1V54B

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v54B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v54B02
4YSPA 3CDZA 3FU7B 1J9TA 1PMYA 3T6ZA 2YXWA 2EIKB 1OF0A 1W8EA 2R7EB 4KNUA 2HRHA 5ANHA 3GXUB 3OMAB 1GW0A 1W6LA 1CC3A 4KOCA 2ZONA 1JZGA 2QDWA 1F56A 1L9SA 1UATA 2IDQA 2AFNA 3X1FA 1SHWA 2ZWNA 2WO3B 3QJUB 3ABGA 5I6LA 5E9NA 1ZDQA 3OD3A 2YEVB 3QJTB 3X1EA 1CUOA 2IH8A 4Q8BA 2J5WA 1IBZA 1PLCA 1L9PA 3V9EA 4WTQA 5EHFA 1JZIA 4E9VA 4GY4A 2XV2A 5AFAA 1FWXA 9PCYA 1OCOB 1ILSA 2YAEA 3H4HA 4G70B 2VW4A 2Y69B 4DP8X 5I26A 5I6NA 1PF3A 3NP3A 3AG3B 1AACA 3NSDA 2FT8A 2PP8A 1SHXA 2UXTA 3NJIA 4HCFA 5B3SB 1PZAA 4YSQA 1SF3A 2JXMA 1IBYA 2RACA 2XV3A 3KW7A 1ZDSA 1KCBA 5AKRA 1TEGA 2XXGA 1KDJA 2IWKA 3BVDB 1ASPA 2VM3A 4EF3A 3UGEA 2IDSA 1NWPA 2CUAA 1E5ZA 4P5SA 5FC9A 3JT2A 1BEXA 1AS7A 3X1GA 2XVBA 4BK5C 4YSAA 4G7QB 1DYZA 1KGYE 2VW7A 4KO5A 3ZIYA 2BZ7A 3PAUA 3CVCA 1IUZA 1WA0X 3H56A 2DWTA 2FT7A 1A4BA 4A2GA 4M3HA 4BDVA 2XWZA 2UXFA 3EH5B 4AZUA 3NYKA 1V55B 5LDUA 1KDIA 1HFUA 3TA4D 2CJ3A 3WNJA 2GB2A 4X4KA 1PNCA 3AG2B 1KYAA 4A2DA 3NP4A 3OQRA 1AOZA 3RYMA 2IDUA 4ENZA 4DPCX 1NPNA 1SDDA 1BQKA 4NAJA 3DTUB 4JHVA 5PCYA 4E9YA 3ZDWA 5B7FA 4AKOA 3PAZA 3WKPA 1J5CA 1PNDA 3IE9A 1SDDB 4E9RA 2IAAC 1A8ZA 4CSPA 1JXFA 1BQ5A 3FSAA 5I6MA 2IH9A 2YAPA 3S8GB 3GDCA 1YLBB 2IDFA 1QLEB 2BP0B 1WS7A 3FPXA 4YSEA 3QPKA 4JHUA 1BXVA 4DPBX 1JZFA 2BWDA 2AANA 1OCCB 2YAMA 1NTDA 2BW5A 3DIVA 1FA4A 1OCZB 1JVOA 5B1JA 3DKHA 3NSCA 6PCYA 4YSUA 2YAHA 5B1BB 2AZAA 3FPYA 2FTAA 2GIMA 4AI7A 2FQGA 3C75A 1ASQA 2WO2B 1ETJA 1BXUA 1XB3A 3BQVA 4YSTA 2B3IA 4N4YB 1M9WA 1NDTA 2ZXWB 5F7AA 3FSZA 4JKNA 1NIAA 1AANA 3FSVA 2Q9OA 3X1NA 3OMIB 3UACA 2DWSA 1PAZA 3N2JA 1DZ0A 4A66A 4YSRA 3KW8A 4DP4X 3NJGA 4N8UA 4G72B 1KBWA 3FSWA 4FA7B 1VLXA 3SBQA 1ET8A 1ET7A 2EILB 3FT0A 2J56A 1HAWA 2NRDA 4ZK8A 4DP1X 4G71B 1ZIBA 1E65A 4GP4B 1NIBA 4F7KA 1RZQA 1J5DA 2EINB 1FFTB 3ABMB 5A7EA 3N55A 3S3CB 3UAAA 2E86A 3V9CA 2P80D 3EH4B 2PPAA 1V10A 5I5JA 1MG2C 1OE2A 1GS7A 1PLBA 2DV6A 3FQYA 4L0PB 3CDZB 3FU7A 4UANA 2BP0A 1CYXA 1L9QA 2BHFA 2PPEA 1NINA 1SFHA 1NIFA 4E9QA 3QJQB 3D12B 2HZHA 4UF7C 1AAJA 1QHQA 1T5KA 3IN2A 7PAZA 1ZV2A 3CVBA 1PCSA 4BWUA 4P5RA 5B7EA 5D4HA 1L9RA 1N70A 1AZRA 3NSFA 5I5MA 2IWFA 2PCFA 3PAVA 2XUWA 3NJJA 5PAZA 2PPDA 4E9WA 4DP7X 3H4FA 2XU9A 1NICA 2GBAA 1X9RA 2VM4A 2VSKB 1J9SA 3TBCA 2JFCA 1OOWA 4A2FA 1HAUA 1RZPA 4DP5X 2TSAA 4YSSA 4AKPA 4F2EA 4E9TA 2PPCA 5I6KA 1SNRA 5B1KA 5IY5B 3FYIB 3FU9A 1BXAA 3QJVB 2OJ1A 2P80A 4HZ1A 4PAZA 2XYBA 2DYRB 3WI9A 1SJMA 3WIAA 4MFHA 1GR7A 3FS9A 4DP0X 2FQEA 2WSDA 3AY2A 4YVNA 1J9RA 3SBPA 2GI0A 1RKRA 2PCYA 4HHWA 5TK4A 4F2FA 4UAHA 2XX0A 3T6VA 3T6WA 3HB3B 2PPFA 2H47C 2J55A 1MDAA 4TXVB 1SF5A 2I7SA 2YXVA 4HAKA 3EHBB 3WKQA 2BP8A 2BW4A 2X88A 1MZZA 3MX0B 4A67A 3L45A 1OCRB 3AG4B 4W1TA 4BDVB 1MG3C 5I28A 2TSBA 1XMEB 1WA1X 3CVDA 2Y1AA 2PLTA 3ZX1A 2QDVA 1JZJA 1A65A 2B08A 1MZYA 3NJHA 2I85A 1E67A 6PAZA 4BXVA 4RH4A 2FQDA 3G5WA 3X1BA 4GP8B 2YQBA 4A2HA 3QQXA 1JVLA 2VW6A 1M56B 1OE3A 3QJRB 4GP5B 4M4RB 2BO0A 2AVFA 3IBOA 2QPEB 3SBRA 3CZUB 2QT6A 3T6XA 4YVUA 1NIDA 5B7MA 3ASNB 1A4CA 4KO9A 1TEFA 4DP6X 2MTAA 1JOIA 3AW5A 3NJLA 3TASA 3EF4A 1WAEA 1QNIA 2CBPA 2QPDB 1JZEA 2EIMB 1BQRA 2VMJA 2W88A 7PCYA 1GYCA 1NZRA 2XLLA 4YSCA 1E5YA 4HIPA 4BWWA 1JXDA 4DP2X 3FQ2A 1ET5A 3X2QB 5AZUA 1AIZA 3ABKB 1OV8A 3PLYA 4NERA 1BYPA 3NJMA 1IKOP 2XX1A 3IEAA 3NJNA 1ILUA 1ZPUA 2HX8A 3S3BB 3MBWB 1PZBA 2HLEB 2CCWA 1TKWA 4K9JA 4KNTA 1V54B 1PZCA 3NSYA 3PPSA 1AG6A 4CSZA 4KO6A 4PCYA 1GS6X 2ZOOA 3ASOB 3AZUA 2DY2A 2GC7C 4DP9X 1AR1B 2W8CA 3OMNB 4FAAB 2AZUA 2HRGA 1I53A 1NPJA 1EHKB 2YAOA 1ID2A 4AX3A 2YAFA 1RCYA 2H5UA 3IN0A 2GC4C 1NWOA 2OCCB 2DYSB 2J57A 3S8FB 4NB7A 1AG0A 1AZNA 4YL4A 1GSKA 3T71A 3U25A 2FWLB 4HALA 2VSMB 4KO7A 8PAZA 2XXFA 3TBBA 2LLNA 4KOBA 2OV0A 2BP8B 2CALA 1SFDA 4YSOA 1GY2A 1N68A 1J9QA 1TU2A 2YARA 3FQ1A 1ZIAA 3SQRA 1AZBA 4Q89A 4QKTA 5TK2A 3OM3B 4HHGA 2BWIA 2UXGA 4A2EA 3UAEA 3NJFA 1GS8A 2FJSA 1KV7A 3S3DB 3UABA 1KCWA 1BAWA 1W6WA 2FNWA 1AZUA 2VN3A 4BXSV 1IC0A 5I5IA 3ZBMA 1L9TA 1X9UA 1R1CA 1B3IA 2A3TA 2R7EA 3JTBA 3PXLA 3FYEB 4QLWA 2UXVA 1JZHA 5I6PA 2H3XC 2I7OA 4YSDA 4HCIA 2PP9A 3AG1B 2X87A 4W9ZA 3QJSB 5I6OA 1XB8A 2GHZA 1ASOA 4WKXA 1L9OA 4KNSA 2HX9A 1ADWA 1EZLA 3GYRA 3EH3B 1AS8A 2FT6A 1OE1A 5B1JC 4GYBA 5D4IA 3WG7B 1PLAA 1E30A 1AQ8A 1CYWA 2IWEA 5F7BA 3CG8A 4A68A 2PP7A 1CURA 1WA2X 3FU8A 1A3ZA 1AZCA 4G7SB 3ABLB 4GXFA 2HX7A 2MRYA 3WNIA 3ERXA 1PY0A 5B1AB 2GSMB 2CAKA 4E9SA 1BYOA 5D4JA 3HEIB 1GY1A 1URIA 2YAQA 2N0MA 2EIJB 1JERA 2HXAA 2XV0A 4G7RB 3PCYA 3NT0A 2UX6A 4E9XA 1M57B 1A4AA 1AS6A 1NIEA 2Q5BA 2UX7A 3T9WA 1JXGA 2BZCA 3NJKA 1KBVA 4BWTA 1WS8A 1XB6A 2JKWA 3UADA 4DPAX 4HCGA 3TU6A 4AKQA 2FQFA 2IDTA
chains in the Genus database with same CATH superfamily
