ZRV A;  2F1M A;  4TV8 B;  1GAX A;  1R6N A;  5DN6 G;  2XAG A;  4EB6 A;  3UO3 A;  2CH7 A;  1XQ8 A;  3E86 A;  3RFR A;  4JTD B;  5LL6 Y;  1Q81 W;  4KUM A;  3C3S A;  2BSK A;  1AI6 A;  4QNH B;  4DV0 O;  2L35 A;  4BIO A;  1RSO B;  2LJ2 A;  1B04 A;  3WU2 Z;  2CTQ A;  1Y4M A;  1ZL8 B;  1FD9 A;  4CZZ A;  2D3O W;  3BA8 A;  2HJF C;  5EK0 A;  4WFF A;  1IBK B;  2OIG A;  1PV0 A;  3CRC A;  2IU3 A;  3LNN A;  1F7Y A;  1QR9 A;  3KCY A;  3L9D A;  1EBO A;  3OTO O;  1IZ3 A;  5E1A C;  1O9H A;  2RDC A;  1OCC C;  2YI9 A;  1MSD A;  3BAB A;  3DTU B;  1YJ9 V;  3AG2 B;  5FPR A;  4FZ1 A;  4H33 A;  2DYS B;  4UCO A;  2IU0 A;  2FL4 A;  3G80 A;  1XNR O;  2HFE C;  3SYA A;  3ZED A;  3ZIA G;  1PM9 A;  5J2U B;  1XNQ B;  2M6Y A;  2H8P C;  3IJ4 A;  4FJC C;  3AK1 A;  1VQP V;  5CA3 A;  1SQP H;  4CH3 A;  4LNU A;  1K73 W;  4I4T B;  3NXS A;  3D8C A;  4YJ2 A;  2P5O A;  1MZE A;  1N32 O;  1L0L H;  1WPX A;  3ASN B;  4WFE A;  1WAZ A;  3U0Z A;  1WB8 A;  1UPG A;  4DV3 B;  1BE3 H;  4J7J A;  1QCE A;  2CDY A;  3MDS A;  1UFI A;  1VQO V;  2UXC B;  1N33 B;  3CRA A;  4FLZ A;  3QTC A;  4JYA O;  1TUE B;  4JI8 B;  3ZCC A;  3L72 H;  4BWA A;  4X8A A;  5JH7 A;  2E5L B;  1SQV H;  4PA9 A;  1KC8 W;  2DWE C;  1XOU A;  3JCU Z;  2GHY A;  4FFK A;  5LP6 B;  3K04 A;  2P7T C;  1MOF A;  3EVK A;  2EIK C;  3ABK C;  2BOC C;  4O4H B;  3OW2 U;  2M7W A;  4OXS A;  3G71 V;  4KL1 A;  4X1I A;  4DYL A;  4DV6 B;  2QM7 A;  5KMG B;  1FXH A;  4JI3 B;  2EIM B;  2V7Q G;  3ZN0 A;  1SC5 B;  2F23 A;  2IW5 A;  2ZIM A;  4WFG A;  3ETE A;  2NNU A;  3LSU A;  5H9C A;  1AJN A;  3H1I H;  4NXM O;  2XAF A;  2Q9L A;  4X1Y A;  5IDJ A;  4I0X A;  2DJV A;  1GM9 A;  2Q68 A;  5EBL C;  1BHB A;  2VRZ A;  2HVJ C;  1AB3 A;  4IIJ B;  2R72 A;  5A9G A;  4DV2 O;  3R65 A;  1JR9 A;  2PY5 A;  3U11 A;  4DR7 O;  1NR7 A;  3HKB B;  1QLE B;  1GM7 A;  1XIL A;  4MVO A;  5CN0 A;  2OIE A;  4J11 A;  4TV8 A;  3LNM B;  1H2S B;  3BAA A;  3ZRS A;  1BS3 A;  2XAJ A;  3RWR D;  1HNX O;  2ZE7 A;  3DC6 A;  2WA4 A;  1ZTE A;  1OV9 A;  3JD3 A;  3E2E A;  2CUG A;  4GLX A;  4J41 A;  1RSO A;  3E8F A;  2ADQ B;  2EJR A;  2O57 A;  4JI4 B;  1ZL8 A;  1SQG A;  1N34 B;  2HEP A;  4K0K B;  1N8R W;  3SJB C;  2QM8 A;  3H9V A;  2R70 A;  3ICX A;  4F4L A;  2OTJ V;  1R6K A;  2HVK C;  4DUY