1V54B

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v54B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v54B02
4HCGA 5ANHA 1L9SA 4W9ZA 5I6MA 3S8FB 3H4HA 4KO9A 3AG3B 1SDDA 4YSQA 1MZYA 1VLXA 1AQ8A 5I6NA 1PY0A 2B3IA 2W8CA 1JZJA 1A8ZA 2XV0A 3UAEA 1BYPA 2YAEA 1FWXA 1PF3A 1RZPA 3V9EA 4G7RB 2BP0B 1J9SA 3PAVA 1NTDA 3JTBA 4W1TA 4CSPA 4GY4A 1KBWA 2DY2A 3MBWB 5B1JA 1WA0X 1NIBA 2RACA 1BXAA 1MDAA 4N4YB 2ZWNA 2XUWA 1SHWA 4E9RA 1W8EA 2VW4A 3ABKB 3UACA 3FSAA 4YSCA 2J57A 3PAZA 3EH5B 3T71A 1CYWA 3ERXA 6PAZA 2GIMA 1IUZA 3FPXA 3QJVB 1RKRA 2AANA 2PP8A 4UF7C 2Y69B 3S3BB 2R7EB 3TU6A 4AKPA 5F7AA 2PLTA 2IDQA 4KNTA 4BWTA 5LDUA 3S8GB 2ZOOA 5F7BA 1AG0A 2VW7A 2X87A 3TA4D 1ASQA 4G72B 2UXVA 3ABGA 3SBQA 3X1GA 1AZNA 3EH4B 2I85A 5TK2A 2XWZA 1JXDA 3QJSB 1RCYA 4WTQA 5B1BB 2QT6A 1JZFA 2FT8A 1SJMA 3BQVA 1J9RA 1SNRA 4JKNA 4M4RB 3OMNB 2VM4A 3FSWA 4DP9X 2GHZA 4YL4A 2XV2A 4DPBX 3TBCA 3DTUB 4YSUA 1AOZA 1GS6X 1CURA 4DP2X 1OCOB 3OM3B 2UX6A 1NIDA 1QNIA 3X1BA 3NT0A 2NRDA 2I7OA 2QPDB 2YAFA 4MFHA 7PCYA 1MG2C 1OCCB 1N68A 2XYBA 3UGEA 3X2QB 4YSOA 4YVUA 1AIZA 4L0PB 2Q9OA 2WO3B 4E9QA 2DV6A 1J9QA 4AI7A 2N0MA 1GYCA 1PZAA 4CSZA 1AANA 4YSSA 1ADWA 3H4FA 1W6WA 2YEVB 2GC7C 1SDDB 4UANA 1ZDSA 2E86A 4A2HA 1TU2A 1A3ZA 1FFTB 2GC4C 5I6PA 3C75A 2UXFA 1PZBA 2YAHA 3N2JA 4YVNA 5AZUA 4BK5C 4NB7A 3RYMA 2HRGA 5I5IA 4HCFA 2BZ7A 1EHKB 3FQ2A 1NIEA 3WNIA 1R1CA 3NJFA 1BYOA 3WKQA 1KCWA 1GSKA 1SFDA 1SF5A 2XLLA 4GP4B 3AY2A 1V10A 2X88A 1OE1A 3H56A 1BQKA 1I53A 3AZUA 4M3HA 3WG7B 1NINA 4P5RA 1ZV2A 3GYRA 2FT6A 1ZIAA 3NSDA 1KCBA 2EILB 9PCYA 2YXWA 3QJTB 4E9YA 2PP9A 2EINB 1OCRB 1AZRA 3V9CA 3IN2A 3CVDA 2HZHA 2BZCA 5D4HA 1E67A 3NSCA 3ABLB 2HLEB 4TXVB 4HAKA 4FA7B 1ILSA 5TK4A 1L9PA 4HIPA 1A65A 3NYKA 3S3DB 3IE9A 3JT2A 2J56A 2DYRB 4YSDA 2PCFA 2YAQA 1KV7A 4DP7X 1ZIBA 4ENZA 1PNCA 1HAWA 2ZXWB 1BXVA 3CVBA 1AZUA 1ID2A 2EIKB 1TKWA 1WAEA 5B3SB 4QLWA 3FYEB 4BXVA 2DWTA 3TBBA 1FA4A 2ZONA 1AZCA 1URIA 3NSYA 7PAZA 3ASOB 1A4CA 2IH9A 4DPAX 5I28A 3UAAA 1AAJA 1JXGA 1PCSA 1A4AA 1E5YA 2JFCA 4YSTA 1ILUA 3OD3A 1AS7A 4PCYA 1JZGA 2VN3A 4Q89A 4NAJA 1AS6A 1HFUA 1PNDA 3MX0B 4HCIA 4AZUA 1OOWA 1B3IA 2TSAA 5PCYA 1L9OA 1BAWA 3NJLA 2OCCB 1PMYA 4G7SB 4A66A 1IBZA 1GY1A 4A68A 2YAPA 2IAAC 4BWUA 5IY5B 4DPCX 2IH8A 1L9TA 1XMEB 4HHGA 3X1FA 4E9XA 1OE2A 3FSZA 1ZPUA 4DP5X 3AW5A 2CJ3A 3NJIA 2CUAA 4GYBA 3NP3A 3SBPA 2PPDA 3KW8A 3NP4A 4YSPA 4KOCA 2QPEB 1X9UA 2YAOA 1M57B 2J5WA 1GR7A 3ZBMA 4E9SA 3FU7A 3QPKA 1GY2A 1V55B 2PPFA 4A2GA 2JXMA 4DP4X 4AKQA 3OMAB 4HZ1A 1MZZA 2HRHA 1KBVA 2PPEA 2YXVA 4YSRA 2XXFA 2MTAA 2UX7A 5I26A 4EF3A 2DWSA 3FU9A 3PCYA 1IBYA 4F7KA 2IDTA 1AACA 1MG3C 1CYXA 1JZHA 3AG2B 2CALA 5B1KA 5AKRA 1ZDQA 4ZK8A 2FQEA 3AG1B 3QQXA 3AG4B 4BXSV 3G5WA 4KO7A 2HX8A 3T6WA 1AR1B 4YSAA 4QKTA 3ZDWA 1JXFA 1HAUA 3N55A 1AS8A 2IDFA 2BO0A 2W88A 2HX9A 5B7MA 3CDZA 4A2FA 2BWDA 4E9TA 5B1AB 1DYZA 4P5SA 4AX3A 4G7QB 2QDVA 2Q5BA 1WA1X 1ASOA 5D4IA 4E9VA 1ET5A 8PAZA 1SF3A 1E65A 1JOIA 2GSMB 1X9RA 3T6ZA 3UABA 1OE3A 3WKPA 4PAZA 2P80A 1BQ5A 1NZRA 2FWLB 5I6KA 2CAKA 1DZ0A 1KDJA 2XVBA 3GDCA 4A2DA 1SFHA 3SQRA 2UXTA 2FQDA 1NICA 5EHFA 5B7FA 3NJKA 1NIFA 2XX1A 2IDSA 1L9QA 4AKOA 3DIVA 2BHFA 3QJRB 3HB3B 2TSBA 3NSFA 4G70B 4HHWA 1WS8A 4KO6A 3L45A 3NJMA 5AFAA 1JZIA 3QJQB 3X1NA 2YARA 2FQGA 3FQYA 3NJJA 2B08A 1NIAA 4A67A 3WNJA 1UATA 1NPNA 2CBPA 4BWWA 1SHXA 4KNSA 4GXFA 3IBOA 4E9WA 2UXGA 1TEFA 2AZAA 1TEGA 1E30A 2Y1AA 1JZEA 4G71B 1ASPA 1M9WA 1ET7A 2IWEA 1YLBB 5PAZA 1PLAA 1JVOA 1L9RA 3T6XA 2MRYA 4JHVA 3WIAA 1AZBA 2JKWA 1W6LA 4KO5A 1BQRA 3FU7B 3FYIB 1EZLA 3DKHA 4KNUA 5FC9A 1NWOA 1RZQA 2VMJA 2VSKB 4F2FA 4DP8X 1J5DA 1JERA 2IDUA 2PCYA 2PP7A 1XB3A 2VSMB 3CG8A 1AG6A 4JHUA 2PPAA 3NJHA 3ZIYA 4BDVA 2QDWA 1GW0A 3D12B 4DP6X 1BXUA 2BP8A 3PAUA 3OMIB 1GS7A 4UAHA 1KYAA 3CZUB 2BWIA 1NDTA 2IWKA 5A7EA 1IKOP 4Q8BA 4X4KA 3CVCA 2HX7A 3QJUB 2FQFA 1E5ZA 1JVLA 4DP1X 5B7EA 1F56A 1PZCA 2BP0A 2H5UA 2YQBA 3CDZB 2I7SA 2XU9A 3T6VA 2EIJB 5B1JC 1PLBA 3ZX1A 1XB8A 5I5MA 3U25A 2VM3A 3EH3B 1T5KA 1QHQA 1OF0A 2FT7A 1CUOA 3FPYA 2XV3A 4GP5B 2FNWA 2A3TA 3IN0A 1NWPA 3HEIB 4GP8B 1OV8A 3S3CB 3T9WA 2CCWA 3EHBB 1QLEB 6PCYA 1BEXA 1A4BA 3PPSA 1J5CA 4NERA 1N70A 2EIMB 3NJGA 3FSVA 1PAZA 2GBAA 2LLNA 2VW6A 4YSEA 2H47C 1M56B 3PXLA 2R7EA 5I6OA 5D4JA 4DP0X 1OCZB 2HXAA 2WSDA 2AFNA 3BVDB 4RH4A 3OQRA 3KW7A 1GS8A 1PLCA 5I5JA 1WA2X 3FS9A 3WI9A 3TASA 2BW4A 5I6LA 3EF4A 3SBRA 4WKXA 2DYSB 4F2EA 2YAMA 2H3XC 3FQ1A 4K9JA 2BW5A 1KGYE 4HALA 3IEAA 4A2EA 3PLYA 2OV0A 3X1EA 2PPCA 2FJSA 2XX0A 5E9NA 2OJ1A 2AVFA 4FAAB 1J9TA 2FTAA 1IC0A 2GB2A 3ABMB 2XXGA 3FT0A 3GXUB 3FU8A 3ASNB 2IWFA 1WS7A 3NJNA 2P80D 4N8UA 1CC3A 1ET8A 3UADA 1XB6A 2AZUA 1KDIA 2WO2B 1ETJA 4BDVB 2GI0A 4KOBA 1NPJA 1V54B 2BP8B 2J55A
chains in the Genus database with same CATH superfamily