2A83A 3FU7B 5J0BA 5KVEL 3H6JA 2DDQH 4XBMA 3T6ZA 3IKCA 4MBRA 2EO7A 1IAOA 2P06A 1YDPB 4G9DB 3FQ4A 1NCNA 4ZSOA 2NNRA 3BDBA 5CP7A 5I1HH 3P11L 3ULVH 3VQYA 3QYMA 2ZONA 3RYFB 5DZ9A 4TVPL 1DGSA 3EO0B 4BV1A 5MI0B 3EGXA 3WFHA 3U11A 1NEZG 5I18H 2KZWA 5EZIL 3QISA 2VR5A 3HNSH 3EXAA 4ERSL 4DZBB 4LLWA 3U1SL 3VCLB 2WLNA 4LB8A 3QFDA 3LKNA 5JIHA 4HSCX 3T4AC 1NCGA 5K1NA 1G6UA 4YY3B 3K5NA 2VLLB 1NBQA 2BC4A 3F83A 5BJTA 1VP7A 2EACA 3FUHA 4KDTA 5CCJA 3GRWA 4MAUH 3QJHA 2WCPA 1TTRA 1FYTE 4PBXA 1IVLA 5DHDA 1K2DA 4WSJA 4I7ZB 5E8OB 1AI1L 5IB3A 1KIRA 2YK1H 3FQWA 2E27L 3O6MH 5L9DL 3W5NA 1YAIA 3AG3B 4NWUH 4BFIB 2C4FU 5IW6B 1IO4C 2MPVA 3ZKQD 1U8JA 2PP8A 1QTPA 2VLRB 2XA8L 1TCMA 4OQTA 3FQNB 5DO8A 2BTQB 4FS0A 1CI3M 1YJNV 1CU4H 1H5BA 5F7LB 2AJVH 3RGVA 4PJBE 2CO1A 1OTUD 3BT2L 1IBMO 2QJDA 3HKBA 4IMLA 4OZHB 4OGAC 1JF5A 1G6RH 1LLAA 5FV1L 1N6VA 3K3QA 3UGEA 3VH8B 2JKXA 4DTGH 3IB4A 3JWNC 1B0GB 3TXQA 4HJJL 5E7BA 4BUHA 4P5SA 4BZ1A 1N9PA 2YQGA 3QEQD 1ZHKB 1SQMA 3X1GA 3WFVA 4MNGB 1RP9A 2IBBA 2AXWA 3RX7A 1JF6A 3UTQA 1TA8A 4YEFA 5H6QA 5LXGL 1KN2H 1WA0X 3TNNB 4BDVA 3DTDA 5EDSA 4ZS7L 3GBEA 1KNOA 5DS8B 3LRLA 5EU4A 4CZZA 5IM7B 1KDIA 2QKIA 1RJZA 5AEAA 4YHZH 4GCZA 1NAMA 2BCKA 1VACB 3AQDA 4ODUA 4TQ8A 5DURB 2NN4A 5KVEH 4XNMA 2BHUA 4GRLA 4X6BA 4X4YB 4NQVA 4NWTL 1QR9A 1QEXA 1YNTF 4KXRA 4FXGC 4ALAL 2BVQA 1MIEL 4Y1AB 3FONB 1RZ8A 1QSFE 4KHTH 4MD0A 1INQB 4KH2A 4J10A 5HFLA 3IJEA 3DX6A 2PO6D 1HHKB 4MS8C 1PNDA 3FAXA 4NO0A 4TVPH 5HJBA 5JHDA 3I2CL 2X9XA 1AO7B 4YK4C 5KSBF 2COVD 2Q4PA 1KJ2A 4GIAA 4JZOA 1HL9A 4P23A 4Y0GA 2R69L 4XVSL 3ROOB 1CLYH 1EHXA 2GQHA 4F33B 5I18L 3H2QA 1XF4B 3MV11 5EZIH 1I4FB 4JN1L 3JAWB 1FNHA 5TPWL 2CNYA 2WQVA 2WUCH 3FFOA 4HIXL 5IV2A 3H7LA 3ALWA 4F7EB 3AT0A 4FGMA 3RUGF 3DRQA 4BBWA 4O4LB 3SE9L 3CQQA 4EN3C 2P7TB 5DK0A 4ZI8A 4QKXB 1NGPL 1VFMA 3NSCA 4L5FH 1CG9A 5K9OA 3RWEA 1QFWH 3CSXA 5B1BB 1RZJC 2FTAA 2Y1VA 3FPYA 3ZYIA 4J7ZA 2HSIA 1MSWD 1F1GA 1FGVH 1UM5L 1ZV9A 2K0RA 5IB1B 4G8EB 3MRCA 3MODH 4FPPA 3DBXB 3KYNA 3SKMA 3WEOA 1CDGA 4NI3A 1TUPA 1NMCC 4JQVC 4PJIA 5AB1A 3ISRA 4K7FA 4X5WA 2JNZA 3KXFB 4YL9A 4B96A 3OMIB 3BW9A 1JZ5A 3DI2B 1RHFA 3BT2H 1G0YR 5HDRA 3TVMC 5IW6A 2Q9LA 5GZNC 3VXMD 4MJIA 4D3CL 5KZCB 1DR9A 3PQYA 2WWNA 3HNTL 4B3SB 1V7NH 4TUOB 4F57H 3SYOA 1E4KA 1GYWA 5EOTA 3VW3L 4IMKC 4MXQD 3D07A 4N0UA 4NUMA 4XXWA 3WTYA 2F53A 1KKCA 1YEDB 3VYPA 1QQDA 5HGBB 4LRIA 3SPHA 4QXTA 1T89C 1SXBA 2OW7A 4IDJH 4X4XB 4JMXA 4YZWA 5I8CA 5A6LA 2DQFA 5C6TH 1S7TB 4JO8A 3Q3GA 1WBXA 1CGVA 5AOIA 4H0GA 4DF9A 1RZKL 2ESVA 3H2PA 4I2XE 3VA6A 1TU2B 1NKOA 1WCBB 4OZGB 5EIVA 3L4VA 1S7QB 6FABH 5CLYA 2A9HA 2D3NA 3UBXG 1F3JB 2F9BT 2A9CA 4D7BA 3INOA 4P49A 3OKMB 3PFQA 5KVFE 2WB7A 4U1IA 4HJ0D 1KIPA 3FQXB 4LP8A 4MTXA 1KGCD 2ZPKH 4NLHA 3OZLA 4B3MO 1Y18B 5DC9B 3QAZB 4TVSa 3D12B 4W4NA 5EC2B 5LBQA 4NQVB 1ZK5A 3QEUB 3KWXA 3N42F 5I1CH 4LASL 4GS7B 4G7VH 1LDPL 3CVBA 4JGUA 4Q74A 4R5XA 1GC1L 3K6DA 3W0WE 1IC4L 2F54E 1AILA 4J39A 2P49B 2W0FA 2QQLL 3PP3H 5L8KB 4F6RB 2E6JA 3JQOB 2EIZB 5DZNA 2V9QA 3FFDB 2PO6B 2X28A 3VGAC 4X66B 1MWAL 3VQ1C 2YPVL 1WWBX 2XG5B 3BSGA 4KGLA 3RQ3A 5BOPA 5K9JL 3ULUC 3VFWB 1U41A 3LCYA 2QZQA 4WFFE 2VR9A 1CFTB 2VSKB 2P42B 4M7ZC 1KXVA 5CJXC 2VTFA 3ZDYE 5BNXD 1FGVL 4O4LA 1OSZA 3PWJB 5DLLA 5A6MA 3C60C 4BZ1L 4WWID 3F5TA 1CIUA 4QPKA 1XGPB 1KXQA 1TPXB 4YQXH 5K9OB 3INUL 3RWEB 1QOKA 1IM9B 2W9EL 4DJMA 4JFFA 2D2CC 1EBPA 3S9DB 3ULUH 3H54A 4Q6IA 4UINH 2JB6A 5LAPA 3U7AA 1KMGA 4XCFH 5E5LA 3E8HA 4PJIB 3E9TA 2HWZH 3VD5A 1T66D 4B9CA 3K72A 5IJCC 4LBAA 2OR9H 3IDNA 1P84F 4P30A 4JI3O 4HHWA 4UV7L 4QJ3B 5D2LB 5J12C 5CB4A 2X0WA 3W81A 5GTIZ 1SXZA 1DQLL 2O72A 3DIFA 3HC4H 4EDWL 1K5NA 4RQQA 4WHCA 3OXSB 4EUPB 2CBQA 1ZAGA 4OFVA 2X6BA 5F9JA 1YRKA 4XNUL 2BP8A 5LP6A 4GXUM 1PZ2A 1I5XA 5DWUH 2AJXH 3SQOL 1DVFC 4YWGL 4B3VA 2IMMA 1XCQB 1BHBA 2J88H 2O6PA 4AE0A 3VQVA 1GC1C 4HPHA 3RT3C 4WHYH 2MHAB 3VFVB 2VQTA 3IWVA 2FYVA 3FT2A 5BVJB 1A02N 2WXNA 2L04A 4JKWA 4WRLA 4DW0A 1OAYH 1S9XA 2DQFB 2Z31D 3ZK0A 5IMKB 1ZA3A 5KVFL 3ME0B 2WTRA 2I69A 4V2CB 1KOAA 4DK6A 4AITA 2VDRB 1E67A 4NTXA 1BCCH 1VQ7V 5GGVH 4RH4A 2FQDA 4M1GH 1UB5B 4NN5C 1QSEA 2UUCB 2WLLB 3JV4A 4E5XG 2VMDA 3TBVA 1TZGL 4KKAD 1L1FA 5EZOL 3NIFB 3OR7C 1JZ6A 3WLWC 1FNSH 4NNPL 2QMKA 4TS6A 3L95B 4BCZA 4UCVA 4F7MB 4ZFGH 1ORQC 4Z5RA 3WFBH 3F84A 3TASA 1FL6A 1IBLB 3QCUL 4HS3A 1Z32X 4R97C 3RI5F 4NWUL 4WF7A 1G1OA 1NFKA 2IGFL 1RMFL 1HWHB 1WPBA 1QLEL 2NW2B 3FQRB 5AUMB 3TIDB 1LE5A 5GXBB 4ORGB 3KGRA 4QEGA 4XXCC 2AEOA 1T3FA 1JV5B 3MROA 4I4TA 4KRPC 3V4VH 5D1XB 1YEJH 3IMRA 4M5SA 3Q2NA 3DX0A 3NJMA 1JIBA 1BOYA 1SJHB 3NJNA 4Y19A 4PGBA 5BPPA 2R23A 5D6DA 5T1DL 4R7NB 1YMHA 2NR6C 5JDJA 3RTQB 1TKWA 5T33L 3DLQR 4GIPD 4IIJA 5JJJB 4AVIA 2OR9L 3SJVB 2OMVA 2E7HA 2CDEB 4OCXL 4UV7H 1DBAH 3UZEA 4GUOA 2BH0A 2LHAA 2F1BA 3K08A 1TCRB 2D31B 5C6WH 1JYXA 5DFTA 4MXVE 3IDYB 3PNWA 1MWOA 4YFDB 3RJOA 4X8AA 4B3RB 1O9WA 3FN3A 3ARDA 2P8LA 4P2QA 3A22A 1EFXB 4AIOA 3PPEA 1NWOA 1NCCH 4AGMA 2AJXL 4GFXA 5BRZD 4NWTH 3OHXA 1XILA 5FPRA 1AZNA 5E94A 4ALAH 4C55A 3IGKA 5IJDC 3VFNA 1TVHA 1YUHB 1G6RA 3O3BA 2AJZA 2YD8A 4PJGF 3HKCA 2LLNA 3VG9B 1TZ8A 2BP8B 1K5QA 3DX3A 4JPKH 5L4JA 2VDMH 4JFHE 3L3OA 5AAWC 4FQXB 4PJGB 2VIRB 1INDL 3NSXA 2X38A 3I2CH 4FFWD 5I17A 3GZPA 1HYRC 4QE9A 2CO6B 3T65A 3ESPA 1YMMB 5FF6A 1CTMA 4PJ7B 5IBLC 3RJQB 1DVFA 3ARBC 3ZS8C 1FL3A 2ALAA 1NH2D 2XAHA 1GRWA 3PL6B 5TPWH 2R39A 