1V54B

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v54B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v54B02
4DP5X 1FFTB 1NPNA 3NP4A 5I6PA 4A68A 3FSVA 1KDJA 3NJMA 4GP4B 5TK4A 2LLNA 2UXFA 1BYPA 3PXLA 2HLEB 5A7EA 3UGEA 1IBZA 1BXVA 3DKHA 5I6OA 3SQRA 2OJ1A 1E67A 5B1KA 1FA4A 4EF3A 3EH4B 3JTBA 2YXVA 1KCWA 1KYAA 2QDVA 2VW7A 4WKXA 3GYRA 3KW8A 3QJTB 2PLTA 3CG8A 1E65A 2A3TA 1WA1X 4W9ZA 1A65A 2JXMA 1JZGA 3NSFA 2Q9OA 4G70B 1QLEB 3ZBMA 5B1JC 5EHFA 3NJJA 4YSPA 4BXSV 2J5WA 1ZIAA 1NWOA 2YAHA 1RZQA 2YAFA 3FQ1A 1T5KA 1WA2X 2HX8A 2UX6A 1JXDA 3MBWB 2EIKB 3H4FA 3QPKA 2FJSA 1PY0A 2BW5A 1L9PA 1A8ZA 1X9UA 4GP5B 1RCYA 1JVLA 1ZPUA 4PAZA 1PAZA 1L9SA 3T9WA 1AZBA 4DP1X 2QPDB 4YL4A 5F7AA 4G71B 1PF3A 3AG2B 2PPDA 1OOWA 5D4HA 4AX3A 1SHWA 4Q8BA 3ABLB 1PNDA 4AKPA 5D4JA 2X88A 3KW7A 1NIAA 2GI0A 3NJLA 3QJQB 4KO7A 4P5RA 4BWUA 1AQ8A 1M9WA 5ANHA 3FS9A 4AI7A 1NIEA 1MG3C 4KO9A 3WI9A 4DP7X 4HIPA 5B7FA 3NP3A 4YSCA 1BQKA 3QQXA 2CAKA 4A2GA 1AIZA 4AKQA 4M3HA 3BQVA 2QPEB 1ILSA 1ZV2A 2FQGA 3U25A 4PCYA 1ASQA 2WO3B 3FT0A 1AZCA 2BHFA 2TSBA 1BEXA 3FU8A 1M56B 3UADA 1ET5A 1KBVA 2CUAA 1E30A 2AZAA 1MG2C 1XB8A 3S8GB 4GP8B 1XMEB 1JZFA 1A3ZA 5B1JA 2HX9A 5PAZA 2AZUA 2EIJB 5AKRA 3ABMB 2EINB 3WIAA 3X1EA 2MRYA 3FPYA 3CZUB 3JT2A 2EILB 2BP8B 1GR7A 3NJFA 3AZUA 2IWEA 2VW4A 1KV7A 1IC0A 1ZDQA 3FQ2A 4KOBA 1MZYA 4UF7C 4DP8X 4JKNA 1KDIA 3NSDA 3TBBA 2VM4A 2PP8A 1NTDA 4YSSA 1ASOA 3TU6A 2RACA 2XLLA 3S3DB 5AFAA 4HHWA 1AOZA 2AFNA 2J56A 2VN3A 4P5SA 3NSYA 3T6WA 4A66A 1A4CA 2VSMB 1BXUA 2GBAA 3CVDA 4BXVA 1EHKB 1URIA 2FT6A 4N4YB 1PZCA 1MZZA 1SJMA 1BYOA 4BDVA 1I53A 3ZX1A 4UAHA 1PCSA 2W8CA 1FWXA 2N0MA 2UX7A 4E9SA 2YAOA 4RH4A 3QJSB 4NERA 4KO6A 2PCYA 1NPJA 1AS8A 1BAWA 1JOIA 2VM3A 2IDSA 7PAZA 2FQDA 1GW0A 1OF0A 2UXGA 2XX0A 2XYBA 1L9TA 1NICA 2FT7A 1J5CA 4KO5A 3TA4D 1ASPA 3IE9A 3NJHA 4HHGA 4HCIA 1PMYA 4YSQA 1ILUA 2IH9A 2BP8A 2IDQA 2QDWA 3WNJA 4DP2X 1OE1A 1HAUA 4GY4A 4X4KA 1TKWA 3HEIB 1OCZB 3V9CA 1KBWA 1RKRA 1PZBA 2VMJA 2HXAA 2XV2A 4E9WA 3FYIB 4CSPA 1JXFA 1AG6A 2I7OA 3OD3A 4G7SB 4DP0X 1PLBA 3UAAA 4DP6X 2YAMA 1CURA 4FAAB 1JZIA 1AZUA 4FA7B 4A2HA 2H5UA 3PPSA 3T71A 3NJNA 3GXUB 1J5DA 2GC7C 4YSRA 1MDAA 1NWPA 5I28A 2W88A 3X2QB 2JFCA 1WAEA 1NZRA 1J9QA 1GY1A 1XB3A 5FC9A 1R1CA 4A2FA 1IKOP 2YAQA 3ASNB 1GYCA 4G7RB 3NJIA 4YSTA 3GDCA 3H56A 4M4RB 4CSZA 3UAEA 4HCGA 3FPXA 3NYKA 1OCOB 4E9TA 3OMAB 1AR1B 2BO0A 3FU9A 3TBCA 3SBQA 4A2EA 5B1AB 1AZRA 2CJ3A 1E5ZA 2UXVA 3WKQA 2H3XC 4QKTA 3CDZB 2PCFA 1OV8A 1IUZA 1SNRA 1OE3A 3X1NA 1V55B 1L9QA 2WSDA 3NJGA 1W6WA 2BP0B 2IWFA 2HRHA 2Y1AA 4BWTA 2YEVB 2ZXWB 4YVUA 4BK5C 3C75A 1AANA 1EZLA 3AG1B 4HALA 4TXVB 4BDVB 3FSWA 1XB6A 3IN2A 1JZHA 2DWTA 2IDUA 2BZ7A 9PCYA 5LDUA 5D4IA 4YSAA 4E9VA 2ZWNA 3EHBB 2PPAA 1WS7A 2H47C 1UATA 3OMIB 1WS8A 2BW4A 4F2EA 2DY2A 2TSAA 1W8EA 3X1GA 2YAEA 2DWSA 3BVDB 7PCYA 5PCYA 1JERA 2DV6A 2HRGA 4KNSA 2P80A 1PLAA 3CVBA 2CALA 3S8FB 2B3IA 2XX1A 1J9RA 1V10A 4GYBA 4AZUA 4E9YA 3T6XA 1CYXA 1CUOA 1GY2A 3ERXA 1N68A 2I85A 2R7EB 2FQFA 3X1FA 3FQYA 3CDZA 2FT8A 5I5IA 1GSKA 1ZIBA 4NB7A 1V54B 1PZAA 1SHXA 2UXTA 2B08A 3PAZA 1ZDSA 3UACA 2BP0A 4Q89A 3S3BB 5I5MA 1J9SA 3L45A 1M57B 1GS7A 3ABGA 4G72B 3AW5A 2XU9A 1TU2A 1W6LA 4DPAX 1NDTA 2FNWA 2ZOOA 1L9RA 1VLXA 3PCYA 5I5JA 5E9NA 1QHQA 4KOCA 5I6LA 4DP4X 8PAZA 2J55A 2PPCA 1OCRB 4KNTA 1SF3A 4YSDA 3AG4B 1SFDA 2GSMB 2IWKA 2OV0A 1JZJA 3RYMA 1JZEA 3D12B 1E5YA 3NSCA 3ZIYA 1SFHA 3OQRA 4YVNA 4AKOA 1L9OA 3QJRB 2DYRB 2XV3A 3EH5B 4NAJA 3S3CB 2HZHA 4JHUA 2NRDA 2BWIA 1ADWA 3IEAA 2E86A 3MX0B 4WTQA 5TK2A 1CYWA 2CBPA 2R7EA 3ZDWA 3DIVA 1ET7A 3NT0A 3WNIA 1OCCB 5B7MA 3PAUA 2CCWA 2MTAA 2PP9A 4N8UA 3FU7B 2Y69B 3SBPA 2GIMA 1YLBB 3OMNB 3AG3B 3HB3B 1OE2A 2FQEA 4HCFA 4K9JA 4E9XA 1F56A 2PPFA 2XXGA 1NIDA 2YQBA 2IDTA 2AVFA 2XWZA 3FSZA 1SDDB 1JVOA 4A67A 2PPEA 2BWDA 5AZUA 2QT6A 2YAPA 1HFUA 3FSAA 2P80D 4YSUA 1PNCA 4HAKA 5B3SB 2XUWA 5B1BB 6PAZA 3WG7B 3EH3B 4GXFA 3T6VA 5F7BA 2FWLB 2GC4C 1AS7A 3TASA 4BWWA 3PAVA 3N55A 2EIMB 1AG0A 4ZK8A 4A2DA 2XV0A 1X9RA 1A4AA 1AAJA 3H4HA 4DP9X 3NJKA 2XXFA 2GB2A 4F7KA 1SF5A 3N2JA 2VSKB 2YXWA 1TEGA 1HAWA 1NIBA 2XVBA 3V9EA 3ASOB 1NIFA 3QJUB 3CVCA 1KCBA 2WO2B 3IN0A 2AANA 4YSEA 1IBYA 4YSOA 1NINA 1GS6X 3FU7A 5B7EA 2IDFA 4E9RA 3DTUB 4W1TA 2PP7A 3EF4A 1N70A 5IY5B 2ZONA 4F2FA 1RZPA 3PLYA 1KGYE 2GHZA 1BXAA 1CC3A 1A4BA 1SDDA 4KNUA 6PCYA 1WA0X 3T6ZA 4L0PB 5I6KA 2VW6A 2FTAA 1JXGA 3IBOA 1PLCA 3X1BA 2BZCA 3WKPA 2YARA 3OM3B 4ENZA 2OCCB 3G5WA 1TEFA 4E9QA 5I26A 2JKWA 1B3IA 1QNIA 1AZNA 3ABKB 1GS8A 5I6NA 1ID2A 3SBRA 1BQ5A 2X87A 3FYEB 4G7QB 3UABA 2HX7A 1AACA 4MFHA 4UANA 1BQRA 2DYSB 3AY2A 2J57A 5I6MA 2I7SA 3QJVB 1DYZA 1DZ0A 4DPBX 2IH8A 1ET8A 2IAAC 1AS6A 4HZ1A 4QLWA 2Q5BA 1ETJA 1J9TA 4DPCX 4JHVA
chains in the Genus database with same CATH superfamily