3SOTA 4IW4C 3VQWA 2X3AA 1RSOB 2C7UB 1C5BL 4ANUA 2QHLA 4WO0A 4FHKA 3ZR6A 4ZBMA 4O9HH 4X8JB 4XNXH 2WLHA 3AG7A 3BRFA 3UJJH 1EFRG 4G8GB 4MQ7B 4LVHB 4UVAA 3MJ9H 4FTVA 1HJBC 1DEDA 4XRCA 2WB7A 4U1KB 2CA4A 3H6AA 1JK8B 1PF3A 3FQUB 2F23A 4R9HA 4ZXBB 5KW9L 5DFTA 4QRTB 2CBMA 4M5YH 5E99L 3RPBA 2PXYC 2F4VB 1MFDH 1WPXA 3A6CH 3ARDB 3Q06A 1DLBA 2FX7H 1XH3A 4Z0BL 3MBXL 4J3SA 1S7SB 1QVGU 4NKOA 4J10A 1WA0X 5LCVL 5DZLA 3UYPA 5DJZB 5IJCC 5IDJA 3DSNB 4URTB 3SE8L 5IFAL 2R1WB 4I2XE 1WBZB 1YY9C 2CO7B 1ETB1 2QJDA 4K8RD 4R8WL 3ZJAA 5JHAA 3ABKB 1H38A 4W81A 3HBPA 1RSOA 2C7UA 4PJ7F 1JPFB 4FG4A 1EHLH 1ZHLA 1UXMA 2DIAA 2ZF9A 4X8JA 5BRZE 3WB2A 2V5RA 1Q9OB 1VSCA 1X5LA 2G3XA 1CD8A 5E6SB 2GK2A 4WWNA 3RUGF 3SCMC 2B4CH 2BSTA 4BWAA 3S3JA 3L4WA 3OKDB 3TU6A 1J86A 2OSWA 1ACZA 2GAZB 4QRTA 1O9HA 4LF8B 3FONB 4MQXC 1LDPL 4ZMTA 3CCMV 4TSBH 3GI9H 4ZFZB 4F2ME 1CXZB 5TISZ 3E8UL 3BIBX 3SJVB 3I9PA 1HDJA 4EUPA 2EXYC 5TK2A 3F7YA 3MA7A 5AWNH 2Y36L 2QQKL 2B1AH 4HHAA 1X5AA 2X2HA 4HCRA 4XBPB 4JFTA 1KENL 3BQVA 2V9RA 3C5XA 5E6IB 2Y06H 2CO7A 1ES0A 3HOGA 4AGPA 1OAKH 2WW8A 4CU8A 1PEZA 1EEQA 1JPFA 1YY8B 5IM7B 3HJEA 5A2LH 1J1OL 3D7PA 4MXQC 1UG9A 3CVHH 3TBCA 3LKSB 3NPZB 3GK8H 2QMJA 2UX6A 1QNIA 4WWKD 5BXFB 3B77A 3Q05A 5C9JA 2WSSG 4JF3A 1EJOL 3LZOA 4FLQA 3CSFA 1KT2A 2HJKA 2Q20A 1T5EA 1MW2A 3ICXA 4OFKA 2BOCB 4F5CA 3CMEV 1XIWB 1CL7H 4YSOA 5GZNC 1VIWA 4IBYA 1AI5A 1NGPH 4Y19E 3K6OA 3SJVA 2CGNA 2YD0A 5IEHA 5IHWA 1OEZW 4H8UA 1ODAA 2W94A 4TN9A 3LMJH 1MCWW 3WIIH 3QJHB 2E4FA 3O2DH 3QORA 3PHSA 1DF5A 3WFEH 4N2OA 4UT9A 4Y4HA 2ZYRA 5DZPA 1ZHKB 2D3NA 3IVKB 2YMTA 1SXBA 1Q1JH 4UDTA 2JGDA 5D2LB 1CVSC 5FV2A 4E36A 4P2OB 1QBBA 2PUQT 4UANA 3D0LA 2VERN 2D7QA 2PW2A 3OR6A 4FI6A 4JFFB 2XG4A 4G8IA 5GGVH 3E8BA 2OZ4A 3D85B 2K3TA 4GRLC 3H9VA 1J12A 3AAZA 3RZCD 2CLVB 1I4FB 4WCYH 5DS2A 3RVUD 1OPOA 5D5MA 4KK8C 2AK4A 1RVFH 4U1LB 5LBVA 3WN6A 1S2EA 4CL7A 4NPKA 1NTKH 1XOUA 3ARPA 4HF5H 4ACTA 5EN2B 4OT1H 2QKIC 4L8CA 3HPLC 3H9HA 4ZYKB 3JQOB 4CZZA 2R0WH 3M1CA 2MCAA 5D55A 1SRDA 1IX9A 4ZTOH 2F54E 4LLUB 2FD6H 2G2RA 1TF4A 2HFEB 1PLGH 3ULAB 1PZSA 2XKNA 1T66C 4BSWB 4MKMA 3HKDB 3M99B 1KCUL 1NDMB 2HRLA 2LW7A 5GTHZ 2MKLC 5IT2H 1MCPH 2IANA 2O5YH 2YA1A 5ITFB 3P0YH 2J56A 2DYRB 1Y6NR 4WFGA 3H1ZA 1MZFA 4I50A 2XFGB 3W9EB 4KK5C 4Z77A 3VVWA 4NKGB 2EEBA 1N59A 3QWQB 3VD0A 1TJIH 3CVBA 3FCSA 4AYSA 3ATAA 4GRMB 2BJML 4DR7B 2X1WL 2Q6WA 1QLEC 4X20B 1X5MA 1UM4H 4ZYKA 1NANI 3E38A 4ZO6A 3JVGC 4LVOB 3Q6GH 2JFCA 4N2HA 5IHUH 4YSTA 3VDAA 4O4YH 1GC1C 2WXIA 4FZ8L 3Q1SH 4S1QL 4U6TA 3ZKNC 4G1MB 3KHOA 4KUZH 3GMQB 3PWUB 5E5MB 3NRPA 4X8XA 1LL1A 4N86A 1Q8IA 3OGCA 1LEGB 5E8PB 1AIFB 3O6ML 3NJLA 3BVXA 1KLUA 2DOSA 2YMXL 3WLWD 2O5XH 4PRDB 1R34A 1RPOA 1JWSB 1RUMH 2AJYH 4YE4H 3EGDB 4D9QE 2CJUL 3ZHQA 4Y19A 1KBGL 3A6BH 4DPCX 2EC9U 4KZDL 4JGJA 2MOQA 2B1GA 2DYSC 2FRGP 3QNFA 2E9WA 3C08H 1MWAA 3HUJF 3G04B 4X9YA 3CC1A 3DMMA 5TQ2L 4D9RD 2YZ1A 4GYBA 5ICXA 1O7SA 4I1RA 4PV1C 3HZYA 4B5ZA 1BVNP 2HPTA 4JFZH 4DKEL 4Q97A 3DO3A 3P4LA 2C3HA 3QFJE 4XNQB 3L74H 4JI1O 4L2YA 4PREA 5DC0A 2C3VB 2Q4PA 1QUPA 1TU2B 5AKTA 3ARFA 1MJJB 2CO3A 3F6JA 4CAGA 3SE4A 5I8OH 3GMQA 4NENA 2NX5B 4JHAH 2F15A 4ADJA 2VGLM 1UFIA 5FECA 1BZOA 5E8PA 5LJYH 2EECA 3DX1A 2OW6A 2I9TA 2YXMA 3CFTA 1OK0A 2DYPA 4POYA 3OKLA 3ZYIA 1DJWA 4Q9QH 3L4UA 5EA0H 1RIVH 3CMOL 4AM0Q 4KTDL 1IQWH 3MLXH 4NFBA 4UV8A 5J11C 3D3VB 4P2RE 1KIQB 5HD8D 1MI5D 2VJ0A 3QB7C 1URLA 1Y6XA 5HJ3B 2G5RA 3ESNA 5FK9A 4ZK8A 2JJ2G 1FD9A 1MJ7H 2ZWZA 3VGAB 5HY9B 3GKWH 2IPUK 3IDUA 4RQEA 4ONFL 3Q43A 2V5SA 1DO5A 1XV8A 4KO7A 4LLQB 3QIWB 3EBHA 1NJIW 1YEFL 4EVNA 4UCFA 3CTTA 1TMQA 3R0MA 3JASB 2B5IC 4U0RC 4X5WB 3TCXA 2WK2A 2XVLA 1BIIA 1SEBB 4PJ9C 1RPRA 2NX5A 2OA9A 4PP2B 1MKFA 1NCGA 5DD5L 3DSQA 1ZX3A 4UYPA 2M6YA 5J6HA 5JUEH 3BGMB 1UD4A 5E94B 4QGTA 1TETL 1WAZA 1H8LA 3WEAA 5C0CD 2EDQA 2YWZA 3DOHA 4DR3O 2VR9A 1R24A 4BHUI 4PG9B 2WINB 2DI8A 4HK0B 3UABA 4YJ2B 1XAUA 1HNFA 4PR5B 1CGSL 1OGAB 5E00B 2H32H 3D0VA 2ARHA 5C7ZA 5FA3B 1E43A 1KJ3H 3CWGA 5I8CA 2EUZA 2XYCA 4ORGB 4BFGA 1IL1B 2Z0AA 5E2WL 5FR3A 2Q2LA 1NIFA 1FZOB 2Y69C 1QUNA 2E9JA 2WXFA 3RKPA 2XBDA 5DR5L 5IKCA 3QYMA 2QSAA 1GMGA 1GKEA 3QC6X 2UWEA 3E2EA 5CGTA 2VR6A 1KPUB 2VUOA 4Y16D 1CFSB 4FQXB 4AQOA 4E41E 4UQ2A 3NXSA 1KD1W 1JF6A 3UROR 1X5JA 2ZDIA 3FT1A 3L3HB 3GRWH 3QIUA 4UT6H 4Z76B 2V2XA 1NAMH 1CFMA 2FYUH 3BGMA 1IZJA 5F71A 5FM8A 2LGWA 3O9WB 3MRJB 4LSRH 5K59F 3R1GH 2A83B 4NC1E 2Y4TA 3DXAA 2V4DA 4YJ2A 2DICA 1UFUA 2P5WA 6CGTA 1X4ZA 5HHMB 4MXWH 4ERSL 1LK3L 2B0SH 1O9VA 2QPFA 2Y7NA 5FW6A 2VQEB 1X5XA 4B6ZA 3FW6A 4ORGA 2NY6D 3SPCA 3DKHA 4GLRH 4KNUA 2DBJA 4X4XB 1G7HA 2DLEA 2M7WA 4Z0XA 2D9CA 2I9LA 2GTWB 4C58B 5E99H 2P42B 3S5ZA 2IDUA 3ARBD 5C0JA 1NU1H 3IFPB 1YEEL 3QZPA 4PV8B 5DGQA 1K8AW 1Y76A 1T1YB 4WJKB 2NZ1A 2Y07L 1I31A 1PW3A 2VSMB 3H55A 3MBXH 4IOSA 4Z0BH 3NCJL 1YEIL 3RWHA 4BFIA 4K2UL 4DGIL 4IRJB 4MTGA 3SE8H 5IFAH 4G1EB 1HI6B 2DAVA 4K5LA 1KXQE 4PG2C 4XCYA 4UM9A 4ZMZA 3VSTA 1RFYA 1GCFA 5D8JL 4R8WH 2FYVA 4AL8C 1HN1A 2A83A 2C4XA 1SF9A 3NRQA 4KXBA 5T1LB 4NQXB 4X6DE 4NXKA 5E1AA 1ETZA 4JCLA 4CUCA 4I85A 1FUNA 1KJ2L 1DVYA 3L9RB 1A9EA 1V05A 5GRZA 1EXGA 5DWPA 4ZPTB 2ZE8A 1MW1A 3MBEA 3O3EB 4TF4A 5D1ZC 2X09A 5I75C 3CX5F 5MI0C 3MBWA 5CU5A 3U11A 4IOFC 1LDPH 3KBPA 1U2YA 3FF7A 3GHPA 3FUJA 4G8FB 3E8UH 5D7SL 3P77B 5JHDE 1MJ8L 2QWQB 1X7QB 2M8XA 2QQKH 4UQEA 2PYEA 3OKEB 4IRJA 3HHSB 1NWPA 4WBNA 