1PPIA 5F3FA 1LO5A 2VN3A 2XY1A 4D7SA 3G71V 3PXHA 4MSWC 1TMCB 3MV7E 2Z31B 2N74A 1XMQB 4PJDA 3FKSG 1X9UA 3IKCB 1DLBA 1GGCL 2ADJA 3HBZA 2C4XA 3SY0A 3IDGB 2M6YA 4M8QA 3ARGB 5IQNA 1TGOA 4LSVH 2Q8AL 1A5FH 2Y6SD 2OQJA 5D72L 1OHHG 4R26L 1MY5A 4LCYB 5ESAB 4P2RB 1G6VK 5H6RA 2K4WA 4HH9B 1RURL 3BP7B 4JB9H 5I15L 2CKBH 3DC6A 1X4TA 4IEFA 1XF2B 3MXVH 1FQ9C 2P5ED 2VR8A 3QJXA 3NEOA 4NC0B 5IFHH 1L9OA 2A2QT 4H8WC 3QG5A 3FZUC 5FKPB 1CFQB 1HZHL 4B3RO 3S6CA 5HYSB 4L3CA 3V52H 1TAEA 2AHYA 3EHBC 1D5RA 1HOEA 2XZZA 3RKDD 2YMXL 5GSVB 4A68A 5IVXF 1XEDA 4QYAA 5BJTB 5IK3B 5KAIZ 2WUBH 2BPBA 1TF4A 3DJZA 4LCUA 3W37A 1LE5B 3QFJE 4XR8C 4J7KA 3V0FA 5B1AB 2HTLD 2CR6A 2O6DA 1AHKA 3KPLA 4X62O 1BYOA 1MREH 1BZ9A 2QEXV 5DUBA 2XTAA 4PLOB 2GBVA 1LEGA 4JPWH 1Q6UA 1U8JB 2VLRA 1JERA 4TSAH 4W4OC 5DUML 3OB0K 4FDWA 1RP8A 2R23B 3C8KB 4PV1C 3RGVB 3WMQA 1YSCA 2Q3AA 4JFEE 3T3MF 4UOZA 4EB6B 1UOVA 1GYAA 3V4VB 2DTMH 2CDEA 2BSEA 1XMQO 2BZCA 3M8OH 1U8IA 1TCRA 4AENB 3QUYB 2IAND 4JR9L 1JZ4A 5C0NC 4HWBH 4YAQA 2P8LB 3I9PA 2CBOA 1IBGH 1G87A 3A4DA 2EDNA 2ZM6O 2WKOA 4MAYC 3V0DA 5I2IA 1M1SA 1A9VA 1G9MH 5DJYA 5HY9A 5T1KB 2ZXDA 3ZE1F 3VDCA 3HUJF 4IYIA 3BAYA 3CHRA 1IGMH 4KY2A 3HAEA 2Y23A 4M9OA 3VH8G 4BQ8A 4EKJA 4PJ0Z 1NCTA 5IYZA 4FFBB 5C0EA 4A1RA 1GW0A 2RFXB 2OMUB 3IDXL 5EK0A 5LOVB 5AW9B 5FOJA 1YG9A 4GRLB 4G9FD 4P3CH 4GFTB 3D06A 2JH2A 4X6BB 4YBLC 3EYUL 4MMZC 3VG0H 8CGTA 1Q90A 3GWOA 1S7UA 2COQA 4XVUC 1JJOA 1YMMD 3DROB 4YHIA 4EO5A 1PJ9A 2BOCB 5E9NA 4PP2B 4L5FE 1CQKA 1LO5B 5E5MA 1NH2B 3PL6D 4AEEA 1SOKA 1JAEA 1NLBL 4LCWA 3WFCH 3N3EA 3V6ZA 3C12A 5HI4D 3N0AA 5ELIA 2WBKA 3BVWA 1IBZA 4Q8BA 4BZ1H 4GBXD 4HZAA 3MXVL 4NQCD 4TNVF 1KMIZ 4PY7A 3UH8A 5KTEH 2UWEA 3PWPA 1WFUA 3D85D 1I4FA 5DECA 2G2RB 5B22A 1QASA 3CLFL 5ESAA 3HB3D 4DOHE 2Y69B 3D5OF 3L7FA 3WUWG 2X2UA 3DRQB 4N0CC 2R27A 2W0KA 3CK0H 1RUPH 3O6FD 5EUOB 3X14B 3H2WA 2D3VA 2Q20A 2DIEA 5I66B 5FUOH 5T1MA 1VQ6V 3EZJB 1OCZC 3W1ZA 4LF8O 4MKTA 2RACA 2WCSA 4J3OG 1KB9F 1M53A 3MOBL 3SKMB 2IWKA 4ZFOL 5DJXB 4DK1A 2C1PB 4PA4A 1DVXA 2X9ZA 3BDYL 4W9FC 5IHUH 4Y1SA 2BOBC 3EJCA 2OTLV 1WICA 4J41A 3AREC 3AWEA 3DVNA 3LX9A 3MV8A 3OAYK 4GKKB 3OGCB 4JY6B 1MJ7L 4K3JL 4M5YL 1MFEH 1FXKC 3QQ9D 2XAGA 4X7SL 5DMYA 5HBBA 2GVYA 1U3NA 2CHDA 5JQ6L 4KJPD 1D9KC 3CFEB 3MUZ1 3PQYB 4R50A 1CL7I 4WJKB 3OEEG 1VQKV 3ETTA 3Q1SH 4XPTL 4KZEL 3BVXA 3JD4A 3L9YA 5KVFH 2P1YA 5EOTB 1MVUA 1Q5OA 4Z3FA 4X66O 4OIIH 5DD3H 4K3EH 4M61A 2OSLA 2WGXA 3L2LA 3MLSH 4X4XA 2X4OB 1QVFU 4R4BA 4TQEL 2PKDA 1TPXC 4Y4FB 5EOCL 1R6NA 4BWAA 3KLKA 1SVBA 2E0PA 1Z9NA 4JI5O 2FNBA 1LM8V 1JPGB 1S7TA 1UEYA 2NY6B 3HJ0A 5I2IB 4FM0A 4NNPH 5DJYB 3MRQA 3SDAD 3T0AA 3S36L 4ZMVA 1IGCH 1LK3H 3K5MA 2L7QA 4DNLA 3T6QC 1D6EA 4KY1H 3EYUH 2B8OT 2R0LH 3HZKB 2DQGH 4FG6C 4H7VA 3SE3A 2ERJB 1JYVA 1LXMA 4JO2H 2Z7YA 2X6UA 4Y5XA 4OD1H 5LOVA 1SLXA 3ZZQA 1D6VH 4PREB 4F2ME 1OM3L 1XF1A 4ZOAA 3TBYB 4B0MM 3QEUA 2EADA 3CH1A 1KJVA 5BR8O 2OXGB 5EORH 4BZYA 4FYRA 2WO4A 4DPRA 4RFEB 5ISZA 5AW0B 1DL7H 2NR5A 2J25A 2XQYG 4P57B 1AXSA 2VDKL 1YNKL 3BXNA 3C75A 5E79Z 2RALA 1I3RB 4LIQH 1R5WB 3J2PA 1XGTB 1OARH 2X2IA 3C3TA 1K4DB 4S0HA 4JG0L 1TTFA 2WINB 4RUEA 4N4YB 3RIAF 2GTWA 5D1XE 4NRZA 5LGYA 4U4BA 2V3FA 32C2B 2XWBB 3T0WA 5I19H 4U49A 2VQFB 3BJLA 1CFTA 2A06H 1FXKB 1HNXB 3F05A 5DYOA 3IJ4A 2J1ZA 2VGLM 4S2SB 5ERWA 4EKWA 2FZ3B 3RTQC 4L9DA 2ILLA 1KBWA 2M2DA 5CBEB 4LZKA 2XJKA 1FL5A 4KNQA 3C90A 2OXHB 3C6LA 3BDYH 1G7LA 3EOBB 4MB5A 2WXJA 5L3FA 2IPKB 3JWDL 5ICUA 4MJ4A 5IQ9A 3ATBA 1GMEA 2AQ1A 4OI9A 2NRDA 2Z64C 4ZK8A 1MFEL 4KRLB 4DV5O 3ARFD 2P52A 3NIDB 2KUTA 2E6PA 3D25A 4HX1A 4U1KB 5FM4A 3L3DA 1Q1JL 3UL4A 1I9JH 1UXWA 1T2QL 3MOAL 2LW1A 4L3FA 3GGWB 5L88H 2FO4B 2J71A 4DEWA 4UAOC 4ACPA 2YBRB 1AH1A 5L2KD 3VXME 1KN4H 3BQUB 4OAWB 2HJLA 2XRAL 1KUMA 3CFEA 4GKSA 4RGNC 1KB5B 4WCEV 1PLBA 3KNBA 3TC9A 3FQYA 5DD1H 5FW8A 1JPFB 2AI0H 1FSKB 3I6SA 1NINA 3LZOA 4XC1L 1A7RL 3TEZA 2BE3A 1C5DB 2VDNL 1BMWA 2VDRL 4Q9RL 1RUML 2ICEC 4OCWH 3TBTA 2B1HH 4R26H 5IBLD 1Q0YL 2YD1A 2X0VA 1YQ2A 5LCVL 4U3JB 4B95C 3BP5A 1HNFA 1L9RA 1ZHBA 2X9WA 4K07A 3MRHB 2Q68A 4TV9A 4UNIA 4OFKA 3ZQWA 4CN1A 1IC7H 1NAML 4G3YH 2CM6A 5KHHA 4XNQA 5EORL 3OR6C 2DQHH 4MS8D 1XO8A 4NX0A 1A4JB 2ZX6A 1GTOA 4FNLH 2BOLA 4FK5C 3HZMA 1R3KA 3HNVH 4FP8L 2DS4A 3VA2C 1SGKA 4CBZA 1J87A 4E42B 2GITB 5CCKL 3OC8A 3OZ9H 1IGFL 1AJ7L 2WV3A 4DR3B 4UCFA 5GS1C 2OPCA 1E2VA 3V5KB 3J8F7 4OZGF 1XNRB 1VQ5V 3HI6L 5GRXG 2EVFA 4M93B 3VD4A 4DRXB 2APXA 4LNUB 2Q10A 3G6JE 4LKCA 2CKBA 5GRUH 2ETNA 1L0PA 5TF1H 4QIRA 4GEJA 1AOHA 3MV7D 2AMGA 3QWQB 4DK5A 4C47A 2P5PA 1HHJB 3LZFH 3PWPD 4Y9GA 3SPJA 1JPST 1AJQA 1G7MA 2Y3NA 4GSDH 1NGXA 1QA9B 3B7YA 2KC0A 1WB7A 4UAHA 2XX0A 1YYLH 4N0UE 4BAYA 3B2XA 3BEHA 2JVUA 3CX2A 1ED3B 4FQQB 2VZVA 2NY0C 2G4EA 3O41B 3RTQA 3AY4A 2J5LB 1HE7A 3OAZH 1NUDA 1S5HB 4YLBA 3L45A 1EBOA 1P5UC 1RFYA 3QUYC 4ICXA 4JRYE 4AYFA 1OCRB 4PA6A 5EU5A 1IGML 3RIFF 3V2AR 5C9JB 4FQCL 3TXAA 1KPUA 1OTTD 5AB9A 3D25B 1OCCC 1T1XA 4BCYA 3ARFB 4MXQC 2A77L 4I1NB 1C08A 5K39B 3IS0X 4R96A 2FMLA 1UXWB 4AYID 1JK9B 1OGTA 1IDSA 4AJVA 6PAZA 2PYED 3G5WA 4L29A 4QGPA 