O;  1FAF A;  5LGN A;  1RPR A;  2KG7 B;  1G1X B;  1NR1 A;  4L8J A;  4X64 O;  3RYC B;  3FYE B;  3CCQ V;  2GUZ B;  2LGW A;  2YC0 A;  1JCH A;  1MAB G;  4NTX A;  5J2U A;  1YI2 V;  2LGQ A;  3NR7 A;  2YS8 A;  3OR6 C;  5GTI Z;  3W7S A;  4C7U A;  1KP3 A;  2Y0P A;  1X59 A;  3BPZ A;  4LF8 O;  5LGT A;  4AI8 A;  3FFQ A;  1HDJ A;  4I4T A;  3BRC A;  1M4U A;  2R9I A;  1VIB A;  3L73 H;  4P2Z A;  3K59 A;  2QKC A;  2P6J A;  4IYH A;  4FM2 A;  3B8N A;  1GK9 A;  3KCX A;  1H2K A;  2OCC B;  3W7X A;  3CD6 V;  3Q4H B;  2K9P A;  2CTW A;  3CE2 A;  3JAR B;  4DV5 O;  4Z1V A;  4LFA O;  2WPD G;  2A79 B;  1BQZ A;  1SET A;  1A32 A;  5FPO A;  1V55 C;  2KSD A;  2ZE6 A;  4UVC A;  4NXN B;  4P9O A;  2H3O A;  3GWK C;  2CAZ C;  3UT5 B;  1KMI Z;  4LF9 O;  3K06 A;  5LP6 A;  1H38 A;  2PI4 A;  2N74 A;  3JAK B;  1SQB H;  3JSN A;  1OHH G;  1K9M W;  1HNW B;  5JQG B;  4O4H A;  4QJF B;  1WA8 B;  2HR3 A;  5FL7 G;  4DR5 O;  4JI0 O;  3LUT B;  1XMQ O;  3K5N A;  3ETQ A;  3T4Z A;  1KU9 A;  5KMG A;  2BTO A;  2BOB C;  2P4V A;  4LFB B;  3JSL A;  2QTO A;  3L71 H;  3EHB B;  2VWJ A;  4UCU A;  3A8T A;  1N0N A;  3T1C A;  4NR1 A;  2ZR3 A;  3K57 A;  1FKA O;  4QE7 A;  4XDJ A;  3MD0 A;  1XMO B;  1AR4 A;  1JX9 A;  3JAT B;  4J10 A;  3IAY A;  1X4T A;  3K0G A;  2EBO A;  3O9O A;  3G6B A;  4IIJ A;  1WP8 A;  2UU9 B;  2A7W A;  1M9N A;  3FX7 A;  4NVP A;  1IBL O;  5LHH A;  3HKB A;  2YDE A;  1DF4 A;  5DED A;  3B4S A;  4JI5 O;  2X6B A;  2G38 A;  5IY5 B;  1P7B A;  2DW4 A;  1EN6 A;  2DN9 A;  3SPC A;  2JS3 A;  3PJS K;  1FYJ A;  2GTS A;  2HLD G;  4J80 A;  4X20 B;  4OX9 O;  1QBZ A;  4KP4 A;  5TIS Z;  1CPY A;  1VQN V;  4J42 A;  3SYC A;  2AGA A;  4MSW C;  4JZ2 A;  3QNE A;  2Y4T A;  3K9S A;  4JV5 O;  1BZK A;  1K4D C;  2JEX A;  1H8E G;  1KB9 F;  1YIT V;  4J9Y B;  5FNV B;  1KUQ A;  1OCR B;  2P06 A;  3OE7 G;  4LC1 A;  1ORQ C;  4GX0 A;  3ZMT A;  1YJN V;  2KG7 A;  1ZLZ A;  2HHH O;  2Y69 B;  4YY3 O;  2HJD A;  3RYC A;  1V54 C;  4L87 A;  2WLJ A;  1AI7 A; 
#chains in the Genus database with same CATH homology