3ORJA 3MAQA 4WQOA 2EDLA 3K8MA 5DQ9A 1KENH 4J7JA 4PJXE 2XAJA 1T6BX 3PWPB 4RDQF 4YZFF 4R2GC 3OPZL 3GDBA 3HKBB 5KJ4A 2FBJL 4FMKA 5I9QC 3JATB 1J1OH 2ZJSL 1EEZB 1B6QA 2RMNA 1M71A 4N2GA 1QATA 4PH8A 4PJCB 5IEKA 4ZOLA 3GSOA 5L0QB 2VQFO 2RQ8A 1IKNA 2AQ2A 5JTWA 4HJIA 1EJOH 2XWTA 3APMA 2UXNA 4MTFA 4XC1L 4ZUUA 4PD4K 1PL3A 1U58A 1PZDA 1BMGA 3Q3GA 3RWJA 3CXCU 3IDGB 2APXA 4NBZB 4GRWH 3WO3B 3RYCB 2D03L 5I5JA 2F53A 3LVTA 3VW3L 2Q73A 2VLJB 4K8RH 5DJCA 4NSKA 4A2MA 4DV1B 1IV8A 2RDCA 3MO1B 1MXGA 2X41A 1LO0L 1KGYE 2B16A 2XPYA 4LL4A 2BVEA 4DR1B 3KWWB 1AP5A 4PJFF 4J2XA 1AD0B 1BXXA 5GRUL 4LHJB 3FL7A 3HKBA 4FLZA 2WAHA 3LDBB 4FAAB 4K55A 2DF3A 2AQNA 1Q72L 4LCYA 1LP9F 2XXGA 2LLGA 4QRUB 1RUQL 3FU8A 3D52A 2DEYX 1JF1B 1RK0A 3FO1A 4JRWA 1J88A 3I6SA 5C07E 4MW8A 1WFMA 4IGBD 2F8XC 5IQ9B 5AALA 1G7PB 3ZE2F 5D93C 2OAAA 5CA1A 2DB8A 3QDGD 2ARJQ 2LFRA 1YMMD 2ZAGA 3IDGA 2Y6SD 4FRWA 3RYCA 2R9RB 1I3GL 3A8TA 1NPJA 4C4UA 2LGQA 5DJ0B 4KROC 1HR0O 2E4TA 3A0RA 4DF9A 3BSZL 5CGBA 2PTTB 1T7YA 3MO1A 2KC0A 3M17B 4JHBA 1D5AA 1Q0YL 4JFEE 4ZFFA 3OWRA 3ZUCA 5DHYA 3HS9A 1D6EA 3SYQA 5SWQB 2W9EL 5ESVA 1KCUH 4B9GA 3G6BA 1BQHB 1CICC 5D7JC 4D9LL 4TOYL 4JVWA 2WKLA 4W70A 3BPNB 5BZZA 5KHGA 2GBUA 1QFWL 3MXWL 3ZTJH 5KN5B 5JIPA 4WI2A 2NY1B 5DN6G 3FB5C 2CDGA 8CGTA 2LVEA 4PVLA 5BZDB 2AC0A 4JFXB 4ATWA 3OG4B 3FTVA 2L8AA 3PUCA 3IFOB 1PY9A 3TJHD 3AXHA 3KPOB 5E9DA 3WE6B 4DUYB 3C2SA 1PZ3A 3AG1C 4W6XB 4PRIB 2BJMH 4PJXA 4CJ1A 2H6PA 1EAQA 2YSUB 4J6RL 3WMSA 1AR1C 2PTTA 3NN8A 4AIZB 1W8NA 3B9KC 3QJXA 4G80A 4FZ8H 6PAZA 4S1QH 2W0KA 2ARWA 2VZUA 3E83A 3HKCA 4AKPA 4OUUB 4AG4L 4MDRA 3R0NA 3ECQA 1EO8L 3LV3A 4R4BB 1EANA 3O6MH 5I8KL 4OZGE 1KGCD 3ZQXA 5EUKA 4QGPA 2DLFL 5IROC 1QU7A 2P6JA 4QWWD 5E1QA 1GM8A 3X1GA 3IF1B 1LO4L 2CJUH 4KI5C 3D51A 2XWZA 3B2VL 4Z7WB 1UB6B 4KZDH 4R0LB 2FHBA 4QRSA 4KNQA 2J6EA 4B9YA 1G7JB 3S6CA 1AGDA 2WYTA 4JKNA 1PD0A 1I8MB 2EH8L 2J43A 1OKEA 5TQ2H 5M7QA 1NFDE 1QSED 4HWBA 5BQ7A 3FB7C 4M61B 5C3LD 3BABA 4DKEH 4R6ZA 4OFPA 5LA6A 2I07A 2QM7A 2XZZA 5B3JE 1UJWB 4LSVL 2KDYA 3L3OC 2V33A 3MX0A 2DQTL 2Q0AA 5JH7A 1UWFA 4Y5XB 1X9QA 3QEUA 4NJ9L 4N2IA 5AAMA 1XMOO 4RWHA 1S7WB 5C07A 4L2LA 1J0KA 3HKEB 1ZAGA 1IM3A 4ZFQA 5IW6A 4LH7A 3QDHA 4Z7VA 4B9ZA 3IF1A 1GSMA 3CMOH 2WPDG 1SS3A 4X6BB 3DX3A 4HU2A 4TV8A 3NH7L 3UTSB 5JXEC 4Y0GA 3ULUE 4JRLA 4UCRA 4NAQA 1UZ8A 3CPUA 2JSFA 2NQCA 4KXZH 3L9EA 4W9KC 1SN0A 2ITCB 2W38A 3ATFA 5EU6D 4AQEB 4ONFH 1T5WA 2YGQA 1M4UA 4G2KA 1PSKL 3UTTE 2IAMA 1XL6A 1YEFH 4KRLB 1XMQB 4U1JB 4XZ4A 3QXWA 2FHFA 5FHAH 4S10A 3RWDB 5E8EB 3TZVC 5IHZA 3HG4A 1YN6B 5T5NF 4X64B 5JPMC 4E68A 4MNQE 1G7IA 2QVFB 4HCFA 4WAFA 1Y74B 2NY5L 1B0WA 3TWCH 1TTRA 1S7XA 4W9EC 5DD5H 3OSKA 1QSFA 4PGZA 3CH8A 3P9MB 3QJOA 4JREC 4N2AA 2JKNA 3WKQA 3OEEG 3IJSB 1R3IL 1TETH 1F6AA 5I2IA 1LM8V 12E8H 3AY2A 3L3DA 5F3HA 3BZ4A 2MFNA 1U96A 1WNSA 4OZIA 4X65B 1F2XK 2W0PA 5J2TA 2FT6A 3NPSB 4X7TB 1CGSH 3CDGB 4JDZB 4LAQL 5ACMA 3KGUA 1OCRB 4TNWK 2VLMD 2HZHA 5SWSD 3SDAC 4TUYB 5TGBB 4M62L 2ENSA 3QW9A 1D5IH 4DV3O 5E2WH 4M1GL 4PJGA 4AWJC 4PI2A 3MREB 4NO2B 4OZFG 3PL6B 3K06A 4FN0A 3NQKA 2F61A 2NTFA 4U1JA 5DR5H 4YHNB 4PDMA 4AUYA 1L6XA 5FYJU 1L0NH 2ZE0A 1V7MH 3VQYA 5E8EA 5C0GA 2L7UA 1F4HA 3ULVD 4GUNA 4DERA 4AOFA 2E6JA 2JLPA 2NLJC 1IQDB 1L0XA 2XV6B 3HI5L 4XCCL 4RFEA 2GTZB 1K97A 3WHXA 2IDCA 2WCGA 1Q7YW 4BXVA 3MUGA 3IJSA 5KYNA 1URIA 4J3OG 3EHBC 4K3GA 1E4KC 2FATL 5I1JL 5M94B 4ZHQB 3FHEA 2R23A 1QVOB 2MSPA 1AXSA 4PJBF 4PJHF 3WBDA 3ZE0B 1A4AA 2QLVB 3QS3A 3JV6B 4JDZA 3PY9A 1DJSA 3P2TA 4ERSH 1LK3H 1XF5B 2NNXA 1LE9A 4XDKA 2Y5TA 2ZSVA 2DTML 4UIMB 2Y72A 4IJ3B 1HFUA 3PWVB 1U36A 3W7UA 2ICCA 5HHOB 4PY7B 1ZV5A 3PL6A 3BIAX 2OCCB 1JXJA 3VQ1C 4QDGA 5K9KA 4PJ5E 3QZWB 4A68A 1GZQA 3F6IA 4MKTA 5TE4L 1YEEH 4L29B 3ARUA 3CIQA 2Y07H 4HHGA 1LDSA 4LAJH 2GTZA 3NCJH 1P5UA 2IGFL 1MFBL 1YEIH 4XMPL 1WIUA 4JASA 3R66A 4WRLA 4K2UH 4PJAF 4DGIH 3QARA 4UUJA 2CJ3A 4ANWA 4Y9EA 5DVNA 3DUUB 2ZR2A 3MNWA 2V9QA 3JWNE 3MRDB 1S7UB 2Z91A 3ALWA 3GZQA 5D8JH 2XJKA 1JYXA 1KPVB 4O4JB 1A3RH 3F7LA 1RK7A 3EFFA 3GMLA 3UAFA 2X6AA 4BIZA 1P7KB 3T4AB 4KAQL 3QIBA 3CN4A 3OR7A 2VWEC 2K9FB 1T6VN 4QNPE 1W72L 1KJ2H 1PDKB 3HTLX 1YNTF 4AEFA 1X5HA 3D18A 1F3JA 4JG0L 4KV5F 4DP4X 3RDTC 3OMAB 4D7SA 1MZZA 4PY7A 2PNDA 3I6LD 4JAAA 4HZ3A 5LYJA 2X6BA 3DBXA 3L7EB 3SDXE 2ZE7A 3KWVA 3T2NL 5I26A 2CDFA 5EH1A 1JPTH 4OM1L 3BH8B 5E4EB 1JI1A 2E76C 5D7SH 2X4TB 1IKFL 1MJ8H 3G08B 4X6CF 3TA3C 5C0BE 1ZDQA 1UZGA 1XVSA 3LRSA 5T5NG 4QOKD 3QQXA 4DV0O 4TUOB 2NW2A 3OPZH 1K85A 4DEPB 1RZIB 3E6HB 3QUXB 4QT5A 2VOTA 4WKZB 3MYJB 3B40A 2FBJH 5IB4A 4AJYV 5HVHB 2IQAB 1MHEB 4GQQA 4GQRA 3T4AA 1WPBA 2BIHA 4ZKIA 3QVNA 2BO0A 3HHMA 4L48A 2D31A 2ZXGA 3KCXA 4BZ1L 1SYSA 3CDZA 2W95A 2H26B 1VA9A 2ISDA 4DXWA 4LDLB 5B1AB 1DCEA 4X7SL 4XC1H 2HJFA 2QDVA 2Q5BA 3FRUA 3L70H 1Z9PA 2MOGA 5D4IA 3VXSE 3C90A 3CWBH 3GMNA 3GNMH 4AV0A 3V5KB 2W5PA 2D03H 5I16A 3BUQA 3VW3H 1FORH 4LHUA 4LOFA 3WKNA 4NUJA 2D7OA 4NZDA 4F9LC 1E8ZA 4PAZA 4BJLA 4JR9L 3C5ZB 4W4LA 1IX2A 4XBEH 1AQHA 1EDHA 3BJ91 4H8WL 2EICA 3LEVH 1S5LZ 1LO0H 4LPUA 2CUGA 3GZPA 4CC4A 2A1WL 5CR8A 