1V54B

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v54B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v54B02
2VSKB 1XB3A 1PNDA 3T6XA 1A4CA 4A67A 1BXAA 2CCWA 3FPXA 1M9WA 3OMIB 1ET8A 1L9RA 4AX3A 3NP3A 1NIBA 1ZIAA 2PPEA 2IDQA 2Q5BA 4M4RB 2YAMA 3V9EA 5I6LA 1E5ZA 4E9RA 1BEXA 1NTDA 2HRGA 1JXGA 4KNSA 1QLEB 1AR1B 1DZ0A 4X4KA 3NYKA 5AKRA 5D4HA 1WA2X 2FQEA 2YXVA 4KOBA 1PLBA 1V55B 3OMNB 3CVCA 3ZDWA 1AIZA 3FQ2A 5B1BB 1L9PA 1W6WA 4N4YB 2J5WA 4QLWA 4YVNA 1RCYA 1ASOA 1MG2C 3UAEA 3TASA 2HX7A 1SFHA 1PF3A 2DWTA 3NSCA 2JXMA 3FSWA 3PAZA 3WIAA 1WS7A 2PP8A 1A65A 4DP7X 1GY1A 5AZUA 4A2HA 1J9RA 2IDFA 2VW4A 2GC7C 4GP5B 1JERA 3FU8A 2UXTA 1AQ8A 3GYRA 2BP0B 2ZXWB 1PY0A 2IDSA 1CURA 3FSVA 4BK5C 4AKOA 3QJTB 3QJRB 2CBPA 3MBWB 2EIJB 2Y69B 8PAZA 2B08A 1PZBA 2FWLB 3FQ1A 2W8CA 3DTUB 4BWWA 1BQRA 1MZYA 2QPDB 3CVDA 1OCCB 4HALA 2P80D 1AS8A 1OV8A 3CDZB 1PZAA 4NAJA 2UXFA 4HIPA 1ILUA 1AZNA 1A4AA 1ZDQA 2AVFA 1JZEA 1BQ5A 4G72B 2WO3B 1W6LA 4YSTA 3ZBMA 2EILB 1KV7A 1SHWA 3CVBA 1PCSA 3OM3B 2I85A 4F2FA 3NSDA 5EHFA 4K9JA 3EHBB 3L45A 1JVOA 3WI9A 4ENZA 2BW4A 2BP0A 5TK2A 4YSCA 1KBVA 4WKXA 1AAJA 4W9ZA 1OE2A 4YSOA 1GSKA 1ADWA 1L9TA 4YL4A 5B7FA 2BP8A 4NERA 3NJLA 1GS8A 3AG2B 2QPEB 2VW7A 1AACA 5B1AB 2PPFA 3PPSA 1IBYA 4E9QA 4KO9A 2J55A 3CDZA 1JXDA 2FT7A 3NJGA 4KNUA 3FSAA 1F56A 3QPKA 2HX8A 2EIMB 3TA4D 5E9NA 3C75A 2YAFA 3JTBA 2FNWA 4FAAB 3AZUA 2XV3A 5I5MA 4DPBX 4G7RB 1WS8A 1AS6A 2PP9A 2TSBA 2BWDA 2GC4C 2YEVB 1J9SA 2YAQA 4A2DA 5D4JA 1GR7A 1GYCA 2HLEB 1A8ZA 2J57A 3UACA 3NJIA 1NICA 2I7OA 3ERXA 2E86A 4E9YA 3IE9A 5I28A 2IWEA 1M57B 2DV6A 1RZQA 4DP8X 4KOCA 2PPCA 4L0PB 1JZHA 2BZCA 2DY2A 2XX0A 1GS6X 2CUAA 2W88A 3ZX1A 4E9XA 2MTAA 1ILSA 2PP7A 2ZONA 4A2FA 4F2EA 2XVBA 1AANA 1YLBB 3X2QB 1HFUA 2JFCA 3EF4A 1SHXA 1CC3A 3BVDB 1E65A 7PAZA 2GB2A 2NRDA 1J9QA 2HRHA 4P5SA 3KW7A 5I6KA 3X1EA 3ABMB 1MG3C 4YSPA 2XV2A 1SFDA 4MFHA 1NIAA 5B7EA 3OMAB 3QJUB 3U25A 5LDUA 3WG7B 5B1JA 2A3TA 2GHZA 2HZHA 1B3IA 1SDDB 4E9WA 5AFAA 2UXVA 2HX9A 1BYOA 2Y1AA 3OQRA 3PCYA 4GP8B 1OE1A 1NPJA 1PLCA 1RKRA 3NT0A 4NB7A 4EF3A 3UADA 4HZ1A 3NJKA 2QT6A 3PAVA 3S3DB 3X1FA 3T6VA 1OCZB 1NWOA 1JZFA 2CJ3A 3QJSB 1E30A 2CALA 2YARA 5I5IA 1NDTA 1EZLA 4HHGA 2MRYA 1XB8A 2QDVA 3JT2A 1PAZA 3QJVB 2AZUA 3PAUA 1SNRA 3FU7B 3NJNA 4DP2X 1NINA 4HCGA 1DYZA 3KW8A 4DP0X 5I6OA 3AG1B 1QHQA 5FC9A 1E5YA 2H3XC 2PPDA 3IN0A 4AZUA 1SF3A 1NZRA 3X1NA 3TU6A 3IBOA 4YVUA 4E9TA 2XV0A 1TEGA 2CAKA 2GBAA 2R7EB 2AANA 4A2EA 1FFTB 2P80A 5I6PA 3EH5B 5D4IA 3UABA 1NPNA 1X9UA 1PLAA 3IEAA 3WNIA 5B1KA 1URIA 1ZDSA 3AG4B 1ZIBA 2BHFA 2BW5A 4A2GA 3FU9A 2FQFA 3NJHA 1V10A 4BXSV 1GW0A 1J5CA 2RACA 3UGEA 2XXGA 1WA1X 3FPYA 2XXFA 7PCYA 1AG6A 1AS7A 3ZIYA 2VN3A 5I6MA 1HAUA 3ASNB 1V54B 2YAOA 1T5KA 1SJMA 4YSDA 1CYWA 2IDUA 3NJMA 3SBRA 4F7KA 1OOWA 1UATA 1L9QA 3HEIB 2DWSA 3T6WA 1R1CA 4GYBA 2VMJA 3AW5A 4JHVA 2PPAA 2YXWA 1AZUA 1OCOB 3ASOB 1BAWA 4DP5X 2IH9A 2FTAA 4E9SA 4KO5A 2R7EA 4UF7C 3WNJA 3EH4B 1JZGA 2UXGA 2XYBA 1KDJA 1TU2A 1PZCA 2I7SA 3DIVA 4G7SB 5F7BA 3WKQA 1ID2A 1I53A 2PLTA 3D12B 4YSRA 2JKWA 1KGYE 1XMEB 1OCRB 1JOIA 1ASQA 1KDIA 3S3BB 3S8GB 1QNIA 1N70A 2WSDA 4UAHA 4BDVB 9PCYA 1A4BA 1JZIA 2XX1A 3G5WA 4P5RA 1ETJA 3BQVA 3N2JA 3PLYA 2Q9OA 2TSAA 4BWUA 2IAAC 2FJSA 4BWTA 1AG0A 1WAEA 4Q89A 3S8FB 1JZJA 1NIEA 1AZBA 1IKOP 5TK4A 3T6ZA 2J56A 1ET7A 3H4FA 4DPCX 1JVLA 4DP1X 1J5DA 4G71B 1IC0A 3QQXA 1AZCA 2BO0A 1RZPA 3DKHA 4KO7A 3ABLB 3NJFA 1BQKA 1MDAA 1PMYA 2PCYA 1KCBA 2YAPA 2VM3A 2B3IA 2GI0A 5I6NA 1TKWA 3T9WA 3AG3B 1E67A 2HXAA 2EIKB 1X9RA 4HAKA 3V9CA 1ASPA 4YSAA 2BZ7A 2VSMB 3S3CB 3FS9A 4G70B 1J9TA 4A68A 4DP4X 1FA4A 2BWIA 2QDWA 2GSMB 4ZK8A 1OE3A 3PXLA 5I5JA 1FWXA 4N8UA 3EH3B 3UAAA 4BDVA 3SBQA 1WA0X 3WKPA 1ET5A 1L9OA 5I26A 4AI7A 4FA7B 1W8EA 2YAHA 2AZAA 2FQGA 2UX7A 4YSQA 4GXFA 5ANHA 4Q8BA 2VW6A 1N68A 2BP8B 3SBPA 4HCFA 3MX0B 2FQDA 4KO6A 4YSSA 1IBZA 3RYMA 1MZZA 1CUOA 3TBBA 1SDDA 1TEFA 2ZWNA 1GY2A 4HCIA 3CG8A 3X1BA 5B3SB 3HB3B 1L9SA 5F7AA 2N0MA 2IDTA 2ZOOA 3SQRA 3NSFA 1IUZA 4UANA 1CYXA 1XB6A 1NIDA 2XWZA 3FSZA 1KCWA 1EHKB 3GXUB 1NIFA 2H47C 2DYSB 4HHWA 5IY5B 3FQYA 4JHUA 4PAZA 5A7EA 2GIMA 4AKPA 3T71A 1BXUA 3FYIB 2X87A 2FT6A 5PCYA 1PNCA 2AFNA 4WTQA 1JXFA 4DP6X 2XU9A 2YAEA 1SF5A 2EINB 3FU7A 4YSUA 3GDCA 3H56A 3N55A 2FT8A 2IWKA 1ZPUA 1VLXA 2OV0A 4QKTA 4DPAX 6PCYA 1ZV2A 1M56B 2DYRB 3CZUB 2XLLA 3AY2A 3X1GA 3NJJA 4JKNA 2UX6A 2LLNA 2XUWA 4RH4A 4DP9X 1AZRA 2PCFA 4W1TA 1KYAA 4M3HA 3FT0A 3NSYA 3FYEB 1BYPA 3NP4A 4TXVB 4GY4A 4YSEA 4AKQA 1BXVA 2X88A 4CSZA 4E9VA 3IN2A 2IH8A 6PAZA 4BXVA 5B7MA 1GS7A 3H4HA 2OJ1A 1AOZA 5PAZA 2H5UA 4CSPA 1A3ZA 1HAWA 2IWFA 1KBWA 2VM4A 2YQBA 1NWPA 3QJQB 4PCYA 4GP4B 3OD3A 4KNTA 3TBCA 2WO2B 2OCCB 3ABKB 5B1JC 1OF0A 4G7QB 3ABGA 4A66A
chains in the Genus database with same CATH superfamily
