1V54B

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v54B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v54B02
2OV0A 2H3XC 4YSAA 1A4CA 1AZUA 3TBBA 3NSCA 4E9WA 3FU8A 4GP8B 4KO7A 5TK4A 1NZRA 1NWPA 3CZUB 2GC7C 1AS6A 3FYEB 2FT7A 2YXVA 2FQDA 4BDVB 2DYSB 4HCGA 3SBQA 3GXUB 1M57B 1ASQA 1PY0A 4MFHA 1NIDA 1GY1A 2GI0A 2IWKA 2Q9OA 3FT0A 1BXUA 2PPFA 3NP3A 4P5SA 1AQ8A 3ZDWA 5B1JC 3NSYA 2R7EA 1ETJA 2B08A 2FWLB 1AANA 3X1EA 3WKPA 1SF3A 2ZONA 3ASOB 3ASNB 1JZJA 1ZV2A 1BXAA 4QLWA 2GB2A 1A65A 3PAUA 1OCCB 2FT6A 1KGYE 3EH3B 1PZBA 1ET8A 4PCYA 3PPSA 1JZFA 3AG4B 4HHGA 1ET7A 1TKWA 4HZ1A 3AY2A 2I85A 4E9TA 2QDVA 2VSKB 4DP5X 1OCZB 2WO3B 4YSPA 3V9EA 1JZIA 3IBOA 1JERA 4JKNA 1IKOP 1KCBA 3DIVA 3FU9A 3IE9A 3DTUB 4F2EA 5A7EA 1NIAA 3FSZA 3G5WA 3JT2A 2YAQA 2PPCA 2XV3A 2QPEB 4YSDA 2IDTA 1RCYA 1E5ZA 2VSMB 5I6PA 1ZDQA 1BAWA 3EF4A 4A2GA 3OMAB 3NJMA 3CVCA 1WS8A 4E9SA 4E9XA 2XVBA 3EH4B 1AS8A 4RH4A 5B3SB 3X1FA 4BXVA 3HB3B 1CYWA 4WKXA 1A8ZA 1PZCA 1NPNA 4DP1X 3KW8A 2J55A 9PCYA 3FU7B 4G70B 1CYXA 5I6LA 2YARA 1L9RA 1W6WA 2VW4A 4Q89A 4YSRA 3FSVA 2BHFA 3OMNB 3ZBMA 2E86A 2PCFA 2A3TA 1CUOA 3TA4D 1RZPA 3TASA 1X9UA 3UACA 2FQFA 4G7SB 1ILSA 2TSBA 2YAMA 3RYMA 3PLYA 4M3HA 1AG6A 1V10A 1GS8A 1SHWA 1NINA 1GS7A 1NTDA 3C75A 3NJIA 4W9ZA 4KO9A 4Q8BA 4KO5A 1NPJA 3PAVA 5I6NA 6PCYA 3QJVB 1YLBB 6PAZA 1R1CA 2VM4A 4YSEA 5D4IA 7PAZA 3H4FA 3NJNA 2I7OA 2NRDA 1DYZA 3OD3A 4KOBA 1MG3C 1ZIBA 3OM3B 1J9QA 2JFCA 3TBCA 4A67A 3AG3B 1KBVA 5D4JA 2P80A 4YVUA 1PMYA 2JXMA 4UANA 2BW4A 1A4AA 2I7SA 1PF3A 2VN3A 2HX9A 5I6OA 3X1GA 1ASPA 3QJSB 2BZ7A 3UAEA 2BWDA 1UATA 2DY2A 4PAZA 1TEFA 4KNSA 1HAUA 2HLEB 2CAKA 2BP8B 3ABGA 1JZGA 1GS6X 2XUWA 1OE1A 1NIBA 1SDDA 2AVFA 2XXFA 4E9YA 1NICA 2HRGA 2WO2B 4EF3A 5B7MA 2UXFA 4YSSA 2OJ1A 4DP0X 3CDZA 1URIA 2N0MA 4JHVA 1AR1B 1ZDSA 3S3BB 3WI9A 2IAAC 1BQKA 1AZCA 1WA2X 1GY2A 4A2HA 5PAZA 2FQGA 2HX7A 4ZK8A 2YAPA 2YAOA 1L9SA 2UXTA 3SBRA 1AAJA 1M56B 1W8EA 2GSMB 1MDAA 1WA0X 1AG0A 1A3ZA 1ET5A 2AANA 2PPDA 5D4HA 2HX8A 2RACA 1JOIA 3WNIA 1A4BA 2CUAA 1PCSA 2Y69B 1WA1X 3NSFA 1AOZA 1OE2A 1BEXA 1JXFA 3KW7A 5ANHA 1OV8A 2WSDA 4DP4X 3WIAA 5B1KA 1E67A 2UX7A 4QKTA 4DP9X 1MG2C 4KO6A 4BK5C 2IH8A 4JHUA 4TXVB 3AZUA 2PCYA 5TK2A 4UAHA 3NYKA 4HAKA 2AZAA 2DV6A 2VMJA 1XB8A 3CVDA 1J9TA 1L9TA 2PP9A 2Q5BA 4BDVA 2H5UA 2UXVA 4E9RA 3QJTB 1ZIAA 1NWOA 4N8UA 3AG2B 4NERA 2W8CA 1PLCA 4AKPA 1RKRA 1TU2A 3WNJA 4DP7X 3GDCA 2DWTA 4N4YB 4ENZA 1QNIA 2IDSA 2MRYA 3AW5A 3FPYA 3NJGA 2PP7A 2XYBA 1ASOA 5B7FA 5LDUA 3S3DB 3ABMB 1WAEA 4HALA 2QDWA 3ZX1A 2HZHA 1PNCA 3S8FB 1ZPUA 2ZOOA 2OCCB 2HXAA 1CURA 1GSKA 1XMEB 2EILB 2BWIA 4HCIA 1J5DA 2XX0A 4BWTA 5F7AA 1V54B 4X4KA 1JXDA 3SBPA 5I5JA 4HIPA 2XU9A 2B3IA 2X87A 4BWWA 5AKRA 2XX1A 2GIMA 3CVBA 7PCYA 3PCYA 3X2QB 2XLLA 4E9VA 3T6WA 3QPKA 1DZ0A 3TU6A 4FA7B 3OQRA 4HHWA 3NJJA 4A2DA 2CALA 3T9WA 2EIKB 2J56A 4DPCX 1KYAA 2LLNA 1KBWA 2J57A 1J9SA 4KNTA 3AG1B 2TSAA 3S8GB 1PLBA 4GP5B 1J9RA 3FU7A 3BVDB 4YSQA 3FS9A 3T6ZA 2EINB 2IDUA 1GYCA 3WKQA 1IBYA 1B3IA 5B1JA 2IWFA 3BQVA 2UX6A 3EH5B 3ABKB 4FAAB 4W1TA 1QLEB 3X1NA 1RZQA 1ID2A 3SQRA 1L9QA 3DKHA 1AZBA 1HFUA 1IC0A 1SHXA 2AFNA 5I6KA 2QT6A 2YAEA 2IH9A 3EHBB 1NDTA 3FQ1A 4HCFA 5PCYA 3IN2A 4AX3A 1T5KA 4GP4B 1X9RA 1OCOB 4WTQA 2FTAA 3IEAA 2R7EB 3N2JA 3FQYA 1JZHA 2YAHA 1J5CA 2VM3A 1BQ5A 2H47C 4YSTA 1F56A 1OOWA 1JZEA 2P80D 4KNUA 1BYPA 5B1BB 4YL4A 5EHFA 1AACA 2JKWA 2GHZA 2PP8A 1QHQA 4DP8X 3UGEA 3NJKA 4YSUA 1PZAA 3L45A 4K9JA 4L0PB 4G7RB 4NB7A 1E65A 2GBAA 2PPEA 3QJUB 3QJRB 3QQXA 2DWSA 1N68A 3PXLA 3V9CA 3N55A 4F2FA 4A68A 5F7BA 2DYRB 2BP8A 2VW7A 3JTBA 1PNDA 1PLAA 5E9NA 1W6LA 1KV7A 4UF7C 4G71B 1JVOA 3S3CB 5I5IA 2BP0B 1SJMA 1SFHA 2XXGA 1MZZA 4BWUA 2CJ3A 4GXFA 1BXVA 4F7KA 1GR7A 1IUZA 2FT8A 3NP4A 3MBWB 1XB3A 2BZCA 3FQ2A 3H56A 4DP2X 2XV0A 2YXWA 4KOCA 1EZLA 2CCWA 2QPDB 4AKQA 8PAZA 1JVLA 2YQBA 3HEIB 1CC3A 3MX0B 3T6VA 4NAJA 2FNWA 3NJHA 1MZYA 4YSOA 3NJLA 4A2FA 3UADA 3ZIYA 2IWEA 4AKOA 4E9QA 3H4HA 1FFTB 2HRHA 4CSPA 2BP0A 1L9OA 1NIFA 4G7QB 2Y1AA 1SNRA 1IBZA 2VW6A 4CSZA 1XB6A 3NJFA 2IDQA 4YVNA 2YAFA 3GYRA 1VLXA 4A2EA 1OE3A 2MTAA 3T71A 2XWZA 2ZWNA 2BW5A 2YEVB 5B1AB 4DP6X 3PAZA 5I6MA 3FYIB 3NSDA 5I28A 3OMIB 5FC9A 3X1BA 1JXGA 2ZXWB 3FSAA 2FJSA 3D12B 3FPXA 4A66A 5AFAA 2IDFA 2CBPA 1KDIA 1L9PA 2GC4C 4YSCA 3ERXA 1HAWA 2EIJB 1SDDB 4GYBA 1WS7A 3IN0A 1N70A 1ADWA 1E5YA 2BO0A 2FQEA 3NT0A 2W88A 5I5MA 1FA4A 1BYOA 4P5RA 1SF5A 3CDZB 1M9WA 5IY5B 2UXGA 1BQRA 2J5WA 3CG8A 2XV2A 1I53A 1AIZA 3QJQB 2AZUA 1AZNA 1NIEA 5B7EA 4AI7A 2PLTA 1E30A 1ILUA 3U25A 1OF0A 4G72B 3WG7B 3T6XA 1FWXA 5I26A 1KDJA 4GY4A 4DPAX 2X88A 1GW0A 3ABLB 3UABA 1AZRA 1KCWA 1OCRB 2EIMB 1V55B 4BXSV 4DPBX 1EHKB 1PAZA 3UAAA 5AZUA 1TEGA 1AS7A 1SFDA 4M4RB 4AZUA 3FSWA 2PPAA
chains in the Genus database with same CATH superfamily