2EXSA 4A7GA 1IAIL 5G4OA 1CE6B 3ABUA 4PTUB 5GRUH 5HGAA 3NSFA 4LCWD 3L45A 1MHEA 3SEPA 4AX3A 1QQDB 5T33L 5A2FA 1Q72H 1K4DA 1A9BB 1RZ8B 4HP5A 5E8NB 5K9JL 1U8LB 1RUQH 4I0PB 1P84K 3DTXB 4Q9RL 2EDNA 3BUDA 2WLYA 3RPIB 1DTUA 1GPOL 3RX9A 1GKOA 4TS6A 5EN3A 4AH2B 4PJ7B 2H2PD 4X1KB 1B4TA 3RYIA 1E30A 4QKXB 5H37A 3KPMA 3MRPB 4K4KA 1GM9A 3RUGB 1J8SA 1JVOA 5C0ND 4I0XB 3BSZH 3F6LA 2WMPA 3JZYA 5F9WC 3IDXL 2UY7A 1Q0YH 1NSNL 1W0WB 4GIAA 4WCEV 3MV7D 5KMGA 3CSGA 1LEIA 2W9EH 2VLLA 3SDYL 1PL4A 4NKMB 3SKUD 4I3RL 3RVVD 1RZQA 4KXAA 4LL1A 4D9LH 3DYMA 1QR8A 1N12A 2NXYB 2VSKB 3DUSA 3EYFA 3ET9F 1A9BA 3PPEA 5E8NA 1QFWH 2DM2A 3MXWH 5DEZA 5E2VL 1GGIL 4JHUA 3DO7B 4M6NL 2ICEB 2J8UA 4P46A 2P5ED 3AABA 5DUJA 3FJTA 3Q4HB 3OMIB 4NTXA 2WKGA 2YRBA 4N0CC 3T3PE 1HHIB 4HJGB 1FL6B 2YD3A 2EEXA 4OKDA 4AXWB 1JK9B 3ZMUA 3TGXA 2EVIA 3HNVL 5IOPB 2NT0A 3JAKB 4LSQL 2WOBA 3US1A 4J6RH 4G42B 4DTGL 3ZHTA 1R6KA 1A6TB 1G1YA 4KX8A 4MVZA 4GKSB 1W0WA 3FQXB 3VSQA 2DBLL 4NHCH 1JZ2A 1H3VA 2VH5H 2YQBA 3IBEA 5D1XB 4AG4H 32C2A 2BSRA 2R69L 3RWRD 1OD9A 3VX0A 5KYYA 4X98A 5GSVB 4NXSA 4KU1A 1EO8H 5E6YA 4YDIL 1S5JA 3JYCA 2ADQB 2DLFH 2CIKB 3EDJA 1ZUQA 3HRZA 1LO4H 1OF0A 3FPYA 5BUGA 4F8PA 1V54C 4TVPE 3LNMB 1EN4A 2P8MB 4NO0B 1O7DC 5D1QA 3ZRFC 4U1HA 1RJLB 5HVFB 1THCA 2W9DL 4YS4A 5C92A 2J4WH 4AXWA 1JK9A 3H3BC 3TCLB 4FS0A 2VDRB 1MHPL 1P7QD 4NRXA 1XSOA 2SODB 4ZX5A 1EA9C 1DJXA 2YD7A 4P4KD 3EJUA 3M1BA 4UVBA 1LMIA 1TT6A 3MJ8B 3VU2A 5J1SC 3RI5F 1SOKA 4MMYB 4Q9CA 1TPXB 3EGXA 1T5XA 3REWB 4ZUVA 5KS9E 1XQ8A 2DQTH 2EULA 2C8NA 3E3QC 4UVCA 1Z7JA 3B5GA 3G9AB 4N24A 1OP3H 5I6OA 4NJ9H 3OQRA 2RA1A 3DXRA 3F7YC 4XO4A 3EG9B 4GAGL 3FK3A 2ZIOA 4TUJA 3TASA 2HG5B 5JNYA 4B53A 1VQ7V 4G6FB 1I85A 3EF4A 5KBKA 5DK0B 1IAOA 1WE5A 3BPZA 3E9UA 4NO0A 2VISB 1KXHA 1ZD6A 1K2DB 5E08L 1ZEAL 3NH7H 4LF9O 3GTVA 2VDQL 4FL4B 4E0RB 3CZEA 3CCEV 3K91A 1U4EA 4C57C 1WP8A 4D2NA 1NA8A 2Z31D 3ESOA 1YQ2A 1D5XA 1Q43A 4XO3A 1PSKH 5JYMA 3BQUA 1V7NL 2OSXA 1WIOA 3VFUB 2AK1H 2CRMA 2UUCO 3FT0A 4NQSA 4X6DF 3REWA 3FO2B 4NPJA 4O4HB 5MHSE 2O6CA 5JZ7D 2YD1A 2YKKA 3QG5A 4LFAO 3SOBH 1XUQA 2AHIA 3VBBA 2R29L 3EYSL 3ZQ9A 4AEEA 3A6OA 3TVMD 2YD2A 3QORC 2E8YA 1JYWA 1I8LA 1NGXB 1ORSA 4Y4HC 4PJIE 5ERWB 5DK0A 5A40E 4UZSA 2DQ6A 5D5PA 3CAFA 3QHFL 4OQTL 3MHHC 4IHJB 3L6FA 4LAQH 3OR6C 4E0RA 2BSKB 3AB0B 2NY2D 4DCQB 3CMAV 1PY0A 3RG1C 1JZJA 2RGSA 2ETWA 4M62H 1QBAA 4M1GH 4R7DA 1G7MB 1WJ3A 5IBLC 5DSCA 2DQ0A 2AEPL 2FZ3A 3NJVA 5C0AB 5TJWK 2DH3A 3G6JB 3KM2A 4FYQA 4MLIA 4OCLC 4QHMA 1T2JA 4QYAA 4S1SH 5B1JA 1YPZF 1U8NB 2C3XA 2FJGA 5CLZA 2ENJA 3HI5H 2LHAA 3PQYA 4XCCH 3VFTA 1BXAA 4ZSOA 4F7TA 4FYSA 1UPGA 2A79B 4X99A 5IBTL 3COOA 3OJDA 3MRGA 1XR9B 4PRNB 1NGXA 4H0LC 3RTQA 1WA8B 2ZD9A 2FATH 4BK4A 5I1JH 1A7PH 2JI2A 4W9JC 4P2QB 2Z7UA 3T71A 1CYWA 1QRNB 5IK3B 3CCQV 1LWHA 4U3XA 3MGOA 5MENA 2DTMH 1NKDA 2AANA 2CCLA 2PP8A 1ZAUA 3KAAA 4XH2B 5KS9A 4APQA 3CFDA 5LAXB 2PO6D 5MEPB 1MABG 5C3IA 5AOLA 1MSWD 2P7TA 1G8MA 1NPUA 5TE4H 2JJ1G 3HUJA 3V0DA 1VQ6V 1MELA 4NPYB 1U8NA 5J2UB 4J12A 2JIXA 2D0HA 4XMPH 3V0WH 1MFBH 1FLRL 1BQ0A 1MHHA 2VXUL 3QUZA 4MQTB 5IZ7A 3JTSB 4M43L 1I1AD 1QX1A 5CWSB 2X89D 3OGIB 1WA8A 2VLRA 3CC7V 4GRWE 5CSGA 2GHZA 5HGBA 3KXFD 3IMSA 1IC1A 3U0PB 2GTQA 3UG4A 4MJJA 3OGCC 2BNRD 1QRNA 5IK3A 4CNIB 4CU7A 5E5RB 5F21B 4FF9A 4KAQH 3RBSA 2DYRC 3TNNA 3NABH 2AHZA 4WHYH 1W72H 1SLUA 3ES6A 5JW5B 4YK4C 4ZOEA 3ULVH 1WICA 4I3SL 1VZIA 4JG0H 4ZMVA 5FKPB 4IKNA 3D07A 4JRXD 3OTFA 2XYBA 1KG0B 1OP3K 4RMTA 1WFIA 1AKJB 1ESOA 1NKGA 1OAYL 2CU9A 1H2KA 3G6AA 4NGHL 3T2NH 3JWOC 5HGDA 3BVWA 1VFBA 3LXUX 4OM1H 3RNQB 1SYVB 5J2UA 2CXGA 3DMMC 3KLHD 4YBLB 1IKFH 3UAJD 4Y4KB 3PJSA 2VJXA 4LVOC 8FABA 2H94A 2QTVA 4IBLT 3N41F 4MJIA 4NCC2 3P2BA 3IDMA 4CSSA 3ARFC 4EIGB 5LXVA 3L9BA 3SE4C 3F2LA 4A2HA 4DR3B 1CXLA 1GA2A 1LNQA 1M05A 4DPRA 2F0CA 3O45B 4C47A 4YGVB 4BZ1H 3O81A 4F8OA 3ULSA 3IJHB 4ZPVA 4ISVA 4FQJH 4MVUA 1J05B 4X7SH 4ECNA 2A4ZA 1FG2A 4AQ1B 1IGML 2FGZA 2BSCA 2V17L 1AKJA 2QPUA 2MCG1 4AYID 1OE1A 3RGBA 1I53A 2YBRA 4MJ2A 2EP6A 4PGBA 5JDSB 2HHHO 2Q76B 5E4AA 1KJVA 3KYOB 4JR9H 2QTEA 3ZJZA 1A64A 4H8WH 3I9AA 4P99A 4WEEA 4E9YA 4K3JL 1F90H 4MD4A 5KSVB 3LRGA 4DR5O 5F9AC 1K9TA 2GJ6E 4V1DA 2A1WH 3A24A 1IAIH 1JGIA 3N1PC 5DFAA 4J28A 5LBSL 3JT2A 1M6UA 2W81C 2PCFA 3K71A 2YAQA 3MUHL 3SE3A 4LP4A 3SYCA 3O45A 5T33H 2JMRA 4ZJ9A 1F11A 2AQ1A 3CZJA 3IJHA 2GUZA 3P69A 1HWYA 2P4AB 4YDLB 4UBDD 4EKXA 1K5NB 4H1LA 1GPOH 3DECA 3HCVB 5B3JF 3U7WL 4GUPB 2YS4A 5F97E 1NAKH 1WWBX 4JM4L 3CDFA 3BVNB 1KF9B 1QTYT 4ONHB 3EBAA 3TH3T 2Q76A 3QO0B 3WGVB 3UKMA 3KYOA 2DM7A 4U6HB 1ILUA 3OD3A 2DQCL 5GGUA 1OGSA 4L4VA 2XXMB 3FN0L 2FX9L 1NSNH 3SY0B 3VXQB 2C4FU 2P8LA 3H42L 1SUJA 3RYHB 3T3ME 1B3IA 4JFQB 5I1IL 3K6SA 4K71C 2KLTA 4I3RH 5F3BB 2ZDIC 3QIUC 4CH3A 5FYLD 5E2JA 3LNHA 3OVUB 1F3DH 1A6ZB 2ZKHL 1IBMO 1CCZA 4OZHE 1EUUA 2N56A 4R96A 1L9TA 4U1NB 5TDPB 2X4UA 1GGIH 1Z9SB 4M6NH 3V0FA 4H0IA 2GK0B 3HCVA 1I7UA 5HBBA 4HUXA 2QE7G 1IARB 4OPHA 1EBPA 1Q9LB 1PV0A 3B83A 2J1KA 3D39D 3HNVH 2EE3A 4EDXA 1N2RA 2M26A 3M45A 4LSQH 2HEPA 2CMRL 4HGWA 4DTGH 1JNHA 4OCSL 1P4RA 