1P84K 1CLVA 3FN0H 2BM3A 5LBVA 3D85A 3VFUA 4FD0A 4JRXE 2NPLX 5I6PA 1N9PA 3LNDA 5C0CD 4FZ0A 1ED3B 2BRQA 4WO4A 4UVBA 4ORGA 3ZE0B 5C0AD 1MCOL 4Y9FA 4R4BB 3ZVVA 2BSTA 3M8OL 4MMZB 5EU4B 3NTCL 1A2YB 4UM8A 4MS6A 4I9WA 3LD8C 4AVKA 1WZ1H 2FL4A 3PGCB 2OJ1A 3GJEA 2YUAA 1KU9A 4GXUN 1OP5H 4WU7A 4EF3A 1NBVL 1J87A 3KLSA 4JI3O 2BIPA 2XDHA 2ZX8A 4FG0A 4Z0XA 4CL7A 5GPRA 3K5NA 2ZF9A 3T3PB 3RDTB 2ZNWA 4Z7IA 3P4OB 1OIOA 1NCAL 4JI5O 1NEPA 2HG0A 4X42A 3TTYA 1EZVH 5DQDH 2FDBP 2WGXA 1C8PA 1TZ8A 2VRQA 2OP4H 1FLRH 1SN0A 4HS8L 3UP6A 4ZMTA 3N43B 4UFZA 3LAFA 1KBBA 5FL7G 1D5XA 1ZD6A 5JW4M 3ZN1A 2OYQA 3S88H 1LO5A 1UFUA 2EO1A 3JWOL 3KBHE 4KC3B 1UZ6F 3MV9D 5DZOA 3KPSB 3DX2A 4KZDL 2Z7WA 2EEDA 2Y5EA 2DEYX 1M7DB 3MRIB 5EF1A 3I6KB 3LCYA 4EIZC 2G2PA 3D36A 1EPFA 4J7ZA 4PJ9D 4Z7QF 4DGVL 4JCMA 4RGMC 2BCCH 2YGQA 4YHZH 4JI6O 4X8XA 2D7TL 4A5UB 1BSIA 3RYFA 1MHHA 1E8ZA 1UXSB 5FCSH 2NY1C 4ZW5A 1TENA 2WXJA 3G5XA 4E68A 4YLCA 1D9KB 3WB2A 1QRNA 4OLVH 5FO7A 3MUY1 1DUZA 4UM8B 1YMMB 1ZPUA 3RVTD 3O6FB 5ABDE 2CK3G 2VERA 1JPEA 1JDCA 4U7MA 3L5XL 2CUGA 3O9WA 4YXLL 1MPAL 5ID1A 1NGPH 4YLBA 4HKBA 3R06A 3LZFL 3QCVL 2JJWA 4OCRH 1KCLA 4UV7H 5D4HA 2EBOA 1WIUA 3OKMB 2IPUK 3NK3A 4HJ0D 2NY4D 5JW3L 1JG9A 2KUTA 5D7KD 3NJLA 5CXPA 3PV6A 4C56A 1OANA 2P5WE 3FQ4A 4AI7A 3GC3A 4IHOA 5B3JF 4DP7X 1HWGB 3PQYB 4HBCH 3U46A 4RWUA 4MASA 2B5UA 1BQKA 2RBLA 5IMKA 1NR1A 3ZL4L 4KVNH 4Y19B 1NKOA 3WU2Z 2ADGB 1ECYA 1ZHNB 4H8HA 4FMFA 5SWQA 2YSTA 3V0EA 3RW0A 1JWMA 3BQUB 4GKLA 5AYUL 2WWKO 3MRFA 4GG6E 1BREA 5SWZA 5KUMA 4P2CG 3FO0L 3N5AA 2OLDA 4JFXA 4XPGL 3VFNA 2Y72A 4WUUD 4LWSA 2PTTA 2YMTA 4FXKC 4DKTA 1UUSA 2XQYK 1V7ML 4PGEA 4GUNA 3O4OC 3VRLF 4M29A 3VB9A 1JF1B 4X8GA 4C55A 1IGYB 5ITBH 2XQ0A 3VFWA 4PQXA 3MHZA 1IE5A 2X2YA 1XZ0B 3VD1A 4YFLF 4JI2O 3MNZA 2Y3AA 2Z31C 3RYCA 4Z7VB 4PJ5A 3NCMA 3TU6A 1CFNB 1FRGL 5FGRA 4WFAV 4ZS6D 2CTPA 3G04B 4XNYH 4X66B 3Q6FB 4QT5B 5KBDA 4F37F 1FH2A 1ZXQA 1CE1L 2FB4L 3ZTJG 4F24A 4MYPA 1T0MA 4NUMA 3L95A 1BXUA 2B0SH 2GBAA 1AO7E 3M7MX 3ULVH 2K1MA 1NFIA 3K7UA 1KZQA 3GHPA 5EA0H 3KYMB 3MMEB 5FKAA 2CR0A 3BZ4A 4QWWC 4LKCA 1Q72L 1OTUD 4JFTA 2YAOA 2QJ1A 4HK3J 2WCGA 4R7LA 1SUJA 4Y1SA 5BUPA 4XPFL 1ZX3A 2C34A 4Z3GA 1XIWD 2OULB 2R2BA 1TO5A 3DOHA 1E1RG 1OCZC 4D8PA 1HHKB 4NO2A 4ONOA 3AU0A 4RGOH 1UQSA 5HYSG 3QWOB 3IJEB 4HQQH 3PYCA 2V17H 3ZY7A 3D4ZA 4WFGE 1X44A 4ZMXA 2Y4UA 1IBLB 5FO9B 4HNAB 2GG1A 4QHUA 2EDLA 3GRWA 4YY3O 1JBJA 4FM1A 4QE7A 3CCMV 1JTPA 3T0WA 1VMGA 5FYLE 1KTCA 4QRPD 4YWGL 1HOCA 1F3RB 1VGKB 4FXKA 4X5XB 2W9EH 3TJEL 2Z3YA 1GH7A 4Q2ZA 1RLBA 1WPCA 4OV5B 2OJZH 1HSBA 1JPSH 5KVFE 1JZIA 2G38A 3VBBA 4FDWA 1FFPB 5C0IB 1I7RA 4L1DA 4YE4H 2E74C 1F6LL 1YECL 4PGZA 3GXUB 2MEJB 4JAAA 5ACZB 2NX5A 3IMTA 5F7FA 2FO1A 4K94L 1YNLH 2PYED 1E8XA 2Z31A 3KXFB 3PWPB 4K8RD 4PJGA 3BP4A 1DL7L 4M7LH 4JI3B 1OWRM 3AS2A 1YRKA 2TRYA 3V0WH 1G87A 1RZGA 1ZLDA 4OV6F 4ODTL 3G5VA 3TOPA 2R29L 1MZFA 4YEFA 2ZP0T 5F1KC 4P2OB 4V33A 3HE6B 4GKZA 2XJKA 2BNRD 2ZUTA 4O2AA 3LH2L 1DJHA 3NOIA 2HVJA 5DMIH 5LAXB 3ARDD 4DZBA 5CKAA 2ZUWA 4UQ3B 1IC5L 2NLJB 5J6HB 1FG9C 3E6FB 1M05B 4X6DA 4HH8A 3U9PL 4J12A 4P5MB 3EHBC 1W6WA 2QELA 2OXGA 3IF1B 1EGJA 2IWFA 2WYIA 4XBGB 4QYOA 1JK8A 3CRAA 4JBSA 3VXOA 3CX5F 4N85A 3LKPB 5L4FA 2VABA 2Z7YA 5DRWA 4HALA 3BH8B 2F54D 3IAYA 3FSWA 1OVZA 4KH9A 5C09D 4JI6B 4GUOA 3AREB 1NCHA 3KR3H 4KZ0A 2JEXA 1XF3A 3KAAA 4U33A 3KWUA 4IOIA 1N0LA 1OGAE 3RNQB 4O4LA 3QFJD 4Z7WA 4X6BA 1Y0LA 3IFNL 1RXLA 2Y7LA 3IDGB 3IXAA 1IKNC 3NAAH 3O6LL 5BRQA 3VQYA 1JGVL 2DY2A 3KPPB 4KKQA 1NEZA 5CUSH 5MEQA 3O3DB 1JJUA 4FFKA 4NQTA 3U4BL 2G30A 3DO7B 4OGQC 2OFQA 3QYCA 1W0WB 1Z2KA 2V7HB 1X4TA 1NC2A 4KNSA 1IURA 3TLRA 3DV6A 4CVXB 1CGTA 1CG9A 3VYNA 3JV4A 4MVSA 3MRCA 2OW7A 1LK2B 2WQSA 1MRFH 3QS3A 1S4IA 4FG6C 1V27A 3UMNA 2NYZA 2QGCA 1R24B 4QO1A 4N24A 1V8HA 4ZMQA 1U8NB 1JD9A 2UVEA 5D1ZI 4XOCA 4QNHB 4HCRL 2CKBH 3UJIL 4PY8I 3O2DL 3WS3A 4HWEL 1BWMA 1A1MA 2P22C 4LZKA 3ILQD 5K59E 5A2KH 4HS3A 4M62H 1V54B 3BLPX 4JDZB 3OLGA 2LU4A 1A0QH 4XXDA 2MNUA 3VWKD 5AW9B 2HTKD 1P7QB 2D9CA 1MFVA 2Q7GA 1S76D 4MBRA 3UCQA 5E94B 5HGAB 3V6ZB 5B4MC 4P30A 2H3NB 3CH1B 4P2QE 4N8VB 2YPLA 1OCRC 5L3DA 2XFGB 3T1CA 4CVWA 2FBOJ 1WD8A 1Q9WB 1R6VA 4JNXA 1I94O 4MQSB 4B7LA 1XF1A 5HHVH 1ZTEA 2LW3A 1QKZL 2J25A 4L8CB 4ZSOA 3U9WA 1L7TL 4GT7A 3VMNA 4ZUVA 3VXMB 3DROA 3OKOB 1CICC 4WWKD 4WEBH 3KDPB 4S1QH 4JI2B 2HT2D 4GYCB 1NGYA 1PY9A 5FYKH 2ENQA 1ZKAA 1D7BA 2FIKB 3LN4B 4UM9A 1PZUB 2A7WA 4WEEA 5KTEH 5FDYA 1N26A 2XAGA 2WPGA 2Z4QB 1IKNA 1ROCA 3EH5B 4DUWA 1DGSA 2ZWLT 4KI1A 3UTTA 4YS4A 3W9DB 5F3FA 1S7RB 2NMSA 5FPRA 4R84A 5T3ZL 4DKFL 4DO5A 5JMOC 4PRIE 2VDRL 2J1ZA 4X4MA 3BAKA 4JDTH 1HHGB 1W8OA 2YGNA 4Z3HA 5I82A 1DVXA 5DMGC 3MN8A 5LO7A 4PIRF 1GCFA 3FH7A 1FL6B 3DXRB 4ONHA 2A5UA 4Z78A 4JI4O 3GXIA 5I1HL 3L5JA 2BHUA 1PV0A 4HAMA 1TZHA 3FUHA 1ZE3H 2GIMA 4HGWA 5KSAD 4HJGB 5A3ID 5FV1L 1OJHA 3MGTB 1FSKB 3QSKB 3L3HB 4XHQA 5BZDA 4OPHA 4DTGH 2F8OA 3S7GA 2WQ8A 2YS4A 5L2KD 1UA6L 4P46D 1WK0A 1GIGL 1YC7A 2CO6A 3IMSA 4FA8A 2AGJH 5GSRB 4EZLA 3QFGA 4P49A 3BKML 3Q43A 4JI8O 4UTCA 2BWDA 3OHXB 2QT6A 3PP3H 1IM9A 4YY3B 3CPUA 4PJFF 3QWRA 2AP2A 2DQGH 6PAZA 4Q9RH 1NEUA 2LE9A 1QHPA 4APQA 3VCLB 4N2OA 3NFSL 1FFNA 3B1UA 4NSKB 4BQBA 4XR8C 5D7IB 4HG4K 1DJYA 2JI3A 1IILE 1QLEH 3CZFA 3TCXA 1WNSA 2YFOA 2QM8A 2XNAA 2YEZB 3IU4H 3GBLA 4N0FB 1Z7JA 1A4AA 3FB7B 3MV7B 4GAJL 1CICA 2GSIB 5CZXC 5SWSD 4NOFA 