4YGVA 1JZ2A 3RVVC 4P07A 4YR6A 2P43B 1NL0H 2VE6A 3BAKA 4LESA 5I74C 4FQPA 4KK6C 4BIZA 3AQZA 3ULUH 5SWSD 2ATPA 3F64A 1WTGT 1XX9C 3TN0B 2PPEA 3DMMC 3PWUB 4XMLL 3FN0L 5DEGB 5C08D 3H1KH 4E9RA 1K2DA 1QLEB 1AIFB 2JIXA 4H1LB 3CZGA 2FQEA 3GKWH 1O7VA 3SD5A 4D7BA 1IARB 5T33H 3FFCA 4OTXL 3FQ2A 3QJFA 3GSNA 3TZVB 3JALA 1L9MA 1WFIA 3G6JB 3OXRB 5DRXB 4MDIB 1LYQA 4KGJA 4OJFL 4G9DB 2F8XC 4JGSA 4R6UA 5CJXA 4AQYB 2GFBB 1T4KA 2PO6D 2EYRB 5FGBA 1A0QL 3GZQA 4IRZH 5H94B 1KG0B 4EN3D 1A1OB 3ARDA 3FB7A 4FQLH 2LFRA 2GJ6A 2MSPA 1MCJA 1Q8IA 4DOHB 4ZMAT 5D71L 3BVNA 4DN4H 3EOAB 3EYFB 4XPBH 1CURA 2DWXA 5LA6A 3TT3H 2P6JA 4J2QA 1FNGB 1KCKA 4YFLI 1IBKB 2IANB 3BWUC 2GTWB 3WHXB 4EI6A 2ROXA 5J6GB 2YMXL 1H5BA 5IM7A 1HWYA 1A2YB 2BNQE 4L87A 3B6SB 1CTMA 5D1ZD 1KB5A 3F00A 1NA8A 1PPIA 1RUPL 1YEEL 2G9HA 2CTWA 3WKNA 4QRRD 4C56D 3KCXA 4R0LC 4TSFG 1INDL 1D7CA 1FRGL 1ZT7A 2XFXB 2LW7A 3L5HA 5D7EA 1MCWM 3UTPD 1Z1WA 5DDHA 1EAQA 3C5SB 2DWDB 5CLZA 3G6JF 4NM4L 3GI8H 5D4QA 5CZVH 3L54A 1E4XL 4EEEA 1XMOB 3K72A 2G30A 5GGQL 1P9MC 3SY0B 4EUPA 3AC0A 5IQLA 4TUJA 2NR6A 4GW5B 3QCVH 2EILC 2UU9O 5HFLA 4PG9A 3DUUA 5C0AA 5A2CA 2I85A 1L4IA 5IQOA 1KXVC 4X7CC 3VFOB 4W9CC 3K2IA 3HJ0A 1P4IH 3E22B 3CZFB 4HXBL 1VGKB 3QNXB 5DS2A 3EHBB 1NH2B 3V6FB 4APXA 2CDYA 3CIAA 4H88L 4IKNA 4ODHH 1KTKE 1RD6A 3SJQC 2O5XH 4WKXA 5IR1A 2V2TA 4W9ZA 3L70H 4LH6A 1OAKL 5C07B 1YPZE 3JVGC 4N2LA 2QSQA 5DK3A 2P26A 5HI5C 2F95B 1UH3A 2MK3A 2NY2D 3WN5C 5HBBA 1IAIH 4YL4A 2YKKA 4JKMA 2ZKWA 4RAUA 3H42L 1U41A 4NERA 2XAFA 1HI6A 4KZEH 3NJLA 2ZG3A 4MBOA 3ZE1E 1K4DC 5LWYL 3WN6A 1WCBA 4N2EA 2EDWA 1F7YA 4KITB 1IBGL 4HJUA 4PWIA 4N1EA 5DFWH 4XPHH 1Q9WA 2FX8H 4X4XA 5TQ0H 4LP8A 1M90W 1U8NB 3BD5A 1F58L 2DDQH 1G6VK 1DEEB 2OXGA 2DBLL 3VRLE 3ZHFA 1CXFA 3X11A 1YAZA 2EXWD 3EFFA 4FLYA 5B3JE 4CUCA 4I3RL 1AXSA 1YCSA 3BEWA 2WBJC 3MRBA 3T1HO 3JWDH 1Q9KA 4KTDH 4LSSH 1TQBB 4XB8A 4XE0A 5A40E 5I5MA 1WWWX 2ADQB 3KR3L 5INDA 4MMXC 1MWAB 1NLDH 1ETB1 3LHPL 1HNWO 2YLHA 3QIWD 1J9SA 4MQ7A 1U8MA 1ADQL 5DHDA 1S7XB 4JFOA 1FAKT 2XKSA 2B4CC 3CN3A 2Q8AH 5BXFA 5IF0B 2QTOA 5BZWA 1BA9A 4QXUH 4PDVA 4N3TA 4QHUA 5SWQB 4XWGH 4U7MA 3FTSA 2R4SH 3R0NA 4TUUA 5DJ2B 3CRRA 2ZIOA 5EWIL 2YEZB 2YWZA 4NQEE 2W60B 1TYRA 4OZ4A 5KX5A 4LK4A 4NHCH 2H9GB 4OQTH 3F7PC 5J8OA 1Z5VA 4FQCH 4S1DD 1PZ2A 3LD8B 1IEBA 2ZM6B 2C1PB 1AQMA 1SJHA 1P69B 2MHAA 4FFYL 1JGIA 5T5NF 2UXCO 2JI3A 3ET9F 2DMBA 4FFZA 2FCBA 1A8JH 3IWUA 4MLSA 3P0GB 4XN8A 3SDCD 4MD0B 1JVMA 2HWZH 2XY1A 1X5YA 4ZDHA 5KYXB 4UTAA 2ZXQA 5E9DD 1A7OH 1ES0A 4HKXA 2BOCA 1I0HA 3MJ7A 3RB7A 4RRPA 1OLZA 2NCEA 1I8IA 3RWIB 1XHZA 1NANH 3A0BZ 4KMQA 1PLCA 3ABLC 1VFAB 4NJAH 5EFIA 1QKZL 1HQRB 1LO3L 3VD7A 3LVTA 3PY9A 4NEHB 3GKZA 1WT5C 2W9EH 1N64H 4L8BA 3MOBL 1A21A 4QLRA 2JK5A 2VRQA 3L3GA 2EYSB 4P3CL 4L8JA 3CCJV 3RIAF 2RR3A 1JE6A 1NDTA 3LRSA 1WFTA 2X7LA 2BNQA 1NPUA 3GMQA 4DCQB 5LBSL 4AVIA 1KD1W 1HR0O 2AZUA 2OYPA 5JNYB 3D7PA 1Y4MA 4C83B 1EEYA 4G80B 3TJEH 1WEJH 3BPCA 2WWMC 5A2KH 2XWBB 4RWYL 1P7QA 1I8MB 1OEZW 1DP0A 4WI5A 3IDGA 3IN0A 1OD7A 5LGHH 3X1NA 3H6AA 2FHBA 1PL3A 4OLWL 3VRIA 5G4OA 3ATAA 3UBGA 4CL7A 5BMVA 4R7NB 5DUPL 3KEDA 4OIAA 3U46B 2B2XH 1ZJAA 2H3NB 1G0XA 2J6EH 4JFQA 2FWOB 2GKIA 2WC7A 3K79A 2F18A 2JE8A 3VWJD 3T09A 4AT6B 4QHMA 1YDPA 3O0RL 1F2XK 3MD0A 2O4EA 1AJQA 2WJ5A 3QYCA 2C3GA 2OR9L 3FBKA 4MA1B 3VW3L 1FORL 3TXQA 3VU1A 1M6UA 2FGZA 3RGVC 2VIRA 3BE1L 3O2DA 1OTTC 5CBGA 4MCYB 2VQ1A 2XZQH 1YPZA 2FQFA 2UYLA 1V10A 4OI9A 3HAEA 5TF1H 5AVYB 1BSIA 3GQFA 1A22B 4CJ0A 2XXFA 4BD4A 1J0IA 4IBSA 3T1YO 3L3IA 3RZCA 5F89A 1XSKA 4AJWA 5DRNA 2XQ0A 2BOLA 2O5NA 5MHSE 3FUDA 3H9ZA 2ZCKH 4LPYA 4TQPA 2P3YA 3LRMA 4HZLB 5LCVA 3SBRA 4GUQA 3R4DA 4JZ2A 1OOWA 3FONA 4R7XA 3WFCH 3FB6A 3WO3B 3ZE2F 4Z23A 2ZG1A 4KVNH 3FO1A 3MMEA 5D2NA 4GYBA 2YWYA 3U0WL 1MF2H 1XFPA 3QWNA 5ELIA 3HNSH 1T1YA 4Y19D 2BCCH 5JHBA 4BA0A 5EDXA 3D33A 4NI6A 1AZUA 4LF4O 1JA8A 4EE2A 1HHKA 1YEDB 3DSFH 1N5AB 1NFDB 2IAMD 5FL7G 3T3ME 3PWPE 4N8VB 2ZYSA 2GK0A 3ABTA 3ASOC 4G6MH 4PLJC 1PG7H 1E43A 2P67A 3DIVA 2ZOLB 2B59A 4S1QH 3W5NA 1F90H 1I53A 2L6LA 2XN1A 4PRID 5GS1C 3Q8AA 5KAFZ 2PLTA 3ECBB 5H35B 2F58L 1HXYB 3DJSA 3NIDE 1M9SA 1EIBA 2P4VA 4ZMLA 3VXQB 1AVMA 4M8QB 5I1GL 1EMTL 2YGQA 3F04A 1NKRA 2Y0SA 4Y1AA 4NQEA 2QGDA 4A6YA 5CU5A 4ACPA 9PCYA 2IM9A 1JZIA 2GIYA 3AVEA 1TOXA 3FF7A 1D6VL 2OZNA 3MGTA 2JI1A 1AO7B 4TV8B 4X64B 3C5ZA 5KYYB 2HJKB 4FLZA 1JGVL 2Z93A 4N28A 5JQGB 3D39E 3PDDA 4CSSA 3MRDB 4FHKA 1MPAL 4HHAB 3I55V 1ET7A 3RAJH 1JVLA 5KUKA 4FLXA 2E7CA 1I7ZB 1OB0A 2W65B 3CMEV 3L9YA 3MRGA 4O9HL 1KEGL 3CMOL 4ZUSB 1IAIM 4NQXB 2WPDG 2EIBA 5H37A 4ZO6A 1KCBA 1RM1B 4JO3H 3L3OC 4HUVA 4LF8B 1EJ8A 4LNRB 1QTYT 4EJ1C 4Z1MG 3FB8A 3AG3B 1NFDF 3DETD 1GN3A 4KV5F 1WN7A 4QXGH 3EJPA 5AVQB 3V9CA 3U6XA 4XMKH 5IB1B 3NEOA 3PN1A 3IMTA 2IPKB 1PIGA 3TBTB 1G7LB 3B2VH 3DBXB 2GSMB 1UM4H 2DN9A 2RMKB 4P46A 3TBVA 1F51A 5EOQH 2Q7HA 3OEHG 2WQRA 5J11C 3W0WD 1QSEB 5D93C 3TZVD 2WTPA 1CFNB 3VQXA 1GA2A 5I5JA 4WFGD 2V33A 4IDLA 5D70L 3TCUA 5LAPA 2LO1A 4DO2A 3T1FA 3VACA 2Q8VA 4DR4O 4AI7A 3ZMTA 1GH6A 4TT3G 5KA5A 1KJ3L 4G1EB 2M26A 1JCKA 1LTXA 3QJHA 1RZ7L 4WO0A 5HY9A 3GMMB 3GHPA 1DJWA 2QVFB 4NQDB 3TVMA 4PGDB 4JPWL 3CC1A 4G28B 5JW4M 3LEXA 3TEUA 4XC3H 1EAPB 1B9KA 1ECZA 2P5WD 3A4AA 3Q01A 4MXWH 4YXKL 3VXOA 4F3FA 1HSBB 3FCUB 3H53A 3IRPX 2IAND 2Y9RT 3WEXB 3D87B 3VFUA 2EE0A 3RBSA 3CRMA 4OD1H 3WE6B 3X14A 5DC2A 4EB6B 4IMLA 