1FQ9C 3EW3B 2N05A 4W9IC 3QPKA 4WV1B 1JGEA 1TCRB 5AG8A 3ZL4H 2DBLH 2EE2A 2GITA 4RGNB 3SIKA 4ODSL 5IB5A 1QR4A 4XPFL 1DTOA 1BZKA 1UTDA 2GJJA 1H3WM 3A3YB 4IBQA 5JXAL 1KC5L 1KC8W 4YDIH 5HHVL 3BRGC 2JVUA 2AW2A 4WO4B 3MMEA 4O2BB 3FCTB 2UXBO 1CGUA 1VADA 2NYYC 4RQQA 5TDPA 3BAIA 3O8XB 4PJFB 5HHQA 1Z9SA 2AV1B 3VXNB 3UGXA 3ZE1B 3H7BA 2XXCB 1LWJA 1KYFA 2W9DH 5E1AC 3L5JA 5CD5C 3CUPB 2YIBD 1SJHB 3BP6B 1LP9B 1MHPH 1G9EA 3BZFB 4YIQA 1I7ZB 1XEDA 2BM3A 2GJ6A 3E8FA 1F00I 5D2NB 5EO0B 1F6LL 4HMCA 1JXFA 4GBXB 2DQFB 3HZVB 1AS8A 3L3IB 4D9RE 2ICES 1X6NA 4EFBA 2XWEA 3MBEC 4HUUB 4WY7L 2LW1A 5B7MA 5IESL 2DMHA 1JZ5A 1UT2A 3WTYA 3LOWA 1Z0MA 4UB6Z 2UZPA 2BIPA 1A4KB 5JJEB 1NBZA 1VKXA 2B15A 4M93C 4GAGH 4ES9A 4U1MB 4IRJC 1HOEA 3KPSB 1AI1L 3VU1A 4RWYL 4O2BA 1G9ML 2D0FA 3FCTA 4GKJB 3W38A 3VFMB 3CCHB 3LDCA 3HZMA 1TQBC 1JZ4A 3CFCL 4GG8B 3K79A 4KHPO 1ZEAH 5E08H 4GUQA 3PHQA 1OB1B 3G7TA 3KE0A 2VDQH 4L9DA 4OW6A 1SFHA 3EFOB 2UXTA 3BP6A 3BUPA 1TVBB 2PXYD 1FXKB 5DJAA 5IJ0B 1I7ZA 1MI5E 3STZA 2Q1EA 4B3MO 1IKNC 2K1MA 3DIVA 2GT9B 4JY5L 4Y8DC 4BGDA 5LG6A 2OMBA 3D69B 1V7NH 2E7CA 3PWLB 4OFVA 4OZFB 5F6HI 5ISZB 1YY9D 3MKKA 4F6EA 3JV5A 4BWWA 4U3FH 3WO4B 1HZLA 2QVIA 2F9BT 3EYSH 3HVNA 3QHTC 5DEJA 1TZIB 2YPKA 4K23L 1JNLL 3BN9C 3KPSA 4TV9B 1H15B 5GGSB 3HC0A 3U0TB 3SCMD 4HUMB 2Z8RA 4AJWA 1UEYA 4NO5B 4X4ME 3SDXF 2YDEA 1F3RB 5C0CE 2FH6A 3QHFH 4OQTH 3T6XA 4FNTA 3RJQB 4F7PA 3MNVA 4JHVA 1OM3L 4MQXD 5E5LA 4LESA 1HILB 4P23A 1ROWA 3QXUA 4MCYA 3FYIB 5AZ2L 3WE1A 1F4MA 1U8QA 5D7IF 2EXYD 4ELKA 4AIOA 2OS7A 1ZLZA 3D69A 1OJHA 3BUYA 3LNEA 4WU7B 3AUWB 5AZEL 4WI9A 5GSRB 2AEPH 5BVJB 1ETA1 2DEWX 1R5VA 2UZXB 2YD4A 5ISZA 4DKDC 4I7ZB 4L4JA 4DKAA 4YHML 5GRXG 3ATEA 2IM9A 2HKOA 4FJYA 4G6ML 4P3CL 5J6SA 3FTYA 3PAUA 5DEGB 4AV4A 2VAAA 2WKOA 4MXQD 4XDJA 3K74B 5LXTA 3C09C 5IBTH 5GGSA 5LG1A 4LQ1A 3V0VB 3VI4A 5F1NB 2DH2A 2OCFD 5DC4B 3D3QA 4ELME 3CX5J 5L4JA 4FM0A 3QEQD 2BP5M 3ZHLA 1NQTA 4LKXB 3C6LA 4DP1X 1GZHA 4GS7C 1EFXA 5F7UA 5GZND 5C93A 2MCPL 5BOJA 4XXCA 4JO8A 4DW2L 1FAIL 3KL3A 1OWRM 1NL0L 1QWHA 3K58A 4X1YB 2ZKYA 3NAAL 4OF6A 3CLFH 1I3VA 4X6FB 5DRNB 5GSRA 3E22B 4MQSB 4NN5B 5DJ2B 3TETA 5DWUL 3A4AA 2OI9C 4WFFE 5FX3A 5DD6B 4Z7QE 2Q7YA 1KTCA 3C9NB 2A6JA 3WG7C 3WB1A 2KLRA 4NNYA 4I2XB 4W4OA 3FTWA 3E7JA 5FM4A 3UC2A 5B7FA 2VC2B 1FLRH 3BKJL 5FDYA 2VXUH 1HWGB 5C08A 2Y7MA 3VE0A 3VFOA 4M43H 4GRLD 2NUTB 3U4AA 3OPUA 4H0GA 4EN3B 3V0EA 1IAKA 4R7LA 4KK8D 2H0JA 3I50L 1PKQA 3VAEA 1I0HA 3BCFA 2A2QT 1LO5A 3DYOA 5BRZB 1Y0LA 1TTUA 4PRPD 2BNQB 3W2DL 1W0VA 4TLTA 2IG2L 2UU9O 1KLFB 4PRAB 3HW7A 3D0AA 3DUHA 3MRIB 1R3HB 4I3SH 2PI5A 1DHKA 4E2LA 1PU0A 3EJYC 4C56B 2RJZA 4F33A 3HZ3A 4FLOA 1OAYH 4F2MB 3ESPA 4NGHH 4BRVA 1T66D 1TZOA 2ZYHA 4MHHI 4MHHG 4WJG3 3T4ZA 3JWNG 1QW9A 2BW5A 1IGJA 2E7LA 3IEAA 3QPQC 3STLA 4IIQB 4F92B 1R3KB 3TCUA 1CU4L 5LN8A 2PUSA 4AENB 2PPCA 1HHJB 4PS4L 3LPWA 4KK5D 2CAZC 1RJYB 5AW8B 3T3PF 3VJ6B 4C54A 5C2UB 1NC4D 1IIKA 1U8OB 3CC5A 2FTAA 2JKTM 1Y07A 4BZ2H 2W59A 1C7TA 2GB2A 1KB9K 2BNQA 3K72A 4QAWA 1T6WA 4HUVA 4JI8O 5F7DB 1OARL 2CQVA 5F8RC 1KLFA 35C8L 3P4MB 2HVKA 4PRAA 4LIQL 4Z8FL 1TJXA 4GSRA 3QZOA 1E3ZA 1S5IL 4Y7OC 5ID1A 1JYVA 1IGMH 1Q0XL 1JRHL 3QQDB 2V17H 4NQEB 3ZKND 5BS0E 2YI9A 3EAKA 3OV6A 5I6MA 1CDYA 5JIMA 1J8HB 5E9AA 3ZHDA 2PGGA 4X7DC 1K8DA 3PV6A 4ELMA 1A21A 2K9UA 4IKJA 1IZKA 1Y66A 2IAMC 2Y1ZA 4K3JH 5CBAB 4FLTA 2W8CA 1Q38A 1HHJA 4NI6A 4HG4J 5ADPL 4AGLA 4PD4F 4MJ4A 1PFCA 5E0FA 5LBSH 4R3SB 1ZHBB 3FOMB 2BNUB 2XICA 4RO2A 4G27B 2YGVA 4WI8A 2BHUA 4MJ5A 4PJAB 4QYOB 3LQMA 3FD9A 4ZNEE 1QLRB 1NIBA 3UTQA 2KB1A 1SXNA 1M9SA 5DTFB 4PJBA 4JFDA 3AT9A 2XN9E 4PJHA 4R97C 3U7WH 2X0UA 2Q2EB 4N2EA 4E9RA 3NCYP 1PZ5A 5CA3A 3KCPA 3QDGE 4NUQA 1YMME 2RN9A 3EZJB 3ZUNC 1YNTB 3N0AA 4OF3A 4P3WA 2GIMA 3FXIC 2DQCH 1EEYB 5KSBF 3UGUA 1S7QA 1YUHB 1IM9D 3FN0H 5LBQA 1G6UA 2E8ZA 4ICGA 3ME0B 5I17B 2W91A 5FUZL 1IVTA 3H42H 5F7AA 1QLEL 3HC2A 3QWOB 5I1IH 2O6DA 4JO3L 4Q6IB 2JVDA 2AJXL 4JRYD 1XCQA 5KZCD 1UACL 3IAYA 2E3CA 1FPOA 2H1LM 3AXLA 1GC1L 3SDCB 1LMKA 1F86A 2ZKHH 2LV4A 4QYOA 4PRHD 1SA0A 3QJSB 2XCMC 4RFNB 1BHAA 2GG1A 3JV0A 4ZMLA 1X5IA 2R1YA 1M1XB 5FHBL 4E42B 2V6HA 4GG6E 4OLEA 5EZIL 1FFPB 3U4KA 2XT1B 4KX7A 1ML0A 5D70H 3MRMB 5DVOA 2DQJL 4FZEL 4PJ9D 1KWKA 2XV2A 1PQZB 1FXHA 2KKWA 1E28A 3WENA 3SQOL 3X12B 1Z9NA 2ADYA 4PA9A 2E27H 4PS7A 4OCSH 5I0VA 5HYQB 1WB8A 3PL6C 3Q5OA 4OLZL 1YUHA 1ZT1A 1XD0A 3NK3A 1F5WA 3OAUL 4LFHD 4UQCA 4RDBA 2QMKA 2A3QA 1A3LL 3MODL 4ODSH 5HGHA 4B0MM 3I3DA 1OANA 4J1UB 4HKBB 1TNMA 2OXGB 4RMVA 4O2AA 1C8PA 5JXAH 3JVFC 1KC5H 1P5UC 4X6CA 5HHVH 2K6ZA 1B4JL 2ETNA 1X4YA 2C9AA 3BW9B 3I6GB 5I74C 5BS0A 4UUJC 3ULUC 5BOZG 2EIBA 1U3HA 3FT4A 5CEZE 3BP7A 1KGCE 4GLXA 1PZAA 2FTKA 5J57B 3IDJB 2Q7AA 3AJ7A 3IM1A 4OJDH 3MHSC 1PYWB 2D2CB 3QIBC 3S5LA 2PYFA 3OR7C 2C26A 4F37K 1RHHB 1CVRA 3DO7A 2R4SL 4HC1A 1PQZA 3GXFA 4FA8A 3JTTA 4TL4A 3CYOA 3EXJA 2E3VA 5JVDB 2SEBA 4MZ2A 3N2JA 4JZJB 5FYLH 3S97C 2OCCC 1IJNA 1REIA 3BZEB 1QSEE 5CSBA 4WHCA 3MRFA 1OQOA 4ZNEA 4F6RB 2Q0ZX 3FT3A 2AMUA 4DGYH 3TIEA 4LPWA 1SFDA 2XRAH 4DH2A 2XN9A 2E7HA 3I6GA 4RWYH 