4X5XB 3SPIA 5L2KB 2AJZB 2BY1A 1JVLA 1JPEA 1KB5A 3L17A 4A39A 3EOAA 3NIGE 5KYUA 1BAFH 2J6WA 2NY4C 2X40A 1ZJAA 4PWIA 5SWZE 4LWSA 1MJ8L 2X4RA 2XWXA 4M9PA 1XGZA 4N26A 4A55A 5AKVA 3LNHA 1M1XA 2YEVA 1A8JH 1HQ4A 4GRMB 1YMMA 4TLUA 5FF6B 4DQOH 1MJUH 3ZPDA 3ARSA 2OZ4H 4ZG1A 3DC0A 4XAKE 4JPVL 1OQOA 2DWDB 3O2DA 4M7LT 3BRFA 4U3JA 4Y89A 1N67A 1FHNA 1HHIB 3WKML 5A16A 2OJZH 4JG1H 3JALB 3FUIA 5JHLA 5GJSL 5C07B 5G4OA 1MLBB 3SDAA 2ADIA 4KK9D 3I3BA 4FQ1H 2IO5A 2Y4SA 4N8PA 1L0QA 4X6CB 5CU5A 4GG6E 4I55A 4JM4H 1UASA 3CZEA 1XGYH 1B6UA 1GHFL 5B1CA 3PP4H 3RDTA 2BVEA 4NB5A 1FFNA 3TOPA 4YHML 3SPVB 3MBWB 4I9QA 3CFUA 1T2JA 3PJSB 4JHWH 2LQTA 4X0KA 5TF1L 3SGKA 4OXSA 4QCIB 3I5DA 3Q6GL 4B9YA 1BHGA 4FZEH 4DEPC 3JAKA 4HPOL 3ZTJH 4DRXA 1VARA 2YJLA 4YLQT 5DMIH 1LGVA 3MNDA 1G9EA 1FFOB 4H25A 1K3EA 3L4ZA 4NOFA 4U7NA 1CGUA 1NEUA 2DLFL 2HRGA 2LW3A 1J1XL 4U1HA 4Z8FH 3V79C 5DK3A 3GRGA 4IS6A 4Y7MA 5DGRA 4ISVA 2EDFA 2NY2D 1RCYA 3BUYB 3TP4A 4W70A 2OCCB 1WJZA 1NJ9B 1VIWA 2I9LA 3P4NB 5D7LD 3RAJH 3BRDA 2NXYB 3CDGB 1LEGB 4HT1H 1C5BL 4Y4KB 4QGYA 1IM3D 4L4VE 5E51A 5AG9A 4XPBH 3KVPA 4YO0A 1RZKC 3R0MA 1KBGH 1DN0B 3QCVH 4NN6B 4UQAA 2VDQB 5E4EC 5L6YL 3PJNA 3L9RB 4ANUA 3OM3B 3QDMA 4KVPA 2OK0L 1QBLL 2FGZA 2CO2A 3QUYA 3MLTA 3KWUA 4G8IB 5CM1A 3MCYA 5GISH 3ZRSA 2O1AA 2SEBA 3GK8H 1W6WA 2WYZA 3WO4B 3QO1A 4X98B 4RFNB 4CJ0A 3CZFB 2R4SL 3W11D 1RULL 1NKRA 3N1FC 2Z91B 3JTBA 3OKEB 2PYEB 3MA7A 2DBLL 4GQ9H 2OJEA 1AYRA 1G7QA 1U33A 3P77A 2BK8A 2YIBD 1E9QA 2RFXA 3MRLA 3DUHA 4M7KL 4X6CE 1Z5VA 1KENH 3WJLA 3FH5A 2GHZA 4O9HL 4LDLB 1HQ4B 4GRMA 4GRWH 4B50A 4CILA 3RVUD 5FO2A 1W9XA 1NVPD 3CSGA 3MGOA 2P47B 4HFWA 2EDRA 2G9HB 2AZ0A 5KYXB 4PJEA 1H19A 3B1UA 4FQ1L 2EXWC 3EH3B 3NEEA 3HHSB 3TV3L 3UJTH 4CH3A 5IEKA 3HUJB 1PLAA 4JM4L 5C09A 1ZLWH 4JZGA 4HNAA 3ZCCA 3ZHQA 4DV1B 1GZHA 1I9EA 3FTVA 3LEYH 4YZFF 2AQQA 3FU8A 3HKEB 3UP6A 3SEPA 1OTUC 4MYPA 4GXFA 3PUCA 4KTYA 3F7YC 3WJMB 2XPGA 3L3GB 4TF4A 5D4JA 1JD7A 1EQWA 1MOFA 3L7FB 3AXHA 4F6EA 3VM7A 3FB8A 2BIMA 4KL1A 1H6EA 3B9KA 3MJWA 1KJMB 3V95A 2DQ6A 3GIZL 4UB0L 1OAJA 3AG3C 3CVIH 2Z4QB 1IGTA 5C8YA 2D3OW 1FN4A 3NT0A 4H4NA 3UDWC 2RNBA 1T0OA 3SGDI 4JQXC 1H8EG 1UJWB 5LMNB 4XPHL 1AB3A 1KGIA 4Y2DB 4H33A 1L9NA 1P0SE 4QJ4B 2Q1EA 3MX0A 3OMZA 4F58L 4AKQA 4JV5O 3LMJH 4DK3A 3CDZA 5GW7A 5J56B 4IGBD 1RUMH 4J3SA 2IMNA 3A0OA 1H2SB 3QUMB 2OMYB 4LSRL 1ADQH 4PG9A 1W6LA 3AXIA 5EOQL 5I0ZA 2GT9A 1WE5A 2BJML 2AXJA 4NM8L 4F4LA 4JI8O 1L9SA 1UATA 3MRDA 2ZSVA 3TVMA 3X1FA 1DJYA 4MJID 4I9WD 2WMPA 4KROC 4FNSA 2QKSA 1BT8A 4UBDC 3MOQA 4NSKA 3WIIH 2GIYA 2WPDG 3D36C 3L8QA 5FGSA 1I0HA 1OPGH 3OD3A 3NFNB 5IJ0B 4M7KH 5B1NA 4KFZC 4Z1VA 4XXCA 4KK8C 1PD3A 3QZWB 2Y7MA 1XF3B 3LXCA 4LSPL 1NCUA 2YEQA 4KI1A 4LF4O 5CZXC 4UTBA 4UQBA 2VRKA 9PCYA 3HS0A 2WVVA 5DLMH 2WSKA 2CGYA 1RAMA 4PJAE 3X17A 2F74B 3P3UA 5GRUL 1Y1UA 4ILDA 4BA0A 4TULL 2BIQA 1MF2H 4XP5H 1TQTA 4O4YL 3QNXB 1LMKA 3VXUE 5AW3B 2OXGA 1AIFA 4HCFA 5ABDE 1FFRA 3FDWA 4CJ1A 3A0HZ 5EU7C 2AC0A 1PZAA 2ZOLA 4J4PA 4QXGL 1WD8A 1IBMB 1H38A 4Z18A 4JV5B 3R4RA 3QXAB 3CMEV 4HMEA 5KN5A 2P26A 3ESUF 5AKRA 3IS1X 3BPLB 4FN0A 2XXGA 3ARDC 2QDOA 4G80A 4JFYB 3V6FA 4E36A 3MHSC 3IPEA 5ES4B 5GGRB 1ACYL 1A7QH 5DS2A 32C2A 4LF9O 3RPBA 1HCYA 2O26U 1M4KA 1OAQL 2H8PB 3QNZA 3OB0H 5L4MA 2IV8A 4IBWA 2CR3A 1NMCB 2X1WL 3K2MC 5AVRB 4YJ3A 1KTLB 1N5AA 4IBQA 1A1NA 4L8SA 4OLYL 2HTLC 2HLAB 4LSUH 3OVUB 4XP6L 2ZT9C 1I1FB 2YWYA 1HSBB 2VN7A 2GB2A 4H13C 2H1LM 4YY3O 4WHYG 1MHCB 2QQQA 5F70A 1FFQA 2EDLA 3NIDE 3BZEB 1VQMV 5AVVB 1O7DE 1IC5H 5F1SA 5HYJB 4X5LA 1BQHA 3MRRA 1B4JH 2NNFA 2EJ1A 2PZSA 1F5WA 1EJOL 1S7VB 2A73A 2YD2A 3O11B 1REIA 3HC3H 1QHTA 2CXGA 3A6OA 1HH9A 4OJEH 3ZYOA 5C0ND 1HIMH 1I31A 1NUFA 2OZ4L 1A8ZA 3FXIC 4G43B 3DV4B 1HI6A 2VDNB 4GKSB 1BZOA 2BNUB 2C8NA 4Q6KA 3FH7A 3KHQA 4FZ1A 4J42A 4I0PB 3BLKA 5EA0H 5F89A 4JFDA 2IDFA 1JPFA 4YSEA 4J4PD 1GIGH 2IBZY 1JK8B 4KMTL 4AXWA 2EH7H 1EHLH 4PJBF 1AE6H 2H2SD 1I3UA 4H0LB 4HXBH 2X4PB 1H8LA 1EXGA 1YAZA 4P3DA 1OSPL 5LGHL 3LNMB 1HXYB 4LHUB 2WTOA 1RIVH 3P40A 1GHFH 5HHXH 3SSGA 1EO7A 2AZAA 1ZHBB 3CWGA 4AI7A 4IRSD 3GEFA 4G6ML 2JVDA 5E9AA 4QRRD 5D93B 2V6HA 4BIZA 1XB3A 2YRBA 3HG1A 4PVMA 4TNWF 4HUNB 3U36B 4FZ8L 3WIFB 3D4YA 4LE8A 4XP5L 4QTIH 3V4PH 2VSDA 2EKSB 4HKXB 2YGPA 2A0LA 4FZEL 3HLAA 2VQFO 3QE5A 4HIHB 4L8BB 3RDTD 1NAKL 2R9HD 1LYQA 3K0WA 4XAWH 5K33A 1R9FA 1QFOA 3DVGB 5JPMB 4P99A 4EQ3A 3IDMB 3MUGA 2Z6FA 3S3WA 3TJEH 4E9LA 5F3BA 2CUMA 5E2UL 4AYBA 2NY1D 4RBPK 5A6IA 4CGTA 5C3LD 1AFVL 4HEME 3VXRD 2ZOLB 2H4EA 1UJTA 4IKKA 1GZQA 4OY9A 1JCVA 4R7LA 3FT0A 3QXAA 5KN5B 1Q1PA 5E6ID 5HGDA 3IE4A 1ZIBA 2Z92B 5I75C 3SGDH 4EDXA 3P30L 2EECA 1ZHNA 1UZ8B 4AL8H 3E7JA 3ABKC 4XCCL 4OB5H 5F0JB 4EBQH 3N55A 5L6YH 1F23A 1NC4D 2CK0L 1VCBC 1KJ2H 2AKRB 4UCTA 3JD3A 3VXSD 4NRXB 3TA3A 2J4WL 4GYCB 5L2JA 4EFBA 2VC2B 1RPOA 2HLAA 3D18B 4LEBA 5I5JA 1I1FA 3ARVA 1I7ZA 3H85A 4CVZA 1CYXA 1L9QA 4MVZA 1S5HA 2DYPD 3M17A 5JUEH 2ZXGA 4IL6Z 3QO7A 1CE6A 1E2ZA 1SFHA 5JZ7D 4JHZA 2BS9A 1NCAH 2C3GA 3SDDD 2DBLH 1KY6A 2W0PA 4NYLA 3WIHA 43C9A 1AAJA 4EEEA 1XX9C 4QHUA 2IQAA 3MSPA 2GJRA 