5LVEA 3HZMA 3KPRE 5F6HI 3M1BA 1NIFA 3C6LC 4RMQA 1S9KC 2CA4A 3JQOB 3CSPA 5E8PB 3ZN0A 1D2OA 2CBQA 2JTDA 2OMYA 4XO9A 3SO3B 1XF5A 3LOWA 5E00A 5B4MC 1I7TA 1OTSC 1PNMA 5JXAL 3L7FA 4Z77A 5B5EZ 1KUQA 3L73H 4Y8AA 1OAJA 5AOLA 1KB9F 4M43L 4F2ME 2C3WA 3H56A 1AQDA 1F4WL 3LN4A 4PTTA 2HSIA 4HUNB 3RI5K 1B4JH 4NYKA 6PCYA 5TISZ 3WMPA 4XNXH 3X1GA 4ZODA 4NX0A 3G6BA 2PCFA 3S97C 3NOIA 2DQUH 3KCPB 1NH2D 3EHBD 1BZ7B 4N0CC 1WD9A 1NBZA 4P2QB 4TXVB 5I71B 1XF2A 1GJUA 4W4OC 5AWNH 4MVMA 4P59H 2WLJA 2VXTL 2B4CH 1K3ZA 2X88A 2PY5A 3PWPA 2WVSA 1CD1B 3N0PB 2AEIT 4HWZA 4P5TA 2IH8A 5K1JA 4YHNB 1JHTA 5I30L 3O11A 3MV8E 6PAZA 4M6ML 4F7PA 2HR3A 3MDSA 2Y06L 4YHPA 5D96B 5EZLA 5I5RA 3LS4H 4GFTB 4OZIF 3FUFA 2OTJV 1HAWA 1MJ8L 1CXZB 1SDYA 1WISA 2IWFA 3OHXA 4XBGA 3S4SB 3OD3A 5DJZA 4NZJA 3TBCA 1XR8A 2QPFA 3BLKA 4HIIB 5IB3B 1W0KG 2XWCA 3E2EA 3MLVH 1R3IC 1NFIB 3EJZD 1FYTB 2EJ1A 4M56A 4PMFA 3ZL4L 2R29A 4B3TB 4KMTL 2F68X 1NCHA 1QBLH 1EWHA 3DMMB 4K5MA 2HJLA 1TZGH 2H8PC 1JAEA 3E86A 1OARL 1NIBA 1ZIAA 4M4RB 4HJIA 2NZ9C 4GLRI 4J6RH 1FFPB 2G2PA 3B2UD 4TV9B 3OSVA 4UZSA 3VXNA 2V7NA 4A63A 2P06A 3JWNE 1WA2X 3NJXA 1M9NA 3BN9C 3UDWA 4FI7A 5ALCH 1YXBA 1M1XA 1S7RB 4OCSH 5KS9A 4DV0O 3B9DA 4KI1A 4OKDA 2DN7A 2OKMA 1KFGA 1PSKH 2WCGA 4XXDA 4GG6B 4R4FH 1TFHA 2WAHA 4JFEE 43C9A 3P30L 3UAEA 3JV4B 1IGIL 1GYUA 3INUH 4MDJB 2OMBA 3DGDA 2OSYA 3L95B 4XP5L 3AT9A 3VNZA 1I94B 3EJJX 3ZT5A 2XVKA 1SRYA 5DHYA 2O1AA 3O6LL 4RIRA 4NN7C 2Z8SA 1RK1B 1WS7A 1YUHB 3KH3A 1YY9D 5I15H 3HKZA 1TMQA 1WBXB 2HVJA 2FIRT 2OMUA 4XXWC 5ACZB 3MRHA 1VZGA 2JDIG 3D4ZA 3KGUA 2JLLA 2H4EA 3VWKC 2HJFA 1IJ9A 4XN5A 3LIZA 2HKHH 4XNMA 2A5UA 5I17A 4HNAB 4GQRA 4WWKA 2BSED 2XHNA 2YPLE 4DKEL 3P3TA 1IIIA 3PAYA 1MFMA 2KBGA 1MW3A 5ALBH 1GYAA 2H1LM 1F4XH 2XTAA 1N33B 4W9FC 3WYRA 4QYOA 4JN2A 1VZIA 3MI6A 4WWNA 1S4IA 3G04B 4MW3A 2A4EA 2ITDB 3WKMH 3PIQA 4TM9A 4NKMB 3WTUA 3RYIB 2UXFA 4HIPA 1T7ZA 2R2EB 4LSDA 2B5UA 3O6KL 4HIJB 5B22A 4OGQC 3Q4HA 3K6OA 3B8SA 2NN4A 1JZEA 1BQ5A 4MVSA 5IJ0A 4R4BA 4CVZB 3TTYA 2VZTA 5I23A 3QXUA 4GG6F 3FUKA 1DQLH 2EILB 3GUTA 4ZI7A 1RJLA 4IOIA 3KLHD 2H45A 2WWKO 4U3XA 4GW1B 5ADPL 4K3EL 1NCDL 4XP1H 3D1MC 4U1KA 4F2FA 1Z9MA 4UT9A 2FNBA 3SYCA 5IYCO 4RMRA 1ZD6A 4UI2A 2XG5B 2PI5A 1M7IB 4JDTL 2APXA 2B0SH 3T0VA 1XH2A 2BW4A 5DT1H 5IB2B 4JM2A 3NAAH 2OW6A 1SGKA 1PDKA 4O5LH 1XGUB 2X2HA 1IU1A 4P2RE 3BWUF 2F5AH 3AABA 2R0KH 4HJ0D 3MBXH 5FHBL 4L1HA 4ZOCA 4WI7A 4NZDA 5ISZA 1GS8A 4PJ7E 5DQ9B 2LU5A 1QFWI 2LGWA 1A6TB 1FZMA 3UAJD 1B4TA 5J1SC 4KI5C 3L1OH 4HIEA 1XF4B 3LXUX 3NJGA 5MEOB 2DLIA 1TJMA 4C7UA 1NC2B 2WBJB 3GWOA 3SPVA 5KYNA 2RCSL 4LCYA 4ZMPA 3D8MA 5EF2A 3QBTB 4NPJA 1BFOB 1INQB 3P32A 5LGJB 3QORB 1Q90A 5FYKL 2PYFB 3DSNB 1BVZA 1WS8A 4NXKA 5HHNA 3TA3A 2V2XB 3ZGHA 4M5ZL 4LDLB 4XOAA 4E5XG 2G60L 4KJWD 3UACA 4RBPK 1NICA 4JPKL 5CLXA 1IQWH 2E86A 2WXIA 2ZE6A 5I28A 3VCLB 3BKYL 3NN8B 2CIKA 2X44D 4N5ED 4GXUM 3CZKA 1T20B 4ZT1A 4F8OA 2YIBA 4H2CA 4ZFOL 1JYXA 2R0ZH 2DY2A 3LSOB 3L4TA 5FAAA 4GUCA 1T5WA 3QIUC 4XP4L 4GXVL 4RGMC 5FUOL 1J8HB 2OMXB 5F93C 4A2FA 5I1HL 3GO1L 3V4VB 4KRMB 4MJHA 1S78C 4PH8A 3OJDB 3OZ9H 4IRSC 4DYLA 4WFFE 3BT2L 5KYUA 1IBDA 4O4IA 4MNQB 5K5YA 5H4ZA 1JQ0A 1P84F 2FIKB 4CJ1A 3ETDA 2YD9A 1ED3A 1FIEA 3F84A 3HA0A 4JFEA 4E0RA 2ZE7A 1S5IH 2I9LB 5B7EA 2FUQA 3CZSA 4Q6IB 2XQYA 3ZQ9A 5BV7B 1XSIA 3BPOC 1OSYA 1H2NA 2EXYD 3DXAA 5EC2A 3HR6A 4OBRA 2NDGA 2YQ2A 4MS8C 3ZZ1A 3IDJA 4ABVA 1GRWA 4YE0A 2YI9A 3K4DA 4OCRL 3FOLA 3N44B 1U97A 2YXFA 3CDGB 3WLBB 1DVUA 5LXVA 2B1IA 2YLKA 4LL4A 3DO4A 1UB5B 3O9OA 4X8GA 1VENA 4P2YA 4M5TA 1Q0YH 1KBKA 1FLRL 2N3JA 1OJHA 5E1AC 1RFDL 5C7XH 1EO8H 1UUNA 4FJZA 2YPLA 3H2WA 2DQIL 3QHZL 4LSTH 3RVWC 4BKSC 3HC4H 2VSDA 3KGSA 4PVBA 4XAKE 1N34B 4HK3J 5I0DA 4F5CE 3V6ZB 4K5NA 3VFRB 3NR7A 3RP1A 1AKJB 5A2JH 4H8HA 2D7TH 1UH2A 1TR7A 1MCDA 3THML 4JPVH 3ZQWA 5LHHA 3ARZA 4QRSA 1QSED 1F00I 3BKCH 4IS6B 4P49A 1SF3A 3CVHB 3IBOA 1I1YB 3PQYB 4XPFH 4P0DA 1PY4A 2Z64C 4NPKA 4YHLL 2A6IB 4GRLB 6FABL 4MTMA 2IGTA 4GSDL 2JB6B 4YJ3A 4N2NA 3GMNA 4XNZC 1UOVA 5KG9A 1AY1L 3BDXA 5L9DL 3LZRA 4NKOA 4WW2B 4EDXB 5IOPB 2BMKB 1MJ7L 3RGVB 1FE8L 2QKIC 2FL5B 3QA3A 1DN0B 4JDVB 4OFVA 3SE9H 5FGSA 4EIBA 2A4ZA 4ZNEE 1BGXH 3ALXA 1F3JB 3APMA 3R4RA 3HI6L 1W2KT 5IMKA 3VTTA 4NQDD 2JGDB 3N44F 2DQ3A 3PWLB 1D5XB 3HG1B 4PWHA 5ID1A 1Y67A 1KIRB 3AXHA 2CO7B 4HPYH 2WUCH 1CK0L 4P2RA 5BOPA 4KX8A 2A7BA 2Y3AA 2AV1B 2VWKA 4LLDB 1MABG 4WK2B 4WUKL 2H26A 4HPOH 3FFDA 3KWTA 5DUBA 2DYSC 2RH0A 1DQQB 1JF5A 1AP5A 4MJIE 3WGUB 1Q94A 4N6QA 1TEYA 5KSVA 4AM0B 4B7KA 4HEME 5I1JL 4BZYA 3RBZA 5GGVY 2Q6WA 2DWSA 2EINC 3VYPA 4XHJD 4KWUA 5ETUA 3Q8EA 3AW5A 3A67L 1RUMH 2YD8A 1SLWA 2PPAA 1OCOB 3ASOB 4O2EB 1M7XA 3BZ4B 4X9QA 2EH8H 3N1QC 1R3IH 3QULB 5AB2A 3FTWA 5AL8A 3VXUB 3U36B 3WIHH 1E8WA 1VCBC 1RZ8B 5GS1B 1A3QA 4JJ5A 1WAAF 1IC7H 3SGEI 1P4BH 2Z0BA 1V7ML 3MCKB 3QUKB 1NI8A 2K3TA 2NX5D 2O72A 4TVPD 2Z31D 4XDKA 2RQ6A 4WW2F 5CUSH 2KT6A 4WI8A 1RURH 2XFGB 4KL1A 1DEDA 3O41A 5KJRH 1JOIA 4LBEA 3NRPA 5CBFA 1BLNA 1FD9A 1KMIZ 1KB9J 4X62B 3TFBA 1I9IL 1LLAA 3E8GA 2COQA 1I9RH 1PV0A 2XN9E 5E8OA 1M93A 1KLFB 