3H56A 3K03A 1AI1H 3LQAC 1G9MH 4L3EE 2UXCO 2YUVA 3LKRA 1DVFD 4NQCD 1VQKV 3CFCH 1BVKB 1N8RW 1ED3B 3M8AA 1I3UA 5CP7A 2OMZA 2ZOUA 3N2GB 3CVDA 2FH8A 4ZUWB 1K33A 4DESA 3T4AC 3F3HA 5DJ8A 3P9LB 5FF6B 3TYGL 4YIPA 1L9PA 2QELA 3NYKA 5IB2B 4MA3A 2Q8BL 4JQVA 4X5LA 4XBGA 1FJ1A 4JY5H 2OCJA 1KV7A 1WC7B 1HH9A 1Q6UA 1WBXA 3D25B 3TBTA 2HJFC 1SBSH 4GRWF 4RETB 4RZCA 4A04A 3K57A 3TH2T 5T8IA 3OF6D 2DLHA 4K7FB 4F6RA 1ID2A 4ABVA 2YKLL 1FIGL 4DRXB 1MCJA 1KUQA 2NYKA 3TBBA 4K23H 4B9CA 5C8JA 3PP4L 4N8VG 3L95B 5HDBE 4GO6B 4CC4C 2OYQA 3FZUC 4NKDB 2IPKB 4AYGA 4ZNCD 3LDEA 1LK2B 3WN5A 3ZRVA 5D1ZD 1Z5LB 1NGZB 3U6RB 1OM3H 5K1PA 3V8OA 3B7TA 4IOFD 2ZCZA 4JM2F 1S9XB 3VGDA 3RTLA 3ZLQC 5FF6A 1K4DC 3TBWA 5IV2A 4JO1L 4DR2B 3D87B 4G9FE 1TEYA 2IXQB 1L9OA 5B1AC 2VLME 5SWSE 3OZKA 5AZEH 5F2FA 4E41B 4O02L 3P73A 1KB5B 5DJXA 5BMVB 5IY5B 4A7UA 2IH8A 4YHMH 4YY3O 1I8KB 2Y9RT 4R2GD 3TJPA 4GLRI 4HFWB 2H9GA 4E5XG 3II2A 1GL4B 4G6MH 1JDAA 1YDPB 3HBQA 4P3CH 5F3FA 4TNWF 1PX3A 4DRXA 1UXWA 3OAYH 3OZLA 4DV4O 4HWZA 5T1MB 3ULVE 4P9PA 3FQNB 3BUBA 4XWOC 3WLBA 2JDIG 2HR3A 3L71H 2MOVA 3MFGB 3N40F 3B37A 4TULH 3W7SA 3DRTB 1E9PB 1DQDL 4PHZA 4KOCA 1QFWM 2J5WA 2IPKA 3EJPA 1PP9H 1X5ZA 4H20H 4TQHA 3LYRA 3SKOB 1LK2A 4Y9CA 1MCWM 2WAMA 1MUJB 1Z5LA 3MGAA 1BX2B 3RWCA 3ZHVA 2C1OB 2EAEA 3MV8D 4X9HA 2MCPH 4XMXA 1SOQA 4HNAA 1GGYA 4PFEA 1FAIH 2F43G 4MSWB 2FIKA 4DW2H 2XTSA 3JUYA 3TIDB 1NL0H 1XGQB 3QA3B 2OL3B 4I9WA 1EFQA 3NAAH 2PPEA 5LNGA 4J27A 4P46C 3PCYA 3QHZL 5DWUH 4JYAO 4AITA 2Y4UA 2UZYB 4L3EA 4NZTH 1P4BL 2HWZL 3GMMB 5TH2B 3VGHA 3MRBB 3AG3C 2ODHA 3NUKA 3RIAK 3T0WA 3LSQA 2APTA 2Y1VA 1EXUB 1UQSA 4FULA 3GI8L 1VCBC 2OULB 4JJ5A 4X6DB 5GS1B 1QRKA 2C9SA 4QKTA 1L6ZA 3I50H 4XMUA 2D4DA 1RJZB 2HMIC 1BGYH 2W88A 2AXFB 3C60B 2G5BB 2QM4A 3W2DH 1BX2A 3ZGIA 4LF9B 1P1ZA 2GSGB 4P5SA 3IGAB 4OV5A 1GYAA 3HRZC 2H8PB 4KROD 1HH6B 3ML9A 2P90A 1U0QA 1WA1X 4PSRA 2QGEA 3B5HA 4UCOA 3HS0A 3MN8A 3N50A 5D1QC 4MDJA 4DQAA 2RBLA 4MMXB 5BZXA 1TYJA 4HPOL 8PAZA 1N0XL 3I6LE 2UZYA 5JHDB 5JDJA 4OGXL 3SKNB 1FYTE 4O2CB 3MRBA 1I1CA 1CICD 1BZ9A 3IPFA 3DPBB 5JQGB 4A2DA 2VABA 1YYML 1Z1WA 1CU4H 4RRPA 1OTUC 5SWZA 4PS4H 5EOTB 1L9QA 2BHFA 5T3XE 1NT2B 4OVUA 4G9FA 5DQDH 1RJZA 4QOKE 5A16B 4HFUL 4HXBL 2WXPA 2AXFA 5JCOA 2G5BA 4WUUD 5CU9A 1D9KA 1IGCL 5D71L 4IS6A 4KDVA 1WP6A 2FHCA 3IE4A 3MU3A 1DBKL 1OARH 3IGAA 4P06A 35C8H 1HXMB 4XAKD 4TTGA 1YSCA 1I85C 1XNQO 2LTQB 2FO8A 2JNZA 1AR1D 4JQXA 4LU5L 1S5IH 4EEQA 3B9KD 1N8ZA 2X40A 3B8SA 5DVPA 5BMFL 1J5OL 1IBKO 1XZ0B 4IHOA 1M7UA 5AB2A 2I25N 3GSRA 4NZFA 1YLBB 1HVXA 3U82B 2IJIA 4QTHA 1UCTA 3O4LB 4F58L 1CDCA 1FFOA 3T1YO 1WUZA 4G7YL 5DJYA 5JQGA 2X3CA 3FB8B 3QH3B 1JNNL 3BQUC 1U3NA 3RVWC 5IROD 4NQDD 3V5HB 3VXPB 3FU7B 2YBGA 4Z78A 1I8IA 1P7HL 1TPXC 1U8IB 1ZMYA 4NLHA 3SKMA 5ADPH 4KI5D 4F7EA 4X4YA 5BO0D 1YPZA 2AAVA 2JXMB 3DGCR 1ZL8A 1H6EA 4QRBA 3UMTA 3VWKB 2A9DA 1U8PA 2CLZB 1UD3A 3ZN6A 1JTOA 4B3SO 3CCJV 1KN2L 2B5UA 1BIHA 3GC3A 4LCWE 1ZPLA 1T7VA 3IWVA 1DJGA 3FFQA 1I8LC 3HNTL 1KGUA 2BP8A 2FK9A 2NNCA 2WBJA 5DHVH 3CU7A 4WFAV 5DK2A 3B8NA 4CKVX 2IOMA 3ZTJG 1HZHL 1CPUA 3OAYK 5I76B 2P26A 4LCUB 1C5DB 5BY1A 1F0LA 4HUWB 2Y7QA 4ODBD 4L4TD 2OPCA 4J4PD 5EO9B 3DTDA 5DYOA 5IQLA 2HTKC 4U3CA 4WF7A 2YUZA 1JI2A 1VEWA 3O4LA 2V5YA 3QFDA 1E5ZA 2HTLC 4JFEB 2X4NB 4PLOB 4Y4FB 3D6GA 5EF0A 4EOWL 4BFEA 5LP6A 1ZRUA 3ETQA 4L8BB 1ZT4A 3V5HA 1JWMA 5BZBA 1PZCA 4JZGA 3VXPA 1BJ1J 5FUZH 5FCUL 4BFBD 5F9JA 1YI2V 2XU9A 1QLEH 1HHGB 5B1JC 4LFBO 1JZDC 3ILPB 4JO3H 3N1FC 5DS8A 3MV7E 5IIEB 1N3NB 2KQMA 3ARGB 5JXED 1UACH 4YNYB 2OR9L 3WKML 1X6LA 3MLZH 1O7VA 1J95A 2Y5EA 1GC1H 1YEHL 1EIBA 2FT7A 3VFSB 4XOAA 3N41B 4MGXA 1TG8A 3NIGF 3CFKB 3D9AL 4Y5VA 3F7VA 3RTQC 2W80C 1MH5B 3L2LA 1FYTA 5KVFE 4GP8B 3FTGB 1NEZA 5FHBH 3ZMTA 3T9WA 1V3KA 1G87A 2A9BA 3TXQA 5EZIH 1FO0A 2E6QA 3WNNA 1ITCA 2P5EE 3EOAA 3TZVD 3NFPA 1XSJA 2DQJH 2DQ3A 3B3IB 3CFBB 4FZEH 4RIRA 4HEPG 5CMAA 2F7RA 4HSCX 1S72V 3SQOH 2X4NA 2E9BA 3GLZA 4APQC 4BUHA 5ADOH 3KLQA 1OZUA 3LKOB 1VQ9V 3NVQA 1N8OE 1USQA 4JPWL 4GI8A 2VXVL 1FL3A 1IAMA 4DKFL 2P7TC 3OAUH 2N59A 1WAAE 1ZV9A 4URKA 1A3LH 3MODH 4D0DB 1E1RG 4XP9L 5EOCJ 3ILPA 3TBSB 2OMNA 2AQRA 3EUDA 3F5WB 1SQFA 1NM4A 3DIFB 1WA2X 3DX9A 1E5CA 5C09D 5DVLA 4YDVA 4UCVA 4EB6B 3QUZC 4JHZA 4L8DA 3SDAD 1XREA 4WKXA 2BWQA 1XMWA 5T5FA 4XCNB 1S9KC 3CFKA 1HNYA 4AZ8B 1HYSC 1MH5A 1ONQB 1NVPD 1S5HB 4YHZL 2CLRB 1RP9A 2DMBA 3FTGA 5AAPA 4OGYL 2IFFL 2HJLA 3LIZL 3WTSA 3JD3A 3OEHG 4EIZC 1NFDB 5E9NA 3OLDA 2R4SH 3UP1A 3OZ9L 3CDCA 5F1SA 2VDOL 5BCAA 3ABMB 1XCXA 5E8DL 4LEEA 1UZ6E 1YCSA 4KXZI 3WS3B 2HHHB 3Q2CA 5FYJL 2YQ3A 1UXLA 3EHBD 4GKLA 1DQQB 1YHQV 3FUEA 1T04A 2CO4A 4N25A 3SQBA 2C3GA 4Q2ZB 3RJOA 3KS0H 3DV6A 2YICA 3TBYA 2VT0A 1QHPA 5FO7B 4HCGA 4D7PA 4ZZFA 1IGYB 1IZ3A 1CGTA 3PIQA 4GAJL 1F4YH 3WFCL 1ONQA 4MJHA 3M7FB 3DC5A 1WBYA 3EYUL 1U6AL 4IK7A 2X38A 2G2NA 3RA7L 4CC0A 2OTPA 3TYGH 2YAEA 3K2KA 3H1LH 2X1PA 4MA8L 5DRXB 1K34A 1JDCA 4BK8A 3VRIA 4FLXA 3WELA 5AD0B 2Z65C 1ZWIA 1S76D 2IH3A 1BQSA 4MNQB 4JI4O 2HLAB 3MJ7A 4QGYA 4XX1E 4CRPA 1CDBA 2XQYK 5D7EA 3CN1A 1ZGLM 1JJUA 1TCMA 4O4LB 