4OZGA 4PBWD 3SKOB 1BOYA 2AITA 4ZAKC 4J3VA 1BBDL 4A7SA 2D7MA 1AKJD 2B14A 2XVBA 4IHJA 3EFDL 1JNJA 1S9WB 3DGCR 5BJTB 3D05A 3ESMA 4IOFD 3K2KA 5ABAA 5J6SA 4OAWA 1ZL8B 4HGMA 4UNUA 4K8ZA 3FU7A 3EFFA 4OIIH 1CO1A 2DOSA 3TEUA 3GMOA 5FWRA 3VUAA 4PRBB 2O61B 1YAIA 2CJUL 3RRQA 4OQTL 1YSOA 1M9NA 5DI8B 1OAZL 2ED9A 4TOYL 1G1XB 4GXUM 4LF9O 4HMCA 1CC3A 1FC2D 3PQYE 3MCYA 1YEGH 5CIPH 5BUAA 3ABKC 1A4BA 3MTRA 1BWWA 1NKGA 4V1DB 5BVJA 3QXAB 2BXZA 1QBLH 4WWPA 3SD5A 5DC4B 2EE9A 3GPEA 3ME0B 2DKSA 2G0KA 4WI0B 2DYPB 1OW0C 4NRZB 4DR6O 5DJ8B 1UKQA 25C8H 1KENL 3UMTA 2Z65C 3ML0A 1LUWA 1WISA 3SDYL 1YNKH 5I6NA 1HQRB 3CFCH 3SBRA 4F2MA 3IKCB 1GGBH 4G7QB 4PM1A 4NUJA 4FERA 5DRNB 3IRZA 4ZOCA 5HBBA 4OCLC 3DX7A 3TXQA 3O6ML 1A1NB 4DV4O 1R5IA 3CXHJ 4I18C 4X7FC 2Q87A 3MROB 1A6AA 3VD2A 3QZWB 1DZ0A 5C0CB 4DPBX 2IH8A 4ZW8A 4GSXA 2F8IA 3EJZC 1ETJA 4MZ2A 3DJZA 1FXKB 5C0AB 3MCG1 2BFGA 4MS8D 1JFQH 4OFDA 4KUZL 1HKLL 2I5YH 4KVCH 4OF0A 5T33L 4RNRA 3FAXA 4PBVC 4MLIA 5E1AC 5GSVA 1JV2B 5HHOD 1G0DA 1Q9OA 1FIGH 3ARFB 1QSEE 3BDXA 4XX1G 4AVIA 1NH6A 4ZAKA 3F3HA 2AQQA 3DXAD 3DYMA 3CU1A 1KPVB 1AJ7H 3HI6H 2X1OA 5LXVA 3DECA 3IJSA 1UTDA 1CFQA 1T89C 2K70A 3BFOA 1C5DA 4YHIB 3LPFA 5ENWB 1H3TA 1QI5A 2Q3ZA 3CSPA 4CU6A 1A5FL 5GONB 3ISYA 12E8L 2PLTA 3R18A 3EG9A 4MCZA 1QWNA 5KYXB 4J6RH 2SEBB 4AQ8C 4OD2A 4W9ZA 5EZJB 1BFVH 3HJEA 3EOAA 1Q43A 3OR6B 4U1IB 1W0KG 3J80N 4A6YA 2D7PA 1I94B 4DO6A 3I75A 1CCZA 2JRIA 5DVOA 2J8UE 4WI5A 5F7KC 1QLEB 2UUDK 4IGBD 4AUYA 1RJCA 1LEIA 5GZOC 3S3WA 4LPYA 5F7EL 1OW0A 4PJ9B 5IHZB 5LXTB 3R19A 4HAFA 3B8MA 1FL5A 5JMRA 4H2AA 5I1EL 4KXZI 3K6FA 4N86A 4OLWH 1MI5A 1YCIA 1OZ0A 3HKBB 4H4NA 1LE5A 4I1PA 2HX8A 1WPXA 3QWNA 3MOBH 1C1EH 2UU9O 4RISL 4PDRA 3S3JA 5FCUH 5IESH 4WVRA 1KB9K 1PY0A 4FS0A 4I18A 3L3JB 4P99A 5T1KA 3ZMSA 5FYJL 3BVWA 4ZNCD 1N5YL 3Q3GB 2WTRB 1GKFA 5JQ6H 4LH6A 1T1XB 3BHPA 2FO4B 2X4UB 3B2EE 2FWSA 4GP5B 1ZSDB 3S5LG 2Y07L 4WHYG 2X1WL 4ZFZB 2NY4B 1L9SA 3GWKC 4MNHB 2DICA 3QQNA 2SODB 5E56A 1PKOA 4KP4A 4PJDB 3N9GH 5CCKL 2C1OA 4FFYH 1TVBA 2EDFA 2YOCA 4PRHE 5E1AA 2QTOA 4JI4B 3PWPE 4KMTH 4QXUH 1PKQA 3FOLB 4X83A 2J1WA 1T1YA 3BZDA 1IKFL 2YMXH 4I3SL 4K15A 4XN2A 3MRDB 15C8H 2E47A 4XMLL 1MIEH 1HWHB 1AQ8A 5FHAH 4GAYA 2YD3A 2BS8A 1T89A 3BD3A 4NQCE 3N2KB 1L5GA 1AP6A 2BSKB 1YYMH 4XN9A 3RX7A 2IPKA 5E79Z 2LFRA 1F4YL 4JI8B 2MWCA 3GIVB 5D72H 1CXEA 3BQVA 4GG6F 2V2WB 4FNQA 4G6KL 1HYRC 3DETD 4WUUB 4Y8DC 3QCUH 3QG7H 4AQ8A 1Y4MA 1M3JA 5DVNA 5KHJA 5E23A 3BWAB 1G5AA 4NHCL 3MBWA 1F2XK 3AGWA 5GZOA 4L4JA 3AC0A 1SJHA 4DSYA 2WLYA 1JGLL 2EKSA 2XBTA 4NKQB 4N2HA 1DJIA 4UV4H 2H9GA 4MCYA 2MMXA 1DUYA 4JRWA 5T1LA 1NFDB 3M1OA 3JT2A 4J3OG 4LF3B 5EIIB 4JY4B 1TFHA 1LYQA 2PYLA 1MCCA 3STZC 5TD4A 3VFSA 1NUDA 1JCHA 1MZYA 2Z8VC 1TUBB 2FHCA 3NSDA 4NT6B 4ELDA 1TTUA 2IGFH 3GMNA 4FHKA 1M5IA 3UCSC 1U30A 2F68X 3RHWK 4LSUL 1UEMA 4XP6L 1LEGA 3U79A 1YVLA 4NN7B 2Q76A 4R26L 4KHPO 4NWUH 4CA4A 5E6IA 1BVOA 2YFNA 3GS0A 1G7LB 4DK1A 3VFTA 1AI7A 2O26U 5D5PA 3K59A 3Q2WA 2AJSL 4LF9B 4TLUA 3UZEC 4AMKL 4G9DB 4UQ9A 3CVDA 1X5ZA 3H0TA 3PP4L 4UIMA 2UVFA 5BRZD 1NVPD 2EDQA 2YHGA 2X70A 4RMTA 2C9AA 1XIWB 4XMUA 3CDCA 4KK8C 3LNGA 3NEXA 4UAHA 5TE7H 4DR6B 3W7WA 1U3HA 3BJLA 4EIGB 4G3YL 4DQOL 1J5HA 4ZUTA 1JOIA 3K0DA 2YBRA 2DS4A 3EYUH 3R8BB 4GQRA 1MCIA 3CV5A 5C70A 5TGBB 3H1LH 3BGFB 1BECA 4DR7O 4NC1E 1UH3A 3FUKA 1J8RA 3BT0A 2Q7YA 3QO5A 4OFIA 4DV4B 2EACA 3HG4A 1PNKA 3P32A 3PNWA 4QRPB 5GRJL 1KCSL 4FJZA 3CLEL 1N4CA 4JQIL 2IH9A 3N6YA 2YXHA 1NCTA 4TQIA 4AYFB 5E1QA 5MERB 4FYRA 1TKWA 2G4GA 2GTQA 5GS0L 3K72B 3EOBA 4N8CL 5INDB 3BCDA 4JO2L 4NM8L 4XN1A 3BAEL 4NXKA 1PX4A 1B9KA 3K3WA 1YJDL 1PLBA 4LF5O 1QSZA 1K72A 2PYEB 1TZGH 4WJ5B 1T20A 5AD0A 2YAMA 1KBKA 4TNVK 1VQ6V 2NZIA 4HF5L 2E7DA 3CFKA 3FMGL 3U2SA 2GHYA 3STZA 4B7KA 3MI6A 3B6SA 2UWEB 1RI8A 3BSZA 3CZNA 5EO1B 3Q1SH 2A9NH 3AQYA 4TQ8A 3LXAA 3HNSL 3G7TA 4NZUL 2X44D 5GGRA 1RFDH 5HHPB 2BNRB 4M4RB 4PU2A 2EZ0D 4N90D 5K9KA 3EO1B 2VDPL 3NCFB 3ARDB 3UTQB 2AK4A 4AW7A 3V4PH 3TH2T 3GHBH 3PREA 3FCBA 4YBQC 3THOA 3OF6D 1H3VA 3UZEA 3ZMEA 4DH2A 3LRHA 5TPWL 2QVTA 1U0QA 3EH2A 3TNMB 2CGRH 4PGBA 1OCWL 3KCWA 3G6EV 4H25A 1YN6A 3ZJZA 2Z0AA 2XQYG 3QEHB 1NOAA 2AMUA 2YGOA 2F54B 1W16A 5C09B 5IK3A 4ZBMA 5J2UB 1NM9A 1MHCB 3NJGA 2HYMA 4K9EL 4L5FE 4ZOAA 3ZXAC 1AC0A 1Z1WA 4JUSA 2ZXWB 5CBGA 1ORQC 3IC7A 3CHQA 2UU9B 1Q8MA 5LN4A 4TXVB 1RY7B 4NBYB 5DK2A 1KCRH 2XIDA 2IDUA 2BZ7A 4JDEA 2IANB 4ZOBA 4P9HC 2DLHA 1T2JA 3CCLV 3F7LA 5JOEA 3OZLA 5A6IA 3QORC 1COBA 1PS3A 4PYGA 2OZ4H 4PHXA 4Z0BL 1OARH 4XOAA 3D3VA 3T2PA 4L8JA 1UCTA 1SEQL 2FE0A 3TIDB 4FQXD 2MH4A 4OM1H 2ZCEA 5K39A 1UURA 3IWVA 2QPUA 4XTRD 1OTSD 5E2UH 3TWCL 1R33A 2UXBO 1NL0H 4GIAA 4FFVD 2QDOA 4PJFA 2GIYA 4PR5A 3VXSA 3GLAA 3IGUA 4Z6AT 1CUOA 4YAQB 2CG9X 3MRQB 2OMTA 5K59F 5MEND 3TJHC 2BIOA 4PWEA 1N4XH 1WA8B 4QLRA 5CMAA 3LKQB 1BVKA 1W0VB 1DBBH 3QJFA 5AOIA 1H6EA 1ZUQA 5HYJD 4DO2A 1ZDSA 4HBQA 5CNHA 2HWZH 5CBFA 2FJGA 3NN8A 1ZV9A 2APSA 3VFMA 1DN2A 1LWRA 1NCNA 4OGAC 3TCLB 1BGXL 2JIXD 4P07A 3L1OL 5F2VO 4OJAA 1W6LA 3O3AA 5IWAO 5AKVA 1H2SB 3CCJV 4WWKB 5IB2B 3C5ZC 4FNTA 3LMJH 