2E7LC 4P2QD 1FAIL 1JUFB 3RNQB 5AOJA 3ZN1A 5DGQA 2JEXA 1P6AB 3BSZL 4MXQD 2XX1A 3CXDL 2LGQA 5J9PB 3MFFB 3PLYA 5IFAL 5IYZA 3H85A 1B0RB 2DLGA 2HLDG 2DH2A 5TFSL 1AXTL 4BWTA 4CMMA 3CRQA 1QI5A 1GJIA 2BSRB 3OG4B 1KECA 3P40A 4Q4EA 1HTYA 4OTXH 3BQUC 4JI0B 2WSPA 1FYTD 3PJNA 4BUQA 4J41A 4BFEA 1CGWA 2GITA 3QXDA 3KG2A 4PJFF 4PTUB 3QQ4B 1BL8A 1SA0A 3IF1A 3LN9A 4UCRA 4GMSL 1FLTX 2WNXA 3EG9B 3T9WA 4HG4K 1HHIB 3VGDA 1AGFA 2O6FA 1P53A 1J9TA 4UV8A 1CD0A 1NCNA 4JG0L 1R75A 3VD2A 4DK6A 2NY6C 4FXGA 3GWJA 4ELME 3ZHSA 5D71H 3FAVB 2V7QG 3ZT6A 3JAKA 4W68A 4WJ5A 1LE9A 4V33A 1S9XB 2HG0A 1XD1A 2BVPB 2D3JA 4ZTOL 1LVEA 2R0WL 5EPMB 3VFVB 2OX5B 5BS0E 4DR7B 5GS0D 1VRSA 3P77A 4FA7B 4LKCA 5C9KA 1OAYH 4L37B 5E6IC 5ESAA 3DBSA 4L8SB 1U8JA 4OCNC 4MGXA 4YSQA 4BQ6A 3ARFA 2KPWA 4GT0A 3C8KA 1I5XA 2VW6A 4UOW1 2Z1PA 4IGBB 4YHIB 3ZHDA 3IMSA 4RAHA 1VADB 1VZHA 1INDH 1FRGH 5CR8A 3UPCA 2CHZA 4NRXB 3AUWB 4JG5A 4B96A 1GOFA 1UENA 4P57A 4YXWG 4PJCE 4XHQA 3H8NA 1Z2GA 1DUYB 3MLUH 2VQFB 1BG9A 3PHOB 4WV1C 1ZSPA 3W11C 4U4IA 3FT9A 4KXCA 4NM4H 4L3AA 1NCWL 4AENA 2OPCA 4JM4L 1XGRA 3E1F1 3EAKA 1ACXA 1L9SA 1EGJA 3T4AC 3HFML 4UU9A 1OZUA 5E99L 4C56A 3C6LB 3MKGA 3CRAA 1FZJA 4G2AA 5L3GA 1X9QA 2EUWA 4HXBH 5H8DA 3AGWA 2HT3C 1FXKC 5F9AC 5JHLL 4NCDA 4TNVF 5CD3B 4U6VH 3RTQC 4NPYB 1OAKH 3K6SB 1D2DA 2MW2B 3IDXH 3QH3B 4ZAKC 3HZKB 3VNYA 1WRFA 1WUNT 4FNRA 4W4KA 1HJBC 1JXFA 3H42H 3QO1B 4HC1L 2DEXX 4PQXA 3AGVA 3QZWA 2VQEO 1I82A 1AE6H 1MHEA 2QZQA 3BUIA 4MJIA 3P69A 3WXVL 4QKTA 5I1AB 3S35L 4UAOC 5LDSA 3BCCH 1J11A 1OM3H 5KAQG 1CFQA 1KYAA 1F58H 1I7RA 4JI7B 2VL5A 1N8ZA 4OFIA 2DBLH 3CSFA 5HHPB 3P4LA 5D5QA 2X70A 2FATH 2E5EA 3QS2A 3HHSB 4G7YL 4BE5A 4JHWL 3HZYB 5ICUA 2AW2A 3OPZL 3KR3H 3HKDA 1JK8A 4Y4FA 2CH7B 5E5MB 1P4LB 3LHPH 3MV7E 5KSUB 2PMZA 2AGJL 4JANB 4QY8B 1EO5A 2DQHH 5BVPL 1R3KA 4NQTA 1ADQH 3K3WA 2EXSA 4PRDB 4OZHB 3KD4A 1EEZB 1IGJB 2Q10A 4HH9B 2CLRB 3QDJE 3SYOA 1P5VA 4OH2A 4X4YB 3AK3A 4X50A 4UOZA 4LLWB 3ZMZA 2H8PB 1WGOA 3MCYA 5DVPA 3T8VA 1K3EA 1JFQL 3ABGA 4LHUD 3MLTA 5TDOB 3LQMA 5EWIH 5F7LB 4E42B 3ZHQA 1LHZA 4LO9A 4P4KB 3CLWA 1SQVH 3EYSL 4IBTA 1BZDA 3H55A 2AXGA 3NP3A 4N0UE 2EDMA 3QORD 4JYAO 3BD4A 4JV5O 1WG3A 4U1IB 4OLXL 2GVYA 4X4KA 1BM3L 1WHPA 2CTPA 4IBZA 4LCWD 2QJDA 5J7CC 1BFTA 2JJSA 4FNSA 3DVNA 3NIFB 6TAAA 2EUXA 4JYCA 1ZHLA 4M1CC 2YPVL 1UKQA 4LPCA 2IU3A 1G4MA 1FFOB 5EO0B 4LSUL 1NDMB 5HHVL 2R9IA 4FADA 3DDFA 3N43B 1Y18A 3HI1A 4NN7B 1A1MB 3TASA 2IGFL 1GH7A 1J8HD 1M05B 2NNAB 4ZOLA 3N04A 3NQKA 4JUSA 5ESVB 1QTSA 5DMIL 2J71A 1BVKA 3CN0A 3N42B 4TN9A 1FL6B 3I02A 4ELMA 3FZUC 1OPGH 5AZUA 1B6UA 1YIJV 4MNQD 2IDFA 1U3HA 3CLEL 3VWKB 4WGWB 1S9WA 1TG8A 4L48A 1ZLZA 4P3CH 1UWFA 5T1MB 1PBYA 3Q8CA 2J2ZB 3FNKA 3QJRB 2CBPA 3MBWB 2FAUA 1PY9A 5EBLC 4PJ0Z 1R3JA 4WK0B 3ZEDA 5LBSH 1P84J 4K8RD 2HRPL 2XC8A 3QG7H 3ZYJA 4BFJA 4ESKA 5IKCA 3RWHA 5EIVA 1FN4B 1Z5HA 1ORQC 3OXSA 4IK6A 3RVZA 2OBGA 3HE7B 3ML8A 1U30A 4JX0A 3ZRCC 1S3RA 3K2UL 5EF3A 4GAYA 4OGQB 1PGRB 2KERA 5LQBL 4J3BA 4ELKA 1MHHA 1DJIA 3AACA 1PJ9A 1VACB 2BS9A 5EMYA 1LO0L 1KTDA 4Z3IA 5GONB 2ESVA 1DSFH 4OLWH 4C54A 4AQ1B 3S3XA 5E0QA 3NIFF 5I6XC 4GYCB 1CF1A 2W0PA 4WHDA 4PIRF 4FRWA 2WHVA 2NQ3A 4YSTA 4FG6C 4JI5O 2YIHA 4MJ2A 4L4VB 2VN7A 3AG1C 1W0WA 2I26N 3P9LA 3O0RH 3N43F 4L9LA 3QCUL 4DETA 2OR9H 3D0VB 3VW3H 4JN1L 4I48A 1AKJD 2DTSA 1HZHL 1WTLA 3BE1H 1S2EA 4GB9A 1I8LC 2V9UA 3N42F 4I4WB 3TOPA 2WQUA 3RPKA 2VR7A 4E5XB 3J27A 2BP0A 3MV8D 4PLOB 7FABL 5HDRA 4QHNA 1KBVA 4AGPA 5AVZB 1Z9LA 1U8QA 2H6UA 4GJTB 1O9ZA 3AS1A 3LNFA 2R23B 1T66C 3ARXA 1T22B 1S9VA 5JW4Q 4GRLD 2X4TA 3AG4C 1DQVA 4X4MA 4PY7B 3MREA 2VW7A 5B1NA 4BHUA 5B1AB 1XMQB 2WNWA 3RT3C 2YMTA 1WFOA 2B5IC 3FO2B 5EBMB 4C4BA 4CBZA 3TCXA 3WEAA 1UM6H 2F5BL 5DO8A 3U0WH 3VM5A 1T03L 3R8BB 1E4KA 4B53A 5DS1A 4IIJB 2E7HA 5E2WL 4FFBB 2Z7YA 2DLHA 4KTEL 4Z0BL 4YHHO 3ESUF 4X0NA 4Y9FA 2I60H 2ZAGA 4FG2A 2KG7A 2DEWX 3HPLC 5AD0A 3MV7A 2C5DC 5KVFL 4LF7O 4U1HB 1G43A 3E2HB 4PD4F 3UBHA 3OKMB 1IAKA 2BOBA 4XN1A 5CCGE 4F7MA 3P0VL 3CC5B 3ULVL 4ZFZB 4Z7WF 1E90A 3A4DA 2F58H 4BFFA 3A3YB 5D5ME 2VDRL 1CEZA 3J8F7 1T6BX 4RQFA 3CFMA 5ITFB 5CEYB 3SQBB 1L7IL 5I1GH 1Y7VA 1EMTH 4I0PC 1JWMB 3EDDA 5TDPB 3RWDB 5L88L 5HVGB 3BFRA 1IC5H 1HYSC 2GUOA 1CIUA 4BSVB 1NOFA 4PJGE 5I0WA 4GAGH 1D6VH 1B06A 1SN0A 3VXUD 3ZX1A 4MQSB 1TLMA 2C1OA 2OTPA 4IDJL 4N2DA 4DT2A 3QWRA 5L4FA 1YLBB 5GGVL 4XOEA 5DS8B 3GSVA 4JFZH 4CC1A 1K85A 3GXPA 2CJUH 3BA8A 4TOYL 1MPAH 2GB2A 1J9QA 2HRHA 4P5SA 5MEQB 3X1EA 5AG8A 1B0WA 4L9DA 4O9HH 2YRBA 1KEGH 1IGTB 3H6JA 4FA8A 3CMOH 5AB9A 1L3NA 2XV2A 3AAZB 2IPUK 4NO3B 1NIAA 1MQKL 4QPEA 3GJFH 5LNGA 3B2DC 2R8SH 3U25A 5CBHA 1KTLB 5INCB 2MQ3A 2OFQA 5K9JH 2AQSA 4OV6F 5BQDA 4NIYE 3WIFB 4MNGB 1KIPA 1F6LL 3GBML 1PU0A 1ZLWK 4AUUA 2YIAA 1OE1A 4I0CC 3CS5A 1HQ4B 4NBYB 2FDBP 4MD4B 3PL6C 1MCEA 3HUJE 3JV6B 3VJ6B 2NW3A 4ONHB 2VLMD 2Y6SD 3TN0A 5D70H 2NOYA 1DANU 5CFAA 1EQWA 1S77D 2CCVA 3K6IA 5ICYA 5DEGA 2XJKA 1AIFA 1NMAH 1IGMH 4ATWA 4NTYA 3UPRB 4LGSB 2XWJA 4FQIL 1N26A 2B8OT 5F0PB 2JS3A 1NGYB 2CE6A 5F1OB 3US9A 3VFWB 4GKKB 3SPCA 2WA4A 3IMUA 3ULUE 1WIPA 