1F7YA 3AACA 2VXQH 3MLZH 4NHUB 4OGYH 1YCSA 1UCBH 2WXPA 4ZBMA 3F7VA 1TVKA 1QACA 4PJCA 2L7UA 4YIPA 3DV4A 1DE4A 3U4KA 1Y07A 3BSZH 3ALPA 1T5WB 5EU6A 1ODAA 2DL9A 5PAZA 4J8RA 4Z7OE 4K2UH 4YZFE 3QO5A 5EBGA 1A7OL 3GZKA 3I9IA 4LOEA 2GBAA 4XI5D 1DUYB 1H2MA 3BSHA 3B2VL 1Y0LB 4PJ7E 1JR9A 4N2GA 4WI9A 4RNRA 6CGTA 2KB1A 1JL8A 3ZO9A 4A2FA 3U9UB 1FVDA 3TJHC 3PQYE 1DQQB 1OIOA 1W72L 4F2EA 1X5FA 4FQXC 4ZZKA 5DJZA 1E5BA 5C0DB 4ZKIA 1SNRA 3EYOA 1YEGL 3H6AA 3B2PA 3QWNA 1DVFD 4LKXA 1R0AH 2HLDG 3NCCB 1SJMA 3CSBA 3CC4V 2NT1A 1CFBA 1H5BB 4X6CA 5IB5B 3K5RA 3TJEL 4ZXBA 1K8DA 1XGQB 2C26A 2VZSA 3JV5A 5A2JH 1N26A 3Q8AA 1J1OH 4M1DH 5FYLE 3RDTB 4WAFA 3T6WA 5TE4L 6TAAA 2EVJA 5CILH 3MUGB 1KGXA 2XIBA 2YZ8A 4LEEA 2VDMB 2VNCA 4FMKA 5I1AA 4N2DA 1D5AA 4XXDA 3CB2A 2EXTA 4OZ4B 3P30H 4PLKC 5E8DL 4PWJA 1AJNA 5EC1C 2X88A 3GSNA 3O3AA 2VXTH 1P69B 3GJFK 2P67A 5A2FA 2YKLH 2QGEA 3I6KB 3EJYD 2UXCO 3AG4B 1FFOA 1HNWB 3L4YA 4FLOA 4R4ND 5FM5M 2OZ4A 3TNNA 3ZKMD 4BDVB 5I28A 3BAJA 2UUBO 5A2LH 4WI6A 5E6IB 3TNMB 4W4KA 1H3TA 4CS3A 3CVDA 3NACL 2OTJV 4EOWL 1JFFA 3POCA 5FO9B 4K9EL 4EIBA 3MD0A 1FXHA 2XWTB 2ADGB 4JLRA 3QDGE 4D7PA 5J4MA 4BQ9A 1I7UB 4J8QA 5JUEL 3ZBHA 3NJHA 4QHKI 1JV2A 1SRDA 4BXVA 4HKBB 4Y4KA 4Y1AA 4I5BB 4XNYH 5E99L 3GUTB 2VW6A 3HI1B 1P4BL 1OE3A 2ZM6B 2YPVA 3BESR 1P2CB 5IWLC 1PFOA 3GD1C 1S6NA 4XDKA 2DLTA 3RFZB 2RQ6A 3GMMA 1Q9WA 1MN4A 5CIPH 5HPOA 4JZOB 1T4KB 4GB9A 5FWRA 2P46B 5C7ZA 1PEWA 5DUPL 3O45A 1XBRA 4BKSC 4F9PC 1CLOH 5JQGB 3MLTB 3WTUA 1BEYL 5IHLB 2F66C 4G8IA 4ZUSB 3QXWA 3KYAA 1K4CB 3QA3A 3VM5A 2WQ8A 2NDFA 3CZFA 3JZ7A 4FJYA 1VB9A 2BVPB 1ZL8B 1G9NH 4A38A 4YS4A 4UUJB 1X4ZA 4JRLA 2Z91A 4GUPB 1MAJA 4RGOL 4YHKL 1CU4L 4XP1L 3MRLB 4YPGB 4RAHA 3JWDC 3V10A 3QZWG 3M7FB 1AIZA 4TQFA 1XHXA 2NUTB 3BUBA 3FH8A 4L8DA 3PLYA 4YLCA 3KYNB 3MUY1 4UTCA 5GGTH 2B59A 1C8PA 4N68A 1ACYH 1ZPUA 4M48H 4JFTA 2JJWA 4HFWB 3KXFA 4K7FB 3U9UA 4OKVA 4UIKL 3L16A 3OKLB 3BP4A 3AAZA 4LRNH 4O4JA 1HXMA 1V3LA 3X3GH 4L18A 3ZMNA 4Z77A 4MW8A 4QR7A 1Y67A 3PY9A 1E8ZA 4IRZA 5BQDA 4POUB 4ZXBB 3ROLA 2Q0AA 1RK1A 2QGBA 4YHZL 3VVWA 2DIJA 5H37G 4OCNC 4FHBD 2V4DA 1YJDL 5J5EA 1MRDH 3D8CA 3IJYB 4JI0O 2GSGA 2W92A 4AGLA 2N1KA 1DANU 1INEL 2OMBA 4OZFB 5TF0A 4HQQH 2WZ5A 2EDWA 3U25A 3KYKH 4GLRH 4B27A 4MZ2A 4UV4L 2NY3B 3MRGA 3WKNA 3NJXA 4OZ4A 2QGDA 4ONFL 4KHTL 3VQ2C 4XCEA 4DEUA 1IGTB 5JW4R 1HNWO 3ZGIA 1UADC 3HR5B 1TU2A 3G6DL 2ICEA 5CBFA 1U9KA 4P05A 4RFNC 3M1CA 4ADIA 2IJ0C 1F3JA 1CXIA 1P4IH 4GOSA 2EH8H 1J48A 4YX2H 2FDBP 1T80A 2F19L 3FQXA 2OL3L 3NDZE 2ZP9A 3PDGA 3O81A 1AROP 3EXJA 3MRJA 2VO8A 3SZ6A 2EH7L 2IW5A 3BGFB 4XVOA 4OQTL 1U95A 1VFOA 2TRYA 1H15B 5IE9A 2JQAA 3LKOA 4ZUWA 4S1DD 4YHOH 2R7EA 2EDDA 4PJXF 1NGZB 2CE6A 2FSDA 4GW4B 1P9MA 3KJ6H 4QLWA 1P2CA 2C3WA 4P46C 2XFXB 4UT7L 4PG9B 1Q0XL 3PN1A 1N59B 4U05A 1UENA 1UM5H 4WNQB 2K6WA 2F53E 3CXHF 4MD4A 5FFGA 3HW7A 4D0CB 2HEPA 4FZ8H 1J7VR 1NFIA 1D9KA 3HMWL 3B9KC 2ID5A 3DDGA 4WVRA 3BAEL 1M71A 1BQUA 2Z0UA 4RGOH 3UTOA 5C7XH 2O6EA 4HCRH 3QA3B 2BNRA 1ESOA 5J6HB 4KRNA 1OE1A 1VAHA 2WA3A 1WZ1L 2O5YL 3P9LA 1JSYA 1QG3A 3O9WA 3CG8A 4ADGA 4UB8Z 3OUFA 2MNUA 3FFCB 1WA2X 3PP3K 4IHOB 4TLSA 5SX4I 3SO5A 4QGTA 4XP9H 4IOSA 3KLAA 5GHWL 3ZQXA 3H1ZA 2AQNA 3A6CH 3HS0B 5K9KA 1JGLL 3EYFB 4NN7B 3O4LA 4OJAA 4E9SA 3VWKA 3O2WH 4B7EA 2F74A 3AU1B 2CH7B 4BCXA 4C83B 2YAQA 5JDSB 3KBFA 2WW8A 4ZNEA 5GJTH 2PCXA 1F18A 1HH6B 1SN5A 1YJWV 3CU7A 4KFMA 2XOTA 3QZPA 3IM1A 4W9KC 1E5AA 5CB4B 3B56A 4G7YH 3CTTA 3LN4B 2YI8A 4OR1A 5DUJA 6FABL 2CO7B 5DFVC 4HETA 2MQ0A 1L6XA 2IADA 4HZ3A 2CDGB 1RZ7L 3HG5A 1D7FA 2ATKB 3IJYA 5IB2B 4WENB 5JR1H 2IDTA 2Q7HA 3WTSA 3C3SA 4I0CC 5ANMA 1MA1A 4L8SB 3BE1H 1VGEH 5IMKA 3C6EA 3WY4A 3AT8A 4Y4HB 3V0JA 3PF2A 3VI4E 5EYPA 2C3VA 2QDWA 2ICEB 4X64O 2D3JA 5CGMA 1GL4B 4QRUA 4ZO9A 1JN6B 1OAUH 2YGQA 3W7WA 4DUVA 3BPCB 4IOSD 4J7RA 4J3UA 1WBYA 4M62L 1A7OH 5EULV 5CINH 3S3PA 5I6LA 3FC8A 4HIJA 1I7TB 3NCYP 4U7KA 3WHE0 3UJIH 4WO0A 3BFOA 3IDJB 1HH9B 2BDNL 4FG0A 2D7OA 3BAAA 3S8WA 1PAMA 4Z5RB 5CA0B 3DO7B 3EH1A 4H88L 5KHKA 2FWUA 1X5HA 2ZYHA 3GNMH 2PYFA 3INUH 2KLSA 1PZ3A 5IW3A 3SJVE 3QXVA 4K3GA 4AH2A 3HRZB 2HFEB 2KQMA 3RY5A 4LFBO 1W16A 4UAOB 3L48A 5TE7L 2NW2A 5AUMA 3N1GC 2CA4A 4NKDB 4UM9B 1AACA 1P84J 2IFGA 3SKOB 4X9YA 4IOIA 1SHXA 2I5YH 4RDQF 1Q9LB 4HWNA 4PVNA 3VFMA 4E41D 2F53D 4FTDA 4OBSA 3QUZB 3BCFA 4JE0A 4KVCL 3GSUA 2PUQT 2G9KA 3O9WB 4X9BA 3TT3H 1AD0B 4RSVA 5EF2A 4MDIA 4F7TA 1PM9A 3UPAA 1ROWA 1IAIL 1BFSA 2NTFB 5M7QA 1CD1A 2CUAA 3KEHA 2QM4A 3VU1A 4G8GE 1XVSA 1E5ZA 2JEXA 2VXTL 3R18A 3W0WD 3ULUF 1RM1C 4JI8B 4HIHA 1BECA 1E4WH 3JT2A 4L8BA 4Z76A 2IJHA 1CL7H 2XVBA 4RIRB 1KGYE 3FMGL 3DVGA 3R7RA 5E1AB 2BZ7A 4FOMA 3JARA 4Q20A 5KX5A 2VWEC 1BX2B 5EC1B 1S7SB 3FO0H 5J1AB 5F3BB 3T0DA 1CF8L 1JHTB 5IYDO 2IG2H 4ODWA 3ML8A 1P5UB 1UEMA 2F7RA 3SB3A 5JPMC 1ZVHA 5MENB 2D7QA 2BZDA 4W93A 3EIFA 3QJZA 3ZE2F 4JDZB 1ZAUA 1BD2D 5ID0A 5L7XH 4XMZA 2DJMA 3BY6A 3NG5A 1PU0A 1U3YA 3CDCA 1A6WH 3FT1A 5IKCA 5GGVY 5PCYA 4JHVA 4PJ5E 4W9LC 1KTCA 1IGYA 4ZI7A 1N36O 4HUVB 3KL3A 4NPYB 1CS6A 2VXUH 1CLOL 4OZIB 3DPBB 3PL6A 5IMLA 1XGRA 3BWAB 