1PU0A 1ETZB 1P2CB 4TWKA 3BPNB 1PBYA 1KCUL 2C7UB 1EN6A 4MA7L 4OF8A 1ORQA 1RHHA 2BH0A 4KNTA 4M1DH 5JPNB 3BH9B 4LK4A 1VAHA 3EYVA 2R9RB 3POHA 3BABA 2BS9A 3UG4A 1U21A 2GSMB 3QQ4A 2XQBL 1TNMA 4GUPA 5DA0B 5E7BA 4MKTA 3QXTA 1KC5H 4UQDA 4F7MA 4Y1AE 3QORA 4NP4H 5I1CH 4ONGH 5GW7A 1CDGA 2E6PA 4NC2B 3TBWA 3DX9B 1DSYA 4KHPB 4Z1VA 2PW2A 3IJ9A 1E9OB 5GRVK 3IFLH 3SDDC 4ZMAT 1X5GA 2HR3A 1WZLA 2ZG3A 3NZUA 3V7MA 4OGXL 3WNIA 1OCCB 5T5FH 5KSAB 4YK4C 4XC3L 1TFPA 3ESOA 4OCYL 1R3LC 4O51A 2VDOH 3WEOA 5FHBL 1P7GA 2O5XH 4NNPH 4ODBD 5L2KB 4N3TA 2FGWH 1EERB 4KKCD 1GGCH 3MLXH 4UDUB 1VP7A 4LL9A 3WFDH 2ENYA 4MD4A 5I15H 5K5YA 3HS8A 4JRXA 4P9OA 3ULSA 1TT6A 1GTFA 4OQ1A 1IB5A 4DR7B 3J7HA 3MV9E 2C3VB 2HTLC 3TJTA 2GJ6E 2HCZX 2VO8A 4K7FA 4E4EA 3HAEB 1S5IL 4KJPD 4JCWA 4XCNA 5JYMA 2CK0H 1HCYA 3GBNL 3L9RA 5FGCE 3WMSA 4NBXB 3L13A 1BM3L 4ZO7A 2VC2H 2PTVA 2IAMD 3LH8A 4Y1TA 3C5ZA 2UXDO 2DPKA 3S36L 1OGSA 1OT1A 4LF5B 3ZHRA 1E7VA 5SWSB 2VMCA 5C0ND 1R3KB 3RB7A 2Y0IA 1K97A 3FH8A 4JO4L 3UKMA 1IGCL 4KUCD 1UWGL 1YN7A 3RWIA 4KKPA 1OPOA 1I1YA 4W4NA 2YD2A 2EH8L 1E8WA 1XGTA 3WKML 4OD3H 3FU6A 4M8QA 5IY5C 5CBHA 3TEZA 4ZFOL 4YXWG 3RILA 3HHMA 3ARYA 3QO1B 2WO2B 5DJXB 4KK6D 3WS6C 4GXVH 5AYTA 4Z3TA 3BJ91 5CCHE 1KQSU 2Y36L 2Z1PA 3DJRA 5K1VA 5IYZB 3SDDA 3TZVD 3DTUB 4L1BA 1U91A 3W11D 5KMGA 3QDMA 4M7KH 2VZTA 4HKJA 2GBUA 4NQVB 3PL6C 1ZRUA 2Y7MA 5EDXA 4O02H 1R3LA 1WBYB 5I75B 4QEGA 1KPUA 3EDKA 1JMXA 5KYUA 4IJ3C 3QDJA 3QP3A 3BXNA 4NN5C 1P53A 1GJWA 2KZWA 1T4KB 1AHWC 4XDJA 3W7TA 1A7BA 4QTHB 3RX8A 4RZCB 5I9QB 4LCWE 1RM1B 1KD1W 4WUUE 4ZTEA 7FABL 3MUJA 1BD2B 3QH3B 4N8VG 4NTXA 3DX4A 4X4XB 3VFRA 1I1AC 2YUVA 3O41B 4M6OH 1XCQA 4R2GB 2VQEO 2XPYA 3PHOA 5AOZA 3JCZA 3ZRWA 1NT2B 1D5IL 3TYFB 1AACA 2VQTA 3M07A 3FF7A 2CLVB 1S7TA 2W07B 4PG2C 5DUBA 1UEYA 3L4YA 4PSPA 2PGGA 4RFOH 1QQDB 5I8OL 2XA8L 3RJOA 4X5WB 1HXKA 1WP7A 3APQA 2HH0L 3V6FB 2MHAB 2B8OT 5HHOB 3BH4A 1IC1A 4HFUH 5HHQA 4BQ8A 3BSHA 3DX8B 3DXAB 1BYNA 2VDOB 2AI0H 1UJWB 2UXBB 1RURL 2VWEE 2XWBA 3GMQB 1HZKA 4JO3H 1Q6HA 4KRLB 3UIZA 3WB0A 2EIEA 5DYOA 4YHLH 1Y6MR 4Q9CA 2R8SH 2LLNA 2PNDA 4XP5L 2NTFB 3WIHH 4M7JL 3N40F 1QVFU 2Q6AA 5C0EB 5E4IA 5I30H 4EB6A 3WS6A 4QRSB 1KV3A 4RSVA 1MAML 3SQRA 2XN0A 5IMLA 5T1DH 5FV2A 5J12C 1KYAA 4Q58C 2JB5H 3LTVA 4LDCA 4NJAH 3JD2A 3P4NB 1PZ2A 1JRHL 4AC2A 1PY4A 3CHPA 1P4IH 3PL6A 4IGBB 4N26A 2JGUA 3T8XA 2GJZA 1MKFA 2J8UF 3ZRXA 2R23A 3AB0C 4L8SC 3OKYA 5IWAB 3FUMA 3OXRB 1JZGA 3BPZA 2GIXA 3NSFA 1IGTA 1JGDA 2FNBA 1V05A 2OMXA 3BD4A 3P9LA 43CAA 1AHWA 4XRCB 4AXWB 5KW9L 1ETA1 3DVFA 5B1JC 4MJJA 3VI4E 3EJJX 1BQHA 5DJ2B 2J5WA 4NZDA 4QRQB 4X98B 1A6TB 1I1AA 3ASNC 4O2FA 1IBBA 1E1QG 5E9DA 1N8ZA 1EEQA 5TDPB 4MNQB 4P0DA 4U6TA 4AH2B 2ZKXA 3VD0A 1FZMA 4X1KA 2VDQH 4KITB 3BEVB 4PEEA 5DD0H 2BW5A 1XQ4A 4PP1D 4PG2A 4OF5A 3JD3A 1YPZE 3HKZA 1S9XB 5BO0D 1I9IL 4G43A 1PVHA 4NPYA 4G6JH 4BE5A 3PY9A 5D2NC 3VXNA 4UTBL 1X9UA 2ZCHL 1JVLA 4IHBA 2IALB 2ODHA 2LTQB 3ZHUA 2AV1B 3ULUD 2FYUH 4RFNB 3RIFF 1MJUH 1B4JH 4CVZA 5I1GH 4JTAB 2NQDA 3KPNB 3NDYE 3FQRA 1TSHA 1AC6A 3JCUZ 3F7RA 4ZNEE 4FI7A 4G9FE 1UGKA 5CA1A 2LFGA 1KG0A 3GSWB 4LSPL 1LD9A 1DFXA 4U1HA 2IBZH 1IFHL 1TCMA 3LNIA 3T0ED 3E3QE 5C0GA 4YFDB 2K9FB 1NCDL 1SYVB 4QRBA 1KEGL 1BOGB 4UNVA 1CE6B 2P4VA 3MLPA 5MI0B 1QVOA 3ARVA 2WP3T 3PU7A 1UWFA 4M3HA 2BSCA 1YEDA 2A9BA 2CK2A 4HUKB 3U25A 5I24A 1ASQA 2OTUB 1IVLA 1TJGL 5IHUH 4DV3O 3BYTA 2GFBA 4L8SA 4XBPB 5LNEA 3UADA 5BVPH 2VO5A 2UXDB 3HG3A 3QFJE 4MWFA 1XB8A 4PTUB 1N5AA 4TNGA 4XNQA 5DXWA 4NKDB 1A3ZA 1U33A 4W70A 5B1JA 3VRIA 2HAZA 1OAXH 4JM2A 3CTTA 1JDAA 3ABMB 3RTQD 2PF4E 5D70L 3WIAA 1E2VA 1EEYA 5JIMA 2MRYA 2VLRD 3X3GH 4ZOLB 3GBDA 5LL6Y 5FFLA 3QUMH 1A9EB 5H5NA 2WN2A 1SBSH 4GI8A 4EIUA 2J4WH 4X4YB 4GZRB 1UOKA 4GIPD 4HDIA 5CN3A 5BQ7B 1NLDH 1HNGA 1HEJC 3E9TA 3W38A 1OPGL 4I77H 3TEXA 3MCLH 3TTSA 1F4WL 3BP7B 1W0JG 4KDTC 3OAYH 5MEPB 5ETUA 2O6FA 5D2NA 5BRZB 1JYNA 5L2JA 1NVPB 1GKEA 2XG4A 3S34H 4UOW0 4U7NA 5GRUL 7TAAA 3CC4V 5IOPB 3FRUA 1VZHA 5F96H 2CXGA 3CFBB 2CIIA 3TBTB 1MFEH 4A66A 3PWNA 2EDMA 4JFQB 2RMKB 3FQUA 2ADFL 4AENB 4LLWB 1MZZA 1H8LA 5CZVL 1OSZB 1KY6A 1GAFL 1KN4H 4JL2A 3OAAG 3CXCU 1JMZA 1JAEA 1M6UA 2HJFC 1N7ML 1LO4L 1E8YA 1U95A 2A6IA 1TJHH 4LDLB 4NERA 4AQOA 2N05A 2KG7B 2JK5B 9CGTA 2ZUSA 1LLAA 1AS8A 3DGEA 3PWUB 4FTVA 1XF5A 1UT2A 2XI9A 4QYAA 1TUPA 2ARJA 3JWDL 1CVSC 2HN7A 4X6EB 2Q7NA 2VQEB 4U6XA 5GQBA 4XBEH 1J10A 1QD0A 4ZW7A 2PO6C 1EN5A 2VDQB 3DMMD 2FT7A 1DF4A 3AJ7A 4MXWL 1XQ8A 5CU5A 1S7XB 1F4XL 1WIOA 4NJ9L 3IE9A 5KS9E 3HG0A 3QIUC 1YY9D 4XCYA 2AJZB 4WKZB 3BUIA 3FTVA 5ICXA 4YSQA 5L9DL 5FOBB 2A06H 3OZKA 4GSRA 3EOYG 3PPEA 3Q7JA 2YXFA 3FW6A 5J4MA 1AG6A 4Z76B 3T1FA 3OV6A 1RU9H 1U8KB 1CURA 1U3YA 2W9DL 3ZYZA 5CEZD 5HY9A 3RL1A 3IFXA 3A0BZ 1RJZA 3RT3C 4YJ2B 2HHHO 2A4EA 3II3A 1Q81W 5TF0A 4DKEL 4BUHA 2KPWA 3CZJA 4QMEA 3F85A 5KWYC 1WZ1L 4KDTA 5DJCB 2EVFA 3NPZB 4UB6Z 1XGUA 5BR8O 4KZCA 4UQ2B 1EX0A 3CVIL 4YSTA 5D71H 3U4EB 4CSZA 4GT1A 3UT5B 4XMVA 4JKPL 2VR3A 3WG7C 5GGQH 3CLWA 1Y18A 3F65A 3QNYB 4EIBA 3GEWB 3UBHA 4M56A 4E9TA 1FE8L 3MPCA 3NIDB 4WI2A 5DQDL 1SUHA 