4MS2A 1LQSR 3UC0L 2OQJB 3FD9A 4AE0A 3R1GL 3NCCB 1AD0A 3NJNA 3VQWA 1PS3A 2V37A 3G6JA 1H3TA 2BX5A 5BRZB 4D0BB 4DEPB 2BRQA 4G9DA 4JPWH 3OAWA 2CLVB 4HEPA 5K1XA 4NQCE 4PIBA 5DECA 3BGFC 2HCZX 5KEZA 2OMZB 3KEHA 4PHXA 4YXKH 4PDLA 5KTEL 4XMPH 5CR1A 1NZRA 2EYRA 4LLMA 4XNZB 4MSWB 3BISA 5I8CA 3DROB 1TEGA 1VFUA 2MWCA 3SOTA 4MTFA 2QKIB 3LJ3A 2AJUH 4R4ND 5T1KD 2BY2A 1C7TA 5CD5D 4TQEL 1WB8A 4ZPVA 3SSGA 4J3TA 1VAHA 3O45B 1MZEA 3EYFA 3PDGA 4IGBD 1JHKH 3RWGB 2O5ZL 4PV1B 2MTPA 2EO9A 2PW2B 4LEBA 2IANA 4X5XB 3WHXA 2GTWA 3K04A 4XB3A 2AXFB 3PU7A 1M4UA 5JXAH 3F8UB 4TLSA 4UTBL 4Y0GA 3B6SA 4AWJC 4M43H 1I75A 2H0FA 5DLMH 1QBAA 5K1PA 3SJCC 4P5KB 4D9QD 4BRVA 5JIIA 3ZE2E 4XVOA 5I6MA 3U7YL 4NRZA 5MI0C 3H2QA 4JZOB 3WFDL 1XH3B 2BNRB 2XFXA 3OBAA 2GHYA 4ZD3H 5JW5B 4K23H 1URLA 2Z0AA 5EOCH 1AHWC 4LH7A 4OM0H 5EEXA 5T5FL 1LEGB 2DWDA 2XTJC 4O02L 1R47A 3TIDB 1JFFB 4LRNL 3H2PA 1YJDL 3SY0A 4OJCA 4IL6Z 3IETA 5I30H 5L2KB 1GCFA 4LIQH 2A6DA 1QVGU 4GW5A 4WFFD 2NNRA 2P44B 2RIKA 2Y06H 4IMKC 1XGTA 1AGBB 5I9QB 3TC9A 4RDBA 2K0RA 3VFOA 3CZFA 3E22A 3KXFD 2Y2TA 3TX4A 1TA8A 4DV4O 1MJ8H 1VGKA 5F7BA 2Y5TB 4MB1A 1KLGA 3BDYH 1U3YA 4YEEA 4POZD 3HC2A 1X59A 2KDGA 3IGUA 5C07A 5IOKA 3PWNB 3D4GA 3NESA 3JTTA 4TUKL 3ZL4H 1T6VN 3RWCB 2P4KA 1BBJB 2XRAH 4LP5A 4UINH 3S8GB 2AI0L 2XNAB 4NSKB 1XNQB 3IPBA 4AYEC 1OARH 2YGVA 4RVBA 3ZLQC 1I4FB 4P3WA 5L4MA 1MUJB 2KPNA 2WGXA 3LEVL 3MCLH 5AG2A 1R6VA 2VRKA 4CBCA 2WLZA 2FE0A 2WPGA 3GMOA 4KZ0A 3L3JA 4K7PY 4M9OA 4Q89A 1AQKL 2R51A 4YO0B 2CUGA 2PI4A 3D0AA 5EC1A 1EXHA 4JR9H 3KLLA 3QCTL 3W37A 4HK0B 3F6JA 4U31A 2NDFA 3LS5L 1A14H 4CMHC 1QBML 3NACL 3PP4L 3PRZA 4XAKD 3LZFH 3MV11 1MWAA 1FZOA 4YFLF 4XP5H 1QEXA 4KC3B 2CUIA 1N6QL 2FHFA 4NO0B 4YBLC 4L23A 4P4KD 3UZVA 1FDLL 1S7XA 1G9MC 1TTBA 2NY6B 4UCUA 3GJFB 2LTQB 3GHEH 2APWA 3V5HB 1QPXA 3CPUA 4FNLH 5IF0A 1MAKA 5CGYC 2XPYA 4URTB 1WBZB 3MOAL 3RA7L 5F97E 5SWQA 1RH8A 3E3QC 3DOHA 1OE3A 1CR9L 3VXME 2YEZA 4BKLA 2UUAB 4LBAA 4AQZA 2H9GA 3D85D 2EDJA 4OFQA 1YN6B 2EO7A 4FJ6A 1HOCB 4M4PA 4ZFQA 3QEQE 5E6IB 3UBXB 3UM7A 4AGNA 4KAQH 3KPMB 4DKEH 4TV3A 3AK1A 2C1PA 3CCHB 4F9LA 1QATA 4WJG3 2C7UB 4DR3O 1LNUB 5LLIC 2EBOA 5I1IL 1ROWA 4PJBE 4MD0A 3MZGB 4WV1B 4NQCA 1SXZA 3UTSE 2ZDIA 1WZKA 1IBZA 4S0HA 4PU2A 5E6UB 4NTXA 3TBBA 3F6LA 4A38A 3DRTB 3VXSB 3OKKB 5BNXD 4H4NA 2UV3A 3T4AB 4HOWA 4YQXL 1X5FA 4PRBA 5I19H 4LCCC 4I9QA 4RISH 3CN2A 3SKMB 3QZPA 4K3EH 4UNUA 1G1OA 1FXKB 1W0JG 1LQBC 4PJ6A 1M42A 2Z92A 3RTQB 1B0GB 4IRZA 4MJ6B 3FSZA 3HE7D 4ZAKB 4X80L 1Z32X 4JK0D 2EYSA 1CXKA 3HG2A 4YDZA 1X4YA 4ZXBC 4XE5B 2X87A 3HIZA 3HB3D 3ML9A 43CAB 2FT6A 3RFZC 4M6AA 4DCQA 4WTQA 1AGCB 1PG7X 3INOA 5LNEA 4S1RH 3FH5A 4OPAA 4AI8A 4C83A 1KCUH 4I4TB 2F53E 2WXGA 1FJ1B 1V3LA 3MLRL 4G80A 4UAOB 4DKTA 4L4VD 5AW1B 4MVZA 2IWKA 4DZBA 2WSSG 4PJ9A 4X6FB 2BCKB 1YNLL 4AILC 4FN0A 3NA9L 1I8MA 2XN9D 3AY2A 4B41A 2WB7A 4AH2B 5FWRA 4M3HA 4B3MB 2RCSH 5HHOE 3KDPB 2QSAA 2I5YL 3NP4A 4PY8I 1WD8A 4JW3A 1WLEA 3U46A 5B66Z 2H3NA 4LOUC 4YSEA 4OZIE 4DTGL 2GTZB 4ABUA 4AT6A 5FYKH 4HKZB 3KWUA 3N6YA 5KJ4A 1E50A 1TVBB 2HN7B 4KY1L 5KAQF 2JRIA 3VX1A 2EVGA 5F1IB 3AQYA 1P7KB 1JZ5A 3JT0A 1CICD 3WJJA 2H5UA 3NTCL 2DWEC 1N10A 2D8KA 3C09B 4Y5XB 2DQ6A 2VM4A 3PWVB 4CADA 2UVFA 1WWCA 4DR1O 1WZAA 1K73W 3BKYH 4X5QA 2OCCB 1U58B 4DPRA 2MNJB 4OFKA 3RQ3A 4ZNCD 1F4NA 3BSHA 4FI6A 4GPVA 4JUTA 2DOSA 3CCEV 1MRFL 1UZ6F 3ESNA 3DXRA 4MCMA 4QE9A 3L3KB 1GGTA 2EZOA 4ANXA 5E9AA 5FUOH 3D0LB 5I1HH 3CGTA 3ISYA 4HZLA 4RGOL 5DWPA 3S3JA 1RSYA 2DMGA 2YAMA 3IDIB 2A74C 3V9EA 2X28A 5HTSA 2G3MA 4UV4L 2EVJA 5DJAB 3CCRV 2F93B 4JFUA 3BPLC 1NSNH 1P6FA 4Q14A 1LWHA 4AC4A 3TESA 5BS0D 3K80A 4N2BA 3N2GB 1N5AA 3KLKA 3SYPA 4PD4J 4B08A 3UQ8A 5LAXB 4DQOH 1SN5A 2J5WA 1BMWA 1T0OA 1FV1A 2ENPA 3EFOB 4AHCA 4KZDL 2ZINA 3ECBA 3FC8A 4EBQH 1PF3A 5FEBA 5H35A 1HXYA 2VR3A 4HS3B 4WWID 1XTMA 3SJVE 5J2UB 3U6RA 1I5YA 3VXQA 4M8QA 2QHRL 1A65A 4A2HA 3N1PC 1JD7A 3ARGC 4G1MB 3VXMA 4FQ2L 3NFPB 1URFA 4UQ2B 5E2VL 1Q4NX 4XNUH 5AOKA 2L7EA 5FLVA 2Z5UA 3HS0C 1AQ8A 5DFVC 5EBLB 3O6FC 5KANG 2ARHA 3KPTA 3QEQA 4ZW6A 2L4OA 5H2FZ 4QPJA 1E7VA 4JB9L 4AKOA 1AO7A 4G43B 4TV8A 1FBIL 1I1AD 1KELH 1YMMB 2DQIH 3QHZH 4LQFL 5F70A 5KYYA 2HJKA 2DQGL 2Y69B 1ORQB 3LV3B 2WZPD 5B21A 1A7PH 3QFJB 4EIGB 1NCUA 3FCSB 4OQTA 2QPDB 4DV1B 4HHAA 4ZUWB 4MA8L 3BZ5A 1JF1A 4X6DE 4OD2B 1SQXH 1I7ZA 1FXVA 3GFUA 3OGCC 3U6XS 3QSKB 4GLRH 5C8JB 8CGTA 5DYOB 2EEXA 2ITCB 3KYKL 1C9SA 2JQZA 5I6XB 5CA0B 4LNRA 2AVFA 4HGWB 1Q43A 1K34A 5GGRY 5IB1A 1VCAA 1TZIA 2WO3B 4WFEA 4J3OD 4MAUL 4RMUA 1EXUB 5JXED 3MR9B 2I69A 4DW2L 5C0GA 2AEPH 1MJ7H 3QRGH 2YS4A 2VERA 1HL8A 3PNWB 5FYJE 3RY6A 3GBLA 3KVQA 4EXKA 5L0QB 2UXBO 2WGNB 3HI6H 3DIFA 2VKWA 1U96A 1TU2B 5D2LE 3ILPB 2Y2YA 3WI9A 2F8VA 2A0LD 4OGYH 3H54A 4WRLA 3J7AU 1P6WA 3BSGA 2JTYA 2UUCB 5JCOC 3HNTH 4G1EA 2JGUA 3ZKXB 1N5YL 3FB5B 3H1HH 1JWUB 2F53A 4AJVA 2CM6A 5IBLD 4N87A 3IJEB 5J2TB 1E27B 2B5IB 3OAZK 3GMMA 3QDJD 1B6DA 2CD0A 1RZKC 2XV6B 4HZAA 3WFVA 1DL7L 4NQDA 2CJTA 5DJ8B 3U9UB 4PGDA 3VYNA 1GTFA 1LXMA 3PPSA 5I1JH 4OX9B 1EAPA 1KGXA 2DJVA 4HWBH 3VI3B 4I18A 4BV1A 1HSBA 