 2WLI B;  3E89 A;  1K7D A;  5H6R A;  1Q82 W;  4WFB V;  1IXM A;  1F4N A;  4RAI A;  3JD1 A;  4RQF A;  2JEU A;  2JK5 C;  3AG4 C;  3EFF K;  3LSS A;  3LDD A;  2QA4 V;  4GX2 A;  3ZRV A;  1YIJ V;  1R6N A;  4R7C A;  5DN6 G;  2XAG A;  2EIN B;  4PA6 A;  4WFH A;  1S5H C;  1LNQ A;  3ASN C;  3E86 A;  2WAM A;  2EIL B;  4JTD B;  1Q81 W;  4KUM A;  2WWW A;  2R9R B;  1RM1 C;  1AI6 A;  4QNH B;  3CME V;  4JTC B;  3K0D A;  3STZ C;  3CC7 V;  3E35 A;  5EC2 C;  3HB3 B;  1M57 B;  4RUE A;  1Y4M A;  2B1G A;  3CXC U;  1FFT B;  1KP2 A;  2WLL B;  1PNK A;  5L3E A;  2NLJ C;  5H6Q A;  1K92 A;  4CZZ A;  2MK3 A;  3ZRW B;  2D3O W;  4RO2 A;  1S0V A;  4PDR A;  1H8H G;  4JAS A;  2FTK A;  2HJF C;  3SPH A;  3FB5 C;  5EK0 A;  4WFF A;  3SJQ C;  2XND G;  4UVA A;  5B1B C;  5CBF A;  2CK3 G;  2IU3 A;  4HAM A;  5HFM A;  2ZQM A;  5BZB A;  1UJW B;  1NBM G;  1PKX A;  1QR9 A;  1RPO A;  2ZXW B;  1EBO A;  1K3E A;  1NH2 D;  1FXV A;  5E1A C;  1R3J C;  1JVM A;  2IJJ A;  3I56 V;  3AG3 B;  5B3S B;  5L3B A;  2GSM B;  5KUM A;  4LCU C;  1OCC C;  5CMU A;  3OUF A;  4HYO A;  3E8B A;  5LHG A;  3DTU B;  1YJ9 V;  3AG2 B;  4BIU A;  3IGA C;  3MHS C;  4JTA B;  2ITC C;  3SPJ A;  4H33 A;  4TT3 G;  1EFR G;  2DYS B;  3K08 A;  1NVP D;  2K1E A;  3OUS A;  1WLE A;  3JCZ A;  2EIN C;  2Q69 A;  3CCE V;  4MVZ A;  2P67 A;  1B6Q A;  1NVP B;  2IU0 A;  2ZDI C;  2HFE C;  3SYA A;  3ZIA G;  5KA5 A;  3IFX A;  1G8M A;  1SER A;  4QPK A;  5L3F A;  3G4S V;  2H8P C;  4FJC C;  1K97 A;  3B8M A;  4MW8 A;  1VQP V;  2QE7 G;  5CA3 A;  3F5W C;  2EIK B;  4ZKI A;  1K73 W;  3NXS A;  3G6E V;  4X88 A;  3RW0 A;  2Q6A A;  4UXN A;  1WPX A;  1PD3 A;  5B3S C;  4MVM A;  3ASN B;  1M1K W;  3BY6 A;  2EZP A;  4GX1 A;  4WFE A;  1YSC A;  4P9P A;  3A0R A;  1RM1 B;  3LDC A;  1QCE A;  5LGU A;  1VQO V;  2H94 A;  3OAA G;  1QVF U;  1R73 A;  5J9P C;  2Z5U A;  1TUE B;  1YHQ V;  4RQE A;  3P30 A;  5GW7 A;  2XAS A;  1JOY A;  3ZCC A;  2DQ0 A;  2X6C A;  2KB1 A;  2X0L A;  4G2K A;  4U7O A;  3STL C;  3K79 A;  3IC7 A;  4X8A A;  4XDL A;  5IYB O;  4KFM A;  4PA9 A;  1KC8 W;  2IJK A;  2DWE C;  2X7R B;  4Q20 A;  1GMG A;  4LP8 A;  2Z3Y A;  4X89 A;  5B1A B;  3RVZ A;  2GHY A;  4XBF A;  1ARO P;  3K04 A;  4CBC A;  1E79 G;  3CCS V;  2JJ2 G;  1MOF A;  2P7T C;  3T2M A;  1AI4 A;  2EIK C;  1BMF G;  1MG1 A;  3ABK C;  2BOC C;  1OCC B;  5EBM C;  3OW2 U;  2M7W A;  4OXS A;  4MVQ A;  3OMI B;  3G71 V;  2QM7 A;  1KKD A;  1FXH A;  3VOU A;  2EIM B;  4G28 B;  2V7Q G;  4MS2 A;  3ZN0 A;  1SES A;  1M56 