1K7DA 4PV1C 1FLRL 2CJ3A 4JFFD 3UGXA 3JATA 3N41B 5F9AC 3CDZB 8FABB 5E2WL 3TN0D 2XICA 5F8QC 3S88L 1A6VH 2AQTA 2HJFA 2H6UA 5LYJA 1A3RH 3HG5A 4NFCA 4OXSA 3OJVC 2PF6A 2HRHA 5IR1B 4NO0D 4Y89A 3MRJB 5JCOC 3KPMA 4ODUB 1ZWIC 1CXKA 2NSXA 4PJBE 1B2YA 5G4MA 3LNHA 1G9HA 3JD0A 1TU2B 3WCYA 4JREB 3QIUA 3MX0A 3CCUV 1GC1H 1WTGT 2W6JG 4FQXB 4YSAA 3BPOC 3ZS8C 1IAIH 2XUMA 1MRCH 1A47A 4JKKA 2CDYA 2HMIC 3FB8C 4M00A 1UGNA 2O30A 5EIIG 1FFRA 5FUCE 3RWJB 2COVD 3QPXH 3FFDB 4PJHE 4NDMB 1NGPL 2C1PA 5JW4Q 1G1CA 1NMCB 1Z32X 4LOUD 3GBEA 4JPIB 4POUB 5PCYA 5MENB 3P11H 4PY8J 4B9YA 4H1LB 3MVSA 1K3IA 3IFOB 3OAYK 5IQLA 2XX1A 3RUGE 1AVMA 2HVKC 3T1YO 1T3FB 3RB5A 2LAGB 5JH7A 4LHUD 4ZW6A 3K6DA 4HBCL 5DJ0B 4YDLC 3V0AC 4GKSB 1LNUB 3NIGE 5IB3B 4P59H 5IM7B 3ZW3A 1T04A 2LGNA 4ZMYA 3SN6N 1FFXA 2NY5H 4KVNL 4LCYB 3G71V 1N3NB 5EWIH 3HR0A 5DQJB 5ADPL 1T80A 2EXYD 3B5TA 4H5SB 2HLFD 4E42A 1PZAA 2JIXB 2UXTA 4DV3B 1MOEA 1NBQA 1I8KA 3ICXA 2OKMA 2HPOA 4KJYB 4U3FH 3BPCA 1K34A 2IC2A 4GX0A 1H8EG 1OTTD 4YZFE 4LL1A 3IJHB 1D6VH 1UVQA 2WSKA 2YPVH 4MW8A 4HETA 4TTDD 4L2LA 2A6JA 2EIZB 2FNWA 2K4AA 3O3UN 1VLXA 5FECA 5JIPA 3S8WA 2WLZA 2G3XA 1WH0A 4AIZA 3B2VH 3K0WA 1P7HL 2GHWB 4N5EC 4PA4A 1K5WA 4LSTH 5JCOA 1ZWIA 2HT4C 4YJZL 1MABG 5FIEA 1X4XA 3MXVL 5ITBL 3KPRE 2E3CA 5DSCB 3T3ME 1VDGA 1X3DA 5EK0A 2D31B 3VMOA 2B9ZA 3CH8A 3MREA 4JAMA 2FYYA 1HDJA 1XDCA 1G6VK 3LHPL 3MFGB 5DUPH 4AEIH 1FORL 3LIUA 2BNQD 3DXAE 4XNYL 4WFEE 3SCMD 5I73C 2NY3D 4NKOA 3LQZB 2HZHA 3WIIL 1UH4A 1E6OH 4RBPH 1RERA 5I0VA 1P4BH 5I74C 4AK1A 3ZDWA 1RZKC 3D34A 2OIEA 2B0SL 2L04A 1N2RA 4WBNA 2IADA 1HEZA 1AXSA 1Y66A 3JSLA 3KLAA 2BTQA 1KTDA 4AIEA 2EDOA 1OEZW 2X05A 1XEUA 2FJHB 2HVKA 2GT9B 5CILL 1L9NA 1NI8A 2CO3A 1Q90D 3CFDB 3A6BH 5DJAB 1GN4A 1HOEA 4N3UA 3V5HA 1MFBH 5K1JA 1UXWB 4G42B 4XODA 2EIKC 2XTJE 5MP6H 1UKTA 1XEQA 5J2TA 1GN3A 2EEXA 3BLKA 3KNBB 3E9UA 2RD0A 4RGOL 2EEAA 1G9MC 1OHHG 1KJ2H 4HQQL 1EIBA 3DX0A 2JWYA 5DJZB 2V5SA 4LLMA 2C2AA 4A67A 4YHYB 5LMNO 4MD5A 4YDJA 2QL1A 4HUUA 2R72A 1PNCA 1OB1A 3CWGA 4CADB 3GGWB 1Y7VA 5IFHH 1SQGA 1BQZA 5E6ZA 3QNFA 4XAWH 4EOWH 3EH3B 1J5OH 3T4AC 4JZJB 3IDYC 2CR3A 5EN2B 4WF9V 4BWWA 3OB0H 2OJZL 1AG0A 1VARA 1JPSL 4ODSH 3N04A 4XP4H 5T1MB 4PWHA 1U8IA 4BRJA 4YE4L 1HXMB 4NKIH 2HHHB 3WDHA 3I6GB 2GB2A 2QBWA 1CR9H 2RN9A 2WLLA 1T7VA 2DLIA 2R56L 1R3IC 1I3VA 3ML9A 3TPUB 3TZVB 3HE7C 4UT6A 2HLAB 4M7LL 5BR8B 2FSEB 2W60B 2OMVA 3CVCA 3FTZA 5F89B 5IG7A 1AI1H 3V0WL 2AERT 1YEJL 4OH2A 3B2PA 2J2ZB 3N91A 4WEMB 1XOUA 3CX2A 5C7XL 4X62O 4U0QB 1SM3L 4PLKC 5DF0A 4RA0C 2AJ3A 2EIJC 1RPQA 1ZLVH 3JWOC 2PCXA 5DMIL 1KY7A 2X89D 2EECA 3WY3A 1XI1A 2X42A 1ZV5A 5F9OH 1N59A 1TR7A 4L4VD 4U1LA 5CJ8A 1TTRA 4ZMOA 2EILC 2A74C 3OXSA 4LFAB 1K6QL 3H7BA 4P4KC 3HBGA 4MVUA 3RYIA 4IIQC 2VW6A 4OCNC 3WFBH 2BVYA 3FU3A 5E6RB 3WE6A 4I9XA 4UMGA 3WKPA 5JUEH 4K3EH 5HDQL 2AKRB 4AM0A 2OCCB 3QQ3A 4HW6A 2G60H 1E0OB 4PRHA 3F6IA 4HBNA 2JKWA 4I4TB 3KPOA 4O4YH 1CF8H 4ODHH 4EJ1C 2OI9C 4WW1A 2Z6FA 3I5DA 4LVHB 4JGNA 1BQ5A 4GW1A 4XXWC 1HILB 3L71H 1ZA3A 1J1OH 5E08L 3F7VC 3WHE0 1ZJAA 3VJ6B 3JXAA 4URKA 5IB4B 1KTRL 5I0WA 1S7VB 3NAAL 3ZTNH 5CUSL 1CIUA 1R75A 1DTOA 2J57A 3T4AA 1UB5A 1F5WA 3CJJA 1AFVL 1WFJA 1Z6JT 2DB8A 3OAUH 1E50A 2W5PA 4XN7A 1I7FA 1NTMH 2OK0L 1A21A 2X7RB 3L48A 3QAZB 1T5WA 4Z7OB 5CINL 5JXED 4NC1C 3VGEA 4EZKA 8CGTA 1MCSA 3S4SB 2Z93B 3H6JA 2QQLH 4R7NB 5EEXA 3T1YB 4NOBA 1EDYA 4H0GA 1MRFL 2PXYC 1LE9B 2EUXA 4J7KA 4AYID 1F00I 4HHAB 4RBPK 1A02N 1CL7L 2GUYA 2X0WA 3HE7A 5A2AA 1UYWH 1XGRB 1FVEB 4LLDB 2YDEA 4JFSA 3UGEA 3I9PA 2H2SD 3O4LD 5I6OA 5AB1A 3K71B 5L8JB 4NZRH 3QDGE 4BEIA 1NCCL 1KJ2B 1FA4A 1XF4A 4J3XA 2JS5A 3QXWA 1G7MB 3SDCD 1OAJA 4QRTB 4UB0L 4NKGB 5IYCO 3I6SA 5IJCC 1ZEAL 5JTWA 3KW8A 5ERWA 1D5ZA 1BEYL 4QR7A 5LOVB 5GS1B 3MBXL 2ZUQC 3ZO9A 4CBCA 3HKEB 2WPDG 4J10A 5J9PC 1C08A 1I85C 1QRKA 1WA1X 2H0EA 2Q86A 2VSDA 3EDJA 1A65A 1JPXA 3DV4A 2A74A 3VXUD 4XX1E 3VI4F 1QOKA 3GBMH 4GSQA 4K3DH 1X5FA 4P4KA 5DD6A 1NJ9A 3OKKB 4NX0A 2WA3A 5I0DA 2Y22A 1BMZA 4B7IA 1KEMH 1E27B 4FQHB 1XTMA 3WTUA 1DHKA 2XWEA 2FEEI 2E76B 1NWOA 3MOAL 4KUMA 4WEBL 5AVZB 4DN4H 1GTOA 4XXWA 4H13C 5FYKL 1F3DH 2JSFA 2YRZA 2OMUB 3CP1A 1YPZF 2MOVA 4TNWK 5ES4B 2N56A 3F7VA 5ANMB 1VCAA 5IEHA 5KTEL 1SXCA 1G4MA 5D2LF 3D4CA 5IW6B 3BA8A 3PDGA 1IL1B 4D0CA 1U58B 3G9AB 1A4JB 4BQCA 1RCYA 2IG2L 4JDTL 4TF4A 4U4IA 1XTLA 3BKJH 3LEVH 4QD2E 1ND0A 4NUPA 4OJFH 1SA0A 5CU9A 1YMHB 4KXRA 1W91A 4XAKE 3RWHB 3FUJA 2PXYA 3T0EB 3JTTA 1E5BA 4F6RB 4F9LC 5DQ9B 4FLRA 3QJQB 4W4KA 2YLHA 4HIJB 2ESVA 4Z77B 3U10A 3FS9A 5ANHA 2BFVL 4DTGL 4JPVL 2XTLA 1MG3C 1DLHB 1OK8A 1ZT7B 4URTB 1T22A 2AABH 4DHLA 5LJYH 5HDBB 1INQA 2FR4B 2AGJL 2XSKA 1W9XA 3WLWC 4N6QA 5LMNB 2NXYC 5J13C 1HTYA 5AAWC 3EJYC 4WJG3 5GZND 2UXNA 1MJJA 2DQGL 3NSJA 5J9PA 4MZIA 1I85A 2GEQA 3RTQB 4Q9RL 3SYCA 2VLRB 4KI5D 2X3BA 4QXTA 2WY3B 2VR5A 3EYQD 1A6ZB 4IRZH 4BIUA 4AYBA 4ZFFA 1QLEL 3H1ZA 2NXZC 3T0XA 1KF9B 4I9WD 1KTJA 2DLEA 2GW5A 2WLJA 3CLFH 4O4HA 3KZ8A 3L3IA 1VCBC 1RK7A 2WSSG 4R6ZA 4UUJB 4DWHA 2Q8VA 1JV5B 2J1XA 1NTZH 2IWEA 3I56V 3FQTB 1XGPA 1XF2B 1ZDQA 3UFIA 4X8JA 