5DZ9A 1OQXA 4J42A 1NCTA 3HPLB 5ICZB 4OZIA 4N90D 2UZPA 2X4RB 4X20B 4RMBA 4Y4KD 3WE6A 4QTHB 4NXNB 2FNWA 5LMUB 5AB1A 2XV3A 1L5GB 3IVKA 3L1EA 2MCG1 1HX0A 5E8PA 2J6EA 4NLHA 3EFFK 1MHPL 1NGPL 4A2DA 4Z3EA 5DJCB 3F7YA 5HDQH 3ZT7A 4MMZC 4I0PB 2HG5A 4FDWA 3ERXA 4G8GB 3N2KB 1I9IH 2PUSA 3ASWA 4YC2C 4KVPA 5E1IA 3PV6B 1FAIH 5CB4B 2Y4TA 2X05A 4X8AA 1N7MH 5IVOA 4A39A 5L2KD 2J8UE 4J7KA 3J80N 3MBEC 2XA8L 5IFAH 5IBTH 1ZTXL 1HE7A 4ZFOB 4OF6A 5TFSH 1AXTH 4MW8A 4I9WE 2FECI 3F62A 2JFCA 4CDHA 3KJ6L 2GBTA 3QZOA 4TKWA 1G7PB 1OB1B 5I6KA 1G9MH 1KYDA 3SN6N 3EYVA 2IQAA 4KUZL 5K59F 1CD1A 2ZWZA 1CFSB 3T8XB 1PKXA 1QFWH 3MRQB 1F8TL 4U2ZA 1KPRB 4ENED 3HI5H 2BVYA 3PUUA 4KROB 1RQ5A 2GHZA 1KYOK 4E9WA 4XCCH 2HX9A 4HIIA 3TGUH 3WG7C 3RL2B 1EM1A 3PL6B 5CFHA 5AZEH 2VXSL 3JZYA 3L9EA 3QPQD 2A1WH 3MO1A 3ARPA 3QUYC 1CFTA 3DMMA 4FTDA 5LJYH 1R33A 4I9XA 4ZTOH 1UXLA 4PV8B 2VDQL 1MCNA 1YG9A 4U4BA 5KOMC 5GSRB 1O7DC 1FFPA 2MFNA 4K7PL 4I5BA 3BZEB 3NPSB 2MRYA 1UXSB 1H0DA 3GB7C 1UD6A 2QDVA 4JREB 4NO0D 1QP1A 1S7RA 4F93B 1XGZA 4N2FA 4IBYA 4B0MM 2BC4B 3BGFB 5K9QG 5KBLA 4LXFA 2WBXA 1AHKA 3ETQA 4EEQA 4MDJA 2P52A 5C2BL 4ZMYA 1XCWA 1NCWH 4JM4H 3CFTA 3TU6A 5B1CA 4PJDB 1RJZB 4XPTL 1HIML 4BUGA 3HFMH 4LC1A 2FEEL 5E99H 3SGIA 1RK1A 4G9FB 4JAUA 1VMGA 2IOOA 5E8DL 2M8XA 1OGSA 1UOLA 2VDOL 5DN6G 1H15B 1QO3A 3BY6A 2AK1L 2FJFB 3L48A 4NCC2 5ACZA 3H9VA 1AZVA 5GRWA 5J1AB 1UXWB 2Q7GA 2BFVL 4DR5B 4G5ZH 5DZJA 1VIWA 3RYFA 3BFOA 1CLYL 5AW8B 1ZLUK 5A2FA 1UT1A 4HNAA 1BJ1H 3KDMA 4JFWA 1K5QA 2GK2A 3VXSD 3ZMNA 1VSCA 3QDGE 4FQHB 4PLKD 4JI2B 4HC1H 4WEMB 5GGSY 2DPKA 3IXAB 4R0LA 2XXMB 1P49A 1B88A 1WQVT 4JGNA 2CNZA 4GG8B 1QCEA 2FB4H 3BI9X 3G04A 3UTQB 5C0ND 4YY3O 5FO9B 2WZ6A 2XHBA 2ITDA 4LVOC 1BZ9B 1CS6A 1PCXA 4NKMA 4JY5L 3EJSA 3SE8L 3RYIA 3RJOA 4IOSA 2R2EA 3C08L 3DOSA 3MLYL 3KPQB 4HIJA 4BYHA 2V9TA 4H7VA 4DV7B 3CJJA 2QQLL 1P9MA 5HDWA 1OALA 3K5RA 3PS6A 4I1RA 3PQYE 4CVXB 1F4HA 3GT6A 2HB0A 1M1KW 1KXVA 3FU3A 5AYUH 4DFIA 4GW1A 4ABWA 32C2B 5D1ZI 1J5IA 5IESH 2FTAA 3US1A 2AGJH 3CFQA 1FL3B 5LHDA 2R7EA 5BVPH 1T1ZB 4PJDF 1IJNA 4GKJB 2XG5A 3Q2WA 3RVTD 2E4TA 3LKSB 1M7IA 3QGVA 3QUZC 5KJ7E 4NGHH 3OC5A 1ACCA 3JVGA 3ARTA 4MASA 5E6ZA 1YJDC 3GXDA 4ZW5A 1JFHA 3WN5A 3IFOA 3FO9B 4YSRA 1XGUA 4NWUL 1BMFG 2JKWA 1KGYE 1OCRB 3K06A 3BVOA 1RZJC 4JCWA 4UIMA 3ZTEA 1K4DA 4HBQA 3QQNA 3ARED 1UA6L 1Q9OA 5MEPB 4CBPA 2W9DH 4Y9CA 1BBDL 3V10A 1PYWB 3EYSH 4D7PA 3MRIA 5DQ9A 3JARA 4NC1C 4P5RA 1A6TA 4OLXH 2TSAA 1XGQB 3I9IA 3V95A 1XF4A 1U8LB 2FJSA 3EGXA 4F8QA 5MEOA 3OKYA 2PXYD 1H3PH 1XQ8A 1NC2A 2WBJA 1IB5A 4BH8B 3I56V 1TO5A 3D34A 1VESA 3G9AB 4PJFE 4RFNC 3ZS8C 3IRZA 3A47A 4KVCL 4MMXA 3TPUB 1JV2B 3ZN6A 1IEHA 2YPVH 1ZXKA 1BFOA 2DIBA 4ZSOB 4P9ML 5LGJA 1BD2E 1GYVA 4LSUH 5EZOL 2PYFA 5HHVH 2BP3A 5SX4I 1T7XA 2Z8WC 4QRUB 1PMYA 5DD0L 4ZBJA 4U2YA 2VM3A 3L4WA 3I50L 3V6OE 1L0XA 5I1LB 4PRPE 5DMIH 1JRHI 4JVUA 3BKJH 3TK1A 2E6PA 5FO7B 3VCLA 1GL4B 1H2KA 2OMTB 2CBOA 3NN8A 5KVMC 4UB0L 3CLEH 4WU7A 4RRPG 1UEYA 2FH8A 3MNWA 3QNZA 2CXKA 4M8UA 4O2AB 1QAWA 3UTZB 5FK9B 3QIBC 4X8JB 2V5RA 4F24A 1YMHB 3W5MA 2JVDA 2IMMA 4NR1A 3EH3B 3EUUA 2HT4D 4JFFE 3T1WA 3FCBA 4UILL 4L4JA 2P7TC 3LNHA 2YFOA 5HI3D 3OJDA 4NUGL 2QMKA 1FVDB 2AZAA 4J80A 4U0RB 2ED7A 3AB0C 2CRZA 2BINA 3PGDB 3U79A 1DVFB 5ANHA 5LQBH 3CFEB 1FSKB 3P9MB 4HCFA 3ESPA 2I9LA 2VTFA 1NQBA 4FTVB 4HUWB 1XHHA 4Q6IA 2G3ZA 4JDZB 3B8YA 3FT4B 1LO0H 5CP7B 5EOCJ 3O2WL 4WZ9A 2GCYB 3B1TA 4LCCB 4G7VL 1TEFA 1S6NA 2V7HB 2B16A 4HVBA 1RFYA 1CDUA 5IEHB 1W2BU 4GQ9L 1YMMD 1HH6B 5HYJB 3CSTA 4KQ4H 1S7WB 4QCIB 3CMGA 1WT5A 3QCUH 2IDTA 3WLBA 1AI4A 4JN1H 3VGHA 1V7NL 1UB6B 5TE7L 2D3LA 3W9DB 1UB5A 3DSQA 4E2LA 1B0IA 1HS6A 1RIVL 2JNZA 2ZIDA 3GXUB 3STLC 2WY3B 2DQDL 4YDNA 4TL5A 1T0MB 4J6IA 3SDAC 2XNDG 5KVEL 1RZKH 1QFWM 3CHXA 3OHMB 4OW6A 5DK2B 5D6CB 2GIMA 4UYQA 5T3ZE 3HN3A 3QDGA 4LLQA 1JK9B 3U9PL 5AOMA 4JASA 3FYIB 3CPLB 3M17A 1T4WA 4HD5A 4OF3A 3WXWH 3QR0A 1UC6A 3QDAA 2PABA 3V6ZA 2R56L 2ZCHL 1H6FA 3F05A 3RLSA 3VFRA 1QFOA 1DBAL 1GZHC 2EYTB 3GS0A 3GDCA 4K94L 4F37K 2EDTA 3DK0A 3HPJB 5L3CA 5TH2B 3A6CH 3GRBA 2Q7AA 2XT9A 1FH5L 2LOEA 1G7MB 2F5BH 2MCPL 8FABB 4M93C 2R0LH 1K7DA 3HN8A 3WJLC 3PQYA 4PB9H 5B39B 4KK9C 1Y6KR 1H3VA 3BXNB 1JCHA 1WAAA 4Z0BH 1TITA 1D5MB 3OGOE 2IH3C 3I6KA 4MVUA 3FTUA 1T2QL 2NPLX 2YK1L 3JTSA 3Q6GH 1F4YH 5D6DC 3U4BL 5IOPA 4R6ZA 5KVFH 4AKQA 2BMKA 2EDBA 5D7LE 3RGVA 4XMUA 3EVKA 1MCFA 1DN0A 3MJ6A 4NZUL 3P0VH 3H4HA 1F3JA 3I6GA 4FERA 3D36C 2JGDA 1LK3L 1U8OB 3TBSB 1D5XA 3HG1A 4A7VA 4NNPL 1KIRA 2CO7A 3O9WC 4GP4B 3SDDC 2YD0A 5HVHC 1UH4A 4NYLB 1KP3A 1V27A 2AV1A 5EO9B 4GIAA 1E28B 3ABKB 1WIUA 1TTAA 4LLDA 5KAIZ 4GSXA 3L3DB 5B1JC 1MSDA 3DX6B 3T0EE 1YAIA 2YD1A 4FNUA 4LNVA 2VRZA 1BF8A 1FC1A 3O3BB 5HGDA 2WWOA 1IC1A 1WBYB 2A74B 2ZYHA 4MS6A 3WFEL 5JIQA 1EZVY 3FPXA 4IDJH 3ZQXA 1JPTL 5GGVH 4AM0A 4E9LA 1SXNA 3BPLB 1XIWC 4WO4C 3B8NA 5GRVK 4YWGL 4TOYH 3K0GA 1JXGA 2ODMA 2Q69A 1M71B 3QZMA 4LPXA 4BIOA 4PJFA 5FYKD 5J12C 2FJUB 2D7MA 3KPSB 2KZ1B 4G8GD 2H2PC 2YC0A 2SEBB 1EANA 3QULA 3VI4E 4FLRA 5TGBB 4WHCA 3EBAA 5GS1A 2NNXA 4D94A 1S7UB 2YR3A 3P0YH 