1IZKA 3H9HB 3ILQD 2IBGA 3GTTA 5GS0D 1WS7A 3IC7A 3M17B 1UD8A 2J2ZA 1FZMB 2VSCA 4DPBX 5JXAL 2YZ1A 3CHQA 1C1EH 5EOCJ 2GUZB 1DQJA 4PRBB 1F4AA 1BWMA 1QPXA 5C08B 2FATL 2JKLA 3RTQD 1MCSA 2OQJB 4AILC 4I8DA 1EVUA 1VIBA 4N1EA 4XX1E 1I7TA 2GEEA 4KUMA 5IG7B 3V4VL 3CCHA 3BP7A 6PCYA 3GTVA 3ZSSA 5AWNH 3RA7L 3QIBA 3VQXA 1EEUA 3NN8A 4FHJA 1WIPA 3AK3A 2XG4A 1CGXA 4K23L 1X5JA 4L3AA 4YSTA 1EAPB 4OGZA 1RLWA 2MOQA 2I5YL 4C4UA 2IQ9L 4PRHB 1E50A 2HFGH 4ONHB 2VKXA 3K9AA 1L5GB 1D3CA 3DYPA 4NQXB 4X8CA 4FXKB 1IT9H 1SBBA 1KGUA 4UM9D 4ANXA 4B7KA 4DV3B 1AP2A 5CEZD 2XACC 3STZC 3QORB 3VFMB 4Q56A 1PYWB 1ET8A 4NXKA 4RMSA 2WLHA 1A2YB 1SXAA 1INEH 3GSUB 3WS3B 4UTBL 1CCZA 4B3TB 1HNYA 3QJOA 4WW2A 1OQXA 2UUBB 3WN5C 4X1KB 4BGLA 1CD1B 1E65A 3RWJB 2QQKL 3HS8A 4LVHC 3FUMA 1K8DB 1XGQA 2AJYL 2IG2L 4Z7QB 5CN3A 4JFUA 3RWIA 4U31A 5E5UB 3W0WB 5C0AB 2R9RB 4Z7IA 2ZXCA 3BT0A 3WEXA 1CTNA 3H42H 1S7SA 5J1AA 5BUAA 5FGBA 3V0WH 3ILPB 4KUCD 3DUSA 2JTDA 3PV6B 1A6WL 2BP0A 2PPEA 3G04A 3R0NA 4J2XA 2P5EB 3II2A 2NY0B 3WY1A 5BZXA 2OX5B 4AMKH 5IEHA 1BD2B 4NOBA 5M94B 5C0CD 1QHQA 3QUXB 4C4BA 3TO2B 3Q4HB 3QEQE 3LVEA 4FNPA 3MRBA 4JB9L 1EAQA 1RERA 2XA3A 4Q2ZA 3NFPB 3ULVL 2YSUB 3HMWH 2IWFA 1JDDA 2Z7ZA 3HZVA 4X0NA 3K03A 3PWNA 1TJIH 3GUTA 4PP2A 4WUUD 3TH2T 1PZDA 4IQHA 3TA3C 1DQDH 1N34O 3VFUA 2BS8A 5JJNB 4HG4J 5CKAA 5IUCA 4RFOH 1Q90D 2DICA 2H41A 5LNEA 3TN0D 2XQYA 3UG3A 3GVMA 5CBAB 4ABWA 1TITA 2Z35B 3QUKA 1QKZH 1L0XA 1BM7A 4YFLF 1NBVL 1Q7YW 1KTDA 4TUYB 3CSPA 3GXPA 4YGAB 1J8SA 4MAUL 4Y4FC 5CJBA 4NAMA 1W8OA 1V3JA 2R29H 3U0WL 2CM5A 4PA9A 5KVEE 5B1KA 1A1OA 1JCKA 1PSKH 4CADB 1JGIA 1KLUA 2R2BB 2IANB 2V5YA 3QUYD 4O2EA 4PW4A 3ZDZE 3ZY7A 1NSNH 3WI9A 2NLJC 1IGIL 4MFHA 4J23A 5BS0A 2H26A 1JVKA 3O4LE 4L2YA 1S78C 2GI0A 3HKZA 3B3BA 3SQBB 1HOCA 2H32A 5GZOC 1XH2A 1GMGA 5TK4A 2KS0A 5HDLA 2J7LA 4JO3L 1EVTC 3G5XB 1FZJB 3BIBX 1U3HC 3A67L 4TXVB 1MCDA 3ZSTA 1GGIL 1FS0G 4O2BA 4PRAA 4OIBA 1E28A 2UZXB 2JB5H 2D7TH 3SDLA 4O4JB 2P43B 3WS3A 3MJ8B 2CH8A 4XB3A 3BGMB 4N22A 2DKMA 1UCTA 3S34L 2BNQA 3AQXA 5B21A 2CRMA 2TSBA 3RWFA 4P5TA 2IGTA 4KX8A 1RK1B 4WI8A 2PXYA 4M02A 3RWJA 2V2XB 1VMGA 3TZVC 1JE6A 1GPOH 1O7VA 2A74A 2XWJA 2ZKHH 2V3DA 4LAQH 5CJQL 5A2AA 1OCOC 1U2YA 4BEIA 2VR7A 1T6WA 4HD5A 4Y5YB 1DSWA 4B3SO 1ROCA 4AMWA 4Y4HC 5E2VH 4P23C 4A2HA 2F1MA 3QQXA 2ZOWA 4JQIA 1A6TA 4UDTA 1HS6A 5D93C 3RU8L 5F6IC 3UEQA 4GP5B 5EUKA 4FA8A 2QPUA 4JKMA 1JHLL 1G9NC 5D7SH 3ZR6A 4OCYL 3S5YA 2X1XR 2WZ6A 1DCEA 4DZ8B 4AIEA 5B7MA 3HTLX 3ZHUA 3GNML 4XN5A 1LE9A 5IW1B 4UCSA 1JOIA 3SDXE 2A9BA 5E4EB 2R2CA 2GW5A 2EYTA 5D70L 5J2TA 2ENYA 2QPDB 2MOVA 4Q2ZB 4L8JA 3FCGA 1A6ZA 4PREA 1RUPL 3LKOB 4ZUWB 1BSMA 2DYRC 2VDLH 3ZKND 4GO8A 3NESA 4A7GA 3GMLB 1KIUA 2KKQA 4RQEA 3GC3A 4QPEA 4UCUA 3X2QB 2X4UB 2QR4A 2NZ9C 2PW2A 4TLKA 5DMGD 4NERA 3U30C 2QE7G 4GAJL 4V33A 4ZOBA 3FRUB 3PJLA 2MQGA 5HHPA 2X4SB 3FF8A 3IFXA 2ZYRA 3ETBJ 5C71A 1HSAA 4F8PA 2GHYA 3LZRA 1QLFB 1V54B 1M05A 2B2XL 4NJAH 3NSYA 3P73B 5JXED 2EYRB 4FFVD 5BXFB 4OZHF 5C1MB 1IV8A 3KH4A 4A7GF 4N8CH 4JO3H 1WP8A 3B7UX 2ZOKB 3MCKB 3VGGA 2MCPH 1YZBA 4PV9B 5CP3H 4YHHO 4D3CH 3HVNA 4QRTA 2NY6D 3WFEL 3FUFA 4XHQA 2E74C 1JD9A 1NBMG 1YN6B 2XQYK 5CJ5A 3IVKB 3VGHA 4L1TA 1MDTA 4XPFL 5ALBH 1KTJA 4NB7A 1V3KA 4XB8A 5F3HB 3MLPA 1BGXH 3VFPA 1VGKB 2FWLB 2WVSA 3W2DH 4U1NB 3B3IB 1YDPA 3IPFA 4O2CA 4JQIL 3TBBA 1MCRA 1OEZW 2FX8L 1VZIA 3B5TA 1JRHL 1GGYA 3UJJH 4JFED 5CJQH 3BGMA 4PS4H 4ZUUB 4G42B 1N0NA 4P5TB 1J5OL 1T6VN 4HWEL 2R0LL 1PJWA 1I1YB 2DQGL 3KNBB 2EDXA 3U79A 43CAB 4ODHL 3QXDB 4DZBA 3DUUB 4IK6A 1KPVA 2FJGB 5IBUG 3BZ4B 3GJFA 3ZBMA 3MMEB 3TPUA 3VGDA 5JHMA 4NQCA 2OR7A 5D7SL 3L4WA 4DV3O 4KMQA 2UVFA 4KJWC 3TBTB 2I32A 2HN7B 3SPGA 2PTVA 4DKAA 4YUEL 4DV2B 3QJHB 4JRXD 2VWKA 3D4GA 4XMPL 4G7VL 4MSWB 4OUUB 4HCIA 4LARH 5E8OA 5EYPB 4ABVA 3MBEA 5E6YA 1F6LL 2WTPA 1S7WB 3QJSB 4PRHE 3RUGB 4YFLI 1Q94A 4P4KD 3WD5H 2Y3AA 4JG0H 1PNMA 1YC7A 2X53A 4OM0H 3ARGC 5CIPA 4O4HB 1QHOA 4S1QH 2IWGA 3ETSA 7FABH 4F7CB 2X4TA 1YEIL 5E0QA 5DR5H 3E0GA 4DUZB 3IC9A 5GS0L 4V2BA 3UAJA 5K9JH 1A6ZB 4YHLH 4WGVB 1E30A 1P1VA 3GO1H 3DYMA 4ZMTA 3WYRA 1DDHB 1A3ZA 4MJ6B 3A23A 1LP9B 4XHJD 1IKNA 1MFBL 3UC0H 1TZIB 5LHHA 3VH8A 1ZTEA 4RLDA 3VSQA 3Q01A 1TJMA 2A6DA 4L4VA 5KSUB 5J2UB 5DFAA 5I16A 4X80H 3FT3B 4PJHB 4R8CA 5CA1A 2FH8A 4NZUL 1CVSC 3QSKB 2CA3A 2LAAA 2EIJB 1HHJA 2B39A 1Q1JH 2Y2TA 3IXTB 4BQ6A 2X3AA 4OFYA 4ELME 2DQIL 4UINL 5J11B 1RI8A 4DWHA 1Q38A 3VD3A 1VF7A 2JWYA 1AKJB 3AK2A 3G67A 5AVWB 5EO9B 1UA6H 1YN7B 2Q5BA 2EO9A 4N2AA 4WDIB 5AZEL 4FQIL 3W3BA 1EEQA 3MR9B 3KPRA 3CCJV 1DQLH 2EIKC 3H1KH 5LMNO 1UH3A 4PGCB 1T83A 3I6GB 4WO4A 5DD1L 3ZGHA 4EI5D 1HNGA 3FONA 3VXUD 5FYJD 4YSPA 4AYDC 1P6FA 1LO4H 3GZOA 4Y8AA 4NO0B 1YNTB 5CU9A 4LCIL 1WN7A 3EG9A 4RMBA 3OEHG 1ITBB 3QS3A 4AL8C 4OPAA 5ACMA 1KYOK 3NFSH 4WEMB 2AF2A 3LSUA 3JWNE 3WTTA 1J5OH 2O61A 2ZD0A 4ZDHA 1DTOA 5AVSB 1FYHB 5I74B 3HFML 5FYJH 5CZXD 4KOCA 2BS71 5I8OH 4GKKO 2G2NA 4AQAB 4A2MA 1KELL 3EFFA 2FWOB 3T1HB 4PCSA 1TJIL 2YIBA 1W2BU 1NBZA 1XHHA 2WO3B 3GUFA 4YDVB 1A9EA 5GGSB 5FDYA 4AT6A 4DUXA 3TTYA 3KCWA 1IQDB 1QFWI 