5LGUA 3W7UA 4WWKA 1RJZA 4QPEA 4RSYA 5JQGB 5A2CA 2BSTA 4IBTA 3T5WA 1S7XA 5LWYH 1ZGLA 4PA3A 4XI5C 3N42F 3CZUB 3H7BA 4MS8C 2JKJA 5IHZA 1G5GA 2YXVA 1MZFA 2AQ3A 1SPDA 3HC4H 4BWAA 1C12B 2FQDA 4JQXC 4J3SA 2Y25A 3CZGA 2GITA 3ZT7A 3HG3A 2VL4A 5CJ8A 5GHWH 3S2AA 1NIDA 2IWKA 4PRDA 3FT0A 4TN9A 1LE5B 4LR3A 2X10A 2OYQA 4P5SA 1QVOB 4QEGA 1SYSB 3FB6C 3WYRA 3GMRA 4F7PB 4FJZA 1A1OB 3JARA 4HIEB 2F0CA 2NCMA 1BZDA 3BDBA 1TU2B 3JXAA 4FQLH 4I5BB 4JY4A 1K8DB 4YXHH 1MCOH 2BSRA 2ZONA 3V6FB 1SQFA 4XO9A 5TQ0L 1MEXH 2V2WB 5L7XL 4JPRA 4D7SA 5ESQA 1AO7B 1KGYE 1NBQA 4WFGA 3F6IA 2ENQA 4W93A 1WAAF 1ET8A 4XB3A 4K35A 1CLYL 3AG4B 4PRPD 4X6BB 1TKWA 4H5SB 2UU9O 3IJYA 3H9VA 2QVFB 2D7PA 2XCMC 5D7IE 1U91A 4FP8H 1YEHH 3D06A 4RMUA 3DGEA 1KBBA 1T04B 1IKOP 2FJUB 3I5DA 4ZTEA 5B21A 2HR3A 5TE4L 1I4FB 5F3BB 1VQ4V 3DTUB 1K2DA 2FGWH 5C09E 4N5UA 1AJPA 1NOLA 2P5EE 3AMKA 4XGZB 1FO0A 2IDTA 2PO6C 4XE5B 4NTWA 4YR6B 4ODTH 5HPOA 4Y5YA 2GTSA 4J9YB 4TV9A 1RJLA 3BEWB 3P0YL 1DUYB 1TJIH 1XR9A 3TO4D 1J0ZA 3W38A 1N9PA 3SDCA 3QHFH 3VFUB 4HJGB 1WBYA 2EIMC 3IK2A 3VSQA 4KMTH 1A8ZA 4NXNO 2M83A 4DP1X 3H55A 1UWEL 1OD7A 4YAQA 4M7KH 3CSYB 3HE7B 3B5GA 2ICEC 4D3CH 5MENE 1NKGA 1CYXA 4JGUA 4GJTB 1L9RA 4Q89A 4P2RE 5KSBA 4MNGE 5KSAD 4S2SA 1JJ2U 2XWXA 4YUEL 3V6OA 1EO7A 1MFMA 5DUJA 2XAHA 4BRJA 5EO0A 5FYLL 1BBDL 4X6CF 2AXFA 1OP3K 5CBAB 4OUUA 3A24A 4DV2O 1T1YA 3L3HA 4M93B 1GS8A 4P3WA 5E8EA 1RZFH 3OSVA 4KO9A 1Q72L 2ZP8A 5JHMA 3FN0H 1JGEA 2CR6A 3CLEH 4HH9A 2R51A 4IGBB 4QTFA 3PXHA 2FVNA 3VA2C 3GWOA 3MACL 4WTXA 3RX7A 3KWXA 2ICES 4HBQA 4NC0B 3T2LA 4DCQA 3WS3B 1JVMA 4FLRA 1ZVHA 2A6KB 3KR3L 1X7QA 4U1NB 3DPBB 3D48R 4IRZH 5T1LD 2JKTM 3EJZD 5JH7B 1HDMA 1NMCB 2ZX9A 4TULH 4JO4H 4U6VL 3RWHB 3U1QA 2J2ZB 2DKMA 3AADB 1DFBL 4J3OH 3CD6V 4KVCL 3BFRA 4P4RA 4HBNA 1A4AA 3I6KB 5GZOD 5I6OA 4M7LT 3QO0A 3LKQB 2BZ7A 2RR3A 2FH6A 2O5ZL 4YE0A 3ZE0F 5CLWA 4S1QH 1MCNA 3T8VA 1M4UA 4NQUA 5KYUB 2GUYA 3Q05A 3E22A 1MFCH 3DTXB 4JHZA 5DMGC 2CAKA 3ABGA 1JOYA 3ES6B 1GC1C 4HIXH 2E74C 1YEKH 1MCFA 1ZY9A 2QSTA 4XN9A 5HHMB 4DAGL 2WBJA 4B7LA 2GJZA 2GQHA 5CP7A 4JPVH 1U8KA 3ZHQA 3HHRB 1YEJL 2MKLC 2N0MA 4PSPA 2Y5QA 4NBZB 3FB8C 1CU4H 2NW2A 3L6FA 1TAEA 1AZCA 3S98A 1SGKA 4PVLA 1O9VA 3VFWA 5JO5A 2FQGA 3LAFA 4LVOB 4AC4A 2P44B 2ZSWB 3QXVA 5I8CA 2HRPH 4YBLC 1CFQA 5F21B 4BFIB 4NHCH 5CFAA 1HK6A 1IV8A 2VISA 2QWQB 4OZ4A 4JPQA 3AY4A 5CKGA 2NX5A 2E75C 3MLPA 1O6SB 1Q9KA 2WYTA 3OAYK 1YSCA 4ODHL 3RVXC 3QUHA 3WNIA 3LXAA 5CJ5A 1IM9D 1PZ3A 5E6IC 3LRSB 4LNRA 4ENEC 3DROB 1TIUA 2E4TA 4LL9A 5MEQB 1E67A 2GT9A 3VUAA 5KG9B 3N43F 4PJ5A 4JHUA 4TXVB 4MW3A 3O4LA 3B2UC 4LF8B 3D05A 4KUZH 4EB6B 4CNIB 4FQ2L 4HEME 4E42A 4L3FA 3TCLA 5SX4H 3QH3A 1E2VA 1KPVB 1L0YA 2VZUA 1UD4A 5FV1L 3ABTA 2PP9A 5C92A 3LHAA 3W0WB 1YEDB 1MFDH 1WFUA 4I9XA 3L70H 1INDH 2ZUYA 2C9RA 3REWB 5L4MA 4X5RA 1MPAL 2IEPA 4JN2B 1V7ML 1ZSDA 5BMVB 1AR1D 1GZQB 1K3EA 3SCMA 1OO2A 2VTFA 1RLWA 1LEGA 2ADJA 2AJXH 5FB8B 4ZMAT 3H9SD 2IDSA 4EN3A 1EAPA 1TEYA 3MUY1 3WNLA 1IAKB 3ROOA 1AQKL 4FZEH 5E2TL 1DN2A 4WGKA 2XYBA 3E80A 1F4HA 3QB7C 4PRAB 3VFNB 3ABMB 1KCUL 4KKCD 1CBVL 3MLTA 3OPUA 3ZX1A 2A0LA 1L7TH 4NC1E 1ESOA 3EHBC 2AJZB 2P5WD 3EIFA 5K39B 1QFHA 4N1CA 4NZUH 1PSKH 1YRKA 3SZKC 1SMAA 4FLOA 5BUGA 1RZKH 1J5DA 2O72A 4IKJA 1V54B 3RAJL 2BVUA 4NFCA 2N7SA 2V0AA 3FT4B 5CBEA 2G2RA 3DETD 3U9WA 4N2LA 5DSCA 1IC5H 4LLMA 4DUYB 2AEQH 8CGTA 4IKNA 5JHDD 4HOWA 3CN3A 1EHXA 3CVBA 5ALBL 3QJFB 4UFZA 3HKCA 4DKTA 5KS9A 2VLRD 2VDNL 4HHWA 3PIQA 3NA9L 1BAFH 5IROA 4R5TA 2EUXA 1K3IA 1HCZA 4U1HA 1SEQH 4F3FB 1CTNA 5HI5D 1JZ4A 5LHHA 2ZNJA 3B2EE 2NY1D 3JTTB 4ZI7A 2Q3ZA 2IH3A 4ZMZA 4NQVB 4CVZB 3Q8EA 1A9BB 2LAAA 4QHLB 5DMIH 2V2XB 2XETA 2QM7A 3VM5A 1J9RA 3LKNB 3QZLA 1Q0XL 4YK4C 2EECA 3TVMC 3K2KA 1U8PA 5FECB 1JFHA 2IDUA 1Z32X 2BNQB 4J12A 4LLWB 1G4RA 5IDJA 4NO3B 4Y9BA 5EBLA 3VE0B 4M8UA 1MZEA 3U11A 1EGJL 3Q8FA 4FFZL 4WJ5B 1GPOH 2VIRA 1DN0A 5C6PB 3IU4H 3GMOA 4X4MA 1JMZA 5I66B 1I5YA 3KLAA 3QO1A 1BGYH 3B2DC 4DP0X 3BX7C 3WD5L 4DV4O 3GMMA 3GUFA 2AK4E 2WLMA 5AG8A 1AZBA 4QAWA 4X7CC 5T3ZD 3C6SB 4BHUI 1LEKB 1M5IA 3N0AA 3SOBH 3KMDA 4IS6B 1WK0A 5KSBE 2QZ5A 2D31B 2VDMH 1H15A 5IYDO 1LM8V 4OM1L 1NDTA 1TZAA 4GRWB 3S96A 5E6ZA 1XL4A 1YUHB 2F7PA 4MVMA 2VRZA 1K4DA 1QEXA 3IYLW 3S6CA 3GDBA 3H2PA 2WY3B 1U6AL 3EXLA 4RMTA 2DZEA 4PG9A 1J05B 2OT5A 3QG5A 1QBBA 2MKWA 1FGNL 3ATBA 4GAAA 2XBTA 4MAYD 4B97A 2WA3A 1Q3EA 1I82A 1QHQA 2CE4A 3SO5A 2NLJC 5T3XL 5GGSA 3T8MA 4ZMLA 4LF5O 4HS6B 15C8H 5J6SA 2N74A 4A04A 5G5DB 3N55A 4P46B 4HWBH 5IEHB 1FH5H 3SE8H 3NVQA 4L5FE 4CS2A 1CXEA 2F53D 2VITB 3HHSA 5DMJB 1SQ2N 5F1NA 4X20A 1BCIA 5BS0A 5FGRA 4U3JB 4KKRA 3P73A 1KFAL 1PAMA 3FO1B 1ZHNB 2WNXA 1R1BA 5FIEA 4UF7C 3T2PA 1GCYA 2R0LH 5IB1B 1YY9C 2JIXA 4NPYB 3BUQA 4XP6H 3HG0A 2WZ6A 4DVBA 4KTDH 3ZKMD 5GONB 1DDTA 1VQPV 3O45A 4IHOB 3U1PA 5E6YA 5HD8C 4DK1A 5F7EH 2YEZA 4L8SC 2O5XH 32C2A 3EJQA 4UNUA 2ENYA 4WWKC 4XP4H 5C0AD 1MCWW 1Q6UA 1S7VB 3EJYD 4NQDA 5DJ2A 3GI8H 2OZ4A 2C7UB 2O4EA 1EZVX 3QWOB 4JAMA 4MD4A 3BKJH 2ZF9A 1EZLA 4AEHH 5CB4B 3G5VB 2IALB 3QW9A 4PJDF 1O9HA 3DX4A 5DFTA 4MASA 2CUIA 2OI9B 1C5CH 1WQVT 3GMPB 2ZWLT 1EBAA 4N2KA 4OAWB 2D03L 3MROA 5JW4Q 4A2FA 4BFGA 4LNUB 1Y4MA 3GI9H 2YLKA 1K6QL 5EC2B 3B8MA 4H0IA 4WU7A 2KMWA 2IQ9H 4JJOA 2C9XA 4MMXB 4B9PA 3JAWA 2BSCA 4XVTH 1FAKT 4WO4B 4F2ME 3AWFA 5BJTA 1Z1WA 3SR2C 4CS4A 3JZYA 4JYCA 5KHHA 2VR5A 3EYQD 1M1SA 5C0BB 1JRHH 