1DFBL 3QUKA 1XHXA 2NSXA 3M1CA 1OGAB 3HR0A 3B9AA 5D7KD 4PRPA 3GBMH 4P48A 4I89A 4B27A 3UTSD 2K6ZA 1QSVA 4XDJA 1VQOV 4YBQD 4DUZB 3BWAB 5JHDE 4JYYA 1F1GA 1Y6MR 2JKLA 5GZNA 1KLFA 4LLUA 2LQTA 2CO2A 1JUFA 3O6FB 1QSFB 2P49B 3PHAA 4LFCO 4LMQE 4DKDC 3WS3B 4GP5B 4R9HA 1WGVA 3C9NB 1EEQA 3VFPB 1HU8A 3MFFA 1B0RA 3OAZH 1CF8L 4XNYH 3GC3A 4DV6B 4NKDB 4KROD 3VB9A 2B08A 1VF5B 1G9NL 4OLZL 4KK8C 3U1SL 1VF7A 4AXWA 4ASUG 3R1GH 3KYMB 3OGCB 1MSPA 4DSYA 4NENB 5LXTA 4M02A 2OZ4L 2K9UA 3L3OA 1T0PB 4PJIB 5CZRA 3APNA 5CA1B 4XCNB 3QARA 1ZK9A 4X89A 2RHEA 4XBPA 5KTEH 3MNVA 4YK4B 5KYWB 5FFGA 3PHQB 1MW0A 1UOWA 4CVUA 4QRPE 3JSSA 4UQ9A 4QWWD 1ZPLA 4OT1H 4QHPA 3IFNH 2X41A 1GN2A 4JRXB 2Y7NA 5HD8D 3ZBMA 1TUEB 1OSZA 4G82A 1YVWA 3A22A 3UEQA 4HAGA 3S6CA 4YHYB 4TQEH 3X13A 2JKRM 3H3KA 2Y7OA 2XG4A 2VZ3A 4M1GL 2YGOA 4FD0A 1S9XA 2X3CA 4N9GB 2BVPA 5JO5B 3PGFL 3RPIB 4QJ3B 1XSJA 3ZL2A 2AQNA 4HGKC 2OX5A 3MODH 3L45A 4R26L 4FFKA 4UTBH 2DQ0A 5T3XE 1RZIA 4L37A 1EBOA 3ZBHA 1EFXA 5F6HJ 3LNMB 1G9EA 4ECNA 2OYQA 3S9DB 3IPEA 1EJ6A 1XAKA 2HFEB 3UYPA 5EEVA 2D7QA 3D08A 2WYZA 4Z7QF 2ZUYA 4BELD 3WFDH 1VADA 1ZOXA 3ISRA 2BHZA 5E2UL 3CCLV 5F9JB 4B5ZA 1EVUA 4W9HC 4E9QA 1DUYA 4KO9A 5T5FH 3AEIA 3K91A 4P23C 5DJYB 4YXHH 4O02H 2LFSA 3LDBC 2JEUA 4PJIF 3MRMB 4LRNH 1YJDH 3UCQA 15C8L 1RVFL 3WFBL 1U93B 3BESR 2VLKE 2A6KB 3C6LA 3O8XB 4Z7WE 3C75A 2YAFA 2YD4A 4WHTB 4XN7A 3RWFB 3C2AL 3D4YA 1S5JA 2OK0H 2FLMA 3HKFA 5IGXH 1E79G 3NCXA 5CD3A 1PIFA 2N7SA 1AS6A 1ZK5A 2HJDA 2PP9A 4L3EE 3FRPG 1OIOA 1Y76B 4YC2B 2VMDA 3K6SA 3BFQG 2CXGA 3QH3A 4L2YA 5ANME 1N32O 2DD8H 4X7TA 3UDWC 3HZKA 3D50A 1TZOA 4KKNA 4TUKH 2IFGA 5I16B 4JLRA 3QO1A 4FHJA 2AI0H 2KHAA 3MBEB 2AK4E 4JO8A 1GCYA 5K1VA 4ICWA 2QA4V 3S36L 4LSPL 3F7RA 2NTFA 3P4OB 3SJVD 4C4KT 4KX9A 4J12A 2CUAA 3IJ7A 4KI5E 3KVDD 5F1SA 4UV7L 3P2DA 2AHIA 1AQKH 4W4OA 1RHHB 3TO4C 5I0YA 3PHSA 1EUUA 3ZDZE 2F7RA 3QCTH 5EU6B 5CM1A 4PJ8C 2L04A 2FEDD 3TF7C 4HOXA 4ES9A 4AQ8C 2QADC 5G2NA 3VI4A 2UUBO 1TVKB 2CCLA 3HZYA 4YHOL 1QBMH 3KPPB 3NACH 3PP4H 4ONOA 1R19A 2CH7A 3FBQA 4YPGB 3Q13A 4UBDC 5E4IA 4W6YB 5E5MA 5KSUA 2NNFA 3O2VL 1N6QH 2UWEB 3NFNB 4RDQG 2Y48A 5BW7C 1MCPH 3WG7B 1AMYA 4MYWB 2EIZB 4Y5YC 1TPXC 5GHWH 1EEZA 2HPOA 3WIHA 4G8FB 1CDCA 3BHBB 1IGJA 2K4AA 2CLRA 2IJHA 4X4YA 5JHDA 2R27A 1BYOA 1TETL 1IGFL 1VA9A 2Y1AA 3DGGA 1W72L 3MOAH 3QUYB 4TLUA 4LLWA 4Y2LA 4JI4O 2H8PA 1T7YA 3I9AA 1DQDL 5KSBB 3QUXC 1CR9H 3NJKA 4E42A 1BEYL 2BVQB 4KP4A 1PD6A 1RUQL 5HYQA 3I9GH 4M6NL 5F71A 4Z3FA 1EV2E 4POUB 3BJLA 1SZTA 2VO8A 3EXLA 1Q81W 3MRNB 3OX8B 3GB7B 2X4PB 3VFSA 4AVKA 4U1IA 3P2TA 2XBDA 5FYJD 4O2FB 3V4LA 3HG4A 1EZLA 1UJWB 3U48A 3DHUA 1KC8W 1GO3F 1M4KA 2C4FT 2ORBL 1QLRB 2NLJC 5KN5B 3VFNB 1S76D 3CN1A 5I1IH 5IWAO 1A7RL 4I13B 4CN1A 5EA0L 3TJHC 5EU4A 3LTVA 1E6OH 4HMDA 3GI9L 3JD4A 1SM3L 1FFOA 2E9JA 3M7OA 3RWEB 5EO0A 1NTZH 1NDMA 1W0VA 2WXPA 4AEHL 3L2LA 2VAAB 5AVWB 2CK3G 2BRRH 1A4KA 2E27L 2PPDA 2PTVA 3BO8B 4YQXH 4CH5A 3LX9A 4TQFA 1OWWA 2RQ8A 1M05A 3MGOB 1BOGB 4UMGA 2XQBL 2HT2C 2VXVL 1E5UI 3KLAB 4G6KL 4O2CB 2UZIL 1MFCL 2XV0A 4P99A 4H20L 1X6NA 4XXWA 3SOBL 4ZI8A 5JJJB 2UY7B 2UWEF 3G5ZA 4RGNC 5BUPA 3CVIH 2AC0A 2YD3A 4IHOA 3VWKA 3QFDB 2X4SA 1NPNA 1IKNC 3IJSB 3BRGC 3N91A 1DVFD 2VZUA 3CX5F 4FQXD 1D7DA 5F7DB 1XXFC 3ARSA 3FKUS 4FFTA 3VMOA 1BVLB 2J2ZA 5KSBF 1T83C 3MBWA 1M2OA 1QQDB 2ZNXA 3KAAA 4Y16D 1J5CA 1FN4A 1UWGH 2C8NA 2BSTB 5IWLC 3WB0A 2K8MA 4LVOB 5HYJD 3MV9E 1NEPA 3ZIYA 1Q5OA 4E41B 2DQTH 1YNLH 1YI2V 4XMWA 3SDXE 2AXTZ 5BRZE 3K03A 4PW3A 4YIQB 3T3PF 5F9DC 4MTXA 1EHLL 4TSAL 4K71C 2XCMC 4IQHA 2ADPA 1UATA 2I5YH 1DJYA 1IFHL 3P3NA 4AC2A 4DTGH 2E5LO 4I9WD 1A3LH 4Z7WA 2YXWA 3O3AB 4FXLA 1KGJA 1BAWA 5FOJA 1FYJA 4B50A 4U3JA 1ZANL 4LEOB 4O02B 5ENWB 1R5WB 1X7TA 5C3IA 3US0A 4KO5A 4BQCA 3APDA 1JZGA 4WNSA 1JNHB 1X5IA 4FJCC 4DV2B 3NTCH 4I4WA 4L3EA 4TSCL 1MIEL 4N5UA 1OCWL 1YJ9V 5I1EL 2QV4A 5ANMA 4E5XA 1V8HA 1KEML 2GEEA 2Q20A 2ZD0A 4PJ5B 3NH7H 4FS0A 4HS6B 5DO2C 2QR0B 5AW6B 4V1DE 4JO1H 1XMEB 2AAVA 2CAZC 4FLUA 2AK4A 5E6RB 3VG0H 5D7JB 3WGVB 4B6ZA 1IT9L 3LQAC 4WUUE 3QDMB 4DEWA 1N70A 3O4LB 4PY7A 4TULH 4L2LA 4RGOH 3WEOA 5B8CC 5EC2C 3NK3A 3RG1C 3MAWA 4MVBC 4TUYA 4UV4H 3BQVA 3N2JA 4RFNB 4MCNA 4XP6L 4IIJA 4S1SH 3QHFL 5J5EA 3RWRD 4FFBA 1T6WA 3VVWA 3ETTA 3IJYA 4YDVB 4BW9A 5GZOA 1GPOL 4MZ2A 1AD9A 4W9JC 2FBJL 1G94A 5IQ7L 2ZIMA 1LDPL 4DK5A 2B77A 1OHQA 3SCMB 3SGJC 3GSXA 5L8LB 4IYKA 5DVMA 4AV5A 5BOZG 5EF1A 2ZSWB 2CRYA 3CC5A 4ZFZA 3UX9B 3WO4B 4ALAL 1NCOA 3ILQC 2P5OA 4ZPTA 4AJ0A 2ARWA 3VQMA 1OGTB 4ICGA 2DYPA 4UOJA 1MSWD 2YDEA 5ITFA 3SQBA 1H2SB 5CEYA 4RUEA 1HHJB 4FGMA 2QHRH 4PFEA 3PJSK 4F4LA 1ADQA 2N1KA 3BOVA 5DEFB 2HFFB 1JWMA 3B9KD 1LWRA 4OBSA 1KT2B 3QIBB 4FQ2H 5JUEH 5JH7B 4AZ8B 3KPSD 1TYJA 3DV4B 4BSVA 1SJEB 2AJVL 4DHLA 3CE1A 1O6SA 1SMOA 4IRSA 1FBIH 4UDTB 2JJUA 4LQFH 1NFAA 2KKWA 2DQGH 1BJ1J 3GF8A 4OKVB 4R5TA 1A3RH 3B3IA 1T5XA 2V9QA 2ZKYA 1OGAD 4O51B 1X5HA 5HSFA 1UCBL 4MA8H 1HNXB 1BMZA 4RRPM 4DNLA 3STZC 4KFMA 1SQ2N 1M7DB 5K39B 3WSQL 2AV7B 4APQC 5D1QB 4ZJ9A 2ZPKH 3AAZA 4NO3A 4QTIH 4XCFL 1QSFD 5INCA 2OYLA 5BRPA 4L5FL 2HVBA 