1I7TA 4DP8X 3CDFA 3I2CL 1H15A 3FHAA 5KSBE 3CD6V 3DNKA 3GSOA 4PGDB 1MCHA 4X62B 1A4KB 2W0PA 4P4RA 4UQBA 1IVTA 4PUBL 5E8NA 4PG9A 4ATWA 2G2RA 1JZ2A 4YDVB 4TS6A 4YBLC 2WQWA 1YEGL 4OGYH 4HOXA 5HYJE 4BXVA 2C4XA 3L6FA 4HYTB 4Q6GA 1UM5H 4F9LA 1QBLL 2PI4A 4QXVA 4OY9A 1XX9C 5KOVC 3SDXB 1T1WB 2R69A 2AHYA 25C8L 4ZPTA 3DMMB 4UB8Z 3Q9QA 4NFBA 4PRDA 5HHMD 4GAFB 1NPJA 1UUNA 4X7TB 2ZG2A 1C16B 1J05B 3ALXA 1Q3EA 3JASB 1QRND 1YNKL 3R8QA 2WWMD 3CFCL 4KRPC 1YQVH 5E5MA 3E2HB 1WCQA 3IC9A 2XXCB 3O9WD 5AAWA 2A6KA 1HW7A 2X0VA 2J12B 3C08H 4KY1L 2ITCB 5CGMA 2ITFA 3G5ZB 1NGWB 1XBDA 1NUGA 3RKPA 2P8PA 4JN2B 4W9DC 1Z5LB 4Y4FC 2EO7A 4R97C 3DVIA 3T2OA 3WLBB 4PLNC 2ZT9C 3NESA 4XO3A 4C56D 2VMJA 1XNRO 1WJZA 4EPSA 1EAPA 1JFQL 1QSVA 3TYGH 3CRRA 5KVEH 2I5YL 1DDHB 3AG3C 3CXDH 1G6RH 3BUBA 3HB3C 2JJTA 2J88L 4KHXL 1TPXC 4I9QA 1FBIH 3GD1C 4HS6A 4JRYB 1FLTX 1DCLA 3UTSD 4BH8B 5DHYA 5LBGA 3U9UA 4I0KA 2DW5A 3BO8B 3B2XA 4GJTB 2YSSB 5SWZD 4GG8A 1AR1C 2WXQA 2E8ZA 2J20A 4CN1A 2ZOKB 5L88H 4U1NB 5EOTA 1MCJA 2BJMH 2ZXCA 1GHFH 3RGVB 3TVMB 1E6JH 4JFFB 3UYPA 4J6RL 3ZQXA 2TAAA 3N3EA 4C59B 3KLKA 3MYZA 3TN0B 1H0DA 4M6AA 1MVUB 3GMRA 3FU9A 3WUZA 32C2A 1QMUA 2M2DA 2ZG1A 3Q6GH 2M26A 4B3MB 4QRRA 4PS3A 3QG6A 4M8RA 3WOVA 3JV6B 1P7BA 3DC5A 1BIIA 1OV8A 1RUQH 3NPSB 2VDLH 4EI5D 1ZJBA 4QRAA 4CH5A 3HPLC 1QQCA 2NY1D 1V55B 4PJBF 1TEYA 4PJ5D 3NZ8A 1DQLL 3D25B 4TULH 3WAJA 2X4PA 4OLWL 3WHXA 4NXMO 2E0PA 4PJEE 3P9MA 4G8AC 2FAUA 4M5SA 3WNMA 3MOBL 1HESA 1C1EL 1O7VA 5C0BA 1CFTB 4RMWA 5FCUL 5IESL 3BIKB 3L7EB 3VGHA 3TCUA 3H1KH 4C58B 3NGBC 4U1JA 1URZA 3A4DA 5CSBA 1UWXH 2FEEL 4FABL 4H8WC 1IFRA 4PJHF 3MODH 4Y4FA 4L3AA 4Y2NA 4LVEA 5HYQB 5AOLA 5D96B 1G1OA 4JRFA 2Q4PA 3ZPDA 3FQWB 4DF9A 5EZLA 2JI1A 4UQCA 3N9GL 2KPNA 2Q0OC 4FFYL 3A3YB 4LHUB 3UZQB 1QW9A 4FXGB 1PD3A 3RUGF 2A0LC 4F33B 1MSDA 2WD0A 2XT1B 4QXUL 3PHSA 4MVOA 2HRGA 2WHVA 2ZE7A 3WFHA 2YMXL 3OAWA 1LGVA 4HUMB 15C8L 3NIGF 3WXWH 1MIEL 5FHAL 3L2LA 3JWNH 3I3EA 3LEXB 3T6XA 3BVNA 5F89A 1E43A 1JWSB 2WLIB 1YYML 4CC4C 1N68A 4D9QD 5HVHC 3F00A 4FJYA 2YICA 3CC2V 5DCCA 3X13A 3VGAC 3FQYA 1MCDA 1DQQA 2Y5TA 2ED7A 3SGIA 4C7UA 1XCXA 2PTMA 4X1IA 2CU9A 1I8LC 3OTTA 1O6SB 2V33A 4XWOC 1FAIH 2BVQB 2AJVL 2P5EE 3VI3B 3GB7B 4RDQG 1CTOA 3JSSA 3STLB 5EUKA 5DEGA 1PQZB 3NFPA 2H0JA 4Y7MA 3HR6A 2EDHA 2NX5D 4JQXC 3ZYIA 1M7IA 1N0NA 4UCUA 3HPLA 1F58L 1PM9A 1HL9A 1MHEA 2EVGA 3DHJA 2R4RH 4UV4L 4FFBB 5HXMA 3LSOA 4U6HB 5H35B 1G6RB 2Q7AA 1Y6KR 6FABH 3SIKA 4DAGH 4UQIM 4JLRA 4S1SH 1FYHB 4OZIB 2ICCA 1A9VA 2WNWA 1A7QL 3J81N 4NNYA 4H88H 1H8NA 1DBMH 1JNHB 2BNQB 1CLYH 3SCMB 3AG4B 1F6AA 2IWKA 2D0HA 3MCKB 3RYMA 2IGFL 4QUOA 1TVHA 3QQDB 4MJ6A 1UFGA 4Z7OE 2L7UA 4P23D 4LCWA 3ROOB 4QWWD 2EADA 4JGMA 3U0PB 3ZEDA 2PWGA 1CD1B 3BZFA 4DQAA 3I9GH 4NQDE 3NIFB 3QCTH 4BFGA 1FHGA 4E5XB 4ZO9A 5DVPA 4J41A 2A0LA 2X0LA 3H9SD 4HPHA 5ICZB 3LPWA 3ZOAA 1YEEH 3QVNA 1DEDA 2R0WH 2VDLB 4ODVH 2JKTM 2R1XA 5F9WB 5L8LB 3MJ8A 4WK2B 4CC4A 2F74A 5KSVA 4KGLA 3EYUL 4YBHA 5I71B 1XXFC 3GZQA 2ZINA 1Z9MA 2EJRA 1YTFD 2A83B 3NABH 1DFBH 1PL4A 2JCCE 1WO2A 1JXKA 2HJKA 3L1GA 4MMXC 2WYTA 3FSZA 1IO4C 1MWAB 5IFJA 1I8LA 5EC1C 4F3FB 1OQOA 2OJEA 1NC2D 3S2AA 3VSVA 4YHMH 4ZW3A 5F0PB 4WI4A 4A2MA 2YD0A 3IPBA 4NZ8A 1LP9E 4JQXA 1TZOA 1XNRB 1PL3A 3T1HO 2WKOF 4YMPA 5I1DB 2N7BA 1Q9KA 2QWQB 4OZFA 1F0LA 1L7IL 1UJ3B 4DJMA 3IMBA 5AW8B 1FVCB 5F7MC 4UOZA 1K8IA 4XPHH 3ZMUA 5D7LA 1UWXK 1ZLUH 1ZHLB 3S37H 5GRVL 1ZCRA 4RSYA 3ZHLA 3A6OA 1XMWA 1L8DA 4GRWH 1L0QA 1QYGH 4ZHQA 1KTLA 4OQTA 4JZ2A 2A9NL 5D1ZC 2XAFA 3MU3A 1MW1A 2X09A 2CH7A 4IEFA 2AEOA 4M03A 4X0KA 4BE6A 4ESKA 3WNOA 1FNGA 4JW3A 3V9EA 2PW1B 3UG5A 2YPLD 3AUWB 1TCRB 1RFDL 5C3IA 5K9QG 1LTXA 4YSOA 5FGBA 2LR4A 3U7WH 1AY1H 2IDFA 1JHLH 3GHBL 4L4VB 1M93A 3EHBD 4B53A 3D87B 2H1PL 2HT3D 2VLJE 4D9RE 4PWIA 3ZHDA 2P8LB 3RE0A 2VQFB 2J6EH 2CGRL 3C5JB 3NFNB 5IVXA 1B0RA 5IJDC 3WUWG 3PLYA 3WEAA 4RFEA 2GHZA 2ARHA 3Q05A 2CHWA 3X11A 5D2LA 1Z0NA 1WA0X 1UADC 2VXSL 4UM9D 3TBVB 3ULVE 1INEH 4UCTA 1WC7A 2Y4SA 3X1BA 4E41E 4NXMB 3ETTA 3IT8D 4FXLA 1C12B 1GCYA 2DJVA 3IDMA 3UTTD 3ZMVA 4MMXA 3NDZE 2CO7A 2E9GA 4J3BA 2AV7B 1A7PH 5EC1A 5EIVA 1IAKB 3GFUA 5EZOH 3DYPA 5EYPA 4CC6A 2X87A 4G9FA 5KBPA 1YYLL 2OZ4L 4FG6D 4LOEA 3WEXA 4K5NA 2VQ4A 3JAKB 2CE6A 4ZMPA 3DX3A 2GQHA 2VXQL 2LGWA 4R4NC 1Y74B 4OM1L 1BFSA 2Y1ZA 4XN4A 3P3YA 3X17A 4Q4IA 1JGEA 2PWEA 2A9MH 1YDXA 3PG2A 5IW3A 1P5UB 4P9ML 1HHHA 5CHNA 3WFCH 1FFTB 1NL0L 2JKIS 1FV1B 3RVVD 4FFZH 2MQ3A 3O4LB 4GP4B 5D1ZA 2P6JA 2WV3A 3U6RA 5F7HA 4WV1C 2UXFA 1LVEA 4NWTH 5DHVH 5F9JA 3SDCB 1TA8A 3QWRD 4JVUA 4N0UA 2Q20A 4ZXBA 4LDEB 4F8LA 5A7EA 3CUPB 4H0LB 3FONB 5JXAH 3MSPA 2QADB 3VH8B 1HDMA 4AQ1C 3FCSB 3MA7B 5DJYA 3VQVA 3MLVH 2HWZL 3DRQB 1OAQH 4BH7B 1JK9A 3MDJA 3QUZC 4OLUH 2WZ5A 4U3CA 4AQEA 1CICD 3BA9A 2UY7B 4KX9A 4GAGH 3RBSA 3C3TA 3FFCD 4GI6A 3ZE2E 1IU1A 1I9JH 2WYHA 2CAZC 2XN9B 3FCTB 4GI9A 3LMJL 3AFLA 3BLBA 1SMDA 5H2FZ 2CCVA 4W81A 4LHQB 2QGEA 3E35A 3ZT6A 3GSUA 4HIIB 5EUOB 1S9VB 1ZIAA 1L0LH 4GRWB 4DCQA 1FGNH 5E4EB 3UJJH 2DLFH 2AK1H 4U3HA 3TF7C 2VB5A 1LO3H 4GFTB 2XKUA 1FP5A 4X89A 1KC5L 2VDNH 