2OR9L 3EXJA 4P3DA 5AOZA 2B1GA 2EVGA 4JG5A 3FT9A 2ADGA 1DQDL 1IKFH 4FMTA 4U1SB 1EK3A 2BC4B 4OH2A 2A83A 1CF8H 1DO6A 4BCYA 3X1BA 3CZEA 1AHWA 3UYOD 2BRRH 1NFAA 5AW4B 4BSVA 5HGDA 1ODUA 2FJSA 1MRCL 1TETL 3W81A 1PD0A 2UYLA 2OYLA 2B3RA 4Y5YC 5IW1A 4QRSA 2QSAA 2E27L 5IG7A 2DLTA 5JA8B 3QEQB 3WELA 3FQWA 1KZQA 4RZKA 3DOSB 4N2IA 3TA3B 2CUHA 1WLEA 1IGJA 4YHZH 3OLEA 3SDCC 2VQTA 2X4RB 1AGBA 2D7OA 2MJWA 2Z34A 1VQ5V 2Y07H 5DWPA 5A43C 3FCTB 1UA6L 5A3IC 1E9QB 5TDOB 5C9KA 3KPLB 1Z5LA 1I9JH 3CG8A 1JHKL 2ODMA 1I53A 5BR8O 3QUZA 4M1GL 4OCWH 4BQ9A 3KPMA 5CD5C 3N06B 5TISZ 3ULVD 3BZEB 5H35A 3KJ4C 2Q3AA 3U25A 4G72B 4X7EC 3V6OC 2JLPA 5JXED 4LHUD 3LV3A 1ZS2A 4RISL 2CG9X 3VB9A 2Q5ZA 1GKFA 4PA9A 1BX2B 4IRSD 2BCKA 1I9IH 3MJ8A 1TEGA 4I9WA 4NRZB 2JB5L 1IL1B 4UAOC 4B41A 4M6MH 2X2IA 2P4AB 4OCMC 4J3OF 2NY7H 2FJGB 1BZ7A 4MVOA 2XAGA 2ILMA 1JHLL 3DBXA 3DVGA 4PH8A 5T1KA 2A6DA 4YSAA 4Z7NE 5MENB 3V4PB 5EEUA 1Y6MR 4UIMA 3UGUA 1GRWA 3V5KA 2O61A 2XACC 4K73A 5DYOB 1KV3A 1HWYA 3OKOB 4KDTC 4P2RB 1M3IA 4P04A 1LL1A 2LQTA 4XC1H 5EZJA 5JUEL 4E4EA 3GBML 4IOIA 2Y4SA 1X4XA 4OCLC 3DGGA 4X4ME 4XZUA 1MCKA 1UXWA 2OULB 1X5JA 3FONA 2WLIA 3MRQA 3FK3A 4FTVD 1VQNV 2FLMA 1VZGA 3U0TB 3VAEA 3WDIA 3V55A 5B1JC 5DJZB 3S36X 5TGBB 1IFGA 2MW2B 2A9NL 4TUYA 2QADD 4Y1AA 5GRUL 5JPMB 3UAFA 2ESVA 4IRJD 5FM8A 1W0JG 2QDOA 1PDKB 1FVDA 2VYRE 4FG6C 5LA6B 1CFSA 3N9GH 2P42B 4M5TA 2NNRA 2WBJC 1JVKA 4PY8J 1N4CA 5E5LA 3AGVA 3MBEC 2IDCA 3QUXB 4XNYL 2HB0A 4XAKD 5FHBL 1RIUH 3LKRB 3NPSC 4QY8B 1JCVA 1AY1L 1RP9A 3L5WA 5I8EA 1IC1A 3B3IA 5CINL 2HKHL 1W72A 2J73A 4R7XA 1EMTH 3H3PH 2FO4B 2IBBA 3NDZE 4R7NA 4WLCA 1QR9A 4ZZKA 3L81A 3QIWA 2DQIH 4PWGA 5BRZE 1S2EA 3MHHC 1VFUA 3SPCA 5FV2A 1SJEB 5L88H 4H40A 4PBVC 1LR1A 2WUBH 4E9SA 4EJ1C 4E9XA 5C7XH 3GSOA 1QSEA 4RH4A 3AY4C 4BXVA 5IJBC 5DC2A 4EQ2A 3LZNA 2DOCA 2X0LA 3HBPA 3C60A 1GGBL 4B9JA 1N34B 4LPTA 4NKGB 4DR5B 5TE6H 1B3QA 2P6JA 3SGJA 1TUBB 5H5NA 1O7VA 4GINA 4JQIH 4NUJB 4R84A 4AL8C 3ARTA 5DJAA 5DZVA 2VW4A 4BRVA 4GIOA 2DN7A 4QKXB 3SE4A 4LEOB 1UT2A 2F5AL 3BUBA 1MW1A 3WFCH 5FA3B 4GX0A 3ZBMA 2Q7EA 1VIWA 3D2TA 5D7SL 3IF1B 5BXFB 5JOPE 3BDYL 3CCHA 5L3FA 3L2MA 4Z1VA 2B9ZA 4MQTB 3MNWA 4I7ZC 2VN4A 4RNRB 4Z3TA 1V10A 5TQ2H 3DA0A 4J2XA 2WIIA 1FYTA 3P4NB 2F5BL 3SCMC 4HXBL 4DV0B 4MX7A 4WV1B 3JWDC 4FFYA 6PCYA 5DEFB 4WFFD 3C8DA 4R83A 3JATB 1R1CA 1WEJL 2VM4A 4EN3C 1XEDA 4APXA 4NT6A 4JV5B 4JO5A 2IH1A 4B60A 4EIZC 1ETA1 3OD3A 4GOSA 4LCIH 2O6CA 2GJRA 4UCVA 2FJHB 4P9MH 1HTYA 1FL5B 3QJHA 3PWUA 2GJ6E 2ATPA 1YMHB 2BIOA 3MUJA 4WNQB 5ID1A 3IGAA 3U0WH 2RDCA 5HI3D 4ZXBA 3GSRB 4G8EB 1BFOA 1U8CA 4L1HA 5FOBA 3WXWH 2H32A 2VXTH 3MRPA 4M7ZC 5I1LB 1H2GA 3L73H 3S36H 1U8QB 1TTRA 1EDHA 2E6QA 4LKCA 4W9FC 4D7BA 1B4TA 4KROB 4QCIB 5TF0A 4JM2B 5IIEB 3ZUNC 2ZYIA 5EU6B 1QSFD 4U1LB 4N0YH 1T6WA 2PYFA 3C3SA 1PEZA 3ECWA 3KWWB 4HC1H 1XNQB 3OC8A 3UAEA 5DLMH 3HC2A 2YIDA 2DY2A 3OX8B 4I1NB 4P3CL 4RFNC 1QACA 1Q90D 3W9EA 4DR1B 3D09A 3Q6GH 3NH7L 5E8PA 4GAYA 1R9FA 4IYKA 5IROC 2XUWA 1OE1A 4Y19A 5D1XD 1TMCB 4E9YA 2WO2B 2IAMA 4DJMA 1DQMH 5I1AB 4Q6GA 3M7MX 2QL1A 5B7MA 2IH3C 2OXGA 4XWOD 2K7PA 2OJ1A 5LXGH 3VXUB 4GUNA 2Z91A 3D39B 5DJ6A 4MDIB 4S10A 5F7DB 2VOTA 2DBLH 1C08A 5EBLC 5DURB 2O26U 4H0GA 3UZEA 3U7YL 2A74B 3SKNB 3DI2B 3K6SB 1GKEA 4WVRA 4C57C 5F7KC 5INCA 3KZIZ 4N8CH 3DOHA 1OSYA 5D7HA 1FVEB 2PWDA 1TYEB 4HCRA 4TS6A 4DEWA 4EBQH 1BVLB 5FUCE 1DJZA 4U6YA 1KXQE 5DJXA 3CVIH 2XUMA 4O51B 1JYXA 5J11B 5D93B 1M1XA 4GUQA 4BIUA 1PZ5B 2Q2EB 4AYBA 4HGWA 1PBYA 5IUCA 3QWRD 5EDXA 1ZV9A 1G9MH 1OTUC 1AOZA 4DW2H 2J6WA 2N01B 4LQFH 4DP4X 1N0LB 1NTMH 4ANUA 5E8NA 1F86A 1F13A 1K4DC 1D7CA 1E4XH 1U8MB 5JPNB 2PCYA 3IMTA 3CCJV 4N9GA 1TTUA 1X5IA 4N2DA 2OP4L 4ZUVB 3RDTD 1J9TA 3L3IA 3MCKA 4TV3A 1PKOA 2Q5BA 1LO0H 1WP6A 2Z5UA 2H41A 2ZG2A 4XP5H 4E9RA 3FT1A 5AAMA 4RDQG 4N8UA 4PLKD 3T0ED 2AK4B 5GZND 5H4ZA 1YMMD 1O9GA 4UBDC 3ULUE 2VXQA 3D08A 4JFFD 1RULH 2Y0IA 2J6EL 2W8CA 2DJ4A 3C6LD 3GSQB 4LSSH 2IGTA 4NNXA 3DYMA 4PWEA 3V0DA 3LEVL 1YYML 4FERA 3LXCA 3UJJH 3L1EA 1OAZH 3W11C 1VEOA 1I1RA 3BD3A 4IU3A 4LZKA 4EUPA 4Y4KB 4G43B 3NGBB 1AMXA 4JREC 4LCUB 4WIQA 3CH1A 1MI5A 5DQJA 2Q73A 3P0VH 4UQIM 2D0HA 4M5YL 1UZ6E 1A4KB 1SXZA 4U1IA 3QYMA 3MUUA 2VWEE 5LGNA 4FQJL 4KJQC 5E9DA 2WXGA 1G1YA 2LGWA 3BWUF 5JOFA 3RKDD 4G8GD 3QNYA 4LE8A 3A5VA 1GSKA 4FYTA 4HA1A 3TT3L 3S35L 1I9EA 2XKNA 4JYAB 3LEYH 3LKPB 2UZIH 1NDMB 3QI9B 3KPPA 5E03A 5FWQA 5L2KB 1TT6A 4R7DA 5A16A 1H8SA 4O9HL 1GMEA 1MLCB 1OPGL 3LNEA 4OGXH 3PDGA 3NDYE 2BP3A 3PCYA 4BZ1H 4ES8A 1XXDC 2J71A 2OMWA 4X7TB 1QHPA 2R29H 1NCTA 5KTEH 3BP4B 2PYJA 5JJJB 4OD1L 3HG2A 1UXMA 4X65O 1ED3A 1RZ8A 2ATKB 5CN1A 3IJSA 4U6TA 1ZS8A 4GKNA 5IFJA 1XSJA 1IBGH 1EEYB 4FIPC 4N0FA 2N3JA 4L3AA 3AG1B 3IXAB 2FE0A 3NR7A 2N7BA 3GSWB 3NQIA 4X6DA 5KEZA 1TJMA 3FS9A 1N6QH 5CSBA 3NSXA 3SDDC 2BNUA 2ADFL 1WTLA 1QSEE 3PV6A 1XGZA 4WFAV 3V6ZB 2AJVH 5G55A 4CSTA 1OL0A 4B7IA 4LLYB 1KLUB 3RNKA 4K94C 1HSAB 2GSGB 5C97A 3BVXA 4URTB 1WBXA 4W81A 4PRNB 5HTSA 1TQTA 5CM1A 1XNRO 1JUFA 1COBA 2QHRH 1X44A 4HK3N 1A6UH 3M88A 2RGSA 4Q58C 4U1MA 1OV9A 1Z5WA 1BLNA 1QYGH 