4D0DB 2KZWA 3WIFA 2HLAA 4MNGA 1XXDC 4JQIL 3U2JA 4PDMA 4K07A 4BZ2L 4OI7A 5TPWH 3S2CA 1BZKA 3QJOA 1LP9B 4I0XA 3MJ8B 5L7XL 5JOFB 5FYLH 2YJLA 5CILL 1EFQA 3SDAB 1RK0B 1NC4A 4MD4A 4NC2B 1JGDA 3OG6B 3JV6A 3VJ6A 4QNHB 1SUHA 5E1AA 1S7TB 2XWZA 1XGYH 1BZOA 3LDCA 4U3CA 3FQYA 3CXCU 2OSLB 3G08B 3WTTA 1UWXK 1ZVHA 1WHOA 3MJWA 1NGYA 1A6ZB 5CSGA 2Y7SA 5H6QA 3VFWA 4OGAD 2AFNA 4FLQA 4HBCL 1CPYA 2WV3A 1HINH 3II1A 4BFIA 5BRZA 1IEAB 2VLLB 2XBTA 1LEKB 2PYJA 4M93B 4Y2OA 5LBSA 2NUTA 4D0BA 1KC5L 1QVOA 5KVDE 1SY6H 4UDUA 3OF6A 3GSNL 2IH3B 3TNMB 3V5DB 4DV5B 1CD8A 3GTNA 1UD4A 3DROA 3EJYD 4WW1B 1OAXH 2N59A 4PGEB 4U1JB 2O6EA 3CFUA 1PFOA 2QKIA 3SO5A 5KSAB 5L2JA 5A2IH 4DWHA 1P7HL 4DR2O 1CB4A 3BPNC 2AJ3B 1G1CA 1O5DT 5HDLA 3WUWG 4OIBA 4W9EC 2HTKD 3O45A 2P4AB 3RWGA 1D7BA 1LP9F 1NGPH 3SDDB 4BQBA 1A4JB 4FZ1A 1DTOA 2PW2A 4MA3A 4MHHI 4X8CA 3VFMB 5CJ5A 2N01B 1NVPB 3O3DA 4Y4HB 1UZ6E 3RPBA 3ZKMD 5FCSH 4CSPA 1BD2D 4OD3H 4V1DA 2BIPA 5F7WC 5CBEA 1ZS8B 3MHZA 1I7UB 1MJUH 4DAGL 4AEFA 4G7QB 2WM0A 3EADA 4P5KA 1A6AA 1HNZB 1V3JA 1FAFA 1DLFH 1LO5B 3O8XD 1XIWB 1BXAA 4JZOA 1XH3A 4WO4B 5LXGH 1G6RH 2BNRA 3BMVA 3REVB 5IQNA 3KJ6H 2I9TB 1E6JL 2W07A 4CU6A 4BGDA 1EEUA 1KB5L 1UD8A 5FF6A 4P30A 3OAYK 4PMEA 4ZQKA 1LEGA 4NNXA 4GW4B 5JW3L 1ACZA 3TIDA 4G2KA 1C08A 4XC1L 3VA2C 5L2KA 4JFFD 5GGTH 5F1KC 5FDWB 5K33A 3ULVD 3DO7B 3F7VC 3TYGL 1F8TH 3A0OA 4Y5VC 4A7SA 3CE2A 1AGBA 1CIDA 2PO6C 5DMYA 3NZHH 1QR8A 4XNDA 1ASOA 3EYUL 4EN3C 2Y5TA 1WA8A 3DVGB 4O4YH 2J8OA 1AR1D 4LIQE 1JXKA 3RX7A 4XAWH 5AKVA 4LT7A 2E7LA 2VXSH 3PWNA 4FL4B 1UD5A 1ZVSA 2PR4L 3DURA 1B2WL 3IDNB 5FKPB 1BBJA 3RWCA 3F58H 1TYEB 3FHAA 4DP7X 2XNAA 5KBDA 3ZTNL 4NSKA 1OO2A 1J8SA 2X3AA 3B5GA 4LARL 1I4FA 5C8YB 1MUJA 3W1ZA 3APCA 4RFOL 4LCUC 4WU5B 3FKSG 2IDSA 2RFXB 5ERWA 5H2BA 5D1ZC 3U0TB 3NCEB 4LDEB 3TCLA 4F58L 1OXYA 1BVNP 1F1DA 3VQ2C 3BQUA 1JYVA 4YO0A 1PQZA 3FQ1A 1Q0EA 2W8CA 3MRRB 4E68A 4D9RE 3AU0A 1NGQL 4HK0A 1P1ZB 1G7IB 4PJAE 3TIEB 4N2IA 1BGYH 3MHHC 1XSOA 4U6YA 3GVMA 5CCHE 3OW2U 4HAFA 4G3YL 2KQXA 5DK0B 1IL1B 4OZFB 3VGGA 4XPTH 5KHGA 3L2MA 4AYDC 2V4DA 4YAQA 5JIMA 1O6TA 3GJFA 3HNVL 2VUOA 4OVVA 3V5HA 1KCVH 3S88H 1WBZA 1ZLSH 1YYMH 1B2YA 1KV7A 5CWSA 3CVBA 3OM3B 5F2FA 2VLRE 4PW9A 1MXGA 4WTZG 3TNNB 1HOCA 5KUMA 2NY2C 3EFDL 3QEUB 5E6IA 5A2LH 2ARJB 3IU3B 4YN3A 3FRPB 3NQIA 5D7LD 5DZVA 3U4AA 3B7TA 1A9EB 2X12A 4QF1B 1KTJA 5TQ2L 4GUNA 2CUHA 2ZXDA 2DKUA 1OE2A 4HAMA 5EO1B 1KGCE 1IGCH 1Z3GL 3WHE0 3Q5TA 4X6BA 3U82B 5D1XE 3TEWA 4X6CE 1L7TL 4CA4A 2WK2A 4GRWE 4JY5H 4P23B 4WV1A 3SE8H 2QQKL 3C08H 1I8UA 3MLYH 3T0ED 4AGMA 2ZTBA 5TTRA 1IBYA 3FQWA 4JHBA 4JPIB 2VITB 2EXWC 4LOFA 2QQLH 1J8KA 4GT7A 1FCCA 3T4AA 2E9BA 4LAQH 3TV8A 1J48A 3WD5H 3FW6A 3SKMA 2FSDA 4QDGA 1N9PA 3QIWC 2V3EA 1FXKA 2Z65C 4IU3B 3TA4D 2CHNA 1EZUA 2G75B 3CX5J 3RTQA 3LQAH 2ZOWA 3K6FA 4MJ6A 4Q0XH 2D0GA 4J23A 5BJTB 4ZAKA 5C0RL 4ANUA 2IADA 2GC4C 1MNUH 3SIKA 3K8KA 5IT2L 2H6OA 2IWGA 3H1JH 4NWUH 3SE4C 1GYCA 1MFBL 3MNZB 3ULAB 3WKYA 1NCBL 3HLAB 3GBDA 4JL1A 3Q3GB 2JJSC 1AGCA 2UU9B 3O3EA 4HLJA 1UA6H 4KHXL 4DP8X 4LASH 3O6MH 5JHMA 4IKLA 3JAWB 4N8PA 1FJ1A 2IF7A 4S1DC 4Y2DB 5HJGA 4JPSA 1JTOA 5BUAA 2BCKA 4JFHE 2LQRA 4J1UA 5SX5K 5JIDA 4F2EA 4PJ8B 1FXHA 3LH9A 2PR9A 3SDCC 4Q52A 1GGCH 1CFVL 1XD0A 1VQ7V 2CHXA 2WW8A 2W9LA 4NKIL 2KYIA 4JI6O 3W39B 1S3JA 4JY4B 4M7ZC 5HJ3B 5C0CB 3TFKD 2GTZA 1PX4A 1NUDA 4HKZA 4HZ3A 5D7JD 2EECA 1TVBA 1TPXB 1T0NB 3OMAB 5E08H 3V5KB 3AT0A 3I50H 1BZ8A 2FZ3B 1R3JC 4YZFF 2JCCE 3PWVA 2ADFH 1OTUD 1SDDB 2PF4E 3QUXB 4X7SL 2JV6A 2XWXA 4WQOA 1U58A 1E2WA 2CDGB 4Z7UB 3T1HB 1CXIA 4Z7NB 4RMVA 3O2DL 4YL9A 3MACH 1QG3A 1HNWB 1QRKA 2FRGP 3L3KA 1NH6A 3TF4A 3OR7C 2Y7LA 4KKCD 2VXQH 2VGLM 3M07A 4KKRA 1YA5A 4UILH 3SCMD 5MENB 3GPSA 2FK9A 4LFAB 3AFLA 4LDOB 2Q86A 1OT2A 3B40A 1OCZC 2YARA 3X12B 2EDXA 2NLJB 1K4CC 1FJGO 3P73B 2JCWA 2HUHA 2VLJB 2EE3A 3QAZC 1BM7A 4WF9V 4CAGA 3UOAB 1G7HB 2XTSA 2IALA 5LCVL 4XVTL 3N2GA 1D9KD 3ZKQD 4OIIL 2J44A 4ZUVB 5T3XD 2V2WA 3CIQA 4FXKC 1DYZA 1IBMO 1UWEL 3RNKA 2AABH 5HPMB 1FGNH 1JNJA 4XCEA 1KKDA 1AH1A 2ZNWA 3VD9A 2CA3A 3MLZL 3P11L 1GZPB 3TP4A 5DHEA 3VWJC 1DLBA 3UTTB 1NBQA 2AP2A 2OMNA 3EDJA 3HRZC 5HXMA 1XNRO 4HS3A 3V0WL 3II2A 2UXCB 3T04D 4K7FB 3RW0A 5J2UA 4AW4A 4ZS7L 4Z2WA 4QMEA 2CO3A 2HAZA 3FQUB 4G1MA 2P80A 4I2XE 3NFPA 3O65A 4UQ2A 2VLRA 4PV9A 2DQDH 2H0JA 3POHA 1TQTA 4RAVB 2IXQA 2JF1A 4Z7UF 5D1QD 4W4LA 5EBLA 1OSPH 1MI5E 1HWGB 4AW7A 2VDOB 5KVEH 4U33A 4G43A 3PP3K 3U9PH 1QYGH 2BW5A 4YFDB 4H0LC 3GLZA 1ORQA 4JY6A 3LV3A 4A6YL 2EUZA 2P48B 3QFJA 2R56H 2ZCHH 3GSUA 2D03L 4N21A 3FCSA 3SZKC 1X5KA 3UGEA 1DBAH 1WA1X 4K94H 4MBRA 4OD2A 1VF6C 4QD2E 2F15A 1BZEA 4K71B 4UZUA 1LJMA 2KZBA 4JM0A 2LABA 1QLFB 4HV8B 5DYOA 1G7QA 5CA0A 3EOBA 1BQLL 1KFAL 5A2QN 2IAMC 1UPGA 4PGCB 4KKPA 1R1CA 4XBEH 1EXUA 1T2QH 3U4BH 4PJXF 4WNQA 4G9FE 3CC2V 4KZCA 1E1RG 1D5AA 4ZOAA 1I8LA 4ZW3A 2VISB 4BJLA 2LU7A 2Q2LA 4NFBA 1D5BA 1QACA 5DF0A 2ZXAA 1TU2A 4G7SB 4NNPH 2EICA 3CZJA 1C5BL 5T1LB 1ID2A 1GM7A 5C0FB 3CLFL 5FX3A 4FA6A 2D2CB 3FB5A 2HA1A 3GZOA 4OZGB 3ZMSA 2XT1B 4MVOA 1QRNB 1JWUA 1IIKA 2WOYA 4QRQB 5B8CB