3K8MA 4N86A 4OFIA 5DD5H 3CPLA 4DUZO 5I71B 4AEIL 3C9NA 3HCVA 1GGTA 1JBJA 4HJ1A 2YEVB 1EZVX 1I8KA 3EFOB 1BQLH 1MUJA 2C9QA 5KYYA 3MTXA 5B1BC 3Q9QA 1H3GA 2NXYC 1MQ8A 3OBAA 3K06A 4JRWA 3FTZA 4NTWA 1BJMA 1H0DB 4X8JA 4APQC 4ZFGL 3MUJA 4C57C 4E9VA 2R29L 3U0WH 4TQPA 1HHIA 2XV2A 3RWHA 4JRXB 1WDAA 3C5SA 1FZMA 1XCWA 2W95A 4A7UA 2JE8A 4XPAH 3MV9E 4YHYC 1Q81W 4IRJA 4Q0XH 2YXMA 4FADA 3HMXH 3MCLL 3RZCD 4TT3G 3GSXB 3J7AU 1JRHI 4Z7AA 3ZIAG 2FL5A 1H9DA 3IMSA 3QIWD 1MFBH 4TUOA 3UC0L 4LQ1A 4KTEL 3CXDH 4WWNA 3ZW3A 2JKRM 3OGIB 3B9KD 3KPSB 1CO1A 3ABTA 1S3KL 2CGRH 1NBYA 1BW8A 1NEZA 4DEPB 3DMMA 1I8LA 4TLTA 5GS3A 1VPOH 5LQBH 1JZDC 2JCWA 5B3SC 4WU7A 3QUXC 4D0BB 2JB5L 5HGHA 3WE6A 1T03L 1TJHH 5FC9A 4GKJB 3EJPA 4H25B 1LUVA 5J6GB 1XCXA 4X64B 3IDIA 3PNRB 1QVOA 2ESVB 3HN5A 4GKZA 5ICXB 3BRCA 3BUQA 3RJDA 4EI6A 3H56A 3NDYE 4F27A 4A2GA 2BSKA 2HT4D 2XQBL 1BQ0A 1KCVH 4GLXA 1IC1A 1NOAA 1GRJA 3OKMA 4U1IB 1RUQL 1MCIA 4J12A 2ZG3A 5EO9A 4K9EC 1E5UI 3RYMA 4HS6A 3WN6A 1WC7B 3HR0A 2H2SC 1PV0A 4G6AC 3VFSA 1U8LA 2ZCKH 4UDUA 2IJJA 5F8RC 2EP6A 2MQCA 3LNEA 4E9YA 5FYKD 3IGLA 1PX4A 5JHLL 4LLYA 1MIML 1X59A 3LKRB 2OMWB 3EJQA 4QF1B 2YFOA 1ND0B 3KL0A 4ZXBC 2DB8A 2DQMA 5ETUA 1X5XA 3GDCA 1SS3A 2KQNA 1QLEB 3LKPB 4FC3E 3QIUA 1NCOA 3EFFB 5I1LA 2YAMA 3MNZA 4FQHA 4QJ5B 2PW1B 1FJGB 2DWXA 1GGCH 5TDOA 2O6FA 1R5IB 2OT5A 2WLIA 2NLJA 2QZ5A 3L1FA 5KOMC 4J3BA 4EN3A 4JRYA 4MMZA 4HOZA 1A5FL 1IM9A 5CMUA 4WFHA 1HILA 35C8L 5IIEB 3I74A 1OWRM 1BIHA 4D9RE 2YPLB 2YK1L 4KX9A 3PWNB 1G5GA 2Y36H 2BINA 5E6IC 3RIAK 1FUNA 2JB6B 4KMLB 3Q6GH 2EBOA 4S1RH 1NANI 5IFHL 2EJRA 2C7UB 4NNYA 4ZMQA 5C0FA 1A3LH 1QI3A 2M83A 3LIZH 3EJSA 4YDLC 5AVZB 1GCFA 3DI3B 2AJVL 3N2JA 4H40A 3VRIB 5L9DH 4Y4KD 1EGJH 2YMXH 4NQCE 3EGSB 5IVXE 5FEBA 1KTDB 5DC0A 5ITFA 1OP5K 2HT2C 4AHCA 3GKWH 1WAAA 2FLRT 3N50A 3GSRA 4TUJA 4HGMA 1A0QH 3CFCH 1KBPA 1BGXL 1XCQA 1SMAA 2GI7A 4FVMA 4ACTA 3KPSD 3VWJC 4FFVC 2VJXA 2VQ4A 1ZK9A 4PY8J 4B6ZA 1CLCA 2A79B 1N6UA 3ATFA 3L3KB 4GP4B 1RZFH 5C8YB 4PJ8A 4TSAL 3GWJA 2Z9TA 3ABMB 3U46B 4U6VL 3RL1A 3ZKMC 3SQBA 2YN5A 2OAAA 4LF6B 3QEQB 2Y6TE 3APOA 4WKZA 5C70A 3T2NH 2XTJE 2A3QA 2H9GB 5AW2B 3RVVD 2G75A 2X6MA 5C92A 1HKFA 1TQVA 4PJFB 1XAUA 1QSEB 1MG2C 3MREA 3C5JA 4L0PB 3CDZB 1P9MC 3JATB 2JQMA 5ACZA 4R4NC 4KVNL 5JHLH 4HS6B 2IANE 4GEIA 3ZDZB 2BNQB 1FDLL 4JX0A 3RWFB 2QWQB 3L95A 3VFSB 4XT1C 4F7MA 2PYJA 4WWKD 4BQBA 5I1KH 4U3SB 3W7SA 3N2KB 1CLYL 1FL6B 3OB8A 2DM4A 1PD0A 5B7EA 2ZSVB 4LEXL 3LQAL 4FFYA 4KK8D 4Y5YA 4ZAKA 5C0JA 4L2LA 2HJKB 1S9VB 2BHYA 1YEWA 2V33A 1IILE 3NJJA 3TTSA 1UM4L 3PU7A 4JKPH 4ORGA 3SE9H 1N0JA 4PJEF 2XU9A 4FL4B 1CICA 3A4AA 3U0TB 1CXEA 4UT6L 2J6EL 1X9RA 1Q9OA 4A7VA 3VXOA 1UXMA 4LSTL 4N2FA 5FNVA 2PW1A 1SJHA 3ESVF 4YE4H 5T1LD 4HIEA 4ORZC 1HK6A 3RDJA 1BLIA 2ATPB 2F0CA 4HEMA 3NGBB 5ITZA 3SDXA 3NZSA 5HGAA 3AB0B 3SJVA 3OAYH 5IY5B 2BSCA 2Z34A 3NA9L 3D39D 1M4UA 4Z7WE 4HG4K 3F01A 3QJVB 2OJ1A 2RCSL 2YPLD 4FLSA 3WU2Z 1M3JA 3QUMH 2WQAA 1MCJA 3MA9L 2JKNA 2J73A 2FQEA 3CSTA 1SLUA 3ARDB 4N24A 4EXKA 4MNQE 3T0XA 3V6OA 2YUVA 5JIIA 4YBHA 4KXCA 3MUHL 4UWQB 4ZHQB 5CN0A 3BJ91 2YC1B 2CUGA 3G9AB 3CX5F 1ZSHA 3O3DA 4HVBA 1U8OA 5F8QC 5HHPB 2X4SA 2DM7A 2GG1A 1MQKL 4IDJL 1K8IA 5KZCD 1E27A 1R3LA 1Z5YD 1M05B 4Z7NE 1MZZA 4DAGL 1RUAH 4FQXA 1ETA1 4LCIH 2F58L 3H1LH 4PJGA 1KYOJ 2ZUWA 1PLGL 1A1NB 5KS9E 3QG6B 2KG7A 5BZWA 3NFSL 4QXVA 5DVNA 1EZSA 4XBEL 1CE1H 5L4IA 3QNFA 5CMAB 1EMTL 3D3VB 4CH6A 4JM2C 2XFGB 3RL1B 3O9WC 1CLZL 3QDGD 4GIOA 2ODHA 3TYFB 3WEMA 3LPPA 4EI5C 3BZEA 2ZPKL 5EBWC 1DO5A 5L3BA 3ETGA 3MLSL 3ZN0A 3P02A 2F7OA 3KKYA 5HFMA 3O11A 3I6LD 4FE9A 4K71C 5SWQB 1M56B 3LSSA 3KGSA 5F88B 3V5DA 3QJRB 4LASH 1FVEB 3FB8C 1SQ2N 4K7PH 2P5WB 1QTYT 3I75B 5E8PA 4E2LA 1GC1H 3QIUC 4GMSL 2ITEA 5ACZB 2QT6A 1U0QA 4LEXH 5DVKA 4LEOA 5EUOE 1BMFG 4P46D 4DKEH 3CFMA 4N5EC 1A4CA 1IIIA 2A99A 4ZFFA 4HJ0C 3T8XA 4UQ2A 1XBDA 1EIBA 1OHZA 2Q8BH 1JPSL 3KEDA 5C8JA 1AMYA 5HYSA 3IU4L 1FH5H 4RDQG 3CPWU 3BZ4A 4N2CA 1IEAA 2AXGB 4JO2L 5C0JB 1FE8H 1PDKA 3V7AE 1AR4A 2C3HA 2DD8H 4EXPX 4YJ2B 4DR5B 4LL4A 2XZCH 3US9A 2IFFL 4YE4L 1H3UA 3GPSA 2VZUA 4LBEA 3N6YA 4JZJA 3FQ2A 3KPLB 1Q9OB 2X42A 1U8CA 3RVXC 1UJ3B 1NTMH 2A6KA 2VDKH 4KDWA 4AIXA 1RJLA 2BIPA 5FNVB 4DR6O 1XTMA 1IKOP 4NKOA 1AR1C 2MKWA 2OWOA 3FTSA 2HLEB 2MMXA 3CS5A 3GSNH 3JWOL 4NZ8A 2CCWA 4PGJA 1U8MB 3DIDA 3C8KA 3ZTNH 4QRRA 2HWZL 2WZAA 1XREA 5JW3H 5JPMA 4DGYL 3GRWL 1IM9D 1AC6A 4KXDA 3V4VA 5I73B 1NR7A 2AJSH 5IF0A 2UXDB 3ESNA 4CC1A 5GZOD 1I53A 1KCVL 5EO1B 5IQLA 1ADQA 5D5MA 3FN0L 4LGRB 2NSQA 1UACL 5JOFB 1VADB 4XCNB 5J13C 4MB4A 5F7KC 2WY3B 4DGWC 2E46A 3V4PA 1CD0A 3NRQA 3T4AB 3B6SB 4DAGH 2Y72A 4PJHA 1QSZA 2Q3ZA 3JWDH 4GI6A 1E2WA 4HWZB 5HY9B 3D6GA 3H3PL 1FGNL 1KEML 5EWIL 2Z7WA 5F96H 1CYGA 3HAEB 3CE2A 5EZLB 3K2UL 2QWRB 4F37K 1E27B 1KCUL 1NCIA 2CALA 2DJ4A 2R0ZL 1WAAF 4R2GD 3MOAH 1J9QA 5H2BB 1ACCA 1IEBA 3D18A 2WXKA 3CZSA 5LUMA 1NC4A 4NEHB 3TIEA 3UABA 3WCYA 2IU0A 1IBKB 1XCTB 4CC4C 4PRPE 3D3VA 3VX1A 3DX1A 2JK5B 3FL7A 1K33A 2DQ0A 1CE6B 1FC2D 1I94B 1OSYA 4KMTH 4MRCA 4YBLB 4NXMB 5HHOE 3T2LA 1WT5C 4CBPA 3IDUA 4LFBB 