2R56L 4HW6A 2WV3A 1T2QH 1EXHA 1OTSC 1MJJB 5C0EB 3UERA 4J41A 1KPUB 1ZLWK 2H3OA 1XGRA 1G6RL 3VJ6A 3D3VA 2GHWB 2VMCA 3I02A 4N22A 5KSUB 1Y76A 1SHMA 4IW4C 3VSVA 1D2DA 1BQLL 2PW1A 1F02I 1AHWC 1FYTE 4G7VL 3WFBH 2FBRA 2ZYRA 3RFZB 4HJ0C 2N04A 4X8AA 3VX1A 4A6YL 3HI5L 3NJKA 1J1XH 1GIGL 3ZCCA 1WVZA 3EYFA 4G7RB 1LDPH 2BSKB 5CU9A 5JDSB 3FOMB 3HE6D 1HE7A 1N26A 3EADA 4F2MB 1DEDA 3ZOAA 1P4LA 3MNZA 4FNSA 4LPWA 3QQXA 3K6IA 1A25A 1XCTB 3LNDA 1IXMA 5H8DA 5J1AB 4Z7UA 2PXYD 2VMDA 4MAUH 1LQSR 3FHQA 5FUCC 1JWUB 3UBFA 4JPKH 4JLRA 5TH2B 1R5VB 4PJAA 1NC4D 5DJYB 5E2VH 4R8WL 3Q2NA 4JGSA 3QUZC 1D9KB 4NKOA 1MY7A 3ZRFC 3PDOA 5C7ZA 1W91A 2G0KA 3WUWB 3RIFF 1A1NA 4QI3A 3DHMA 1F00I 3X14B 2YIBA 3D0VB 1KLFB 2J5LB 4XHQA 3OFNG 3U7WL 3NFPA 4XO4A 2WWMD 4OFPA 1SVZA 2BVQB 2ZAHA 3FTUA 4U31A 2JGUA 2V2TB 1JGUH 2Y24A 4L5FH 5D1ZD 3OKEB 4A7QA 1MAKA 1P0SE 3KPNA 4H88L 3MREB 4PJCB 2DYPB 1H3PH 1YI2V 1NLDH 2XPZA 2CJ3A 4LARL 1KTDB 1OLLA 3WGUB 2IM9A 3C5JA 1QBML 4EUPG 1XV8A 3MLXH 1GR7A 1H8NA 4FZ8H 3K1DA 3NP4A 3C90A 1GAXA 1MQKH 3OWEA 1DJSA 5FNVB 4K3DH 2QQQA 3IRCA 1PTZA 1ROCA 2XXMB 1GVIA 4UM9A 3RPKA 4X8XA 2A6JA 2ZCLH 2WTOA 2X7LA 1UH4A 5HVHB 2F1BA 3O4OB 4DQAA 2H1PL 1CG9B 4G1EA 1HNGA 4G6AD 2JDIG 4YJ3B 5F7YC 1Q0EA 1HSBB 3NZHH 1T2JA 3I6GA 1WZ1L 4D9RE 4NXMO 1GGTA 5J2UA 1CDGA 2X0WA 4BUGA 2JJVA 2X4QB 4P48A 1HR0O 1N5AA 1CE1H 1SN5A 2R0ZL 4A37A 1JWSB 3MO1B 2W6JG 5LBSA 4XMTA 4ODWA 4JHAL 5FFGA 4WHTA 1DBJH 2QR4A 5C07A 5HGHB 2X2YA 1LEIB 4ZO8A 4CL7A 1N10A 4FMFA 3SODB 4BK8A 4NKMB 4Z7NB 1EBOA 2OBGA 4L9LC 3MJ9L 3LZLA 2FYUH 2R2EB 4IK6A 4P49A 2YMXH 5D7IF 3IXTA 3VSUA 4E41B 2GAZA 3CQQA 3RZCA 3WIHL 3BHPA 3EOBA 5LCVL 6FABH 2VE6B 4OCRL 1FG2B 1KPRA 1QSZA 3V5HB 4EZMA 4X0NA 4DP6X 4HV8A 2BVYA 4IU2A 1VENA 3FYIB 4F7EA 4ODVL 12E8H 1SLXA 5I28A 5ESAA 2VLKB 3IU3A 1A3QA 2WW8A 2R23A 3G08A 1QFWM 3PHSA 4M62L 3MLUL 2WWNA 4DHLA 2JJUA 2HFFA 2Z8SA 1T89C 4G80B 1G1KA 4TNFA 3QIWC 4QHNB 2NY0B 1KDIA 1FPTH 2H0FA 2HG5A 2ZX8A 5AVVB 3F00A 4FS0A 2DQEH 5FO2A 4XCNB 4AIOA 1P7QB 3ARDD 2XV6B 2VSCA 3LQAC 4ODXA 1PYWB 2FK9A 2EDEA 2YD0A 1MFEL 3P54A 4WFHD 4JANB 1IX9A 1BHAA 4DRXB 3C60C 3OGOE 4OLXL 5L3BA 4Z7AA 3KYMA 4KKQA 2B77A 2N0KA 4PA6A 2EXWC 3SGJC 2JKSA 3HR0A 4XNAA 3T1FB 2X0UA 3JSLA 3QJXA 4HUCA 3U9UB 3VG9C 4NUMA 4HUVA 4WW2B 1BHGA 1BQHA 4WDIA 1D7DA 1S3JA 1GW0A 3LHPH 1LK3L 4N0UA 5DT1L 2FO8A 1OCRB 1FAIH 1J1OL 2WZ0A 3K81A 5ENWB 5BRZB 3FQXA 1V55B 1WZKA 5DDHA 4XT1C 5AB9A 1AP2B 4NQCB 4DKEL 5MEPA 1D6VL 4MCMA 2CLRA 5IMMA 2DMHA 2JQAA 1FE8H 1WTGT 3P2BA 1CR9H 4Z1PA 2GTWB 5F1OB 1LO3H 2HKFL 3EJUA 3NSCA 2IPTL 4W9JC 5KBNC 2IH1C 3HB3C 4GBXB 4K2UL 4ZFGH 1YEEL 5A2IH 3SJAC 3FYEB 2EC8A 4P5TC 3NIDE 1E28A 2CH7B 3Q3GB 3UJTL 3IGAC 4LLDB 5LP6A 2YKLH 4Z7QE 3NEEA 2GI0A 4ZXBC 3RE0A 1CWVA 2GBUA 3G4SV 4FE9A 2XWBA 5DYFA 3KAAA 3P9MB 3BVOA 2AJYL 4TYUA 3QC5X 2P8MA 2Z1KA 1GN4A 2X53A 2B08A 1MRFH 1YPZE 2FWLB 3AU0A 4Q74A 3KM2A 3WJJA 1SF3A 1ZHBA 3IDGB 2KG7B 1FZOB 2ZAGA 1SLWA 3GEFA 4HWUA 5I18H 2DKUA 4LCWD 2GB2A 4FADA 2ITDA 2DLFL 3B43A 3JYBA 3GLEA 3GXTA 4LFCO 4XMLH 1BW8A 5EEXA 3BWAA 4DV6B 1H0DA 1YEFH 4I48B 1FRGH 5GS2H 3O9WD 2LU5A 3BPOB 1A7RL 4GCZA 1I8UA 4E9TA 1OAKH 3PQYB 2YPLA 1A0QL 2IAMC 2GJ6B 4ZO7A 5GRJL 1P4BL 2CGYA 2I9TA 4LRNH 5F9JB 1BOGA 4Y4FD 5E1IA 3ZE1E 3KHQA 2AZ0A 1FNSL 3GJFA 1UH2A 1N36B 5AD0A 4F2EA 4EKJA 1NIAA 3CZNA 2EP6A 2VQFO 1S7RB 4X8JB 5EU7E 2F7RA 1RUQL 5ADOH 5C0DA 1QRND 3UZEC 3DV4A 5IBLC 1QFUL 4U1KB 3VQXA 1CCZA 1NEPA 4X4YB 2EE3A 1NUFA 1Z9LA 4RDBA 1HINH 3K5SA 1P53A 4XTRD 5K5YA 4DN3L 4DR4O 3KCPB 1MVUB 2Z31B 3QPQC 2CBTA 1NBVL 3TS8A 2B5UA 4A38A 1G9NC 1KB5L 2NTFA 4JNXA 1G9EA 1QBLL 1E42A 3CFDB 4FQHB 5FA4B 1HEZB 2B59A 1J5OH 4MJIB 3BZ4B 1ID5I 3D69A 5C0ND 4DR2B 1VDGA 3T0AA 4NQSA 2EC9U 3V5DB 3RWCB 3P11L 4WJG3 5E2WL 3TT1L 4A55A 4NN5C 1KIRA 4XCYA 1H8LA 4AYDC 2JCCE 5HHVL 3ARBD 5DFWH 4UQ3A 4M00A 5JYMA 3AREA 1S8DB 4FQQA 3LVEA 1E4JA 4DN4H 4OCNC 2TSBA 1S9VA 2X9ZA 4JM2F 4O4IA 5DD0L 3NABL 4MCYA 1GK9A 5ALCL 5AAMC 3MV7A 1SHWA 1GZHA 1S7WB 4LU5L 1GS7A 4TOYL 1UB5A 1I7ZB 1A6VH 2EE0A 4V1DD 2VZSA 4TUUA 4MMYA 1X5LA 4Y89A 4I1PA 3VRJA 4KY1H 1XH3B 1R5IB 4N2MA 5DJ8B 5TFSH 1NGXB 1YLBB 1TPXC 5AWNH 4Z3GA 4TNWK 5DD1L 3SDYH 5JW3H 4PHZA 2CJUH 1MCLA 1BQHG 1USZA 3SD2A 5D1QA 2YJQA 2C4FT 1C5BL 1A2YA 3VI4A 4ZFOL 3E8UH 5DD6B 1J0JA 4O4HA 3GSUA 5A2KH 4C83A 3E89A 2GABA 1B6UA 2QMKA 3WIIH 1U8IB 2NXYC 4TUJB 5IP4A 2KT6A 4DFIA 2DN9A 1RSYA 5BV7C 4UVCA 5J3HD 1MWOA 3W1ZA 2CLZB 2VGLM 5LKNA 4PW3A 5HHQA 1ENVA 5IJ0B 4TV8B 1NEZA 3BH8B 2DTSA 3HNVH 5IUSA 2IAND 1A7OL 1C5DA 5LXTA 1KBPA 1U3ZA 1MQ8A 2J4WL 4PWJA 3BVUA 2V7NB 5JQIB 2QELA 1S78D 3FFCD 4W68A 3T2OA 3MOAH 1W2BU 1ZLDA 4FQLL 4P59L 4FG4A 2XXFA 3S4SB 1I7RB 4WU5A 1BZKA 3WNPA 1T0MB 3ELQA 4PJFE 2OSYA 3GBEA 4UOW1 3DGCR 3FO2A 4YSSA 5CD3B 1FN4B 1YVWA 3UM7A 5D5ME 2IBZH 2I24N 3F83A 2WYIA 5E1HB 1DJGA 4QHKJ 3S3BB 5J6GA 2W95A 1BQKA 2PTMA 5KHKA 1CD9B 2EIZA 3ET9F 4QDGA 4YDMA 2MPVA 1A1MA 5CEZL 2YAPA 3JD3A 2IPKB 3VWKD 1HZHH 5DJ0A 4KKLD 1WUZA 3ZQ9A 2X6AA 4MA7L 2QKSA 2ITCC 3QXDA 2DWDA 1WP7A 2JJWA 4GAJH 4PRPA 3TH3T 4APQD 2HX8A 5J0BA 3OLGA 2X6MA 