3FFCD 2O6PA 4UU9B 3PF2A 3H9SA 5FGSA 5FO9B 1FIGH 1IAIM 4OR1A 1W8EA 1FGNL 2Y3NA 2OJEB 4QXTB 2HVJB 1X5KA 1GW6A 2J57A 4LXFA 2Y6TE 2F6AA 4KRPC 1DBAL 3I02B 2H7WA 4FFZL 1EX0A 4S11A 5L3GA 3SPHA 5AYUL 3SE3C 5BZWA 1VZHA 2VN4A 3CZFB 4OLYL 4N0YL 1L5GB 3WTWA 1P7GA 2ESVE 4YQXH 3X14A 4FQHA 4DR6B 1C08B 2VW7A 3RWIB 3TA3D 1R47A 4XVSL 2MQCA 4KWUA 2K4WA 5FLXN 2VLKE 2A6DB 2XIBA 4O02H 3BFRA 1L3NA 2C1PA 1NH2D 2WWWA 1JZFA 1X59A 3M8OL 4W4KA 4YO0A 1FNEB 1RD6A 2KUTA 4HIIA 3B2MA 3KEDA 3IJ4A 4JQIL 4WFED 1ZA3A 4IU3A 2CXKA 4PBVC 1VQLV 2ADGB 4N8PA 3MZGB 1S9YB 3CV5A 4LSTL 5IWLA 1NR7A 1DQDH 4LF3B 4WWPA 3HB3C 4JW3A 3P9WB 3ZL1A 1GS6X 4XNMB 4LNRB 3PDOB 5L2JB 3SYOA 5I8EB 3HE7A 3ECBB 3DVIA 3P4OB 1F42A 2JTDA 4N9GA 1J0JA 3CZFA 4WLCA 2CR3A 1MREL 1MG2C 1I94O 4AYEC 1RPKA 1SOXA 2VXTH 5C0IA 2V2WA 1OO2A 4TQIA 5IF0B 4EI0A 1R75A 3CVHB 2A6IB 4NRZB 4NYLA 3QHZH 4GW4A 3C87A 1HEZA 3JV4A 3W9DB 2WHVA 4TPRL 2G5UA 2YIDA 1KCVL 1Y1UA 5CIPH 2XAFA 4FFBA 2R9AA 1NCTA 2IFGA 3VE0B 4QRPD 1NCOA 3FHAA 4ZI7B 2I24N 4YFDB 1E6OL 4PGEA 2A38A 1W6WA 1O6SB 3QQ3B 3GSNL 2ED6A 1YVWA 2VQTA 3UOAB 1CD0A 3GI8H 2OJZL 2YK1L 3C3SA 4UDUB 3D4YA 3WCYA 4LF3A 4X5PA 1UOWA 5C0DA 1HHKA 3CN0A 2IH1A 3PDOA 3DVGB 1PZBA 3LZNA 5AZUA 5AUMA 1HHHA 1F18A 2EVGA 2KLSA 4YH6A 3KXFE 3TN0B 1VCAA 2BZ7A 4Z3IA 3V4PL 2H45A 1P4UA 1IDSA 2BNRE 4HKZA 4H5SA 3RIFK 3MPCA 3VFRA 2EH7L 3SDXB 1H3UA 4MTMA 1K5SA 2NNUA 4YAQA 4B3MB 2XSKA 2ZCHL 3F83A 4HPOH 5CBEA 4DKTA 4NRZA 4JRXE 1N0XH 4ZX4A 4JFSA 3BY6A 3LRHA 4O51B 4Y2LA 1KCSL 1DBML 1QW8A 2EEFA 2X28A 4WSKA 1YMHA 5C0BB 3QDMD 4JPIA 1O6SA 3BI9X 4UAOB 5EIVA 2QSQA 2BZCA 3NSCA 1BLNB 1YYMH 5IVXE 4NDMA 4HIPA 2ATKB 3P30L 4D0CB 2A9ML 1JWUA 1R19A 3A4EA 4RGNC 1ZHNB 1TQVA 2ESVA 4KQ0A 5FO8B 2LQTA 3GSWB 1A0QL 2J7LA 2WUBL 4HFUH 4HXBH 4N0CD 5F6HJ 5I73C 3MRLB 5I1CL 1IGCH 5D71H 3LIUA 2LE9A 3AT0A 1DBKH 3ZGHA 4CADA 4JRFA 1AZUA 1VB9A 5JWPA 3VXSB 5CJ5A 3SSGA 4FTVD 4GXUM 4LU5H 4TSCH 5F70A 5BMFH 3BAJA 3G71V 3WDHA 4XNZC 1NUDA 1G4YB 1MLCA 1Z3RA 2FECL 4PRBA 3D2UB 4GKNA 4TSAL 3JAWB 3NJXA 3STZC 4F58H 5BV7L 5D7IA 4Y2DA 4PCYA 3BAXA 4G7YH 1OSPH 4J23A 4NFDA 3QJFA 1JNNH 2DKSA 1PNDA 1Z2GA 1BZQK 4AGMA 2IIJA 5C8YB 1BAWA 2FR4B 2X6VA 4I4WB 1TGOA 2D73A 1S7VB 2D7TL 3IJEB 1HDMB 2ZCKL 1XGUB 3IS1X 4QUOA 3R18A 4GIOA 3DOSB 3FF8A 4E9XA 3TV8A 3F7KA 1B0GB 1N5AA 4PB0L 1W9XA 3HNTH 3B2DC 1XGZA 4GSUA 5MP6L 5A2IH 1BSMA 4IBUA 2W0LA 1FVEB 1QFWI 4P4RA 4POUB 1JHTA 5B4MC 5H35A 3BESR 5IMMA 2VNCA 4PSPA 2QPEB 2LAGB 1VEOA 3LNIA 4JPQA 1QAWA 1M6OA 4P23C 4WK2B 1GR7A 1KTJA 2QEXV 4NO3B 4KTEH 4O5LL 4EOWH 4HW6A 4DSYA 5IJVB 3C8KB 4JJOA 4N2BA 2DS4A 2AXGA 4AKQA 1U8KB 1NTMH 1YHPA 4J3OD 4M5ZL 1QFUH 5FCUH 5BO1L 2APFA 4JN2A 1C12B 2EDTA 3RGVA 3MZTA 2ZUWA 4P9OA 2UX7A 3D08A 4EF3A 1SXZA 3WKMH 3IWUA 3FRPA 5GGTL 3G5VA 4HX1A 1YEHH 2AQTA 7CGTA 1J87A 2XI9A 4RAUB 5FYLE 2OYMA 1GJWA 3D9AH 3T3PB 2EYRB 4PJEF 1FVEA 2ERJB 1C9SA 3CP1A 3C6LC 1N10A 1ZVHA 4YHIB 1GZHC 2RIKA 1ROPA 4QR7A 1MVFA 4LLYA 3B9DA 3N85L 4P49A 4XXCC 3D39E 1MSPA 5HDBF 3CE2A 1NFAA 4NO3A 2WAQA 5LKNA 2EADA 4OLXH 3QORD 1BDYA 5T1KD 3M6DA 4YHHO 3L5HA 4Y4HD 1ASOA 1UJ3B 1GIGH 4YL9A 3CBJB 4XP9H 3IDIB 4XWGL 5AYTA 5B38A 1WO2A 3BKCL 3GXPA 4W4OC 2WWNA 4P2YA 3VNZA 1JOIA 2GSMB 4P2ZA 2WNXA 2I27N 5FOBA 4NVPA 1BHBA 1KECA 4MB5A 3BEWB 3WU1A 2J12B 3GJEA 3F05A 1JTTA 3V6FA 2XQBH 1YAIA 4HD9A 4OGYH 5IBLD 1NICA 2AK4D 1BM3L 2IFFH 3LIZH 4YHIA 4N0UE 4DJMA 4HCRL 3ZTDC 4ETQA 1COBA 2F8IA 5J6GA 2CUMA 4UYQA 1A1MB 1NBCA 2ZOKA 1WS8A 3VWJB 5K5YA 4J39A 1UB5B 5KVGH 1PKXA 1AD9A 2VDOH 3UG3A 5E8DH 4HBNA 2X4RA 3ZDXE 4YXKL 1DQTA 5C2BL 2H32B 3BPCA 1JZ6A 1DL7L 5CCJA 3Q01A 4NN5C 5IMOB 3T8VA 3UTPD 4I89A 3LQZB 5F1IB 4GXFA 3IBOA 4J6IA 3V6ZA 1C16A 1JZEA 1CXHA 4LLAA 5IWAO 5L2KE 2IAND 2CH7B 3SGJA 2E7LC 4JI0B 2FYYA 4HJJL 2JE8A 3STLC 5PAZA 3KCYA 1YEDB 1HCZA 4WFGD 5KSBB 4Z5RB 5JMOC 5L9DL 3WFCH 4N8VB 4FM1A 3BEWA 3CE1A 3LN5A 3KL0A 4G6AC 4PA7A 4JZOB 1W80A 2ALAA 4YJ3B 3I6KA 4G11A 5C7XH 1CD1A 1JV5B 3EYUH 3T4YB 1U6AH 3D4ZA 1NAMB 3MRKB 4LF4O 3RA7H 3JALB 2M83A 3ML8A 4UT9L 2E74B 5FC9A 5I1LA 3ZRWA 3S34L 4MA8H 43CAA 1PZ2A 4QRRE 4U1GC 3T0BA 3DARA 3X2QC 2HVKC 1E3XA 1CQYA 3N0PB 1XI1A 1AGBA 3EDFA 3GFUA 4JN1L 3AFLA 5ENWB 1VARA 1KELL 1XXDC 2OZ4L 1UXSA 2QQNL 3ESUF 2QDWA 1AHWB 1JFHA 3D12B 4HISA 3ARZA 3QAZB 5ABAA 3RZWA 4UAHA 3GRGA 4DO5A 4CW1A 1QSZA 4E5XB 3CNKA 2YD5A 4Q2ZA 1YCIA 4O2FA 1FGNH 4M48H 2IWKA 1F2QA 4MS8C 5KSBA 4Z5RA 4UNUA 5CZKA 2EDOA 2WWKT 1MCFA 4WF9V 1VDGA 5D9SA 4Y19D 4YJ3A 1DBAH 1IC4L 4FFZH 3QRLA 4YLQT 4U1IB 1UEMA 4XCEA 4PTTA 4N0YH 2XY2A 4H8VA 1AJ7L 3DMMD 2WLZA 4Y1TA 4F15C 4U7OA 1UHVA 4XVSH 1NDGB 3QFGA 4IKLA 5ENWA 3VXRE 4ADIA 1Q94A 4M8UA 5EEWA 5E6UB 2ZKXA 2FNWA 2A3TA 1RU9L 3MRHB 3ARFD 5J9PB 2HYMA 5JW3L 1YSOA 1I3RB 1Q9WB 1CFQB 4KDTA 1E9QA 2CCWA 1JMZA 4JQIH 3O0RL 3O3AB 3R06B 5DM6V 2NXZB 5TD4A 1M2VB 2H0FA 2DYPD 4N2DA 2JI3A 4LSTH 1IILE 1QI3A 4YC2B 3GLAA 2GSIB 1D5BB 4P5KA 4TMPA 1X7TA 1U8CB 3NGBC 4GKZB 2R7EA 1T7XA 3L16A 5DCCA 5E8OA 5HJDA 5LCVA 4L3CB 4D0BA 1AGCB 3T1FB 3HG1A 3QEQE 2J3SA 4M02A 4MX7B 4N20A 2WSDA 5KANG 1G1CA 2L04A 1MREH 5DI8B 2JKXA 4U6VH 