1WTLA 3QP3A 3F5WC 3F62A 3OZKA 1R17A 4XVJH 4JYBA 1ECYA 4D9RD 5A3ID 3NH7L 1OTSD 3PXLA 4DKTA 1FZKB 3ARRA 3DNKA 1DEEB 5HHXL 4NO5B 3FQUB 2IH3A 4UVBA 35C8H 1CGYA 1B2WH 4MAYA 3B8MA 2YUZA 3EZ8A 4MMYA 3L3HA 3UZQA 4ELDA 3IU4H 3T77B 1MCFA 4GAAA 5KBKA 2A7BA 4YNYA 1A3QA 2SODB 2MW2B 3RBGA 3QDJD 5IWLA 2DD8L 4P46B 4KNSA 2R1YA 4G82A 1CD9B 3S97C 2RJMA 5B1JC 3STZA 3QPQC 1MH5B 1MWAB 4AG4H 3SGJA 1BVLB 5MEQB 1CURA 3UYRL 4NT6A 4TYUA 3QZLA 3GMNA 2V3EA 1VA9A 4TSBH 5JOPE 1CGSH 5EEYA 2APBA 2HTKD 2HX7A 5EBMB 1A0QL 1K2DB 3CUPA 3VXSB 1BIIB 1XDCA 5C93A 1UWEL 2G0KA 1UHVA 2EE6A 2JELH 3STBA 1SZNA 1THZA 2HRLA 3QNYA 4DR7O 4I4WA 4OCXH 2D2OA 2F7IA 3GSXA 4PJ9C 2HXAA 1N3NB 1S9WA 3CXHJ 1KGWA 3EYQD 3HHRB 1UACH 5FGBC 3KM2A 2ITCA 2WQSA 4PR5B 1KB5L 4AEHL 5F6IB 4KGJA 2A1WL 3L74H 2OZNA 5CSZB 4IMLB 4ZYKB 5DO2D 4XO9A 5I1AB 1PZUB 2VDKB 2ZUVA 5EO0A 4JM0A 4JO1H 3GSNB 3O3AB 5HGHB 3KD4A 3CX5K 4HCGA 2VJ8A 2FKXA 5DSCA 4WF9V 5FX3A 4FFTA 1OT1A 3LEXB 4N8VA 3RYFA 3IAYA 3F7VC 2K45A 2UUDH 4XOCA 3WXWL 3PWLA 3E83A 5I1KL 5IVZB 1EFRG 2BSKB 3NRFA 3HC0B 3RVVC 5DSCB 1PW3A 2WLJA 3KM1A 3MLXL 1AGFA 4NP4L 1I7UA 3NVQA 1JZ3A 1NAMB 4ETQA 5D7IE 1A7PL 3AWFA 4HDIA 2N4IA 5JLZB 2I26N 2X2JA 4U6TA 1RZGA 2ZE6A 2ZICA 1LNQA 3CAFA 1X6NA 4ETYA 3TIEB 3WTWA 4CMMB 2FYUH 3CH1B 2QTSA 2BC4B 3WNOA 4LF9B 3QJUB 1YEHL 3ABGA 4FI8A 3MUUA 1W59A 2JRIA 1VQ9V 2VL5B 1IX2A 2ZCLL 1BAFL 3UPRA 3BXNB 4D9LH 4BELD 1KSRA 3LH2L 4YDJA 1K4CC 4K3DL 5I1IL 4B9JA 4P5KA 4NO5A 3A6BH 2IH3B 2AQPA 1I1AB 4DESA 5EBMC 2JEUA 3CCVV 3KJ4B 4K5LA 4PRPA 3ARGD 4UVAA 3EDFA 3N06B 3L3HB 2F54A 3P3TA 4PTUB 3H4HA 1RIUL 4DP8X 3BYTA 4MNQB 1VF5B 5DEZA 2DE0X 4HWUA 3T8VA 5TDOB 3MJ9L 3DARA 5B3SB 2V9UA 5ALCH 3C6LB 2ZKOA 3QVAA 4Z7WB 3M6DA 4YSQA 3NEXA 4WEBL 1OD7A 5C0CE 2FEJA 1TOXA 4PH8A 1NC2B 1BVLA 4BSVB 4W9CC 4G8EA 2W07B 3C8DA 3N85H 4ODTL 1XQ4A 4PJXA 3DPDA 3UTQB 4JS7A 2IDSA 3FOMA 4JPWL 3MACL 4BGDA 1ZTXL 4P5TC 4PRIA 4RX4D 2IJIA 4GQQA 3TGXA 4Z2WA 1IFHH 2YKLL 2IAMC 4NZFA 3SCMA 4POZC 4G7QB 4KO5A 3L5HA 2GV9A 1MFCL 1VACA 2A1WH 5ANME 2HLFC 2Q86A 2AW2A 1I82A 2QFPA 3FT9A 2CNZA 3LNDA 1RSYA 2HFFA 3PABB 3Q8EA 3KL5A 2F4VO 4ZTEA 1QSVA 3ZTJG 5KHJA 4A2LA 4ODBD 2X6VA 3GSRB 4TUJB 2K8MA 5CJXA 2QGNA 1LWRA 1N0LA 1ULVA 1AOZA 4BK4A 2R69A 1P4BH 3LDEA 1SETA 1NPNA 3DYOA 4HT1L 4K7PL 4MJJA 4G2KA 3BEVB 5BCAA 5F2FA 2PWFA 4M3KB 3ROOA 4X65B 3U4AA 3AB0C 3BC9A 2ITFA 4PN6A 4NBXB 1J5CA 1NUGA 4LVHB 5IV2B 1YNLH 3QRFM 3EGDB 1BVKA 5IVZA 1QSEE 1MHHB 2FO1A 3DA0A 4WTXA 4QRSA 4LDCA 4XNQB 3W39B 1SVCP 3N41B 2EUZA 3UMTA 1JYNA 5GISL 1FE8L 2Y69C 2QPFA 3H0TB 1BVZA 2PY5A 2R2HB 3WFCL 4E42A 4I18A 4LSQH 1WFJA 1IBLO 5IB1A 4WEUD 2CAZC 3FCUB 4G9FB 5GZND 5INDB 2BCCH 3T1FB 4FXTA 5ITBH 2DQDL 2LOEA 2H1XA 3P3RA 1JMZA 1HQRA 4P2OC 2GIMA 4OF3A 2GJPA 3SE6A 3BW9B 1DQTA 4HYTB 2HJKA 2PO6A 4E41A 4QTFA 3K5LA 3FTUA 3PJSK 1M9WA 1ZA6B 4PRPB 3GZQA 4N6RB 1YYCA 4NUGH 4ALAC 3P9LB 3MJ9H 5ALCL 3FD9A 1CFNA 1YQVL 3FUDA 3G6BA 1G0XA 3KWWA 3LKQA 5FUOL 5GRJL 1PAZA 3KBPA 4FHKA 4UB6Z 4M8UA 3V0HA 4APQD 3V0VB 3LEYL 3ABZA 3MOBH 2XAJA 3BWZA 1SA0A 5LNGA 1Z9LA 3K74B 1ZVSB 5HVFB 4DVBB 2B14A 2OTUA 3U7YL 3AQYA 4Y9BA 4HGKC 1U3HD 2YI9A 3EO9H 1HAWA 2E7LC 3K6FA 2WAMA 3KYKL 1HZKA 2APWA 3Q3GB 1NC2D 2OTWA 2EULA 1KPUB 1XMWA 2QLYA 4PJXB 1U2CA 4LMQE 3UXFA 1X6LA 1T1XB 5TDNA 4KZEH 1FFTB 1WVZA 4URKA 1OGTB 3GIZH 4UB0H 3FTGB 2DTSA 1N5YL 3UAAA 1SLWA 2P6JA 3VFOB 2YIDA 1L8DA 3H3BC 1U8OB 1QRNE 5CEXB 1V10A 2CTPA 5I82A 2VXVL 1LEKA 5SX5H 4X9HA 1SBSH 3OJDA 4QHNA 4RWYH 1MFAH 3PQYD 2VWJA 4XE5B 5FDWB 1SZTA 2X4RB 3N43F 2KDGA 4RA3A 5CO1A 2QJ1A 4YHOL 1BSIA 1I75A 1S7XA 5FK9A 4M6NH 5DT1L 3FB7C 2I27N 5FOBB 5AB2A 3GLZA 2VXSL 3FFDA 4OLZH 3FT2B 3IN2A 1ZV2A 3C2AL 1AYOA 2XG5A 3NSJA 2IH1C 2WKOF 3HPLB 4Y4FD 3ISWA 3WU1A 3FFCD 4RQFA 3MKGA 5T3XL 3VFWA 5K5YA 1Z9PA 4L1HA 2GUOA 1U30A 3BPCA 4JM2B 4WFEE 2UY6B 1SC5B 3J80N 2RTTA 3SDAB 2CR0A 1P4LB 3HBQA 4E9WA 5A3IC 5CZVL 4J3XA 1X5IA 4NQEE 2YGVA 3RVWC 3Q48A 1OB1B 2YS4A 2HVJA 3H0TA 1S78D 1CF1A 4ZT1A 4LEOB 4J11A 5CA0A 5DRXB 1KIQB 1TENA 4NZTL 5IY5C 1FFNB 3ASNC 4S0TD 4PA7A 3HRZC 3REVB 3U9PH 4UQ2B 2YJQA 4X7TB 4LSPH 3TJPA 3MYJB 3L3OC 2AJUL 3T0BA 1V8HA 1OZ0A 5GS1A 2EDMA 3MRNA 4IJTA 2F23A 4XC3H 3SKOA 4DQAA 2ZXQA 4NJ9H 3IMWA 2A38A 2NNAA 3ZKNC 1QFUL 1Q9LA 2RBLA 4HUKB 1PS3A 4MX7B 4Q6IC 4TULH 3WIAA 4ZX3A 1Y6MR 3T3PE 1K5NB 4RQQB 1CI5A 2HVBA 4DGVH 1C16A 1EZVY 1B0IA 4HJTA 4HLZH 4RMWA 2HTKC 4ZTPH 2PCYA 1XH1A 5D1XA 5HI3C 3L2NA 4P4RA 1F51A 1QRND 4QLRA 4UVCA 4RUFA 3QQ9C 4W9EC 4X9FA 5E1IA 1J8HE 4XOEA 2OCCC 3FJTA 3EXLA 3K71B 1B6QA 3MNWB 4WCYH 2XT1B 1UVQB 4MRBA 5IVXA 5DS1A 3H1JH 4A67A 5ISZE 1I9JL 1MFMA 1S9XB 3ZHVA 2I07B 3QZBA 2FIKB 2QBWA 4GAGH 1NCJA 1JHTA 1P53A 2G3MA 4M6ML 1T0NB 1ZMYA 5B5EZ 4ELKB 4LSUL 1EANA 3D1MC 1A7PH 1KGJA 1A65A 1QFPA 1CXLA 2HP4A 1EJ6A 3JV4B 4PIBA 3CRCA 3PIQB 3L3IA 1MZYA 4PWHA 2WBXA 4LSSH 3OT7A 1TQUA 3G6AB 3WO4C 3Q05A 3APQA 3RYCA 4NCC2 3QUHA 4KV5E 3VFOA 2KI6A 1TVHB 1U36A 1ZLZA 3WENA 1M2OA 2PYEA 3MA7B 1F13A 4J6RL 4GUNA 2OJEB 1SY6L 1IGYB 3DETD 2BSSA 1FVCB 2RIKA 2ADFH 3IBOA 1X9QA 4LLDA 3W7XA 5K59E 3O6KL 5FK9B 2W6IG 2EIJC