3KXFE 2CUAA 1CBJA 2YO3A 4I4WA 4BINA 5J4MA 4JFHD 3ZR5A 3FQ4A 1DQLH 1KIPB 4N0UE 3WIAA 2B5IB 43CAB 1YZBA 4X5XA 1JI1A 4DZBB 5IMLA 1BEYH 1GYVA 1H3UA 1RVFL 1FZKA 4I0PB 4U1JA 2XAQA 1TVBB 5F9AC 5GRVK 1L9TA 3NCXA 2HLFD 2H0EA 3TO4A 4WHYG 4DKFH 4XX1G 1VFBA 1NWOA 3JAMN 3UTPE 1NR1A 1WP8A 4OTXL 4QRQA 1D2PA 5KVGE 2NZ9D 2NY4D 4OJYA 3WEAA 3CRRA 1YF2A 2Q7NA 3HLAA 3VQLA 2BOBA 1SJHA 4X80H 4LF3A 3EG9B 2EH7H 3RWDB 3UYPA 2MCG1 1OANA 2QVIA 4ZW6A 1H5BA 4QRRE 4BA0A 1OF2A 3VXRE 1KJ3H 1JV5B 5KSAA 2ZUTA 2FECL 3PJSB 1RSOB 1N3NA 4WENB 3ULUH 3L71H 2R2CA 2WN2A 1CIUA 3FN0L 5FEBA 1ZEAH 1DQJB 3GKZA 2OMVB 3PG2A 3BAWA 4J6RL 4QYAA 5EN2A 4HWNA 1A3LH 2WINB 5DQ9B 1KCRL 4GW4A 5JXAH 1MWAA 2RQEA 2UXNA 4V11A 3FU3A 3IGFA 1RPKA 1OVZA 4P57A 3CFEB 2R59A 4ZNCD 3KLKA 4IYIA 3HW7A 3RUGA 4AVJA 5F7HA 3BH4A 1FXKA 2X87A 4B9FA 2L7QA 4TULL 7PCYA 1MUJB 3A23A 4JO4L 1X4ZA 2NYZA 4L8DA 5HFMA 4S0SD 3IC7A 4NWUH 1PIFA 2ARJA 4LQ1A 1OGAD 3GSVB 3LS5L 3SDAC 2Z7YA 4W9LC 1SA0A 3HKZA 5I1EL 3FRUB 2MQ0A 4FZ1A 4N26A 3JV6A 5T1LA 4U3XA 5TF1H 1GM7A 1J0HA 3ARQA 5B8CA 1HOCB 5HPMA 3I55V 1FNFA 1I1FB 3Q7JA 5A2QN 4XNZC 4RGNE 5GZOA 2KERA 4U3SA 1C8QA 5DZOA 2JEUA 3EO9L 4OI9A 1W72H 1NEZG 4P9HH 1P84K 4H0LC 4UU9A 3BUPA 1NL0H 3OGCA 3K9AA 1JPSL 2CK3G 2GTAA 1XT5A 4W9HC 4Y8AA 3QJOA 1G4MA 1VGKA 1Z0NA 3DJTA 2CJSA 4JFDD 2CHWA 4XBMA 1E8YA 1YJDH 3RZCC 1KJVA 2F1AA 3OZ9H 1GGUA 4OPHA 2NUTB 2R2HA 4JMNA 1PP9H 3OW2U 2DD8L 4WWID 2LTQC 3ZN1A 1CD8A 3IN2A 3QBTB 4DGUA 1OCOB 1C1EL 4J7KA 1F23A 2FTAA 2FLBT 3T65B 1BAGA 1G7HA 5CILL 3AC0A 1PG7X 2B16A 2QPFA 4XMUA 1ZT1A 1QR1B 1BYPA 2A4ZA 2OJEA 2EVJA 5IB4A 4MS6A 1Q38A 2EAEA 3G9AB 1GJWA 1JNHA 1UQSB 4XODA 2UY6A 5AYUH 3HKBA 4U6HA 4DETA 3MRFB 1IGTA 5LAPA 2HG5C 4GG8B 1WFIA 2HH0L 1PZAA 3NACH 4NB7A 3L48A 1CXKA 1MVFA 1CGSL 4K07A 2Q9LA 4MD0B 3TJEH 4RZCA 1IM9A 5IQ9B 1YVLA 2DDQL 4JRFA 3IVKB 5D1QE 3I75A 3N2KB 2EDXA 1QLFA 2JJSC 3IB4A 4OB5H 2FX9H 1AVMA 3D0LA 3NAAL 3VRLE 1NCDL 2M7WA 3HUJA 1TZHB 2VL5B 3K3WA 3MGOB 4RLDA 1ZTMA 1ZTEA 4PY8I 3BGFC 3CFCL 4XMPL 5KZCB 3BYYA 3KGTA 2WSSG 1CFNB 1FFPA 3CBRA 1JGVL 2RIKA 1R75A 3GSNB 4PJ9D 3L3GB 4GS7C 4HG4K 4FZEL 4NUQA 3IDMA 4XPTH 3WTVA 1A5FH 1XHZA 4OZHA 2HLAB 4Q2ZB 4ZW5A 1JV2B 4JRLA 2UVEA 2DWXA 5LMNB 4Z7NF 3GIZL 2ODHA 4GMSL 4D0DB 1B88A 1RZKL 3MBWB 3PP3K 5EPMB 3WTUA 3ARXA 5DFVC 4BZ2A 4DQOH 5CJOL 2KB1A 1W2KT 5E79Z 3EYVA 3L9RA 3APMA 3PWPD 3O3UN 2L6LA 3VCLA 1AP6A 4RFEB 2PCFB 3DSNA 2P5WA 3SE6A 2P24A 2HTKD 3WKNA 3OR7A 5E51A 1N5YL 3U0PB 5D8JH 2G75B 5F3HA 4FL4C 1NH6A 5T1DH 3VGFA 4LVEA 4B9YA 1G1OA 4TRPL 3DARA 3QC6X 5DXWA 4DEPC 1SEQL 4KPHL 3CTTA 4WK4B 5JHDA 1BVOA 4XXDA 1EJOL 1RP3B 4XBPA 2IWEA 2HSIA 4UINH 2VDKH 4F4LA 5DMIL 5FHAH 3QQDA 4IBLT 2BP0A 5EOTA 1L9OA 2ITDC 2YD7A 1P4UA 3EH2A 1UACH 4UTBA 1X6NA 3B2VL 2V5MA 4N2FA 2YWYA 4PJGA 1EN4A 1XB6A 3R8BB 3QISA 4LVNB 3L3JB 2BX5A 1S7TA 4OLZH 3RWIA 1CXIA 4D8OA 2Z8WC 4L18A 2CRIA 3IU4L 4H20L 3M45A 3WNNA 3GS0A 2FJFB 3KPRB 4NO5B 3D6GA 5CMAB 4AQEB 4ZMQA 1BJMA 1FFNA 3PAZA 4Z7QB 5KN5A 4A1RA 3OMIB 4WW2F 2E47A 2JGDA 3B9EA 2BY3A 2ZZUT 3UO1L 3QT2A 1GTOA 1KEML 4NJ9H 4E5XG 5GQBA 1YPZB 5AKVA 1IIKA 1SMOA 2P4VA 5J2TB 1M9SA 4GO6B 2LGNA 1MFVA 4LKXA 3ZY7A 2W65B 5LNGA 3U10A 1C16A 4XCCL 3ASNC 4LXFA 5I5MA 3D07A 2VXQH 5E99L 5FCSH 4U2ZA 5CCKL 2EVHA 3L4TA 3DURA 3W9DB 3CVHA 4UNTA 1IAOB 2UY7A 3ZE1B 4CVXA 4L4TB 1FL6A 4ALAL 4J28A 5GS1B 4R4FH 2X09A 5B7EA 4BD4A 4QGPA 1R24B 2VXVL 2JLLA 4J3XA 4MAYA 4H13B 4DR6O 5A2FA 1KC8W 5MI0C 5J6HB 2CTQA 1G7JB 1N59B 5FF6A 1KIQB 3AREC 3SPIA 3PGDA 3QUKB 1DDHA 3O8XD 4O02A 4XNXH 3VFGL 1EHKB 1UM6L 4CJ0A 4X1KA 3GBDA 4OF3A 3A2FA 4NXNB 2VN7A 1GZHC 3ZS8C 4C7UA 3I85A 3P3NA 3JWOC 4R26L 3QWNA 4X98A 4BQ8A 1M1KW 4AZUA 5L6YH 1P7KB 4Z3FA 2QBWA 2YBRA 3GXNA 3V0FA 4ZTOL 1MF2L 4K7PY 1AR5A 2R27A 2WC7A 4QNPE 3MTXA 4JTAB 3LSOB 5IVZB 3RB5A 4GW5A 3MYJB 4ANWA 1ETZB 3BSZA 2EEAA 2JCCB 1S72V 1JPTH 2QQLL 2Z7WA 3CXHJ 2W60B 2VUKA 4GW1B 4L37B 1BPLB 4MVQA 4GSDL 1I8KA 3E38A 1UM5H 4ESKA 1WWWX 5ITBH 3Q2LA 4NKQB 3GZQA 5BNXD 4OLVH 3WB2A 2VDQL 4FQXB 4CAGA 5T5FH 2D2CB 3SJCC 4P4KB 3VFRB 2Y0PA 2YD1A 4RRPM 3STLA 5IMOA 2WBWB 3KBHE 2EXTA 5C0CE 1DBML 2AI0H 4CBZA 1UH3A 2O6DA 3PAUA 3O6FD 1C5CL 2ZJSL 3IFXA 4WI2A 3MR9A 1WB8A 5F1IB 5DWUL 2UZYA 3EFOB 1N7ML 1KJ2B 3AY2A 1KCVL 3TO2A 5KVGL 3IPBA 1JQ0A 2VT0A 2JKIS 4Q6IB 3B5TA 3IBOA 5BMFH 3QA3A 2G30A 1R3LA 1PLGH 4PR5B 3IE9A 3LH9A 2PPCA 3VMNA 3BAEH 3FQNA 3IMRA 2CKBB 3MHZA 5GGVL 3UEZA 5IGXH 3N1MC 1DCEA 3GIVA 4D7PA 3A6CL 2YRLA 3FH7A 4TNVK 1G43A 2D7QA 3NRFA 1IKFL 2Y23A 4A2GA 4Z76B 3OMAB 4TVPH 3TF7C 3NJMA 3JWNE 2DWDC 3GMLB 4X9GA 3NXSA 4GEIA 1F5WA 1NQTA 4AM0B 1CYWA 4MZIA 3QF7A 3UL4A 3IDNB 2ZIDA 3KW8A 3QZWG 3WHXB 1OLZA 4QWWD 2XQBH 5DR5L 2JV6A 1AIFB 5IW6B 5BVJA 1CD0A 2WQXA 5D5MB 4XVUD 5CA0A 5HYIA 2MQ3A 2Z0BA 3WHE1 1U8JB 5I0WA 1AO7D 1V3MA 3DMMB 4LSTL 4Y9CA 4Q9RL 4OZHE 3W39A 4A2LA 1ZA6B 1UJWB 4J3OD 1X5XA 2EYRB 2YPVL 4M6OH 3MVSA 3TN0B 3VFPB 5K9JL 3FO0L 3G7TA 3MJ7A 4GKOA 3OG4B 4QF1A 3O81A 3RYMA 2VR7A 3SQBA 3TO4C 3ULUF 1BWWA 3CFQA 2KQMA 3CSTA 2XBZA 2CCLA 3N40F 3EYUH 1M71B 2YD9A 3LNHA 4HJJH 5E1QA 2AHIA 4C56E 1KYOF 