C;  2WLK A;  2QKS A;  2IW5 A;  3ZRX A;  4WFG A;  3CP1 A;  3ETE A;  1YJW V;  1VQ4 V;  2NNU A;  3ZMZ A;  5LBQ A;  2EIJ C;  5EC1 C;  2IJI A;  1JJ2 U;  5H9C A;  1AJN A;  1FS0 G;  1K34 A;  3OR7 C;  1QVG U;  2F43 G;  2A9H A;  4R8C A;  4MTX A;  3E8H A;  2XAF A;  3FB6 C;  2A0L A;  1VQ9 V;  3X2Q C;  4GCZ A;  2JDI G;  5B1O A;  5IDJ A;  1OCO B;  3BEH A;  4GX5 A;  3SPG A;  1GM9 A;  2Q68 A;  5EBL C;  1NKD A;  1BHB A;  2W0F C;  3P32 A;  2HVJ C;  1M90 W;  4E2L A;  1Q7Y W;  3TK1 A;  2WLI A;  3OGC C;  5B1A C;  2YEV B;  3R65 A;  3OMA B;  4DXW A;  1NR7 A;  1QLE B;  1KQS U;  1GM7 A;  1S3J A;  3CMA V;  3K3W A;  4MVO A;  1XL4 A;  5CN0 A;  2OTL V;  2PI5 A;  3D3I A;  3LNM B;  4JYB A;  1K5S A;  3ZRS A;  2OCC C;  4P30 A;  1DTO A;  2XAJ A;  4MTO A;  1Q86 W;  3OMN B;  2EIM C;  3JD3 A;  3E2E A;  1KD1 W;  3AG1 C;  4UVB A;  3CPW U;  3ZMS A;  3E8F A;  3QO7 A;  2EJR A;  4WF9 V;  1F51 A;  2ATK C;  2W6J G;  1W2B U;  1J95 A;  4XDK A;  1EZJ A;  1XL6 A;  5C93 A;  2WLL A;  4EKW A;  3CCV V;  3ZRW A;  3E83 A;  2X6A A;  3WFV A;  4PA4 A;  4TSF G;  1NJI W;  1N8R W;  4FMT A;  4MT8 A;  1OCO C;  2QM8 A;  2XAQ A;  4J9Z B;  1W0K G;  3E8G A;  4MTG A;  1DF5 A;  2AHZ A;  4F4L A;  3ABK B;  2ITD C;  4MVR A;  2OTJ V;  1PL0 A;  1R6K A;  2HVK C;  1AJP A;  2HG5 C;  1CP9 A;  2AHY A;  5LGN A;  5IYC O;  4PA7 A;  2UXN A;  3ABT A;  1RPR A;  1QLE C;  1QLN A;  4FIP C;  1M56 B;  1I5X A;  3W7U A;  3ASO B;  4JYC A;  3W7W A;  1NR1 A;  1VQ6 V;  3H01 A;  3JD0 A;  5CBH A;  2WLM A;  3ZJZ A;  2DQ3 A;  2EIJ B;  1G4Y B;  3FKS G;  1FXK B;  4WFA V;  3CYO A;  3GB7 C;  4FK5 C;  1YTF D;  3FYE B;  4UV8 A;  3CCQ V;  5CBG A;  4H37 A;  3UKM A;  5KA6 A;  1F23 A;  5LHI A;  3LDE A;  1JCH A;  2P90 A;  2XAH A;  1HWY A;  1MAB G;  3RVY A;  1YI2 V;  2B5U A;  1YTF B;  1PNL A;  2V1D A;  3X2Q B;  1QR8 A;  1R3I C;  1K8A W;  2JJ1 G;  3OR6 C;  3W7S A;  5L3D A;  2DWD C;  1KP3 A;  4Z1M G;  3FB8 C;  4JAV A;  3DGE A;  1P4R A;  1BHA A;  4BAY A;  5LGT A;  2B1I A;  2LFR A;  2Q67 A;  2DYR C;  1VQK V;  2R9I A;  4I9W A;  4P2Z A;  4MVU A;  3RBZ A;  4QE9 A;  3TCU A;  2P6J A;  5EBW C;  3ABM B;  3B8N A;  2ZD9 A;  1GK9 A;  1S72 V;  3JD4 A;  2OCC B;  3W7X A;  3CD6 V;  2IJH A;  3ETD A;  3SYP A;  4PDM A;  1GO3 F;  1ROP A;  3OFN G;  2IH1 C;  