3MLUH 5CEZE 4MZ3A 4NP4L 5DMGD 4IS6B 3NJVA 4OCMC 4ONGL 2GUOB 3SDAC 2R4SH 3RYHB 1WIPA 4UAOC 4BK4A 2Y6SC 5KAIZ 1QFPA 1QR1B 3ZO0A 1FNEB 2P8MA 1DN0B 1L9PA 2MKLC 3LRSB 2CHXA 4U1KA 3WGUB 4H26A 3ZZSA 3EYFB 1KXTA 4ELMB 3P4MB 3QIBC 1MCKA 3AT8A 2ADIA 4OI7A 5T5FL 4LBEB 1NBZB 3TBYB 2XFXB 1D7DA 1RJYB 2Y7QA 2VDOL 3LH9A 4MNGA 2AXHA 1KYFA 3O45A 1HZHL 4NNPL 5FKPA 2WZPA 4AGPA 3ZE1B 3F6LA 4ORZC 1V3KA 2FGWL 2EIBA 4WV1A 3TJPA 5FUCC 3EH1A 3CVHH 3MLXL 4KAQH 4OT1H 3VD3A 1J8KA 4LSSH 3N1FC 2JB6B 2GTWA 3EFOB 4JFUA 3WFDL 3G6JF 2EYRA 2X38A 3CPLB 3VFUB 2QZQA 4JG1H 4N6RA 2CMRH 3V95A 3G6DH 2WBWB 4HH9A 2ZPKH 5CP3H 4AQ1A 5GS0C 2PI5A 4ORGB 5HYSA 3W9EB 4RMQA 1WAAE 3F12B 3V6BR 1IVSA 5EBLC 2BSTB 3PXHA 3QUZA 2FQGA 5AL8A 1GN2A 4I50B 4WU5B 3U0TA 2CK0L 2H8PB 3ETBJ 1LILA 2NNAB 3T1HB 3ZUNC 3PAYA 4UOJA 3CN1A 1NS1A 4I3RH 5LXGH 1BW8A 2NZ1A 2JH2A 2QKSA 4ZAKD 5FGSA 5BOJA 2RQ8A 1YCSA 5HDWA 4B5EA 3CC5A 5B22A 2ZOLB 4FKHA 4MJ5B 3C9NB 5CA3A 3LZRA 1EUTA 3FKSG 2R9HC 3F58H 4OD3L 5DHVB 4FVMA 4Z1PA 5KSBF 5E24E 2E7MA 2VW4A 4JFDA 3SDAA 3T77A 4TOIA 1OALA 1QUPA 1TYJA 4JFEA 4KOBA 1P84F 2O1AA 3S4SG 3CN3A 4JKNA 4PJAB 3MRPA 2CM6A 2QV2A 4FNSA 4GXVL 3E8VA 4MA3A 3RIAK 1ASOA 4FULA 1QO3A 1IEHA 1TZIA 3NTCH 1T6BX 2XYCA 1XILA 3QIBA 1G7IA 2V0AA 3GLEA 3K03A 1WFTA 2F1EA 4FC3E 4J3OF 4M93B 4MAYD 5K9QI 4QAWA 5H6RA 4JI7B 1RSOA 4FYTA 4TV9A 2Z7ZA 4K9EC 1YZBA 3L3OC 3JAWA 1MHHB 3RYFB 4U0RB 5EIBD 4NCDA 4XMPL 4XP1H 5HHMB 1MI5D 1AGFA 4BA0A 3G5XB 4PTTA 2FT6A 4JVWA 4N4YB 3OQ3B 1JJOA 5K9OB 2D4FA 4LVNC 2UX7A 1TETL 5HHXH 3CSBA 5ID1B 5T8IA 2ADPA 1FCGA 3QJSB 5KLVH 5E0FA 2C9VA 2PCYA 4HKBB 5IJBC 2Q5ZA 4MA1C 5BS0D 3Q48A 3LRKA 3FTXA 2WBJD 5CB4A 2OMZA 3EJZD 2VDNB 4F91B 1USZA 3RUGA 1XGZA 3BSGA 5LGYA 5EBLA 4EKWA 4QJ4B 1NICA 3PV6B 4C56B 2ZSWA 1RULH 2WANA 3D39B 3LD8B 1NFKA 2X53A 2H3KA 4RFOL 3K4ZA 3FO2B 5DK0B 2XTJC 5A6LA 4NGHL 4DGVH 1OD9A 2WINA 4DEUA 2VT0A 1QHTA 1K5NB 4ELKB 4ZOEA 3UTSB 3M17A 5CN0A 3X2QC 5SWQB 1FPOA 2AI0L 2OS7A 1F90L 3LUTB 3QEUB 3N43F 1JWMB 3UBFA 5HPMA 4U1MA 4DP6X 1EVTC 4BSWB 3BW9A 5SWZB 4CGUB 4TUJA 4FAAB 4YHLL 1MPAH 3CVHB 1IBFA 2OM5A 2R8SL 4JFXB 2E5EA 3VRJA 4DVBB 1CT8B 5DRXA 2BHYA 2GVYA 2Z9TA 5IWLC 3GXMA 4LWSB 2PTTB 3FBQA 3QIWC 5F7NC 3WD5H 5I30L 2XG5A 5JW3H 5CBAB 5T1DL 5DM6V 5IW1B 1EHXA 3NJIA 3ECQA 3PDDA 4NJAL 5GZOD 2ZXGA 1S7QA 4CC0A 2YMOA 3SZ6A 1P4IL 3ETDA 3PHQA 4CH6A 1C7SA 4G8GB 4QCIB 4RGMB 1XSJA 1DANU 1NMAH 2X41A 4KNQA 1J0KA 4EI5B 4HG4J 3LHAA 4Q6KA 4DFHA 3MNZB 2OWOA 2NY1B 1JPFB 1KP2A 3LIZH 4PJ5B 4A37A 4EI0A 5CJXC 3SJVD 4WFEA 1F6FB 3SOTA 5E00A 5AUMA 3B9AA 4CU7A 4NXNO 3JD4A 1T0NB 2D0FA 4FQPA 1E5CA 1XGQA 5BCAA 4AIXA 1ZGLB 2YC1A 3L95B 3H3PL 1DEEA 2HJDA 5F7WC 2Q10A 1IAII 3VXRD 3IU3B 3OLDA 4P2RD 5IMMA 2DWEB 3CZGA 5FKAB 1NM4A 4IIJA 4LKCB 2XHBA 2ICEB 2VDQL 1S46A 3CHSA 4BUQA 4Z3FA 2AZ0A 1S78C 4TQDA 3CE2A 1XCTA 4B9FA 1HCFX 1KMGA 5E99H 2O6CA 1QNZL 2FUTA 1MUJB 4P3CH 2R2BB 3ABZA 5I16A 4D8PB 1MH5A 2IMMA 4F80A 1UQSB 2O72A 1U8QB 1GMEA 5J7CC 1MCQA 4CH3A 1MJUL 4L18A 2AJXH 1OT2A 4K5PA 4S1DC 5DDHA 3HUJA 4R50A 4QHUB 3UTOA 2MCAA 1A3QA 5IQ9B 5L3EA 1ZVNA 3LY6A 2CALA 4OVUA 4WHTB 2QGNA 2F0CA 2CGYA 5IWLA 3JARA 1F4AA 3OX8A 5JOFB 3R0NA 1XSIA 1I7ZB 5FB8B 4FLXA 3O4OB 2RAMA 4JFOA 2BXYA 2LVCA 1DF5A 3BEWA 1SRDA 4N87A 2ZD9A 1I7RB 2GI7A 2WBXA 3KHOA 4BV1A 2ZNJA 3K6OA 2NX5B 3B7YA 2ZOTA 4POZC 1H6UA 4S0SD 5TDNB 2BP0A 3LXBA 4ODXB 3K3QA 1NDGB 5CJXA 5BVPL 4PJGB 3TA3B 2A6DB 5IB5A 3NEOA 4LLYB 3A4EA 1EAQA 1OAXL 4J2XA 4LKXA 3X3GL 1FGVL 4GKZB 1WB7A 4LQFH 2ZTBA 1KXQA 2YA0A 4RX4D 2ZJSL 4O2AB 4FQJH 4P23B 5IJ0A 4ZUWA 4F7EB 1QTPA 2J4WL 3MHHC 1NLDL 1GGTA 4X6DB 3MCLL 2KLTA 3BGMB 5HJDA 4YHOH 5BY1A 1QX1A 5E1IA 4LSRH 2OXGB 1EJ8A 4HT1L 4QYOB 3H9SB 1J88A 1JK8B 4KK8D 4AKOA 5BV7H 2AQ3A 3S34L 5C6PB 3W82A 1FVDA 2XWTA 5F96L 4WNSA 3FOMA 3KJ6L 3ZR6A 4AGNA 1PEWA 1MFEL 4LVOC 1XF3B 2UZYA 3ZYJA 4CC5A 1IRAY 2CBPA 4QTFA 1N0LB 4O4LB 3MNVB 5E2VH 1Y0LB 2R29H 3RVZA 2YIHA 4X64B 3IXAB 3EYOA 3LOWA 1BZKA 1YTFB 3F62A 1KN4L 4OCXL 2BC4A 5J3HC 3LH2H 2JCCF 4RZKA 1HT6A 4LDOB 3VXUE 3GMMA 1KB9J 3LB6C 1IC5H 1D5MA 5B21A 5JQHC 3QAQA 5EEYA 3HG1D 5ESVA 1CGVA 1NC2B 3D3VD 1FZKA 3I6LE 3KH3A 2R2EB 3DV6B 3T65B 1TYEB 3U9PH 1TVKB 2BSRB 4X6CB 3V5KA 2XWZA 3MRCB 3SO3C 4MDJB 3HZVB 2HJLB 1C9SA 2E7CA 1LP9F 1LNQA 4QO1B 4LNUA 3GWJA 3TV8A 4HWBH 2XUWA 4LRIC 4LCCB 5MEOB 4G8IA 4PBDA 1OKEA 4LP8A 2EP6A 3WO3B 3VXSD 2EUZA 1FPTL 5JNYA 3FQXB 3LPPA 1T6WA 5D5MA 3D1MC 4QGPA 1IAIM 1MIMH 1RU9L 4EQ2A 2K6ZA 4L8BA 2DIBA 3N55A 4BGLA 1CFSA 4XO5A 2VOTA 3MR9B 4CW1B 4JHAH 3GEFA 3MRLA 2EVJA 1AHMA 1NCWH 2YPLB 3H1JH 4AUJA 3EGXA 1S5JA 3H1HH 2ZWKA 3H9HA 2XXFA 4NVPA 2YSUB 4YBQD 1AGBA 1I1CA 2E56A 4XGZA 2QEJA 4QOKE 5I1LA 4WEUD 3ETBF 2AXJA 4JJ5B 4TQEH 4BCXA 4X5RA 2Y25A 4G80A 4CS2A 4PJ8C 5D71L 4ZSOB 4YSEA 4FHBD 2DWDB 2OYPA 3UJIH 3CSYA 4HCRH 2FRGP 4M61B 3EJTA 3O2DH 2CIKA 1N70A 1ECZA 2WB1A 4HWEH 5FF6A 4IBWA 4FM0A 4UM9B 2B77A 2RALA 1LXMA 5IQ7L 1INDH 1M53A 1ZHBA 3PWJA 5DD1L 3ULVF 3TPKA 4NXNB 2X28A 3UTTB 1HC1A 5J1SC 1OL0A 1A6VL 4R9HA 3UERA 4N28A 4L3CA 4PLJC 1QABA 2IOOA 4KI5E 1U8HA 1URFA 4NYLA 4AQAA 4BZ1L 