4IKIA 2W0FA 3L4CA 2OJZH 2BOBC 3KXFB 1QSVA 4LCVA 2GK2A 5EIBD 3VU2A 3B7RL 4ZD3H 3ZVVA 4WEBL 2Y7LA 4HJUA 5EA0L 4X50A 4FLVA 1UZ6F 1H5BC 2IW5A 3AK3A 5CBHA 2ZKXA 3BZFB 4PFEA 1OWRM 5KSAC 4FRWA 4LLUA 2JFCA 4RAUB 4LHUA 5JXEA 4ZFQA 5LOVB 1KT2A 5C8JA 2YSSB 5FO7A 4ZI8A 5F72S 2P80A 1VPOL 1CYGA 2WXFA 3O2VH 5KAIZ 1A7QL 2RMKB 5EZIH 3O3AB 5IVXA 4XP1H 1GC1L 2ZE6A 1AQDB 4ETQA 1KJ2H 1WLHA 1N32B 1XCQB 3CUPA 3V4UL 5DZ9A 3OUSA 2CCVA 1LNQA 4KV5E 5DHYB 5IB2A 4O00A 1TEFA 1A6ZA 2CHDA 1E5CA 5TDNB 4XBEL 2ICEB 3V4VA 4QRRB 3VXRB 1DBKL 2E7CA 3ML9A 5E4OA 2ISDA 2CKBH 4YDLC 3GMNA 1L0LH 3HI1B 3MRBB 4K23H 4PGDB 3EJZC 4HLEA 43C9B 3DX9B 3Q48A 2VDOB 4IMLB 4FTVA 3HZYB 2D4FA 5JVDA 3K58A 5B8CC 1MHEA 1JDAA 2J88H 4IGBD 1CZ8H 3CS5A 5GZOC 4CC0A 3QORB 2E3CA 1PY4A 2UXXA 2Q86A 4WBNA 4PP1C 1HIML 1WO2A 1TNNA 4UOQA 1UD5A 2P8LA 3E8HA 2J43A 4IRJA 3OGCC 1LO4L 2E56A 4H25A 3SDLA 5T33L 4LIQL 3KDPB 3QUMA 3SKOB 4XPBL 4F58L 3DRTB 2WK2A 2J72A 3CMOH 3ZDXE 2DEYX 1DLFL 1TOXA 2DQIL 3OMZA 3CSXA 3QDMD 4K3GA 3CZFA 5ANHA 1ECZA 1UWFA 1MCDA 1RERA 3H9YA 4QXUL 2UX7A 4N90E 2EO1A 4CMMB 2YZ1A 4RGNB 1JGDB 4AXWA 1NDGA 5LGJB 4R6ZA 1R3JA 2BOCA 3F5WB 2WJ7A 4XXWA 2EIEA 4AVKA 4DV4B 3VGBA 2I07B 1NGWB 2H5UA 2C4FU 2ARHA 5I1CL 4I4TA 4HBCH 2HJDA 5KHIA 1C7SA 3ETQA 4FG0A 1XDCA 4JHWH 3S9DB 1RK1B 1JNNH 1G7IA 5CJQH 1KSRA 4PJEA 2E74B 3AG7A 5CBGA 3PHQB 1DQQB 4HLZG 1TZIA 4UT9H 2SEBA 1JR9A 4M5SA 3UG4A 5D2NA 3IJ8A 2HP8A 1YZZA 3DIFB 2RQ6A 2H3NA 4G7YH 4LEBA 4QMEA 5D7KE 4PLNC 5DZLA 5TQ2L 2Z92B 4H8WH 3APOA 3FB8B 3IKKA 4B9CA 4Y9FA 4O4LB 2OTWB 4C54A 3F7KA 3L54A 3B9AA 4UDTA 2HAZA 5DF0A 5DLLA 3CXHF 3ZRWB 5F9WC 1YNKH 1ADQA 2CR0A 4HOXA 4GLRH 3TIDA 4U6XA 2ZOOA 1DUZB 2R69H 4YBLB 2WKOA 3ZKND 5FPIA 5H2BB 1CGXA 2LHAA 4WJKB 4NB5A 4AI8A 4IIQB 3DV6B 4LF5B 4J5VA 2I69A 1AR1C 4Y16B 1M7IB 2C3VB 4HPOH 4YDNA 2DJMA 2H9GB 1KFGA 2MH4A 3EJPA 3HIZA 3MU3A 1IEBB 4HIPA 3SBPA 4IBWA 5DUPH 2Y5TA 4OFQA 4WFFA 1HQRB 5C0GB 1W0WB 1S9YB 2VDOH 4QOKE 1NBZA 3EYSL 2J44A 2EYSB 3L9DA 2Q8BL 3EH1A 2G4GA 2OLDA 3GMQA 4XAWH 1DZ0A 1AGDA 1RK7A 1IZJA 4MSWB 2R9AA 3OXRA 1YECH 3W0WD 4LHUG 4KKCC 5C2BL 4DPCX 3BXNB 4YXWG 2OXHA 2UUDH 4GKLA 3SPGA 4KXDA 3J7AU 2CDFB 3OR7C 2Q8AH 5GSRA 1B90A 1SZNA 3Q6GL 3D18B 3BIAX 5DK0A 4AEIH 2QFRA 4ISVA 3ZTDC 3DETC 5KMGB 1QSFA 5AW0B 3U6XS 2FUQA 1DQML 1O5DT 1NAMH 3QFJE 1FZMB 4AQAB 1B3IA 1OHQA 5IB3B 3DK2A 3ABKB 1Q90A 4G27B 4FNLL 4PW9A 3RYFB 2Q6AA 4ZPVB 2YR3A 3IWUA 2O6FA 2NY3B 5C0JA 2W0PA 2XZAL 1A4JB 1S7UA 3GT6A 4W70A 3M1OA 2EJ7A 1NFIB 4RETB 2OFQA 5D1XA 5SX5K 5HI5C 5I1IL 5IZ7A 4CH4A 2NY1C 3GJEA 3MXVH 1OB0A 3BIKA 3EDJA 1DK1A 4I13B 3U1SL 4EZJA 4N8CL 3DIDA 3EHBB 5D6DA 5AZEH 5JQ6L 2EVFA 5CLXA 4ZO6A 4HMCA 1KEGL 5CLYA 1T2XA 3G6JE 4S1SL 1IFRA 4FA8A 2P3YA 5CA1A 4YJ2A 1BD2D 4XPHL 1F56A 4X7DC 2P47B 3FC8A 3UPRA 2EDNA 2V8MA 4DW2L 5I0XA 1NCGA 3M1CA 4AE1A 3UTTD 1IAIM 1VF5B 3VGAB 1TR7A 4Q14A 1TXKA 3F04A 1TITA 3OB0K 1NCUA 3AFLA 3PUCA 3QWRA 4FEIA 5GGUB 2H4EA 2YUVA 4JZGA 2OL3B 1AH1A 1N68A 4RUFA 1RU9L 3DVNB 1CTMA 3FQUB 3S2CA 5INDB 4BFEA 4JRXD 3CX5F 2ZE0A 4JDZB 4A68A 3CZJA 2AV7B 5C0FB 1XTLA 4YK4B 4MVZA 1IT9H 5IVXE 1K8IA 3RVWD 3L17A 4DV5B 4ZUUA 3ML8A 3TV3L 1OCWH 4FULA 2CO2A 4MAYC 2X7RB 4CS3A 3HN5A 4FLSA 4NN6C 3IGLA 3MRMB 2WXHA 1TSRA 1EIBA 4R2GB 5LDSA 3T0EA 4LLVB 5GZNA 1YMMA 4OZIB 3NFNA 3UMNA 4JFFA 4NRXA 2RJMA 1AC6A 4MYWB 4LK4A 5DVKA 1IU1A 2BVOB 3D9AL 1I7FA 1QCEA 2P67A 4PGJA 3ECBA 2HVKB 3CGTA 4WUUB 5CAYB 1FL3B 1ZL8B 1UVQB 1VQ7V 2BZCA 3KVPA 1R3IH 4IM8A 1SOQA 2UZIL 3GBLA 4N1HB 3DX7B 3NIDF 4LGRB 2FBJL 5I73C 3LNGA 4DV7O 2NYYD 3T4YB 2OQJA 4Z7QF 2PWGA 4PJXA 5EWIH 3SGKA 1S3KL 2JB6A 3LDBC 2X4TB 5E24E 4G8GA 3VB8A 1UTDA 3F7YB 2BS71 1XF1A 3NZSA 1UWXH 4TQEH 3LSSA 3KNBB 4IBQA 5D71H 4P46D 1IEAB 1YPZF 4N25A 4F91B 2FNWA 2G9HB 4NTXA 3ZKMC 4UT6H 4PRID 3VI3B 1P1VA 3DUUA 3STLC 3DXRA 5MP6L 3DBSA 5B1BC 1A3RH 4KVNL 2OMZA 3EJYC 3GZOA 4Z0XA 1TCRB 1EO8H 4ZBMA 3K5RA 3FUEA 4XMVA 4N68A 1R0AH 3SYAA 2BHYA 5D2LE 3MRGB 4HYOA 2XWZA 3GJFK 4NNYB 1MNNA 3VXQB 2BW5A 4KJPD 3ZE1F 1FO0L 1RQ5A 5KVMC 5HY9B 2LU4A 5EOQL 5FKPA 4R7VA 2LFGA 4KQ4L 1MRDL 2H0JA 4N5ED 3BYTA 4HKZA 5I17B 2W9DH 1MN4A 1R3LC 2YUXA 2QHRL 5I9QC 2YICA 4F7MA 2WP3O 4A63A 4GXVL 3BAKA 2HUHA 2OL3H 3K3QA 1JFQL 4HJTA 2WVTA 5JDJA 2G3ZA 4DK0A 3WY4A 5JCOA 2FHCA 1INQA 3D25B 3ERXA 5D2NE 5D96B 5FYKE 4L8SB 4W6YB 5C0CB 3IM1A 2QVMA 3TIEA 5C0IA 1K8AW 5F6IC 3P30H 3A0BZ 4PV8A 5ADPH 1YYCA 2NNAB 1M7UA 5AZ2H 3VXOA 3EYQC 4BR6A 4GAGL 2CU9A 4TSBH 1TO4A 3BD4A 5ELIA 1NCIA 2AGJL 4OVVA 4I3RL 3SKJL 4NGHL 5DMKB 4K71C 2JCCF 2YRBA 3WXVL 2OIGA 4DOHE 1CXFA 3WFDL 4DH2A 1ILUA 1XGYL 2ZG1A 3T6XA 3SJVE 1FWXA 1X5ZA 3QHZL 1AP5A 4WO4D 1U96A 1ZT7B 2Y7QB 3L5JA 1BIIA 4IJTA 4UIKH 4OF0A 1A7NH 4JPKL 1JMXA 1XWVA 4AYMC 1VZHA 3T0BA 4M8QA 4L0YA 3HE6A 2VH5L 4OGYH 4O5LH 1XI1A 1LP9A 3OXSB 2QQNH 1I75A 2PXYA 2CSPA 3QRLA 4TLKA 3UBGA 5KWYC 2W0FC 1Q7YW 4YC2C 3J2PA 4WCYL 2PPAA 3VQ1C 3MYZA 2FL5B 3TNNB 1T1XA 3BW9B 1IC4L 1U91B 4L5FL 3QZNA 4XO5A 1WV7T 2MSPA 2XWTA 3QAZC 4I3SL 1URFA 1Y18A 5L4JA 2F58L 2XXCB 5D7JB 3TA3D 1RUAH 5JXEC 4LFAB 2XHNA 1FO0B 4FZ8L 2I5YH 4TT3G 4PI2A 