3AG1 B;  3ASO C;  2WLH A;  4UV9 A;  2WPD G;  2A79 B;  1SET A;  1H2G A;  1FXK C;  2HKO A;  3F7Y C;  1V55 C;  1L1F A;  4PDV A;  4UVC A;  3K03 A;  1ENV A;  1OZ0 A;  4RUF A;  1S77 D;  4P9O A;  1SZT A;  3HPL C;  3ETG A;  3FB7 C;  3D36 A;  4QIW F;  1GM8 A;  3K06 A;  4MVS A;  1H38 A;  1VQ7 V;  4U7N A;  2QEX V;  1OCR C;  3ML0 A;  3OM3 B;  1SRY A;  2PI4 A;  5HFL A;  1E1Q G;  2W6I G;  1ZWI C;  1KEC A;  3M99 B;  1OHH G;  1NQT A;  1K9M W;  2LP7 A;  4QJF B;  3TET A;  4ASU G;  2HR3 A;  5FL7 G;  2WSS G;  4JF3 A;  3LUT B;  3ABM C;  3T4Z A;  4LBE C;  4PDL A;  3CCR V;  2BOB C;  2Y69 C;  4JGS A;  2QTO A;  3K9A A;  4MTF A;  3ABL C;  2LFS A;  4GT1 A;  3SPI A;  3EHB B;  1BL8 A;  3VBB A;  3OEH G;  2ZDI A;  3UM7 A;  4PA3 A;  1K4C C;  3F7V C;  3T1C A;  2ZR2 A;  1W0J G;  4PEL A;  2ZR3 A;  3LSQ A;  3W7T A;  4QE7 A;  1MSW D;  1VQ8 V;  1JPX A;  4XDJ A;  3MHH C;  1AJQ A;  3MD0 A;  1JX9 A;  1NH2 B;  3ZN1 A;  2EZO A;  5IYD O;  2Y48 A;  3ZMV A;  3FYI B;  4UUJ C;  3QO5 A;  1K5Q A;  3K0G A;  3GWO A;  2EBO A;  3CCJ V;  1F4M A;  2DYR B;  1AR1 B;  1M9N A;  1Y66 A;  4N23 A;  4R6Z A;  2YEV A;  2EIL C;  5LHH A;  3WG7 B;  4BW5 A;  2OT5 A;  4QPJ A;  1DF4 A;  2YSU B;  2JIZ G;  1PNM A;  5B1N A;  3CC2 V;  2X6B A;  1K33 A;  1M57 C;  5IY5 B;  1THZ A;  1VQL V;  3B77 A;  1R3L C;  1V54 B;  1P7B A;  2C2A A;  2DW4 A;  1OCZ B;  3SPC A;  3PJS K;  4JAU A;  1CEZ A;  2HLD G;  3SYQ A;  4MW3 A;  4TWK A;  1QBZ A;  4KP4 A;  1V55 B;  1CPY A;  4WCE V;  1COW G;  4G27 B;  3AG4 B;  1VQN V;  3SYC A;  4MSW C;  2ZXW C;  3QNE A;  4DO2 A;  1AI5 A;  1VQM V;  3CCU V;  3OEE G;  4JPR A;  3CCL V;  3AG3 C;  1K4D C;  5L3C A;  1S76 D;  2JEX A;  1H8E G;  2XOK G;  1YIT V;  4J9Y B;  3CCM V;  4BIZ A;  2IH3 C;  1OCR B;  3AG2 C;  3OE7 G;  4ZBM A;  1I5Y A;  4LC1 A;  1ORQ C;  1VQ5 V;  1GKF A;  2DYS C;  4YXW G;  1JQ0 A;  3T4D A;  5L3G A;  4GX0 A;  1R3K C;  3WG7 C;  3CC4 V;  3ZMT A;  5DM6 V;  1YJN V;  5KUK A;  3ZMU A;  3I55 V;  1DLB A;  3JD2 A;  4R50 A;  4FPP A;  4I5S A;  3ABU A;  2Y69 B;  1E1R G;  1GTO A;  3KG2 A;  3AEI A;  5IY5 C;  3ABL B;  4N21 A;  3QO8 A;  5B1B B;  4HZ3 A;  3JYC A;  2WLN A;  1V54 C;  4L87 A;  3SYO A;  2WLJ A;  1OCZ C;  1FXK A;  1AI7 A;  2UXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...