3U9UA 5F6IB 2XWBB 1M7IB 4HJSA 3LEXA 3K2IA 3PYCA 5BJTB 4X9FA 4GW1B 3QWNA 4GI6A 2FL5B 4WHYG 4A2LA 2HSIA 4TPRH 5IHLB 1KCVH 3T8XA 2V8MA 1U8HA 2VRAA 3WDJA 4NXNB 2YFOA 3OB0H 2NX5D 4P57A 3AGVA 1E6OH 1SXCA 1BZEA 4KK6C 3GBLA 1A7RL 2PTVA 1GZPA 2OM5A 5DMYA 4GRWB 1M2VA 3CZKA 3GJFA 3JWOL 5EC2A 3J7AU 2AVFA 1MWAL 2OJZH 2YK1H 4L1SA 3D4CA 3V6OA 3WEOA 4E2OA 1INEL 4FFKA 4GAAA 5CN0A 1D5BA 4PMFA 3VXUE 4R7XA 1Z2KA 5BR8B 4QRRA 3QCTL 3CRAA 3FBKA 4GKZA 4EXPX 5C0EB 3GUTA 3ASNB 4XZUB 2ORBL 1FVDB 4L3CA 1WS7A 5I71B 1S7TB 4YBHA 4JG9A 1KCLA 3V4PH 4DZBA 4JDVB 4PRPE 2JB5L 4K3HA 4JTDB 4IHBA 4X0KB 1U3HC 2GI0A 2EH7H 2KG7B 3P40A 4LC1A 1XQ4A 2E9GA 2XIDA 2ZCHH 2X2JA 4PD4J 5C0FA 1OSZA 1D7DA 3BPOC 3QULB 4ZO7A 4JM2B 4FHBD 4XHJC 1M57C 2YA2A 3IT8D 1DBMH 5TFSL 2BTQB 3QIUD 3KBHE 4LF7O 4LEXL 3BXNA 1IEBB 1DVTA 5C3TA 3V9EA 5EC1A 1RZPA 2ZOLB 2BP0B 4XPTL 1BFVL 2YEQA 3HRPA 3JTBA 1RLWA 3PNRB 3G5ZA 3MUJA 3HMWH 5HHPB 4OFYA 3OJ2C 5IMLB 1DQML 1KBWA 3DXAD 5C0EA 4H0HB 2ZNXA 4XOBA 1FVDA 3KPQA 4AC2A 4HQQL 2CJSA 2P5WD 4L1LA 5I1CH 5IQMA 1IAII 2VE6A 2VWKA 3VXRA 1Y18B 2CDEA 3QFJD 4WWKB 2Y4SA 3K8LA 1MDAA 2XUWA 4ABUA 2HFGL 3DDGA 1BEYL 5CHNA 2KG7A 2NDFA 2F4VO 5H5NA 3FN3A 3J2PA 3AG4C 1K7DA 3BSHA 4OGQC 1O5PA 2YWYA 3QULA 3WUZA 3UZQA 4LLMB 3LH9A 2Z7WA 3FTUA 3G5YB 4JM2A 3ZKQD 1OF2B 3I84A 2PABA 2MIZA 3QDJA 2ATAA 1KB9F 2UYLB 5BV7H 4YY3B 2BTQA 2QKAA 2OQJA 3O3UN 4IOSD 4JQVC 4Q58C 3MKGA 4XPAL 3UBHA 4LLVB 2CPCA 2HLFD 3GZKA 3S37L 5BRQA 3SHSA 4EN2A 2VDLL 3WY3A 1MXDA 5D7LE 4UM9D 1G9NC 3VH8G 2NYYD 2ZOLA 5LDUA 3TESA 1IGTA 4GMSL 1X5FA 5IJDC 2JKSA 4G7VH 4JANB 2D7TH 1XCWA 2UXVA 2I26N 2RD0A 2ZCKH 4G9DB 5CD5D 3VTTA 3EH4B 2OTJV 3BWUF 3MLSL 1D5ZA 3JZ7A 5HHMD 1FNLA 4IGGA 2JCWA 2NY4C 2ZX5A 4LCCA 4WTQA 3C5JB 2QT6A 1H0DA 2LFGA 4PB0H 4LF8O 4WNQB 1VERA 5MP6H 1H2GA 4C4KT 3IPBA 4HEMA 2BHZA 3ZL4L 5F0LB 1VZGA 3MBED 3WN5C 1EEUA 4XVTL 2CTPA 5HYFA 2HH0L 4JYAB 3S8WA 1FZJA 2UYLA 1M93A 1FI8C 3VXUA 2NRDA 4O5LH 4B3RO 4HOWA 3EYOB 2PYED 3C5SB 3IAQA 3KG5A 3KLAA 4IRJD 3HI1A 1G6RA 5DUPL 4M5ZH 2P22C 5CD3B 1MN4A 1MHCB 2BSSA 1NMBL 3M88A 4LKCB 3MTXA 3WKYA 2OMWA 1QLFA 3KD4A 5DQJA 5SV3A 4H13B 4IBVA 1TZHA 1J9CT 4PLKC 1TUBB 3DNKA 5I82A 4QRQB 3GQFA 4JRYE 1RJCA 5TDOA 4BKLA 2YOCA 3FOLB 2Y2YA 4QTIL 2QDOA 5IQNA 4CH6A 1MCQA 1KTDA 1ZKAA 4NRYA 5G4MA 2VMCA 2YEVB 4PRHE 1DVSA 1I7RB 5JOPD 2YSSA 3OB0K 1ZDSA 3DBSA 4O4IB 5F1KC 3VD2A 2X0WA 2EYSB 2F53D 3N85H 2CRYA 3DWTA 2WXRA 3S96B 3QUKB 4U2ZA 3DVNA 3JD2A 2DQUH 2DJUA 4UZGA 4CVXB 5LGHL 1MCCA 3EYOA 1H8HG 3BN9D 3FQ2A 3PV7A 5AOIA 3VYNA 4FNPA 1AZZC 4KKLC 1TKWB 4NZRL 1MHCA 1R3JB 2J2ZB 2WB1A 5CCKL 4EFEA 4LKCA 2RR3A 4XWGH 2OMTB 4QCIB 3BKCH 2R0KH 1XCTA 4CMMB 1DN0B 1HESA 5AKVA 1JZ8A 1ZTMA 1K4CA 3U4BL 4KJPC 1LE5B 3KWUA 3ZT7A 3GYRA 1ZIAA 2DI7A 4AZ8A 3M07A 1T0NB 2PMZA 1AR2A 3BOVA 3H0TA 3V9CA 3IN2A 3KYNB 2YEVA 4EUPH 4O2EB 2CPUA 4HAKA 3WNKA 3J80N 1ILSA 1AQKL 1BM3H 3TPKA 4J80A 4HCRH 4O4IA 3GWJA 5IREA 1OHQA 4J3OH 5D7LA 4DETA 4JFVA 2R2BB 5F7YC 2EJ1A 3BH9A 3HLAA 1T1WA 4L3AA 4RESB 5C2BH 4YXKH 5GONB 4MNGE 3HS0C 4PUBL 5H2FZ 5KOVC 1DL7H 3FFOA 3W0WA 4CBCA 1LEKB 2EIKB 1TKWA 1WAEA 4QLWA 2J2ZA 3IJYA 3Q9QA 4OH2A 5E51A 2IH9A 2Y25A 4HJJH 4F37F 5GIRB 4JFHD 5L9DH 2EIMC 3APDA 5HPOA 4RAIA 4QPJA 4K8ZA 3K0YA 4B3SB 5ICZB 1T0NA 4WSGA 3IXAB 1M5IA 1NFKA 1MI5B 3UBXI 4NQCE 4MAZA 1IXBA 1B4RA 5JCOC 2GJZB 1D2PA 1D9KC 2IALA 2Q86A 3C6EA 4UT9H 1HSAA 5E9DD 2X4SA 3S34H 1CQKA 2X9XA 3R4DA 4GQPH 4QHLB 5JQIB 1L0PA 1NC2B 2Q87A 4Z1MG 3S37X 4JE4B 4JN1H 1LLAA 1HKLL 3LX9A 1RZJL 4IYKA 4JQXC 5TQ0L 3HR5B 1KELH 4B41A 2OZ4H 2IOIA 3T2LA 2ZG3A 4PIRF 2X9ZA 1SGKA 3FFDB 4NNXA 3NJIA 4AUJA 2TAAA 5DEFB 3IRCA 4LFBB 4U6YB 3VI3E 3K4DA 1JHKL 5GIRA 2V7HA 1H8NA 4FG6C 1SC5B 3Q8FA 3H2WA 5C0CB 2A7BA 3WJLA 3MDSA 5KYXA 3EJYD 3KPNA 4K94L 5GS0D 1IC4H 1B3QA 3BDXA 3B3BA 1TQTA 4B0MB 4ZUTB 2GFBA 3N42B 4ZT1A 4JPKL 3FH7A 3LNFA 1AJ7H 1GAXA 1T80A 4XX1G 1NC2A 1B04A 2CHNA 1G7QB 3H1IH 2G0KA 2I32A 4FYRA 2P43B 2WBJC 3FU9A 2LTQC 1K5WA 4P3DA 4ODUB 1SQMA 1MJUL 3PREA 4XOCA 5H6QA 1Y4MA 4WUKH 2F1BA 1CYXA 3MSPA 3UBFA 3EJJX 1KJ2B 4LCVA 4Y16B 1RU9H 4JYYA 5JW3H 3FFDA 5GJTH 3S2AA 3VG0L 5CINL 3O4OC 2BDNL 5GGQL 2FQEA 1OP5H 1XF2A 3TGUH 3H6JA 4XX5A 5C07D 3O0RH 5AW0B 3LB6C 2E75B 5LP6C 1IM3D 1JUFA 3BO8A 2Z4QA 4PCSA 4QXUH 4GW5B 3ZDWA 3NZHL 1VQNV 5HHNB 3N91A 2IJKA 1BQUA 3HIZA 3SD2A 1XNRB 5MEOB 4MDIB 3KYKL 1HE7A 5J1AA 4R84A 4WGWB 4DVBA 3V0JA 1L0YA 4CVWA 2ZZUT 4FCAA 1EAPB 2V8LA 3SDDA 1MY5A 4S2SA 1WWCA 2MCMA 4Q6YA 3RWFA 1WISA 1RK1A 1K9MW 5I6XC 2NY6B 3MV8E 4B9JA 4Y5VC 1J0IA 1IEAA 2Z1PA 3F7VC 3FU0A 1RI8A 5JPNB 3E6FB 1RULL 2IAMD 4UQ3B 4UTAL 2B1OA 4NFCA 3T6ZA 3U30C 1I7FA 4JM0A 3V4VA 3WNPA 1WJZA 3MRQA 3W3BA 2P80A 3ARBB 1M7DB 2ICWA 3VACA 2A6KB 4HV8A 2FWLB 4AMKL 1KDJA 3GDCA 4NQQA 1P5VB 4QIWF 4BELD 2R2CA 1BV8A 5GS0L 1A7RH 1H2MA 1QSFD 3ZU8A 4M7ZB 3JWOH 4AKOA 1I1YB 1MWAH 2B9BA 3L8QA 1INEH 3MV9A 1TTFA 3QCTH 2CBTA 2ZXDA 4FIPC 4A67A 4HWBL 2ORBH 4FLRA 4BKTC 4M00A 4BE6A 1HINH 3G67A 5JR1L 3O3DB 4NYKA 3DHJA 4M7KL 1D7BA 4JFOA 1X3DA 1HNGA 1UOLA 2JB5H 2JH2A 5BW7A 1GJIA 2Z92B 1RP3B 4M1DL 3VCLA 5ESAA