1ASQA 4YFLI 3ZDZB 3O65A 1L9NA 3KM1A 2X89D 5D1ZA 3R66A 3B2UD 5IBUB 3SDXA 2PPFA 4IEFA 4IRSC 5EIIA 5F7LB 1BXXA 2PTTA 3BKYH 3KPTA 3NSYA 3ZTJH 3KYOB 1BFTA 3X1EA 4B9IA 3MRKA 5EN3A 5CF3A 5JORA 4NBYB 1AGEA 3LRHA 4WI7A 5C09D 3KHOA 4AV5A 5I23A 2P5ED 4AQ1A 1G9HA 2FT6A 2M1KA 2ZUWA 3K4DA 5FDWA 1Q4NX 4AITA 2PKDA 3K2UL 3Q5YA 4F37F 5IWLA 4PJFF 4K7FB 3QIBB 2VUYA 4RQFA 3K9SA 1G87A 3CDFA 5D5MF 4B50A 1AD9A 1M2OA 2QDVA 4LCCB 3VACA 1KN2L 4ECNA 3WEOA 3OZKA 2MFNA 3MBXL 2ADIA 5ITZA 5L8LB 1KCBA 4JRWA 2CTPA 1A14L 2H8PB 5DTFB 3RWFB 1HHIA 1MFUA 2V8LA 3KPQB 4QRUA 4R3SA 5E5UB 4OJDH 5L4FA 4O4YL 5MEND 2QADC 3NSJA 2VSMB 4NRYB 4TQ8A 5C08E 1UOVA 2VLLB 4RWYH 1ND0A 2W81C 4OD2B 4P2RD 1T0PB 4BFBD 2A1WH 2QSQA 4IRJC 3VH8A 3HLKA 2E9JA 1CT8B 4AL8L 1A8JH 3HMWH 1F41A 3AXLA 1Q94B 3QDJE 2B20A 4JR9L 5T5NF 5JW5B 3TYFA 4QD2E 2Z4QB 4BE6A 3HVDA 1Q1JH 3MPCA 3VQVA 2BK8A 3HC0B 3CCEV 3CNKA 3HPLA 3O11B 4R9HA 4XRCA 5I6LA 1CGWA 1E1QG 3JWNH 3VWJA 3ZTNH 1ACZA 1F8TH 2DWYA 5EK0A 3DK0A 1RHHA 4R96B 4WY7L 2EXYD 3BUYA 5F7FA 2BHFA 4R4BB 2BOCC 1R3JC 1X59A 4FXGA 3JWDL 1OB1A 3DI3B 1SEBA 3DSQA 4RGOL 3ARDA 4M3HA 4IIJA 2DQCH 5G4OA 4WFHA 1M7XA 3C75A 4PA7A 3QUXD 4Q0XH 2EYTB 3GTVA 3ZDXB 2F74A 4UQDA 1UASA 4QRBA 4YSEA 5CP7B 5D2NC 1BVNT 3MBEB 4KXCA 1F90L 3NJNA 5H94B 1DYZA 4M43H 3TC9A 4BZ2H 3MUHL 1RI8A 4KOBA 3OM3B 1AQMA 3U6RA 2QV4A 1KBVA 4GUPB 1E9OA 3W56A 3DO7B 1PZDA 4TOIA 3NCJL 3DRQB 4LGSB 1EVTC 2ICWJ 4QJFB 1MXDA 1CP9A 2R1WA 5GJSL 1Y74A 1F4AA 1U93B 2GFBB 4B3VA 3FL7A 3UTQA 2XFXB 2ORBH 3RI5K 4MNQE 1CFMA 2DM3A 4HZLA 4OI8A 4E9LA 5FUOL 25C8L 1XR8A 3C09C 4MLIA 4OD3H 4TUOB 1JZGA 5IR1A 4PBXA 4BSWA 4CSSA 4YXLH 4FXKA 4UTBH 1SBSL 2PWHA 4YDJA 4XMZA 1IKNA 1N8RW 4H2CA 1NCJA 4X83A 2FWOB 3UP1A 1D5XB 5HI3C 2WXIA 4HT1L 5I71C 3TCLB 3BT2H 2HKOA 3QH3B 3NZUA 3NRPA 4XMLL 3UJIH 3MMEB 4RMBA 1WA2X 5DVOA 2PF4E 4QIWF 1L7IH 4I7ZB 4UUJB 3ULVC 3KVDD 1IVTA 1MHCA 4GKSB 5ILTL 5E70A 1OAKL 4JFUA 3T3PB 4LCWA 2DQGH 3MRJB 4JFXB 1IDSA 3I9GH 4LRNL 4QOKB 3TZVA 2Q4PA 2ADJB 4LASH 3KEDA 4X65B 4JK0D 3LXUX 3VGEA 1H8HG 3CCMV 3B37A 1WA0X 5KSVB 3O9WA 2FIRT 5D1XC 3ROOB 5ADOL 5ICZB 1F1DA 3BCFA 3K71A 3JASA 3SPHA 2EDFA 4XWOC 1O7SA 4Y4FA 4CC6A 3T04D 4JM2D 3LKOB 1YN7B 3KW7A 4L1DA 5D6DC 2ETNA 3MRRB 4NM4L 3PAYA 3L5HA 2XASA 4M7ZB 3AEIA 5IG7B 3PHOB 1BVZA 1QRNA 2XG4B 1QNZH 3BE1H 1LP9E 3QEHA 5GRVL 3VH8G 2G3NA 3BVTA 4OCSL 5E5MA 4ZDHB 1CL7H 1VACB 1XNRB 2NNXA 4JDVA 1N4XH 1P69B 1NPUA 5CGYD 4OIIL 2AQNA 3LYRA 3FB5B 4K9EC 4O02H 1GRJA 3L3KB 1OAQL 3VTMA 5LBVA 4RWUA 5KS9B 1CMOA 3MNVA 2IWGA 3KWTA 3S34L 1PLCA 1RKRA 4FYQA 4RMQA 1Z3RA 3GDCA 5DURD 4WFEE 4U1GC 2Z6FA 4BQBA 2AEWA 4PHXA 3KPSA 2MRYA 4JZNA 5EU3A 5JW4R 4E36A 2EDWA 2GI7A 3FPYA 1VKXA 4NDMB 3O2DA 3SDXE 3VTAA 2PNDA 3G6JB 1NU1H 1P7BA 3WS6A 5I74B 3S3DB 1G84A 3ARBA 3UO3A 2JQZA 4YDVA 5IQNA 3I2CH 4NEHB 3RDTC 2OSXA 4DT2A 3OAUL 1N19A 4GLXA 2YXYA 3CDGA 5AWNL 1QLNA 1YY8B 3VFOA 1E6JL 3KLAB 4PLKC 3T0EC 5LHGA 3T77B 2HN7A 4V1DA 5GZNC 1TZGH 1VADA 2D3JA 1JN6A 5I16B 1T66D 2AMUA 1AI5A 2CK0L 2OZ4L 5IW3A 1HT6A 2B3IA 3TBSA 3CBKB 4KU1A 3DDGA 3E8UL 4M1DL 2F7OA 4FLTA 2GIMA 4MZRA 2HPTA 5IFHL 2D3NA 2WTPA 5HJBA 3LY6A 4KUCF 3AS3A 3OQRA 4FQCH 4L9DA 1L3NA 2PCPB 3S96B 3DWTA 5EZLA 1A6WL 4NKDA 1KYAA 2LLNA 1ZTXE 2AK4D 1FIGH 4HOZA 1QFWH 3SGKC 1WAAA 2XWEA 2A73A 4PG9B 3RKDC 5G4NA 1GZPA 1PLBA 3CXDH 1NTZH 1MJUH 3FU7A 4K94L 3D87B 5EULV 1U3HA 1I8LA 1AR4A 3NUKA 5EF0A 4KMQA 1SQPH 3MOAL 2BJMH 2CAZC 1NBYB 1Y0LB 4Y4KD 3I6SA 3N85H 5GGSB 5FW6A 3V52L 1V9PA 1YEGL 3OUFA 2IANA 2MNUA 1XZ0B 1P1ZA 2ZOLA 5D7LE 4RVBA 1QI3A 3FFCA 4S1DD 3QDGE 1CE6B 2OYKA 3FKUS 3ZTCC 1E50A 4ZSOE 3ZL4L 1KXTB 3QI9D 5L2KD 2D7MA 2AV1B 4JO3H 4Z7WB 3QNZA 4WI0B 1HR0B 1R3KA 3RBSA 3V8CA 2ZT9C 3VW3H 2EACA 4HKBB 1HXMA 3WV0A 5FGCE 3VWKA 4KL1A 3WU1A 2OK0L 2F4VB 4W9KC 3C8KB 4OLUL 4Q4EA 1HL9A 1WZMA 1H3XA 4YBQD 4DVBB 3BPLB 3R1GH 4OZIF 4LPYA 2DMKA 3QR0A 1I9RH 3EOAB 3K04A 2VDPB 4UI2A 5JCOC 2YKKA 3GKWL 4FCHA 4B5ZA 5I0DA 3FUNA 4QTIH 1BF8A 2B1HL 2VLJA 3T8XB 1E65A 2XN1A 1XD1A 5CR1A 4X6CA 4MCZA 2PPEA 4ZOBA 5FW7A 3PWNA 5KHGA 2R9HD 4NQDB 1PEWA 3CN0A 5D2LB 5E8DH 2DWSA 4HOMA 2BY0A 4BCZA 4XCFL 3C08L 1H6FA 1M90W 1GSMA 1XF3A 5DRWB 3EGSB 2QSCL 5L3DA 4WEMB 1LQBC 3BFQG 4NQXB 4NJAL 3VXPA 3SDDB 4IBVA 1N2RB 2GKIA 3SQOH 1URLA 3QTCA 1UM4L 1PNDA 2EIKC 3DOIA 1I3VA 3L4ZA 3UAJD 2FECI 2WYHA 2NNFA 4K3EL 4ZIBA 4BYHA 3OKNA 4WU7B 5K1NA 3HE6C 1DSWA 3QXWA 2ZKWA 4PCTA 4ZS7L 4UYPA 1P5UB 2IBGA 1NFDE 1UUNA 3T4ZA 2E8YA 2PXYC 4FEMA 2JTYA 3KDMA 3CE2A 4QNPF 4MMZA 5E08L 1HDJA 1CK0H 2NT0A 2D3OW 5A2LH 1NGYA 2DI8A 2W38A 3NCFB 5MHSE 1PFOA 5BOZG 2NUPB 5EU4A 1QW8A 3NCCB 3V4VH 2CPUA 2QGCA 1BFVL 3UO8B 3RJDA 1RJYB 1BT8A 4DOHB 4YMPA 3S37L 1XF2B 1G0XA 3D1MC 3SJVB 2CCWA 3LZRA 4DVRL 3ELAT 2WWMC 1MH5A 1HQ4A 4KK8D 4QHUA 4AKQA 1J10A 4OLEA 5D1ZC 3QDAA 4HULB 2IF7A 1JGLH 5IJVA 1XSIA 4YSOA 3HMXA 1YXBA 4OZFA 4UV4L 4IT5A 3H4HA 1D9KD 1FFTB 1AGBB 1IGFL 4F1ZA 1LMKA 4PJ0Z 5I1GH 1OGAA 3BRGC 4NXKA 4UV7H 2H3KA 4G7QB 4AQ1C 1KGJA 1KG0B 2CXGA 3O0RL 4Z8FH 2V3DA 3CEIA 1ERNA 4GRMA 1EFRG 5IWLC 1VLXA 35C8L 2QWPB 1OE3A 4Z7OE 1W72L 4G6AC 1HHJA 