1QFWH 1FYTD 3T2MA 3ES6B 2IJJA 2WAQA 3MRNA 4QF1A 4G82A 2VZUA 3BIBX 3WIFA 4J3OC 5FA3A 3SKMA 4GW5A 1YF2A 1K9TA 2JXMB 4IU2A 2ODIA 1QKZH 1H38A 3RFZC 1TZHB 5FO8A 1L7TH 4KFZC 4HGWB 5CBEA 5IEKA 1IAIL 3WENA 4U6YA 1DBAH 2IV8A 4LRIA 5BV7B 5EBWB 4IRSC 5EPMB 5A2IH 1E28B 3BD5A 1FG2A 2VUKA 3QPXL 4OUOA 3RX5A 2VXTH 3G6JA 1K2DB 2BMKB 3S5LA 1HSAA 1V7NH 1G9NC 3GSVA 1LEKA 3CN0A 1AGEB 3ZDYE 2YKKA 3UO1L 1S5HC 4MMZC 5CLTA 3L4ZA 3ESPA 3C09B 4JRXD 3ZDZE 1TZAA 3VQ1C 4DP5X 3P11L 4HK0B 3KBEA 2NOYA 5T3ZH 4DKFH 5IYBO 1NPNA 2VAAA 2VDRH 1HN1A 4FNRA 4JPRA 3T4YA 3OGCB 5B66Z 3H42H 3IB4A 1HHJB 5DC9B 3FSVA 1FFNB 4JDVA 4M8UA 2W1NA 5BO1L 1U41A 1U8CB 3BX7C 4OGAD 1IBZA 3CZFB 2Y06H 1BXVA 2NY5L 4QPJA 4UOW1 2XNAB 3HI5H 5EWIL 1OP3H 3KCPA 4E9LA 3V2AR 2ZYHA 1IBHA 1CICB 2KKWA 3C5ZD 5HHME 2LO1A 4ZTOL 2QZ5A 3FFCB 1QRNE 3U1SL 1S7UB 4G7VH 4GQQA 1UA6H 4YXHL 3WGVB 4ZZFA 4B5ZA 1E65A 1BQUA 5L3CA 1MVYA 3W7XA 2F53B 4FPPA 2IV9A 3HVNA 4GH7B 1D6VL 2VWKA 2Y7NA 5FNVA 2YPVL 1HH6A 4KV5E 4OAWB 3Q01A 3EFFB 4W9KC 2LABA 5C2BL 3GNMH 3RTLA 3GMOB 4C4BA 3P3NA 3B2VL 3ZBMA 1VFMA 5KBKA 4LSTL 3GSXA 3QE5A 5E51A 3NJJA 1X5MA 1JTTA 4ADGA 4Z7QB 5IVZB 3SDDD 3CZLA 1LMIA 2P1YA 1D9KC 4NQEA 4BSVA 5GS2D 4UTBA 2WOYA 5JYLA 2Y23A 3Q5YA 5EMYA 3RFZA 4ZX4A 3CC1A 1U93B 3E8UL 2HKHL 2HLDG 1ADQA 1YHQV 1XUQA 1FN4B 4N2LA 5DUPL 4AEIL 4JFWA 1RVFH 4IRSA 5BXZA 2APBA 2GAZB 4CSSA 1ED3A 3VXQB 1GGYA 3QDJD 4F8NA 1BBDH 3BVTA 3JWNG 1BM7A 3EFDH 5E5RB 1S5HA 4MMZA 2VDKH 5EU4A 1NCOA 2X3AA 1PAZA 4DP1X 5GIRB 1A2YA 4F20A 3GSNA 3NRQA 5F7AA 1R0AH 4R83A 1ICTA 3PGCA 1R5IB 2PPDA 1BAGA 3JWDC 3P1VA 4AX3A 3B09A 1A6AB 3A6BL 3GHEH 2HTLD 2P46B 3ABLB 1OAZH 1MFBL 3FTYA 3JQOB 4TOYH 1I31A 1NIAA 2V5TA 3P4OA 4ZMNA 1M9WA 5HD8C 4B95C 5MP6L 2NQ3A 1XWVA 3J07A 3BQUC 4N1CA 1J1PL 5E1HB 4NS0A 3VFVA 1WAAF 3NXSA 3UTZB 1EEZA 1KJ2L 5GSVB 5CLYA 1GTNA 2ZOWA 5CN2A 1KENH 2W0LA 1A7NH 2WMPA 3C60D 4LFCB 3CN2A 1A7OH 1H8OA 2NW2B 4MDRA 4PRAA 3HS0C 3IJSB 4ATTA 1VFOA 5IFHL 3KPSA 3JTSB 4EOWL 1J5OL 1C5DB 5L0QC 4TVPE 1M7DA 2AZAA 3P30H 3TV3H 3I6KA 5KYWB 4PJ0Z 1TIUA 2LJ2A 3L17A 2MNJB 2HX9A 3K6NA 4XP4L 5DR5L 2NR5A 4D0BB 4J3SA 2M83A 3VD9A 5IFAL 2ZXEB 2IH1C 4G2AA 2LVEA 3BPLC 1D9KA 4A6YB 3VGGA 1CR9L 1R19A 3I75B 1YMMA 3NJFA 1CGXA 1NCJA 3K2UL 4KUZH 4RLDA 3PL6D 1HKLH 35C8L 5T33H 4LLVA 3SPJA 1UM6H 2AAVA 2OMYB 1J0IA 4MAYB 1AI1L 3JYBA 1JCVA 3BE1H 3OKMA 4OTXL 3C2SA 4AYMC 5HVWA 1FL5B 2JQMA 3HRZB 5C97A 3ULUL 3N1QC 4WI7A 3S3DB 1D5RA 1MI5B 1LE5B 1Y6NR 4JMXA 1XBLA 3A22A 5IF0A 2EDXA 4BM7A 2QPSA 5E03A 1OY3B 4Z8FL 1UASA 1AXTH 1WWWX 4KL1A 2G5UA 4HSAC 1BFTA 1XMOO 3T2QA 3U4AA 2BX5A 5EU3B 1I1AD 12E8H 5F9OL 3FB6B 3QF7A 1I8UA 1OP3K 2WVVB 4Y19A 5BS0B 1PZCA 4F1ZA 4H44B 2XQYA 2ADGA 2WBJB 1ZHNA 3WFBL 3BHBA 1BA9A 4L1TA 3QPQD 2BDNH 3O0LA 4K3EL 3IGLA 5C6WH 3BQUA 4I48A 3VE0B 3CMGA 1Y6XA 2C9XA 2G60L 2QQKH 5EBGA 4LF7O 2FECI 1VB9A 1BAWA 1JF5A 1CF8L 1B4TA 1TVBB 2C26A 4ODHL 2VM3A 3H6AA 1KJMA 1PKQB 4I0XB 2CJTA 4FA6A 2FLMA 3BYYA 4MTMA 1T1YB 2XYBA 3MGOB 4WFGD 5K9JH 3HS0A 5I1EH 4DR5O 4XCEB 3DOSA 4QNPE 3VACA 3ZTNL 1U4FA 2AXWA 1WG3A 2E9WA 4HUVA 2CTQA 4LIQH 5DZJA 4B3EA 2DN9A 2WBKA 2X4SB 3WEBA 4OUUB 4X4KA 5FYLD 1AMYA 4MTGA 2X4OA 5DMKB 2VDKB 1RKRA 2WXHA 3TESA 1UD3A 1UFIA 3FYIB 5C9JB 2WQRA 3R66A 3I74A 2P5EA 4LGRB 4G7SB 2IH1A 2QQLL 5DHDA 2WXLA 3LXCA 4Z7VA 4ZYKA 1CFNA 1HNXO 3G67A 1YEHH 5TQ0H 3G04A 2ZAHA 3Q6FA 4QT5A 3PPSA 2JGDB 5CCKH 1P9MC 4YPJA 1UYWL 1PP9H 1I1RA 1BCIA 3FDWA 2W88A 4RWHA 1KJVB 4P2OC 3APOA 1OAUL 5AW0B 4XMZA 1KGCE 3E22A 2Y3NA 3FN3A 4I3SH 7CGTA 3IGFA 1DUYB 1IKOP 4FNUA 3T4DA 4Z7WE 2PY5A 1BZQK 3UQ8A 2EO9A 3KYMA 3MMEA 4YIQB 5C08B 3X3FL 3SJVB 4M7ZB 4JZGA 3ESVF 2RQEA 1CDHA 1SJXA 4MJIE 4HCGA 1VZIA 2YGVA 3BRDA 3PE9A 4EEQA 3ZN6A 3OMAB 1TLKA 3GMNB 5TH2B 3TBCA 2DL2A 4PMEA 1J0YA 2UXVA 1HHKA 1LEGB 3UEZA 4P2RB 4U7OA 2VTFA 4UYPA 5AB0A 3QWOA 2AGAA 5FO2A 3VFTB 1KEML 4EBQH 3U1QA 4FP8H 1Z3GL 4NHCH 4PP2A 4HNAA 1L9QA 1M2VA 1W59A 3H0TB 4N9GB 1NJIW 1N64H 2OA9A 3B77A 3IGAC 1Z5HA 3NQKA 5J57B 2BOCB 1VGKA 3QRLA 3DTXA 1VEOA 4ZO6A 9PCYA 1OGAD 5BZXA 3ULVC 4UZUA 4Y4KB 5LDUA 3AXLB 2MSPA 4GSDL 4ANUA 3B9EA 2V9RA 2NNRA 2JCCA 2WJ7A 4F4LA 2LU5A 1UXLA 2OQJB 5ACZA 4Y9BA 3BKJL 4YHNB 1SOKA 5G5DA 4PW3A 3AM8C 4OZ4B 5C07E 2YZ8A 3L4WA 4LSUH 5T3XD 4XP6H 4FTVD 2ZCKL 2NYKA 4Q20A 2DJSA 1RPOA 1OHZA 4G11A 3RHWF 2KERA 1TKWB 5F0LB 1LP9A 3MLSL 1P9MA 2AJSH 5CGBA 1UD2A 3EOBB 3J2PA 4AUUA 1SHSA 4JFHD 4P2OA 1SEBA 5DGQA 1SOQA 3MAQA 2AABL 4JAVA 3EXAA 2R7EB 3ATAA 5LBSH 5LAXA 5AD0B 3X1FA 3P0YH 4UQ3A 4TSAH 1SHMA 3IFPA 2R27A 3U2SB 2F93B 2E4TA 3UTTE 3B6SB 4BIKA 1PG7L 4DQOH 2RGSA 4L1HA 4P5MA 5A7BA 4P9HH 4Q89A 3SE6A 1EHAA 2RNBA 2KDGA 4X4ME 4PJ7B 4XBGA 5AEAA 5DU7A 2ZKYA 4QIWF 1TQVA 3D6GA 2DL9A 2KQXA 1OP9A 1Q1JL 5GRJH 4ZS7H 4IRZL 3KYOA 5FLVA 3MRBA 4JQIH 4Q4EA 4LEXH 1CDYA 3CLFL 1ZSHA 3RNQA 3KE0A 1XO8A 1A6WH 1YA5A 4PCKA 5LAPA 1H9VA 2GJPA 2XY1A 5I5JA 1EFQA 1LJMA 4KRMB 3IGAA 1GPOL 5IUCA 1P5VA 3LEYH 8PAZA 2FH6A 1XL4A 2GCYA 4H25B 1YJDH 5JIDA 4AMXA 1YN6B 1L6ZA 4IKKA 5KAQG 4CU8A 3H2QA 2ZQMA 3RWDB 4QAMB 5IBUB 3KVQA 4QXGL 3BY6A 3FULA 4GB9A 3DO7A 4YC2C