5BZDB 5FDYA 4C58B 4ZW7A 1VERA 2DYPD 2JXMB 3FDWA 1NL0L 1K4CA 1QUNB 2DQTL 4QRTA 5DZJA 2VDPH 1AI1L 2IJKA 3VD3A 5A3ID 3QCTH 3LV3B 1OSPH 4KK6D 1YHQV 1SUHA 2A4EA 4P5KA 2A0LD 2O5NA 3QIUB 1JXGA 2HFGH 2BCKB 3MJ8B 3O3EA 4A66A 5A6MA 4UDUB 1OAXL 3CQFA 3CPUA 5FK9A 1G7QA 4P5MA 3RTQB 1Q82W 1HAWA 2XC8A 3RX9A 1G4YB 1EFXD 3KPSE 3K59A 1NEUA 1NKRA 1EJ8A 5ITFB 3DBXB 1B4LA 3MRIA 5T1MB 2OSWA 1A64A 1OQOA 4JKPL 1E5YA 2VSDA 2O61B 5I76A 4GSUA 3E6HB 3EO0B 5DD3L 3NZ8B 4JUSA 5HYJE 3VD2A 2GEQA 3SJQC 1E5BA 1M2VB 2CLVA 1M05A 2BVPB 2XVGA 4HAGA 4XWGL 4OBSA 4KHXL 5FYKH 3HPLC 4Z5RA 3LRKA 4XZUB 1UZGA 1G7LA 1UXWB 1MFBL 1SM3H 2WLIB 4BELD 2X40A 5I75C 1VFAB 4V1DE 2X05A 4YGAB 4NCC2 5E0QA 1JF1A 4GKZA 1WA8B 1BBJB 3QK0A 1EFQA 3RW0A 1I85A 4FXGC 5JHLA 4FFYL 5C08B 4OB5L 4UQ9A 4DR4B 2XKSA 2OMBA 1NJ9B 3ARDC 4PJ8B 3COOA 1QMUA 1VFMA 4L9LB 2EKSB 2IJIA 1KYDA 4ONFL 4M4RB 5K59E 1E5AA 4NQEE 1ROPA 1FVDB 2YC1A 4IKLA 4KBPA 3OKMB 3SN6N 3FMGH 3UBXI 5GS2D 3DJZA 2XG5B 2QPSA 1E4HA 2EBOA 4L29B 2YQGA 4LLQB 5B3SC 1U8HA 4FPPA 2NY0D 1P2CA 2JKNA 3M8AA 1XGTA 1XHXA 2ROYA 4DR5O 1P7QD 3IAGC 3LN4A 4HIHB 1NBCA 4HCGA 3WJMA 1LK2A 4R50A 4X1YA 4OKVB 3KE0A 3ZW3A 1PX4A 3K2MC 3UIZA 2MPAH 3HZVA 1D5BB 1JTOA 1S5HA 1R3HB 1M4KA 3GSXB 4RBPH 1WSST 3ZDWA 4NKIL 2FBOJ 2IQAA 2F95B 4PGZA 4KV5F 5DI8A 2ZSVA 3HPJA 4X0KA 3WKPA 1RUPH 1D5MA 2EXSA 2CRMA 3A67L 1F3DH 3KCWA 1E90A 3K0WA 4Q56A 3C60B 1XILA 2C4XA 1CN4A 2P7TC 2NN4A 4PCYA 2QKIB 3P4OB 4Z6AT 5CZVH 4DV0O 5BRZD 4FXKC 4FTDA 5DEJA 2EIJC 4HIIA 2I85A 2DLIA 1IKNC 3QXAA 1L0PA 3MOQA 2VSKB 2KDYA 1AE6L 2B1AL 4I77L 3ARGB 1UJTA 2Z93A 4P2QA 3DYPA 4HCRL 3H53A 4NI3A 1RUMH 5IY5C 2APXA 4HUUA 5BO1H 4KJQD 2K0RA 4OZFG 1GGCH 2FD6H 5D72H 1VQMV 5GGQH 2VLJE 1G9NL 4B6ZA 1FD9A 4DR7B 1FVCB 3S5LA 1OK0A 4MNQB 4YE4H 2XRAH 3AAZA 4JB9L 3TZVC 4ZUSA 4IJ3C 4H8VA 4ZG1A 3CVCA 3ZDXF 1PG7L 4OT1H 5E00A 5JOPD 4MJ2A 4ZUWB 3O9WC 3HB3B 2IH1B 4NJ9L 1XNQO 4ZTPH 3M1BA 1BG9A 2V1DA 1ZJBA 4P5TB 5L8KB 1A6AA 9PCYA 4Q9QH 4DR1O 5CWSA 4Y4FC 5JOEA 2GUZA 3F58H 5F1SA 1IRAY 5KANI 4O2FA 1F45A 4B95C 4IHJA 4YH6A 2H32B 3U0ZA 4WZ9A 1UXSA 5I1DB 3UXFA 1S7SA 2VXQL 3D50A 1M3JA 3W82A 5IMKA 3TASA 3CRQA 4H44B 4G7SB 3PL6A 2YMTA 4KZ0A 4HK0A 3S3SA 5K9OB 5BQ7B 1AI6A 2YAMA 4XTRC 3X3FH 3GWJA 1FORH 2GJ6D 4KJYA 1AKJD 1ES0A 2XTLA 3W9EB 3DHUA 1P84J 3IETA 1F18A 4NR1A 2OKMA 3C12A 5T1JA 3QFGA 1P5VB 5E94B 2Z4TA 4X5WB 2OMYA 1NGZA 1AGCB 3GS4A 3PFQA 4ZX3A 1T22A 5C0NC 2OXGB 4LSVH 4NZTL 1CLOL 3DSFH 3G5YB 4MT8A 1BGXH 2ID5A 2J1YA 4XMXA 2BXZA 3NOIA 5DRZA 1J9QA 1M6OA 4HFUL 1CQYA 1DVYA 3ARBC 3E2HB 4FYSA 2Q6WA 4JTCB 5BV7L 2Z31D 1LO2H 5GGTL 1GN2A 5B1NA 3ILPA 3VXME 4B96A 3WTTA 1SMDA 3GBNL 3O8XA 3Q5TA 2X38A 4YVUA 1WE5A 4CN4A 1ZCRA 1D5ZB 3APNA 4ELKA 4K8RH 2A6IB 3O6KH 4MJID 3T3PF 4TPRH 2CGZA 4NCDA 5DJXB 1O9WA 2G60H 4PJDA 2WWKT 4FLHA 3BVNB 3HS0B 1M1XB 2HJLA 3NN8A 1ZX3A 2FYYA 2DQHH 4M7LL 5B38G 2BVTA 1Q9LB 2FB4L 2DQ6A 4KNSA 1IE5A 1UM5L 3CLFL 5E1AC 4FD0A 4G1MA 4UILH 3HRZA 3F8UB 3BJLA 4AENA 4DGIL 5K1JA 3VXTA 5FF6B 5E8NB 2EDRA 2YLHA 2WZPD 3QS2A 3BEVB 1HL8A 4NN5B 1T03H 2L35A 4K5LA 4N9GB 5JIHA 4Y5XA 1SLUA 3V0VA 3MAQA 4AIXA 3RY4A 1SVCP 2EE9A 3L3IB 3MCKB 2CMRL 3IDXL 2H7WA 2UXCB 3G9VA 1U3HC 1PZSA 2G5BA 1EEZA 2WQ8A 1I8LC 3GRWL 1J5HA 3EF7A 2HFTA 1IX2A 5J3HC 1AJ7H 1T5WA 3U48A 1L9SA 4HG4J 1XGUB 3IRZA 2MHAA 1HWHB 3ECUA 1AAJA 3O6FA 4JYAO 1TPXB 1PLGL 5ANME 2AABL 2JEXA 2JVDA 1WFOA 1S78C 2NXZB 2WPDG 3ML0A 2Q76A 1T1ZA 2PPDA 3FN9A 2AQ1A 3MCLL 5IOPB 3SOTA 4CILA 2KZ1B 4ZOLB 4OJFL 3AK2A 4U1IB 3HG1B 1FS0G 1H3TA 1OPOA 3G6JF 4EOWL 3ULUD 5GTHZ 4LESA 4KO6A 3NIGE 5JQGA 4AMKH 2J25A 2V37A 5DM6V 2WB1A 3CN4A 3KWUA 4P05A 3CCUV 3S5LG 3VWKC 5C6TL 4AJWA 5IKCB 2XQYG 4KKLC 1X4TA 1UA3A 1FIEA 2VMJA 2ED9A 4R7DB 5DA4A 1H9DA 1X7TA 1C12A 2CIKB 4FABH 1B6DA 4ZMPA 3QJTB 3ZZQA 3AT8A 5D7LB 4MZ3A 3CXFA 1LE5A 2JELH 4BKTC 1QVOA 1SYSA 3QDGB 1LMIA 3O2WL 3O3BB 4ZSOB 3ZT6A 5ICUA 1U3JA 1RZ8B 4HIEA 1NGPH 4M6OL 4KRLB 1TU2A 2EUWA 3V6BR 1K8DA 1QNIA 2FEDD 3V6FA 4EDWL 1CFVH 5IVXF 2V2WA 1AO7A 1E3FA 3EFFB 2PP7A 2R9RB 3NFSH 4RX4D 3VRIB 4B27A 3V7MA 4PJHE 3IFLH 5JQHC 3HAEG 4GSQA 3MNDA 3GK8H 5FGCB 4X6BA 2VXSL 2BNUB 4HISA 4LP4A 2Z0UA 3FUJA 2C2AA 1XREA 2HG0A 3WN5B 4JN1L 3II3A 2HLFC 2PW2B 2H1XA 3J8F7 2ITCB 2OMXB 4XVSL 3EBHA 2NZ9C 2NY4C 1N6VA 1K92A 1YQVH 1I4FA 1X4YA 1CPUA 3MODL 5F3BA 2X6VA 4L3EB 1MJ8L 2FZ3B 1XTMA 3ETDA 4XGZA 1YNLH 4A7GF 4YR6A 4U1MB 2LT9A 3X2QB 4NUGH 3O2VL 5DD5H 1BLNB 3WCYA 4I0PD 4E9VA 4MMZC 1QSED 4UT7L 1ZLSH 5IQ7H 4LEXL 1NAKH 3BEWA 3KL3A 3PS6A 1QTYT 4XR8C 4IIZA 1DUYA 1RK0B 4N24A 4P2QE 3QRGH 4AG4L 4D94A 3BCCH 3IDIB 1M56C 4FDWA 5CUSH 2J56A 4Z7WF 3VFUA 4HJGA 2YUWA 1QTSA 1BCCH 2Q8VA 5LBSL 4PJ7E 4XN7A 1TFHA 2TSAA 5JMRA 3S8GB 4HEPA 3C5ZB 2H6OA 1VARA 3CHQA 3CSYA 3HE7A 3VD1A 5CZXD 5L0QB 1EAJA 2EINB 4GQZA 4R0LB 3ALXA 1D2OA 1HE8A 3QRBA 4GSRA 4WAFA 2IU3A 1KUMA 1NFDB 1ZTXH 1VGEL 4X8GA 1CDJA 3MNZB 3O6LL 4KZEL 3F6LA 1NCAL 4NUPA 2V9QA 1FYTD 4KDVA 4C59B 1RZQA 1XF4B 1ID2A 3P3RA 5E7FA 3T09A 5D2LF 4F5CA 5CBAA 5IFJB 1HFUA 2Z8VC 3ZMRA 3ZIMA 3OQ3B 3HG4A 4JEGB 1ZUQA 1RMFL 2WUCH 3BSHA 5E6RB 4DWHA 3GPSA